data_1MWA
# 
_entry.id   1MWA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1MWA         
RCSB  RCSB017244   
WWPDB D_1000017244 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.pdb_id           1MWA 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1JTR 
_pdbx_database_PDB_obs_spr.date             2002-11-27 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MWA 
_pdbx_database_status.recvd_initial_deposition_date   2002-09-27 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Luz, J.G.'     1 
'Huang, M.D.'   2 
'Garcia, K.C.'  3 
'Rudolph, M.G.' 4 
'Teyton, L.'    5 
'Wilson, I.A.'  6 
# 
_citation.id                        primary 
_citation.title                     
;Structural comparison of allogeneic and syngeneic T cell receptor-peptide-major histocompatibility
complex complexes: a buried alloreactive mutation subtly alters peptide presentation substantially
increasing V(beta) Interactions.
;
_citation.journal_abbrev            J.EXP.MED. 
_citation.journal_volume            195 
_citation.page_first                1175 
_citation.page_last                 1186 
_citation.year                      2002 
_citation.journal_id_ASTM           JEMEAV 
_citation.country                   US 
_citation.journal_id_ISSN           0022-1007 
_citation.journal_id_CSD            0774 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   11994422 
_citation.pdbx_database_id_DOI      10.1084/jem.20011644 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Luz, J.G.'     1 ? 
primary 'Huang, M.D.'   2 ? 
primary 'Garcia, K.C.'  3 ? 
primary 'Rudolph, M.G.' 4 ? 
primary 'Teyton, L.'    5 ? 
primary 'Wilson, I.A.'  6 ? 
# 
_cell.entry_id           1MWA 
_cell.length_a           297.899 
_cell.length_b           95.942 
_cell.length_c           84.735 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1MWA 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man '2C T CELL RECEPTOR ALPHA CHAIN' 22298.889 2   ? ? ?                ? 
2  polymer     man '2C T CELL RECEPTOR BETA CHAIN' 26284.180 2   ? ? ?                ? 
3  polymer     man 'H-2KBM3 MHC CLASS I MOLECULE HEAVY CHAIN' 31719.406 2   ? ? ?                ? 
4  polymer     man 'MICROGLOBULIN MHC LIGHT CHAIN' 11704.359 2   ? ? ?                ? 
5  polymer     syn DEV8 1064.168  2   ? ? 'residues 54-61' 'derived from NADH-UBIQUINONE OXIDOREDUCTASE MLRQ SUBUNIT' 
6  branched    man '2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 424.401   2   ? ? ? ? 
7  branched    man 
'beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose' 586.542   3   
? ? ?                ?                                                          
8  non-polymer syn GLYCEROL 92.094    3   ? ? ?                ?                                                          
9  non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   1   ? ? ?                ? 
10 non-polymer syn 'ACETIC ACID' 60.052    1   ? ? ?                ?                                                          
11 water       nat water 18.015    675 ? ? ?                ?                                                          
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 '2C alpha chain'                                                               
2 '2C beta chain'                                                                
3 'H-2Kbm3 heavy chain, H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN' 
4 'microglobulin light chain'                                                    
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASV
HWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQNPEPAVYALKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDATV
LDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPC
;
;QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASV
HWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQNPEPAVYALKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDATV
LDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPC
;
A,C ? 
2 'polypeptide(L)' no no 
;EAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILEL
ATPSQTSVYFCASGGGGTLYFGAGTRLSVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGK
EVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADC
;
;EAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILEL
ATPSQTSVYFCASGGGGTLYFGAGTRLSVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGK
EVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADC
;
B,D ? 
3 'polypeptide(L)' no no 
;GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVSLRT
LLGYYNQSAGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYL
EGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGT
FQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWR
;
;GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVSLRT
LLGYYNQSAGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYL
EGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGT
FQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWR
;
H,I ? 
4 'polypeptide(L)' no no 
;IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYAC
RVKHDSMAEPKTVYWDRDM
;
;IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYAC
RVKHDSMAEPKTVYWDRDM
;
L,M ? 
5 'polypeptide(L)' no no EQYKFYSV EQYKFYSV P,Q ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   SER n 
1 3   VAL n 
1 4   THR n 
1 5   GLN n 
1 6   PRO n 
1 7   ASP n 
1 8   ALA n 
1 9   ARG n 
1 10  VAL n 
1 11  THR n 
1 12  VAL n 
1 13  SER n 
1 14  GLU n 
1 15  GLY n 
1 16  ALA n 
1 17  SER n 
1 18  LEU n 
1 19  GLN n 
1 20  LEU n 
1 21  ARG n 
1 22  CYS n 
1 23  LYS n 
1 24  TYR n 
1 25  SER n 
1 26  TYR n 
1 27  SER n 
1 28  ALA n 
1 29  THR n 
1 30  PRO n 
1 31  TYR n 
1 32  LEU n 
1 33  PHE n 
1 34  TRP n 
1 35  TYR n 
1 36  VAL n 
1 37  GLN n 
1 38  TYR n 
1 39  PRO n 
1 40  ARG n 
1 41  GLN n 
1 42  GLY n 
1 43  LEU n 
1 44  GLN n 
1 45  LEU n 
1 46  LEU n 
1 47  LEU n 
1 48  LYS n 
1 49  TYR n 
1 50  TYR n 
1 51  SER n 
1 52  GLY n 
1 53  ASP n 
1 54  PRO n 
1 55  VAL n 
1 56  VAL n 
1 57  GLN n 
1 58  GLY n 
1 59  VAL n 
1 60  ASN n 
1 61  GLY n 
1 62  PHE n 
1 63  GLU n 
1 64  ALA n 
1 65  GLU n 
1 66  PHE n 
1 67  SER n 
1 68  LYS n 
1 69  SER n 
1 70  ASN n 
1 71  SER n 
1 72  SER n 
1 73  PHE n 
1 74  HIS n 
1 75  LEU n 
1 76  ARG n 
1 77  LYS n 
1 78  ALA n 
1 79  SER n 
1 80  VAL n 
1 81  HIS n 
1 82  TRP n 
1 83  SER n 
1 84  ASP n 
1 85  SER n 
1 86  ALA n 
1 87  VAL n 
1 88  TYR n 
1 89  PHE n 
1 90  CYS n 
1 91  ALA n 
1 92  VAL n 
1 93  SER n 
1 94  GLY n 
1 95  PHE n 
1 96  ALA n 
1 97  SER n 
1 98  ALA n 
1 99  LEU n 
1 100 THR n 
1 101 PHE n 
1 102 GLY n 
1 103 SER n 
1 104 GLY n 
1 105 THR n 
1 106 LYS n 
1 107 VAL n 
1 108 ILE n 
1 109 VAL n 
1 110 LEU n 
1 111 PRO n 
1 112 TYR n 
1 113 ILE n 
1 114 GLN n 
1 115 ASN n 
1 116 PRO n 
1 117 GLU n 
1 118 PRO n 
1 119 ALA n 
1 120 VAL n 
1 121 TYR n 
1 122 ALA n 
1 123 LEU n 
1 124 LYS n 
1 125 ASP n 
1 126 PRO n 
1 127 ARG n 
1 128 SER n 
1 129 GLN n 
1 130 ASP n 
1 131 SER n 
1 132 THR n 
1 133 LEU n 
1 134 CYS n 
1 135 LEU n 
1 136 PHE n 
1 137 THR n 
1 138 ASP n 
1 139 PHE n 
1 140 ASP n 
1 141 SER n 
1 142 GLN n 
1 143 ILE n 
1 144 ASN n 
1 145 VAL n 
1 146 PRO n 
1 147 LYS n 
1 148 THR n 
1 149 MET n 
1 150 GLU n 
1 151 SER n 
1 152 GLY n 
1 153 THR n 
1 154 PHE n 
1 155 ILE n 
1 156 THR n 
1 157 ASP n 
1 158 ALA n 
1 159 THR n 
1 160 VAL n 
1 161 LEU n 
1 162 ASP n 
1 163 MET n 
1 164 LYS n 
1 165 ALA n 
1 166 MET n 
1 167 ASP n 
1 168 SER n 
1 169 LYS n 
1 170 SER n 
1 171 ASN n 
1 172 GLY n 
1 173 ALA n 
1 174 ILE n 
1 175 ALA n 
1 176 TRP n 
1 177 SER n 
1 178 ASN n 
1 179 GLN n 
1 180 THR n 
1 181 SER n 
1 182 PHE n 
1 183 THR n 
1 184 CYS n 
1 185 GLN n 
1 186 ASP n 
1 187 ILE n 
1 188 PHE n 
1 189 LYS n 
1 190 GLU n 
1 191 THR n 
1 192 ASN n 
1 193 ALA n 
1 194 THR n 
1 195 TYR n 
1 196 PRO n 
1 197 SER n 
1 198 SER n 
1 199 ASP n 
1 200 VAL n 
1 201 PRO n 
1 202 CYS n 
2 1   GLU n 
2 2   ALA n 
2 3   ALA n 
2 4   VAL n 
2 5   THR n 
2 6   GLN n 
2 7   SER n 
2 8   PRO n 
2 9   ARG n 
2 10  ASN n 
2 11  LYS n 
2 12  VAL n 
2 13  ALA n 
2 14  VAL n 
2 15  THR n 
2 16  GLY n 
2 17  GLY n 
2 18  LYS n 
2 19  VAL n 
2 20  THR n 
2 21  LEU n 
2 22  SER n 
2 23  CYS n 
2 24  ASN n 
2 25  GLN n 
2 26  THR n 
2 27  ASN n 
2 28  ASN n 
2 29  HIS n 
2 30  ASN n 
2 31  ASN n 
2 32  MET n 
2 33  TYR n 
2 34  TRP n 
2 35  TYR n 
2 36  ARG n 
2 37  GLN n 
2 38  ASP n 
2 39  THR n 
2 40  GLY n 
2 41  HIS n 
2 42  GLY n 
2 43  LEU n 
2 44  ARG n 
2 45  LEU n 
2 46  ILE n 
2 47  HIS n 
2 48  TYR n 
2 49  SER n 
2 50  TYR n 
2 51  GLY n 
2 52  ALA n 
2 53  GLY n 
2 54  SER n 
2 55  THR n 
2 56  GLU n 
2 57  LYS n 
2 58  GLY n 
2 59  ASP n 
2 60  ILE n 
2 61  PRO n 
2 62  ASP n 
2 63  GLY n 
2 64  TYR n 
2 65  LYS n 
2 66  ALA n 
2 67  SER n 
2 68  ARG n 
2 69  PRO n 
2 70  SER n 
2 71  GLN n 
2 72  GLU n 
2 73  ASN n 
2 74  PHE n 
2 75  SER n 
2 76  LEU n 
2 77  ILE n 
2 78  LEU n 
2 79  GLU n 
2 80  LEU n 
2 81  ALA n 
2 82  THR n 
2 83  PRO n 
2 84  SER n 
2 85  GLN n 
2 86  THR n 
2 87  SER n 
2 88  VAL n 
2 89  TYR n 
2 90  PHE n 
2 91  CYS n 
2 92  ALA n 
2 93  SER n 
2 94  GLY n 
2 95  GLY n 
2 96  GLY n 
2 97  GLY n 
2 98  THR n 
2 99  LEU n 
2 100 TYR n 
2 101 PHE n 
2 102 GLY n 
2 103 ALA n 
2 104 GLY n 
2 105 THR n 
2 106 ARG n 
2 107 LEU n 
2 108 SER n 
2 109 VAL n 
2 110 LEU n 
2 111 GLU n 
2 112 ASP n 
2 113 LEU n 
2 114 ARG n 
2 115 ASN n 
2 116 VAL n 
2 117 THR n 
2 118 PRO n 
2 119 PRO n 
2 120 LYS n 
2 121 VAL n 
2 122 SER n 
2 123 LEU n 
2 124 PHE n 
2 125 GLU n 
2 126 PRO n 
2 127 SER n 
2 128 LYS n 
2 129 ALA n 
2 130 GLU n 
2 131 ILE n 
2 132 ALA n 
2 133 ASN n 
2 134 LYS n 
2 135 GLN n 
2 136 LYS n 
2 137 ALA n 
2 138 THR n 
2 139 LEU n 
2 140 VAL n 
2 141 CYS n 
2 142 LEU n 
2 143 ALA n 
2 144 ARG n 
2 145 GLY n 
2 146 PHE n 
2 147 PHE n 
2 148 PRO n 
2 149 ASP n 
2 150 HIS n 
2 151 VAL n 
2 152 GLU n 
2 153 LEU n 
2 154 SER n 
2 155 TRP n 
2 156 TRP n 
2 157 VAL n 
2 158 ASN n 
2 159 GLY n 
2 160 LYS n 
2 161 GLU n 
2 162 VAL n 
2 163 HIS n 
2 164 SER n 
2 165 GLY n 
2 166 VAL n 
2 167 SER n 
2 168 THR n 
2 169 ASP n 
2 170 PRO n 
2 171 GLN n 
2 172 ALA n 
2 173 TYR n 
2 174 LYS n 
2 175 GLU n 
2 176 SER n 
2 177 ASN n 
2 178 TYR n 
2 179 SER n 
2 180 TYR n 
2 181 CYS n 
2 182 LEU n 
2 183 SER n 
2 184 SER n 
2 185 ARG n 
2 186 LEU n 
2 187 ARG n 
2 188 VAL n 
2 189 SER n 
2 190 ALA n 
2 191 THR n 
2 192 PHE n 
2 193 TRP n 
2 194 HIS n 
2 195 ASN n 
2 196 PRO n 
2 197 ARG n 
2 198 ASN n 
2 199 HIS n 
2 200 PHE n 
2 201 ARG n 
2 202 CYS n 
2 203 GLN n 
2 204 VAL n 
2 205 GLN n 
2 206 PHE n 
2 207 HIS n 
2 208 GLY n 
2 209 LEU n 
2 210 SER n 
2 211 GLU n 
2 212 GLU n 
2 213 ASP n 
2 214 LYS n 
2 215 TRP n 
2 216 PRO n 
2 217 GLU n 
2 218 GLY n 
2 219 SER n 
2 220 PRO n 
2 221 LYS n 
2 222 PRO n 
2 223 VAL n 
2 224 THR n 
2 225 GLN n 
2 226 ASN n 
2 227 ILE n 
2 228 SER n 
2 229 ALA n 
2 230 GLU n 
2 231 ALA n 
2 232 TRP n 
2 233 GLY n 
2 234 ARG n 
2 235 ALA n 
2 236 ASP n 
2 237 CYS n 
3 1   GLY n 
3 2   PRO n 
3 3   HIS n 
3 4   SER n 
3 5   LEU n 
3 6   ARG n 
3 7   TYR n 
3 8   PHE n 
3 9   VAL n 
3 10  THR n 
3 11  ALA n 
3 12  VAL n 
3 13  SER n 
3 14  ARG n 
3 15  PRO n 
3 16  GLY n 
3 17  LEU n 
3 18  GLY n 
3 19  GLU n 
3 20  PRO n 
3 21  ARG n 
3 22  TYR n 
3 23  MET n 
3 24  GLU n 
3 25  VAL n 
3 26  GLY n 
3 27  TYR n 
3 28  VAL n 
3 29  ASP n 
3 30  ASP n 
3 31  THR n 
3 32  GLU n 
3 33  PHE n 
3 34  VAL n 
3 35  ARG n 
3 36  PHE n 
3 37  ASP n 
3 38  SER n 
3 39  ASP n 
3 40  ALA n 
3 41  GLU n 
3 42  ASN n 
3 43  PRO n 
3 44  ARG n 
3 45  TYR n 
3 46  GLU n 
3 47  PRO n 
3 48  ARG n 
3 49  ALA n 
3 50  ARG n 
3 51  TRP n 
3 52  MET n 
3 53  GLU n 
3 54  GLN n 
3 55  GLU n 
3 56  GLY n 
3 57  PRO n 
3 58  GLU n 
3 59  TYR n 
3 60  TRP n 
3 61  GLU n 
3 62  ARG n 
3 63  GLU n 
3 64  THR n 
3 65  GLN n 
3 66  LYS n 
3 67  ALA n 
3 68  LYS n 
3 69  GLY n 
3 70  ASN n 
3 71  GLU n 
3 72  GLN n 
3 73  SER n 
3 74  PHE n 
3 75  ARG n 
3 76  VAL n 
3 77  SER n 
3 78  LEU n 
3 79  ARG n 
3 80  THR n 
3 81  LEU n 
3 82  LEU n 
3 83  GLY n 
3 84  TYR n 
3 85  TYR n 
3 86  ASN n 
3 87  GLN n 
3 88  SER n 
3 89  ALA n 
3 90  GLY n 
3 91  GLY n 
3 92  SER n 
3 93  HIS n 
3 94  THR n 
3 95  ILE n 
3 96  GLN n 
3 97  VAL n 
3 98  ILE n 
3 99  SER n 
3 100 GLY n 
3 101 CYS n 
3 102 GLU n 
3 103 VAL n 
3 104 GLY n 
3 105 SER n 
3 106 ASP n 
3 107 GLY n 
3 108 ARG n 
3 109 LEU n 
3 110 LEU n 
3 111 ARG n 
3 112 GLY n 
3 113 TYR n 
3 114 GLN n 
3 115 GLN n 
3 116 TYR n 
3 117 ALA n 
3 118 TYR n 
3 119 ASP n 
3 120 GLY n 
3 121 CYS n 
3 122 ASP n 
3 123 TYR n 
3 124 ILE n 
3 125 ALA n 
3 126 LEU n 
3 127 ASN n 
3 128 GLU n 
3 129 ASP n 
3 130 LEU n 
3 131 LYS n 
3 132 THR n 
3 133 TRP n 
3 134 THR n 
3 135 ALA n 
3 136 ALA n 
3 137 ASP n 
3 138 MET n 
3 139 ALA n 
3 140 ALA n 
3 141 LEU n 
3 142 ILE n 
3 143 THR n 
3 144 LYS n 
3 145 HIS n 
3 146 LYS n 
3 147 TRP n 
3 148 GLU n 
3 149 GLN n 
3 150 ALA n 
3 151 GLY n 
3 152 GLU n 
3 153 ALA n 
3 154 GLU n 
3 155 ARG n 
3 156 LEU n 
3 157 ARG n 
3 158 ALA n 
3 159 TYR n 
3 160 LEU n 
3 161 GLU n 
3 162 GLY n 
3 163 THR n 
3 164 CYS n 
3 165 VAL n 
3 166 GLU n 
3 167 TRP n 
3 168 LEU n 
3 169 ARG n 
3 170 ARG n 
3 171 TYR n 
3 172 LEU n 
3 173 LYS n 
3 174 ASN n 
3 175 GLY n 
3 176 ASN n 
3 177 ALA n 
3 178 THR n 
3 179 LEU n 
3 180 LEU n 
3 181 ARG n 
3 182 THR n 
3 183 ASP n 
3 184 SER n 
3 185 PRO n 
3 186 LYS n 
3 187 ALA n 
3 188 HIS n 
3 189 VAL n 
3 190 THR n 
3 191 HIS n 
3 192 HIS n 
3 193 SER n 
3 194 ARG n 
3 195 PRO n 
3 196 GLU n 
3 197 ASP n 
3 198 LYS n 
3 199 VAL n 
3 200 THR n 
3 201 LEU n 
3 202 ARG n 
3 203 CYS n 
3 204 TRP n 
3 205 ALA n 
3 206 LEU n 
3 207 GLY n 
3 208 PHE n 
3 209 TYR n 
3 210 PRO n 
3 211 ALA n 
3 212 ASP n 
3 213 ILE n 
3 214 THR n 
3 215 LEU n 
3 216 THR n 
3 217 TRP n 
3 218 GLN n 
3 219 LEU n 
3 220 ASN n 
3 221 GLY n 
3 222 GLU n 
3 223 GLU n 
3 224 LEU n 
3 225 ILE n 
3 226 GLN n 
3 227 ASP n 
3 228 MET n 
3 229 GLU n 
3 230 LEU n 
3 231 VAL n 
3 232 GLU n 
3 233 THR n 
3 234 ARG n 
3 235 PRO n 
3 236 ALA n 
3 237 GLY n 
3 238 ASP n 
3 239 GLY n 
3 240 THR n 
3 241 PHE n 
3 242 GLN n 
3 243 LYS n 
3 244 TRP n 
3 245 ALA n 
3 246 SER n 
3 247 VAL n 
3 248 VAL n 
3 249 VAL n 
3 250 PRO n 
3 251 LEU n 
3 252 GLY n 
3 253 LYS n 
3 254 GLU n 
3 255 GLN n 
3 256 TYR n 
3 257 TYR n 
3 258 THR n 
3 259 CYS n 
3 260 HIS n 
3 261 VAL n 
3 262 TYR n 
3 263 HIS n 
3 264 GLN n 
3 265 GLY n 
3 266 LEU n 
3 267 PRO n 
3 268 GLU n 
3 269 PRO n 
3 270 LEU n 
3 271 THR n 
3 272 LEU n 
3 273 ARG n 
3 274 TRP n 
3 275 ARG n 
4 1   ILE n 
4 2   GLN n 
4 3   LYS n 
4 4   THR n 
4 5   PRO n 
4 6   GLN n 
4 7   ILE n 
4 8   GLN n 
4 9   VAL n 
4 10  TYR n 
4 11  SER n 
4 12  ARG n 
4 13  HIS n 
4 14  PRO n 
4 15  PRO n 
4 16  GLU n 
4 17  ASN n 
4 18  GLY n 
4 19  LYS n 
4 20  PRO n 
4 21  ASN n 
4 22  ILE n 
4 23  LEU n 
4 24  ASN n 
4 25  CYS n 
4 26  TYR n 
4 27  VAL n 
4 28  THR n 
4 29  GLN n 
4 30  PHE n 
4 31  HIS n 
4 32  PRO n 
4 33  PRO n 
4 34  HIS n 
4 35  ILE n 
4 36  GLU n 
4 37  ILE n 
4 38  GLN n 
4 39  MET n 
4 40  LEU n 
4 41  LYS n 
4 42  ASN n 
4 43  GLY n 
4 44  LYS n 
4 45  LYS n 
4 46  ILE n 
4 47  PRO n 
4 48  LYS n 
4 49  VAL n 
4 50  GLU n 
4 51  MET n 
4 52  SER n 
4 53  ASP n 
4 54  MET n 
4 55  SER n 
4 56  PHE n 
4 57  SER n 
4 58  LYS n 
4 59  ASP n 
4 60  TRP n 
4 61  SER n 
4 62  PHE n 
4 63  TYR n 
4 64  ILE n 
4 65  LEU n 
4 66  ALA n 
4 67  HIS n 
4 68  THR n 
4 69  GLU n 
4 70  PHE n 
4 71  THR n 
4 72  PRO n 
4 73  THR n 
4 74  GLU n 
4 75  THR n 
4 76  ASP n 
4 77  THR n 
4 78  TYR n 
4 79  ALA n 
4 80  CYS n 
4 81  ARG n 
4 82  VAL n 
4 83  LYS n 
4 84  HIS n 
4 85  ASP n 
4 86  SER n 
4 87  MET n 
4 88  ALA n 
4 89  GLU n 
4 90  PRO n 
4 91  LYS n 
4 92  THR n 
4 93  VAL n 
4 94  TYR n 
4 95  TRP n 
4 96  ASP n 
4 97  ARG n 
4 98  ASP n 
4 99  MET n 
5 1   GLU n 
5 2   GLN n 
5 3   TYR n 
5 4   LYS n 
5 5   PHE n 
5 6   TYR n 
5 7   SER n 
5 8   VAL n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'fruit fly' 'Drosophila melanogaster' 7227 
Drosophila ? ? ? ? ? S2 ? ? ? ? ? ? ? 'metalloth. promoter' ? ? ? ? ? ? 
2 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'fruit fly' 'Drosophila melanogaster' 7227 
Drosophila ? ? ? ? ? S2 ? ? ? ? ? ? ? 'metalloth. promoter' ? ? ? ? ? ? 
3 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'fruit fly' 'Drosophila melanogaster' 7227 
Drosophila ? ? ? ? ? S2 ? ? ? ? ? ? ? 'metalloth. promoter' ? ? ? ? ? ? 
4 1 sample ? ? ? 'house mouse' Mus ? ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? 'fruit fly' 'Drosophila melanogaster' 7227 
Drosophila ? ? ? ? ? S2 ? ? ? ? ? ? ? 'metalloth. promoter' ? ? ? ? ? ? 
# 
_pdbx_entity_src_syn.entity_id              5 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                
'The peptide was chemically synthesized. The peptide is naturally found in Mus musculus (Mouse).' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 GB  1012285A   1 
;QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVNGFEAEFSKSNSSFHLRKASV
HWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQNPEPAVYQLKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDKTV
LDMKAMDSKSNGAIAWSNQTSFTCQDIFKETNATYPSSDVPC
;
21 224220  ? 
2 GB  AAB41230   2 
;EAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPDGYKASRPSQENFSLILEL
ATPSQTSVYFCASGGQGRAEQFFGPGTRLTVLEDLRNVTPPKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVN
GKEVHSGVSTDPQAYKESNYSYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADC
;
30 1791255 ? 
3 UNP HA1B_MOUSE 3 
;GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRT
LLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYL
EGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGT
FQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWE
;
22 P01901  ? 
4 UNP B2MG_MOUSE 4 
;IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYAC
RVKHDSMAEPKTVYWDRDM
;
21 P01887  ? 
5 UNP NUML_MOUSE 5 EQYKFYSV 54 Q62425  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 1MWA A 1 ? 202 ? 224220  21 ? 222 ? 1 213 
2  1 1MWA C 1 ? 202 ? 224220  21 ? 222 ? 1 213 
3  2 1MWA B 1 ? 237 ? 1791255 30 ? 268 ? 1 247 
4  2 1MWA D 1 ? 237 ? 1791255 30 ? 268 ? 1 247 
5  3 1MWA H 1 ? 275 ? P01901  22 ? 296 ? 1 275 
6  3 1MWA I 1 ? 275 ? P01901  22 ? 296 ? 1 275 
7  4 1MWA L 1 ? 99  ? P01887  21 ? 119 ? 1 99  
8  4 1MWA M 1 ? 99  ? P01887  21 ? 119 ? 1 99  
9  5 1MWA P 1 ? 8   ? Q62425  54 ? 61  ? 1 8   
10 5 1MWA Q 1 ? 8   ? Q62425  54 ? 61  ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1MWA ALA A 122 ? GB  224220  GLN 142 'SEE REMARK 999' 127 1  
1 1MWA ALA A 158 ? GB  224220  LYS 178 'SEE REMARK 999' 165 2  
2 1MWA ALA C 122 ? GB  224220  GLN 142 'SEE REMARK 999' 127 3  
2 1MWA ALA C 158 ? GB  224220  LYS 178 'SEE REMARK 999' 165 4  
3 1MWA GLY B 96  ? GB  1791255 GLN 125 'SEE REMARK 999' 97  5  
3 1MWA ?   B ?   ? GB  1791255 ARG 127 'SEE REMARK 999' ?   6  
3 1MWA ?   B ?   ? GB  1791255 ALA 128 'SEE REMARK 999' ?   7  
3 1MWA THR B 98  ? GB  1791255 GLU 129 'SEE REMARK 999' 105 8  
3 1MWA LEU B 99  ? GB  1791255 GLN 130 'SEE REMARK 999' 106 9  
3 1MWA TYR B 100 ? GB  1791255 PHE 131 'SEE REMARK 999' 107 10 
3 1MWA ALA B 103 ? GB  1791255 PRO 134 'SEE REMARK 999' 110 11 
3 1MWA SER B 108 ? GB  1791255 THR 139 'SEE REMARK 999' 115 12 
4 1MWA GLY D 96  ? GB  1791255 GLN 125 'SEE REMARK 999' 97  13 
4 1MWA ?   D ?   ? GB  1791255 ARG 127 'SEE REMARK 999' ?   14 
4 1MWA ?   D ?   ? GB  1791255 ALA 128 'SEE REMARK 999' ?   15 
4 1MWA THR D 98  ? GB  1791255 GLU 129 'SEE REMARK 999' 105 16 
4 1MWA LEU D 99  ? GB  1791255 GLN 130 'SEE REMARK 999' 106 17 
4 1MWA TYR D 100 ? GB  1791255 PHE 131 'SEE REMARK 999' 107 18 
4 1MWA ALA D 103 ? GB  1791255 PRO 134 'SEE REMARK 999' 110 19 
4 1MWA SER D 108 ? GB  1791255 THR 139 'SEE REMARK 999' 115 20 
5 1MWA SER H 77  ? UNP P01901  ASP 98  conflict         77  21 
5 1MWA ALA H 89  ? UNP P01901  LYS 110 conflict         89  22 
5 1MWA ARG H 275 ? UNP P01901  GLU 296 conflict         275 23 
6 1MWA SER I 77  ? UNP P01901  ASP 98  conflict         77  24 
6 1MWA ALA I 89  ? UNP P01901  LYS 110 conflict         89  25 
6 1MWA ARG I 275 ? UNP P01901  GLU 296 conflict         275 26 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACY non-polymer                  . 'ACETIC ACID'                            ?                               'C2 H4 O2'       
60.052  
ALA 'L-peptide linking'          y ALANINE                                  ?                               'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking'          y ARGININE                                 ?                               'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ?                               'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ?                               'C4 H7 N O4'     
133.103 
BMA 'D-saccharide, beta linking' . beta-D-mannopyranose                     ?                               'C6 H12 O6'      
180.156 
CYS 'L-peptide linking'          y CYSTEINE                                 ?                               'C3 H7 N O2 S'   
121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ?                               'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ?                               'C5 H9 N O4'     
147.129 
GLY 'peptide linking'            y GLYCINE                                  ?                               'C2 H5 N O2'     
75.067  
GOL non-polymer                  . GLYCEROL                                 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       
92.094  
HIS 'L-peptide linking'          y HISTIDINE                                ?                               'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer                  . WATER                                    ?                               'H2 O'           
18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ?                               'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ?                               'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking'          y LYSINE                                   ?                               'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking'          y METHIONINE                               ?                               'C5 H11 N O2 S'  
149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ?                               'C8 H15 N O6'    
221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ?                               'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking'          y PROLINE                                  ?                               'C5 H9 N O2'     
115.130 
SER 'L-peptide linking'          y SERINE                                   ?                               'C3 H7 N O3'     
105.093 
THR 'L-peptide linking'          y THREONINE                                ?                               'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ?                               'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ?                               'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking'          y VALINE                                   ?                               'C5 H11 N O2'    
117.146 
# 
_exptl.entry_id          1MWA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   62.17 
_exptl_crystal.density_Matthews      3.25 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277.16 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pdbx_details    
'0.1M TRIS ACETATE, 12% PEG4000, 18% glycerol, pH 6.8, VAPOR DIFFUSION, SITTING DROP, temperature 277.16K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           104.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-01-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI (311)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     1MWA 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.d_resolution_high            2.4 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   ? 
_reflns.number_obs                   95548 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.052 
_reflns.pdbx_netI_over_sigmaI        22.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.44 
_reflns_shell.percent_possible_all   99.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.453 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1MWA 
_refine.ls_number_reflns_obs                     90694 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             49.39 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    100.0 
_refine.ls_R_factor_obs                          0.28543 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.28398 
_refine.ls_R_factor_R_free                       0.31273 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  4781 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               47.497 
_refine.aniso_B[1][1]                            -0.30 
_refine.aniso_B[2][2]                            2.81 
_refine.aniso_B[3][3]                            -2.51 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.29970 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       0.43932 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        13089 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         209 
_refine_hist.number_atoms_solvent             675 
_refine_hist.number_atoms_total               13973 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        49.39 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d    0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg 1.633 ? ? ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr      0.094 ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1MWA 
_struct.title                     '2C/H-2KBM3/DEV8 ALLOGENEIC COMPLEX' 
_struct.pdbx_descriptor           
;2C T Cell receptor alpha chain/2C T Cell receptor beta chain/H-2Kbm3 MHC Class I molecule heavy chain/microglobulin MHC light chain/dEV8
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MWA 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'Ig domain, antigen recognition, complementarity determining region, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 2  ? 
D  N N 2  ? 
E  N N 3  ? 
F  N N 3  ? 
G  N N 4  ? 
H  N N 4  ? 
I  N N 5  ? 
J  N N 5  ? 
K  N N 6  ? 
L  N N 7  ? 
M  N N 7  ? 
N  N N 7  ? 
O  N N 6  ? 
P  N N 8  ? 
Q  N N 9  ? 
R  N N 8  ? 
S  N N 8  ? 
T  N N 10 ? 
U  N N 11 ? 
V  N N 11 ? 
W  N N 11 ? 
X  N N 11 ? 
Y  N N 11 ? 
Z  N N 11 ? 
AA N N 11 ? 
BA N N 11 ? 
CA N N 11 ? 
DA N N 11 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 81  ? SER A 85  ? HIS A 81  SER A 85  5 ? 5  
HELX_P HELX_P2  2  THR A 183 ? PHE A 188 ? THR A 190 PHE A 195 1 ? 6  
HELX_P HELX_P3  3  HIS B 81  ? SER B 85  ? HIS C 81  SER C 85  5 ? 5  
HELX_P HELX_P4  4  THR C 82  ? THR C 86  ? THR B 83  THR B 87  5 ? 5  
HELX_P HELX_P5  5  SER C 127 ? GLN C 135 ? SER B 133 GLN B 141 1 ? 9  
HELX_P HELX_P6  6  ALA C 190 ? ASN C 195 ? ALA B 200 ASN B 205 1 ? 6  
HELX_P HELX_P7  7  THR D 82  ? THR D 86  ? THR D 83  THR D 87  5 ? 5  
HELX_P HELX_P8  8  SER D 189 ? HIS D 194 ? SER D 199 HIS D 204 1 ? 6  
HELX_P HELX_P9  9  ALA E 49  ? GLU E 55  ? ALA H 49  GLU H 55  5 ? 7  
HELX_P HELX_P10 10 GLY E 56  ? TYR E 85  ? GLY H 56  TYR H 85  1 ? 30 
HELX_P HELX_P11 11 ASP E 137 ? ALA E 150 ? ASP H 137 ALA H 150 1 ? 14 
HELX_P HELX_P12 12 GLY E 151 ? GLY E 162 ? GLY H 151 GLY H 162 1 ? 12 
HELX_P HELX_P13 13 GLY E 162 ? LEU E 180 ? GLY H 162 LEU H 180 1 ? 19 
HELX_P HELX_P14 14 ALA F 49  ? GLN F 54  ? ALA I 49  GLN I 54  5 ? 6  
HELX_P HELX_P15 15 GLU F 58  ? TYR F 85  ? GLU I 58  TYR I 85  1 ? 28 
HELX_P HELX_P16 16 ALA F 140 ? LYS F 146 ? ALA I 140 LYS I 146 1 ? 7  
HELX_P HELX_P17 17 GLY F 151 ? ALA F 153 ? GLY I 151 ALA I 153 5 ? 3  
HELX_P HELX_P18 18 GLU F 154 ? GLY F 162 ? GLU I 154 GLY I 162 1 ? 9  
HELX_P HELX_P19 19 GLY F 162 ? LEU F 180 ? GLY I 162 LEU I 180 1 ? 19 
HELX_P HELX_P20 20 LYS F 253 ? GLN F 255 ? LYS I 253 GLN I 255 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 22  SG  ? ? ? 1_555 A CYS 90  SG ? ? A CYS 22  A CYS 90  1_555 ? ? ? ? ? ? ? 2.018 ? ?               
disulf2  disulf ?    ? A CYS 134 SG  ? ? ? 1_555 A CYS 184 SG ? ? A CYS 141 A CYS 191 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf3  disulf ?    ? B CYS 22  SG  ? ? ? 1_555 B CYS 90  SG ? ? C CYS 22  C CYS 90  1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf4  disulf ?    ? B CYS 134 SG  ? ? ? 1_555 B CYS 184 SG ? ? C CYS 141 C CYS 191 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf5  disulf ?    ? C CYS 23  SG  ? ? ? 1_555 C CYS 91  SG ? ? B CYS 23  B CYS 92  1_555 ? ? ? ? ? ? ? 2.022 ? ?               
disulf6  disulf ?    ? C CYS 141 SG  ? ? ? 1_555 C CYS 202 SG ? ? B CYS 147 B CYS 212 1_555 ? ? ? ? ? ? ? 2.001 ? ?               
disulf7  disulf ?    ? D CYS 23  SG  ? ? ? 1_555 D CYS 91  SG ? ? D CYS 23  D CYS 92  1_555 ? ? ? ? ? ? ? 2.029 ? ?               
disulf8  disulf ?    ? D CYS 141 SG  ? ? ? 1_555 D CYS 202 SG ? ? D CYS 147 D CYS 212 1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf9  disulf ?    ? E CYS 101 SG  ? ? ? 1_555 E CYS 164 SG ? ? H CYS 101 H CYS 164 1_555 ? ? ? ? ? ? ? 2.060 ? ?               
disulf10 disulf ?    ? E CYS 203 SG  ? ? ? 1_555 E CYS 259 SG ? ? H CYS 203 H CYS 259 1_555 ? ? ? ? ? ? ? 2.021 ? ?               
disulf11 disulf ?    ? F CYS 101 SG  ? ? ? 1_555 F CYS 164 SG ? ? I CYS 101 I CYS 164 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf12 disulf ?    ? F CYS 203 SG  ? ? ? 1_555 F CYS 259 SG ? ? I CYS 203 I CYS 259 1_555 ? ? ? ? ? ? ? 2.014 ? ?               
disulf13 disulf ?    ? G CYS 25  SG  ? ? ? 1_555 G CYS 80  SG ? ? L CYS 25  L CYS 80  1_555 ? ? ? ? ? ? ? 2.020 ? ?               
disulf14 disulf ?    ? H CYS 25  SG  ? ? ? 1_555 H CYS 80  SG ? ? M CYS 25  M CYS 80  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
covale1  covale one  ? A ASN 70  ND2 ? ? ? 1_555 K NAG .   C1 ? ? A ASN 70  E NAG 1   1_555 ? ? ? ? ? ? ? 1.416 ? N-Glycosylation 
covale2  covale one  ? A ASN 178 ND2 ? ? ? 1_555 L NAG .   C1 ? ? A ASN 185 F NAG 1   1_555 ? ? ? ? ? ? ? 1.938 ? N-Glycosylation 
covale3  covale one  ? B ASN 70  ND2 ? ? ? 1_555 M NAG .   C1 ? ? C ASN 70  G NAG 1   1_555 ? ? ? ? ? ? ? 1.476 ? N-Glycosylation 
covale4  covale one  ? C ASN 24  ND2 ? ? ? 1_555 Q NAG .   C1 ? ? B ASN 24  B NAG 808 1_555 ? ? ? ? ? ? ? 1.495 ? N-Glycosylation 
covale5  covale one  ? C ASN 226 ND2 ? ? ? 1_555 N NAG .   C1 ? ? B ASN 236 J NAG 1   1_555 ? ? ? ? ? ? ? 1.954 ? N-Glycosylation 
covale6  covale one  ? E ASN 176 ND2 ? ? ? 1_555 O NAG .   C1 ? ? H ASN 176 K NAG 1   1_555 ? ? ? ? ? ? ? 1.467 ? N-Glycosylation 
covale7  covale both ? K NAG .   O4  ? ? ? 1_555 K NAG .   C1 ? ? E NAG 1   E NAG 2   1_555 ? ? ? ? ? ? ? 1.510 ? ?               
covale8  covale both ? L NAG .   O4  ? ? ? 1_555 L NAG .   C1 ? ? F NAG 1   F NAG 2   1_555 ? ? ? ? ? ? ? 1.736 ? ?               
covale9  covale both ? L NAG .   O4  ? ? ? 1_555 L BMA .   C1 ? ? F NAG 2   F BMA 3   1_555 ? ? ? ? ? ? ? 1.415 ? ?               
covale10 covale both ? M NAG .   O4  ? ? ? 1_555 M NAG .   C1 ? ? G NAG 1   G NAG 2   1_555 ? ? ? ? ? ? ? 1.406 ? ?               
covale11 covale both ? M NAG .   O4  ? ? ? 1_555 M BMA .   C1 ? ? G NAG 2   G BMA 3   1_555 ? ? ? ? ? ? ? 1.470 ? ?               
covale12 covale both ? N NAG .   O4  ? ? ? 1_555 N NAG .   C1 ? ? J NAG 1   J NAG 2   1_555 ? ? ? ? ? ? ? 1.463 ? ?               
covale13 covale both ? N NAG .   O4  ? ? ? 1_555 N BMA .   C1 ? ? J NAG 2   J BMA 3   1_555 ? ? ? ? ? ? ? 1.330 ? ?               
covale14 covale both ? O NAG .   O4  ? ? ? 1_555 O NAG .   C1 ? ? K NAG 1   K NAG 2   1_555 ? ? ? ? ? ? ? 1.971 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 7   C . ? SER 7   B PRO 8   C ? PRO 8   B 1 -1.92 
2 SER 7   D . ? SER 7   D PRO 8   D ? PRO 8   D 1 -2.15 
3 TYR 209 E . ? TYR 209 H PRO 210 E ? PRO 210 H 1 -3.21 
4 TYR 209 F . ? TYR 209 I PRO 210 F ? PRO 210 I 1 -1.27 
5 HIS 31  G . ? HIS 31  L PRO 32  G ? PRO 32  L 1 4.17  
6 HIS 31  H . ? HIS 31  M PRO 32  H ? PRO 32  M 1 -1.93 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 2 ? 
B  ? 4 ? 
C  ? 5 ? 
D  ? 4 ? 
E  ? 4 ? 
F  ? 3 ? 
G  ? 2 ? 
H  ? 4 ? 
I  ? 5 ? 
J  ? 3 ? 
K  ? 2 ? 
L  ? 4 ? 
M  ? 5 ? 
N  ? 6 ? 
O  ? 4 ? 
P  ? 4 ? 
Q  ? 4 ? 
R  ? 4 ? 
S  ? 5 ? 
T  ? 6 ? 
U  ? 4 ? 
V  ? 4 ? 
W  ? 4 ? 
X  ? 7 ? 
Y  ? 4 ? 
Z  ? 4 ? 
AA ? 4 ? 
AB ? 7 ? 
AC ? 2 ? 
AD ? 4 ? 
AE ? 4 ? 
AF ? 3 ? 
AG ? 4 ? 
AH ? 4 ? 
AI ? 4 ? 
AJ ? 4 ? 
AK ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
C  1 2 ? anti-parallel 
C  2 3 ? anti-parallel 
C  3 4 ? anti-parallel 
C  4 5 ? parallel      
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? anti-parallel 
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
I  3 4 ? anti-parallel 
I  4 5 ? parallel      
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
K  1 2 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
L  3 4 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
M  4 5 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
N  4 5 ? anti-parallel 
N  5 6 ? parallel      
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
O  3 4 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
R  3 4 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
S  4 5 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? anti-parallel 
T  4 5 ? anti-parallel 
T  5 6 ? parallel      
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
X  1 2 ? anti-parallel 
X  2 3 ? anti-parallel 
X  3 4 ? anti-parallel 
X  4 5 ? anti-parallel 
X  5 6 ? anti-parallel 
X  6 7 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? anti-parallel 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AB 5 6 ? anti-parallel 
AB 6 7 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 SER A 2   ? THR A 4   ? SER A 2   THR A 4   
A  2 LYS A 23  ? SER A 25  ? LYS A 23  SER A 25  
B  1 LEU A 43  ? TYR A 49  ? LEU A 43  TYR A 49  
B  2 TYR A 31  ? GLN A 37  ? TYR A 31  GLN A 37  
B  3 ALA A 86  ? SER A 93  ? ALA A 86  SER A 93  
B  4 THR A 100 ? PHE A 101 ? THR A 105 PHE A 106 
C  1 LEU A 43  ? TYR A 49  ? LEU A 43  TYR A 49  
C  2 TYR A 31  ? GLN A 37  ? TYR A 31  GLN A 37  
C  3 ALA A 86  ? SER A 93  ? ALA A 86  SER A 93  
C  4 THR A 105 ? LEU A 110 ? THR A 110 LEU A 115 
C  5 ARG A 9   ? SER A 13  ? ARG A 9   SER A 13  
D  1 LEU A 18  ? LEU A 20  ? LEU A 18  LEU A 20  
D  2 SER A 72  ? LYS A 77  ? SER A 72  LYS A 77  
D  3 GLU A 63  ? SER A 67  ? GLU A 63  SER A 67  
D  4 VAL A 55  ? GLN A 57  ? VAL A 55  GLN A 57  
E  1 THR A 159 ? ASP A 162 ? THR A 166 ASP A 169 
E  2 LYS A 169 ? SER A 177 ? LYS A 176 SER A 184 
E  3 CYS A 134 ? THR A 137 ? CYS A 141 THR A 144 
E  4 ALA A 119 ? ALA A 122 ? ALA A 124 ALA A 127 
F  1 THR A 159 ? ASP A 162 ? THR A 166 ASP A 169 
F  2 LYS A 169 ? SER A 177 ? LYS A 176 SER A 184 
F  3 THR A 153 ? ILE A 155 ? THR A 160 ILE A 162 
G  1 VAL B 3   ? THR B 4   ? VAL C 3   THR C 4   
G  2 LYS B 23  ? TYR B 24  ? LYS C 23  TYR C 24  
H  1 GLN B 44  ? LYS B 48  ? GLN C 44  LYS C 48  
H  2 TYR B 31  ? GLN B 37  ? TYR C 31  GLN C 37  
H  3 ALA B 86  ? SER B 93  ? ALA C 86  SER C 93  
H  4 THR B 100 ? PHE B 101 ? THR C 105 PHE C 106 
I  1 GLN B 44  ? LYS B 48  ? GLN C 44  LYS C 48  
I  2 TYR B 31  ? GLN B 37  ? TYR C 31  GLN C 37  
I  3 ALA B 86  ? SER B 93  ? ALA C 86  SER C 93  
I  4 LYS B 106 ? LEU B 110 ? LYS C 111 LEU C 115 
I  5 VAL B 10  ? SER B 13  ? VAL C 10  SER C 13  
J  1 LEU B 18  ? LEU B 20  ? LEU C 18  LEU C 20  
J  2 LEU B 75  ? LYS B 77  ? LEU C 75  LYS C 77  
J  3 PHE B 62  ? ALA B 64  ? PHE C 62  ALA C 64  
K  1 THR B 159 ? LEU B 161 ? THR C 166 LEU C 168 
K  2 SER B 170 ? GLY B 172 ? SER C 177 GLY C 179 
L  1 VAL C 4   ? SER C 7   ? VAL B 4   SER B 7   
L  2 VAL C 19  ? GLN C 25  ? VAL B 19  GLN B 25  
L  3 ASN C 73  ? LEU C 78  ? ASN B 74  LEU B 79  
L  4 LYS C 65  ? SER C 70  ? LYS B 66  SER B 71  
M  1 GLU C 56  ? LYS C 57  ? GLU B 56  LYS B 57  
M  2 LEU C 43  ? SER C 49  ? LEU B 43  SER B 49  
M  3 ASN C 31  ? GLN C 37  ? ASN B 31  GLN B 37  
M  4 SER C 87  ? GLY C 94  ? SER B 88  GLY B 95  
M  5 LEU C 99  ? PHE C 101 ? LEU B 106 PHE B 108 
N  1 GLU C 56  ? LYS C 57  ? GLU B 56  LYS B 57  
N  2 LEU C 43  ? SER C 49  ? LEU B 43  SER B 49  
N  3 ASN C 31  ? GLN C 37  ? ASN B 31  GLN B 37  
N  4 SER C 87  ? GLY C 94  ? SER B 88  GLY B 95  
N  5 THR C 105 ? LEU C 110 ? THR B 112 LEU B 316 
N  6 ASN C 10  ? VAL C 14  ? ASN B 10  VAL B 14  
O  1 LYS C 120 ? PHE C 124 ? LYS B 126 PHE B 130 
O  2 LYS C 136 ? PHE C 146 ? LYS B 142 PHE B 152 
O  3 TYR C 180 ? SER C 189 ? TYR B 190 SER B 199 
O  4 VAL C 166 ? THR C 168 ? VAL B 172 THR B 174 
P  1 LYS C 120 ? PHE C 124 ? LYS B 126 PHE B 130 
P  2 LYS C 136 ? PHE C 146 ? LYS B 142 PHE B 152 
P  3 TYR C 180 ? SER C 189 ? TYR B 190 SER B 199 
P  4 TYR C 173 ? LYS C 174 ? TYR B 179 LYS B 180 
Q  1 LYS C 160 ? GLU C 161 ? LYS B 166 GLU B 167 
Q  2 VAL C 151 ? VAL C 157 ? VAL B 157 VAL B 163 
Q  3 HIS C 199 ? PHE C 206 ? HIS B 209 PHE B 216 
Q  4 GLN C 225 ? TRP C 232 ? GLN B 235 TRP B 242 
R  1 VAL D 4   ? SER D 7   ? VAL D 4   SER D 7   
R  2 VAL D 19  ? GLN D 25  ? VAL D 19  GLN D 25  
R  3 ASN D 73  ? LEU D 78  ? ASN D 74  LEU D 79  
R  4 LYS D 65  ? SER D 70  ? LYS D 66  SER D 71  
S  1 GLU D 56  ? LYS D 57  ? GLU D 56  LYS D 57  
S  2 LEU D 43  ? SER D 49  ? LEU D 43  SER D 49  
S  3 ASN D 31  ? GLN D 37  ? ASN D 31  GLN D 37  
S  4 SER D 87  ? GLY D 94  ? SER D 88  GLY D 95  
S  5 LEU D 99  ? PHE D 101 ? LEU D 106 PHE D 108 
T  1 GLU D 56  ? LYS D 57  ? GLU D 56  LYS D 57  
T  2 LEU D 43  ? SER D 49  ? LEU D 43  SER D 49  
T  3 ASN D 31  ? GLN D 37  ? ASN D 31  GLN D 37  
T  4 SER D 87  ? GLY D 94  ? SER D 88  GLY D 95  
T  5 THR D 105 ? LEU D 110 ? THR D 112 LEU D 316 
T  6 ASN D 10  ? VAL D 14  ? ASN D 10  VAL D 14  
U  1 LYS D 120 ? PHE D 124 ? LYS D 126 PHE D 130 
U  2 LYS D 136 ? PHE D 146 ? LYS D 142 PHE D 152 
U  3 TYR D 180 ? SER D 189 ? TYR D 190 SER D 199 
U  4 VAL D 166 ? THR D 168 ? VAL D 172 THR D 174 
V  1 LYS D 120 ? PHE D 124 ? LYS D 126 PHE D 130 
V  2 LYS D 136 ? PHE D 146 ? LYS D 142 PHE D 152 
V  3 TYR D 180 ? SER D 189 ? TYR D 190 SER D 199 
V  4 TYR D 173 ? LYS D 174 ? TYR D 179 LYS D 180 
W  1 LYS D 160 ? GLU D 161 ? LYS D 166 GLU D 167 
W  2 VAL D 151 ? VAL D 157 ? VAL D 157 VAL D 163 
W  3 HIS D 199 ? PHE D 206 ? HIS D 209 PHE D 216 
W  4 GLN D 225 ? TRP D 232 ? GLN D 235 TRP D 242 
X  1 GLU E 46  ? PRO E 47  ? GLU H 46  PRO H 47  
X  2 THR E 31  ? ASP E 37  ? THR H 31  ASP H 37  
X  3 GLY E 18  ? VAL E 28  ? GLY H 18  VAL H 28  
X  4 HIS E 3   ? ARG E 14  ? HIS H 3   ARG H 14  
X  5 THR E 94  ? VAL E 103 ? THR H 94  VAL H 103 
X  6 LEU E 109 ? TYR E 118 ? LEU H 109 TYR H 118 
X  7 CYS E 121 ? ALA E 125 ? CYS H 121 ALA H 125 
Y  1 LYS E 186 ? SER E 193 ? LYS H 186 SER H 193 
Y  2 LYS E 198 ? PHE E 208 ? LYS H 198 PHE H 208 
Y  3 PHE E 241 ? PRO E 250 ? PHE H 241 PRO H 250 
Y  4 GLU E 229 ? LEU E 230 ? GLU H 229 LEU H 230 
Z  1 LYS E 186 ? SER E 193 ? LYS H 186 SER H 193 
Z  2 LYS E 198 ? PHE E 208 ? LYS H 198 PHE H 208 
Z  3 PHE E 241 ? PRO E 250 ? PHE H 241 PRO H 250 
Z  4 ARG E 234 ? PRO E 235 ? ARG H 234 PRO H 235 
AA 1 GLU E 222 ? GLU E 223 ? GLU H 222 GLU H 223 
AA 2 LEU E 215 ? LEU E 219 ? LEU H 215 LEU H 219 
AA 3 TYR E 257 ? VAL E 261 ? TYR H 257 VAL H 261 
AA 4 LEU E 270 ? ARG E 273 ? LEU H 270 ARG H 273 
AB 1 GLU F 46  ? PRO F 47  ? GLU I 46  PRO I 47  
AB 2 THR F 31  ? ASP F 37  ? THR I 31  ASP I 37  
AB 3 GLY F 18  ? VAL F 28  ? GLY I 18  VAL I 28  
AB 4 HIS F 3   ? ARG F 14  ? HIS I 3   ARG I 14  
AB 5 ILE F 95  ? VAL F 103 ? ILE I 95  VAL I 103 
AB 6 ARG F 111 ? TYR F 118 ? ARG I 111 TYR I 118 
AB 7 CYS F 121 ? ASP F 122 ? CYS I 121 ASP I 122 
AC 1 ALA F 125 ? LEU F 126 ? ALA I 125 LEU I 126 
AC 2 TRP F 133 ? THR F 134 ? TRP I 133 THR I 134 
AD 1 LYS F 186 ? ARG F 194 ? LYS I 186 ARG I 194 
AD 2 LYS F 198 ? PHE F 208 ? LYS I 198 PHE I 208 
AD 3 PHE F 241 ? PRO F 250 ? PHE I 241 PRO I 250 
AD 4 MET F 228 ? LEU F 230 ? MET I 228 LEU I 230 
AE 1 LYS F 186 ? ARG F 194 ? LYS I 186 ARG I 194 
AE 2 LYS F 198 ? PHE F 208 ? LYS I 198 PHE I 208 
AE 3 PHE F 241 ? PRO F 250 ? PHE I 241 PRO I 250 
AE 4 ARG F 234 ? PRO F 235 ? ARG I 234 PRO I 235 
AF 1 THR F 214 ? LEU F 219 ? THR I 214 LEU I 219 
AF 2 TYR F 257 ? TYR F 262 ? TYR I 257 TYR I 262 
AF 3 LEU F 270 ? ARG F 273 ? LEU I 270 ARG I 273 
AG 1 GLN G 6   ? SER G 11  ? GLN L 6   SER L 11  
AG 2 ASN G 21  ? PHE G 30  ? ASN L 21  PHE L 30  
AG 3 PHE G 62  ? PHE G 70  ? PHE L 62  PHE L 70  
AG 4 GLU G 50  ? MET G 51  ? GLU L 50  MET L 51  
AH 1 GLN G 6   ? SER G 11  ? GLN L 6   SER L 11  
AH 2 ASN G 21  ? PHE G 30  ? ASN L 21  PHE L 30  
AH 3 PHE G 62  ? PHE G 70  ? PHE L 62  PHE L 70  
AH 4 SER G 55  ? PHE G 56  ? SER L 55  PHE L 56  
AI 1 LYS G 44  ? LYS G 45  ? LYS L 44  LYS L 45  
AI 2 GLU G 36  ? LYS G 41  ? GLU L 36  LYS L 41  
AI 3 TYR G 78  ? LYS G 83  ? TYR L 78  LYS L 83  
AI 4 LYS G 91  ? TYR G 94  ? LYS L 91  TYR L 94  
AJ 1 GLN H 6   ? TYR H 10  ? GLN M 6   TYR M 10  
AJ 2 ASN H 21  ? PHE H 30  ? ASN M 21  PHE M 30  
AJ 3 PHE H 62  ? PHE H 70  ? PHE M 62  PHE M 70  
AJ 4 SER H 55  ? PHE H 56  ? SER M 55  PHE M 56  
AK 1 GLU H 36  ? MET H 39  ? GLU M 36  MET M 39  
AK 2 ALA H 79  ? HIS H 84  ? ALA M 79  HIS M 84  
AK 3 MET H 87  ? TYR H 94  ? MET M 87  TYR M 94  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N THR A 4   ? N THR A 4   O LYS A 23  ? O LYS A 23  
B  1 2 O LEU A 46  ? O LEU A 46  N TRP A 34  ? N TRP A 34  
B  2 3 N TYR A 31  ? N TYR A 31  O SER A 93  ? O SER A 93  
B  3 4 N VAL A 92  ? N VAL A 92  O THR A 100 ? O THR A 105 
C  1 2 O LEU A 46  ? O LEU A 46  N TRP A 34  ? N TRP A 34  
C  2 3 N TYR A 31  ? N TYR A 31  O SER A 93  ? O SER A 93  
C  3 4 N ALA A 86  ? N ALA A 86  O VAL A 107 ? O VAL A 112 
C  4 5 O ILE A 108 ? O ILE A 113 N VAL A 10  ? N VAL A 10  
D  1 2 N LEU A 20  ? N LEU A 20  O LEU A 75  ? O LEU A 75  
D  2 3 O ARG A 76  ? O ARG A 76  N GLU A 63  ? N GLU A 63  
D  3 4 O ALA A 64  ? O ALA A 64  N VAL A 56  ? N VAL A 56  
E  1 2 N LEU A 161 ? N LEU A 168 O SER A 170 ? O SER A 177 
E  2 3 O ALA A 173 ? O ALA A 180 N PHE A 136 ? N PHE A 143 
E  3 4 O LEU A 135 ? O LEU A 142 N TYR A 121 ? N TYR A 126 
F  1 2 N LEU A 161 ? N LEU A 168 O SER A 170 ? O SER A 177 
F  2 3 O TRP A 176 ? O TRP A 183 N PHE A 154 ? N PHE A 161 
G  1 2 N THR B 4   ? N THR C 4   O LYS B 23  ? O LYS C 23  
H  1 2 O LEU B 46  ? O LEU C 46  N TRP B 34  ? N TRP C 34  
H  2 3 N TYR B 35  ? N TYR C 35  O PHE B 89  ? O PHE C 89  
H  3 4 N VAL B 92  ? N VAL C 92  O THR B 100 ? O THR C 105 
I  1 2 O LEU B 46  ? O LEU C 46  N TRP B 34  ? N TRP C 34  
I  2 3 N TYR B 35  ? N TYR C 35  O PHE B 89  ? O PHE C 89  
I  3 4 N ALA B 86  ? N ALA C 86  O VAL B 107 ? O VAL C 112 
I  4 5 O LYS B 106 ? O LYS C 111 N VAL B 10  ? N VAL C 10  
J  1 2 N LEU B 20  ? N LEU C 20  O LEU B 75  ? O LEU C 75  
J  2 3 O ARG B 76  ? O ARG C 76  N GLU B 63  ? N GLU C 63  
K  1 2 N LEU B 161 ? N LEU C 168 O SER B 170 ? O SER C 177 
L  1 2 N THR C 5   ? N THR B 5   O ASN C 24  ? O ASN B 24  
L  2 3 N VAL C 19  ? N VAL B 19  O LEU C 78  ? O LEU B 79  
L  3 4 O ILE C 77  ? O ILE B 78  N LYS C 65  ? N LYS B 66  
M  1 2 O GLU C 56  ? O GLU B 56  N TYR C 48  ? N TYR B 48  
M  2 3 O ILE C 46  ? O ILE B 46  N TRP C 34  ? N TRP B 34  
M  3 4 N TYR C 35  ? N TYR B 35  O PHE C 90  ? O PHE B 91  
M  4 5 N SER C 93  ? N SER B 94  O TYR C 100 ? O TYR B 107 
N  1 2 O GLU C 56  ? O GLU B 56  N TYR C 48  ? N TYR B 48  
N  2 3 O ILE C 46  ? O ILE B 46  N TRP C 34  ? N TRP B 34  
N  3 4 N TYR C 35  ? N TYR B 35  O PHE C 90  ? O PHE B 91  
N  4 5 N SER C 87  ? N SER B 88  O LEU C 107 ? O LEU B 114 
N  5 6 O SER C 108 ? O SER B 115 N LYS C 11  ? N LYS B 11  
O  1 2 N LYS C 120 ? N LYS B 126 O ARG C 144 ? O ARG B 150 
O  2 3 N ALA C 143 ? N ALA B 149 O LEU C 182 ? O LEU B 192 
O  3 4 O ARG C 185 ? O ARG B 195 N SER C 167 ? N SER B 173 
P  1 2 N LYS C 120 ? N LYS B 126 O ARG C 144 ? O ARG B 150 
P  2 3 N ALA C 143 ? N ALA B 149 O LEU C 182 ? O LEU B 192 
P  3 4 O CYS C 181 ? O CYS B 191 N TYR C 173 ? N TYR B 179 
Q  1 2 O LYS C 160 ? O LYS B 166 N VAL C 157 ? N VAL B 163 
Q  2 3 N TRP C 156 ? N TRP B 162 O ARG C 201 ? O ARG B 211 
Q  3 4 N PHE C 206 ? N PHE B 216 O GLN C 225 ? O GLN B 235 
R  1 2 N THR D 5   ? N THR D 5   O ASN D 24  ? O ASN D 24  
R  2 3 N VAL D 19  ? N VAL D 19  O LEU D 78  ? O LEU D 79  
R  3 4 O ILE D 77  ? O ILE D 78  N LYS D 65  ? N LYS D 66  
S  1 2 O GLU D 56  ? O GLU D 56  N TYR D 48  ? N TYR D 48  
S  2 3 O ILE D 46  ? O ILE D 46  N TRP D 34  ? N TRP D 34  
S  3 4 N TYR D 35  ? N TYR D 35  O PHE D 90  ? O PHE D 91  
S  4 5 N SER D 93  ? N SER D 94  O TYR D 100 ? O TYR D 107 
T  1 2 O GLU D 56  ? O GLU D 56  N TYR D 48  ? N TYR D 48  
T  2 3 O ILE D 46  ? O ILE D 46  N TRP D 34  ? N TRP D 34  
T  3 4 N TYR D 35  ? N TYR D 35  O PHE D 90  ? O PHE D 91  
T  4 5 N SER D 87  ? N SER D 88  O LEU D 107 ? O LEU D 114 
T  5 6 O SER D 108 ? O SER D 115 N LYS D 11  ? N LYS D 11  
U  1 2 N LYS D 120 ? N LYS D 126 O ARG D 144 ? O ARG D 150 
U  2 3 N ALA D 143 ? N ALA D 149 O LEU D 182 ? O LEU D 192 
U  3 4 O ARG D 185 ? O ARG D 195 N SER D 167 ? N SER D 173 
V  1 2 N LYS D 120 ? N LYS D 126 O ARG D 144 ? O ARG D 150 
V  2 3 N ALA D 143 ? N ALA D 149 O LEU D 182 ? O LEU D 192 
V  3 4 O CYS D 181 ? O CYS D 191 N TYR D 173 ? N TYR D 179 
W  1 2 O LYS D 160 ? O LYS D 166 N VAL D 157 ? N VAL D 163 
W  2 3 N TRP D 156 ? N TRP D 162 O ARG D 201 ? O ARG D 211 
W  3 4 N PHE D 206 ? N PHE D 216 O GLN D 225 ? O GLN D 235 
X  1 2 O GLU E 46  ? O GLU H 46  N ARG E 35  ? N ARG H 35  
X  2 3 O THR E 31  ? O THR H 31  N VAL E 28  ? N VAL H 28  
X  3 4 O VAL E 25  ? O VAL H 25  N PHE E 8   ? N PHE H 8   
X  4 5 N VAL E 9   ? N VAL H 9   O VAL E 97  ? O VAL H 97  
X  5 6 N GLU E 102 ? N GLU H 102 O ARG E 111 ? O ARG H 111 
X  6 7 N TYR E 118 ? N TYR H 118 O CYS E 121 ? O CYS H 121 
Y  1 2 N HIS E 188 ? N HIS H 188 O TRP E 204 ? O TRP H 204 
Y  2 3 N CYS E 203 ? N CYS H 203 O ALA E 245 ? O ALA H 245 
Y  3 4 O SER E 246 ? O SER H 246 N GLU E 229 ? N GLU H 229 
Z  1 2 N HIS E 188 ? N HIS H 188 O TRP E 204 ? O TRP H 204 
Z  2 3 N CYS E 203 ? N CYS H 203 O ALA E 245 ? O ALA H 245 
Z  3 4 O GLN E 242 ? O GLN H 242 N ARG E 234 ? N ARG H 234 
AA 1 2 O GLU E 222 ? O GLU H 222 N LEU E 219 ? N LEU H 219 
AA 2 3 N GLN E 218 ? N GLN H 218 O THR E 258 ? O THR H 258 
AA 3 4 N CYS E 259 ? N CYS H 259 O LEU E 272 ? O LEU H 272 
AB 1 2 O GLU F 46  ? O GLU I 46  N ARG F 35  ? N ARG I 35  
AB 2 3 O PHE F 36  ? O PHE I 36  N GLU F 24  ? N GLU I 24  
AB 3 4 O TYR F 27  ? O TYR I 27  N ARG F 6   ? N ARG I 6   
AB 4 5 N TYR F 7   ? N TYR I 7   O SER F 99  ? O SER I 99  
AB 5 6 N GLN F 96  ? N GLN I 96  O ALA F 117 ? O ALA I 117 
AB 6 7 N TYR F 118 ? N TYR I 118 O CYS F 121 ? O CYS I 121 
AC 1 2 N ALA F 125 ? N ALA I 125 O THR F 134 ? O THR I 134 
AD 1 2 N HIS F 188 ? N HIS I 188 O TRP F 204 ? O TRP I 204 
AD 2 3 N CYS F 203 ? N CYS I 203 O ALA F 245 ? O ALA I 245 
AD 3 4 O SER F 246 ? O SER I 246 N GLU F 229 ? N GLU I 229 
AE 1 2 N HIS F 188 ? N HIS I 188 O TRP F 204 ? O TRP I 204 
AE 2 3 N CYS F 203 ? N CYS I 203 O ALA F 245 ? O ALA I 245 
AE 3 4 O GLN F 242 ? O GLN I 242 N ARG F 234 ? N ARG I 234 
AF 1 2 N THR F 214 ? N THR I 214 O TYR F 262 ? O TYR I 262 
AF 2 3 N CYS F 259 ? N CYS I 259 O LEU F 272 ? O LEU I 272 
AG 1 2 N TYR G 10  ? N TYR L 10  O ASN G 24  ? O ASN L 24  
AG 2 3 N ASN G 21  ? N ASN L 21  O PHE G 70  ? O PHE L 70  
AG 3 4 O HIS G 67  ? O HIS L 67  N GLU G 50  ? N GLU L 50  
AH 1 2 N TYR G 10  ? N TYR L 10  O ASN G 24  ? O ASN L 24  
AH 2 3 N ASN G 21  ? N ASN L 21  O PHE G 70  ? O PHE L 70  
AH 3 4 O TYR G 63  ? O TYR L 63  N SER G 55  ? N SER L 55  
AI 1 2 O LYS G 44  ? O LYS L 44  N LYS G 41  ? N LYS L 41  
AI 2 3 N GLN G 38  ? N GLN L 38  O ARG G 81  ? O ARG L 81  
AI 3 4 N VAL G 82  ? N VAL L 82  O LYS G 91  ? O LYS L 91  
AJ 1 2 N GLN H 8   ? N GLN M 8   O TYR H 26  ? O TYR M 26  
AJ 2 3 N ASN H 21  ? N ASN M 21  O PHE H 70  ? O PHE M 70  
AJ 3 4 O TYR H 63  ? O TYR M 63  N SER H 55  ? N SER M 55  
AK 1 2 N GLN H 38  ? N GLN M 38  O ARG H 81  ? O ARG M 81  
AK 2 3 N HIS H 84  ? N HIS M 84  O MET H 87  ? O MET M 87  
# 
_database_PDB_matrix.entry_id          1MWA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1MWA 
_atom_sites.fract_transf_matrix[1][1]   0.003357 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010423 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011801 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N   . GLN A  1  1   ? 85.435  19.601 31.379  1.00 23.36  ? 1    GLN A N   1 
ATOM   2     C CA  . GLN A  1  1   ? 85.697  20.449 32.569  1.00 22.44  ? 1    GLN A CA  1 
ATOM   3     C C   . GLN A  1  1   ? 84.487  20.467 33.506  1.00 21.82  ? 1    GLN A C   1 
ATOM   4     O O   . GLN A  1  1   ? 83.479  21.109 33.241  1.00 21.58  ? 1    GLN A O   1 
ATOM   5     C CB  . GLN A  1  1   ? 86.053  21.868 32.121  1.00 22.63  ? 1    GLN A CB  1 
ATOM   6     C CG  . GLN A  1  1   ? 85.213  22.373 30.936  1.00 22.76  ? 1    GLN A CG  1 
ATOM   7     C CD  . GLN A  1  1   ? 85.033  23.901 30.954  1.00 24.49  ? 1    GLN A CD  1 
ATOM   8     O OE1 . GLN A  1  1   ? 85.835  24.650 30.360  1.00 22.18  ? 1    GLN A OE1 1 
ATOM   9     N NE2 . GLN A  1  1   ? 83.979  24.362 31.643  1.00 22.85  ? 1    GLN A NE2 1 
ATOM   10    N N   . SER A  1  2   ? 84.555  19.680 34.567  1.00 21.30  ? 2    SER A N   1 
ATOM   11    C CA  . SER A  1  2   ? 83.505  19.680 35.563  1.00 20.74  ? 2    SER A CA  1 
ATOM   12    C C   . SER A  1  2   ? 84.068  19.770 36.972  1.00 20.22  ? 2    SER A C   1 
ATOM   13    O O   . SER A  1  2   ? 85.213  19.416 37.217  1.00 20.10  ? 2    SER A O   1 
ATOM   14    C CB  . SER A  1  2   ? 82.671  18.418 35.430  1.00 20.41  ? 2    SER A CB  1 
ATOM   15    O OG  . SER A  1  2   ? 81.664  18.413 36.430  1.00 20.18  ? 2    SER A OG  1 
ATOM   16    N N   . VAL A  1  3   ? 83.248  20.234 37.899  1.00 19.74  ? 3    VAL A N   1 
ATOM   17    C CA  . VAL A  1  3   ? 83.679  20.396 39.272  1.00 19.76  ? 3    VAL A CA  1 
ATOM   18    C C   . VAL A  1  3   ? 82.486  20.194 40.201  1.00 19.85  ? 3    VAL A C   1 
ATOM   19    O O   . VAL A  1  3   ? 81.349  20.457 39.824  1.00 19.69  ? 3    VAL A O   1 
ATOM   20    C CB  . VAL A  1  3   ? 84.273  21.810 39.472  1.00 19.88  ? 3    VAL A CB  1 
ATOM   21    C CG1 . VAL A  1  3   ? 83.184  22.792 39.834  1.00 20.33  ? 3    VAL A CG1 1 
ATOM   22    C CG2 . VAL A  1  3   ? 85.383  21.799 40.512  1.00 19.39  ? 3    VAL A CG2 1 
ATOM   23    N N   . THR A  1  4   ? 82.739  19.704 41.406  1.00 20.43  ? 4    THR A N   1 
ATOM   24    C CA  . THR A  1  4   ? 81.674  19.500 42.378  1.00 21.36  ? 4    THR A CA  1 
ATOM   25    C C   . THR A  1  4   ? 82.188  19.599 43.814  1.00 21.77  ? 4    THR A C   1 
ATOM   26    O O   . THR A  1  4   ? 83.365  19.337 44.100  1.00 22.17  ? 4    THR A O   1 
ATOM   27    C CB  . THR A  1  4   ? 80.951  18.137 42.171  1.00 21.70  ? 4    THR A CB  1 
ATOM   28    O OG1 . THR A  1  4   ? 81.803  17.057 42.562  1.00 21.50  ? 4    THR A OG1 1 
ATOM   29    C CG2 . THR A  1  4   ? 80.614  17.900 40.702  1.00 23.05  ? 4    THR A CG2 1 
ATOM   30    N N   . GLN A  1  5   ? 81.298  19.989 44.714  1.00 22.20  ? 5    GLN A N   1 
ATOM   31    C CA  . GLN A  1  5   ? 81.637  20.110 46.123  1.00 22.86  ? 5    GLN A CA  1 
ATOM   32    C C   . GLN A  1  5   ? 80.660  19.211 46.882  1.00 23.67  ? 5    GLN A C   1 
ATOM   33    O O   . GLN A  1  5   ? 79.519  19.593 47.102  1.00 24.33  ? 5    GLN A O   1 
ATOM   34    C CB  . GLN A  1  5   ? 81.521  21.567 46.565  1.00 22.69  ? 5    GLN A CB  1 
ATOM   35    C CG  . GLN A  1  5   ? 82.402  22.524 45.741  1.00 22.79  ? 5    GLN A CG  1 
ATOM   36    C CD  . GLN A  1  5   ? 82.256  23.986 46.140  1.00 23.03  ? 5    GLN A CD  1 
ATOM   37    O OE1 . GLN A  1  5   ? 81.865  24.827 45.304  1.00 21.94  ? 5    GLN A OE1 1 
ATOM   38    N NE2 . GLN A  1  5   ? 82.565  24.304 47.372  1.00 23.89  ? 5    GLN A NE2 1 
ATOM   39    N N   . PRO A  1  6   ? 81.134  18.039 47.308  1.00 24.47  ? 6    PRO A N   1 
ATOM   40    C CA  . PRO A  1  6   ? 80.356  16.984 47.985  1.00 24.91  ? 6    PRO A CA  1 
ATOM   41    C C   . PRO A  1  6   ? 79.766  17.347 49.356  1.00 25.75  ? 6    PRO A C   1 
ATOM   42    O O   . PRO A  1  6   ? 78.798  16.712 49.783  1.00 25.98  ? 6    PRO A O   1 
ATOM   43    C CB  . PRO A  1  6   ? 81.390  15.872 48.145  1.00 24.78  ? 6    PRO A CB  1 
ATOM   44    C CG  . PRO A  1  6   ? 82.669  16.639 48.313  1.00 24.63  ? 6    PRO A CG  1 
ATOM   45    C CD  . PRO A  1  6   ? 82.566  17.706 47.273  1.00 24.31  ? 6    PRO A CD  1 
ATOM   46    N N   . ASP A  1  7   ? 80.326  18.338 50.039  1.00 26.22  ? 7    ASP A N   1 
ATOM   47    C CA  . ASP A  1  7   ? 79.793  18.729 51.342  1.00 26.47  ? 7    ASP A CA  1 
ATOM   48    C C   . ASP A  1  7   ? 79.060  20.061 51.229  1.00 26.95  ? 7    ASP A C   1 
ATOM   49    O O   . ASP A  1  7   ? 79.676  21.112 51.055  1.00 26.98  ? 7    ASP A O   1 
ATOM   50    C CB  . ASP A  1  7   ? 80.907  18.833 52.382  1.00 26.47  ? 7    ASP A CB  1 
ATOM   51    C CG  . ASP A  1  7   ? 81.580  17.503 52.656  1.00 26.58  ? 7    ASP A CG  1 
ATOM   52    O OD1 . ASP A  1  7   ? 82.465  17.081 51.879  1.00 25.88  ? 7    ASP A OD1 1 
ATOM   53    O OD2 . ASP A  1  7   ? 81.268  16.817 53.644  1.00 27.76  ? 7    ASP A OD2 1 
ATOM   54    N N   . ALA A  1  8   ? 77.738  20.015 51.323  1.00 27.11  ? 8    ALA A N   1 
ATOM   55    C CA  . ALA A  1  8   ? 76.940  21.219 51.210  1.00 27.30  ? 8    ALA A CA  1 
ATOM   56    C C   . ALA A  1  8   ? 77.180  22.192 52.360  1.00 27.52  ? 8    ALA A C   1 
ATOM   57    O O   . ALA A  1  8   ? 77.203  23.397 52.147  1.00 27.56  ? 8    ALA A O   1 
ATOM   58    C CB  . ALA A  1  8   ? 75.473  20.857 51.115  1.00 27.49  ? 8    ALA A CB  1 
ATOM   59    N N   . ARG A  1  9   ? 77.356  21.678 53.573  1.00 27.88  ? 9    ARG A N   1 
ATOM   60    C CA  . ARG A  1  9   ? 77.573  22.531 54.736  1.00 28.08  ? 9    ARG A CA  1 
ATOM   61    C C   . ARG A  1  9   ? 78.716  22.031 55.606  1.00 27.49  ? 9    ARG A C   1 
ATOM   62    O O   . ARG A  1  9   ? 78.886  20.829 55.805  1.00 27.24  ? 9    ARG A O   1 
ATOM   63    C CB  . ARG A  1  9   ? 76.325  22.581 55.606  1.00 29.00  ? 9    ARG A CB  1 
ATOM   64    C CG  . ARG A  1  9   ? 75.029  22.663 54.862  1.00 31.88  ? 9    ARG A CG  1 
ATOM   65    C CD  . ARG A  1  9   ? 73.838  22.513 55.794  1.00 35.26  ? 9    ARG A CD  1 
ATOM   66    N NE  . ARG A  1  9   ? 73.688  23.653 56.700  1.00 38.30  ? 9    ARG A NE  1 
ATOM   67    C CZ  . ARG A  1  9   ? 73.281  24.863 56.323  1.00 40.47  ? 9    ARG A CZ  1 
ATOM   68    N NH1 . ARG A  1  9   ? 72.991  25.108 55.047  1.00 40.95  ? 9    ARG A NH1 1 
ATOM   69    N NH2 . ARG A  1  9   ? 73.168  25.836 57.222  1.00 40.93  ? 9    ARG A NH2 1 
ATOM   70    N N   . VAL A  1  10  ? 79.488  22.965 56.146  1.00 26.57  ? 10   VAL A N   1 
ATOM   71    C CA  . VAL A  1  10  ? 80.595  22.611 57.009  1.00 25.80  ? 10   VAL A CA  1 
ATOM   72    C C   . VAL A  1  10  ? 80.568  23.519 58.223  1.00 25.50  ? 10   VAL A C   1 
ATOM   73    O O   . VAL A  1  10  ? 80.638  24.735 58.102  1.00 25.44  ? 10   VAL A O   1 
ATOM   74    C CB  . VAL A  1  10  ? 81.932  22.755 56.282  1.00 25.52  ? 10   VAL A CB  1 
ATOM   75    C CG1 . VAL A  1  10  ? 83.068  22.391 57.208  1.00 25.01  ? 10   VAL A CG1 1 
ATOM   76    C CG2 . VAL A  1  10  ? 81.951  21.869 55.045  1.00 25.48  ? 10   VAL A CG2 1 
ATOM   77    N N   . THR A  1  11  ? 80.454  22.918 59.397  1.00 25.31  ? 11   THR A N   1 
ATOM   78    C CA  . THR A  1  11  ? 80.397  23.676 60.635  1.00 25.12  ? 11   THR A CA  1 
ATOM   79    C C   . THR A  1  11  ? 81.579  23.296 61.508  1.00 24.56  ? 11   THR A C   1 
ATOM   80    O O   . THR A  1  11  ? 81.726  22.142 61.890  1.00 24.53  ? 11   THR A O   1 
ATOM   81    C CB  . THR A  1  11  ? 79.081  23.380 61.349  1.00 25.33  ? 11   THR A CB  1 
ATOM   82    O OG1 . THR A  1  11  ? 77.988  23.702 60.479  1.00 25.61  ? 11   THR A OG1 1 
ATOM   83    C CG2 . THR A  1  11  ? 78.903  24.252 62.591  1.00 26.00  ? 11   THR A CG2 1 
ATOM   84    N N   . VAL A  1  12  ? 82.426  24.278 61.797  1.00 24.27  ? 12   VAL A N   1 
ATOM   85    C CA  . VAL A  1  12  ? 83.615  24.084 62.619  1.00 23.93  ? 12   VAL A CA  1 
ATOM   86    C C   . VAL A  1  12  ? 83.612  25.086 63.766  1.00 23.80  ? 12   VAL A C   1 
ATOM   87    O O   . VAL A  1  12  ? 82.863  26.059 63.741  1.00 23.82  ? 12   VAL A O   1 
ATOM   88    C CB  . VAL A  1  12  ? 84.899  24.313 61.804  1.00 23.70  ? 12   VAL A CB  1 
ATOM   89    C CG1 . VAL A  1  12  ? 85.037  23.265 60.715  1.00 23.99  ? 12   VAL A CG1 1 
ATOM   90    C CG2 . VAL A  1  12  ? 84.898  25.707 61.209  1.00 23.52  ? 12   VAL A CG2 1 
ATOM   91    N N   . SER A  1  13  ? 84.470  24.851 64.757  1.00 23.43  ? 13   SER A N   1 
ATOM   92    C CA  . SER A  1  13  ? 84.571  25.727 65.915  1.00 23.11  ? 13   SER A CA  1 
ATOM   93    C C   . SER A  1  13  ? 85.690  26.720 65.733  1.00 22.67  ? 13   SER A C   1 
ATOM   94    O O   . SER A  1  13  ? 86.744  26.400 65.189  1.00 22.81  ? 13   SER A O   1 
ATOM   95    C CB  . SER A  1  13  ? 84.844  24.925 67.190  1.00 23.11  ? 13   SER A CB  1 
ATOM   96    O OG  . SER A  1  13  ? 83.834  23.966 67.434  1.00 23.92  ? 13   SER A OG  1 
ATOM   97    N N   . GLU A  1  14  ? 85.465  27.930 66.216  1.00 22.21  ? 14   GLU A N   1 
ATOM   98    C CA  . GLU A  1  14  ? 86.474  28.962 66.137  1.00 21.89  ? 14   GLU A CA  1 
ATOM   99    C C   . GLU A  1  14  ? 87.813  28.411 66.635  1.00 21.18  ? 14   GLU A C   1 
ATOM   100   O O   . GLU A  1  14  ? 87.859  27.593 67.559  1.00 20.75  ? 14   GLU A O   1 
ATOM   101   C CB  . GLU A  1  14  ? 86.037  30.150 66.972  1.00 22.27  ? 14   GLU A CB  1 
ATOM   102   C CG  . GLU A  1  14  ? 87.002  31.300 66.935  1.00 24.02  ? 14   GLU A CG  1 
ATOM   103   C CD  . GLU A  1  14  ? 86.292  32.620 67.076  1.00 25.68  ? 14   GLU A CD  1 
ATOM   104   O OE1 . GLU A  1  14  ? 85.743  32.883 68.164  1.00 26.92  ? 14   GLU A OE1 1 
ATOM   105   O OE2 . GLU A  1  14  ? 86.276  33.383 66.090  1.00 26.66  ? 14   GLU A OE2 1 
ATOM   106   N N   . GLY A  1  15  ? 88.901  28.848 66.011  1.00 20.53  ? 15   GLY A N   1 
ATOM   107   C CA  . GLY A  1  15  ? 90.225  28.382 66.391  1.00 20.01  ? 15   GLY A CA  1 
ATOM   108   C C   . GLY A  1  15  ? 90.588  27.019 65.817  1.00 19.55  ? 15   GLY A C   1 
ATOM   109   O O   . GLY A  1  15  ? 91.712  26.558 65.988  1.00 19.95  ? 15   GLY A O   1 
ATOM   110   N N   . ALA A  1  16  ? 89.645  26.355 65.155  1.00 19.00  ? 16   ALA A N   1 
ATOM   111   C CA  . ALA A  1  16  ? 89.923  25.052 64.558  1.00 18.38  ? 16   ALA A CA  1 
ATOM   112   C C   . ALA A  1  16  ? 90.528  25.233 63.168  1.00 17.99  ? 16   ALA A C   1 
ATOM   113   O O   . ALA A  1  16  ? 90.639  26.341 62.663  1.00 18.10  ? 16   ALA A O   1 
ATOM   114   C CB  . ALA A  1  16  ? 88.660  24.218 64.464  1.00 18.13  ? 16   ALA A CB  1 
ATOM   115   N N   . SER A  1  17  ? 90.919  24.129 62.555  1.00 17.43  ? 17   SER A N   1 
ATOM   116   C CA  . SER A  1  17  ? 91.490  24.165 61.229  1.00 17.08  ? 17   SER A CA  1 
ATOM   117   C C   . SER A  1  17  ? 90.324  23.886 60.287  1.00 16.72  ? 17   SER A C   1 
ATOM   118   O O   . SER A  1  17  ? 89.255  23.488 60.744  1.00 16.68  ? 17   SER A O   1 
ATOM   119   C CB  . SER A  1  17  ? 92.580  23.098 61.101  1.00 16.66  ? 17   SER A CB  1 
ATOM   120   O OG  . SER A  1  17  ? 92.000  21.811 61.011  1.00 16.18  ? 17   SER A OG  1 
ATOM   121   N N   . LEU A  1  18  ? 90.510  24.092 58.987  1.00 16.58  ? 18   LEU A N   1 
ATOM   122   C CA  . LEU A  1  18  ? 89.412  23.883 58.032  1.00 16.31  ? 18   LEU A CA  1 
ATOM   123   C C   . LEU A  1  18  ? 89.877  23.364 56.676  1.00 17.23  ? 18   LEU A C   1 
ATOM   124   O O   . LEU A  1  18  ? 90.928  23.754 56.167  1.00 17.61  ? 18   LEU A O   1 
ATOM   125   C CB  . LEU A  1  18  ? 88.648  25.197 57.823  1.00 15.18  ? 18   LEU A CB  1 
ATOM   126   C CG  . LEU A  1  18  ? 87.367  25.209 56.983  1.00 13.99  ? 18   LEU A CG  1 
ATOM   127   C CD1 . LEU A  1  18  ? 86.325  24.225 57.555  1.00 12.51  ? 18   LEU A CD1 1 
ATOM   128   C CD2 . LEU A  1  18  ? 86.797  26.609 56.951  1.00 13.00  ? 18   LEU A CD2 1 
ATOM   129   N N   . GLN A  1  19  ? 89.070  22.492 56.088  1.00 18.17  ? 19   GLN A N   1 
ATOM   130   C CA  . GLN A  1  19  ? 89.365  21.963 54.774  1.00 19.42  ? 19   GLN A CA  1 
ATOM   131   C C   . GLN A  1  19  ? 88.101  21.901 53.949  1.00 19.58  ? 19   GLN A C   1 
ATOM   132   O O   . GLN A  1  19  ? 87.129  21.289 54.351  1.00 19.83  ? 19   GLN A O   1 
ATOM   133   C CB  . GLN A  1  19  ? 89.972  20.560 54.842  1.00 19.72  ? 19   GLN A CB  1 
ATOM   134   C CG  . GLN A  1  19  ? 89.991  19.903 53.468  1.00 21.02  ? 19   GLN A CG  1 
ATOM   135   C CD  . GLN A  1  19  ? 90.725  18.571 53.415  1.00 21.83  ? 19   GLN A CD  1 
ATOM   136   O OE1 . GLN A  1  19  ? 91.956  18.525 53.280  1.00 20.40  ? 19   GLN A OE1 1 
ATOM   137   N NE2 . GLN A  1  19  ? 89.962  17.482 53.481  1.00 21.70  ? 19   GLN A NE2 1 
ATOM   138   N N   . LEU A  1  20  ? 88.116  22.525 52.782  1.00 19.87  ? 20   LEU A N   1 
ATOM   139   C CA  . LEU A  1  20  ? 86.959  22.467 51.916  1.00 20.12  ? 20   LEU A CA  1 
ATOM   140   C C   . LEU A  1  20  ? 87.305  21.584 50.727  1.00 20.32  ? 20   LEU A C   1 
ATOM   141   O O   . LEU A  1  20  ? 88.267  21.834 50.007  1.00 20.29  ? 20   LEU A O   1 
ATOM   142   C CB  . LEU A  1  20  ? 86.515  23.872 51.493  1.00 20.28  ? 20   LEU A CB  1 
ATOM   143   C CG  . LEU A  1  20  ? 85.497  24.507 52.452  1.00 20.19  ? 20   LEU A CG  1 
ATOM   144   C CD1 . LEU A  1  20  ? 85.830  24.192 53.907  1.00 21.26  ? 20   LEU A CD1 1 
ATOM   145   C CD2 . LEU A  1  20  ? 85.427  25.996 52.238  1.00 20.16  ? 20   LEU A CD2 1 
ATOM   146   N N   . ARG A  1  21  ? 86.516  20.532 50.551  1.00 20.52  ? 21   ARG A N   1 
ATOM   147   C CA  . ARG A  1  21  ? 86.734  19.567 49.488  1.00 20.35  ? 21   ARG A CA  1 
ATOM   148   C C   . ARG A  1  21  ? 86.190  20.012 48.143  1.00 19.81  ? 21   ARG A C   1 
ATOM   149   O O   . ARG A  1  21  ? 85.059  20.482 48.049  1.00 19.60  ? 21   ARG A O   1 
ATOM   150   C CB  . ARG A  1  21  ? 86.092  18.237 49.870  1.00 20.46  ? 21   ARG A CB  1 
ATOM   151   C CG  . ARG A  1  21  ? 86.666  17.603 51.121  1.00 21.78  ? 21   ARG A CG  1 
ATOM   152   C CD  . ARG A  1  21  ? 86.320  16.125 51.234  1.00 22.52  ? 21   ARG A CD  1 
ATOM   153   N NE  . ARG A  1  21  ? 84.893  15.895 51.445  1.00 23.79  ? 21   ARG A NE  1 
ATOM   154   C CZ  . ARG A  1  21  ? 84.278  14.737 51.224  1.00 24.26  ? 21   ARG A CZ  1 
ATOM   155   N NH1 . ARG A  1  21  ? 84.956  13.693 50.765  1.00 24.67  ? 21   ARG A NH1 1 
ATOM   156   N NH2 . ARG A  1  21  ? 82.980  14.615 51.469  1.00 24.66  ? 21   ARG A NH2 1 
ATOM   157   N N   . CYS A  1  22  ? 87.001  19.829 47.101  1.00 19.53  ? 22   CYS A N   1 
ATOM   158   C CA  . CYS A  1  22  ? 86.611  20.158 45.729  1.00 18.65  ? 22   CYS A CA  1 
ATOM   159   C C   . CYS A  1  22  ? 87.149  19.107 44.781  1.00 18.72  ? 22   CYS A C   1 
ATOM   160   O O   . CYS A  1  22  ? 88.337  18.814 44.800  1.00 18.31  ? 22   CYS A O   1 
ATOM   161   C CB  . CYS A  1  22  ? 87.175  21.499 45.289  1.00 18.32  ? 22   CYS A CB  1 
ATOM   162   S SG  . CYS A  1  22  ? 86.701  21.920 43.591  1.00 17.30  ? 22   CYS A SG  1 
ATOM   163   N N   . LYS A  1  23  ? 86.269  18.556 43.948  1.00 18.95  ? 23   LYS A N   1 
ATOM   164   C CA  . LYS A  1  23  ? 86.629  17.536 42.975  1.00 18.93  ? 23   LYS A CA  1 
ATOM   165   C C   . LYS A  1  23  ? 86.339  18.056 41.573  1.00 18.73  ? 23   LYS A C   1 
ATOM   166   O O   . LYS A  1  23  ? 85.332  18.721 41.347  1.00 18.92  ? 23   LYS A O   1 
ATOM   167   C CB  . LYS A  1  23  ? 85.783  16.269 43.167  1.00 19.25  ? 23   LYS A CB  1 
ATOM   168   C CG  . LYS A  1  23  ? 85.705  15.705 44.563  1.00 19.68  ? 23   LYS A CG  1 
ATOM   169   C CD  . LYS A  1  23  ? 86.558  14.465 44.708  1.00 20.14  ? 23   LYS A CD  1 
ATOM   170   C CE  . LYS A  1  23  ? 87.936  14.790 45.234  1.00 20.28  ? 23   LYS A CE  1 
ATOM   171   N NZ  . LYS A  1  23  ? 88.869  13.652 45.008  1.00 21.07  ? 23   LYS A NZ  1 
ATOM   172   N N   . TYR A  1  24  ? 87.205  17.741 40.625  1.00 18.17  ? 24   TYR A N   1 
ATOM   173   C CA  . TYR A  1  24  ? 86.968  18.145 39.249  1.00 17.67  ? 24   TYR A CA  1 
ATOM   174   C C   . TYR A  1  24  ? 87.141  16.921 38.389  1.00 18.00  ? 24   TYR A C   1 
ATOM   175   O O   . TYR A  1  24  ? 87.943  16.054 38.706  1.00 17.54  ? 24   TYR A O   1 
ATOM   176   C CB  . TYR A  1  24  ? 87.942  19.248 38.795  1.00 17.02  ? 24   TYR A CB  1 
ATOM   177   C CG  . TYR A  1  24  ? 89.359  18.782 38.601  1.00 14.82  ? 24   TYR A CG  1 
ATOM   178   C CD1 . TYR A  1  24  ? 89.743  18.108 37.455  1.00 14.30  ? 24   TYR A CD1 1 
ATOM   179   C CD2 . TYR A  1  24  ? 90.319  19.013 39.576  1.00 14.74  ? 24   TYR A CD2 1 
ATOM   180   C CE1 . TYR A  1  24  ? 91.048  17.665 37.288  1.00 13.60  ? 24   TYR A CE1 1 
ATOM   181   C CE2 . TYR A  1  24  ? 91.614  18.584 39.426  1.00 13.53  ? 24   TYR A CE2 1 
ATOM   182   C CZ  . TYR A  1  24  ? 91.979  17.907 38.286  1.00 14.51  ? 24   TYR A CZ  1 
ATOM   183   O OH  . TYR A  1  24  ? 93.284  17.459 38.150  1.00 17.35  ? 24   TYR A OH  1 
ATOM   184   N N   . SER A  1  25  ? 86.368  16.829 37.319  1.00 18.77  ? 25   SER A N   1 
ATOM   185   C CA  . SER A  1  25  ? 86.538  15.735 36.384  1.00 19.47  ? 25   SER A CA  1 
ATOM   186   C C   . SER A  1  25  ? 87.054  16.392 35.121  1.00 19.94  ? 25   SER A C   1 
ATOM   187   O O   . SER A  1  25  ? 86.536  17.425 34.715  1.00 19.83  ? 25   SER A O   1 
ATOM   188   C CB  . SER A  1  25  ? 85.223  15.023 36.121  1.00 19.62  ? 25   SER A CB  1 
ATOM   189   O OG  . SER A  1  25  ? 85.475  13.725 35.605  1.00 19.95  ? 25   SER A OG  1 
ATOM   190   N N   . TYR A  1  26  ? 88.088  15.831 34.508  1.00 21.08  ? 26   TYR A N   1 
ATOM   191   C CA  . TYR A  1  26  ? 88.637  16.444 33.300  1.00 21.78  ? 26   TYR A CA  1 
ATOM   192   C C   . TYR A  1  26  ? 89.845  15.753 32.729  1.00 22.46  ? 26   TYR A C   1 
ATOM   193   O O   . TYR A  1  26  ? 90.798  15.439 33.441  1.00 22.60  ? 26   TYR A O   1 
ATOM   194   C CB  . TYR A  1  26  ? 89.037  17.885 33.586  1.00 21.76  ? 26   TYR A CB  1 
ATOM   195   C CG  . TYR A  1  26  ? 89.269  18.753 32.370  1.00 21.99  ? 26   TYR A CG  1 
ATOM   196   C CD1 . TYR A  1  26  ? 88.398  18.722 31.279  1.00 21.73  ? 26   TYR A CD1 1 
ATOM   197   C CD2 . TYR A  1  26  ? 90.320  19.660 32.340  1.00 22.59  ? 26   TYR A CD2 1 
ATOM   198   C CE1 . TYR A  1  26  ? 88.578  19.556 30.192  1.00 21.10  ? 26   TYR A CE1 1 
ATOM   199   C CE2 . TYR A  1  26  ? 90.513  20.501 31.254  1.00 22.49  ? 26   TYR A CE2 1 
ATOM   200   C CZ  . TYR A  1  26  ? 89.638  20.444 30.180  1.00 22.00  ? 26   TYR A CZ  1 
ATOM   201   O OH  . TYR A  1  26  ? 89.818  21.290 29.107  1.00 20.94  ? 26   TYR A OH  1 
ATOM   202   N N   . SER A  1  27  ? 89.843  15.640 31.410  1.00 23.04  ? 27   SER A N   1 
ATOM   203   C CA  . SER A  1  27  ? 90.864  14.860 30.741  1.00 23.45  ? 27   SER A CA  1 
ATOM   204   C C   . SER A  1  27  ? 92.249  15.505 30.717  1.00 23.11  ? 27   SER A C   1 
ATOM   205   O O   . SER A  1  27  ? 93.237  14.805 30.526  1.00 24.49  ? 27   SER A O   1 
ATOM   206   C CB  . SER A  1  27  ? 90.401  14.468 29.338  1.00 23.50  ? 27   SER A CB  1 
ATOM   207   O OG  . SER A  1  27  ? 90.277  15.592 28.493  1.00 24.42  ? 27   SER A OG  1 
ATOM   208   N N   . ALA A  1  28  ? 92.330  16.818 30.902  1.00 22.52  ? 28   ALA A N   1 
ATOM   209   C CA  . ALA A  1  28  ? 93.621  17.497 30.953  1.00 21.82  ? 28   ALA A CA  1 
ATOM   210   C C   . ALA A  1  28  ? 93.746  18.160 32.318  1.00 21.21  ? 28   ALA A C   1 
ATOM   211   O O   . ALA A  1  28  ? 93.003  17.839 33.249  1.00 21.77  ? 28   ALA A O   1 
ATOM   212   C CB  . ALA A  1  28  ? 93.743  18.540 29.841  1.00 21.62  ? 28   ALA A CB  1 
ATOM   213   N N   . THR A  1  29  ? 94.688  19.083 32.428  1.00 20.06  ? 29   THR A N   1 
ATOM   214   C CA  . THR A  1  29  ? 94.824  19.887 33.622  1.00 18.94  ? 29   THR A CA  1 
ATOM   215   C C   . THR A  1  29  ? 93.990  21.160 33.334  1.00 17.90  ? 29   THR A C   1 
ATOM   216   O O   . THR A  1  29  ? 94.238  21.832 32.336  1.00 18.30  ? 29   THR A O   1 
ATOM   217   C CB  . THR A  1  29  ? 96.307  20.163 33.934  1.00 19.42  ? 29   THR A CB  1 
ATOM   218   O OG1 . THR A  1  29  ? 96.936  18.943 34.361  1.00 18.45  ? 29   THR A OG1 1 
ATOM   219   C CG2 . THR A  1  29  ? 96.451  21.134 35.110  1.00 20.66  ? 29   THR A CG2 1 
ATOM   220   N N   . PRO A  1  30  ? 92.999  21.471 34.180  1.00 16.62  ? 30   PRO A N   1 
ATOM   221   C CA  . PRO A  1  30  ? 92.163  22.669 34.054  1.00 15.97  ? 30   PRO A CA  1 
ATOM   222   C C   . PRO A  1  30  ? 92.682  23.835 34.873  1.00 15.41  ? 30   PRO A C   1 
ATOM   223   O O   . PRO A  1  30  ? 93.612  23.681 35.674  1.00 15.98  ? 30   PRO A O   1 
ATOM   224   C CB  . PRO A  1  30  ? 90.862  22.208 34.691  1.00 15.78  ? 30   PRO A CB  1 
ATOM   225   C CG  . PRO A  1  30  ? 91.393  21.505 35.941  1.00 15.59  ? 30   PRO A CG  1 
ATOM   226   C CD  . PRO A  1  30  ? 92.599  20.708 35.377  1.00 16.88  ? 30   PRO A CD  1 
ATOM   227   N N   . TYR A  1  31  ? 92.094  25.006 34.674  1.00 14.32  ? 31   TYR A N   1 
ATOM   228   C CA  . TYR A  1  31  ? 92.422  26.117 35.538  1.00 13.24  ? 31   TYR A CA  1 
ATOM   229   C C   . TYR A  1  31  ? 91.518  25.873 36.736  1.00 12.26  ? 31   TYR A C   1 
ATOM   230   O O   . TYR A  1  31  ? 90.384  25.418 36.572  1.00 11.45  ? 31   TYR A O   1 
ATOM   231   C CB  . TYR A  1  31  ? 92.030  27.452 34.942  1.00 13.12  ? 31   TYR A CB  1 
ATOM   232   C CG  . TYR A  1  31  ? 92.902  27.961 33.823  1.00 12.46  ? 31   TYR A CG  1 
ATOM   233   C CD1 . TYR A  1  31  ? 94.181  27.461 33.599  1.00 10.95  ? 31   TYR A CD1 1 
ATOM   234   C CD2 . TYR A  1  31  ? 92.439  28.964 32.999  1.00 11.45  ? 31   TYR A CD2 1 
ATOM   235   C CE1 . TYR A  1  31  ? 94.966  27.957 32.592  1.00 10.06  ? 31   TYR A CE1 1 
ATOM   236   C CE2 . TYR A  1  31  ? 93.210  29.459 31.994  1.00 12.11  ? 31   TYR A CE2 1 
ATOM   237   C CZ  . TYR A  1  31  ? 94.473  28.963 31.792  1.00 11.05  ? 31   TYR A CZ  1 
ATOM   238   O OH  . TYR A  1  31  ? 95.207  29.488 30.763  1.00 11.55  ? 31   TYR A OH  1 
ATOM   239   N N   . LEU A  1  32  ? 91.997  26.194 37.929  1.00 11.38  ? 32   LEU A N   1 
ATOM   240   C CA  . LEU A  1  32  ? 91.195  26.023 39.140  1.00 10.68  ? 32   LEU A CA  1 
ATOM   241   C C   . LEU A  1  32  ? 91.120  27.326 39.957  1.00 10.06  ? 32   LEU A C   1 
ATOM   242   O O   . LEU A  1  32  ? 92.090  28.080 40.019  1.00 9.71   ? 32   LEU A O   1 
ATOM   243   C CB  . LEU A  1  32  ? 91.770  24.894 39.981  1.00 11.12  ? 32   LEU A CB  1 
ATOM   244   C CG  . LEU A  1  32  ? 91.688  23.495 39.352  1.00 12.33  ? 32   LEU A CG  1 
ATOM   245   C CD1 . LEU A  1  32  ? 92.829  22.675 39.822  1.00 12.50  ? 32   LEU A CD1 1 
ATOM   246   C CD2 . LEU A  1  32  ? 90.360  22.813 39.692  1.00 14.17  ? 32   LEU A CD2 1 
ATOM   247   N N   . PHE A  1  33  ? 89.958  27.561 40.578  1.00 9.06   ? 33   PHE A N   1 
ATOM   248   C CA  . PHE A  1  33  ? 89.677  28.764 41.348  1.00 8.28   ? 33   PHE A CA  1 
ATOM   249   C C   . PHE A  1  33  ? 88.833  28.510 42.635  1.00 7.78   ? 33   PHE A C   1 
ATOM   250   O O   . PHE A  1  33  ? 88.057  27.550 42.721  1.00 7.69   ? 33   PHE A O   1 
ATOM   251   C CB  . PHE A  1  33  ? 88.888  29.756 40.479  1.00 8.20   ? 33   PHE A CB  1 
ATOM   252   C CG  . PHE A  1  33  ? 89.376  29.895 39.047  1.00 6.62   ? 33   PHE A CG  1 
ATOM   253   C CD1 . PHE A  1  33  ? 88.927  29.055 38.062  1.00 7.19   ? 33   PHE A CD1 1 
ATOM   254   C CD2 . PHE A  1  33  ? 90.227  30.935 38.687  1.00 5.69   ? 33   PHE A CD2 1 
ATOM   255   C CE1 . PHE A  1  33  ? 89.343  29.236 36.726  1.00 7.47   ? 33   PHE A CE1 1 
ATOM   256   C CE2 . PHE A  1  33  ? 90.647  31.108 37.392  1.00 3.23   ? 33   PHE A CE2 1 
ATOM   257   C CZ  . PHE A  1  33  ? 90.200  30.266 36.408  1.00 6.21   ? 33   PHE A CZ  1 
ATOM   258   N N   . TRP A  1  34  ? 88.997  29.387 43.622  1.00 6.73   ? 34   TRP A N   1 
ATOM   259   C CA  . TRP A  1  34  ? 88.224  29.352 44.873  1.00 6.42   ? 34   TRP A CA  1 
ATOM   260   C C   . TRP A  1  34  ? 87.749  30.775 45.137  1.00 6.96   ? 34   TRP A C   1 
ATOM   261   O O   . TRP A  1  34  ? 88.558  31.695 45.146  1.00 6.49   ? 34   TRP A O   1 
ATOM   262   C CB  . TRP A  1  34  ? 89.053  28.895 46.088  1.00 5.38   ? 34   TRP A CB  1 
ATOM   263   C CG  . TRP A  1  34  ? 88.980  27.438 46.329  1.00 3.99   ? 34   TRP A CG  1 
ATOM   264   C CD1 . TRP A  1  34  ? 89.955  26.533 46.072  1.00 3.63   ? 34   TRP A CD1 1 
ATOM   265   C CD2 . TRP A  1  34  ? 87.864  26.695 46.841  1.00 2.00   ? 34   TRP A CD2 1 
ATOM   266   N NE1 . TRP A  1  34  ? 89.516  25.272 46.377  1.00 4.43   ? 34   TRP A NE1 1 
ATOM   267   C CE2 . TRP A  1  34  ? 88.232  25.345 46.848  1.00 2.18   ? 34   TRP A CE2 1 
ATOM   268   C CE3 . TRP A  1  34  ? 86.587  27.040 47.295  1.00 2.67   ? 34   TRP A CE3 1 
ATOM   269   C CZ2 . TRP A  1  34  ? 87.378  24.332 47.284  1.00 2.48   ? 34   TRP A CZ2 1 
ATOM   270   C CZ3 . TRP A  1  34  ? 85.732  26.029 47.724  1.00 3.74   ? 34   TRP A CZ3 1 
ATOM   271   C CH2 . TRP A  1  34  ? 86.132  24.690 47.709  1.00 2.46   ? 34   TRP A CH2 1 
ATOM   272   N N   . TYR A  1  35  ? 86.448  30.944 45.360  1.00 7.81   ? 35   TYR A N   1 
ATOM   273   C CA  . TYR A  1  35  ? 85.866  32.258 45.647  1.00 8.11   ? 35   TYR A CA  1 
ATOM   274   C C   . TYR A  1  35  ? 85.087  32.175 46.937  1.00 8.97   ? 35   TYR A C   1 
ATOM   275   O O   . TYR A  1  35  ? 84.655  31.091 47.321  1.00 8.60   ? 35   TYR A O   1 
ATOM   276   C CB  . TYR A  1  35  ? 84.867  32.673 44.564  1.00 7.56   ? 35   TYR A CB  1 
ATOM   277   C CG  . TYR A  1  35  ? 85.448  33.082 43.248  1.00 6.71   ? 35   TYR A CG  1 
ATOM   278   C CD1 . TYR A  1  35  ? 85.906  32.145 42.346  1.00 5.24   ? 35   TYR A CD1 1 
ATOM   279   C CD2 . TYR A  1  35  ? 85.492  34.414 42.884  1.00 6.02   ? 35   TYR A CD2 1 
ATOM   280   C CE1 . TYR A  1  35  ? 86.405  32.534 41.124  1.00 4.25   ? 35   TYR A CE1 1 
ATOM   281   C CE2 . TYR A  1  35  ? 85.990  34.799 41.683  1.00 5.19   ? 35   TYR A CE2 1 
ATOM   282   C CZ  . TYR A  1  35  ? 86.438  33.869 40.801  1.00 3.76   ? 35   TYR A CZ  1 
ATOM   283   O OH  . TYR A  1  35  ? 86.917  34.302 39.583  1.00 5.60   ? 35   TYR A OH  1 
ATOM   284   N N   . VAL A  1  36  ? 84.866  33.326 47.570  1.00 10.15  ? 36   VAL A N   1 
ATOM   285   C CA  . VAL A  1  36  ? 84.082  33.396 48.789  1.00 11.75  ? 36   VAL A CA  1 
ATOM   286   C C   . VAL A  1  36  ? 82.877  34.270 48.518  1.00 12.99  ? 36   VAL A C   1 
ATOM   287   O O   . VAL A  1  36  ? 82.969  35.260 47.813  1.00 12.39  ? 36   VAL A O   1 
ATOM   288   C CB  . VAL A  1  36  ? 84.790  34.099 49.957  1.00 11.77  ? 36   VAL A CB  1 
ATOM   289   C CG1 . VAL A  1  36  ? 84.100  33.742 51.267  1.00 11.68  ? 36   VAL A CG1 1 
ATOM   290   C CG2 . VAL A  1  36  ? 86.217  33.743 50.010  1.00 13.47  ? 36   VAL A CG2 1 
ATOM   291   N N   . GLN A  1  37  ? 81.740  33.908 49.078  1.00 14.94  ? 37   GLN A N   1 
ATOM   292   C CA  . GLN A  1  37  ? 80.592  34.767 48.942  1.00 17.22  ? 37   GLN A CA  1 
ATOM   293   C C   . GLN A  1  37  ? 80.066  35.099 50.326  1.00 18.62  ? 37   GLN A C   1 
ATOM   294   O O   . GLN A  1  37  ? 79.599  34.232 51.043  1.00 17.47  ? 37   GLN A O   1 
ATOM   295   C CB  . GLN A  1  37  ? 79.476  34.151 48.107  1.00 17.45  ? 37   GLN A CB  1 
ATOM   296   C CG  . GLN A  1  37  ? 78.233  35.034 48.169  1.00 17.68  ? 37   GLN A CG  1 
ATOM   297   C CD  . GLN A  1  37  ? 77.122  34.588 47.262  1.00 18.89  ? 37   GLN A CD  1 
ATOM   298   O OE1 . GLN A  1  37  ? 76.626  35.374 46.456  1.00 20.96  ? 37   GLN A OE1 1 
ATOM   299   N NE2 . GLN A  1  37  ? 76.713  33.336 47.390  1.00 18.95  ? 37   GLN A NE2 1 
ATOM   300   N N   . TYR A  1  38  ? 80.160  36.370 50.686  1.00 21.72  ? 38   TYR A N   1 
ATOM   301   C CA  . TYR A  1  38  ? 79.643  36.845 51.953  1.00 24.03  ? 38   TYR A CA  1 
ATOM   302   C C   . TYR A  1  38  ? 78.157  37.126 51.789  1.00 25.81  ? 38   TYR A C   1 
ATOM   303   O O   . TYR A  1  38  ? 77.668  37.297 50.675  1.00 26.03  ? 38   TYR A O   1 
ATOM   304   C CB  . TYR A  1  38  ? 80.423  38.095 52.434  1.00 24.51  ? 38   TYR A CB  1 
ATOM   305   C CG  . TYR A  1  38  ? 81.660  37.633 53.146  1.00 25.01  ? 38   TYR A CG  1 
ATOM   306   C CD1 . TYR A  1  38  ? 82.839  37.407 52.451  1.00 24.65  ? 38   TYR A CD1 1 
ATOM   307   C CD2 . TYR A  1  38  ? 81.607  37.264 54.482  1.00 25.43  ? 38   TYR A CD2 1 
ATOM   308   C CE1 . TYR A  1  38  ? 83.943  36.870 53.078  1.00 24.53  ? 38   TYR A CE1 1 
ATOM   309   C CE2 . TYR A  1  38  ? 82.707  36.722 55.113  1.00 25.67  ? 38   TYR A CE2 1 
ATOM   310   C CZ  . TYR A  1  38  ? 83.867  36.524 54.405  1.00 24.66  ? 38   TYR A CZ  1 
ATOM   311   O OH  . TYR A  1  38  ? 84.950  35.971 55.038  1.00 24.65  ? 38   TYR A OH  1 
ATOM   312   N N   . PRO A  1  39  ? 77.458  37.183 52.917  1.00 28.13  ? 39   PRO A N   1 
ATOM   313   C CA  . PRO A  1  39  ? 76.018  37.420 53.043  1.00 29.43  ? 39   PRO A CA  1 
ATOM   314   C C   . PRO A  1  39  ? 75.136  37.894 51.878  1.00 30.45  ? 39   PRO A C   1 
ATOM   315   O O   . PRO A  1  39  ? 74.339  37.078 51.437  1.00 31.13  ? 39   PRO A O   1 
ATOM   316   C CB  . PRO A  1  39  ? 75.993  38.358 54.226  1.00 29.71  ? 39   PRO A CB  1 
ATOM   317   C CG  . PRO A  1  39  ? 76.922  37.597 55.156  1.00 29.33  ? 39   PRO A CG  1 
ATOM   318   C CD  . PRO A  1  39  ? 78.064  37.122 54.256  1.00 28.28  ? 39   PRO A CD  1 
ATOM   319   N N   . ARG A  1  40  ? 75.210  39.131 51.404  1.00 31.60  ? 40   ARG A N   1 
ATOM   320   C CA  . ARG A  1  40  ? 74.296  39.535 50.313  1.00 32.78  ? 40   ARG A CA  1 
ATOM   321   C C   . ARG A  1  40  ? 75.011  40.149 49.110  1.00 31.72  ? 40   ARG A C   1 
ATOM   322   O O   . ARG A  1  40  ? 74.556  41.146 48.557  1.00 31.17  ? 40   ARG A O   1 
ATOM   323   C CB  . ARG A  1  40  ? 73.241  40.518 50.850  1.00 33.95  ? 40   ARG A CB  1 
ATOM   324   C CG  . ARG A  1  40  ? 71.895  40.514 50.109  1.00 38.00  ? 40   ARG A CG  1 
ATOM   325   C CD  . ARG A  1  40  ? 71.903  41.243 48.756  1.00 42.60  ? 40   ARG A CD  1 
ATOM   326   N NE  . ARG A  1  40  ? 72.429  42.605 48.865  1.00 45.16  ? 40   ARG A NE  1 
ATOM   327   C CZ  . ARG A  1  40  ? 71.854  43.581 49.561  1.00 47.06  ? 40   ARG A CZ  1 
ATOM   328   N NH1 . ARG A  1  40  ? 70.718  43.362 50.210  1.00 47.49  ? 40   ARG A NH1 1 
ATOM   329   N NH2 . ARG A  1  40  ? 72.418  44.783 49.610  1.00 47.59  ? 40   ARG A NH2 1 
ATOM   330   N N   . GLN A  1  41  ? 76.119  39.544 48.696  1.00 31.09  ? 41   GLN A N   1 
ATOM   331   C CA  . GLN A  1  41  ? 76.904  40.089 47.591  1.00 30.36  ? 41   GLN A CA  1 
ATOM   332   C C   . GLN A  1  41  ? 77.443  39.038 46.630  1.00 29.06  ? 41   GLN A C   1 
ATOM   333   O O   . GLN A  1  41  ? 77.150  37.854 46.756  1.00 29.20  ? 41   GLN A O   1 
ATOM   334   C CB  . GLN A  1  41  ? 78.065  40.900 48.154  1.00 30.63  ? 41   GLN A CB  1 
ATOM   335   C CG  . GLN A  1  41  ? 78.926  40.119 49.105  1.00 31.33  ? 41   GLN A CG  1 
ATOM   336   C CD  . GLN A  1  41  ? 79.333  40.932 50.309  1.00 32.42  ? 41   GLN A CD  1 
ATOM   337   O OE1 . GLN A  1  41  ? 78.484  41.503 50.990  1.00 34.51  ? 41   GLN A OE1 1 
ATOM   338   N NE2 . GLN A  1  41  ? 80.626  40.983 50.582  1.00 32.04  ? 41   GLN A NE2 1 
ATOM   339   N N   . GLY A  1  42  ? 78.228  39.498 45.659  1.00 27.36  ? 42   GLY A N   1 
ATOM   340   C CA  . GLY A  1  42  ? 78.821  38.622 44.671  1.00 26.03  ? 42   GLY A CA  1 
ATOM   341   C C   . GLY A  1  42  ? 80.043  37.898 45.205  1.00 24.74  ? 42   GLY A C   1 
ATOM   342   O O   . GLY A  1  42  ? 80.332  37.929 46.395  1.00 23.73  ? 42   GLY A O   1 
ATOM   343   N N   . LEU A  1  43  ? 80.775  37.250 44.305  1.00 23.44  ? 43   LEU A N   1 
ATOM   344   C CA  . LEU A  1  43  ? 81.953  36.486 44.688  1.00 21.77  ? 43   LEU A CA  1 
ATOM   345   C C   . LEU A  1  43  ? 83.260  37.253 44.609  1.00 21.03  ? 43   LEU A C   1 
ATOM   346   O O   . LEU A  1  43  ? 83.425  38.180 43.825  1.00 20.79  ? 43   LEU A O   1 
ATOM   347   C CB  . LEU A  1  43  ? 82.076  35.256 43.806  1.00 21.49  ? 43   LEU A CB  1 
ATOM   348   C CG  . LEU A  1  43  ? 81.019  34.170 43.910  1.00 20.04  ? 43   LEU A CG  1 
ATOM   349   C CD1 . LEU A  1  43  ? 79.612  34.708 43.709  1.00 19.33  ? 43   LEU A CD1 1 
ATOM   350   C CD2 . LEU A  1  43  ? 81.376  33.133 42.862  1.00 18.41  ? 43   LEU A CD2 1 
ATOM   351   N N   . GLN A  1  44  ? 84.206  36.822 45.426  1.00 20.17  ? 44   GLN A N   1 
ATOM   352   C CA  . GLN A  1  44  ? 85.516  37.425 45.458  1.00 19.92  ? 44   GLN A CA  1 
ATOM   353   C C   . GLN A  1  44  ? 86.518  36.285 45.405  1.00 18.08  ? 44   GLN A C   1 
ATOM   354   O O   . GLN A  1  44  ? 86.308  35.264 46.032  1.00 18.69  ? 44   GLN A O   1 
ATOM   355   C CB  . GLN A  1  44  ? 85.654  38.223 46.744  1.00 20.58  ? 44   GLN A CB  1 
ATOM   356   C CG  . GLN A  1  44  ? 84.380  38.992 47.072  1.00 22.93  ? 44   GLN A CG  1 
ATOM   357   C CD  . GLN A  1  44  ? 84.378  40.417 46.539  1.00 25.19  ? 44   GLN A CD  1 
ATOM   358   O OE1 . GLN A  1  44  ? 85.428  41.064 46.463  1.00 27.10  ? 44   GLN A OE1 1 
ATOM   359   N NE2 . GLN A  1  44  ? 83.193  40.919 46.188  1.00 26.24  ? 44   GLN A NE2 1 
ATOM   360   N N   . LEU A  1  45  ? 87.595  36.445 44.647  1.00 16.47  ? 45   LEU A N   1 
ATOM   361   C CA  . LEU A  1  45  ? 88.596  35.395 44.517  1.00 14.86  ? 45   LEU A CA  1 
ATOM   362   C C   . LEU A  1  45  ? 89.468  35.243 45.768  1.00 13.96  ? 45   LEU A C   1 
ATOM   363   O O   . LEU A  1  45  ? 89.843  36.228 46.398  1.00 13.73  ? 45   LEU A O   1 
ATOM   364   C CB  . LEU A  1  45  ? 89.492  35.678 43.298  1.00 14.68  ? 45   LEU A CB  1 
ATOM   365   C CG  . LEU A  1  45  ? 90.592  34.632 43.040  1.00 12.98  ? 45   LEU A CG  1 
ATOM   366   C CD1 . LEU A  1  45  ? 89.959  33.303 42.676  1.00 11.59  ? 45   LEU A CD1 1 
ATOM   367   C CD2 . LEU A  1  45  ? 91.525  35.067 41.947  1.00 12.05  ? 45   LEU A CD2 1 
ATOM   368   N N   . LEU A  1  46  ? 89.783  34.000 46.117  1.00 13.19  ? 46   LEU A N   1 
ATOM   369   C CA  . LEU A  1  46  ? 90.664  33.700 47.237  1.00 12.97  ? 46   LEU A CA  1 
ATOM   370   C C   . LEU A  1  46  ? 91.990  33.302 46.620  1.00 13.15  ? 46   LEU A C   1 
ATOM   371   O O   . LEU A  1  46  ? 93.060  33.702 47.079  1.00 13.72  ? 46   LEU A O   1 
ATOM   372   C CB  . LEU A  1  46  ? 90.129  32.541 48.090  1.00 12.78  ? 46   LEU A CB  1 
ATOM   373   C CG  . LEU A  1  46  ? 88.940  32.817 49.015  1.00 11.59  ? 46   LEU A CG  1 
ATOM   374   C CD1 . LEU A  1  46  ? 88.541  31.562 49.729  1.00 10.81  ? 46   LEU A CD1 1 
ATOM   375   C CD2 . LEU A  1  46  ? 89.291  33.886 50.018  1.00 11.98  ? 46   LEU A CD2 1 
ATOM   376   N N   . LEU A  1  47  ? 91.907  32.508 45.562  1.00 13.13  ? 47   LEU A N   1 
ATOM   377   C CA  . LEU A  1  47  ? 93.090  32.057 44.857  1.00 13.13  ? 47   LEU A CA  1 
ATOM   378   C C   . LEU A  1  47  ? 92.726  31.314 43.583  1.00 12.83  ? 47   LEU A C   1 
ATOM   379   O O   . LEU A  1  47  ? 91.579  30.919 43.393  1.00 13.32  ? 47   LEU A O   1 
ATOM   380   C CB  . LEU A  1  47  ? 93.938  31.164 45.766  1.00 13.17  ? 47   LEU A CB  1 
ATOM   381   C CG  . LEU A  1  47  ? 93.186  30.079 46.545  1.00 14.06  ? 47   LEU A CG  1 
ATOM   382   C CD1 . LEU A  1  47  ? 92.704  28.973 45.639  1.00 12.71  ? 47   LEU A CD1 1 
ATOM   383   C CD2 . LEU A  1  47  ? 94.092  29.513 47.615  1.00 14.86  ? 47   LEU A CD2 1 
ATOM   384   N N   . LYS A  1  48  ? 93.723  31.135 42.723  1.00 12.58  ? 48   LYS A N   1 
ATOM   385   C CA  . LYS A  1  48  ? 93.588  30.407 41.469  1.00 12.94  ? 48   LYS A CA  1 
ATOM   386   C C   . LYS A  1  48  ? 94.844  29.577 41.258  1.00 12.48  ? 48   LYS A C   1 
ATOM   387   O O   . LYS A  1  48  ? 95.862  29.790 41.917  1.00 11.57  ? 48   LYS A O   1 
ATOM   388   C CB  . LYS A  1  48  ? 93.437  31.366 40.283  1.00 13.57  ? 48   LYS A CB  1 
ATOM   389   C CG  . LYS A  1  48  ? 94.462  32.484 40.316  1.00 14.62  ? 48   LYS A CG  1 
ATOM   390   C CD  . LYS A  1  48  ? 94.708  33.116 38.981  1.00 17.02  ? 48   LYS A CD  1 
ATOM   391   C CE  . LYS A  1  48  ? 95.578  34.359 39.137  1.00 19.52  ? 48   LYS A CE  1 
ATOM   392   N NZ  . LYS A  1  48  ? 94.925  35.428 39.986  1.00 21.09  ? 48   LYS A NZ  1 
ATOM   393   N N   . TYR A  1  49  ? 94.748  28.623 40.337  1.00 12.37  ? 49   TYR A N   1 
ATOM   394   C CA  . TYR A  1  49  ? 95.857  27.776 39.942  1.00 11.76  ? 49   TYR A CA  1 
ATOM   395   C C   . TYR A  1  49  ? 95.782  27.709 38.424  1.00 12.09  ? 49   TYR A C   1 
ATOM   396   O O   . TYR A  1  49  ? 94.716  27.442 37.876  1.00 12.23  ? 49   TYR A O   1 
ATOM   397   C CB  . TYR A  1  49  ? 95.709  26.375 40.540  1.00 11.80  ? 49   TYR A CB  1 
ATOM   398   C CG  . TYR A  1  49  ? 96.774  25.410 40.063  1.00 11.89  ? 49   TYR A CG  1 
ATOM   399   C CD1 . TYR A  1  49  ? 98.078  25.499 40.523  1.00 11.88  ? 49   TYR A CD1 1 
ATOM   400   C CD2 . TYR A  1  49  ? 96.485  24.439 39.111  1.00 11.21  ? 49   TYR A CD2 1 
ATOM   401   C CE1 . TYR A  1  49  ? 99.051  24.648 40.058  1.00 11.12  ? 49   TYR A CE1 1 
ATOM   402   C CE2 . TYR A  1  49  ? 97.450  23.582 38.659  1.00 10.80  ? 49   TYR A CE2 1 
ATOM   403   C CZ  . TYR A  1  49  ? 98.731  23.691 39.129  1.00 11.14  ? 49   TYR A CZ  1 
ATOM   404   O OH  . TYR A  1  49  ? 99.702  22.841 38.652  1.00 11.72  ? 49   TYR A OH  1 
ATOM   405   N N   . TYR A  1  50  ? 96.887  27.992 37.739  1.00 12.52  ? 50   TYR A N   1 
ATOM   406   C CA  . TYR A  1  50  ? 96.923  27.923 36.279  1.00 12.97  ? 50   TYR A CA  1 
ATOM   407   C C   . TYR A  1  50  ? 97.791  26.732 35.922  1.00 14.26  ? 50   TYR A C   1 
ATOM   408   O O   . TYR A  1  50  ? 97.382  25.846 35.165  1.00 15.13  ? 50   TYR A O   1 
ATOM   409   C CB  . TYR A  1  50  ? 97.516  29.189 35.665  1.00 11.96  ? 50   TYR A CB  1 
ATOM   410   C CG  . TYR A  1  50  ? 96.628  30.428 35.690  1.00 9.61   ? 50   TYR A CG  1 
ATOM   411   C CD1 . TYR A  1  50  ? 97.189  31.700 35.763  1.00 8.31   ? 50   TYR A CD1 1 
ATOM   412   C CD2 . TYR A  1  50  ? 95.241  30.336 35.613  1.00 7.28   ? 50   TYR A CD2 1 
ATOM   413   C CE1 . TYR A  1  50  ? 96.396  32.839 35.764  1.00 6.83   ? 50   TYR A CE1 1 
ATOM   414   C CE2 . TYR A  1  50  ? 94.443  31.470 35.609  1.00 4.51   ? 50   TYR A CE2 1 
ATOM   415   C CZ  . TYR A  1  50  ? 95.032  32.716 35.683  1.00 5.76   ? 50   TYR A CZ  1 
ATOM   416   O OH  . TYR A  1  50  ? 94.265  33.856 35.695  1.00 5.38   ? 50   TYR A OH  1 
ATOM   417   N N   . SER A  1  51  ? 98.994  26.718 36.478  1.00 15.63  ? 51   SER A N   1 
ATOM   418   C CA  . SER A  1  51  ? 99.936  25.625 36.265  1.00 17.00  ? 51   SER A CA  1 
ATOM   419   C C   . SER A  1  51  ? 101.080 25.793 37.259  1.00 17.44  ? 51   SER A C   1 
ATOM   420   O O   . SER A  1  51  ? 101.102 26.765 37.998  1.00 17.99  ? 51   SER A O   1 
ATOM   421   C CB  . SER A  1  51  ? 100.475 25.637 34.835  1.00 17.16  ? 51   SER A CB  1 
ATOM   422   O OG  . SER A  1  51  ? 101.663 26.402 34.762  1.00 18.39  ? 51   SER A OG  1 
ATOM   423   N N   . GLY A  1  52  ? 102.016 24.848 37.289  1.00 18.27  ? 52   GLY A N   1 
ATOM   424   C CA  . GLY A  1  52  ? 103.158 24.938 38.194  1.00 18.26  ? 52   GLY A CA  1 
ATOM   425   C C   . GLY A  1  52  ? 102.938 24.354 39.584  1.00 18.42  ? 52   GLY A C   1 
ATOM   426   O O   . GLY A  1  52  ? 102.180 23.412 39.760  1.00 18.91  ? 52   GLY A O   1 
ATOM   427   N N   . ASP A  1  53  ? 103.613 24.925 40.575  1.00 18.58  ? 53   ASP A N   1 
ATOM   428   C CA  . ASP A  1  53  ? 103.493 24.493 41.963  1.00 18.34  ? 53   ASP A CA  1 
ATOM   429   C C   . ASP A  1  53  ? 102.029 24.226 42.326  1.00 17.74  ? 53   ASP A C   1 
ATOM   430   O O   . ASP A  1  53  ? 101.175 25.103 42.187  1.00 17.59  ? 53   ASP A O   1 
ATOM   431   C CB  . ASP A  1  53  ? 104.080 25.573 42.885  1.00 18.82  ? 53   ASP A CB  1 
ATOM   432   C CG  . ASP A  1  53  ? 104.292 25.083 44.299  1.00 19.15  ? 53   ASP A CG  1 
ATOM   433   O OD1 . ASP A  1  53  ? 105.156 25.632 45.019  1.00 20.14  ? 53   ASP A OD1 1 
ATOM   434   O OD2 . ASP A  1  53  ? 103.635 24.138 44.755  1.00 21.16  ? 53   ASP A OD2 1 
ATOM   435   N N   . PRO A  1  54  ? 101.746 23.006 42.783  1.00 17.30  ? 54   PRO A N   1 
ATOM   436   C CA  . PRO A  1  54  ? 100.395 22.573 43.180  1.00 16.62  ? 54   PRO A CA  1 
ATOM   437   C C   . PRO A  1  54  ? 99.861  23.214 44.467  1.00 16.03  ? 54   PRO A C   1 
ATOM   438   O O   . PRO A  1  54  ? 98.646  23.165 44.728  1.00 15.56  ? 54   PRO A O   1 
ATOM   439   C CB  . PRO A  1  54  ? 100.570 21.063 43.344  1.00 16.98  ? 54   PRO A CB  1 
ATOM   440   C CG  . PRO A  1  54  ? 101.993 20.939 43.807  1.00 17.52  ? 54   PRO A CG  1 
ATOM   441   C CD  . PRO A  1  54  ? 102.716 21.905 42.899  1.00 17.34  ? 54   PRO A CD  1 
ATOM   442   N N   . VAL A  1  55  ? 100.747 23.809 45.262  1.00 15.35  ? 55   VAL A N   1 
ATOM   443   C CA  . VAL A  1  55  ? 100.328 24.490 46.471  1.00 15.14  ? 55   VAL A CA  1 
ATOM   444   C C   . VAL A  1  55  ? 100.247 26.002 46.236  1.00 15.03  ? 55   VAL A C   1 
ATOM   445   O O   . VAL A  1  55  ? 101.266 26.661 46.043  1.00 15.40  ? 55   VAL A O   1 
ATOM   446   C CB  . VAL A  1  55  ? 101.298 24.236 47.630  1.00 15.37  ? 55   VAL A CB  1 
ATOM   447   C CG1 . VAL A  1  55  ? 101.349 22.752 47.977  1.00 15.61  ? 55   VAL A CG1 1 
ATOM   448   C CG2 . VAL A  1  55  ? 102.688 24.767 47.276  1.00 16.92  ? 55   VAL A CG2 1 
ATOM   449   N N   . VAL A  1  56  ? 99.050  26.573 46.248  1.00 14.57  ? 56   VAL A N   1 
ATOM   450   C CA  . VAL A  1  56  ? 98.959  28.018 46.057  1.00 14.40  ? 56   VAL A CA  1 
ATOM   451   C C   . VAL A  1  56  ? 98.395  28.655 47.313  1.00 14.96  ? 56   VAL A C   1 
ATOM   452   O O   . VAL A  1  56  ? 97.441  28.157 47.917  1.00 13.89  ? 56   VAL A O   1 
ATOM   453   C CB  . VAL A  1  56  ? 98.116  28.440 44.819  1.00 14.18  ? 56   VAL A CB  1 
ATOM   454   C CG1 . VAL A  1  56  ? 97.932  27.282 43.853  1.00 12.91  ? 56   VAL A CG1 1 
ATOM   455   C CG2 . VAL A  1  56  ? 96.781  29.019 45.244  1.00 14.60  ? 56   VAL A CG2 1 
ATOM   456   N N   . GLN A  1  57  ? 99.017  29.757 47.706  1.00 15.80  ? 57   GLN A N   1 
ATOM   457   C CA  . GLN A  1  57  ? 98.610  30.495 48.878  1.00 16.97  ? 57   GLN A CA  1 
ATOM   458   C C   . GLN A  1  57  ? 97.754  31.695 48.453  1.00 17.97  ? 57   GLN A C   1 
ATOM   459   O O   . GLN A  1  57  ? 98.103  32.431 47.531  1.00 16.49  ? 57   GLN A O   1 
ATOM   460   C CB  . GLN A  1  57  ? 99.846  30.939 49.655  1.00 17.30  ? 57   GLN A CB  1 
ATOM   461   C CG  . GLN A  1  57  ? 100.450 29.843 50.517  1.00 18.07  ? 57   GLN A CG  1 
ATOM   462   C CD  . GLN A  1  57  ? 101.430 30.389 51.538  1.00 18.55  ? 57   GLN A CD  1 
ATOM   463   O OE1 . GLN A  1  57  ? 102.553 30.747 51.192  1.00 19.46  ? 57   GLN A OE1 1 
ATOM   464   N NE2 . GLN A  1  57  ? 101.002 30.464 52.798  1.00 18.68  ? 57   GLN A NE2 1 
ATOM   465   N N   . GLY A  1  58  ? 96.622  31.882 49.128  1.00 19.35  ? 58   GLY A N   1 
ATOM   466   C CA  . GLY A  1  58  ? 95.723  32.963 48.775  1.00 20.15  ? 58   GLY A CA  1 
ATOM   467   C C   . GLY A  1  58  ? 95.540  33.993 49.864  1.00 21.14  ? 58   GLY A C   1 
ATOM   468   O O   . GLY A  1  58  ? 96.367  34.112 50.765  1.00 21.34  ? 58   GLY A O   1 
ATOM   469   N N   . VAL A  1  59  ? 94.440  34.730 49.779  1.00 22.43  ? 59   VAL A N   1 
ATOM   470   C CA  . VAL A  1  59  ? 94.141  35.780 50.741  1.00 23.46  ? 59   VAL A CA  1 
ATOM   471   C C   . VAL A  1  59  ? 93.692  35.203 52.074  1.00 24.78  ? 59   VAL A C   1 
ATOM   472   O O   . VAL A  1  59  ? 93.084  34.136 52.131  1.00 25.01  ? 59   VAL A O   1 
ATOM   473   C CB  . VAL A  1  59  ? 93.050  36.758 50.213  1.00 23.40  ? 59   VAL A CB  1 
ATOM   474   C CG1 . VAL A  1  59  ? 93.548  37.486 48.976  1.00 23.98  ? 59   VAL A CG1 1 
ATOM   475   C CG2 . VAL A  1  59  ? 91.754  36.023 49.910  1.00 22.95  ? 59   VAL A CG2 1 
ATOM   476   N N   . ASN A  1  60  ? 94.025  35.923 53.142  1.00 25.93  ? 60   ASN A N   1 
ATOM   477   C CA  . ASN A  1  60  ? 93.625  35.582 54.500  1.00 27.16  ? 60   ASN A CA  1 
ATOM   478   C C   . ASN A  1  60  ? 93.837  34.161 54.980  1.00 24.94  ? 60   ASN A C   1 
ATOM   479   O O   . ASN A  1  60  ? 92.892  33.509 55.430  1.00 24.37  ? 60   ASN A O   1 
ATOM   480   C CB  . ASN A  1  60  ? 92.163  35.909 54.675  1.00 29.62  ? 60   ASN A CB  1 
ATOM   481   C CG  . ASN A  1  60  ? 91.854  36.426 56.035  1.00 37.84  ? 60   ASN A CG  1 
ATOM   482   O OD1 . ASN A  1  60  ? 92.563  36.160 57.010  1.00 40.71  ? 60   ASN A OD1 1 
ATOM   483   N ND2 . ASN A  1  60  ? 90.764  37.162 56.112  1.00 54.44  ? 60   ASN A ND2 1 
ATOM   484   N N   . GLY A  1  61  ? 95.069  33.680 54.894  1.00 22.67  ? 61   GLY A N   1 
ATOM   485   C CA  . GLY A  1  61  ? 95.387  32.370 55.415  1.00 20.68  ? 61   GLY A CA  1 
ATOM   486   C C   . GLY A  1  61  ? 94.827  31.237 54.606  1.00 19.23  ? 61   GLY A C   1 
ATOM   487   O O   . GLY A  1  61  ? 94.967  30.085 54.992  1.00 19.75  ? 61   GLY A O   1 
ATOM   488   N N   . PHE A  1  62  ? 94.211  31.547 53.475  1.00 17.26  ? 62   PHE A N   1 
ATOM   489   C CA  . PHE A  1  62  ? 93.661  30.504 52.635  1.00 15.38  ? 62   PHE A CA  1 
ATOM   490   C C   . PHE A  1  62  ? 94.683  29.954 51.685  1.00 14.19  ? 62   PHE A C   1 
ATOM   491   O O   . PHE A  1  62  ? 95.560  30.673 51.222  1.00 13.53  ? 62   PHE A O   1 
ATOM   492   C CB  . PHE A  1  62  ? 92.461  31.015 51.855  1.00 14.99  ? 62   PHE A CB  1 
ATOM   493   C CG  . PHE A  1  62  ? 91.224  31.101 52.683  1.00 13.67  ? 62   PHE A CG  1 
ATOM   494   C CD1 . PHE A  1  62  ? 90.695  32.326 53.041  1.00 13.05  ? 62   PHE A CD1 1 
ATOM   495   C CD2 . PHE A  1  62  ? 90.600  29.946 53.126  1.00 12.27  ? 62   PHE A CD2 1 
ATOM   496   C CE1 . PHE A  1  62  ? 89.559  32.391 53.819  1.00 12.53  ? 62   PHE A CE1 1 
ATOM   497   C CE2 . PHE A  1  62  ? 89.463  30.008 53.906  1.00 10.06  ? 62   PHE A CE2 1 
ATOM   498   C CZ  . PHE A  1  62  ? 88.945  31.214 54.251  1.00 10.79  ? 62   PHE A CZ  1 
ATOM   499   N N   . GLU A  1  63  ? 94.567  28.663 51.402  1.00 13.11  ? 63   GLU A N   1 
ATOM   500   C CA  . GLU A  1  63  ? 95.466  28.030 50.467  1.00 13.03  ? 63   GLU A CA  1 
ATOM   501   C C   . GLU A  1  63  ? 94.919  26.704 49.981  1.00 12.80  ? 63   GLU A C   1 
ATOM   502   O O   . GLU A  1  63  ? 94.182  26.001 50.679  1.00 12.20  ? 63   GLU A O   1 
ATOM   503   C CB  . GLU A  1  63  ? 96.840  27.831 51.085  1.00 13.57  ? 63   GLU A CB  1 
ATOM   504   C CG  . GLU A  1  63  ? 96.901  26.756 52.118  1.00 14.43  ? 63   GLU A CG  1 
ATOM   505   C CD  . GLU A  1  63  ? 98.309  26.568 52.630  1.00 17.30  ? 63   GLU A CD  1 
ATOM   506   O OE1 . GLU A  1  63  ? 98.903  27.560 53.140  1.00 17.95  ? 63   GLU A OE1 1 
ATOM   507   O OE2 . GLU A  1  63  ? 98.810  25.427 52.510  1.00 17.29  ? 63   GLU A OE2 1 
ATOM   508   N N   . ALA A  1  64  ? 95.281  26.360 48.762  1.00 12.15  ? 64   ALA A N   1 
ATOM   509   C CA  . ALA A  1  64  ? 94.786  25.135 48.197  1.00 12.29  ? 64   ALA A CA  1 
ATOM   510   C C   . ALA A  1  64  ? 95.925  24.331 47.621  1.00 12.73  ? 64   ALA A C   1 
ATOM   511   O O   . ALA A  1  64  ? 97.041  24.832 47.455  1.00 13.15  ? 64   ALA A O   1 
ATOM   512   C CB  . ALA A  1  64  ? 93.769  25.447 47.132  1.00 12.04  ? 64   ALA A CB  1 
ATOM   513   N N   . GLU A  1  65  ? 95.647  23.071 47.338  1.00 13.35  ? 65   GLU A N   1 
ATOM   514   C CA  . GLU A  1  65  ? 96.634  22.220 46.707  1.00 14.33  ? 65   GLU A CA  1 
ATOM   515   C C   . GLU A  1  65  ? 95.980  21.376 45.622  1.00 14.48  ? 65   GLU A C   1 
ATOM   516   O O   . GLU A  1  65  ? 95.059  20.578 45.882  1.00 13.50  ? 65   GLU A O   1 
ATOM   517   C CB  . GLU A  1  65  ? 97.340  21.301 47.692  1.00 14.71  ? 65   GLU A CB  1 
ATOM   518   C CG  . GLU A  1  65  ? 98.289  20.372 46.928  1.00 15.79  ? 65   GLU A CG  1 
ATOM   519   C CD  . GLU A  1  65  ? 98.988  19.372 47.799  1.00 15.85  ? 65   GLU A CD  1 
ATOM   520   O OE1 . GLU A  1  65  ? 99.864  18.625 47.280  1.00 17.15  ? 65   GLU A OE1 1 
ATOM   521   O OE2 . GLU A  1  65  ? 98.646  19.330 48.989  1.00 16.05  ? 65   GLU A OE2 1 
ATOM   522   N N   . PHE A  1  66  ? 96.449  21.581 44.401  1.00 14.85  ? 66   PHE A N   1 
ATOM   523   C CA  . PHE A  1  66  ? 95.958  20.824 43.261  1.00 15.01  ? 66   PHE A CA  1 
ATOM   524   C C   . PHE A  1  66  ? 96.607  19.457 43.281  1.00 16.25  ? 66   PHE A C   1 
ATOM   525   O O   . PHE A  1  66  ? 97.827  19.335 43.403  1.00 15.21  ? 66   PHE A O   1 
ATOM   526   C CB  . PHE A  1  66  ? 96.310  21.558 41.980  1.00 14.49  ? 66   PHE A CB  1 
ATOM   527   C CG  . PHE A  1  66  ? 96.316  20.704 40.731  1.00 12.95  ? 66   PHE A CG  1 
ATOM   528   C CD1 . PHE A  1  66  ? 97.486  20.105 40.292  1.00 10.65  ? 66   PHE A CD1 1 
ATOM   529   C CD2 . PHE A  1  66  ? 95.177  20.596 39.940  1.00 11.00  ? 66   PHE A CD2 1 
ATOM   530   C CE1 . PHE A  1  66  ? 97.512  19.387 39.109  1.00 11.86  ? 66   PHE A CE1 1 
ATOM   531   C CE2 . PHE A  1  66  ? 95.195  19.876 38.759  1.00 10.38  ? 66   PHE A CE2 1 
ATOM   532   C CZ  . PHE A  1  66  ? 96.364  19.276 38.335  1.00 10.41  ? 66   PHE A CZ  1 
ATOM   533   N N   . SER A  1  67  ? 95.772  18.431 43.191  1.00 18.16  ? 67   SER A N   1 
ATOM   534   C CA  . SER A  1  67  ? 96.242  17.062 43.144  1.00 19.62  ? 67   SER A CA  1 
ATOM   535   C C   . SER A  1  67  ? 95.696  16.398 41.896  1.00 20.59  ? 67   SER A C   1 
ATOM   536   O O   . SER A  1  67  ? 94.518  16.053 41.844  1.00 20.44  ? 67   SER A O   1 
ATOM   537   C CB  . SER A  1  67  ? 95.763  16.279 44.351  1.00 19.77  ? 67   SER A CB  1 
ATOM   538   O OG  . SER A  1  67  ? 95.912  14.892 44.100  1.00 19.35  ? 67   SER A OG  1 
ATOM   539   N N   . LYS A  1  68  ? 96.555  16.233 40.894  1.00 21.83  ? 68   LYS A N   1 
ATOM   540   C CA  . LYS A  1  68  ? 96.179  15.592 39.646  1.00 22.70  ? 68   LYS A CA  1 
ATOM   541   C C   . LYS A  1  68  ? 95.716  14.166 39.940  1.00 23.46  ? 68   LYS A C   1 
ATOM   542   O O   . LYS A  1  68  ? 94.689  13.708 39.447  1.00 23.24  ? 68   LYS A O   1 
ATOM   543   C CB  . LYS A  1  68  ? 97.381  15.558 38.715  1.00 23.12  ? 68   LYS A CB  1 
ATOM   544   C CG  . LYS A  1  68  ? 97.035  15.194 37.286  1.00 24.45  ? 68   LYS A CG  1 
ATOM   545   C CD  . LYS A  1  68  ? 98.237  15.344 36.405  1.00 25.65  ? 68   LYS A CD  1 
ATOM   546   C CE  . LYS A  1  68  ? 97.898  15.049 34.972  1.00 27.58  ? 68   LYS A CE  1 
ATOM   547   N NZ  . LYS A  1  68  ? 99.143  15.077 34.154  1.00 28.70  ? 68   LYS A NZ  1 
ATOM   548   N N   . SER A  1  69  ? 96.495  13.470 40.755  1.00 24.42  ? 69   SER A N   1 
ATOM   549   C CA  . SER A  1  69  ? 96.163  12.123 41.154  1.00 24.92  ? 69   SER A CA  1 
ATOM   550   C C   . SER A  1  69  ? 94.707  12.108 41.602  1.00 25.51  ? 69   SER A C   1 
ATOM   551   O O   . SER A  1  69  ? 93.829  11.643 40.873  1.00 25.79  ? 69   SER A O   1 
ATOM   552   C CB  . SER A  1  69  ? 97.054  11.702 42.315  1.00 24.85  ? 69   SER A CB  1 
ATOM   553   O OG  . SER A  1  69  ? 98.403  12.030 42.054  1.00 25.79  ? 69   SER A OG  1 
ATOM   554   N N   . ASN A  1  70  ? 94.468  12.637 42.802  1.00 25.42  ? 70   ASN A N   1 
ATOM   555   C CA  . ASN A  1  70  ? 93.139  12.695 43.399  1.00 25.91  ? 70   ASN A CA  1 
ATOM   556   C C   . ASN A  1  70  ? 92.135  13.544 42.625  1.00 23.95  ? 70   ASN A C   1 
ATOM   557   O O   . ASN A  1  70  ? 90.944  13.539 42.919  1.00 24.01  ? 70   ASN A O   1 
ATOM   558   C CB  . ASN A  1  70  ? 93.252  13.232 44.809  1.00 27.23  ? 70   ASN A CB  1 
ATOM   559   C CG  . ASN A  1  70  ? 94.300  12.524 45.607  1.00 33.51  ? 70   ASN A CG  1 
ATOM   560   O OD1 . ASN A  1  70  ? 95.197  11.887 45.063  1.00 34.56  ? 70   ASN A OD1 1 
ATOM   561   N ND2 . ASN A  1  70  ? 94.192  12.658 46.918  1.00 47.39  ? 70   ASN A ND2 1 
ATOM   562   N N   . SER A  1  71  ? 92.613  14.291 41.648  1.00 22.05  ? 71   SER A N   1 
ATOM   563   C CA  . SER A  1  71  ? 91.716  15.086 40.847  1.00 20.74  ? 71   SER A CA  1 
ATOM   564   C C   . SER A  1  71  ? 90.956  16.007 41.799  1.00 19.40  ? 71   SER A C   1 
ATOM   565   O O   . SER A  1  71  ? 89.734  16.147 41.718  1.00 19.58  ? 71   SER A O   1 
ATOM   566   C CB  . SER A  1  71  ? 90.768  14.145 40.108  1.00 20.78  ? 71   SER A CB  1 
ATOM   567   O OG  . SER A  1  71  ? 90.184  14.749 38.977  1.00 21.23  ? 71   SER A OG  1 
ATOM   568   N N   . SER A  1  72  ? 91.694  16.631 42.712  1.00 17.37  ? 72   SER A N   1 
ATOM   569   C CA  . SER A  1  72  ? 91.098  17.500 43.714  1.00 15.42  ? 72   SER A CA  1 
ATOM   570   C C   . SER A  1  72  ? 91.803  18.836 43.842  1.00 14.48  ? 72   SER A C   1 
ATOM   571   O O   . SER A  1  72  ? 92.923  19.011 43.377  1.00 13.74  ? 72   SER A O   1 
ATOM   572   C CB  . SER A  1  72  ? 91.155  16.808 45.056  1.00 15.32  ? 72   SER A CB  1 
ATOM   573   O OG  . SER A  1  72  ? 92.494  16.455 45.341  1.00 14.83  ? 72   SER A OG  1 
ATOM   574   N N   . PHE A  1  73  ? 91.133  19.770 44.506  1.00 13.97  ? 73   PHE A N   1 
ATOM   575   C CA  . PHE A  1  73  ? 91.657  21.108 44.732  1.00 13.40  ? 73   PHE A CA  1 
ATOM   576   C C   . PHE A  1  73  ? 91.050  21.638 46.036  1.00 13.87  ? 73   PHE A C   1 
ATOM   577   O O   . PHE A  1  73  ? 90.300  22.618 46.065  1.00 14.81  ? 73   PHE A O   1 
ATOM   578   C CB  . PHE A  1  73  ? 91.310  21.997 43.550  1.00 12.67  ? 73   PHE A CB  1 
ATOM   579   C CG  . PHE A  1  73  ? 92.029  23.313 43.538  1.00 11.10  ? 73   PHE A CG  1 
ATOM   580   C CD1 . PHE A  1  73  ? 93.410  23.370 43.598  1.00 9.22   ? 73   PHE A CD1 1 
ATOM   581   C CD2 . PHE A  1  73  ? 91.321  24.498 43.446  1.00 9.45   ? 73   PHE A CD2 1 
ATOM   582   C CE1 . PHE A  1  73  ? 94.073  24.583 43.578  1.00 8.01   ? 73   PHE A CE1 1 
ATOM   583   C CE2 . PHE A  1  73  ? 91.993  25.723 43.421  1.00 8.15   ? 73   PHE A CE2 1 
ATOM   584   C CZ  . PHE A  1  73  ? 93.363  25.754 43.490  1.00 7.79   ? 73   PHE A CZ  1 
ATOM   585   N N   . HIS A  1  74  ? 91.395  20.973 47.123  1.00 14.17  ? 74   HIS A N   1 
ATOM   586   C CA  . HIS A  1  74  ? 90.873  21.310 48.450  1.00 14.64  ? 74   HIS A CA  1 
ATOM   587   C C   . HIS A  1  74  ? 91.420  22.615 49.022  1.00 14.54  ? 74   HIS A C   1 
ATOM   588   O O   . HIS A  1  74  ? 92.591  22.937 48.831  1.00 14.76  ? 74   HIS A O   1 
ATOM   589   C CB  . HIS A  1  74  ? 91.150  20.125 49.358  1.00 14.78  ? 74   HIS A CB  1 
ATOM   590   C CG  . HIS A  1  74  ? 90.563  18.848 48.833  1.00 16.08  ? 74   HIS A CG  1 
ATOM   591   N ND1 . HIS A  1  74  ? 89.775  18.804 47.703  1.00 17.81  ? 74   HIS A ND1 1 
ATOM   592   C CD2 . HIS A  1  74  ? 90.667  17.571 49.266  1.00 16.90  ? 74   HIS A CD2 1 
ATOM   593   C CE1 . HIS A  1  74  ? 89.419  17.556 47.464  1.00 18.58  ? 74   HIS A CE1 1 
ATOM   594   N NE2 . HIS A  1  74  ? 89.946  16.789 48.400  1.00 18.93  ? 74   HIS A NE2 1 
ATOM   595   N N   . LEU A  1  75  ? 90.553  23.383 49.683  1.00 14.14  ? 75   LEU A N   1 
ATOM   596   C CA  . LEU A  1  75  ? 90.940  24.664 50.282  1.00 13.79  ? 75   LEU A CA  1 
ATOM   597   C C   . LEU A  1  75  ? 91.220  24.481 51.771  1.00 14.16  ? 75   LEU A C   1 
ATOM   598   O O   . LEU A  1  75  ? 90.544  23.698 52.427  1.00 14.60  ? 75   LEU A O   1 
ATOM   599   C CB  . LEU A  1  75  ? 89.830  25.715 50.094  1.00 12.99  ? 75   LEU A CB  1 
ATOM   600   C CG  . LEU A  1  75  ? 90.114  27.151 50.567  1.00 10.65  ? 75   LEU A CG  1 
ATOM   601   C CD1 . LEU A  1  75  ? 91.170  27.814 49.690  1.00 8.63   ? 75   LEU A CD1 1 
ATOM   602   C CD2 . LEU A  1  75  ? 88.837  27.976 50.554  1.00 9.32   ? 75   LEU A CD2 1 
ATOM   603   N N   . ARG A  1  76  ? 92.195  25.219 52.302  1.00 14.79  ? 76   ARG A N   1 
ATOM   604   C CA  . ARG A  1  76  ? 92.558  25.112 53.711  1.00 15.64  ? 76   ARG A CA  1 
ATOM   605   C C   . ARG A  1  76  ? 92.897  26.421 54.390  1.00 14.89  ? 76   ARG A C   1 
ATOM   606   O O   . ARG A  1  76  ? 93.307  27.391 53.755  1.00 15.12  ? 76   ARG A O   1 
ATOM   607   C CB  . ARG A  1  76  ? 93.762  24.187 53.884  1.00 16.75  ? 76   ARG A CB  1 
ATOM   608   C CG  . ARG A  1  76  ? 93.496  22.780 53.450  1.00 21.06  ? 76   ARG A CG  1 
ATOM   609   C CD  . ARG A  1  76  ? 94.661  21.848 53.681  1.00 24.99  ? 76   ARG A CD  1 
ATOM   610   N NE  . ARG A  1  76  ? 94.274  20.518 53.244  1.00 29.53  ? 76   ARG A NE  1 
ATOM   611   C CZ  . ARG A  1  76  ? 95.073  19.468 53.195  1.00 33.70  ? 76   ARG A CZ  1 
ATOM   612   N NH1 . ARG A  1  76  ? 96.344  19.566 53.567  1.00 35.41  ? 76   ARG A NH1 1 
ATOM   613   N NH2 . ARG A  1  76  ? 94.591  18.309 52.764  1.00 35.76  ? 76   ARG A NH2 1 
ATOM   614   N N   . LYS A  1  77  ? 92.725  26.418 55.705  1.00 13.75  ? 77   LYS A N   1 
ATOM   615   C CA  . LYS A  1  77  ? 93.081  27.537 56.549  1.00 13.03  ? 77   LYS A CA  1 
ATOM   616   C C   . LYS A  1  77  ? 93.381  26.886 57.883  1.00 12.70  ? 77   LYS A C   1 
ATOM   617   O O   . LYS A  1  77  ? 92.554  26.147 58.420  1.00 12.45  ? 77   LYS A O   1 
ATOM   618   C CB  . LYS A  1  77  ? 91.939  28.551 56.695  1.00 12.99  ? 77   LYS A CB  1 
ATOM   619   C CG  . LYS A  1  77  ? 92.365  29.804 57.433  1.00 10.99  ? 77   LYS A CG  1 
ATOM   620   C CD  . LYS A  1  77  ? 91.334  30.907 57.330  1.00 11.81  ? 77   LYS A CD  1 
ATOM   621   C CE  . LYS A  1  77  ? 91.874  32.202 57.899  1.00 10.44  ? 77   LYS A CE  1 
ATOM   622   N NZ  . LYS A  1  77  ? 90.992  33.354 57.561  1.00 10.51  ? 77   LYS A NZ  1 
ATOM   623   N N   . ALA A  1  78  ? 94.570  27.150 58.402  1.00 12.77  ? 78   ALA A N   1 
ATOM   624   C CA  . ALA A  1  78  ? 95.007  26.556 59.648  1.00 13.12  ? 78   ALA A CA  1 
ATOM   625   C C   . ALA A  1  78  ? 94.070  26.926 60.774  1.00 13.44  ? 78   ALA A C   1 
ATOM   626   O O   . ALA A  1  78  ? 93.629  26.053 61.510  1.00 13.37  ? 78   ALA A O   1 
ATOM   627   C CB  . ALA A  1  78  ? 96.446  26.984 59.984  1.00 12.37  ? 78   ALA A CB  1 
ATOM   628   N N   . SER A  1  79  ? 93.750  28.213 60.880  1.00 13.71  ? 79   SER A N   1 
ATOM   629   C CA  . SER A  1  79  ? 92.920  28.697 61.973  1.00 14.23  ? 79   SER A CA  1 
ATOM   630   C C   . SER A  1  79  ? 91.866  29.728 61.562  1.00 15.11  ? 79   SER A C   1 
ATOM   631   O O   . SER A  1  79  ? 92.174  30.880 61.247  1.00 14.77  ? 79   SER A O   1 
ATOM   632   C CB  . SER A  1  79  ? 93.822  29.279 63.067  1.00 13.77  ? 79   SER A CB  1 
ATOM   633   O OG  . SER A  1  79  ? 93.066  29.699 64.172  1.00 11.71  ? 79   SER A OG  1 
ATOM   634   N N   . VAL A  1  80  ? 90.612  29.300 61.599  1.00 16.74  ? 80   VAL A N   1 
ATOM   635   C CA  . VAL A  1  80  ? 89.497  30.158 61.225  1.00 18.23  ? 80   VAL A CA  1 
ATOM   636   C C   . VAL A  1  80  ? 88.793  30.741 62.436  1.00 19.00  ? 80   VAL A C   1 
ATOM   637   O O   . VAL A  1  80  ? 88.820  30.178 63.517  1.00 19.20  ? 80   VAL A O   1 
ATOM   638   C CB  . VAL A  1  80  ? 88.459  29.383 60.426  1.00 18.06  ? 80   VAL A CB  1 
ATOM   639   C CG1 . VAL A  1  80  ? 89.081  28.838 59.172  1.00 19.11  ? 80   VAL A CG1 1 
ATOM   640   C CG2 . VAL A  1  80  ? 87.886  28.257 61.267  1.00 17.93  ? 80   VAL A CG2 1 
ATOM   641   N N   . HIS A  1  81  ? 88.171  31.891 62.250  1.00 20.23  ? 81   HIS A N   1 
ATOM   642   C CA  . HIS A  1  81  ? 87.397  32.492 63.319  1.00 20.95  ? 81   HIS A CA  1 
ATOM   643   C C   . HIS A  1  81  ? 86.050  32.815 62.699  1.00 20.90  ? 81   HIS A C   1 
ATOM   644   O O   . HIS A  1  81  ? 85.811  32.541 61.517  1.00 20.13  ? 81   HIS A O   1 
ATOM   645   C CB  . HIS A  1  81  ? 88.066  33.759 63.875  1.00 21.40  ? 81   HIS A CB  1 
ATOM   646   C CG  . HIS A  1  81  ? 89.503  33.563 64.257  1.00 22.68  ? 81   HIS A CG  1 
ATOM   647   N ND1 . HIS A  1  81  ? 90.526  33.609 63.336  1.00 23.63  ? 81   HIS A ND1 1 
ATOM   648   C CD2 . HIS A  1  81  ? 90.082  33.291 65.450  1.00 22.98  ? 81   HIS A CD2 1 
ATOM   649   C CE1 . HIS A  1  81  ? 91.675  33.381 63.944  1.00 23.76  ? 81   HIS A CE1 1 
ATOM   650   N NE2 . HIS A  1  81  ? 91.433  33.182 65.228  1.00 24.68  ? 81   HIS A NE2 1 
ATOM   651   N N   . TRP A  1  82  ? 85.185  33.415 63.509  1.00 20.89  ? 82   TRP A N   1 
ATOM   652   C CA  . TRP A  1  82  ? 83.840  33.777 63.103  1.00 20.28  ? 82   TRP A CA  1 
ATOM   653   C C   . TRP A  1  82  ? 83.730  34.418 61.718  1.00 18.69  ? 82   TRP A C   1 
ATOM   654   O O   . TRP A  1  82  ? 82.945  33.968 60.903  1.00 17.69  ? 82   TRP A O   1 
ATOM   655   C CB  . TRP A  1  82  ? 83.242  34.695 64.156  1.00 20.99  ? 82   TRP A CB  1 
ATOM   656   C CG  . TRP A  1  82  ? 81.827  35.045 63.896  1.00 22.30  ? 82   TRP A CG  1 
ATOM   657   C CD1 . TRP A  1  82  ? 80.814  34.190 63.591  1.00 23.51  ? 82   TRP A CD1 1 
ATOM   658   C CD2 . TRP A  1  82  ? 81.262  36.349 63.920  1.00 24.57  ? 82   TRP A CD2 1 
ATOM   659   N NE1 . TRP A  1  82  ? 79.642  34.886 63.422  1.00 25.18  ? 82   TRP A NE1 1 
ATOM   660   C CE2 . TRP A  1  82  ? 79.891  36.219 63.622  1.00 26.17  ? 82   TRP A CE2 1 
ATOM   661   C CE3 . TRP A  1  82  ? 81.775  37.627 64.170  1.00 25.75  ? 82   TRP A CE3 1 
ATOM   662   C CZ2 . TRP A  1  82  ? 79.028  37.318 63.572  1.00 26.83  ? 82   TRP A CZ2 1 
ATOM   663   C CZ3 . TRP A  1  82  ? 80.916  38.716 64.122  1.00 26.12  ? 82   TRP A CZ3 1 
ATOM   664   C CH2 . TRP A  1  82  ? 79.562  38.554 63.825  1.00 26.63  ? 82   TRP A CH2 1 
ATOM   665   N N   . SER A  1  83  ? 84.519  35.455 61.456  1.00 17.63  ? 83   SER A N   1 
ATOM   666   C CA  . SER A  1  83  ? 84.464  36.162 60.176  1.00 16.61  ? 83   SER A CA  1 
ATOM   667   C C   . SER A  1  83  ? 84.688  35.295 58.924  1.00 16.48  ? 83   SER A C   1 
ATOM   668   O O   . SER A  1  83  ? 84.427  35.744 57.809  1.00 16.32  ? 83   SER A O   1 
ATOM   669   C CB  . SER A  1  83  ? 85.444  37.329 60.188  1.00 16.12  ? 83   SER A CB  1 
ATOM   670   O OG  . SER A  1  83  ? 86.735  36.903 60.564  1.00 16.00  ? 83   SER A OG  1 
ATOM   671   N N   . ASP A  1  84  ? 85.173  34.069 59.094  1.00 16.37  ? 84   ASP A N   1 
ATOM   672   C CA  . ASP A  1  84  ? 85.380  33.184 57.950  1.00 16.09  ? 84   ASP A CA  1 
ATOM   673   C C   . ASP A  1  84  ? 84.065  32.561 57.519  1.00 16.24  ? 84   ASP A C   1 
ATOM   674   O O   . ASP A  1  84  ? 83.999  31.876 56.494  1.00 15.71  ? 84   ASP A O   1 
ATOM   675   C CB  . ASP A  1  84  ? 86.362  32.077 58.286  1.00 16.06  ? 84   ASP A CB  1 
ATOM   676   C CG  . ASP A  1  84  ? 87.751  32.588 58.495  1.00 16.30  ? 84   ASP A CG  1 
ATOM   677   O OD1 . ASP A  1  84  ? 88.321  33.169 57.546  1.00 15.82  ? 84   ASP A OD1 1 
ATOM   678   O OD2 . ASP A  1  84  ? 88.339  32.424 59.581  1.00 17.12  ? 84   ASP A OD2 1 
ATOM   679   N N   . SER A  1  85  ? 83.028  32.777 58.332  1.00 16.21  ? 85   SER A N   1 
ATOM   680   C CA  . SER A  1  85  ? 81.704  32.264 58.039  1.00 16.01  ? 85   SER A CA  1 
ATOM   681   C C   . SER A  1  85  ? 81.304  32.856 56.704  1.00 15.61  ? 85   SER A C   1 
ATOM   682   O O   . SER A  1  85  ? 81.360  34.061 56.530  1.00 16.35  ? 85   SER A O   1 
ATOM   683   C CB  . SER A  1  85  ? 80.713  32.707 59.110  1.00 16.21  ? 85   SER A CB  1 
ATOM   684   O OG  . SER A  1  85  ? 81.086  32.237 60.391  1.00 16.22  ? 85   SER A OG  1 
ATOM   685   N N   . ALA A  1  86  ? 80.920  32.017 55.756  1.00 15.39  ? 86   ALA A N   1 
ATOM   686   C CA  . ALA A  1  86  ? 80.534  32.502 54.433  1.00 15.12  ? 86   ALA A CA  1 
ATOM   687   C C   . ALA A  1  86  ? 80.268  31.319 53.544  1.00 14.70  ? 86   ALA A C   1 
ATOM   688   O O   . ALA A  1  86  ? 80.261  30.182 54.016  1.00 14.50  ? 86   ALA A O   1 
ATOM   689   C CB  . ALA A  1  86  ? 81.643  33.356 53.831  1.00 15.29  ? 86   ALA A CB  1 
ATOM   690   N N   . VAL A  1  87  ? 80.052  31.588 52.258  1.00 14.01  ? 87   VAL A N   1 
ATOM   691   C CA  . VAL A  1  87  ? 79.823  30.532 51.297  1.00 13.42  ? 87   VAL A CA  1 
ATOM   692   C C   . VAL A  1  87  ? 81.032  30.493 50.370  1.00 14.27  ? 87   VAL A C   1 
ATOM   693   O O   . VAL A  1  87  ? 81.407  31.511 49.777  1.00 14.21  ? 87   VAL A O   1 
ATOM   694   C CB  . VAL A  1  87  ? 78.544  30.749 50.481  1.00 13.48  ? 87   VAL A CB  1 
ATOM   695   C CG1 . VAL A  1  87  ? 78.381  29.629 49.450  1.00 12.73  ? 87   VAL A CG1 1 
ATOM   696   C CG2 . VAL A  1  87  ? 77.313  30.813 51.401  1.00 12.07  ? 87   VAL A CG2 1 
ATOM   697   N N   . TYR A  1  88  ? 81.645  29.314 50.260  1.00 14.47  ? 88   TYR A N   1 
ATOM   698   C CA  . TYR A  1  88  ? 82.821  29.132 49.424  1.00 14.06  ? 88   TYR A CA  1 
ATOM   699   C C   . TYR A  1  88  ? 82.540  28.341 48.187  1.00 13.78  ? 88   TYR A C   1 
ATOM   700   O O   . TYR A  1  88  ? 81.916  27.282 48.243  1.00 13.09  ? 88   TYR A O   1 
ATOM   701   C CB  . TYR A  1  88  ? 83.901  28.429 50.204  1.00 14.26  ? 88   TYR A CB  1 
ATOM   702   C CG  . TYR A  1  88  ? 84.319  29.223 51.386  1.00 14.72  ? 88   TYR A CG  1 
ATOM   703   C CD1 . TYR A  1  88  ? 83.498  29.318 52.487  1.00 15.47  ? 88   TYR A CD1 1 
ATOM   704   C CD2 . TYR A  1  88  ? 85.538  29.902 51.398  1.00 15.21  ? 88   TYR A CD2 1 
ATOM   705   C CE1 . TYR A  1  88  ? 83.882  30.053 53.594  1.00 17.79  ? 88   TYR A CE1 1 
ATOM   706   C CE2 . TYR A  1  88  ? 85.926  30.636 52.488  1.00 15.99  ? 88   TYR A CE2 1 
ATOM   707   C CZ  . TYR A  1  88  ? 85.092  30.711 53.583  1.00 17.44  ? 88   TYR A CZ  1 
ATOM   708   O OH  . TYR A  1  88  ? 85.463  31.436 54.683  1.00 19.96  ? 88   TYR A OH  1 
ATOM   709   N N   . PHE A  1  89  ? 83.044  28.860 47.070  1.00 13.85  ? 89   PHE A N   1 
ATOM   710   C CA  . PHE A  1  89  ? 82.845  28.243 45.776  1.00 13.56  ? 89   PHE A CA  1 
ATOM   711   C C   . PHE A  1  89  ? 84.147  27.770 45.133  1.00 14.00  ? 89   PHE A C   1 
ATOM   712   O O   . PHE A  1  89  ? 85.185  28.424 45.187  1.00 14.55  ? 89   PHE A O   1 
ATOM   713   C CB  . PHE A  1  89  ? 82.095  29.204 44.853  1.00 13.20  ? 89   PHE A CB  1 
ATOM   714   C CG  . PHE A  1  89  ? 80.626  29.371 45.218  1.00 13.71  ? 89   PHE A CG  1 
ATOM   715   C CD1 . PHE A  1  89  ? 79.711  28.357 44.957  1.00 13.34  ? 89   PHE A CD1 1 
ATOM   716   C CD2 . PHE A  1  89  ? 80.176  30.525 45.848  1.00 12.95  ? 89   PHE A CD2 1 
ATOM   717   C CE1 . PHE A  1  89  ? 78.368  28.492 45.306  1.00 13.60  ? 89   PHE A CE1 1 
ATOM   718   C CE2 . PHE A  1  89  ? 78.839  30.669 46.206  1.00 13.13  ? 89   PHE A CE2 1 
ATOM   719   C CZ  . PHE A  1  89  ? 77.930  29.649 45.932  1.00 13.48  ? 89   PHE A CZ  1 
ATOM   720   N N   . CYS A  1  90  ? 84.071  26.600 44.535  1.00 13.93  ? 90   CYS A N   1 
ATOM   721   C CA  . CYS A  1  90  ? 85.172  26.048 43.811  1.00 13.88  ? 90   CYS A CA  1 
ATOM   722   C C   . CYS A  1  90  ? 84.724  26.267 42.391  1.00 13.71  ? 90   CYS A C   1 
ATOM   723   O O   . CYS A  1  90  ? 83.530  26.205 42.116  1.00 13.67  ? 90   CYS A O   1 
ATOM   724   C CB  . CYS A  1  90  ? 85.290  24.561 44.066  1.00 13.98  ? 90   CYS A CB  1 
ATOM   725   S SG  . CYS A  1  90  ? 86.855  23.929 43.487  1.00 14.77  ? 90   CYS A SG  1 
ATOM   726   N N   . ALA A  1  91  ? 85.658  26.511 41.485  1.00 13.32  ? 91   ALA A N   1 
ATOM   727   C CA  . ALA A  1  91  ? 85.290  26.740 40.100  1.00 13.08  ? 91   ALA A CA  1 
ATOM   728   C C   . ALA A  1  91  ? 86.348  26.157 39.203  1.00 13.22  ? 91   ALA A C   1 
ATOM   729   O O   . ALA A  1  91  ? 87.445  25.852 39.652  1.00 13.29  ? 91   ALA A O   1 
ATOM   730   C CB  . ALA A  1  91  ? 85.135  28.220 39.836  1.00 13.00  ? 91   ALA A CB  1 
ATOM   731   N N   . VAL A  1  92  ? 86.032  26.022 37.924  1.00 13.33  ? 92   VAL A N   1 
ATOM   732   C CA  . VAL A  1  92  ? 86.985  25.442 36.997  1.00 13.41  ? 92   VAL A CA  1 
ATOM   733   C C   . VAL A  1  92  ? 86.820  25.954 35.572  1.00 13.78  ? 92   VAL A C   1 
ATOM   734   O O   . VAL A  1  92  ? 85.733  26.370 35.167  1.00 13.44  ? 92   VAL A O   1 
ATOM   735   C CB  . VAL A  1  92  ? 86.868  23.904 36.958  1.00 12.79  ? 92   VAL A CB  1 
ATOM   736   C CG1 . VAL A  1  92  ? 85.566  23.499 36.321  1.00 11.94  ? 92   VAL A CG1 1 
ATOM   737   C CG2 . VAL A  1  92  ? 88.018  23.299 36.163  1.00 13.16  ? 92   VAL A CG2 1 
ATOM   738   N N   . SER A  1  93  ? 87.911  25.875 34.814  1.00 14.07  ? 93   SER A N   1 
ATOM   739   C CA  . SER A  1  93  ? 87.915  26.276 33.418  1.00 14.56  ? 93   SER A CA  1 
ATOM   740   C C   . SER A  1  93  ? 88.875  25.401 32.631  1.00 14.17  ? 93   SER A C   1 
ATOM   741   O O   . SER A  1  93  ? 89.978  25.101 33.085  1.00 13.26  ? 93   SER A O   1 
ATOM   742   C CB  . SER A  1  93  ? 88.338  27.735 33.283  1.00 14.80  ? 93   SER A CB  1 
ATOM   743   O OG  . SER A  1  93  ? 87.903  28.263 32.053  1.00 15.60  ? 93   SER A OG  1 
ATOM   744   N N   . GLY A  1  94  ? 88.412  24.993 31.404  1.00 19.86  ? 99   GLY A N   1 
ATOM   745   C CA  . GLY A  1  94  ? 89.187  24.177 30.495  1.00 20.19  ? 99   GLY A CA  1 
ATOM   746   C C   . GLY A  1  94  ? 88.902  24.574 29.064  1.00 20.30  ? 99   GLY A C   1 
ATOM   747   O O   . GLY A  1  94  ? 89.567  25.443 28.528  1.00 20.10  ? 99   GLY A O   1 
ATOM   748   N N   . PHE A  1  95  ? 87.909  23.926 28.459  1.00 21.36  ? 100  PHE A N   1 
ATOM   749   C CA  . PHE A  1  95  ? 87.486  24.203 27.082  1.00 22.22  ? 100  PHE A CA  1 
ATOM   750   C C   . PHE A  1  95  ? 87.369  25.710 26.845  1.00 21.86  ? 100  PHE A C   1 
ATOM   751   O O   . PHE A  1  95  ? 88.084  26.311 26.031  1.00 21.23  ? 100  PHE A O   1 
ATOM   752   C CB  . PHE A  1  95  ? 86.064  23.656 26.805  1.00 22.74  ? 100  PHE A CB  1 
ATOM   753   C CG  . PHE A  1  95  ? 85.943  22.155 26.759  1.00 24.64  ? 100  PHE A CG  1 
ATOM   754   C CD1 . PHE A  1  95  ? 84.723  21.586 26.416  1.00 26.34  ? 100  PHE A CD1 1 
ATOM   755   C CD2 . PHE A  1  95  ? 87.007  21.319 27.049  1.00 26.04  ? 100  PHE A CD2 1 
ATOM   756   C CE1 . PHE A  1  95  ? 84.567  20.213 26.348  1.00 28.25  ? 100  PHE A CE1 1 
ATOM   757   C CE2 . PHE A  1  95  ? 86.859  19.931 26.988  1.00 27.96  ? 100  PHE A CE2 1 
ATOM   758   C CZ  . PHE A  1  95  ? 85.637  19.378 26.636  1.00 28.45  ? 100  PHE A CZ  1 
ATOM   759   N N   . ALA A  1  96  ? 86.405  26.272 27.566  1.00 21.12  ? 101  ALA A N   1 
ATOM   760   C CA  . ALA A  1  96  ? 86.009  27.663 27.487  1.00 21.06  ? 101  ALA A CA  1 
ATOM   761   C C   . ALA A  1  96  ? 86.717  28.568 28.477  1.00 20.81  ? 101  ALA A C   1 
ATOM   762   O O   . ALA A  1  96  ? 87.317  28.103 29.442  1.00 20.42  ? 101  ALA A O   1 
ATOM   763   C CB  . ALA A  1  96  ? 84.498  27.756 27.706  1.00 20.90  ? 101  ALA A CB  1 
ATOM   764   N N   . SER A  1  97  ? 86.609  29.872 28.223  1.00 20.59  ? 102  SER A N   1 
ATOM   765   C CA  . SER A  1  97  ? 87.203  30.894 29.079  1.00 20.75  ? 102  SER A CA  1 
ATOM   766   C C   . SER A  1  97  ? 86.264  31.248 30.254  1.00 20.48  ? 102  SER A C   1 
ATOM   767   O O   . SER A  1  97  ? 86.642  31.994 31.152  1.00 21.34  ? 102  SER A O   1 
ATOM   768   C CB  . SER A  1  97  ? 87.516  32.162 28.265  1.00 20.57  ? 102  SER A CB  1 
ATOM   769   O OG  . SER A  1  97  ? 88.291  31.887 27.105  1.00 21.00  ? 102  SER A OG  1 
ATOM   770   N N   . ALA A  1  98  ? 85.042  30.731 30.243  1.00 19.85  ? 103  ALA A N   1 
ATOM   771   C CA  . ALA A  1  98  ? 84.097  30.991 31.326  1.00 19.49  ? 103  ALA A CA  1 
ATOM   772   C C   . ALA A  1  98  ? 84.364  30.009 32.464  1.00 18.96  ? 103  ALA A C   1 
ATOM   773   O O   . ALA A  1  98  ? 85.008  28.981 32.252  1.00 19.29  ? 103  ALA A O   1 
ATOM   774   C CB  . ALA A  1  98  ? 82.675  30.832 30.828  1.00 19.35  ? 103  ALA A CB  1 
ATOM   775   N N   . LEU A  1  99  ? 83.887  30.306 33.669  1.00 18.09  ? 104  LEU A N   1 
ATOM   776   C CA  . LEU A  1  99  ? 84.111  29.377 34.777  1.00 17.51  ? 104  LEU A CA  1 
ATOM   777   C C   . LEU A  1  99  ? 82.854  28.580 35.069  1.00 16.47  ? 104  LEU A C   1 
ATOM   778   O O   . LEU A  1  99  ? 81.753  29.115 35.040  1.00 16.59  ? 104  LEU A O   1 
ATOM   779   C CB  . LEU A  1  99  ? 84.546  30.087 36.067  1.00 17.92  ? 104  LEU A CB  1 
ATOM   780   C CG  . LEU A  1  99  ? 85.544  31.246 36.120  1.00 18.51  ? 104  LEU A CG  1 
ATOM   781   C CD1 . LEU A  1  99  ? 85.670  31.631 37.579  1.00 20.00  ? 104  LEU A CD1 1 
ATOM   782   C CD2 . LEU A  1  99  ? 86.904  30.906 35.584  1.00 18.98  ? 104  LEU A CD2 1 
ATOM   783   N N   . THR A  1  100 ? 83.033  27.294 35.338  1.00 15.62  ? 105  THR A N   1 
ATOM   784   C CA  . THR A  1  100 ? 81.940  26.417 35.735  1.00 14.98  ? 105  THR A CA  1 
ATOM   785   C C   . THR A  1  100 ? 82.049  26.343 37.247  1.00 14.44  ? 105  THR A C   1 
ATOM   786   O O   . THR A  1  100 ? 83.124  26.057 37.771  1.00 14.19  ? 105  THR A O   1 
ATOM   787   C CB  . THR A  1  100 ? 82.141  25.008 35.182  1.00 14.70  ? 105  THR A CB  1 
ATOM   788   O OG1 . THR A  1  100 ? 82.360  25.061 33.771  1.00 15.42  ? 105  THR A OG1 1 
ATOM   789   C CG2 . THR A  1  100 ? 80.891  24.178 35.380  1.00 14.79  ? 105  THR A CG2 1 
ATOM   790   N N   . PHE A  1  101 ? 80.958  26.578 37.958  1.00 14.21  ? 106  PHE A N   1 
ATOM   791   C CA  . PHE A  1  101 ? 81.008  26.596 39.415  1.00 13.99  ? 106  PHE A CA  1 
ATOM   792   C C   . PHE A  1  101 ? 80.425  25.390 40.106  1.00 15.15  ? 106  PHE A C   1 
ATOM   793   O O   . PHE A  1  101 ? 79.453  24.808 39.644  1.00 15.65  ? 106  PHE A O   1 
ATOM   794   C CB  . PHE A  1  101 ? 80.278  27.828 39.930  1.00 13.29  ? 106  PHE A CB  1 
ATOM   795   C CG  . PHE A  1  101 ? 81.039  29.089 39.743  1.00 11.94  ? 106  PHE A CG  1 
ATOM   796   C CD1 . PHE A  1  101 ? 80.941  29.799 38.561  1.00 10.28  ? 106  PHE A CD1 1 
ATOM   797   C CD2 . PHE A  1  101 ? 81.885  29.549 40.739  1.00 10.06  ? 106  PHE A CD2 1 
ATOM   798   C CE1 . PHE A  1  101 ? 81.658  30.947 38.377  1.00 9.61   ? 106  PHE A CE1 1 
ATOM   799   C CE2 . PHE A  1  101 ? 82.600  30.700 40.571  1.00 9.91   ? 106  PHE A CE2 1 
ATOM   800   C CZ  . PHE A  1  101 ? 82.493  31.404 39.386  1.00 10.71  ? 106  PHE A CZ  1 
ATOM   801   N N   . GLY A  1  102 ? 81.017  25.027 41.239  1.00 16.26  ? 107  GLY A N   1 
ATOM   802   C CA  . GLY A  1  102 ? 80.487  23.939 42.034  1.00 17.04  ? 107  GLY A CA  1 
ATOM   803   C C   . GLY A  1  102 ? 79.263  24.487 42.761  1.00 17.62  ? 107  GLY A C   1 
ATOM   804   O O   . GLY A  1  102 ? 79.040  25.700 42.793  1.00 17.24  ? 107  GLY A O   1 
ATOM   805   N N   . SER A  1  103 ? 78.460  23.606 43.340  1.00 18.36  ? 108  SER A N   1 
ATOM   806   C CA  . SER A  1  103 ? 77.251  24.034 44.034  1.00 19.09  ? 108  SER A CA  1 
ATOM   807   C C   . SER A  1  103 ? 77.554  24.884 45.263  1.00 19.13  ? 108  SER A C   1 
ATOM   808   O O   . SER A  1  103 ? 76.746  25.708 45.652  1.00 19.98  ? 108  SER A O   1 
ATOM   809   C CB  . SER A  1  103 ? 76.404  22.822 44.410  1.00 19.47  ? 108  SER A CB  1 
ATOM   810   O OG  . SER A  1  103 ? 77.227  21.728 44.779  1.00 20.52  ? 108  SER A OG  1 
ATOM   811   N N   . GLY A  1  104 ? 78.717  24.686 45.877  1.00 19.37  ? 109  GLY A N   1 
ATOM   812   C CA  . GLY A  1  104 ? 79.109  25.502 47.017  1.00 18.55  ? 109  GLY A CA  1 
ATOM   813   C C   . GLY A  1  104 ? 79.005  24.886 48.394  1.00 18.06  ? 109  GLY A C   1 
ATOM   814   O O   . GLY A  1  104 ? 78.187  24.011 48.652  1.00 18.20  ? 109  GLY A O   1 
ATOM   815   N N   . THR A  1  105 ? 79.846  25.376 49.292  1.00 17.42  ? 110  THR A N   1 
ATOM   816   C CA  . THR A  1  105 ? 79.862  24.905 50.665  1.00 16.83  ? 110  THR A CA  1 
ATOM   817   C C   . THR A  1  105 ? 79.688  26.046 51.645  1.00 16.59  ? 110  THR A C   1 
ATOM   818   O O   . THR A  1  105 ? 80.508  26.961 51.683  1.00 16.02  ? 110  THR A O   1 
ATOM   819   C CB  . THR A  1  105 ? 81.176  24.244 50.964  1.00 16.63  ? 110  THR A CB  1 
ATOM   820   O OG1 . THR A  1  105 ? 81.433  23.227 49.988  1.00 17.47  ? 110  THR A OG1 1 
ATOM   821   C CG2 . THR A  1  105 ? 81.116  23.554 52.324  1.00 16.21  ? 110  THR A CG2 1 
ATOM   822   N N   . LYS A  1  106 ? 78.622  26.003 52.433  1.00 16.78  ? 111  LYS A N   1 
ATOM   823   C CA  . LYS A  1  106 ? 78.409  27.050 53.422  1.00 17.64  ? 111  LYS A CA  1 
ATOM   824   C C   . LYS A  1  106 ? 79.196  26.707 54.684  1.00 17.34  ? 111  LYS A C   1 
ATOM   825   O O   . LYS A  1  106 ? 79.030  25.629 55.264  1.00 17.17  ? 111  LYS A O   1 
ATOM   826   C CB  . LYS A  1  106 ? 76.930  27.207 53.756  1.00 18.08  ? 111  LYS A CB  1 
ATOM   827   C CG  . LYS A  1  106 ? 76.635  28.301 54.766  1.00 19.44  ? 111  LYS A CG  1 
ATOM   828   C CD  . LYS A  1  106 ? 75.165  28.293 55.123  1.00 23.25  ? 111  LYS A CD  1 
ATOM   829   C CE  . LYS A  1  106 ? 74.844  29.225 56.282  1.00 25.60  ? 111  LYS A CE  1 
ATOM   830   N NZ  . LYS A  1  106 ? 73.461  29.018 56.815  1.00 26.66  ? 111  LYS A NZ  1 
ATOM   831   N N   . VAL A  1  107 ? 80.061  27.621 55.100  1.00 17.09  ? 112  VAL A N   1 
ATOM   832   C CA  . VAL A  1  107 ? 80.867  27.391 56.289  1.00 17.32  ? 112  VAL A CA  1 
ATOM   833   C C   . VAL A  1  107 ? 80.353  28.141 57.513  1.00 17.40  ? 112  VAL A C   1 
ATOM   834   O O   . VAL A  1  107 ? 80.229  29.366 57.505  1.00 17.85  ? 112  VAL A O   1 
ATOM   835   C CB  . VAL A  1  107 ? 82.316  27.783 56.052  1.00 17.18  ? 112  VAL A CB  1 
ATOM   836   C CG1 . VAL A  1  107 ? 83.095  27.694 57.357  1.00 17.70  ? 112  VAL A CG1 1 
ATOM   837   C CG2 . VAL A  1  107 ? 82.938  26.884 54.996  1.00 17.95  ? 112  VAL A CG2 1 
ATOM   838   N N   . ILE A  1  108 ? 80.051  27.397 58.565  1.00 17.48  ? 113  ILE A N   1 
ATOM   839   C CA  . ILE A  1  108 ? 79.590  27.986 59.819  1.00 17.83  ? 113  ILE A CA  1 
ATOM   840   C C   . ILE A  1  108 ? 80.673  27.767 60.857  1.00 18.60  ? 113  ILE A C   1 
ATOM   841   O O   . ILE A  1  108 ? 80.943  26.624 61.232  1.00 17.85  ? 113  ILE A O   1 
ATOM   842   C CB  . ILE A  1  108 ? 78.300  27.304 60.337  1.00 17.53  ? 113  ILE A CB  1 
ATOM   843   C CG1 . ILE A  1  108 ? 77.080  27.729 59.523  1.00 17.35  ? 113  ILE A CG1 1 
ATOM   844   C CG2 . ILE A  1  108 ? 78.092  27.621 61.823  1.00 18.17  ? 113  ILE A CG2 1 
ATOM   845   C CD1 . ILE A  1  108 ? 76.910  26.944 58.240  1.00 17.90  ? 113  ILE A CD1 1 
ATOM   846   N N   . VAL A  1  109 ? 81.307  28.839 61.318  1.00 19.62  ? 114  VAL A N   1 
ATOM   847   C CA  . VAL A  1  109 ? 82.323  28.690 62.355  1.00 21.10  ? 114  VAL A CA  1 
ATOM   848   C C   . VAL A  1  109 ? 81.787  29.244 63.684  1.00 21.60  ? 114  VAL A C   1 
ATOM   849   O O   . VAL A  1  109 ? 81.474  30.426 63.819  1.00 21.71  ? 114  VAL A O   1 
ATOM   850   C CB  . VAL A  1  109 ? 83.683  29.311 61.955  1.00 21.38  ? 114  VAL A CB  1 
ATOM   851   C CG1 . VAL A  1  109 ? 83.491  30.600 61.210  1.00 23.08  ? 114  VAL A CG1 1 
ATOM   852   C CG2 . VAL A  1  109 ? 84.559  29.517 63.191  1.00 21.71  ? 114  VAL A CG2 1 
ATOM   853   N N   . LEU A  1  110 ? 81.662  28.350 64.651  1.00 22.16  ? 115  LEU A N   1 
ATOM   854   C CA  . LEU A  1  110 ? 81.102  28.666 65.956  1.00 22.73  ? 115  LEU A CA  1 
ATOM   855   C C   . LEU A  1  110 ? 82.009  29.492 66.852  1.00 23.53  ? 115  LEU A C   1 
ATOM   856   O O   . LEU A  1  110 ? 83.077  29.034 67.245  1.00 23.12  ? 115  LEU A O   1 
ATOM   857   C CB  . LEU A  1  110 ? 80.750  27.356 66.648  1.00 22.68  ? 115  LEU A CB  1 
ATOM   858   C CG  . LEU A  1  110 ? 79.858  26.480 65.756  1.00 22.11  ? 115  LEU A CG  1 
ATOM   859   C CD1 . LEU A  1  110 ? 79.826  25.044 66.245  1.00 21.45  ? 115  LEU A CD1 1 
ATOM   860   C CD2 . LEU A  1  110 ? 78.452  27.086 65.682  1.00 20.33  ? 115  LEU A CD2 1 
ATOM   861   N N   . PRO A  1  111 ? 81.577  30.700 67.217  1.00 24.93  ? 116  PRO A N   1 
ATOM   862   C CA  . PRO A  1  111 ? 82.401  31.526 68.088  1.00 25.85  ? 116  PRO A CA  1 
ATOM   863   C C   . PRO A  1  111 ? 82.298  30.858 69.439  1.00 27.58  ? 116  PRO A C   1 
ATOM   864   O O   . PRO A  1  111 ? 81.275  30.234 69.725  1.00 27.16  ? 116  PRO A O   1 
ATOM   865   C CB  . PRO A  1  111 ? 81.669  32.852 68.072  1.00 25.21  ? 116  PRO A CB  1 
ATOM   866   C CG  . PRO A  1  111 ? 80.254  32.404 68.079  1.00 24.64  ? 116  PRO A CG  1 
ATOM   867   C CD  . PRO A  1  111 ? 80.266  31.341 66.988  1.00 24.43  ? 116  PRO A CD  1 
ATOM   868   N N   . TYR A  1  112 ? 83.325  30.940 70.261  1.00 29.97  ? 117  TYR A N   1 
ATOM   869   C CA  . TYR A  1  112 ? 83.202  30.289 71.546  1.00 32.45  ? 117  TYR A CA  1 
ATOM   870   C C   . TYR A  1  112 ? 82.974  31.284 72.658  1.00 32.98  ? 117  TYR A C   1 
ATOM   871   O O   . TYR A  1  112 ? 83.742  32.223 72.839  1.00 33.32  ? 117  TYR A O   1 
ATOM   872   C CB  . TYR A  1  112 ? 84.372  29.351 71.831  1.00 33.42  ? 117  TYR A CB  1 
ATOM   873   C CG  . TYR A  1  112 ? 85.724  29.953 72.102  1.00 36.70  ? 117  TYR A CG  1 
ATOM   874   C CD1 . TYR A  1  112 ? 86.229  30.001 73.397  1.00 39.50  ? 117  TYR A CD1 1 
ATOM   875   C CD2 . TYR A  1  112 ? 86.545  30.374 71.057  1.00 39.49  ? 117  TYR A CD2 1 
ATOM   876   C CE1 . TYR A  1  112 ? 87.506  30.485 73.651  1.00 41.23  ? 117  TYR A CE1 1 
ATOM   877   C CE2 . TYR A  1  112 ? 87.825  30.865 71.299  1.00 40.87  ? 117  TYR A CE2 1 
ATOM   878   C CZ  . TYR A  1  112 ? 88.302  30.915 72.598  1.00 41.52  ? 117  TYR A CZ  1 
ATOM   879   O OH  . TYR A  1  112 ? 89.574  31.386 72.848  1.00 42.18  ? 117  TYR A OH  1 
ATOM   880   N N   . ILE A  1  113 ? 81.878  31.076 73.377  1.00 33.78  ? 118  ILE A N   1 
ATOM   881   C CA  . ILE A  1  113 ? 81.487  31.939 74.474  1.00 34.21  ? 118  ILE A CA  1 
ATOM   882   C C   . ILE A  1  113 ? 82.104  31.449 75.772  1.00 34.82  ? 118  ILE A C   1 
ATOM   883   O O   . ILE A  1  113 ? 81.749  30.395 76.293  1.00 34.62  ? 118  ILE A O   1 
ATOM   884   C CB  . ILE A  1  113 ? 79.951  31.988 74.578  1.00 34.31  ? 118  ILE A CB  1 
ATOM   885   C CG1 . ILE A  1  113 ? 79.358  32.385 73.218  1.00 33.96  ? 118  ILE A CG1 1 
ATOM   886   C CG2 . ILE A  1  113 ? 79.519  32.942 75.697  1.00 33.40  ? 118  ILE A CG2 1 
ATOM   887   C CD1 . ILE A  1  113 ? 79.951  33.651 72.622  1.00 33.62  ? 118  ILE A CD1 1 
ATOM   888   N N   . GLN A  1  114 ? 83.039  32.236 76.282  1.00 35.70  ? 119  GLN A N   1 
ATOM   889   C CA  . GLN A  1  114 ? 83.752  31.907 77.506  1.00 36.75  ? 119  GLN A CA  1 
ATOM   890   C C   . GLN A  1  114 ? 82.814  31.668 78.688  1.00 36.65  ? 119  GLN A C   1 
ATOM   891   O O   . GLN A  1  114 ? 82.964  30.682 79.407  1.00 36.73  ? 119  GLN A O   1 
ATOM   892   C CB  . GLN A  1  114 ? 84.757  33.019 77.824  1.00 37.09  ? 119  GLN A CB  1 
ATOM   893   C CG  . GLN A  1  114 ? 85.387  33.609 76.559  1.00 39.25  ? 119  GLN A CG  1 
ATOM   894   C CD  . GLN A  1  114 ? 86.535  34.570 76.824  1.00 41.04  ? 119  GLN A CD  1 
ATOM   895   O OE1 . GLN A  1  114 ? 86.607  35.199 77.882  1.00 42.16  ? 119  GLN A OE1 1 
ATOM   896   N NE2 . GLN A  1  114 ? 87.436  34.690 75.851  1.00 41.76  ? 119  GLN A NE2 1 
ATOM   897   N N   . ASN A  1  115 ? 81.845  32.557 78.887  1.00 36.69  ? 120  ASN A N   1 
ATOM   898   C CA  . ASN A  1  115 ? 80.922  32.405 80.009  1.00 36.72  ? 120  ASN A CA  1 
ATOM   899   C C   . ASN A  1  115 ? 79.460  32.490 79.593  1.00 37.02  ? 120  ASN A C   1 
ATOM   900   O O   . ASN A  1  115 ? 78.812  33.505 79.831  1.00 36.86  ? 120  ASN A O   1 
ATOM   901   C CB  . ASN A  1  115 ? 81.194  33.470 81.080  1.00 36.41  ? 120  ASN A CB  1 
ATOM   902   C CG  . ASN A  1  115 ? 82.673  33.717 81.301  1.00 36.21  ? 120  ASN A CG  1 
ATOM   903   O OD1 . ASN A  1  115 ? 83.439  32.793 81.590  1.00 35.29  ? 120  ASN A OD1 1 
ATOM   904   N ND2 . ASN A  1  115 ? 83.085  34.972 81.163  1.00 35.50  ? 120  ASN A ND2 1 
ATOM   905   N N   . PRO A  1  116 ? 78.896  31.434 79.016  1.00 37.44  ? 121  PRO A N   1 
ATOM   906   C CA  . PRO A  1  116 ? 77.501  31.551 78.618  1.00 37.67  ? 121  PRO A CA  1 
ATOM   907   C C   . PRO A  1  116 ? 76.637  31.904 79.831  1.00 38.03  ? 121  PRO A C   1 
ATOM   908   O O   . PRO A  1  116 ? 76.991  31.575 80.956  1.00 38.05  ? 121  PRO A O   1 
ATOM   909   C CB  . PRO A  1  116 ? 77.185  30.161 78.066  1.00 37.58  ? 121  PRO A CB  1 
ATOM   910   C CG  . PRO A  1  116 ? 78.122  29.275 78.784  1.00 37.31  ? 121  PRO A CG  1 
ATOM   911   C CD  . PRO A  1  116 ? 79.403  30.069 78.770  1.00 37.48  ? 121  PRO A CD  1 
ATOM   912   N N   . GLU A  1  117 ? 75.532  32.600 79.581  1.00 38.60  ? 122  GLU A N   1 
ATOM   913   C CA  . GLU A  1  117 ? 74.575  32.996 80.604  1.00 39.01  ? 122  GLU A CA  1 
ATOM   914   C C   . GLU A  1  117 ? 73.201  32.881 79.951  1.00 38.55  ? 122  GLU A C   1 
ATOM   915   O O   . GLU A  1  117 ? 72.400  33.815 80.009  1.00 38.73  ? 122  GLU A O   1 
ATOM   916   C CB  . GLU A  1  117 ? 74.796  34.445 81.042  1.00 39.82  ? 122  GLU A CB  1 
ATOM   917   C CG  . GLU A  1  117 ? 76.061  34.716 81.836  1.00 41.96  ? 122  GLU A CG  1 
ATOM   918   C CD  . GLU A  1  117 ? 76.100  36.141 82.371  1.00 44.75  ? 122  GLU A CD  1 
ATOM   919   O OE1 . GLU A  1  117 ? 76.007  37.090 81.551  1.00 45.37  ? 122  GLU A OE1 1 
ATOM   920   O OE2 . GLU A  1  117 ? 76.216  36.315 83.610  1.00 46.18  ? 122  GLU A OE2 1 
ATOM   921   N N   . PRO A  1  118 ? 72.907  31.715 79.385  1.00 37.99  ? 123  PRO A N   1 
ATOM   922   C CA  . PRO A  1  118 ? 71.668  31.463 78.641  1.00 37.74  ? 123  PRO A CA  1 
ATOM   923   C C   . PRO A  1  118 ? 70.407  32.046 79.281  1.00 37.59  ? 123  PRO A C   1 
ATOM   924   O O   . PRO A  1  118 ? 69.883  31.505 80.251  1.00 37.12  ? 123  PRO A O   1 
ATOM   925   C CB  . PRO A  1  118 ? 71.616  29.934 78.593  1.00 37.79  ? 123  PRO A CB  1 
ATOM   926   C CG  . PRO A  1  118 ? 72.510  29.510 79.708  1.00 37.73  ? 123  PRO A CG  1 
ATOM   927   C CD  . PRO A  1  118 ? 73.647  30.464 79.605  1.00 37.96  ? 123  PRO A CD  1 
ATOM   928   N N   . ALA A  1  119 ? 69.927  33.146 78.706  1.00 37.47  ? 124  ALA A N   1 
ATOM   929   C CA  . ALA A  1  119 ? 68.730  33.819 79.193  1.00 37.36  ? 124  ALA A CA  1 
ATOM   930   C C   . ALA A  1  119 ? 67.676  33.922 78.099  1.00 37.33  ? 124  ALA A C   1 
ATOM   931   O O   . ALA A  1  119 ? 67.991  33.880 76.909  1.00 37.08  ? 124  ALA A O   1 
ATOM   932   C CB  . ALA A  1  119 ? 69.081  35.211 79.708  1.00 37.22  ? 124  ALA A CB  1 
ATOM   933   N N   . VAL A  1  120 ? 66.423  34.070 78.517  1.00 37.19  ? 125  VAL A N   1 
ATOM   934   C CA  . VAL A  1  120 ? 65.312  34.210 77.588  1.00 36.87  ? 125  VAL A CA  1 
ATOM   935   C C   . VAL A  1  120 ? 64.420  35.355 78.045  1.00 36.41  ? 125  VAL A C   1 
ATOM   936   O O   . VAL A  1  120 ? 63.382  35.119 78.650  1.00 36.77  ? 125  VAL A O   1 
ATOM   937   C CB  . VAL A  1  120 ? 64.486  32.919 77.513  1.00 36.96  ? 125  VAL A CB  1 
ATOM   938   C CG1 . VAL A  1  120 ? 63.386  33.049 76.465  1.00 37.23  ? 125  VAL A CG1 1 
ATOM   939   C CG2 . VAL A  1  120 ? 65.388  31.745 77.199  1.00 36.55  ? 125  VAL A CG2 1 
ATOM   940   N N   . TYR A  1  121 ? 64.830  36.590 77.750  1.00 35.97  ? 126  TYR A N   1 
ATOM   941   C CA  . TYR A  1  121 ? 64.079  37.791 78.151  1.00 35.32  ? 126  TYR A CA  1 
ATOM   942   C C   . TYR A  1  121 ? 62.803  38.035 77.356  1.00 35.29  ? 126  TYR A C   1 
ATOM   943   O O   . TYR A  1  121 ? 62.667  37.599 76.208  1.00 35.34  ? 126  TYR A O   1 
ATOM   944   C CB  . TYR A  1  121 ? 64.954  39.047 78.028  1.00 35.17  ? 126  TYR A CB  1 
ATOM   945   C CG  . TYR A  1  121 ? 66.286  38.932 78.725  1.00 34.65  ? 126  TYR A CG  1 
ATOM   946   C CD1 . TYR A  1  121 ? 67.439  38.636 78.008  1.00 34.43  ? 126  TYR A CD1 1 
ATOM   947   C CD2 . TYR A  1  121 ? 66.387  39.090 80.102  1.00 34.21  ? 126  TYR A CD2 1 
ATOM   948   C CE1 . TYR A  1  121 ? 68.661  38.506 78.644  1.00 34.45  ? 126  TYR A CE1 1 
ATOM   949   C CE2 . TYR A  1  121 ? 67.597  38.962 80.747  1.00 34.13  ? 126  TYR A CE2 1 
ATOM   950   C CZ  . TYR A  1  121 ? 68.730  38.668 80.016  1.00 34.18  ? 126  TYR A CZ  1 
ATOM   951   O OH  . TYR A  1  121 ? 69.932  38.539 80.663  1.00 33.69  ? 126  TYR A OH  1 
ATOM   952   N N   . ALA A  1  122 ? 61.882  38.761 77.986  1.00 35.09  ? 127  ALA A N   1 
ATOM   953   C CA  . ALA A  1  122 ? 60.608  39.132 77.387  1.00 34.98  ? 127  ALA A CA  1 
ATOM   954   C C   . ALA A  1  122 ? 60.693  40.587 76.967  1.00 35.03  ? 127  ALA A C   1 
ATOM   955   O O   . ALA A  1  122 ? 61.019  41.458 77.780  1.00 35.14  ? 127  ALA A O   1 
ATOM   956   C CB  . ALA A  1  122 ? 59.478  38.952 78.390  1.00 34.95  ? 127  ALA A CB  1 
ATOM   957   N N   . LEU A  1  123 ? 60.407  40.852 75.698  1.00 34.66  ? 128  LEU A N   1 
ATOM   958   C CA  . LEU A  1  123 ? 60.451  42.207 75.181  1.00 34.64  ? 128  LEU A CA  1 
ATOM   959   C C   . LEU A  1  123 ? 59.118  42.503 74.526  1.00 34.53  ? 128  LEU A C   1 
ATOM   960   O O   . LEU A  1  123 ? 58.490  41.609 73.961  1.00 34.47  ? 128  LEU A O   1 
ATOM   961   C CB  . LEU A  1  123 ? 61.586  42.359 74.165  1.00 34.78  ? 128  LEU A CB  1 
ATOM   962   C CG  . LEU A  1  123 ? 63.016  42.269 74.708  1.00 35.10  ? 128  LEU A CG  1 
ATOM   963   C CD1 . LEU A  1  123 ? 63.299  40.899 75.271  1.00 35.05  ? 128  LEU A CD1 1 
ATOM   964   C CD2 . LEU A  1  123 ? 64.004  42.576 73.602  1.00 35.87  ? 128  LEU A CD2 1 
ATOM   965   N N   . LYS A  1  124 ? 58.675  43.752 74.608  1.00 34.58  ? 129  LYS A N   1 
ATOM   966   C CA  . LYS A  1  124 ? 57.404  44.130 74.005  1.00 34.45  ? 129  LYS A CA  1 
ATOM   967   C C   . LYS A  1  124 ? 57.561  45.363 73.132  1.00 34.17  ? 129  LYS A C   1 
ATOM   968   O O   . LYS A  1  124 ? 58.476  46.158 73.311  1.00 33.80  ? 129  LYS A O   1 
ATOM   969   C CB  . LYS A  1  124 ? 56.338  44.387 75.077  1.00 34.69  ? 129  LYS A CB  1 
ATOM   970   C CG  . LYS A  1  124 ? 56.452  45.744 75.764  1.00 34.88  ? 129  LYS A CG  1 
ATOM   971   C CD  . LYS A  1  124 ? 55.154  46.145 76.469  1.00 35.09  ? 129  LYS A CD  1 
ATOM   972   C CE  . LYS A  1  124 ? 54.029  46.505 75.490  1.00 35.21  ? 129  LYS A CE  1 
ATOM   973   N NZ  . LYS A  1  124 ? 53.404  45.340 74.796  1.00 35.59  ? 129  LYS A NZ  1 
ATOM   974   N N   . ASP A  1  125 ? 56.619  45.502 72.181  1.00 29.89  ? 132  ASP A N   1 
ATOM   975   C CA  . ASP A  1  125 ? 56.509  46.639 71.300  1.00 29.52  ? 132  ASP A CA  1 
ATOM   976   C C   . ASP A  1  125 ? 55.613  47.634 72.022  1.00 30.67  ? 132  ASP A C   1 
ATOM   977   O O   . ASP A  1  125 ? 54.427  47.368 72.191  1.00 31.01  ? 132  ASP A O   1 
ATOM   978   C CB  . ASP A  1  125 ? 55.875  46.172 69.993  1.00 28.71  ? 132  ASP A CB  1 
ATOM   979   C CG  . ASP A  1  125 ? 55.483  47.302 69.088  1.00 26.59  ? 132  ASP A CG  1 
ATOM   980   O OD1 . ASP A  1  125 ? 55.848  48.459 69.352  1.00 23.51  ? 132  ASP A OD1 1 
ATOM   981   O OD2 . ASP A  1  125 ? 54.791  47.095 68.075  1.00 26.21  ? 132  ASP A OD2 1 
ATOM   982   N N   . PRO A  1  126 ? 56.155  48.779 72.445  1.00 31.69  ? 133  PRO A N   1 
ATOM   983   C CA  . PRO A  1  126 ? 55.363  49.774 73.184  1.00 32.33  ? 133  PRO A CA  1 
ATOM   984   C C   . PRO A  1  126 ? 54.225  50.393 72.375  1.00 33.16  ? 133  PRO A C   1 
ATOM   985   O O   . PRO A  1  126 ? 53.341  51.038 72.943  1.00 33.50  ? 133  PRO A O   1 
ATOM   986   C CB  . PRO A  1  126 ? 56.406  50.821 73.570  1.00 32.52  ? 133  PRO A CB  1 
ATOM   987   C CG  . PRO A  1  126 ? 57.423  50.721 72.471  1.00 32.28  ? 133  PRO A CG  1 
ATOM   988   C CD  . PRO A  1  126 ? 57.543  49.239 72.250  1.00 31.77  ? 133  PRO A CD  1 
ATOM   989   N N   . ARG A  1  127 ? 54.234  50.183 71.066  1.00 33.85  ? 134  ARG A N   1 
ATOM   990   C CA  . ARG A  1  127 ? 53.198  50.732 70.210  1.00 34.07  ? 134  ARG A CA  1 
ATOM   991   C C   . ARG A  1  127 ? 52.104  49.710 69.960  1.00 35.89  ? 134  ARG A C   1 
ATOM   992   O O   . ARG A  1  127 ? 50.963  50.063 69.681  1.00 35.97  ? 134  ARG A O   1 
ATOM   993   C CB  . ARG A  1  127 ? 53.809  51.204 68.896  1.00 33.45  ? 134  ARG A CB  1 
ATOM   994   C CG  . ARG A  1  127 ? 54.827  52.335 69.074  1.00 30.05  ? 134  ARG A CG  1 
ATOM   995   C CD  . ARG A  1  127 ? 55.266  52.956 67.755  1.00 25.67  ? 134  ARG A CD  1 
ATOM   996   N NE  . ARG A  1  127 ? 56.125  54.112 67.973  1.00 22.64  ? 134  ARG A NE  1 
ATOM   997   C CZ  . ARG A  1  127 ? 57.433  54.061 68.220  1.00 20.61  ? 134  ARG A CZ  1 
ATOM   998   N NH1 . ARG A  1  127 ? 58.082  52.902 68.272  1.00 18.96  ? 134  ARG A NH1 1 
ATOM   999   N NH2 . ARG A  1  127 ? 58.100  55.188 68.427  1.00 20.11  ? 134  ARG A NH2 1 
ATOM   1000  N N   . SER A  1  128 ? 52.448  48.434 70.061  1.00 38.05  ? 135  SER A N   1 
ATOM   1001  C CA  . SER A  1  128 ? 51.455  47.393 69.869  1.00 39.84  ? 135  SER A CA  1 
ATOM   1002  C C   . SER A  1  128 ? 51.245  46.718 71.204  1.00 41.17  ? 135  SER A C   1 
ATOM   1003  O O   . SER A  1  128 ? 52.158  46.095 71.741  1.00 41.09  ? 135  SER A O   1 
ATOM   1004  C CB  . SER A  1  128 ? 51.904  46.374 68.829  1.00 40.03  ? 135  SER A CB  1 
ATOM   1005  O OG  . SER A  1  128 ? 50.815  45.544 68.451  1.00 40.94  ? 135  SER A OG  1 
ATOM   1006  N N   . GLN A  1  129 ? 50.040  46.858 71.740  1.00 43.10  ? 136  GLN A N   1 
ATOM   1007  C CA  . GLN A  1  129 ? 49.700  46.279 73.031  1.00 44.73  ? 136  GLN A CA  1 
ATOM   1008  C C   . GLN A  1  129 ? 49.597  44.758 72.947  1.00 45.52  ? 136  GLN A C   1 
ATOM   1009  O O   . GLN A  1  129 ? 49.020  44.223 72.000  1.00 45.63  ? 136  GLN A O   1 
ATOM   1010  C CB  . GLN A  1  129 ? 48.382  46.866 73.529  1.00 45.00  ? 136  GLN A CB  1 
ATOM   1011  C CG  . GLN A  1  129 ? 48.170  46.678 75.015  1.00 46.33  ? 136  GLN A CG  1 
ATOM   1012  C CD  . GLN A  1  129 ? 49.301  47.267 75.842  1.00 47.47  ? 136  GLN A CD  1 
ATOM   1013  O OE1 . GLN A  1  129 ? 49.468  46.920 77.012  1.00 47.94  ? 136  GLN A OE1 1 
ATOM   1014  N NE2 . GLN A  1  129 ? 50.077  48.162 75.238  1.00 48.25  ? 136  GLN A NE2 1 
ATOM   1015  N N   . ASP A  1  130 ? 50.169  44.068 73.930  1.00 46.51  ? 137  ASP A N   1 
ATOM   1016  C CA  . ASP A  1  130 ? 50.131  42.611 73.964  1.00 47.29  ? 137  ASP A CA  1 
ATOM   1017  C C   . ASP A  1  130 ? 50.860  42.021 72.756  1.00 47.02  ? 137  ASP A C   1 
ATOM   1018  O O   . ASP A  1  130 ? 50.381  41.072 72.130  1.00 47.42  ? 137  ASP A O   1 
ATOM   1019  C CB  . ASP A  1  130 ? 48.676  42.140 73.973  1.00 47.90  ? 137  ASP A CB  1 
ATOM   1020  C CG  . ASP A  1  130 ? 48.532  40.665 74.278  1.00 49.33  ? 137  ASP A CG  1 
ATOM   1021  O OD1 . ASP A  1  130 ? 49.511  39.901 74.123  1.00 51.33  ? 137  ASP A OD1 1 
ATOM   1022  O OD2 . ASP A  1  130 ? 47.446  40.197 74.670  1.00 51.33  ? 137  ASP A OD2 1 
ATOM   1023  N N   . SER A  1  131 ? 52.014  42.590 72.427  1.00 46.44  ? 138  SER A N   1 
ATOM   1024  C CA  . SER A  1  131 ? 52.813  42.127 71.295  1.00 45.82  ? 138  SER A CA  1 
ATOM   1025  C C   . SER A  1  131 ? 53.946  41.207 71.771  1.00 45.18  ? 138  SER A C   1 
ATOM   1026  O O   . SER A  1  131 ? 54.961  41.687 72.277  1.00 44.97  ? 138  SER A O   1 
ATOM   1027  C CB  . SER A  1  131 ? 53.400  43.335 70.582  1.00 45.79  ? 138  SER A CB  1 
ATOM   1028  O OG  . SER A  1  131 ? 54.127  44.122 71.509  1.00 46.12  ? 138  SER A OG  1 
ATOM   1029  N N   . THR A  1  132 ? 53.776  39.893 71.602  1.00 44.39  ? 139  THR A N   1 
ATOM   1030  C CA  . THR A  1  132 ? 54.776  38.912 72.067  1.00 43.64  ? 139  THR A CA  1 
ATOM   1031  C C   . THR A  1  132 ? 56.091  38.932 71.302  1.00 42.29  ? 139  THR A C   1 
ATOM   1032  O O   . THR A  1  132 ? 56.177  39.484 70.206  1.00 42.70  ? 139  THR A O   1 
ATOM   1033  C CB  . THR A  1  132 ? 54.197  37.462 72.080  1.00 43.99  ? 139  THR A CB  1 
ATOM   1034  O OG1 . THR A  1  132 ? 55.175  36.549 72.608  1.00 43.97  ? 139  THR A OG1 1 
ATOM   1035  C CG2 . THR A  1  132 ? 53.873  36.963 70.665  1.00 44.46  ? 139  THR A CG2 1 
ATOM   1036  N N   . LEU A  1  133 ? 57.110  38.333 71.919  1.00 40.63  ? 140  LEU A N   1 
ATOM   1037  C CA  . LEU A  1  133 ? 58.456  38.209 71.358  1.00 38.78  ? 140  LEU A CA  1 
ATOM   1038  C C   . LEU A  1  133 ? 59.474  37.909 72.468  1.00 38.55  ? 140  LEU A C   1 
ATOM   1039  O O   . LEU A  1  133 ? 59.676  38.719 73.372  1.00 37.73  ? 140  LEU A O   1 
ATOM   1040  C CB  . LEU A  1  133 ? 58.845  39.474 70.598  1.00 37.94  ? 140  LEU A CB  1 
ATOM   1041  C CG  . LEU A  1  133 ? 60.265  39.553 70.053  1.00 35.20  ? 140  LEU A CG  1 
ATOM   1042  C CD1 . LEU A  1  133 ? 60.270  40.393 68.789  1.00 33.81  ? 140  LEU A CD1 1 
ATOM   1043  C CD2 . LEU A  1  133 ? 61.198  40.122 71.094  1.00 33.04  ? 140  LEU A CD2 1 
ATOM   1044  N N   . CYS A  1  134 ? 60.108  36.740 72.393  1.00 38.50  ? 141  CYS A N   1 
ATOM   1045  C CA  . CYS A  1  134 ? 61.110  36.328 73.379  1.00 38.62  ? 141  CYS A CA  1 
ATOM   1046  C C   . CYS A  1  134 ? 62.521  36.329 72.801  1.00 37.28  ? 141  CYS A C   1 
ATOM   1047  O O   . CYS A  1  134 ? 62.740  35.892 71.674  1.00 37.19  ? 141  CYS A O   1 
ATOM   1048  C CB  . CYS A  1  134 ? 60.793  34.930 73.885  1.00 39.53  ? 141  CYS A CB  1 
ATOM   1049  S SG  . CYS A  1  134 ? 59.136  34.779 74.573  1.00 43.23  ? 141  CYS A SG  1 
ATOM   1050  N N   . LEU A  1  135 ? 63.478  36.804 73.593  1.00 36.01  ? 142  LEU A N   1 
ATOM   1051  C CA  . LEU A  1  135 ? 64.874  36.877 73.174  1.00 34.66  ? 142  LEU A CA  1 
ATOM   1052  C C   . LEU A  1  135 ? 65.733  35.883 73.937  1.00 34.07  ? 142  LEU A C   1 
ATOM   1053  O O   . LEU A  1  135 ? 65.968  36.064 75.137  1.00 33.88  ? 142  LEU A O   1 
ATOM   1054  C CB  . LEU A  1  135 ? 65.417  38.291 73.413  1.00 34.33  ? 142  LEU A CB  1 
ATOM   1055  C CG  . LEU A  1  135 ? 66.923  38.491 73.250  1.00 33.72  ? 142  LEU A CG  1 
ATOM   1056  C CD1 . LEU A  1  135 ? 67.297  38.547 71.779  1.00 33.24  ? 142  LEU A CD1 1 
ATOM   1057  C CD2 . LEU A  1  135 ? 67.341  39.768 73.950  1.00 32.83  ? 142  LEU A CD2 1 
ATOM   1058  N N   . PHE A  1  136 ? 66.189  34.840 73.236  1.00 32.98  ? 143  PHE A N   1 
ATOM   1059  C CA  . PHE A  1  136 ? 67.073  33.814 73.794  1.00 31.69  ? 143  PHE A CA  1 
ATOM   1060  C C   . PHE A  1  136 ? 68.480  34.284 73.476  1.00 30.39  ? 143  PHE A C   1 
ATOM   1061  O O   . PHE A  1  136 ? 68.848  34.347 72.317  1.00 30.13  ? 143  PHE A O   1 
ATOM   1062  C CB  . PHE A  1  136 ? 66.820  32.463 73.104  1.00 31.91  ? 143  PHE A CB  1 
ATOM   1063  C CG  . PHE A  1  136 ? 67.624  31.302 73.665  1.00 32.28  ? 143  PHE A CG  1 
ATOM   1064  C CD1 . PHE A  1  136 ? 67.749  30.124 72.937  1.00 32.57  ? 143  PHE A CD1 1 
ATOM   1065  C CD2 . PHE A  1  136 ? 68.221  31.369 74.922  1.00 32.72  ? 143  PHE A CD2 1 
ATOM   1066  C CE1 . PHE A  1  136 ? 68.454  29.037 73.443  1.00 32.40  ? 143  PHE A CE1 1 
ATOM   1067  C CE2 . PHE A  1  136 ? 68.934  30.281 75.437  1.00 32.64  ? 143  PHE A CE2 1 
ATOM   1068  C CZ  . PHE A  1  136 ? 69.049  29.117 74.695  1.00 33.02  ? 143  PHE A CZ  1 
ATOM   1069  N N   . THR A  1  137 ? 69.269  34.626 74.483  1.00 29.47  ? 144  THR A N   1 
ATOM   1070  C CA  . THR A  1  137 ? 70.616  35.118 74.224  1.00 28.91  ? 144  THR A CA  1 
ATOM   1071  C C   . THR A  1  137 ? 71.656  34.688 75.254  1.00 29.04  ? 144  THR A C   1 
ATOM   1072  O O   . THR A  1  137 ? 71.326  34.234 76.355  1.00 28.83  ? 144  THR A O   1 
ATOM   1073  C CB  . THR A  1  137 ? 70.605  36.656 74.139  1.00 28.69  ? 144  THR A CB  1 
ATOM   1074  O OG1 . THR A  1  137 ? 71.903  37.139 73.782  1.00 29.18  ? 144  THR A OG1 1 
ATOM   1075  C CG2 . THR A  1  137 ? 70.322  37.259 75.489  1.00 28.16  ? 144  THR A CG2 1 
ATOM   1076  N N   . ASP A  1  138 ? 72.922  34.841 74.864  1.00 28.99  ? 145  ASP A N   1 
ATOM   1077  C CA  . ASP A  1  138 ? 74.060  34.529 75.710  1.00 29.30  ? 145  ASP A CA  1 
ATOM   1078  C C   . ASP A  1  138 ? 74.286  33.042 75.957  1.00 29.90  ? 145  ASP A C   1 
ATOM   1079  O O   . ASP A  1  138 ? 75.001  32.665 76.888  1.00 29.82  ? 145  ASP A O   1 
ATOM   1080  C CB  . ASP A  1  138 ? 73.938  35.269 77.030  1.00 29.22  ? 145  ASP A CB  1 
ATOM   1081  C CG  . ASP A  1  138 ? 74.017  36.762 76.856  1.00 29.38  ? 145  ASP A CG  1 
ATOM   1082  O OD1 . ASP A  1  138 ? 74.958  37.225 76.180  1.00 28.85  ? 145  ASP A OD1 1 
ATOM   1083  O OD2 . ASP A  1  138 ? 73.176  37.536 77.364  1.00 30.51  ? 145  ASP A OD2 1 
ATOM   1084  N N   . PHE A  1  139 ? 73.701  32.199 75.115  1.00 30.42  ? 146  PHE A N   1 
ATOM   1085  C CA  . PHE A  1  139 ? 73.884  30.764 75.249  1.00 31.11  ? 146  PHE A CA  1 
ATOM   1086  C C   . PHE A  1  139 ? 75.147  30.252 74.551  1.00 32.28  ? 146  PHE A C   1 
ATOM   1087  O O   . PHE A  1  139 ? 75.880  31.011 73.911  1.00 32.14  ? 146  PHE A O   1 
ATOM   1088  C CB  . PHE A  1  139 ? 72.669  30.018 74.722  1.00 31.05  ? 146  PHE A CB  1 
ATOM   1089  C CG  . PHE A  1  139 ? 72.276  30.371 73.310  1.00 30.72  ? 146  PHE A CG  1 
ATOM   1090  C CD1 . PHE A  1  139 ? 72.592  29.521 72.256  1.00 29.54  ? 146  PHE A CD1 1 
ATOM   1091  C CD2 . PHE A  1  139 ? 71.525  31.509 73.049  1.00 29.86  ? 146  PHE A CD2 1 
ATOM   1092  C CE1 . PHE A  1  139 ? 72.191  29.806 70.971  1.00 29.20  ? 146  PHE A CE1 1 
ATOM   1093  C CE2 . PHE A  1  139 ? 71.123  31.807 71.758  1.00 30.53  ? 146  PHE A CE2 1 
ATOM   1094  C CZ  . PHE A  1  139 ? 71.458  30.951 70.714  1.00 30.27  ? 146  PHE A CZ  1 
ATOM   1095  N N   . ASP A  1  140 ? 75.376  28.950 74.690  1.00 33.54  ? 147  ASP A N   1 
ATOM   1096  C CA  . ASP A  1  140 ? 76.532  28.276 74.127  1.00 34.88  ? 147  ASP A CA  1 
ATOM   1097  C C   . ASP A  1  140 ? 76.363  28.104 72.626  1.00 35.27  ? 147  ASP A C   1 
ATOM   1098  O O   . ASP A  1  140 ? 75.245  27.954 72.141  1.00 34.60  ? 147  ASP A O   1 
ATOM   1099  C CB  . ASP A  1  140 ? 76.680  26.910 74.797  1.00 35.84  ? 147  ASP A CB  1 
ATOM   1100  C CG  . ASP A  1  140 ? 78.065  26.340 74.659  1.00 38.05  ? 147  ASP A CG  1 
ATOM   1101  O OD1 . ASP A  1  140 ? 79.033  26.995 75.109  1.00 41.37  ? 147  ASP A OD1 1 
ATOM   1102  O OD2 . ASP A  1  140 ? 78.260  25.234 74.113  1.00 40.26  ? 147  ASP A OD2 1 
ATOM   1103  N N   . SER A  1  141 ? 77.479  28.121 71.899  1.00 36.31  ? 148  SER A N   1 
ATOM   1104  C CA  . SER A  1  141 ? 77.471  27.973 70.447  1.00 37.27  ? 148  SER A CA  1 
ATOM   1105  C C   . SER A  1  141 ? 77.309  26.510 70.060  1.00 38.63  ? 148  SER A C   1 
ATOM   1106  O O   . SER A  1  141 ? 76.963  26.177 68.926  1.00 38.66  ? 148  SER A O   1 
ATOM   1107  C CB  . SER A  1  141 ? 78.778  28.498 69.850  1.00 37.28  ? 148  SER A CB  1 
ATOM   1108  O OG  . SER A  1  141 ? 78.945  29.884 70.073  1.00 37.05  ? 148  SER A OG  1 
ATOM   1109  N N   . GLN A  1  142 ? 77.577  25.637 71.016  1.00 40.42  ? 149  GLN A N   1 
ATOM   1110  C CA  . GLN A  1  142 ? 77.498  24.207 70.795  1.00 42.10  ? 149  GLN A CA  1 
ATOM   1111  C C   . GLN A  1  142 ? 76.078  23.714 70.972  1.00 43.28  ? 149  GLN A C   1 
ATOM   1112  O O   . GLN A  1  142 ? 75.598  22.872 70.220  1.00 43.41  ? 149  GLN A O   1 
ATOM   1113  C CB  . GLN A  1  142 ? 78.420  23.496 71.779  1.00 42.32  ? 149  GLN A CB  1 
ATOM   1114  C CG  . GLN A  1  142 ? 79.881  23.893 71.618  1.00 42.99  ? 149  GLN A CG  1 
ATOM   1115  C CD  . GLN A  1  142 ? 80.512  23.277 70.389  1.00 43.54  ? 149  GLN A CD  1 
ATOM   1116  O OE1 . GLN A  1  142 ? 80.880  23.980 69.449  1.00 44.14  ? 149  GLN A OE1 1 
ATOM   1117  N NE2 . GLN A  1  142 ? 80.640  21.959 70.393  1.00 43.82  ? 149  GLN A NE2 1 
ATOM   1118  N N   . ILE A  1  143 ? 75.408  24.251 71.981  1.00 44.90  ? 150  ILE A N   1 
ATOM   1119  C CA  . ILE A  1  143 ? 74.046  23.861 72.294  1.00 45.99  ? 150  ILE A CA  1 
ATOM   1120  C C   . ILE A  1  143 ? 73.141  24.034 71.063  1.00 47.53  ? 150  ILE A C   1 
ATOM   1121  O O   . ILE A  1  143 ? 73.534  24.675 70.095  1.00 47.75  ? 150  ILE A O   1 
ATOM   1122  C CB  . ILE A  1  143 ? 73.565  24.689 73.494  1.00 45.77  ? 150  ILE A CB  1 
ATOM   1123  C CG1 . ILE A  1  143 ? 72.686  23.831 74.405  1.00 44.96  ? 150  ILE A CG1 1 
ATOM   1124  C CG2 . ILE A  1  143 ? 72.906  25.973 73.017  1.00 45.48  ? 150  ILE A CG2 1 
ATOM   1125  C CD1 . ILE A  1  143 ? 73.409  22.639 74.999  1.00 44.34  ? 150  ILE A CD1 1 
ATOM   1126  N N   . ASN A  1  144 ? 71.943  23.452 71.087  1.00 49.53  ? 151  ASN A N   1 
ATOM   1127  C CA  . ASN A  1  144 ? 71.033  23.536 69.934  1.00 51.24  ? 151  ASN A CA  1 
ATOM   1128  C C   . ASN A  1  144 ? 69.718  24.263 70.191  1.00 52.56  ? 151  ASN A C   1 
ATOM   1129  O O   . ASN A  1  144 ? 68.933  23.873 71.051  1.00 52.53  ? 151  ASN A O   1 
ATOM   1130  C CB  . ASN A  1  144 ? 70.718  22.141 69.396  1.00 51.50  ? 151  ASN A CB  1 
ATOM   1131  C CG  . ASN A  1  144 ? 71.902  21.499 68.707  1.00 52.08  ? 151  ASN A CG  1 
ATOM   1132  O OD1 . ASN A  1  144 ? 72.389  21.995 67.687  1.00 52.76  ? 151  ASN A OD1 1 
ATOM   1133  N ND2 . ASN A  1  144 ? 72.371  20.384 69.257  1.00 52.64  ? 151  ASN A ND2 1 
ATOM   1134  N N   . VAL A  1  145 ? 69.479  25.309 69.411  1.00 54.29  ? 152  VAL A N   1 
ATOM   1135  C CA  . VAL A  1  145 ? 68.264  26.105 69.516  1.00 55.83  ? 152  VAL A CA  1 
ATOM   1136  C C   . VAL A  1  145 ? 67.096  25.410 68.821  1.00 57.12  ? 152  VAL A C   1 
ATOM   1137  O O   . VAL A  1  145 ? 67.148  25.162 67.618  1.00 57.23  ? 152  VAL A O   1 
ATOM   1138  C CB  . VAL A  1  145 ? 68.468  27.480 68.866  1.00 55.88  ? 152  VAL A CB  1 
ATOM   1139  C CG1 . VAL A  1  145 ? 67.228  28.336 69.033  1.00 56.35  ? 152  VAL A CG1 1 
ATOM   1140  C CG2 . VAL A  1  145 ? 69.683  28.163 69.466  1.00 56.05  ? 152  VAL A CG2 1 
ATOM   1141  N N   . PRO A  1  146 ? 66.028  25.122 69.564  1.00 58.81  ? 153  PRO A N   1 
ATOM   1142  C CA  . PRO A  1  146 ? 64.856  24.439 69.006  1.00 60.09  ? 153  PRO A CA  1 
ATOM   1143  C C   . PRO A  1  146 ? 64.152  25.270 67.931  1.00 61.43  ? 153  PRO A C   1 
ATOM   1144  O O   . PRO A  1  146 ? 64.347  26.485 67.859  1.00 61.29  ? 153  PRO A O   1 
ATOM   1145  C CB  . PRO A  1  146 ? 63.963  24.251 70.233  1.00 60.04  ? 153  PRO A CB  1 
ATOM   1146  C CG  . PRO A  1  146 ? 64.315  25.409 71.090  1.00 59.51  ? 153  PRO A CG  1 
ATOM   1147  C CD  . PRO A  1  146 ? 65.818  25.457 70.982  1.00 58.98  ? 153  PRO A CD  1 
ATOM   1148  N N   . LYS A  1  147 ? 63.356  24.606 67.098  1.00 63.02  ? 154  LYS A N   1 
ATOM   1149  C CA  . LYS A  1  147 ? 62.630  25.280 66.026  1.00 64.48  ? 154  LYS A CA  1 
ATOM   1150  C C   . LYS A  1  147 ? 61.124  25.088 66.183  1.00 65.63  ? 154  LYS A C   1 
ATOM   1151  O O   . LYS A  1  147 ? 60.669  24.476 67.148  1.00 65.61  ? 154  LYS A O   1 
ATOM   1152  C CB  . LYS A  1  147 ? 63.105  24.779 64.660  1.00 64.60  ? 154  LYS A CB  1 
ATOM   1153  C CG  . LYS A  1  147 ? 63.188  23.268 64.523  1.00 65.04  ? 154  LYS A CG  1 
ATOM   1154  C CD  . LYS A  1  147 ? 64.062  22.870 63.339  1.00 65.15  ? 154  LYS A CD  1 
ATOM   1155  C CE  . LYS A  1  147 ? 65.497  23.360 63.518  1.00 65.14  ? 154  LYS A CE  1 
ATOM   1156  N NZ  . LYS A  1  147 ? 66.421  22.857 62.463  1.00 64.97  ? 154  LYS A NZ  1 
ATOM   1157  N N   . THR A  1  148 ? 60.352  25.624 65.242  1.00 67.17  ? 155  THR A N   1 
ATOM   1158  C CA  . THR A  1  148 ? 58.892  25.523 65.301  1.00 68.36  ? 155  THR A CA  1 
ATOM   1159  C C   . THR A  1  148 ? 58.385  24.208 64.732  1.00 68.89  ? 155  THR A C   1 
ATOM   1160  O O   . THR A  1  148 ? 58.908  23.710 63.736  1.00 69.16  ? 155  THR A O   1 
ATOM   1161  C CB  . THR A  1  148 ? 58.216  26.694 64.565  1.00 68.58  ? 155  THR A CB  1 
ATOM   1162  O OG1 . THR A  1  148 ? 56.917  26.286 64.110  1.00 69.15  ? 155  THR A OG1 1 
ATOM   1163  C CG2 . THR A  1  148 ? 58.996  27.091 63.313  1.00 69.12  ? 155  THR A CG2 1 
ATOM   1164  N N   . MET A  1  149 ? 57.357  23.657 65.373  1.00 69.48  ? 156  MET A N   1 
ATOM   1165  C CA  . MET A  1  149 ? 56.776  22.382 64.961  1.00 69.80  ? 156  MET A CA  1 
ATOM   1166  C C   . MET A  1  149 ? 55.333  22.511 64.466  1.00 69.44  ? 156  MET A C   1 
ATOM   1167  O O   . MET A  1  149 ? 54.573  21.541 64.508  1.00 69.63  ? 156  MET A O   1 
ATOM   1168  C CB  . MET A  1  149 ? 56.838  21.380 66.118  1.00 70.20  ? 156  MET A CB  1 
ATOM   1169  C CG  . MET A  1  149 ? 55.889  21.678 67.272  1.00 71.11  ? 156  MET A CG  1 
ATOM   1170  S SD  . MET A  1  149 ? 55.784  23.427 67.700  1.00 72.24  ? 156  MET A SD  1 
ATOM   1171  C CE  . MET A  1  149 ? 57.139  23.608 68.862  1.00 72.95  ? 156  MET A CE  1 
ATOM   1172  N N   . GLU A  1  150 ? 54.959  23.702 64.003  1.00 68.77  ? 157  GLU A N   1 
ATOM   1173  C CA  . GLU A  1  150 ? 53.615  23.932 63.476  1.00 68.09  ? 157  GLU A CA  1 
ATOM   1174  C C   . GLU A  1  150 ? 53.527  25.319 62.844  1.00 67.06  ? 157  GLU A C   1 
ATOM   1175  O O   . GLU A  1  150 ? 54.531  26.024 62.743  1.00 67.07  ? 157  GLU A O   1 
ATOM   1176  C CB  . GLU A  1  150 ? 52.558  23.781 64.580  1.00 68.29  ? 157  GLU A CB  1 
ATOM   1177  C CG  . GLU A  1  150 ? 52.375  24.989 65.489  1.00 68.80  ? 157  GLU A CG  1 
ATOM   1178  C CD  . GLU A  1  150 ? 53.586  25.270 66.346  1.00 69.56  ? 157  GLU A CD  1 
ATOM   1179  O OE1 . GLU A  1  150 ? 54.623  25.686 65.788  1.00 69.86  ? 157  GLU A OE1 1 
ATOM   1180  O OE2 . GLU A  1  150 ? 53.499  25.074 67.578  1.00 69.91  ? 157  GLU A OE2 1 
ATOM   1181  N N   . SER A  1  151 ? 52.326  25.698 62.412  1.00 65.78  ? 158  SER A N   1 
ATOM   1182  C CA  . SER A  1  151 ? 52.093  27.010 61.815  1.00 64.59  ? 158  SER A CA  1 
ATOM   1183  C C   . SER A  1  151 ? 51.772  28.000 62.926  1.00 63.18  ? 158  SER A C   1 
ATOM   1184  O O   . SER A  1  151 ? 51.613  27.609 64.080  1.00 62.97  ? 158  SER A O   1 
ATOM   1185  C CB  . SER A  1  151 ? 50.927  26.961 60.820  1.00 64.76  ? 158  SER A CB  1 
ATOM   1186  O OG  . SER A  1  151 ? 51.219  26.129 59.710  1.00 65.04  ? 158  SER A OG  1 
ATOM   1187  N N   . GLY A  1  152 ? 51.682  29.281 62.584  1.00 61.49  ? 159  GLY A N   1 
ATOM   1188  C CA  . GLY A  1  152 ? 51.370  30.303 63.571  1.00 59.94  ? 159  GLY A CA  1 
ATOM   1189  C C   . GLY A  1  152 ? 52.539  30.716 64.452  1.00 58.47  ? 159  GLY A C   1 
ATOM   1190  O O   . GLY A  1  152 ? 52.668  31.893 64.794  1.00 58.13  ? 159  GLY A O   1 
ATOM   1191  N N   . THR A  1  153 ? 53.382  29.755 64.830  1.00 56.73  ? 160  THR A N   1 
ATOM   1192  C CA  . THR A  1  153 ? 54.547  30.036 65.670  1.00 55.37  ? 160  THR A CA  1 
ATOM   1193  C C   . THR A  1  153 ? 55.817  30.224 64.837  1.00 53.85  ? 160  THR A C   1 
ATOM   1194  O O   . THR A  1  153 ? 55.913  29.722 63.714  1.00 53.76  ? 160  THR A O   1 
ATOM   1195  C CB  . THR A  1  153 ? 54.771  28.900 66.677  1.00 55.32  ? 160  THR A CB  1 
ATOM   1196  O OG1 . THR A  1  153 ? 53.628  28.773 67.532  1.00 55.55  ? 160  THR A OG1 1 
ATOM   1197  C CG2 . THR A  1  153 ? 55.947  29.222 67.600  1.00 55.35  ? 160  THR A CG2 1 
ATOM   1198  N N   . PHE A  1  154 ? 56.789  30.945 65.393  1.00 52.03  ? 161  PHE A N   1 
ATOM   1199  C CA  . PHE A  1  154 ? 58.045  31.197 64.692  1.00 50.48  ? 161  PHE A CA  1 
ATOM   1200  C C   . PHE A  1  154 ? 59.228  31.427 65.630  1.00 48.82  ? 161  PHE A C   1 
ATOM   1201  O O   . PHE A  1  154 ? 59.108  32.093 66.660  1.00 48.62  ? 161  PHE A O   1 
ATOM   1202  C CB  . PHE A  1  154 ? 57.904  32.408 63.758  1.00 50.56  ? 161  PHE A CB  1 
ATOM   1203  C CG  . PHE A  1  154 ? 58.444  32.157 62.382  1.00 50.78  ? 161  PHE A CG  1 
ATOM   1204  C CD1 . PHE A  1  154 ? 59.803  31.958 62.182  1.00 51.38  ? 161  PHE A CD1 1 
ATOM   1205  C CD2 . PHE A  1  154 ? 57.587  32.060 61.297  1.00 51.22  ? 161  PHE A CD2 1 
ATOM   1206  C CE1 . PHE A  1  154 ? 60.303  31.681 60.917  1.00 51.33  ? 161  PHE A CE1 1 
ATOM   1207  C CE2 . PHE A  1  154 ? 58.076  31.783 60.026  1.00 51.41  ? 161  PHE A CE2 1 
ATOM   1208  C CZ  . PHE A  1  154 ? 59.438  31.592 59.836  1.00 51.46  ? 161  PHE A CZ  1 
ATOM   1209  N N   . ILE A  1  155 ? 60.372  30.865 65.252  1.00 46.70  ? 162  ILE A N   1 
ATOM   1210  C CA  . ILE A  1  155 ? 61.611  31.024 65.997  1.00 44.77  ? 162  ILE A CA  1 
ATOM   1211  C C   . ILE A  1  155 ? 62.677  31.252 64.952  1.00 42.94  ? 162  ILE A C   1 
ATOM   1212  O O   . ILE A  1  155 ? 62.601  30.701 63.857  1.00 42.62  ? 162  ILE A O   1 
ATOM   1213  C CB  . ILE A  1  155 ? 61.964  29.771 66.803  1.00 44.84  ? 162  ILE A CB  1 
ATOM   1214  C CG1 . ILE A  1  155 ? 60.728  29.235 67.523  1.00 44.79  ? 162  ILE A CG1 1 
ATOM   1215  C CG2 . ILE A  1  155 ? 63.072  30.089 67.792  1.00 44.57  ? 162  ILE A CG2 1 
ATOM   1216  C CD1 . ILE A  1  155 ? 60.881  27.820 68.023  1.00 44.59  ? 162  ILE A CD1 1 
ATOM   1217  N N   . THR A  1  156 ? 63.670  32.064 65.277  1.00 40.87  ? 163  THR A N   1 
ATOM   1218  C CA  . THR A  1  156 ? 64.736  32.345 64.327  1.00 38.97  ? 163  THR A CA  1 
ATOM   1219  C C   . THR A  1  156 ? 65.940  31.445 64.575  1.00 37.24  ? 163  THR A C   1 
ATOM   1220  O O   . THR A  1  156 ? 66.175  31.007 65.702  1.00 37.02  ? 163  THR A O   1 
ATOM   1221  C CB  . THR A  1  156 ? 65.173  33.811 64.428  1.00 38.96  ? 163  THR A CB  1 
ATOM   1222  O OG1 . THR A  1  156 ? 65.418  34.152 65.801  1.00 38.51  ? 163  THR A OG1 1 
ATOM   1223  C CG2 . THR A  1  156 ? 64.065  34.742 63.958  1.00 38.93  ? 163  THR A CG2 1 
ATOM   1224  N N   . ASP A  1  157 ? 66.703  31.173 63.519  1.00 35.00  ? 164  ASP A N   1 
ATOM   1225  C CA  . ASP A  1  157 ? 67.911  30.377 63.653  1.00 33.20  ? 164  ASP A CA  1 
ATOM   1226  C C   . ASP A  1  157 ? 68.915  31.184 64.461  1.00 31.77  ? 164  ASP A C   1 
ATOM   1227  O O   . ASP A  1  157 ? 68.774  32.392 64.614  1.00 31.52  ? 164  ASP A O   1 
ATOM   1228  C CB  . ASP A  1  157 ? 68.519  30.061 62.288  1.00 33.27  ? 164  ASP A CB  1 
ATOM   1229  C CG  . ASP A  1  157 ? 67.658  29.146 61.462  1.00 33.02  ? 164  ASP A CG  1 
ATOM   1230  O OD1 . ASP A  1  157 ? 67.054  28.213 62.036  1.00 33.69  ? 164  ASP A OD1 1 
ATOM   1231  O OD2 . ASP A  1  157 ? 67.547  29.303 60.230  1.00 31.87  ? 164  ASP A OD2 1 
ATOM   1232  N N   . ALA A  1  158 ? 69.939  30.521 64.972  1.00 30.21  ? 165  ALA A N   1 
ATOM   1233  C CA  . ALA A  1  158 ? 70.954  31.220 65.728  1.00 28.70  ? 165  ALA A CA  1 
ATOM   1234  C C   . ALA A  1  158 ? 71.483  32.329 64.837  1.00 27.41  ? 165  ALA A C   1 
ATOM   1235  O O   . ALA A  1  158 ? 71.383  32.245 63.613  1.00 27.72  ? 165  ALA A O   1 
ATOM   1236  C CB  . ALA A  1  158 ? 72.090  30.263 66.121  1.00 28.74  ? 165  ALA A CB  1 
ATOM   1237  N N   . THR A  1  159 ? 72.010  33.380 65.451  1.00 25.64  ? 166  THR A N   1 
ATOM   1238  C CA  . THR A  1  159 ? 72.650  34.476 64.732  1.00 24.01  ? 166  THR A CA  1 
ATOM   1239  C C   . THR A  1  159 ? 73.660  34.987 65.743  1.00 23.23  ? 166  THR A C   1 
ATOM   1240  O O   . THR A  1  159 ? 73.408  34.920 66.953  1.00 22.31  ? 166  THR A O   1 
ATOM   1241  C CB  . THR A  1  159 ? 71.702  35.622 64.381  1.00 23.28  ? 166  THR A CB  1 
ATOM   1242  O OG1 . THR A  1  159 ? 71.488  36.424 65.549  1.00 24.21  ? 166  THR A OG1 1 
ATOM   1243  C CG2 . THR A  1  159 ? 70.350  35.112 63.953  1.00 22.67  ? 166  THR A CG2 1 
ATOM   1244  N N   . VAL A  1  160 ? 74.793  35.476 65.255  1.00 22.46  ? 167  VAL A N   1 
ATOM   1245  C CA  . VAL A  1  160 ? 75.850  35.975 66.124  1.00 22.40  ? 167  VAL A CA  1 
ATOM   1246  C C   . VAL A  1  160 ? 75.884  37.476 66.061  1.00 22.42  ? 167  VAL A C   1 
ATOM   1247  O O   . VAL A  1  160 ? 75.672  38.049 65.013  1.00 22.65  ? 167  VAL A O   1 
ATOM   1248  C CB  . VAL A  1  160 ? 77.248  35.467 65.689  1.00 22.06  ? 167  VAL A CB  1 
ATOM   1249  C CG1 . VAL A  1  160 ? 78.298  35.848 66.717  1.00 21.69  ? 167  VAL A CG1 1 
ATOM   1250  C CG2 . VAL A  1  160 ? 77.231  33.964 65.501  1.00 22.07  ? 167  VAL A CG2 1 
ATOM   1251  N N   . LEU A  1  161 ? 76.160  38.103 67.190  1.00 23.30  ? 168  LEU A N   1 
ATOM   1252  C CA  . LEU A  1  161 ? 76.263  39.545 67.262  1.00 24.42  ? 168  LEU A CA  1 
ATOM   1253  C C   . LEU A  1  161 ? 77.574  39.835 67.968  1.00 25.84  ? 168  LEU A C   1 
ATOM   1254  O O   . LEU A  1  161 ? 77.988  39.083 68.840  1.00 25.77  ? 168  LEU A O   1 
ATOM   1255  C CB  . LEU A  1  161 ? 75.069  40.119 68.029  1.00 24.40  ? 168  LEU A CB  1 
ATOM   1256  C CG  . LEU A  1  161 ? 75.099  41.581 68.459  1.00 23.99  ? 168  LEU A CG  1 
ATOM   1257  C CD1 . LEU A  1  161 ? 73.687  42.103 68.571  1.00 23.94  ? 168  LEU A CD1 1 
ATOM   1258  C CD2 . LEU A  1  161 ? 75.818  41.718 69.784  1.00 24.18  ? 168  LEU A CD2 1 
ATOM   1259  N N   . ASP A  1  162 ? 78.236  40.921 67.598  1.00 27.87  ? 169  ASP A N   1 
ATOM   1260  C CA  . ASP A  1  162 ? 79.515  41.246 68.210  1.00 29.36  ? 169  ASP A CA  1 
ATOM   1261  C C   . ASP A  1  162 ? 79.655  42.738 68.507  1.00 31.10  ? 169  ASP A C   1 
ATOM   1262  O O   . ASP A  1  162 ? 79.563  43.575 67.611  1.00 31.26  ? 169  ASP A O   1 
ATOM   1263  C CB  . ASP A  1  162 ? 80.641  40.753 67.303  1.00 29.20  ? 169  ASP A CB  1 
ATOM   1264  C CG  . ASP A  1  162 ? 81.988  41.291 67.699  1.00 29.58  ? 169  ASP A CG  1 
ATOM   1265  O OD1 . ASP A  1  162 ? 82.464  41.005 68.822  1.00 28.27  ? 169  ASP A OD1 1 
ATOM   1266  O OD2 . ASP A  1  162 ? 82.631  42.017 66.917  1.00 31.35  ? 169  ASP A OD2 1 
ATOM   1267  N N   . MET A  1  163 ? 79.878  43.052 69.781  1.00 33.67  ? 170  MET A N   1 
ATOM   1268  C CA  . MET A  1  163 ? 80.032  44.427 70.252  1.00 35.69  ? 170  MET A CA  1 
ATOM   1269  C C   . MET A  1  163 ? 81.504  44.801 70.315  1.00 37.94  ? 170  MET A C   1 
ATOM   1270  O O   . MET A  1  163 ? 82.336  43.974 70.664  1.00 38.39  ? 170  MET A O   1 
ATOM   1271  C CB  . MET A  1  163 ? 79.433  44.570 71.649  1.00 35.31  ? 170  MET A CB  1 
ATOM   1272  C CG  . MET A  1  163 ? 77.996  44.111 71.772  1.00 34.81  ? 170  MET A CG  1 
ATOM   1273  S SD  . MET A  1  163 ? 77.425  44.207 73.477  1.00 32.60  ? 170  MET A SD  1 
ATOM   1274  C CE  . MET A  1  163 ? 77.352  45.961 73.653  1.00 33.01  ? 170  MET A CE  1 
ATOM   1275  N N   . LYS A  1  164 ? 81.819  46.056 70.005  1.00 40.86  ? 171  LYS A N   1 
ATOM   1276  C CA  . LYS A  1  164 ? 83.206  46.537 70.019  1.00 43.16  ? 171  LYS A CA  1 
ATOM   1277  C C   . LYS A  1  164 ? 83.770  46.747 71.428  1.00 44.39  ? 171  LYS A C   1 
ATOM   1278  O O   . LYS A  1  164 ? 84.677  47.560 71.624  1.00 44.66  ? 171  LYS A O   1 
ATOM   1279  C CB  . LYS A  1  164 ? 83.331  47.842 69.220  1.00 43.83  ? 171  LYS A CB  1 
ATOM   1280  C CG  . LYS A  1  164 ? 83.152  47.689 67.710  1.00 45.10  ? 171  LYS A CG  1 
ATOM   1281  C CD  . LYS A  1  164 ? 83.401  49.012 66.989  1.00 46.66  ? 171  LYS A CD  1 
ATOM   1282  C CE  . LYS A  1  164 ? 83.083  48.928 65.505  1.00 47.28  ? 171  LYS A CE  1 
ATOM   1283  N NZ  . LYS A  1  164 ? 83.320  50.228 64.817  1.00 47.52  ? 171  LYS A NZ  1 
ATOM   1284  N N   . ALA A  1  165 ? 83.240  46.003 72.396  1.00 45.92  ? 172  ALA A N   1 
ATOM   1285  C CA  . ALA A  1  165 ? 83.689  46.074 73.783  1.00 46.97  ? 172  ALA A CA  1 
ATOM   1286  C C   . ALA A  1  165 ? 84.364  44.754 74.151  1.00 47.86  ? 172  ALA A C   1 
ATOM   1287  O O   . ALA A  1  165 ? 83.775  43.915 74.838  1.00 48.11  ? 172  ALA A O   1 
ATOM   1288  C CB  . ALA A  1  165 ? 82.506  46.334 74.707  1.00 46.98  ? 172  ALA A CB  1 
ATOM   1289  N N   . MET A  1  166 ? 85.600  44.577 73.691  1.00 48.66  ? 173  MET A N   1 
ATOM   1290  C CA  . MET A  1  166 ? 86.345  43.351 73.943  1.00 49.18  ? 173  MET A CA  1 
ATOM   1291  C C   . MET A  1  166 ? 85.506  42.197 73.410  1.00 48.97  ? 173  MET A C   1 
ATOM   1292  O O   . MET A  1  166 ? 84.674  42.393 72.519  1.00 49.25  ? 173  MET A O   1 
ATOM   1293  C CB  . MET A  1  166 ? 86.602  43.178 75.440  1.00 49.81  ? 173  MET A CB  1 
ATOM   1294  C CG  . MET A  1  166 ? 87.821  42.330 75.770  1.00 51.00  ? 173  MET A CG  1 
ATOM   1295  S SD  . MET A  1  166 ? 89.340  43.046 75.111  1.00 52.71  ? 173  MET A SD  1 
ATOM   1296  C CE  . MET A  1  166 ? 89.766  41.848 73.819  1.00 53.58  ? 173  MET A CE  1 
ATOM   1297  N N   . ASP A  1  167 ? 85.706  40.997 73.947  1.00 48.34  ? 174  ASP A N   1 
ATOM   1298  C CA  . ASP A  1  167 ? 84.925  39.864 73.495  1.00 47.59  ? 174  ASP A CA  1 
ATOM   1299  C C   . ASP A  1  167 ? 83.489  40.146 73.874  1.00 46.21  ? 174  ASP A C   1 
ATOM   1300  O O   . ASP A  1  167 ? 83.173  40.312 75.053  1.00 46.28  ? 174  ASP A O   1 
ATOM   1301  C CB  . ASP A  1  167 ? 85.388  38.563 74.143  1.00 48.10  ? 174  ASP A CB  1 
ATOM   1302  C CG  . ASP A  1  167 ? 84.661  37.353 73.588  1.00 49.27  ? 174  ASP A CG  1 
ATOM   1303  O OD1 . ASP A  1  167 ? 83.485  37.125 73.962  1.00 50.03  ? 174  ASP A OD1 1 
ATOM   1304  O OD2 . ASP A  1  167 ? 85.208  36.590 72.759  1.00 50.93  ? 174  ASP A OD2 1 
ATOM   1305  N N   . SER A  1  168 ? 82.623  40.224 72.874  1.00 44.32  ? 175  SER A N   1 
ATOM   1306  C CA  . SER A  1  168 ? 81.220  40.493 73.130  1.00 42.74  ? 175  SER A CA  1 
ATOM   1307  C C   . SER A  1  168 ? 80.326  39.777 72.140  1.00 41.02  ? 175  SER A C   1 
ATOM   1308  O O   . SER A  1  168 ? 79.253  40.272 71.783  1.00 41.30  ? 175  SER A O   1 
ATOM   1309  C CB  . SER A  1  168 ? 80.960  41.991 73.073  1.00 42.95  ? 175  SER A CB  1 
ATOM   1310  O OG  . SER A  1  168 ? 81.669  42.661 74.100  1.00 43.43  ? 175  SER A OG  1 
ATOM   1311  N N   . LYS A  1  169 ? 80.762  38.612 71.684  1.00 38.74  ? 176  LYS A N   1 
ATOM   1312  C CA  . LYS A  1  169 ? 79.944  37.854 70.759  1.00 36.67  ? 176  LYS A CA  1 
ATOM   1313  C C   . LYS A  1  169 ? 78.897  37.171 71.601  1.00 35.73  ? 176  LYS A C   1 
ATOM   1314  O O   . LYS A  1  169 ? 79.105  36.932 72.794  1.00 35.70  ? 176  LYS A O   1 
ATOM   1315  C CB  . LYS A  1  169 ? 80.761  36.833 69.975  1.00 36.01  ? 176  LYS A CB  1 
ATOM   1316  C CG  . LYS A  1  169 ? 81.699  37.472 68.977  1.00 33.59  ? 176  LYS A CG  1 
ATOM   1317  C CD  . LYS A  1  169 ? 82.275  36.468 68.019  1.00 31.62  ? 176  LYS A CD  1 
ATOM   1318  C CE  . LYS A  1  169 ? 83.544  37.006 67.389  1.00 30.38  ? 176  LYS A CE  1 
ATOM   1319  N NZ  . LYS A  1  169 ? 84.507  37.456 68.433  1.00 28.83  ? 176  LYS A NZ  1 
ATOM   1320  N N   . SER A  1  170 ? 77.760  36.880 70.992  1.00 34.20  ? 177  SER A N   1 
ATOM   1321  C CA  . SER A  1  170 ? 76.690  36.237 71.715  1.00 32.96  ? 177  SER A CA  1 
ATOM   1322  C C   . SER A  1  170 ? 75.625  35.806 70.739  1.00 32.21  ? 177  SER A C   1 
ATOM   1323  O O   . SER A  1  170 ? 75.191  36.579 69.876  1.00 31.67  ? 177  SER A O   1 
ATOM   1324  C CB  . SER A  1  170 ? 76.087  37.194 72.731  1.00 33.07  ? 177  SER A CB  1 
ATOM   1325  O OG  . SER A  1  170 ? 75.110  38.017 72.118  1.00 32.49  ? 177  SER A OG  1 
ATOM   1326  N N   . ASN A  1  171 ? 75.211  34.557 70.888  1.00 31.18  ? 178  ASN A N   1 
ATOM   1327  C CA  . ASN A  1  171 ? 74.212  33.987 70.027  1.00 31.00  ? 178  ASN A CA  1 
ATOM   1328  C C   . ASN A  1  171 ? 72.848  34.512 70.397  1.00 30.71  ? 178  ASN A C   1 
ATOM   1329  O O   . ASN A  1  171 ? 72.648  35.042 71.488  1.00 30.62  ? 178  ASN A O   1 
ATOM   1330  C CB  . ASN A  1  171 ? 74.245  32.478 70.159  1.00 31.14  ? 178  ASN A CB  1 
ATOM   1331  C CG  . ASN A  1  171 ? 75.653  31.947 70.289  1.00 31.36  ? 178  ASN A CG  1 
ATOM   1332  O OD1 . ASN A  1  171 ? 76.260  31.990 71.364  1.00 32.51  ? 178  ASN A OD1 1 
ATOM   1333  N ND2 . ASN A  1  171 ? 76.190  31.460 69.188  1.00 31.28  ? 178  ASN A ND2 1 
ATOM   1334  N N   . GLY A  1  172 ? 71.903  34.368 69.488  1.00 30.64  ? 179  GLY A N   1 
ATOM   1335  C CA  . GLY A  1  172 ? 70.563  34.832 69.765  1.00 30.63  ? 179  GLY A CA  1 
ATOM   1336  C C   . GLY A  1  172 ? 69.524  34.152 68.910  1.00 30.89  ? 179  GLY A C   1 
ATOM   1337  O O   . GLY A  1  172 ? 69.769  33.821 67.752  1.00 30.84  ? 179  GLY A O   1 
ATOM   1338  N N   . ALA A  1  173 ? 68.358  33.940 69.505  1.00 31.42  ? 180  ALA A N   1 
ATOM   1339  C CA  . ALA A  1  173 ? 67.223  33.346 68.828  1.00 31.62  ? 180  ALA A CA  1 
ATOM   1340  C C   . ALA A  1  173 ? 66.009  34.140 69.279  1.00 32.15  ? 180  ALA A C   1 
ATOM   1341  O O   . ALA A  1  173 ? 65.857  34.422 70.469  1.00 31.97  ? 180  ALA A O   1 
ATOM   1342  C CB  . ALA A  1  173 ? 67.077  31.875 69.200  1.00 31.57  ? 180  ALA A CB  1 
ATOM   1343  N N   . ILE A  1  174 ? 65.166  34.522 68.325  1.00 33.04  ? 181  ILE A N   1 
ATOM   1344  C CA  . ILE A  1  174 ? 63.967  35.291 68.625  1.00 33.96  ? 181  ILE A CA  1 
ATOM   1345  C C   . ILE A  1  174 ? 62.743  34.468 68.293  1.00 35.02  ? 181  ILE A C   1 
ATOM   1346  O O   . ILE A  1  174 ? 62.728  33.755 67.290  1.00 34.86  ? 181  ILE A O   1 
ATOM   1347  C CB  . ILE A  1  174 ? 63.925  36.594 67.814  1.00 33.83  ? 181  ILE A CB  1 
ATOM   1348  C CG1 . ILE A  1  174 ? 65.170  37.426 68.091  1.00 33.34  ? 181  ILE A CG1 1 
ATOM   1349  C CG2 . ILE A  1  174 ? 62.683  37.392 68.171  1.00 33.66  ? 181  ILE A CG2 1 
ATOM   1350  C CD1 . ILE A  1  174 ? 65.249  38.656 67.240  1.00 34.24  ? 181  ILE A CD1 1 
ATOM   1351  N N   . ALA A  1  175 ? 61.725  34.580 69.142  1.00 36.52  ? 182  ALA A N   1 
ATOM   1352  C CA  . ALA A  1  175 ? 60.475  33.859 68.960  1.00 37.91  ? 182  ALA A CA  1 
ATOM   1353  C C   . ALA A  1  175 ? 59.259  34.715 69.301  1.00 39.42  ? 182  ALA A C   1 
ATOM   1354  O O   . ALA A  1  175 ? 59.336  35.657 70.082  1.00 39.44  ? 182  ALA A O   1 
ATOM   1355  C CB  . ALA A  1  175 ? 60.473  32.610 69.807  1.00 37.95  ? 182  ALA A CB  1 
ATOM   1356  N N   . TRP A  1  176 ? 58.131  34.353 68.712  1.00 41.68  ? 183  TRP A N   1 
ATOM   1357  C CA  . TRP A  1  176 ? 56.851  35.030 68.909  1.00 43.32  ? 183  TRP A CA  1 
ATOM   1358  C C   . TRP A  1  176 ? 55.825  33.987 68.425  1.00 46.51  ? 183  TRP A C   1 
ATOM   1359  O O   . TRP A  1  176 ? 56.191  33.060 67.695  1.00 46.65  ? 183  TRP A O   1 
ATOM   1360  C CB  . TRP A  1  176 ? 56.800  36.382 68.179  1.00 42.02  ? 183  TRP A CB  1 
ATOM   1361  C CG  . TRP A  1  176 ? 56.807  36.297 66.699  1.00 38.31  ? 183  TRP A CG  1 
ATOM   1362  C CD1 . TRP A  1  176 ? 55.718  36.224 65.887  1.00 35.99  ? 183  TRP A CD1 1 
ATOM   1363  C CD2 . TRP A  1  176 ? 57.949  36.294 65.839  1.00 34.72  ? 183  TRP A CD2 1 
ATOM   1364  N NE1 . TRP A  1  176 ? 56.109  36.169 64.569  1.00 33.83  ? 183  TRP A NE1 1 
ATOM   1365  C CE2 . TRP A  1  176 ? 57.476  36.208 64.512  1.00 33.49  ? 183  TRP A CE2 1 
ATOM   1366  C CE3 . TRP A  1  176 ? 59.329  36.352 66.053  1.00 34.11  ? 183  TRP A CE3 1 
ATOM   1367  C CZ2 . TRP A  1  176 ? 58.330  36.178 63.409  1.00 32.38  ? 183  TRP A CZ2 1 
ATOM   1368  C CZ3 . TRP A  1  176 ? 60.179  36.321 64.952  1.00 33.83  ? 183  TRP A CZ3 1 
ATOM   1369  C CH2 . TRP A  1  176 ? 59.673  36.238 63.648  1.00 32.10  ? 183  TRP A CH2 1 
ATOM   1370  N N   . SER A  1  177 ? 54.578  34.105 68.867  1.00 50.40  ? 184  SER A N   1 
ATOM   1371  C CA  . SER A  1  177 ? 53.506  33.169 68.536  1.00 53.61  ? 184  SER A CA  1 
ATOM   1372  C C   . SER A  1  177 ? 52.191  33.925 68.569  1.00 56.47  ? 184  SER A C   1 
ATOM   1373  O O   . SER A  1  177 ? 52.008  34.798 69.417  1.00 57.03  ? 184  SER A O   1 
ATOM   1374  C CB  . SER A  1  177 ? 53.381  32.079 69.589  1.00 53.64  ? 184  SER A CB  1 
ATOM   1375  O OG  . SER A  1  177 ? 52.602  32.550 70.678  1.00 53.84  ? 184  SER A OG  1 
ATOM   1376  N N   . ASN A  1  178 ? 51.269  33.579 67.663  1.00 59.72  ? 185  ASN A N   1 
ATOM   1377  C CA  . ASN A  1  178 ? 49.946  34.195 67.578  1.00 62.26  ? 185  ASN A CA  1 
ATOM   1378  C C   . ASN A  1  178 ? 49.061  33.677 68.708  1.00 63.41  ? 185  ASN A C   1 
ATOM   1379  O O   . ASN A  1  178 ? 48.023  34.260 69.026  1.00 63.89  ? 185  ASN A O   1 
ATOM   1380  C CB  . ASN A  1  178 ? 49.294  33.869 66.232  1.00 63.03  ? 185  ASN A CB  1 
ATOM   1381  C CG  . ASN A  1  178 ? 49.053  32.388 66.050  1.00 64.84  ? 185  ASN A CG  1 
ATOM   1382  O OD1 . ASN A  1  178 ? 49.997  31.604 65.973  1.00 66.72  ? 185  ASN A OD1 1 
ATOM   1383  N ND2 . ASN A  1  178 ? 47.787  31.993 65.984  1.00 67.41  ? 185  ASN A ND2 1 
ATOM   1384  N N   . GLN A  1  179 ? 49.490  32.574 69.312  1.00 64.70  ? 186  GLN A N   1 
ATOM   1385  C CA  . GLN A  1  179 ? 48.765  31.954 70.414  1.00 65.71  ? 186  GLN A CA  1 
ATOM   1386  C C   . GLN A  1  179 ? 48.238  32.967 71.412  1.00 66.22  ? 186  GLN A C   1 
ATOM   1387  O O   . GLN A  1  179 ? 48.939  33.903 71.791  1.00 66.40  ? 186  GLN A O   1 
ATOM   1388  C CB  . GLN A  1  179 ? 49.665  30.950 71.123  1.00 65.91  ? 186  GLN A CB  1 
ATOM   1389  C CG  . GLN A  1  179 ? 49.956  29.742 70.263  1.00 66.70  ? 186  GLN A CG  1 
ATOM   1390  C CD  . GLN A  1  179 ? 50.948  28.782 70.879  1.00 67.50  ? 186  GLN A CD  1 
ATOM   1391  O OE1 . GLN A  1  179 ? 52.127  29.107 71.028  1.00 67.47  ? 186  GLN A OE1 1 
ATOM   1392  N NE2 . GLN A  1  179 ? 50.477  27.590 71.232  1.00 67.75  ? 186  GLN A NE2 1 
ATOM   1393  N N   . THR A  1  180 ? 46.990  32.776 71.825  1.00 66.90  ? 187  THR A N   1 
ATOM   1394  C CA  . THR A  1  180 ? 46.375  33.667 72.794  1.00 67.24  ? 187  THR A CA  1 
ATOM   1395  C C   . THR A  1  180 ? 47.383  33.844 73.912  1.00 67.35  ? 187  THR A C   1 
ATOM   1396  O O   . THR A  1  180 ? 47.767  34.964 74.234  1.00 67.43  ? 187  THR A O   1 
ATOM   1397  C CB  . THR A  1  180 ? 45.060  33.086 73.347  1.00 67.38  ? 187  THR A CB  1 
ATOM   1398  O OG1 . THR A  1  180 ? 45.300  31.805 73.950  1.00 67.26  ? 187  THR A OG1 1 
ATOM   1399  C CG2 . THR A  1  180 ? 44.053  32.849 72.217  1.00 67.64  ? 187  THR A CG2 1 
ATOM   1400  N N   . SER A  1  181 ? 47.836  32.726 74.476  1.00 67.40  ? 188  SER A N   1 
ATOM   1401  C CA  . SER A  1  181 ? 48.819  32.756 75.554  1.00 67.41  ? 188  SER A CA  1 
ATOM   1402  C C   . SER A  1  181 ? 50.096  32.006 75.186  1.00 67.18  ? 188  SER A C   1 
ATOM   1403  O O   . SER A  1  181 ? 50.447  31.901 74.010  1.00 67.17  ? 188  SER A O   1 
ATOM   1404  C CB  . SER A  1  181 ? 48.224  32.178 76.841  1.00 67.43  ? 188  SER A CB  1 
ATOM   1405  O OG  . SER A  1  181 ? 47.304  33.082 77.426  1.00 67.58  ? 188  SER A OG  1 
ATOM   1406  N N   . PHE A  1  182 ? 50.780  31.494 76.208  1.00 66.88  ? 189  PHE A N   1 
ATOM   1407  C CA  . PHE A  1  182 ? 52.036  30.765 76.052  1.00 66.58  ? 189  PHE A CA  1 
ATOM   1408  C C   . PHE A  1  182 ? 53.182  31.756 76.006  1.00 65.52  ? 189  PHE A C   1 
ATOM   1409  O O   . PHE A  1  182 ? 53.364  32.459 75.017  1.00 65.46  ? 189  PHE A O   1 
ATOM   1410  C CB  . PHE A  1  182 ? 52.016  29.878 74.803  1.00 66.97  ? 189  PHE A CB  1 
ATOM   1411  C CG  . PHE A  1  182 ? 50.852  28.933 74.778  1.00 68.34  ? 189  PHE A CG  1 
ATOM   1412  C CD1 . PHE A  1  182 ? 50.681  28.004 75.794  1.00 69.41  ? 189  PHE A CD1 1 
ATOM   1413  C CD2 . PHE A  1  182 ? 49.894  29.016 73.784  1.00 69.41  ? 189  PHE A CD2 1 
ATOM   1414  C CE1 . PHE A  1  182 ? 49.583  27.156 75.804  1.00 69.91  ? 189  PHE A CE1 1 
ATOM   1415  C CE2 . PHE A  1  182 ? 48.793  28.173 73.782  1.00 69.95  ? 189  PHE A CE2 1 
ATOM   1416  C CZ  . PHE A  1  182 ? 48.637  27.240 74.794  1.00 70.07  ? 189  PHE A CZ  1 
ATOM   1417  N N   . THR A  1  183 ? 53.947  31.813 77.091  1.00 64.33  ? 190  THR A N   1 
ATOM   1418  C CA  . THR A  1  183 ? 55.062  32.745 77.185  1.00 63.29  ? 190  THR A CA  1 
ATOM   1419  C C   . THR A  1  183 ? 56.374  32.129 76.689  1.00 62.15  ? 190  THR A C   1 
ATOM   1420  O O   . THR A  1  183 ? 56.367  31.203 75.877  1.00 62.08  ? 190  THR A O   1 
ATOM   1421  C CB  . THR A  1  183 ? 55.202  33.258 78.630  1.00 63.40  ? 190  THR A CB  1 
ATOM   1422  O OG1 . THR A  1  183 ? 56.029  34.432 78.651  1.00 63.49  ? 190  THR A OG1 1 
ATOM   1423  C CG2 . THR A  1  183 ? 55.888  32.222 79.520  1.00 63.61  ? 190  THR A CG2 1 
ATOM   1424  N N   . CYS A  1  184 ? 57.493  32.655 77.181  1.00 60.72  ? 191  CYS A N   1 
ATOM   1425  C CA  . CYS A  1  184 ? 58.820  32.216 76.762  1.00 59.37  ? 191  CYS A CA  1 
ATOM   1426  C C   . CYS A  1  184 ? 59.259  30.860 77.313  1.00 60.04  ? 191  CYS A C   1 
ATOM   1427  O O   . CYS A  1  184 ? 59.797  30.035 76.580  1.00 59.93  ? 191  CYS A O   1 
ATOM   1428  C CB  . CYS A  1  184 ? 59.845  33.279 77.143  1.00 58.28  ? 191  CYS A CB  1 
ATOM   1429  S SG  . CYS A  1  184 ? 59.387  34.931 76.578  1.00 53.74  ? 191  CYS A SG  1 
ATOM   1430  N N   . GLN A  1  185 ? 59.056  30.639 78.605  1.00 60.73  ? 192  GLN A N   1 
ATOM   1431  C CA  . GLN A  1  185 ? 59.426  29.370 79.221  1.00 61.34  ? 192  GLN A CA  1 
ATOM   1432  C C   . GLN A  1  185 ? 58.844  28.222 78.406  1.00 61.69  ? 192  GLN A C   1 
ATOM   1433  O O   . GLN A  1  185 ? 59.547  27.296 78.009  1.00 61.67  ? 192  GLN A O   1 
ATOM   1434  C CB  . GLN A  1  185 ? 58.884  29.308 80.648  1.00 61.49  ? 192  GLN A CB  1 
ATOM   1435  C CG  . GLN A  1  185 ? 57.394  29.597 80.733  1.00 62.16  ? 192  GLN A CG  1 
ATOM   1436  C CD  . GLN A  1  185 ? 56.902  29.829 82.145  1.00 63.00  ? 192  GLN A CD  1 
ATOM   1437  O OE1 . GLN A  1  185 ? 57.529  30.553 82.919  1.00 63.67  ? 192  GLN A OE1 1 
ATOM   1438  N NE2 . GLN A  1  185 ? 55.766  29.229 82.480  1.00 62.98  ? 192  GLN A NE2 1 
ATOM   1439  N N   . ASP A  1  186 ? 57.547  28.314 78.147  1.00 62.32  ? 193  ASP A N   1 
ATOM   1440  C CA  . ASP A  1  186 ? 56.816  27.297 77.408  1.00 62.90  ? 193  ASP A CA  1 
ATOM   1441  C C   . ASP A  1  186 ? 57.350  27.079 75.996  1.00 63.69  ? 193  ASP A C   1 
ATOM   1442  O O   . ASP A  1  186 ? 57.234  25.981 75.453  1.00 63.88  ? 193  ASP A O   1 
ATOM   1443  C CB  . ASP A  1  186 ? 55.345  27.689 77.337  1.00 62.75  ? 193  ASP A CB  1 
ATOM   1444  C CG  . ASP A  1  186 ? 54.885  28.425 78.571  1.00 62.51  ? 193  ASP A CG  1 
ATOM   1445  O OD1 . ASP A  1  186 ? 54.963  27.848 79.677  1.00 62.11  ? 193  ASP A OD1 1 
ATOM   1446  O OD2 . ASP A  1  186 ? 54.445  29.591 78.506  1.00 62.04  ? 193  ASP A OD2 1 
ATOM   1447  N N   . ILE A  1  187 ? 57.929  28.116 75.397  1.00 64.54  ? 194  ILE A N   1 
ATOM   1448  C CA  . ILE A  1  187 ? 58.445  28.000 74.032  1.00 65.23  ? 194  ILE A CA  1 
ATOM   1449  C C   . ILE A  1  187 ? 59.918  27.576 73.980  1.00 65.73  ? 194  ILE A C   1 
ATOM   1450  O O   . ILE A  1  187 ? 60.307  26.796 73.110  1.00 65.66  ? 194  ILE A O   1 
ATOM   1451  C CB  . ILE A  1  187 ? 58.243  29.311 73.249  1.00 65.27  ? 194  ILE A CB  1 
ATOM   1452  C CG1 . ILE A  1  187 ? 58.774  29.158 71.823  1.00 65.53  ? 194  ILE A CG1 1 
ATOM   1453  C CG2 . ILE A  1  187 ? 58.924  30.457 73.946  1.00 65.53  ? 194  ILE A CG2 1 
ATOM   1454  C CD1 . ILE A  1  187 ? 57.904  28.280 70.950  1.00 66.07  ? 194  ILE A CD1 1 
ATOM   1455  N N   . PHE A  1  188 ? 60.728  28.098 74.900  1.00 66.45  ? 195  PHE A N   1 
ATOM   1456  C CA  . PHE A  1  188 ? 62.152  27.762 74.970  1.00 67.08  ? 195  PHE A CA  1 
ATOM   1457  C C   . PHE A  1  188 ? 62.418  26.854 76.170  1.00 68.04  ? 195  PHE A C   1 
ATOM   1458  O O   . PHE A  1  188 ? 63.329  27.084 76.965  1.00 68.07  ? 195  PHE A O   1 
ATOM   1459  C CB  . PHE A  1  188 ? 63.008  29.028 75.059  1.00 66.77  ? 195  PHE A CB  1 
ATOM   1460  C CG  . PHE A  1  188 ? 63.139  29.758 73.752  1.00 66.03  ? 195  PHE A CG  1 
ATOM   1461  C CD1 . PHE A  1  188 ? 62.071  30.459 73.228  1.00 65.26  ? 195  PHE A CD1 1 
ATOM   1462  C CD2 . PHE A  1  188 ? 64.324  29.721 73.034  1.00 65.23  ? 195  PHE A CD2 1 
ATOM   1463  C CE1 . PHE A  1  188 ? 62.178  31.114 72.020  1.00 64.99  ? 195  PHE A CE1 1 
ATOM   1464  C CE2 . PHE A  1  188 ? 64.437  30.379 71.819  1.00 64.78  ? 195  PHE A CE2 1 
ATOM   1465  C CZ  . PHE A  1  188 ? 63.361  31.076 71.312  1.00 64.80  ? 195  PHE A CZ  1 
ATOM   1466  N N   . LYS A  1  189 ? 61.596  25.818 76.279  1.00 69.12  ? 196  LYS A N   1 
ATOM   1467  C CA  . LYS A  1  189 ? 61.656  24.833 77.353  1.00 70.04  ? 196  LYS A CA  1 
ATOM   1468  C C   . LYS A  1  189 ? 63.056  24.346 77.752  1.00 70.67  ? 196  LYS A C   1 
ATOM   1469  O O   . LYS A  1  189 ? 63.255  23.920 78.891  1.00 70.69  ? 196  LYS A O   1 
ATOM   1470  C CB  . LYS A  1  189 ? 60.793  23.642 76.951  1.00 70.16  ? 196  LYS A CB  1 
ATOM   1471  C CG  . LYS A  1  189 ? 60.969  23.250 75.488  1.00 70.57  ? 196  LYS A CG  1 
ATOM   1472  C CD  . LYS A  1  189 ? 60.044  22.126 75.090  1.00 71.00  ? 196  LYS A CD  1 
ATOM   1473  C CE  . LYS A  1  189 ? 60.326  20.878 75.897  1.00 71.35  ? 196  LYS A CE  1 
ATOM   1474  N NZ  . LYS A  1  189 ? 59.445  19.762 75.480  1.00 71.49  ? 196  LYS A NZ  1 
ATOM   1475  N N   . GLU A  1  190 ? 64.017  24.401 76.832  1.00 71.44  ? 197  GLU A N   1 
ATOM   1476  C CA  . GLU A  1  190 ? 65.379  23.948 77.124  1.00 72.04  ? 197  GLU A CA  1 
ATOM   1477  C C   . GLU A  1  190 ? 66.381  25.088 77.108  1.00 72.53  ? 197  GLU A C   1 
ATOM   1478  O O   . GLU A  1  190 ? 66.965  25.399 76.071  1.00 72.58  ? 197  GLU A O   1 
ATOM   1479  C CB  . GLU A  1  190 ? 65.816  22.886 76.117  1.00 72.07  ? 197  GLU A CB  1 
ATOM   1480  C CG  . GLU A  1  190 ? 64.829  21.747 75.978  1.00 72.30  ? 197  GLU A CG  1 
ATOM   1481  C CD  . GLU A  1  190 ? 64.177  21.391 77.299  1.00 72.38  ? 197  GLU A CD  1 
ATOM   1482  O OE1 . GLU A  1  190 ? 64.904  21.232 78.303  1.00 72.38  ? 197  GLU A OE1 1 
ATOM   1483  O OE2 . GLU A  1  190 ? 62.937  21.282 77.336  1.00 72.35  ? 197  GLU A OE2 1 
ATOM   1484  N N   . THR A  1  191 ? 66.591  25.707 78.261  1.00 73.14  ? 198  THR A N   1 
ATOM   1485  C CA  . THR A  1  191 ? 67.523  26.819 78.350  1.00 73.66  ? 198  THR A CA  1 
ATOM   1486  C C   . THR A  1  191 ? 68.096  26.898 79.755  1.00 73.74  ? 198  THR A C   1 
ATOM   1487  O O   . THR A  1  191 ? 68.639  25.927 80.274  1.00 73.78  ? 198  THR A O   1 
ATOM   1488  C CB  . THR A  1  191 ? 66.829  28.150 77.997  1.00 73.76  ? 198  THR A CB  1 
ATOM   1489  O OG1 . THR A  1  191 ? 65.810  28.440 78.963  1.00 74.06  ? 198  THR A OG1 1 
ATOM   1490  C CG2 . THR A  1  191 ? 66.124  28.064 76.647  1.00 74.31  ? 198  THR A CG2 1 
ATOM   1491  N N   . ASN A  1  192 ? 67.940  28.118 80.387  1.00 76.83  ? 203  ASN A N   1 
ATOM   1492  C CA  . ASN A  1  192 ? 68.387  28.409 81.738  1.00 76.81  ? 203  ASN A CA  1 
ATOM   1493  C C   . ASN A  1  192 ? 67.585  29.585 82.302  1.00 77.04  ? 203  ASN A C   1 
ATOM   1494  O O   . ASN A  1  192 ? 66.361  29.614 82.177  1.00 76.93  ? 203  ASN A O   1 
ATOM   1495  C CB  . ASN A  1  192 ? 69.891  28.693 81.743  1.00 76.63  ? 203  ASN A CB  1 
ATOM   1496  C CG  . ASN A  1  192 ? 70.708  27.536 82.299  1.00 76.30  ? 203  ASN A CG  1 
ATOM   1497  O OD1 . ASN A  1  192 ? 70.481  26.376 81.959  1.00 75.81  ? 203  ASN A OD1 1 
ATOM   1498  N ND2 . ASN A  1  192 ? 71.669  27.853 83.160  1.00 76.07  ? 203  ASN A ND2 1 
ATOM   1499  N N   . ALA A  1  193 ? 68.268  30.551 82.909  1.00 77.44  ? 204  ALA A N   1 
ATOM   1500  C CA  . ALA A  1  193 ? 67.612  31.713 83.509  1.00 77.83  ? 204  ALA A CA  1 
ATOM   1501  C C   . ALA A  1  193 ? 66.545  32.335 82.604  1.00 78.36  ? 204  ALA A C   1 
ATOM   1502  O O   . ALA A  1  193 ? 66.775  32.560 81.419  1.00 78.35  ? 204  ALA A O   1 
ATOM   1503  C CB  . ALA A  1  193 ? 68.652  32.758 83.886  1.00 77.71  ? 204  ALA A CB  1 
ATOM   1504  N N   . THR A  1  194 ? 65.378  32.612 83.178  1.00 79.05  ? 205  THR A N   1 
ATOM   1505  C CA  . THR A  1  194 ? 64.276  33.219 82.437  1.00 79.70  ? 205  THR A CA  1 
ATOM   1506  C C   . THR A  1  194 ? 63.754  34.433 83.201  1.00 80.73  ? 205  THR A C   1 
ATOM   1507  O O   . THR A  1  194 ? 62.572  34.509 83.535  1.00 80.72  ? 205  THR A O   1 
ATOM   1508  C CB  . THR A  1  194 ? 63.128  32.216 82.238  1.00 79.47  ? 205  THR A CB  1 
ATOM   1509  O OG1 . THR A  1  194 ? 63.603  31.059 81.535  1.00 79.13  ? 205  THR A OG1 1 
ATOM   1510  C CG2 . THR A  1  194 ? 62.026  32.817 81.362  1.00 79.15  ? 205  THR A CG2 1 
ATOM   1511  N N   . TYR A  1  195 ? 64.647  35.377 83.477  1.00 81.96  ? 206  TYR A N   1 
ATOM   1512  C CA  . TYR A  1  195 ? 64.308  36.591 84.221  1.00 83.01  ? 206  TYR A CA  1 
ATOM   1513  C C   . TYR A  1  195 ? 62.975  37.232 83.821  1.00 83.84  ? 206  TYR A C   1 
ATOM   1514  O O   . TYR A  1  195 ? 62.673  37.365 82.634  1.00 83.88  ? 206  TYR A O   1 
ATOM   1515  C CB  . TYR A  1  195 ? 65.433  37.622 84.071  1.00 83.14  ? 206  TYR A CB  1 
ATOM   1516  C CG  . TYR A  1  195 ? 66.643  37.295 84.916  1.00 83.59  ? 206  TYR A CG  1 
ATOM   1517  C CD1 . TYR A  1  195 ? 67.515  36.276 84.550  1.00 83.96  ? 206  TYR A CD1 1 
ATOM   1518  C CD2 . TYR A  1  195 ? 66.891  37.978 86.101  1.00 83.88  ? 206  TYR A CD2 1 
ATOM   1519  C CE1 . TYR A  1  195 ? 68.607  35.952 85.338  1.00 84.13  ? 206  TYR A CE1 1 
ATOM   1520  C CE2 . TYR A  1  195 ? 67.979  37.662 86.895  1.00 84.08  ? 206  TYR A CE2 1 
ATOM   1521  C CZ  . TYR A  1  195 ? 68.834  36.648 86.509  1.00 84.14  ? 206  TYR A CZ  1 
ATOM   1522  O OH  . TYR A  1  195 ? 69.916  36.325 87.298  1.00 84.10  ? 206  TYR A OH  1 
ATOM   1523  N N   . PRO A  1  196 ? 62.167  37.610 84.816  1.00 84.86  ? 207  PRO A N   1 
ATOM   1524  C CA  . PRO A  1  196 ? 60.884  38.264 84.561  1.00 85.53  ? 207  PRO A CA  1 
ATOM   1525  C C   . PRO A  1  196 ? 61.078  39.762 84.367  1.00 86.38  ? 207  PRO A C   1 
ATOM   1526  O O   . PRO A  1  196 ? 61.882  40.374 85.071  1.00 86.40  ? 207  PRO A O   1 
ATOM   1527  C CB  . PRO A  1  196 ? 60.105  37.957 85.836  1.00 85.43  ? 207  PRO A CB  1 
ATOM   1528  C CG  . PRO A  1  196 ? 61.156  38.075 86.881  1.00 85.21  ? 207  PRO A CG  1 
ATOM   1529  C CD  . PRO A  1  196 ? 62.353  37.369 86.260  1.00 84.89  ? 207  PRO A CD  1 
ATOM   1530  N N   . SER A  1  197 ? 60.361  40.345 83.412  1.00 87.45  ? 208  SER A N   1 
ATOM   1531  C CA  . SER A  1  197 ? 60.476  41.774 83.143  1.00 88.31  ? 208  SER A CA  1 
ATOM   1532  C C   . SER A  1  197 ? 59.783  42.572 84.246  1.00 89.22  ? 208  SER A C   1 
ATOM   1533  O O   . SER A  1  197 ? 59.543  43.770 84.101  1.00 89.31  ? 208  SER A O   1 
ATOM   1534  C CB  . SER A  1  197 ? 59.870  42.118 81.781  1.00 88.25  ? 208  SER A CB  1 
ATOM   1535  O OG  . SER A  1  197 ? 58.474  41.878 81.761  1.00 88.12  ? 208  SER A OG  1 
ATOM   1536  N N   . SER A  1  198 ? 59.461  41.894 85.345  1.00 90.34  ? 209  SER A N   1 
ATOM   1537  C CA  . SER A  1  198 ? 58.805  42.520 86.485  1.00 91.28  ? 209  SER A CA  1 
ATOM   1538  C C   . SER A  1  198 ? 59.713  43.588 87.091  1.00 92.12  ? 209  SER A C   1 
ATOM   1539  O O   . SER A  1  198 ? 60.720  43.271 87.723  1.00 92.16  ? 209  SER A O   1 
ATOM   1540  C CB  . SER A  1  198 ? 58.462  41.467 87.541  1.00 91.27  ? 209  SER A CB  1 
ATOM   1541  O OG  . SER A  1  198 ? 57.635  40.453 86.998  1.00 91.29  ? 209  SER A OG  1 
ATOM   1542  N N   . ASP A  1  199 ? 59.340  44.849 86.887  1.00 93.14  ? 210  ASP A N   1 
ATOM   1543  C CA  . ASP A  1  199 ? 60.094  46.005 87.372  1.00 93.92  ? 210  ASP A CA  1 
ATOM   1544  C C   . ASP A  1  199 ? 60.612  45.844 88.809  1.00 94.48  ? 210  ASP A C   1 
ATOM   1545  O O   . ASP A  1  199 ? 59.950  45.240 89.655  1.00 94.44  ? 210  ASP A O   1 
ATOM   1546  C CB  . ASP A  1  199 ? 59.204  47.250 87.270  1.00 94.09  ? 210  ASP A CB  1 
ATOM   1547  C CG  . ASP A  1  199 ? 59.982  48.542 87.371  1.00 94.36  ? 210  ASP A CG  1 
ATOM   1548  O OD1 . ASP A  1  199 ? 60.914  48.745 86.565  1.00 94.56  ? 210  ASP A OD1 1 
ATOM   1549  O OD2 . ASP A  1  199 ? 59.706  49.408 88.228  1.00 94.60  ? 210  ASP A OD2 1 
ATOM   1550  N N   . VAL A  1  200 ? 61.801  46.386 89.070  1.00 95.16  ? 211  VAL A N   1 
ATOM   1551  C CA  . VAL A  1  200 ? 62.416  46.338 90.399  1.00 95.66  ? 211  VAL A CA  1 
ATOM   1552  C C   . VAL A  1  200 ? 62.003  47.576 91.208  1.00 96.16  ? 211  VAL A C   1 
ATOM   1553  O O   . VAL A  1  200 ? 62.290  48.705 90.806  1.00 96.27  ? 211  VAL A O   1 
ATOM   1554  C CB  . VAL A  1  200 ? 63.961  46.286 90.310  1.00 95.62  ? 211  VAL A CB  1 
ATOM   1555  C CG1 . VAL A  1  200 ? 64.422  44.928 89.799  1.00 95.61  ? 211  VAL A CG1 1 
ATOM   1556  C CG2 . VAL A  1  200 ? 64.487  47.395 89.411  1.00 95.62  ? 211  VAL A CG2 1 
ATOM   1557  N N   . PRO A  1  201 ? 61.321  47.372 92.337  1.00 96.68  ? 212  PRO A N   1 
ATOM   1558  C CA  . PRO A  1  201 ? 60.869  48.482 93.181  1.00 97.00  ? 212  PRO A CA  1 
ATOM   1559  C C   . PRO A  1  201 ? 61.980  49.445 93.589  1.00 97.31  ? 212  PRO A C   1 
ATOM   1560  O O   . PRO A  1  201 ? 63.127  49.046 93.804  1.00 97.29  ? 212  PRO A O   1 
ATOM   1561  C CB  . PRO A  1  201 ? 60.274  47.763 94.392  1.00 97.01  ? 212  PRO A CB  1 
ATOM   1562  C CG  . PRO A  1  201 ? 59.771  46.498 93.818  1.00 96.88  ? 212  PRO A CG  1 
ATOM   1563  C CD  . PRO A  1  201 ? 60.895  46.081 92.902  1.00 96.76  ? 212  PRO A CD  1 
ATOM   1564  N N   . CYS A  1  202 ? 61.614  50.716 93.698  1.00 97.63  ? 213  CYS A N   1 
ATOM   1565  C CA  . CYS A  1  202 ? 62.558  51.768 94.028  1.00 97.92  ? 213  CYS A CA  1 
ATOM   1566  C C   . CYS A  1  202 ? 61.826  52.860 94.797  1.00 97.89  ? 213  CYS A C   1 
ATOM   1567  O O   . CYS A  1  202 ? 62.233  53.208 95.912  1.00 97.90  ? 213  CYS A O   1 
ATOM   1568  C CB  . CYS A  1  202 ? 63.155  52.332 92.732  1.00 98.06  ? 213  CYS A CB  1 
ATOM   1569  S SG  . CYS A  1  202 ? 64.574  53.440 92.914  1.00 98.39  ? 213  CYS A SG  1 
ATOM   1570  O OXT . CYS A  1  202 ? 60.822  53.371 94.287  1.00 97.85  ? 213  CYS A OXT 1 
ATOM   1571  N N   . GLN B  1  1   ? 157.666 10.607 7.466   1.00 79.30  ? 1    GLN C N   1 
ATOM   1572  C CA  . GLN B  1  1   ? 159.061 11.114 7.596   1.00 79.20  ? 1    GLN C CA  1 
ATOM   1573  C C   . GLN B  1  1   ? 159.999 10.364 6.642   1.00 79.13  ? 1    GLN C C   1 
ATOM   1574  O O   . GLN B  1  1   ? 161.213 10.571 6.660   1.00 78.98  ? 1    GLN C O   1 
ATOM   1575  C CB  . GLN B  1  1   ? 159.539 10.963 9.046   1.00 79.16  ? 1    GLN C CB  1 
ATOM   1576  C CG  . GLN B  1  1   ? 160.578 11.992 9.481   1.00 78.81  ? 1    GLN C CG  1 
ATOM   1577  C CD  . GLN B  1  1   ? 160.037 13.413 9.470   1.00 78.19  ? 1    GLN C CD  1 
ATOM   1578  O OE1 . GLN B  1  1   ? 159.041 13.710 10.133  1.00 77.30  ? 1    GLN C OE1 1 
ATOM   1579  N NE2 . GLN B  1  1   ? 160.690 14.291 8.719   1.00 77.59  ? 1    GLN C NE2 1 
ATOM   1580  N N   . SER B  1  2   ? 159.437 9.447  5.858   1.00 79.01  ? 2    SER C N   1 
ATOM   1581  C CA  . SER B  1  2   ? 160.202 8.679  4.885   1.00 78.93  ? 2    SER C CA  1 
ATOM   1582  C C   . SER B  1  2   ? 159.637 8.744  3.465   1.00 78.74  ? 2    SER C C   1 
ATOM   1583  O O   . SER B  1  2   ? 158.537 8.259  3.207   1.00 78.65  ? 2    SER C O   1 
ATOM   1584  C CB  . SER B  1  2   ? 160.236 7.225  5.351   1.00 78.98  ? 2    SER C CB  1 
ATOM   1585  O OG  . SER B  1  2   ? 158.932 6.780  5.686   1.00 79.16  ? 2    SER C OG  1 
ATOM   1586  N N   . VAL B  1  3   ? 160.410 9.321  2.546   1.00 78.52  ? 3    VAL C N   1 
ATOM   1587  C CA  . VAL B  1  3   ? 159.992 9.458  1.149   1.00 78.38  ? 3    VAL C CA  1 
ATOM   1588  C C   . VAL B  1  3   ? 160.856 8.651  0.178   1.00 78.17  ? 3    VAL C C   1 
ATOM   1589  O O   . VAL B  1  3   ? 162.083 8.696  0.236   1.00 78.04  ? 3    VAL C O   1 
ATOM   1590  C CB  . VAL B  1  3   ? 160.022 10.930 0.700   1.00 78.38  ? 3    VAL C CB  1 
ATOM   1591  C CG1 . VAL B  1  3   ? 161.380 11.530 0.970   1.00 78.29  ? 3    VAL C CG1 1 
ATOM   1592  C CG2 . VAL B  1  3   ? 159.675 11.037 -0.778  1.00 78.45  ? 3    VAL C CG2 1 
ATOM   1593  N N   . THR B  1  4   ? 160.196 7.927  -0.722  1.00 78.08  ? 4    THR C N   1 
ATOM   1594  C CA  . THR B  1  4   ? 160.881 7.118  -1.727  1.00 78.05  ? 4    THR C CA  1 
ATOM   1595  C C   . THR B  1  4   ? 160.375 7.459  -3.125  1.00 78.12  ? 4    THR C C   1 
ATOM   1596  O O   . THR B  1  4   ? 159.173 7.414  -3.380  1.00 77.98  ? 4    THR C O   1 
ATOM   1597  C CB  . THR B  1  4   ? 160.651 5.623  -1.475  1.00 77.97  ? 4    THR C CB  1 
ATOM   1598  O OG1 . THR B  1  4   ? 161.059 5.278  -0.144  1.00 77.66  ? 4    THR C OG1 1 
ATOM   1599  C CG2 . THR B  1  4   ? 161.519 4.785  -2.415  1.00 77.93  ? 4    THR C CG2 1 
ATOM   1600  N N   . GLN B  1  5   ? 161.299 7.787  -4.025  1.00 78.37  ? 5    GLN C N   1 
ATOM   1601  C CA  . GLN B  1  5   ? 160.961 8.140  -5.402  1.00 78.59  ? 5    GLN C CA  1 
ATOM   1602  C C   . GLN B  1  5   ? 161.437 7.056  -6.380  1.00 79.29  ? 5    GLN C C   1 
ATOM   1603  O O   . GLN B  1  5   ? 162.597 7.062  -6.793  1.00 79.37  ? 5    GLN C O   1 
ATOM   1604  C CB  . GLN B  1  5   ? 161.606 9.484  -5.775  1.00 78.16  ? 5    GLN C CB  1 
ATOM   1605  C CG  . GLN B  1  5   ? 161.573 10.543 -4.679  1.00 77.12  ? 5    GLN C CG  1 
ATOM   1606  C CD  . GLN B  1  5   ? 161.960 11.923 -5.185  1.00 75.92  ? 5    GLN C CD  1 
ATOM   1607  O OE1 . GLN B  1  5   ? 162.249 12.824 -4.396  1.00 74.98  ? 5    GLN C OE1 1 
ATOM   1608  N NE2 . GLN B  1  5   ? 161.960 12.092 -6.500  1.00 75.11  ? 5    GLN C NE2 1 
ATOM   1609  N N   . PRO B  1  6   ? 160.553 6.124  -6.752  1.00 80.10  ? 6    PRO C N   1 
ATOM   1610  C CA  . PRO B  1  6   ? 160.895 5.050  -7.691  1.00 80.65  ? 6    PRO C CA  1 
ATOM   1611  C C   . PRO B  1  6   ? 161.356 5.568  -9.072  1.00 81.25  ? 6    PRO C C   1 
ATOM   1612  O O   . PRO B  1  6   ? 162.094 4.854  -9.752  1.00 81.23  ? 6    PRO C O   1 
ATOM   1613  C CB  . PRO B  1  6   ? 159.588 4.257  -7.788  1.00 80.63  ? 6    PRO C CB  1 
ATOM   1614  C CG  . PRO B  1  6   ? 158.911 4.522  -6.495  1.00 80.52  ? 6    PRO C CG  1 
ATOM   1615  C CD  . PRO B  1  6   ? 159.162 5.991  -6.289  1.00 80.21  ? 6    PRO C CD  1 
ATOM   1616  N N   . ASP B  1  7   ? 160.923 6.775  -9.484  1.00 81.96  ? 7    ASP C N   1 
ATOM   1617  C CA  . ASP B  1  7   ? 161.377 7.430  -10.732 1.00 82.44  ? 7    ASP C CA  1 
ATOM   1618  C C   . ASP B  1  7   ? 162.906 7.355  -10.889 1.00 82.67  ? 7    ASP C C   1 
ATOM   1619  O O   . ASP B  1  7   ? 163.454 6.307  -11.235 1.00 82.74  ? 7    ASP C O   1 
ATOM   1620  C CB  . ASP B  1  7   ? 160.958 8.904  -10.735 1.00 82.56  ? 7    ASP C CB  1 
ATOM   1621  C CG  . ASP B  1  7   ? 161.015 9.521  -9.359  1.00 82.75  ? 7    ASP C CG  1 
ATOM   1622  O OD1 . ASP B  1  7   ? 160.305 10.519 -9.113  1.00 82.77  ? 7    ASP C OD1 1 
ATOM   1623  O OD2 . ASP B  1  7   ? 161.752 9.047  -8.472  1.00 83.01  ? 7    ASP C OD2 1 
ATOM   1624  N N   . ALA B  1  8   ? 163.570 8.493  -10.674 1.00 82.93  ? 8    ALA C N   1 
ATOM   1625  C CA  . ALA B  1  8   ? 165.041 8.593  -10.514 1.00 83.11  ? 8    ALA C CA  1 
ATOM   1626  C C   . ALA B  1  8   ? 165.882 8.509  -11.707 1.00 83.11  ? 8    ALA C C   1 
ATOM   1627  O O   . ALA B  1  8   ? 167.106 8.514  -11.665 1.00 83.18  ? 8    ALA C O   1 
ATOM   1628  C CB  . ALA B  1  8   ? 165.516 7.586  -9.517  1.00 83.19  ? 8    ALA C CB  1 
ATOM   1629  N N   . ARG B  1  9   ? 165.208 8.423  -12.785 1.00 83.09  ? 9    ARG C N   1 
ATOM   1630  C CA  . ARG B  1  9   ? 165.881 8.689  -13.979 1.00 83.04  ? 9    ARG C CA  1 
ATOM   1631  C C   . ARG B  1  9   ? 164.753 8.639  -14.913 1.00 82.71  ? 9    ARG C C   1 
ATOM   1632  O O   . ARG B  1  9   ? 164.198 7.595  -15.259 1.00 82.66  ? 9    ARG C O   1 
ATOM   1633  C CB  . ARG B  1  9   ? 167.102 7.810  -14.297 1.00 83.18  ? 9    ARG C CB  1 
ATOM   1634  C CG  . ARG B  1  9   ? 166.937 6.337  -14.195 1.00 83.63  ? 9    ARG C CG  1 
ATOM   1635  C CD  . ARG B  1  9   ? 166.182 5.783  -15.377 1.00 84.11  ? 9    ARG C CD  1 
ATOM   1636  N NE  . ARG B  1  9   ? 166.831 6.016  -16.669 1.00 84.21  ? 9    ARG C NE  1 
ATOM   1637  C CZ  . ARG B  1  9   ? 166.397 5.481  -17.804 1.00 84.66  ? 9    ARG C CZ  1 
ATOM   1638  N NH1 . ARG B  1  9   ? 165.325 4.699  -17.790 1.00 84.73  ? 9    ARG C NH1 1 
ATOM   1639  N NH2 . ARG B  1  9   ? 167.023 5.718  -18.950 1.00 84.78  ? 9    ARG C NH2 1 
ATOM   1640  N N   . VAL B  1  10  ? 164.392 9.836  -15.276 1.00 82.31  ? 10   VAL C N   1 
ATOM   1641  C CA  . VAL B  1  10  ? 163.282 9.982  -16.167 1.00 82.02  ? 10   VAL C CA  1 
ATOM   1642  C C   . VAL B  1  10  ? 163.696 10.468 -17.550 1.00 81.47  ? 10   VAL C C   1 
ATOM   1643  O O   . VAL B  1  10  ? 164.464 11.422 -17.679 1.00 81.58  ? 10   VAL C O   1 
ATOM   1644  C CB  . VAL B  1  10  ? 162.249 10.943 -15.569 1.00 82.15  ? 10   VAL C CB  1 
ATOM   1645  C CG1 . VAL B  1  10  ? 161.067 11.072 -16.502 1.00 82.21  ? 10   VAL C CG1 1 
ATOM   1646  C CG2 . VAL B  1  10  ? 161.801 10.452 -14.192 1.00 82.30  ? 10   VAL C CG2 1 
ATOM   1647  N N   . THR B  1  11  ? 163.163 9.813  -18.578 1.00 80.67  ? 11   THR C N   1 
ATOM   1648  C CA  . THR B  1  11  ? 163.424 10.193 -19.962 1.00 79.97  ? 11   THR C CA  1 
ATOM   1649  C C   . THR B  1  11  ? 162.107 10.556 -20.633 1.00 79.18  ? 11   THR C C   1 
ATOM   1650  O O   . THR B  1  11  ? 161.124 9.831  -20.491 1.00 79.15  ? 11   THR C O   1 
ATOM   1651  C CB  . THR B  1  11  ? 164.048 9.033  -20.747 1.00 80.05  ? 11   THR C CB  1 
ATOM   1652  O OG1 . THR B  1  11  ? 165.179 8.504  -20.038 1.00 80.02  ? 11   THR C OG1 1 
ATOM   1653  C CG2 . THR B  1  11  ? 164.574 9.528  -22.099 1.00 80.22  ? 11   THR C CG2 1 
ATOM   1654  N N   . VAL B  1  12  ? 162.078 11.662 -21.373 1.00 78.20  ? 12   VAL C N   1 
ATOM   1655  C CA  . VAL B  1  12  ? 160.844 12.069 -22.045 1.00 77.40  ? 12   VAL C CA  1 
ATOM   1656  C C   . VAL B  1  12  ? 161.024 13.158 -23.104 1.00 76.65  ? 12   VAL C C   1 
ATOM   1657  O O   . VAL B  1  12  ? 161.886 14.026 -22.982 1.00 76.45  ? 12   VAL C O   1 
ATOM   1658  C CB  . VAL B  1  12  ? 159.800 12.559 -21.025 1.00 77.41  ? 12   VAL C CB  1 
ATOM   1659  C CG1 . VAL B  1  12  ? 160.189 13.926 -20.475 1.00 77.33  ? 12   VAL C CG1 1 
ATOM   1660  C CG2 . VAL B  1  12  ? 158.427 12.601 -21.667 1.00 77.49  ? 12   VAL C CG2 1 
ATOM   1661  N N   . SER B  1  13  ? 160.182 13.107 -24.136 1.00 75.81  ? 13   SER C N   1 
ATOM   1662  C CA  . SER B  1  13  ? 160.210 14.082 -25.222 1.00 75.11  ? 13   SER C CA  1 
ATOM   1663  C C   . SER B  1  13  ? 159.428 15.329 -24.827 1.00 74.48  ? 13   SER C C   1 
ATOM   1664  O O   . SER B  1  13  ? 158.439 15.242 -24.102 1.00 74.29  ? 13   SER C O   1 
ATOM   1665  C CB  . SER B  1  13  ? 159.603 13.482 -26.492 1.00 75.14  ? 13   SER C CB  1 
ATOM   1666  O OG  . SER B  1  13  ? 160.305 12.321 -26.896 1.00 75.05  ? 13   SER C OG  1 
ATOM   1667  N N   . GLU B  1  14  ? 159.870 16.483 -25.318 1.00 73.77  ? 14   GLU C N   1 
ATOM   1668  C CA  . GLU B  1  14  ? 159.233 17.761 -25.002 1.00 73.31  ? 14   GLU C CA  1 
ATOM   1669  C C   . GLU B  1  14  ? 157.799 17.882 -25.510 1.00 72.73  ? 14   GLU C C   1 
ATOM   1670  O O   . GLU B  1  14  ? 157.423 17.265 -26.508 1.00 72.74  ? 14   GLU C O   1 
ATOM   1671  C CB  . GLU B  1  14  ? 160.057 18.912 -25.571 1.00 73.41  ? 14   GLU C CB  1 
ATOM   1672  C CG  . GLU B  1  14  ? 159.508 20.285 -25.221 1.00 73.67  ? 14   GLU C CG  1 
ATOM   1673  C CD  . GLU B  1  14  ? 160.083 21.379 -26.093 1.00 74.12  ? 14   GLU C CD  1 
ATOM   1674  O OE1 . GLU B  1  14  ? 159.828 21.355 -27.317 1.00 74.12  ? 14   GLU C OE1 1 
ATOM   1675  O OE2 . GLU B  1  14  ? 160.787 22.261 -25.555 1.00 74.38  ? 14   GLU C OE2 1 
ATOM   1676  N N   . GLY B  1  15  ? 157.008 18.698 -24.815 1.00 71.96  ? 15   GLY C N   1 
ATOM   1677  C CA  . GLY B  1  15  ? 155.622 18.925 -25.180 1.00 71.20  ? 15   GLY C CA  1 
ATOM   1678  C C   . GLY B  1  15  ? 154.712 17.788 -24.758 1.00 70.55  ? 15   GLY C C   1 
ATOM   1679  O O   . GLY B  1  15  ? 153.492 17.903 -24.835 1.00 70.48  ? 15   GLY C O   1 
ATOM   1680  N N   . ALA B  1  16  ? 155.304 16.686 -24.310 1.00 69.80  ? 16   ALA C N   1 
ATOM   1681  C CA  . ALA B  1  16  ? 154.541 15.521 -23.876 1.00 69.31  ? 16   ALA C CA  1 
ATOM   1682  C C   . ALA B  1  16  ? 154.119 15.651 -22.411 1.00 69.01  ? 16   ALA C C   1 
ATOM   1683  O O   . ALA B  1  16  ? 154.210 16.726 -21.821 1.00 68.65  ? 16   ALA C O   1 
ATOM   1684  C CB  . ALA B  1  16  ? 155.362 14.257 -24.080 1.00 69.23  ? 16   ALA C CB  1 
ATOM   1685  N N   . SER B  1  17  ? 153.653 14.549 -21.832 1.00 68.74  ? 17   SER C N   1 
ATOM   1686  C CA  . SER B  1  17  ? 153.209 14.542 -20.443 1.00 68.60  ? 17   SER C CA  1 
ATOM   1687  C C   . SER B  1  17  ? 154.313 14.050 -19.516 1.00 68.61  ? 17   SER C C   1 
ATOM   1688  O O   . SER B  1  17  ? 155.101 13.182 -19.884 1.00 68.67  ? 17   SER C O   1 
ATOM   1689  C CB  . SER B  1  17  ? 151.955 13.675 -20.287 1.00 68.52  ? 17   SER C CB  1 
ATOM   1690  O OG  . SER B  1  17  ? 152.181 12.348 -20.729 1.00 68.12  ? 17   SER C OG  1 
ATOM   1691  N N   . LEU B  1  18  ? 154.362 14.618 -18.315 1.00 68.60  ? 18   LEU C N   1 
ATOM   1692  C CA  . LEU B  1  18  ? 155.365 14.248 -17.318 1.00 68.65  ? 18   LEU C CA  1 
ATOM   1693  C C   . LEU B  1  18  ? 154.713 13.562 -16.113 1.00 68.51  ? 18   LEU C C   1 
ATOM   1694  O O   . LEU B  1  18  ? 153.535 13.778 -15.834 1.00 68.59  ? 18   LEU C O   1 
ATOM   1695  C CB  . LEU B  1  18  ? 156.124 15.495 -16.862 1.00 68.66  ? 18   LEU C CB  1 
ATOM   1696  C CG  . LEU B  1  18  ? 157.185 15.310 -15.779 1.00 68.88  ? 18   LEU C CG  1 
ATOM   1697  C CD1 . LEU B  1  18  ? 158.167 14.214 -16.171 1.00 68.79  ? 18   LEU C CD1 1 
ATOM   1698  C CD2 . LEU B  1  18  ? 157.906 16.631 -15.547 1.00 68.88  ? 18   LEU C CD2 1 
ATOM   1699  N N   . GLN B  1  19  ? 155.480 12.743 -15.397 1.00 68.29  ? 19   GLN C N   1 
ATOM   1700  C CA  . GLN B  1  19  ? 154.953 12.029 -14.238 1.00 68.01  ? 19   GLN C CA  1 
ATOM   1701  C C   . GLN B  1  19  ? 156.075 11.437 -13.373 1.00 67.57  ? 19   GLN C C   1 
ATOM   1702  O O   . GLN B  1  19  ? 156.500 10.299 -13.576 1.00 67.58  ? 19   GLN C O   1 
ATOM   1703  C CB  . GLN B  1  19  ? 154.009 10.918 -14.709 1.00 68.13  ? 19   GLN C CB  1 
ATOM   1704  C CG  . GLN B  1  19  ? 152.695 10.820 -13.940 1.00 68.31  ? 19   GLN C CG  1 
ATOM   1705  C CD  . GLN B  1  19  ? 152.868 10.405 -12.493 1.00 68.56  ? 19   GLN C CD  1 
ATOM   1706  O OE1 . GLN B  1  19  ? 152.381 9.325  -12.096 1.00 68.56  ? 19   GLN C OE1 1 
ATOM   1707  N NE2 . GLN B  1  19  ? 153.526 11.223 -11.706 1.00 68.88  ? 19   GLN C NE2 1 
ATOM   1708  N N   . LEU B  1  20  ? 156.535 12.217 -12.399 1.00 67.03  ? 20   LEU C N   1 
ATOM   1709  C CA  . LEU B  1  20  ? 157.607 11.812 -11.487 1.00 66.67  ? 20   LEU C CA  1 
ATOM   1710  C C   . LEU B  1  20  ? 157.048 11.313 -10.148 1.00 66.35  ? 20   LEU C C   1 
ATOM   1711  O O   . LEU B  1  20  ? 156.991 12.057 -9.168  1.00 66.34  ? 20   LEU C O   1 
ATOM   1712  C CB  . LEU B  1  20  ? 158.544 12.993 -11.244 1.00 66.48  ? 20   LEU C CB  1 
ATOM   1713  C CG  . LEU B  1  20  ? 157.777 14.288 -10.955 1.00 66.50  ? 20   LEU C CG  1 
ATOM   1714  C CD1 . LEU B  1  20  ? 158.619 15.226 -10.138 1.00 66.30  ? 20   LEU C CD1 1 
ATOM   1715  C CD2 . LEU B  1  20  ? 157.310 14.949 -12.253 1.00 66.03  ? 20   LEU C CD2 1 
ATOM   1716  N N   . ARG B  1  21  ? 156.653 10.047 -10.112 1.00 66.02  ? 21   ARG C N   1 
ATOM   1717  C CA  . ARG B  1  21  ? 156.067 9.442  -8.915  1.00 65.82  ? 21   ARG C CA  1 
ATOM   1718  C C   . ARG B  1  21  ? 156.854 9.645  -7.617  1.00 65.41  ? 21   ARG C C   1 
ATOM   1719  O O   . ARG B  1  21  ? 158.078 9.755  -7.624  1.00 65.36  ? 21   ARG C O   1 
ATOM   1720  C CB  . ARG B  1  21  ? 155.844 7.948  -9.150  1.00 65.97  ? 21   ARG C CB  1 
ATOM   1721  C CG  . ARG B  1  21  ? 157.060 7.199  -9.655  1.00 66.59  ? 21   ARG C CG  1 
ATOM   1722  C CD  . ARG B  1  21  ? 156.791 5.709  -9.829  1.00 67.27  ? 21   ARG C CD  1 
ATOM   1723  N NE  . ARG B  1  21  ? 157.981 4.985  -10.262 1.00 67.79  ? 21   ARG C NE  1 
ATOM   1724  C CZ  . ARG B  1  21  ? 158.565 5.135  -11.443 1.00 68.39  ? 21   ARG C CZ  1 
ATOM   1725  N NH1 . ARG B  1  21  ? 158.065 5.984  -12.333 1.00 68.64  ? 21   ARG C NH1 1 
ATOM   1726  N NH2 . ARG B  1  21  ? 159.655 4.436  -11.736 1.00 68.19  ? 21   ARG C NH2 1 
ATOM   1727  N N   . CYS B  1  22  ? 156.117 9.691  -6.506  1.00 65.03  ? 22   CYS C N   1 
ATOM   1728  C CA  . CYS B  1  22  ? 156.674 9.858  -5.164  1.00 64.58  ? 22   CYS C CA  1 
ATOM   1729  C C   . CYS B  1  22  ? 155.829 9.113  -4.139  1.00 64.34  ? 22   CYS C C   1 
ATOM   1730  O O   . CYS B  1  22  ? 154.601 9.168  -4.176  1.00 64.21  ? 22   CYS C O   1 
ATOM   1731  C CB  . CYS B  1  22  ? 156.707 11.330 -4.758  1.00 64.49  ? 22   CYS C CB  1 
ATOM   1732  S SG  . CYS B  1  22  ? 157.220 11.600 -3.043  1.00 64.17  ? 22   CYS C SG  1 
ATOM   1733  N N   . LYS B  1  23  ? 156.489 8.435  -3.208  1.00 64.02  ? 23   LYS C N   1 
ATOM   1734  C CA  . LYS B  1  23  ? 155.777 7.703  -2.171  1.00 63.66  ? 23   LYS C CA  1 
ATOM   1735  C C   . LYS B  1  23  ? 156.331 7.986  -0.778  1.00 63.46  ? 23   LYS C C   1 
ATOM   1736  O O   . LYS B  1  23  ? 157.505 8.325  -0.614  1.00 63.49  ? 23   LYS C O   1 
ATOM   1737  C CB  . LYS B  1  23  ? 155.805 6.203  -2.461  1.00 63.59  ? 23   LYS C CB  1 
ATOM   1738  C CG  . LYS B  1  23  ? 154.795 5.768  -3.512  1.00 63.43  ? 23   LYS C CG  1 
ATOM   1739  C CD  . LYS B  1  23  ? 154.718 4.252  -3.619  1.00 63.37  ? 23   LYS C CD  1 
ATOM   1740  C CE  . LYS B  1  23  ? 153.625 3.806  -4.582  1.00 63.00  ? 23   LYS C CE  1 
ATOM   1741  N NZ  . LYS B  1  23  ? 153.556 2.321  -4.705  1.00 62.71  ? 23   LYS C NZ  1 
ATOM   1742  N N   . TYR B  1  24  ? 155.457 7.852  0.217   1.00 63.13  ? 24   TYR C N   1 
ATOM   1743  C CA  . TYR B  1  24  ? 155.800 8.084  1.615   1.00 62.70  ? 24   TYR C CA  1 
ATOM   1744  C C   . TYR B  1  24  ? 155.373 6.860  2.418   1.00 62.34  ? 24   TYR C C   1 
ATOM   1745  O O   . TYR B  1  24  ? 154.753 5.944  1.887   1.00 62.28  ? 24   TYR C O   1 
ATOM   1746  C CB  . TYR B  1  24  ? 155.069 9.326  2.144   1.00 62.58  ? 24   TYR C CB  1 
ATOM   1747  C CG  . TYR B  1  24  ? 153.563 9.151  2.171   1.00 62.84  ? 24   TYR C CG  1 
ATOM   1748  C CD1 . TYR B  1  24  ? 152.945 8.460  3.208   1.00 62.98  ? 24   TYR C CD1 1 
ATOM   1749  C CD2 . TYR B  1  24  ? 152.764 9.641  1.141   1.00 62.93  ? 24   TYR C CD2 1 
ATOM   1750  C CE1 . TYR B  1  24  ? 151.579 8.269  3.227   1.00 63.19  ? 24   TYR C CE1 1 
ATOM   1751  C CE2 . TYR B  1  24  ? 151.392 9.455  1.153   1.00 63.07  ? 24   TYR C CE2 1 
ATOM   1752  C CZ  . TYR B  1  24  ? 150.807 8.766  2.202   1.00 63.47  ? 24   TYR C CZ  1 
ATOM   1753  O OH  . TYR B  1  24  ? 149.446 8.559  2.242   1.00 63.98  ? 24   TYR C OH  1 
ATOM   1754  N N   . SER B  1  25  ? 155.705 6.859  3.701   1.00 62.10  ? 25   SER C N   1 
ATOM   1755  C CA  . SER B  1  25  ? 155.339 5.775  4.599   1.00 62.02  ? 25   SER C CA  1 
ATOM   1756  C C   . SER B  1  25  ? 155.073 6.415  5.954   1.00 61.86  ? 25   SER C C   1 
ATOM   1757  O O   . SER B  1  25  ? 156.002 6.895  6.606   1.00 61.73  ? 25   SER C O   1 
ATOM   1758  C CB  . SER B  1  25  ? 156.478 4.758  4.712   1.00 62.02  ? 25   SER C CB  1 
ATOM   1759  O OG  . SER B  1  25  ? 156.853 4.261  3.440   1.00 62.10  ? 25   SER C OG  1 
ATOM   1760  N N   . TYR B  1  26  ? 153.812 6.438  6.375   1.00 61.70  ? 26   TYR C N   1 
ATOM   1761  C CA  . TYR B  1  26  ? 153.470 7.071  7.644   1.00 61.58  ? 26   TYR C CA  1 
ATOM   1762  C C   . TYR B  1  26  ? 152.397 6.323  8.437   1.00 61.49  ? 26   TYR C C   1 
ATOM   1763  O O   . TYR B  1  26  ? 151.754 5.412  7.922   1.00 61.52  ? 26   TYR C O   1 
ATOM   1764  C CB  . TYR B  1  26  ? 153.024 8.530  7.402   1.00 61.49  ? 26   TYR C CB  1 
ATOM   1765  C CG  . TYR B  1  26  ? 153.536 9.440  8.491   1.00 61.49  ? 26   TYR C CG  1 
ATOM   1766  C CD1 . TYR B  1  26  ? 154.778 10.045 8.384   1.00 61.52  ? 26   TYR C CD1 1 
ATOM   1767  C CD2 . TYR B  1  26  ? 152.817 9.625  9.664   1.00 61.28  ? 26   TYR C CD2 1 
ATOM   1768  C CE1 . TYR B  1  26  ? 155.280 10.825 9.409   1.00 61.83  ? 26   TYR C CE1 1 
ATOM   1769  C CE2 . TYR B  1  26  ? 153.306 10.397 10.692  1.00 61.62  ? 26   TYR C CE2 1 
ATOM   1770  C CZ  . TYR B  1  26  ? 154.537 10.996 10.563  1.00 61.98  ? 26   TYR C CZ  1 
ATOM   1771  O OH  . TYR B  1  26  ? 155.026 11.765 11.594  1.00 62.55  ? 26   TYR C OH  1 
ATOM   1772  N N   . SER B  1  27  ? 152.225 6.721  9.698   1.00 61.39  ? 27   SER C N   1 
ATOM   1773  C CA  . SER B  1  27  ? 151.215 6.149  10.588  1.00 61.23  ? 27   SER C CA  1 
ATOM   1774  C C   . SER B  1  27  ? 149.930 6.973  10.494  1.00 61.03  ? 27   SER C C   1 
ATOM   1775  O O   . SER B  1  27  ? 148.853 6.516  10.876  1.00 60.92  ? 27   SER C O   1 
ATOM   1776  C CB  . SER B  1  27  ? 151.714 6.145  12.040  1.00 61.21  ? 27   SER C CB  1 
ATOM   1777  O OG  . SER B  1  27  ? 152.774 5.221  12.229  1.00 60.95  ? 27   SER C OG  1 
ATOM   1778  N N   . ALA B  1  28  ? 150.067 8.196  9.989   1.00 60.80  ? 28   ALA C N   1 
ATOM   1779  C CA  . ALA B  1  28  ? 148.955 9.120  9.812   1.00 60.65  ? 28   ALA C CA  1 
ATOM   1780  C C   . ALA B  1  28  ? 149.282 10.023 8.625   1.00 60.57  ? 28   ALA C C   1 
ATOM   1781  O O   . ALA B  1  28  ? 150.248 9.777  7.908   1.00 60.57  ? 28   ALA C O   1 
ATOM   1782  C CB  . ALA B  1  28  ? 148.748 9.944  11.068  1.00 60.54  ? 28   ALA C CB  1 
ATOM   1783  N N   . THR B  1  29  ? 148.492 11.073 8.418   1.00 60.44  ? 29   THR C N   1 
ATOM   1784  C CA  . THR B  1  29  ? 148.728 11.982 7.297   1.00 60.16  ? 29   THR C CA  1 
ATOM   1785  C C   . THR B  1  29  ? 149.751 13.065 7.643   1.00 59.90  ? 29   THR C C   1 
ATOM   1786  O O   . THR B  1  29  ? 149.593 13.791 8.622   1.00 59.78  ? 29   THR C O   1 
ATOM   1787  C CB  . THR B  1  29  ? 147.424 12.650 6.848   1.00 60.23  ? 29   THR C CB  1 
ATOM   1788  O OG1 . THR B  1  29  ? 146.415 11.654 6.629   1.00 60.45  ? 29   THR C OG1 1 
ATOM   1789  C CG2 . THR B  1  29  ? 147.620 13.356 5.502   1.00 60.25  ? 29   THR C CG2 1 
ATOM   1790  N N   . PRO B  1  30  ? 150.837 13.119 6.875   1.00 59.71  ? 30   PRO C N   1 
ATOM   1791  C CA  . PRO B  1  30  ? 151.898 14.113 7.028   1.00 59.46  ? 30   PRO C CA  1 
ATOM   1792  C C   . PRO B  1  30  ? 151.908 15.214 5.978   1.00 58.98  ? 30   PRO C C   1 
ATOM   1793  O O   . PRO B  1  30  ? 151.130 15.167 5.026   1.00 59.10  ? 30   PRO C O   1 
ATOM   1794  C CB  . PRO B  1  30  ? 153.135 13.245 6.869   1.00 59.66  ? 30   PRO C CB  1 
ATOM   1795  C CG  . PRO B  1  30  ? 152.734 12.380 5.700   1.00 59.62  ? 30   PRO C CG  1 
ATOM   1796  C CD  . PRO B  1  30  ? 151.273 12.036 5.978   1.00 59.78  ? 30   PRO C CD  1 
ATOM   1797  N N   . TYR B  1  31  ? 152.779 16.204 6.160   1.00 58.50  ? 31   TYR C N   1 
ATOM   1798  C CA  . TYR B  1  31  ? 152.906 17.282 5.190   1.00 58.20  ? 31   TYR C CA  1 
ATOM   1799  C C   . TYR B  1  31  ? 153.610 16.663 3.988   1.00 58.17  ? 31   TYR C C   1 
ATOM   1800  O O   . TYR B  1  31  ? 154.268 15.630 4.124   1.00 57.84  ? 31   TYR C O   1 
ATOM   1801  C CB  . TYR B  1  31  ? 153.755 18.430 5.726   1.00 58.12  ? 31   TYR C CB  1 
ATOM   1802  C CG  . TYR B  1  31  ? 153.100 19.354 6.733   1.00 57.78  ? 31   TYR C CG  1 
ATOM   1803  C CD1 . TYR B  1  31  ? 152.192 18.878 7.668   1.00 57.74  ? 31   TYR C CD1 1 
ATOM   1804  C CD2 . TYR B  1  31  ? 153.448 20.701 6.785   1.00 57.64  ? 31   TYR C CD2 1 
ATOM   1805  C CE1 . TYR B  1  31  ? 151.633 19.722 8.621   1.00 57.97  ? 31   TYR C CE1 1 
ATOM   1806  C CE2 . TYR B  1  31  ? 152.898 21.551 7.732   1.00 57.77  ? 31   TYR C CE2 1 
ATOM   1807  C CZ  . TYR B  1  31  ? 151.990 21.055 8.647   1.00 58.12  ? 31   TYR C CZ  1 
ATOM   1808  O OH  . TYR B  1  31  ? 151.436 21.894 9.588   1.00 58.26  ? 31   TYR C OH  1 
ATOM   1809  N N   . LEU B  1  32  ? 153.475 17.287 2.821   1.00 58.17  ? 32   LEU C N   1 
ATOM   1810  C CA  . LEU B  1  32  ? 154.090 16.781 1.602   1.00 58.25  ? 32   LEU C CA  1 
ATOM   1811  C C   . LEU B  1  32  ? 154.590 17.955 0.768   1.00 58.35  ? 32   LEU C C   1 
ATOM   1812  O O   . LEU B  1  32  ? 153.823 18.867 0.474   1.00 58.45  ? 32   LEU C O   1 
ATOM   1813  C CB  . LEU B  1  32  ? 153.069 15.975 0.795   1.00 58.42  ? 32   LEU C CB  1 
ATOM   1814  C CG  . LEU B  1  32  ? 152.384 14.789 1.479   1.00 58.95  ? 32   LEU C CG  1 
ATOM   1815  C CD1 . LEU B  1  32  ? 151.150 14.400 0.685   1.00 59.51  ? 32   LEU C CD1 1 
ATOM   1816  C CD2 . LEU B  1  32  ? 153.325 13.603 1.610   1.00 59.00  ? 32   LEU C CD2 1 
ATOM   1817  N N   . PHE B  1  33  ? 155.868 17.928 0.385   1.00 58.45  ? 33   PHE C N   1 
ATOM   1818  C CA  . PHE B  1  33  ? 156.467 19.016 -0.399  1.00 58.53  ? 33   PHE C CA  1 
ATOM   1819  C C   . PHE B  1  33  ? 157.170 18.561 -1.690  1.00 58.82  ? 33   PHE C C   1 
ATOM   1820  O O   . PHE B  1  33  ? 157.733 17.461 -1.758  1.00 58.64  ? 33   PHE C O   1 
ATOM   1821  C CB  . PHE B  1  33  ? 157.496 19.773 0.447   1.00 58.44  ? 33   PHE C CB  1 
ATOM   1822  C CG  . PHE B  1  33  ? 156.938 20.416 1.684   1.00 57.84  ? 33   PHE C CG  1 
ATOM   1823  C CD1 . PHE B  1  33  ? 156.548 19.652 2.772   1.00 57.56  ? 33   PHE C CD1 1 
ATOM   1824  C CD2 . PHE B  1  33  ? 156.845 21.798 1.773   1.00 57.61  ? 33   PHE C CD2 1 
ATOM   1825  C CE1 . PHE B  1  33  ? 156.051 20.259 3.922   1.00 57.86  ? 33   PHE C CE1 1 
ATOM   1826  C CE2 . PHE B  1  33  ? 156.356 22.409 2.911   1.00 57.59  ? 33   PHE C CE2 1 
ATOM   1827  C CZ  . PHE B  1  33  ? 155.957 21.641 3.990   1.00 57.67  ? 33   PHE C CZ  1 
ATOM   1828  N N   . TRP B  1  34  ? 157.145 19.435 -2.699  1.00 59.12  ? 34   TRP C N   1 
ATOM   1829  C CA  . TRP B  1  34  ? 157.811 19.198 -3.983  1.00 59.29  ? 34   TRP C CA  1 
ATOM   1830  C C   . TRP B  1  34  ? 158.773 20.349 -4.270  1.00 59.93  ? 34   TRP C C   1 
ATOM   1831  O O   . TRP B  1  34  ? 158.347 21.501 -4.374  1.00 59.83  ? 34   TRP C O   1 
ATOM   1832  C CB  . TRP B  1  34  ? 156.798 19.073 -5.129  1.00 58.90  ? 34   TRP C CB  1 
ATOM   1833  C CG  . TRP B  1  34  ? 156.402 17.656 -5.400  1.00 58.32  ? 34   TRP C CG  1 
ATOM   1834  C CD1 . TRP B  1  34  ? 155.166 17.103 -5.218  1.00 57.93  ? 34   TRP C CD1 1 
ATOM   1835  C CD2 . TRP B  1  34  ? 157.248 16.595 -5.876  1.00 57.61  ? 34   TRP C CD2 1 
ATOM   1836  N NE1 . TRP B  1  34  ? 155.188 15.769 -5.552  1.00 57.87  ? 34   TRP C NE1 1 
ATOM   1837  C CE2 . TRP B  1  34  ? 156.454 15.430 -5.959  1.00 57.53  ? 34   TRP C CE2 1 
ATOM   1838  C CE3 . TRP B  1  34  ? 158.597 16.511 -6.244  1.00 57.46  ? 34   TRP C CE3 1 
ATOM   1839  C CZ2 . TRP B  1  34  ? 156.964 14.200 -6.390  1.00 56.94  ? 34   TRP C CZ2 1 
ATOM   1840  C CZ3 . TRP B  1  34  ? 159.103 15.283 -6.674  1.00 56.86  ? 34   TRP C CZ3 1 
ATOM   1841  C CH2 . TRP B  1  34  ? 158.287 14.147 -6.741  1.00 56.79  ? 34   TRP C CH2 1 
ATOM   1842  N N   . TYR B  1  35  ? 160.061 20.027 -4.391  1.00 60.94  ? 35   TYR C N   1 
ATOM   1843  C CA  . TYR B  1  35  ? 161.115 21.017 -4.648  1.00 61.74  ? 35   TYR C CA  1 
ATOM   1844  C C   . TYR B  1  35  ? 161.987 20.679 -5.868  1.00 62.98  ? 35   TYR C C   1 
ATOM   1845  O O   . TYR B  1  35  ? 162.198 19.509 -6.194  1.00 62.95  ? 35   TYR C O   1 
ATOM   1846  C CB  . TYR B  1  35  ? 162.027 21.140 -3.419  1.00 61.38  ? 35   TYR C CB  1 
ATOM   1847  C CG  . TYR B  1  35  ? 161.575 22.134 -2.363  1.00 60.53  ? 35   TYR C CG  1 
ATOM   1848  C CD1 . TYR B  1  35  ? 161.012 21.708 -1.164  1.00 59.79  ? 35   TYR C CD1 1 
ATOM   1849  C CD2 . TYR B  1  35  ? 161.747 23.501 -2.552  1.00 59.98  ? 35   TYR C CD2 1 
ATOM   1850  C CE1 . TYR B  1  35  ? 160.617 22.625 -0.185  1.00 59.50  ? 35   TYR C CE1 1 
ATOM   1851  C CE2 . TYR B  1  35  ? 161.357 24.421 -1.589  1.00 59.28  ? 35   TYR C CE2 1 
ATOM   1852  C CZ  . TYR B  1  35  ? 160.793 23.982 -0.410  1.00 59.16  ? 35   TYR C CZ  1 
ATOM   1853  O OH  . TYR B  1  35  ? 160.408 24.909 0.536   1.00 58.00  ? 35   TYR C OH  1 
ATOM   1854  N N   . VAL B  1  36  ? 162.503 21.713 -6.529  1.00 64.57  ? 36   VAL C N   1 
ATOM   1855  C CA  . VAL B  1  36  ? 163.374 21.538 -7.692  1.00 66.03  ? 36   VAL C CA  1 
ATOM   1856  C C   . VAL B  1  36  ? 164.504 22.564 -7.696  1.00 67.67  ? 36   VAL C C   1 
ATOM   1857  O O   . VAL B  1  36  ? 164.291 23.738 -7.393  1.00 67.60  ? 36   VAL C O   1 
ATOM   1858  C CB  . VAL B  1  36  ? 162.597 21.657 -9.020  1.00 65.87  ? 36   VAL C CB  1 
ATOM   1859  C CG1 . VAL B  1  36  ? 161.681 20.475 -9.194  1.00 65.33  ? 36   VAL C CG1 1 
ATOM   1860  C CG2 . VAL B  1  36  ? 161.810 22.957 -9.073  1.00 65.64  ? 36   VAL C CG2 1 
ATOM   1861  N N   . GLN B  1  37  ? 165.704 22.109 -8.043  1.00 69.93  ? 37   GLN C N   1 
ATOM   1862  C CA  . GLN B  1  37  ? 166.880 22.971 -8.082  1.00 71.82  ? 37   GLN C CA  1 
ATOM   1863  C C   . GLN B  1  37  ? 167.611 22.806 -9.405  1.00 73.71  ? 37   GLN C C   1 
ATOM   1864  O O   . GLN B  1  37  ? 167.667 21.711 -9.968  1.00 73.75  ? 37   GLN C O   1 
ATOM   1865  C CB  . GLN B  1  37  ? 167.824 22.635 -6.917  1.00 71.84  ? 37   GLN C CB  1 
ATOM   1866  C CG  . GLN B  1  37  ? 169.235 23.251 -6.994  1.00 71.77  ? 37   GLN C CG  1 
ATOM   1867  C CD  . GLN B  1  37  ? 169.286 24.718 -6.601  1.00 71.56  ? 37   GLN C CD  1 
ATOM   1868  O OE1 . GLN B  1  37  ? 168.626 25.556 -7.213  1.00 71.80  ? 37   GLN C OE1 1 
ATOM   1869  N NE2 . GLN B  1  37  ? 170.083 25.032 -5.586  1.00 71.12  ? 37   GLN C NE2 1 
ATOM   1870  N N   . TYR B  1  38  ? 168.163 23.913 -9.892  1.00 76.03  ? 38   TYR C N   1 
ATOM   1871  C CA  . TYR B  1  38  ? 168.940 23.935 -11.120 1.00 77.90  ? 38   TYR C CA  1 
ATOM   1872  C C   . TYR B  1  38  ? 170.398 23.911 -10.678 1.00 79.10  ? 38   TYR C C   1 
ATOM   1873  O O   . TYR B  1  38  ? 170.713 24.422 -9.603  1.00 79.32  ? 38   TYR C O   1 
ATOM   1874  C CB  . TYR B  1  38  ? 168.664 25.227 -11.893 1.00 78.20  ? 38   TYR C CB  1 
ATOM   1875  C CG  . TYR B  1  38  ? 167.219 25.453 -12.307 1.00 79.30  ? 38   TYR C CG  1 
ATOM   1876  C CD1 . TYR B  1  38  ? 166.768 26.730 -12.633 1.00 80.12  ? 38   TYR C CD1 1 
ATOM   1877  C CD2 . TYR B  1  38  ? 166.314 24.397 -12.397 1.00 79.83  ? 38   TYR C CD2 1 
ATOM   1878  C CE1 . TYR B  1  38  ? 165.459 26.953 -13.030 1.00 80.46  ? 38   TYR C CE1 1 
ATOM   1879  C CE2 . TYR B  1  38  ? 165.000 24.612 -12.795 1.00 80.25  ? 38   TYR C CE2 1 
ATOM   1880  C CZ  . TYR B  1  38  ? 164.580 25.894 -13.109 1.00 80.47  ? 38   TYR C CZ  1 
ATOM   1881  O OH  . TYR B  1  38  ? 163.279 26.124 -13.502 1.00 80.51  ? 38   TYR C OH  1 
ATOM   1882  N N   . PRO B  1  39  ? 171.305 23.341 -11.472 1.00 80.53  ? 39   PRO C N   1 
ATOM   1883  C CA  . PRO B  1  39  ? 172.704 23.305 -11.042 1.00 81.33  ? 39   PRO C CA  1 
ATOM   1884  C C   . PRO B  1  39  ? 173.244 24.721 -10.801 1.00 82.06  ? 39   PRO C C   1 
ATOM   1885  O O   . PRO B  1  39  ? 173.606 25.431 -11.741 1.00 82.23  ? 39   PRO C O   1 
ATOM   1886  C CB  . PRO B  1  39  ? 173.405 22.601 -12.206 1.00 81.34  ? 39   PRO C CB  1 
ATOM   1887  C CG  . PRO B  1  39  ? 172.533 22.897 -13.372 1.00 81.15  ? 39   PRO C CG  1 
ATOM   1888  C CD  . PRO B  1  39  ? 171.143 22.739 -12.809 1.00 80.65  ? 39   PRO C CD  1 
ATOM   1889  N N   . ARG B  1  40  ? 173.272 25.109 -9.526  1.00 82.79  ? 40   ARG C N   1 
ATOM   1890  C CA  . ARG B  1  40  ? 173.734 26.425 -9.080  1.00 83.38  ? 40   ARG C CA  1 
ATOM   1891  C C   . ARG B  1  40  ? 172.714 27.500 -9.436  1.00 83.50  ? 40   ARG C C   1 
ATOM   1892  O O   . ARG B  1  40  ? 172.930 28.311 -10.337 1.00 83.52  ? 40   ARG C O   1 
ATOM   1893  C CB  . ARG B  1  40  ? 175.111 26.765 -9.658  1.00 83.62  ? 40   ARG C CB  1 
ATOM   1894  C CG  . ARG B  1  40  ? 175.829 27.883 -8.905  1.00 84.37  ? 40   ARG C CG  1 
ATOM   1895  C CD  . ARG B  1  40  ? 177.306 28.019 -9.279  1.00 85.07  ? 40   ARG C CD  1 
ATOM   1896  N NE  . ARG B  1  40  ? 177.991 29.054 -8.505  1.00 85.61  ? 40   ARG C NE  1 
ATOM   1897  C CZ  . ARG B  1  40  ? 178.217 28.996 -7.194  1.00 86.05  ? 40   ARG C CZ  1 
ATOM   1898  N NH1 . ARG B  1  40  ? 177.816 27.947 -6.484  1.00 86.07  ? 40   ARG C NH1 1 
ATOM   1899  N NH2 . ARG B  1  40  ? 178.844 29.993 -6.584  1.00 86.22  ? 40   ARG C NH2 1 
ATOM   1900  N N   . GLN B  1  41  ? 171.601 27.496 -8.711  1.00 83.65  ? 41   GLN C N   1 
ATOM   1901  C CA  . GLN B  1  41  ? 170.524 28.449 -8.942  1.00 83.73  ? 41   GLN C CA  1 
ATOM   1902  C C   . GLN B  1  41  ? 169.935 28.957 -7.631  1.00 83.67  ? 41   GLN C C   1 
ATOM   1903  O O   . GLN B  1  41  ? 169.767 30.161 -7.440  1.00 83.80  ? 41   GLN C O   1 
ATOM   1904  C CB  . GLN B  1  41  ? 169.425 27.792 -9.776  1.00 83.76  ? 41   GLN C CB  1 
ATOM   1905  C CG  . GLN B  1  41  ? 168.222 28.679 -10.017 1.00 84.05  ? 41   GLN C CG  1 
ATOM   1906  C CD  . GLN B  1  41  ? 168.596 29.993 -10.673 1.00 84.29  ? 41   GLN C CD  1 
ATOM   1907  O OE1 . GLN B  1  41  ? 169.167 30.008 -11.764 1.00 84.46  ? 41   GLN C OE1 1 
ATOM   1908  N NE2 . GLN B  1  41  ? 168.282 31.099 -10.009 1.00 84.34  ? 41   GLN C NE2 1 
ATOM   1909  N N   . GLY B  1  42  ? 169.627 28.031 -6.731  1.00 83.49  ? 42   GLY C N   1 
ATOM   1910  C CA  . GLY B  1  42  ? 169.025 28.370 -5.457  1.00 83.24  ? 42   GLY C CA  1 
ATOM   1911  C C   . GLY B  1  42  ? 167.734 27.581 -5.333  1.00 83.01  ? 42   GLY C C   1 
ATOM   1912  O O   . GLY B  1  42  ? 167.061 27.331 -6.335  1.00 82.99  ? 42   GLY C O   1 
ATOM   1913  N N   . LEU B  1  43  ? 167.379 27.187 -4.115  1.00 82.63  ? 43   LEU C N   1 
ATOM   1914  C CA  . LEU B  1  43  ? 166.177 26.385 -3.894  1.00 82.29  ? 43   LEU C CA  1 
ATOM   1915  C C   . LEU B  1  43  ? 164.870 27.171 -3.981  1.00 81.80  ? 43   LEU C C   1 
ATOM   1916  O O   . LEU B  1  43  ? 164.740 28.243 -3.392  1.00 81.81  ? 43   LEU C O   1 
ATOM   1917  C CB  . LEU B  1  43  ? 166.253 25.696 -2.537  1.00 82.31  ? 43   LEU C CB  1 
ATOM   1918  C CG  . LEU B  1  43  ? 165.142 24.673 -2.318  1.00 82.39  ? 43   LEU C CG  1 
ATOM   1919  C CD1 . LEU B  1  43  ? 165.163 23.632 -3.433  1.00 82.55  ? 43   LEU C CD1 1 
ATOM   1920  C CD2 . LEU B  1  43  ? 165.307 24.018 -0.965  1.00 82.47  ? 43   LEU C CD2 1 
ATOM   1921  N N   . GLN B  1  44  ? 163.897 26.613 -4.701  1.00 81.13  ? 44   GLN C N   1 
ATOM   1922  C CA  . GLN B  1  44  ? 162.598 27.259 -4.861  1.00 80.50  ? 44   GLN C CA  1 
ATOM   1923  C C   . GLN B  1  44  ? 161.433 26.287 -4.634  1.00 79.54  ? 44   GLN C C   1 
ATOM   1924  O O   . GLN B  1  44  ? 161.520 25.104 -4.966  1.00 79.34  ? 44   GLN C O   1 
ATOM   1925  C CB  . GLN B  1  44  ? 162.502 27.904 -6.248  1.00 80.76  ? 44   GLN C CB  1 
ATOM   1926  C CG  . GLN B  1  44  ? 161.593 29.131 -6.294  1.00 81.15  ? 44   GLN C CG  1 
ATOM   1927  C CD  . GLN B  1  44  ? 162.001 30.211 -5.299  1.00 81.45  ? 44   GLN C CD  1 
ATOM   1928  O OE1 . GLN B  1  44  ? 162.175 29.940 -4.109  1.00 81.13  ? 44   GLN C OE1 1 
ATOM   1929  N NE2 . GLN B  1  44  ? 162.147 31.439 -5.784  1.00 81.39  ? 44   GLN C NE2 1 
ATOM   1930  N N   . LEU B  1  45  ? 160.342 26.806 -4.071  1.00 78.47  ? 45   LEU C N   1 
ATOM   1931  C CA  . LEU B  1  45  ? 159.155 26.007 -3.753  1.00 77.51  ? 45   LEU C CA  1 
ATOM   1932  C C   . LEU B  1  45  ? 158.023 26.110 -4.779  1.00 76.51  ? 45   LEU C C   1 
ATOM   1933  O O   . LEU B  1  45  ? 157.719 27.190 -5.282  1.00 76.34  ? 45   LEU C O   1 
ATOM   1934  C CB  . LEU B  1  45  ? 158.617 26.421 -2.379  1.00 77.59  ? 45   LEU C CB  1 
ATOM   1935  C CG  . LEU B  1  45  ? 157.134 26.136 -2.119  1.00 77.75  ? 45   LEU C CG  1 
ATOM   1936  C CD1 . LEU B  1  45  ? 156.850 24.665 -2.320  1.00 77.94  ? 45   LEU C CD1 1 
ATOM   1937  C CD2 . LEU B  1  45  ? 156.735 26.567 -0.718  1.00 77.60  ? 45   LEU C CD2 1 
ATOM   1938  N N   . LEU B  1  46  ? 157.380 24.975 -5.052  1.00 75.33  ? 46   LEU C N   1 
ATOM   1939  C CA  . LEU B  1  46  ? 156.262 24.925 -5.992  1.00 74.26  ? 46   LEU C CA  1 
ATOM   1940  C C   . LEU B  1  46  ? 154.894 24.833 -5.314  1.00 73.46  ? 46   LEU C C   1 
ATOM   1941  O O   . LEU B  1  46  ? 154.089 25.758 -5.422  1.00 73.49  ? 46   LEU C O   1 
ATOM   1942  C CB  . LEU B  1  46  ? 156.439 23.759 -6.963  1.00 74.09  ? 46   LEU C CB  1 
ATOM   1943  C CG  . LEU B  1  46  ? 157.583 23.939 -7.963  1.00 73.48  ? 46   LEU C CG  1 
ATOM   1944  C CD1 . LEU B  1  46  ? 157.582 22.792 -8.957  1.00 72.87  ? 46   LEU C CD1 1 
ATOM   1945  C CD2 . LEU B  1  46  ? 157.451 25.272 -8.685  1.00 73.25  ? 46   LEU C CD2 1 
ATOM   1946  N N   . LEU B  1  47  ? 154.625 23.724 -4.627  1.00 72.36  ? 47   LEU C N   1 
ATOM   1947  C CA  . LEU B  1  47  ? 153.332 23.538 -3.964  1.00 71.48  ? 47   LEU C CA  1 
ATOM   1948  C C   . LEU B  1  47  ? 153.436 22.919 -2.569  1.00 70.59  ? 47   LEU C C   1 
ATOM   1949  O O   . LEU B  1  47  ? 154.276 22.049 -2.322  1.00 70.57  ? 47   LEU C O   1 
ATOM   1950  C CB  . LEU B  1  47  ? 152.408 22.680 -4.840  1.00 71.50  ? 47   LEU C CB  1 
ATOM   1951  C CG  . LEU B  1  47  ? 152.839 21.264 -5.242  1.00 71.60  ? 47   LEU C CG  1 
ATOM   1952  C CD1 . LEU B  1  47  ? 152.835 20.320 -4.054  1.00 71.74  ? 47   LEU C CD1 1 
ATOM   1953  C CD2 . LEU B  1  47  ? 151.899 20.739 -6.313  1.00 71.60  ? 47   LEU C CD2 1 
ATOM   1954  N N   . LYS B  1  48  ? 152.576 23.375 -1.661  1.00 69.25  ? 48   LYS C N   1 
ATOM   1955  C CA  . LYS B  1  48  ? 152.540 22.835 -0.305  1.00 68.05  ? 48   LYS C CA  1 
ATOM   1956  C C   . LYS B  1  48  ? 151.143 22.303 0.013   1.00 66.82  ? 48   LYS C C   1 
ATOM   1957  O O   . LYS B  1  48  ? 150.138 22.969 -0.253  1.00 66.76  ? 48   LYS C O   1 
ATOM   1958  C CB  . LYS B  1  48  ? 152.977 23.884 0.730   1.00 68.06  ? 48   LYS C CB  1 
ATOM   1959  C CG  . LYS B  1  48  ? 152.138 25.150 0.815   1.00 68.08  ? 48   LYS C CG  1 
ATOM   1960  C CD  . LYS B  1  48  ? 152.841 26.165 1.716   1.00 68.22  ? 48   LYS C CD  1 
ATOM   1961  C CE  . LYS B  1  48  ? 152.003 27.396 1.985   1.00 68.26  ? 48   LYS C CE  1 
ATOM   1962  N NZ  . LYS B  1  48  ? 151.575 28.066 0.726   1.00 68.61  ? 48   LYS C NZ  1 
ATOM   1963  N N   . TYR B  1  49  ? 151.091 21.100 0.583   1.00 65.07  ? 49   TYR C N   1 
ATOM   1964  C CA  . TYR B  1  49  ? 149.825 20.459 0.928   1.00 63.57  ? 49   TYR C CA  1 
ATOM   1965  C C   . TYR B  1  49  ? 149.691 20.150 2.427   1.00 62.53  ? 49   TYR C C   1 
ATOM   1966  O O   . TYR B  1  49  ? 150.023 19.058 2.878   1.00 62.31  ? 49   TYR C O   1 
ATOM   1967  C CB  . TYR B  1  49  ? 149.657 19.180 0.097   1.00 63.35  ? 49   TYR C CB  1 
ATOM   1968  C CG  . TYR B  1  49  ? 148.646 18.209 0.660   1.00 62.72  ? 49   TYR C CG  1 
ATOM   1969  C CD1 . TYR B  1  49  ? 147.325 18.585 0.871   1.00 62.18  ? 49   TYR C CD1 1 
ATOM   1970  C CD2 . TYR B  1  49  ? 149.020 16.918 1.000   1.00 62.21  ? 49   TYR C CD2 1 
ATOM   1971  C CE1 . TYR B  1  49  ? 146.408 17.694 1.401   1.00 61.68  ? 49   TYR C CE1 1 
ATOM   1972  C CE2 . TYR B  1  49  ? 148.115 16.023 1.531   1.00 61.34  ? 49   TYR C CE2 1 
ATOM   1973  C CZ  . TYR B  1  49  ? 146.811 16.415 1.727   1.00 61.43  ? 49   TYR C CZ  1 
ATOM   1974  O OH  . TYR B  1  49  ? 145.907 15.525 2.252   1.00 61.24  ? 49   TYR C OH  1 
ATOM   1975  N N   . TYR B  1  50  ? 149.200 21.126 3.189   1.00 61.41  ? 50   TYR C N   1 
ATOM   1976  C CA  . TYR B  1  50  ? 148.977 20.971 4.631   1.00 60.35  ? 50   TYR C CA  1 
ATOM   1977  C C   . TYR B  1  50  ? 147.819 19.972 4.787   1.00 59.77  ? 50   TYR C C   1 
ATOM   1978  O O   . TYR B  1  50  ? 148.049 18.812 5.116   1.00 59.54  ? 50   TYR C O   1 
ATOM   1979  C CB  . TYR B  1  50  ? 148.584 22.314 5.246   1.00 60.09  ? 50   TYR C CB  1 
ATOM   1980  C CG  . TYR B  1  50  ? 149.667 23.374 5.370   1.00 59.38  ? 50   TYR C CG  1 
ATOM   1981  C CD1 . TYR B  1  50  ? 149.329 24.677 5.713   1.00 59.33  ? 50   TYR C CD1 1 
ATOM   1982  C CD2 . TYR B  1  50  ? 151.015 23.080 5.186   1.00 58.90  ? 50   TYR C CD2 1 
ATOM   1983  C CE1 . TYR B  1  50  ? 150.291 25.663 5.859   1.00 59.25  ? 50   TYR C CE1 1 
ATOM   1984  C CE2 . TYR B  1  50  ? 151.991 24.064 5.333   1.00 58.82  ? 50   TYR C CE2 1 
ATOM   1985  C CZ  . TYR B  1  50  ? 151.620 25.354 5.671   1.00 59.13  ? 50   TYR C CZ  1 
ATOM   1986  O OH  . TYR B  1  50  ? 152.570 26.346 5.820   1.00 59.29  ? 50   TYR C OH  1 
ATOM   1987  N N   . SER B  1  51  ? 146.572 20.461 4.891   1.00 59.16  ? 51   SER C N   1 
ATOM   1988  C CA  . SER B  1  51  ? 145.526 19.803 4.110   1.00 58.54  ? 51   SER C CA  1 
ATOM   1989  C C   . SER B  1  51  ? 144.543 20.842 3.544   1.00 57.86  ? 51   SER C C   1 
ATOM   1990  O O   . SER B  1  51  ? 144.934 21.948 3.173   1.00 57.86  ? 51   SER C O   1 
ATOM   1991  C CB  . SER B  1  51  ? 144.808 18.674 4.843   1.00 58.78  ? 51   SER C CB  1 
ATOM   1992  O OG  . SER B  1  51  ? 143.830 18.071 4.004   1.00 59.48  ? 51   SER C OG  1 
ATOM   1993  N N   . GLY B  1  52  ? 143.284 20.448 3.452   1.00 57.05  ? 52   GLY C N   1 
ATOM   1994  C CA  . GLY B  1  52  ? 142.381 20.988 2.448   1.00 56.14  ? 52   GLY C CA  1 
ATOM   1995  C C   . GLY B  1  52  ? 142.196 20.033 1.271   1.00 55.50  ? 52   GLY C C   1 
ATOM   1996  O O   . GLY B  1  52  ? 142.259 18.809 1.433   1.00 55.21  ? 52   GLY C O   1 
ATOM   1997  N N   . ASP B  1  53  ? 141.948 20.605 0.091   1.00 54.86  ? 53   ASP C N   1 
ATOM   1998  C CA  . ASP B  1  53  ? 141.751 19.849 -1.148  1.00 54.34  ? 53   ASP C CA  1 
ATOM   1999  C C   . ASP B  1  53  ? 143.000 19.023 -1.388  1.00 54.38  ? 53   ASP C C   1 
ATOM   2000  O O   . ASP B  1  53  ? 144.107 19.520 -1.196  1.00 54.30  ? 53   ASP C O   1 
ATOM   2001  C CB  . ASP B  1  53  ? 141.558 20.824 -2.321  1.00 54.22  ? 53   ASP C CB  1 
ATOM   2002  C CG  . ASP B  1  53  ? 140.895 20.186 -3.540  1.00 53.42  ? 53   ASP C CG  1 
ATOM   2003  O OD1 . ASP B  1  53  ? 141.338 19.120 -4.020  1.00 51.41  ? 53   ASP C OD1 1 
ATOM   2004  O OD2 . ASP B  1  53  ? 139.916 20.729 -4.089  1.00 53.40  ? 53   ASP C OD2 1 
ATOM   2005  N N   . PRO B  1  54  ? 142.844 17.756 -1.772  1.00 54.58  ? 54   PRO C N   1 
ATOM   2006  C CA  . PRO B  1  54  ? 144.001 16.900 -2.051  1.00 54.77  ? 54   PRO C CA  1 
ATOM   2007  C C   . PRO B  1  54  ? 144.682 17.277 -3.362  1.00 55.24  ? 54   PRO C C   1 
ATOM   2008  O O   . PRO B  1  54  ? 145.342 16.444 -3.989  1.00 55.33  ? 54   PRO C O   1 
ATOM   2009  C CB  . PRO B  1  54  ? 143.384 15.504 -2.111  1.00 54.72  ? 54   PRO C CB  1 
ATOM   2010  C CG  . PRO B  1  54  ? 142.021 15.761 -2.627  1.00 54.96  ? 54   PRO C CG  1 
ATOM   2011  C CD  . PRO B  1  54  ? 141.587 16.998 -1.872  1.00 54.59  ? 54   PRO C CD  1 
ATOM   2012  N N   . VAL B  1  55  ? 144.511 18.536 -3.765  1.00 55.72  ? 55   VAL C N   1 
ATOM   2013  C CA  . VAL B  1  55  ? 145.141 19.081 -4.963  1.00 56.03  ? 55   VAL C CA  1 
ATOM   2014  C C   . VAL B  1  55  ? 145.329 20.593 -4.776  1.00 56.70  ? 55   VAL C C   1 
ATOM   2015  O O   . VAL B  1  55  ? 144.366 21.327 -4.561  1.00 56.16  ? 55   VAL C O   1 
ATOM   2016  C CB  . VAL B  1  55  ? 144.314 18.804 -6.247  1.00 55.86  ? 55   VAL C CB  1 
ATOM   2017  C CG1 . VAL B  1  55  ? 144.008 17.320 -6.383  1.00 55.43  ? 55   VAL C CG1 1 
ATOM   2018  C CG2 . VAL B  1  55  ? 143.047 19.611 -6.256  1.00 56.04  ? 55   VAL C CG2 1 
ATOM   2019  N N   . VAL B  1  56  ? 146.581 21.042 -4.838  1.00 57.77  ? 56   VAL C N   1 
ATOM   2020  C CA  . VAL B  1  56  ? 146.920 22.457 -4.682  1.00 58.72  ? 56   VAL C CA  1 
ATOM   2021  C C   . VAL B  1  56  ? 147.207 23.072 -6.048  1.00 59.61  ? 56   VAL C C   1 
ATOM   2022  O O   . VAL B  1  56  ? 147.529 22.358 -6.994  1.00 59.63  ? 56   VAL C O   1 
ATOM   2023  C CB  . VAL B  1  56  ? 148.175 22.629 -3.813  1.00 58.63  ? 56   VAL C CB  1 
ATOM   2024  C CG1 . VAL B  1  56  ? 148.330 24.082 -3.383  1.00 58.50  ? 56   VAL C CG1 1 
ATOM   2025  C CG2 . VAL B  1  56  ? 148.112 21.712 -2.601  1.00 58.96  ? 56   VAL C CG2 1 
ATOM   2026  N N   . GLN B  1  57  ? 147.113 24.393 -6.161  1.00 60.76  ? 57   GLN C N   1 
ATOM   2027  C CA  . GLN B  1  57  ? 147.384 25.033 -7.444  1.00 61.72  ? 57   GLN C CA  1 
ATOM   2028  C C   . GLN B  1  57  ? 148.879 25.309 -7.599  1.00 62.19  ? 57   GLN C C   1 
ATOM   2029  O O   . GLN B  1  57  ? 149.329 26.447 -7.457  1.00 62.41  ? 57   GLN C O   1 
ATOM   2030  C CB  . GLN B  1  57  ? 146.581 26.326 -7.594  1.00 61.89  ? 57   GLN C CB  1 
ATOM   2031  C CG  . GLN B  1  57  ? 146.337 26.730 -9.047  1.00 62.63  ? 57   GLN C CG  1 
ATOM   2032  C CD  . GLN B  1  57  ? 145.294 25.866 -9.751  1.00 63.18  ? 57   GLN C CD  1 
ATOM   2033  O OE1 . GLN B  1  57  ? 145.374 24.634 -9.741  1.00 63.89  ? 57   GLN C OE1 1 
ATOM   2034  N NE2 . GLN B  1  57  ? 144.320 26.515 -10.368 1.00 62.92  ? 57   GLN C NE2 1 
ATOM   2035  N N   . GLY B  1  58  ? 149.641 24.257 -7.892  1.00 62.71  ? 58   GLY C N   1 
ATOM   2036  C CA  . GLY B  1  58  ? 151.079 24.374 -8.066  1.00 62.89  ? 58   GLY C CA  1 
ATOM   2037  C C   . GLY B  1  58  ? 151.450 25.331 -9.184  1.00 63.14  ? 58   GLY C C   1 
ATOM   2038  O O   . GLY B  1  58  ? 151.084 25.117 -10.335 1.00 63.25  ? 58   GLY C O   1 
ATOM   2039  N N   . VAL B  1  59  ? 152.193 26.379 -8.837  1.00 63.45  ? 59   VAL C N   1 
ATOM   2040  C CA  . VAL B  1  59  ? 152.614 27.415 -9.787  1.00 63.50  ? 59   VAL C CA  1 
ATOM   2041  C C   . VAL B  1  59  ? 153.553 26.948 -10.902 1.00 63.51  ? 59   VAL C C   1 
ATOM   2042  O O   . VAL B  1  59  ? 154.436 26.120 -10.684 1.00 63.55  ? 59   VAL C O   1 
ATOM   2043  C CB  . VAL B  1  59  ? 153.276 28.600 -9.044  1.00 63.46  ? 59   VAL C CB  1 
ATOM   2044  C CG1 . VAL B  1  59  ? 153.973 29.524 -10.023 1.00 63.66  ? 59   VAL C CG1 1 
ATOM   2045  C CG2 . VAL B  1  59  ? 152.231 29.373 -8.257  1.00 63.42  ? 59   VAL C CG2 1 
ATOM   2046  N N   . ASN B  1  60  ? 153.334 27.514 -12.091 1.00 63.42  ? 60   ASN C N   1 
ATOM   2047  C CA  . ASN B  1  60  ? 154.130 27.264 -13.296 1.00 63.27  ? 60   ASN C CA  1 
ATOM   2048  C C   . ASN B  1  60  ? 153.851 25.950 -14.022 1.00 62.68  ? 60   ASN C C   1 
ATOM   2049  O O   . ASN B  1  60  ? 154.736 25.392 -14.667 1.00 62.66  ? 60   ASN C O   1 
ATOM   2050  C CB  . ASN B  1  60  ? 155.627 27.431 -13.009 1.00 63.68  ? 60   ASN C CB  1 
ATOM   2051  C CG  . ASN B  1  60  ? 156.079 28.885 -13.088 1.00 64.21  ? 60   ASN C CG  1 
ATOM   2052  O OD1 . ASN B  1  60  ? 155.462 29.772 -12.499 1.00 65.05  ? 60   ASN C OD1 1 
ATOM   2053  N ND2 . ASN B  1  60  ? 157.161 29.131 -13.820 1.00 64.53  ? 60   ASN C ND2 1 
ATOM   2054  N N   . GLY B  1  61  ? 152.615 25.468 -13.936 1.00 61.95  ? 61   GLY C N   1 
ATOM   2055  C CA  . GLY B  1  61  ? 152.229 24.260 -14.650 1.00 61.23  ? 61   GLY C CA  1 
ATOM   2056  C C   . GLY B  1  61  ? 152.391 22.936 -13.930 1.00 60.56  ? 61   GLY C C   1 
ATOM   2057  O O   . GLY B  1  61  ? 152.234 21.876 -14.542 1.00 60.50  ? 61   GLY C O   1 
ATOM   2058  N N   . PHE B  1  62  ? 152.697 22.978 -12.638 1.00 59.58  ? 62   PHE C N   1 
ATOM   2059  C CA  . PHE B  1  62  ? 152.860 21.750 -11.879 1.00 58.63  ? 62   PHE C CA  1 
ATOM   2060  C C   . PHE B  1  62  ? 151.775 21.636 -10.832 1.00 58.18  ? 62   PHE C C   1 
ATOM   2061  O O   . PHE B  1  62  ? 151.264 22.638 -10.336 1.00 57.97  ? 62   PHE C O   1 
ATOM   2062  C CB  . PHE B  1  62  ? 154.219 21.703 -11.183 1.00 58.74  ? 62   PHE C CB  1 
ATOM   2063  C CG  . PHE B  1  62  ? 155.305 22.454 -11.899 1.00 58.64  ? 62   PHE C CG  1 
ATOM   2064  C CD1 . PHE B  1  62  ? 155.406 23.830 -11.778 1.00 58.48  ? 62   PHE C CD1 1 
ATOM   2065  C CD2 . PHE B  1  62  ? 156.242 21.785 -12.669 1.00 58.47  ? 62   PHE C CD2 1 
ATOM   2066  C CE1 . PHE B  1  62  ? 156.413 24.525 -12.421 1.00 58.26  ? 62   PHE C CE1 1 
ATOM   2067  C CE2 . PHE B  1  62  ? 157.249 22.479 -13.314 1.00 58.21  ? 62   PHE C CE2 1 
ATOM   2068  C CZ  . PHE B  1  62  ? 157.331 23.855 -13.187 1.00 58.21  ? 62   PHE C CZ  1 
ATOM   2069  N N   . GLU B  1  63  ? 151.432 20.401 -10.493 1.00 57.71  ? 63   GLU C N   1 
ATOM   2070  C CA  . GLU B  1  63  ? 150.422 20.134 -9.486  1.00 57.26  ? 63   GLU C CA  1 
ATOM   2071  C C   . GLU B  1  63  ? 150.469 18.660 -9.110  1.00 57.41  ? 63   GLU C C   1 
ATOM   2072  O O   . GLU B  1  63  ? 150.612 17.793 -9.971  1.00 57.29  ? 63   GLU C O   1 
ATOM   2073  C CB  . GLU B  1  63  ? 149.029 20.510 -9.994  1.00 56.98  ? 63   GLU C CB  1 
ATOM   2074  C CG  . GLU B  1  63  ? 148.596 19.783 -11.251 1.00 55.96  ? 63   GLU C CG  1 
ATOM   2075  C CD  . GLU B  1  63  ? 147.168 20.117 -11.639 1.00 54.94  ? 63   GLU C CD  1 
ATOM   2076  O OE1 . GLU B  1  63  ? 146.831 21.319 -11.703 1.00 53.58  ? 63   GLU C OE1 1 
ATOM   2077  O OE2 . GLU B  1  63  ? 146.385 19.177 -11.880 1.00 54.40  ? 63   GLU C OE2 1 
ATOM   2078  N N   . ALA B  1  64  ? 150.354 18.385 -7.817  1.00 57.72  ? 64   ALA C N   1 
ATOM   2079  C CA  . ALA B  1  64  ? 150.400 17.019 -7.315  1.00 57.81  ? 64   ALA C CA  1 
ATOM   2080  C C   . ALA B  1  64  ? 149.106 16.650 -6.592  1.00 57.92  ? 64   ALA C C   1 
ATOM   2081  O O   . ALA B  1  64  ? 148.365 17.521 -6.137  1.00 57.86  ? 64   ALA C O   1 
ATOM   2082  C CB  . ALA B  1  64  ? 151.591 16.855 -6.389  1.00 57.75  ? 64   ALA C CB  1 
ATOM   2083  N N   . GLU B  1  65  ? 148.840 15.350 -6.499  1.00 58.07  ? 65   GLU C N   1 
ATOM   2084  C CA  . GLU B  1  65  ? 147.647 14.851 -5.826  1.00 58.20  ? 65   GLU C CA  1 
ATOM   2085  C C   . GLU B  1  65  ? 148.031 13.830 -4.762  1.00 58.35  ? 65   GLU C C   1 
ATOM   2086  O O   . GLU B  1  65  ? 149.009 13.100 -4.922  1.00 58.45  ? 65   GLU C O   1 
ATOM   2087  C CB  . GLU B  1  65  ? 146.694 14.217 -6.834  1.00 58.17  ? 65   GLU C CB  1 
ATOM   2088  C CG  . GLU B  1  65  ? 145.480 13.567 -6.196  1.00 58.42  ? 65   GLU C CG  1 
ATOM   2089  C CD  . GLU B  1  65  ? 144.427 13.187 -7.213  1.00 58.82  ? 65   GLU C CD  1 
ATOM   2090  O OE1 . GLU B  1  65  ? 143.542 12.369 -6.883  1.00 58.86  ? 65   GLU C OE1 1 
ATOM   2091  O OE2 . GLU B  1  65  ? 144.486 13.709 -8.345  1.00 59.26  ? 65   GLU C OE2 1 
ATOM   2092  N N   . PHE B  1  66  ? 147.256 13.785 -3.680  1.00 58.45  ? 66   PHE C N   1 
ATOM   2093  C CA  . PHE B  1  66  ? 147.523 12.871 -2.571  1.00 58.47  ? 66   PHE C CA  1 
ATOM   2094  C C   . PHE B  1  66  ? 146.492 11.764 -2.473  1.00 59.26  ? 66   PHE C C   1 
ATOM   2095  O O   . PHE B  1  66  ? 145.296 11.985 -2.681  1.00 59.13  ? 66   PHE C O   1 
ATOM   2096  C CB  . PHE B  1  66  ? 147.554 13.646 -1.253  1.00 57.94  ? 66   PHE C CB  1 
ATOM   2097  C CG  . PHE B  1  66  ? 147.450 12.784 -0.024  1.00 56.56  ? 66   PHE C CG  1 
ATOM   2098  C CD1 . PHE B  1  66  ? 146.436 12.999 0.895   1.00 55.35  ? 66   PHE C CD1 1 
ATOM   2099  C CD2 . PHE B  1  66  ? 148.376 11.788 0.234   1.00 55.44  ? 66   PHE C CD2 1 
ATOM   2100  C CE1 . PHE B  1  66  ? 146.337 12.232 2.036   1.00 54.55  ? 66   PHE C CE1 1 
ATOM   2101  C CE2 . PHE B  1  66  ? 148.278 11.018 1.379   1.00 55.17  ? 66   PHE C CE2 1 
ATOM   2102  C CZ  . PHE B  1  66  ? 147.257 11.241 2.279   1.00 54.49  ? 66   PHE C CZ  1 
ATOM   2103  N N   . SER B  1  67  ? 146.972 10.572 -2.145  1.00 60.14  ? 67   SER C N   1 
ATOM   2104  C CA  . SER B  1  67  ? 146.111 9.417  -1.979  1.00 61.14  ? 67   SER C CA  1 
ATOM   2105  C C   . SER B  1  67  ? 146.624 8.585  -0.823  1.00 61.87  ? 67   SER C C   1 
ATOM   2106  O O   . SER B  1  67  ? 147.668 7.945  -0.931  1.00 61.90  ? 67   SER C O   1 
ATOM   2107  C CB  . SER B  1  67  ? 146.093 8.567  -3.250  1.00 61.18  ? 67   SER C CB  1 
ATOM   2108  O OG  . SER B  1  67  ? 145.365 9.209  -4.278  1.00 61.52  ? 67   SER C OG  1 
ATOM   2109  N N   . LYS B  1  68  ? 145.908 8.603  0.293   1.00 62.78  ? 68   LYS C N   1 
ATOM   2110  C CA  . LYS B  1  68  ? 146.311 7.796  1.426   1.00 63.71  ? 68   LYS C CA  1 
ATOM   2111  C C   . LYS B  1  68  ? 145.933 6.374  1.045   1.00 64.68  ? 68   LYS C C   1 
ATOM   2112  O O   . LYS B  1  68  ? 146.371 5.404  1.662   1.00 64.85  ? 68   LYS C O   1 
ATOM   2113  C CB  . LYS B  1  68  ? 145.582 8.224  2.697   1.00 63.75  ? 68   LYS C CB  1 
ATOM   2114  C CG  . LYS B  1  68  ? 146.100 7.550  3.956   1.00 63.52  ? 68   LYS C CG  1 
ATOM   2115  C CD  . LYS B  1  68  ? 145.484 8.152  5.206   1.00 63.45  ? 68   LYS C CD  1 
ATOM   2116  C CE  . LYS B  1  68  ? 146.333 7.851  6.430   1.00 63.35  ? 68   LYS C CE  1 
ATOM   2117  N NZ  . LYS B  1  68  ? 147.745 8.295  6.232   1.00 63.17  ? 68   LYS C NZ  1 
ATOM   2118  N N   . SER B  1  69  ? 145.098 6.275  0.012   1.00 65.81  ? 69   SER C N   1 
ATOM   2119  C CA  . SER B  1  69  ? 144.647 4.999  -0.519  1.00 66.73  ? 69   SER C CA  1 
ATOM   2120  C C   . SER B  1  69  ? 145.846 4.342  -1.184  1.00 67.36  ? 69   SER C C   1 
ATOM   2121  O O   . SER B  1  69  ? 146.073 3.141  -1.046  1.00 67.41  ? 69   SER C O   1 
ATOM   2122  C CB  . SER B  1  69  ? 143.545 5.221  -1.557  1.00 66.88  ? 69   SER C CB  1 
ATOM   2123  O OG  . SER B  1  69  ? 142.459 5.950  -1.009  1.00 67.30  ? 69   SER C OG  1 
ATOM   2124  N N   . ASN B  1  70  ? 146.607 5.159  -1.907  1.00 68.10  ? 70   ASN C N   1 
ATOM   2125  C CA  . ASN B  1  70  ? 147.809 4.722  -2.602  1.00 68.86  ? 70   ASN C CA  1 
ATOM   2126  C C   . ASN B  1  70  ? 149.032 5.007  -1.749  1.00 67.38  ? 70   ASN C C   1 
ATOM   2127  O O   . ASN B  1  70  ? 150.072 4.361  -1.894  1.00 67.29  ? 70   ASN C O   1 
ATOM   2128  C CB  . ASN B  1  70  ? 147.940 5.457  -3.941  1.00 70.19  ? 70   ASN C CB  1 
ATOM   2129  C CG  . ASN B  1  70  ? 146.820 5.101  -4.904  1.00 75.72  ? 70   ASN C CG  1 
ATOM   2130  O OD1 . ASN B  1  70  ? 146.298 3.992  -4.838  1.00 77.12  ? 70   ASN C OD1 1 
ATOM   2131  N ND2 . ASN B  1  70  ? 146.436 6.029  -5.792  1.00 86.66  ? 70   ASN C ND2 1 
ATOM   2132  N N   . SER B  1  71  ? 148.887 5.983  -0.855  1.00 65.66  ? 71   SER C N   1 
ATOM   2133  C CA  . SER B  1  71  ? 149.967 6.410  0.017   1.00 64.17  ? 71   SER C CA  1 
ATOM   2134  C C   . SER B  1  71  ? 151.017 7.061  -0.873  1.00 62.54  ? 71   SER C C   1 
ATOM   2135  O O   . SER B  1  71  ? 152.206 6.772  -0.765  1.00 62.48  ? 71   SER C O   1 
ATOM   2136  C CB  . SER B  1  71  ? 150.561 5.216  0.762   1.00 64.32  ? 71   SER C CB  1 
ATOM   2137  O OG  . SER B  1  71  ? 149.570 4.230  1.010   1.00 64.45  ? 71   SER C OG  1 
ATOM   2138  N N   . SER B  1  72  ? 150.557 7.933  -1.764  1.00 60.55  ? 72   SER C N   1 
ATOM   2139  C CA  . SER B  1  72  ? 151.430 8.602  -2.717  1.00 59.07  ? 72   SER C CA  1 
ATOM   2140  C C   . SER B  1  72  ? 151.262 10.117 -2.700  1.00 57.40  ? 72   SER C C   1 
ATOM   2141  O O   . SER B  1  72  ? 150.587 10.669 -1.838  1.00 57.37  ? 72   SER C O   1 
ATOM   2142  C CB  . SER B  1  72  ? 151.132 8.094  -4.129  1.00 59.38  ? 72   SER C CB  1 
ATOM   2143  O OG  . SER B  1  72  ? 151.430 6.717  -4.265  1.00 59.89  ? 72   SER C OG  1 
ATOM   2144  N N   . PHE B  1  73  ? 151.881 10.775 -3.675  1.00 55.45  ? 73   PHE C N   1 
ATOM   2145  C CA  . PHE B  1  73  ? 151.821 12.225 -3.825  1.00 53.98  ? 73   PHE C CA  1 
ATOM   2146  C C   . PHE B  1  73  ? 152.478 12.574 -5.164  1.00 53.76  ? 73   PHE C C   1 
ATOM   2147  O O   . PHE B  1  73  ? 153.007 13.672 -5.353  1.00 53.56  ? 73   PHE C O   1 
ATOM   2148  C CB  . PHE B  1  73  ? 152.548 12.908 -2.666  1.00 53.09  ? 73   PHE C CB  1 
ATOM   2149  C CG  . PHE B  1  73  ? 152.387 14.411 -2.620  1.00 51.06  ? 73   PHE C CG  1 
ATOM   2150  C CD1 . PHE B  1  73  ? 151.131 15.001 -2.612  1.00 50.66  ? 73   PHE C CD1 1 
ATOM   2151  C CD2 . PHE B  1  73  ? 153.502 15.232 -2.540  1.00 49.58  ? 73   PHE C CD2 1 
ATOM   2152  C CE1 . PHE B  1  73  ? 150.996 16.398 -2.538  1.00 49.68  ? 73   PHE C CE1 1 
ATOM   2153  C CE2 . PHE B  1  73  ? 153.375 16.617 -2.466  1.00 48.76  ? 73   PHE C CE2 1 
ATOM   2154  C CZ  . PHE B  1  73  ? 152.123 17.200 -2.465  1.00 48.75  ? 73   PHE C CZ  1 
ATOM   2155  N N   . HIS B  1  74  ? 152.439 11.615 -6.086  1.00 53.47  ? 74   HIS C N   1 
ATOM   2156  C CA  . HIS B  1  74  ? 153.016 11.760 -7.419  1.00 53.28  ? 74   HIS C CA  1 
ATOM   2157  C C   . HIS B  1  74  ? 152.716 13.128 -8.033  1.00 53.38  ? 74   HIS C C   1 
ATOM   2158  O O   . HIS B  1  74  ? 151.582 13.603 -7.987  1.00 53.18  ? 74   HIS C O   1 
ATOM   2159  C CB  . HIS B  1  74  ? 152.465 10.670 -8.342  1.00 53.20  ? 74   HIS C CB  1 
ATOM   2160  C CG  . HIS B  1  74  ? 152.546 9.287  -7.769  1.00 53.17  ? 74   HIS C CG  1 
ATOM   2161  N ND1 . HIS B  1  74  ? 151.824 8.228  -8.277  1.00 52.90  ? 74   HIS C ND1 1 
ATOM   2162  C CD2 . HIS B  1  74  ? 153.258 8.792  -6.730  1.00 53.09  ? 74   HIS C CD2 1 
ATOM   2163  C CE1 . HIS B  1  74  ? 152.089 7.140  -7.575  1.00 52.97  ? 74   HIS C CE1 1 
ATOM   2164  N NE2 . HIS B  1  74  ? 152.956 7.456  -6.629  1.00 53.04  ? 74   HIS C NE2 1 
ATOM   2165  N N   . LEU B  1  75  ? 153.739 13.747 -8.616  1.00 53.75  ? 75   LEU C N   1 
ATOM   2166  C CA  . LEU B  1  75  ? 153.604 15.057 -9.251  1.00 54.28  ? 75   LEU C CA  1 
ATOM   2167  C C   . LEU B  1  75  ? 153.302 14.904 -10.747 1.00 54.71  ? 75   LEU C C   1 
ATOM   2168  O O   . LEU B  1  75  ? 153.569 13.857 -11.343 1.00 54.52  ? 75   LEU C O   1 
ATOM   2169  C CB  . LEU B  1  75  ? 154.889 15.878 -9.056  1.00 54.29  ? 75   LEU C CB  1 
ATOM   2170  C CG  . LEU B  1  75  ? 154.930 17.320 -9.581  1.00 54.06  ? 75   LEU C CG  1 
ATOM   2171  C CD1 . LEU B  1  75  ? 154.074 18.236 -8.733  1.00 53.50  ? 75   LEU C CD1 1 
ATOM   2172  C CD2 . LEU B  1  75  ? 156.360 17.815 -9.577  1.00 54.35  ? 75   LEU C CD2 1 
ATOM   2173  N N   . ARG B  1  76  ? 152.744 15.951 -11.345 1.00 55.31  ? 76   ARG C N   1 
ATOM   2174  C CA  . ARG B  1  76  ? 152.402 15.930 -12.763 1.00 55.91  ? 76   ARG C CA  1 
ATOM   2175  C C   . ARG B  1  76  ? 152.596 17.281 -13.446 1.00 56.62  ? 76   ARG C C   1 
ATOM   2176  O O   . ARG B  1  76  ? 152.328 18.328 -12.856 1.00 56.69  ? 76   ARG C O   1 
ATOM   2177  C CB  . ARG B  1  76  ? 150.959 15.484 -12.942 1.00 55.70  ? 76   ARG C CB  1 
ATOM   2178  C CG  . ARG B  1  76  ? 150.762 13.990 -12.916 1.00 55.71  ? 76   ARG C CG  1 
ATOM   2179  C CD  . ARG B  1  76  ? 149.456 13.627 -13.573 1.00 56.54  ? 76   ARG C CD  1 
ATOM   2180  N NE  . ARG B  1  76  ? 149.403 12.260 -14.077 1.00 56.96  ? 76   ARG C NE  1 
ATOM   2181  C CZ  . ARG B  1  76  ? 148.503 11.830 -14.956 1.00 56.25  ? 76   ARG C CZ  1 
ATOM   2182  N NH1 . ARG B  1  76  ? 147.584 12.663 -15.431 1.00 55.53  ? 76   ARG C NH1 1 
ATOM   2183  N NH2 . ARG B  1  76  ? 148.519 10.567 -15.360 1.00 56.34  ? 76   ARG C NH2 1 
ATOM   2184  N N   . LYS B  1  77  ? 153.052 17.244 -14.697 1.00 57.50  ? 77   LYS C N   1 
ATOM   2185  C CA  . LYS B  1  77  ? 153.286 18.458 -15.470 1.00 58.24  ? 77   LYS C CA  1 
ATOM   2186  C C   . LYS B  1  77  ? 152.250 18.629 -16.582 1.00 58.85  ? 77   LYS C C   1 
ATOM   2187  O O   . LYS B  1  77  ? 151.773 17.648 -17.157 1.00 58.90  ? 77   LYS C O   1 
ATOM   2188  C CB  . LYS B  1  77  ? 154.696 18.443 -16.061 1.00 58.54  ? 77   LYS C CB  1 
ATOM   2189  C CG  . LYS B  1  77  ? 154.989 19.608 -16.992 1.00 59.23  ? 77   LYS C CG  1 
ATOM   2190  C CD  . LYS B  1  77  ? 154.687 20.948 -16.331 1.00 59.99  ? 77   LYS C CD  1 
ATOM   2191  C CE  . LYS B  1  77  ? 154.822 22.097 -17.318 1.00 60.19  ? 77   LYS C CE  1 
ATOM   2192  N NZ  . LYS B  1  77  ? 154.522 23.418 -16.699 1.00 60.42  ? 77   LYS C NZ  1 
ATOM   2193  N N   . ALA B  1  78  ? 151.915 19.886 -16.875 1.00 59.58  ? 78   ALA C N   1 
ATOM   2194  C CA  . ALA B  1  78  ? 150.922 20.237 -17.889 1.00 60.02  ? 78   ALA C CA  1 
ATOM   2195  C C   . ALA B  1  78  ? 151.508 20.282 -19.299 1.00 60.62  ? 78   ALA C C   1 
ATOM   2196  O O   . ALA B  1  78  ? 151.136 19.483 -20.154 1.00 60.57  ? 78   ALA C O   1 
ATOM   2197  C CB  . ALA B  1  78  ? 150.292 21.576 -17.546 1.00 59.99  ? 78   ALA C CB  1 
ATOM   2198  N N   . SER B  1  79  ? 152.409 21.229 -19.542 1.00 61.49  ? 79   SER C N   1 
ATOM   2199  C CA  . SER B  1  79  ? 153.059 21.365 -20.841 1.00 62.29  ? 79   SER C CA  1 
ATOM   2200  C C   . SER B  1  79  ? 154.570 21.239 -20.650 1.00 62.92  ? 79   SER C C   1 
ATOM   2201  O O   . SER B  1  79  ? 155.277 22.239 -20.519 1.00 62.87  ? 79   SER C O   1 
ATOM   2202  C CB  . SER B  1  79  ? 152.715 22.717 -21.470 1.00 62.26  ? 79   SER C CB  1 
ATOM   2203  O OG  . SER B  1  79  ? 152.980 22.709 -22.861 1.00 62.45  ? 79   SER C OG  1 
ATOM   2204  N N   . VAL B  1  80  ? 155.054 20.001 -20.629 1.00 63.85  ? 80   VAL C N   1 
ATOM   2205  C CA  . VAL B  1  80  ? 156.473 19.724 -20.400 1.00 64.93  ? 80   VAL C CA  1 
ATOM   2206  C C   . VAL B  1  80  ? 157.399 20.435 -21.390 1.00 65.58  ? 80   VAL C C   1 
ATOM   2207  O O   . VAL B  1  80  ? 157.599 19.979 -22.517 1.00 65.54  ? 80   VAL C O   1 
ATOM   2208  C CB  . VAL B  1  80  ? 156.758 18.197 -20.411 1.00 65.07  ? 80   VAL C CB  1 
ATOM   2209  C CG1 . VAL B  1  80  ? 155.735 17.466 -19.542 1.00 65.30  ? 80   VAL C CG1 1 
ATOM   2210  C CG2 . VAL B  1  80  ? 156.750 17.643 -21.824 1.00 65.20  ? 80   VAL C CG2 1 
ATOM   2211  N N   . HIS B  1  81  ? 157.969 21.556 -20.958 1.00 66.43  ? 81   HIS C N   1 
ATOM   2212  C CA  . HIS B  1  81  ? 158.872 22.319 -21.819 1.00 67.09  ? 81   HIS C CA  1 
ATOM   2213  C C   . HIS B  1  81  ? 160.272 22.497 -21.239 1.00 67.39  ? 81   HIS C C   1 
ATOM   2214  O O   . HIS B  1  81  ? 160.452 22.920 -20.096 1.00 67.38  ? 81   HIS C O   1 
ATOM   2215  C CB  . HIS B  1  81  ? 158.259 23.675 -22.172 1.00 67.20  ? 81   HIS C CB  1 
ATOM   2216  C CG  . HIS B  1  81  ? 157.158 23.585 -23.182 1.00 67.77  ? 81   HIS C CG  1 
ATOM   2217  N ND1 . HIS B  1  81  ? 156.399 24.672 -23.558 1.00 68.45  ? 81   HIS C ND1 1 
ATOM   2218  C CD2 . HIS B  1  81  ? 156.685 22.533 -23.893 1.00 68.43  ? 81   HIS C CD2 1 
ATOM   2219  C CE1 . HIS B  1  81  ? 155.507 24.294 -24.456 1.00 68.68  ? 81   HIS C CE1 1 
ATOM   2220  N NE2 . HIS B  1  81  ? 155.659 23.001 -24.677 1.00 68.59  ? 81   HIS C NE2 1 
ATOM   2221  N N   . TRP B  1  82  ? 161.252 22.167 -22.074 1.00 67.77  ? 82   TRP C N   1 
ATOM   2222  C CA  . TRP B  1  82  ? 162.679 22.244 -21.765 1.00 68.00  ? 82   TRP C CA  1 
ATOM   2223  C C   . TRP B  1  82  ? 163.118 23.364 -20.815 1.00 67.76  ? 82   TRP C C   1 
ATOM   2224  O O   . TRP B  1  82  ? 164.060 23.186 -20.038 1.00 67.67  ? 82   TRP C O   1 
ATOM   2225  C CB  . TRP B  1  82  ? 163.450 22.365 -23.085 1.00 68.29  ? 82   TRP C CB  1 
ATOM   2226  C CG  . TRP B  1  82  ? 164.906 22.145 -22.937 1.00 68.87  ? 82   TRP C CG  1 
ATOM   2227  C CD1 . TRP B  1  82  ? 165.549 20.948 -22.871 1.00 69.38  ? 82   TRP C CD1 1 
ATOM   2228  C CD2 . TRP B  1  82  ? 165.913 23.151 -22.813 1.00 69.70  ? 82   TRP C CD2 1 
ATOM   2229  N NE1 . TRP B  1  82  ? 166.899 21.144 -22.716 1.00 69.89  ? 82   TRP C NE1 1 
ATOM   2230  C CE2 . TRP B  1  82  ? 167.149 22.491 -22.676 1.00 70.16  ? 82   TRP C CE2 1 
ATOM   2231  C CE3 . TRP B  1  82  ? 165.895 24.551 -22.803 1.00 70.14  ? 82   TRP C CE3 1 
ATOM   2232  C CZ2 . TRP B  1  82  ? 168.353 23.179 -22.532 1.00 70.61  ? 82   TRP C CZ2 1 
ATOM   2233  C CZ3 . TRP B  1  82  ? 167.091 25.234 -22.661 1.00 70.53  ? 82   TRP C CZ3 1 
ATOM   2234  C CH2 . TRP B  1  82  ? 168.302 24.547 -22.527 1.00 70.74  ? 82   TRP C CH2 1 
ATOM   2235  N N   . SER B  1  83  ? 162.445 24.508 -20.875 1.00 67.48  ? 83   SER C N   1 
ATOM   2236  C CA  . SER B  1  83  ? 162.809 25.663 -20.054 1.00 67.24  ? 83   SER C CA  1 
ATOM   2237  C C   . SER B  1  83  ? 162.686 25.453 -18.541 1.00 66.80  ? 83   SER C C   1 
ATOM   2238  O O   . SER B  1  83  ? 162.691 26.422 -17.780 1.00 66.82  ? 83   SER C O   1 
ATOM   2239  C CB  . SER B  1  83  ? 161.978 26.877 -20.466 1.00 67.33  ? 83   SER C CB  1 
ATOM   2240  O OG  . SER B  1  83  ? 162.528 28.066 -19.925 1.00 67.30  ? 83   SER C OG  1 
ATOM   2241  N N   . ASP B  1  84  ? 162.590 24.200 -18.104 1.00 66.11  ? 84   ASP C N   1 
ATOM   2242  C CA  . ASP B  1  84  ? 162.488 23.895 -16.678 1.00 65.47  ? 84   ASP C CA  1 
ATOM   2243  C C   . ASP B  1  84  ? 163.099 22.529 -16.330 1.00 64.55  ? 84   ASP C C   1 
ATOM   2244  O O   . ASP B  1  84  ? 162.899 22.024 -15.219 1.00 64.49  ? 84   ASP C O   1 
ATOM   2245  C CB  . ASP B  1  84  ? 161.023 23.935 -16.221 1.00 65.70  ? 84   ASP C CB  1 
ATOM   2246  C CG  . ASP B  1  84  ? 160.376 25.299 -16.412 1.00 66.09  ? 84   ASP C CG  1 
ATOM   2247  O OD1 . ASP B  1  84  ? 160.947 26.314 -15.950 1.00 66.37  ? 84   ASP C OD1 1 
ATOM   2248  O OD2 . ASP B  1  84  ? 159.283 25.424 -17.008 1.00 66.24  ? 84   ASP C OD2 1 
ATOM   2249  N N   . SER B  1  85  ? 163.839 21.940 -17.271 1.00 63.30  ? 85   SER C N   1 
ATOM   2250  C CA  . SER B  1  85  ? 164.486 20.640 -17.067 1.00 62.18  ? 85   SER C CA  1 
ATOM   2251  C C   . SER B  1  85  ? 165.324 20.668 -15.797 1.00 61.34  ? 85   SER C C   1 
ATOM   2252  O O   . SER B  1  85  ? 166.078 21.615 -15.587 1.00 61.10  ? 85   SER C O   1 
ATOM   2253  C CB  . SER B  1  85  ? 165.398 20.302 -18.249 1.00 62.10  ? 85   SER C CB  1 
ATOM   2254  O OG  . SER B  1  85  ? 164.721 20.417 -19.487 1.00 61.15  ? 85   SER C OG  1 
ATOM   2255  N N   . ALA B  1  86  ? 165.201 19.643 -14.953 1.00 60.51  ? 86   ALA C N   1 
ATOM   2256  C CA  . ALA B  1  86  ? 165.969 19.607 -13.704 1.00 59.82  ? 86   ALA C CA  1 
ATOM   2257  C C   . ALA B  1  86  ? 165.817 18.323 -12.888 1.00 59.59  ? 86   ALA C C   1 
ATOM   2258  O O   . ALA B  1  86  ? 165.564 17.246 -13.428 1.00 58.97  ? 86   ALA C O   1 
ATOM   2259  C CB  . ALA B  1  86  ? 165.605 20.809 -12.842 1.00 59.61  ? 86   ALA C CB  1 
ATOM   2260  N N   . VAL B  1  87  ? 166.010 18.467 -11.578 1.00 59.84  ? 87   VAL C N   1 
ATOM   2261  C CA  . VAL B  1  87  ? 165.900 17.378 -10.613 1.00 60.20  ? 87   VAL C CA  1 
ATOM   2262  C C   . VAL B  1  87  ? 164.725 17.670 -9.687  1.00 60.60  ? 87   VAL C C   1 
ATOM   2263  O O   . VAL B  1  87  ? 164.529 18.815 -9.272  1.00 60.46  ? 87   VAL C O   1 
ATOM   2264  C CB  . VAL B  1  87  ? 167.168 17.260 -9.753  1.00 60.23  ? 87   VAL C CB  1 
ATOM   2265  C CG1 . VAL B  1  87  ? 168.270 16.536 -10.519 1.00 60.42  ? 87   VAL C CG1 1 
ATOM   2266  C CG2 . VAL B  1  87  ? 167.634 18.642 -9.308  1.00 60.05  ? 87   VAL C CG2 1 
ATOM   2267  N N   . TYR B  1  88  ? 163.953 16.639 -9.357  1.00 61.08  ? 88   TYR C N   1 
ATOM   2268  C CA  . TYR B  1  88  ? 162.777 16.820 -8.506  1.00 61.69  ? 88   TYR C CA  1 
ATOM   2269  C C   . TYR B  1  88  ? 162.865 16.102 -7.169  1.00 61.98  ? 88   TYR C C   1 
ATOM   2270  O O   . TYR B  1  88  ? 163.043 14.884 -7.115  1.00 61.99  ? 88   TYR C O   1 
ATOM   2271  C CB  . TYR B  1  88  ? 161.513 16.369 -9.244  1.00 61.83  ? 88   TYR C CB  1 
ATOM   2272  C CG  . TYR B  1  88  ? 161.186 17.216 -10.454 1.00 62.12  ? 88   TYR C CG  1 
ATOM   2273  C CD1 . TYR B  1  88  ? 161.988 17.180 -11.589 1.00 62.80  ? 88   TYR C CD1 1 
ATOM   2274  C CD2 . TYR B  1  88  ? 160.081 18.062 -10.459 1.00 62.22  ? 88   TYR C CD2 1 
ATOM   2275  C CE1 . TYR B  1  88  ? 161.702 17.962 -12.694 1.00 62.77  ? 88   TYR C CE1 1 
ATOM   2276  C CE2 . TYR B  1  88  ? 159.788 18.846 -11.555 1.00 62.40  ? 88   TYR C CE2 1 
ATOM   2277  C CZ  . TYR B  1  88  ? 160.602 18.792 -12.671 1.00 62.91  ? 88   TYR C CZ  1 
ATOM   2278  O OH  . TYR B  1  88  ? 160.317 19.570 -13.770 1.00 63.22  ? 88   TYR C OH  1 
ATOM   2279  N N   . PHE B  1  89  ? 162.716 16.877 -6.095  1.00 62.40  ? 89   PHE C N   1 
ATOM   2280  C CA  . PHE B  1  89  ? 162.759 16.357 -4.734  1.00 62.66  ? 89   PHE C CA  1 
ATOM   2281  C C   . PHE B  1  89  ? 161.389 16.404 -4.071  1.00 63.37  ? 89   PHE C C   1 
ATOM   2282  O O   . PHE B  1  89  ? 160.685 17.414 -4.120  1.00 63.32  ? 89   PHE C O   1 
ATOM   2283  C CB  . PHE B  1  89  ? 163.786 17.128 -3.903  1.00 62.48  ? 89   PHE C CB  1 
ATOM   2284  C CG  . PHE B  1  89  ? 165.186 16.632 -4.100  1.00 62.18  ? 89   PHE C CG  1 
ATOM   2285  C CD1 . PHE B  1  89  ? 165.732 15.702 -3.228  1.00 62.01  ? 89   PHE C CD1 1 
ATOM   2286  C CD2 . PHE B  1  89  ? 165.934 17.045 -5.190  1.00 61.41  ? 89   PHE C CD2 1 
ATOM   2287  C CE1 . PHE B  1  89  ? 167.006 15.209 -3.427  1.00 61.86  ? 89   PHE C CE1 1 
ATOM   2288  C CE2 . PHE B  1  89  ? 167.211 16.557 -5.393  1.00 61.55  ? 89   PHE C CE2 1 
ATOM   2289  C CZ  . PHE B  1  89  ? 167.748 15.636 -4.512  1.00 61.50  ? 89   PHE C CZ  1 
ATOM   2290  N N   . CYS B  1  90  ? 161.032 15.291 -3.445  1.00 64.14  ? 90   CYS C N   1 
ATOM   2291  C CA  . CYS B  1  90  ? 159.758 15.136 -2.774  1.00 64.74  ? 90   CYS C CA  1 
ATOM   2292  C C   . CYS B  1  90  ? 160.050 14.796 -1.314  1.00 65.51  ? 90   CYS C C   1 
ATOM   2293  O O   . CYS B  1  90  ? 160.522 13.705 -1.020  1.00 65.64  ? 90   CYS C O   1 
ATOM   2294  C CB  . CYS B  1  90  ? 158.998 14.005 -3.463  1.00 64.59  ? 90   CYS C CB  1 
ATOM   2295  S SG  . CYS B  1  90  ? 157.373 13.605 -2.813  1.00 64.15  ? 90   CYS C SG  1 
ATOM   2296  N N   . ALA B  1  91  ? 159.792 15.732 -0.404  1.00 66.46  ? 91   ALA C N   1 
ATOM   2297  C CA  . ALA B  1  91  ? 160.075 15.512 1.018   1.00 67.01  ? 91   ALA C CA  1 
ATOM   2298  C C   . ALA B  1  91  ? 158.878 15.761 1.935   1.00 67.51  ? 91   ALA C C   1 
ATOM   2299  O O   . ALA B  1  91  ? 158.235 16.809 1.864   1.00 67.84  ? 91   ALA C O   1 
ATOM   2300  C CB  . ALA B  1  91  ? 161.241 16.381 1.452   1.00 67.07  ? 91   ALA C CB  1 
ATOM   2301  N N   . VAL B  1  92  ? 158.607 14.798 2.815   1.00 67.97  ? 92   VAL C N   1 
ATOM   2302  C CA  . VAL B  1  92  ? 157.493 14.891 3.758   1.00 68.22  ? 92   VAL C CA  1 
ATOM   2303  C C   . VAL B  1  92  ? 157.881 15.574 5.071   1.00 68.40  ? 92   VAL C C   1 
ATOM   2304  O O   . VAL B  1  92  ? 159.012 16.033 5.244   1.00 68.22  ? 92   VAL C O   1 
ATOM   2305  C CB  . VAL B  1  92  ? 156.918 13.493 4.095   1.00 68.39  ? 92   VAL C CB  1 
ATOM   2306  C CG1 . VAL B  1  92  ? 156.428 12.796 2.838   1.00 68.51  ? 92   VAL C CG1 1 
ATOM   2307  C CG2 . VAL B  1  92  ? 157.956 12.642 4.810   1.00 68.55  ? 92   VAL C CG2 1 
ATOM   2308  N N   . SER B  1  93  ? 156.916 15.627 5.985   1.00 68.59  ? 93   SER C N   1 
ATOM   2309  C CA  . SER B  1  93  ? 157.083 16.223 7.302   1.00 68.88  ? 93   SER C CA  1 
ATOM   2310  C C   . SER B  1  93  ? 156.171 15.483 8.263   1.00 69.06  ? 93   SER C C   1 
ATOM   2311  O O   . SER B  1  93  ? 154.958 15.420 8.052   1.00 69.24  ? 93   SER C O   1 
ATOM   2312  C CB  . SER B  1  93  ? 156.683 17.692 7.287   1.00 68.92  ? 93   SER C CB  1 
ATOM   2313  O OG  . SER B  1  93  ? 156.320 18.130 8.587   1.00 68.41  ? 93   SER C OG  1 
ATOM   2314  N N   . GLY B  1  94  ? 156.751 14.950 9.412   1.00 73.02  ? 99   GLY C N   1 
ATOM   2315  C CA  . GLY B  1  94  ? 155.888 14.221 10.319  1.00 73.28  ? 99   GLY C CA  1 
ATOM   2316  C C   . GLY B  1  94  ? 156.324 14.285 11.766  1.00 73.58  ? 99   GLY C C   1 
ATOM   2317  O O   . GLY B  1  94  ? 155.490 14.159 12.657  1.00 73.39  ? 99   GLY C O   1 
ATOM   2318  N N   . PHE B  1  95  ? 157.620 14.477 12.006  1.00 74.01  ? 100  PHE C N   1 
ATOM   2319  C CA  . PHE B  1  95  ? 158.147 14.529 13.372  1.00 74.38  ? 100  PHE C CA  1 
ATOM   2320  C C   . PHE B  1  95  ? 158.171 15.923 13.984  1.00 74.14  ? 100  PHE C C   1 
ATOM   2321  O O   . PHE B  1  95  ? 157.962 16.079 15.190  1.00 73.93  ? 100  PHE C O   1 
ATOM   2322  C CB  . PHE B  1  95  ? 159.553 13.925 13.425  1.00 74.78  ? 100  PHE C CB  1 
ATOM   2323  C CG  . PHE B  1  95  ? 159.590 12.516 13.957  1.00 76.14  ? 100  PHE C CG  1 
ATOM   2324  C CD1 . PHE B  1  95  ? 160.804 11.878 14.180  1.00 77.21  ? 100  PHE C CD1 1 
ATOM   2325  C CD2 . PHE B  1  95  ? 158.413 11.831 14.243  1.00 77.00  ? 100  PHE C CD2 1 
ATOM   2326  C CE1 . PHE B  1  95  ? 160.846 10.581 14.676  1.00 77.67  ? 100  PHE C CE1 1 
ATOM   2327  C CE2 . PHE B  1  95  ? 158.447 10.535 14.739  1.00 77.54  ? 100  PHE C CE2 1 
ATOM   2328  C CZ  . PHE B  1  95  ? 159.665 9.908  14.955  1.00 77.81  ? 100  PHE C CZ  1 
ATOM   2329  N N   . ALA B  1  96  ? 158.441 16.928 13.158  1.00 73.92  ? 101  ALA C N   1 
ATOM   2330  C CA  . ALA B  1  96  ? 158.503 18.309 13.618  1.00 73.62  ? 101  ALA C CA  1 
ATOM   2331  C C   . ALA B  1  96  ? 158.399 19.233 12.418  1.00 73.21  ? 101  ALA C C   1 
ATOM   2332  O O   . ALA B  1  96  ? 157.423 19.183 11.673  1.00 73.33  ? 101  ALA C O   1 
ATOM   2333  C CB  . ALA B  1  96  ? 159.799 18.557 14.363  1.00 73.79  ? 101  ALA C CB  1 
ATOM   2334  N N   . SER B  1  97  ? 159.414 20.068 12.227  1.00 72.70  ? 102  SER C N   1 
ATOM   2335  C CA  . SER B  1  97  ? 159.443 21.002 11.107  1.00 72.36  ? 102  SER C CA  1 
ATOM   2336  C C   . SER B  1  97  ? 160.595 20.701 10.138  1.00 71.70  ? 102  SER C C   1 
ATOM   2337  O O   . SER B  1  97  ? 160.893 21.495 9.243   1.00 71.66  ? 102  SER C O   1 
ATOM   2338  C CB  . SER B  1  97  ? 159.524 22.443 11.623  1.00 72.44  ? 102  SER C CB  1 
ATOM   2339  O OG  . SER B  1  97  ? 160.183 22.516 12.879  1.00 72.46  ? 102  SER C OG  1 
ATOM   2340  N N   . ALA B  1  98  ? 161.229 19.545 10.321  1.00 70.79  ? 103  ALA C N   1 
ATOM   2341  C CA  . ALA B  1  98  ? 162.337 19.126 9.472   1.00 70.06  ? 103  ALA C CA  1 
ATOM   2342  C C   . ALA B  1  98  ? 161.811 18.206 8.382   1.00 69.17  ? 103  ALA C C   1 
ATOM   2343  O O   . ALA B  1  98  ? 161.106 17.237 8.666   1.00 69.21  ? 103  ALA C O   1 
ATOM   2344  C CB  . ALA B  1  98  ? 163.407 18.408 10.297  1.00 70.14  ? 103  ALA C CB  1 
ATOM   2345  N N   . LEU B  1  99  ? 162.158 18.511 7.138   1.00 68.03  ? 104  LEU C N   1 
ATOM   2346  C CA  . LEU B  1  99  ? 161.712 17.718 6.003   1.00 67.09  ? 104  LEU C CA  1 
ATOM   2347  C C   . LEU B  1  99  ? 162.733 16.657 5.619   1.00 66.45  ? 104  LEU C C   1 
ATOM   2348  O O   . LEU B  1  99  ? 163.925 16.935 5.539   1.00 66.35  ? 104  LEU C O   1 
ATOM   2349  C CB  . LEU B  1  99  ? 161.452 18.625 4.800   1.00 66.91  ? 104  LEU C CB  1 
ATOM   2350  C CG  . LEU B  1  99  ? 160.397 19.717 4.983   1.00 66.56  ? 104  LEU C CG  1 
ATOM   2351  C CD1 . LEU B  1  99  ? 160.273 20.510 3.696   1.00 66.65  ? 104  LEU C CD1 1 
ATOM   2352  C CD2 . LEU B  1  99  ? 159.055 19.124 5.368   1.00 65.97  ? 104  LEU C CD2 1 
ATOM   2353  N N   . THR B  1  100 ? 162.251 15.441 5.385   1.00 65.82  ? 105  THR C N   1 
ATOM   2354  C CA  . THR B  1  100 ? 163.099 14.336 4.953   1.00 65.16  ? 105  THR C CA  1 
ATOM   2355  C C   . THR B  1  100 ? 162.898 14.159 3.447   1.00 64.77  ? 105  THR C C   1 
ATOM   2356  O O   . THR B  1  100 ? 161.786 13.895 2.987   1.00 64.30  ? 105  THR C O   1 
ATOM   2357  C CB  . THR B  1  100 ? 162.745 13.038 5.696   1.00 65.12  ? 105  THR C CB  1 
ATOM   2358  O OG1 . THR B  1  100 ? 161.328 12.812 5.653   1.00 65.38  ? 105  THR C OG1 1 
ATOM   2359  C CG2 . THR B  1  100 ? 163.099 13.150 7.172   1.00 65.11  ? 105  THR C CG2 1 
ATOM   2360  N N   . PHE B  1  101 ? 163.976 14.318 2.684   1.00 64.42  ? 106  PHE C N   1 
ATOM   2361  C CA  . PHE B  1  101 ? 163.912 14.218 1.229   1.00 64.06  ? 106  PHE C CA  1 
ATOM   2362  C C   . PHE B  1  101 ? 164.172 12.826 0.678   1.00 64.08  ? 106  PHE C C   1 
ATOM   2363  O O   . PHE B  1  101 ? 164.938 12.046 1.241   1.00 63.97  ? 106  PHE C O   1 
ATOM   2364  C CB  . PHE B  1  101 ? 164.908 15.187 0.597   1.00 63.97  ? 106  PHE C CB  1 
ATOM   2365  C CG  . PHE B  1  101 ? 164.581 16.629 0.836   1.00 63.38  ? 106  PHE C CG  1 
ATOM   2366  C CD1 . PHE B  1  101 ? 164.606 17.157 2.118   1.00 63.04  ? 106  PHE C CD1 1 
ATOM   2367  C CD2 . PHE B  1  101 ? 164.243 17.455 -0.220  1.00 63.11  ? 106  PHE C CD2 1 
ATOM   2368  C CE1 . PHE B  1  101 ? 164.300 18.489 2.343   1.00 63.04  ? 106  PHE C CE1 1 
ATOM   2369  C CE2 . PHE B  1  101 ? 163.935 18.791 -0.006  1.00 63.39  ? 106  PHE C CE2 1 
ATOM   2370  C CZ  . PHE B  1  101 ? 163.964 19.309 1.280   1.00 63.22  ? 106  PHE C CZ  1 
ATOM   2371  N N   . GLY B  1  102 ? 163.519 12.523 -0.437  1.00 64.20  ? 107  GLY C N   1 
ATOM   2372  C CA  . GLY B  1  102 ? 163.718 11.252 -1.094  1.00 64.45  ? 107  GLY C CA  1 
ATOM   2373  C C   . GLY B  1  102 ? 164.977 11.447 -1.908  1.00 64.78  ? 107  GLY C C   1 
ATOM   2374  O O   . GLY B  1  102 ? 165.444 12.577 -2.042  1.00 64.50  ? 107  GLY C O   1 
ATOM   2375  N N   . SER B  1  103 ? 165.541 10.372 -2.441  1.00 65.45  ? 108  SER C N   1 
ATOM   2376  C CA  . SER B  1  103 ? 166.751 10.498 -3.235  1.00 66.20  ? 108  SER C CA  1 
ATOM   2377  C C   . SER B  1  103 ? 166.526 11.563 -4.303  1.00 67.03  ? 108  SER C C   1 
ATOM   2378  O O   . SER B  1  103 ? 167.341 12.472 -4.468  1.00 67.07  ? 108  SER C O   1 
ATOM   2379  C CB  . SER B  1  103 ? 167.111 9.162  -3.879  1.00 66.20  ? 108  SER C CB  1 
ATOM   2380  O OG  . SER B  1  103 ? 167.319 8.168  -2.891  1.00 66.07  ? 108  SER C OG  1 
ATOM   2381  N N   . GLY B  1  104 ? 165.408 11.456 -5.016  1.00 67.98  ? 109  GLY C N   1 
ATOM   2382  C CA  . GLY B  1  104 ? 165.083 12.421 -6.048  1.00 68.83  ? 109  GLY C CA  1 
ATOM   2383  C C   . GLY B  1  104 ? 164.628 11.785 -7.345  1.00 69.80  ? 109  GLY C C   1 
ATOM   2384  O O   . GLY B  1  104 ? 164.017 10.715 -7.349  1.00 69.82  ? 109  GLY C O   1 
ATOM   2385  N N   . THR B  1  105 ? 164.926 12.462 -8.450  1.00 70.89  ? 110  THR C N   1 
ATOM   2386  C CA  . THR B  1  105 ? 164.561 11.993 -9.778  1.00 71.79  ? 110  THR C CA  1 
ATOM   2387  C C   . THR B  1  105 ? 164.961 13.025 -10.825 1.00 72.92  ? 110  THR C C   1 
ATOM   2388  O O   . THR B  1  105 ? 164.476 14.157 -10.812 1.00 72.95  ? 110  THR C O   1 
ATOM   2389  C CB  . THR B  1  105 ? 163.056 11.722 -9.870  1.00 71.66  ? 110  THR C CB  1 
ATOM   2390  O OG1 . THR B  1  105 ? 162.728 11.254 -11.185 1.00 71.43  ? 110  THR C OG1 1 
ATOM   2391  C CG2 . THR B  1  105 ? 162.248 13.003 -9.659  1.00 71.72  ? 110  THR C CG2 1 
ATOM   2392  N N   . LYS B  1  106 ? 165.858 12.629 -11.724 1.00 74.32  ? 111  LYS C N   1 
ATOM   2393  C CA  . LYS B  1  106 ? 166.323 13.511 -12.785 1.00 75.45  ? 111  LYS C CA  1 
ATOM   2394  C C   . LYS B  1  106 ? 165.380 13.437 -13.980 1.00 76.35  ? 111  LYS C C   1 
ATOM   2395  O O   . LYS B  1  106 ? 165.076 12.351 -14.476 1.00 76.20  ? 111  LYS C O   1 
ATOM   2396  C CB  . LYS B  1  106 ? 167.736 13.122 -13.217 1.00 75.61  ? 111  LYS C CB  1 
ATOM   2397  C CG  . LYS B  1  106 ? 168.328 14.041 -14.270 1.00 76.34  ? 111  LYS C CG  1 
ATOM   2398  C CD  . LYS B  1  106 ? 169.709 13.585 -14.694 1.00 77.40  ? 111  LYS C CD  1 
ATOM   2399  C CE  . LYS B  1  106 ? 170.317 14.529 -15.720 1.00 77.98  ? 111  LYS C CE  1 
ATOM   2400  N NZ  . LYS B  1  106 ? 171.671 14.087 -16.157 1.00 78.41  ? 111  LYS C NZ  1 
ATOM   2401  N N   . VAL B  1  107 ? 164.923 14.599 -14.439 1.00 77.71  ? 112  VAL C N   1 
ATOM   2402  C CA  . VAL B  1  107 ? 164.004 14.670 -15.571 1.00 78.94  ? 112  VAL C CA  1 
ATOM   2403  C C   . VAL B  1  107 ? 164.598 15.450 -16.740 1.00 80.37  ? 112  VAL C C   1 
ATOM   2404  O O   . VAL B  1  107 ? 165.026 16.595 -16.589 1.00 80.24  ? 112  VAL C O   1 
ATOM   2405  C CB  . VAL B  1  107 ? 162.666 15.316 -15.168 1.00 78.80  ? 112  VAL C CB  1 
ATOM   2406  C CG1 . VAL B  1  107 ? 161.792 15.528 -16.395 1.00 78.69  ? 112  VAL C CG1 1 
ATOM   2407  C CG2 . VAL B  1  107 ? 161.943 14.444 -14.149 1.00 78.51  ? 112  VAL C CG2 1 
ATOM   2408  N N   . ILE B  1  108 ? 164.605 14.821 -17.910 1.00 82.39  ? 113  ILE C N   1 
ATOM   2409  C CA  . ILE B  1  108 ? 165.140 15.433 -19.117 1.00 84.18  ? 113  ILE C CA  1 
ATOM   2410  C C   . ILE B  1  108 ? 164.048 15.562 -20.169 1.00 86.02  ? 113  ILE C C   1 
ATOM   2411  O O   . ILE B  1  108 ? 163.620 14.566 -20.747 1.00 86.16  ? 113  ILE C O   1 
ATOM   2412  C CB  . ILE B  1  108 ? 166.285 14.578 -19.681 1.00 84.12  ? 113  ILE C CB  1 
ATOM   2413  C CG1 . ILE B  1  108 ? 167.295 14.257 -18.576 1.00 84.05  ? 113  ILE C CG1 1 
ATOM   2414  C CG2 . ILE B  1  108 ? 166.958 15.305 -20.840 1.00 84.04  ? 113  ILE C CG2 1 
ATOM   2415  C CD1 . ILE B  1  108 ? 168.348 13.237 -18.971 1.00 83.86  ? 113  ILE C CD1 1 
ATOM   2416  N N   . VAL B  1  109 ? 163.596 16.788 -20.414 1.00 88.37  ? 114  VAL C N   1 
ATOM   2417  C CA  . VAL B  1  109 ? 162.556 17.034 -21.411 1.00 90.35  ? 114  VAL C CA  1 
ATOM   2418  C C   . VAL B  1  109 ? 163.179 17.399 -22.760 1.00 92.31  ? 114  VAL C C   1 
ATOM   2419  O O   . VAL B  1  109 ? 163.259 18.570 -23.135 1.00 92.43  ? 114  VAL C O   1 
ATOM   2420  C CB  . VAL B  1  109 ? 161.592 18.148 -20.967 1.00 90.28  ? 114  VAL C CB  1 
ATOM   2421  C CG1 . VAL B  1  109 ? 162.360 19.379 -20.564 1.00 90.15  ? 114  VAL C CG1 1 
ATOM   2422  C CG2 . VAL B  1  109 ? 160.611 18.471 -22.080 1.00 90.36  ? 114  VAL C CG2 1 
ATOM   2423  N N   . LEU B  1  110 ? 163.620 16.376 -23.480 1.00 94.67  ? 115  LEU C N   1 
ATOM   2424  C CA  . LEU B  1  110 ? 164.244 16.547 -24.785 1.00 96.63  ? 115  LEU C CA  1 
ATOM   2425  C C   . LEU B  1  110 ? 163.384 17.413 -25.700 1.00 98.23  ? 115  LEU C C   1 
ATOM   2426  O O   . LEU B  1  110 ? 162.250 17.052 -26.012 1.00 98.33  ? 115  LEU C O   1 
ATOM   2427  C CB  . LEU B  1  110 ? 164.470 15.180 -25.447 1.00 96.78  ? 115  LEU C CB  1 
ATOM   2428  C CG  . LEU B  1  110 ? 165.371 14.165 -24.733 1.00 97.24  ? 115  LEU C CG  1 
ATOM   2429  C CD1 . LEU B  1  110 ? 166.748 14.763 -24.495 1.00 97.51  ? 115  LEU C CD1 1 
ATOM   2430  C CD2 . LEU B  1  110 ? 164.756 13.712 -23.419 1.00 97.46  ? 115  LEU C CD2 1 
ATOM   2431  N N   . PRO B  1  111 ? 163.910 18.565 -26.117 1.00 100.20 ? 116  PRO C N   1 
ATOM   2432  C CA  . PRO B  1  111 ? 163.188 19.465 -27.016 1.00 101.57 ? 116  PRO C CA  1 
ATOM   2433  C C   . PRO B  1  111 ? 163.261 18.977 -28.459 1.00 103.07 ? 116  PRO C C   1 
ATOM   2434  O O   . PRO B  1  111 ? 164.018 18.054 -28.761 1.00 103.16 ? 116  PRO C O   1 
ATOM   2435  C CB  . PRO B  1  111 ? 163.937 20.781 -26.827 1.00 101.49 ? 116  PRO C CB  1 
ATOM   2436  C CG  . PRO B  1  111 ? 165.338 20.325 -26.673 1.00 100.91 ? 116  PRO C CG  1 
ATOM   2437  C CD  . PRO B  1  111 ? 165.206 19.149 -25.727 1.00 100.29 ? 116  PRO C CD  1 
ATOM   2438  N N   . TYR B  1  112 ? 162.474 19.586 -29.338 1.00 104.86 ? 117  TYR C N   1 
ATOM   2439  C CA  . TYR B  1  112 ? 162.460 19.188 -30.739 1.00 106.38 ? 117  TYR C CA  1 
ATOM   2440  C C   . TYR B  1  112 ? 163.003 20.322 -31.595 1.00 107.60 ? 117  TYR C C   1 
ATOM   2441  O O   . TYR B  1  112 ? 163.219 21.429 -31.106 1.00 107.66 ? 117  TYR C O   1 
ATOM   2442  C CB  . TYR B  1  112 ? 161.035 18.826 -31.181 1.00 106.49 ? 117  TYR C CB  1 
ATOM   2443  C CG  . TYR B  1  112 ? 160.273 19.974 -31.813 1.00 106.91 ? 117  TYR C CG  1 
ATOM   2444  C CD1 . TYR B  1  112 ? 160.375 20.234 -33.176 1.00 107.15 ? 117  TYR C CD1 1 
ATOM   2445  C CD2 . TYR B  1  112 ? 159.455 20.799 -31.049 1.00 107.29 ? 117  TYR C CD2 1 
ATOM   2446  C CE1 . TYR B  1  112 ? 159.691 21.284 -33.761 1.00 107.35 ? 117  TYR C CE1 1 
ATOM   2447  C CE2 . TYR B  1  112 ? 158.762 21.855 -31.627 1.00 107.52 ? 117  TYR C CE2 1 
ATOM   2448  C CZ  . TYR B  1  112 ? 158.886 22.091 -32.984 1.00 107.51 ? 117  TYR C CZ  1 
ATOM   2449  O OH  . TYR B  1  112 ? 158.204 23.136 -33.565 1.00 107.66 ? 117  TYR C OH  1 
ATOM   2450  N N   . ILE B  1  113 ? 163.223 20.041 -32.874 1.00 109.17 ? 118  ILE C N   1 
ATOM   2451  C CA  . ILE B  1  113 ? 163.720 21.046 -33.808 1.00 110.45 ? 118  ILE C CA  1 
ATOM   2452  C C   . ILE B  1  113 ? 163.117 20.869 -35.192 1.00 111.54 ? 118  ILE C C   1 
ATOM   2453  O O   . ILE B  1  113 ? 162.314 19.968 -35.433 1.00 111.68 ? 118  ILE C O   1 
ATOM   2454  C CB  . ILE B  1  113 ? 165.260 20.994 -33.919 1.00 110.48 ? 118  ILE C CB  1 
ATOM   2455  C CG1 . ILE B  1  113 ? 165.752 19.543 -33.959 1.00 110.50 ? 118  ILE C CG1 1 
ATOM   2456  C CG2 . ILE B  1  113 ? 165.893 21.756 -32.767 1.00 110.61 ? 118  ILE C CG2 1 
ATOM   2457  C CD1 . ILE B  1  113 ? 165.268 18.752 -35.161 1.00 110.40 ? 118  ILE C CD1 1 
ATOM   2458  N N   . GLN B  1  114 ? 163.524 21.746 -36.097 1.00 112.88 ? 119  GLN C N   1 
ATOM   2459  C CA  . GLN B  1  114 ? 163.070 21.719 -37.474 1.00 113.99 ? 119  GLN C CA  1 
ATOM   2460  C C   . GLN B  1  114 ? 164.298 22.050 -38.308 1.00 114.85 ? 119  GLN C C   1 
ATOM   2461  O O   . GLN B  1  114 ? 164.201 22.446 -39.469 1.00 114.94 ? 119  GLN C O   1 
ATOM   2462  C CB  . GLN B  1  114 ? 161.970 22.759 -37.682 1.00 114.08 ? 119  GLN C CB  1 
ATOM   2463  C CG  . GLN B  1  114 ? 160.775 22.555 -36.759 1.00 114.38 ? 119  GLN C CG  1 
ATOM   2464  C CD  . GLN B  1  114 ? 159.808 23.722 -36.750 1.00 114.70 ? 119  GLN C CD  1 
ATOM   2465  O OE1 . GLN B  1  114 ? 158.622 23.549 -37.097 1.00 114.85 ? 119  GLN C OE1 1 
ATOM   2466  N NE2 . GLN B  1  114 ? 160.273 24.884 -36.356 1.00 114.86 ? 119  GLN C NE2 1 
ATOM   2467  N N   . ASN B  1  115 ? 165.458 21.875 -37.680 1.00 115.93 ? 120  ASN C N   1 
ATOM   2468  C CA  . ASN B  1  115 ? 166.745 22.143 -38.295 1.00 116.85 ? 120  ASN C CA  1 
ATOM   2469  C C   . ASN B  1  115 ? 167.693 20.962 -38.040 1.00 117.70 ? 120  ASN C C   1 
ATOM   2470  O O   . ASN B  1  115 ? 168.817 21.163 -37.581 1.00 117.80 ? 120  ASN C O   1 
ATOM   2471  C CB  . ASN B  1  115 ? 167.318 23.437 -37.698 1.00 116.84 ? 120  ASN C CB  1 
ATOM   2472  C CG  . ASN B  1  115 ? 168.503 23.987 -38.475 1.00 116.87 ? 120  ASN C CG  1 
ATOM   2473  O OD1 . ASN B  1  115 ? 168.465 25.148 -38.933 1.00 116.82 ? 120  ASN C OD1 1 
ATOM   2474  N ND2 . ASN B  1  115 ? 169.546 23.210 -38.613 1.00 116.87 ? 120  ASN C ND2 1 
ATOM   2475  N N   . PRO B  1  116 ? 167.253 19.731 -38.331 1.00 118.71 ? 121  PRO C N   1 
ATOM   2476  C CA  . PRO B  1  116 ? 168.088 18.545 -38.103 1.00 119.34 ? 121  PRO C CA  1 
ATOM   2477  C C   . PRO B  1  116 ? 169.265 18.474 -39.077 1.00 119.99 ? 121  PRO C C   1 
ATOM   2478  O O   . PRO B  1  116 ? 169.091 18.178 -40.261 1.00 120.07 ? 121  PRO C O   1 
ATOM   2479  C CB  . PRO B  1  116 ? 167.106 17.395 -38.331 1.00 119.30 ? 121  PRO C CB  1 
ATOM   2480  C CG  . PRO B  1  116 ? 166.206 17.935 -39.375 1.00 119.13 ? 121  PRO C CG  1 
ATOM   2481  C CD  . PRO B  1  116 ? 165.948 19.348 -38.902 1.00 118.79 ? 121  PRO C CD  1 
ATOM   2482  N N   . GLU B  1  117 ? 170.458 18.747 -38.557 1.00 120.75 ? 122  GLU C N   1 
ATOM   2483  C CA  . GLU B  1  117 ? 171.681 18.763 -39.355 1.00 121.34 ? 122  GLU C CA  1 
ATOM   2484  C C   . GLU B  1  117 ? 172.809 17.956 -38.700 1.00 121.87 ? 122  GLU C C   1 
ATOM   2485  O O   . GLU B  1  117 ? 173.628 18.512 -37.968 1.00 121.89 ? 122  GLU C O   1 
ATOM   2486  C CB  . GLU B  1  117 ? 172.127 20.211 -39.546 1.00 121.33 ? 122  GLU C CB  1 
ATOM   2487  C CG  . GLU B  1  117 ? 171.969 21.042 -38.282 1.00 121.30 ? 122  GLU C CG  1 
ATOM   2488  C CD  . GLU B  1  117 ? 172.307 22.502 -38.478 1.00 121.20 ? 122  GLU C CD  1 
ATOM   2489  O OE1 . GLU B  1  117 ? 171.757 23.127 -39.408 1.00 121.07 ? 122  GLU C OE1 1 
ATOM   2490  O OE2 . GLU B  1  117 ? 173.117 23.029 -37.691 1.00 121.17 ? 122  GLU C OE2 1 
ATOM   2491  N N   . PRO B  1  118 ? 172.860 16.650 -38.970 1.00 122.55 ? 123  PRO C N   1 
ATOM   2492  C CA  . PRO B  1  118 ? 173.887 15.771 -38.399 1.00 123.02 ? 123  PRO C CA  1 
ATOM   2493  C C   . PRO B  1  118 ? 175.264 16.037 -39.001 1.00 123.55 ? 123  PRO C C   1 
ATOM   2494  O O   . PRO B  1  118 ? 175.587 15.536 -40.078 1.00 123.61 ? 123  PRO C O   1 
ATOM   2495  C CB  . PRO B  1  118 ? 173.377 14.380 -38.778 1.00 122.98 ? 123  PRO C CB  1 
ATOM   2496  C CG  . PRO B  1  118 ? 172.707 14.619 -40.078 1.00 122.80 ? 123  PRO C CG  1 
ATOM   2497  C CD  . PRO B  1  118 ? 171.939 15.891 -39.833 1.00 122.61 ? 123  PRO C CD  1 
ATOM   2498  N N   . ALA B  1  119 ? 176.068 16.828 -38.299 1.00 124.17 ? 124  ALA C N   1 
ATOM   2499  C CA  . ALA B  1  119 ? 177.399 17.180 -38.779 1.00 124.68 ? 124  ALA C CA  1 
ATOM   2500  C C   . ALA B  1  119 ? 178.479 16.941 -37.727 1.00 125.18 ? 124  ALA C C   1 
ATOM   2501  O O   . ALA B  1  119 ? 178.186 16.576 -36.588 1.00 125.18 ? 124  ALA C O   1 
ATOM   2502  C CB  . ALA B  1  119 ? 177.416 18.632 -39.224 1.00 124.68 ? 124  ALA C CB  1 
ATOM   2503  N N   . VAL B  1  120 ? 179.730 17.152 -38.131 1.00 125.83 ? 125  VAL C N   1 
ATOM   2504  C CA  . VAL B  1  120 ? 180.889 16.985 -37.259 1.00 126.34 ? 125  VAL C CA  1 
ATOM   2505  C C   . VAL B  1  120 ? 182.022 17.899 -37.736 1.00 126.74 ? 125  VAL C C   1 
ATOM   2506  O O   . VAL B  1  120 ? 182.870 17.482 -38.526 1.00 126.82 ? 125  VAL C O   1 
ATOM   2507  C CB  . VAL B  1  120 ? 181.397 15.531 -37.266 1.00 126.36 ? 125  VAL C CB  1 
ATOM   2508  C CG1 . VAL B  1  120 ? 182.651 15.410 -36.416 1.00 126.37 ? 125  VAL C CG1 1 
ATOM   2509  C CG2 . VAL B  1  120 ? 180.319 14.585 -36.763 1.00 126.43 ? 125  VAL C CG2 1 
ATOM   2510  N N   . TYR B  1  121 ? 182.035 19.140 -37.258 1.00 127.20 ? 126  TYR C N   1 
ATOM   2511  C CA  . TYR B  1  121 ? 183.055 20.113 -37.658 1.00 127.59 ? 126  TYR C CA  1 
ATOM   2512  C C   . TYR B  1  121 ? 184.361 19.963 -36.875 1.00 127.72 ? 126  TYR C C   1 
ATOM   2513  O O   . TYR B  1  121 ? 184.556 18.984 -36.159 1.00 127.79 ? 126  TYR C O   1 
ATOM   2514  C CB  . TYR B  1  121 ? 182.517 21.537 -37.502 1.00 127.70 ? 126  TYR C CB  1 
ATOM   2515  C CG  . TYR B  1  121 ? 181.351 21.859 -38.413 1.00 128.11 ? 126  TYR C CG  1 
ATOM   2516  C CD1 . TYR B  1  121 ? 180.079 21.360 -38.155 1.00 128.50 ? 126  TYR C CD1 1 
ATOM   2517  C CD2 . TYR B  1  121 ? 181.522 22.667 -39.532 1.00 128.44 ? 126  TYR C CD2 1 
ATOM   2518  C CE1 . TYR B  1  121 ? 179.010 21.654 -38.990 1.00 128.73 ? 126  TYR C CE1 1 
ATOM   2519  C CE2 . TYR B  1  121 ? 180.461 22.965 -40.371 1.00 128.63 ? 126  TYR C CE2 1 
ATOM   2520  C CZ  . TYR B  1  121 ? 179.209 22.459 -40.096 1.00 128.75 ? 126  TYR C CZ  1 
ATOM   2521  O OH  . TYR B  1  121 ? 178.156 22.759 -40.930 1.00 128.86 ? 126  TYR C OH  1 
ATOM   2522  N N   . ALA B  1  122 ? 185.252 20.944 -37.023 1.00 127.83 ? 127  ALA C N   1 
ATOM   2523  C CA  . ALA B  1  122 ? 186.548 20.936 -36.345 1.00 127.85 ? 127  ALA C CA  1 
ATOM   2524  C C   . ALA B  1  122 ? 186.844 22.280 -35.674 1.00 127.77 ? 127  ALA C C   1 
ATOM   2525  O O   . ALA B  1  122 ? 186.234 23.299 -35.999 1.00 127.82 ? 127  ALA C O   1 
ATOM   2526  C CB  . ALA B  1  122 ? 187.650 20.592 -37.338 1.00 127.87 ? 127  ALA C CB  1 
ATOM   2527  N N   . LEU B  1  123 ? 187.789 22.273 -34.737 1.00 127.62 ? 128  LEU C N   1 
ATOM   2528  C CA  . LEU B  1  123 ? 188.164 23.482 -34.009 1.00 127.49 ? 128  LEU C CA  1 
ATOM   2529  C C   . LEU B  1  123 ? 189.571 23.369 -33.422 1.00 127.34 ? 128  LEU C C   1 
ATOM   2530  O O   . LEU B  1  123 ? 189.934 22.343 -32.845 1.00 127.36 ? 128  LEU C O   1 
ATOM   2531  C CB  . LEU B  1  123 ? 187.152 23.765 -32.892 1.00 127.48 ? 128  LEU C CB  1 
ATOM   2532  C CG  . LEU B  1  123 ? 186.882 22.650 -31.881 1.00 127.54 ? 128  LEU C CG  1 
ATOM   2533  C CD1 . LEU B  1  123 ? 186.046 23.192 -30.734 1.00 127.58 ? 128  LEU C CD1 1 
ATOM   2534  C CD2 . LEU B  1  123 ? 186.177 21.478 -32.544 1.00 127.53 ? 128  LEU C CD2 1 
ATOM   2535  N N   . LYS B  1  124 ? 190.359 24.430 -33.578 1.00 127.09 ? 129  LYS C N   1 
ATOM   2536  C CA  . LYS B  1  124 ? 191.726 24.459 -33.075 1.00 126.84 ? 129  LYS C CA  1 
ATOM   2537  C C   . LYS B  1  124 ? 191.905 25.655 -32.155 1.00 126.74 ? 129  LYS C C   1 
ATOM   2538  O O   . LYS B  1  124 ? 191.060 26.546 -32.109 1.00 126.67 ? 129  LYS C O   1 
ATOM   2539  C CB  . LYS B  1  124 ? 192.724 24.538 -34.235 1.00 126.78 ? 129  LYS C CB  1 
ATOM   2540  C CG  . LYS B  1  124 ? 192.693 23.333 -35.174 1.00 126.54 ? 129  LYS C CG  1 
ATOM   2541  C CD  . LYS B  1  124 ? 191.438 23.297 -36.039 1.00 126.18 ? 129  LYS C CD  1 
ATOM   2542  C CE  . LYS B  1  124 ? 191.389 22.043 -36.901 1.00 125.94 ? 129  LYS C CE  1 
ATOM   2543  N NZ  . LYS B  1  124 ? 190.204 22.015 -37.800 1.00 125.68 ? 129  LYS C NZ  1 
ATOM   2544  N N   . ASP B  1  125 ? 193.077 25.723 -31.399 1.00 124.67 ? 132  ASP C N   1 
ATOM   2545  C CA  . ASP B  1  125 ? 193.306 26.805 -30.450 1.00 124.66 ? 132  ASP C CA  1 
ATOM   2546  C C   . ASP B  1  125 ? 194.347 27.812 -30.953 1.00 124.49 ? 132  ASP C C   1 
ATOM   2547  O O   . ASP B  1  125 ? 195.347 27.428 -31.562 1.00 124.52 ? 132  ASP C O   1 
ATOM   2548  C CB  . ASP B  1  125 ? 193.742 26.217 -29.111 1.00 124.73 ? 132  ASP C CB  1 
ATOM   2549  C CG  . ASP B  1  125 ? 194.073 27.277 -28.091 1.00 124.83 ? 132  ASP C CG  1 
ATOM   2550  O OD1 . ASP B  1  125 ? 193.198 28.113 -27.784 1.00 124.96 ? 132  ASP C OD1 1 
ATOM   2551  O OD2 . ASP B  1  125 ? 195.195 27.336 -27.553 1.00 124.96 ? 132  ASP C OD2 1 
ATOM   2552  N N   . PRO B  1  126 ? 194.091 29.103 -30.723 1.00 124.25 ? 133  PRO C N   1 
ATOM   2553  C CA  . PRO B  1  126 ? 194.995 30.190 -31.116 1.00 124.07 ? 133  PRO C CA  1 
ATOM   2554  C C   . PRO B  1  126 ? 196.310 30.255 -30.345 1.00 123.84 ? 133  PRO C C   1 
ATOM   2555  O O   . PRO B  1  126 ? 197.146 31.108 -30.639 1.00 123.82 ? 133  PRO C O   1 
ATOM   2556  C CB  . PRO B  1  126 ? 194.146 31.440 -30.857 1.00 124.11 ? 133  PRO C CB  1 
ATOM   2557  C CG  . PRO B  1  126 ? 192.752 30.946 -30.933 1.00 124.15 ? 133  PRO C CG  1 
ATOM   2558  C CD  . PRO B  1  126 ? 192.831 29.645 -30.196 1.00 124.22 ? 133  PRO C CD  1 
ATOM   2559  N N   . ARG B  1  127 ? 196.487 29.369 -29.374 1.00 123.59 ? 134  ARG C N   1 
ATOM   2560  C CA  . ARG B  1  127 ? 197.713 29.327 -28.587 1.00 123.37 ? 134  ARG C CA  1 
ATOM   2561  C C   . ARG B  1  127 ? 198.209 27.891 -28.486 1.00 123.28 ? 134  ARG C C   1 
ATOM   2562  O O   . ARG B  1  127 ? 199.295 27.629 -27.967 1.00 123.23 ? 134  ARG C O   1 
ATOM   2563  C CB  . ARG B  1  127 ? 197.466 29.902 -27.190 1.00 123.28 ? 134  ARG C CB  1 
ATOM   2564  C CG  . ARG B  1  127 ? 197.082 31.369 -27.195 1.00 123.01 ? 134  ARG C CG  1 
ATOM   2565  C CD  . ARG B  1  127 ? 198.158 32.251 -27.819 1.00 122.73 ? 134  ARG C CD  1 
ATOM   2566  N NE  . ARG B  1  127 ? 197.780 33.659 -27.864 1.00 122.46 ? 134  ARG C NE  1 
ATOM   2567  C CZ  . ARG B  1  127 ? 196.759 34.139 -28.563 1.00 122.20 ? 134  ARG C CZ  1 
ATOM   2568  N NH1 . ARG B  1  127 ? 196.002 33.325 -29.284 1.00 122.11 ? 134  ARG C NH1 1 
ATOM   2569  N NH2 . ARG B  1  127 ? 196.491 35.436 -28.544 1.00 122.09 ? 134  ARG C NH2 1 
ATOM   2570  N N   . SER B  1  128 ? 197.395 26.969 -28.990 1.00 123.17 ? 135  SER C N   1 
ATOM   2571  C CA  . SER B  1  128 ? 197.709 25.550 -28.984 1.00 123.07 ? 135  SER C CA  1 
ATOM   2572  C C   . SER B  1  128 ? 197.639 25.036 -30.415 1.00 122.94 ? 135  SER C C   1 
ATOM   2573  O O   . SER B  1  128 ? 196.556 24.898 -30.985 1.00 122.90 ? 135  SER C O   1 
ATOM   2574  C CB  . SER B  1  128 ? 196.716 24.789 -28.105 1.00 123.11 ? 135  SER C CB  1 
ATOM   2575  O OG  . SER B  1  128 ? 197.013 23.404 -28.071 1.00 123.17 ? 135  SER C OG  1 
ATOM   2576  N N   . GLN B  1  129 ? 198.800 24.754 -30.994 1.00 122.80 ? 136  GLN C N   1 
ATOM   2577  C CA  . GLN B  1  129 ? 198.880 24.268 -32.365 1.00 122.71 ? 136  GLN C CA  1 
ATOM   2578  C C   . GLN B  1  129 ? 198.528 22.782 -32.465 1.00 122.65 ? 136  GLN C C   1 
ATOM   2579  O O   . GLN B  1  129 ? 199.189 22.035 -33.187 1.00 122.69 ? 136  GLN C O   1 
ATOM   2580  C CB  . GLN B  1  129 ? 200.291 24.494 -32.914 1.00 122.68 ? 136  GLN C CB  1 
ATOM   2581  C CG  . GLN B  1  129 ? 200.855 25.884 -32.648 1.00 122.66 ? 136  GLN C CG  1 
ATOM   2582  C CD  . GLN B  1  129 ? 200.024 26.988 -33.270 1.00 122.66 ? 136  GLN C CD  1 
ATOM   2583  O OE1 . GLN B  1  129 ? 199.848 27.030 -34.488 1.00 122.70 ? 136  GLN C OE1 1 
ATOM   2584  N NE2 . GLN B  1  129 ? 199.516 27.888 -32.437 1.00 122.63 ? 136  GLN C NE2 1 
ATOM   2585  N N   . ASP B  1  130 ? 197.490 22.352 -31.750 1.00 122.52 ? 137  ASP C N   1 
ATOM   2586  C CA  . ASP B  1  130 ? 197.085 20.946 -31.778 1.00 122.39 ? 137  ASP C CA  1 
ATOM   2587  C C   . ASP B  1  130 ? 195.679 20.725 -31.211 1.00 122.24 ? 137  ASP C C   1 
ATOM   2588  O O   . ASP B  1  130 ? 194.753 21.481 -31.511 1.00 122.19 ? 137  ASP C O   1 
ATOM   2589  C CB  . ASP B  1  130 ? 198.096 20.095 -31.004 1.00 122.41 ? 137  ASP C CB  1 
ATOM   2590  C CG  . ASP B  1  130 ? 197.965 18.620 -31.314 1.00 122.42 ? 137  ASP C CG  1 
ATOM   2591  O OD1 . ASP B  1  130 ? 198.609 17.799 -30.624 1.00 122.34 ? 137  ASP C OD1 1 
ATOM   2592  O OD2 . ASP B  1  130 ? 197.228 18.211 -32.237 1.00 122.51 ? 137  ASP C OD2 1 
ATOM   2593  N N   . SER B  1  131 ? 195.534 19.679 -30.397 1.00 122.07 ? 138  SER C N   1 
ATOM   2594  C CA  . SER B  1  131 ? 194.259 19.324 -29.782 1.00 121.90 ? 138  SER C CA  1 
ATOM   2595  C C   . SER B  1  131 ? 193.196 19.056 -30.844 1.00 121.82 ? 138  SER C C   1 
ATOM   2596  O O   . SER B  1  131 ? 192.376 19.921 -31.151 1.00 121.82 ? 138  SER C O   1 
ATOM   2597  C CB  . SER B  1  131 ? 193.801 20.426 -28.827 1.00 121.84 ? 138  SER C CB  1 
ATOM   2598  O OG  . SER B  1  131 ? 194.708 20.572 -27.747 1.00 121.71 ? 138  SER C OG  1 
ATOM   2599  N N   . THR B  1  132 ? 193.223 17.846 -31.396 1.00 121.71 ? 139  THR C N   1 
ATOM   2600  C CA  . THR B  1  132 ? 192.288 17.429 -32.441 1.00 121.57 ? 139  THR C CA  1 
ATOM   2601  C C   . THR B  1  132 ? 190.939 16.962 -31.890 1.00 121.48 ? 139  THR C C   1 
ATOM   2602  O O   . THR B  1  132 ? 190.864 15.973 -31.159 1.00 121.43 ? 139  THR C O   1 
ATOM   2603  C CB  . THR B  1  132 ? 192.914 16.305 -33.289 1.00 121.54 ? 139  THR C CB  1 
ATOM   2604  O OG1 . THR B  1  132 ? 191.895 15.641 -34.051 1.00 121.46 ? 139  THR C OG1 1 
ATOM   2605  C CG2 . THR B  1  132 ? 193.544 15.233 -32.399 1.00 121.50 ? 139  THR C CG2 1 
ATOM   2606  N N   . LEU B  1  133 ? 189.877 17.676 -32.256 1.00 121.38 ? 140  LEU C N   1 
ATOM   2607  C CA  . LEU B  1  133 ? 188.524 17.339 -31.816 1.00 121.28 ? 140  LEU C CA  1 
ATOM   2608  C C   . LEU B  1  133 ? 187.474 17.753 -32.842 1.00 121.10 ? 140  LEU C C   1 
ATOM   2609  O O   . LEU B  1  133 ? 187.800 18.092 -33.981 1.00 121.10 ? 140  LEU C O   1 
ATOM   2610  C CB  . LEU B  1  133 ? 188.205 18.014 -30.485 1.00 121.33 ? 140  LEU C CB  1 
ATOM   2611  C CG  . LEU B  1  133 ? 188.022 19.529 -30.501 1.00 121.53 ? 140  LEU C CG  1 
ATOM   2612  C CD1 . LEU B  1  133 ? 187.363 19.984 -29.211 1.00 121.59 ? 140  LEU C CD1 1 
ATOM   2613  C CD2 . LEU B  1  133 ? 189.361 20.212 -30.706 1.00 121.68 ? 140  LEU C CD2 1 
ATOM   2614  N N   . CYS B  1  134 ? 186.211 17.733 -32.420 1.00 120.84 ? 141  CYS C N   1 
ATOM   2615  C CA  . CYS B  1  134 ? 185.095 18.080 -33.292 1.00 120.62 ? 141  CYS C CA  1 
ATOM   2616  C C   . CYS B  1  134 ? 183.973 18.747 -32.493 1.00 120.28 ? 141  CYS C C   1 
ATOM   2617  O O   . CYS B  1  134 ? 183.636 18.303 -31.395 1.00 120.32 ? 141  CYS C O   1 
ATOM   2618  C CB  . CYS B  1  134 ? 184.567 16.816 -33.968 1.00 120.70 ? 141  CYS C CB  1 
ATOM   2619  S SG  . CYS B  1  134 ? 185.603 15.365 -33.669 1.00 121.01 ? 141  CYS C SG  1 
ATOM   2620  N N   . LEU B  1  135 ? 183.395 19.808 -33.053 1.00 119.81 ? 142  LEU C N   1 
ATOM   2621  C CA  . LEU B  1  135 ? 182.321 20.556 -32.397 1.00 119.36 ? 142  LEU C CA  1 
ATOM   2622  C C   . LEU B  1  135 ? 180.982 20.377 -33.117 1.00 118.96 ? 142  LEU C C   1 
ATOM   2623  O O   . LEU B  1  135 ? 180.919 20.410 -34.345 1.00 118.97 ? 142  LEU C O   1 
ATOM   2624  C CB  . LEU B  1  135 ? 182.701 22.044 -32.327 1.00 119.35 ? 142  LEU C CB  1 
ATOM   2625  C CG  . LEU B  1  135 ? 181.668 23.102 -31.928 1.00 119.23 ? 142  LEU C CG  1 
ATOM   2626  C CD1 . LEU B  1  135 ? 180.784 23.452 -33.111 1.00 119.10 ? 142  LEU C CD1 1 
ATOM   2627  C CD2 . LEU B  1  135 ? 180.847 22.639 -30.738 1.00 119.16 ? 142  LEU C CD2 1 
ATOM   2628  N N   . PHE B  1  136 ? 179.914 20.197 -32.342 1.00 118.44 ? 143  PHE C N   1 
ATOM   2629  C CA  . PHE B  1  136 ? 178.574 20.016 -32.898 1.00 117.98 ? 143  PHE C CA  1 
ATOM   2630  C C   . PHE B  1  136 ? 177.725 21.278 -32.815 1.00 117.74 ? 143  PHE C C   1 
ATOM   2631  O O   . PHE B  1  136 ? 178.179 22.325 -32.357 1.00 117.71 ? 143  PHE C O   1 
ATOM   2632  C CB  . PHE B  1  136 ? 177.840 18.888 -32.173 1.00 117.86 ? 143  PHE C CB  1 
ATOM   2633  C CG  . PHE B  1  136 ? 178.309 17.515 -32.548 1.00 117.49 ? 143  PHE C CG  1 
ATOM   2634  C CD1 . PHE B  1  136 ? 179.587 17.090 -32.223 1.00 117.23 ? 143  PHE C CD1 1 
ATOM   2635  C CD2 . PHE B  1  136 ? 177.465 16.644 -33.219 1.00 117.21 ? 143  PHE C CD2 1 
ATOM   2636  C CE1 . PHE B  1  136 ? 180.017 15.821 -32.563 1.00 117.15 ? 143  PHE C CE1 1 
ATOM   2637  C CE2 . PHE B  1  136 ? 177.887 15.372 -33.563 1.00 117.10 ? 143  PHE C CE2 1 
ATOM   2638  C CZ  . PHE B  1  136 ? 179.165 14.960 -33.234 1.00 117.13 ? 143  PHE C CZ  1 
ATOM   2639  N N   . THR B  1  137 ? 176.478 21.149 -33.262 1.00 117.43 ? 144  THR C N   1 
ATOM   2640  C CA  . THR B  1  137 ? 175.514 22.242 -33.259 1.00 117.17 ? 144  THR C CA  1 
ATOM   2641  C C   . THR B  1  137 ? 174.235 21.785 -33.967 1.00 117.03 ? 144  THR C C   1 
ATOM   2642  O O   . THR B  1  137 ? 174.262 21.427 -35.145 1.00 116.99 ? 144  THR C O   1 
ATOM   2643  C CB  . THR B  1  137 ? 176.104 23.494 -33.938 1.00 117.07 ? 144  THR C CB  1 
ATOM   2644  O OG1 . THR B  1  137 ? 175.080 24.482 -34.126 1.00 116.91 ? 144  THR C OG1 1 
ATOM   2645  C CG2 . THR B  1  137 ? 176.649 23.162 -35.325 1.00 116.98 ? 144  THR C CG2 1 
ATOM   2646  N N   . ASP B  1  138 ? 173.124 21.783 -33.232 1.00 116.88 ? 145  ASP C N   1 
ATOM   2647  C CA  . ASP B  1  138 ? 171.824 21.367 -33.760 1.00 116.78 ? 145  ASP C CA  1 
ATOM   2648  C C   . ASP B  1  138 ? 171.773 19.855 -33.982 1.00 116.75 ? 145  ASP C C   1 
ATOM   2649  O O   . ASP B  1  138 ? 172.432 19.340 -34.886 1.00 116.74 ? 145  ASP C O   1 
ATOM   2650  C CB  . ASP B  1  138 ? 171.523 22.080 -35.079 1.00 116.76 ? 145  ASP C CB  1 
ATOM   2651  C CG  . ASP B  1  138 ? 171.547 23.584 -34.949 1.00 116.72 ? 145  ASP C CG  1 
ATOM   2652  O OD1 . ASP B  1  138 ? 170.762 24.128 -34.145 1.00 116.93 ? 145  ASP C OD1 1 
ATOM   2653  O OD2 . ASP B  1  138 ? 172.323 24.288 -35.627 1.00 116.58 ? 145  ASP C OD2 1 
ATOM   2654  N N   . PHE B  1  139 ? 170.996 19.144 -33.165 1.00 116.68 ? 146  PHE C N   1 
ATOM   2655  C CA  . PHE B  1  139 ? 170.882 17.690 -33.312 1.00 116.65 ? 146  PHE C CA  1 
ATOM   2656  C C   . PHE B  1  139 ? 169.585 17.086 -32.758 1.00 116.55 ? 146  PHE C C   1 
ATOM   2657  O O   . PHE B  1  139 ? 168.911 17.685 -31.917 1.00 116.51 ? 146  PHE C O   1 
ATOM   2658  C CB  . PHE B  1  139 ? 172.094 16.996 -32.683 1.00 116.66 ? 146  PHE C CB  1 
ATOM   2659  C CG  . PHE B  1  139 ? 172.207 17.164 -31.188 1.00 116.82 ? 146  PHE C CG  1 
ATOM   2660  C CD1 . PHE B  1  139 ? 171.202 16.717 -30.337 1.00 116.94 ? 146  PHE C CD1 1 
ATOM   2661  C CD2 . PHE B  1  139 ? 173.343 17.731 -30.631 1.00 116.96 ? 146  PHE C CD2 1 
ATOM   2662  C CE1 . PHE B  1  139 ? 171.321 16.848 -28.962 1.00 116.95 ? 146  PHE C CE1 1 
ATOM   2663  C CE2 . PHE B  1  139 ? 173.468 17.862 -29.255 1.00 117.04 ? 146  PHE C CE2 1 
ATOM   2664  C CZ  . PHE B  1  139 ? 172.455 17.421 -28.420 1.00 117.04 ? 146  PHE C CZ  1 
ATOM   2665  N N   . ASP B  1  140 ? 169.255 15.887 -33.240 1.00 116.45 ? 147  ASP C N   1 
ATOM   2666  C CA  . ASP B  1  140 ? 168.058 15.161 -32.814 1.00 116.36 ? 147  ASP C CA  1 
ATOM   2667  C C   . ASP B  1  140 ? 168.289 14.421 -31.504 1.00 116.38 ? 147  ASP C C   1 
ATOM   2668  O O   . ASP B  1  140 ? 169.196 13.596 -31.401 1.00 116.39 ? 147  ASP C O   1 
ATOM   2669  C CB  . ASP B  1  140 ? 167.631 14.152 -33.883 1.00 116.28 ? 147  ASP C CB  1 
ATOM   2670  C CG  . ASP B  1  140 ? 166.832 14.788 -34.993 1.00 116.24 ? 147  ASP C CG  1 
ATOM   2671  O OD1 . ASP B  1  140 ? 166.497 14.089 -35.975 1.00 116.11 ? 147  ASP C OD1 1 
ATOM   2672  O OD2 . ASP B  1  140 ? 166.497 15.988 -34.947 1.00 116.31 ? 147  ASP C OD2 1 
ATOM   2673  N N   . SER B  1  141 ? 167.454 14.708 -30.511 1.00 116.40 ? 148  SER C N   1 
ATOM   2674  C CA  . SER B  1  141 ? 167.564 14.072 -29.204 1.00 116.43 ? 148  SER C CA  1 
ATOM   2675  C C   . SER B  1  141 ? 167.002 12.653 -29.224 1.00 116.48 ? 148  SER C C   1 
ATOM   2676  O O   . SER B  1  141 ? 166.000 12.369 -28.568 1.00 116.53 ? 148  SER C O   1 
ATOM   2677  C CB  . SER B  1  141 ? 166.826 14.905 -28.154 1.00 116.43 ? 148  SER C CB  1 
ATOM   2678  O OG  . SER B  1  141 ? 165.463 15.078 -28.503 1.00 116.40 ? 148  SER C OG  1 
ATOM   2679  N N   . GLN B  1  142 ? 167.652 11.766 -29.972 1.00 116.55 ? 149  GLN C N   1 
ATOM   2680  C CA  . GLN B  1  142 ? 167.205 10.379 -30.070 1.00 116.62 ? 149  GLN C CA  1 
ATOM   2681  C C   . GLN B  1  142 ? 168.360 9.385  -30.200 1.00 116.90 ? 149  GLN C C   1 
ATOM   2682  O O   . GLN B  1  142 ? 168.255 8.246  -29.743 1.00 116.90 ? 149  GLN C O   1 
ATOM   2683  C CB  . GLN B  1  142 ? 166.237 10.217 -31.245 1.00 116.49 ? 149  GLN C CB  1 
ATOM   2684  C CG  . GLN B  1  142 ? 164.962 11.042 -31.109 1.00 116.08 ? 149  GLN C CG  1 
ATOM   2685  C CD  . GLN B  1  142 ? 164.125 10.652 -29.899 1.00 115.65 ? 149  GLN C CD  1 
ATOM   2686  O OE1 . GLN B  1  142 ? 163.148 11.326 -29.572 1.00 115.45 ? 149  GLN C OE1 1 
ATOM   2687  N NE2 . GLN B  1  142 ? 164.502 9.566  -29.235 1.00 115.26 ? 149  GLN C NE2 1 
ATOM   2688  N N   . ILE B  1  143 ? 169.453 9.807  -30.829 1.00 117.29 ? 150  ILE C N   1 
ATOM   2689  C CA  . ILE B  1  143 ? 170.622 8.945  -30.985 1.00 117.64 ? 150  ILE C CA  1 
ATOM   2690  C C   . ILE B  1  143 ? 171.617 9.274  -29.879 1.00 118.03 ? 150  ILE C C   1 
ATOM   2691  O O   . ILE B  1  143 ? 171.814 10.442 -29.545 1.00 118.01 ? 150  ILE C O   1 
ATOM   2692  C CB  . ILE B  1  143 ? 171.289 9.141  -32.364 1.00 117.58 ? 150  ILE C CB  1 
ATOM   2693  C CG1 . ILE B  1  143 ? 170.303 8.796  -33.483 1.00 117.49 ? 150  ILE C CG1 1 
ATOM   2694  C CG2 . ILE B  1  143 ? 172.535 8.266  -32.476 1.00 117.43 ? 150  ILE C CG2 1 
ATOM   2695  C CD1 . ILE B  1  143 ? 170.887 8.907  -34.877 1.00 117.48 ? 150  ILE C CD1 1 
ATOM   2696  N N   . ASN B  1  144 ? 172.242 8.248  -29.311 1.00 118.54 ? 151  ASN C N   1 
ATOM   2697  C CA  . ASN B  1  144 ? 173.206 8.454  -28.234 1.00 119.02 ? 151  ASN C CA  1 
ATOM   2698  C C   . ASN B  1  144 ? 174.589 8.834  -28.748 1.00 119.31 ? 151  ASN C C   1 
ATOM   2699  O O   . ASN B  1  144 ? 175.080 8.265  -29.723 1.00 119.34 ? 151  ASN C O   1 
ATOM   2700  C CB  . ASN B  1  144 ? 173.315 7.207  -27.351 1.00 119.14 ? 151  ASN C CB  1 
ATOM   2701  C CG  . ASN B  1  144 ? 173.941 6.020  -28.072 1.00 119.36 ? 151  ASN C CG  1 
ATOM   2702  O OD1 . ASN B  1  144 ? 174.325 5.036  -27.440 1.00 119.73 ? 151  ASN C OD1 1 
ATOM   2703  N ND2 . ASN B  1  144 ? 174.040 6.104  -29.394 1.00 119.47 ? 151  ASN C ND2 1 
ATOM   2704  N N   . VAL B  1  145 ? 175.214 9.800  -28.086 1.00 119.67 ? 152  VAL C N   1 
ATOM   2705  C CA  . VAL B  1  145 ? 176.554 10.221 -28.459 1.00 119.96 ? 152  VAL C CA  1 
ATOM   2706  C C   . VAL B  1  145 ? 177.482 9.027  -28.230 1.00 120.19 ? 152  VAL C C   1 
ATOM   2707  O O   . VAL B  1  145 ? 177.462 8.427  -27.155 1.00 120.20 ? 152  VAL C O   1 
ATOM   2708  C CB  . VAL B  1  145 ? 177.020 11.423 -27.614 1.00 119.99 ? 152  VAL C CB  1 
ATOM   2709  C CG1 . VAL B  1  145 ? 178.434 11.830 -28.002 1.00 120.04 ? 152  VAL C CG1 1 
ATOM   2710  C CG2 . VAL B  1  145 ? 176.064 12.596 -27.791 1.00 119.97 ? 152  VAL C CG2 1 
ATOM   2711  N N   . PRO B  1  146 ? 178.304 8.682  -29.221 1.00 120.45 ? 153  PRO C N   1 
ATOM   2712  C CA  . PRO B  1  146 ? 179.197 7.526  -29.100 1.00 120.60 ? 153  PRO C CA  1 
ATOM   2713  C C   . PRO B  1  146 ? 180.261 7.727  -28.026 1.00 120.75 ? 153  PRO C C   1 
ATOM   2714  O O   . PRO B  1  146 ? 181.162 8.549  -28.186 1.00 120.78 ? 153  PRO C O   1 
ATOM   2715  C CB  . PRO B  1  146 ? 179.824 7.445  -30.489 1.00 120.60 ? 153  PRO C CB  1 
ATOM   2716  C CG  . PRO B  1  146 ? 179.868 8.863  -30.917 1.00 120.57 ? 153  PRO C CG  1 
ATOM   2717  C CD  . PRO B  1  146 ? 178.513 9.378  -30.503 1.00 120.48 ? 153  PRO C CD  1 
ATOM   2718  N N   . LYS B  1  147 ? 180.145 6.980  -26.934 1.00 120.92 ? 154  LYS C N   1 
ATOM   2719  C CA  . LYS B  1  147 ? 181.102 7.074  -25.837 1.00 121.07 ? 154  LYS C CA  1 
ATOM   2720  C C   . LYS B  1  147 ? 182.475 6.553  -26.267 1.00 121.32 ? 154  LYS C C   1 
ATOM   2721  O O   . LYS B  1  147 ? 182.797 6.541  -27.454 1.00 121.29 ? 154  LYS C O   1 
ATOM   2722  C CB  . LYS B  1  147 ? 180.592 6.312  -24.610 1.00 121.01 ? 154  LYS C CB  1 
ATOM   2723  C CG  . LYS B  1  147 ? 179.611 7.110  -23.751 1.00 120.69 ? 154  LYS C CG  1 
ATOM   2724  C CD  . LYS B  1  147 ? 179.244 6.376  -22.464 1.00 120.30 ? 154  LYS C CD  1 
ATOM   2725  C CE  . LYS B  1  147 ? 180.444 6.187  -21.543 1.00 120.09 ? 154  LYS C CE  1 
ATOM   2726  N NZ  . LYS B  1  147 ? 180.974 7.472  -21.014 1.00 120.07 ? 154  LYS C NZ  1 
ATOM   2727  N N   . THR B  1  148 ? 183.283 6.124  -25.303 1.00 121.64 ? 155  THR C N   1 
ATOM   2728  C CA  . THR B  1  148 ? 184.621 5.629  -25.609 1.00 121.91 ? 155  THR C CA  1 
ATOM   2729  C C   . THR B  1  148 ? 185.017 4.427  -24.762 1.00 122.13 ? 155  THR C C   1 
ATOM   2730  O O   . THR B  1  148 ? 184.550 4.263  -23.634 1.00 122.15 ? 155  THR C O   1 
ATOM   2731  C CB  . THR B  1  148 ? 185.654 6.737  -25.397 1.00 121.93 ? 155  THR C CB  1 
ATOM   2732  O OG1 . THR B  1  148 ? 186.969 6.239  -25.687 1.00 121.93 ? 155  THR C OG1 1 
ATOM   2733  C CG2 . THR B  1  148 ? 185.677 7.171  -23.931 1.00 121.91 ? 155  THR C CG2 1 
ATOM   2734  N N   . MET B  1  149 ? 185.899 3.601  -25.317 1.00 122.39 ? 156  MET C N   1 
ATOM   2735  C CA  . MET B  1  149 ? 186.391 2.412  -24.630 1.00 122.60 ? 156  MET C CA  1 
ATOM   2736  C C   . MET B  1  149 ? 187.918 2.328  -24.713 1.00 122.70 ? 156  MET C C   1 
ATOM   2737  O O   . MET B  1  149 ? 188.476 1.320  -25.148 1.00 122.70 ? 156  MET C O   1 
ATOM   2738  C CB  . MET B  1  149 ? 185.746 1.151  -25.217 1.00 122.64 ? 156  MET C CB  1 
ATOM   2739  C CG  . MET B  1  149 ? 185.778 1.066  -26.735 1.00 122.71 ? 156  MET C CG  1 
ATOM   2740  S SD  . MET B  1  149 ? 185.007 -0.442 -27.362 1.00 122.73 ? 156  MET C SD  1 
ATOM   2741  C CE  . MET B  1  149 ? 186.446 -1.417 -27.766 1.00 122.67 ? 156  MET C CE  1 
ATOM   2742  N N   . GLU B  1  150 ? 188.583 3.401  -24.289 1.00 122.81 ? 157  GLU C N   1 
ATOM   2743  C CA  . GLU B  1  150 ? 190.042 3.475  -24.288 1.00 122.88 ? 157  GLU C CA  1 
ATOM   2744  C C   . GLU B  1  150 ? 190.513 4.597  -23.369 1.00 122.87 ? 157  GLU C C   1 
ATOM   2745  O O   . GLU B  1  150 ? 190.323 5.775  -23.677 1.00 122.91 ? 157  GLU C O   1 
ATOM   2746  C CB  . GLU B  1  150 ? 190.579 3.736  -25.694 1.00 122.89 ? 157  GLU C CB  1 
ATOM   2747  C CG  . GLU B  1  150 ? 192.088 3.938  -25.718 1.00 122.91 ? 157  GLU C CG  1 
ATOM   2748  C CD  . GLU B  1  150 ? 192.586 4.554  -27.009 1.00 122.90 ? 157  GLU C CD  1 
ATOM   2749  O OE1 . GLU B  1  150 ? 192.256 5.727  -27.282 1.00 122.83 ? 157  GLU C OE1 1 
ATOM   2750  O OE2 . GLU B  1  150 ? 193.319 3.863  -27.745 1.00 122.85 ? 157  GLU C OE2 1 
ATOM   2751  N N   . SER B  1  151 ? 191.136 4.231  -22.252 1.00 122.83 ? 158  SER C N   1 
ATOM   2752  C CA  . SER B  1  151 ? 191.639 5.206  -21.285 1.00 122.74 ? 158  SER C CA  1 
ATOM   2753  C C   . SER B  1  151 ? 192.703 6.114  -21.903 1.00 122.62 ? 158  SER C C   1 
ATOM   2754  O O   . SER B  1  151 ? 193.900 5.932  -21.677 1.00 122.62 ? 158  SER C O   1 
ATOM   2755  C CB  . SER B  1  151 ? 192.217 4.487  -20.065 1.00 122.75 ? 158  SER C CB  1 
ATOM   2756  O OG  . SER B  1  151 ? 192.640 5.411  -19.077 1.00 122.70 ? 158  SER C OG  1 
ATOM   2757  N N   . GLY B  1  152 ? 192.256 7.094  -22.680 1.00 122.45 ? 159  GLY C N   1 
ATOM   2758  C CA  . GLY B  1  152 ? 193.157 8.027  -23.331 1.00 122.26 ? 159  GLY C CA  1 
ATOM   2759  C C   . GLY B  1  152 ? 192.383 9.057  -24.132 1.00 122.05 ? 159  GLY C C   1 
ATOM   2760  O O   . GLY B  1  152 ? 192.938 10.053 -24.595 1.00 122.03 ? 159  GLY C O   1 
ATOM   2761  N N   . THR B  1  153 ? 191.088 8.805  -24.294 1.00 121.78 ? 160  THR C N   1 
ATOM   2762  C CA  . THR B  1  153 ? 190.205 9.696  -25.027 1.00 121.60 ? 160  THR C CA  1 
ATOM   2763  C C   . THR B  1  153 ? 188.771 9.425  -24.605 1.00 121.46 ? 160  THR C C   1 
ATOM   2764  O O   . THR B  1  153 ? 188.304 8.290  -24.673 1.00 121.43 ? 160  THR C O   1 
ATOM   2765  C CB  . THR B  1  153 ? 190.333 9.468  -26.535 1.00 121.57 ? 160  THR C CB  1 
ATOM   2766  O OG1 . THR B  1  153 ? 191.644 9.845  -26.977 1.00 121.51 ? 160  THR C OG1 1 
ATOM   2767  C CG2 . THR B  1  153 ? 189.347 10.357 -27.296 1.00 121.51 ? 160  THR C CG2 1 
ATOM   2768  N N   . PHE B  1  154 ? 188.078 10.473 -24.173 1.00 121.28 ? 161  PHE C N   1 
ATOM   2769  C CA  . PHE B  1  154 ? 186.698 10.353 -23.722 1.00 121.13 ? 161  PHE C CA  1 
ATOM   2770  C C   . PHE B  1  154 ? 185.740 11.108 -24.643 1.00 120.99 ? 161  PHE C C   1 
ATOM   2771  O O   . PHE B  1  154 ? 186.143 11.608 -25.692 1.00 121.01 ? 161  PHE C O   1 
ATOM   2772  C CB  . PHE B  1  154 ? 186.570 10.883 -22.292 1.00 121.12 ? 161  PHE C CB  1 
ATOM   2773  C CG  . PHE B  1  154 ? 187.194 9.992  -21.246 1.00 121.02 ? 161  PHE C CG  1 
ATOM   2774  C CD1 . PHE B  1  154 ? 188.537 9.645  -21.309 1.00 120.85 ? 161  PHE C CD1 1 
ATOM   2775  C CD2 . PHE B  1  154 ? 186.434 9.514  -20.189 1.00 120.94 ? 161  PHE C CD2 1 
ATOM   2776  C CE1 . PHE B  1  154 ? 189.108 8.832  -20.339 1.00 120.77 ? 161  PHE C CE1 1 
ATOM   2777  C CE2 . PHE B  1  154 ? 186.999 8.702  -19.215 1.00 120.91 ? 161  PHE C CE2 1 
ATOM   2778  C CZ  . PHE B  1  154 ? 188.337 8.361  -19.291 1.00 120.79 ? 161  PHE C CZ  1 
ATOM   2779  N N   . ILE B  1  155 ? 184.471 11.177 -24.239 1.00 120.76 ? 162  ILE C N   1 
ATOM   2780  C CA  . ILE B  1  155 ? 183.433 11.879 -24.993 1.00 120.55 ? 162  ILE C CA  1 
ATOM   2781  C C   . ILE B  1  155 ? 182.478 12.533 -24.001 1.00 120.41 ? 162  ILE C C   1 
ATOM   2782  O O   . ILE B  1  155 ? 182.325 12.050 -22.880 1.00 120.43 ? 162  ILE C O   1 
ATOM   2783  C CB  . ILE B  1  155 ? 182.632 10.907 -25.885 1.00 120.49 ? 162  ILE C CB  1 
ATOM   2784  C CG1 . ILE B  1  155 ? 183.560 10.142 -26.833 1.00 120.44 ? 162  ILE C CG1 1 
ATOM   2785  C CG2 . ILE B  1  155 ? 181.576 11.673 -26.676 1.00 120.40 ? 162  ILE C CG2 1 
ATOM   2786  C CD1 . ILE B  1  155 ? 184.242 11.009 -27.870 1.00 120.34 ? 162  ILE C CD1 1 
ATOM   2787  N N   . THR B  1  156 ? 181.833 13.624 -24.406 1.00 120.21 ? 163  THR C N   1 
ATOM   2788  C CA  . THR B  1  156 ? 180.886 14.305 -23.524 1.00 120.03 ? 163  THR C CA  1 
ATOM   2789  C C   . THR B  1  156 ? 179.475 13.764 -23.705 1.00 119.75 ? 163  THR C C   1 
ATOM   2790  O O   . THR B  1  156 ? 179.260 12.782 -24.414 1.00 119.72 ? 163  THR C O   1 
ATOM   2791  C CB  . THR B  1  156 ? 180.880 15.826 -23.756 1.00 120.08 ? 163  THR C CB  1 
ATOM   2792  O OG1 . THR B  1  156 ? 180.713 16.115 -25.153 1.00 120.15 ? 163  THR C OG1 1 
ATOM   2793  C CG2 . THR B  1  156 ? 182.209 16.442 -23.332 1.00 120.16 ? 163  THR C CG2 1 
ATOM   2794  N N   . ASP B  1  157 ? 178.515 14.419 -23.060 1.00 119.44 ? 164  ASP C N   1 
ATOM   2795  C CA  . ASP B  1  157 ? 177.123 14.000 -23.125 1.00 119.20 ? 164  ASP C CA  1 
ATOM   2796  C C   . ASP B  1  157 ? 176.305 14.905 -24.040 1.00 119.08 ? 164  ASP C C   1 
ATOM   2797  O O   . ASP B  1  157 ? 176.047 14.562 -25.193 1.00 119.10 ? 164  ASP C O   1 
ATOM   2798  C CB  . ASP B  1  157 ? 176.524 13.989 -21.723 1.00 119.11 ? 164  ASP C CB  1 
ATOM   2799  C CG  . ASP B  1  157 ? 177.409 13.285 -20.724 1.00 118.91 ? 164  ASP C CG  1 
ATOM   2800  O OD1 . ASP B  1  157 ? 177.741 12.100 -20.947 1.00 118.72 ? 164  ASP C OD1 1 
ATOM   2801  O OD2 . ASP B  1  157 ? 177.817 13.861 -19.694 1.00 118.60 ? 164  ASP C OD2 1 
ATOM   2802  N N   . ALA B  1  158 ? 175.896 16.060 -23.524 1.00 118.91 ? 165  ALA C N   1 
ATOM   2803  C CA  . ALA B  1  158 ? 175.105 17.001 -24.307 1.00 118.79 ? 165  ALA C CA  1 
ATOM   2804  C C   . ALA B  1  158 ? 175.048 18.366 -23.633 1.00 118.65 ? 165  ALA C C   1 
ATOM   2805  O O   . ALA B  1  158 ? 175.176 18.475 -22.413 1.00 118.66 ? 165  ALA C O   1 
ATOM   2806  C CB  . ALA B  1  158 ? 173.698 16.459 -24.513 1.00 118.83 ? 165  ALA C CB  1 
ATOM   2807  N N   . THR B  1  159 ? 174.856 19.404 -24.442 1.00 118.43 ? 166  THR C N   1 
ATOM   2808  C CA  . THR B  1  159 ? 174.768 20.772 -23.945 1.00 118.26 ? 166  THR C CA  1 
ATOM   2809  C C   . THR B  1  159 ? 173.814 21.558 -24.832 1.00 118.08 ? 166  THR C C   1 
ATOM   2810  O O   . THR B  1  159 ? 173.173 20.989 -25.714 1.00 118.05 ? 166  THR C O   1 
ATOM   2811  C CB  . THR B  1  159 ? 176.140 21.454 -23.957 1.00 118.27 ? 166  THR C CB  1 
ATOM   2812  O OG1 . THR B  1  159 ? 176.644 21.509 -25.299 1.00 118.42 ? 166  THR C OG1 1 
ATOM   2813  C CG2 . THR B  1  159 ? 177.157 20.658 -23.152 1.00 118.25 ? 166  THR C CG2 1 
ATOM   2814  N N   . VAL B  1  160 ? 173.728 22.865 -24.606 1.00 117.87 ? 167  VAL C N   1 
ATOM   2815  C CA  . VAL B  1  160 ? 172.840 23.710 -25.396 1.00 117.73 ? 167  VAL C CA  1 
ATOM   2816  C C   . VAL B  1  160 ? 173.351 25.140 -25.524 1.00 117.63 ? 167  VAL C C   1 
ATOM   2817  O O   . VAL B  1  160 ? 174.154 25.603 -24.717 1.00 117.64 ? 167  VAL C O   1 
ATOM   2818  C CB  . VAL B  1  160 ? 171.433 23.764 -24.784 1.00 117.71 ? 167  VAL C CB  1 
ATOM   2819  C CG1 . VAL B  1  160 ? 170.729 22.427 -24.945 1.00 117.72 ? 167  VAL C CG1 1 
ATOM   2820  C CG2 . VAL B  1  160 ? 171.519 24.153 -23.322 1.00 117.74 ? 167  VAL C CG2 1 
ATOM   2821  N N   . LEU B  1  161 ? 172.862 25.829 -26.550 1.00 117.48 ? 168  LEU C N   1 
ATOM   2822  C CA  . LEU B  1  161 ? 173.224 27.214 -26.820 1.00 117.38 ? 168  LEU C CA  1 
ATOM   2823  C C   . LEU B  1  161 ? 172.004 27.927 -27.398 1.00 117.25 ? 168  LEU C C   1 
ATOM   2824  O O   . LEU B  1  161 ? 171.430 27.479 -28.391 1.00 117.22 ? 168  LEU C O   1 
ATOM   2825  C CB  . LEU B  1  161 ? 174.408 27.290 -27.792 1.00 117.40 ? 168  LEU C CB  1 
ATOM   2826  C CG  . LEU B  1  161 ? 174.510 26.231 -28.893 1.00 117.42 ? 168  LEU C CG  1 
ATOM   2827  C CD1 . LEU B  1  161 ? 175.485 26.691 -29.966 1.00 117.52 ? 168  LEU C CD1 1 
ATOM   2828  C CD2 . LEU B  1  161 ? 174.948 24.898 -28.315 1.00 117.39 ? 168  LEU C CD2 1 
ATOM   2829  N N   . ASP B  1  162 ? 171.607 29.033 -26.774 1.00 117.11 ? 169  ASP C N   1 
ATOM   2830  C CA  . ASP B  1  162 ? 170.432 29.782 -27.213 1.00 117.01 ? 169  ASP C CA  1 
ATOM   2831  C C   . ASP B  1  162 ? 170.736 31.075 -27.961 1.00 116.96 ? 169  ASP C C   1 
ATOM   2832  O O   . ASP B  1  162 ? 171.790 31.684 -27.785 1.00 116.99 ? 169  ASP C O   1 
ATOM   2833  C CB  . ASP B  1  162 ? 169.551 30.116 -26.012 1.00 116.99 ? 169  ASP C CB  1 
ATOM   2834  C CG  . ASP B  1  162 ? 168.496 31.147 -26.338 1.00 116.98 ? 169  ASP C CG  1 
ATOM   2835  O OD1 . ASP B  1  162 ? 167.613 30.858 -27.176 1.00 117.14 ? 169  ASP C OD1 1 
ATOM   2836  O OD2 . ASP B  1  162 ? 168.495 32.274 -25.801 1.00 116.81 ? 169  ASP C OD2 1 
ATOM   2837  N N   . MET B  1  163 ? 169.782 31.477 -28.796 1.00 116.86 ? 170  MET C N   1 
ATOM   2838  C CA  . MET B  1  163 ? 169.845 32.714 -29.562 1.00 116.80 ? 170  MET C CA  1 
ATOM   2839  C C   . MET B  1  163 ? 168.485 33.365 -29.363 1.00 116.58 ? 170  MET C C   1 
ATOM   2840  O O   . MET B  1  163 ? 167.669 32.870 -28.590 1.00 116.57 ? 170  MET C O   1 
ATOM   2841  C CB  . MET B  1  163 ? 170.077 32.441 -31.054 1.00 116.90 ? 170  MET C CB  1 
ATOM   2842  C CG  . MET B  1  163 ? 170.397 33.701 -31.874 1.00 117.01 ? 170  MET C CG  1 
ATOM   2843  S SD  . MET B  1  163 ? 170.461 33.464 -33.664 1.00 117.25 ? 170  MET C SD  1 
ATOM   2844  C CE  . MET B  1  163 ? 169.078 34.483 -34.209 1.00 117.23 ? 170  MET C CE  1 
ATOM   2845  N N   . LYS B  1  164 ? 168.226 34.462 -30.062 1.00 116.36 ? 171  LYS C N   1 
ATOM   2846  C CA  . LYS B  1  164 ? 166.942 35.135 -29.948 1.00 116.19 ? 171  LYS C CA  1 
ATOM   2847  C C   . LYS B  1  164 ? 165.952 34.537 -30.949 1.00 116.06 ? 171  LYS C C   1 
ATOM   2848  O O   . LYS B  1  164 ? 164.742 34.727 -30.826 1.00 116.08 ? 171  LYS C O   1 
ATOM   2849  C CB  . LYS B  1  164 ? 167.110 36.640 -30.176 1.00 116.15 ? 171  LYS C CB  1 
ATOM   2850  C CG  . LYS B  1  164 ? 168.098 37.293 -29.209 1.00 116.05 ? 171  LYS C CG  1 
ATOM   2851  C CD  . LYS B  1  164 ? 168.142 38.808 -29.350 1.00 115.93 ? 171  LYS C CD  1 
ATOM   2852  C CE  . LYS B  1  164 ? 166.837 39.457 -28.911 1.00 115.86 ? 171  LYS C CE  1 
ATOM   2853  N NZ  . LYS B  1  164 ? 166.496 39.154 -27.493 1.00 115.73 ? 171  LYS C NZ  1 
ATOM   2854  N N   . ALA B  1  165 ? 166.481 33.803 -31.928 1.00 115.87 ? 172  ALA C N   1 
ATOM   2855  C CA  . ALA B  1  165 ? 165.678 33.162 -32.970 1.00 115.69 ? 172  ALA C CA  1 
ATOM   2856  C C   . ALA B  1  165 ? 164.547 32.326 -32.385 1.00 115.53 ? 172  ALA C C   1 
ATOM   2857  O O   . ALA B  1  165 ? 164.747 31.600 -31.412 1.00 115.51 ? 172  ALA C O   1 
ATOM   2858  C CB  . ALA B  1  165 ? 166.567 32.282 -33.844 1.00 115.69 ? 172  ALA C CB  1 
ATOM   2859  N N   . MET B  1  166 ? 163.364 32.415 -32.989 1.00 115.36 ? 173  MET C N   1 
ATOM   2860  C CA  . MET B  1  166 ? 162.201 31.656 -32.523 1.00 115.23 ? 173  MET C CA  1 
ATOM   2861  C C   . MET B  1  166 ? 162.349 30.162 -32.793 1.00 115.10 ? 173  MET C C   1 
ATOM   2862  O O   . MET B  1  166 ? 161.380 29.470 -33.105 1.00 115.08 ? 173  MET C O   1 
ATOM   2863  C CB  . MET B  1  166 ? 160.919 32.183 -33.166 1.00 115.22 ? 173  MET C CB  1 
ATOM   2864  C CG  . MET B  1  166 ? 160.312 33.359 -32.417 1.00 115.27 ? 173  MET C CG  1 
ATOM   2865  S SD  . MET B  1  166 ? 161.513 34.658 -32.078 1.00 115.28 ? 173  MET C SD  1 
ATOM   2866  C CE  . MET B  1  166 ? 161.695 35.342 -33.697 1.00 115.32 ? 173  MET C CE  1 
ATOM   2867  N N   . ASP B  1  167 ? 163.579 29.683 -32.663 1.00 114.96 ? 174  ASP C N   1 
ATOM   2868  C CA  . ASP B  1  167 ? 163.922 28.283 -32.851 1.00 114.84 ? 174  ASP C CA  1 
ATOM   2869  C C   . ASP B  1  167 ? 165.390 28.175 -32.473 1.00 114.84 ? 174  ASP C C   1 
ATOM   2870  O O   . ASP B  1  167 ? 166.135 27.367 -33.025 1.00 114.88 ? 174  ASP C O   1 
ATOM   2871  C CB  . ASP B  1  167 ? 163.714 27.851 -34.302 1.00 114.74 ? 174  ASP C CB  1 
ATOM   2872  C CG  . ASP B  1  167 ? 163.753 26.347 -34.476 1.00 114.50 ? 174  ASP C CG  1 
ATOM   2873  O OD1 . ASP B  1  167 ? 164.821 25.735 -34.256 1.00 114.24 ? 174  ASP C OD1 1 
ATOM   2874  O OD2 . ASP B  1  167 ? 162.744 25.708 -34.835 1.00 114.30 ? 174  ASP C OD2 1 
ATOM   2875  N N   . SER B  1  168 ? 165.801 29.020 -31.531 1.00 114.83 ? 175  SER C N   1 
ATOM   2876  C CA  . SER B  1  168 ? 167.177 29.056 -31.060 1.00 114.82 ? 175  SER C CA  1 
ATOM   2877  C C   . SER B  1  168 ? 167.519 27.808 -30.253 1.00 114.92 ? 175  SER C C   1 
ATOM   2878  O O   . SER B  1  168 ? 168.030 27.902 -29.137 1.00 114.91 ? 175  SER C O   1 
ATOM   2879  C CB  . SER B  1  168 ? 167.397 30.297 -30.200 1.00 114.75 ? 175  SER C CB  1 
ATOM   2880  O OG  . SER B  1  168 ? 167.218 31.480 -30.955 1.00 114.59 ? 175  SER C OG  1 
ATOM   2881  N N   . LYS B  1  169 ? 167.235 26.641 -30.825 1.00 115.07 ? 176  LYS C N   1 
ATOM   2882  C CA  . LYS B  1  169 ? 167.507 25.369 -30.165 1.00 115.19 ? 176  LYS C CA  1 
ATOM   2883  C C   . LYS B  1  169 ? 168.791 24.721 -30.674 1.00 115.55 ? 176  LYS C C   1 
ATOM   2884  O O   . LYS B  1  169 ? 168.781 23.577 -31.130 1.00 115.56 ? 176  LYS C O   1 
ATOM   2885  C CB  . LYS B  1  169 ? 166.329 24.413 -30.353 1.00 115.02 ? 176  LYS C CB  1 
ATOM   2886  C CG  . LYS B  1  169 ? 165.112 24.785 -29.522 1.00 114.60 ? 176  LYS C CG  1 
ATOM   2887  C CD  . LYS B  1  169 ? 164.037 23.719 -29.593 1.00 113.99 ? 176  LYS C CD  1 
ATOM   2888  C CE  . LYS B  1  169 ? 162.946 23.963 -28.566 1.00 113.63 ? 176  LYS C CE  1 
ATOM   2889  N NZ  . LYS B  1  169 ? 163.477 23.920 -27.177 1.00 113.29 ? 176  LYS C NZ  1 
ATOM   2890  N N   . SER B  1  170 ? 169.894 25.458 -30.590 1.00 115.95 ? 177  SER C N   1 
ATOM   2891  C CA  . SER B  1  170 ? 171.190 24.949 -31.016 1.00 116.27 ? 177  SER C CA  1 
ATOM   2892  C C   . SER B  1  170 ? 171.778 24.121 -29.878 1.00 116.54 ? 177  SER C C   1 
ATOM   2893  O O   . SER B  1  170 ? 171.731 24.531 -28.717 1.00 116.54 ? 177  SER C O   1 
ATOM   2894  C CB  . SER B  1  170 ? 172.127 26.104 -31.373 1.00 116.30 ? 177  SER C CB  1 
ATOM   2895  O OG  . SER B  1  170 ? 173.356 25.625 -31.894 1.00 116.35 ? 177  SER C OG  1 
ATOM   2896  N N   . ASN B  1  171 ? 172.325 22.957 -30.211 1.00 116.86 ? 178  ASN C N   1 
ATOM   2897  C CA  . ASN B  1  171 ? 172.900 22.065 -29.210 1.00 117.11 ? 178  ASN C CA  1 
ATOM   2898  C C   . ASN B  1  171 ? 174.358 21.724 -29.511 1.00 117.40 ? 178  ASN C C   1 
ATOM   2899  O O   . ASN B  1  171 ? 175.057 22.492 -30.169 1.00 117.39 ? 178  ASN C O   1 
ATOM   2900  C CB  . ASN B  1  171 ? 172.064 20.791 -29.121 1.00 117.07 ? 178  ASN C CB  1 
ATOM   2901  C CG  . ASN B  1  171 ? 170.588 21.077 -28.944 1.00 116.99 ? 178  ASN C CG  1 
ATOM   2902  O OD1 . ASN B  1  171 ? 169.927 21.572 -29.856 1.00 116.71 ? 178  ASN C OD1 1 
ATOM   2903  N ND2 . ASN B  1  171 ? 170.063 20.772 -27.764 1.00 117.00 ? 178  ASN C ND2 1 
ATOM   2904  N N   . GLY B  1  172 ? 174.819 20.577 -29.020 1.00 117.78 ? 179  GLY C N   1 
ATOM   2905  C CA  . GLY B  1  172 ? 176.190 20.157 -29.252 1.00 118.09 ? 179  GLY C CA  1 
ATOM   2906  C C   . GLY B  1  172 ? 176.742 19.179 -28.228 1.00 118.34 ? 179  GLY C C   1 
ATOM   2907  O O   . GLY B  1  172 ? 176.124 18.919 -27.195 1.00 118.31 ? 179  GLY C O   1 
ATOM   2908  N N   . ALA B  1  173 ? 177.920 18.639 -28.529 1.00 118.66 ? 180  ALA C N   1 
ATOM   2909  C CA  . ALA B  1  173 ? 178.599 17.683 -27.663 1.00 118.93 ? 180  ALA C CA  1 
ATOM   2910  C C   . ALA B  1  173 ? 180.084 17.664 -28.024 1.00 119.22 ? 180  ALA C C   1 
ATOM   2911  O O   . ALA B  1  173 ? 180.531 16.824 -28.806 1.00 119.23 ? 180  ALA C O   1 
ATOM   2912  C CB  . ALA B  1  173 ? 177.993 16.298 -27.831 1.00 118.88 ? 180  ALA C CB  1 
ATOM   2913  N N   . ILE B  1  174 ? 180.839 18.597 -27.451 1.00 119.57 ? 181  ILE C N   1 
ATOM   2914  C CA  . ILE B  1  174 ? 182.270 18.728 -27.726 1.00 119.85 ? 181  ILE C CA  1 
ATOM   2915  C C   . ILE B  1  174 ? 183.115 17.639 -27.075 1.00 120.08 ? 181  ILE C C   1 
ATOM   2916  O O   . ILE B  1  174 ? 182.923 17.307 -25.909 1.00 120.06 ? 181  ILE C O   1 
ATOM   2917  C CB  . ILE B  1  174 ? 182.777 20.102 -27.256 1.00 119.88 ? 181  ILE C CB  1 
ATOM   2918  C CG1 . ILE B  1  174 ? 181.922 21.212 -27.869 1.00 119.90 ? 181  ILE C CG1 1 
ATOM   2919  C CG2 . ILE B  1  174 ? 184.241 20.280 -27.645 1.00 119.97 ? 181  ILE C CG2 1 
ATOM   2920  C CD1 . ILE B  1  174 ? 182.263 22.602 -27.382 1.00 119.89 ? 181  ILE C CD1 1 
ATOM   2921  N N   . ALA B  1  175 ? 184.067 17.104 -27.835 1.00 120.42 ? 182  ALA C N   1 
ATOM   2922  C CA  . ALA B  1  175 ? 184.955 16.057 -27.343 1.00 120.74 ? 182  ALA C CA  1 
ATOM   2923  C C   . ALA B  1  175 ? 186.270 16.051 -28.125 1.00 121.04 ? 182  ALA C C   1 
ATOM   2924  O O   . ALA B  1  175 ? 186.264 16.091 -29.356 1.00 121.07 ? 182  ALA C O   1 
ATOM   2925  C CB  . ALA B  1  175 ? 184.271 14.703 -27.449 1.00 120.74 ? 182  ALA C CB  1 
ATOM   2926  N N   . TRP B  1  176 ? 187.391 15.992 -27.406 1.00 121.37 ? 183  TRP C N   1 
ATOM   2927  C CA  . TRP B  1  176 ? 188.718 15.990 -28.024 1.00 121.60 ? 183  TRP C CA  1 
ATOM   2928  C C   . TRP B  1  176 ? 189.547 14.780 -27.599 1.00 121.80 ? 183  TRP C C   1 
ATOM   2929  O O   . TRP B  1  176 ? 189.003 13.774 -27.143 1.00 121.80 ? 183  TRP C O   1 
ATOM   2930  C CB  . TRP B  1  176 ? 189.464 17.285 -27.675 1.00 121.62 ? 183  TRP C CB  1 
ATOM   2931  C CG  . TRP B  1  176 ? 189.655 17.513 -26.205 1.00 121.67 ? 183  TRP C CG  1 
ATOM   2932  C CD1 . TRP B  1  176 ? 190.578 16.918 -25.394 1.00 121.70 ? 183  TRP C CD1 1 
ATOM   2933  C CD2 . TRP B  1  176 ? 188.906 18.406 -25.371 1.00 121.65 ? 183  TRP C CD2 1 
ATOM   2934  N NE1 . TRP B  1  176 ? 190.447 17.382 -24.107 1.00 121.69 ? 183  TRP C NE1 1 
ATOM   2935  C CE2 . TRP B  1  176 ? 189.427 18.297 -24.065 1.00 121.65 ? 183  TRP C CE2 1 
ATOM   2936  C CE3 . TRP B  1  176 ? 187.842 19.289 -25.594 1.00 121.63 ? 183  TRP C CE3 1 
ATOM   2937  C CZ2 . TRP B  1  176 ? 188.922 19.034 -22.993 1.00 121.63 ? 183  TRP C CZ2 1 
ATOM   2938  C CZ3 . TRP B  1  176 ? 187.343 20.020 -24.528 1.00 121.57 ? 183  TRP C CZ3 1 
ATOM   2939  C CH2 . TRP B  1  176 ? 187.884 19.888 -23.244 1.00 121.57 ? 183  TRP C CH2 1 
ATOM   2940  N N   . SER B  1  177 ? 190.865 14.881 -27.759 1.00 122.07 ? 184  SER C N   1 
ATOM   2941  C CA  . SER B  1  177 ? 191.770 13.798 -27.387 1.00 122.27 ? 184  SER C CA  1 
ATOM   2942  C C   . SER B  1  177 ? 193.231 14.226 -27.469 1.00 122.38 ? 184  SER C C   1 
ATOM   2943  O O   . SER B  1  177 ? 193.651 14.863 -28.436 1.00 122.38 ? 184  SER C O   1 
ATOM   2944  C CB  . SER B  1  177 ? 191.554 12.587 -28.294 1.00 122.29 ? 184  SER C CB  1 
ATOM   2945  O OG  . SER B  1  177 ? 192.002 12.847 -29.612 1.00 122.36 ? 184  SER C OG  1 
ATOM   2946  N N   . ASN B  1  178 ? 193.999 13.863 -26.447 1.00 122.52 ? 185  ASN C N   1 
ATOM   2947  C CA  . ASN B  1  178 ? 195.422 14.171 -26.399 1.00 122.61 ? 185  ASN C CA  1 
ATOM   2948  C C   . ASN B  1  178 ? 196.220 12.904 -26.700 1.00 122.72 ? 185  ASN C C   1 
ATOM   2949  O O   . ASN B  1  178 ? 197.418 12.830 -26.429 1.00 122.74 ? 185  ASN C O   1 
ATOM   2950  C CB  . ASN B  1  178 ? 195.806 14.737 -25.028 1.00 122.58 ? 185  ASN C CB  1 
ATOM   2951  C CG  . ASN B  1  178 ? 195.344 13.859 -23.879 1.00 122.50 ? 185  ASN C CG  1 
ATOM   2952  O OD1 . ASN B  1  178 ? 195.728 12.694 -23.777 1.00 122.41 ? 185  ASN C OD1 1 
ATOM   2953  N ND2 . ASN B  1  178 ? 194.515 14.418 -23.005 1.00 122.43 ? 185  ASN C ND2 1 
ATOM   2954  N N   . GLN B  1  179 ? 195.534 11.909 -27.262 1.00 122.84 ? 186  GLN C N   1 
ATOM   2955  C CA  . GLN B  1  179 ? 196.135 10.627 -27.614 1.00 122.91 ? 186  GLN C CA  1 
ATOM   2956  C C   . GLN B  1  179 ? 196.736 10.729 -29.022 1.00 122.99 ? 186  GLN C C   1 
ATOM   2957  O O   . GLN B  1  179 ? 196.952 11.832 -29.525 1.00 123.00 ? 186  GLN C O   1 
ATOM   2958  C CB  . GLN B  1  179 ? 195.067 9.525  -27.555 1.00 122.90 ? 186  GLN C CB  1 
ATOM   2959  C CG  . GLN B  1  179 ? 195.598 8.090  -27.507 1.00 122.81 ? 186  GLN C CG  1 
ATOM   2960  C CD  . GLN B  1  179 ? 196.267 7.740  -26.192 1.00 122.69 ? 186  GLN C CD  1 
ATOM   2961  O OE1 . GLN B  1  179 ? 195.656 7.844  -25.130 1.00 122.53 ? 186  GLN C OE1 1 
ATOM   2962  N NE2 . GLN B  1  179 ? 197.522 7.312  -26.260 1.00 122.63 ? 186  GLN C NE2 1 
ATOM   2963  N N   . THR B  1  180 ? 196.999 9.589  -29.656 1.00 123.07 ? 187  THR C N   1 
ATOM   2964  C CA  . THR B  1  180 ? 197.571 9.564  -31.004 1.00 123.14 ? 187  THR C CA  1 
ATOM   2965  C C   . THR B  1  180 ? 196.655 10.263 -32.013 1.00 123.14 ? 187  THR C C   1 
ATOM   2966  O O   . THR B  1  180 ? 195.648 10.857 -31.629 1.00 123.14 ? 187  THR C O   1 
ATOM   2967  C CB  . THR B  1  180 ? 197.851 8.118  -31.447 1.00 123.17 ? 187  THR C CB  1 
ATOM   2968  O OG1 . THR B  1  180 ? 196.681 7.308  -31.257 1.00 123.19 ? 187  THR C OG1 1 
ATOM   2969  C CG2 . THR B  1  180 ? 198.943 7.492  -30.579 1.00 123.25 ? 187  THR C CG2 1 
ATOM   2970  N N   . SER B  1  181 ? 196.997 10.201 -33.299 1.00 123.10 ? 188  SER C N   1 
ATOM   2971  C CA  . SER B  1  181 ? 196.177 10.869 -34.312 1.00 123.04 ? 188  SER C CA  1 
ATOM   2972  C C   . SER B  1  181 ? 194.795 10.280 -34.403 1.00 122.90 ? 188  SER C C   1 
ATOM   2973  O O   . SER B  1  181 ? 194.589 9.199  -34.957 1.00 122.98 ? 188  SER C O   1 
ATOM   2974  C CB  . SER B  1  181 ? 196.791 10.821 -35.709 1.00 123.06 ? 188  SER C CB  1 
ATOM   2975  O OG  . SER B  1  181 ? 196.084 11.680 -36.589 1.00 123.11 ? 188  SER C OG  1 
ATOM   2976  N N   . PHE B  1  182 ? 193.846 11.020 -33.861 1.00 122.64 ? 189  PHE C N   1 
ATOM   2977  C CA  . PHE B  1  182 ? 192.463 10.635 -33.917 1.00 122.41 ? 189  PHE C CA  1 
ATOM   2978  C C   . PHE B  1  182 ? 191.761 11.841 -34.500 1.00 122.24 ? 189  PHE C C   1 
ATOM   2979  O O   . PHE B  1  182 ? 191.528 12.833 -33.809 1.00 122.27 ? 189  PHE C O   1 
ATOM   2980  C CB  . PHE B  1  182 ? 191.955 10.258 -32.525 1.00 122.37 ? 189  PHE C CB  1 
ATOM   2981  C CG  . PHE B  1  182 ? 192.506 8.944  -32.035 1.00 122.25 ? 189  PHE C CG  1 
ATOM   2982  C CD1 . PHE B  1  182 ? 192.286 7.780  -32.759 1.00 122.17 ? 189  PHE C CD1 1 
ATOM   2983  C CD2 . PHE B  1  182 ? 193.279 8.876  -30.885 1.00 122.12 ? 189  PHE C CD2 1 
ATOM   2984  C CE1 . PHE B  1  182 ? 192.810 6.568  -32.341 1.00 122.08 ? 189  PHE C CE1 1 
ATOM   2985  C CE2 . PHE B  1  182 ? 193.808 7.663  -30.459 1.00 122.03 ? 189  PHE C CE2 1 
ATOM   2986  C CZ  . PHE B  1  182 ? 193.573 6.508  -31.190 1.00 122.03 ? 189  PHE C CZ  1 
ATOM   2987  N N   . THR B  1  183 ? 191.491 11.769 -35.800 1.00 121.99 ? 190  THR C N   1 
ATOM   2988  C CA  . THR B  1  183 ? 190.807 12.842 -36.500 1.00 121.76 ? 190  THR C CA  1 
ATOM   2989  C C   . THR B  1  183 ? 189.381 12.870 -35.974 1.00 121.50 ? 190  THR C C   1 
ATOM   2990  O O   . THR B  1  183 ? 189.154 12.674 -34.782 1.00 121.52 ? 190  THR C O   1 
ATOM   2991  C CB  . THR B  1  183 ? 190.809 12.608 -38.018 1.00 121.79 ? 190  THR C CB  1 
ATOM   2992  O OG1 . THR B  1  183 ? 190.284 11.305 -38.313 1.00 121.79 ? 190  THR C OG1 1 
ATOM   2993  C CG2 . THR B  1  183 ? 192.233 12.629 -38.571 1.00 121.86 ? 190  THR C CG2 1 
ATOM   2994  N N   . CYS B  1  184 ? 188.413 13.093 -36.852 1.00 121.13 ? 191  CYS C N   1 
ATOM   2995  C CA  . CYS B  1  184 ? 187.029 13.133 -36.408 1.00 120.82 ? 191  CYS C CA  1 
ATOM   2996  C C   . CYS B  1  184 ? 186.121 12.201 -37.185 1.00 120.50 ? 191  CYS C C   1 
ATOM   2997  O O   . CYS B  1  184 ? 185.147 12.622 -37.807 1.00 120.47 ? 191  CYS C O   1 
ATOM   2998  C CB  . CYS B  1  184 ? 186.514 14.561 -36.448 1.00 120.87 ? 191  CYS C CB  1 
ATOM   2999  S SG  . CYS B  1  184 ? 187.106 15.488 -35.022 1.00 120.83 ? 191  CYS C SG  1 
ATOM   3000  N N   . GLN B  1  185 ? 186.458 10.920 -37.114 1.00 120.12 ? 192  GLN C N   1 
ATOM   3001  C CA  . GLN B  1  185 ? 185.724 9.852  -37.770 1.00 119.81 ? 192  GLN C CA  1 
ATOM   3002  C C   . GLN B  1  185 ? 186.163 8.551  -37.102 1.00 119.51 ? 192  GLN C C   1 
ATOM   3003  O O   . GLN B  1  185 ? 185.732 7.464  -37.480 1.00 119.49 ? 192  GLN C O   1 
ATOM   3004  C CB  . GLN B  1  185 ? 186.044 9.820  -39.268 1.00 119.81 ? 192  GLN C CB  1 
ATOM   3005  C CG  . GLN B  1  185 ? 185.571 11.056 -40.029 1.00 119.86 ? 192  GLN C CG  1 
ATOM   3006  C CD  . GLN B  1  185 ? 186.092 11.123 -41.450 1.00 120.00 ? 192  GLN C CD  1 
ATOM   3007  O OE1 . GLN B  1  185 ? 187.302 11.143 -41.676 1.00 120.06 ? 192  GLN C OE1 1 
ATOM   3008  N NE2 . GLN B  1  185 ? 185.179 11.171 -42.412 1.00 120.12 ? 192  GLN C NE2 1 
ATOM   3009  N N   . ASP B  1  186 ? 187.032 8.686  -36.099 1.00 119.18 ? 193  ASP C N   1 
ATOM   3010  C CA  . ASP B  1  186 ? 187.564 7.553  -35.350 1.00 118.89 ? 193  ASP C CA  1 
ATOM   3011  C C   . ASP B  1  186 ? 186.531 7.011  -34.367 1.00 118.53 ? 193  ASP C C   1 
ATOM   3012  O O   . ASP B  1  186 ? 186.733 5.959  -33.761 1.00 118.45 ? 193  ASP C O   1 
ATOM   3013  C CB  . ASP B  1  186 ? 188.815 7.974  -34.572 1.00 118.95 ? 193  ASP C CB  1 
ATOM   3014  C CG  . ASP B  1  186 ? 189.884 8.575  -35.459 1.00 119.04 ? 193  ASP C CG  1 
ATOM   3015  O OD1 . ASP B  1  186 ? 189.624 9.621  -36.094 1.00 119.20 ? 193  ASP C OD1 1 
ATOM   3016  O OD2 . ASP B  1  186 ? 191.014 8.054  -35.563 1.00 119.10 ? 193  ASP C OD2 1 
ATOM   3017  N N   . ILE B  1  187 ? 185.430 7.739  -34.208 1.00 118.14 ? 194  ILE C N   1 
ATOM   3018  C CA  . ILE B  1  187 ? 184.361 7.347  -33.295 1.00 117.81 ? 194  ILE C CA  1 
ATOM   3019  C C   . ILE B  1  187 ? 183.001 7.519  -33.965 1.00 117.65 ? 194  ILE C C   1 
ATOM   3020  O O   . ILE B  1  187 ? 182.076 6.742  -33.728 1.00 117.55 ? 194  ILE C O   1 
ATOM   3021  C CB  . ILE B  1  187 ? 184.413 8.192  -32.003 1.00 117.73 ? 194  ILE C CB  1 
ATOM   3022  C CG1 . ILE B  1  187 ? 183.256 7.819  -31.070 1.00 117.61 ? 194  ILE C CG1 1 
ATOM   3023  C CG2 . ILE B  1  187 ? 184.371 9.675  -32.343 1.00 117.57 ? 194  ILE C CG2 1 
ATOM   3024  C CD1 . ILE B  1  187 ? 183.360 6.419  -30.491 1.00 117.51 ? 194  ILE C CD1 1 
ATOM   3025  N N   . PHE B  1  188 ? 182.893 8.543  -34.805 1.00 117.54 ? 195  PHE C N   1 
ATOM   3026  C CA  . PHE B  1  188 ? 181.658 8.843  -35.515 1.00 117.46 ? 195  PHE C CA  1 
ATOM   3027  C C   . PHE B  1  188 ? 181.549 8.008  -36.788 1.00 117.67 ? 195  PHE C C   1 
ATOM   3028  O O   . PHE B  1  188 ? 181.048 8.480  -37.808 1.00 117.63 ? 195  PHE C O   1 
ATOM   3029  C CB  . PHE B  1  188 ? 181.618 10.328 -35.878 1.00 117.30 ? 195  PHE C CB  1 
ATOM   3030  C CG  . PHE B  1  188 ? 181.762 11.250 -34.696 1.00 116.79 ? 195  PHE C CG  1 
ATOM   3031  C CD1 . PHE B  1  188 ? 182.210 12.549 -34.873 1.00 116.41 ? 195  PHE C CD1 1 
ATOM   3032  C CD2 . PHE B  1  188 ? 181.445 10.824 -33.415 1.00 116.33 ? 195  PHE C CD2 1 
ATOM   3033  C CE1 . PHE B  1  188 ? 182.343 13.409 -33.795 1.00 116.17 ? 195  PHE C CE1 1 
ATOM   3034  C CE2 . PHE B  1  188 ? 181.576 11.679 -32.331 1.00 116.16 ? 195  PHE C CE2 1 
ATOM   3035  C CZ  . PHE B  1  188 ? 182.026 12.973 -32.523 1.00 116.13 ? 195  PHE C CZ  1 
ATOM   3036  N N   . LYS B  1  189 ? 182.019 6.767  -36.722 1.00 117.94 ? 196  LYS C N   1 
ATOM   3037  C CA  . LYS B  1  189 ? 181.990 5.869  -37.874 1.00 118.16 ? 196  LYS C CA  1 
ATOM   3038  C C   . LYS B  1  189 ? 180.575 5.456  -38.268 1.00 118.42 ? 196  LYS C C   1 
ATOM   3039  O O   . LYS B  1  189 ? 180.315 5.154  -39.433 1.00 118.41 ? 196  LYS C O   1 
ATOM   3040  C CB  . LYS B  1  189 ? 182.808 4.610  -37.584 1.00 118.13 ? 196  LYS C CB  1 
ATOM   3041  C CG  . LYS B  1  189 ? 184.255 4.866  -37.211 1.00 118.06 ? 196  LYS C CG  1 
ATOM   3042  C CD  . LYS B  1  189 ? 184.989 3.570  -36.910 1.00 118.01 ? 196  LYS C CD  1 
ATOM   3043  C CE  . LYS B  1  189 ? 184.339 2.800  -35.766 1.00 118.01 ? 196  LYS C CE  1 
ATOM   3044  N NZ  . LYS B  1  189 ? 183.038 2.174  -36.138 1.00 118.00 ? 196  LYS C NZ  1 
ATOM   3045  N N   . GLU B  1  190 ? 179.664 5.434  -37.300 1.00 118.74 ? 197  GLU C N   1 
ATOM   3046  C CA  . GLU B  1  190 ? 178.288 5.021  -37.564 1.00 118.99 ? 197  GLU C CA  1 
ATOM   3047  C C   . GLU B  1  190 ? 177.258 5.981  -36.973 1.00 119.34 ? 197  GLU C C   1 
ATOM   3048  O O   . GLU B  1  190 ? 176.107 5.604  -36.749 1.00 119.39 ? 197  GLU C O   1 
ATOM   3049  C CB  . GLU B  1  190 ? 178.066 3.605  -37.027 1.00 118.89 ? 197  GLU C CB  1 
ATOM   3050  C CG  . GLU B  1  190 ? 178.918 2.557  -37.730 1.00 118.56 ? 197  GLU C CG  1 
ATOM   3051  C CD  . GLU B  1  190 ? 179.201 1.349  -36.862 1.00 118.23 ? 197  GLU C CD  1 
ATOM   3052  O OE1 . GLU B  1  190 ? 179.825 1.520  -35.794 1.00 118.08 ? 197  GLU C OE1 1 
ATOM   3053  O OE2 . GLU B  1  190 ? 178.806 0.229  -37.248 1.00 117.98 ? 197  GLU C OE2 1 
ATOM   3054  N N   . THR B  1  191 ? 177.672 7.219  -36.724 1.00 119.76 ? 198  THR C N   1 
ATOM   3055  C CA  . THR B  1  191 ? 176.768 8.226  -36.185 1.00 120.13 ? 198  THR C CA  1 
ATOM   3056  C C   . THR B  1  191 ? 175.635 8.441  -37.172 1.00 120.27 ? 198  THR C C   1 
ATOM   3057  O O   . THR B  1  191 ? 174.478 8.135  -36.895 1.00 120.34 ? 198  THR C O   1 
ATOM   3058  C CB  . THR B  1  191 ? 177.502 9.557  -35.962 1.00 120.22 ? 198  THR C CB  1 
ATOM   3059  O OG1 . THR B  1  191 ? 178.462 9.416  -34.906 1.00 120.29 ? 198  THR C OG1 1 
ATOM   3060  C CG2 . THR B  1  191 ? 176.526 10.645 -35.508 1.00 120.43 ? 198  THR C CG2 1 
ATOM   3061  N N   . ASN B  1  192 ? 176.027 8.998  -38.383 1.00 124.98 ? 203  ASN C N   1 
ATOM   3062  C CA  . ASN B  1  192 ? 175.085 9.239  -39.462 1.00 125.16 ? 203  ASN C CA  1 
ATOM   3063  C C   . ASN B  1  192 ? 175.787 9.920  -40.622 1.00 125.58 ? 203  ASN C C   1 
ATOM   3064  O O   . ASN B  1  192 ? 175.729 9.445  -41.756 1.00 125.57 ? 203  ASN C O   1 
ATOM   3065  C CB  . ASN B  1  192 ? 173.919 10.105 -38.983 1.00 125.01 ? 203  ASN C CB  1 
ATOM   3066  C CG  . ASN B  1  192 ? 172.869 10.301 -40.057 1.00 124.70 ? 203  ASN C CG  1 
ATOM   3067  O OD1 . ASN B  1  192 ? 172.295 9.337  -40.563 1.00 124.28 ? 203  ASN C OD1 1 
ATOM   3068  N ND2 . ASN B  1  192 ? 172.618 11.552 -40.417 1.00 124.44 ? 203  ASN C ND2 1 
ATOM   3069  N N   . ALA B  1  193 ? 176.455 11.033 -40.333 1.00 126.13 ? 204  ALA C N   1 
ATOM   3070  C CA  . ALA B  1  193 ? 177.163 11.782 -41.364 1.00 126.64 ? 204  ALA C CA  1 
ATOM   3071  C C   . ALA B  1  193 ? 178.166 12.761 -40.758 1.00 127.19 ? 204  ALA C C   1 
ATOM   3072  O O   . ALA B  1  193 ? 178.309 12.845 -39.537 1.00 127.18 ? 204  ALA C O   1 
ATOM   3073  C CB  . ALA B  1  193 ? 176.166 12.525 -42.243 1.00 126.61 ? 204  ALA C CB  1 
ATOM   3074  N N   . THR B  1  194 ? 178.855 13.498 -41.627 1.00 127.92 ? 205  THR C N   1 
ATOM   3075  C CA  . THR B  1  194 ? 179.843 14.486 -41.205 1.00 128.54 ? 205  THR C CA  1 
ATOM   3076  C C   . THR B  1  194 ? 179.944 15.615 -42.225 1.00 129.12 ? 205  THR C C   1 
ATOM   3077  O O   . THR B  1  194 ? 179.397 15.522 -43.324 1.00 129.20 ? 205  THR C O   1 
ATOM   3078  C CB  . THR B  1  194 ? 181.224 13.839 -41.041 1.00 128.54 ? 205  THR C CB  1 
ATOM   3079  O OG1 . THR B  1  194 ? 182.174 14.828 -40.617 1.00 128.56 ? 205  THR C OG1 1 
ATOM   3080  C CG2 . THR B  1  194 ? 181.739 13.314 -42.381 1.00 128.56 ? 205  THR C CG2 1 
ATOM   3081  N N   . TYR B  1  195 ? 180.654 16.677 -41.853 1.00 129.84 ? 206  TYR C N   1 
ATOM   3082  C CA  . TYR B  1  195 ? 180.839 17.834 -42.725 1.00 130.43 ? 206  TYR C CA  1 
ATOM   3083  C C   . TYR B  1  195 ? 182.314 18.242 -42.794 1.00 130.97 ? 206  TYR C C   1 
ATOM   3084  O O   . TYR B  1  195 ? 182.762 19.082 -42.013 1.00 131.01 ? 206  TYR C O   1 
ATOM   3085  C CB  . TYR B  1  195 ? 180.015 19.021 -42.213 1.00 130.45 ? 206  TYR C CB  1 
ATOM   3086  C CG  . TYR B  1  195 ? 178.549 19.020 -42.607 1.00 130.48 ? 206  TYR C CG  1 
ATOM   3087  C CD1 . TYR B  1  195 ? 177.745 17.902 -42.403 1.00 130.51 ? 206  TYR C CD1 1 
ATOM   3088  C CD2 . TYR B  1  195 ? 177.962 20.154 -43.158 1.00 130.47 ? 206  TYR C CD2 1 
ATOM   3089  C CE1 . TYR B  1  195 ? 176.400 17.912 -42.746 1.00 130.48 ? 206  TYR C CE1 1 
ATOM   3090  C CE2 . TYR B  1  195 ? 176.619 20.174 -43.504 1.00 130.45 ? 206  TYR C CE2 1 
ATOM   3091  C CZ  . TYR B  1  195 ? 175.844 19.051 -43.296 1.00 130.46 ? 206  TYR C CZ  1 
ATOM   3092  O OH  . TYR B  1  195 ? 174.510 19.068 -43.636 1.00 130.43 ? 206  TYR C OH  1 
ATOM   3093  N N   . PRO B  1  196 ? 183.079 17.628 -43.697 1.00 131.64 ? 207  PRO C N   1 
ATOM   3094  C CA  . PRO B  1  196 ? 184.499 17.956 -43.866 1.00 132.09 ? 207  PRO C CA  1 
ATOM   3095  C C   . PRO B  1  196 ? 184.753 19.435 -44.170 1.00 132.55 ? 207  PRO C C   1 
ATOM   3096  O O   . PRO B  1  196 ? 184.439 19.916 -45.259 1.00 132.63 ? 207  PRO C O   1 
ATOM   3097  C CB  . PRO B  1  196 ? 184.914 17.053 -45.030 1.00 132.05 ? 207  PRO C CB  1 
ATOM   3098  C CG  . PRO B  1  196 ? 184.034 15.866 -44.862 1.00 131.90 ? 207  PRO C CG  1 
ATOM   3099  C CD  . PRO B  1  196 ? 182.695 16.493 -44.553 1.00 131.71 ? 207  PRO C CD  1 
ATOM   3100  N N   . SER B  1  197 ? 185.320 20.141 -43.193 1.00 133.08 ? 208  SER C N   1 
ATOM   3101  C CA  . SER B  1  197 ? 185.615 21.566 -43.325 1.00 133.46 ? 208  SER C CA  1 
ATOM   3102  C C   . SER B  1  197 ? 186.896 21.810 -44.116 1.00 133.80 ? 208  SER C C   1 
ATOM   3103  O O   . SER B  1  197 ? 187.695 20.896 -44.317 1.00 133.86 ? 208  SER C O   1 
ATOM   3104  C CB  . SER B  1  197 ? 185.748 22.207 -41.941 1.00 133.45 ? 208  SER C CB  1 
ATOM   3105  O OG  . SER B  1  197 ? 184.574 22.025 -41.170 1.00 133.49 ? 208  SER C OG  1 
ATOM   3106  N N   . SER B  1  198 ? 187.088 23.051 -44.557 1.00 134.20 ? 209  SER C N   1 
ATOM   3107  C CA  . SER B  1  198 ? 188.278 23.425 -45.319 1.00 134.54 ? 209  SER C CA  1 
ATOM   3108  C C   . SER B  1  198 ? 188.469 24.940 -45.347 1.00 134.76 ? 209  SER C C   1 
ATOM   3109  O O   . SER B  1  198 ? 188.991 25.525 -44.398 1.00 134.81 ? 209  SER C O   1 
ATOM   3110  C CB  . SER B  1  198 ? 188.194 22.886 -46.749 1.00 134.58 ? 209  SER C CB  1 
ATOM   3111  O OG  . SER B  1  198 ? 188.296 21.474 -46.772 1.00 134.68 ? 209  SER C OG  1 
ATOM   3112  N N   . ASP B  1  199 ? 188.050 25.570 -46.441 1.00 134.99 ? 210  ASP C N   1 
ATOM   3113  C CA  . ASP B  1  199 ? 188.184 27.012 -46.592 1.00 135.16 ? 210  ASP C CA  1 
ATOM   3114  C C   . ASP B  1  199 ? 187.166 27.544 -47.600 1.00 135.31 ? 210  ASP C C   1 
ATOM   3115  O O   . ASP B  1  199 ? 187.137 27.110 -48.751 1.00 135.34 ? 210  ASP C O   1 
ATOM   3116  C CB  . ASP B  1  199 ? 189.600 27.361 -47.048 1.00 135.17 ? 210  ASP C CB  1 
ATOM   3117  C CG  . ASP B  1  199 ? 189.880 28.840 -46.970 1.00 135.23 ? 210  ASP C CG  1 
ATOM   3118  O OD1 . ASP B  1  199 ? 190.982 29.267 -47.377 1.00 135.28 ? 210  ASP C OD1 1 
ATOM   3119  O OD2 . ASP B  1  199 ? 189.037 29.637 -46.508 1.00 135.30 ? 210  ASP C OD2 1 
ATOM   3120  N N   . VAL B  1  200 ? 186.339 28.489 -47.157 1.00 135.47 ? 211  VAL C N   1 
ATOM   3121  C CA  . VAL B  1  200 ? 185.299 29.092 -47.996 1.00 135.56 ? 211  VAL C CA  1 
ATOM   3122  C C   . VAL B  1  200 ? 185.845 29.633 -49.324 1.00 135.56 ? 211  VAL C C   1 
ATOM   3123  O O   . VAL B  1  200 ? 187.021 29.988 -49.416 1.00 135.60 ? 211  VAL C O   1 
ATOM   3124  C CB  . VAL B  1  200 ? 184.591 30.244 -47.249 1.00 135.59 ? 211  VAL C CB  1 
ATOM   3125  C CG1 . VAL B  1  200 ? 183.968 29.733 -45.956 1.00 135.58 ? 211  VAL C CG1 1 
ATOM   3126  C CG2 . VAL B  1  200 ? 185.567 31.377 -46.958 1.00 135.64 ? 211  VAL C CG2 1 
ATOM   3127  N N   . PRO B  1  201 ? 185.006 29.666 -50.363 1.00 135.55 ? 212  PRO C N   1 
ATOM   3128  C CA  . PRO B  1  201 ? 185.413 30.183 -51.673 1.00 135.56 ? 212  PRO C CA  1 
ATOM   3129  C C   . PRO B  1  201 ? 185.864 31.639 -51.628 1.00 135.56 ? 212  PRO C C   1 
ATOM   3130  O O   . PRO B  1  201 ? 185.050 32.545 -51.450 1.00 135.57 ? 212  PRO C O   1 
ATOM   3131  C CB  . PRO B  1  201 ? 184.146 30.008 -52.513 1.00 135.54 ? 212  PRO C CB  1 
ATOM   3132  C CG  . PRO B  1  201 ? 183.489 28.833 -51.894 1.00 135.52 ? 212  PRO C CG  1 
ATOM   3133  C CD  . PRO B  1  201 ? 183.642 29.113 -50.420 1.00 135.54 ? 212  PRO C CD  1 
ATOM   3134  N N   . CYS B  1  202 ? 187.167 31.850 -51.784 1.00 135.55 ? 213  CYS C N   1 
ATOM   3135  C CA  . CYS B  1  202 ? 187.737 33.190 -51.755 1.00 135.52 ? 213  CYS C CA  1 
ATOM   3136  C C   . CYS B  1  202 ? 187.837 33.763 -53.162 1.00 135.55 ? 213  CYS C C   1 
ATOM   3137  O O   . CYS B  1  202 ? 187.480 33.072 -54.123 1.00 135.54 ? 213  CYS C O   1 
ATOM   3138  C CB  . CYS B  1  202 ? 189.119 33.168 -51.094 1.00 135.50 ? 213  CYS C CB  1 
ATOM   3139  S SG  . CYS B  1  202 ? 190.296 32.004 -51.824 1.00 135.38 ? 213  CYS C SG  1 
ATOM   3140  O OXT . CYS B  1  202 ? 188.271 34.910 -53.313 1.00 135.60 ? 213  CYS C OXT 1 
ATOM   3141  N N   . GLU C  2  1   ? 89.972  47.034 43.098  1.00 38.91  ? 1    GLU B N   1 
ATOM   3142  C CA  . GLU C  2  1   ? 88.986  47.816 42.299  1.00 38.83  ? 1    GLU B CA  1 
ATOM   3143  C C   . GLU C  2  1   ? 88.186  46.879 41.385  1.00 37.50  ? 1    GLU B C   1 
ATOM   3144  O O   . GLU C  2  1   ? 87.101  46.429 41.752  1.00 38.03  ? 1    GLU B O   1 
ATOM   3145  C CB  . GLU C  2  1   ? 89.708  48.889 41.482  1.00 39.56  ? 1    GLU B CB  1 
ATOM   3146  C CG  . GLU C  2  1   ? 88.932  50.194 41.345  1.00 41.51  ? 1    GLU B CG  1 
ATOM   3147  C CD  . GLU C  2  1   ? 87.621  50.041 40.592  1.00 42.85  ? 1    GLU B CD  1 
ATOM   3148  O OE1 . GLU C  2  1   ? 86.754  50.925 40.740  1.00 44.07  ? 1    GLU B OE1 1 
ATOM   3149  O OE2 . GLU C  2  1   ? 87.459  49.048 39.853  1.00 43.51  ? 1    GLU B OE2 1 
ATOM   3150  N N   . ALA C  2  2   ? 88.686  46.652 40.173  1.00 35.57  ? 2    ALA B N   1 
ATOM   3151  C CA  . ALA C  2  2   ? 88.084  45.723 39.220  1.00 33.84  ? 2    ALA B CA  1 
ATOM   3152  C C   . ALA C  2  2   ? 86.553  45.788 39.252  1.00 32.18  ? 2    ALA B C   1 
ATOM   3153  O O   . ALA C  2  2   ? 85.886  44.749 39.317  1.00 31.47  ? 2    ALA B O   1 
ATOM   3154  C CB  . ALA C  2  2   ? 88.571  44.303 39.467  1.00 33.75  ? 2    ALA B CB  1 
ATOM   3155  N N   . ALA C  2  3   ? 86.020  47.014 39.157  1.00 30.02  ? 3    ALA B N   1 
ATOM   3156  C CA  . ALA C  2  3   ? 84.577  47.294 39.253  1.00 28.02  ? 3    ALA B CA  1 
ATOM   3157  C C   . ALA C  2  3   ? 83.642  46.779 38.164  1.00 26.26  ? 3    ALA B C   1 
ATOM   3158  O O   . ALA C  2  3   ? 83.906  46.900 36.970  1.00 26.53  ? 3    ALA B O   1 
ATOM   3159  C CB  . ALA C  2  3   ? 84.362  48.784 39.422  1.00 27.92  ? 3    ALA B CB  1 
ATOM   3160  N N   . VAL C  2  4   ? 82.515  46.246 38.626  1.00 24.17  ? 4    VAL B N   1 
ATOM   3161  C CA  . VAL C  2  4   ? 81.444  45.730 37.790  1.00 22.32  ? 4    VAL B CA  1 
ATOM   3162  C C   . VAL C  2  4   ? 80.149  46.164 38.469  1.00 21.50  ? 4    VAL B C   1 
ATOM   3163  O O   . VAL C  2  4   ? 79.919  45.819 39.625  1.00 20.94  ? 4    VAL B O   1 
ATOM   3164  C CB  . VAL C  2  4   ? 81.486  44.199 37.713  1.00 21.62  ? 4    VAL B CB  1 
ATOM   3165  C CG1 . VAL C  2  4   ? 80.336  43.682 36.868  1.00 21.15  ? 4    VAL B CG1 1 
ATOM   3166  C CG2 . VAL C  2  4   ? 82.809  43.737 37.142  1.00 20.75  ? 4    VAL B CG2 1 
ATOM   3167  N N   . THR C  2  5   ? 79.311  46.921 37.762  1.00 20.89  ? 5    THR B N   1 
ATOM   3168  C CA  . THR C  2  5   ? 78.071  47.444 38.338  1.00 20.22  ? 5    THR B CA  1 
ATOM   3169  C C   . THR C  2  5   ? 76.830  46.932 37.628  1.00 20.15  ? 5    THR B C   1 
ATOM   3170  O O   . THR C  2  5   ? 76.685  47.097 36.418  1.00 20.19  ? 5    THR B O   1 
ATOM   3171  C CB  . THR C  2  5   ? 78.083  48.973 38.281  1.00 20.19  ? 5    THR B CB  1 
ATOM   3172  O OG1 . THR C  2  5   ? 79.126  49.477 39.129  1.00 20.76  ? 5    THR B OG1 1 
ATOM   3173  C CG2 . THR C  2  5   ? 76.776  49.560 38.827  1.00 20.59  ? 5    THR B CG2 1 
ATOM   3174  N N   . GLN C  2  6   ? 75.925  46.323 38.385  1.00 20.35  ? 6    GLN B N   1 
ATOM   3175  C CA  . GLN C  2  6   ? 74.700  45.783 37.811  1.00 20.67  ? 6    GLN B CA  1 
ATOM   3176  C C   . GLN C  2  6   ? 73.532  46.685 38.165  1.00 20.94  ? 6    GLN B C   1 
ATOM   3177  O O   . GLN C  2  6   ? 73.480  47.229 39.258  1.00 21.20  ? 6    GLN B O   1 
ATOM   3178  C CB  . GLN C  2  6   ? 74.417  44.381 38.353  1.00 20.69  ? 6    GLN B CB  1 
ATOM   3179  C CG  . GLN C  2  6   ? 75.609  43.438 38.332  1.00 21.50  ? 6    GLN B CG  1 
ATOM   3180  C CD  . GLN C  2  6   ? 75.246  42.033 38.790  1.00 22.41  ? 6    GLN B CD  1 
ATOM   3181  O OE1 . GLN C  2  6   ? 76.131  41.216 39.031  1.00 24.13  ? 6    GLN B OE1 1 
ATOM   3182  N NE2 . GLN C  2  6   ? 73.951  41.754 38.919  1.00 20.26  ? 6    GLN B NE2 1 
ATOM   3183  N N   . SER C  2  7   ? 72.574  46.816 37.258  1.00 21.20  ? 7    SER B N   1 
ATOM   3184  C CA  . SER C  2  7   ? 71.416  47.645 37.523  1.00 21.66  ? 7    SER B CA  1 
ATOM   3185  C C   . SER C  2  7   ? 70.185  47.107 36.805  1.00 21.76  ? 7    SER B C   1 
ATOM   3186  O O   . SER C  2  7   ? 70.245  46.789 35.608  1.00 21.41  ? 7    SER B O   1 
ATOM   3187  C CB  . SER C  2  7   ? 71.688  49.070 37.063  1.00 21.70  ? 7    SER B CB  1 
ATOM   3188  O OG  . SER C  2  7   ? 72.125  49.058 35.715  1.00 23.22  ? 7    SER B OG  1 
ATOM   3189  N N   . PRO C  2  8   ? 69.057  47.060 37.515  1.00 21.71  ? 8    PRO B N   1 
ATOM   3190  C CA  . PRO C  2  8   ? 68.961  47.452 38.925  1.00 21.83  ? 8    PRO B CA  1 
ATOM   3191  C C   . PRO C  2  8   ? 69.484  46.435 39.935  1.00 22.44  ? 8    PRO B C   1 
ATOM   3192  O O   . PRO C  2  8   ? 69.995  45.409 39.538  1.00 23.08  ? 8    PRO B O   1 
ATOM   3193  C CB  . PRO C  2  8   ? 67.461  47.668 39.097  1.00 21.46  ? 8    PRO B CB  1 
ATOM   3194  C CG  . PRO C  2  8   ? 66.877  46.702 38.190  1.00 21.52  ? 8    PRO B CG  1 
ATOM   3195  C CD  . PRO C  2  8   ? 67.722  46.838 36.947  1.00 21.64  ? 8    PRO B CD  1 
ATOM   3196  N N   . ARG C  2  9   ? 69.382  46.759 41.225  1.00 23.36  ? 9    ARG B N   1 
ATOM   3197  C CA  . ARG C  2  9   ? 69.809  45.886 42.313  1.00 23.65  ? 9    ARG B CA  1 
ATOM   3198  C C   . ARG C  2  9   ? 68.709  44.874 42.545  1.00 22.87  ? 9    ARG B C   1 
ATOM   3199  O O   . ARG C  2  9   ? 68.962  43.721 42.887  1.00 22.53  ? 9    ARG B O   1 
ATOM   3200  C CB  . ARG C  2  9   ? 69.956  46.667 43.626  1.00 25.30  ? 9    ARG B CB  1 
ATOM   3201  C CG  . ARG C  2  9   ? 71.213  47.452 43.830  1.00 28.75  ? 9    ARG B CG  1 
ATOM   3202  C CD  . ARG C  2  9   ? 72.395  46.532 43.890  1.00 34.95  ? 9    ARG B CD  1 
ATOM   3203  N NE  . ARG C  2  9   ? 72.972  46.328 45.214  1.00 39.19  ? 9    ARG B NE  1 
ATOM   3204  C CZ  . ARG C  2  9   ? 74.153  45.764 45.365  1.00 41.87  ? 9    ARG B CZ  1 
ATOM   3205  N NH1 . ARG C  2  9   ? 74.797  45.390 44.274  1.00 43.28  ? 9    ARG B NH1 1 
ATOM   3206  N NH2 . ARG C  2  9   ? 74.694  45.575 46.562  1.00 43.12  ? 9    ARG B NH2 1 
ATOM   3207  N N   . ASN C  2  10  ? 67.473  45.349 42.402  1.00 22.15  ? 10   ASN B N   1 
ATOM   3208  C CA  . ASN C  2  10  ? 66.277  44.544 42.623  1.00 21.53  ? 10   ASN B CA  1 
ATOM   3209  C C   . ASN C  2  10  ? 65.223  44.787 41.547  1.00 22.46  ? 10   ASN B C   1 
ATOM   3210  O O   . ASN C  2  10  ? 65.211  45.826 40.889  1.00 21.96  ? 10   ASN B O   1 
ATOM   3211  C CB  . ASN C  2  10  ? 65.674  44.873 43.982  1.00 20.45  ? 10   ASN B CB  1 
ATOM   3212  C CG  . ASN C  2  10  ? 66.676  44.736 45.117  1.00 19.26  ? 10   ASN B CG  1 
ATOM   3213  O OD1 . ASN C  2  10  ? 66.714  43.712 45.792  1.00 18.02  ? 10   ASN B OD1 1 
ATOM   3214  N ND2 . ASN C  2  10  ? 67.491  45.769 45.331  1.00 14.56  ? 10   ASN B ND2 1 
ATOM   3215  N N   . LYS C  2  11  ? 64.318  43.832 41.386  1.00 23.52  ? 11   LYS B N   1 
ATOM   3216  C CA  . LYS C  2  11  ? 63.278  43.967 40.391  1.00 24.61  ? 11   LYS B CA  1 
ATOM   3217  C C   . LYS C  2  11  ? 62.085  43.093 40.723  1.00 25.53  ? 11   LYS B C   1 
ATOM   3218  O O   . LYS C  2  11  ? 62.222  41.900 40.986  1.00 25.90  ? 11   LYS B O   1 
ATOM   3219  C CB  . LYS C  2  11  ? 63.832  43.600 39.012  1.00 25.09  ? 11   LYS B CB  1 
ATOM   3220  C CG  . LYS C  2  11  ? 62.860  43.797 37.877  1.00 25.29  ? 11   LYS B CG  1 
ATOM   3221  C CD  . LYS C  2  11  ? 62.500  45.267 37.673  1.00 25.97  ? 11   LYS B CD  1 
ATOM   3222  C CE  . LYS C  2  11  ? 61.464  45.412 36.558  1.00 26.39  ? 11   LYS B CE  1 
ATOM   3223  N NZ  . LYS C  2  11  ? 60.881  46.774 36.452  1.00 26.55  ? 11   LYS B NZ  1 
ATOM   3224  N N   . VAL C  2  12  ? 60.910  43.709 40.717  1.00 26.73  ? 12   VAL B N   1 
ATOM   3225  C CA  . VAL C  2  12  ? 59.662  43.015 40.967  1.00 27.25  ? 12   VAL B CA  1 
ATOM   3226  C C   . VAL C  2  12  ? 58.892  43.068 39.662  1.00 27.62  ? 12   VAL B C   1 
ATOM   3227  O O   . VAL C  2  12  ? 58.216  44.049 39.394  1.00 28.34  ? 12   VAL B O   1 
ATOM   3228  C CB  . VAL C  2  12  ? 58.833  43.721 42.059  1.00 27.27  ? 12   VAL B CB  1 
ATOM   3229  C CG1 . VAL C  2  12  ? 57.511  42.996 42.282  1.00 27.50  ? 12   VAL B CG1 1 
ATOM   3230  C CG2 . VAL C  2  12  ? 59.614  43.788 43.348  1.00 27.52  ? 12   VAL B CG2 1 
ATOM   3231  N N   . ALA C  2  13  ? 59.011  42.032 38.842  1.00 27.84  ? 13   ALA B N   1 
ATOM   3232  C CA  . ALA C  2  13  ? 58.318  41.985 37.560  1.00 27.98  ? 13   ALA B CA  1 
ATOM   3233  C C   . ALA C  2  13  ? 57.240  40.912 37.598  1.00 28.51  ? 13   ALA B C   1 
ATOM   3234  O O   . ALA C  2  13  ? 57.279  40.028 38.443  1.00 28.95  ? 13   ALA B O   1 
ATOM   3235  C CB  . ALA C  2  13  ? 59.306  41.698 36.437  1.00 27.62  ? 13   ALA B CB  1 
ATOM   3236  N N   . VAL C  2  14  ? 56.285  40.982 36.678  1.00 28.96  ? 14   VAL B N   1 
ATOM   3237  C CA  . VAL C  2  14  ? 55.202  40.011 36.634  1.00 29.58  ? 14   VAL B CA  1 
ATOM   3238  C C   . VAL C  2  14  ? 55.324  39.167 35.369  1.00 29.77  ? 14   VAL B C   1 
ATOM   3239  O O   . VAL C  2  14  ? 55.907  39.608 34.384  1.00 29.33  ? 14   VAL B O   1 
ATOM   3240  C CB  . VAL C  2  14  ? 53.813  40.712 36.672  1.00 30.03  ? 14   VAL B CB  1 
ATOM   3241  C CG1 . VAL C  2  14  ? 53.605  41.569 35.427  1.00 31.00  ? 14   VAL B CG1 1 
ATOM   3242  C CG2 . VAL C  2  14  ? 52.694  39.693 36.794  1.00 30.14  ? 14   VAL B CG2 1 
ATOM   3243  N N   . THR C  2  15  ? 54.770  37.957 35.402  1.00 30.45  ? 15   THR B N   1 
ATOM   3244  C CA  . THR C  2  15  ? 54.805  37.059 34.253  1.00 31.14  ? 15   THR B CA  1 
ATOM   3245  C C   . THR C  2  15  ? 54.412  37.800 32.981  1.00 31.53  ? 15   THR B C   1 
ATOM   3246  O O   . THR C  2  15  ? 53.505  38.630 32.992  1.00 31.85  ? 15   THR B O   1 
ATOM   3247  C CB  . THR C  2  15  ? 53.821  35.888 34.436  1.00 31.44  ? 15   THR B CB  1 
ATOM   3248  O OG1 . THR C  2  15  ? 54.052  35.223 35.685  1.00 31.25  ? 15   THR B OG1 1 
ATOM   3249  C CG2 . THR C  2  15  ? 54.047  34.833 33.350  1.00 31.85  ? 15   THR B CG2 1 
ATOM   3250  N N   . GLY C  2  16  ? 55.084  37.493 31.880  1.00 31.86  ? 16   GLY B N   1 
ATOM   3251  C CA  . GLY C  2  16  ? 54.796  38.152 30.618  1.00 31.94  ? 16   GLY B CA  1 
ATOM   3252  C C   . GLY C  2  16  ? 55.514  39.484 30.507  1.00 32.04  ? 16   GLY B C   1 
ATOM   3253  O O   . GLY C  2  16  ? 55.667  40.034 29.412  1.00 32.01  ? 16   GLY B O   1 
ATOM   3254  N N   . GLY C  2  17  ? 55.960  39.998 31.650  1.00 32.14  ? 17   GLY B N   1 
ATOM   3255  C CA  . GLY C  2  17  ? 56.659  41.270 31.704  1.00 32.08  ? 17   GLY B CA  1 
ATOM   3256  C C   . GLY C  2  17  ? 57.980  41.301 30.955  1.00 32.07  ? 17   GLY B C   1 
ATOM   3257  O O   . GLY C  2  17  ? 58.498  40.273 30.513  1.00 31.54  ? 17   GLY B O   1 
ATOM   3258  N N   . LYS C  2  18  ? 58.517  42.509 30.823  1.00 32.25  ? 18   LYS B N   1 
ATOM   3259  C CA  . LYS C  2  18  ? 59.777  42.744 30.141  1.00 32.47  ? 18   LYS B CA  1 
ATOM   3260  C C   . LYS C  2  18  ? 60.795  43.195 31.170  1.00 32.30  ? 18   LYS B C   1 
ATOM   3261  O O   . LYS C  2  18  ? 60.566  44.186 31.870  1.00 33.16  ? 18   LYS B O   1 
ATOM   3262  C CB  . LYS C  2  18  ? 59.611  43.842 29.089  1.00 32.69  ? 18   LYS B CB  1 
ATOM   3263  C CG  . LYS C  2  18  ? 60.842  44.098 28.237  1.00 33.02  ? 18   LYS B CG  1 
ATOM   3264  C CD  . LYS C  2  18  ? 61.143  42.909 27.350  1.00 34.56  ? 18   LYS B CD  1 
ATOM   3265  C CE  . LYS C  2  18  ? 62.341  43.165 26.459  1.00 35.11  ? 18   LYS B CE  1 
ATOM   3266  N NZ  . LYS C  2  18  ? 62.135  44.378 25.626  1.00 36.25  ? 18   LYS B NZ  1 
ATOM   3267  N N   . VAL C  2  19  ? 61.913  42.477 31.264  1.00 31.49  ? 19   VAL B N   1 
ATOM   3268  C CA  . VAL C  2  19  ? 62.960  42.819 32.220  1.00 30.57  ? 19   VAL B CA  1 
ATOM   3269  C C   . VAL C  2  19  ? 64.311  42.938 31.529  1.00 30.17  ? 19   VAL B C   1 
ATOM   3270  O O   . VAL C  2  19  ? 64.688  42.084 30.731  1.00 30.39  ? 19   VAL B O   1 
ATOM   3271  C CB  . VAL C  2  19  ? 63.095  41.751 33.329  1.00 30.62  ? 19   VAL B CB  1 
ATOM   3272  C CG1 . VAL C  2  19  ? 64.184  42.151 34.320  1.00 30.00  ? 19   VAL B CG1 1 
ATOM   3273  C CG2 . VAL C  2  19  ? 61.770  41.540 34.047  1.00 30.52  ? 19   VAL B CG2 1 
ATOM   3274  N N   . THR C  2  20  ? 65.034  44.007 31.837  1.00 29.42  ? 20   THR B N   1 
ATOM   3275  C CA  . THR C  2  20  ? 66.369  44.207 31.307  1.00 28.57  ? 20   THR B CA  1 
ATOM   3276  C C   . THR C  2  20  ? 67.310  44.426 32.477  1.00 27.57  ? 20   THR B C   1 
ATOM   3277  O O   . THR C  2  20  ? 67.166  45.387 33.231  1.00 27.05  ? 20   THR B O   1 
ATOM   3278  C CB  . THR C  2  20  ? 66.454  45.425 30.379  1.00 28.77  ? 20   THR B CB  1 
ATOM   3279  O OG1 . THR C  2  20  ? 65.749  45.162 29.160  1.00 30.13  ? 20   THR B OG1 1 
ATOM   3280  C CG2 . THR C  2  20  ? 67.915  45.690 29.958  1.00 28.49  ? 20   THR B CG2 1 
ATOM   3281  N N   . LEU C  2  21  ? 68.265  43.518 32.625  1.00 26.46  ? 21   LEU B N   1 
ATOM   3282  C CA  . LEU C  2  21  ? 69.275  43.629 33.651  1.00 25.53  ? 21   LEU B CA  1 
ATOM   3283  C C   . LEU C  2  21  ? 70.488  44.135 32.890  1.00 25.27  ? 21   LEU B C   1 
ATOM   3284  O O   . LEU C  2  21  ? 70.768  43.660 31.797  1.00 24.62  ? 21   LEU B O   1 
ATOM   3285  C CB  . LEU C  2  21  ? 69.557  42.267 34.275  1.00 25.42  ? 21   LEU B CB  1 
ATOM   3286  C CG  . LEU C  2  21  ? 68.391  41.519 34.923  1.00 24.59  ? 21   LEU B CG  1 
ATOM   3287  C CD1 . LEU C  2  21  ? 68.932  40.224 35.502  1.00 25.56  ? 21   LEU B CD1 1 
ATOM   3288  C CD2 . LEU C  2  21  ? 67.721  42.336 36.006  1.00 23.19  ? 21   LEU B CD2 1 
ATOM   3289  N N   . SER C  2  22  ? 71.197  45.116 33.430  1.00 25.20  ? 22   SER B N   1 
ATOM   3290  C CA  . SER C  2  22  ? 72.347  45.643 32.714  1.00 25.07  ? 22   SER B CA  1 
ATOM   3291  C C   . SER C  2  22  ? 73.594  45.613 33.581  1.00 25.04  ? 22   SER B C   1 
ATOM   3292  O O   . SER C  2  22  ? 73.515  45.705 34.803  1.00 24.95  ? 22   SER B O   1 
ATOM   3293  C CB  . SER C  2  22  ? 72.069  47.068 32.209  1.00 25.26  ? 22   SER B CB  1 
ATOM   3294  O OG  . SER C  2  22  ? 72.363  48.040 33.198  1.00 25.68  ? 22   SER B OG  1 
ATOM   3295  N N   . CYS C  2  23  ? 74.740  45.488 32.920  1.00 24.96  ? 23   CYS B N   1 
ATOM   3296  C CA  . CYS C  2  23  ? 76.032  45.424 33.566  1.00 25.19  ? 23   CYS B CA  1 
ATOM   3297  C C   . CYS C  2  23  ? 76.921  46.486 32.950  1.00 25.73  ? 23   CYS B C   1 
ATOM   3298  O O   . CYS C  2  23  ? 77.029  46.568 31.735  1.00 25.48  ? 23   CYS B O   1 
ATOM   3299  C CB  . CYS C  2  23  ? 76.658  44.059 33.306  1.00 25.62  ? 23   CYS B CB  1 
ATOM   3300  S SG  . CYS C  2  23  ? 78.105  43.625 34.302  1.00 23.97  ? 23   CYS B SG  1 
ATOM   3301  N N   . ASN C  2  24  ? 77.557  47.289 33.789  1.00 26.42  ? 24   ASN B N   1 
ATOM   3302  C CA  . ASN C  2  24  ? 78.478  48.309 33.331  1.00 27.67  ? 24   ASN B CA  1 
ATOM   3303  C C   . ASN C  2  24  ? 79.814  47.868 33.886  1.00 25.23  ? 24   ASN B C   1 
ATOM   3304  O O   . ASN C  2  24  ? 79.886  47.396 35.019  1.00 25.20  ? 24   ASN B O   1 
ATOM   3305  C CB  . ASN C  2  24  ? 78.104  49.688 33.887  1.00 29.94  ? 24   ASN B CB  1 
ATOM   3306  C CG  . ASN C  2  24  ? 77.510  50.621 32.841  1.00 39.28  ? 24   ASN B CG  1 
ATOM   3307  O OD1 . ASN C  2  24  ? 76.793  50.178 31.929  1.00 42.01  ? 24   ASN B OD1 1 
ATOM   3308  N ND2 . ASN C  2  24  ? 77.838  51.945 32.958  1.00 56.33  ? 24   ASN B ND2 1 
ATOM   3309  N N   . GLN C  2  25  ? 80.868  48.027 33.101  1.00 23.05  ? 25   GLN B N   1 
ATOM   3310  C CA  . GLN C  2  25  ? 82.193  47.596 33.498  1.00 21.78  ? 25   GLN B CA  1 
ATOM   3311  C C   . GLN C  2  25  ? 83.246  48.665 33.206  1.00 21.26  ? 25   GLN B C   1 
ATOM   3312  O O   . GLN C  2  25  ? 83.212  49.293 32.158  1.00 20.83  ? 25   GLN B O   1 
ATOM   3313  C CB  . GLN C  2  25  ? 82.526  46.313 32.725  1.00 21.48  ? 25   GLN B CB  1 
ATOM   3314  C CG  . GLN C  2  25  ? 83.826  45.670 33.090  1.00 19.83  ? 25   GLN B CG  1 
ATOM   3315  C CD  . GLN C  2  25  ? 84.636  45.261 31.884  1.00 18.10  ? 25   GLN B CD  1 
ATOM   3316  O OE1 . GLN C  2  25  ? 85.876  45.278 31.947  1.00 18.65  ? 25   GLN B OE1 1 
ATOM   3317  N NE2 . GLN C  2  25  ? 83.989  44.890 30.816  1.00 16.87  ? 25   GLN B NE2 1 
ATOM   3318  N N   . THR C  2  26  ? 84.179  48.873 34.134  1.00 21.08  ? 26   THR B N   1 
ATOM   3319  C CA  . THR C  2  26  ? 85.269  49.829 33.915  1.00 20.88  ? 26   THR B CA  1 
ATOM   3320  C C   . THR C  2  26  ? 86.586  49.072 33.924  1.00 20.87  ? 26   THR B C   1 
ATOM   3321  O O   . THR C  2  26  ? 87.647  49.685 33.890  1.00 20.73  ? 26   THR B O   1 
ATOM   3322  C CB  . THR C  2  26  ? 85.326  50.965 34.969  1.00 20.79  ? 26   THR B CB  1 
ATOM   3323  O OG1 . THR C  2  26  ? 85.511  50.422 36.282  1.00 21.12  ? 26   THR B OG1 1 
ATOM   3324  C CG2 . THR C  2  26  ? 84.025  51.778 34.996  1.00 20.16  ? 26   THR B CG2 1 
ATOM   3325  N N   . ASN C  2  27  ? 86.503  47.740 33.967  1.00 20.76  ? 27   ASN B N   1 
ATOM   3326  C CA  . ASN C  2  27  ? 87.682  46.879 33.967  1.00 21.10  ? 27   ASN B CA  1 
ATOM   3327  C C   . ASN C  2  27  ? 88.340  46.783 32.598  1.00 20.65  ? 27   ASN B C   1 
ATOM   3328  O O   . ASN C  2  27  ? 89.470  46.327 32.482  1.00 19.93  ? 27   ASN B O   1 
ATOM   3329  C CB  . ASN C  2  27  ? 87.318  45.468 34.415  1.00 21.61  ? 27   ASN B CB  1 
ATOM   3330  C CG  . ASN C  2  27  ? 86.886  45.403 35.856  1.00 22.07  ? 27   ASN B CG  1 
ATOM   3331  O OD1 . ASN C  2  27  ? 87.359  46.168 36.686  1.00 22.28  ? 27   ASN B OD1 1 
ATOM   3332  N ND2 . ASN C  2  27  ? 85.981  44.482 36.160  1.00 22.17  ? 27   ASN B ND2 1 
ATOM   3333  N N   . ASN C  2  28  ? 87.619  47.196 31.561  1.00 20.93  ? 28   ASN B N   1 
ATOM   3334  C CA  . ASN C  2  28  ? 88.138  47.151 30.198  1.00 20.87  ? 28   ASN B CA  1 
ATOM   3335  C C   . ASN C  2  28  ? 88.500  45.714 29.822  1.00 20.87  ? 28   ASN B C   1 
ATOM   3336  O O   . ASN C  2  28  ? 89.471  45.480 29.105  1.00 20.88  ? 28   ASN B O   1 
ATOM   3337  C CB  . ASN C  2  28  ? 89.358  48.078 30.077  1.00 21.21  ? 28   ASN B CB  1 
ATOM   3338  C CG  . ASN C  2  28  ? 89.739  48.375 28.638  1.00 22.02  ? 28   ASN B CG  1 
ATOM   3339  O OD1 . ASN C  2  28  ? 88.885  48.600 27.789  1.00 22.57  ? 28   ASN B OD1 1 
ATOM   3340  N ND2 . ASN C  2  28  ? 91.035  48.392 28.366  1.00 24.40  ? 28   ASN B ND2 1 
ATOM   3341  N N   . HIS C  2  29  ? 87.724  44.753 30.326  1.00 20.90  ? 29   HIS B N   1 
ATOM   3342  C CA  . HIS C  2  29  ? 87.933  43.335 30.027  1.00 20.75  ? 29   HIS B CA  1 
ATOM   3343  C C   . HIS C  2  29  ? 87.141  42.955 28.796  1.00 21.18  ? 29   HIS B C   1 
ATOM   3344  O O   . HIS C  2  29  ? 86.011  43.403 28.610  1.00 22.00  ? 29   HIS B O   1 
ATOM   3345  C CB  . HIS C  2  29  ? 87.481  42.437 31.176  1.00 20.46  ? 29   HIS B CB  1 
ATOM   3346  C CG  . HIS C  2  29  ? 88.376  42.496 32.367  1.00 19.23  ? 29   HIS B CG  1 
ATOM   3347  N ND1 . HIS C  2  29  ? 87.924  42.844 33.618  1.00 18.25  ? 29   HIS B ND1 1 
ATOM   3348  C CD2 . HIS C  2  29  ? 89.704  42.283 32.492  1.00 18.62  ? 29   HIS B CD2 1 
ATOM   3349  C CE1 . HIS C  2  29  ? 88.938  42.844 34.465  1.00 17.33  ? 29   HIS B CE1 1 
ATOM   3350  N NE2 . HIS C  2  29  ? 90.028  42.505 33.807  1.00 17.08  ? 29   HIS B NE2 1 
ATOM   3351  N N   . ASN C  2  30  ? 87.734  42.119 27.962  1.00 21.37  ? 30   ASN B N   1 
ATOM   3352  C CA  . ASN C  2  30  ? 87.097  41.700 26.728  1.00 22.44  ? 30   ASN B CA  1 
ATOM   3353  C C   . ASN C  2  30  ? 85.894  40.778 26.900  1.00 22.50  ? 30   ASN B C   1 
ATOM   3354  O O   . ASN C  2  30  ? 84.911  40.914 26.177  1.00 22.59  ? 30   ASN B O   1 
ATOM   3355  C CB  . ASN C  2  30  ? 88.126  41.023 25.828  1.00 22.47  ? 30   ASN B CB  1 
ATOM   3356  C CG  . ASN C  2  30  ? 89.129  41.990 25.277  1.00 23.21  ? 30   ASN B CG  1 
ATOM   3357  O OD1 . ASN C  2  30  ? 90.197  41.594 24.806  1.00 25.09  ? 30   ASN B OD1 1 
ATOM   3358  N ND2 . ASN C  2  30  ? 88.798  43.278 25.329  1.00 24.09  ? 30   ASN B ND2 1 
ATOM   3359  N N   . ASN C  2  31  ? 85.994  39.832 27.833  1.00 22.86  ? 31   ASN B N   1 
ATOM   3360  C CA  . ASN C  2  31  ? 84.936  38.848 28.076  1.00 22.67  ? 31   ASN B CA  1 
ATOM   3361  C C   . ASN C  2  31  ? 83.982  39.286 29.183  1.00 22.30  ? 31   ASN B C   1 
ATOM   3362  O O   . ASN C  2  31  ? 84.392  39.927 30.148  1.00 22.59  ? 31   ASN B O   1 
ATOM   3363  C CB  . ASN C  2  31  ? 85.557  37.502 28.454  1.00 22.73  ? 31   ASN B CB  1 
ATOM   3364  C CG  . ASN C  2  31  ? 86.572  37.007 27.433  1.00 22.83  ? 31   ASN B CG  1 
ATOM   3365  O OD1 . ASN C  2  31  ? 87.652  36.539 27.793  1.00 22.64  ? 31   ASN B OD1 1 
ATOM   3366  N ND2 . ASN C  2  31  ? 86.225  37.093 26.158  1.00 23.17  ? 31   ASN B ND2 1 
ATOM   3367  N N   . MET C  2  32  ? 82.708  38.935 29.041  1.00 21.69  ? 32   MET B N   1 
ATOM   3368  C CA  . MET C  2  32  ? 81.704  39.262 30.049  1.00 21.04  ? 32   MET B CA  1 
ATOM   3369  C C   . MET C  2  32  ? 80.752  38.088 30.210  1.00 20.32  ? 32   MET B C   1 
ATOM   3370  O O   . MET C  2  32  ? 80.508  37.363 29.257  1.00 19.88  ? 32   MET B O   1 
ATOM   3371  C CB  . MET C  2  32  ? 80.962  40.552 29.687  1.00 20.94  ? 32   MET B CB  1 
ATOM   3372  C CG  . MET C  2  32  ? 81.775  41.796 30.071  1.00 20.70  ? 32   MET B CG  1 
ATOM   3373  S SD  . MET C  2  32  ? 81.075  43.367 29.600  1.00 20.13  ? 32   MET B SD  1 
ATOM   3374  C CE  . MET C  2  32  ? 80.080  43.762 31.087  1.00 20.31  ? 32   MET B CE  1 
ATOM   3375  N N   . TYR C  2  33  ? 80.238  37.892 31.423  1.00 19.86  ? 33   TYR B N   1 
ATOM   3376  C CA  . TYR C  2  33  ? 79.356  36.764 31.707  1.00 19.40  ? 33   TYR B CA  1 
ATOM   3377  C C   . TYR C  2  33  ? 78.120  37.157 32.502  1.00 19.18  ? 33   TYR B C   1 
ATOM   3378  O O   . TYR C  2  33  ? 78.138  38.113 33.270  1.00 19.45  ? 33   TYR B O   1 
ATOM   3379  C CB  . TYR C  2  33  ? 80.149  35.695 32.474  1.00 19.47  ? 33   TYR B CB  1 
ATOM   3380  C CG  . TYR C  2  33  ? 81.491  35.436 31.832  1.00 19.96  ? 33   TYR B CG  1 
ATOM   3381  C CD1 . TYR C  2  33  ? 82.552  36.319 32.008  1.00 19.97  ? 33   TYR B CD1 1 
ATOM   3382  C CD2 . TYR C  2  33  ? 81.683  34.348 30.985  1.00 21.16  ? 33   TYR B CD2 1 
ATOM   3383  C CE1 . TYR C  2  33  ? 83.767  36.113 31.369  1.00 20.38  ? 33   TYR B CE1 1 
ATOM   3384  C CE2 . TYR C  2  33  ? 82.905  34.137 30.345  1.00 20.44  ? 33   TYR B CE2 1 
ATOM   3385  C CZ  . TYR C  2  33  ? 83.934  35.020 30.538  1.00 19.54  ? 33   TYR B CZ  1 
ATOM   3386  O OH  . TYR C  2  33  ? 85.132  34.805 29.892  1.00 20.24  ? 33   TYR B OH  1 
ATOM   3387  N N   . TRP C  2  34  ? 77.042  36.409 32.309  1.00 18.89  ? 34   TRP B N   1 
ATOM   3388  C CA  . TRP C  2  34  ? 75.803  36.636 33.038  1.00 18.42  ? 34   TRP B CA  1 
ATOM   3389  C C   . TRP C  2  34  ? 75.419  35.306 33.640  1.00 17.57  ? 34   TRP B C   1 
ATOM   3390  O O   . TRP C  2  34  ? 75.157  34.345 32.914  1.00 17.24  ? 34   TRP B O   1 
ATOM   3391  C CB  . TRP C  2  34  ? 74.678  37.136 32.122  1.00 18.60  ? 34   TRP B CB  1 
ATOM   3392  C CG  . TRP C  2  34  ? 74.445  38.614 32.227  1.00 19.81  ? 34   TRP B CG  1 
ATOM   3393  C CD1 . TRP C  2  34  ? 74.631  39.543 31.249  1.00 20.08  ? 34   TRP B CD1 1 
ATOM   3394  C CD2 . TRP C  2  34  ? 74.000  39.337 33.386  1.00 21.60  ? 34   TRP B CD2 1 
ATOM   3395  N NE1 . TRP C  2  34  ? 74.335  40.798 31.726  1.00 21.74  ? 34   TRP B NE1 1 
ATOM   3396  C CE2 . TRP C  2  34  ? 73.947  40.700 33.037  1.00 22.21  ? 34   TRP B CE2 1 
ATOM   3397  C CE3 . TRP C  2  34  ? 73.640  38.969 34.686  1.00 22.32  ? 34   TRP B CE3 1 
ATOM   3398  C CZ2 . TRP C  2  34  ? 73.554  41.691 33.937  1.00 22.79  ? 34   TRP B CZ2 1 
ATOM   3399  C CZ3 . TRP C  2  34  ? 73.250  39.957 35.579  1.00 22.80  ? 34   TRP B CZ3 1 
ATOM   3400  C CH2 . TRP C  2  34  ? 73.212  41.298 35.201  1.00 22.63  ? 34   TRP B CH2 1 
ATOM   3401  N N   . TYR C  2  35  ? 75.404  35.254 34.966  1.00 16.57  ? 35   TYR B N   1 
ATOM   3402  C CA  . TYR C  2  35  ? 75.069  34.038 35.678  1.00 15.81  ? 35   TYR B CA  1 
ATOM   3403  C C   . TYR C  2  35  ? 73.833  34.230 36.545  1.00 15.71  ? 35   TYR B C   1 
ATOM   3404  O O   . TYR C  2  35  ? 73.461  35.353 36.877  1.00 16.08  ? 35   TYR B O   1 
ATOM   3405  C CB  . TYR C  2  35  ? 76.193  33.652 36.613  1.00 15.19  ? 35   TYR B CB  1 
ATOM   3406  C CG  . TYR C  2  35  ? 77.497  33.147 36.045  1.00 14.56  ? 35   TYR B CG  1 
ATOM   3407  C CD1 . TYR C  2  35  ? 78.522  34.023 35.734  1.00 14.43  ? 35   TYR B CD1 1 
ATOM   3408  C CD2 . TYR C  2  35  ? 77.755  31.786 35.952  1.00 13.18  ? 35   TYR B CD2 1 
ATOM   3409  C CE1 . TYR C  2  35  ? 79.756  33.561 35.298  1.00 14.39  ? 35   TYR B CE1 1 
ATOM   3410  C CE2 . TYR C  2  35  ? 78.984  31.322 35.525  1.00 14.07  ? 35   TYR B CE2 1 
ATOM   3411  C CZ  . TYR C  2  35  ? 79.980  32.217 35.201  1.00 13.35  ? 35   TYR B CZ  1 
ATOM   3412  O OH  . TYR C  2  35  ? 81.212  31.770 34.786  1.00 14.55  ? 35   TYR B OH  1 
ATOM   3413  N N   . ARG C  2  36  ? 73.191  33.130 36.911  1.00 15.41  ? 36   ARG B N   1 
ATOM   3414  C CA  . ARG C  2  36  ? 72.089  33.212 37.855  1.00 15.66  ? 36   ARG B CA  1 
ATOM   3415  C C   . ARG C  2  36  ? 72.510  32.310 39.007  1.00 16.01  ? 36   ARG B C   1 
ATOM   3416  O O   . ARG C  2  36  ? 73.268  31.359 38.800  1.00 15.83  ? 36   ARG B O   1 
ATOM   3417  C CB  . ARG C  2  36  ? 70.745  32.795 37.244  1.00 15.06  ? 36   ARG B CB  1 
ATOM   3418  C CG  . ARG C  2  36  ? 70.672  31.407 36.698  1.00 14.03  ? 36   ARG B CG  1 
ATOM   3419  C CD  . ARG C  2  36  ? 69.257  31.044 36.324  1.00 13.64  ? 36   ARG B CD  1 
ATOM   3420  N NE  . ARG C  2  36  ? 68.465  30.747 37.512  1.00 13.73  ? 36   ARG B NE  1 
ATOM   3421  C CZ  . ARG C  2  36  ? 67.149  30.575 37.531  1.00 12.69  ? 36   ARG B CZ  1 
ATOM   3422  N NH1 . ARG C  2  36  ? 66.437  30.662 36.414  1.00 12.38  ? 36   ARG B NH1 1 
ATOM   3423  N NH2 . ARG C  2  36  ? 66.544  30.308 38.680  1.00 11.57  ? 36   ARG B NH2 1 
ATOM   3424  N N   . GLN C  2  37  ? 72.085  32.622 40.224  1.00 16.57  ? 37   GLN B N   1 
ATOM   3425  C CA  . GLN C  2  37  ? 72.452  31.765 41.349  1.00 17.51  ? 37   GLN B CA  1 
ATOM   3426  C C   . GLN C  2  37  ? 71.205  31.237 42.045  1.00 18.70  ? 37   GLN B C   1 
ATOM   3427  O O   . GLN C  2  37  ? 70.269  31.990 42.292  1.00 18.57  ? 37   GLN B O   1 
ATOM   3428  C CB  . GLN C  2  37  ? 73.339  32.494 42.357  1.00 17.33  ? 37   GLN B CB  1 
ATOM   3429  C CG  . GLN C  2  37  ? 73.546  31.685 43.619  1.00 15.49  ? 37   GLN B CG  1 
ATOM   3430  C CD  . GLN C  2  37  ? 74.498  32.318 44.584  1.00 15.01  ? 37   GLN B CD  1 
ATOM   3431  O OE1 . GLN C  2  37  ? 75.310  31.604 45.205  1.00 15.61  ? 37   GLN B OE1 1 
ATOM   3432  N NE2 . GLN C  2  37  ? 74.427  33.615 44.735  1.00 13.82  ? 37   GLN B NE2 1 
ATOM   3433  N N   . ASP C  2  38  ? 71.209  29.944 42.352  1.00 19.92  ? 38   ASP B N   1 
ATOM   3434  C CA  . ASP C  2  38  ? 70.080  29.292 42.992  1.00 21.65  ? 38   ASP B CA  1 
ATOM   3435  C C   . ASP C  2  38  ? 70.593  28.177 43.896  1.00 22.79  ? 38   ASP B C   1 
ATOM   3436  O O   . ASP C  2  38  ? 71.647  27.606 43.629  1.00 23.54  ? 38   ASP B O   1 
ATOM   3437  C CB  . ASP C  2  38  ? 69.146  28.727 41.924  1.00 21.67  ? 38   ASP B CB  1 
ATOM   3438  C CG  . ASP C  2  38  ? 68.662  29.785 40.971  1.00 22.07  ? 38   ASP B CG  1 
ATOM   3439  O OD1 . ASP C  2  38  ? 67.768  30.576 41.352  1.00 23.29  ? 38   ASP B OD1 1 
ATOM   3440  O OD2 . ASP C  2  38  ? 69.144  29.901 39.829  1.00 21.01  ? 38   ASP B OD2 1 
ATOM   3441  N N   . THR C  2  39  ? 69.854  27.853 44.953  1.00 24.11  ? 39   THR B N   1 
ATOM   3442  C CA  . THR C  2  39  ? 70.302  26.820 45.892  1.00 25.20  ? 39   THR B CA  1 
ATOM   3443  C C   . THR C  2  39  ? 70.244  25.429 45.307  1.00 26.27  ? 39   THR B C   1 
ATOM   3444  O O   . THR C  2  39  ? 69.205  24.987 44.827  1.00 26.78  ? 39   THR B O   1 
ATOM   3445  C CB  . THR C  2  39  ? 69.475  26.818 47.186  1.00 25.27  ? 39   THR B CB  1 
ATOM   3446  O OG1 . THR C  2  39  ? 68.084  26.661 46.878  1.00 24.28  ? 39   THR B OG1 1 
ATOM   3447  C CG2 . THR C  2  39  ? 69.620  28.143 47.932  1.00 24.87  ? 39   THR B CG2 1 
ATOM   3448  N N   . GLY C  2  40  ? 71.363  24.727 45.384  1.00 27.40  ? 40   GLY B N   1 
ATOM   3449  C CA  . GLY C  2  40  ? 71.443  23.389 44.844  1.00 28.06  ? 40   GLY B CA  1 
ATOM   3450  C C   . GLY C  2  40  ? 72.069  23.423 43.463  1.00 28.74  ? 40   GLY B C   1 
ATOM   3451  O O   . GLY C  2  40  ? 72.444  22.380 42.933  1.00 28.74  ? 40   GLY B O   1 
ATOM   3452  N N   . HIS C  2  41  ? 72.187  24.622 42.886  1.00 29.19  ? 41   HIS B N   1 
ATOM   3453  C CA  . HIS C  2  41  ? 72.765  24.784 41.552  1.00 29.61  ? 41   HIS B CA  1 
ATOM   3454  C C   . HIS C  2  41  ? 73.963  25.708 41.517  1.00 29.22  ? 41   HIS B C   1 
ATOM   3455  O O   . HIS C  2  41  ? 74.461  26.010 40.437  1.00 30.11  ? 41   HIS B O   1 
ATOM   3456  C CB  . HIS C  2  41  ? 71.739  25.363 40.571  1.00 30.15  ? 41   HIS B CB  1 
ATOM   3457  C CG  . HIS C  2  41  ? 70.405  24.692 40.622  1.00 31.29  ? 41   HIS B CG  1 
ATOM   3458  N ND1 . HIS C  2  41  ? 70.009  23.755 39.693  1.00 32.60  ? 41   HIS B ND1 1 
ATOM   3459  C CD2 . HIS C  2  41  ? 69.379  24.814 41.496  1.00 32.32  ? 41   HIS B CD2 1 
ATOM   3460  C CE1 . HIS C  2  41  ? 68.795  23.328 39.992  1.00 33.42  ? 41   HIS B CE1 1 
ATOM   3461  N NE2 . HIS C  2  41  ? 68.391  23.953 41.084  1.00 33.29  ? 41   HIS B NE2 1 
ATOM   3462  N N   . GLY C  2  42  ? 74.421  26.186 42.667  1.00 28.54  ? 42   GLY B N   1 
ATOM   3463  C CA  . GLY C  2  42  ? 75.541  27.105 42.665  1.00 27.45  ? 42   GLY B CA  1 
ATOM   3464  C C   . GLY C  2  42  ? 75.256  28.170 41.620  1.00 26.59  ? 42   GLY B C   1 
ATOM   3465  O O   . GLY C  2  42  ? 74.104  28.541 41.419  1.00 26.69  ? 42   GLY B O   1 
ATOM   3466  N N   . LEU C  2  43  ? 76.293  28.664 40.956  1.00 25.48  ? 43   LEU B N   1 
ATOM   3467  C CA  . LEU C  2  43  ? 76.127  29.664 39.908  1.00 24.57  ? 43   LEU B CA  1 
ATOM   3468  C C   . LEU C  2  43  ? 76.144  28.910 38.590  1.00 23.89  ? 43   LEU B C   1 
ATOM   3469  O O   . LEU C  2  43  ? 76.886  27.932 38.461  1.00 23.50  ? 43   LEU B O   1 
ATOM   3470  C CB  . LEU C  2  43  ? 77.280  30.683 39.913  1.00 24.31  ? 43   LEU B CB  1 
ATOM   3471  C CG  . LEU C  2  43  ? 77.179  32.008 40.666  1.00 24.07  ? 43   LEU B CG  1 
ATOM   3472  C CD1 . LEU C  2  43  ? 76.852  31.796 42.128  1.00 23.94  ? 43   LEU B CD1 1 
ATOM   3473  C CD2 . LEU C  2  43  ? 78.505  32.764 40.518  1.00 24.09  ? 43   LEU B CD2 1 
ATOM   3474  N N   . ARG C  2  44  ? 75.344  29.375 37.624  1.00 22.90  ? 44   ARG B N   1 
ATOM   3475  C CA  . ARG C  2  44  ? 75.254  28.779 36.287  1.00 22.10  ? 44   ARG B CA  1 
ATOM   3476  C C   . ARG C  2  44  ? 75.284  29.859 35.197  1.00 21.35  ? 44   ARG B C   1 
ATOM   3477  O O   . ARG C  2  44  ? 74.600  30.880 35.308  1.00 21.31  ? 44   ARG B O   1 
ATOM   3478  C CB  . ARG C  2  44  ? 73.970  27.977 36.144  1.00 22.16  ? 44   ARG B CB  1 
ATOM   3479  C CG  . ARG C  2  44  ? 73.971  26.649 36.849  1.00 22.53  ? 44   ARG B CG  1 
ATOM   3480  C CD  . ARG C  2  44  ? 72.618  25.950 36.764  1.00 22.26  ? 44   ARG B CD  1 
ATOM   3481  N NE  . ARG C  2  44  ? 71.570  26.789 37.328  1.00 22.85  ? 44   ARG B NE  1 
ATOM   3482  C CZ  . ARG C  2  44  ? 70.318  26.415 37.518  1.00 22.95  ? 44   ARG B CZ  1 
ATOM   3483  N NH1 . ARG C  2  44  ? 69.933  25.195 37.197  1.00 23.37  ? 44   ARG B NH1 1 
ATOM   3484  N NH2 . ARG C  2  44  ? 69.445  27.274 38.030  1.00 23.46  ? 44   ARG B NH2 1 
ATOM   3485  N N   . LEU C  2  45  ? 76.056  29.611 34.139  1.00 20.41  ? 45   LEU B N   1 
ATOM   3486  C CA  . LEU C  2  45  ? 76.225  30.556 33.029  1.00 20.01  ? 45   LEU B CA  1 
ATOM   3487  C C   . LEU C  2  45  ? 75.024  30.606 32.079  1.00 19.61  ? 45   LEU B C   1 
ATOM   3488  O O   . LEU C  2  45  ? 74.524  29.567 31.639  1.00 18.93  ? 45   LEU B O   1 
ATOM   3489  C CB  . LEU C  2  45  ? 77.483  30.204 32.230  1.00 19.94  ? 45   LEU B CB  1 
ATOM   3490  C CG  . LEU C  2  45  ? 77.989  31.263 31.247  1.00 21.06  ? 45   LEU B CG  1 
ATOM   3491  C CD1 . LEU C  2  45  ? 78.546  32.456 32.006  1.00 21.78  ? 45   LEU B CD1 1 
ATOM   3492  C CD2 . LEU C  2  45  ? 79.063  30.690 30.332  1.00 20.83  ? 45   LEU B CD2 1 
ATOM   3493  N N   . ILE C  2  46  ? 74.581  31.827 31.767  1.00 18.99  ? 46   ILE B N   1 
ATOM   3494  C CA  . ILE C  2  46  ? 73.454  32.051 30.867  1.00 18.52  ? 46   ILE B CA  1 
ATOM   3495  C C   . ILE C  2  46  ? 73.914  32.538 29.491  1.00 18.59  ? 46   ILE B C   1 
ATOM   3496  O O   . ILE C  2  46  ? 73.492  32.010 28.473  1.00 18.78  ? 46   ILE B O   1 
ATOM   3497  C CB  . ILE C  2  46  ? 72.488  33.086 31.442  1.00 18.35  ? 46   ILE B CB  1 
ATOM   3498  C CG1 . ILE C  2  46  ? 72.006  32.661 32.828  1.00 17.74  ? 46   ILE B CG1 1 
ATOM   3499  C CG2 . ILE C  2  46  ? 71.316  33.243 30.514  1.00 18.91  ? 46   ILE B CG2 1 
ATOM   3500  C CD1 . ILE C  2  46  ? 70.952  33.552 33.401  1.00 17.05  ? 46   ILE B CD1 1 
ATOM   3501  N N   . HIS C  2  47  ? 74.768  33.554 29.471  1.00 18.34  ? 47   HIS B N   1 
ATOM   3502  C CA  . HIS C  2  47  ? 75.293  34.107 28.232  1.00 18.32  ? 47   HIS B CA  1 
ATOM   3503  C C   . HIS C  2  47  ? 76.600  34.829 28.552  1.00 18.64  ? 47   HIS B C   1 
ATOM   3504  O O   . HIS C  2  47  ? 76.733  35.416 29.619  1.00 19.04  ? 47   HIS B O   1 
ATOM   3505  C CB  . HIS C  2  47  ? 74.345  35.142 27.654  1.00 18.29  ? 47   HIS B CB  1 
ATOM   3506  C CG  . HIS C  2  47  ? 73.188  34.592 26.882  1.00 18.64  ? 47   HIS B CG  1 
ATOM   3507  N ND1 . HIS C  2  47  ? 73.334  33.939 25.676  1.00 18.98  ? 47   HIS B ND1 1 
ATOM   3508  C CD2 . HIS C  2  47  ? 71.853  34.701 27.089  1.00 18.12  ? 47   HIS B CD2 1 
ATOM   3509  C CE1 . HIS C  2  47  ? 72.140  33.647 25.192  1.00 18.49  ? 47   HIS B CE1 1 
ATOM   3510  N NE2 . HIS C  2  47  ? 71.226  34.102 26.027  1.00 17.09  ? 47   HIS B NE2 1 
ATOM   3511  N N   . TYR C  2  48  ? 77.548  34.797 27.623  1.00 18.55  ? 48   TYR B N   1 
ATOM   3512  C CA  . TYR C  2  48  ? 78.828  35.477 27.779  1.00 18.35  ? 48   TYR B CA  1 
ATOM   3513  C C   . TYR C  2  48  ? 79.142  36.171 26.458  1.00 17.93  ? 48   TYR B C   1 
ATOM   3514  O O   . TYR C  2  48  ? 78.397  36.036 25.491  1.00 17.91  ? 48   TYR B O   1 
ATOM   3515  C CB  . TYR C  2  48  ? 79.947  34.478 28.133  1.00 18.95  ? 48   TYR B CB  1 
ATOM   3516  C CG  . TYR C  2  48  ? 80.150  33.409 27.082  1.00 20.34  ? 48   TYR B CG  1 
ATOM   3517  C CD1 . TYR C  2  48  ? 81.170  33.511 26.133  1.00 22.01  ? 48   TYR B CD1 1 
ATOM   3518  C CD2 . TYR C  2  48  ? 79.309  32.307 27.024  1.00 21.87  ? 48   TYR B CD2 1 
ATOM   3519  C CE1 . TYR C  2  48  ? 81.340  32.539 25.153  1.00 22.67  ? 48   TYR B CE1 1 
ATOM   3520  C CE2 . TYR C  2  48  ? 79.467  31.334 26.055  1.00 24.01  ? 48   TYR B CE2 1 
ATOM   3521  C CZ  . TYR C  2  48  ? 80.485  31.451 25.122  1.00 24.67  ? 48   TYR B CZ  1 
ATOM   3522  O OH  . TYR C  2  48  ? 80.631  30.465 24.166  1.00 27.65  ? 48   TYR B OH  1 
ATOM   3523  N N   . SER C  2  49  ? 80.260  36.879 26.404  1.00 17.89  ? 49   SER B N   1 
ATOM   3524  C CA  . SER C  2  49  ? 80.632  37.622 25.221  1.00 18.16  ? 49   SER B CA  1 
ATOM   3525  C C   . SER C  2  49  ? 82.134  37.804 25.139  1.00 19.40  ? 49   SER B C   1 
ATOM   3526  O O   . SER C  2  49  ? 82.782  38.040 26.153  1.00 20.11  ? 49   SER B O   1 
ATOM   3527  C CB  . SER C  2  49  ? 79.943  38.986 25.260  1.00 17.94  ? 49   SER B CB  1 
ATOM   3528  O OG  . SER C  2  49  ? 80.753  40.008 24.714  1.00 15.40  ? 49   SER B OG  1 
ATOM   3529  N N   . TYR C  2  50  ? 82.679  37.700 23.926  1.00 21.00  ? 50   TYR B N   1 
ATOM   3530  C CA  . TYR C  2  50  ? 84.110  37.855 23.685  1.00 22.22  ? 50   TYR B CA  1 
ATOM   3531  C C   . TYR C  2  50  ? 84.450  39.277 23.305  1.00 23.25  ? 50   TYR B C   1 
ATOM   3532  O O   . TYR C  2  50  ? 85.574  39.567 22.911  1.00 23.73  ? 50   TYR B O   1 
ATOM   3533  C CB  . TYR C  2  50  ? 84.586  36.939 22.544  1.00 22.71  ? 50   TYR B CB  1 
ATOM   3534  C CG  . TYR C  2  50  ? 84.806  35.491 22.919  1.00 23.55  ? 50   TYR B CG  1 
ATOM   3535  C CD1 . TYR C  2  50  ? 83.823  34.530 22.681  1.00 24.43  ? 50   TYR B CD1 1 
ATOM   3536  C CD2 . TYR C  2  50  ? 86.001  35.077 23.505  1.00 24.03  ? 50   TYR B CD2 1 
ATOM   3537  C CE1 . TYR C  2  50  ? 84.027  33.192 23.024  1.00 24.96  ? 50   TYR B CE1 1 
ATOM   3538  C CE2 . TYR C  2  50  ? 86.212  33.745 23.850  1.00 24.02  ? 50   TYR B CE2 1 
ATOM   3539  C CZ  . TYR C  2  50  ? 85.222  32.812 23.611  1.00 24.89  ? 50   TYR B CZ  1 
ATOM   3540  O OH  . TYR C  2  50  ? 85.429  31.497 23.954  1.00 26.62  ? 50   TYR B OH  1 
ATOM   3541  N N   . GLY C  2  51  ? 83.481  40.172 23.390  1.00 24.65  ? 51   GLY B N   1 
ATOM   3542  C CA  . GLY C  2  51  ? 83.738  41.548 23.040  1.00 25.59  ? 51   GLY B CA  1 
ATOM   3543  C C   . GLY C  2  51  ? 82.506  42.221 22.486  1.00 27.01  ? 51   GLY B C   1 
ATOM   3544  O O   . GLY C  2  51  ? 81.490  41.567 22.229  1.00 26.99  ? 51   GLY B O   1 
ATOM   3545  N N   . ALA C  2  52  ? 82.604  43.536 22.307  1.00 28.29  ? 52   ALA B N   1 
ATOM   3546  C CA  . ALA C  2  52  ? 81.501  44.332 21.801  1.00 29.44  ? 52   ALA B CA  1 
ATOM   3547  C C   . ALA C  2  52  ? 80.969  43.716 20.526  1.00 30.19  ? 52   ALA B C   1 
ATOM   3548  O O   . ALA C  2  52  ? 81.686  43.632 19.538  1.00 31.04  ? 52   ALA B O   1 
ATOM   3549  C CB  . ALA C  2  52  ? 81.967  45.753 21.533  1.00 29.44  ? 52   ALA B CB  1 
ATOM   3550  N N   . GLY C  2  53  ? 79.716  43.285 20.544  1.00 31.08  ? 53   GLY B N   1 
ATOM   3551  C CA  . GLY C  2  53  ? 79.115  42.695 19.361  1.00 31.72  ? 53   GLY B CA  1 
ATOM   3552  C C   . GLY C  2  53  ? 79.095  41.181 19.436  1.00 32.31  ? 53   GLY B C   1 
ATOM   3553  O O   . GLY C  2  53  ? 78.546  40.504 18.562  1.00 32.37  ? 53   GLY B O   1 
ATOM   3554  N N   . SER C  2  54  ? 79.701  40.643 20.486  1.00 32.67  ? 54   SER B N   1 
ATOM   3555  C CA  . SER C  2  54  ? 79.747  39.204 20.659  1.00 33.11  ? 54   SER B CA  1 
ATOM   3556  C C   . SER C  2  54  ? 78.707  38.761 21.683  1.00 33.76  ? 54   SER B C   1 
ATOM   3557  O O   . SER C  2  54  ? 78.426  39.473 22.641  1.00 32.89  ? 54   SER B O   1 
ATOM   3558  C CB  . SER C  2  54  ? 81.145  38.773 21.106  1.00 33.00  ? 54   SER B CB  1 
ATOM   3559  O OG  . SER C  2  54  ? 81.211  37.372 21.281  1.00 32.11  ? 54   SER B OG  1 
ATOM   3560  N N   . THR C  2  55  ? 78.124  37.590 21.454  1.00 34.82  ? 55   THR B N   1 
ATOM   3561  C CA  . THR C  2  55  ? 77.144  37.020 22.367  1.00 35.90  ? 55   THR B CA  1 
ATOM   3562  C C   . THR C  2  55  ? 76.994  35.556 22.061  1.00 36.40  ? 55   THR B C   1 
ATOM   3563  O O   . THR C  2  55  ? 76.789  35.174 20.908  1.00 36.90  ? 55   THR B O   1 
ATOM   3564  C CB  . THR C  2  55  ? 75.756  37.663 22.221  1.00 36.14  ? 55   THR B CB  1 
ATOM   3565  O OG1 . THR C  2  55  ? 75.742  38.963 22.826  1.00 36.59  ? 55   THR B OG1 1 
ATOM   3566  C CG2 . THR C  2  55  ? 74.713  36.835 22.984  1.00 36.44  ? 55   THR B CG2 1 
ATOM   3567  N N   . GLU C  2  56  ? 77.078  34.732 23.093  1.00 36.80  ? 56   GLU B N   1 
ATOM   3568  C CA  . GLU C  2  56  ? 76.915  33.306 22.899  1.00 37.08  ? 56   GLU B CA  1 
ATOM   3569  C C   . GLU C  2  56  ? 76.309  32.610 24.096  1.00 36.51  ? 56   GLU B C   1 
ATOM   3570  O O   . GLU C  2  56  ? 76.725  32.792 25.236  1.00 36.48  ? 56   GLU B O   1 
ATOM   3571  C CB  . GLU C  2  56  ? 78.235  32.664 22.498  1.00 37.63  ? 56   GLU B CB  1 
ATOM   3572  C CG  . GLU C  2  56  ? 78.396  32.649 20.986  1.00 38.96  ? 56   GLU B CG  1 
ATOM   3573  C CD  . GLU C  2  56  ? 79.777  32.244 20.547  1.00 39.92  ? 56   GLU B CD  1 
ATOM   3574  O OE1 . GLU C  2  56  ? 80.721  33.023 20.785  1.00 40.66  ? 56   GLU B OE1 1 
ATOM   3575  O OE2 . GLU C  2  56  ? 79.913  31.151 19.963  1.00 40.79  ? 56   GLU B OE2 1 
ATOM   3576  N N   . LYS C  2  57  ? 75.307  31.805 23.789  1.00 35.83  ? 57   LYS B N   1 
ATOM   3577  C CA  . LYS C  2  57  ? 74.558  31.056 24.771  1.00 35.33  ? 57   LYS B CA  1 
ATOM   3578  C C   . LYS C  2  57  ? 75.448  30.281 25.731  1.00 34.62  ? 57   LYS B C   1 
ATOM   3579  O O   . LYS C  2  57  ? 76.473  29.725 25.338  1.00 34.34  ? 57   LYS B O   1 
ATOM   3580  C CB  . LYS C  2  57  ? 73.592  30.143 24.022  1.00 35.37  ? 57   LYS B CB  1 
ATOM   3581  C CG  . LYS C  2  57  ? 72.752  30.948 23.018  1.00 35.85  ? 57   LYS B CG  1 
ATOM   3582  C CD  . LYS C  2  57  ? 71.860  30.107 22.131  1.00 36.70  ? 57   LYS B CD  1 
ATOM   3583  C CE  . LYS C  2  57  ? 71.123  30.964 21.101  1.00 37.08  ? 57   LYS B CE  1 
ATOM   3584  N NZ  . LYS C  2  57  ? 70.532  30.157 19.992  1.00 37.34  ? 57   LYS B NZ  1 
ATOM   3585  N N   . GLY C  2  58  ? 75.050  30.279 27.000  1.00 34.11  ? 58   GLY B N   1 
ATOM   3586  C CA  . GLY C  2  58  ? 75.774  29.566 28.035  1.00 33.83  ? 58   GLY B CA  1 
ATOM   3587  C C   . GLY C  2  58  ? 75.219  28.165 28.234  1.00 33.66  ? 58   GLY B C   1 
ATOM   3588  O O   . GLY C  2  58  ? 74.812  27.503 27.275  1.00 33.47  ? 58   GLY B O   1 
ATOM   3589  N N   . ASP C  2  59  ? 75.199  27.716 29.485  1.00 33.43  ? 59   ASP B N   1 
ATOM   3590  C CA  . ASP C  2  59  ? 74.713  26.386 29.825  1.00 33.40  ? 59   ASP B CA  1 
ATOM   3591  C C   . ASP C  2  59  ? 73.201  26.377 29.953  1.00 32.91  ? 59   ASP B C   1 
ATOM   3592  O O   . ASP C  2  59  ? 72.572  25.329 29.827  1.00 33.10  ? 59   ASP B O   1 
ATOM   3593  C CB  . ASP C  2  59  ? 75.331  25.912 31.139  1.00 33.82  ? 59   ASP B CB  1 
ATOM   3594  C CG  . ASP C  2  59  ? 76.818  25.687 31.037  1.00 34.20  ? 59   ASP B CG  1 
ATOM   3595  O OD1 . ASP C  2  59  ? 77.274  25.009 30.087  1.00 36.15  ? 59   ASP B OD1 1 
ATOM   3596  O OD2 . ASP C  2  59  ? 77.593  26.156 31.886  1.00 35.24  ? 59   ASP B OD2 1 
ATOM   3597  N N   . ILE C  2  60  ? 72.624  27.549 30.206  1.00 32.30  ? 60   ILE B N   1 
ATOM   3598  C CA  . ILE C  2  60  ? 71.178  27.678 30.363  1.00 31.54  ? 60   ILE B CA  1 
ATOM   3599  C C   . ILE C  2  60  ? 70.637  28.951 29.708  1.00 31.48  ? 60   ILE B C   1 
ATOM   3600  O O   . ILE C  2  60  ? 70.014  29.780 30.366  1.00 31.49  ? 60   ILE B O   1 
ATOM   3601  C CB  . ILE C  2  60  ? 70.807  27.641 31.853  1.00 31.29  ? 60   ILE B CB  1 
ATOM   3602  C CG1 . ILE C  2  60  ? 71.492  28.781 32.609  1.00 30.74  ? 60   ILE B CG1 1 
ATOM   3603  C CG2 . ILE C  2  60  ? 71.215  26.296 32.454  1.00 30.81  ? 60   ILE B CG2 1 
ATOM   3604  C CD1 . ILE C  2  60  ? 71.069  28.886 34.070  1.00 30.30  ? 60   ILE B CD1 1 
ATOM   3605  N N   . PRO C  2  61  ? 70.848  29.089 28.401  1.00 31.55  ? 61   PRO B N   1 
ATOM   3606  C CA  . PRO C  2  61  ? 70.411  30.272 27.652  1.00 31.64  ? 61   PRO B CA  1 
ATOM   3607  C C   . PRO C  2  61  ? 68.903  30.439 27.531  1.00 31.55  ? 61   PRO B C   1 
ATOM   3608  O O   . PRO C  2  61  ? 68.403  31.561 27.541  1.00 31.94  ? 61   PRO B O   1 
ATOM   3609  C CB  . PRO C  2  61  ? 71.033  30.032 26.280  1.00 31.87  ? 61   PRO B CB  1 
ATOM   3610  C CG  . PRO C  2  61  ? 71.031  28.548 26.166  1.00 31.40  ? 61   PRO B CG  1 
ATOM   3611  C CD  . PRO C  2  61  ? 71.521  28.122 27.516  1.00 31.65  ? 61   PRO B CD  1 
ATOM   3612  N N   . ASP C  2  62  ? 68.192  29.329 27.424  1.00 31.59  ? 62   ASP B N   1 
ATOM   3613  C CA  . ASP C  2  62  ? 66.744  29.339 27.250  1.00 31.59  ? 62   ASP B CA  1 
ATOM   3614  C C   . ASP C  2  62  ? 65.962  30.308 28.114  1.00 31.43  ? 62   ASP B C   1 
ATOM   3615  O O   . ASP C  2  62  ? 65.999  30.250 29.341  1.00 31.72  ? 62   ASP B O   1 
ATOM   3616  C CB  . ASP C  2  62  ? 66.211  27.928 27.426  1.00 31.83  ? 62   ASP B CB  1 
ATOM   3617  C CG  . ASP C  2  62  ? 66.628  27.035 26.295  1.00 32.36  ? 62   ASP B CG  1 
ATOM   3618  O OD1 . ASP C  2  62  ? 66.474  25.800 26.391  1.00 33.28  ? 62   ASP B OD1 1 
ATOM   3619  O OD2 . ASP C  2  62  ? 67.130  27.526 25.263  1.00 32.92  ? 62   ASP B OD2 1 
ATOM   3620  N N   . GLY C  2  63  ? 65.240  31.199 27.447  1.00 31.19  ? 63   GLY B N   1 
ATOM   3621  C CA  . GLY C  2  63  ? 64.417  32.174 28.133  1.00 31.17  ? 63   GLY B CA  1 
ATOM   3622  C C   . GLY C  2  63  ? 65.078  33.524 28.221  1.00 31.03  ? 63   GLY B C   1 
ATOM   3623  O O   . GLY C  2  63  ? 64.452  34.501 28.613  1.00 31.51  ? 63   GLY B O   1 
ATOM   3624  N N   . TYR C  2  64  ? 66.420  33.596 27.877  1.00 26.88  ? 65   TYR B N   1 
ATOM   3625  C CA  . TYR C  2  64  ? 67.149  34.853 27.981  1.00 26.26  ? 65   TYR B CA  1 
ATOM   3626  C C   . TYR C  2  64  ? 67.785  35.228 26.661  1.00 26.46  ? 65   TYR B C   1 
ATOM   3627  O O   . TYR C  2  64  ? 67.969  34.396 25.785  1.00 26.54  ? 65   TYR B O   1 
ATOM   3628  C CB  . TYR C  2  64  ? 68.265  34.746 29.017  1.00 25.75  ? 65   TYR B CB  1 
ATOM   3629  C CG  . TYR C  2  64  ? 67.866  34.249 30.380  1.00 24.11  ? 65   TYR B CG  1 
ATOM   3630  C CD1 . TYR C  2  64  ? 67.793  32.887 30.649  1.00 23.02  ? 65   TYR B CD1 1 
ATOM   3631  C CD2 . TYR C  2  64  ? 67.605  35.139 31.419  1.00 22.16  ? 65   TYR B CD2 1 
ATOM   3632  C CE1 . TYR C  2  64  ? 67.466  32.423 31.916  1.00 21.15  ? 65   TYR B CE1 1 
ATOM   3633  C CE2 . TYR C  2  64  ? 67.271  34.685 32.682  1.00 20.26  ? 65   TYR B CE2 1 
ATOM   3634  C CZ  . TYR C  2  64  ? 67.203  33.326 32.926  1.00 20.01  ? 65   TYR B CZ  1 
ATOM   3635  O OH  . TYR C  2  64  ? 66.876  32.866 34.186  1.00 18.28  ? 65   TYR B OH  1 
ATOM   3636  N N   . LYS C  2  65  ? 68.144  36.496 26.553  1.00 27.07  ? 66   LYS B N   1 
ATOM   3637  C CA  . LYS C  2  65  ? 68.809  37.033 25.383  1.00 27.82  ? 66   LYS B CA  1 
ATOM   3638  C C   . LYS C  2  65  ? 69.863  37.995 25.909  1.00 28.06  ? 66   LYS B C   1 
ATOM   3639  O O   . LYS C  2  65  ? 69.818  38.394 27.077  1.00 28.15  ? 66   LYS B O   1 
ATOM   3640  C CB  . LYS C  2  65  ? 67.831  37.792 24.490  1.00 28.10  ? 66   LYS B CB  1 
ATOM   3641  C CG  . LYS C  2  65  ? 66.941  36.918 23.615  1.00 30.02  ? 66   LYS B CG  1 
ATOM   3642  C CD  . LYS C  2  65  ? 66.193  37.771 22.594  1.00 31.43  ? 66   LYS B CD  1 
ATOM   3643  C CE  . LYS C  2  65  ? 65.173  36.965 21.802  1.00 32.65  ? 66   LYS B CE  1 
ATOM   3644  N NZ  . LYS C  2  65  ? 64.252  37.842 21.021  1.00 32.50  ? 66   LYS B NZ  1 
ATOM   3645  N N   . ALA C  2  66  ? 70.808  38.371 25.060  1.00 28.04  ? 67   ALA B N   1 
ATOM   3646  C CA  . ALA C  2  66  ? 71.841  39.293 25.486  1.00 28.18  ? 67   ALA B CA  1 
ATOM   3647  C C   . ALA C  2  66  ? 72.292  40.180 24.347  1.00 28.28  ? 67   ALA B C   1 
ATOM   3648  O O   . ALA C  2  66  ? 72.102  39.859 23.176  1.00 28.07  ? 67   ALA B O   1 
ATOM   3649  C CB  . ALA C  2  66  ? 73.011  38.532 26.048  1.00 28.60  ? 67   ALA B CB  1 
ATOM   3650  N N   . SER C  2  67  ? 72.882  41.306 24.708  1.00 28.44  ? 68   SER B N   1 
ATOM   3651  C CA  . SER C  2  67  ? 73.410  42.255 23.742  1.00 28.56  ? 68   SER B CA  1 
ATOM   3652  C C   . SER C  2  67  ? 74.685  42.867 24.293  1.00 28.37  ? 68   SER B C   1 
ATOM   3653  O O   . SER C  2  67  ? 74.728  43.248 25.462  1.00 28.20  ? 68   SER B O   1 
ATOM   3654  C CB  . SER C  2  67  ? 72.385  43.346 23.450  1.00 28.61  ? 68   SER B CB  1 
ATOM   3655  O OG  . SER C  2  67  ? 71.237  42.793 22.839  1.00 30.41  ? 68   SER B OG  1 
ATOM   3656  N N   . ARG C  2  68  ? 75.721  42.928 23.470  1.00 28.24  ? 69   ARG B N   1 
ATOM   3657  C CA  . ARG C  2  68  ? 76.988  43.511 23.893  1.00 28.14  ? 69   ARG B CA  1 
ATOM   3658  C C   . ARG C  2  68  ? 77.305  44.761 23.061  1.00 28.02  ? 69   ARG B C   1 
ATOM   3659  O O   . ARG C  2  68  ? 78.223  44.759 22.247  1.00 28.28  ? 69   ARG B O   1 
ATOM   3660  C CB  . ARG C  2  68  ? 78.105  42.488 23.774  1.00 27.84  ? 69   ARG B CB  1 
ATOM   3661  C CG  . ARG C  2  68  ? 79.393  42.929 24.425  1.00 28.04  ? 69   ARG B CG  1 
ATOM   3662  C CD  . ARG C  2  68  ? 79.530  42.468 25.867  1.00 27.90  ? 69   ARG B CD  1 
ATOM   3663  N NE  . ARG C  2  68  ? 80.940  42.299 26.207  1.00 27.96  ? 69   ARG B NE  1 
ATOM   3664  C CZ  . ARG C  2  68  ? 81.734  43.287 26.563  1.00 26.60  ? 69   ARG B CZ  1 
ATOM   3665  N NH1 . ARG C  2  68  ? 81.245  44.509 26.654  1.00 26.76  ? 69   ARG B NH1 1 
ATOM   3666  N NH2 . ARG C  2  68  ? 83.011  43.059 26.841  1.00 26.28  ? 69   ARG B NH2 1 
ATOM   3667  N N   . PRO C  2  69  ? 76.571  45.840 23.330  1.00 27.95  ? 70   PRO B N   1 
ATOM   3668  C CA  . PRO C  2  69  ? 76.655  47.136 22.635  1.00 27.89  ? 70   PRO B CA  1 
ATOM   3669  C C   . PRO C  2  69  ? 78.066  47.696 22.567  1.00 28.04  ? 70   PRO B C   1 
ATOM   3670  O O   . PRO C  2  69  ? 78.477  48.259 21.557  1.00 28.43  ? 70   PRO B O   1 
ATOM   3671  C CB  . PRO C  2  69  ? 75.792  48.041 23.518  1.00 27.82  ? 70   PRO B CB  1 
ATOM   3672  C CG  . PRO C  2  69  ? 74.862  47.108 24.202  1.00 27.76  ? 70   PRO B CG  1 
ATOM   3673  C CD  . PRO C  2  69  ? 75.687  45.922 24.500  1.00 27.75  ? 70   PRO B CD  1 
ATOM   3674  N N   . SER C  2  70  ? 78.802  47.550 23.654  1.00 28.12  ? 71   SER B N   1 
ATOM   3675  C CA  . SER C  2  70  ? 80.156  48.056 23.705  1.00 28.22  ? 71   SER B CA  1 
ATOM   3676  C C   . SER C  2  70  ? 80.939  47.327 24.786  1.00 28.06  ? 71   SER B C   1 
ATOM   3677  O O   . SER C  2  70  ? 80.379  46.552 25.554  1.00 27.67  ? 71   SER B O   1 
ATOM   3678  C CB  . SER C  2  70  ? 80.139  49.554 23.999  1.00 28.19  ? 71   SER B CB  1 
ATOM   3679  O OG  . SER C  2  70  ? 79.567  49.813 25.273  1.00 28.70  ? 71   SER B OG  1 
ATOM   3680  N N   . GLN C  2  71  ? 82.237  47.595 24.835  1.00 27.82  ? 72   GLN B N   1 
ATOM   3681  C CA  . GLN C  2  71  ? 83.116  46.991 25.818  1.00 27.75  ? 72   GLN B CA  1 
ATOM   3682  C C   . GLN C  2  71  ? 82.547  47.118 27.229  1.00 27.15  ? 72   GLN B C   1 
ATOM   3683  O O   . GLN C  2  71  ? 82.442  46.146 27.964  1.00 27.49  ? 72   GLN B O   1 
ATOM   3684  C CB  . GLN C  2  71  ? 84.475  47.684 25.773  1.00 28.10  ? 72   GLN B CB  1 
ATOM   3685  C CG  . GLN C  2  71  ? 85.462  47.127 26.765  1.00 29.21  ? 72   GLN B CG  1 
ATOM   3686  C CD  . GLN C  2  71  ? 86.208  45.939 26.208  1.00 29.87  ? 72   GLN B CD  1 
ATOM   3687  O OE1 . GLN C  2  71  ? 87.333  46.077 25.751  1.00 31.11  ? 72   GLN B OE1 1 
ATOM   3688  N NE2 . GLN C  2  71  ? 85.579  44.772 26.228  1.00 31.06  ? 72   GLN B NE2 1 
ATOM   3689  N N   . GLU C  2  72  ? 82.153  48.328 27.588  1.00 26.33  ? 73   GLU B N   1 
ATOM   3690  C CA  . GLU C  2  72  ? 81.676  48.624 28.936  1.00 25.20  ? 73   GLU B CA  1 
ATOM   3691  C C   . GLU C  2  72  ? 80.470  47.860 29.444  1.00 25.39  ? 73   GLU B C   1 
ATOM   3692  O O   . GLU C  2  72  ? 80.386  47.593 30.643  1.00 25.39  ? 73   GLU B O   1 
ATOM   3693  C CB  . GLU C  2  72  ? 81.397  50.118 29.068  1.00 24.18  ? 73   GLU B CB  1 
ATOM   3694  C CG  . GLU C  2  72  ? 82.620  50.994 28.887  1.00 22.30  ? 73   GLU B CG  1 
ATOM   3695  C CD  . GLU C  2  72  ? 83.182  50.947 27.479  1.00 21.44  ? 73   GLU B CD  1 
ATOM   3696  O OE1 . GLU C  2  72  ? 82.397  50.879 26.511  1.00 21.91  ? 73   GLU B OE1 1 
ATOM   3697  O OE2 . GLU C  2  72  ? 84.415  50.982 27.331  1.00 21.82  ? 73   GLU B OE2 1 
ATOM   3698  N N   . ASN C  2  73  ? 79.528  47.504 28.578  1.00 25.25  ? 74   ASN B N   1 
ATOM   3699  C CA  . ASN C  2  73  ? 78.337  46.836 29.097  1.00 24.97  ? 74   ASN B CA  1 
ATOM   3700  C C   . ASN C  2  73  ? 77.768  45.668 28.310  1.00 24.38  ? 74   ASN B C   1 
ATOM   3701  O O   . ASN C  2  73  ? 77.865  45.614 27.084  1.00 24.36  ? 74   ASN B O   1 
ATOM   3702  C CB  . ASN C  2  73  ? 77.250  47.863 29.329  1.00 25.46  ? 74   ASN B CB  1 
ATOM   3703  C CG  . ASN C  2  73  ? 76.728  48.427 28.060  1.00 26.05  ? 74   ASN B CG  1 
ATOM   3704  O OD1 . ASN C  2  73  ? 75.914  47.799 27.383  1.00 27.48  ? 74   ASN B OD1 1 
ATOM   3705  N ND2 . ASN C  2  73  ? 77.187  49.624 27.714  1.00 26.42  ? 74   ASN B ND2 1 
ATOM   3706  N N   . PHE C  2  74  ? 77.134  44.766 29.064  1.00 23.55  ? 75   PHE B N   1 
ATOM   3707  C CA  . PHE C  2  74  ? 76.550  43.520 28.576  1.00 22.53  ? 75   PHE B CA  1 
ATOM   3708  C C   . PHE C  2  74  ? 75.185  43.317 29.242  1.00 21.57  ? 75   PHE B C   1 
ATOM   3709  O O   . PHE C  2  74  ? 75.105  43.186 30.458  1.00 21.65  ? 75   PHE B O   1 
ATOM   3710  C CB  . PHE C  2  74  ? 77.508  42.400 28.979  1.00 22.75  ? 75   PHE B CB  1 
ATOM   3711  C CG  . PHE C  2  74  ? 77.131  41.029 28.499  1.00 22.01  ? 75   PHE B CG  1 
ATOM   3712  C CD1 . PHE C  2  74  ? 76.672  40.819 27.217  1.00 21.25  ? 75   PHE B CD1 1 
ATOM   3713  C CD2 . PHE C  2  74  ? 77.331  39.937 29.326  1.00 21.12  ? 75   PHE B CD2 1 
ATOM   3714  C CE1 . PHE C  2  74  ? 76.393  39.537 26.774  1.00 22.34  ? 75   PHE B CE1 1 
ATOM   3715  C CE2 . PHE C  2  74  ? 77.057  38.660 28.899  1.00 21.12  ? 75   PHE B CE2 1 
ATOM   3716  C CZ  . PHE C  2  74  ? 76.583  38.455 27.618  1.00 22.53  ? 75   PHE B CZ  1 
ATOM   3717  N N   . SER C  2  75  ? 74.115  43.279 28.460  1.00 20.99  ? 76   SER B N   1 
ATOM   3718  C CA  . SER C  2  75  ? 72.768  43.150 29.024  1.00 21.15  ? 76   SER B CA  1 
ATOM   3719  C C   . SER C  2  75  ? 72.111  41.790 28.837  1.00 21.29  ? 76   SER B C   1 
ATOM   3720  O O   . SER C  2  75  ? 72.309  41.131 27.826  1.00 21.69  ? 76   SER B O   1 
ATOM   3721  C CB  . SER C  2  75  ? 71.836  44.205 28.417  1.00 20.85  ? 76   SER B CB  1 
ATOM   3722  O OG  . SER C  2  75  ? 72.425  45.492 28.423  1.00 21.70  ? 76   SER B OG  1 
ATOM   3723  N N   . LEU C  2  76  ? 71.297  41.402 29.811  1.00 21.53  ? 77   LEU B N   1 
ATOM   3724  C CA  . LEU C  2  76  ? 70.557  40.157 29.759  1.00 22.61  ? 77   LEU B CA  1 
ATOM   3725  C C   . LEU C  2  76  ? 69.084  40.528 29.586  1.00 23.98  ? 77   LEU B C   1 
ATOM   3726  O O   . LEU C  2  76  ? 68.468  41.060 30.504  1.00 24.19  ? 77   LEU B O   1 
ATOM   3727  C CB  . LEU C  2  76  ? 70.765  39.378 31.061  1.00 22.43  ? 77   LEU B CB  1 
ATOM   3728  C CG  . LEU C  2  76  ? 70.108  38.005 31.205  1.00 21.78  ? 77   LEU B CG  1 
ATOM   3729  C CD1 . LEU C  2  76  ? 70.976  36.927 30.624  1.00 21.65  ? 77   LEU B CD1 1 
ATOM   3730  C CD2 . LEU C  2  76  ? 69.839  37.723 32.667  1.00 21.78  ? 77   LEU B CD2 1 
ATOM   3731  N N   . ILE C  2  77  ? 68.512  40.284 28.411  1.00 25.52  ? 78   ILE B N   1 
ATOM   3732  C CA  . ILE C  2  77  ? 67.103  40.642 28.196  1.00 26.38  ? 78   ILE B CA  1 
ATOM   3733  C C   . ILE C  2  77  ? 66.139  39.494 28.506  1.00 27.10  ? 78   ILE B C   1 
ATOM   3734  O O   . ILE C  2  77  ? 66.400  38.340 28.148  1.00 26.81  ? 78   ILE B O   1 
ATOM   3735  C CB  . ILE C  2  77  ? 66.858  41.123 26.752  1.00 26.46  ? 78   ILE B CB  1 
ATOM   3736  C CG1 . ILE C  2  77  ? 67.502  42.489 26.516  1.00 26.72  ? 78   ILE B CG1 1 
ATOM   3737  C CG2 . ILE C  2  77  ? 65.364  41.237 26.489  1.00 26.55  ? 78   ILE B CG2 1 
ATOM   3738  C CD1 . ILE C  2  77  ? 69.001  42.487 26.558  1.00 27.39  ? 78   ILE B CD1 1 
ATOM   3739  N N   . LEU C  2  78  ? 65.024  39.825 29.163  1.00 27.81  ? 79   LEU B N   1 
ATOM   3740  C CA  . LEU C  2  78  ? 63.981  38.847 29.488  1.00 28.77  ? 79   LEU B CA  1 
ATOM   3741  C C   . LEU C  2  78  ? 62.658  39.240 28.834  1.00 29.55  ? 79   LEU B C   1 
ATOM   3742  O O   . LEU C  2  78  ? 61.686  39.528 29.527  1.00 29.85  ? 79   LEU B O   1 
ATOM   3743  C CB  . LEU C  2  78  ? 63.771  38.761 31.000  1.00 28.76  ? 79   LEU B CB  1 
ATOM   3744  C CG  . LEU C  2  78  ? 64.703  37.868 31.814  1.00 29.68  ? 79   LEU B CG  1 
ATOM   3745  C CD1 . LEU C  2  78  ? 64.347  37.972 33.293  1.00 30.02  ? 79   LEU B CD1 1 
ATOM   3746  C CD2 . LEU C  2  78  ? 64.580  36.434 31.341  1.00 30.30  ? 79   LEU B CD2 1 
ATOM   3747  N N   . GLU C  2  79  ? 62.615  39.251 27.505  1.00 30.59  ? 80   GLU B N   1 
ATOM   3748  C CA  . GLU C  2  79  ? 61.404  39.646 26.768  1.00 31.53  ? 80   GLU B CA  1 
ATOM   3749  C C   . GLU C  2  79  ? 60.085  39.091 27.299  1.00 31.50  ? 80   GLU B C   1 
ATOM   3750  O O   . GLU C  2  79  ? 59.055  39.734 27.168  1.00 31.78  ? 80   GLU B O   1 
ATOM   3751  C CB  . GLU C  2  79  ? 61.541  39.290 25.293  1.00 31.95  ? 80   GLU B CB  1 
ATOM   3752  C CG  . GLU C  2  79  ? 62.493  40.198 24.547  1.00 33.99  ? 80   GLU B CG  1 
ATOM   3753  C CD  . GLU C  2  79  ? 62.614  39.837 23.086  1.00 36.90  ? 80   GLU B CD  1 
ATOM   3754  O OE1 . GLU C  2  79  ? 61.613  39.981 22.344  1.00 38.57  ? 80   GLU B OE1 1 
ATOM   3755  O OE2 . GLU C  2  79  ? 63.712  39.407 22.682  1.00 38.56  ? 80   GLU B OE2 1 
ATOM   3756  N N   . LEU C  2  80  ? 60.114  37.901 27.884  1.00 31.91  ? 81   LEU B N   1 
ATOM   3757  C CA  . LEU C  2  80  ? 58.911  37.283 28.430  1.00 32.04  ? 81   LEU B CA  1 
ATOM   3758  C C   . LEU C  2  80  ? 59.296  36.542 29.699  1.00 32.21  ? 81   LEU B C   1 
ATOM   3759  O O   . LEU C  2  80  ? 59.703  35.383 29.645  1.00 32.57  ? 81   LEU B O   1 
ATOM   3760  C CB  . LEU C  2  80  ? 58.316  36.307 27.412  1.00 32.24  ? 81   LEU B CB  1 
ATOM   3761  C CG  . LEU C  2  80  ? 56.934  35.694 27.651  1.00 32.29  ? 81   LEU B CG  1 
ATOM   3762  C CD1 . LEU C  2  80  ? 56.620  34.784 26.475  1.00 32.21  ? 81   LEU B CD1 1 
ATOM   3763  C CD2 . LEU C  2  80  ? 56.857  34.924 28.959  1.00 32.31  ? 81   LEU B CD2 1 
ATOM   3764  N N   . ALA C  2  81  ? 59.164  37.207 30.843  1.00 32.52  ? 82   ALA B N   1 
ATOM   3765  C CA  . ALA C  2  81  ? 59.543  36.617 32.129  1.00 32.39  ? 82   ALA B CA  1 
ATOM   3766  C C   . ALA C  2  81  ? 58.614  35.507 32.607  1.00 32.37  ? 82   ALA B C   1 
ATOM   3767  O O   . ALA C  2  81  ? 57.401  35.581 32.443  1.00 32.65  ? 82   ALA B O   1 
ATOM   3768  C CB  . ALA C  2  81  ? 59.652  37.702 33.193  1.00 32.07  ? 82   ALA B CB  1 
ATOM   3769  N N   . THR C  2  82  ? 59.208  34.472 33.191  1.00 32.52  ? 83   THR B N   1 
ATOM   3770  C CA  . THR C  2  82  ? 58.461  33.360 33.763  1.00 32.69  ? 83   THR B CA  1 
ATOM   3771  C C   . THR C  2  82  ? 58.930  33.242 35.203  1.00 32.91  ? 83   THR B C   1 
ATOM   3772  O O   . THR C  2  82  ? 60.096  33.509 35.489  1.00 33.26  ? 83   THR B O   1 
ATOM   3773  C CB  . THR C  2  82  ? 58.724  32.035 33.018  1.00 32.74  ? 83   THR B CB  1 
ATOM   3774  O OG1 . THR C  2  82  ? 60.099  31.639 33.163  1.00 32.78  ? 83   THR B OG1 1 
ATOM   3775  C CG2 . THR C  2  82  ? 58.474  32.194 31.518  1.00 32.82  ? 83   THR B CG2 1 
ATOM   3776  N N   . PRO C  2  83  ? 58.042  32.873 36.126  1.00 32.99  ? 84   PRO B N   1 
ATOM   3777  C CA  . PRO C  2  83  ? 58.439  32.748 37.530  1.00 32.94  ? 84   PRO B CA  1 
ATOM   3778  C C   . PRO C  2  83  ? 59.654  31.850 37.762  1.00 32.67  ? 84   PRO B C   1 
ATOM   3779  O O   . PRO C  2  83  ? 60.298  31.941 38.810  1.00 32.88  ? 84   PRO B O   1 
ATOM   3780  C CB  . PRO C  2  83  ? 57.171  32.213 38.204  1.00 33.00  ? 84   PRO B CB  1 
ATOM   3781  C CG  . PRO C  2  83  ? 56.346  31.674 37.093  1.00 33.47  ? 84   PRO B CG  1 
ATOM   3782  C CD  . PRO C  2  83  ? 56.606  32.604 35.955  1.00 33.12  ? 84   PRO B CD  1 
ATOM   3783  N N   . SER C  2  84  ? 59.980  31.012 36.787  1.00 31.94  ? 85   SER B N   1 
ATOM   3784  C CA  . SER C  2  84  ? 61.138  30.136 36.901  1.00 31.33  ? 85   SER B CA  1 
ATOM   3785  C C   . SER C  2  84  ? 62.410  30.965 36.972  1.00 30.27  ? 85   SER B C   1 
ATOM   3786  O O   . SER C  2  84  ? 63.416  30.526 37.525  1.00 30.53  ? 85   SER B O   1 
ATOM   3787  C CB  . SER C  2  84  ? 61.230  29.219 35.689  1.00 31.53  ? 85   SER B CB  1 
ATOM   3788  O OG  . SER C  2  84  ? 61.473  29.980 34.516  1.00 32.06  ? 85   SER B OG  1 
ATOM   3789  N N   . GLN C  2  85  ? 62.358  32.167 36.407  1.00 28.76  ? 86   GLN B N   1 
ATOM   3790  C CA  . GLN C  2  85  ? 63.518  33.050 36.363  1.00 27.37  ? 86   GLN B CA  1 
ATOM   3791  C C   . GLN C  2  85  ? 63.718  33.918 37.605  1.00 26.50  ? 86   GLN B C   1 
ATOM   3792  O O   . GLN C  2  85  ? 64.602  34.778 37.633  1.00 26.95  ? 86   GLN B O   1 
ATOM   3793  C CB  . GLN C  2  85  ? 63.447  33.891 35.097  1.00 26.98  ? 86   GLN B CB  1 
ATOM   3794  C CG  . GLN C  2  85  ? 63.264  32.999 33.880  1.00 25.83  ? 86   GLN B CG  1 
ATOM   3795  C CD  . GLN C  2  85  ? 63.044  33.752 32.591  1.00 24.82  ? 86   GLN B CD  1 
ATOM   3796  O OE1 . GLN C  2  85  ? 62.096  34.528 32.468  1.00 24.19  ? 86   GLN B OE1 1 
ATOM   3797  N NE2 . GLN C  2  85  ? 63.910  33.510 31.617  1.00 23.03  ? 86   GLN B NE2 1 
ATOM   3798  N N   . THR C  2  86  ? 62.912  33.694 38.635  1.00 25.11  ? 87   THR B N   1 
ATOM   3799  C CA  . THR C  2  86  ? 63.098  34.414 39.882  1.00 23.90  ? 87   THR B CA  1 
ATOM   3800  C C   . THR C  2  86  ? 64.438  33.944 40.405  1.00 23.32  ? 87   THR B C   1 
ATOM   3801  O O   . THR C  2  86  ? 64.660  32.745 40.519  1.00 23.15  ? 87   THR B O   1 
ATOM   3802  C CB  . THR C  2  86  ? 62.024  34.035 40.893  1.00 23.49  ? 87   THR B CB  1 
ATOM   3803  O OG1 . THR C  2  86  ? 60.802  34.711 40.578  1.00 23.22  ? 87   THR B OG1 1 
ATOM   3804  C CG2 . THR C  2  86  ? 62.424  34.479 42.306  1.00 22.84  ? 87   THR B CG2 1 
ATOM   3805  N N   . SER C  2  87  ? 65.336  34.865 40.728  1.00 22.91  ? 88   SER B N   1 
ATOM   3806  C CA  . SER C  2  87  ? 66.659  34.465 41.198  1.00 22.49  ? 88   SER B CA  1 
ATOM   3807  C C   . SER C  2  87  ? 67.564  35.670 41.404  1.00 21.81  ? 88   SER B C   1 
ATOM   3808  O O   . SER C  2  87  ? 67.115  36.816 41.334  1.00 21.82  ? 88   SER B O   1 
ATOM   3809  C CB  . SER C  2  87  ? 67.287  33.518 40.162  1.00 22.78  ? 88   SER B CB  1 
ATOM   3810  O OG  . SER C  2  87  ? 68.605  33.143 40.492  1.00 23.06  ? 88   SER B OG  1 
ATOM   3811  N N   . VAL C  2  88  ? 68.841  35.395 41.652  1.00 20.71  ? 89   VAL B N   1 
ATOM   3812  C CA  . VAL C  2  88  ? 69.846  36.434 41.814  1.00 19.96  ? 89   VAL B CA  1 
ATOM   3813  C C   . VAL C  2  88  ? 70.802  36.296 40.641  1.00 19.89  ? 89   VAL B C   1 
ATOM   3814  O O   . VAL C  2  88  ? 71.351  35.224 40.415  1.00 20.17  ? 89   VAL B O   1 
ATOM   3815  C CB  . VAL C  2  88  ? 70.611  36.273 43.141  1.00 19.41  ? 89   VAL B CB  1 
ATOM   3816  C CG1 . VAL C  2  88  ? 71.643  37.357 43.294  1.00 18.66  ? 89   VAL B CG1 1 
ATOM   3817  C CG2 . VAL C  2  88  ? 69.643  36.315 44.300  1.00 18.87  ? 89   VAL B CG2 1 
ATOM   3818  N N   . TYR C  2  89  ? 70.999  37.372 39.892  1.00 19.92  ? 90   TYR B N   1 
ATOM   3819  C CA  . TYR C  2  89  ? 71.861  37.332 38.718  1.00 20.27  ? 90   TYR B CA  1 
ATOM   3820  C C   . TYR C  2  89  ? 73.140  38.118 38.922  1.00 20.39  ? 90   TYR B C   1 
ATOM   3821  O O   . TYR C  2  89  ? 73.132  39.159 39.564  1.00 21.13  ? 90   TYR B O   1 
ATOM   3822  C CB  . TYR C  2  89  ? 71.124  37.891 37.500  1.00 20.26  ? 90   TYR B CB  1 
ATOM   3823  C CG  . TYR C  2  89  ? 69.872  37.136 37.150  1.00 20.24  ? 90   TYR B CG  1 
ATOM   3824  C CD1 . TYR C  2  89  ? 68.713  37.273 37.906  1.00 21.29  ? 90   TYR B CD1 1 
ATOM   3825  C CD2 . TYR C  2  89  ? 69.844  36.279 36.063  1.00 21.69  ? 90   TYR B CD2 1 
ATOM   3826  C CE1 . TYR C  2  89  ? 67.555  36.565 37.579  1.00 21.80  ? 90   TYR B CE1 1 
ATOM   3827  C CE2 . TYR C  2  89  ? 68.694  35.565 35.732  1.00 21.04  ? 90   TYR B CE2 1 
ATOM   3828  C CZ  . TYR C  2  89  ? 67.563  35.712 36.487  1.00 20.48  ? 90   TYR B CZ  1 
ATOM   3829  O OH  . TYR C  2  89  ? 66.445  34.994 36.144  1.00 21.93  ? 90   TYR B OH  1 
ATOM   3830  N N   . PHE C  2  90  ? 74.237  37.617 38.366  1.00 20.50  ? 91   PHE B N   1 
ATOM   3831  C CA  . PHE C  2  90  ? 75.525  38.290 38.488  1.00 20.72  ? 91   PHE B CA  1 
ATOM   3832  C C   . PHE C  2  90  ? 76.233  38.289 37.159  1.00 21.16  ? 91   PHE B C   1 
ATOM   3833  O O   . PHE C  2  90  ? 76.269  37.257 36.481  1.00 20.93  ? 91   PHE B O   1 
ATOM   3834  C CB  . PHE C  2  90  ? 76.470  37.556 39.430  1.00 20.23  ? 91   PHE B CB  1 
ATOM   3835  C CG  . PHE C  2  90  ? 76.006  37.459 40.848  1.00 18.97  ? 91   PHE B CG  1 
ATOM   3836  C CD1 . PHE C  2  90  ? 75.206  36.412 41.251  1.00 17.19  ? 91   PHE B CD1 1 
ATOM   3837  C CD2 . PHE C  2  90  ? 76.449  38.367 41.799  1.00 17.65  ? 91   PHE B CD2 1 
ATOM   3838  C CE1 . PHE C  2  90  ? 74.820  36.284 42.560  1.00 16.91  ? 91   PHE B CE1 1 
ATOM   3839  C CE2 . PHE C  2  90  ? 76.070  38.239 43.117  1.00 17.00  ? 91   PHE B CE2 1 
ATOM   3840  C CZ  . PHE C  2  90  ? 75.254  37.192 43.497  1.00 17.01  ? 91   PHE B CZ  1 
ATOM   3841  N N   . CYS C  2  91  ? 76.803  39.432 36.788  1.00 21.28  ? 92   CYS B N   1 
ATOM   3842  C CA  . CYS C  2  91  ? 77.607  39.477 35.586  1.00 21.96  ? 92   CYS B CA  1 
ATOM   3843  C C   . CYS C  2  91  ? 79.020  39.582 36.081  1.00 20.83  ? 92   CYS B C   1 
ATOM   3844  O O   . CYS C  2  91  ? 79.273  40.101 37.170  1.00 20.88  ? 92   CYS B O   1 
ATOM   3845  C CB  . CYS C  2  91  ? 77.292  40.665 34.687  1.00 22.49  ? 92   CYS B CB  1 
ATOM   3846  S SG  . CYS C  2  91  ? 77.330  42.227 35.540  1.00 26.95  ? 92   CYS B SG  1 
ATOM   3847  N N   . ALA C  2  92  ? 79.941  39.082 35.281  1.00 19.69  ? 93   ALA B N   1 
ATOM   3848  C CA  . ALA C  2  92  ? 81.338  39.122 35.631  1.00 18.81  ? 93   ALA B CA  1 
ATOM   3849  C C   . ALA C  2  92  ? 82.066  39.555 34.392  1.00 18.16  ? 93   ALA B C   1 
ATOM   3850  O O   . ALA C  2  92  ? 81.585  39.336 33.279  1.00 18.30  ? 93   ALA B O   1 
ATOM   3851  C CB  . ALA C  2  92  ? 81.822  37.729 36.076  1.00 18.49  ? 93   ALA B CB  1 
ATOM   3852  N N   . SER C  2  93  ? 83.203  40.207 34.570  1.00 17.07  ? 94   SER B N   1 
ATOM   3853  C CA  . SER C  2  93  ? 84.000  40.560 33.427  1.00 17.04  ? 94   SER B CA  1 
ATOM   3854  C C   . SER C  2  93  ? 85.184  39.642 33.623  1.00 17.26  ? 94   SER B C   1 
ATOM   3855  O O   . SER C  2  93  ? 85.457  39.238 34.749  1.00 16.97  ? 94   SER B O   1 
ATOM   3856  C CB  . SER C  2  93  ? 84.403  42.031 33.440  1.00 16.27  ? 94   SER B CB  1 
ATOM   3857  O OG  . SER C  2  93  ? 85.312  42.302 34.474  1.00 17.20  ? 94   SER B OG  1 
ATOM   3858  N N   . GLY C  2  94  ? 85.875  39.271 32.560  1.00 17.04  ? 95   GLY B N   1 
ATOM   3859  C CA  . GLY C  2  94  ? 87.008  38.401 32.756  1.00 17.87  ? 95   GLY B CA  1 
ATOM   3860  C C   . GLY C  2  94  ? 88.100  38.687 31.765  1.00 18.44  ? 95   GLY B C   1 
ATOM   3861  O O   . GLY C  2  94  ? 87.836  39.162 30.657  1.00 18.68  ? 95   GLY B O   1 
ATOM   3862  N N   . GLY C  2  95  ? 89.332  38.388 32.151  1.00 18.85  ? 96   GLY B N   1 
ATOM   3863  C CA  . GLY C  2  95  ? 90.447  38.627 31.260  1.00 19.42  ? 96   GLY B CA  1 
ATOM   3864  C C   . GLY C  2  95  ? 91.094  37.377 30.712  1.00 19.52  ? 96   GLY B C   1 
ATOM   3865  O O   . GLY C  2  95  ? 92.285  37.394 30.387  1.00 20.66  ? 96   GLY B O   1 
ATOM   3866  N N   . GLY C  2  96  ? 90.334  36.297 30.599  1.00 19.26  ? 97   GLY B N   1 
ATOM   3867  C CA  . GLY C  2  96  ? 90.902  35.055 30.095  1.00 19.14  ? 97   GLY B CA  1 
ATOM   3868  C C   . GLY C  2  96  ? 91.073  34.008 31.174  1.00 18.82  ? 97   GLY B C   1 
ATOM   3869  O O   . GLY C  2  96  ? 91.050  32.815 30.896  1.00 18.64  ? 97   GLY B O   1 
ATOM   3870  N N   . GLY C  2  97  ? 91.254  34.456 32.411  1.00 18.85  ? 98   GLY B N   1 
ATOM   3871  C CA  . GLY C  2  97  ? 91.418  33.543 33.527  1.00 18.86  ? 98   GLY B CA  1 
ATOM   3872  C C   . GLY C  2  97  ? 90.369  33.755 34.603  1.00 18.94  ? 98   GLY B C   1 
ATOM   3873  O O   . GLY C  2  97  ? 89.240  33.267 34.522  1.00 19.14  ? 98   GLY B O   1 
ATOM   3874  N N   . THR C  2  98  ? 90.709  34.583 35.650  1.00 16.44  ? 105  THR B N   1 
ATOM   3875  C CA  . THR C  2  98  ? 89.815  34.794 36.771  1.00 16.54  ? 105  THR B CA  1 
ATOM   3876  C C   . THR C  2  98  ? 88.758  35.865 36.476  1.00 16.02  ? 105  THR B C   1 
ATOM   3877  O O   . THR C  2  98  ? 89.061  36.876 35.866  1.00 16.79  ? 105  THR B O   1 
ATOM   3878  C CB  . THR C  2  98  ? 90.630  35.209 38.007  1.00 16.64  ? 105  THR B CB  1 
ATOM   3879  O OG1 . THR C  2  98  ? 91.332  36.429 37.735  1.00 18.43  ? 105  THR B OG1 1 
ATOM   3880  C CG2 . THR C  2  98  ? 91.681  34.185 38.333  1.00 15.32  ? 105  THR B CG2 1 
ATOM   3881  N N   . LEU C  2  99  ? 87.528  35.640 36.934  1.00 15.19  ? 106  LEU B N   1 
ATOM   3882  C CA  . LEU C  2  99  ? 86.426  36.580 36.751  1.00 14.24  ? 106  LEU B CA  1 
ATOM   3883  C C   . LEU C  2  99  ? 86.167  37.496 37.943  1.00 14.84  ? 106  LEU B C   1 
ATOM   3884  O O   . LEU C  2  99  ? 86.396  37.120 39.109  1.00 14.49  ? 106  LEU B O   1 
ATOM   3885  C CB  . LEU C  2  99  ? 85.131  35.824 36.483  1.00 14.03  ? 106  LEU B CB  1 
ATOM   3886  C CG  . LEU C  2  99  ? 85.184  34.842 35.316  1.00 12.79  ? 106  LEU B CG  1 
ATOM   3887  C CD1 . LEU C  2  99  ? 83.782  34.572 34.837  1.00 11.94  ? 106  LEU B CD1 1 
ATOM   3888  C CD2 . LEU C  2  99  ? 86.037  35.393 34.196  1.00 12.45  ? 106  LEU B CD2 1 
ATOM   3889  N N   . TYR C  2  100 ? 85.646  38.687 37.636  1.00 14.86  ? 107  TYR B N   1 
ATOM   3890  C CA  . TYR C  2  100 ? 85.302  39.688 38.640  1.00 14.90  ? 107  TYR B CA  1 
ATOM   3891  C C   . TYR C  2  100 ? 83.788  39.852 38.620  1.00 14.87  ? 107  TYR B C   1 
ATOM   3892  O O   . TYR C  2  100 ? 83.221  40.080 37.559  1.00 14.69  ? 107  TYR B O   1 
ATOM   3893  C CB  . TYR C  2  100 ? 86.016  41.016 38.313  1.00 15.23  ? 107  TYR B CB  1 
ATOM   3894  C CG  . TYR C  2  100 ? 87.513  40.834 38.291  1.00 15.27  ? 107  TYR B CG  1 
ATOM   3895  C CD1 . TYR C  2  100 ? 88.150  40.270 37.182  1.00 15.66  ? 107  TYR B CD1 1 
ATOM   3896  C CD2 . TYR C  2  100 ? 88.276  41.123 39.403  1.00 14.67  ? 107  TYR B CD2 1 
ATOM   3897  C CE1 . TYR C  2  100 ? 89.511  40.044 37.171  1.00 13.98  ? 107  TYR B CE1 1 
ATOM   3898  C CE2 . TYR C  2  100 ? 89.641  40.885 39.408  1.00 16.04  ? 107  TYR B CE2 1 
ATOM   3899  C CZ  . TYR C  2  100 ? 90.252  40.344 38.290  1.00 16.01  ? 107  TYR B CZ  1 
ATOM   3900  O OH  . TYR C  2  100 ? 91.610  40.109 38.306  1.00 16.97  ? 107  TYR B OH  1 
ATOM   3901  N N   . PHE C  2  101 ? 83.131  39.741 39.776  1.00 14.66  ? 108  PHE B N   1 
ATOM   3902  C CA  . PHE C  2  101 ? 81.671  39.819 39.818  1.00 14.63  ? 108  PHE B CA  1 
ATOM   3903  C C   . PHE C  2  101 ? 81.092  41.123 40.341  1.00 14.70  ? 108  PHE B C   1 
ATOM   3904  O O   . PHE C  2  101 ? 81.655  41.775 41.217  1.00 14.92  ? 108  PHE B O   1 
ATOM   3905  C CB  . PHE C  2  101 ? 81.072  38.696 40.680  1.00 14.69  ? 108  PHE B CB  1 
ATOM   3906  C CG  . PHE C  2  101 ? 81.389  37.304 40.213  1.00 14.01  ? 108  PHE B CG  1 
ATOM   3907  C CD1 . PHE C  2  101 ? 82.577  36.691 40.576  1.00 13.73  ? 108  PHE B CD1 1 
ATOM   3908  C CD2 . PHE C  2  101 ? 80.478  36.592 39.440  1.00 14.44  ? 108  PHE B CD2 1 
ATOM   3909  C CE1 . PHE C  2  101 ? 82.865  35.393 40.167  1.00 13.51  ? 108  PHE B CE1 1 
ATOM   3910  C CE2 . PHE C  2  101 ? 80.761  35.295 39.017  1.00 14.48  ? 108  PHE B CE2 1 
ATOM   3911  C CZ  . PHE C  2  101 ? 81.953  34.695 39.389  1.00 13.87  ? 108  PHE B CZ  1 
ATOM   3912  N N   . GLY C  2  102 ? 79.916  41.458 39.825  1.00 14.20  ? 109  GLY B N   1 
ATOM   3913  C CA  . GLY C  2  102 ? 79.204  42.629 40.275  1.00 13.73  ? 109  GLY B CA  1 
ATOM   3914  C C   . GLY C  2  102 ? 78.519  42.185 41.554  1.00 13.76  ? 109  GLY B C   1 
ATOM   3915  O O   . GLY C  2  102 ? 78.641  41.032 41.935  1.00 12.66  ? 109  GLY B O   1 
ATOM   3916  N N   . ALA C  2  103 ? 77.780  43.067 42.214  1.00 14.31  ? 110  ALA B N   1 
ATOM   3917  C CA  . ALA C  2  103 ? 77.145  42.694 43.473  1.00 14.86  ? 110  ALA B CA  1 
ATOM   3918  C C   . ALA C  2  103 ? 75.787  41.965 43.384  1.00 15.44  ? 110  ALA B C   1 
ATOM   3919  O O   . ALA C  2  103 ? 75.166  41.691 44.418  1.00 15.34  ? 110  ALA B O   1 
ATOM   3920  C CB  . ALA C  2  103 ? 77.038  43.902 44.347  1.00 14.95  ? 110  ALA B CB  1 
ATOM   3921  N N   . GLY C  2  104 ? 75.335  41.627 42.181  1.00 16.00  ? 111  GLY B N   1 
ATOM   3922  C CA  . GLY C  2  104 ? 74.094  40.882 42.039  1.00 17.33  ? 111  GLY B CA  1 
ATOM   3923  C C   . GLY C  2  104 ? 72.823  41.692 41.842  1.00 18.73  ? 111  GLY B C   1 
ATOM   3924  O O   . GLY C  2  104 ? 72.794  42.915 42.012  1.00 18.58  ? 111  GLY B O   1 
ATOM   3925  N N   . THR C  2  105 ? 71.757  40.994 41.465  1.00 20.09  ? 112  THR B N   1 
ATOM   3926  C CA  . THR C  2  105 ? 70.464  41.624 41.242  1.00 21.20  ? 112  THR B CA  1 
ATOM   3927  C C   . THR C  2  105 ? 69.365  40.658 41.609  1.00 22.26  ? 112  THR B C   1 
ATOM   3928  O O   . THR C  2  105 ? 69.190  39.662 40.914  1.00 22.15  ? 112  THR B O   1 
ATOM   3929  C CB  . THR C  2  105 ? 70.269  41.969 39.757  1.00 21.48  ? 112  THR B CB  1 
ATOM   3930  O OG1 . THR C  2  105 ? 71.241  42.934 39.327  1.00 22.44  ? 112  THR B OG1 1 
ATOM   3931  C CG2 . THR C  2  105 ? 68.903  42.617 39.539  1.00 21.05  ? 112  THR B CG2 1 
ATOM   3932  N N   . ARG C  2  106 ? 68.619  40.934 42.679  1.00 23.67  ? 113  ARG B N   1 
ATOM   3933  C CA  . ARG C  2  106 ? 67.499  40.068 43.042  1.00 24.97  ? 113  ARG B CA  1 
ATOM   3934  C C   . ARG C  2  106 ? 66.374  40.339 42.053  1.00 25.21  ? 113  ARG B C   1 
ATOM   3935  O O   . ARG C  2  106 ? 66.052  41.494 41.769  1.00 25.08  ? 113  ARG B O   1 
ATOM   3936  C CB  . ARG C  2  106 ? 66.950  40.360 44.441  1.00 25.71  ? 113  ARG B CB  1 
ATOM   3937  C CG  . ARG C  2  106 ? 67.884  40.197 45.611  1.00 28.85  ? 113  ARG B CG  1 
ATOM   3938  C CD  . ARG C  2  106 ? 67.094  40.143 46.923  1.00 32.26  ? 113  ARG B CD  1 
ATOM   3939  N NE  . ARG C  2  106 ? 67.922  40.180 48.122  1.00 36.11  ? 113  ARG B NE  1 
ATOM   3940  C CZ  . ARG C  2  106 ? 68.141  41.274 48.850  1.00 38.90  ? 113  ARG B CZ  1 
ATOM   3941  N NH1 . ARG C  2  106 ? 67.602  42.439 48.500  1.00 39.49  ? 113  ARG B NH1 1 
ATOM   3942  N NH2 . ARG C  2  106 ? 68.909  41.206 49.930  1.00 39.72  ? 113  ARG B NH2 1 
ATOM   3943  N N   . LEU C  2  107 ? 65.762  39.280 41.543  1.00 25.85  ? 114  LEU B N   1 
ATOM   3944  C CA  . LEU C  2  107 ? 64.652  39.426 40.609  1.00 26.15  ? 114  LEU B CA  1 
ATOM   3945  C C   . LEU C  2  107 ? 63.543  38.486 41.028  1.00 26.26  ? 114  LEU B C   1 
ATOM   3946  O O   . LEU C  2  107 ? 63.786  37.304 41.264  1.00 26.23  ? 114  LEU B O   1 
ATOM   3947  C CB  . LEU C  2  107 ? 65.098  39.097 39.182  1.00 26.24  ? 114  LEU B CB  1 
ATOM   3948  C CG  . LEU C  2  107 ? 63.983  38.994 38.134  1.00 27.02  ? 114  LEU B CG  1 
ATOM   3949  C CD1 . LEU C  2  107 ? 63.147  40.276 38.082  1.00 27.36  ? 114  LEU B CD1 1 
ATOM   3950  C CD2 . LEU C  2  107 ? 64.589  38.693 36.769  1.00 27.68  ? 114  LEU B CD2 1 
ATOM   3951  N N   . SER C  2  108 ? 62.329  39.009 41.142  1.00 26.30  ? 115  SER B N   1 
ATOM   3952  C CA  . SER C  2  108 ? 61.196  38.167 41.489  1.00 26.51  ? 115  SER B CA  1 
ATOM   3953  C C   . SER C  2  108 ? 60.150  38.220 40.401  1.00 26.68  ? 115  SER B C   1 
ATOM   3954  O O   . SER C  2  108 ? 59.661  39.285 40.057  1.00 25.90  ? 115  SER B O   1 
ATOM   3955  C CB  . SER C  2  108 ? 60.572  38.595 42.808  1.00 26.31  ? 115  SER B CB  1 
ATOM   3956  O OG  . SER C  2  108 ? 61.382  38.175 43.884  1.00 27.44  ? 115  SER B OG  1 
ATOM   3957  N N   . VAL C  2  109 ? 59.814  37.063 39.852  1.00 27.68  ? 116  VAL B N   1 
ATOM   3958  C CA  . VAL C  2  109 ? 58.788  37.009 38.829  1.00 28.55  ? 116  VAL B CA  1 
ATOM   3959  C C   . VAL C  2  109 ? 57.512  36.502 39.467  1.00 29.05  ? 116  VAL B C   1 
ATOM   3960  O O   . VAL C  2  109 ? 57.455  35.372 39.946  1.00 29.27  ? 116  VAL B O   1 
ATOM   3961  C CB  . VAL C  2  109 ? 59.162  36.097 37.680  1.00 28.53  ? 116  VAL B CB  1 
ATOM   3962  C CG1 . VAL C  2  109 ? 58.022  36.067 36.662  1.00 28.94  ? 116  VAL B CG1 1 
ATOM   3963  C CG2 . VAL C  2  109 ? 60.448  36.581 37.029  1.00 28.28  ? 116  VAL B CG2 1 
ATOM   3964  N N   . LEU C  2  110 ? 56.450  37.427 39.497  1.00 72.00  ? 316  LEU B N   1 
ATOM   3965  C CA  . LEU C  2  110 ? 55.219  37.028 40.154  1.00 72.01  ? 316  LEU B CA  1 
ATOM   3966  C C   . LEU C  2  110 ? 54.098  36.761 39.159  1.00 69.48  ? 316  LEU B C   1 
ATOM   3967  O O   . LEU C  2  110 ? 54.019  37.389 38.096  1.00 70.00  ? 316  LEU B O   1 
ATOM   3968  C CB  . LEU C  2  110 ? 54.788  38.109 41.139  1.00 73.42  ? 316  LEU B CB  1 
ATOM   3969  C CG  . LEU C  2  110 ? 55.852  38.563 42.137  1.00 77.12  ? 316  LEU B CG  1 
ATOM   3970  C CD1 . LEU C  2  110 ? 56.756  39.599 41.497  1.00 80.10  ? 316  LEU B CD1 1 
ATOM   3971  C CD2 . LEU C  2  110 ? 55.196  39.144 43.360  1.00 79.07  ? 316  LEU B CD2 1 
ATOM   3972  N N   . GLU C  2  111 ? 53.232  35.822 39.535  1.00 53.78  ? 117  GLU B N   1 
ATOM   3973  C CA  . GLU C  2  111 ? 52.080  35.416 38.741  1.00 51.09  ? 117  GLU B CA  1 
ATOM   3974  C C   . GLU C  2  111 ? 50.972  36.441 38.894  1.00 49.60  ? 117  GLU B C   1 
ATOM   3975  O O   . GLU C  2  111 ? 50.031  36.479 38.102  1.00 49.26  ? 117  GLU B O   1 
ATOM   3976  C CB  . GLU C  2  111 ? 51.586  34.039 39.204  1.00 50.68  ? 117  GLU B CB  1 
ATOM   3977  C CG  . GLU C  2  111 ? 52.345  32.860 38.596  1.00 49.71  ? 117  GLU B CG  1 
ATOM   3978  C CD  . GLU C  2  111 ? 52.632  31.755 39.603  1.00 49.03  ? 117  GLU B CD  1 
ATOM   3979  O OE1 . GLU C  2  111 ? 51.721  31.394 40.376  1.00 49.10  ? 117  GLU B OE1 1 
ATOM   3980  O OE2 . GLU C  2  111 ? 53.773  31.243 39.628  1.00 49.05  ? 117  GLU B OE2 1 
ATOM   3981  N N   . ASP C  2  112 ? 51.105  37.268 39.925  1.00 47.94  ? 118  ASP B N   1 
ATOM   3982  C CA  . ASP C  2  112 ? 50.154  38.322 40.226  1.00 46.91  ? 118  ASP B CA  1 
ATOM   3983  C C   . ASP C  2  112 ? 50.973  39.485 40.772  1.00 45.79  ? 118  ASP B C   1 
ATOM   3984  O O   . ASP C  2  112 ? 52.047  39.276 41.333  1.00 45.60  ? 118  ASP B O   1 
ATOM   3985  C CB  . ASP C  2  112 ? 49.152  37.843 41.276  1.00 47.10  ? 118  ASP B CB  1 
ATOM   3986  C CG  . ASP C  2  112 ? 47.859  38.613 41.232  1.00 47.60  ? 118  ASP B CG  1 
ATOM   3987  O OD1 . ASP C  2  112 ? 46.947  38.310 42.038  1.00 48.83  ? 118  ASP B OD1 1 
ATOM   3988  O OD2 . ASP C  2  112 ? 47.681  39.533 40.408  1.00 47.97  ? 118  ASP B OD2 1 
ATOM   3989  N N   . LEU C  2  113 ? 50.481  40.707 40.629  1.00 44.55  ? 119  LEU B N   1 
ATOM   3990  C CA  . LEU C  2  113 ? 51.241  41.853 41.110  1.00 43.70  ? 119  LEU B CA  1 
ATOM   3991  C C   . LEU C  2  113 ? 50.592  42.537 42.300  1.00 43.55  ? 119  LEU B C   1 
ATOM   3992  O O   . LEU C  2  113 ? 51.034  43.600 42.729  1.00 43.18  ? 119  LEU B O   1 
ATOM   3993  C CB  . LEU C  2  113 ? 51.430  42.864 39.982  1.00 43.16  ? 119  LEU B CB  1 
ATOM   3994  C CG  . LEU C  2  113 ? 52.560  43.854 40.236  1.00 42.07  ? 119  LEU B CG  1 
ATOM   3995  C CD1 . LEU C  2  113 ? 53.888  43.119 40.125  1.00 41.66  ? 119  LEU B CD1 1 
ATOM   3996  C CD2 . LEU C  2  113 ? 52.497  45.011 39.259  1.00 41.68  ? 119  LEU B CD2 1 
ATOM   3997  N N   . ARG C  2  114 ? 49.553  41.918 42.842  1.00 43.70  ? 120  ARG B N   1 
ATOM   3998  C CA  . ARG C  2  114 ? 48.820  42.504 43.959  1.00 43.91  ? 120  ARG B CA  1 
ATOM   3999  C C   . ARG C  2  114 ? 49.085  41.845 45.307  1.00 43.19  ? 120  ARG B C   1 
ATOM   4000  O O   . ARG C  2  114 ? 48.525  42.261 46.323  1.00 43.25  ? 120  ARG B O   1 
ATOM   4001  C CB  . ARG C  2  114 ? 47.332  42.474 43.658  1.00 44.51  ? 120  ARG B CB  1 
ATOM   4002  C CG  . ARG C  2  114 ? 46.822  41.111 43.269  1.00 46.38  ? 120  ARG B CG  1 
ATOM   4003  C CD  . ARG C  2  114 ? 45.361  41.142 42.916  1.00 48.78  ? 120  ARG B CD  1 
ATOM   4004  N NE  . ARG C  2  114 ? 44.828  39.815 42.652  1.00 50.60  ? 120  ARG B NE  1 
ATOM   4005  C CZ  . ARG C  2  114 ? 43.561  39.575 42.359  1.00 51.82  ? 120  ARG B CZ  1 
ATOM   4006  N NH1 . ARG C  2  114 ? 42.696  40.580 42.292  1.00 52.30  ? 120  ARG B NH1 1 
ATOM   4007  N NH2 . ARG C  2  114 ? 43.155  38.332 42.136  1.00 52.25  ? 120  ARG B NH2 1 
ATOM   4008  N N   . ASN C  2  115 ? 49.930  40.821 45.322  1.00 42.26  ? 121  ASN B N   1 
ATOM   4009  C CA  . ASN C  2  115 ? 50.277  40.156 46.571  1.00 41.45  ? 121  ASN B CA  1 
ATOM   4010  C C   . ASN C  2  115 ? 51.412  40.915 47.262  1.00 40.29  ? 121  ASN B C   1 
ATOM   4011  O O   . ASN C  2  115 ? 51.640  40.760 48.464  1.00 40.44  ? 121  ASN B O   1 
ATOM   4012  C CB  . ASN C  2  115 ? 50.692  38.707 46.308  1.00 41.80  ? 121  ASN B CB  1 
ATOM   4013  C CG  . ASN C  2  115 ? 49.553  37.861 45.764  1.00 41.94  ? 121  ASN B CG  1 
ATOM   4014  O OD1 . ASN C  2  115 ? 48.511  37.724 46.402  1.00 42.10  ? 121  ASN B OD1 1 
ATOM   4015  N ND2 . ASN C  2  115 ? 49.747  37.292 44.580  1.00 42.41  ? 121  ASN B ND2 1 
ATOM   4016  N N   . VAL C  2  116 ? 52.117  41.731 46.481  1.00 38.73  ? 122  VAL B N   1 
ATOM   4017  C CA  . VAL C  2  116 ? 53.238  42.531 46.964  1.00 37.62  ? 122  VAL B CA  1 
ATOM   4018  C C   . VAL C  2  116 ? 52.761  43.405 48.109  1.00 36.29  ? 122  VAL B C   1 
ATOM   4019  O O   . VAL C  2  116 ? 51.611  43.819 48.117  1.00 36.26  ? 122  VAL B O   1 
ATOM   4020  C CB  . VAL C  2  116 ? 53.797  43.415 45.833  1.00 37.58  ? 122  VAL B CB  1 
ATOM   4021  C CG1 . VAL C  2  116 ? 52.672  44.117 45.130  1.00 38.52  ? 122  VAL B CG1 1 
ATOM   4022  C CG2 . VAL C  2  116 ? 54.782  44.428 46.367  1.00 37.54  ? 122  VAL B CG2 1 
ATOM   4023  N N   . THR C  2  117 ? 53.627  43.681 49.080  1.00 34.74  ? 123  THR B N   1 
ATOM   4024  C CA  . THR C  2  117 ? 53.221  44.502 50.220  1.00 33.71  ? 123  THR B CA  1 
ATOM   4025  C C   . THR C  2  117 ? 54.390  45.033 51.027  1.00 32.81  ? 123  THR B C   1 
ATOM   4026  O O   . THR C  2  117 ? 55.342  44.307 51.276  1.00 32.48  ? 123  THR B O   1 
ATOM   4027  C CB  . THR C  2  117 ? 52.354  43.690 51.175  1.00 33.63  ? 123  THR B CB  1 
ATOM   4028  O OG1 . THR C  2  117 ? 51.350  42.980 50.440  1.00 34.15  ? 123  THR B OG1 1 
ATOM   4029  C CG2 . THR C  2  117 ? 51.617  44.611 52.132  1.00 33.05  ? 123  THR B CG2 1 
ATOM   4030  N N   . PRO C  2  118 ? 54.329  46.305 51.427  1.00 31.98  ? 124  PRO B N   1 
ATOM   4031  C CA  . PRO C  2  118 ? 55.383  46.909 52.243  1.00 31.15  ? 124  PRO B CA  1 
ATOM   4032  C C   . PRO C  2  118 ? 55.479  46.265 53.611  1.00 30.37  ? 124  PRO B C   1 
ATOM   4033  O O   . PRO C  2  118 ? 54.564  45.547 54.008  1.00 30.12  ? 124  PRO B O   1 
ATOM   4034  C CB  . PRO C  2  118 ? 54.936  48.366 52.352  1.00 31.22  ? 124  PRO B CB  1 
ATOM   4035  C CG  . PRO C  2  118 ? 54.138  48.576 51.126  1.00 31.52  ? 124  PRO B CG  1 
ATOM   4036  C CD  . PRO C  2  118 ? 53.337  47.313 51.021  1.00 31.89  ? 124  PRO B CD  1 
ATOM   4037  N N   . PRO C  2  119 ? 56.595  46.448 54.307  1.00 29.50  ? 125  PRO B N   1 
ATOM   4038  C CA  . PRO C  2  119 ? 56.729  45.867 55.636  1.00 28.87  ? 125  PRO B CA  1 
ATOM   4039  C C   . PRO C  2  119 ? 56.196  46.700 56.782  1.00 28.20  ? 125  PRO B C   1 
ATOM   4040  O O   . PRO C  2  119 ? 56.177  47.926 56.741  1.00 28.31  ? 125  PRO B O   1 
ATOM   4041  C CB  . PRO C  2  119 ? 58.237  45.695 55.757  1.00 28.84  ? 125  PRO B CB  1 
ATOM   4042  C CG  . PRO C  2  119 ? 58.740  46.910 55.088  1.00 29.07  ? 125  PRO B CG  1 
ATOM   4043  C CD  . PRO C  2  119 ? 57.885  46.993 53.843  1.00 29.29  ? 125  PRO B CD  1 
ATOM   4044  N N   . LYS C  2  120 ? 55.753  45.998 57.810  1.00 27.70  ? 126  LYS B N   1 
ATOM   4045  C CA  . LYS C  2  120 ? 55.302  46.612 59.037  1.00 27.12  ? 126  LYS B CA  1 
ATOM   4046  C C   . LYS C  2  120 ? 56.510  46.411 59.931  1.00 26.01  ? 126  LYS B C   1 
ATOM   4047  O O   . LYS C  2  120 ? 56.933  45.281 60.130  1.00 25.39  ? 126  LYS B O   1 
ATOM   4048  C CB  . LYS C  2  120 ? 54.107  45.854 59.613  1.00 27.56  ? 126  LYS B CB  1 
ATOM   4049  C CG  . LYS C  2  120 ? 52.774  46.129 58.950  1.00 29.29  ? 126  LYS B CG  1 
ATOM   4050  C CD  . LYS C  2  120 ? 52.116  47.345 59.584  1.00 32.11  ? 126  LYS B CD  1 
ATOM   4051  C CE  . LYS C  2  120 ? 50.711  47.590 59.070  1.00 32.82  ? 126  LYS B CE  1 
ATOM   4052  N NZ  . LYS C  2  120 ? 50.004  48.553 59.962  1.00 33.16  ? 126  LYS B NZ  1 
ATOM   4053  N N   . VAL C  2  121 ? 57.104  47.480 60.440  1.00 25.24  ? 127  VAL B N   1 
ATOM   4054  C CA  . VAL C  2  121 ? 58.253  47.308 61.317  1.00 24.58  ? 127  VAL B CA  1 
ATOM   4055  C C   . VAL C  2  121 ? 57.942  47.938 62.655  1.00 24.13  ? 127  VAL B C   1 
ATOM   4056  O O   . VAL C  2  121 ? 57.365  49.017 62.713  1.00 23.61  ? 127  VAL B O   1 
ATOM   4057  C CB  . VAL C  2  121 ? 59.550  47.917 60.733  1.00 24.38  ? 127  VAL B CB  1 
ATOM   4058  C CG1 . VAL C  2  121 ? 59.326  48.363 59.309  1.00 24.29  ? 127  VAL B CG1 1 
ATOM   4059  C CG2 . VAL C  2  121 ? 60.053  49.057 61.593  1.00 24.30  ? 127  VAL B CG2 1 
ATOM   4060  N N   . SER C  2  122 ? 58.328  47.246 63.726  1.00 23.66  ? 128  SER B N   1 
ATOM   4061  C CA  . SER C  2  122 ? 58.125  47.727 65.083  1.00 22.89  ? 128  SER B CA  1 
ATOM   4062  C C   . SER C  2  122 ? 59.389  47.469 65.880  1.00 22.45  ? 128  SER B C   1 
ATOM   4063  O O   . SER C  2  122 ? 60.106  46.492 65.630  1.00 22.52  ? 128  SER B O   1 
ATOM   4064  C CB  . SER C  2  122 ? 56.938  47.020 65.722  1.00 23.18  ? 128  SER B CB  1 
ATOM   4065  O OG  . SER C  2  122 ? 56.929  45.648 65.370  1.00 23.65  ? 128  SER B OG  1 
ATOM   4066  N N   . LEU C  2  123 ? 59.669  48.344 66.840  1.00 21.46  ? 129  LEU B N   1 
ATOM   4067  C CA  . LEU C  2  123 ? 60.878  48.227 67.637  1.00 20.92  ? 129  LEU B CA  1 
ATOM   4068  C C   . LEU C  2  123 ? 60.558  47.778 69.059  1.00 20.80  ? 129  LEU B C   1 
ATOM   4069  O O   . LEU C  2  123 ? 59.919  48.517 69.824  1.00 20.68  ? 129  LEU B O   1 
ATOM   4070  C CB  . LEU C  2  123 ? 61.603  49.577 67.652  1.00 20.86  ? 129  LEU B CB  1 
ATOM   4071  C CG  . LEU C  2  123 ? 63.024  49.682 68.218  1.00 20.68  ? 129  LEU B CG  1 
ATOM   4072  C CD1 . LEU C  2  123 ? 63.952  48.747 67.519  1.00 19.28  ? 129  LEU B CD1 1 
ATOM   4073  C CD2 . LEU C  2  123 ? 63.528  51.111 68.054  1.00 20.55  ? 129  LEU B CD2 1 
ATOM   4074  N N   . PHE C  2  124 ? 61.000  46.570 69.406  1.00 20.10  ? 130  PHE B N   1 
ATOM   4075  C CA  . PHE C  2  124 ? 60.790  46.022 70.739  1.00 19.60  ? 130  PHE B CA  1 
ATOM   4076  C C   . PHE C  2  124 ? 61.923  46.514 71.614  1.00 21.31  ? 130  PHE B C   1 
ATOM   4077  O O   . PHE C  2  124 ? 63.092  46.383 71.270  1.00 21.78  ? 130  PHE B O   1 
ATOM   4078  C CB  . PHE C  2  124 ? 60.759  44.492 70.716  1.00 18.40  ? 130  PHE B CB  1 
ATOM   4079  C CG  . PHE C  2  124 ? 59.564  43.929 70.007  1.00 14.66  ? 130  PHE B CG  1 
ATOM   4080  C CD1 . PHE C  2  124 ? 59.442  44.040 68.640  1.00 11.87  ? 130  PHE B CD1 1 
ATOM   4081  C CD2 . PHE C  2  124 ? 58.548  43.318 70.711  1.00 13.48  ? 130  PHE B CD2 1 
ATOM   4082  C CE1 . PHE C  2  124 ? 58.335  43.559 67.990  1.00 10.68  ? 130  PHE B CE1 1 
ATOM   4083  C CE2 . PHE C  2  124 ? 57.425  42.836 70.058  1.00 12.32  ? 130  PHE B CE2 1 
ATOM   4084  C CZ  . PHE C  2  124 ? 57.328  42.955 68.695  1.00 11.10  ? 130  PHE B CZ  1 
ATOM   4085  N N   . GLU C  2  125 ? 61.577  47.077 72.759  1.00 23.34  ? 131  GLU B N   1 
ATOM   4086  C CA  . GLU C  2  125 ? 62.570  47.634 73.661  1.00 24.70  ? 131  GLU B CA  1 
ATOM   4087  C C   . GLU C  2  125 ? 63.185  46.545 74.537  1.00 25.36  ? 131  GLU B C   1 
ATOM   4088  O O   . GLU C  2  125 ? 62.647  45.437 74.619  1.00 25.05  ? 131  GLU B O   1 
ATOM   4089  C CB  . GLU C  2  125 ? 61.909  48.740 74.481  1.00 25.37  ? 131  GLU B CB  1 
ATOM   4090  C CG  . GLU C  2  125 ? 60.989  49.604 73.614  1.00 26.74  ? 131  GLU B CG  1 
ATOM   4091  C CD  . GLU C  2  125 ? 60.362  50.776 74.348  1.00 28.79  ? 131  GLU B CD  1 
ATOM   4092  O OE1 . GLU C  2  125 ? 59.983  50.609 75.529  1.00 30.46  ? 131  GLU B OE1 1 
ATOM   4093  O OE2 . GLU C  2  125 ? 60.229  51.862 73.733  1.00 28.84  ? 131  GLU B OE2 1 
ATOM   4094  N N   . PRO C  2  126 ? 64.343  46.822 75.134  1.00 26.37  ? 132  PRO B N   1 
ATOM   4095  C CA  . PRO C  2  126 ? 65.009  45.836 75.989  1.00 27.35  ? 132  PRO B CA  1 
ATOM   4096  C C   . PRO C  2  126 ? 64.379  45.629 77.353  1.00 28.22  ? 132  PRO B C   1 
ATOM   4097  O O   . PRO C  2  126 ? 64.002  46.588 78.030  1.00 29.07  ? 132  PRO B O   1 
ATOM   4098  C CB  . PRO C  2  126 ? 66.434  46.387 76.104  1.00 27.13  ? 132  PRO B CB  1 
ATOM   4099  C CG  . PRO C  2  126 ? 66.249  47.842 76.001  1.00 27.15  ? 132  PRO B CG  1 
ATOM   4100  C CD  . PRO C  2  126 ? 65.194  48.006 74.928  1.00 26.62  ? 132  PRO B CD  1 
ATOM   4101  N N   . SER C  2  127 ? 64.260  44.362 77.738  1.00 28.91  ? 133  SER B N   1 
ATOM   4102  C CA  . SER C  2  127 ? 63.708  44.002 79.028  1.00 29.40  ? 133  SER B CA  1 
ATOM   4103  C C   . SER C  2  127 ? 64.671  44.561 80.061  1.00 29.52  ? 133  SER B C   1 
ATOM   4104  O O   . SER C  2  127 ? 65.866  44.664 79.796  1.00 29.56  ? 133  SER B O   1 
ATOM   4105  C CB  . SER C  2  127 ? 63.626  42.485 79.168  1.00 29.82  ? 133  SER B CB  1 
ATOM   4106  O OG  . SER C  2  127 ? 64.885  41.948 79.526  1.00 29.51  ? 133  SER B OG  1 
ATOM   4107  N N   . LYS C  2  128 ? 64.158  44.919 81.231  1.00 29.57  ? 134  LYS B N   1 
ATOM   4108  C CA  . LYS C  2  128 ? 64.989  45.486 82.284  1.00 29.55  ? 134  LYS B CA  1 
ATOM   4109  C C   . LYS C  2  128 ? 65.811  44.422 82.991  1.00 29.23  ? 134  LYS B C   1 
ATOM   4110  O O   . LYS C  2  128 ? 66.812  44.722 83.642  1.00 29.04  ? 134  LYS B O   1 
ATOM   4111  C CB  . LYS C  2  128 ? 64.124  46.253 83.282  1.00 29.99  ? 134  LYS B CB  1 
ATOM   4112  C CG  . LYS C  2  128 ? 63.819  47.678 82.827  1.00 30.96  ? 134  LYS B CG  1 
ATOM   4113  C CD  . LYS C  2  128 ? 63.008  48.427 83.848  1.00 31.68  ? 134  LYS B CD  1 
ATOM   4114  C CE  . LYS C  2  128 ? 61.610  47.870 83.916  1.00 32.38  ? 134  LYS B CE  1 
ATOM   4115  N NZ  . LYS C  2  128 ? 60.867  48.104 82.649  1.00 32.75  ? 134  LYS B NZ  1 
ATOM   4116  N N   . ALA C  2  129 ? 65.382  43.174 82.862  1.00 28.88  ? 135  ALA B N   1 
ATOM   4117  C CA  . ALA C  2  129 ? 66.110  42.070 83.447  1.00 28.53  ? 135  ALA B CA  1 
ATOM   4118  C C   . ALA C  2  129 ? 67.484  42.012 82.775  1.00 28.85  ? 135  ALA B C   1 
ATOM   4119  O O   . ALA C  2  129 ? 68.516  42.035 83.452  1.00 28.82  ? 135  ALA B O   1 
ATOM   4120  C CB  . ALA C  2  129 ? 65.355  40.785 83.234  1.00 28.46  ? 135  ALA B CB  1 
ATOM   4121  N N   . GLU C  2  130 ? 67.496  41.952 81.442  1.00 28.89  ? 136  GLU B N   1 
ATOM   4122  C CA  . GLU C  2  130 ? 68.752  41.909 80.702  1.00 29.48  ? 136  GLU B CA  1 
ATOM   4123  C C   . GLU C  2  130 ? 69.630  43.056 81.151  1.00 30.03  ? 136  GLU B C   1 
ATOM   4124  O O   . GLU C  2  130 ? 70.752  42.854 81.604  1.00 29.49  ? 136  GLU B O   1 
ATOM   4125  C CB  . GLU C  2  130 ? 68.526  42.014 79.182  1.00 29.83  ? 136  GLU B CB  1 
ATOM   4126  C CG  . GLU C  2  130 ? 69.828  42.086 78.376  1.00 29.37  ? 136  GLU B CG  1 
ATOM   4127  C CD  . GLU C  2  130 ? 69.629  42.241 76.867  1.00 30.54  ? 136  GLU B CD  1 
ATOM   4128  O OE1 . GLU C  2  130 ? 70.633  42.141 76.124  1.00 29.43  ? 136  GLU B OE1 1 
ATOM   4129  O OE2 . GLU C  2  130 ? 68.485  42.466 76.411  1.00 30.99  ? 136  GLU B OE2 1 
ATOM   4130  N N   . ILE C  2  131 ? 69.094  44.264 81.019  1.00 31.14  ? 137  ILE B N   1 
ATOM   4131  C CA  . ILE C  2  131 ? 69.801  45.489 81.377  1.00 32.19  ? 137  ILE B CA  1 
ATOM   4132  C C   . ILE C  2  131 ? 70.253  45.545 82.829  1.00 33.29  ? 137  ILE B C   1 
ATOM   4133  O O   . ILE C  2  131 ? 71.262  46.176 83.146  1.00 33.62  ? 137  ILE B O   1 
ATOM   4134  C CB  . ILE C  2  131 ? 68.903  46.703 81.124  1.00 32.32  ? 137  ILE B CB  1 
ATOM   4135  C CG1 . ILE C  2  131 ? 68.357  46.668 79.694  1.00 31.80  ? 137  ILE B CG1 1 
ATOM   4136  C CG2 . ILE C  2  131 ? 69.686  47.990 81.387  1.00 32.27  ? 137  ILE B CG2 1 
ATOM   4137  C CD1 . ILE C  2  131 ? 67.096  47.471 79.521  1.00 31.24  ? 137  ILE B CD1 1 
ATOM   4138  N N   . ALA C  2  132 ? 69.503  44.901 83.712  1.00 34.25  ? 138  ALA B N   1 
ATOM   4139  C CA  . ALA C  2  132 ? 69.809  44.942 85.136  1.00 35.28  ? 138  ALA B CA  1 
ATOM   4140  C C   . ALA C  2  132 ? 71.074  44.186 85.529  1.00 36.00  ? 138  ALA B C   1 
ATOM   4141  O O   . ALA C  2  132 ? 72.025  44.773 86.051  1.00 36.20  ? 138  ALA B O   1 
ATOM   4142  C CB  . ALA C  2  132 ? 68.637  44.408 85.920  1.00 35.39  ? 138  ALA B CB  1 
ATOM   4143  N N   . ASN C  2  133 ? 71.070  42.880 85.290  1.00 36.52  ? 139  ASN B N   1 
ATOM   4144  C CA  . ASN C  2  133 ? 72.181  42.019 85.678  1.00 36.98  ? 139  ASN B CA  1 
ATOM   4145  C C   . ASN C  2  133 ? 73.307  41.836 84.669  1.00 36.50  ? 139  ASN B C   1 
ATOM   4146  O O   . ASN C  2  133 ? 74.365  41.312 85.031  1.00 36.85  ? 139  ASN B O   1 
ATOM   4147  C CB  . ASN C  2  133 ? 71.644  40.649 86.068  1.00 37.66  ? 139  ASN B CB  1 
ATOM   4148  C CG  . ASN C  2  133 ? 70.483  40.224 85.213  1.00 38.78  ? 139  ASN B CG  1 
ATOM   4149  O OD1 . ASN C  2  133 ? 69.326  40.390 85.600  1.00 40.97  ? 139  ASN B OD1 1 
ATOM   4150  N ND2 . ASN C  2  133 ? 70.777  39.686 84.035  1.00 40.02  ? 139  ASN B ND2 1 
ATOM   4151  N N   . LYS C  2  134 ? 73.094  42.251 83.422  1.00 35.68  ? 140  LYS B N   1 
ATOM   4152  C CA  . LYS C  2  134 ? 74.127  42.116 82.392  1.00 34.78  ? 140  LYS B CA  1 
ATOM   4153  C C   . LYS C  2  134 ? 74.645  43.456 81.882  1.00 34.17  ? 140  LYS B C   1 
ATOM   4154  O O   . LYS C  2  134 ? 75.561  43.500 81.069  1.00 34.15  ? 140  LYS B O   1 
ATOM   4155  C CB  . LYS C  2  134 ? 73.604  41.294 81.223  1.00 34.58  ? 140  LYS B CB  1 
ATOM   4156  C CG  . LYS C  2  134 ? 73.303  39.863 81.592  1.00 34.68  ? 140  LYS B CG  1 
ATOM   4157  C CD  . LYS C  2  134 ? 72.908  39.051 80.379  1.00 34.53  ? 140  LYS B CD  1 
ATOM   4158  C CE  . LYS C  2  134 ? 72.743  37.583 80.732  1.00 34.71  ? 140  LYS B CE  1 
ATOM   4159  N NZ  . LYS C  2  134 ? 72.207  36.772 79.598  1.00 34.53  ? 140  LYS B NZ  1 
ATOM   4160  N N   . GLN C  2  135 ? 74.060  44.548 82.360  1.00 33.59  ? 141  GLN B N   1 
ATOM   4161  C CA  . GLN C  2  135 ? 74.478  45.883 81.948  1.00 32.85  ? 141  GLN B CA  1 
ATOM   4162  C C   . GLN C  2  135 ? 74.508  46.020 80.427  1.00 32.08  ? 141  GLN B C   1 
ATOM   4163  O O   . GLN C  2  135 ? 75.292  46.800 79.883  1.00 32.41  ? 141  GLN B O   1 
ATOM   4164  C CB  . GLN C  2  135 ? 75.861  46.215 82.520  1.00 33.11  ? 141  GLN B CB  1 
ATOM   4165  C CG  . GLN C  2  135 ? 75.996  46.042 84.032  1.00 33.48  ? 141  GLN B CG  1 
ATOM   4166  C CD  . GLN C  2  135 ? 75.941  44.583 84.471  1.00 34.08  ? 141  GLN B CD  1 
ATOM   4167  O OE1 . GLN C  2  135 ? 76.700  43.750 83.972  1.00 33.39  ? 141  GLN B OE1 1 
ATOM   4168  N NE2 . GLN C  2  135 ? 75.040  44.275 85.401  1.00 33.23  ? 141  GLN B NE2 1 
ATOM   4169  N N   . LYS C  2  136 ? 73.660  45.261 79.740  1.00 30.94  ? 142  LYS B N   1 
ATOM   4170  C CA  . LYS C  2  136 ? 73.578  45.328 78.284  1.00 30.09  ? 142  LYS B CA  1 
ATOM   4171  C C   . LYS C  2  136 ? 72.120  45.508 77.886  1.00 29.13  ? 142  LYS B C   1 
ATOM   4172  O O   . LYS C  2  136 ? 71.221  45.237 78.672  1.00 28.76  ? 142  LYS B O   1 
ATOM   4173  C CB  . LYS C  2  136 ? 74.143  44.060 77.632  1.00 29.94  ? 142  LYS B CB  1 
ATOM   4174  C CG  . LYS C  2  136 ? 75.654  43.915 77.737  1.00 30.75  ? 142  LYS B CG  1 
ATOM   4175  C CD  . LYS C  2  136 ? 76.121  42.596 77.143  1.00 32.59  ? 142  LYS B CD  1 
ATOM   4176  C CE  . LYS C  2  136 ? 77.593  42.330 77.411  1.00 33.27  ? 142  LYS B CE  1 
ATOM   4177  N NZ  . LYS C  2  136 ? 78.445  43.417 76.870  1.00 33.34  ? 142  LYS B NZ  1 
ATOM   4178  N N   . ALA C  2  137 ? 71.890  45.968 76.663  1.00 28.12  ? 143  ALA B N   1 
ATOM   4179  C CA  . ALA C  2  137 ? 70.536  46.189 76.183  1.00 27.38  ? 143  ALA B CA  1 
ATOM   4180  C C   . ALA C  2  137 ? 70.367  45.667 74.766  1.00 26.85  ? 143  ALA B C   1 
ATOM   4181  O O   . ALA C  2  137 ? 71.038  46.132 73.846  1.00 27.05  ? 143  ALA B O   1 
ATOM   4182  C CB  . ALA C  2  137 ? 70.213  47.675 76.234  1.00 27.46  ? 143  ALA B CB  1 
ATOM   4183  N N   . THR C  2  138 ? 69.473  44.706 74.573  1.00 26.06  ? 144  THR B N   1 
ATOM   4184  C CA  . THR C  2  138 ? 69.238  44.204 73.226  1.00 25.58  ? 144  THR B CA  1 
ATOM   4185  C C   . THR C  2  138 ? 67.961  44.794 72.667  1.00 25.15  ? 144  THR B C   1 
ATOM   4186  O O   . THR C  2  138 ? 66.877  44.394 73.059  1.00 25.06  ? 144  THR B O   1 
ATOM   4187  C CB  . THR C  2  138 ? 69.096  42.672 73.172  1.00 25.61  ? 144  THR B CB  1 
ATOM   4188  O OG1 . THR C  2  138 ? 70.310  42.033 73.588  1.00 25.43  ? 144  THR B OG1 1 
ATOM   4189  C CG2 . THR C  2  138 ? 68.862  42.214 71.718  1.00 25.29  ? 144  THR B CG2 1 
ATOM   4190  N N   . LEU C  2  139 ? 68.081  45.748 71.755  1.00 24.83  ? 145  LEU B N   1 
ATOM   4191  C CA  . LEU C  2  139 ? 66.897  46.289 71.122  1.00 24.33  ? 145  LEU B CA  1 
ATOM   4192  C C   . LEU C  2  139 ? 66.634  45.304 70.013  1.00 24.84  ? 145  LEU B C   1 
ATOM   4193  O O   . LEU C  2  139 ? 67.575  44.783 69.425  1.00 24.95  ? 145  LEU B O   1 
ATOM   4194  C CB  . LEU C  2  139 ? 67.135  47.680 70.538  1.00 23.76  ? 145  LEU B CB  1 
ATOM   4195  C CG  . LEU C  2  139 ? 67.182  48.871 71.492  1.00 22.11  ? 145  LEU B CG  1 
ATOM   4196  C CD1 . LEU C  2  139 ? 68.541  48.942 72.146  1.00 21.70  ? 145  LEU B CD1 1 
ATOM   4197  C CD2 . LEU C  2  139 ? 66.901  50.161 70.729  1.00 21.85  ? 145  LEU B CD2 1 
ATOM   4198  N N   . VAL C  2  140 ? 65.373  45.031 69.717  1.00 25.35  ? 146  VAL B N   1 
ATOM   4199  C CA  . VAL C  2  140 ? 65.071  44.081 68.662  1.00 25.63  ? 146  VAL B CA  1 
ATOM   4200  C C   . VAL C  2  140 ? 64.124  44.637 67.605  1.00 25.71  ? 146  VAL B C   1 
ATOM   4201  O O   . VAL C  2  140 ? 62.997  45.031 67.900  1.00 25.78  ? 146  VAL B O   1 
ATOM   4202  C CB  . VAL C  2  140 ? 64.500  42.784 69.232  1.00 25.69  ? 146  VAL B CB  1 
ATOM   4203  C CG1 . VAL C  2  140 ? 63.512  43.090 70.336  1.00 26.99  ? 146  VAL B CG1 1 
ATOM   4204  C CG2 . VAL C  2  140 ? 63.844  41.973 68.129  1.00 26.03  ? 146  VAL B CG2 1 
ATOM   4205  N N   . CYS C  2  141 ? 64.600  44.660 66.364  1.00 25.58  ? 147  CYS B N   1 
ATOM   4206  C CA  . CYS C  2  141 ? 63.793  45.130 65.262  1.00 24.92  ? 147  CYS B CA  1 
ATOM   4207  C C   . CYS C  2  141 ? 63.201  43.959 64.530  1.00 25.40  ? 147  CYS B C   1 
ATOM   4208  O O   . CYS C  2  141 ? 63.899  43.020 64.156  1.00 25.22  ? 147  CYS B O   1 
ATOM   4209  C CB  . CYS C  2  141 ? 64.598  45.918 64.264  1.00 24.90  ? 147  CYS B CB  1 
ATOM   4210  S SG  . CYS C  2  141 ? 63.477  46.702 63.090  1.00 22.87  ? 147  CYS B SG  1 
ATOM   4211  N N   . LEU C  2  142 ? 61.905  44.046 64.298  1.00 25.75  ? 148  LEU B N   1 
ATOM   4212  C CA  . LEU C  2  142 ? 61.190  42.990 63.635  1.00 26.14  ? 148  LEU B CA  1 
ATOM   4213  C C   . LEU C  2  142 ? 60.387  43.568 62.475  1.00 26.09  ? 148  LEU B C   1 
ATOM   4214  O O   . LEU C  2  142 ? 59.680  44.568 62.630  1.00 26.51  ? 148  LEU B O   1 
ATOM   4215  C CB  . LEU C  2  142 ? 60.288  42.312 64.653  1.00 26.04  ? 148  LEU B CB  1 
ATOM   4216  C CG  . LEU C  2  142 ? 59.370  41.227 64.127  1.00 27.26  ? 148  LEU B CG  1 
ATOM   4217  C CD1 . LEU C  2  142 ? 60.157  40.189 63.324  1.00 28.45  ? 148  LEU B CD1 1 
ATOM   4218  C CD2 . LEU C  2  142 ? 58.664  40.595 65.306  1.00 27.04  ? 148  LEU B CD2 1 
ATOM   4219  N N   . ALA C  2  143 ? 60.520  42.955 61.306  1.00 25.83  ? 149  ALA B N   1 
ATOM   4220  C CA  . ALA C  2  143 ? 59.801  43.405 60.125  1.00 25.73  ? 149  ALA B CA  1 
ATOM   4221  C C   . ALA C  2  143 ? 58.875  42.297 59.674  1.00 25.91  ? 149  ALA B C   1 
ATOM   4222  O O   . ALA C  2  143 ? 59.324  41.194 59.363  1.00 25.82  ? 149  ALA B O   1 
ATOM   4223  C CB  . ALA C  2  143 ? 60.773  43.768 59.005  1.00 25.64  ? 149  ALA B CB  1 
ATOM   4224  N N   . ARG C  2  144 ? 57.586  42.598 59.627  1.00 26.39  ? 150  ARG B N   1 
ATOM   4225  C CA  . ARG C  2  144 ? 56.582  41.628 59.232  1.00 27.05  ? 150  ARG B CA  1 
ATOM   4226  C C   . ARG C  2  144 ? 55.736  42.155 58.086  1.00 27.54  ? 150  ARG B C   1 
ATOM   4227  O O   . ARG C  2  144 ? 55.714  43.359 57.834  1.00 27.97  ? 150  ARG B O   1 
ATOM   4228  C CB  . ARG C  2  144 ? 55.669  41.347 60.416  1.00 27.38  ? 150  ARG B CB  1 
ATOM   4229  C CG  . ARG C  2  144 ? 56.348  40.753 61.628  1.00 28.13  ? 150  ARG B CG  1 
ATOM   4230  C CD  . ARG C  2  144 ? 55.807  39.368 61.927  1.00 28.63  ? 150  ARG B CD  1 
ATOM   4231  N NE  . ARG C  2  144 ? 55.139  39.283 63.223  1.00 29.16  ? 150  ARG B NE  1 
ATOM   4232  C CZ  . ARG C  2  144 ? 54.200  38.393 63.524  1.00 29.49  ? 150  ARG B CZ  1 
ATOM   4233  N NH1 . ARG C  2  144 ? 53.789  37.516 62.617  1.00 29.34  ? 150  ARG B NH1 1 
ATOM   4234  N NH2 . ARG C  2  144 ? 53.664  38.378 64.737  1.00 30.25  ? 150  ARG B NH2 1 
ATOM   4235  N N   . GLY C  2  145 ? 55.052  41.251 57.384  1.00 27.69  ? 151  GLY B N   1 
ATOM   4236  C CA  . GLY C  2  145 ? 54.116  41.634 56.329  1.00 27.71  ? 151  GLY B CA  1 
ATOM   4237  C C   . GLY C  2  145 ? 54.536  41.949 54.905  1.00 27.91  ? 151  GLY B C   1 
ATOM   4238  O O   . GLY C  2  145 ? 53.664  42.116 54.062  1.00 28.12  ? 151  GLY B O   1 
ATOM   4239  N N   . PHE C  2  146 ? 55.826  42.048 54.611  1.00 27.75  ? 152  PHE B N   1 
ATOM   4240  C CA  . PHE C  2  146 ? 56.254  42.363 53.251  1.00 27.31  ? 152  PHE B CA  1 
ATOM   4241  C C   . PHE C  2  146 ? 56.257  41.093 52.423  1.00 27.69  ? 152  PHE B C   1 
ATOM   4242  O O   . PHE C  2  146 ? 56.470  40.014 52.969  1.00 28.36  ? 152  PHE B O   1 
ATOM   4243  C CB  . PHE C  2  146 ? 57.652  42.988 53.257  1.00 26.50  ? 152  PHE B CB  1 
ATOM   4244  C CG  . PHE C  2  146 ? 58.680  42.153 53.959  1.00 25.49  ? 152  PHE B CG  1 
ATOM   4245  C CD1 . PHE C  2  146 ? 59.432  41.212 53.261  1.00 25.03  ? 152  PHE B CD1 1 
ATOM   4246  C CD2 . PHE C  2  146 ? 58.896  42.294 55.320  1.00 23.79  ? 152  PHE B CD2 1 
ATOM   4247  C CE1 . PHE C  2  146 ? 60.391  40.438 53.910  1.00 23.11  ? 152  PHE B CE1 1 
ATOM   4248  C CE2 . PHE C  2  146 ? 59.839  41.514 55.971  1.00 23.80  ? 152  PHE B CE2 1 
ATOM   4249  C CZ  . PHE C  2  146 ? 60.591  40.585 55.260  1.00 23.02  ? 152  PHE B CZ  1 
ATOM   4250  N N   . PHE C  2  147 ? 56.012  41.195 51.119  1.00 27.59  ? 153  PHE B N   1 
ATOM   4251  C CA  . PHE C  2  147 ? 56.050  39.990 50.301  1.00 28.05  ? 153  PHE B CA  1 
ATOM   4252  C C   . PHE C  2  147 ? 57.360  39.889 49.528  1.00 28.37  ? 153  PHE B C   1 
ATOM   4253  O O   . PHE C  2  147 ? 58.382  39.549 50.132  1.00 28.88  ? 153  PHE B O   1 
ATOM   4254  C CB  . PHE C  2  147 ? 54.832  39.831 49.385  1.00 28.03  ? 153  PHE B CB  1 
ATOM   4255  C CG  . PHE C  2  147 ? 54.950  38.664 48.434  1.00 28.76  ? 153  PHE B CG  1 
ATOM   4256  C CD1 . PHE C  2  147 ? 55.574  37.483 48.830  1.00 28.66  ? 153  PHE B CD1 1 
ATOM   4257  C CD2 . PHE C  2  147 ? 54.465  38.754 47.135  1.00 29.38  ? 153  PHE B CD2 1 
ATOM   4258  C CE1 . PHE C  2  147 ? 55.703  36.421 47.957  1.00 28.79  ? 153  PHE B CE1 1 
ATOM   4259  C CE2 . PHE C  2  147 ? 54.591  37.685 46.254  1.00 29.46  ? 153  PHE B CE2 1 
ATOM   4260  C CZ  . PHE C  2  147 ? 55.211  36.520 46.665  1.00 29.37  ? 153  PHE B CZ  1 
ATOM   4261  N N   . PRO C  2  148 ? 57.430  40.312 48.271  1.00 27.91  ? 154  PRO B N   1 
ATOM   4262  C CA  . PRO C  2  148 ? 58.689  40.081 47.579  1.00 27.83  ? 154  PRO B CA  1 
ATOM   4263  C C   . PRO C  2  148 ? 59.797  40.473 48.576  1.00 27.72  ? 154  PRO B C   1 
ATOM   4264  O O   . PRO C  2  148 ? 59.945  41.651 48.907  1.00 27.83  ? 154  PRO B O   1 
ATOM   4265  C CB  . PRO C  2  148 ? 58.599  41.017 46.375  1.00 27.56  ? 154  PRO B CB  1 
ATOM   4266  C CG  . PRO C  2  148 ? 57.720  42.103 46.851  1.00 27.92  ? 154  PRO B CG  1 
ATOM   4267  C CD  . PRO C  2  148 ? 56.632  41.350 47.593  1.00 28.07  ? 154  PRO B CD  1 
ATOM   4268  N N   . ASP C  2  149 ? 60.529  39.470 49.064  1.00 27.37  ? 155  ASP B N   1 
ATOM   4269  C CA  . ASP C  2  149 ? 61.577  39.639 50.080  1.00 27.40  ? 155  ASP B CA  1 
ATOM   4270  C C   . ASP C  2  149 ? 62.826  40.419 49.667  1.00 26.46  ? 155  ASP B C   1 
ATOM   4271  O O   . ASP C  2  149 ? 63.948  39.996 49.951  1.00 26.30  ? 155  ASP B O   1 
ATOM   4272  C CB  . ASP C  2  149 ? 62.014  38.265 50.606  1.00 27.90  ? 155  ASP B CB  1 
ATOM   4273  C CG  . ASP C  2  149 ? 62.759  37.459 49.567  1.00 29.08  ? 155  ASP B CG  1 
ATOM   4274  O OD1 . ASP C  2  149 ? 63.607  36.617 49.933  1.00 30.21  ? 155  ASP B OD1 1 
ATOM   4275  O OD2 . ASP C  2  149 ? 62.542  37.618 48.350  1.00 31.92  ? 155  ASP B OD2 1 
ATOM   4276  N N   . HIS C  2  150 ? 62.645  41.561 49.020  1.00 25.40  ? 156  HIS B N   1 
ATOM   4277  C CA  . HIS C  2  150 ? 63.790  42.382 48.648  1.00 24.60  ? 156  HIS B CA  1 
ATOM   4278  C C   . HIS C  2  150 ? 63.865  43.522 49.652  1.00 24.32  ? 156  HIS B C   1 
ATOM   4279  O O   . HIS C  2  150 ? 63.444  44.635 49.366  1.00 24.70  ? 156  HIS B O   1 
ATOM   4280  C CB  . HIS C  2  150 ? 63.661  42.941 47.230  1.00 24.01  ? 156  HIS B CB  1 
ATOM   4281  C CG  . HIS C  2  150 ? 63.367  41.910 46.185  1.00 22.00  ? 156  HIS B CG  1 
ATOM   4282  N ND1 . HIS C  2  150 ? 63.561  42.142 44.841  1.00 21.44  ? 156  HIS B ND1 1 
ATOM   4283  C CD2 . HIS C  2  150 ? 62.852  40.661 46.277  1.00 21.13  ? 156  HIS B CD2 1 
ATOM   4284  C CE1 . HIS C  2  150 ? 63.191  41.078 44.152  1.00 20.70  ? 156  HIS B CE1 1 
ATOM   4285  N NE2 . HIS C  2  150 ? 62.753  40.166 44.999  1.00 19.92  ? 156  HIS B NE2 1 
ATOM   4286  N N   . VAL C  2  151 ? 64.391  43.230 50.835  1.00 23.89  ? 157  VAL B N   1 
ATOM   4287  C CA  . VAL C  2  151 ? 64.508  44.229 51.884  1.00 23.39  ? 157  VAL B CA  1 
ATOM   4288  C C   . VAL C  2  151 ? 65.909  44.304 52.484  1.00 23.42  ? 157  VAL B C   1 
ATOM   4289  O O   . VAL C  2  151 ? 66.665  43.334 52.459  1.00 22.95  ? 157  VAL B O   1 
ATOM   4290  C CB  . VAL C  2  151 ? 63.548  43.929 53.021  1.00 23.12  ? 157  VAL B CB  1 
ATOM   4291  C CG1 . VAL C  2  151 ? 62.119  44.086 52.556  1.00 23.36  ? 157  VAL B CG1 1 
ATOM   4292  C CG2 . VAL C  2  151 ? 63.796  42.541 53.543  1.00 21.81  ? 157  VAL B CG2 1 
ATOM   4293  N N   . GLU C  2  152 ? 66.241  45.471 53.023  1.00 23.31  ? 158  GLU B N   1 
ATOM   4294  C CA  . GLU C  2  152 ? 67.521  45.682 53.674  1.00 23.67  ? 158  GLU B CA  1 
ATOM   4295  C C   . GLU C  2  152 ? 67.251  46.335 55.018  1.00 22.72  ? 158  GLU B C   1 
ATOM   4296  O O   . GLU C  2  152 ? 66.673  47.411 55.081  1.00 22.50  ? 158  GLU B O   1 
ATOM   4297  C CB  . GLU C  2  152 ? 68.430  46.566 52.826  1.00 24.22  ? 158  GLU B CB  1 
ATOM   4298  C CG  . GLU C  2  152 ? 69.140  45.807 51.719  1.00 26.59  ? 158  GLU B CG  1 
ATOM   4299  C CD  . GLU C  2  152 ? 68.997  46.457 50.353  1.00 29.08  ? 158  GLU B CD  1 
ATOM   4300  O OE1 . GLU C  2  152 ? 69.286  45.769 49.349  1.00 30.59  ? 158  GLU B OE1 1 
ATOM   4301  O OE2 . GLU C  2  152 ? 68.599  47.644 50.274  1.00 30.41  ? 158  GLU B OE2 1 
ATOM   4302  N N   . LEU C  2  153 ? 67.670  45.669 56.086  1.00 21.96  ? 159  LEU B N   1 
ATOM   4303  C CA  . LEU C  2  153 ? 67.468  46.175 57.433  1.00 21.18  ? 159  LEU B CA  1 
ATOM   4304  C C   . LEU C  2  153 ? 68.734  46.889 57.869  1.00 20.43  ? 159  LEU B C   1 
ATOM   4305  O O   . LEU C  2  153 ? 69.832  46.350 57.747  1.00 20.60  ? 159  LEU B O   1 
ATOM   4306  C CB  . LEU C  2  153 ? 67.121  45.015 58.384  1.00 20.83  ? 159  LEU B CB  1 
ATOM   4307  C CG  . LEU C  2  153 ? 66.926  45.176 59.895  1.00 19.31  ? 159  LEU B CG  1 
ATOM   4308  C CD1 . LEU C  2  153 ? 67.129  46.586 60.369  1.00 19.67  ? 159  LEU B CD1 1 
ATOM   4309  C CD2 . LEU C  2  153 ? 65.544  44.677 60.267  1.00 18.11  ? 159  LEU B CD2 1 
ATOM   4310  N N   . SER C  2  154 ? 68.579  48.114 58.355  1.00 19.29  ? 160  SER B N   1 
ATOM   4311  C CA  . SER C  2  154 ? 69.714  48.870 58.868  1.00 18.77  ? 160  SER B CA  1 
ATOM   4312  C C   . SER C  2  154 ? 69.371  49.473 60.244  1.00 17.83  ? 160  SER B C   1 
ATOM   4313  O O   . SER C  2  154 ? 68.207  49.576 60.604  1.00 17.00  ? 160  SER B O   1 
ATOM   4314  C CB  . SER C  2  154 ? 70.101  49.968 57.879  1.00 18.63  ? 160  SER B CB  1 
ATOM   4315  O OG  . SER C  2  154 ? 69.059  50.912 57.739  1.00 18.94  ? 160  SER B OG  1 
ATOM   4316  N N   . TRP C  2  155 ? 70.392  49.856 61.005  1.00 17.65  ? 161  TRP B N   1 
ATOM   4317  C CA  . TRP C  2  155 ? 70.194  50.482 62.310  1.00 17.45  ? 161  TRP B CA  1 
ATOM   4318  C C   . TRP C  2  155 ? 70.813  51.874 62.324  1.00 17.44  ? 161  TRP B C   1 
ATOM   4319  O O   . TRP C  2  155 ? 71.912  52.069 61.811  1.00 17.65  ? 161  TRP B O   1 
ATOM   4320  C CB  . TRP C  2  155 ? 70.838  49.652 63.415  1.00 17.56  ? 161  TRP B CB  1 
ATOM   4321  C CG  . TRP C  2  155 ? 70.074  48.446 63.804  1.00 16.71  ? 161  TRP B CG  1 
ATOM   4322  C CD1 . TRP C  2  155 ? 70.253  47.179 63.339  1.00 16.56  ? 161  TRP B CD1 1 
ATOM   4323  C CD2 . TRP C  2  155 ? 69.029  48.375 64.774  1.00 16.47  ? 161  TRP B CD2 1 
ATOM   4324  N NE1 . TRP C  2  155 ? 69.375  46.323 63.956  1.00 15.93  ? 161  TRP B NE1 1 
ATOM   4325  C CE2 . TRP C  2  155 ? 68.610  47.035 64.842  1.00 16.07  ? 161  TRP B CE2 1 
ATOM   4326  C CE3 . TRP C  2  155 ? 68.397  49.317 65.598  1.00 15.52  ? 161  TRP B CE3 1 
ATOM   4327  C CZ2 . TRP C  2  155 ? 67.595  46.613 65.694  1.00 15.76  ? 161  TRP B CZ2 1 
ATOM   4328  C CZ3 . TRP C  2  155 ? 67.395  48.897 66.441  1.00 14.20  ? 161  TRP B CZ3 1 
ATOM   4329  C CH2 . TRP C  2  155 ? 67.004  47.556 66.486  1.00 14.80  ? 161  TRP B CH2 1 
ATOM   4330  N N   . TRP C  2  156 ? 70.108  52.838 62.910  1.00 17.48  ? 162  TRP B N   1 
ATOM   4331  C CA  . TRP C  2  156 ? 70.606  54.218 62.993  1.00 17.38  ? 162  TRP B CA  1 
ATOM   4332  C C   . TRP C  2  156 ? 70.554  54.754 64.412  1.00 17.18  ? 162  TRP B C   1 
ATOM   4333  O O   . TRP C  2  156 ? 69.484  54.844 65.011  1.00 17.52  ? 162  TRP B O   1 
ATOM   4334  C CB  . TRP C  2  156 ? 69.803  55.143 62.073  1.00 17.21  ? 162  TRP B CB  1 
ATOM   4335  C CG  . TRP C  2  156 ? 69.880  54.723 60.657  1.00 16.45  ? 162  TRP B CG  1 
ATOM   4336  C CD1 . TRP C  2  156 ? 69.307  53.628 60.113  1.00 15.17  ? 162  TRP B CD1 1 
ATOM   4337  C CD2 . TRP C  2  156 ? 70.608  55.366 59.604  1.00 16.18  ? 162  TRP B CD2 1 
ATOM   4338  N NE1 . TRP C  2  156 ? 69.619  53.546 58.782  1.00 16.15  ? 162  TRP B NE1 1 
ATOM   4339  C CE2 . TRP C  2  156 ? 70.420  54.604 58.444  1.00 16.48  ? 162  TRP B CE2 1 
ATOM   4340  C CE3 . TRP C  2  156 ? 71.393  56.523 59.523  1.00 17.24  ? 162  TRP B CE3 1 
ATOM   4341  C CZ2 . TRP C  2  156 ? 70.990  54.952 57.211  1.00 17.08  ? 162  TRP B CZ2 1 
ATOM   4342  C CZ3 . TRP C  2  156 ? 71.960  56.869 58.297  1.00 16.15  ? 162  TRP B CZ3 1 
ATOM   4343  C CH2 . TRP C  2  156 ? 71.756  56.085 57.164  1.00 16.43  ? 162  TRP B CH2 1 
ATOM   4344  N N   . VAL C  2  157 ? 71.720  55.119 64.934  1.00 17.09  ? 163  VAL B N   1 
ATOM   4345  C CA  . VAL C  2  157 ? 71.849  55.643 66.286  1.00 16.60  ? 163  VAL B CA  1 
ATOM   4346  C C   . VAL C  2  157 ? 72.282  57.106 66.213  1.00 17.36  ? 163  VAL B C   1 
ATOM   4347  O O   . VAL C  2  157 ? 73.324  57.436 65.644  1.00 17.40  ? 163  VAL B O   1 
ATOM   4348  C CB  . VAL C  2  157 ? 72.858  54.801 67.094  1.00 16.23  ? 163  VAL B CB  1 
ATOM   4349  C CG1 . VAL C  2  157 ? 73.141  55.433 68.450  1.00 14.87  ? 163  VAL B CG1 1 
ATOM   4350  C CG2 . VAL C  2  157 ? 72.313  53.384 67.281  1.00 15.44  ? 163  VAL B CG2 1 
ATOM   4351  N N   . ASN C  2  158 ? 71.460  57.983 66.780  1.00 18.29  ? 164  ASN B N   1 
ATOM   4352  C CA  . ASN C  2  158 ? 71.738  59.406 66.752  1.00 18.62  ? 164  ASN B CA  1 
ATOM   4353  C C   . ASN C  2  158 ? 72.106  59.816 65.336  1.00 19.42  ? 164  ASN B C   1 
ATOM   4354  O O   . ASN C  2  158 ? 73.171  60.374 65.090  1.00 19.39  ? 164  ASN B O   1 
ATOM   4355  C CB  . ASN C  2  158 ? 72.850  59.734 67.741  1.00 18.50  ? 164  ASN B CB  1 
ATOM   4356  C CG  . ASN C  2  158 ? 72.443  59.446 69.166  1.00 18.00  ? 164  ASN B CG  1 
ATOM   4357  O OD1 . ASN C  2  158 ? 71.273  59.197 69.437  1.00 19.68  ? 164  ASN B OD1 1 
ATOM   4358  N ND2 . ASN C  2  158 ? 73.397  59.469 70.081  1.00 17.03  ? 164  ASN B ND2 1 
ATOM   4359  N N   . GLY C  2  159 ? 71.218  59.498 64.401  1.00 20.76  ? 165  GLY B N   1 
ATOM   4360  C CA  . GLY C  2  159 ? 71.409  59.837 62.999  1.00 21.88  ? 165  GLY B CA  1 
ATOM   4361  C C   . GLY C  2  159 ? 72.434  59.103 62.143  1.00 22.91  ? 165  GLY B C   1 
ATOM   4362  O O   . GLY C  2  159 ? 72.402  59.277 60.929  1.00 23.49  ? 165  GLY B O   1 
ATOM   4363  N N   . LYS C  2  160 ? 73.338  58.314 62.734  1.00 24.13  ? 166  LYS B N   1 
ATOM   4364  C CA  . LYS C  2  160 ? 74.371  57.591 61.962  1.00 24.64  ? 166  LYS B CA  1 
ATOM   4365  C C   . LYS C  2  160 ? 74.193  56.067 61.927  1.00 24.46  ? 166  LYS B C   1 
ATOM   4366  O O   . LYS C  2  160 ? 73.904  55.447 62.942  1.00 24.14  ? 166  LYS B O   1 
ATOM   4367  C CB  . LYS C  2  160 ? 75.769  57.901 62.515  1.00 25.16  ? 166  LYS B CB  1 
ATOM   4368  C CG  . LYS C  2  160 ? 76.452  59.122 61.906  1.00 27.40  ? 166  LYS B CG  1 
ATOM   4369  C CD  . LYS C  2  160 ? 75.628  60.399 62.071  1.00 30.30  ? 166  LYS B CD  1 
ATOM   4370  C CE  . LYS C  2  160 ? 76.220  61.559 61.280  1.00 31.25  ? 166  LYS B CE  1 
ATOM   4371  N NZ  . LYS C  2  160 ? 76.331  61.240 59.824  1.00 32.67  ? 166  LYS B NZ  1 
ATOM   4372  N N   . GLU C  2  161 ? 74.399  55.456 60.764  1.00 24.42  ? 167  GLU B N   1 
ATOM   4373  C CA  . GLU C  2  161 ? 74.259  54.010 60.671  1.00 24.61  ? 167  GLU B CA  1 
ATOM   4374  C C   . GLU C  2  161 ? 75.291  53.334 61.573  1.00 25.25  ? 167  GLU B C   1 
ATOM   4375  O O   . GLU C  2  161 ? 76.459  53.712 61.587  1.00 25.31  ? 167  GLU B O   1 
ATOM   4376  C CB  . GLU C  2  161 ? 74.414  53.508 59.234  1.00 24.02  ? 167  GLU B CB  1 
ATOM   4377  C CG  . GLU C  2  161 ? 73.702  52.177 59.035  1.00 23.60  ? 167  GLU B CG  1 
ATOM   4378  C CD  . GLU C  2  161 ? 73.826  51.578 57.641  1.00 23.08  ? 167  GLU B CD  1 
ATOM   4379  O OE1 . GLU C  2  161 ? 74.012  52.317 56.651  1.00 22.49  ? 167  GLU B OE1 1 
ATOM   4380  O OE2 . GLU C  2  161 ? 73.707  50.340 57.539  1.00 22.59  ? 167  GLU B OE2 1 
ATOM   4381  N N   . VAL C  2  162 ? 74.856  52.328 62.322  1.00 25.93  ? 168  VAL B N   1 
ATOM   4382  C CA  . VAL C  2  162 ? 75.753  51.611 63.218  1.00 26.28  ? 168  VAL B CA  1 
ATOM   4383  C C   . VAL C  2  162 ? 75.887  50.171 62.727  1.00 26.24  ? 168  VAL B C   1 
ATOM   4384  O O   . VAL C  2  162 ? 74.960  49.626 62.120  1.00 26.27  ? 168  VAL B O   1 
ATOM   4385  C CB  . VAL C  2  162 ? 75.226  51.649 64.668  1.00 26.40  ? 168  VAL B CB  1 
ATOM   4386  C CG1 . VAL C  2  162 ? 73.926  50.879 64.777  1.00 26.52  ? 168  VAL B CG1 1 
ATOM   4387  C CG2 . VAL C  2  162 ? 76.250  51.095 65.623  1.00 27.89  ? 168  VAL B CG2 1 
ATOM   4388  N N   . HIS C  2  163 ? 77.041  49.557 62.975  1.00 26.00  ? 169  HIS B N   1 
ATOM   4389  C CA  . HIS C  2  163 ? 77.284  48.184 62.539  1.00 25.32  ? 169  HIS B CA  1 
ATOM   4390  C C   . HIS C  2  163 ? 77.645  47.295 63.721  1.00 24.38  ? 169  HIS B C   1 
ATOM   4391  O O   . HIS C  2  163 ? 77.162  46.165 63.844  1.00 24.16  ? 169  HIS B O   1 
ATOM   4392  C CB  . HIS C  2  163 ? 78.394  48.158 61.484  1.00 25.63  ? 169  HIS B CB  1 
ATOM   4393  C CG  . HIS C  2  163 ? 78.024  48.866 60.220  1.00 26.75  ? 169  HIS B CG  1 
ATOM   4394  N ND1 . HIS C  2  163 ? 77.060  48.389 59.356  1.00 28.16  ? 169  HIS B ND1 1 
ATOM   4395  C CD2 . HIS C  2  163 ? 78.453  50.037 59.692  1.00 26.74  ? 169  HIS B CD2 1 
ATOM   4396  C CE1 . HIS C  2  163 ? 76.918  49.231 58.348  1.00 26.73  ? 169  HIS B CE1 1 
ATOM   4397  N NE2 . HIS C  2  163 ? 77.753  50.238 58.527  1.00 25.80  ? 169  HIS B NE2 1 
ATOM   4398  N N   . SER C  2  164 ? 78.512  47.810 64.578  1.00 23.19  ? 170  SER B N   1 
ATOM   4399  C CA  . SER C  2  164 ? 78.921  47.097 65.772  1.00 22.80  ? 170  SER B CA  1 
ATOM   4400  C C   . SER C  2  164 ? 77.711  46.865 66.659  1.00 21.76  ? 170  SER B C   1 
ATOM   4401  O O   . SER C  2  164 ? 76.913  47.766 66.858  1.00 21.96  ? 170  SER B O   1 
ATOM   4402  C CB  . SER C  2  164 ? 79.951  47.914 66.538  1.00 22.84  ? 170  SER B CB  1 
ATOM   4403  O OG  . SER C  2  164 ? 79.903  47.604 67.922  1.00 25.03  ? 170  SER B OG  1 
ATOM   4404  N N   . GLY C  2  165 ? 77.563  45.652 67.172  1.00 20.96  ? 171  GLY B N   1 
ATOM   4405  C CA  . GLY C  2  165 ? 76.444  45.337 68.039  1.00 20.59  ? 171  GLY B CA  1 
ATOM   4406  C C   . GLY C  2  165 ? 75.176  45.007 67.274  1.00 20.07  ? 171  GLY B C   1 
ATOM   4407  O O   . GLY C  2  165 ? 74.094  44.924 67.862  1.00 20.27  ? 171  GLY B O   1 
ATOM   4408  N N   . VAL C  2  166 ? 75.317  44.812 65.965  1.00 19.30  ? 172  VAL B N   1 
ATOM   4409  C CA  . VAL C  2  166 ? 74.201  44.502 65.078  1.00 18.46  ? 172  VAL B CA  1 
ATOM   4410  C C   . VAL C  2  166 ? 74.316  43.108 64.449  1.00 19.11  ? 172  VAL B C   1 
ATOM   4411  O O   . VAL C  2  166 ? 75.369  42.731 63.930  1.00 18.53  ? 172  VAL B O   1 
ATOM   4412  C CB  . VAL C  2  166 ? 74.127  45.511 63.937  1.00 17.62  ? 172  VAL B CB  1 
ATOM   4413  C CG1 . VAL C  2  166 ? 72.995  45.149 62.980  1.00 16.68  ? 172  VAL B CG1 1 
ATOM   4414  C CG2 . VAL C  2  166 ? 73.961  46.910 64.490  1.00 17.06  ? 172  VAL B CG2 1 
ATOM   4415  N N   . SER C  2  167 ? 73.205  42.370 64.479  1.00 19.66  ? 173  SER B N   1 
ATOM   4416  C CA  . SER C  2  167 ? 73.117  41.033 63.916  1.00 20.09  ? 173  SER B CA  1 
ATOM   4417  C C   . SER C  2  167 ? 71.742  40.899 63.297  1.00 20.82  ? 173  SER B C   1 
ATOM   4418  O O   . SER C  2  167 ? 70.735  40.919 63.994  1.00 21.45  ? 173  SER B O   1 
ATOM   4419  C CB  . SER C  2  167 ? 73.310  39.970 64.993  1.00 20.18  ? 173  SER B CB  1 
ATOM   4420  O OG  . SER C  2  167 ? 73.018  38.678 64.489  1.00 19.62  ? 173  SER B OG  1 
ATOM   4421  N N   . THR C  2  168 ? 71.704  40.753 61.981  1.00 21.75  ? 174  THR B N   1 
ATOM   4422  C CA  . THR C  2  168 ? 70.451  40.677 61.246  1.00 22.12  ? 174  THR B CA  1 
ATOM   4423  C C   . THR C  2  168 ? 70.291  39.329 60.557  1.00 23.39  ? 174  THR B C   1 
ATOM   4424  O O   . THR C  2  168 ? 71.230  38.849 59.923  1.00 23.94  ? 174  THR B O   1 
ATOM   4425  C CB  . THR C  2  168 ? 70.444  41.800 60.197  1.00 21.49  ? 174  THR B CB  1 
ATOM   4426  O OG1 . THR C  2  168 ? 70.563  43.063 60.857  1.00 20.48  ? 174  THR B OG1 1 
ATOM   4427  C CG2 . THR C  2  168 ? 69.143  41.846 59.413  1.00 20.92  ? 174  THR B CG2 1 
ATOM   4428  N N   . ASP C  2  169 ? 69.107  38.725 60.677  1.00 24.84  ? 175  ASP B N   1 
ATOM   4429  C CA  . ASP C  2  169 ? 68.829  37.447 60.024  1.00 25.89  ? 175  ASP B CA  1 
ATOM   4430  C C   . ASP C  2  169 ? 69.422  37.555 58.641  1.00 27.19  ? 175  ASP B C   1 
ATOM   4431  O O   . ASP C  2  169 ? 69.329  38.616 58.025  1.00 27.09  ? 175  ASP B O   1 
ATOM   4432  C CB  . ASP C  2  169 ? 67.323  37.194 59.876  1.00 25.54  ? 175  ASP B CB  1 
ATOM   4433  C CG  . ASP C  2  169 ? 66.615  37.023 61.198  1.00 25.99  ? 175  ASP B CG  1 
ATOM   4434  O OD1 . ASP C  2  169 ? 67.221  36.480 62.152  1.00 27.11  ? 175  ASP B OD1 1 
ATOM   4435  O OD2 . ASP C  2  169 ? 65.432  37.402 61.349  1.00 25.85  ? 175  ASP B OD2 1 
ATOM   4436  N N   . PRO C  2  170 ? 70.080  36.513 58.140  1.00 28.85  ? 176  PRO B N   1 
ATOM   4437  C CA  . PRO C  2  170 ? 70.622  36.640 56.790  1.00 30.07  ? 176  PRO B CA  1 
ATOM   4438  C C   . PRO C  2  170 ? 69.508  36.615 55.754  1.00 31.55  ? 176  PRO B C   1 
ATOM   4439  O O   . PRO C  2  170 ? 69.342  37.582 55.016  1.00 32.45  ? 176  PRO B O   1 
ATOM   4440  C CB  . PRO C  2  170 ? 71.554  35.431 56.670  1.00 29.68  ? 176  PRO B CB  1 
ATOM   4441  C CG  . PRO C  2  170 ? 70.938  34.422 57.561  1.00 29.33  ? 176  PRO B CG  1 
ATOM   4442  C CD  . PRO C  2  170 ? 70.496  35.242 58.765  1.00 28.84  ? 176  PRO B CD  1 
ATOM   4443  N N   . GLN C  2  171 ? 68.749  35.525 55.724  1.00 33.06  ? 177  GLN B N   1 
ATOM   4444  C CA  . GLN C  2  171 ? 67.653  35.350 54.783  1.00 34.24  ? 177  GLN B CA  1 
ATOM   4445  C C   . GLN C  2  171 ? 66.333  35.743 55.430  1.00 34.94  ? 177  GLN B C   1 
ATOM   4446  O O   . GLN C  2  171 ? 66.166  35.652 56.647  1.00 34.30  ? 177  GLN B O   1 
ATOM   4447  C CB  . GLN C  2  171 ? 67.591  33.886 54.346  1.00 34.90  ? 177  GLN B CB  1 
ATOM   4448  C CG  . GLN C  2  171 ? 66.604  33.577 53.229  1.00 36.68  ? 177  GLN B CG  1 
ATOM   4449  C CD  . GLN C  2  171 ? 66.931  34.300 51.935  1.00 38.30  ? 177  GLN B CD  1 
ATOM   4450  O OE1 . GLN C  2  171 ? 68.104  34.452 51.574  1.00 39.25  ? 177  GLN B OE1 1 
ATOM   4451  N NE2 . GLN C  2  171 ? 65.895  34.742 51.230  1.00 39.12  ? 177  GLN B NE2 1 
ATOM   4452  N N   . ALA C  2  172 ? 65.392  36.201 54.620  1.00 36.03  ? 178  ALA B N   1 
ATOM   4453  C CA  . ALA C  2  172 ? 64.096  36.564 55.155  1.00 37.26  ? 178  ALA B CA  1 
ATOM   4454  C C   . ALA C  2  172 ? 63.341  35.265 55.359  1.00 38.29  ? 178  ALA B C   1 
ATOM   4455  O O   . ALA C  2  172 ? 63.567  34.302 54.638  1.00 38.47  ? 178  ALA B O   1 
ATOM   4456  C CB  . ALA C  2  172 ? 63.358  37.468 54.204  1.00 37.31  ? 178  ALA B CB  1 
ATOM   4457  N N   . TYR C  2  173 ? 62.463  35.228 56.353  1.00 39.69  ? 179  TYR B N   1 
ATOM   4458  C CA  . TYR C  2  173 ? 61.679  34.030 56.618  1.00 40.80  ? 179  TYR B CA  1 
ATOM   4459  C C   . TYR C  2  173 ? 60.298  34.192 56.011  1.00 41.68  ? 179  TYR B C   1 
ATOM   4460  O O   . TYR C  2  173 ? 59.924  35.282 55.589  1.00 41.76  ? 179  TYR B O   1 
ATOM   4461  C CB  . TYR C  2  173 ? 61.565  33.778 58.118  1.00 40.98  ? 179  TYR B CB  1 
ATOM   4462  C CG  . TYR C  2  173 ? 62.876  33.402 58.779  1.00 41.70  ? 179  TYR B CG  1 
ATOM   4463  C CD1 . TYR C  2  173 ? 63.718  34.375 59.297  1.00 42.12  ? 179  TYR B CD1 1 
ATOM   4464  C CD2 . TYR C  2  173 ? 63.271  32.074 58.882  1.00 42.25  ? 179  TYR B CD2 1 
ATOM   4465  C CE1 . TYR C  2  173 ? 64.918  34.038 59.901  1.00 42.19  ? 179  TYR B CE1 1 
ATOM   4466  C CE2 . TYR C  2  173 ? 64.467  31.728 59.488  1.00 42.06  ? 179  TYR B CE2 1 
ATOM   4467  C CZ  . TYR C  2  173 ? 65.286  32.714 59.995  1.00 42.05  ? 179  TYR B CZ  1 
ATOM   4468  O OH  . TYR C  2  173 ? 66.475  32.382 60.605  1.00 41.50  ? 179  TYR B OH  1 
ATOM   4469  N N   . LYS C  2  174 ? 59.539  33.105 55.982  1.00 42.78  ? 180  LYS B N   1 
ATOM   4470  C CA  . LYS C  2  174 ? 58.205  33.124 55.410  1.00 43.86  ? 180  LYS B CA  1 
ATOM   4471  C C   . LYS C  2  174 ? 57.169  32.708 56.450  1.00 44.34  ? 180  LYS B C   1 
ATOM   4472  O O   . LYS C  2  174 ? 57.172  31.569 56.915  1.00 44.55  ? 180  LYS B O   1 
ATOM   4473  C CB  . LYS C  2  174 ? 58.154  32.183 54.206  1.00 43.97  ? 180  LYS B CB  1 
ATOM   4474  C CG  . LYS C  2  174 ? 57.069  32.500 53.195  1.00 45.27  ? 180  LYS B CG  1 
ATOM   4475  C CD  . LYS C  2  174 ? 57.256  31.665 51.933  1.00 46.81  ? 180  LYS B CD  1 
ATOM   4476  C CE  . LYS C  2  174 ? 56.285  32.054 50.826  1.00 47.52  ? 180  LYS B CE  1 
ATOM   4477  N NZ  . LYS C  2  174 ? 56.291  31.071 49.696  1.00 48.11  ? 180  LYS B NZ  1 
ATOM   4478  N N   . GLU C  2  175 ? 56.286  33.631 56.815  1.00 44.82  ? 181  GLU B N   1 
ATOM   4479  C CA  . GLU C  2  175 ? 55.245  33.331 57.786  1.00 45.40  ? 181  GLU B CA  1 
ATOM   4480  C C   . GLU C  2  175 ? 54.100  32.656 57.048  1.00 45.61  ? 181  GLU B C   1 
ATOM   4481  O O   . GLU C  2  175 ? 53.912  31.447 57.144  1.00 45.55  ? 181  GLU B O   1 
ATOM   4482  C CB  . GLU C  2  175 ? 54.741  34.601 58.455  1.00 45.51  ? 181  GLU B CB  1 
ATOM   4483  C CG  . GLU C  2  175 ? 55.800  35.657 58.649  1.00 45.88  ? 181  GLU B CG  1 
ATOM   4484  C CD  . GLU C  2  175 ? 55.237  36.890 59.311  1.00 46.38  ? 181  GLU B CD  1 
ATOM   4485  O OE1 . GLU C  2  175 ? 55.000  36.834 60.535  1.00 46.67  ? 181  GLU B OE1 1 
ATOM   4486  O OE2 . GLU C  2  175 ? 55.020  37.900 58.606  1.00 46.34  ? 181  GLU B OE2 1 
ATOM   4487  N N   . SER C  2  176 ? 53.335  33.450 56.307  1.00 46.06  ? 182  SER B N   1 
ATOM   4488  C CA  . SER C  2  176 ? 52.239  32.911 55.523  1.00 46.36  ? 182  SER B CA  1 
ATOM   4489  C C   . SER C  2  176 ? 52.825  32.551 54.170  1.00 46.38  ? 182  SER B C   1 
ATOM   4490  O O   . SER C  2  176 ? 54.018  32.266 54.062  1.00 46.59  ? 182  SER B O   1 
ATOM   4491  C CB  . SER C  2  176 ? 51.094  33.924 55.378  1.00 46.31  ? 182  SER B CB  1 
ATOM   4492  O OG  . SER C  2  176 ? 51.339  34.845 54.329  1.00 46.60  ? 182  SER B OG  1 
ATOM   4493  N N   . ASN C  2  177 ? 52.011  32.628 53.068  1.00 46.70  ? 186  ASN B N   1 
ATOM   4494  C CA  . ASN C  2  177 ? 52.487  32.245 51.749  1.00 46.58  ? 186  ASN B CA  1 
ATOM   4495  C C   . ASN C  2  177 ? 52.873  33.444 50.893  1.00 46.07  ? 186  ASN B C   1 
ATOM   4496  O O   . ASN C  2  177 ? 53.551  33.292 49.880  1.00 45.92  ? 186  ASN B O   1 
ATOM   4497  C CB  . ASN C  2  177 ? 51.421  31.423 51.037  1.00 46.93  ? 186  ASN B CB  1 
ATOM   4498  C CG  . ASN C  2  177 ? 51.991  30.602 49.910  1.00 47.65  ? 186  ASN B CG  1 
ATOM   4499  O OD1 . ASN C  2  177 ? 52.833  29.730 50.126  1.00 48.39  ? 186  ASN B OD1 1 
ATOM   4500  N ND2 . ASN C  2  177 ? 51.545  30.883 48.691  1.00 49.00  ? 186  ASN B ND2 1 
ATOM   4501  N N   . TYR C  2  178 ? 52.424  34.630 51.292  1.00 45.59  ? 187  TYR B N   1 
ATOM   4502  C CA  . TYR C  2  178 ? 52.752  35.862 50.579  1.00 45.26  ? 187  TYR B CA  1 
ATOM   4503  C C   . TYR C  2  178 ? 53.190  36.886 51.595  1.00 44.80  ? 187  TYR B C   1 
ATOM   4504  O O   . TYR C  2  178 ? 52.900  38.065 51.458  1.00 44.67  ? 187  TYR B O   1 
ATOM   4505  C CB  . TYR C  2  178 ? 51.550  36.425 49.811  1.00 45.39  ? 187  TYR B CB  1 
ATOM   4506  C CG  . TYR C  2  178 ? 50.921  35.443 48.857  1.00 45.72  ? 187  TYR B CG  1 
ATOM   4507  C CD1 . TYR C  2  178 ? 49.910  34.593 49.280  1.00 45.85  ? 187  TYR B CD1 1 
ATOM   4508  C CD2 . TYR C  2  178 ? 51.353  35.351 47.541  1.00 45.59  ? 187  TYR B CD2 1 
ATOM   4509  C CE1 . TYR C  2  178 ? 49.348  33.675 48.418  1.00 46.14  ? 187  TYR B CE1 1 
ATOM   4510  C CE2 . TYR C  2  178 ? 50.800  34.438 46.673  1.00 45.66  ? 187  TYR B CE2 1 
ATOM   4511  C CZ  . TYR C  2  178 ? 49.798  33.603 47.114  1.00 46.05  ? 187  TYR B CZ  1 
ATOM   4512  O OH  . TYR C  2  178 ? 49.246  32.689 46.249  1.00 46.73  ? 187  TYR B OH  1 
ATOM   4513  N N   . SER C  2  179 ? 53.829  36.387 52.697  1.00 36.62  ? 189  SER B N   1 
ATOM   4514  C CA  . SER C  2  179 ? 54.258  37.286 53.757  1.00 36.28  ? 189  SER B CA  1 
ATOM   4515  C C   . SER C  2  179 ? 55.598  36.828 54.308  1.00 35.78  ? 189  SER B C   1 
ATOM   4516  O O   . SER C  2  179 ? 55.751  35.669 54.684  1.00 36.16  ? 189  SER B O   1 
ATOM   4517  C CB  . SER C  2  179 ? 53.209  37.304 54.868  1.00 36.27  ? 189  SER B CB  1 
ATOM   4518  O OG  . SER C  2  179 ? 53.657  38.045 55.986  1.00 36.29  ? 189  SER B OG  1 
ATOM   4519  N N   . TYR C  2  180 ? 56.568  37.737 54.346  1.00 35.07  ? 190  TYR B N   1 
ATOM   4520  C CA  . TYR C  2  180 ? 57.894  37.431 54.876  1.00 34.47  ? 190  TYR B CA  1 
ATOM   4521  C C   . TYR C  2  180 ? 58.169  38.237 56.145  1.00 33.58  ? 190  TYR B C   1 
ATOM   4522  O O   . TYR C  2  180 ? 57.621  39.319 56.319  1.00 33.63  ? 190  TYR B O   1 
ATOM   4523  C CB  . TYR C  2  180 ? 58.975  37.754 53.847  1.00 34.50  ? 190  TYR B CB  1 
ATOM   4524  C CG  . TYR C  2  180 ? 59.146  36.749 52.739  1.00 35.08  ? 190  TYR B CG  1 
ATOM   4525  C CD1 . TYR C  2  180 ? 58.352  36.793 51.602  1.00 35.77  ? 190  TYR B CD1 1 
ATOM   4526  C CD2 . TYR C  2  180 ? 60.128  35.772 52.813  1.00 35.88  ? 190  TYR B CD2 1 
ATOM   4527  C CE1 . TYR C  2  180 ? 58.526  35.876 50.574  1.00 36.46  ? 190  TYR B CE1 1 
ATOM   4528  C CE2 . TYR C  2  180 ? 60.307  34.851 51.797  1.00 36.05  ? 190  TYR B CE2 1 
ATOM   4529  C CZ  . TYR C  2  180 ? 59.506  34.907 50.679  1.00 36.40  ? 190  TYR B CZ  1 
ATOM   4530  O OH  . TYR C  2  180 ? 59.691  33.995 49.663  1.00 37.35  ? 190  TYR B OH  1 
ATOM   4531  N N   . CYS C  2  181 ? 59.015  37.700 57.022  1.00 32.85  ? 191  CYS B N   1 
ATOM   4532  C CA  . CYS C  2  181 ? 59.395  38.375 58.263  1.00 32.21  ? 191  CYS B CA  1 
ATOM   4533  C C   . CYS C  2  181 ? 60.902  38.334 58.377  1.00 30.89  ? 191  CYS B C   1 
ATOM   4534  O O   . CYS C  2  181 ? 61.535  37.424 57.856  1.00 30.92  ? 191  CYS B O   1 
ATOM   4535  C CB  . CYS C  2  181 ? 58.747  37.728 59.501  1.00 32.58  ? 191  CYS B CB  1 
ATOM   4536  S SG  . CYS C  2  181 ? 59.427  36.146 60.075  1.00 34.42  ? 191  CYS B SG  1 
ATOM   4537  N N   . LEU C  2  182 ? 61.469  39.333 59.047  1.00 29.72  ? 192  LEU B N   1 
ATOM   4538  C CA  . LEU C  2  182 ? 62.912  39.461 59.226  1.00 28.39  ? 192  LEU B CA  1 
ATOM   4539  C C   . LEU C  2  182 ? 63.140  40.221 60.525  1.00 27.45  ? 192  LEU B C   1 
ATOM   4540  O O   . LEU C  2  182 ? 62.435  41.185 60.802  1.00 27.65  ? 192  LEU B O   1 
ATOM   4541  C CB  . LEU C  2  182 ? 63.516  40.257 58.066  1.00 28.20  ? 192  LEU B CB  1 
ATOM   4542  C CG  . LEU C  2  182 ? 65.034  40.479 58.055  1.00 27.89  ? 192  LEU B CG  1 
ATOM   4543  C CD1 . LEU C  2  182 ? 65.727  39.314 57.396  1.00 26.88  ? 192  LEU B CD1 1 
ATOM   4544  C CD2 . LEU C  2  182 ? 65.370  41.749 57.303  1.00 28.32  ? 192  LEU B CD2 1 
ATOM   4545  N N   . SER C  2  183 ? 64.113  39.804 61.323  1.00 26.32  ? 193  SER B N   1 
ATOM   4546  C CA  . SER C  2  183 ? 64.374  40.492 62.578  1.00 25.69  ? 193  SER B CA  1 
ATOM   4547  C C   . SER C  2  183 ? 65.838  40.845 62.729  1.00 24.67  ? 193  SER B C   1 
ATOM   4548  O O   . SER C  2  183 ? 66.700  40.327 62.018  1.00 24.82  ? 193  SER B O   1 
ATOM   4549  C CB  . SER C  2  183 ? 63.965  39.638 63.768  1.00 26.15  ? 193  SER B CB  1 
ATOM   4550  O OG  . SER C  2  183 ? 64.984  38.702 64.074  1.00 27.60  ? 193  SER B OG  1 
ATOM   4551  N N   . SER C  2  184 ? 66.105  41.736 63.670  1.00 23.01  ? 194  SER B N   1 
ATOM   4552  C CA  . SER C  2  184 ? 67.460  42.153 63.935  1.00 22.08  ? 194  SER B CA  1 
ATOM   4553  C C   . SER C  2  184 ? 67.630  42.605 65.376  1.00 22.33  ? 194  SER B C   1 
ATOM   4554  O O   . SER C  2  184 ? 66.680  43.066 66.026  1.00 21.56  ? 194  SER B O   1 
ATOM   4555  C CB  . SER C  2  184 ? 67.875  43.280 63.002  1.00 21.31  ? 194  SER B CB  1 
ATOM   4556  O OG  . SER C  2  184 ? 69.178  43.715 63.348  1.00 18.53  ? 194  SER B OG  1 
ATOM   4557  N N   . ARG C  2  185 ? 68.863  42.470 65.854  1.00 22.30  ? 195  ARG B N   1 
ATOM   4558  C CA  . ARG C  2  185 ? 69.220  42.850 67.204  1.00 22.34  ? 195  ARG B CA  1 
ATOM   4559  C C   . ARG C  2  185 ? 70.213  43.982 67.146  1.00 22.38  ? 195  ARG B C   1 
ATOM   4560  O O   . ARG C  2  185 ? 70.958  44.136 66.176  1.00 22.05  ? 195  ARG B O   1 
ATOM   4561  C CB  . ARG C  2  185 ? 69.870  41.676 67.935  1.00 22.48  ? 195  ARG B CB  1 
ATOM   4562  C CG  . ARG C  2  185 ? 68.941  40.544 68.304  1.00 23.13  ? 195  ARG B CG  1 
ATOM   4563  C CD  . ARG C  2  185 ? 69.658  39.203 68.391  1.00 22.99  ? 195  ARG B CD  1 
ATOM   4564  N NE  . ARG C  2  185 ? 70.880  39.263 69.180  1.00 23.74  ? 195  ARG B NE  1 
ATOM   4565  C CZ  . ARG C  2  185 ? 71.835  38.333 69.160  1.00 23.81  ? 195  ARG B CZ  1 
ATOM   4566  N NH1 . ARG C  2  185 ? 71.728  37.269 68.384  1.00 23.18  ? 195  ARG B NH1 1 
ATOM   4567  N NH2 . ARG C  2  185 ? 72.909  38.472 69.915  1.00 24.43  ? 195  ARG B NH2 1 
ATOM   4568  N N   . LEU C  2  186 ? 70.223  44.775 68.201  1.00 23.03  ? 196  LEU B N   1 
ATOM   4569  C CA  . LEU C  2  186 ? 71.171  45.864 68.331  1.00 23.47  ? 196  LEU B CA  1 
ATOM   4570  C C   . LEU C  2  186 ? 71.424  45.930 69.806  1.00 24.03  ? 196  LEU B C   1 
ATOM   4571  O O   . LEU C  2  186 ? 70.532  46.300 70.566  1.00 24.33  ? 196  LEU B O   1 
ATOM   4572  C CB  . LEU C  2  186 ? 70.600  47.188 67.845  1.00 23.09  ? 196  LEU B CB  1 
ATOM   4573  C CG  . LEU C  2  186 ? 71.519  48.349 68.242  1.00 22.57  ? 196  LEU B CG  1 
ATOM   4574  C CD1 . LEU C  2  186 ? 72.891  48.191 67.585  1.00 22.01  ? 196  LEU B CD1 1 
ATOM   4575  C CD2 . LEU C  2  186 ? 70.906  49.676 67.870  1.00 22.37  ? 196  LEU B CD2 1 
ATOM   4576  N N   . ARG C  2  187 ? 72.620  45.536 70.214  1.00 24.86  ? 197  ARG B N   1 
ATOM   4577  C CA  . ARG C  2  187 ? 72.972  45.527 71.620  1.00 25.70  ? 197  ARG B CA  1 
ATOM   4578  C C   . ARG C  2  187 ? 73.972  46.627 71.955  1.00 25.55  ? 197  ARG B C   1 
ATOM   4579  O O   . ARG C  2  187 ? 74.940  46.860 71.229  1.00 25.90  ? 197  ARG B O   1 
ATOM   4580  C CB  . ARG C  2  187 ? 73.527  44.156 72.019  1.00 26.64  ? 197  ARG B CB  1 
ATOM   4581  C CG  . ARG C  2  187 ? 73.979  44.078 73.475  1.00 29.49  ? 197  ARG B CG  1 
ATOM   4582  C CD  . ARG C  2  187 ? 74.428  42.690 73.912  1.00 32.72  ? 197  ARG B CD  1 
ATOM   4583  N NE  . ARG C  2  187 ? 73.328  41.831 74.355  1.00 34.56  ? 197  ARG B NE  1 
ATOM   4584  C CZ  . ARG C  2  187 ? 73.488  40.722 75.077  1.00 36.13  ? 197  ARG B CZ  1 
ATOM   4585  N NH1 . ARG C  2  187 ? 74.702  40.326 75.440  1.00 36.39  ? 197  ARG B NH1 1 
ATOM   4586  N NH2 . ARG C  2  187 ? 72.434  40.007 75.450  1.00 37.15  ? 197  ARG B NH2 1 
ATOM   4587  N N   . VAL C  2  188 ? 73.706  47.307 73.064  1.00 25.14  ? 198  VAL B N   1 
ATOM   4588  C CA  . VAL C  2  188 ? 74.550  48.382 73.564  1.00 25.06  ? 198  VAL B CA  1 
ATOM   4589  C C   . VAL C  2  188 ? 74.573  48.252 75.079  1.00 25.34  ? 198  VAL B C   1 
ATOM   4590  O O   . VAL C  2  188 ? 73.833  47.449 75.652  1.00 25.06  ? 198  VAL B O   1 
ATOM   4591  C CB  . VAL C  2  188 ? 73.989  49.782 73.216  1.00 24.60  ? 198  VAL B CB  1 
ATOM   4592  C CG1 . VAL C  2  188 ? 74.022  50.015 71.722  1.00 24.21  ? 198  VAL B CG1 1 
ATOM   4593  C CG2 . VAL C  2  188 ? 72.572  49.928 73.743  1.00 23.83  ? 198  VAL B CG2 1 
ATOM   4594  N N   . SER C  2  189 ? 75.412  49.049 75.724  1.00 25.77  ? 199  SER B N   1 
ATOM   4595  C CA  . SER C  2  189 ? 75.513  49.014 77.172  1.00 26.24  ? 199  SER B CA  1 
ATOM   4596  C C   . SER C  2  189 ? 74.180  49.464 77.737  1.00 26.64  ? 199  SER B C   1 
ATOM   4597  O O   . SER C  2  189 ? 73.280  49.839 76.988  1.00 26.76  ? 199  SER B O   1 
ATOM   4598  C CB  . SER C  2  189 ? 76.635  49.938 77.645  1.00 26.32  ? 199  SER B CB  1 
ATOM   4599  O OG  . SER C  2  189 ? 76.425  51.270 77.200  1.00 26.90  ? 199  SER B OG  1 
ATOM   4600  N N   . ALA C  2  190 ? 74.044  49.405 79.053  1.00 27.41  ? 200  ALA B N   1 
ATOM   4601  C CA  . ALA C  2  190 ? 72.823  49.846 79.715  1.00 27.97  ? 200  ALA B CA  1 
ATOM   4602  C C   . ALA C  2  190 ? 72.902  51.370 79.804  1.00 28.60  ? 200  ALA B C   1 
ATOM   4603  O O   . ALA C  2  190 ? 71.902  52.074 79.683  1.00 28.70  ? 200  ALA B O   1 
ATOM   4604  C CB  . ALA C  2  190 ? 72.727  49.235 81.107  1.00 28.01  ? 200  ALA B CB  1 
ATOM   4605  N N   . THR C  2  191 ? 74.120  51.861 80.011  1.00 29.25  ? 201  THR B N   1 
ATOM   4606  C CA  . THR C  2  191 ? 74.387  53.283 80.116  1.00 29.80  ? 201  THR B CA  1 
ATOM   4607  C C   . THR C  2  191 ? 73.947  53.988 78.853  1.00 30.17  ? 201  THR B C   1 
ATOM   4608  O O   . THR C  2  191 ? 73.205  54.961 78.888  1.00 30.15  ? 201  THR B O   1 
ATOM   4609  C CB  . THR C  2  191 ? 75.891  53.514 80.304  1.00 29.96  ? 201  THR B CB  1 
ATOM   4610  O OG1 . THR C  2  191 ? 76.313  52.953 81.553  1.00 30.28  ? 201  THR B OG1 1 
ATOM   4611  C CG2 . THR C  2  191 ? 76.220  55.011 80.364  1.00 29.84  ? 201  THR B CG2 1 
ATOM   4612  N N   . PHE C  2  192 ? 74.427  53.485 77.728  1.00 31.02  ? 202  PHE B N   1 
ATOM   4613  C CA  . PHE C  2  192 ? 74.105  54.069 76.442  1.00 31.21  ? 202  PHE B CA  1 
ATOM   4614  C C   . PHE C  2  192 ? 72.595  54.085 76.226  1.00 31.52  ? 202  PHE B C   1 
ATOM   4615  O O   . PHE C  2  192 ? 72.065  55.000 75.597  1.00 31.69  ? 202  PHE B O   1 
ATOM   4616  C CB  . PHE C  2  192 ? 74.797  53.297 75.320  1.00 31.04  ? 202  PHE B CB  1 
ATOM   4617  C CG  . PHE C  2  192 ? 74.807  54.031 74.021  1.00 31.03  ? 202  PHE B CG  1 
ATOM   4618  C CD1 . PHE C  2  192 ? 73.713  53.977 73.174  1.00 31.59  ? 202  PHE B CD1 1 
ATOM   4619  C CD2 . PHE C  2  192 ? 75.893  54.812 73.663  1.00 31.01  ? 202  PHE B CD2 1 
ATOM   4620  C CE1 . PHE C  2  192 ? 73.704  54.681 71.977  1.00 31.08  ? 202  PHE B CE1 1 
ATOM   4621  C CE2 . PHE C  2  192 ? 75.896  55.517 72.468  1.00 31.24  ? 202  PHE B CE2 1 
ATOM   4622  C CZ  . PHE C  2  192 ? 74.797  55.448 71.623  1.00 31.01  ? 202  PHE B CZ  1 
ATOM   4623  N N   . TRP C  2  193 ? 71.906  53.082 76.763  1.00 31.62  ? 203  TRP B N   1 
ATOM   4624  C CA  . TRP C  2  193 ? 70.456  52.977 76.618  1.00 31.72  ? 203  TRP B CA  1 
ATOM   4625  C C   . TRP C  2  193 ? 69.691  53.925 77.552  1.00 32.00  ? 203  TRP B C   1 
ATOM   4626  O O   . TRP C  2  193 ? 68.891  54.748 77.102  1.00 32.28  ? 203  TRP B O   1 
ATOM   4627  C CB  . TRP C  2  193 ? 70.009  51.526 76.845  1.00 31.47  ? 203  TRP B CB  1 
ATOM   4628  C CG  . TRP C  2  193 ? 68.541  51.372 77.078  1.00 31.35  ? 203  TRP B CG  1 
ATOM   4629  C CD1 . TRP C  2  193 ? 67.941  50.973 78.232  1.00 31.80  ? 203  TRP B CD1 1 
ATOM   4630  C CD2 . TRP C  2  193 ? 67.479  51.614 76.141  1.00 31.79  ? 203  TRP B CD2 1 
ATOM   4631  N NE1 . TRP C  2  193 ? 66.575  50.954 78.080  1.00 31.47  ? 203  TRP B NE1 1 
ATOM   4632  C CE2 . TRP C  2  193 ? 66.263  51.344 76.805  1.00 31.68  ? 203  TRP B CE2 1 
ATOM   4633  C CE3 . TRP C  2  193 ? 67.432  52.036 74.807  1.00 31.76  ? 203  TRP B CE3 1 
ATOM   4634  C CZ2 . TRP C  2  193 ? 65.016  51.487 76.186  1.00 31.83  ? 203  TRP B CZ2 1 
ATOM   4635  C CZ3 . TRP C  2  193 ? 66.188  52.180 74.192  1.00 32.25  ? 203  TRP B CZ3 1 
ATOM   4636  C CH2 . TRP C  2  193 ? 65.001  51.904 74.882  1.00 31.87  ? 203  TRP B CH2 1 
ATOM   4637  N N   . HIS C  2  194 ? 69.926  53.818 78.853  1.00 31.84  ? 204  HIS B N   1 
ATOM   4638  C CA  . HIS C  2  194 ? 69.216  54.681 79.786  1.00 31.46  ? 204  HIS B CA  1 
ATOM   4639  C C   . HIS C  2  194 ? 69.455  56.143 79.466  1.00 31.86  ? 204  HIS B C   1 
ATOM   4640  O O   . HIS C  2  194 ? 68.746  57.011 79.967  1.00 31.95  ? 204  HIS B O   1 
ATOM   4641  C CB  . HIS C  2  194 ? 69.615  54.395 81.233  1.00 30.80  ? 204  HIS B CB  1 
ATOM   4642  C CG  . HIS C  2  194 ? 69.382  52.981 81.644  1.00 28.94  ? 204  HIS B CG  1 
ATOM   4643  N ND1 . HIS C  2  194 ? 70.281  52.274 82.410  1.00 27.68  ? 204  HIS B ND1 1 
ATOM   4644  C CD2 . HIS C  2  194 ? 68.367  52.128 81.371  1.00 27.11  ? 204  HIS B CD2 1 
ATOM   4645  C CE1 . HIS C  2  194 ? 69.830  51.048 82.595  1.00 27.28  ? 204  HIS B CE1 1 
ATOM   4646  N NE2 . HIS C  2  194 ? 68.668  50.934 81.978  1.00 27.23  ? 204  HIS B NE2 1 
ATOM   4647  N N   . ASN C  2  195 ? 70.453  56.416 78.633  1.00 32.28  ? 205  ASN B N   1 
ATOM   4648  C CA  . ASN C  2  195 ? 70.764  57.790 78.253  1.00 32.77  ? 205  ASN B CA  1 
ATOM   4649  C C   . ASN C  2  195 ? 69.704  58.323 77.277  1.00 32.96  ? 205  ASN B C   1 
ATOM   4650  O O   . ASN C  2  195 ? 69.819  58.132 76.070  1.00 32.96  ? 205  ASN B O   1 
ATOM   4651  C CB  . ASN C  2  195 ? 72.153  57.871 77.618  1.00 32.53  ? 205  ASN B CB  1 
ATOM   4652  C CG  . ASN C  2  195 ? 72.564  59.290 77.322  1.00 32.81  ? 205  ASN B CG  1 
ATOM   4653  O OD1 . ASN C  2  195 ? 71.744  60.201 77.381  1.00 33.27  ? 205  ASN B OD1 1 
ATOM   4654  N ND2 . ASN C  2  195 ? 73.836  59.492 77.005  1.00 33.16  ? 205  ASN B ND2 1 
ATOM   4655  N N   . PRO C  2  196 ? 68.728  59.073 77.785  1.00 33.28  ? 206  PRO B N   1 
ATOM   4656  C CA  . PRO C  2  196 ? 67.621  59.582 76.973  1.00 32.99  ? 206  PRO B CA  1 
ATOM   4657  C C   . PRO C  2  196 ? 68.122  60.521 75.883  1.00 32.73  ? 206  PRO B C   1 
ATOM   4658  O O   . PRO C  2  196 ? 67.345  60.993 75.058  1.00 32.24  ? 206  PRO B O   1 
ATOM   4659  C CB  . PRO C  2  196 ? 66.772  60.321 78.000  1.00 33.18  ? 206  PRO B CB  1 
ATOM   4660  C CG  . PRO C  2  196 ? 67.789  60.860 78.937  1.00 33.67  ? 206  PRO B CG  1 
ATOM   4661  C CD  . PRO C  2  196 ? 68.732  59.694 79.123  1.00 33.56  ? 206  PRO B CD  1 
ATOM   4662  N N   . ARG C  2  197 ? 69.426  60.774 75.879  1.00 32.38  ? 207  ARG B N   1 
ATOM   4663  C CA  . ARG C  2  197 ? 70.041  61.629 74.873  1.00 32.07  ? 207  ARG B CA  1 
ATOM   4664  C C   . ARG C  2  197 ? 70.231  60.819 73.582  1.00 30.40  ? 207  ARG B C   1 
ATOM   4665  O O   . ARG C  2  197 ? 70.344  61.373 72.492  1.00 30.32  ? 207  ARG B O   1 
ATOM   4666  C CB  . ARG C  2  197 ? 71.387  62.156 75.395  1.00 32.87  ? 207  ARG B CB  1 
ATOM   4667  C CG  . ARG C  2  197 ? 72.078  63.201 74.541  1.00 35.35  ? 207  ARG B CG  1 
ATOM   4668  C CD  . ARG C  2  197 ? 71.398  64.548 74.593  1.00 38.59  ? 207  ARG B CD  1 
ATOM   4669  N NE  . ARG C  2  197 ? 70.130  64.519 73.875  1.00 41.14  ? 207  ARG B NE  1 
ATOM   4670  C CZ  . ARG C  2  197 ? 69.366  65.575 73.656  1.00 42.79  ? 207  ARG B CZ  1 
ATOM   4671  N NH1 . ARG C  2  197 ? 69.733  66.771 74.099  1.00 43.42  ? 207  ARG B NH1 1 
ATOM   4672  N NH2 . ARG C  2  197 ? 68.234  65.435 72.985  1.00 43.08  ? 207  ARG B NH2 1 
ATOM   4673  N N   . ASN C  2  198 ? 70.247  59.499 73.711  1.00 28.33  ? 208  ASN B N   1 
ATOM   4674  C CA  . ASN C  2  198 ? 70.443  58.637 72.554  1.00 26.57  ? 208  ASN B CA  1 
ATOM   4675  C C   . ASN C  2  198 ? 69.144  58.254 71.871  1.00 24.65  ? 208  ASN B C   1 
ATOM   4676  O O   . ASN C  2  198 ? 68.165  57.899 72.528  1.00 24.22  ? 208  ASN B O   1 
ATOM   4677  C CB  . ASN C  2  198 ? 71.216  57.381 72.952  1.00 26.50  ? 208  ASN B CB  1 
ATOM   4678  C CG  . ASN C  2  198 ? 72.560  57.708 73.550  1.00 26.43  ? 208  ASN B CG  1 
ATOM   4679  O OD1 . ASN C  2  198 ? 73.151  58.728 73.217  1.00 26.75  ? 208  ASN B OD1 1 
ATOM   4680  N ND2 . ASN C  2  198 ? 73.046  56.856 74.446  1.00 25.95  ? 208  ASN B ND2 1 
ATOM   4681  N N   . HIS C  2  199 ? 69.169  58.330 70.543  1.00 22.48  ? 209  HIS B N   1 
ATOM   4682  C CA  . HIS C  2  199 ? 68.037  58.000 69.695  1.00 21.07  ? 209  HIS B CA  1 
ATOM   4683  C C   . HIS C  2  199 ? 68.395  56.773 68.875  1.00 20.44  ? 209  HIS B C   1 
ATOM   4684  O O   . HIS C  2  199 ? 69.501  56.668 68.358  1.00 20.74  ? 209  HIS B O   1 
ATOM   4685  C CB  . HIS C  2  199 ? 67.737  59.171 68.757  1.00 20.56  ? 209  HIS B CB  1 
ATOM   4686  C CG  . HIS C  2  199 ? 66.767  58.843 67.662  1.00 19.53  ? 209  HIS B CG  1 
ATOM   4687  N ND1 . HIS C  2  199 ? 67.159  58.326 66.446  1.00 18.75  ? 209  HIS B ND1 1 
ATOM   4688  C CD2 . HIS C  2  199 ? 65.420  58.960 67.601  1.00 18.20  ? 209  HIS B CD2 1 
ATOM   4689  C CE1 . HIS C  2  199 ? 66.095  58.137 65.685  1.00 17.17  ? 209  HIS B CE1 1 
ATOM   4690  N NE2 . HIS C  2  199 ? 65.028  58.517 66.361  1.00 17.29  ? 209  HIS B NE2 1 
ATOM   4691  N N   . PHE C  2  200 ? 67.461  55.843 68.757  1.00 19.30  ? 210  PHE B N   1 
ATOM   4692  C CA  . PHE C  2  200 ? 67.704  54.636 67.999  1.00 18.25  ? 210  PHE B CA  1 
ATOM   4693  C C   . PHE C  2  200 ? 66.608  54.478 66.971  1.00 18.12  ? 210  PHE B C   1 
ATOM   4694  O O   . PHE C  2  200 ? 65.444  54.821 67.215  1.00 17.31  ? 210  PHE B O   1 
ATOM   4695  C CB  . PHE C  2  200 ? 67.709  53.409 68.897  1.00 18.07  ? 210  PHE B CB  1 
ATOM   4696  C CG  . PHE C  2  200 ? 68.555  53.543 70.129  1.00 17.72  ? 210  PHE B CG  1 
ATOM   4697  C CD1 . PHE C  2  200 ? 68.122  54.308 71.206  1.00 18.10  ? 210  PHE B CD1 1 
ATOM   4698  C CD2 . PHE C  2  200 ? 69.752  52.859 70.236  1.00 16.69  ? 210  PHE B CD2 1 
ATOM   4699  C CE1 . PHE C  2  200 ? 68.884  54.403 72.354  1.00 17.67  ? 210  PHE B CE1 1 
ATOM   4700  C CE2 . PHE C  2  200 ? 70.513  52.947 71.379  1.00 16.58  ? 210  PHE B CE2 1 
ATOM   4701  C CZ  . PHE C  2  200 ? 70.082  53.723 72.437  1.00 17.31  ? 210  PHE B CZ  1 
ATOM   4702  N N   . ARG C  2  201 ? 66.975  53.945 65.816  1.00 18.01  ? 211  ARG B N   1 
ATOM   4703  C CA  . ARG C  2  201 ? 65.999  53.773 64.769  1.00 18.06  ? 211  ARG B CA  1 
ATOM   4704  C C   . ARG C  2  201 ? 66.324  52.572 63.911  1.00 17.92  ? 211  ARG B C   1 
ATOM   4705  O O   . ARG C  2  201 ? 67.467  52.358 63.513  1.00 17.96  ? 211  ARG B O   1 
ATOM   4706  C CB  . ARG C  2  201 ? 65.930  55.037 63.932  1.00 18.03  ? 211  ARG B CB  1 
ATOM   4707  C CG  . ARG C  2  201 ? 64.889  55.054 62.846  1.00 17.86  ? 211  ARG B CG  1 
ATOM   4708  C CD  . ARG C  2  201 ? 64.992  56.322 62.026  1.00 17.95  ? 211  ARG B CD  1 
ATOM   4709  N NE  . ARG C  2  201 ? 65.053  56.036 60.597  1.00 20.08  ? 211  ARG B NE  1 
ATOM   4710  C CZ  . ARG C  2  201 ? 66.084  56.328 59.807  1.00 19.63  ? 211  ARG B CZ  1 
ATOM   4711  N NH1 . ARG C  2  201 ? 67.156  56.923 60.285  1.00 19.22  ? 211  ARG B NH1 1 
ATOM   4712  N NH2 . ARG C  2  201 ? 66.043  56.013 58.525  1.00 21.03  ? 211  ARG B NH2 1 
ATOM   4713  N N   . CYS C  2  202 ? 65.297  51.774 63.665  1.00 17.85  ? 212  CYS B N   1 
ATOM   4714  C CA  . CYS C  2  202 ? 65.416  50.625 62.813  1.00 18.28  ? 212  CYS B CA  1 
ATOM   4715  C C   . CYS C  2  202 ? 64.755  51.008 61.512  1.00 17.71  ? 212  CYS B C   1 
ATOM   4716  O O   . CYS C  2  202 ? 63.653  51.536 61.513  1.00 17.34  ? 212  CYS B O   1 
ATOM   4717  C CB  . CYS C  2  202 ? 64.681  49.440 63.396  1.00 18.90  ? 212  CYS B CB  1 
ATOM   4718  S SG  . CYS C  2  202 ? 64.617  48.091 62.209  1.00 23.20  ? 212  CYS B SG  1 
ATOM   4719  N N   . GLN C  2  203 ? 65.439  50.751 60.407  1.00 17.79  ? 213  GLN B N   1 
ATOM   4720  C CA  . GLN C  2  203 ? 64.936  51.067 59.088  1.00 17.58  ? 213  GLN B CA  1 
ATOM   4721  C C   . GLN C  2  203 ? 64.907  49.820 58.229  1.00 18.23  ? 213  GLN B C   1 
ATOM   4722  O O   . GLN C  2  203 ? 65.787  48.962 58.319  1.00 18.02  ? 213  GLN B O   1 
ATOM   4723  C CB  . GLN C  2  203 ? 65.837  52.086 58.431  1.00 17.67  ? 213  GLN B CB  1 
ATOM   4724  C CG  . GLN C  2  203 ? 65.444  52.443 57.023  1.00 17.53  ? 213  GLN B CG  1 
ATOM   4725  C CD  . GLN C  2  203 ? 66.458  53.355 56.399  1.00 18.54  ? 213  GLN B CD  1 
ATOM   4726  O OE1 . GLN C  2  203 ? 66.595  54.509 56.801  1.00 18.48  ? 213  GLN B OE1 1 
ATOM   4727  N NE2 . GLN C  2  203 ? 67.196  52.837 55.431  1.00 18.71  ? 213  GLN B NE2 1 
ATOM   4728  N N   . VAL C  2  204 ? 63.894  49.723 57.380  1.00 18.46  ? 214  VAL B N   1 
ATOM   4729  C CA  . VAL C  2  204 ? 63.788  48.576 56.514  1.00 18.66  ? 214  VAL B CA  1 
ATOM   4730  C C   . VAL C  2  204 ? 63.441  49.001 55.117  1.00 19.54  ? 214  VAL B C   1 
ATOM   4731  O O   . VAL C  2  204 ? 62.270  49.185 54.791  1.00 19.89  ? 214  VAL B O   1 
ATOM   4732  C CB  . VAL C  2  204 ? 62.725  47.627 57.009  1.00 18.28  ? 214  VAL B CB  1 
ATOM   4733  C CG1 . VAL C  2  204 ? 62.674  46.413 56.101  1.00 16.55  ? 214  VAL B CG1 1 
ATOM   4734  C CG2 . VAL C  2  204 ? 63.023  47.255 58.463  1.00 18.23  ? 214  VAL B CG2 1 
ATOM   4735  N N   . GLN C  2  205 ? 64.455  49.163 54.284  1.00 20.66  ? 215  GLN B N   1 
ATOM   4736  C CA  . GLN C  2  205 ? 64.195  49.561 52.919  1.00 22.21  ? 215  GLN B CA  1 
ATOM   4737  C C   . GLN C  2  205 ? 63.551  48.395 52.188  1.00 22.78  ? 215  GLN B C   1 
ATOM   4738  O O   . GLN C  2  205 ? 64.136  47.312 52.086  1.00 22.99  ? 215  GLN B O   1 
ATOM   4739  C CB  . GLN C  2  205 ? 65.472  49.988 52.211  1.00 22.82  ? 215  GLN B CB  1 
ATOM   4740  C CG  . GLN C  2  205 ? 65.207  50.577 50.830  1.00 24.53  ? 215  GLN B CG  1 
ATOM   4741  C CD  . GLN C  2  205 ? 66.404  51.315 50.286  1.00 25.94  ? 215  GLN B CD  1 
ATOM   4742  O OE1 . GLN C  2  205 ? 66.273  52.408 49.725  1.00 28.12  ? 215  GLN B OE1 1 
ATOM   4743  N NE2 . GLN C  2  205 ? 67.575  50.730 50.453  1.00 26.17  ? 215  GLN B NE2 1 
ATOM   4744  N N   . PHE C  2  206 ? 62.343  48.630 51.693  1.00 23.21  ? 216  PHE B N   1 
ATOM   4745  C CA  . PHE C  2  206 ? 61.577  47.634 50.962  1.00 24.22  ? 216  PHE B CA  1 
ATOM   4746  C C   . PHE C  2  206 ? 61.616  47.904 49.466  1.00 24.99  ? 216  PHE B C   1 
ATOM   4747  O O   . PHE C  2  206 ? 61.248  48.990 49.020  1.00 25.09  ? 216  PHE B O   1 
ATOM   4748  C CB  . PHE C  2  206 ? 60.119  47.674 51.418  1.00 24.28  ? 216  PHE B CB  1 
ATOM   4749  C CG  . PHE C  2  206 ? 59.184  46.849 50.571  1.00 23.86  ? 216  PHE B CG  1 
ATOM   4750  C CD1 . PHE C  2  206 ? 59.236  45.465 50.608  1.00 22.62  ? 216  PHE B CD1 1 
ATOM   4751  C CD2 . PHE C  2  206 ? 58.230  47.461 49.763  1.00 24.86  ? 216  PHE B CD2 1 
ATOM   4752  C CE1 . PHE C  2  206 ? 58.359  44.701 49.867  1.00 23.62  ? 216  PHE B CE1 1 
ATOM   4753  C CE2 . PHE C  2  206 ? 57.343  46.698 49.003  1.00 24.66  ? 216  PHE B CE2 1 
ATOM   4754  C CZ  . PHE C  2  206 ? 57.409  45.315 49.056  1.00 24.20  ? 216  PHE B CZ  1 
ATOM   4755  N N   . HIS C  2  207 ? 62.037  46.910 48.693  1.00 25.76  ? 217  HIS B N   1 
ATOM   4756  C CA  . HIS C  2  207 ? 62.103  47.058 47.241  1.00 26.51  ? 217  HIS B CA  1 
ATOM   4757  C C   . HIS C  2  207 ? 60.866  46.477 46.596  1.00 27.95  ? 217  HIS B C   1 
ATOM   4758  O O   . HIS C  2  207 ? 60.658  45.267 46.630  1.00 27.67  ? 217  HIS B O   1 
ATOM   4759  C CB  . HIS C  2  207 ? 63.350  46.379 46.682  1.00 25.69  ? 217  HIS B CB  1 
ATOM   4760  C CG  . HIS C  2  207 ? 64.622  47.083 47.022  1.00 24.10  ? 217  HIS B CG  1 
ATOM   4761  N ND1 . HIS C  2  207 ? 65.024  48.238 46.389  1.00 23.91  ? 217  HIS B ND1 1 
ATOM   4762  C CD2 . HIS C  2  207 ? 65.601  46.779 47.903  1.00 23.09  ? 217  HIS B CD2 1 
ATOM   4763  C CE1 . HIS C  2  207 ? 66.197  48.615 46.863  1.00 22.66  ? 217  HIS B CE1 1 
ATOM   4764  N NE2 . HIS C  2  207 ? 66.569  47.745 47.784  1.00 22.86  ? 217  HIS B NE2 1 
ATOM   4765  N N   . GLY C  2  208 ? 60.045  47.348 46.013  1.00 29.97  ? 218  GLY B N   1 
ATOM   4766  C CA  . GLY C  2  208 ? 58.809  46.914 45.397  1.00 31.60  ? 218  GLY B CA  1 
ATOM   4767  C C   . GLY C  2  208 ? 58.491  47.521 44.045  1.00 33.40  ? 218  GLY B C   1 
ATOM   4768  O O   . GLY C  2  208 ? 59.360  47.682 43.185  1.00 33.37  ? 218  GLY B O   1 
ATOM   4769  N N   . LEU C  2  209 ? 57.215  47.846 43.869  1.00 35.50  ? 219  LEU B N   1 
ATOM   4770  C CA  . LEU C  2  209 ? 56.699  48.403 42.624  1.00 37.36  ? 219  LEU B CA  1 
ATOM   4771  C C   . LEU C  2  209 ? 57.471  49.615 42.100  1.00 39.11  ? 219  LEU B C   1 
ATOM   4772  O O   . LEU C  2  209 ? 57.778  50.552 42.845  1.00 39.13  ? 219  LEU B O   1 
ATOM   4773  C CB  . LEU C  2  209 ? 55.227  48.774 42.803  1.00 37.23  ? 219  LEU B CB  1 
ATOM   4774  C CG  . LEU C  2  209 ? 54.291  48.087 41.812  1.00 37.14  ? 219  LEU B CG  1 
ATOM   4775  C CD1 . LEU C  2  209 ? 54.346  46.576 42.016  1.00 36.94  ? 219  LEU B CD1 1 
ATOM   4776  C CD2 . LEU C  2  209 ? 52.875  48.607 41.984  1.00 36.81  ? 219  LEU B CD2 1 
ATOM   4777  N N   . SER C  2  210 ? 57.768  49.575 40.803  1.00 41.12  ? 220  SER B N   1 
ATOM   4778  C CA  . SER C  2  210 ? 58.475  50.647 40.119  1.00 42.75  ? 220  SER B CA  1 
ATOM   4779  C C   . SER C  2  210 ? 57.493  51.788 39.893  1.00 44.14  ? 220  SER B C   1 
ATOM   4780  O O   . SER C  2  210 ? 56.289  51.564 39.770  1.00 44.14  ? 220  SER B O   1 
ATOM   4781  C CB  . SER C  2  210 ? 59.003  50.158 38.758  1.00 42.95  ? 220  SER B CB  1 
ATOM   4782  O OG  . SER C  2  210 ? 59.609  48.876 38.845  1.00 42.88  ? 220  SER B OG  1 
ATOM   4783  N N   . GLU C  2  211 ? 58.000  53.012 39.834  1.00 45.87  ? 221  GLU B N   1 
ATOM   4784  C CA  . GLU C  2  211 ? 57.150  54.171 39.581  1.00 47.35  ? 221  GLU B CA  1 
ATOM   4785  C C   . GLU C  2  211 ? 56.463  54.012 38.226  1.00 48.41  ? 221  GLU B C   1 
ATOM   4786  O O   . GLU C  2  211 ? 55.320  54.435 38.038  1.00 48.45  ? 221  GLU B O   1 
ATOM   4787  C CB  . GLU C  2  211 ? 57.976  55.462 39.600  1.00 47.55  ? 221  GLU B CB  1 
ATOM   4788  C CG  . GLU C  2  211 ? 59.201  55.440 38.695  1.00 47.99  ? 221  GLU B CG  1 
ATOM   4789  C CD  . GLU C  2  211 ? 60.327  54.567 39.235  1.00 48.38  ? 221  GLU B CD  1 
ATOM   4790  O OE1 . GLU C  2  211 ? 61.341  54.392 38.526  1.00 48.39  ? 221  GLU B OE1 1 
ATOM   4791  O OE2 . GLU C  2  211 ? 60.201  54.053 40.368  1.00 48.19  ? 221  GLU B OE2 1 
ATOM   4792  N N   . GLU C  2  212 ? 57.169  53.391 37.286  1.00 49.73  ? 222  GLU B N   1 
ATOM   4793  C CA  . GLU C  2  212 ? 56.635  53.166 35.949  1.00 50.71  ? 222  GLU B CA  1 
ATOM   4794  C C   . GLU C  2  212 ? 55.762  51.903 35.903  1.00 50.91  ? 222  GLU B C   1 
ATOM   4795  O O   . GLU C  2  212 ? 55.494  51.372 34.828  1.00 51.06  ? 222  GLU B O   1 
ATOM   4796  C CB  . GLU C  2  212 ? 57.773  53.067 34.916  1.00 51.26  ? 222  GLU B CB  1 
ATOM   4797  C CG  . GLU C  2  212 ? 58.596  54.348 34.703  1.00 52.39  ? 222  GLU B CG  1 
ATOM   4798  C CD  . GLU C  2  212 ? 57.902  55.398 33.840  1.00 53.70  ? 222  GLU B CD  1 
ATOM   4799  O OE1 . GLU C  2  212 ? 57.226  55.028 32.861  1.00 54.86  ? 222  GLU B OE1 1 
ATOM   4800  O OE2 . GLU C  2  212 ? 58.046  56.605 34.125  1.00 54.13  ? 222  GLU B OE2 1 
ATOM   4801  N N   . ASP C  2  213 ? 55.338  51.417 37.069  1.00 51.15  ? 223  ASP B N   1 
ATOM   4802  C CA  . ASP C  2  213 ? 54.447  50.258 37.158  1.00 51.20  ? 223  ASP B CA  1 
ATOM   4803  C C   . ASP C  2  213 ? 53.061  50.784 37.500  1.00 51.21  ? 223  ASP B C   1 
ATOM   4804  O O   . ASP C  2  213 ? 52.932  51.799 38.185  1.00 51.15  ? 223  ASP B O   1 
ATOM   4805  C CB  . ASP C  2  213 ? 54.866  49.292 38.269  1.00 51.37  ? 223  ASP B CB  1 
ATOM   4806  C CG  . ASP C  2  213 ? 55.970  48.358 37.860  1.00 51.44  ? 223  ASP B CG  1 
ATOM   4807  O OD1 . ASP C  2  213 ? 55.974  47.876 36.707  1.00 52.03  ? 223  ASP B OD1 1 
ATOM   4808  O OD2 . ASP C  2  213 ? 56.865  48.045 38.667  1.00 51.88  ? 223  ASP B OD2 1 
ATOM   4809  N N   . LYS C  2  214 ? 52.024  50.093 37.044  1.00 51.03  ? 224  LYS B N   1 
ATOM   4810  C CA  . LYS C  2  214 ? 50.662  50.529 37.319  1.00 50.91  ? 224  LYS B CA  1 
ATOM   4811  C C   . LYS C  2  214 ? 50.087  49.827 38.538  1.00 50.38  ? 224  LYS B C   1 
ATOM   4812  O O   . LYS C  2  214 ? 50.398  48.669 38.808  1.00 50.47  ? 224  LYS B O   1 
ATOM   4813  C CB  . LYS C  2  214 ? 49.757  50.284 36.108  1.00 51.08  ? 224  LYS B CB  1 
ATOM   4814  C CG  . LYS C  2  214 ? 50.194  51.041 34.867  1.00 51.88  ? 224  LYS B CG  1 
ATOM   4815  C CD  . LYS C  2  214 ? 49.142  51.027 33.775  1.00 52.55  ? 224  LYS B CD  1 
ATOM   4816  C CE  . LYS C  2  214 ? 49.566  51.911 32.607  1.00 53.45  ? 224  LYS B CE  1 
ATOM   4817  N NZ  . LYS C  2  214 ? 48.489  52.097 31.591  1.00 54.16  ? 224  LYS B NZ  1 
ATOM   4818  N N   . TRP C  2  215 ? 49.246  50.549 39.269  1.00 49.70  ? 225  TRP B N   1 
ATOM   4819  C CA  . TRP C  2  215 ? 48.582  50.025 40.449  1.00 48.91  ? 225  TRP B CA  1 
ATOM   4820  C C   . TRP C  2  215 ? 47.091  50.328 40.298  1.00 49.18  ? 225  TRP B C   1 
ATOM   4821  O O   . TRP C  2  215 ? 46.755  51.358 39.714  1.00 49.15  ? 225  TRP B O   1 
ATOM   4822  C CB  . TRP C  2  215 ? 49.112  50.728 41.700  1.00 48.28  ? 225  TRP B CB  1 
ATOM   4823  C CG  . TRP C  2  215 ? 48.647  50.101 42.951  1.00 45.75  ? 225  TRP B CG  1 
ATOM   4824  C CD1 . TRP C  2  215 ? 47.919  50.685 43.942  1.00 44.30  ? 225  TRP B CD1 1 
ATOM   4825  C CD2 . TRP C  2  215 ? 48.864  48.750 43.355  1.00 44.21  ? 225  TRP B CD2 1 
ATOM   4826  N NE1 . TRP C  2  215 ? 47.672  49.778 44.944  1.00 43.60  ? 225  TRP B NE1 1 
ATOM   4827  C CE2 . TRP C  2  215 ? 48.242  48.579 44.606  1.00 43.25  ? 225  TRP B CE2 1 
ATOM   4828  C CE3 . TRP C  2  215 ? 49.531  47.659 42.783  1.00 43.73  ? 225  TRP B CE3 1 
ATOM   4829  C CZ2 . TRP C  2  215 ? 48.264  47.371 45.291  1.00 43.19  ? 225  TRP B CZ2 1 
ATOM   4830  C CZ3 . TRP C  2  215 ? 49.551  46.462 43.461  1.00 42.97  ? 225  TRP B CZ3 1 
ATOM   4831  C CH2 . TRP C  2  215 ? 48.924  46.325 44.705  1.00 43.31  ? 225  TRP B CH2 1 
ATOM   4832  N N   . PRO C  2  216 ? 46.198  49.371 40.621  1.00 49.56  ? 226  PRO B N   1 
ATOM   4833  C CA  . PRO C  2  216 ? 44.767  49.604 40.768  1.00 49.69  ? 226  PRO B CA  1 
ATOM   4834  C C   . PRO C  2  216 ? 44.488  50.722 41.708  1.00 49.48  ? 226  PRO B C   1 
ATOM   4835  O O   . PRO C  2  216 ? 45.350  51.589 41.846  1.00 49.61  ? 226  PRO B O   1 
ATOM   4836  C CB  . PRO C  2  216 ? 44.195  48.226 41.100  1.00 49.92  ? 226  PRO B CB  1 
ATOM   4837  C CG  . PRO C  2  216 ? 45.086  47.321 40.288  1.00 50.10  ? 226  PRO B CG  1 
ATOM   4838  C CD  . PRO C  2  216 ? 46.427  48.005 40.166  1.00 49.83  ? 226  PRO B CD  1 
ATOM   4839  N N   . GLU C  2  217 ? 43.331  50.781 42.327  1.00 49.18  ? 227  GLU B N   1 
ATOM   4840  C CA  . GLU C  2  217 ? 43.127  52.015 43.008  1.00 48.98  ? 227  GLU B CA  1 
ATOM   4841  C C   . GLU C  2  217 ? 42.292  52.032 44.199  1.00 47.95  ? 227  GLU B C   1 
ATOM   4842  O O   . GLU C  2  217 ? 41.275  51.368 44.384  1.00 48.08  ? 227  GLU B O   1 
ATOM   4843  C CB  . GLU C  2  217 ? 42.631  53.071 42.041  1.00 49.44  ? 227  GLU B CB  1 
ATOM   4844  C CG  . GLU C  2  217 ? 42.772  54.495 42.568  1.00 51.02  ? 227  GLU B CG  1 
ATOM   4845  C CD  . GLU C  2  217 ? 42.550  55.510 41.460  1.00 52.53  ? 227  GLU B CD  1 
ATOM   4846  O OE1 . GLU C  2  217 ? 42.296  55.069 40.319  1.00 53.33  ? 227  GLU B OE1 1 
ATOM   4847  O OE2 . GLU C  2  217 ? 42.625  56.729 41.720  1.00 53.39  ? 227  GLU B OE2 1 
ATOM   4848  N N   . GLY C  2  218 ? 42.783  52.930 44.979  1.00 46.71  ? 228  GLY B N   1 
ATOM   4849  C CA  . GLY C  2  218 ? 42.380  53.009 46.303  1.00 45.56  ? 228  GLY B CA  1 
ATOM   4850  C C   . GLY C  2  218 ? 43.712  52.592 46.877  1.00 44.51  ? 228  GLY B C   1 
ATOM   4851  O O   . GLY C  2  218 ? 44.683  53.351 46.842  1.00 44.57  ? 228  GLY B O   1 
ATOM   4852  N N   . SER C  2  219 ? 43.801  51.348 47.278  1.00 42.80  ? 229  SER B N   1 
ATOM   4853  C CA  . SER C  2  219 ? 44.943  50.926 48.078  1.00 41.28  ? 229  SER B CA  1 
ATOM   4854  C C   . SER C  2  219 ? 46.256  51.593 47.658  1.00 39.46  ? 229  SER B C   1 
ATOM   4855  O O   . SER C  2  219 ? 46.559  51.668 46.471  1.00 39.17  ? 229  SER B O   1 
ATOM   4856  C CB  . SER C  2  219 ? 45.089  49.405 48.014  1.00 41.46  ? 229  SER B CB  1 
ATOM   4857  O OG  . SER C  2  219 ? 46.193  48.957 48.782  1.00 42.13  ? 229  SER B OG  1 
ATOM   4858  N N   . PRO C  2  220 ? 47.054  52.046 48.628  1.00 37.43  ? 230  PRO B N   1 
ATOM   4859  C CA  . PRO C  2  220 ? 48.328  52.697 48.317  1.00 35.93  ? 230  PRO B CA  1 
ATOM   4860  C C   . PRO C  2  220 ? 49.216  51.812 47.448  1.00 34.47  ? 230  PRO B C   1 
ATOM   4861  O O   . PRO C  2  220 ? 49.029  50.599 47.376  1.00 34.41  ? 230  PRO B O   1 
ATOM   4862  C CB  . PRO C  2  220 ? 48.931  52.962 49.702  1.00 35.92  ? 230  PRO B CB  1 
ATOM   4863  C CG  . PRO C  2  220 ? 48.271  51.983 50.579  1.00 36.72  ? 230  PRO B CG  1 
ATOM   4864  C CD  . PRO C  2  220 ? 46.852  51.954 50.083  1.00 37.41  ? 230  PRO B CD  1 
ATOM   4865  N N   . LYS C  2  221 ? 50.170  52.437 46.774  1.00 32.80  ? 231  LYS B N   1 
ATOM   4866  C CA  . LYS C  2  221 ? 51.059  51.745 45.846  1.00 31.42  ? 231  LYS B CA  1 
ATOM   4867  C C   . LYS C  2  221 ? 52.321  51.174 46.519  1.00 30.27  ? 231  LYS B C   1 
ATOM   4868  O O   . LYS C  2  221 ? 53.149  51.931 47.029  1.00 30.04  ? 231  LYS B O   1 
ATOM   4869  C CB  . LYS C  2  221 ? 51.438  52.735 44.742  1.00 31.17  ? 231  LYS B CB  1 
ATOM   4870  C CG  . LYS C  2  221 ? 52.153  52.153 43.548  1.00 31.28  ? 231  LYS B CG  1 
ATOM   4871  C CD  . LYS C  2  221 ? 51.952  53.070 42.345  1.00 31.08  ? 231  LYS B CD  1 
ATOM   4872  C CE  . LYS C  2  221 ? 52.711  52.607 41.118  1.00 30.77  ? 231  LYS B CE  1 
ATOM   4873  N NZ  . LYS C  2  221 ? 54.119  53.072 41.109  1.00 30.42  ? 231  LYS B NZ  1 
ATOM   4874  N N   . PRO C  2  222 ? 52.467  49.845 46.517  1.00 28.63  ? 232  PRO B N   1 
ATOM   4875  C CA  . PRO C  2  222 ? 53.622  49.166 47.123  1.00 27.60  ? 232  PRO B CA  1 
ATOM   4876  C C   . PRO C  2  222 ? 54.927  49.444 46.386  1.00 26.57  ? 232  PRO B C   1 
ATOM   4877  O O   . PRO C  2  222 ? 55.594  48.545 45.882  1.00 25.47  ? 232  PRO B O   1 
ATOM   4878  C CB  . PRO C  2  222 ? 53.226  47.684 47.057  1.00 27.87  ? 232  PRO B CB  1 
ATOM   4879  C CG  . PRO C  2  222 ? 52.320  47.607 45.885  1.00 28.42  ? 232  PRO B CG  1 
ATOM   4880  C CD  . PRO C  2  222 ? 51.510  48.876 45.958  1.00 28.77  ? 232  PRO B CD  1 
ATOM   4881  N N   . VAL C  2  223 ? 55.264  50.726 46.338  1.00 25.91  ? 233  VAL B N   1 
ATOM   4882  C CA  . VAL C  2  223 ? 56.471  51.210 45.698  1.00 25.39  ? 233  VAL B CA  1 
ATOM   4883  C C   . VAL C  2  223 ? 57.609  51.131 46.698  1.00 24.92  ? 233  VAL B C   1 
ATOM   4884  O O   . VAL C  2  223 ? 57.390  51.080 47.908  1.00 25.22  ? 233  VAL B O   1 
ATOM   4885  C CB  . VAL C  2  223 ? 56.301  52.680 45.249  1.00 25.50  ? 233  VAL B CB  1 
ATOM   4886  C CG1 . VAL C  2  223 ? 55.879  53.547 46.423  1.00 25.12  ? 233  VAL B CG1 1 
ATOM   4887  C CG2 . VAL C  2  223 ? 57.589  53.218 44.634  1.00 26.82  ? 233  VAL B CG2 1 
ATOM   4888  N N   . THR C  2  224 ? 58.829  51.121 46.193  1.00 24.33  ? 234  THR B N   1 
ATOM   4889  C CA  . THR C  2  224 ? 59.991  51.077 47.053  1.00 23.48  ? 234  THR B CA  1 
ATOM   4890  C C   . THR C  2  224 ? 59.842  52.159 48.098  1.00 23.34  ? 234  THR B C   1 
ATOM   4891  O O   . THR C  2  224 ? 59.278  53.219 47.826  1.00 24.10  ? 234  THR B O   1 
ATOM   4892  C CB  . THR C  2  224 ? 61.242  51.303 46.215  1.00 23.32  ? 234  THR B CB  1 
ATOM   4893  O OG1 . THR C  2  224 ? 61.445  50.165 45.369  1.00 22.29  ? 234  THR B OG1 1 
ATOM   4894  C CG2 . THR C  2  224 ? 62.487  51.424 47.090  1.00 22.78  ? 234  THR B CG2 1 
ATOM   4895  N N   . GLN C  2  225 ? 60.345  51.897 49.296  1.00 22.73  ? 235  GLN B N   1 
ATOM   4896  C CA  . GLN C  2  225 ? 60.235  52.861 50.381  1.00 22.11  ? 235  GLN B CA  1 
ATOM   4897  C C   . GLN C  2  225 ? 60.925  52.348 51.632  1.00 21.48  ? 235  GLN B C   1 
ATOM   4898  O O   . GLN C  2  225 ? 61.112  51.148 51.801  1.00 20.90  ? 235  GLN B O   1 
ATOM   4899  C CB  . GLN C  2  225 ? 58.763  53.088 50.716  1.00 22.02  ? 235  GLN B CB  1 
ATOM   4900  C CG  . GLN C  2  225 ? 58.124  51.841 51.302  1.00 22.29  ? 235  GLN B CG  1 
ATOM   4901  C CD  . GLN C  2  225 ? 56.680  52.015 51.697  1.00 23.51  ? 235  GLN B CD  1 
ATOM   4902  O OE1 . GLN C  2  225 ? 56.349  52.812 52.576  1.00 23.92  ? 235  GLN B OE1 1 
ATOM   4903  N NE2 . GLN C  2  225 ? 55.811  51.253 51.060  1.00 25.72  ? 235  GLN B NE2 1 
ATOM   4904  N N   . ASN C  2  226 ? 61.282  53.268 52.513  1.00 21.39  ? 236  ASN B N   1 
ATOM   4905  C CA  . ASN C  2  226 ? 61.869  52.911 53.788  1.00 21.80  ? 236  ASN B CA  1 
ATOM   4906  C C   . ASN C  2  226 ? 60.801  53.040 54.852  1.00 21.12  ? 236  ASN B C   1 
ATOM   4907  O O   . ASN C  2  226 ? 60.057  54.012 54.872  1.00 20.85  ? 236  ASN B O   1 
ATOM   4908  C CB  . ASN C  2  226 ? 63.013  53.842 54.153  1.00 22.83  ? 236  ASN B CB  1 
ATOM   4909  C CG  . ASN C  2  226 ? 64.144  53.775 53.188  1.00 24.53  ? 236  ASN B CG  1 
ATOM   4910  O OD1 . ASN C  2  226 ? 64.489  52.714 52.674  1.00 26.05  ? 236  ASN B OD1 1 
ATOM   4911  N ND2 . ASN C  2  226 ? 64.751  54.915 52.939  1.00 28.68  ? 236  ASN B ND2 1 
ATOM   4912  N N   . ILE C  2  227 ? 60.723  52.050 55.728  1.00 20.70  ? 237  ILE B N   1 
ATOM   4913  C CA  . ILE C  2  227 ? 59.786  52.069 56.830  1.00 19.97  ? 237  ILE B CA  1 
ATOM   4914  C C   . ILE C  2  227 ? 60.629  51.932 58.074  1.00 19.62  ? 237  ILE B C   1 
ATOM   4915  O O   . ILE C  2  227 ? 61.484  51.044 58.160  1.00 19.83  ? 237  ILE B O   1 
ATOM   4916  C CB  . ILE C  2  227 ? 58.796  50.910 56.757  1.00 20.43  ? 237  ILE B CB  1 
ATOM   4917  C CG1 . ILE C  2  227 ? 57.991  50.975 55.454  1.00 20.71  ? 237  ILE B CG1 1 
ATOM   4918  C CG2 . ILE C  2  227 ? 57.846  50.970 57.956  1.00 20.25  ? 237  ILE B CG2 1 
ATOM   4919  C CD1 . ILE C  2  227 ? 57.088  52.181 55.365  1.00 20.97  ? 237  ILE B CD1 1 
ATOM   4920  N N   . SER C  2  228 ? 60.405  52.804 59.044  1.00 18.70  ? 238  SER B N   1 
ATOM   4921  C CA  . SER C  2  228 ? 61.199  52.756 60.246  1.00 18.11  ? 238  SER B CA  1 
ATOM   4922  C C   . SER C  2  228 ? 60.378  52.761 61.519  1.00 17.94  ? 238  SER B C   1 
ATOM   4923  O O   . SER C  2  228 ? 59.178  52.972 61.499  1.00 17.22  ? 238  SER B O   1 
ATOM   4924  C CB  . SER C  2  228 ? 62.181  53.925 60.258  1.00 18.54  ? 238  SER B CB  1 
ATOM   4925  O OG  . SER C  2  228 ? 63.022  53.891 59.113  1.00 17.01  ? 238  SER B OG  1 
ATOM   4926  N N   . ALA C  2  229 ? 61.066  52.500 62.624  1.00 18.04  ? 239  ALA B N   1 
ATOM   4927  C CA  . ALA C  2  229 ? 60.486  52.502 63.950  1.00 17.90  ? 239  ALA B CA  1 
ATOM   4928  C C   . ALA C  2  229 ? 61.608  53.000 64.855  1.00 18.32  ? 239  ALA B C   1 
ATOM   4929  O O   . ALA C  2  229 ? 62.783  52.671 64.635  1.00 17.78  ? 239  ALA B O   1 
ATOM   4930  C CB  . ALA C  2  229 ? 60.056  51.116 64.341  1.00 18.19  ? 239  ALA B CB  1 
ATOM   4931  N N   . GLU C  2  230 ? 61.255  53.779 65.871  1.00 18.70  ? 240  GLU B N   1 
ATOM   4932  C CA  . GLU C  2  230 ? 62.244  54.366 66.744  1.00 19.25  ? 240  GLU B CA  1 
ATOM   4933  C C   . GLU C  2  230 ? 61.953  54.207 68.225  1.00 20.70  ? 240  GLU B C   1 
ATOM   4934  O O   . GLU C  2  230 ? 60.836  53.936 68.643  1.00 20.97  ? 240  GLU B O   1 
ATOM   4935  C CB  . GLU C  2  230 ? 62.340  55.849 66.436  1.00 19.29  ? 240  GLU B CB  1 
ATOM   4936  C CG  . GLU C  2  230 ? 61.007  56.537 66.600  1.00 18.67  ? 240  GLU B CG  1 
ATOM   4937  C CD  . GLU C  2  230 ? 61.091  58.018 66.399  1.00 18.84  ? 240  GLU B CD  1 
ATOM   4938  O OE1 . GLU C  2  230 ? 60.124  58.707 66.780  1.00 19.40  ? 240  GLU B OE1 1 
ATOM   4939  O OE2 . GLU C  2  230 ? 62.115  58.487 65.863  1.00 19.65  ? 240  GLU B OE2 1 
ATOM   4940  N N   . ALA C  2  231 ? 62.996  54.394 69.016  1.00 22.38  ? 241  ALA B N   1 
ATOM   4941  C CA  . ALA C  2  231 ? 62.903  54.329 70.456  1.00 23.48  ? 241  ALA B CA  1 
ATOM   4942  C C   . ALA C  2  231 ? 63.922  55.320 70.954  1.00 24.90  ? 241  ALA B C   1 
ATOM   4943  O O   . ALA C  2  231 ? 64.946  55.553 70.313  1.00 24.52  ? 241  ALA B O   1 
ATOM   4944  C CB  . ALA C  2  231 ? 63.229  52.945 70.957  1.00 23.79  ? 241  ALA B CB  1 
ATOM   4945  N N   . TRP C  2  232 ? 63.638  55.918 72.094  1.00 27.18  ? 242  TRP B N   1 
ATOM   4946  C CA  . TRP C  2  232 ? 64.551  56.878 72.665  1.00 29.18  ? 242  TRP B CA  1 
ATOM   4947  C C   . TRP C  2  232 ? 65.080  56.271 73.937  1.00 30.79  ? 242  TRP B C   1 
ATOM   4948  O O   . TRP C  2  232 ? 64.344  55.576 74.624  1.00 30.40  ? 242  TRP B O   1 
ATOM   4949  C CB  . TRP C  2  232 ? 63.826  58.197 72.957  1.00 29.44  ? 242  TRP B CB  1 
ATOM   4950  C CG  . TRP C  2  232 ? 64.617  59.343 72.465  1.00 29.79  ? 242  TRP B CG  1 
ATOM   4951  C CD1 . TRP C  2  232 ? 65.773  59.826 72.998  1.00 29.79  ? 242  TRP B CD1 1 
ATOM   4952  C CD2 . TRP C  2  232 ? 64.368  60.109 71.288  1.00 29.54  ? 242  TRP B CD2 1 
ATOM   4953  N NE1 . TRP C  2  232 ? 66.254  60.859 72.231  1.00 29.77  ? 242  TRP B NE1 1 
ATOM   4954  C CE2 . TRP C  2  232 ? 65.409  61.052 71.171  1.00 29.78  ? 242  TRP B CE2 1 
ATOM   4955  C CE3 . TRP C  2  232 ? 63.367  60.097 70.318  1.00 29.55  ? 242  TRP B CE3 1 
ATOM   4956  C CZ2 . TRP C  2  232 ? 65.470  61.974 70.132  1.00 29.71  ? 242  TRP B CZ2 1 
ATOM   4957  C CZ3 . TRP C  2  232 ? 63.431  61.008 69.289  1.00 29.96  ? 242  TRP B CZ3 1 
ATOM   4958  C CH2 . TRP C  2  232 ? 64.477  61.932 69.200  1.00 29.75  ? 242  TRP B CH2 1 
ATOM   4959  N N   . GLY C  2  233 ? 66.351  56.511 74.245  1.00 33.22  ? 243  GLY B N   1 
ATOM   4960  C CA  . GLY C  2  233 ? 66.921  55.990 75.471  1.00 35.69  ? 243  GLY B CA  1 
ATOM   4961  C C   . GLY C  2  233 ? 66.075  56.485 76.629  1.00 37.98  ? 243  GLY B C   1 
ATOM   4962  O O   . GLY C  2  233 ? 65.324  57.445 76.471  1.00 38.23  ? 243  GLY B O   1 
ATOM   4963  N N   . ARG C  2  234 ? 66.181  55.855 77.794  1.00 40.68  ? 244  ARG B N   1 
ATOM   4964  C CA  . ARG C  2  234 ? 65.371  56.285 78.939  1.00 42.80  ? 244  ARG B CA  1 
ATOM   4965  C C   . ARG C  2  234 ? 65.938  55.848 80.275  1.00 44.04  ? 244  ARG B C   1 
ATOM   4966  O O   . ARG C  2  234 ? 66.722  54.918 80.346  1.00 44.18  ? 244  ARG B O   1 
ATOM   4967  C CB  . ARG C  2  234 ? 63.948  55.755 78.789  1.00 43.12  ? 244  ARG B CB  1 
ATOM   4968  C CG  . ARG C  2  234 ? 63.901  54.380 78.167  1.00 44.70  ? 244  ARG B CG  1 
ATOM   4969  C CD  . ARG C  2  234 ? 63.038  54.339 76.926  1.00 46.43  ? 244  ARG B CD  1 
ATOM   4970  N NE  . ARG C  2  234 ? 61.730  53.748 77.182  1.00 48.42  ? 244  ARG B NE  1 
ATOM   4971  C CZ  . ARG C  2  234 ? 60.761  53.665 76.279  1.00 50.29  ? 244  ARG B CZ  1 
ATOM   4972  N NH1 . ARG C  2  234 ? 60.949  54.140 75.053  1.00 50.83  ? 244  ARG B NH1 1 
ATOM   4973  N NH2 . ARG C  2  234 ? 59.599  53.106 76.600  1.00 50.96  ? 244  ARG B NH2 1 
ATOM   4974  N N   . ALA C  2  235 ? 65.524  56.528 81.337  1.00 45.82  ? 245  ALA B N   1 
ATOM   4975  C CA  . ALA C  2  235 ? 65.981  56.210 82.681  1.00 47.17  ? 245  ALA B CA  1 
ATOM   4976  C C   . ALA C  2  235 ? 65.259  54.985 83.205  1.00 48.35  ? 245  ALA B C   1 
ATOM   4977  O O   . ALA C  2  235 ? 64.135  54.695 82.802  1.00 48.61  ? 245  ALA B O   1 
ATOM   4978  C CB  . ALA C  2  235 ? 65.735  57.386 83.604  1.00 47.29  ? 245  ALA B CB  1 
ATOM   4979  N N   . ASP C  2  236 ? 65.901  54.264 84.109  1.00 49.71  ? 246  ASP B N   1 
ATOM   4980  C CA  . ASP C  2  236 ? 65.269  53.094 84.683  1.00 50.97  ? 246  ASP B CA  1 
ATOM   4981  C C   . ASP C  2  236 ? 64.698  53.477 86.042  1.00 51.58  ? 246  ASP B C   1 
ATOM   4982  O O   . ASP C  2  236 ? 65.430  53.565 87.032  1.00 51.76  ? 246  ASP B O   1 
ATOM   4983  C CB  . ASP C  2  236 ? 66.270  51.954 84.818  1.00 51.38  ? 246  ASP B CB  1 
ATOM   4984  C CG  . ASP C  2  236 ? 65.643  50.601 84.564  1.00 52.11  ? 246  ASP B CG  1 
ATOM   4985  O OD1 . ASP C  2  236 ? 64.862  50.127 85.424  1.00 52.27  ? 246  ASP B OD1 1 
ATOM   4986  O OD2 . ASP C  2  236 ? 65.893  49.964 83.515  1.00 52.45  ? 246  ASP B OD2 1 
ATOM   4987  N N   . CYS C  2  237 ? 63.392  53.727 86.075  1.00 52.14  ? 247  CYS B N   1 
ATOM   4988  C CA  . CYS C  2  237 ? 62.702  54.100 87.305  1.00 52.51  ? 247  CYS B CA  1 
ATOM   4989  C C   . CYS C  2  237 ? 62.171  52.851 88.002  1.00 52.57  ? 247  CYS B C   1 
ATOM   4990  O O   . CYS C  2  237 ? 60.956  52.632 88.017  1.00 52.56  ? 247  CYS B O   1 
ATOM   4991  C CB  . CYS C  2  237 ? 61.547  55.061 87.006  1.00 52.68  ? 247  CYS B CB  1 
ATOM   4992  S SG  . CYS C  2  237 ? 62.040  56.728 86.489  1.00 53.01  ? 247  CYS B SG  1 
ATOM   4993  O OXT . CYS C  2  237 ? 62.964  52.068 88.535  1.00 52.77  ? 247  CYS B OXT 1 
ATOM   4994  N N   . GLU D  2  1   ? 164.309 41.423 0.647   1.00 89.86  ? 1    GLU D N   1 
ATOM   4995  C CA  . GLU D  2  1   ? 165.601 40.701 0.840   1.00 89.82  ? 1    GLU D CA  1 
ATOM   4996  C C   . GLU D  2  1   ? 165.542 39.688 1.981   1.00 89.85  ? 1    GLU D C   1 
ATOM   4997  O O   . GLU D  2  1   ? 166.232 39.828 2.993   1.00 89.82  ? 1    GLU D O   1 
ATOM   4998  C CB  . GLU D  2  1   ? 166.738 41.697 1.080   1.00 89.88  ? 1    GLU D CB  1 
ATOM   4999  C CG  . GLU D  2  1   ? 167.663 41.874 -0.115  1.00 89.78  ? 1    GLU D CG  1 
ATOM   5000  C CD  . GLU D  2  1   ? 168.518 40.645 -0.377  1.00 89.77  ? 1    GLU D CD  1 
ATOM   5001  O OE1 . GLU D  2  1   ? 169.407 40.347 0.450   1.00 89.40  ? 1    GLU D OE1 1 
ATOM   5002  O OE2 . GLU D  2  1   ? 168.301 39.976 -1.410  1.00 89.90  ? 1    GLU D OE2 1 
ATOM   5003  N N   . ALA D  2  2   ? 164.655 38.709 1.838   1.00 89.82  ? 2    ALA D N   1 
ATOM   5004  C CA  . ALA D  2  2   ? 164.526 37.620 2.786   1.00 89.69  ? 2    ALA D CA  1 
ATOM   5005  C C   . ALA D  2  2   ? 165.135 36.368 2.174   1.00 89.60  ? 2    ALA D C   1 
ATOM   5006  O O   . ALA D  2  2   ? 164.668 35.887 1.140   1.00 89.45  ? 2    ALA D O   1 
ATOM   5007  C CB  . ALA D  2  2   ? 163.058 37.395 3.111   1.00 89.70  ? 2    ALA D CB  1 
ATOM   5008  N N   . ALA D  2  3   ? 166.184 35.848 2.802   1.00 89.52  ? 3    ALA D N   1 
ATOM   5009  C CA  . ALA D  2  3   ? 166.853 34.664 2.285   1.00 89.44  ? 3    ALA D CA  1 
ATOM   5010  C C   . ALA D  2  3   ? 167.831 34.080 3.297   1.00 89.34  ? 3    ALA D C   1 
ATOM   5011  O O   . ALA D  2  3   ? 167.705 34.301 4.497   1.00 89.28  ? 3    ALA D O   1 
ATOM   5012  C CB  . ALA D  2  3   ? 167.573 35.009 0.989   1.00 89.49  ? 3    ALA D CB  1 
ATOM   5013  N N   . VAL D  2  4   ? 168.804 33.329 2.794   1.00 89.29  ? 4    VAL D N   1 
ATOM   5014  C CA  . VAL D  2  4   ? 169.827 32.701 3.619   1.00 89.27  ? 4    VAL D CA  1 
ATOM   5015  C C   . VAL D  2  4   ? 171.214 32.943 3.005   1.00 89.16  ? 4    VAL D C   1 
ATOM   5016  O O   . VAL D  2  4   ? 171.562 32.360 1.979   1.00 89.20  ? 4    VAL D O   1 
ATOM   5017  C CB  . VAL D  2  4   ? 169.569 31.182 3.756   1.00 89.28  ? 4    VAL D CB  1 
ATOM   5018  C CG1 . VAL D  2  4   ? 170.598 30.545 4.677   1.00 89.38  ? 4    VAL D CG1 1 
ATOM   5019  C CG2 . VAL D  2  4   ? 168.164 30.935 4.281   1.00 89.10  ? 4    VAL D CG2 1 
ATOM   5020  N N   . THR D  2  5   ? 171.999 33.811 3.637   1.00 88.97  ? 5    THR D N   1 
ATOM   5021  C CA  . THR D  2  5   ? 173.341 34.136 3.159   1.00 88.73  ? 5    THR D CA  1 
ATOM   5022  C C   . THR D  2  5   ? 174.284 32.950 3.312   1.00 88.71  ? 5    THR D C   1 
ATOM   5023  O O   . THR D  2  5   ? 174.243 32.247 4.320   1.00 88.75  ? 5    THR D O   1 
ATOM   5024  C CB  . THR D  2  5   ? 173.907 35.321 3.949   1.00 88.67  ? 5    THR D CB  1 
ATOM   5025  O OG1 . THR D  2  5   ? 173.110 36.491 3.713   1.00 88.57  ? 5    THR D OG1 1 
ATOM   5026  C CG2 . THR D  2  5   ? 175.324 35.660 3.481   1.00 88.59  ? 5    THR D CG2 1 
ATOM   5027  N N   . GLN D  2  6   ? 175.146 32.740 2.320   1.00 88.69  ? 6    GLN D N   1 
ATOM   5028  C CA  . GLN D  2  6   ? 176.095 31.628 2.367   1.00 88.65  ? 6    GLN D CA  1 
ATOM   5029  C C   . GLN D  2  6   ? 177.568 32.035 2.385   1.00 88.53  ? 6    GLN D C   1 
ATOM   5030  O O   . GLN D  2  6   ? 177.986 32.958 1.684   1.00 88.46  ? 6    GLN D O   1 
ATOM   5031  C CB  . GLN D  2  6   ? 175.840 30.667 1.208   1.00 88.67  ? 6    GLN D CB  1 
ATOM   5032  C CG  . GLN D  2  6   ? 174.655 29.748 1.439   1.00 88.48  ? 6    GLN D CG  1 
ATOM   5033  C CD  . GLN D  2  6   ? 174.779 28.932 2.714   1.00 88.24  ? 6    GLN D CD  1 
ATOM   5034  O OE1 . GLN D  2  6   ? 174.772 29.483 3.813   1.00 88.11  ? 6    GLN D OE1 1 
ATOM   5035  N NE2 . GLN D  2  6   ? 174.892 27.619 2.571   1.00 87.97  ? 6    GLN D NE2 1 
ATOM   5036  N N   . SER D  2  7   ? 178.340 31.314 3.197   1.00 88.46  ? 7    SER D N   1 
ATOM   5037  C CA  . SER D  2  7   ? 179.774 31.533 3.360   1.00 88.40  ? 7    SER D CA  1 
ATOM   5038  C C   . SER D  2  7   ? 180.344 30.390 4.209   1.00 88.28  ? 7    SER D C   1 
ATOM   5039  O O   . SER D  2  7   ? 179.943 30.237 5.367   1.00 88.21  ? 7    SER D O   1 
ATOM   5040  C CB  . SER D  2  7   ? 180.035 32.871 4.064   1.00 88.40  ? 7    SER D CB  1 
ATOM   5041  O OG  . SER D  2  7   ? 179.525 33.966 3.322   1.00 88.35  ? 7    SER D OG  1 
ATOM   5042  N N   . PRO D  2  8   ? 181.289 29.598 3.690   1.00 88.15  ? 8    PRO D N   1 
ATOM   5043  C CA  . PRO D  2  8   ? 181.849 29.658 2.333   1.00 88.01  ? 8    PRO D CA  1 
ATOM   5044  C C   . PRO D  2  8   ? 181.117 28.815 1.290   1.00 87.82  ? 8    PRO D C   1 
ATOM   5045  O O   . PRO D  2  8   ? 180.959 27.604 1.451   1.00 87.74  ? 8    PRO D O   1 
ATOM   5046  C CB  . PRO D  2  8   ? 183.258 29.115 2.557   1.00 88.07  ? 8    PRO D CB  1 
ATOM   5047  C CG  . PRO D  2  8   ? 183.017 28.024 3.538   1.00 88.13  ? 8    PRO D CG  1 
ATOM   5048  C CD  . PRO D  2  8   ? 182.044 28.648 4.523   1.00 88.16  ? 8    PRO D CD  1 
ATOM   5049  N N   . ARG D  2  9   ? 180.691 29.468 0.215   1.00 87.57  ? 9    ARG D N   1 
ATOM   5050  C CA  . ARG D  2  9   ? 179.986 28.800 -0.868  1.00 87.33  ? 9    ARG D CA  1 
ATOM   5051  C C   . ARG D  2  9   ? 180.883 27.723 -1.468  1.00 87.42  ? 9    ARG D C   1 
ATOM   5052  O O   . ARG D  2  9   ? 180.473 26.979 -2.356  1.00 87.27  ? 9    ARG D O   1 
ATOM   5053  C CB  . ARG D  2  9   ? 179.594 29.814 -1.937  1.00 87.12  ? 9    ARG D CB  1 
ATOM   5054  C CG  . ARG D  2  9   ? 179.087 31.130 -1.373  1.00 86.52  ? 9    ARG D CG  1 
ATOM   5055  C CD  . ARG D  2  9   ? 178.737 32.128 -2.456  1.00 85.72  ? 9    ARG D CD  1 
ATOM   5056  N NE  . ARG D  2  9   ? 178.851 33.509 -2.000  1.00 84.91  ? 9    ARG D NE  1 
ATOM   5057  C CZ  . ARG D  2  9   ? 178.676 34.568 -2.781  1.00 84.58  ? 9    ARG D CZ  1 
ATOM   5058  N NH1 . ARG D  2  9   ? 178.371 34.409 -4.064  1.00 84.55  ? 9    ARG D NH1 1 
ATOM   5059  N NH2 . ARG D  2  9   ? 178.808 35.790 -2.282  1.00 84.37  ? 9    ARG D NH2 1 
ATOM   5060  N N   . ASN D  2  10  ? 182.113 27.652 -0.965  1.00 87.62  ? 10   ASN D N   1 
ATOM   5061  C CA  . ASN D  2  10  ? 183.099 26.683 -1.421  1.00 87.77  ? 10   ASN D CA  1 
ATOM   5062  C C   . ASN D  2  10  ? 184.339 26.702 -0.523  1.00 87.86  ? 10   ASN D C   1 
ATOM   5063  O O   . ASN D  2  10  ? 184.884 27.764 -0.224  1.00 87.80  ? 10   ASN D O   1 
ATOM   5064  C CB  . ASN D  2  10  ? 183.498 26.963 -2.875  1.00 87.80  ? 10   ASN D CB  1 
ATOM   5065  C CG  . ASN D  2  10  ? 183.975 28.391 -3.093  1.00 87.80  ? 10   ASN D CG  1 
ATOM   5066  O OD1 . ASN D  2  10  ? 184.986 28.816 -2.537  1.00 87.79  ? 10   ASN D OD1 1 
ATOM   5067  N ND2 . ASN D  2  10  ? 183.252 29.134 -3.920  1.00 88.06  ? 10   ASN D ND2 1 
ATOM   5068  N N   . LYS D  2  11  ? 184.776 25.525 -0.088  1.00 87.99  ? 11   LYS D N   1 
ATOM   5069  C CA  . LYS D  2  11  ? 185.965 25.423 0.751   1.00 88.10  ? 11   LYS D CA  1 
ATOM   5070  C C   . LYS D  2  11  ? 186.605 24.038 0.668   1.00 88.50  ? 11   LYS D C   1 
ATOM   5071  O O   . LYS D  2  11  ? 185.911 23.027 0.559   1.00 88.52  ? 11   LYS D O   1 
ATOM   5072  C CB  . LYS D  2  11  ? 185.624 25.753 2.206   1.00 87.91  ? 11   LYS D CB  1 
ATOM   5073  C CG  . LYS D  2  11  ? 186.797 25.578 3.166   1.00 87.44  ? 11   LYS D CG  1 
ATOM   5074  C CD  . LYS D  2  11  ? 188.021 26.361 2.706   1.00 86.79  ? 11   LYS D CD  1 
ATOM   5075  C CE  . LYS D  2  11  ? 189.240 26.062 3.557   1.00 86.23  ? 11   LYS D CE  1 
ATOM   5076  N NZ  . LYS D  2  11  ? 190.464 26.693 2.994   1.00 85.81  ? 11   LYS D NZ  1 
ATOM   5077  N N   . VAL D  2  12  ? 187.935 24.008 0.712   1.00 88.95  ? 12   VAL D N   1 
ATOM   5078  C CA  . VAL D  2  12  ? 188.699 22.768 0.686   1.00 89.29  ? 12   VAL D CA  1 
ATOM   5079  C C   . VAL D  2  12  ? 189.331 22.600 2.060   1.00 89.52  ? 12   VAL D C   1 
ATOM   5080  O O   . VAL D  2  12  ? 190.493 22.946 2.264   1.00 89.48  ? 12   VAL D O   1 
ATOM   5081  C CB  . VAL D  2  12  ? 189.822 22.799 -0.372  1.00 89.37  ? 12   VAL D CB  1 
ATOM   5082  C CG1 . VAL D  2  12  ? 190.596 21.481 -0.364  1.00 89.44  ? 12   VAL D CG1 1 
ATOM   5083  C CG2 . VAL D  2  12  ? 189.250 23.064 -1.747  1.00 89.41  ? 12   VAL D CG2 1 
ATOM   5084  N N   . ALA D  2  13  ? 188.552 22.086 3.004   1.00 89.89  ? 13   ALA D N   1 
ATOM   5085  C CA  . ALA D  2  13  ? 189.028 21.882 4.368   1.00 90.12  ? 13   ALA D CA  1 
ATOM   5086  C C   . ALA D  2  13  ? 190.297 21.029 4.404   1.00 90.26  ? 13   ALA D C   1 
ATOM   5087  O O   . ALA D  2  13  ? 190.918 20.763 3.373   1.00 90.25  ? 13   ALA D O   1 
ATOM   5088  C CB  . ALA D  2  13  ? 187.935 21.234 5.208   1.00 90.12  ? 13   ALA D CB  1 
ATOM   5089  N N   . VAL D  2  14  ? 190.669 20.609 5.609   1.00 90.35  ? 14   VAL D N   1 
ATOM   5090  C CA  . VAL D  2  14  ? 191.845 19.779 5.829   1.00 90.31  ? 14   VAL D CA  1 
ATOM   5091  C C   . VAL D  2  14  ? 191.343 18.428 6.333   1.00 90.05  ? 14   VAL D C   1 
ATOM   5092  O O   . VAL D  2  14  ? 190.137 18.241 6.487   1.00 90.20  ? 14   VAL D O   1 
ATOM   5093  C CB  . VAL D  2  14  ? 192.768 20.418 6.883   1.00 90.46  ? 14   VAL D CB  1 
ATOM   5094  C CG1 . VAL D  2  14  ? 194.185 19.879 6.760   1.00 90.78  ? 14   VAL D CG1 1 
ATOM   5095  C CG2 . VAL D  2  14  ? 192.755 21.936 6.749   1.00 90.58  ? 14   VAL D CG2 1 
ATOM   5096  N N   . THR D  2  15  ? 192.245 17.484 6.589   1.00 89.63  ? 15   THR D N   1 
ATOM   5097  C CA  . THR D  2  15  ? 191.832 16.181 7.105   1.00 89.27  ? 15   THR D CA  1 
ATOM   5098  C C   . THR D  2  15  ? 191.618 16.321 8.604   1.00 88.87  ? 15   THR D C   1 
ATOM   5099  O O   . THR D  2  15  ? 191.544 15.337 9.338   1.00 88.81  ? 15   THR D O   1 
ATOM   5100  C CB  . THR D  2  15  ? 192.891 15.106 6.837   1.00 89.35  ? 15   THR D CB  1 
ATOM   5101  O OG1 . THR D  2  15  ? 193.223 15.083 5.442   1.00 89.56  ? 15   THR D OG1 1 
ATOM   5102  C CG2 . THR D  2  15  ? 192.338 13.713 7.162   1.00 89.32  ? 15   THR D CG2 1 
ATOM   5103  N N   . GLY D  2  16  ? 191.529 17.566 9.050   1.00 88.36  ? 16   GLY D N   1 
ATOM   5104  C CA  . GLY D  2  16  ? 191.320 17.867 10.449  1.00 87.96  ? 16   GLY D CA  1 
ATOM   5105  C C   . GLY D  2  16  ? 191.023 19.341 10.652  1.00 87.56  ? 16   GLY D C   1 
ATOM   5106  O O   . GLY D  2  16  ? 190.577 19.754 11.719  1.00 87.53  ? 16   GLY D O   1 
ATOM   5107  N N   . GLY D  2  17  ? 191.265 20.135 9.614   1.00 87.08  ? 17   GLY D N   1 
ATOM   5108  C CA  . GLY D  2  17  ? 191.055 21.572 9.665   1.00 86.66  ? 17   GLY D CA  1 
ATOM   5109  C C   . GLY D  2  17  ? 189.666 22.017 10.075  1.00 86.21  ? 17   GLY D C   1 
ATOM   5110  O O   . GLY D  2  17  ? 188.667 21.604 9.486   1.00 86.13  ? 17   GLY D O   1 
ATOM   5111  N N   . LYS D  2  18  ? 189.614 22.878 11.088  1.00 85.63  ? 18   LYS D N   1 
ATOM   5112  C CA  . LYS D  2  18  ? 188.353 23.405 11.586  1.00 85.08  ? 18   LYS D CA  1 
ATOM   5113  C C   . LYS D  2  18  ? 187.614 24.087 10.443  1.00 84.94  ? 18   LYS D C   1 
ATOM   5114  O O   . LYS D  2  18  ? 188.221 24.798 9.639   1.00 84.87  ? 18   LYS D O   1 
ATOM   5115  C CB  . LYS D  2  18  ? 188.602 24.407 12.718  1.00 84.81  ? 18   LYS D CB  1 
ATOM   5116  C CG  . LYS D  2  18  ? 187.374 24.728 13.569  1.00 83.81  ? 18   LYS D CG  1 
ATOM   5117  C CD  . LYS D  2  18  ? 187.670 25.832 14.571  1.00 82.71  ? 18   LYS D CD  1 
ATOM   5118  C CE  . LYS D  2  18  ? 186.851 25.690 15.845  1.00 82.16  ? 18   LYS D CE  1 
ATOM   5119  N NZ  . LYS D  2  18  ? 185.387 25.686 15.599  1.00 82.01  ? 18   LYS D NZ  1 
ATOM   5120  N N   . VAL D  2  19  ? 186.307 23.862 10.369  1.00 84.72  ? 19   VAL D N   1 
ATOM   5121  C CA  . VAL D  2  19  ? 185.484 24.462 9.327   1.00 84.57  ? 19   VAL D CA  1 
ATOM   5122  C C   . VAL D  2  19  ? 184.073 24.734 9.852   1.00 84.21  ? 19   VAL D C   1 
ATOM   5123  O O   . VAL D  2  19  ? 183.352 23.812 10.221  1.00 84.07  ? 19   VAL D O   1 
ATOM   5124  C CB  . VAL D  2  19  ? 185.414 23.555 8.084   1.00 84.73  ? 19   VAL D CB  1 
ATOM   5125  C CG1 . VAL D  2  19  ? 184.537 24.187 7.014   1.00 84.93  ? 19   VAL D CG1 1 
ATOM   5126  C CG2 . VAL D  2  19  ? 186.811 23.303 7.536   1.00 84.84  ? 19   VAL D CG2 1 
ATOM   5127  N N   . THR D  2  20  ? 183.698 26.011 9.889   1.00 83.89  ? 20   THR D N   1 
ATOM   5128  C CA  . THR D  2  20  ? 182.383 26.436 10.364  1.00 83.56  ? 20   THR D CA  1 
ATOM   5129  C C   . THR D  2  20  ? 181.624 27.155 9.252   1.00 83.28  ? 20   THR D C   1 
ATOM   5130  O O   . THR D  2  20  ? 182.024 28.232 8.811   1.00 83.21  ? 20   THR D O   1 
ATOM   5131  C CB  . THR D  2  20  ? 182.525 27.386 11.566  1.00 83.55  ? 20   THR D CB  1 
ATOM   5132  O OG1 . THR D  2  20  ? 183.136 26.701 12.667  1.00 83.48  ? 20   THR D OG1 1 
ATOM   5133  C CG2 . THR D  2  20  ? 181.150 27.849 12.060  1.00 83.42  ? 20   THR D CG2 1 
ATOM   5134  N N   . LEU D  2  21  ? 180.523 26.556 8.815   1.00 83.01  ? 21   LEU D N   1 
ATOM   5135  C CA  . LEU D  2  21  ? 179.701 27.109 7.740   1.00 82.79  ? 21   LEU D CA  1 
ATOM   5136  C C   . LEU D  2  21  ? 178.767 28.222 8.237   1.00 82.44  ? 21   LEU D C   1 
ATOM   5137  O O   . LEU D  2  21  ? 177.786 27.955 8.928   1.00 82.39  ? 21   LEU D O   1 
ATOM   5138  C CB  . LEU D  2  21  ? 178.900 25.976 7.102   1.00 82.87  ? 21   LEU D CB  1 
ATOM   5139  C CG  . LEU D  2  21  ? 179.787 24.829 6.596   1.00 82.96  ? 21   LEU D CG  1 
ATOM   5140  C CD1 . LEU D  2  21  ? 178.990 23.551 6.407   1.00 82.91  ? 21   LEU D CD1 1 
ATOM   5141  C CD2 . LEU D  2  21  ? 180.476 25.236 5.303   1.00 83.14  ? 21   LEU D CD2 1 
ATOM   5142  N N   . SER D  2  22  ? 179.076 29.463 7.863   1.00 81.97  ? 22   SER D N   1 
ATOM   5143  C CA  . SER D  2  22  ? 178.310 30.638 8.289   1.00 81.62  ? 22   SER D CA  1 
ATOM   5144  C C   . SER D  2  22  ? 176.970 30.826 7.575   1.00 81.31  ? 22   SER D C   1 
ATOM   5145  O O   . SER D  2  22  ? 176.859 31.657 6.673   1.00 81.50  ? 22   SER D O   1 
ATOM   5146  C CB  . SER D  2  22  ? 179.152 31.902 8.088   1.00 81.62  ? 22   SER D CB  1 
ATOM   5147  O OG  . SER D  2  22  ? 180.380 31.822 8.792   1.00 81.59  ? 22   SER D OG  1 
ATOM   5148  N N   . CYS D  2  23  ? 175.952 30.080 7.999   1.00 80.73  ? 23   CYS D N   1 
ATOM   5149  C CA  . CYS D  2  23  ? 174.613 30.177 7.413   1.00 80.09  ? 23   CYS D CA  1 
ATOM   5150  C C   . CYS D  2  23  ? 173.788 31.256 8.116   1.00 79.38  ? 23   CYS D C   1 
ATOM   5151  O O   . CYS D  2  23  ? 173.422 31.097 9.282   1.00 79.24  ? 23   CYS D O   1 
ATOM   5152  C CB  . CYS D  2  23  ? 173.896 28.826 7.515   1.00 80.13  ? 23   CYS D CB  1 
ATOM   5153  S SG  . CYS D  2  23  ? 172.160 28.826 7.005   1.00 80.56  ? 23   CYS D SG  1 
ATOM   5154  N N   . ASN D  2  24  ? 173.501 32.347 7.406   1.00 78.58  ? 24   ASN D N   1 
ATOM   5155  C CA  . ASN D  2  24  ? 172.712 33.455 7.954   1.00 77.97  ? 24   ASN D CA  1 
ATOM   5156  C C   . ASN D  2  24  ? 171.253 33.416 7.500   1.00 77.21  ? 24   ASN D C   1 
ATOM   5157  O O   . ASN D  2  24  ? 170.797 32.413 6.957   1.00 77.03  ? 24   ASN D O   1 
ATOM   5158  C CB  . ASN D  2  24  ? 173.331 34.797 7.566   1.00 77.98  ? 24   ASN D CB  1 
ATOM   5159  C CG  . ASN D  2  24  ? 174.559 35.128 8.383   1.00 78.24  ? 24   ASN D CG  1 
ATOM   5160  O OD1 . ASN D  2  24  ? 175.570 34.431 8.315   1.00 78.57  ? 24   ASN D OD1 1 
ATOM   5161  N ND2 . ASN D  2  24  ? 174.478 36.199 9.166   1.00 78.61  ? 24   ASN D ND2 1 
ATOM   5162  N N   . GLN D  2  25  ? 170.528 34.512 7.726   1.00 76.36  ? 25   GLN D N   1 
ATOM   5163  C CA  . GLN D  2  25  ? 169.117 34.600 7.354   1.00 75.82  ? 25   GLN D CA  1 
ATOM   5164  C C   . GLN D  2  25  ? 168.563 36.019 7.500   1.00 75.19  ? 25   GLN D C   1 
ATOM   5165  O O   . GLN D  2  25  ? 169.218 36.895 8.063   1.00 75.39  ? 25   GLN D O   1 
ATOM   5166  C CB  . GLN D  2  25  ? 168.292 33.666 8.234   1.00 75.93  ? 25   GLN D CB  1 
ATOM   5167  C CG  . GLN D  2  25  ? 168.291 34.086 9.700   1.00 76.13  ? 25   GLN D CG  1 
ATOM   5168  C CD  . GLN D  2  25  ? 167.335 33.277 10.552  1.00 76.28  ? 25   GLN D CD  1 
ATOM   5169  O OE1 . GLN D  2  25  ? 167.481 32.062 10.679  1.00 76.06  ? 25   GLN D OE1 1 
ATOM   5170  N NE2 . GLN D  2  25  ? 166.359 33.950 11.147  1.00 76.31  ? 25   GLN D NE2 1 
ATOM   5171  N N   . THR D  2  26  ? 167.345 36.224 6.998   1.00 74.25  ? 26   THR D N   1 
ATOM   5172  C CA  . THR D  2  26  ? 166.640 37.506 7.072   1.00 73.51  ? 26   THR D CA  1 
ATOM   5173  C C   . THR D  2  26  ? 165.152 37.242 6.852   1.00 72.69  ? 26   THR D C   1 
ATOM   5174  O O   . THR D  2  26  ? 164.502 37.948 6.079   1.00 72.88  ? 26   THR D O   1 
ATOM   5175  C CB  . THR D  2  26  ? 167.112 38.499 5.982   1.00 73.63  ? 26   THR D CB  1 
ATOM   5176  O OG1 . THR D  2  26  ? 166.896 37.933 4.681   1.00 73.51  ? 26   THR D OG1 1 
ATOM   5177  C CG2 . THR D  2  26  ? 168.611 38.787 6.081   1.00 73.63  ? 26   THR D CG2 1 
ATOM   5178  N N   . ASN D  2  27  ? 164.610 36.233 7.529   1.00 71.47  ? 27   ASN D N   1 
ATOM   5179  C CA  . ASN D  2  27  ? 163.211 35.853 7.325   1.00 70.30  ? 27   ASN D CA  1 
ATOM   5180  C C   . ASN D  2  27  ? 162.329 35.709 8.573   1.00 69.20  ? 27   ASN D C   1 
ATOM   5181  O O   . ASN D  2  27  ? 161.131 35.439 8.451   1.00 68.85  ? 27   ASN D O   1 
ATOM   5182  C CB  . ASN D  2  27  ? 163.168 34.550 6.535   1.00 70.30  ? 27   ASN D CB  1 
ATOM   5183  C CG  . ASN D  2  27  ? 164.238 33.573 6.970   1.00 70.35  ? 27   ASN D CG  1 
ATOM   5184  O OD1 . ASN D  2  27  ? 164.530 33.439 8.159   1.00 70.08  ? 27   ASN D OD1 1 
ATOM   5185  N ND2 . ASN D  2  27  ? 164.832 32.883 6.006   1.00 70.96  ? 27   ASN D ND2 1 
ATOM   5186  N N   . ASN D  2  28  ? 162.907 35.876 9.758   1.00 67.95  ? 28   ASN D N   1 
ATOM   5187  C CA  . ASN D  2  28  ? 162.141 35.777 11.003  1.00 66.96  ? 28   ASN D CA  1 
ATOM   5188  C C   . ASN D  2  28  ? 161.775 34.349 11.401  1.00 65.96  ? 28   ASN D C   1 
ATOM   5189  O O   . ASN D  2  28  ? 160.917 34.149 12.265  1.00 66.05  ? 28   ASN D O   1 
ATOM   5190  C CB  . ASN D  2  28  ? 160.857 36.611 10.911  1.00 66.92  ? 28   ASN D CB  1 
ATOM   5191  C CG  . ASN D  2  28  ? 161.088 38.083 11.205  1.00 66.99  ? 28   ASN D CG  1 
ATOM   5192  O OD1 . ASN D  2  28  ? 161.807 38.772 10.478  1.00 67.23  ? 28   ASN D OD1 1 
ATOM   5193  N ND2 . ASN D  2  28  ? 160.470 38.574 12.274  1.00 66.63  ? 28   ASN D ND2 1 
ATOM   5194  N N   . HIS D  2  29  ? 162.428 33.361 10.795  1.00 64.62  ? 29   HIS D N   1 
ATOM   5195  C CA  . HIS D  2  29  ? 162.116 31.961 11.080  1.00 63.49  ? 29   HIS D CA  1 
ATOM   5196  C C   . HIS D  2  29  ? 162.856 31.371 12.266  1.00 62.78  ? 29   HIS D C   1 
ATOM   5197  O O   . HIS D  2  29  ? 164.063 31.535 12.409  1.00 62.67  ? 29   HIS D O   1 
ATOM   5198  C CB  . HIS D  2  29  ? 162.375 31.104 9.849   1.00 63.30  ? 29   HIS D CB  1 
ATOM   5199  C CG  . HIS D  2  29  ? 161.509 31.460 8.687   1.00 62.49  ? 29   HIS D CG  1 
ATOM   5200  N ND1 . HIS D  2  29  ? 160.184 31.811 8.832   1.00 61.75  ? 29   HIS D ND1 1 
ATOM   5201  C CD2 . HIS D  2  29  ? 161.776 31.529 7.363   1.00 61.40  ? 29   HIS D CD2 1 
ATOM   5202  C CE1 . HIS D  2  29  ? 159.671 32.075 7.645   1.00 61.61  ? 29   HIS D CE1 1 
ATOM   5203  N NE2 . HIS D  2  29  ? 160.617 31.913 6.737   1.00 61.17  ? 29   HIS D NE2 1 
ATOM   5204  N N   . ASN D  2  30  ? 162.109 30.658 13.101  1.00 61.95  ? 30   ASN D N   1 
ATOM   5205  C CA  . ASN D  2  30  ? 162.665 30.027 14.285  1.00 61.41  ? 30   ASN D CA  1 
ATOM   5206  C C   . ASN D  2  30  ? 163.286 28.688 13.927  1.00 60.81  ? 30   ASN D C   1 
ATOM   5207  O O   . ASN D  2  30  ? 164.006 28.092 14.723  1.00 60.58  ? 30   ASN D O   1 
ATOM   5208  C CB  . ASN D  2  30  ? 161.573 29.822 15.337  1.00 61.47  ? 30   ASN D CB  1 
ATOM   5209  C CG  . ASN D  2  30  ? 160.895 31.113 15.726  1.00 61.73  ? 30   ASN D CG  1 
ATOM   5210  O OD1 . ASN D  2  30  ? 160.374 31.827 14.869  1.00 62.76  ? 30   ASN D OD1 1 
ATOM   5211  N ND2 . ASN D  2  30  ? 160.897 31.426 17.019  1.00 61.80  ? 30   ASN D ND2 1 
ATOM   5212  N N   . ASN D  2  31  ? 163.009 28.216 12.719  1.00 60.27  ? 31   ASN D N   1 
ATOM   5213  C CA  . ASN D  2  31  ? 163.525 26.927 12.288  1.00 59.70  ? 31   ASN D CA  1 
ATOM   5214  C C   . ASN D  2  31  ? 164.657 27.007 11.272  1.00 59.64  ? 31   ASN D C   1 
ATOM   5215  O O   . ASN D  2  31  ? 164.592 27.754 10.301  1.00 59.32  ? 31   ASN D O   1 
ATOM   5216  C CB  . ASN D  2  31  ? 162.382 26.067 11.761  1.00 59.46  ? 31   ASN D CB  1 
ATOM   5217  C CG  . ASN D  2  31  ? 161.489 25.548 12.877  1.00 59.09  ? 31   ASN D CG  1 
ATOM   5218  O OD1 . ASN D  2  31  ? 160.424 24.989 12.628  1.00 58.62  ? 31   ASN D OD1 1 
ATOM   5219  N ND2 . ASN D  2  31  ? 161.927 25.731 14.119  1.00 59.33  ? 31   ASN D ND2 1 
ATOM   5220  N N   . MET D  2  32  ? 165.699 26.224 11.534  1.00 59.89  ? 32   MET D N   1 
ATOM   5221  C CA  . MET D  2  32  ? 166.876 26.142 10.683  1.00 60.00  ? 32   MET D CA  1 
ATOM   5222  C C   . MET D  2  32  ? 167.451 24.736 10.767  1.00 60.61  ? 32   MET D C   1 
ATOM   5223  O O   . MET D  2  32  ? 167.443 24.117 11.834  1.00 60.55  ? 32   MET D O   1 
ATOM   5224  C CB  . MET D  2  32  ? 167.924 27.157 11.115  1.00 59.74  ? 32   MET D CB  1 
ATOM   5225  C CG  . MET D  2  32  ? 167.659 28.537 10.580  1.00 58.87  ? 32   MET D CG  1 
ATOM   5226  S SD  . MET D  2  32  ? 168.955 29.698 10.983  1.00 58.37  ? 32   MET D SD  1 
ATOM   5227  C CE  . MET D  2  32  ? 169.923 29.627 9.471   1.00 57.28  ? 32   MET D CE  1 
ATOM   5228  N N   . TYR D  2  33  ? 167.952 24.235 9.641   1.00 61.37  ? 33   TYR D N   1 
ATOM   5229  C CA  . TYR D  2  33  ? 168.477 22.878 9.580   1.00 62.06  ? 33   TYR D CA  1 
ATOM   5230  C C   . TYR D  2  33  ? 169.711 22.779 8.695   1.00 63.24  ? 33   TYR D C   1 
ATOM   5231  O O   . TYR D  2  33  ? 170.014 23.692 7.929   1.00 63.40  ? 33   TYR D O   1 
ATOM   5232  C CB  . TYR D  2  33  ? 167.384 21.940 9.053   1.00 61.89  ? 33   TYR D CB  1 
ATOM   5233  C CG  . TYR D  2  33  ? 166.015 22.258 9.623   1.00 61.08  ? 33   TYR D CG  1 
ATOM   5234  C CD1 . TYR D  2  33  ? 165.316 23.397 9.225   1.00 60.52  ? 33   TYR D CD1 1 
ATOM   5235  C CD2 . TYR D  2  33  ? 165.439 21.447 10.588  1.00 60.57  ? 33   TYR D CD2 1 
ATOM   5236  C CE1 . TYR D  2  33  ? 164.079 23.710 9.774   1.00 59.79  ? 33   TYR D CE1 1 
ATOM   5237  C CE2 . TYR D  2  33  ? 164.203 21.752 11.140  1.00 60.29  ? 33   TYR D CE2 1 
ATOM   5238  C CZ  . TYR D  2  33  ? 163.531 22.880 10.730  1.00 59.84  ? 33   TYR D CZ  1 
ATOM   5239  O OH  . TYR D  2  33  ? 162.309 23.166 11.288  1.00 59.35  ? 33   TYR D OH  1 
ATOM   5240  N N   . TRP D  2  34  ? 170.423 21.664 8.815   1.00 64.49  ? 34   TRP D N   1 
ATOM   5241  C CA  . TRP D  2  34  ? 171.615 21.414 8.017   1.00 65.46  ? 34   TRP D CA  1 
ATOM   5242  C C   . TRP D  2  34  ? 171.461 20.085 7.304   1.00 66.36  ? 34   TRP D C   1 
ATOM   5243  O O   . TRP D  2  34  ? 171.030 19.108 7.907   1.00 66.46  ? 34   TRP D O   1 
ATOM   5244  C CB  . TRP D  2  34  ? 172.868 21.395 8.898   1.00 65.52  ? 34   TRP D CB  1 
ATOM   5245  C CG  . TRP D  2  34  ? 173.552 22.719 8.931   1.00 65.79  ? 34   TRP D CG  1 
ATOM   5246  C CD1 . TRP D  2  34  ? 173.796 23.493 10.026  1.00 66.22  ? 34   TRP D CD1 1 
ATOM   5247  C CD2 . TRP D  2  34  ? 174.045 23.452 7.805   1.00 65.86  ? 34   TRP D CD2 1 
ATOM   5248  N NE1 . TRP D  2  34  ? 174.416 24.662 9.652   1.00 66.13  ? 34   TRP D NE1 1 
ATOM   5249  C CE2 . TRP D  2  34  ? 174.581 24.660 8.291   1.00 66.09  ? 34   TRP D CE2 1 
ATOM   5250  C CE3 . TRP D  2  34  ? 174.091 23.207 6.429   1.00 66.17  ? 34   TRP D CE3 1 
ATOM   5251  C CZ2 . TRP D  2  34  ? 175.154 25.615 7.455   1.00 66.21  ? 34   TRP D CZ2 1 
ATOM   5252  C CZ3 . TRP D  2  34  ? 174.660 24.155 5.600   1.00 66.32  ? 34   TRP D CZ3 1 
ATOM   5253  C CH2 . TRP D  2  34  ? 175.182 25.345 6.117   1.00 66.33  ? 34   TRP D CH2 1 
ATOM   5254  N N   . TYR D  2  35  ? 171.810 20.045 6.024   1.00 67.46  ? 35   TYR D N   1 
ATOM   5255  C CA  . TYR D  2  35  ? 171.693 18.814 5.256   1.00 68.42  ? 35   TYR D CA  1 
ATOM   5256  C C   . TYR D  2  35  ? 172.965 18.434 4.494   1.00 69.39  ? 35   TYR D C   1 
ATOM   5257  O O   . TYR D  2  35  ? 173.920 19.203 4.425   1.00 69.42  ? 35   TYR D O   1 
ATOM   5258  C CB  . TYR D  2  35  ? 170.527 18.915 4.273   1.00 68.50  ? 35   TYR D CB  1 
ATOM   5259  C CG  . TYR D  2  35  ? 169.154 18.910 4.912   1.00 68.37  ? 35   TYR D CG  1 
ATOM   5260  C CD1 . TYR D  2  35  ? 168.650 20.043 5.541   1.00 68.34  ? 35   TYR D CD1 1 
ATOM   5261  C CD2 . TYR D  2  35  ? 168.354 17.773 4.871   1.00 68.09  ? 35   TYR D CD2 1 
ATOM   5262  C CE1 . TYR D  2  35  ? 167.390 20.038 6.119   1.00 67.89  ? 35   TYR D CE1 1 
ATOM   5263  C CE2 . TYR D  2  35  ? 167.096 17.758 5.444   1.00 67.73  ? 35   TYR D CE2 1 
ATOM   5264  C CZ  . TYR D  2  35  ? 166.617 18.891 6.066   1.00 67.57  ? 35   TYR D CZ  1 
ATOM   5265  O OH  . TYR D  2  35  ? 165.367 18.872 6.639   1.00 66.91  ? 35   TYR D OH  1 
ATOM   5266  N N   . ARG D  2  36  ? 172.952 17.235 3.923   1.00 70.62  ? 36   ARG D N   1 
ATOM   5267  C CA  . ARG D  2  36  ? 174.074 16.713 3.158   1.00 71.70  ? 36   ARG D CA  1 
ATOM   5268  C C   . ARG D  2  36  ? 173.532 16.004 1.917   1.00 72.72  ? 36   ARG D C   1 
ATOM   5269  O O   . ARG D  2  36  ? 173.551 14.778 1.824   1.00 72.81  ? 36   ARG D O   1 
ATOM   5270  C CB  . ARG D  2  36  ? 174.882 15.751 4.028   1.00 71.56  ? 36   ARG D CB  1 
ATOM   5271  C CG  . ARG D  2  36  ? 175.973 14.972 3.325   1.00 71.56  ? 36   ARG D CG  1 
ATOM   5272  C CD  . ARG D  2  36  ? 176.653 14.009 4.289   1.00 71.58  ? 36   ARG D CD  1 
ATOM   5273  N NE  . ARG D  2  36  ? 177.469 12.996 3.632   1.00 71.53  ? 36   ARG D NE  1 
ATOM   5274  C CZ  . ARG D  2  36  ? 178.082 12.007 4.273   1.00 71.48  ? 36   ARG D CZ  1 
ATOM   5275  N NH1 . ARG D  2  36  ? 177.978 11.897 5.592   1.00 71.39  ? 36   ARG D NH1 1 
ATOM   5276  N NH2 . ARG D  2  36  ? 178.801 11.123 3.598   1.00 71.47  ? 36   ARG D NH2 1 
ATOM   5277  N N   . GLN D  2  37  ? 173.027 16.786 0.971   1.00 74.05  ? 37   GLN D N   1 
ATOM   5278  C CA  . GLN D  2  37  ? 172.473 16.230 -0.258  1.00 75.11  ? 37   GLN D CA  1 
ATOM   5279  C C   . GLN D  2  37  ? 173.563 15.685 -1.165  1.00 75.86  ? 37   GLN D C   1 
ATOM   5280  O O   . GLN D  2  37  ? 174.600 16.323 -1.347  1.00 75.83  ? 37   GLN D O   1 
ATOM   5281  C CB  . GLN D  2  37  ? 171.668 17.289 -1.012  1.00 75.26  ? 37   GLN D CB  1 
ATOM   5282  C CG  . GLN D  2  37  ? 170.870 16.744 -2.190  1.00 75.91  ? 37   GLN D CG  1 
ATOM   5283  C CD  . GLN D  2  37  ? 171.745 16.339 -3.363  1.00 76.37  ? 37   GLN D CD  1 
ATOM   5284  O OE1 . GLN D  2  37  ? 171.318 15.578 -4.232  1.00 76.41  ? 37   GLN D OE1 1 
ATOM   5285  N NE2 . GLN D  2  37  ? 172.971 16.849 -3.393  1.00 76.82  ? 37   GLN D NE2 1 
ATOM   5286  N N   . ASP D  2  38  ? 173.323 14.512 -1.748  1.00 76.92  ? 38   ASP D N   1 
ATOM   5287  C CA  . ASP D  2  38  ? 174.299 13.925 -2.660  1.00 77.69  ? 38   ASP D CA  1 
ATOM   5288  C C   . ASP D  2  38  ? 173.838 12.676 -3.406  1.00 78.16  ? 38   ASP D C   1 
ATOM   5289  O O   . ASP D  2  38  ? 172.741 12.164 -3.188  1.00 78.12  ? 38   ASP D O   1 
ATOM   5290  C CB  . ASP D  2  38  ? 175.589 13.622 -1.912  1.00 77.81  ? 38   ASP D CB  1 
ATOM   5291  C CG  . ASP D  2  38  ? 176.774 14.302 -2.534  1.00 78.40  ? 38   ASP D CG  1 
ATOM   5292  O OD1 . ASP D  2  38  ? 176.647 15.496 -2.887  1.00 78.83  ? 38   ASP D OD1 1 
ATOM   5293  O OD2 . ASP D  2  38  ? 177.860 13.711 -2.708  1.00 79.21  ? 38   ASP D OD2 1 
ATOM   5294  N N   . THR D  2  39  ? 174.708 12.204 -4.294  1.00 78.79  ? 39   THR D N   1 
ATOM   5295  C CA  . THR D  2  39  ? 174.453 11.031 -5.119  1.00 79.29  ? 39   THR D CA  1 
ATOM   5296  C C   . THR D  2  39  ? 174.351 9.750  -4.304  1.00 79.79  ? 39   THR D C   1 
ATOM   5297  O O   . THR D  2  39  ? 175.368 9.172  -3.919  1.00 79.89  ? 39   THR D O   1 
ATOM   5298  C CB  . THR D  2  39  ? 175.586 10.857 -6.131  1.00 79.30  ? 39   THR D CB  1 
ATOM   5299  O OG1 . THR D  2  39  ? 175.763 12.068 -6.878  1.00 79.28  ? 39   THR D OG1 1 
ATOM   5300  C CG2 . THR D  2  39  ? 175.238 9.768  -7.145  1.00 79.46  ? 39   THR D CG2 1 
ATOM   5301  N N   . GLY D  2  40  ? 173.126 9.294  -4.065  1.00 80.29  ? 40   GLY D N   1 
ATOM   5302  C CA  . GLY D  2  40  ? 172.917 8.074  -3.306  1.00 80.71  ? 40   GLY D CA  1 
ATOM   5303  C C   . GLY D  2  40  ? 171.681 8.124  -2.427  1.00 81.04  ? 40   GLY D C   1 
ATOM   5304  O O   . GLY D  2  40  ? 170.742 7.350  -2.620  1.00 81.05  ? 40   GLY D O   1 
ATOM   5305  N N   . HIS D  2  41  ? 171.688 9.032  -1.454  1.00 81.36  ? 41   HIS D N   1 
ATOM   5306  C CA  . HIS D  2  41  ? 170.563 9.193  -0.537  1.00 81.61  ? 41   HIS D CA  1 
ATOM   5307  C C   . HIS D  2  41  ? 169.979 10.596 -0.644  1.00 81.58  ? 41   HIS D C   1 
ATOM   5308  O O   . HIS D  2  41  ? 169.054 10.951 0.085   1.00 81.58  ? 41   HIS D O   1 
ATOM   5309  C CB  . HIS D  2  41  ? 171.003 8.923  0.904   1.00 81.74  ? 41   HIS D CB  1 
ATOM   5310  C CG  . HIS D  2  41  ? 171.444 7.513  1.147   1.00 82.24  ? 41   HIS D CG  1 
ATOM   5311  N ND1 . HIS D  2  41  ? 172.672 7.037  0.741   1.00 82.56  ? 41   HIS D ND1 1 
ATOM   5312  C CD2 . HIS D  2  41  ? 170.818 6.475  1.750   1.00 82.58  ? 41   HIS D CD2 1 
ATOM   5313  C CE1 . HIS D  2  41  ? 172.784 5.766  1.084   1.00 82.65  ? 41   HIS D CE1 1 
ATOM   5314  N NE2 . HIS D  2  41  ? 171.673 5.401  1.698   1.00 82.61  ? 41   HIS D NE2 1 
ATOM   5315  N N   . GLY D  2  42  ? 170.525 11.391 -1.557  1.00 81.59  ? 42   GLY D N   1 
ATOM   5316  C CA  . GLY D  2  42  ? 170.053 12.746 -1.756  1.00 81.49  ? 42   GLY D CA  1 
ATOM   5317  C C   . GLY D  2  42  ? 170.379 13.645 -0.583  1.00 81.42  ? 42   GLY D C   1 
ATOM   5318  O O   . GLY D  2  42  ? 171.479 13.596 -0.039  1.00 81.21  ? 42   GLY D O   1 
ATOM   5319  N N   . LEU D  2  43  ? 169.410 14.470 -0.200  1.00 81.54  ? 43   LEU D N   1 
ATOM   5320  C CA  . LEU D  2  43  ? 169.566 15.410 0.902   1.00 81.59  ? 43   LEU D CA  1 
ATOM   5321  C C   . LEU D  2  43  ? 169.284 14.733 2.243   1.00 81.83  ? 43   LEU D C   1 
ATOM   5322  O O   . LEU D  2  43  ? 168.228 14.132 2.431   1.00 81.75  ? 43   LEU D O   1 
ATOM   5323  C CB  . LEU D  2  43  ? 168.620 16.596 0.694   1.00 81.49  ? 43   LEU D CB  1 
ATOM   5324  C CG  . LEU D  2  43  ? 168.765 17.822 1.590   1.00 81.32  ? 43   LEU D CG  1 
ATOM   5325  C CD1 . LEU D  2  43  ? 170.004 18.613 1.230   1.00 81.35  ? 43   LEU D CD1 1 
ATOM   5326  C CD2 . LEU D  2  43  ? 167.542 18.695 1.441   1.00 81.31  ? 43   LEU D CD2 1 
ATOM   5327  N N   . ARG D  2  44  ? 170.240 14.832 3.165   1.00 82.23  ? 44   ARG D N   1 
ATOM   5328  C CA  . ARG D  2  44  ? 170.110 14.250 4.501   1.00 82.51  ? 44   ARG D CA  1 
ATOM   5329  C C   . ARG D  2  44  ? 170.323 15.327 5.567   1.00 82.30  ? 44   ARG D C   1 
ATOM   5330  O O   . ARG D  2  44  ? 171.233 16.142 5.450   1.00 82.32  ? 44   ARG D O   1 
ATOM   5331  C CB  . ARG D  2  44  ? 171.131 13.126 4.705   1.00 82.77  ? 44   ARG D CB  1 
ATOM   5332  C CG  . ARG D  2  44  ? 170.969 11.937 3.768   1.00 83.78  ? 44   ARG D CG  1 
ATOM   5333  C CD  . ARG D  2  44  ? 171.716 12.104 2.452   1.00 84.94  ? 44   ARG D CD  1 
ATOM   5334  N NE  . ARG D  2  44  ? 173.164 11.967 2.608   1.00 85.72  ? 44   ARG D NE  1 
ATOM   5335  C CZ  . ARG D  2  44  ? 174.028 11.919 1.598   1.00 86.39  ? 44   ARG D CZ  1 
ATOM   5336  N NH1 . ARG D  2  44  ? 173.599 12.000 0.346   1.00 86.90  ? 44   ARG D NH1 1 
ATOM   5337  N NH2 . ARG D  2  44  ? 175.326 11.792 1.838   1.00 86.46  ? 44   ARG D NH2 1 
ATOM   5338  N N   . LEU D  2  45  ? 169.489 15.313 6.606   1.00 82.05  ? 45   LEU D N   1 
ATOM   5339  C CA  . LEU D  2  45  ? 169.568 16.284 7.702   1.00 81.76  ? 45   LEU D CA  1 
ATOM   5340  C C   . LEU D  2  45  ? 170.771 16.046 8.623   1.00 81.40  ? 45   LEU D C   1 
ATOM   5341  O O   . LEU D  2  45  ? 171.149 14.903 8.883   1.00 81.48  ? 45   LEU D O   1 
ATOM   5342  C CB  . LEU D  2  45  ? 168.278 16.232 8.529   1.00 81.75  ? 45   LEU D CB  1 
ATOM   5343  C CG  . LEU D  2  45  ? 168.174 17.184 9.720   1.00 81.85  ? 45   LEU D CG  1 
ATOM   5344  C CD1 . LEU D  2  45  ? 168.139 18.625 9.241   1.00 81.77  ? 45   LEU D CD1 1 
ATOM   5345  C CD2 . LEU D  2  45  ? 166.932 16.861 10.529  1.00 81.88  ? 45   LEU D CD2 1 
ATOM   5346  N N   . ILE D  2  46  ? 171.359 17.132 9.122   1.00 80.81  ? 46   ILE D N   1 
ATOM   5347  C CA  . ILE D  2  46  ? 172.513 17.047 10.017  1.00 80.41  ? 46   ILE D CA  1 
ATOM   5348  C C   . ILE D  2  46  ? 172.092 17.416 11.441  1.00 79.95  ? 46   ILE D C   1 
ATOM   5349  O O   . ILE D  2  46  ? 171.920 16.546 12.294  1.00 79.82  ? 46   ILE D O   1 
ATOM   5350  C CB  . ILE D  2  46  ? 173.652 17.984 9.549   1.00 80.39  ? 46   ILE D CB  1 
ATOM   5351  C CG1 . ILE D  2  46  ? 173.898 17.833 8.048   1.00 80.33  ? 46   ILE D CG1 1 
ATOM   5352  C CG2 . ILE D  2  46  ? 174.930 17.667 10.296  1.00 80.28  ? 46   ILE D CG2 1 
ATOM   5353  C CD1 . ILE D  2  46  ? 174.338 16.446 7.639   1.00 80.47  ? 46   ILE D CD1 1 
ATOM   5354  N N   . HIS D  2  47  ? 171.939 18.712 11.689  1.00 79.39  ? 47   HIS D N   1 
ATOM   5355  C CA  . HIS D  2  47  ? 171.516 19.208 12.991  1.00 78.98  ? 47   HIS D CA  1 
ATOM   5356  C C   . HIS D  2  47  ? 170.463 20.280 12.746  1.00 78.59  ? 47   HIS D C   1 
ATOM   5357  O O   . HIS D  2  47  ? 170.508 20.970 11.726  1.00 78.68  ? 47   HIS D O   1 
ATOM   5358  C CB  . HIS D  2  47  ? 172.685 19.834 13.761  1.00 78.93  ? 47   HIS D CB  1 
ATOM   5359  C CG  . HIS D  2  47  ? 173.819 18.895 14.046  1.00 78.85  ? 47   HIS D CG  1 
ATOM   5360  N ND1 . HIS D  2  47  ? 174.638 18.393 13.059  1.00 78.73  ? 47   HIS D ND1 1 
ATOM   5361  C CD2 . HIS D  2  47  ? 174.296 18.403 15.214  1.00 78.63  ? 47   HIS D CD2 1 
ATOM   5362  C CE1 . HIS D  2  47  ? 175.560 17.620 13.604  1.00 78.62  ? 47   HIS D CE1 1 
ATOM   5363  N NE2 . HIS D  2  47  ? 175.375 17.610 14.911  1.00 78.63  ? 47   HIS D NE2 1 
ATOM   5364  N N   . TYR D  2  48  ? 169.519 20.426 13.670  1.00 78.03  ? 48   TYR D N   1 
ATOM   5365  C CA  . TYR D  2  48  ? 168.486 21.448 13.520  1.00 77.42  ? 48   TYR D CA  1 
ATOM   5366  C C   . TYR D  2  48  ? 168.267 22.264 14.791  1.00 76.78  ? 48   TYR D C   1 
ATOM   5367  O O   . TYR D  2  48  ? 168.909 22.020 15.814  1.00 76.51  ? 48   TYR D O   1 
ATOM   5368  C CB  . TYR D  2  48  ? 167.169 20.836 13.019  1.00 77.48  ? 48   TYR D CB  1 
ATOM   5369  C CG  . TYR D  2  48  ? 166.546 19.740 13.863  1.00 77.55  ? 48   TYR D CG  1 
ATOM   5370  C CD1 . TYR D  2  48  ? 165.915 20.026 15.068  1.00 77.61  ? 48   TYR D CD1 1 
ATOM   5371  C CD2 . TYR D  2  48  ? 166.541 18.424 13.421  1.00 77.69  ? 48   TYR D CD2 1 
ATOM   5372  C CE1 . TYR D  2  48  ? 165.320 19.023 15.821  1.00 77.73  ? 48   TYR D CE1 1 
ATOM   5373  C CE2 . TYR D  2  48  ? 165.950 17.415 14.163  1.00 77.74  ? 48   TYR D CE2 1 
ATOM   5374  C CZ  . TYR D  2  48  ? 165.342 17.718 15.363  1.00 77.78  ? 48   TYR D CZ  1 
ATOM   5375  O OH  . TYR D  2  48  ? 164.757 16.716 16.108  1.00 77.59  ? 48   TYR D OH  1 
ATOM   5376  N N   . SER D  2  49  ? 167.359 23.236 14.703  1.00 76.11  ? 49   SER D N   1 
ATOM   5377  C CA  . SER D  2  49  ? 167.049 24.135 15.813  1.00 75.58  ? 49   SER D CA  1 
ATOM   5378  C C   . SER D  2  49  ? 165.554 24.456 15.902  1.00 75.19  ? 49   SER D C   1 
ATOM   5379  O O   . SER D  2  49  ? 164.804 24.220 14.955  1.00 75.10  ? 49   SER D O   1 
ATOM   5380  C CB  . SER D  2  49  ? 167.842 25.432 15.641  1.00 75.46  ? 49   SER D CB  1 
ATOM   5381  O OG  . SER D  2  49  ? 167.368 26.451 16.501  1.00 75.23  ? 49   SER D OG  1 
ATOM   5382  N N   . TYR D  2  50  ? 165.132 24.989 17.048  1.00 74.88  ? 50   TYR D N   1 
ATOM   5383  C CA  . TYR D  2  50  ? 163.734 25.377 17.260  1.00 74.74  ? 50   TYR D CA  1 
ATOM   5384  C C   . TYR D  2  50  ? 163.599 26.873 17.525  1.00 74.70  ? 50   TYR D C   1 
ATOM   5385  O O   . TYR D  2  50  ? 162.593 27.322 18.076  1.00 74.58  ? 50   TYR D O   1 
ATOM   5386  C CB  . TYR D  2  50  ? 163.106 24.586 18.414  1.00 74.56  ? 50   TYR D CB  1 
ATOM   5387  C CG  . TYR D  2  50  ? 162.597 23.229 17.980  1.00 74.48  ? 50   TYR D CG  1 
ATOM   5388  C CD1 . TYR D  2  50  ? 163.254 22.064 18.360  1.00 73.95  ? 50   TYR D CD1 1 
ATOM   5389  C CD2 . TYR D  2  50  ? 161.473 23.112 17.162  1.00 73.95  ? 50   TYR D CD2 1 
ATOM   5390  C CE1 . TYR D  2  50  ? 162.803 20.821 17.948  1.00 73.90  ? 50   TYR D CE1 1 
ATOM   5391  C CE2 . TYR D  2  50  ? 161.016 21.871 16.745  1.00 73.53  ? 50   TYR D CE2 1 
ATOM   5392  C CZ  . TYR D  2  50  ? 161.686 20.732 17.142  1.00 73.57  ? 50   TYR D CZ  1 
ATOM   5393  O OH  . TYR D  2  50  ? 161.247 19.494 16.740  1.00 73.80  ? 50   TYR D OH  1 
ATOM   5394  N N   . GLY D  2  51  ? 164.610 27.639 17.128  1.00 74.71  ? 51   GLY D N   1 
ATOM   5395  C CA  . GLY D  2  51  ? 164.581 29.078 17.317  1.00 74.92  ? 51   GLY D CA  1 
ATOM   5396  C C   . GLY D  2  51  ? 165.901 29.663 17.773  1.00 75.13  ? 51   GLY D C   1 
ATOM   5397  O O   . GLY D  2  51  ? 166.966 29.240 17.331  1.00 75.36  ? 51   GLY D O   1 
ATOM   5398  N N   . ALA D  2  52  ? 165.828 30.645 18.665  1.00 75.27  ? 52   ALA D N   1 
ATOM   5399  C CA  . ALA D  2  52  ? 167.025 31.308 19.172  1.00 75.38  ? 52   ALA D CA  1 
ATOM   5400  C C   . ALA D  2  52  ? 167.797 30.439 20.165  1.00 75.45  ? 52   ALA D C   1 
ATOM   5401  O O   . ALA D  2  52  ? 167.330 30.173 21.271  1.00 75.33  ? 52   ALA D O   1 
ATOM   5402  C CB  . ALA D  2  52  ? 166.651 32.635 19.814  1.00 75.43  ? 52   ALA D CB  1 
ATOM   5403  N N   . GLY D  2  53  ? 168.986 30.006 19.759  1.00 75.63  ? 53   GLY D N   1 
ATOM   5404  C CA  . GLY D  2  53  ? 169.840 29.195 20.609  1.00 75.84  ? 53   GLY D CA  1 
ATOM   5405  C C   . GLY D  2  53  ? 169.312 27.804 20.901  1.00 76.03  ? 53   GLY D C   1 
ATOM   5406  O O   . GLY D  2  53  ? 168.780 27.556 21.980  1.00 76.10  ? 53   GLY D O   1 
ATOM   5407  N N   . SER D  2  54  ? 169.472 26.889 19.950  1.00 76.25  ? 54   SER D N   1 
ATOM   5408  C CA  . SER D  2  54  ? 169.003 25.519 20.124  1.00 76.44  ? 54   SER D CA  1 
ATOM   5409  C C   . SER D  2  54  ? 169.615 24.594 19.079  1.00 76.66  ? 54   SER D C   1 
ATOM   5410  O O   . SER D  2  54  ? 169.832 24.995 17.938  1.00 76.51  ? 54   SER D O   1 
ATOM   5411  C CB  . SER D  2  54  ? 167.476 25.472 20.024  1.00 76.50  ? 54   SER D CB  1 
ATOM   5412  O OG  . SER D  2  54  ? 166.989 24.143 20.118  1.00 76.43  ? 54   SER D OG  1 
ATOM   5413  N N   . THR D  2  55  ? 169.890 23.355 19.476  1.00 77.02  ? 55   THR D N   1 
ATOM   5414  C CA  . THR D  2  55  ? 170.466 22.369 18.566  1.00 77.42  ? 55   THR D CA  1 
ATOM   5415  C C   . THR D  2  55  ? 170.036 20.957 18.935  1.00 77.88  ? 55   THR D C   1 
ATOM   5416  O O   . THR D  2  55  ? 170.390 20.448 19.997  1.00 77.95  ? 55   THR D O   1 
ATOM   5417  C CB  . THR D  2  55  ? 172.001 22.437 18.581  1.00 77.33  ? 55   THR D CB  1 
ATOM   5418  O OG1 . THR D  2  55  ? 172.444 23.680 18.018  1.00 77.21  ? 55   THR D OG1 1 
ATOM   5419  C CG2 . THR D  2  55  ? 172.595 21.335 17.697  1.00 77.10  ? 55   THR D CG2 1 
ATOM   5420  N N   . GLU D  2  56  ? 169.269 20.330 18.050  1.00 78.56  ? 56   GLU D N   1 
ATOM   5421  C CA  . GLU D  2  56  ? 168.798 18.967 18.267  1.00 79.12  ? 56   GLU D CA  1 
ATOM   5422  C C   . GLU D  2  56  ? 169.180 18.073 17.083  1.00 79.82  ? 56   GLU D C   1 
ATOM   5423  O O   . GLU D  2  56  ? 169.400 18.557 15.970  1.00 79.93  ? 56   GLU D O   1 
ATOM   5424  C CB  . GLU D  2  56  ? 167.278 18.950 18.478  1.00 78.95  ? 56   GLU D CB  1 
ATOM   5425  C CG  . GLU D  2  56  ? 166.817 19.384 19.871  1.00 78.46  ? 56   GLU D CG  1 
ATOM   5426  C CD  . GLU D  2  56  ? 166.601 20.883 20.003  1.00 77.75  ? 56   GLU D CD  1 
ATOM   5427  O OE1 . GLU D  2  56  ? 167.509 21.664 19.655  1.00 77.40  ? 56   GLU D OE1 1 
ATOM   5428  O OE2 . GLU D  2  56  ? 165.518 21.282 20.471  1.00 77.02  ? 56   GLU D OE2 1 
ATOM   5429  N N   . LYS D  2  57  ? 169.259 16.769 17.333  1.00 80.59  ? 57   LYS D N   1 
ATOM   5430  C CA  . LYS D  2  57  ? 169.618 15.805 16.297  1.00 81.27  ? 57   LYS D CA  1 
ATOM   5431  C C   . LYS D  2  57  ? 168.367 15.133 15.726  1.00 81.89  ? 57   LYS D C   1 
ATOM   5432  O O   . LYS D  2  57  ? 167.370 14.956 16.428  1.00 81.99  ? 57   LYS D O   1 
ATOM   5433  C CB  . LYS D  2  57  ? 170.565 14.748 16.871  1.00 81.30  ? 57   LYS D CB  1 
ATOM   5434  C CG  . LYS D  2  57  ? 171.791 15.330 17.576  1.00 81.26  ? 57   LYS D CG  1 
ATOM   5435  C CD  . LYS D  2  57  ? 172.758 14.244 18.036  1.00 81.27  ? 57   LYS D CD  1 
ATOM   5436  C CE  . LYS D  2  57  ? 172.124 13.299 19.046  1.00 80.98  ? 57   LYS D CE  1 
ATOM   5437  N NZ  . LYS D  2  57  ? 173.056 12.210 19.449  1.00 80.97  ? 57   LYS D NZ  1 
ATOM   5438  N N   . GLY D  2  58  ? 168.420 14.762 14.451  1.00 82.60  ? 58   GLY D N   1 
ATOM   5439  C CA  . GLY D  2  58  ? 167.281 14.124 13.811  1.00 83.09  ? 58   GLY D CA  1 
ATOM   5440  C C   . GLY D  2  58  ? 167.632 13.095 12.752  1.00 83.55  ? 58   GLY D C   1 
ATOM   5441  O O   . GLY D  2  58  ? 166.818 12.221 12.450  1.00 83.59  ? 58   GLY D O   1 
ATOM   5442  N N   . ASP D  2  59  ? 168.833 13.186 12.188  1.00 84.02  ? 59   ASP D N   1 
ATOM   5443  C CA  . ASP D  2  59  ? 169.248 12.244 11.151  1.00 84.46  ? 59   ASP D CA  1 
ATOM   5444  C C   . ASP D  2  59  ? 170.720 11.824 11.266  1.00 84.62  ? 59   ASP D C   1 
ATOM   5445  O O   . ASP D  2  59  ? 171.018 10.757 11.805  1.00 84.72  ? 59   ASP D O   1 
ATOM   5446  C CB  . ASP D  2  59  ? 168.974 12.840 9.770   1.00 84.54  ? 59   ASP D CB  1 
ATOM   5447  C CG  . ASP D  2  59  ? 169.055 11.814 8.667   1.00 84.69  ? 59   ASP D CG  1 
ATOM   5448  O OD1 . ASP D  2  59  ? 168.243 10.863 8.668   1.00 85.00  ? 59   ASP D OD1 1 
ATOM   5449  O OD2 . ASP D  2  59  ? 169.905 11.898 7.759   1.00 84.87  ? 59   ASP D OD2 1 
ATOM   5450  N N   . ILE D  2  60  ? 171.629 12.656 10.756  1.00 84.69  ? 60   ILE D N   1 
ATOM   5451  C CA  . ILE D  2  60  ? 173.064 12.356 10.781  1.00 84.69  ? 60   ILE D CA  1 
ATOM   5452  C C   . ILE D  2  60  ? 173.819 13.095 11.882  1.00 84.62  ? 60   ILE D C   1 
ATOM   5453  O O   . ILE D  2  60  ? 174.192 14.254 11.701  1.00 84.77  ? 60   ILE D O   1 
ATOM   5454  C CB  . ILE D  2  60  ? 173.722 12.735 9.441   1.00 84.70  ? 60   ILE D CB  1 
ATOM   5455  C CG1 . ILE D  2  60  ? 173.043 12.007 8.283   1.00 84.78  ? 60   ILE D CG1 1 
ATOM   5456  C CG2 . ILE D  2  60  ? 175.211 12.403 9.482   1.00 84.70  ? 60   ILE D CG2 1 
ATOM   5457  C CD1 . ILE D  2  60  ? 173.584 12.400 6.921   1.00 84.73  ? 60   ILE D CD1 1 
ATOM   5458  N N   . PRO D  2  61  ? 174.038 12.456 13.028  1.00 84.49  ? 61   PRO D N   1 
ATOM   5459  C CA  . PRO D  2  61  ? 174.787 13.106 14.103  1.00 84.28  ? 61   PRO D CA  1 
ATOM   5460  C C   . PRO D  2  61  ? 176.308 12.976 13.957  1.00 83.89  ? 61   PRO D C   1 
ATOM   5461  O O   . PRO D  2  61  ? 176.983 13.962 13.657  1.00 83.86  ? 61   PRO D O   1 
ATOM   5462  C CB  . PRO D  2  61  ? 174.265 12.379 15.342  1.00 84.37  ? 61   PRO D CB  1 
ATOM   5463  C CG  . PRO D  2  61  ? 174.097 10.981 14.855  1.00 84.58  ? 61   PRO D CG  1 
ATOM   5464  C CD  . PRO D  2  61  ? 173.484 11.163 13.476  1.00 84.60  ? 61   PRO D CD  1 
ATOM   5465  N N   . ASP D  2  62  ? 176.820 11.766 14.161  1.00 83.41  ? 62   ASP D N   1 
ATOM   5466  C CA  . ASP D  2  62  ? 178.247 11.459 14.083  1.00 83.02  ? 62   ASP D CA  1 
ATOM   5467  C C   . ASP D  2  62  ? 179.026 12.229 13.020  1.00 82.78  ? 62   ASP D C   1 
ATOM   5468  O O   . ASP D  2  62  ? 178.587 12.360 11.878  1.00 82.79  ? 62   ASP D O   1 
ATOM   5469  C CB  . ASP D  2  62  ? 178.423 9.957  13.852  1.00 82.90  ? 62   ASP D CB  1 
ATOM   5470  C CG  . ASP D  2  62  ? 178.108 9.145  15.086  1.00 82.73  ? 62   ASP D CG  1 
ATOM   5471  O OD1 . ASP D  2  62  ? 177.620 8.003  14.947  1.00 82.44  ? 62   ASP D OD1 1 
ATOM   5472  O OD2 . ASP D  2  62  ? 178.326 9.591  16.232  1.00 82.46  ? 62   ASP D OD2 1 
ATOM   5473  N N   . GLY D  2  63  ? 180.196 12.727 13.413  1.00 82.46  ? 63   GLY D N   1 
ATOM   5474  C CA  . GLY D  2  63  ? 181.063 13.451 12.500  1.00 82.14  ? 63   GLY D CA  1 
ATOM   5475  C C   . GLY D  2  63  ? 180.837 14.945 12.455  1.00 81.94  ? 63   GLY D C   1 
ATOM   5476  O O   . GLY D  2  63  ? 181.752 15.708 12.144  1.00 81.77  ? 63   GLY D O   1 
ATOM   5477  N N   . TYR D  2  64  ? 179.552 15.407 12.764  1.00 77.18  ? 65   TYR D N   1 
ATOM   5478  C CA  . TYR D  2  64  ? 179.269 16.831 12.658  1.00 77.08  ? 65   TYR D CA  1 
ATOM   5479  C C   . TYR D  2  64  ? 178.889 17.432 14.003  1.00 76.61  ? 65   TYR D C   1 
ATOM   5480  O O   . TYR D  2  64  ? 178.673 16.722 14.987  1.00 76.59  ? 65   TYR D O   1 
ATOM   5481  C CB  . TYR D  2  64  ? 178.152 17.067 11.642  1.00 77.28  ? 65   TYR D CB  1 
ATOM   5482  C CG  . TYR D  2  64  ? 178.367 16.354 10.326  1.00 77.85  ? 65   TYR D CG  1 
ATOM   5483  C CD1 . TYR D  2  64  ? 177.994 15.024 10.162  1.00 78.36  ? 65   TYR D CD1 1 
ATOM   5484  C CD2 . TYR D  2  64  ? 178.952 17.008 9.248   1.00 78.52  ? 65   TYR D CD2 1 
ATOM   5485  C CE1 . TYR D  2  64  ? 178.199 14.363 8.956   1.00 78.71  ? 65   TYR D CE1 1 
ATOM   5486  C CE2 . TYR D  2  64  ? 179.161 16.358 8.040   1.00 78.84  ? 65   TYR D CE2 1 
ATOM   5487  C CZ  . TYR D  2  64  ? 178.783 15.036 7.899   1.00 78.82  ? 65   TYR D CZ  1 
ATOM   5488  O OH  . TYR D  2  64  ? 178.988 14.389 6.702   1.00 78.88  ? 65   TYR D OH  1 
ATOM   5489  N N   . LYS D  2  65  ? 178.802 18.756 14.018  1.00 75.96  ? 66   LYS D N   1 
ATOM   5490  C CA  . LYS D  2  65  ? 178.464 19.511 15.214  1.00 75.43  ? 66   LYS D CA  1 
ATOM   5491  C C   . LYS D  2  65  ? 177.889 20.856 14.777  1.00 74.60  ? 66   LYS D C   1 
ATOM   5492  O O   . LYS D  2  65  ? 178.404 21.478 13.852  1.00 74.55  ? 66   LYS D O   1 
ATOM   5493  C CB  . LYS D  2  65  ? 179.726 19.718 16.059  1.00 75.65  ? 66   LYS D CB  1 
ATOM   5494  C CG  . LYS D  2  65  ? 179.559 20.590 17.293  1.00 76.02  ? 66   LYS D CG  1 
ATOM   5495  C CD  . LYS D  2  65  ? 180.912 20.844 17.946  1.00 76.44  ? 66   LYS D CD  1 
ATOM   5496  C CE  . LYS D  2  65  ? 180.812 21.770 19.145  1.00 76.68  ? 66   LYS D CE  1 
ATOM   5497  N NZ  . LYS D  2  65  ? 182.157 22.094 19.701  1.00 76.80  ? 66   LYS D NZ  1 
ATOM   5498  N N   . ALA D  2  66  ? 176.827 21.306 15.436  1.00 73.64  ? 67   ALA D N   1 
ATOM   5499  C CA  . ALA D  2  66  ? 176.200 22.577 15.079  1.00 72.82  ? 67   ALA D CA  1 
ATOM   5500  C C   . ALA D  2  66  ? 176.263 23.592 16.214  1.00 72.03  ? 67   ALA D C   1 
ATOM   5501  O O   . ALA D  2  66  ? 176.822 23.317 17.275  1.00 72.05  ? 67   ALA D O   1 
ATOM   5502  C CB  . ALA D  2  66  ? 174.763 22.348 14.665  1.00 72.79  ? 67   ALA D CB  1 
ATOM   5503  N N   . SER D  2  67  ? 175.679 24.765 15.981  1.00 70.99  ? 68   SER D N   1 
ATOM   5504  C CA  . SER D  2  67  ? 175.670 25.832 16.973  1.00 70.26  ? 68   SER D CA  1 
ATOM   5505  C C   . SER D  2  67  ? 174.732 26.971 16.574  1.00 69.60  ? 68   SER D C   1 
ATOM   5506  O O   . SER D  2  67  ? 174.836 27.514 15.476  1.00 69.42  ? 68   SER D O   1 
ATOM   5507  C CB  . SER D  2  67  ? 177.086 26.374 17.170  1.00 70.35  ? 68   SER D CB  1 
ATOM   5508  O OG  . SER D  2  67  ? 177.661 26.758 15.933  1.00 70.24  ? 68   SER D OG  1 
ATOM   5509  N N   . ARG D  2  68  ? 173.827 27.331 17.480  1.00 68.84  ? 69   ARG D N   1 
ATOM   5510  C CA  . ARG D  2  68  ? 172.859 28.401 17.254  1.00 68.25  ? 69   ARG D CA  1 
ATOM   5511  C C   . ARG D  2  68  ? 173.323 29.685 17.955  1.00 68.16  ? 69   ARG D C   1 
ATOM   5512  O O   . ARG D  2  68  ? 172.956 29.922 19.105  1.00 68.01  ? 69   ARG D O   1 
ATOM   5513  C CB  . ARG D  2  68  ? 171.502 27.977 17.828  1.00 67.95  ? 69   ARG D CB  1 
ATOM   5514  C CG  . ARG D  2  68  ? 170.287 28.622 17.185  1.00 66.94  ? 69   ARG D CG  1 
ATOM   5515  C CD  . ARG D  2  68  ? 170.012 28.057 15.807  1.00 65.73  ? 69   ARG D CD  1 
ATOM   5516  N NE  . ARG D  2  68  ? 168.630 28.218 15.369  1.00 64.36  ? 69   ARG D NE  1 
ATOM   5517  C CZ  . ARG D  2  68  ? 168.087 29.366 15.003  1.00 63.63  ? 69   ARG D CZ  1 
ATOM   5518  N NH1 . ARG D  2  68  ? 168.800 30.482 15.028  1.00 63.58  ? 69   ARG D NH1 1 
ATOM   5519  N NH2 . ARG D  2  68  ? 166.820 29.400 14.614  1.00 63.42  ? 69   ARG D NH2 1 
ATOM   5520  N N   . PRO D  2  69  ? 174.167 30.490 17.302  1.00 67.96  ? 70   PRO D N   1 
ATOM   5521  C CA  . PRO D  2  69  ? 174.647 31.741 17.897  1.00 67.95  ? 70   PRO D CA  1 
ATOM   5522  C C   . PRO D  2  69  ? 173.610 32.858 17.976  1.00 68.04  ? 70   PRO D C   1 
ATOM   5523  O O   . PRO D  2  69  ? 173.904 33.921 18.523  1.00 68.28  ? 70   PRO D O   1 
ATOM   5524  C CB  . PRO D  2  69  ? 175.811 32.129 16.980  1.00 67.96  ? 70   PRO D CB  1 
ATOM   5525  C CG  . PRO D  2  69  ? 176.201 30.849 16.328  1.00 67.89  ? 70   PRO D CG  1 
ATOM   5526  C CD  . PRO D  2  69  ? 174.873 30.213 16.042  1.00 67.85  ? 70   PRO D CD  1 
ATOM   5527  N N   . SER D  2  70  ? 172.416 32.610 17.448  1.00 68.05  ? 71   SER D N   1 
ATOM   5528  C CA  . SER D  2  70  ? 171.334 33.589 17.461  1.00 68.01  ? 71   SER D CA  1 
ATOM   5529  C C   . SER D  2  70  ? 170.301 33.253 16.388  1.00 68.16  ? 71   SER D C   1 
ATOM   5530  O O   . SER D  2  70  ? 170.522 32.371 15.557  1.00 68.11  ? 71   SER D O   1 
ATOM   5531  C CB  . SER D  2  70  ? 171.881 34.995 17.219  1.00 67.94  ? 71   SER D CB  1 
ATOM   5532  O OG  . SER D  2  70  ? 172.873 34.986 16.209  1.00 67.78  ? 71   SER D OG  1 
ATOM   5533  N N   . GLN D  2  71  ? 169.172 33.958 16.412  1.00 68.30  ? 72   GLN D N   1 
ATOM   5534  C CA  . GLN D  2  71  ? 168.131 33.760 15.413  1.00 68.48  ? 72   GLN D CA  1 
ATOM   5535  C C   . GLN D  2  71  ? 168.629 34.381 14.115  1.00 69.24  ? 72   GLN D C   1 
ATOM   5536  O O   . GLN D  2  71  ? 168.095 34.127 13.033  1.00 69.19  ? 72   GLN D O   1 
ATOM   5537  C CB  . GLN D  2  71  ? 166.829 34.433 15.842  1.00 68.14  ? 72   GLN D CB  1 
ATOM   5538  C CG  . GLN D  2  71  ? 165.662 34.195 14.892  1.00 67.40  ? 72   GLN D CG  1 
ATOM   5539  C CD  . GLN D  2  71  ? 164.497 33.456 15.547  1.00 67.02  ? 72   GLN D CD  1 
ATOM   5540  O OE1 . GLN D  2  71  ? 163.463 33.223 14.911  1.00 65.82  ? 72   GLN D OE1 1 
ATOM   5541  N NE2 . GLN D  2  71  ? 164.658 33.099 16.820  1.00 66.51  ? 72   GLN D NE2 1 
ATOM   5542  N N   . GLU D  2  72  ? 169.660 35.210 14.241  1.00 70.19  ? 73   GLU D N   1 
ATOM   5543  C CA  . GLU D  2  72  ? 170.274 35.868 13.099  1.00 70.83  ? 73   GLU D CA  1 
ATOM   5544  C C   . GLU D  2  72  ? 171.523 35.073 12.739  1.00 71.49  ? 73   GLU D C   1 
ATOM   5545  O O   . GLU D  2  72  ? 172.551 35.648 12.386  1.00 71.51  ? 73   GLU D O   1 
ATOM   5546  C CB  . GLU D  2  72  ? 170.666 37.311 13.450  1.00 70.83  ? 73   GLU D CB  1 
ATOM   5547  C CG  . GLU D  2  72  ? 169.566 38.158 14.085  1.00 70.75  ? 73   GLU D CG  1 
ATOM   5548  C CD  . GLU D  2  72  ? 168.457 38.539 13.119  1.00 70.59  ? 73   GLU D CD  1 
ATOM   5549  O OE1 . GLU D  2  72  ? 168.763 39.102 12.046  1.00 70.02  ? 73   GLU D OE1 1 
ATOM   5550  O OE2 . GLU D  2  72  ? 167.274 38.287 13.444  1.00 70.35  ? 73   GLU D OE2 1 
ATOM   5551  N N   . ASN D  2  73  ? 171.437 33.749 12.853  1.00 72.33  ? 74   ASN D N   1 
ATOM   5552  C CA  . ASN D  2  73  ? 172.574 32.881 12.554  1.00 73.17  ? 74   ASN D CA  1 
ATOM   5553  C C   . ASN D  2  73  ? 172.272 31.395 12.697  1.00 73.77  ? 74   ASN D C   1 
ATOM   5554  O O   . ASN D  2  73  ? 171.171 31.008 13.082  1.00 74.01  ? 74   ASN D O   1 
ATOM   5555  C CB  . ASN D  2  73  ? 173.762 33.228 13.452  1.00 73.22  ? 74   ASN D CB  1 
ATOM   5556  C CG  . ASN D  2  73  ? 174.822 34.028 12.731  1.00 73.40  ? 74   ASN D CG  1 
ATOM   5557  O OD1 . ASN D  2  73  ? 175.875 34.334 13.291  1.00 73.88  ? 74   ASN D OD1 1 
ATOM   5558  N ND2 . ASN D  2  73  ? 174.553 34.368 11.477  1.00 73.54  ? 74   ASN D ND2 1 
ATOM   5559  N N   . PHE D  2  74  ? 173.280 30.581 12.387  1.00 74.55  ? 75   PHE D N   1 
ATOM   5560  C CA  . PHE D  2  74  ? 173.200 29.124 12.453  1.00 75.08  ? 75   PHE D CA  1 
ATOM   5561  C C   . PHE D  2  74  ? 174.364 28.554 11.648  1.00 75.59  ? 75   PHE D C   1 
ATOM   5562  O O   . PHE D  2  74  ? 174.289 28.470 10.424  1.00 75.53  ? 75   PHE D O   1 
ATOM   5563  C CB  . PHE D  2  74  ? 171.882 28.645 11.858  1.00 75.16  ? 75   PHE D CB  1 
ATOM   5564  C CG  . PHE D  2  74  ? 171.538 27.217 12.172  1.00 75.20  ? 75   PHE D CG  1 
ATOM   5565  C CD1 . PHE D  2  74  ? 171.605 26.734 13.468  1.00 75.16  ? 75   PHE D CD1 1 
ATOM   5566  C CD2 . PHE D  2  74  ? 171.091 26.370 11.170  1.00 75.38  ? 75   PHE D CD2 1 
ATOM   5567  C CE1 . PHE D  2  74  ? 171.246 25.427 13.758  1.00 75.25  ? 75   PHE D CE1 1 
ATOM   5568  C CE2 . PHE D  2  74  ? 170.732 25.063 11.454  1.00 75.25  ? 75   PHE D CE2 1 
ATOM   5569  C CZ  . PHE D  2  74  ? 170.809 24.592 12.747  1.00 75.29  ? 75   PHE D CZ  1 
ATOM   5570  N N   . SER D  2  75  ? 175.438 28.173 12.339  1.00 76.32  ? 76   SER D N   1 
ATOM   5571  C CA  . SER D  2  75  ? 176.634 27.636 11.692  1.00 76.85  ? 76   SER D CA  1 
ATOM   5572  C C   . SER D  2  75  ? 177.025 26.262 12.247  1.00 77.67  ? 76   SER D C   1 
ATOM   5573  O O   . SER D  2  75  ? 177.032 26.056 13.460  1.00 77.68  ? 76   SER D O   1 
ATOM   5574  C CB  . SER D  2  75  ? 177.789 28.617 11.875  1.00 76.73  ? 76   SER D CB  1 
ATOM   5575  O OG  . SER D  2  75  ? 177.379 29.936 11.556  1.00 76.32  ? 76   SER D OG  1 
ATOM   5576  N N   . LEU D  2  76  ? 177.359 25.334 11.350  1.00 78.75  ? 77   LEU D N   1 
ATOM   5577  C CA  . LEU D  2  76  ? 177.732 23.965 11.725  1.00 79.57  ? 77   LEU D CA  1 
ATOM   5578  C C   . LEU D  2  76  ? 179.247 23.755 11.736  1.00 80.41  ? 77   LEU D C   1 
ATOM   5579  O O   . LEU D  2  76  ? 179.906 23.918 10.706  1.00 80.44  ? 77   LEU D O   1 
ATOM   5580  C CB  . LEU D  2  76  ? 177.073 22.971 10.762  1.00 79.52  ? 77   LEU D CB  1 
ATOM   5581  C CG  . LEU D  2  76  ? 177.369 21.481 10.935  1.00 79.31  ? 77   LEU D CG  1 
ATOM   5582  C CD1 . LEU D  2  76  ? 176.277 20.669 10.273  1.00 79.19  ? 77   LEU D CD1 1 
ATOM   5583  C CD2 . LEU D  2  76  ? 178.718 21.133 10.348  1.00 79.33  ? 77   LEU D CD2 1 
ATOM   5584  N N   . ILE D  2  77  ? 179.781 23.365 12.896  1.00 81.42  ? 78   ILE D N   1 
ATOM   5585  C CA  . ILE D  2  77  ? 181.223 23.151 13.076  1.00 82.19  ? 78   ILE D CA  1 
ATOM   5586  C C   . ILE D  2  77  ? 181.671 21.695 12.930  1.00 82.87  ? 78   ILE D C   1 
ATOM   5587  O O   . ILE D  2  77  ? 180.949 20.767 13.290  1.00 82.84  ? 78   ILE D O   1 
ATOM   5588  C CB  . ILE D  2  77  ? 181.684 23.644 14.465  1.00 82.23  ? 78   ILE D CB  1 
ATOM   5589  C CG1 . ILE D  2  77  ? 180.939 24.914 14.877  1.00 82.33  ? 78   ILE D CG1 1 
ATOM   5590  C CG2 . ILE D  2  77  ? 183.185 23.897 14.449  1.00 82.33  ? 78   ILE D CG2 1 
ATOM   5591  C CD1 . ILE D  2  77  ? 179.548 24.661 15.422  1.00 82.29  ? 78   ILE D CD1 1 
ATOM   5592  N N   . LEU D  2  78  ? 182.889 21.515 12.421  1.00 83.82  ? 79   LEU D N   1 
ATOM   5593  C CA  . LEU D  2  78  ? 183.480 20.190 12.236  1.00 84.57  ? 79   LEU D CA  1 
ATOM   5594  C C   . LEU D  2  78  ? 184.978 20.293 11.901  1.00 85.16  ? 79   LEU D C   1 
ATOM   5595  O O   . LEU D  2  78  ? 185.352 20.448 10.739  1.00 85.23  ? 79   LEU D O   1 
ATOM   5596  C CB  . LEU D  2  78  ? 182.731 19.410 11.143  1.00 84.56  ? 79   LEU D CB  1 
ATOM   5597  C CG  . LEU D  2  78  ? 182.680 19.954 9.711   1.00 84.67  ? 79   LEU D CG  1 
ATOM   5598  C CD1 . LEU D  2  78  ? 181.932 18.972 8.833   1.00 84.60  ? 79   LEU D CD1 1 
ATOM   5599  C CD2 . LEU D  2  78  ? 182.009 21.308 9.657   1.00 84.75  ? 79   LEU D CD2 1 
ATOM   5600  N N   . GLU D  2  79  ? 185.828 20.207 12.923  1.00 85.92  ? 80   GLU D N   1 
ATOM   5601  C CA  . GLU D  2  79  ? 187.282 20.295 12.741  1.00 86.54  ? 80   GLU D CA  1 
ATOM   5602  C C   . GLU D  2  79  ? 187.869 19.115 11.956  1.00 86.98  ? 80   GLU D C   1 
ATOM   5603  O O   . GLU D  2  79  ? 188.203 19.244 10.777  1.00 87.04  ? 80   GLU D O   1 
ATOM   5604  C CB  . GLU D  2  79  ? 187.998 20.391 14.098  1.00 86.59  ? 80   GLU D CB  1 
ATOM   5605  C CG  . GLU D  2  79  ? 187.867 21.724 14.823  1.00 86.78  ? 80   GLU D CG  1 
ATOM   5606  C CD  . GLU D  2  79  ? 186.575 21.855 15.610  1.00 86.98  ? 80   GLU D CD  1 
ATOM   5607  O OE1 . GLU D  2  79  ? 186.304 20.988 16.466  1.00 86.95  ? 80   GLU D OE1 1 
ATOM   5608  O OE2 . GLU D  2  79  ? 185.831 22.831 15.379  1.00 87.17  ? 80   GLU D OE2 1 
ATOM   5609  N N   . LEU D  2  80  ? 188.003 17.975 12.632  1.00 87.49  ? 81   LEU D N   1 
ATOM   5610  C CA  . LEU D  2  80  ? 188.561 16.756 12.048  1.00 87.79  ? 81   LEU D CA  1 
ATOM   5611  C C   . LEU D  2  80  ? 187.641 16.143 10.991  1.00 88.13  ? 81   LEU D C   1 
ATOM   5612  O O   . LEU D  2  80  ? 186.760 15.347 11.310  1.00 88.08  ? 81   LEU D O   1 
ATOM   5613  C CB  . LEU D  2  80  ? 188.849 15.742 13.165  1.00 87.78  ? 81   LEU D CB  1 
ATOM   5614  C CG  . LEU D  2  80  ? 189.471 14.384 12.829  1.00 87.68  ? 81   LEU D CG  1 
ATOM   5615  C CD1 . LEU D  2  80  ? 190.197 13.852 14.052  1.00 87.58  ? 81   LEU D CD1 1 
ATOM   5616  C CD2 . LEU D  2  80  ? 188.415 13.394 12.370  1.00 87.55  ? 81   LEU D CD2 1 
ATOM   5617  N N   . ALA D  2  81  ? 187.858 16.516 9.733   1.00 88.60  ? 82   ALA D N   1 
ATOM   5618  C CA  . ALA D  2  81  ? 187.057 16.003 8.629   1.00 89.02  ? 82   ALA D CA  1 
ATOM   5619  C C   . ALA D  2  81  ? 187.452 14.566 8.299   1.00 89.53  ? 82   ALA D C   1 
ATOM   5620  O O   . ALA D  2  81  ? 188.591 14.159 8.525   1.00 89.61  ? 82   ALA D O   1 
ATOM   5621  C CB  . ALA D  2  81  ? 187.226 16.885 7.410   1.00 88.96  ? 82   ALA D CB  1 
ATOM   5622  N N   . THR D  2  82  ? 186.505 13.807 7.756   1.00 90.14  ? 83   THR D N   1 
ATOM   5623  C CA  . THR D  2  82  ? 186.730 12.410 7.394   1.00 90.61  ? 83   THR D CA  1 
ATOM   5624  C C   . THR D  2  82  ? 186.579 12.233 5.882   1.00 90.91  ? 83   THR D C   1 
ATOM   5625  O O   . THR D  2  82  ? 186.010 13.097 5.216   1.00 90.88  ? 83   THR D O   1 
ATOM   5626  C CB  . THR D  2  82  ? 185.719 11.511 8.133   1.00 90.71  ? 83   THR D CB  1 
ATOM   5627  O OG1 . THR D  2  82  ? 185.999 10.128 7.873   1.00 90.81  ? 83   THR D OG1 1 
ATOM   5628  C CG2 . THR D  2  82  ? 184.299 11.762 7.623   1.00 90.76  ? 83   THR D CG2 1 
ATOM   5629  N N   . PRO D  2  83  ? 187.107 11.142 5.324   1.00 91.30  ? 84   PRO D N   1 
ATOM   5630  C CA  . PRO D  2  83  ? 186.975 10.898 3.885   1.00 91.51  ? 84   PRO D CA  1 
ATOM   5631  C C   . PRO D  2  83  ? 185.523 10.960 3.422   1.00 91.62  ? 84   PRO D C   1 
ATOM   5632  O O   . PRO D  2  83  ? 185.245 11.359 2.291   1.00 91.64  ? 84   PRO D O   1 
ATOM   5633  C CB  . PRO D  2  83  ? 187.567 9.498  3.726   1.00 91.55  ? 84   PRO D CB  1 
ATOM   5634  C CG  . PRO D  2  83  ? 188.620 9.460  4.773   1.00 91.51  ? 84   PRO D CG  1 
ATOM   5635  C CD  . PRO D  2  83  ? 187.937 10.103 5.961   1.00 91.36  ? 84   PRO D CD  1 
ATOM   5636  N N   . SER D  2  84  ? 184.608 10.585 4.310   1.00 91.75  ? 85   SER D N   1 
ATOM   5637  C CA  . SER D  2  84  ? 183.182 10.593 4.006   1.00 91.82  ? 85   SER D CA  1 
ATOM   5638  C C   . SER D  2  84  ? 182.533 11.963 4.236   1.00 91.88  ? 85   SER D C   1 
ATOM   5639  O O   . SER D  2  84  ? 181.311 12.093 4.161   1.00 91.92  ? 85   SER D O   1 
ATOM   5640  C CB  . SER D  2  84  ? 182.462 9.526  4.835   1.00 91.77  ? 85   SER D CB  1 
ATOM   5641  O OG  . SER D  2  84  ? 182.689 9.708  6.220   1.00 91.54  ? 85   SER D OG  1 
ATOM   5642  N N   . GLN D  2  85  ? 183.345 12.980 4.515   1.00 91.86  ? 86   GLN D N   1 
ATOM   5643  C CA  . GLN D  2  85  ? 182.823 14.329 4.716   1.00 91.80  ? 86   GLN D CA  1 
ATOM   5644  C C   . GLN D  2  85  ? 182.678 15.040 3.377   1.00 91.45  ? 86   GLN D C   1 
ATOM   5645  O O   . GLN D  2  85  ? 182.196 16.172 3.313   1.00 91.53  ? 86   GLN D O   1 
ATOM   5646  C CB  . GLN D  2  85  ? 183.732 15.151 5.633   1.00 91.98  ? 86   GLN D CB  1 
ATOM   5647  C CG  . GLN D  2  85  ? 183.328 15.117 7.098   1.00 92.52  ? 86   GLN D CG  1 
ATOM   5648  C CD  . GLN D  2  85  ? 183.675 16.396 7.835   1.00 93.00  ? 86   GLN D CD  1 
ATOM   5649  O OE1 . GLN D  2  85  ? 183.440 16.504 9.039   1.00 93.18  ? 86   GLN D OE1 1 
ATOM   5650  N NE2 . GLN D  2  85  ? 184.229 17.368 7.120   1.00 93.07  ? 86   GLN D NE2 1 
ATOM   5651  N N   . THR D  2  86  ? 183.104 14.371 2.310   1.00 90.88  ? 87   THR D N   1 
ATOM   5652  C CA  . THR D  2  86  ? 183.018 14.931 0.969   1.00 90.36  ? 87   THR D CA  1 
ATOM   5653  C C   . THR D  2  86  ? 181.589 14.813 0.457   1.00 89.65  ? 87   THR D C   1 
ATOM   5654  O O   . THR D  2  86  ? 181.104 13.708 0.206   1.00 89.61  ? 87   THR D O   1 
ATOM   5655  C CB  . THR D  2  86  ? 183.952 14.183 0.008   1.00 90.51  ? 87   THR D CB  1 
ATOM   5656  O OG1 . THR D  2  86  ? 185.296 14.209 0.509   1.00 90.60  ? 87   THR D OG1 1 
ATOM   5657  C CG2 . THR D  2  86  ? 183.987 14.877 -1.356  1.00 90.67  ? 87   THR D CG2 1 
ATOM   5658  N N   . SER D  2  87  ? 180.925 15.955 0.300   1.00 88.73  ? 88   SER D N   1 
ATOM   5659  C CA  . SER D  2  87  ? 179.545 16.001 -0.172  1.00 87.90  ? 88   SER D CA  1 
ATOM   5660  C C   . SER D  2  87  ? 179.127 17.453 -0.382  1.00 87.09  ? 88   SER D C   1 
ATOM   5661  O O   . SER D  2  87  ? 179.974 18.338 -0.502  1.00 87.07  ? 88   SER D O   1 
ATOM   5662  C CB  . SER D  2  87  ? 178.617 15.337 0.848   1.00 87.89  ? 88   SER D CB  1 
ATOM   5663  O OG  . SER D  2  87  ? 177.264 15.405 0.435   1.00 88.09  ? 88   SER D OG  1 
ATOM   5664  N N   . VAL D  2  88  ? 177.821 17.693 -0.431  1.00 86.09  ? 89   VAL D N   1 
ATOM   5665  C CA  . VAL D  2  88  ? 177.291 19.040 -0.591  1.00 85.23  ? 89   VAL D CA  1 
ATOM   5666  C C   . VAL D  2  88  ? 176.266 19.271 0.510   1.00 84.66  ? 89   VAL D C   1 
ATOM   5667  O O   . VAL D  2  88  ? 175.310 18.509 0.650   1.00 84.55  ? 89   VAL D O   1 
ATOM   5668  C CB  . VAL D  2  88  ? 176.633 19.242 -1.966  1.00 85.11  ? 89   VAL D CB  1 
ATOM   5669  C CG1 . VAL D  2  88  ? 176.258 20.703 -2.155  1.00 85.00  ? 89   VAL D CG1 1 
ATOM   5670  C CG2 . VAL D  2  88  ? 177.572 18.798 -3.072  1.00 84.75  ? 89   VAL D CG2 1 
ATOM   5671  N N   . TYR D  2  89  ? 176.477 20.326 1.291   1.00 83.99  ? 90   TYR D N   1 
ATOM   5672  C CA  . TYR D  2  89  ? 175.609 20.642 2.417   1.00 83.41  ? 90   TYR D CA  1 
ATOM   5673  C C   . TYR D  2  89  ? 174.730 21.863 2.165   1.00 82.92  ? 90   TYR D C   1 
ATOM   5674  O O   . TYR D  2  89  ? 175.117 22.797 1.463   1.00 82.82  ? 90   TYR D O   1 
ATOM   5675  C CB  . TYR D  2  89  ? 176.455 20.879 3.671   1.00 83.36  ? 90   TYR D CB  1 
ATOM   5676  C CG  . TYR D  2  89  ? 177.439 19.769 3.993   1.00 83.08  ? 90   TYR D CG  1 
ATOM   5677  C CD1 . TYR D  2  89  ? 177.015 18.454 4.142   1.00 82.82  ? 90   TYR D CD1 1 
ATOM   5678  C CD2 . TYR D  2  89  ? 178.792 20.041 4.165   1.00 82.96  ? 90   TYR D CD2 1 
ATOM   5679  C CE1 . TYR D  2  89  ? 177.911 17.442 4.449   1.00 82.79  ? 90   TYR D CE1 1 
ATOM   5680  C CE2 . TYR D  2  89  ? 179.694 19.034 4.473   1.00 82.80  ? 90   TYR D CE2 1 
ATOM   5681  C CZ  . TYR D  2  89  ? 179.248 17.738 4.613   1.00 82.77  ? 90   TYR D CZ  1 
ATOM   5682  O OH  . TYR D  2  89  ? 180.140 16.735 4.920   1.00 82.85  ? 90   TYR D OH  1 
ATOM   5683  N N   . PHE D  2  90  ? 173.542 21.843 2.756   1.00 82.32  ? 91   PHE D N   1 
ATOM   5684  C CA  . PHE D  2  90  ? 172.594 22.939 2.632   1.00 82.03  ? 91   PHE D CA  1 
ATOM   5685  C C   . PHE D  2  90  ? 171.949 23.183 3.988   1.00 81.73  ? 91   PHE D C   1 
ATOM   5686  O O   . PHE D  2  90  ? 171.699 22.240 4.740   1.00 81.67  ? 91   PHE D O   1 
ATOM   5687  C CB  . PHE D  2  90  ? 171.494 22.600 1.623   1.00 82.04  ? 91   PHE D CB  1 
ATOM   5688  C CG  . PHE D  2  90  ? 171.838 22.918 0.186   1.00 81.95  ? 91   PHE D CG  1 
ATOM   5689  C CD1 . PHE D  2  90  ? 172.867 22.257 -0.470  1.00 81.84  ? 91   PHE D CD1 1 
ATOM   5690  C CD2 . PHE D  2  90  ? 171.094 23.853 -0.521  1.00 81.78  ? 91   PHE D CD2 1 
ATOM   5691  C CE1 . PHE D  2  90  ? 173.158 22.536 -1.802  1.00 81.70  ? 91   PHE D CE1 1 
ATOM   5692  C CE2 . PHE D  2  90  ? 171.382 24.136 -1.853  1.00 81.68  ? 91   PHE D CE2 1 
ATOM   5693  C CZ  . PHE D  2  90  ? 172.415 23.475 -2.492  1.00 81.44  ? 91   PHE D CZ  1 
ATOM   5694  N N   . CYS D  2  91  ? 171.683 24.449 4.297   1.00 81.36  ? 92   CYS D N   1 
ATOM   5695  C CA  . CYS D  2  91  ? 171.025 24.815 5.545   1.00 80.95  ? 92   CYS D CA  1 
ATOM   5696  C C   . CYS D  2  91  ? 169.616 25.296 5.221   1.00 80.51  ? 92   CYS D C   1 
ATOM   5697  O O   . CYS D  2  91  ? 169.412 25.995 4.228   1.00 80.55  ? 92   CYS D O   1 
ATOM   5698  C CB  . CYS D  2  91  ? 171.809 25.896 6.298   1.00 80.99  ? 92   CYS D CB  1 
ATOM   5699  S SG  . CYS D  2  91  ? 172.000 27.496 5.481   1.00 80.94  ? 92   CYS D SG  1 
ATOM   5700  N N   . ALA D  2  92  ? 168.649 24.918 6.053   1.00 79.86  ? 93   ALA D N   1 
ATOM   5701  C CA  . ALA D  2  92  ? 167.251 25.288 5.827   1.00 79.32  ? 93   ALA D CA  1 
ATOM   5702  C C   . ALA D  2  92  ? 166.687 26.289 6.844   1.00 78.68  ? 93   ALA D C   1 
ATOM   5703  O O   . ALA D  2  92  ? 167.274 26.528 7.896   1.00 78.61  ? 93   ALA D O   1 
ATOM   5704  C CB  . ALA D  2  92  ? 166.390 24.034 5.797   1.00 79.32  ? 93   ALA D CB  1 
ATOM   5705  N N   . SER D  2  93  ? 165.540 26.868 6.495   1.00 77.86  ? 94   SER D N   1 
ATOM   5706  C CA  . SER D  2  93  ? 164.835 27.833 7.332   1.00 77.17  ? 94   SER D CA  1 
ATOM   5707  C C   . SER D  2  93  ? 163.352 27.485 7.277   1.00 76.49  ? 94   SER D C   1 
ATOM   5708  O O   . SER D  2  93  ? 162.952 26.624 6.501   1.00 76.27  ? 94   SER D O   1 
ATOM   5709  C CB  . SER D  2  93  ? 165.046 29.257 6.809   1.00 77.23  ? 94   SER D CB  1 
ATOM   5710  O OG  . SER D  2  93  ? 166.410 29.638 6.863   1.00 77.38  ? 94   SER D OG  1 
ATOM   5711  N N   . GLY D  2  94  ? 162.532 28.146 8.088   1.00 75.78  ? 95   GLY D N   1 
ATOM   5712  C CA  . GLY D  2  94  ? 161.103 27.874 8.065   1.00 75.22  ? 95   GLY D CA  1 
ATOM   5713  C C   . GLY D  2  94  ? 160.372 27.987 9.389   1.00 74.75  ? 95   GLY D C   1 
ATOM   5714  O O   . GLY D  2  94  ? 160.953 28.339 10.411  1.00 74.73  ? 95   GLY D O   1 
ATOM   5715  N N   . GLY D  2  95  ? 159.079 27.683 9.357   1.00 74.23  ? 96   GLY D N   1 
ATOM   5716  C CA  . GLY D  2  95  ? 158.241 27.743 10.540  1.00 73.86  ? 96   GLY D CA  1 
ATOM   5717  C C   . GLY D  2  95  ? 157.064 26.794 10.409  1.00 73.58  ? 96   GLY D C   1 
ATOM   5718  O O   . GLY D  2  95  ? 155.912 27.216 10.287  1.00 73.21  ? 96   GLY D O   1 
ATOM   5719  N N   . GLY D  2  96  ? 157.365 25.500 10.437  1.00 73.41  ? 97   GLY D N   1 
ATOM   5720  C CA  . GLY D  2  96  ? 156.349 24.477 10.297  1.00 73.15  ? 97   GLY D CA  1 
ATOM   5721  C C   . GLY D  2  96  ? 156.531 23.786 8.962   1.00 73.09  ? 97   GLY D C   1 
ATOM   5722  O O   . GLY D  2  96  ? 156.692 22.568 8.903   1.00 72.86  ? 97   GLY D O   1 
ATOM   5723  N N   . GLY D  2  97  ? 156.524 24.576 7.889   1.00 73.27  ? 98   GLY D N   1 
ATOM   5724  C CA  . GLY D  2  97  ? 156.690 24.044 6.544   1.00 73.48  ? 98   GLY D CA  1 
ATOM   5725  C C   . GLY D  2  97  ? 156.766 25.114 5.473   1.00 73.63  ? 98   GLY D C   1 
ATOM   5726  O O   . GLY D  2  97  ? 156.586 24.851 4.283   1.00 73.62  ? 98   GLY D O   1 
ATOM   5727  N N   . THR D  2  98  ? 157.060 26.411 5.888   1.00 77.91  ? 105  THR D N   1 
ATOM   5728  C CA  . THR D  2  98  ? 157.164 27.499 4.929   1.00 77.94  ? 105  THR D CA  1 
ATOM   5729  C C   . THR D  2  98  ? 158.557 28.114 5.017   1.00 78.28  ? 105  THR D C   1 
ATOM   5730  O O   . THR D  2  98  ? 158.768 29.114 5.699   1.00 78.11  ? 105  THR D O   1 
ATOM   5731  C CB  . THR D  2  98  ? 156.070 28.547 5.192   1.00 77.72  ? 105  THR D CB  1 
ATOM   5732  O OG1 . THR D  2  98  ? 156.245 29.661 4.306   1.00 77.49  ? 105  THR D OG1 1 
ATOM   5733  C CG2 . THR D  2  98  ? 156.164 29.095 6.617   1.00 77.23  ? 105  THR D CG2 1 
ATOM   5734  N N   . LEU D  2  99  ? 159.499 27.503 4.305   1.00 78.86  ? 106  LEU D N   1 
ATOM   5735  C CA  . LEU D  2  99  ? 160.898 27.928 4.309   1.00 79.42  ? 106  LEU D CA  1 
ATOM   5736  C C   . LEU D  2  99  ? 161.195 29.100 3.369   1.00 80.19  ? 106  LEU D C   1 
ATOM   5737  O O   . LEU D  2  99  ? 160.514 29.299 2.361   1.00 80.04  ? 106  LEU D O   1 
ATOM   5738  C CB  . LEU D  2  99  ? 161.805 26.745 3.931   1.00 79.32  ? 106  LEU D CB  1 
ATOM   5739  C CG  . LEU D  2  99  ? 161.256 25.314 4.031   1.00 79.16  ? 106  LEU D CG  1 
ATOM   5740  C CD1 . LEU D  2  99  ? 162.348 24.326 3.652   1.00 79.03  ? 106  LEU D CD1 1 
ATOM   5741  C CD2 . LEU D  2  99  ? 160.733 25.002 5.424   1.00 79.09  ? 106  LEU D CD2 1 
ATOM   5742  N N   . TYR D  2  100 ? 162.225 29.869 3.720   1.00 81.17  ? 107  TYR D N   1 
ATOM   5743  C CA  . TYR D  2  100 ? 162.675 31.011 2.927   1.00 82.09  ? 107  TYR D CA  1 
ATOM   5744  C C   . TYR D  2  100 ? 164.207 30.959 2.815   1.00 82.94  ? 107  TYR D C   1 
ATOM   5745  O O   . TYR D  2  100 ? 164.923 31.452 3.689   1.00 83.06  ? 107  TYR D O   1 
ATOM   5746  C CB  . TYR D  2  100 ? 162.229 32.333 3.568   1.00 82.05  ? 107  TYR D CB  1 
ATOM   5747  C CG  . TYR D  2  100 ? 160.746 32.634 3.420   1.00 81.86  ? 107  TYR D CG  1 
ATOM   5748  C CD1 . TYR D  2  100 ? 159.790 31.851 4.056   1.00 81.71  ? 107  TYR D CD1 1 
ATOM   5749  C CD2 . TYR D  2  100 ? 160.303 33.705 2.649   1.00 81.63  ? 107  TYR D CD2 1 
ATOM   5750  C CE1 . TYR D  2  100 ? 158.439 32.119 3.930   1.00 81.49  ? 107  TYR D CE1 1 
ATOM   5751  C CE2 . TYR D  2  100 ? 158.946 33.980 2.516   1.00 81.45  ? 107  TYR D CE2 1 
ATOM   5752  C CZ  . TYR D  2  100 ? 158.021 33.181 3.161   1.00 81.27  ? 107  TYR D CZ  1 
ATOM   5753  O OH  . TYR D  2  100 ? 156.671 33.433 3.044   1.00 80.98  ? 107  TYR D OH  1 
ATOM   5754  N N   . PHE D  2  101 ? 164.695 30.362 1.730   1.00 83.92  ? 108  PHE D N   1 
ATOM   5755  C CA  . PHE D  2  101 ? 166.130 30.171 1.509   1.00 84.72  ? 108  PHE D CA  1 
ATOM   5756  C C   . PHE D  2  101 ? 166.898 31.367 0.965   1.00 85.72  ? 108  PHE D C   1 
ATOM   5757  O O   . PHE D  2  101 ? 166.338 32.425 0.696   1.00 85.86  ? 108  PHE D O   1 
ATOM   5758  C CB  . PHE D  2  101 ? 166.348 28.981 0.574   1.00 84.56  ? 108  PHE D CB  1 
ATOM   5759  C CG  . PHE D  2  101 ? 166.185 27.653 1.248   1.00 84.26  ? 108  PHE D CG  1 
ATOM   5760  C CD1 . PHE D  2  101 ? 165.068 27.389 2.026   1.00 83.89  ? 108  PHE D CD1 1 
ATOM   5761  C CD2 . PHE D  2  101 ? 167.156 26.672 1.117   1.00 83.98  ? 108  PHE D CD2 1 
ATOM   5762  C CE1 . PHE D  2  101 ? 164.919 26.174 2.655   1.00 83.87  ? 108  PHE D CE1 1 
ATOM   5763  C CE2 . PHE D  2  101 ? 167.012 25.449 1.746   1.00 83.93  ? 108  PHE D CE2 1 
ATOM   5764  C CZ  . PHE D  2  101 ? 165.890 25.199 2.518   1.00 84.11  ? 108  PHE D CZ  1 
ATOM   5765  N N   . GLY D  2  102 ? 168.202 31.162 0.810   1.00 86.91  ? 109  GLY D N   1 
ATOM   5766  C CA  . GLY D  2  102 ? 169.099 32.171 0.284   1.00 87.88  ? 109  GLY D CA  1 
ATOM   5767  C C   . GLY D  2  102 ? 170.211 31.543 -0.533  1.00 88.81  ? 109  GLY D C   1 
ATOM   5768  O O   . GLY D  2  102 ? 170.649 32.125 -1.525  1.00 88.91  ? 109  GLY D O   1 
ATOM   5769  N N   . ALA D  2  103 ? 170.665 30.358 -0.114  1.00 89.90  ? 110  ALA D N   1 
ATOM   5770  C CA  . ALA D  2  103 ? 171.728 29.629 -0.810  1.00 90.73  ? 110  ALA D CA  1 
ATOM   5771  C C   . ALA D  2  103 ? 172.201 28.395 -0.028  1.00 91.55  ? 110  ALA D C   1 
ATOM   5772  O O   . ALA D  2  103 ? 171.575 27.985 0.950   1.00 91.62  ? 110  ALA D O   1 
ATOM   5773  C CB  . ALA D  2  103 ? 172.905 30.555 -1.090  1.00 90.72  ? 110  ALA D CB  1 
ATOM   5774  N N   . GLY D  2  104 ? 173.314 27.814 -0.476  1.00 92.58  ? 111  GLY D N   1 
ATOM   5775  C CA  . GLY D  2  104 ? 173.900 26.636 0.148   1.00 93.34  ? 111  GLY D CA  1 
ATOM   5776  C C   . GLY D  2  104 ? 175.358 26.490 -0.270  1.00 94.05  ? 111  GLY D C   1 
ATOM   5777  O O   . GLY D  2  104 ? 175.846 27.281 -1.077  1.00 94.09  ? 111  GLY D O   1 
ATOM   5778  N N   . THR D  2  105 ? 176.067 25.494 0.261   1.00 94.86  ? 112  THR D N   1 
ATOM   5779  C CA  . THR D  2  105 ? 177.480 25.314 -0.099  1.00 95.52  ? 112  THR D CA  1 
ATOM   5780  C C   . THR D  2  105 ? 177.922 23.859 -0.199  1.00 96.11  ? 112  THR D C   1 
ATOM   5781  O O   . THR D  2  105 ? 177.096 22.949 -0.260  1.00 96.19  ? 112  THR D O   1 
ATOM   5782  C CB  . THR D  2  105 ? 178.399 26.016 0.907   1.00 95.52  ? 112  THR D CB  1 
ATOM   5783  O OG1 . THR D  2  105 ? 178.395 25.303 2.151   1.00 95.66  ? 112  THR D OG1 1 
ATOM   5784  C CG2 . THR D  2  105 ? 177.906 27.423 1.214   1.00 95.56  ? 112  THR D CG2 1 
ATOM   5785  N N   . ARG D  2  106 ? 179.239 23.654 -0.219  1.00 96.79  ? 113  ARG D N   1 
ATOM   5786  C CA  . ARG D  2  106 ? 179.811 22.312 -0.307  1.00 97.34  ? 113  ARG D CA  1 
ATOM   5787  C C   . ARG D  2  106 ? 181.183 22.164 0.360   1.00 98.14  ? 113  ARG D C   1 
ATOM   5788  O O   . ARG D  2  106 ? 181.879 23.150 0.613   1.00 98.27  ? 113  ARG D O   1 
ATOM   5789  C CB  . ARG D  2  106 ? 179.900 21.866 -1.760  1.00 97.15  ? 113  ARG D CB  1 
ATOM   5790  C CG  . ARG D  2  106 ? 180.617 22.817 -2.673  1.00 96.50  ? 113  ARG D CG  1 
ATOM   5791  C CD  . ARG D  2  106 ? 180.950 22.155 -3.992  1.00 95.78  ? 113  ARG D CD  1 
ATOM   5792  N NE  . ARG D  2  106 ? 181.424 23.110 -4.981  1.00 95.21  ? 113  ARG D NE  1 
ATOM   5793  C CZ  . ARG D  2  106 ? 180.658 24.013 -5.575  1.00 94.83  ? 113  ARG D CZ  1 
ATOM   5794  N NH1 . ARG D  2  106 ? 179.366 24.090 -5.281  1.00 94.76  ? 113  ARG D NH1 1 
ATOM   5795  N NH2 . ARG D  2  106 ? 181.182 24.845 -6.463  1.00 94.66  ? 113  ARG D NH2 1 
ATOM   5796  N N   . LEU D  2  107 ? 181.557 20.912 0.627   1.00 99.02  ? 114  LEU D N   1 
ATOM   5797  C CA  . LEU D  2  107 ? 182.822 20.582 1.283   1.00 99.70  ? 114  LEU D CA  1 
ATOM   5798  C C   . LEU D  2  107 ? 183.637 19.532 0.522   1.00 100.19 ? 114  LEU D C   1 
ATOM   5799  O O   . LEU D  2  107 ? 183.103 18.510 0.087   1.00 100.16 ? 114  LEU D O   1 
ATOM   5800  C CB  . LEU D  2  107 ? 182.547 20.076 2.703   1.00 99.78  ? 114  LEU D CB  1 
ATOM   5801  C CG  . LEU D  2  107 ? 183.744 19.552 3.496   1.00 100.11 ? 114  LEU D CG  1 
ATOM   5802  C CD1 . LEU D  2  107 ? 184.780 20.652 3.687   1.00 100.40 ? 114  LEU D CD1 1 
ATOM   5803  C CD2 . LEU D  2  107 ? 183.281 19.017 4.838   1.00 100.19 ? 114  LEU D CD2 1 
ATOM   5804  N N   . SER D  2  108 ? 184.938 19.788 0.389   1.00 100.86 ? 115  SER D N   1 
ATOM   5805  C CA  . SER D  2  108 ? 185.855 18.885 -0.306  1.00 101.38 ? 115  SER D CA  1 
ATOM   5806  C C   . SER D  2  108 ? 187.100 18.612 0.539   1.00 101.73 ? 115  SER D C   1 
ATOM   5807  O O   . SER D  2  108 ? 188.132 19.262 0.366   1.00 101.78 ? 115  SER D O   1 
ATOM   5808  C CB  . SER D  2  108 ? 186.272 19.492 -1.645  1.00 101.45 ? 115  SER D CB  1 
ATOM   5809  O OG  . SER D  2  108 ? 186.907 20.745 -1.455  1.00 101.57 ? 115  SER D OG  1 
ATOM   5810  N N   . VAL D  2  109 ? 187.000 17.644 1.445   1.00 102.15 ? 116  VAL D N   1 
ATOM   5811  C CA  . VAL D  2  109 ? 188.111 17.292 2.325   1.00 102.45 ? 116  VAL D CA  1 
ATOM   5812  C C   . VAL D  2  109 ? 188.959 16.179 1.726   1.00 102.56 ? 116  VAL D C   1 
ATOM   5813  O O   . VAL D  2  109 ? 188.447 15.235 1.124   1.00 102.62 ? 116  VAL D O   1 
ATOM   5814  C CB  . VAL D  2  109 ? 187.614 16.848 3.716   1.00 102.51 ? 116  VAL D CB  1 
ATOM   5815  C CG1 . VAL D  2  109 ? 186.721 17.918 4.314   1.00 102.58 ? 116  VAL D CG1 1 
ATOM   5816  C CG2 . VAL D  2  109 ? 186.875 15.524 3.624   1.00 102.57 ? 116  VAL D CG2 1 
ATOM   5817  N N   . LEU D  2  110 ? 190.322 16.295 1.910   1.00 139.42 ? 316  LEU D N   1 
ATOM   5818  C CA  . LEU D  2  110 ? 191.264 15.308 1.407   1.00 139.37 ? 316  LEU D CA  1 
ATOM   5819  C C   . LEU D  2  110 ? 192.554 15.412 2.216   1.00 136.50 ? 316  LEU D C   1 
ATOM   5820  O O   . LEU D  2  110 ? 192.664 16.242 3.120   1.00 136.81 ? 316  LEU D O   1 
ATOM   5821  C CB  . LEU D  2  110 ? 191.534 15.550 -0.084  1.00 140.57 ? 316  LEU D CB  1 
ATOM   5822  C CG  . LEU D  2  110 ? 192.228 14.438 -0.874  1.00 144.65 ? 316  LEU D CG  1 
ATOM   5823  C CD1 . LEU D  2  110 ? 191.315 13.233 -1.011  1.00 147.07 ? 316  LEU D CD1 1 
ATOM   5824  C CD2 . LEU D  2  110 ? 192.629 14.948 -2.242  1.00 147.12 ? 316  LEU D CD2 1 
ATOM   5825  N N   . GLU D  2  111 ? 193.526 14.569 1.889   1.00 120.75 ? 117  GLU D N   1 
ATOM   5826  C CA  . GLU D  2  111 ? 194.805 14.563 2.588   1.00 117.80 ? 117  GLU D CA  1 
ATOM   5827  C C   . GLU D  2  111 ? 195.855 15.361 1.823   1.00 116.45 ? 117  GLU D C   1 
ATOM   5828  O O   . GLU D  2  111 ? 196.847 15.812 2.397   1.00 116.07 ? 117  GLU D O   1 
ATOM   5829  C CB  . GLU D  2  111 ? 195.293 13.125 2.785   1.00 117.11 ? 117  GLU D CB  1 
ATOM   5830  C CG  . GLU D  2  111 ? 194.317 12.223 3.529   1.00 115.14 ? 117  GLU D CG  1 
ATOM   5831  C CD  . GLU D  2  111 ? 193.085 11.881 2.712   1.00 113.26 ? 117  GLU D CD  1 
ATOM   5832  O OE1 . GLU D  2  111 ? 193.239 11.317 1.608   1.00 112.37 ? 117  GLU D OE1 1 
ATOM   5833  O OE2 . GLU D  2  111 ? 191.961 12.175 3.173   1.00 112.40 ? 117  GLU D OE2 1 
ATOM   5834  N N   . ASP D  2  112 ? 195.634 15.521 0.523   1.00 114.97 ? 118  ASP D N   1 
ATOM   5835  C CA  . ASP D  2  112 ? 196.549 16.265 -0.326  1.00 114.02 ? 118  ASP D CA  1 
ATOM   5836  C C   . ASP D  2  112 ? 195.998 17.668 -0.528  1.00 113.58 ? 118  ASP D C   1 
ATOM   5837  O O   . ASP D  2  112 ? 195.096 17.875 -1.336  1.00 113.47 ? 118  ASP D O   1 
ATOM   5838  C CB  . ASP D  2  112 ? 196.704 15.565 -1.678  1.00 113.83 ? 118  ASP D CB  1 
ATOM   5839  C CG  . ASP D  2  112 ? 197.637 16.304 -2.609  1.00 113.43 ? 118  ASP D CG  1 
ATOM   5840  O OD1 . ASP D  2  112 ? 197.807 15.859 -3.767  1.00 112.99 ? 118  ASP D OD1 1 
ATOM   5841  O OD2 . ASP D  2  112 ? 198.237 17.338 -2.249  1.00 112.93 ? 118  ASP D OD2 1 
ATOM   5842  N N   . LEU D  2  113 ? 196.525 18.626 0.229   1.00 113.13 ? 119  LEU D N   1 
ATOM   5843  C CA  . LEU D  2  113 ? 196.110 20.015 0.106   1.00 112.86 ? 119  LEU D CA  1 
ATOM   5844  C C   . LEU D  2  113 ? 197.052 20.716 -0.852  1.00 112.95 ? 119  LEU D C   1 
ATOM   5845  O O   . LEU D  2  113 ? 196.845 21.871 -1.225  1.00 112.92 ? 119  LEU D O   1 
ATOM   5846  C CB  . LEU D  2  113 ? 196.127 20.710 1.469   1.00 112.67 ? 119  LEU D CB  1 
ATOM   5847  C CG  . LEU D  2  113 ? 195.770 22.202 1.463   1.00 112.22 ? 119  LEU D CG  1 
ATOM   5848  C CD1 . LEU D  2  113 ? 194.422 22.444 0.790   1.00 111.98 ? 119  LEU D CD1 1 
ATOM   5849  C CD2 . LEU D  2  113 ? 195.767 22.746 2.884   1.00 111.93 ? 119  LEU D CD2 1 
ATOM   5850  N N   . ARG D  2  114 ? 198.097 19.995 -1.242  1.00 113.06 ? 120  ARG D N   1 
ATOM   5851  C CA  . ARG D  2  114 ? 199.101 20.506 -2.161  1.00 113.22 ? 120  ARG D CA  1 
ATOM   5852  C C   . ARG D  2  114 ? 198.820 19.898 -3.529  1.00 113.57 ? 120  ARG D C   1 
ATOM   5853  O O   . ARG D  2  114 ? 199.524 19.005 -4.008  1.00 113.58 ? 120  ARG D O   1 
ATOM   5854  C CB  . ARG D  2  114 ? 200.495 20.186 -1.636  1.00 113.11 ? 120  ARG D CB  1 
ATOM   5855  C CG  . ARG D  2  114 ? 200.689 20.519 -0.161  1.00 112.77 ? 120  ARG D CG  1 
ATOM   5856  C CD  . ARG D  2  114 ? 202.042 20.071 0.375   1.00 112.42 ? 120  ARG D CD  1 
ATOM   5857  N NE  . ARG D  2  114 ? 202.241 18.627 0.269   1.00 112.15 ? 120  ARG D NE  1 
ATOM   5858  C CZ  . ARG D  2  114 ? 202.643 18.005 -0.836  1.00 111.94 ? 120  ARG D CZ  1 
ATOM   5859  N NH1 . ARG D  2  114 ? 202.892 18.694 -1.944  1.00 111.74 ? 120  ARG D NH1 1 
ATOM   5860  N NH2 . ARG D  2  114 ? 202.796 16.689 -0.839  1.00 111.94 ? 120  ARG D NH2 1 
ATOM   5861  N N   . ASN D  2  115 ? 197.749 20.408 -4.140  1.00 114.00 ? 121  ASN D N   1 
ATOM   5862  C CA  . ASN D  2  115 ? 197.232 19.845 -5.387  1.00 114.40 ? 121  ASN D CA  1 
ATOM   5863  C C   . ASN D  2  115 ? 196.267 20.740 -6.091  1.00 114.79 ? 121  ASN D C   1 
ATOM   5864  O O   . ASN D  2  115 ? 195.919 20.547 -7.256  1.00 114.77 ? 121  ASN D O   1 
ATOM   5865  C CB  . ASN D  2  115 ? 196.479 18.569 -5.055  1.00 114.39 ? 121  ASN D CB  1 
ATOM   5866  C CG  . ASN D  2  115 ? 195.232 18.833 -4.216  1.00 114.40 ? 121  ASN D CG  1 
ATOM   5867  O OD1 . ASN D  2  115 ? 194.866 19.980 -3.956  1.00 114.31 ? 121  ASN D OD1 1 
ATOM   5868  N ND2 . ASN D  2  115 ? 194.576 17.761 -3.788  1.00 114.36 ? 121  ASN D ND2 1 
ATOM   5869  N N   . VAL D  2  116 ? 195.819 21.710 -5.355  1.00 115.33 ? 122  VAL D N   1 
ATOM   5870  C CA  . VAL D  2  116 ? 194.916 22.633 -5.907  1.00 115.76 ? 122  VAL D CA  1 
ATOM   5871  C C   . VAL D  2  116 ? 195.703 23.607 -6.774  1.00 116.22 ? 122  VAL D C   1 
ATOM   5872  O O   . VAL D  2  116 ? 196.216 24.602 -6.278  1.00 116.25 ? 122  VAL D O   1 
ATOM   5873  C CB  . VAL D  2  116 ? 194.139 23.309 -4.780  1.00 115.73 ? 122  VAL D CB  1 
ATOM   5874  C CG1 . VAL D  2  116 ? 193.172 22.310 -4.149  1.00 115.65 ? 122  VAL D CG1 1 
ATOM   5875  C CG2 . VAL D  2  116 ? 195.078 23.858 -3.722  1.00 115.67 ? 122  VAL D CG2 1 
ATOM   5876  N N   . THR D  2  117 ? 195.802 23.314 -8.071  1.00 116.80 ? 123  THR D N   1 
ATOM   5877  C CA  . THR D  2  117 ? 196.468 24.237 -8.993  1.00 117.32 ? 123  THR D CA  1 
ATOM   5878  C C   . THR D  2  117 ? 195.464 25.135 -9.710  1.00 117.81 ? 123  THR D C   1 
ATOM   5879  O O   . THR D  2  117 ? 194.308 24.759 -9.877  1.00 117.81 ? 123  THR D O   1 
ATOM   5880  C CB  . THR D  2  117 ? 197.289 23.487 -10.050 1.00 117.32 ? 123  THR D CB  1 
ATOM   5881  O OG1 . THR D  2  117 ? 196.459 22.537 -10.734 1.00 117.21 ? 123  THR D OG1 1 
ATOM   5882  C CG2 . THR D  2  117 ? 198.415 22.692 -9.403  1.00 117.35 ? 123  THR D CG2 1 
ATOM   5883  N N   . PRO D  2  118 ? 195.905 26.320 -10.140 1.00 118.47 ? 124  PRO D N   1 
ATOM   5884  C CA  . PRO D  2  118 ? 195.036 27.264 -10.849 1.00 118.90 ? 124  PRO D CA  1 
ATOM   5885  C C   . PRO D  2  118 ? 194.333 26.623 -12.044 1.00 119.39 ? 124  PRO D C   1 
ATOM   5886  O O   . PRO D  2  118 ? 194.826 25.634 -12.582 1.00 119.44 ? 124  PRO D O   1 
ATOM   5887  C CB  . PRO D  2  118 ? 196.016 28.354 -11.287 1.00 118.87 ? 124  PRO D CB  1 
ATOM   5888  C CG  . PRO D  2  118 ? 197.031 28.346 -10.206 1.00 118.72 ? 124  PRO D CG  1 
ATOM   5889  C CD  . PRO D  2  118 ? 197.261 26.874 -9.976  1.00 118.52 ? 124  PRO D CD  1 
ATOM   5890  N N   . PRO D  2  119 ? 193.180 27.160 -12.439 1.00 119.99 ? 125  PRO D N   1 
ATOM   5891  C CA  . PRO D  2  119 ? 192.420 26.611 -13.562 1.00 120.33 ? 125  PRO D CA  1 
ATOM   5892  C C   . PRO D  2  119 ? 192.943 27.068 -14.919 1.00 120.70 ? 125  PRO D C   1 
ATOM   5893  O O   . PRO D  2  119 ? 193.034 28.264 -15.185 1.00 120.69 ? 125  PRO D O   1 
ATOM   5894  C CB  . PRO D  2  119 ? 191.019 27.147 -13.293 1.00 120.30 ? 125  PRO D CB  1 
ATOM   5895  C CG  . PRO D  2  119 ? 191.294 28.504 -12.776 1.00 120.17 ? 125  PRO D CG  1 
ATOM   5896  C CD  . PRO D  2  119 ? 192.462 28.291 -11.824 1.00 120.04 ? 125  PRO D CD  1 
ATOM   5897  N N   . LYS D  2  120 ? 193.295 26.110 -15.767 1.00 121.17 ? 126  LYS D N   1 
ATOM   5898  C CA  . LYS D  2  120 ? 193.800 26.423 -17.096 1.00 121.58 ? 126  LYS D CA  1 
ATOM   5899  C C   . LYS D  2  120 ? 192.635 26.554 -18.070 1.00 121.97 ? 126  LYS D C   1 
ATOM   5900  O O   . LYS D  2  120 ? 191.942 25.578 -18.358 1.00 122.00 ? 126  LYS D O   1 
ATOM   5901  C CB  . LYS D  2  120 ? 194.774 25.345 -17.570 1.00 121.55 ? 126  LYS D CB  1 
ATOM   5902  C CG  . LYS D  2  120 ? 196.082 25.318 -16.792 1.00 121.54 ? 126  LYS D CG  1 
ATOM   5903  C CD  . LYS D  2  120 ? 197.103 24.393 -17.432 1.00 121.51 ? 126  LYS D CD  1 
ATOM   5904  C CE  . LYS D  2  120 ? 198.445 24.478 -16.723 1.00 121.47 ? 126  LYS D CE  1 
ATOM   5905  N NZ  . LYS D  2  120 ? 199.486 23.649 -17.389 1.00 121.47 ? 126  LYS D NZ  1 
ATOM   5906  N N   . VAL D  2  121 ? 192.425 27.768 -18.571 1.00 122.45 ? 127  VAL D N   1 
ATOM   5907  C CA  . VAL D  2  121 ? 191.336 28.045 -19.504 1.00 122.81 ? 127  VAL D CA  1 
ATOM   5908  C C   . VAL D  2  121 ? 191.808 28.164 -20.955 1.00 122.99 ? 127  VAL D C   1 
ATOM   5909  O O   . VAL D  2  121 ? 192.370 29.182 -21.361 1.00 122.94 ? 127  VAL D O   1 
ATOM   5910  C CB  . VAL D  2  121 ? 190.587 29.339 -19.109 1.00 122.93 ? 127  VAL D CB  1 
ATOM   5911  C CG1 . VAL D  2  121 ? 191.560 30.493 -18.955 1.00 123.12 ? 127  VAL D CG1 1 
ATOM   5912  C CG2 . VAL D  2  121 ? 189.515 29.674 -20.135 1.00 123.02 ? 127  VAL D CG2 1 
ATOM   5913  N N   . SER D  2  122 ? 191.566 27.112 -21.731 1.00 123.25 ? 128  SER D N   1 
ATOM   5914  C CA  . SER D  2  122 ? 191.928 27.093 -23.143 1.00 123.47 ? 128  SER D CA  1 
ATOM   5915  C C   . SER D  2  122 ? 190.802 27.765 -23.927 1.00 123.68 ? 128  SER D C   1 
ATOM   5916  O O   . SER D  2  122 ? 189.908 28.364 -23.327 1.00 123.70 ? 128  SER D O   1 
ATOM   5917  C CB  . SER D  2  122 ? 192.124 25.652 -23.617 1.00 123.44 ? 128  SER D CB  1 
ATOM   5918  O OG  . SER D  2  122 ? 193.117 24.991 -22.850 1.00 123.25 ? 128  SER D OG  1 
ATOM   5919  N N   . LEU D  2  123 ? 190.828 27.668 -25.255 1.00 123.91 ? 129  LEU D N   1 
ATOM   5920  C CA  . LEU D  2  123 ? 189.787 28.300 -26.068 1.00 124.07 ? 129  LEU D CA  1 
ATOM   5921  C C   . LEU D  2  123 ? 189.909 27.969 -27.559 1.00 124.15 ? 129  LEU D C   1 
ATOM   5922  O O   . LEU D  2  123 ? 190.729 28.550 -28.266 1.00 124.19 ? 129  LEU D O   1 
ATOM   5923  C CB  . LEU D  2  123 ? 189.832 29.823 -25.864 1.00 124.10 ? 129  LEU D CB  1 
ATOM   5924  C CG  . LEU D  2  123 ? 188.658 30.686 -26.334 1.00 124.16 ? 129  LEU D CG  1 
ATOM   5925  C CD1 . LEU D  2  123 ? 188.846 32.102 -25.804 1.00 124.22 ? 129  LEU D CD1 1 
ATOM   5926  C CD2 . LEU D  2  123 ? 188.545 30.696 -27.846 1.00 124.15 ? 129  LEU D CD2 1 
ATOM   5927  N N   . PHE D  2  124 ? 189.077 27.045 -28.033 1.00 124.22 ? 130  PHE D N   1 
ATOM   5928  C CA  . PHE D  2  124 ? 189.076 26.658 -29.441 1.00 124.28 ? 130  PHE D CA  1 
ATOM   5929  C C   . PHE D  2  124 ? 188.139 27.579 -30.229 1.00 124.39 ? 130  PHE D C   1 
ATOM   5930  O O   . PHE D  2  124 ? 187.420 28.384 -29.638 1.00 124.37 ? 130  PHE D O   1 
ATOM   5931  C CB  . PHE D  2  124 ? 188.624 25.205 -29.595 1.00 124.23 ? 130  PHE D CB  1 
ATOM   5932  C CG  . PHE D  2  124 ? 189.523 24.206 -28.912 1.00 124.11 ? 130  PHE D CG  1 
ATOM   5933  C CD1 . PHE D  2  124 ? 189.502 24.056 -27.533 1.00 124.00 ? 130  PHE D CD1 1 
ATOM   5934  C CD2 . PHE D  2  124 ? 190.382 23.408 -29.654 1.00 123.99 ? 130  PHE D CD2 1 
ATOM   5935  C CE1 . PHE D  2  124 ? 190.326 23.131 -26.905 1.00 123.93 ? 130  PHE D CE1 1 
ATOM   5936  C CE2 . PHE D  2  124 ? 191.207 22.482 -29.034 1.00 123.87 ? 130  PHE D CE2 1 
ATOM   5937  C CZ  . PHE D  2  124 ? 191.179 22.343 -27.657 1.00 123.87 ? 130  PHE D CZ  1 
ATOM   5938  N N   . GLU D  2  125 ? 188.146 27.461 -31.556 1.00 124.50 ? 131  GLU D N   1 
ATOM   5939  C CA  . GLU D  2  125 ? 187.285 28.292 -32.403 1.00 124.59 ? 131  GLU D CA  1 
ATOM   5940  C C   . GLU D  2  125 ? 186.645 27.487 -33.538 1.00 124.43 ? 131  GLU D C   1 
ATOM   5941  O O   . GLU D  2  125 ? 187.153 26.435 -33.920 1.00 124.40 ? 131  GLU D O   1 
ATOM   5942  C CB  . GLU D  2  125 ? 188.075 29.475 -32.980 1.00 124.72 ? 131  GLU D CB  1 
ATOM   5943  C CG  . GLU D  2  125 ? 189.109 29.105 -34.032 1.00 125.14 ? 131  GLU D CG  1 
ATOM   5944  C CD  . GLU D  2  125 ? 190.084 30.235 -34.307 1.00 125.54 ? 131  GLU D CD  1 
ATOM   5945  O OE1 . GLU D  2  125 ? 190.653 30.777 -33.336 1.00 125.82 ? 131  GLU D OE1 1 
ATOM   5946  O OE2 . GLU D  2  125 ? 190.283 30.583 -35.490 1.00 125.71 ? 131  GLU D OE2 1 
ATOM   5947  N N   . PRO D  2  126 ? 185.556 28.008 -34.106 1.00 124.26 ? 132  PRO D N   1 
ATOM   5948  C CA  . PRO D  2  126 ? 184.822 27.331 -35.180 1.00 124.14 ? 132  PRO D CA  1 
ATOM   5949  C C   . PRO D  2  126 ? 185.674 27.021 -36.410 1.00 123.98 ? 132  PRO D C   1 
ATOM   5950  O O   . PRO D  2  126 ? 186.729 27.622 -36.619 1.00 123.93 ? 132  PRO D O   1 
ATOM   5951  C CB  . PRO D  2  126 ? 183.714 28.333 -35.511 1.00 124.15 ? 132  PRO D CB  1 
ATOM   5952  C CG  . PRO D  2  126 ? 184.313 29.641 -35.153 1.00 124.19 ? 132  PRO D CG  1 
ATOM   5953  C CD  . PRO D  2  126 ? 184.983 29.338 -33.842 1.00 124.24 ? 132  PRO D CD  1 
ATOM   5954  N N   . SER D  2  127 ? 185.205 26.068 -37.208 1.00 123.76 ? 133  SER D N   1 
ATOM   5955  C CA  . SER D  2  127 ? 185.898 25.654 -38.419 1.00 123.59 ? 133  SER D CA  1 
ATOM   5956  C C   . SER D  2  127 ? 185.650 26.666 -39.530 1.00 123.40 ? 133  SER D C   1 
ATOM   5957  O O   . SER D  2  127 ? 185.169 27.772 -39.279 1.00 123.41 ? 133  SER D O   1 
ATOM   5958  C CB  . SER D  2  127 ? 185.404 24.277 -38.862 1.00 123.57 ? 133  SER D CB  1 
ATOM   5959  O OG  . SER D  2  127 ? 184.033 24.322 -39.211 1.00 123.51 ? 133  SER D OG  1 
ATOM   5960  N N   . LYS D  2  128 ? 185.980 26.282 -40.758 1.00 123.12 ? 134  LYS D N   1 
ATOM   5961  C CA  . LYS D  2  128 ? 185.778 27.150 -41.909 1.00 122.87 ? 134  LYS D CA  1 
ATOM   5962  C C   . LYS D  2  128 ? 184.651 26.599 -42.773 1.00 122.62 ? 134  LYS D C   1 
ATOM   5963  O O   . LYS D  2  128 ? 184.466 27.022 -43.914 1.00 122.61 ? 134  LYS D O   1 
ATOM   5964  C CB  . LYS D  2  128 ? 187.065 27.265 -42.726 1.00 122.86 ? 134  LYS D CB  1 
ATOM   5965  C CG  . LYS D  2  128 ? 188.228 27.886 -41.962 1.00 122.85 ? 134  LYS D CG  1 
ATOM   5966  C CD  . LYS D  2  128 ? 187.891 29.280 -41.445 1.00 122.79 ? 134  LYS D CD  1 
ATOM   5967  C CE  . LYS D  2  128 ? 187.622 30.252 -42.582 1.00 122.72 ? 134  LYS D CE  1 
ATOM   5968  N NZ  . LYS D  2  128 ? 188.818 30.439 -43.446 1.00 122.65 ? 134  LYS D NZ  1 
ATOM   5969  N N   . ALA D  2  129 ? 183.905 25.648 -42.217 1.00 122.31 ? 135  ALA D N   1 
ATOM   5970  C CA  . ALA D  2  129 ? 182.786 25.036 -42.921 1.00 122.07 ? 135  ALA D CA  1 
ATOM   5971  C C   . ALA D  2  129 ? 181.473 25.506 -42.318 1.00 121.85 ? 135  ALA D C   1 
ATOM   5972  O O   . ALA D  2  129 ? 180.396 25.183 -42.820 1.00 121.81 ? 135  ALA D O   1 
ATOM   5973  C CB  . ALA D  2  129 ? 182.877 23.529 -42.849 1.00 122.06 ? 135  ALA D CB  1 
ATOM   5974  N N   . GLU D  2  130 ? 181.572 26.263 -41.232 1.00 121.61 ? 136  GLU D N   1 
ATOM   5975  C CA  . GLU D  2  130 ? 180.400 26.783 -40.543 1.00 121.43 ? 136  GLU D CA  1 
ATOM   5976  C C   . GLU D  2  130 ? 180.610 28.250 -40.200 1.00 121.28 ? 136  GLU D C   1 
ATOM   5977  O O   . GLU D  2  130 ? 180.284 28.697 -39.101 1.00 121.32 ? 136  GLU D O   1 
ATOM   5978  C CB  . GLU D  2  130 ? 180.150 25.991 -39.264 1.00 121.41 ? 136  GLU D CB  1 
ATOM   5979  C CG  . GLU D  2  130 ? 181.309 26.043 -38.284 1.00 121.35 ? 136  GLU D CG  1 
ATOM   5980  C CD  . GLU D  2  130 ? 181.059 25.218 -37.041 1.00 121.27 ? 136  GLU D CD  1 
ATOM   5981  O OE1 . GLU D  2  130 ? 180.036 25.455 -36.365 1.00 121.09 ? 136  GLU D OE1 1 
ATOM   5982  O OE2 . GLU D  2  130 ? 181.887 24.335 -36.740 1.00 121.24 ? 136  GLU D OE2 1 
ATOM   5983  N N   . ILE D  2  131 ? 181.163 28.995 -41.147 1.00 121.05 ? 137  ILE D N   1 
ATOM   5984  C CA  . ILE D  2  131 ? 181.434 30.411 -40.949 1.00 120.81 ? 137  ILE D CA  1 
ATOM   5985  C C   . ILE D  2  131 ? 180.882 31.187 -42.153 1.00 120.66 ? 137  ILE D C   1 
ATOM   5986  O O   . ILE D  2  131 ? 181.322 32.296 -42.455 1.00 120.67 ? 137  ILE D O   1 
ATOM   5987  C CB  . ILE D  2  131 ? 182.962 30.628 -40.739 1.00 120.79 ? 137  ILE D CB  1 
ATOM   5988  C CG1 . ILE D  2  131 ? 183.286 32.108 -40.509 1.00 120.59 ? 137  ILE D CG1 1 
ATOM   5989  C CG2 . ILE D  2  131 ? 183.743 30.015 -41.897 1.00 120.81 ? 137  ILE D CG2 1 
ATOM   5990  C CD1 . ILE D  2  131 ? 184.766 32.400 -40.323 1.00 120.39 ? 137  ILE D CD1 1 
ATOM   5991  N N   . ALA D  2  132 ? 179.900 30.584 -42.825 1.00 120.42 ? 138  ALA D N   1 
ATOM   5992  C CA  . ALA D  2  132 ? 179.251 31.181 -43.991 1.00 120.24 ? 138  ALA D CA  1 
ATOM   5993  C C   . ALA D  2  132 ? 177.958 30.434 -44.335 1.00 120.10 ? 138  ALA D C   1 
ATOM   5994  O O   . ALA D  2  132 ? 176.889 31.037 -44.426 1.00 120.09 ? 138  ALA D O   1 
ATOM   5995  C CB  . ALA D  2  132 ? 180.192 31.169 -45.186 1.00 120.24 ? 138  ALA D CB  1 
ATOM   5996  N N   . ASN D  2  133 ? 178.070 29.119 -44.520 1.00 119.95 ? 139  ASN D N   1 
ATOM   5997  C CA  . ASN D  2  133 ? 176.937 28.254 -44.864 1.00 119.84 ? 139  ASN D CA  1 
ATOM   5998  C C   . ASN D  2  133 ? 175.597 28.621 -44.224 1.00 119.88 ? 139  ASN D C   1 
ATOM   5999  O O   . ASN D  2  133 ? 174.547 28.471 -44.849 1.00 119.81 ? 139  ASN D O   1 
ATOM   6000  C CB  . ASN D  2  133 ? 177.264 26.801 -44.505 1.00 119.77 ? 139  ASN D CB  1 
ATOM   6001  C CG  . ASN D  2  133 ? 178.029 26.081 -45.602 1.00 119.65 ? 139  ASN D CG  1 
ATOM   6002  O OD1 . ASN D  2  133 ? 178.466 24.944 -45.423 1.00 119.40 ? 139  ASN D OD1 1 
ATOM   6003  N ND2 . ASN D  2  133 ? 178.188 26.736 -46.747 1.00 119.60 ? 139  ASN D ND2 1 
ATOM   6004  N N   . LYS D  2  134 ? 175.633 29.089 -42.981 1.00 119.98 ? 140  LYS D N   1 
ATOM   6005  C CA  . LYS D  2  134 ? 174.409 29.425 -42.260 1.00 120.10 ? 140  LYS D CA  1 
ATOM   6006  C C   . LYS D  2  134 ? 174.516 30.735 -41.486 1.00 120.18 ? 140  LYS D C   1 
ATOM   6007  O O   . LYS D  2  134 ? 173.625 31.068 -40.704 1.00 120.18 ? 140  LYS D O   1 
ATOM   6008  C CB  . LYS D  2  134 ? 174.076 28.305 -41.277 1.00 120.16 ? 140  LYS D CB  1 
ATOM   6009  C CG  . LYS D  2  134 ? 175.226 28.001 -40.327 1.00 120.15 ? 140  LYS D CG  1 
ATOM   6010  C CD  . LYS D  2  134 ? 174.819 27.105 -39.179 1.00 120.22 ? 140  LYS D CD  1 
ATOM   6011  C CE  . LYS D  2  134 ? 176.004 26.839 -38.264 1.00 120.29 ? 140  LYS D CE  1 
ATOM   6012  N NZ  . LYS D  2  134 ? 177.067 26.060 -38.952 1.00 120.38 ? 140  LYS D NZ  1 
ATOM   6013  N N   . GLN D  2  135 ? 175.606 31.467 -41.691 1.00 120.30 ? 141  GLN D N   1 
ATOM   6014  C CA  . GLN D  2  135 ? 175.819 32.728 -40.990 1.00 120.39 ? 141  GLN D CA  1 
ATOM   6015  C C   . GLN D  2  135 ? 175.915 32.500 -39.481 1.00 120.66 ? 141  GLN D C   1 
ATOM   6016  O O   . GLN D  2  135 ? 175.899 33.451 -38.705 1.00 120.68 ? 141  GLN D O   1 
ATOM   6017  C CB  . GLN D  2  135 ? 174.681 33.707 -41.292 1.00 120.25 ? 141  GLN D CB  1 
ATOM   6018  C CG  . GLN D  2  135 ? 174.468 33.976 -42.771 1.00 119.85 ? 141  GLN D CG  1 
ATOM   6019  C CD  . GLN D  2  135 ? 173.405 35.026 -43.021 1.00 119.49 ? 141  GLN D CD  1 
ATOM   6020  O OE1 . GLN D  2  135 ? 173.537 36.168 -42.585 1.00 119.06 ? 141  GLN D OE1 1 
ATOM   6021  N NE2 . GLN D  2  135 ? 172.345 34.642 -43.723 1.00 119.30 ? 141  GLN D NE2 1 
ATOM   6022  N N   . LYS D  2  136 ? 176.006 31.235 -39.075 1.00 120.98 ? 142  LYS D N   1 
ATOM   6023  C CA  . LYS D  2  136 ? 176.103 30.872 -37.662 1.00 121.24 ? 142  LYS D CA  1 
ATOM   6024  C C   . LYS D  2  136 ? 177.463 30.246 -37.348 1.00 121.38 ? 142  LYS D C   1 
ATOM   6025  O O   . LYS D  2  136 ? 178.139 29.736 -38.240 1.00 121.34 ? 142  LYS D O   1 
ATOM   6026  C CB  . LYS D  2  136 ? 174.989 29.890 -37.285 1.00 121.30 ? 142  LYS D CB  1 
ATOM   6027  C CG  . LYS D  2  136 ? 173.592 30.494 -37.229 1.00 121.47 ? 142  LYS D CG  1 
ATOM   6028  C CD  . LYS D  2  136 ? 172.542 29.428 -36.928 1.00 121.55 ? 142  LYS D CD  1 
ATOM   6029  C CE  . LYS D  2  136 ? 171.167 30.030 -36.658 1.00 121.47 ? 142  LYS D CE  1 
ATOM   6030  N NZ  . LYS D  2  136 ? 171.119 30.812 -35.391 1.00 121.34 ? 142  LYS D NZ  1 
ATOM   6031  N N   . ALA D  2  137 ? 177.851 30.282 -36.075 1.00 121.56 ? 143  ALA D N   1 
ATOM   6032  C CA  . ALA D  2  137 ? 179.130 29.720 -35.643 1.00 121.70 ? 143  ALA D CA  1 
ATOM   6033  C C   . ALA D  2  137 ? 179.096 29.312 -34.168 1.00 121.79 ? 143  ALA D C   1 
ATOM   6034  O O   . ALA D  2  137 ? 178.846 30.141 -33.291 1.00 121.77 ? 143  ALA D O   1 
ATOM   6035  C CB  . ALA D  2  137 ? 180.247 30.720 -35.886 1.00 121.72 ? 143  ALA D CB  1 
ATOM   6036  N N   . THR D  2  138 ? 179.360 28.033 -33.905 1.00 121.90 ? 144  THR D N   1 
ATOM   6037  C CA  . THR D  2  138 ? 179.359 27.500 -32.543 1.00 121.95 ? 144  THR D CA  1 
ATOM   6038  C C   . THR D  2  138 ? 180.772 27.409 -31.958 1.00 121.95 ? 144  THR D C   1 
ATOM   6039  O O   . THR D  2  138 ? 181.503 26.455 -32.226 1.00 121.93 ? 144  THR D O   1 
ATOM   6040  C CB  . THR D  2  138 ? 178.719 26.102 -32.517 1.00 121.94 ? 144  THR D CB  1 
ATOM   6041  O OG1 . THR D  2  138 ? 177.334 26.189 -32.879 1.00 121.91 ? 144  THR D OG1 1 
ATOM   6042  C CG2 . THR D  2  138 ? 178.754 25.518 -31.103 1.00 121.96 ? 144  THR D CG2 1 
ATOM   6043  N N   . LEU D  2  139 ? 181.137 28.401 -31.149 1.00 121.96 ? 145  LEU D N   1 
ATOM   6044  C CA  . LEU D  2  139 ? 182.453 28.460 -30.509 1.00 121.97 ? 145  LEU D CA  1 
ATOM   6045  C C   . LEU D  2  139 ? 182.456 27.756 -29.146 1.00 121.89 ? 145  LEU D C   1 
ATOM   6046  O O   . LEU D  2  139 ? 181.480 27.101 -28.783 1.00 121.92 ? 145  LEU D O   1 
ATOM   6047  C CB  . LEU D  2  139 ? 182.912 29.919 -30.361 1.00 122.03 ? 145  LEU D CB  1 
ATOM   6048  C CG  . LEU D  2  139 ? 181.896 30.990 -29.952 1.00 122.19 ? 145  LEU D CG  1 
ATOM   6049  C CD1 . LEU D  2  139 ? 182.626 32.253 -29.518 1.00 122.26 ? 145  LEU D CD1 1 
ATOM   6050  C CD2 . LEU D  2  139 ? 180.948 31.298 -31.102 1.00 122.27 ? 145  LEU D CD2 1 
ATOM   6051  N N   . VAL D  2  140 ? 183.550 27.893 -28.396 1.00 121.75 ? 146  VAL D N   1 
ATOM   6052  C CA  . VAL D  2  140 ? 183.671 27.249 -27.086 1.00 121.64 ? 146  VAL D CA  1 
ATOM   6053  C C   . VAL D  2  140 ? 184.865 27.759 -26.273 1.00 121.48 ? 146  VAL D C   1 
ATOM   6054  O O   . VAL D  2  140 ? 185.837 28.268 -26.829 1.00 121.48 ? 146  VAL D O   1 
ATOM   6055  C CB  . VAL D  2  140 ? 183.814 25.718 -27.238 1.00 121.67 ? 146  VAL D CB  1 
ATOM   6056  C CG1 . VAL D  2  140 ? 185.005 25.384 -28.119 1.00 121.70 ? 146  VAL D CG1 1 
ATOM   6057  C CG2 . VAL D  2  140 ? 183.968 25.052 -25.880 1.00 121.71 ? 146  VAL D CG2 1 
ATOM   6058  N N   . CYS D  2  141 ? 184.775 27.611 -24.953 1.00 121.27 ? 147  CYS D N   1 
ATOM   6059  C CA  . CYS D  2  141 ? 185.841 28.006 -24.040 1.00 121.10 ? 147  CYS D CA  1 
ATOM   6060  C C   . CYS D  2  141 ? 186.009 26.887 -23.010 1.00 121.04 ? 147  CYS D C   1 
ATOM   6061  O O   . CYS D  2  141 ? 185.101 26.075 -22.829 1.00 121.06 ? 147  CYS D O   1 
ATOM   6062  C CB  . CYS D  2  141 ? 185.493 29.322 -23.348 1.00 121.03 ? 147  CYS D CB  1 
ATOM   6063  S SG  . CYS D  2  141 ? 186.829 30.002 -22.339 1.00 120.81 ? 147  CYS D SG  1 
ATOM   6064  N N   . LEU D  2  142 ? 187.159 26.833 -22.340 1.00 120.93 ? 148  LEU D N   1 
ATOM   6065  C CA  . LEU D  2  142 ? 187.412 25.768 -21.363 1.00 120.83 ? 148  LEU D CA  1 
ATOM   6066  C C   . LEU D  2  142 ? 187.659 26.241 -19.932 1.00 120.76 ? 148  LEU D C   1 
ATOM   6067  O O   . LEU D  2  142 ? 187.564 27.428 -19.623 1.00 120.81 ? 148  LEU D O   1 
ATOM   6068  C CB  . LEU D  2  142 ? 188.598 24.905 -21.808 1.00 120.76 ? 148  LEU D CB  1 
ATOM   6069  C CG  . LEU D  2  142 ? 188.413 24.046 -23.058 1.00 120.62 ? 148  LEU D CG  1 
ATOM   6070  C CD1 . LEU D  2  142 ? 188.320 24.920 -24.294 1.00 120.53 ? 148  LEU D CD1 1 
ATOM   6071  C CD2 . LEU D  2  142 ? 189.574 23.076 -23.182 1.00 120.60 ? 148  LEU D CD2 1 
ATOM   6072  N N   . ALA D  2  143 ? 187.974 25.278 -19.069 1.00 120.64 ? 149  ALA D N   1 
ATOM   6073  C CA  . ALA D  2  143 ? 188.242 25.522 -17.658 1.00 120.51 ? 149  ALA D CA  1 
ATOM   6074  C C   . ALA D  2  143 ? 188.624 24.196 -17.004 1.00 120.40 ? 149  ALA D C   1 
ATOM   6075  O O   . ALA D  2  143 ? 188.163 23.883 -15.908 1.00 120.39 ? 149  ALA D O   1 
ATOM   6076  C CB  . ALA D  2  143 ? 187.016 26.099 -16.979 1.00 120.52 ? 149  ALA D CB  1 
ATOM   6077  N N   . ARG D  2  144 ? 189.457 23.420 -17.693 1.00 120.26 ? 150  ARG D N   1 
ATOM   6078  C CA  . ARG D  2  144 ? 189.893 22.117 -17.204 1.00 120.12 ? 150  ARG D CA  1 
ATOM   6079  C C   . ARG D  2  144 ? 191.413 22.028 -17.160 1.00 120.31 ? 150  ARG D C   1 
ATOM   6080  O O   . ARG D  2  144 ? 192.103 22.583 -18.014 1.00 120.24 ? 150  ARG D O   1 
ATOM   6081  C CB  . ARG D  2  144 ? 189.324 21.013 -18.100 1.00 119.93 ? 150  ARG D CB  1 
ATOM   6082  C CG  . ARG D  2  144 ? 189.961 19.642 -17.918 1.00 119.27 ? 150  ARG D CG  1 
ATOM   6083  C CD  . ARG D  2  144 ? 191.261 19.489 -18.670 1.00 118.53 ? 150  ARG D CD  1 
ATOM   6084  N NE  . ARG D  2  144 ? 191.086 19.746 -20.095 1.00 117.95 ? 150  ARG D NE  1 
ATOM   6085  C CZ  . ARG D  2  144 ? 192.080 19.815 -20.969 1.00 117.46 ? 150  ARG D CZ  1 
ATOM   6086  N NH1 . ARG D  2  144 ? 193.330 19.643 -20.568 1.00 117.36 ? 150  ARG D NH1 1 
ATOM   6087  N NH2 . ARG D  2  144 ? 191.825 20.055 -22.248 1.00 117.29 ? 150  ARG D NH2 1 
ATOM   6088  N N   . GLY D  2  145 ? 191.931 21.315 -16.166 1.00 120.56 ? 151  GLY D N   1 
ATOM   6089  C CA  . GLY D  2  145 ? 193.364 21.152 -16.028 1.00 120.83 ? 151  GLY D CA  1 
ATOM   6090  C C   . GLY D  2  145 ? 193.870 21.711 -14.716 1.00 121.12 ? 151  GLY D C   1 
ATOM   6091  O O   . GLY D  2  145 ? 194.682 22.635 -14.697 1.00 121.20 ? 151  GLY D O   1 
ATOM   6092  N N   . PHE D  2  146 ? 193.378 21.151 -13.616 1.00 121.45 ? 152  PHE D N   1 
ATOM   6093  C CA  . PHE D  2  146 ? 193.770 21.584 -12.279 1.00 121.73 ? 152  PHE D CA  1 
ATOM   6094  C C   . PHE D  2  146 ? 193.162 20.647 -11.243 1.00 122.04 ? 152  PHE D C   1 
ATOM   6095  O O   . PHE D  2  146 ? 192.887 19.494 -11.551 1.00 122.01 ? 152  PHE D O   1 
ATOM   6096  C CB  . PHE D  2  146 ? 193.350 23.036 -12.024 1.00 121.69 ? 152  PHE D CB  1 
ATOM   6097  C CG  . PHE D  2  146 ? 191.889 23.322 -12.271 1.00 121.49 ? 152  PHE D CG  1 
ATOM   6098  C CD1 . PHE D  2  146 ? 191.288 23.003 -13.481 1.00 121.29 ? 152  PHE D CD1 1 
ATOM   6099  C CD2 . PHE D  2  146 ? 191.128 23.961 -11.303 1.00 121.40 ? 152  PHE D CD2 1 
ATOM   6100  C CE1 . PHE D  2  146 ? 189.957 23.295 -13.711 1.00 121.27 ? 152  PHE D CE1 1 
ATOM   6101  C CE2 . PHE D  2  146 ? 189.792 24.257 -11.528 1.00 121.32 ? 152  PHE D CE2 1 
ATOM   6102  C CZ  . PHE D  2  146 ? 189.207 23.923 -12.735 1.00 121.27 ? 152  PHE D CZ  1 
ATOM   6103  N N   . PHE D  2  147 ? 192.951 21.124 -10.020 1.00 122.43 ? 153  PHE D N   1 
ATOM   6104  C CA  . PHE D  2  147 ? 192.376 20.264 -8.988  1.00 122.76 ? 153  PHE D CA  1 
ATOM   6105  C C   . PHE D  2  147 ? 191.092 20.781 -8.329  1.00 122.94 ? 153  PHE D C   1 
ATOM   6106  O O   . PHE D  2  147 ? 190.203 19.985 -8.023  1.00 122.99 ? 153  PHE D O   1 
ATOM   6107  C CB  . PHE D  2  147 ? 193.409 19.936 -7.912  1.00 122.82 ? 153  PHE D CB  1 
ATOM   6108  C CG  . PHE D  2  147 ? 192.949 18.879 -6.947  1.00 123.06 ? 153  PHE D CG  1 
ATOM   6109  C CD1 . PHE D  2  147 ? 192.582 17.624 -7.402  1.00 123.26 ? 153  PHE D CD1 1 
ATOM   6110  C CD2 . PHE D  2  147 ? 192.856 19.145 -5.594  1.00 123.27 ? 153  PHE D CD2 1 
ATOM   6111  C CE1 . PHE D  2  147 ? 192.144 16.648 -6.527  1.00 123.35 ? 153  PHE D CE1 1 
ATOM   6112  C CE2 . PHE D  2  147 ? 192.418 18.170 -4.708  1.00 123.39 ? 153  PHE D CE2 1 
ATOM   6113  C CZ  . PHE D  2  147 ? 192.064 16.918 -5.178  1.00 123.36 ? 153  PHE D CZ  1 
ATOM   6114  N N   . PRO D  2  148 ? 191.007 22.077 -8.028  1.00 123.11 ? 154  PRO D N   1 
ATOM   6115  C CA  . PRO D  2  148 ? 189.785 22.615 -7.425  1.00 123.17 ? 154  PRO D CA  1 
ATOM   6116  C C   . PRO D  2  148 ? 188.577 22.549 -8.354  1.00 123.17 ? 154  PRO D C   1 
ATOM   6117  O O   . PRO D  2  148 ? 188.247 23.514 -9.041  1.00 123.20 ? 154  PRO D O   1 
ATOM   6118  C CB  . PRO D  2  148 ? 190.179 24.054 -7.088  1.00 123.20 ? 154  PRO D CB  1 
ATOM   6119  C CG  . PRO D  2  148 ? 191.646 23.963 -6.883  1.00 123.16 ? 154  PRO D CG  1 
ATOM   6120  C CD  . PRO D  2  148 ? 192.079 23.088 -8.028  1.00 123.12 ? 154  PRO D CD  1 
ATOM   6121  N N   . ASP D  2  149 ? 187.917 21.395 -8.349  1.00 123.16 ? 155  ASP D N   1 
ATOM   6122  C CA  . ASP D  2  149 ? 186.755 21.143 -9.200  1.00 123.15 ? 155  ASP D CA  1 
ATOM   6123  C C   . ASP D  2  149 ? 185.521 21.996 -8.890  1.00 123.13 ? 155  ASP D C   1 
ATOM   6124  O O   . ASP D  2  149 ? 184.398 21.609 -9.214  1.00 123.08 ? 155  ASP D O   1 
ATOM   6125  C CB  . ASP D  2  149 ? 186.388 19.659 -9.138  1.00 123.15 ? 155  ASP D CB  1 
ATOM   6126  C CG  . ASP D  2  149 ? 186.496 19.089 -7.742  1.00 123.12 ? 155  ASP D CG  1 
ATOM   6127  O OD1 . ASP D  2  149 ? 187.623 19.032 -7.199  1.00 123.04 ? 155  ASP D OD1 1 
ATOM   6128  O OD2 . ASP D  2  149 ? 185.492 18.673 -7.129  1.00 123.14 ? 155  ASP D OD2 1 
ATOM   6129  N N   . HIS D  2  150 ? 185.729 23.156 -8.276  1.00 123.14 ? 156  HIS D N   1 
ATOM   6130  C CA  . HIS D  2  150 ? 184.631 24.060 -7.962  1.00 123.17 ? 156  HIS D CA  1 
ATOM   6131  C C   . HIS D  2  150 ? 184.680 25.227 -8.943  1.00 123.22 ? 156  HIS D C   1 
ATOM   6132  O O   . HIS D  2  150 ? 185.080 26.331 -8.574  1.00 123.22 ? 156  HIS D O   1 
ATOM   6133  C CB  . HIS D  2  150 ? 184.757 24.591 -6.529  1.00 123.16 ? 156  HIS D CB  1 
ATOM   6134  C CG  . HIS D  2  150 ? 184.888 23.522 -5.487  1.00 123.08 ? 156  HIS D CG  1 
ATOM   6135  N ND1 . HIS D  2  150 ? 183.922 22.562 -5.276  1.00 123.06 ? 156  HIS D ND1 1 
ATOM   6136  C CD2 . HIS D  2  150 ? 185.866 23.274 -4.584  1.00 123.08 ? 156  HIS D CD2 1 
ATOM   6137  C CE1 . HIS D  2  150 ? 184.300 21.766 -4.291  1.00 123.04 ? 156  HIS D CE1 1 
ATOM   6138  N NE2 . HIS D  2  150 ? 185.477 22.176 -3.855  1.00 123.04 ? 156  HIS D NE2 1 
ATOM   6139  N N   . VAL D  2  151 ? 184.285 24.987 -10.192 1.00 123.30 ? 157  VAL D N   1 
ATOM   6140  C CA  . VAL D  2  151 ? 184.327 26.035 -11.216 1.00 123.38 ? 157  VAL D CA  1 
ATOM   6141  C C   . VAL D  2  151 ? 183.137 26.043 -12.182 1.00 123.37 ? 157  VAL D C   1 
ATOM   6142  O O   . VAL D  2  151 ? 182.594 24.994 -12.534 1.00 123.34 ? 157  VAL D O   1 
ATOM   6143  C CB  . VAL D  2  151 ? 185.619 25.934 -12.049 1.00 123.44 ? 157  VAL D CB  1 
ATOM   6144  C CG1 . VAL D  2  151 ? 186.839 26.112 -11.156 1.00 123.51 ? 157  VAL D CG1 1 
ATOM   6145  C CG2 . VAL D  2  151 ? 185.679 24.601 -12.776 1.00 123.51 ? 157  VAL D CG2 1 
ATOM   6146  N N   . GLU D  2  152 ? 182.756 27.247 -12.608 1.00 123.39 ? 158  GLU D N   1 
ATOM   6147  C CA  . GLU D  2  152 ? 181.656 27.454 -13.547 1.00 123.41 ? 158  GLU D CA  1 
ATOM   6148  C C   . GLU D  2  152 ? 182.049 28.552 -14.547 1.00 123.35 ? 158  GLU D C   1 
ATOM   6149  O O   . GLU D  2  152 ? 182.159 29.720 -14.177 1.00 123.32 ? 158  GLU D O   1 
ATOM   6150  C CB  . GLU D  2  152 ? 180.380 27.875 -12.804 1.00 123.48 ? 158  GLU D CB  1 
ATOM   6151  C CG  . GLU D  2  152 ? 179.889 26.898 -11.739 1.00 123.61 ? 158  GLU D CG  1 
ATOM   6152  C CD  . GLU D  2  152 ? 180.545 27.103 -10.383 1.00 123.73 ? 158  GLU D CD  1 
ATOM   6153  O OE1 . GLU D  2  152 ? 180.293 26.285 -9.471  1.00 123.67 ? 158  GLU D OE1 1 
ATOM   6154  O OE2 . GLU D  2  152 ? 181.308 28.080 -10.223 1.00 123.75 ? 158  GLU D OE2 1 
ATOM   6155  N N   . LEU D  2  153 ? 182.255 28.174 -15.807 1.00 123.31 ? 159  LEU D N   1 
ATOM   6156  C CA  . LEU D  2  153 ? 182.657 29.119 -16.857 1.00 123.30 ? 159  LEU D CA  1 
ATOM   6157  C C   . LEU D  2  153 ? 181.628 30.228 -17.096 1.00 123.34 ? 159  LEU D C   1 
ATOM   6158  O O   . LEU D  2  153 ? 180.547 30.221 -16.506 1.00 123.36 ? 159  LEU D O   1 
ATOM   6159  C CB  . LEU D  2  153 ? 182.912 28.381 -18.178 1.00 123.26 ? 159  LEU D CB  1 
ATOM   6160  C CG  . LEU D  2  153 ? 183.965 27.273 -18.190 1.00 123.11 ? 159  LEU D CG  1 
ATOM   6161  C CD1 . LEU D  2  153 ? 183.457 26.046 -17.451 1.00 123.04 ? 159  LEU D CD1 1 
ATOM   6162  C CD2 . LEU D  2  153 ? 184.307 26.914 -19.623 1.00 123.02 ? 159  LEU D CD2 1 
ATOM   6163  N N   . SER D  2  154 ? 181.974 31.173 -17.972 1.00 123.36 ? 160  SER D N   1 
ATOM   6164  C CA  . SER D  2  154 ? 181.092 32.296 -18.299 1.00 123.37 ? 160  SER D CA  1 
ATOM   6165  C C   . SER D  2  154 ? 181.479 33.006 -19.600 1.00 123.37 ? 160  SER D C   1 
ATOM   6166  O O   . SER D  2  154 ? 182.632 32.958 -20.025 1.00 123.38 ? 160  SER D O   1 
ATOM   6167  C CB  . SER D  2  154 ? 181.093 33.314 -17.159 1.00 123.37 ? 160  SER D CB  1 
ATOM   6168  O OG  . SER D  2  154 ? 180.345 34.465 -17.512 1.00 123.26 ? 160  SER D OG  1 
ATOM   6169  N N   . TRP D  2  155 ? 180.501 33.669 -20.216 1.00 123.37 ? 161  TRP D N   1 
ATOM   6170  C CA  . TRP D  2  155 ? 180.710 34.409 -21.461 1.00 123.35 ? 161  TRP D CA  1 
ATOM   6171  C C   . TRP D  2  155 ? 180.267 35.860 -21.321 1.00 123.37 ? 161  TRP D C   1 
ATOM   6172  O O   . TRP D  2  155 ? 179.074 36.152 -21.317 1.00 123.35 ? 161  TRP D O   1 
ATOM   6173  C CB  . TRP D  2  155 ? 179.942 33.756 -22.616 1.00 123.33 ? 161  TRP D CB  1 
ATOM   6174  C CG  . TRP D  2  155 ? 180.564 32.485 -23.082 1.00 123.25 ? 161  TRP D CG  1 
ATOM   6175  C CD1 . TRP D  2  155 ? 180.373 31.239 -22.562 1.00 123.18 ? 161  TRP D CD1 1 
ATOM   6176  C CD2 . TRP D  2  155 ? 181.509 32.334 -24.147 1.00 123.18 ? 161  TRP D CD2 1 
ATOM   6177  N NE1 . TRP D  2  155 ? 181.137 30.320 -23.240 1.00 123.24 ? 161  TRP D NE1 1 
ATOM   6178  C CE2 . TRP D  2  155 ? 181.845 30.967 -24.220 1.00 123.23 ? 161  TRP D CE2 1 
ATOM   6179  C CE3 . TRP D  2  155 ? 182.106 33.220 -25.052 1.00 123.11 ? 161  TRP D CE3 1 
ATOM   6180  C CZ2 . TRP D  2  155 ? 182.749 30.466 -25.159 1.00 123.23 ? 161  TRP D CZ2 1 
ATOM   6181  C CZ3 . TRP D  2  155 ? 183.004 32.720 -25.984 1.00 123.09 ? 161  TRP D CZ3 1 
ATOM   6182  C CH2 . TRP D  2  155 ? 183.316 31.356 -26.029 1.00 123.09 ? 161  TRP D CH2 1 
ATOM   6183  N N   . TRP D  2  156 ? 181.231 36.767 -21.218 1.00 123.45 ? 162  TRP D N   1 
ATOM   6184  C CA  . TRP D  2  156 ? 180.929 38.186 -21.072 1.00 123.51 ? 162  TRP D CA  1 
ATOM   6185  C C   . TRP D  2  156 ? 181.219 38.923 -22.374 1.00 123.38 ? 162  TRP D C   1 
ATOM   6186  O O   . TRP D  2  156 ? 182.024 38.471 -23.189 1.00 123.33 ? 162  TRP D O   1 
ATOM   6187  C CB  . TRP D  2  156 ? 181.757 38.793 -19.936 1.00 123.63 ? 162  TRP D CB  1 
ATOM   6188  C CG  . TRP D  2  156 ? 182.160 37.797 -18.885 1.00 123.99 ? 162  TRP D CG  1 
ATOM   6189  C CD1 . TRP D  2  156 ? 183.159 36.872 -18.975 1.00 124.25 ? 162  TRP D CD1 1 
ATOM   6190  C CD2 . TRP D  2  156 ? 181.574 37.626 -17.588 1.00 124.25 ? 162  TRP D CD2 1 
ATOM   6191  N NE1 . TRP D  2  156 ? 183.229 36.135 -17.818 1.00 124.31 ? 162  TRP D NE1 1 
ATOM   6192  C CE2 . TRP D  2  156 ? 182.270 36.579 -16.948 1.00 124.34 ? 162  TRP D CE2 1 
ATOM   6193  C CE3 . TRP D  2  156 ? 180.531 38.254 -16.900 1.00 124.39 ? 162  TRP D CE3 1 
ATOM   6194  C CZ2 . TRP D  2  156 ? 181.956 36.147 -15.659 1.00 124.44 ? 162  TRP D CZ2 1 
ATOM   6195  C CZ3 . TRP D  2  156 ? 180.221 37.824 -15.619 1.00 124.56 ? 162  TRP D CZ3 1 
ATOM   6196  C CH2 . TRP D  2  156 ? 180.931 36.779 -15.013 1.00 124.51 ? 162  TRP D CH2 1 
ATOM   6197  N N   . VAL D  2  157 ? 180.560 40.060 -22.567 1.00 123.25 ? 163  VAL D N   1 
ATOM   6198  C CA  . VAL D  2  157 ? 180.751 40.856 -23.773 1.00 123.18 ? 163  VAL D CA  1 
ATOM   6199  C C   . VAL D  2  157 ? 180.854 42.337 -23.432 1.00 122.99 ? 163  VAL D C   1 
ATOM   6200  O O   . VAL D  2  157 ? 180.023 42.871 -22.698 1.00 122.95 ? 163  VAL D O   1 
ATOM   6201  C CB  . VAL D  2  157 ? 179.601 40.635 -24.766 1.00 123.23 ? 163  VAL D CB  1 
ATOM   6202  C CG1 . VAL D  2  157 ? 179.750 41.555 -25.969 1.00 123.32 ? 163  VAL D CG1 1 
ATOM   6203  C CG2 . VAL D  2  157 ? 179.570 39.179 -25.210 1.00 123.27 ? 163  VAL D CG2 1 
ATOM   6204  N N   . ASN D  2  158 ? 181.875 42.995 -23.976 1.00 122.76 ? 164  ASN D N   1 
ATOM   6205  C CA  . ASN D  2  158 ? 182.105 44.412 -23.717 1.00 122.56 ? 164  ASN D CA  1 
ATOM   6206  C C   . ASN D  2  158 ? 181.979 44.681 -22.215 1.00 122.25 ? 164  ASN D C   1 
ATOM   6207  O O   . ASN D  2  158 ? 182.236 43.792 -21.403 1.00 122.23 ? 164  ASN D O   1 
ATOM   6208  C CB  . ASN D  2  158 ? 181.122 45.276 -24.516 1.00 122.61 ? 164  ASN D CB  1 
ATOM   6209  C CG  . ASN D  2  158 ? 181.316 45.150 -26.020 1.00 122.73 ? 164  ASN D CG  1 
ATOM   6210  O OD1 . ASN D  2  158 ? 180.821 45.972 -26.792 1.00 122.94 ? 164  ASN D OD1 1 
ATOM   6211  N ND2 . ASN D  2  158 ? 182.033 44.118 -26.442 1.00 122.75 ? 164  ASN D ND2 1 
ATOM   6212  N N   . GLY D  2  159 ? 181.576 45.892 -21.844 1.00 121.85 ? 165  GLY D N   1 
ATOM   6213  C CA  . GLY D  2  159 ? 181.439 46.247 -20.440 1.00 121.46 ? 165  GLY D CA  1 
ATOM   6214  C C   . GLY D  2  159 ? 180.243 45.646 -19.721 1.00 121.03 ? 165  GLY D C   1 
ATOM   6215  O O   . GLY D  2  159 ? 180.170 45.701 -18.493 1.00 121.01 ? 165  GLY D O   1 
ATOM   6216  N N   . LYS D  2  160 ? 179.297 45.089 -20.472 1.00 120.49 ? 166  LYS D N   1 
ATOM   6217  C CA  . LYS D  2  160 ? 178.118 44.469 -19.874 1.00 120.02 ? 166  LYS D CA  1 
ATOM   6218  C C   . LYS D  2  160 ? 178.211 42.953 -19.974 1.00 119.56 ? 166  LYS D C   1 
ATOM   6219  O O   . LYS D  2  160 ? 179.251 42.407 -20.340 1.00 119.51 ? 166  LYS D O   1 
ATOM   6220  C CB  . LYS D  2  160 ? 176.836 44.953 -20.559 1.00 120.03 ? 166  LYS D CB  1 
ATOM   6221  C CG  . LYS D  2  160 ? 176.313 46.287 -20.050 1.00 119.97 ? 166  LYS D CG  1 
ATOM   6222  C CD  . LYS D  2  160 ? 177.280 47.419 -20.326 1.00 119.89 ? 166  LYS D CD  1 
ATOM   6223  C CE  . LYS D  2  160 ? 176.737 48.742 -19.823 1.00 119.82 ? 166  LYS D CE  1 
ATOM   6224  N NZ  . LYS D  2  160 ? 177.666 49.867 -20.117 1.00 119.79 ? 166  LYS D NZ  1 
ATOM   6225  N N   . GLU D  2  161 ? 177.113 42.280 -19.653 1.00 118.95 ? 167  GLU D N   1 
ATOM   6226  C CA  . GLU D  2  161 ? 177.064 40.828 -19.697 1.00 118.47 ? 167  GLU D CA  1 
ATOM   6227  C C   . GLU D  2  161 ? 175.918 40.356 -20.584 1.00 117.90 ? 167  GLU D C   1 
ATOM   6228  O O   . GLU D  2  161 ? 174.774 40.773 -20.409 1.00 117.87 ? 167  GLU D O   1 
ATOM   6229  C CB  . GLU D  2  161 ? 176.890 40.277 -18.280 1.00 118.53 ? 167  GLU D CB  1 
ATOM   6230  C CG  . GLU D  2  161 ? 176.632 38.783 -18.205 1.00 118.62 ? 167  GLU D CG  1 
ATOM   6231  C CD  . GLU D  2  161 ? 176.291 38.331 -16.799 1.00 118.70 ? 167  GLU D CD  1 
ATOM   6232  O OE1 . GLU D  2  161 ? 177.166 38.427 -15.915 1.00 118.76 ? 167  GLU D OE1 1 
ATOM   6233  O OE2 . GLU D  2  161 ? 175.145 37.889 -16.574 1.00 118.78 ? 167  GLU D OE2 1 
ATOM   6234  N N   . VAL D  2  162 ? 176.233 39.488 -21.538 1.00 117.19 ? 168  VAL D N   1 
ATOM   6235  C CA  . VAL D  2  162 ? 175.221 38.940 -22.434 1.00 116.60 ? 168  VAL D CA  1 
ATOM   6236  C C   . VAL D  2  162 ? 174.339 37.969 -21.660 1.00 115.89 ? 168  VAL D C   1 
ATOM   6237  O O   . VAL D  2  162 ? 174.717 37.498 -20.589 1.00 115.83 ? 168  VAL D O   1 
ATOM   6238  C CB  . VAL D  2  162 ? 175.856 38.207 -23.626 1.00 116.67 ? 168  VAL D CB  1 
ATOM   6239  C CG1 . VAL D  2  162 ? 176.408 39.210 -24.620 1.00 116.72 ? 168  VAL D CG1 1 
ATOM   6240  C CG2 . VAL D  2  162 ? 176.952 37.269 -23.149 1.00 116.88 ? 168  VAL D CG2 1 
ATOM   6241  N N   . HIS D  2  163 ? 173.167 37.667 -22.205 1.00 115.02 ? 169  HIS D N   1 
ATOM   6242  C CA  . HIS D  2  163 ? 172.237 36.768 -21.533 1.00 114.31 ? 169  HIS D CA  1 
ATOM   6243  C C   . HIS D  2  163 ? 171.874 35.540 -22.366 1.00 113.73 ? 169  HIS D C   1 
ATOM   6244  O O   . HIS D  2  163 ? 170.707 35.339 -22.702 1.00 113.69 ? 169  HIS D O   1 
ATOM   6245  C CB  . HIS D  2  163 ? 170.967 37.531 -21.154 1.00 114.26 ? 169  HIS D CB  1 
ATOM   6246  C CG  . HIS D  2  163 ? 171.194 38.622 -20.153 1.00 114.12 ? 169  HIS D CG  1 
ATOM   6247  N ND1 . HIS D  2  163 ? 171.652 38.378 -18.876 1.00 114.01 ? 169  HIS D ND1 1 
ATOM   6248  C CD2 . HIS D  2  163 ? 171.018 39.962 -20.238 1.00 114.00 ? 169  HIS D CD2 1 
ATOM   6249  C CE1 . HIS D  2  163 ? 171.750 39.520 -18.219 1.00 113.90 ? 169  HIS D CE1 1 
ATOM   6250  N NE2 . HIS D  2  163 ? 171.370 40.496 -19.023 1.00 113.94 ? 169  HIS D NE2 1 
ATOM   6251  N N   . SER D  2  164 ? 172.872 34.717 -22.687 1.00 112.98 ? 170  SER D N   1 
ATOM   6252  C CA  . SER D  2  164 ? 172.648 33.494 -23.459 1.00 112.36 ? 170  SER D CA  1 
ATOM   6253  C C   . SER D  2  164 ? 173.956 32.810 -23.841 1.00 111.85 ? 170  SER D C   1 
ATOM   6254  O O   . SER D  2  164 ? 175.040 33.343 -23.607 1.00 111.77 ? 170  SER D O   1 
ATOM   6255  C CB  . SER D  2  164 ? 171.852 33.789 -24.731 1.00 112.34 ? 170  SER D CB  1 
ATOM   6256  O OG  . SER D  2  164 ? 171.540 32.589 -25.416 1.00 112.24 ? 170  SER D OG  1 
ATOM   6257  N N   . GLY D  2  165 ? 173.839 31.625 -24.433 1.00 111.27 ? 171  GLY D N   1 
ATOM   6258  C CA  . GLY D  2  165 ? 175.001 30.869 -24.864 1.00 110.81 ? 171  GLY D CA  1 
ATOM   6259  C C   . GLY D  2  165 ? 175.604 29.989 -23.787 1.00 110.43 ? 171  GLY D C   1 
ATOM   6260  O O   . GLY D  2  165 ? 175.488 28.766 -23.848 1.00 110.33 ? 171  GLY D O   1 
ATOM   6261  N N   . VAL D  2  166 ? 176.254 30.615 -22.809 1.00 110.04 ? 172  VAL D N   1 
ATOM   6262  C CA  . VAL D  2  166 ? 176.905 29.903 -21.708 1.00 109.78 ? 172  VAL D CA  1 
ATOM   6263  C C   . VAL D  2  166 ? 176.320 28.514 -21.490 1.00 109.80 ? 172  VAL D C   1 
ATOM   6264  O O   . VAL D  2  166 ? 175.254 28.367 -20.892 1.00 109.79 ? 172  VAL D O   1 
ATOM   6265  C CB  . VAL D  2  166 ? 176.801 30.689 -20.385 1.00 109.64 ? 172  VAL D CB  1 
ATOM   6266  C CG1 . VAL D  2  166 ? 177.493 29.927 -19.261 1.00 109.39 ? 172  VAL D CG1 1 
ATOM   6267  C CG2 . VAL D  2  166 ? 177.415 32.068 -20.539 1.00 109.51 ? 172  VAL D CG2 1 
ATOM   6268  N N   . SER D  2  167 ? 177.025 27.498 -21.981 1.00 109.82 ? 173  SER D N   1 
ATOM   6269  C CA  . SER D  2  167 ? 176.591 26.114 -21.832 1.00 109.84 ? 173  SER D CA  1 
ATOM   6270  C C   . SER D  2  167 ? 177.541 25.368 -20.899 1.00 109.99 ? 173  SER D C   1 
ATOM   6271  O O   . SER D  2  167 ? 178.045 24.295 -21.233 1.00 109.90 ? 173  SER D O   1 
ATOM   6272  C CB  . SER D  2  167 ? 176.540 25.419 -23.190 1.00 109.73 ? 173  SER D CB  1 
ATOM   6273  O OG  . SER D  2  167 ? 175.860 24.182 -23.094 1.00 109.41 ? 173  SER D OG  1 
ATOM   6274  N N   . THR D  2  168 ? 177.780 25.954 -19.730 1.00 110.23 ? 174  THR D N   1 
ATOM   6275  C CA  . THR D  2  168 ? 178.657 25.368 -18.725 1.00 110.47 ? 174  THR D CA  1 
ATOM   6276  C C   . THR D  2  168 ? 178.082 24.049 -18.221 1.00 110.77 ? 174  THR D C   1 
ATOM   6277  O O   . THR D  2  168 ? 177.129 24.046 -17.438 1.00 110.75 ? 174  THR D O   1 
ATOM   6278  C CB  . THR D  2  168 ? 178.794 26.315 -17.527 1.00 110.47 ? 174  THR D CB  1 
ATOM   6279  O OG1 . THR D  2  168 ? 179.109 27.640 -17.977 1.00 110.41 ? 174  THR D OG1 1 
ATOM   6280  C CG2 . THR D  2  168 ? 179.948 25.875 -16.629 1.00 110.48 ? 174  THR D CG2 1 
ATOM   6281  N N   . ASP D  2  169 ? 178.661 22.936 -18.662 1.00 111.12 ? 175  ASP D N   1 
ATOM   6282  C CA  . ASP D  2  169 ? 178.196 21.612 -18.248 1.00 111.40 ? 175  ASP D CA  1 
ATOM   6283  C C   . ASP D  2  169 ? 177.876 21.574 -16.754 1.00 111.73 ? 175  ASP D C   1 
ATOM   6284  O O   . ASP D  2  169 ? 178.732 21.872 -15.922 1.00 111.76 ? 175  ASP D O   1 
ATOM   6285  C CB  . ASP D  2  169 ? 179.247 20.546 -18.564 1.00 111.33 ? 175  ASP D CB  1 
ATOM   6286  C CG  . ASP D  2  169 ? 179.314 20.209 -20.032 1.00 111.22 ? 175  ASP D CG  1 
ATOM   6287  O OD1 . ASP D  2  169 ? 178.282 19.787 -20.597 1.00 111.15 ? 175  ASP D OD1 1 
ATOM   6288  O OD2 . ASP D  2  169 ? 180.373 20.333 -20.683 1.00 111.04 ? 175  ASP D OD2 1 
ATOM   6289  N N   . PRO D  2  170 ? 176.638 21.225 -16.412 1.00 112.13 ? 176  PRO D N   1 
ATOM   6290  C CA  . PRO D  2  170 ? 176.214 21.143 -15.011 1.00 112.47 ? 176  PRO D CA  1 
ATOM   6291  C C   . PRO D  2  170 ? 177.121 20.295 -14.119 1.00 112.85 ? 176  PRO D C   1 
ATOM   6292  O O   . PRO D  2  170 ? 177.014 20.381 -12.896 1.00 112.92 ? 176  PRO D O   1 
ATOM   6293  C CB  . PRO D  2  170 ? 174.807 20.560 -15.125 1.00 112.44 ? 176  PRO D CB  1 
ATOM   6294  C CG  . PRO D  2  170 ? 174.320 21.141 -16.410 1.00 112.28 ? 176  PRO D CG  1 
ATOM   6295  C CD  . PRO D  2  170 ? 175.510 20.960 -17.321 1.00 112.11 ? 176  PRO D CD  1 
ATOM   6296  N N   . GLN D  2  171 ? 178.005 19.500 -14.715 1.00 113.30 ? 177  GLN D N   1 
ATOM   6297  C CA  . GLN D  2  171 ? 178.922 18.679 -13.931 1.00 113.68 ? 177  GLN D CA  1 
ATOM   6298  C C   . GLN D  2  171 ? 180.198 18.335 -14.697 1.00 114.06 ? 177  GLN D C   1 
ATOM   6299  O O   . GLN D  2  171 ? 180.169 18.110 -15.908 1.00 114.07 ? 177  GLN D O   1 
ATOM   6300  C CB  . GLN D  2  171 ? 178.225 17.402 -13.468 1.00 113.66 ? 177  GLN D CB  1 
ATOM   6301  C CG  . GLN D  2  171 ? 178.509 17.060 -12.014 1.00 113.73 ? 177  GLN D CG  1 
ATOM   6302  C CD  . GLN D  2  171 ? 178.189 18.212 -11.071 1.00 113.82 ? 177  GLN D CD  1 
ATOM   6303  O OE1 . GLN D  2  171 ? 178.951 19.175 -10.972 1.00 113.80 ? 177  GLN D OE1 1 
ATOM   6304  N NE2 . GLN D  2  171 ? 177.057 18.118 -10.383 1.00 113.86 ? 177  GLN D NE2 1 
ATOM   6305  N N   . ALA D  2  172 ? 181.313 18.282 -13.970 1.00 114.51 ? 178  ALA D N   1 
ATOM   6306  C CA  . ALA D  2  172 ? 182.626 18.010 -14.555 1.00 114.85 ? 178  ALA D CA  1 
ATOM   6307  C C   . ALA D  2  172 ? 182.997 16.531 -14.662 1.00 115.14 ? 178  ALA D C   1 
ATOM   6308  O O   . ALA D  2  172 ? 182.466 15.683 -13.944 1.00 115.15 ? 178  ALA D O   1 
ATOM   6309  C CB  . ALA D  2  172 ? 183.695 18.749 -13.764 1.00 114.88 ? 178  ALA D CB  1 
ATOM   6310  N N   . TYR D  2  173 ? 183.934 16.250 -15.567 1.00 115.51 ? 179  TYR D N   1 
ATOM   6311  C CA  . TYR D  2  173 ? 184.433 14.901 -15.810 1.00 115.85 ? 179  TYR D CA  1 
ATOM   6312  C C   . TYR D  2  173 ? 185.764 14.731 -15.089 1.00 116.08 ? 179  TYR D C   1 
ATOM   6313  O O   . TYR D  2  173 ? 186.296 15.691 -14.541 1.00 116.15 ? 179  TYR D O   1 
ATOM   6314  C CB  . TYR D  2  173 ? 184.620 14.678 -17.314 1.00 115.91 ? 179  TYR D CB  1 
ATOM   6315  C CG  . TYR D  2  173 ? 183.382 15.018 -18.113 1.00 116.11 ? 179  TYR D CG  1 
ATOM   6316  C CD1 . TYR D  2  173 ? 182.233 14.243 -18.007 1.00 116.34 ? 179  TYR D CD1 1 
ATOM   6317  C CD2 . TYR D  2  173 ? 183.350 16.131 -18.948 1.00 116.33 ? 179  TYR D CD2 1 
ATOM   6318  C CE1 . TYR D  2  173 ? 181.085 14.559 -18.718 1.00 116.47 ? 179  TYR D CE1 1 
ATOM   6319  C CE2 . TYR D  2  173 ? 182.205 16.457 -19.664 1.00 116.47 ? 179  TYR D CE2 1 
ATOM   6320  C CZ  . TYR D  2  173 ? 181.076 15.666 -19.544 1.00 116.49 ? 179  TYR D CZ  1 
ATOM   6321  O OH  . TYR D  2  173 ? 179.935 15.979 -20.248 1.00 116.59 ? 179  TYR D OH  1 
ATOM   6322  N N   . LYS D  2  174 ? 186.311 13.520 -15.099 1.00 116.34 ? 180  LYS D N   1 
ATOM   6323  C CA  . LYS D  2  174 ? 187.572 13.256 -14.413 1.00 116.57 ? 180  LYS D CA  1 
ATOM   6324  C C   . LYS D  2  174 ? 188.515 12.393 -15.247 1.00 116.72 ? 180  LYS D C   1 
ATOM   6325  O O   . LYS D  2  174 ? 188.524 11.168 -15.120 1.00 116.71 ? 180  LYS D O   1 
ATOM   6326  C CB  . LYS D  2  174 ? 187.285 12.578 -13.075 1.00 116.63 ? 180  LYS D CB  1 
ATOM   6327  C CG  . LYS D  2  174 ? 188.509 12.209 -12.265 1.00 116.79 ? 180  LYS D CG  1 
ATOM   6328  C CD  . LYS D  2  174 ? 188.086 11.543 -10.971 1.00 116.98 ? 180  LYS D CD  1 
ATOM   6329  C CE  . LYS D  2  174 ? 189.265 11.183 -10.094 1.00 117.05 ? 180  LYS D CE  1 
ATOM   6330  N NZ  . LYS D  2  174 ? 188.803 10.659 -8.779  1.00 117.13 ? 180  LYS D NZ  1 
ATOM   6331  N N   . GLU D  2  175 ? 189.313 13.038 -16.093 1.00 116.91 ? 181  GLU D N   1 
ATOM   6332  C CA  . GLU D  2  175 ? 190.261 12.327 -16.945 1.00 117.04 ? 181  GLU D CA  1 
ATOM   6333  C C   . GLU D  2  175 ? 191.470 11.871 -16.136 1.00 117.14 ? 181  GLU D C   1 
ATOM   6334  O O   . GLU D  2  175 ? 191.951 10.750 -16.300 1.00 117.17 ? 181  GLU D O   1 
ATOM   6335  C CB  . GLU D  2  175 ? 190.712 13.211 -18.111 1.00 117.04 ? 181  GLU D CB  1 
ATOM   6336  C CG  . GLU D  2  175 ? 191.593 14.387 -17.717 1.00 117.02 ? 181  GLU D CG  1 
ATOM   6337  C CD  . GLU D  2  175 ? 192.095 15.161 -18.920 1.00 117.01 ? 181  GLU D CD  1 
ATOM   6338  O OE1 . GLU D  2  175 ? 191.278 15.837 -19.581 1.00 116.97 ? 181  GLU D OE1 1 
ATOM   6339  O OE2 . GLU D  2  175 ? 193.308 15.090 -19.209 1.00 116.96 ? 181  GLU D OE2 1 
ATOM   6340  N N   . SER D  2  176 ? 191.959 12.751 -15.268 1.00 117.25 ? 182  SER D N   1 
ATOM   6341  C CA  . SER D  2  176 ? 193.099 12.438 -14.420 1.00 117.32 ? 182  SER D CA  1 
ATOM   6342  C C   . SER D  2  176 ? 192.580 11.959 -13.075 1.00 117.32 ? 182  SER D C   1 
ATOM   6343  O O   . SER D  2  176 ? 191.384 11.716 -12.909 1.00 117.36 ? 182  SER D O   1 
ATOM   6344  C CB  . SER D  2  176 ? 193.998 13.665 -14.235 1.00 117.34 ? 182  SER D CB  1 
ATOM   6345  O OG  . SER D  2  176 ? 194.630 14.028 -15.451 1.00 117.32 ? 182  SER D OG  1 
ATOM   6346  N N   . ASN D  2  177 ? 193.497 11.816 -12.069 1.00 116.70 ? 186  ASN D N   1 
ATOM   6347  C CA  . ASN D  2  177 ? 193.098 11.389 -10.741 1.00 116.67 ? 186  ASN D CA  1 
ATOM   6348  C C   . ASN D  2  177 ? 193.001 12.598 -9.814  1.00 116.57 ? 186  ASN D C   1 
ATOM   6349  O O   . ASN D  2  177 ? 192.587 12.477 -8.662  1.00 116.51 ? 186  ASN D O   1 
ATOM   6350  C CB  . ASN D  2  177 ? 194.108 10.374 -10.210 1.00 116.73 ? 186  ASN D CB  1 
ATOM   6351  C CG  . ASN D  2  177 ? 193.623 9.658  -8.965  1.00 116.86 ? 186  ASN D CG  1 
ATOM   6352  O OD1 . ASN D  2  177 ? 194.264 8.723  -8.487  1.00 117.03 ? 186  ASN D OD1 1 
ATOM   6353  N ND2 . ASN D  2  177 ? 192.488 10.094 -8.432  1.00 116.92 ? 186  ASN D ND2 1 
ATOM   6354  N N   . TYR D  2  178 ? 193.388 13.765 -10.324 1.00 116.49 ? 187  TYR D N   1 
ATOM   6355  C CA  . TYR D  2  178 ? 193.351 14.998 -9.539  1.00 116.41 ? 187  TYR D CA  1 
ATOM   6356  C C   . TYR D  2  178 ? 193.056 16.209 -10.414 1.00 116.39 ? 187  TYR D C   1 
ATOM   6357  O O   . TYR D  2  178 ? 193.312 17.350 -10.032 1.00 116.32 ? 187  TYR D O   1 
ATOM   6358  C CB  . TYR D  2  178 ? 194.676 15.199 -8.795  1.00 116.37 ? 187  TYR D CB  1 
ATOM   6359  C CG  . TYR D  2  178 ? 194.941 14.117 -7.771  1.00 116.26 ? 187  TYR D CG  1 
ATOM   6360  C CD1 . TYR D  2  178 ? 195.509 12.905 -8.143  1.00 116.23 ? 187  TYR D CD1 1 
ATOM   6361  C CD2 . TYR D  2  178 ? 194.584 14.291 -6.439  1.00 116.18 ? 187  TYR D CD2 1 
ATOM   6362  C CE1 . TYR D  2  178 ? 195.724 11.899 -7.216  1.00 116.23 ? 187  TYR D CE1 1 
ATOM   6363  C CE2 . TYR D  2  178 ? 194.797 13.293 -5.504  1.00 116.17 ? 187  TYR D CE2 1 
ATOM   6364  C CZ  . TYR D  2  178 ? 195.366 12.099 -5.897  1.00 116.22 ? 187  TYR D CZ  1 
ATOM   6365  O OH  . TYR D  2  178 ? 195.577 11.103 -4.972  1.00 116.44 ? 187  TYR D OH  1 
ATOM   6366  N N   . SER D  2  179 ? 192.476 15.968 -11.643 1.00 116.16 ? 189  SER D N   1 
ATOM   6367  C CA  . SER D  2  179 ? 192.124 17.047 -12.550 1.00 116.14 ? 189  SER D CA  1 
ATOM   6368  C C   . SER D  2  179 ? 190.823 16.719 -13.261 1.00 116.09 ? 189  SER D C   1 
ATOM   6369  O O   . SER D  2  179 ? 190.677 15.643 -13.842 1.00 116.03 ? 189  SER D O   1 
ATOM   6370  C CB  . SER D  2  179 ? 193.245 17.278 -13.564 1.00 116.17 ? 189  SER D CB  1 
ATOM   6371  O OG  . SER D  2  179 ? 194.350 17.927 -12.957 1.00 116.18 ? 189  SER D OG  1 
ATOM   6372  N N   . TYR D  2  180 ? 189.886 17.660 -13.217 1.00 116.06 ? 190  TYR D N   1 
ATOM   6373  C CA  . TYR D  2  180 ? 188.574 17.468 -13.825 1.00 116.03 ? 190  TYR D CA  1 
ATOM   6374  C C   . TYR D  2  180 ? 188.351 18.304 -15.083 1.00 115.96 ? 190  TYR D C   1 
ATOM   6375  O O   . TYR D  2  180 ? 188.999 19.331 -15.284 1.00 115.91 ? 190  TYR D O   1 
ATOM   6376  C CB  . TYR D  2  180 ? 187.486 17.758 -12.785 1.00 116.08 ? 190  TYR D CB  1 
ATOM   6377  C CG  . TYR D  2  180 ? 187.546 16.797 -11.614 1.00 116.22 ? 190  TYR D CG  1 
ATOM   6378  C CD1 . TYR D  2  180 ? 188.600 16.842 -10.706 1.00 116.33 ? 190  TYR D CD1 1 
ATOM   6379  C CD2 . TYR D  2  180 ? 186.573 15.819 -11.438 1.00 116.31 ? 190  TYR D CD2 1 
ATOM   6380  C CE1 . TYR D  2  180 ? 188.676 15.948 -9.649  1.00 116.45 ? 190  TYR D CE1 1 
ATOM   6381  C CE2 . TYR D  2  180 ? 186.639 14.921 -10.383 1.00 116.37 ? 190  TYR D CE2 1 
ATOM   6382  C CZ  . TYR D  2  180 ? 187.693 14.991 -9.493  1.00 116.44 ? 190  TYR D CZ  1 
ATOM   6383  O OH  . TYR D  2  180 ? 187.764 14.101 -8.445  1.00 116.50 ? 190  TYR D OH  1 
ATOM   6384  N N   . CYS D  2  181 ? 187.413 17.853 -15.913 1.00 115.93 ? 191  CYS D N   1 
ATOM   6385  C CA  . CYS D  2  181 ? 187.090 18.511 -17.177 1.00 115.92 ? 191  CYS D CA  1 
ATOM   6386  C C   . CYS D  2  181 ? 185.706 19.154 -17.190 1.00 116.00 ? 191  CYS D C   1 
ATOM   6387  O O   . CYS D  2  181 ? 184.821 18.759 -16.438 1.00 115.97 ? 191  CYS D O   1 
ATOM   6388  C CB  . CYS D  2  181 ? 187.181 17.499 -18.316 1.00 115.90 ? 191  CYS D CB  1 
ATOM   6389  S SG  . CYS D  2  181 ? 188.628 16.425 -18.225 1.00 115.72 ? 191  CYS D SG  1 
ATOM   6390  N N   . LEU D  2  182 ? 185.529 20.138 -18.069 1.00 116.10 ? 192  LEU D N   1 
ATOM   6391  C CA  . LEU D  2  182 ? 184.263 20.852 -18.201 1.00 116.21 ? 192  LEU D CA  1 
ATOM   6392  C C   . LEU D  2  182 ? 184.309 21.698 -19.476 1.00 116.34 ? 192  LEU D C   1 
ATOM   6393  O O   . LEU D  2  182 ? 185.393 22.048 -19.945 1.00 116.30 ? 192  LEU D O   1 
ATOM   6394  C CB  . LEU D  2  182 ? 184.039 21.748 -16.975 1.00 116.20 ? 192  LEU D CB  1 
ATOM   6395  C CG  . LEU D  2  182 ? 182.621 22.226 -16.664 1.00 116.15 ? 192  LEU D CG  1 
ATOM   6396  C CD1 . LEU D  2  182 ? 181.714 21.036 -16.413 1.00 116.18 ? 192  LEU D CD1 1 
ATOM   6397  C CD2 . LEU D  2  182 ? 182.636 23.137 -15.447 1.00 116.10 ? 192  LEU D CD2 1 
ATOM   6398  N N   . SER D  2  183 ? 183.147 22.027 -20.039 1.00 116.53 ? 193  SER D N   1 
ATOM   6399  C CA  . SER D  2  183 ? 183.100 22.825 -21.269 1.00 116.64 ? 193  SER D CA  1 
ATOM   6400  C C   . SER D  2  183 ? 181.818 23.651 -21.435 1.00 116.85 ? 193  SER D C   1 
ATOM   6401  O O   . SER D  2  183 ? 180.732 23.212 -21.059 1.00 116.88 ? 193  SER D O   1 
ATOM   6402  C CB  . SER D  2  183 ? 183.279 21.913 -22.483 1.00 116.57 ? 193  SER D CB  1 
ATOM   6403  O OG  . SER D  2  183 ? 182.256 20.935 -22.541 1.00 116.36 ? 193  SER D OG  1 
ATOM   6404  N N   . SER D  2  184 ? 181.961 24.844 -22.013 1.00 117.09 ? 194  SER D N   1 
ATOM   6405  C CA  . SER D  2  184 ? 180.837 25.749 -22.264 1.00 117.31 ? 194  SER D CA  1 
ATOM   6406  C C   . SER D  2  184 ? 180.846 26.166 -23.736 1.00 117.56 ? 194  SER D C   1 
ATOM   6407  O O   . SER D  2  184 ? 181.613 25.617 -24.521 1.00 117.56 ? 194  SER D O   1 
ATOM   6408  C CB  . SER D  2  184 ? 180.941 26.989 -21.377 1.00 117.26 ? 194  SER D CB  1 
ATOM   6409  O OG  . SER D  2  184 ? 182.059 27.780 -21.738 1.00 117.15 ? 194  SER D OG  1 
ATOM   6410  N N   . ARG D  2  185 ? 180.002 27.125 -24.116 1.00 117.84 ? 195  ARG D N   1 
ATOM   6411  C CA  . ARG D  2  185 ? 179.960 27.581 -25.512 1.00 118.08 ? 195  ARG D CA  1 
ATOM   6412  C C   . ARG D  2  185 ? 179.054 28.788 -25.782 1.00 118.31 ? 195  ARG D C   1 
ATOM   6413  O O   . ARG D  2  185 ? 178.426 29.331 -24.872 1.00 118.31 ? 195  ARG D O   1 
ATOM   6414  C CB  . ARG D  2  185 ? 179.565 26.425 -26.435 1.00 118.06 ? 195  ARG D CB  1 
ATOM   6415  C CG  . ARG D  2  185 ? 178.256 25.752 -26.101 1.00 118.00 ? 195  ARG D CG  1 
ATOM   6416  C CD  . ARG D  2  185 ? 178.405 24.243 -26.080 1.00 117.82 ? 195  ARG D CD  1 
ATOM   6417  N NE  . ARG D  2  185 ? 179.367 23.830 -25.060 1.00 117.75 ? 195  ARG D NE  1 
ATOM   6418  C CZ  . ARG D  2  185 ? 179.749 22.579 -24.841 1.00 117.64 ? 195  ARG D CZ  1 
ATOM   6419  N NH1 . ARG D  2  185 ? 179.255 21.590 -25.571 1.00 117.68 ? 195  ARG D NH1 1 
ATOM   6420  N NH2 . ARG D  2  185 ? 180.626 22.314 -23.884 1.00 117.54 ? 195  ARG D NH2 1 
ATOM   6421  N N   . LEU D  2  186 ? 179.005 29.195 -27.051 1.00 118.56 ? 196  LEU D N   1 
ATOM   6422  C CA  . LEU D  2  186 ? 178.217 30.344 -27.487 1.00 118.74 ? 196  LEU D CA  1 
ATOM   6423  C C   . LEU D  2  186 ? 178.112 30.359 -29.021 1.00 118.82 ? 196  LEU D C   1 
ATOM   6424  O O   . LEU D  2  186 ? 178.948 29.774 -29.707 1.00 118.82 ? 196  LEU D O   1 
ATOM   6425  C CB  . LEU D  2  186 ? 178.883 31.634 -26.989 1.00 118.80 ? 196  LEU D CB  1 
ATOM   6426  C CG  . LEU D  2  186 ? 178.198 32.979 -27.233 1.00 119.05 ? 196  LEU D CG  1 
ATOM   6427  C CD1 . LEU D  2  186 ? 176.920 33.082 -26.423 1.00 119.16 ? 196  LEU D CD1 1 
ATOM   6428  C CD2 . LEU D  2  186 ? 179.144 34.108 -26.861 1.00 119.20 ? 196  LEU D CD2 1 
ATOM   6429  N N   . ARG D  2  187 ? 177.085 31.023 -29.551 1.00 118.94 ? 197  ARG D N   1 
ATOM   6430  C CA  . ARG D  2  187 ? 176.877 31.119 -31.001 1.00 118.98 ? 197  ARG D CA  1 
ATOM   6431  C C   . ARG D  2  187 ? 176.965 32.568 -31.498 1.00 119.13 ? 197  ARG D C   1 
ATOM   6432  O O   . ARG D  2  187 ? 176.478 33.489 -30.840 1.00 119.16 ? 197  ARG D O   1 
ATOM   6433  C CB  . ARG D  2  187 ? 175.520 30.522 -31.381 1.00 118.90 ? 197  ARG D CB  1 
ATOM   6434  C CG  . ARG D  2  187 ? 175.019 30.927 -32.759 1.00 118.68 ? 197  ARG D CG  1 
ATOM   6435  C CD  . ARG D  2  187 ? 173.769 30.172 -33.182 1.00 118.39 ? 197  ARG D CD  1 
ATOM   6436  N NE  . ARG D  2  187 ? 174.064 28.797 -33.578 1.00 118.24 ? 197  ARG D NE  1 
ATOM   6437  C CZ  . ARG D  2  187 ? 173.161 27.938 -34.034 1.00 118.05 ? 197  ARG D CZ  1 
ATOM   6438  N NH1 . ARG D  2  187 ? 171.892 28.306 -34.152 1.00 118.09 ? 197  ARG D NH1 1 
ATOM   6439  N NH2 . ARG D  2  187 ? 173.522 26.708 -34.377 1.00 117.87 ? 197  ARG D NH2 1 
ATOM   6440  N N   . VAL D  2  188 ? 177.577 32.758 -32.666 1.00 119.25 ? 198  VAL D N   1 
ATOM   6441  C CA  . VAL D  2  188 ? 177.744 34.090 -33.254 1.00 119.28 ? 198  VAL D CA  1 
ATOM   6442  C C   . VAL D  2  188 ? 177.220 34.176 -34.692 1.00 119.31 ? 198  VAL D C   1 
ATOM   6443  O O   . VAL D  2  188 ? 177.734 33.514 -35.593 1.00 119.21 ? 198  VAL D O   1 
ATOM   6444  C CB  . VAL D  2  188 ? 179.224 34.505 -33.241 1.00 119.28 ? 198  VAL D CB  1 
ATOM   6445  C CG1 . VAL D  2  188 ? 179.685 34.762 -31.817 1.00 119.21 ? 198  VAL D CG1 1 
ATOM   6446  C CG2 . VAL D  2  188 ? 180.077 33.433 -33.885 1.00 119.27 ? 198  VAL D CG2 1 
ATOM   6447  N N   . SER D  2  189 ? 176.202 35.010 -34.895 1.00 119.40 ? 199  SER D N   1 
ATOM   6448  C CA  . SER D  2  189 ? 175.584 35.192 -36.208 1.00 119.51 ? 199  SER D CA  1 
ATOM   6449  C C   . SER D  2  189 ? 176.538 35.801 -37.235 1.00 119.62 ? 199  SER D C   1 
ATOM   6450  O O   . SER D  2  189 ? 177.757 35.762 -37.071 1.00 119.58 ? 199  SER D O   1 
ATOM   6451  C CB  . SER D  2  189 ? 174.337 36.072 -36.087 1.00 119.49 ? 199  SER D CB  1 
ATOM   6452  O OG  . SER D  2  189 ? 173.375 35.484 -35.231 1.00 119.54 ? 199  SER D OG  1 
ATOM   6453  N N   . ALA D  2  190 ? 175.964 36.356 -38.299 1.00 119.80 ? 200  ALA D N   1 
ATOM   6454  C CA  . ALA D  2  190 ? 176.730 36.974 -39.376 1.00 119.96 ? 200  ALA D CA  1 
ATOM   6455  C C   . ALA D  2  190 ? 177.496 38.203 -38.893 1.00 120.11 ? 200  ALA D C   1 
ATOM   6456  O O   . ALA D  2  190 ? 178.727 38.206 -38.864 1.00 120.14 ? 200  ALA D O   1 
ATOM   6457  C CB  . ALA D  2  190 ? 175.800 37.354 -40.518 1.00 119.95 ? 200  ALA D CB  1 
ATOM   6458  N N   . THR D  2  191 ? 176.762 39.248 -38.518 1.00 120.28 ? 201  THR D N   1 
ATOM   6459  C CA  . THR D  2  191 ? 177.369 40.482 -38.025 1.00 120.38 ? 201  THR D CA  1 
ATOM   6460  C C   . THR D  2  191 ? 177.805 40.299 -36.572 1.00 120.48 ? 201  THR D C   1 
ATOM   6461  O O   . THR D  2  191 ? 177.699 41.216 -35.755 1.00 120.49 ? 201  THR D O   1 
ATOM   6462  C CB  . THR D  2  191 ? 176.378 41.655 -38.137 1.00 120.37 ? 201  THR D CB  1 
ATOM   6463  O OG1 . THR D  2  191 ? 176.942 42.831 -37.537 1.00 120.35 ? 201  THR D OG1 1 
ATOM   6464  C CG2 . THR D  2  191 ? 175.087 41.358 -37.369 1.00 120.40 ? 201  THR D CG2 1 
ATOM   6465  N N   . PHE D  2  192 ? 178.297 39.102 -36.265 1.00 120.59 ? 202  PHE D N   1 
ATOM   6466  C CA  . PHE D  2  192 ? 178.748 38.752 -34.925 1.00 120.70 ? 202  PHE D CA  1 
ATOM   6467  C C   . PHE D  2  192 ? 180.268 38.590 -34.882 1.00 120.75 ? 202  PHE D C   1 
ATOM   6468  O O   . PHE D  2  192 ? 181.001 39.543 -34.612 1.00 120.79 ? 202  PHE D O   1 
ATOM   6469  C CB  . PHE D  2  192 ? 178.077 37.449 -34.476 1.00 120.68 ? 202  PHE D CB  1 
ATOM   6470  C CG  . PHE D  2  192 ? 177.004 37.638 -33.440 1.00 120.62 ? 202  PHE D CG  1 
ATOM   6471  C CD1 . PHE D  2  192 ? 177.283 37.447 -32.095 1.00 120.55 ? 202  PHE D CD1 1 
ATOM   6472  C CD2 . PHE D  2  192 ? 175.717 37.998 -33.808 1.00 120.55 ? 202  PHE D CD2 1 
ATOM   6473  C CE1 . PHE D  2  192 ? 176.299 37.618 -31.134 1.00 120.49 ? 202  PHE D CE1 1 
ATOM   6474  C CE2 . PHE D  2  192 ? 174.727 38.169 -32.853 1.00 120.52 ? 202  PHE D CE2 1 
ATOM   6475  C CZ  . PHE D  2  192 ? 175.020 37.979 -31.513 1.00 120.45 ? 202  PHE D CZ  1 
ATOM   6476  N N   . TRP D  2  193 ? 180.728 37.371 -35.151 1.00 120.76 ? 203  TRP D N   1 
ATOM   6477  C CA  . TRP D  2  193 ? 182.149 37.043 -35.139 1.00 120.74 ? 203  TRP D CA  1 
ATOM   6478  C C   . TRP D  2  193 ? 182.858 37.535 -36.399 1.00 121.01 ? 203  TRP D C   1 
ATOM   6479  O O   . TRP D  2  193 ? 184.072 37.741 -36.395 1.00 121.08 ? 203  TRP D O   1 
ATOM   6480  C CB  . TRP D  2  193 ? 182.317 35.529 -34.983 1.00 120.52 ? 203  TRP D CB  1 
ATOM   6481  C CG  . TRP D  2  193 ? 183.696 35.021 -35.246 1.00 119.80 ? 203  TRP D CG  1 
ATOM   6482  C CD1 . TRP D  2  193 ? 184.233 34.704 -36.459 1.00 119.27 ? 203  TRP D CD1 1 
ATOM   6483  C CD2 . TRP D  2  193 ? 184.716 34.759 -34.276 1.00 119.15 ? 203  TRP D CD2 1 
ATOM   6484  N NE1 . TRP D  2  193 ? 185.526 34.268 -36.305 1.00 119.03 ? 203  TRP D NE1 1 
ATOM   6485  C CE2 . TRP D  2  193 ? 185.848 34.291 -34.974 1.00 118.99 ? 203  TRP D CE2 1 
ATOM   6486  C CE3 . TRP D  2  193 ? 184.789 34.875 -32.883 1.00 118.87 ? 203  TRP D CE3 1 
ATOM   6487  C CZ2 . TRP D  2  193 ? 187.034 33.941 -34.330 1.00 118.89 ? 203  TRP D CZ2 1 
ATOM   6488  C CZ3 . TRP D  2  193 ? 185.968 34.527 -32.244 1.00 118.77 ? 203  TRP D CZ3 1 
ATOM   6489  C CH2 . TRP D  2  193 ? 187.074 34.065 -32.968 1.00 118.81 ? 203  TRP D CH2 1 
ATOM   6490  N N   . HIS D  2  194 ? 182.096 37.726 -37.472 1.00 121.27 ? 204  HIS D N   1 
ATOM   6491  C CA  . HIS D  2  194 ? 182.649 38.199 -38.737 1.00 121.48 ? 204  HIS D CA  1 
ATOM   6492  C C   . HIS D  2  194 ? 182.643 39.721 -38.752 1.00 121.53 ? 204  HIS D C   1 
ATOM   6493  O O   . HIS D  2  194 ? 183.039 40.349 -39.735 1.00 121.56 ? 204  HIS D O   1 
ATOM   6494  C CB  . HIS D  2  194 ? 181.823 37.671 -39.910 1.00 121.55 ? 204  HIS D CB  1 
ATOM   6495  C CG  . HIS D  2  194 ? 181.433 36.232 -39.770 1.00 121.71 ? 204  HIS D CG  1 
ATOM   6496  N ND1 . HIS D  2  194 ? 180.602 35.782 -38.767 1.00 121.70 ? 204  HIS D ND1 1 
ATOM   6497  C CD2 . HIS D  2  194 ? 181.762 35.143 -40.503 1.00 121.84 ? 204  HIS D CD2 1 
ATOM   6498  C CE1 . HIS D  2  194 ? 180.436 34.477 -38.887 1.00 121.88 ? 204  HIS D CE1 1 
ATOM   6499  N NE2 . HIS D  2  194 ? 181.127 34.065 -39.934 1.00 121.98 ? 204  HIS D NE2 1 
ATOM   6500  N N   . ASN D  2  195 ? 182.181 40.302 -37.649 1.00 121.58 ? 205  ASN D N   1 
ATOM   6501  C CA  . ASN D  2  195 ? 182.102 41.745 -37.497 1.00 121.60 ? 205  ASN D CA  1 
ATOM   6502  C C   . ASN D  2  195 ? 183.493 42.320 -37.218 1.00 121.63 ? 205  ASN D C   1 
ATOM   6503  O O   . ASN D  2  195 ? 184.109 41.988 -36.204 1.00 121.61 ? 205  ASN D O   1 
ATOM   6504  C CB  . ASN D  2  195 ? 181.141 42.085 -36.353 1.00 121.54 ? 205  ASN D CB  1 
ATOM   6505  C CG  . ASN D  2  195 ? 180.720 43.539 -36.353 1.00 121.47 ? 205  ASN D CG  1 
ATOM   6506  O OD1 . ASN D  2  195 ? 180.309 44.079 -37.380 1.00 121.38 ? 205  ASN D OD1 1 
ATOM   6507  N ND2 . ASN D  2  195 ? 180.809 44.179 -35.194 1.00 121.37 ? 205  ASN D ND2 1 
ATOM   6508  N N   . PRO D  2  196 ? 184.001 43.154 -38.130 1.00 121.67 ? 206  PRO D N   1 
ATOM   6509  C CA  . PRO D  2  196 ? 185.320 43.783 -37.992 1.00 121.72 ? 206  PRO D CA  1 
ATOM   6510  C C   . PRO D  2  196 ? 185.562 44.524 -36.678 1.00 121.79 ? 206  PRO D C   1 
ATOM   6511  O O   . PRO D  2  196 ? 186.608 45.156 -36.522 1.00 121.79 ? 206  PRO D O   1 
ATOM   6512  C CB  . PRO D  2  196 ? 185.365 44.727 -39.195 1.00 121.70 ? 206  PRO D CB  1 
ATOM   6513  C CG  . PRO D  2  196 ? 184.583 43.985 -40.217 1.00 121.66 ? 206  PRO D CG  1 
ATOM   6514  C CD  . PRO D  2  196 ? 183.393 43.497 -39.427 1.00 121.64 ? 206  PRO D CD  1 
ATOM   6515  N N   . ARG D  2  197 ? 184.621 44.431 -35.742 1.00 121.90 ? 207  ARG D N   1 
ATOM   6516  C CA  . ARG D  2  197 ? 184.776 45.080 -34.444 1.00 121.98 ? 207  ARG D CA  1 
ATOM   6517  C C   . ARG D  2  197 ? 183.730 44.678 -33.404 1.00 122.04 ? 207  ARG D C   1 
ATOM   6518  O O   . ARG D  2  197 ? 182.542 44.961 -33.550 1.00 122.07 ? 207  ARG D O   1 
ATOM   6519  C CB  . ARG D  2  197 ? 184.771 46.597 -34.602 1.00 121.97 ? 207  ARG D CB  1 
ATOM   6520  C CG  . ARG D  2  197 ? 183.655 47.150 -35.458 1.00 121.92 ? 207  ARG D CG  1 
ATOM   6521  C CD  . ARG D  2  197 ? 183.410 48.620 -35.165 1.00 121.88 ? 207  ARG D CD  1 
ATOM   6522  N NE  . ARG D  2  197 ? 184.638 49.306 -34.762 1.00 121.93 ? 207  ARG D NE  1 
ATOM   6523  C CZ  . ARG D  2  197 ? 185.720 49.431 -35.524 1.00 121.91 ? 207  ARG D CZ  1 
ATOM   6524  N NH1 . ARG D  2  197 ? 185.742 48.915 -36.746 1.00 121.89 ? 207  ARG D NH1 1 
ATOM   6525  N NH2 . ARG D  2  197 ? 186.787 50.071 -35.062 1.00 121.91 ? 207  ARG D NH2 1 
ATOM   6526  N N   . ASN D  2  198 ? 184.203 44.028 -32.344 1.00 122.09 ? 208  ASN D N   1 
ATOM   6527  C CA  . ASN D  2  198 ? 183.366 43.581 -31.237 1.00 122.12 ? 208  ASN D CA  1 
ATOM   6528  C C   . ASN D  2  198 ? 184.279 43.095 -30.107 1.00 121.99 ? 208  ASN D C   1 
ATOM   6529  O O   . ASN D  2  198 ? 185.502 43.174 -30.228 1.00 121.99 ? 208  ASN D O   1 
ATOM   6530  C CB  . ASN D  2  198 ? 182.422 42.465 -31.693 1.00 122.19 ? 208  ASN D CB  1 
ATOM   6531  C CG  . ASN D  2  198 ? 183.145 41.344 -32.415 1.00 122.34 ? 208  ASN D CG  1 
ATOM   6532  O OD1 . ASN D  2  198 ? 183.748 41.553 -33.468 1.00 122.48 ? 208  ASN D OD1 1 
ATOM   6533  N ND2 . ASN D  2  198 ? 183.083 40.144 -31.852 1.00 122.49 ? 208  ASN D ND2 1 
ATOM   6534  N N   . HIS D  2  199 ? 183.701 42.597 -29.016 1.00 121.82 ? 209  HIS D N   1 
ATOM   6535  C CA  . HIS D  2  199 ? 184.508 42.106 -27.895 1.00 121.66 ? 209  HIS D CA  1 
ATOM   6536  C C   . HIS D  2  199 ? 183.896 40.895 -27.189 1.00 121.52 ? 209  HIS D C   1 
ATOM   6537  O O   . HIS D  2  199 ? 182.748 40.934 -26.755 1.00 121.49 ? 209  HIS D O   1 
ATOM   6538  C CB  . HIS D  2  199 ? 184.744 43.223 -26.876 1.00 121.64 ? 209  HIS D CB  1 
ATOM   6539  C CG  . HIS D  2  199 ? 185.603 42.812 -25.720 1.00 121.56 ? 209  HIS D CG  1 
ATOM   6540  N ND1 . HIS D  2  199 ? 186.917 42.424 -25.871 1.00 121.49 ? 209  HIS D ND1 1 
ATOM   6541  C CD2 . HIS D  2  199 ? 185.334 42.721 -24.396 1.00 121.47 ? 209  HIS D CD2 1 
ATOM   6542  C CE1 . HIS D  2  199 ? 187.421 42.114 -24.691 1.00 121.42 ? 209  HIS D CE1 1 
ATOM   6543  N NE2 . HIS D  2  199 ? 186.481 42.286 -23.779 1.00 121.47 ? 209  HIS D NE2 1 
ATOM   6544  N N   . PHE D  2  200 ? 184.684 39.828 -27.076 1.00 121.35 ? 210  PHE D N   1 
ATOM   6545  C CA  . PHE D  2  200 ? 184.262 38.597 -26.413 1.00 121.21 ? 210  PHE D CA  1 
ATOM   6546  C C   . PHE D  2  200 ? 184.995 38.454 -25.082 1.00 121.01 ? 210  PHE D C   1 
ATOM   6547  O O   . PHE D  2  200 ? 186.047 39.062 -24.885 1.00 121.04 ? 210  PHE D O   1 
ATOM   6548  C CB  . PHE D  2  200 ? 184.588 37.384 -27.286 1.00 121.26 ? 210  PHE D CB  1 
ATOM   6549  C CG  . PHE D  2  200 ? 183.711 37.244 -28.498 1.00 121.49 ? 210  PHE D CG  1 
ATOM   6550  C CD1 . PHE D  2  200 ? 182.376 36.889 -28.368 1.00 121.62 ? 210  PHE D CD1 1 
ATOM   6551  C CD2 . PHE D  2  200 ? 184.226 37.448 -29.769 1.00 121.71 ? 210  PHE D CD2 1 
ATOM   6552  C CE1 . PHE D  2  200 ? 181.568 36.747 -29.485 1.00 121.70 ? 210  PHE D CE1 1 
ATOM   6553  C CE2 . PHE D  2  200 ? 183.422 37.307 -30.891 1.00 121.81 ? 210  PHE D CE2 1 
ATOM   6554  C CZ  . PHE D  2  200 ? 182.092 36.957 -30.747 1.00 121.78 ? 210  PHE D CZ  1 
ATOM   6555  N N   . ARG D  2  201 ? 184.448 37.644 -24.178 1.00 120.73 ? 211  ARG D N   1 
ATOM   6556  C CA  . ARG D  2  201 ? 185.073 37.414 -22.874 1.00 120.49 ? 211  ARG D CA  1 
ATOM   6557  C C   . ARG D  2  201 ? 184.675 36.069 -22.266 1.00 120.51 ? 211  ARG D C   1 
ATOM   6558  O O   . ARG D  2  201 ? 183.505 35.695 -22.285 1.00 120.53 ? 211  ARG D O   1 
ATOM   6559  C CB  . ARG D  2  201 ? 184.702 38.526 -21.895 1.00 120.34 ? 211  ARG D CB  1 
ATOM   6560  C CG  . ARG D  2  201 ? 185.199 39.902 -22.272 1.00 119.86 ? 211  ARG D CG  1 
ATOM   6561  C CD  . ARG D  2  201 ? 185.167 40.855 -21.094 1.00 119.31 ? 211  ARG D CD  1 
ATOM   6562  N NE  . ARG D  2  201 ? 185.984 40.355 -19.989 1.00 118.98 ? 211  ARG D NE  1 
ATOM   6563  C CZ  . ARG D  2  201 ? 187.302 40.191 -20.046 1.00 118.68 ? 211  ARG D CZ  1 
ATOM   6564  N NH1 . ARG D  2  201 ? 187.967 40.494 -21.153 1.00 118.62 ? 211  ARG D NH1 1 
ATOM   6565  N NH2 . ARG D  2  201 ? 187.961 39.723 -18.993 1.00 118.53 ? 211  ARG D NH2 1 
ATOM   6566  N N   . CYS D  2  202 ? 185.657 35.354 -21.721 1.00 120.47 ? 212  CYS D N   1 
ATOM   6567  C CA  . CYS D  2  202 ? 185.419 34.065 -21.075 1.00 120.47 ? 212  CYS D CA  1 
ATOM   6568  C C   . CYS D  2  202 ? 186.118 34.049 -19.718 1.00 120.51 ? 212  CYS D C   1 
ATOM   6569  O O   . CYS D  2  202 ? 187.242 34.533 -19.599 1.00 120.51 ? 212  CYS D O   1 
ATOM   6570  C CB  . CYS D  2  202 ? 185.947 32.922 -21.937 1.00 120.45 ? 212  CYS D CB  1 
ATOM   6571  S SG  . CYS D  2  202 ? 185.949 31.328 -21.088 1.00 120.53 ? 212  CYS D SG  1 
ATOM   6572  N N   . GLN D  2  203 ? 185.464 33.497 -18.697 1.00 120.55 ? 213  GLN D N   1 
ATOM   6573  C CA  . GLN D  2  203 ? 186.061 33.453 -17.358 1.00 120.61 ? 213  GLN D CA  1 
ATOM   6574  C C   . GLN D  2  203 ? 185.803 32.156 -16.583 1.00 120.72 ? 213  GLN D C   1 
ATOM   6575  O O   . GLN D  2  203 ? 184.717 31.578 -16.655 1.00 120.69 ? 213  GLN D O   1 
ATOM   6576  C CB  . GLN D  2  203 ? 185.589 34.651 -16.531 1.00 120.57 ? 213  GLN D CB  1 
ATOM   6577  C CG  . GLN D  2  203 ? 186.384 34.867 -15.253 1.00 120.43 ? 213  GLN D CG  1 
ATOM   6578  C CD  . GLN D  2  203 ? 186.033 36.170 -14.559 1.00 120.36 ? 213  GLN D CD  1 
ATOM   6579  O OE1 . GLN D  2  203 ? 186.612 36.507 -13.527 1.00 120.34 ? 213  GLN D OE1 1 
ATOM   6580  N NE2 . GLN D  2  203 ? 185.084 36.906 -15.124 1.00 120.33 ? 213  GLN D NE2 1 
ATOM   6581  N N   . VAL D  2  204 ? 186.825 31.718 -15.844 1.00 120.81 ? 214  VAL D N   1 
ATOM   6582  C CA  . VAL D  2  204 ? 186.769 30.505 -15.028 1.00 120.89 ? 214  VAL D CA  1 
ATOM   6583  C C   . VAL D  2  204 ? 186.754 30.899 -13.554 1.00 120.85 ? 214  VAL D C   1 
ATOM   6584  O O   . VAL D  2  204 ? 187.806 31.070 -12.936 1.00 120.90 ? 214  VAL D O   1 
ATOM   6585  C CB  . VAL D  2  204 ? 187.990 29.584 -15.268 1.00 120.97 ? 214  VAL D CB  1 
ATOM   6586  C CG1 . VAL D  2  204 ? 187.939 28.374 -14.335 1.00 121.05 ? 214  VAL D CG1 1 
ATOM   6587  C CG2 . VAL D  2  204 ? 188.040 29.124 -16.709 1.00 121.04 ? 214  VAL D CG2 1 
ATOM   6588  N N   . GLN D  2  205 ? 185.557 31.047 -13.001 1.00 120.78 ? 215  GLN D N   1 
ATOM   6589  C CA  . GLN D  2  205 ? 185.378 31.422 -11.605 1.00 120.69 ? 215  GLN D CA  1 
ATOM   6590  C C   . GLN D  2  205 ? 186.065 30.411 -10.685 1.00 120.62 ? 215  GLN D C   1 
ATOM   6591  O O   . GLN D  2  205 ? 185.415 29.544 -10.103 1.00 120.59 ? 215  GLN D O   1 
ATOM   6592  C CB  . GLN D  2  205 ? 183.884 31.489 -11.297 1.00 120.70 ? 215  GLN D CB  1 
ATOM   6593  C CG  . GLN D  2  205 ? 183.529 32.166 -9.996  1.00 120.69 ? 215  GLN D CG  1 
ATOM   6594  C CD  . GLN D  2  205 ? 182.032 32.257 -9.809  1.00 120.72 ? 215  GLN D CD  1 
ATOM   6595  O OE1 . GLN D  2  205 ? 181.356 31.237 -9.672  1.00 120.87 ? 215  GLN D OE1 1 
ATOM   6596  N NE2 . GLN D  2  205 ? 181.505 33.475 -9.818  1.00 120.84 ? 215  GLN D NE2 1 
ATOM   6597  N N   . PHE D  2  206 ? 187.383 30.534 -10.562 1.00 120.58 ? 216  PHE D N   1 
ATOM   6598  C CA  . PHE D  2  206 ? 188.176 29.630 -9.734  1.00 120.53 ? 216  PHE D CA  1 
ATOM   6599  C C   . PHE D  2  206 ? 187.911 29.828 -8.246  1.00 120.65 ? 216  PHE D C   1 
ATOM   6600  O O   . PHE D  2  206 ? 187.966 30.948 -7.739  1.00 120.67 ? 216  PHE D O   1 
ATOM   6601  C CB  . PHE D  2  206 ? 189.664 29.830 -10.013 1.00 120.43 ? 216  PHE D CB  1 
ATOM   6602  C CG  . PHE D  2  206 ? 190.555 28.929 -9.208  1.00 120.18 ? 216  PHE D CG  1 
ATOM   6603  C CD1 . PHE D  2  206 ? 190.505 27.555 -9.375  1.00 119.99 ? 216  PHE D CD1 1 
ATOM   6604  C CD2 . PHE D  2  206 ? 191.438 29.455 -8.278  1.00 119.88 ? 216  PHE D CD2 1 
ATOM   6605  C CE1 . PHE D  2  206 ? 191.323 26.724 -8.635  1.00 119.78 ? 216  PHE D CE1 1 
ATOM   6606  C CE2 . PHE D  2  206 ? 192.259 28.626 -7.530  1.00 119.65 ? 216  PHE D CE2 1 
ATOM   6607  C CZ  . PHE D  2  206 ? 192.201 27.260 -7.709  1.00 119.64 ? 216  PHE D CZ  1 
ATOM   6608  N N   . HIS D  2  207 ? 187.635 28.730 -7.551  1.00 120.82 ? 217  HIS D N   1 
ATOM   6609  C CA  . HIS D  2  207 ? 187.369 28.767 -6.119  1.00 120.97 ? 217  HIS D CA  1 
ATOM   6610  C C   . HIS D  2  207 ? 188.554 28.155 -5.374  1.00 121.33 ? 217  HIS D C   1 
ATOM   6611  O O   . HIS D  2  207 ? 188.627 26.938 -5.211  1.00 121.31 ? 217  HIS D O   1 
ATOM   6612  C CB  . HIS D  2  207 ? 186.090 27.987 -5.805  1.00 120.82 ? 217  HIS D CB  1 
ATOM   6613  C CG  . HIS D  2  207 ? 184.874 28.511 -6.505  1.00 120.34 ? 217  HIS D CG  1 
ATOM   6614  N ND1 . HIS D  2  207 ? 183.688 27.810 -6.563  1.00 119.99 ? 217  HIS D ND1 1 
ATOM   6615  C CD2 . HIS D  2  207 ? 184.659 29.667 -7.177  1.00 119.93 ? 217  HIS D CD2 1 
ATOM   6616  C CE1 . HIS D  2  207 ? 182.796 28.512 -7.239  1.00 119.85 ? 217  HIS D CE1 1 
ATOM   6617  N NE2 . HIS D  2  207 ? 183.360 29.643 -7.623  1.00 119.76 ? 217  HIS D NE2 1 
ATOM   6618  N N   . GLY D  2  208 ? 189.483 28.991 -4.922  1.00 121.76 ? 218  GLY D N   1 
ATOM   6619  C CA  . GLY D  2  208 ? 190.661 28.480 -4.239  1.00 122.18 ? 218  GLY D CA  1 
ATOM   6620  C C   . GLY D  2  208 ? 190.822 28.804 -2.766  1.00 122.55 ? 218  GLY D C   1 
ATOM   6621  O O   . GLY D  2  208 ? 189.856 29.088 -2.054  1.00 122.61 ? 218  GLY D O   1 
ATOM   6622  N N   . LEU D  2  209 ? 192.074 28.743 -2.318  1.00 122.93 ? 219  LEU D N   1 
ATOM   6623  C CA  . LEU D  2  209 ? 192.438 29.012 -0.933  1.00 123.20 ? 219  LEU D CA  1 
ATOM   6624  C C   . LEU D  2  209 ? 192.316 30.499 -0.611  1.00 123.36 ? 219  LEU D C   1 
ATOM   6625  O O   . LEU D  2  209 ? 192.580 31.354 -1.458  1.00 123.35 ? 219  LEU D O   1 
ATOM   6626  C CB  . LEU D  2  209 ? 193.874 28.542 -0.671  1.00 123.24 ? 219  LEU D CB  1 
ATOM   6627  C CG  . LEU D  2  209 ? 194.186 27.065 -0.940  1.00 123.36 ? 219  LEU D CG  1 
ATOM   6628  C CD1 . LEU D  2  209 ? 195.677 26.812 -0.775  1.00 123.34 ? 219  LEU D CD1 1 
ATOM   6629  C CD2 . LEU D  2  209 ? 193.382 26.171 -0.010  1.00 123.43 ? 219  LEU D CD2 1 
ATOM   6630  N N   . SER D  2  210 ? 191.917 30.799 0.621   1.00 123.51 ? 220  SER D N   1 
ATOM   6631  C CA  . SER D  2  210 ? 191.762 32.177 1.067   1.00 123.62 ? 220  SER D CA  1 
ATOM   6632  C C   . SER D  2  210 ? 193.104 32.900 1.022   1.00 123.65 ? 220  SER D C   1 
ATOM   6633  O O   . SER D  2  210 ? 194.158 32.269 0.932   1.00 123.67 ? 220  SER D O   1 
ATOM   6634  C CB  . SER D  2  210 ? 191.205 32.212 2.493   1.00 123.66 ? 220  SER D CB  1 
ATOM   6635  O OG  . SER D  2  210 ? 189.991 31.484 2.587   1.00 123.71 ? 220  SER D OG  1 
ATOM   6636  N N   . GLU D  2  211 ? 193.059 34.226 1.093   1.00 123.66 ? 221  GLU D N   1 
ATOM   6637  C CA  . GLU D  2  211 ? 194.267 35.042 1.072   1.00 123.66 ? 221  GLU D CA  1 
ATOM   6638  C C   . GLU D  2  211 ? 194.952 34.971 2.435   1.00 123.51 ? 221  GLU D C   1 
ATOM   6639  O O   . GLU D  2  211 ? 195.750 35.839 2.790   1.00 123.49 ? 221  GLU D O   1 
ATOM   6640  C CB  . GLU D  2  211 ? 193.920 36.494 0.730   1.00 123.73 ? 221  GLU D CB  1 
ATOM   6641  C CG  . GLU D  2  211 ? 193.263 36.676 -0.633  1.00 123.94 ? 221  GLU D CG  1 
ATOM   6642  C CD  . GLU D  2  211 ? 191.983 35.873 -0.785  1.00 124.13 ? 221  GLU D CD  1 
ATOM   6643  O OE1 . GLU D  2  211 ? 191.086 36.014 0.073   1.00 124.20 ? 221  GLU D OE1 1 
ATOM   6644  O OE2 . GLU D  2  211 ? 191.877 35.097 -1.758  1.00 124.18 ? 221  GLU D OE2 1 
ATOM   6645  N N   . GLU D  2  212 ? 194.629 33.926 3.192   1.00 123.33 ? 222  GLU D N   1 
ATOM   6646  C CA  . GLU D  2  212 ? 195.181 33.723 4.525   1.00 123.11 ? 222  GLU D CA  1 
ATOM   6647  C C   . GLU D  2  212 ? 195.677 32.291 4.712   1.00 122.96 ? 222  GLU D C   1 
ATOM   6648  O O   . GLU D  2  212 ? 195.708 31.784 5.834   1.00 122.99 ? 222  GLU D O   1 
ATOM   6649  C CB  . GLU D  2  212 ? 194.119 34.033 5.581   1.00 123.07 ? 222  GLU D CB  1 
ATOM   6650  C CG  . GLU D  2  212 ? 193.615 35.465 5.553   1.00 122.89 ? 222  GLU D CG  1 
ATOM   6651  C CD  . GLU D  2  212 ? 192.405 35.674 6.440   1.00 122.70 ? 222  GLU D CD  1 
ATOM   6652  O OE1 . GLU D  2  212 ? 191.984 36.838 6.604   1.00 122.52 ? 222  GLU D OE1 1 
ATOM   6653  O OE2 . GLU D  2  212 ? 191.871 34.677 6.970   1.00 122.62 ? 222  GLU D OE2 1 
ATOM   6654  N N   . ASP D  2  213 ? 196.056 31.638 3.618   1.00 122.74 ? 223  ASP D N   1 
ATOM   6655  C CA  . ASP D  2  213 ? 196.561 30.272 3.686   1.00 122.56 ? 223  ASP D CA  1 
ATOM   6656  C C   . ASP D  2  213 ? 198.034 30.246 3.285   1.00 122.44 ? 223  ASP D C   1 
ATOM   6657  O O   . ASP D  2  213 ? 198.570 31.244 2.804   1.00 122.40 ? 223  ASP D O   1 
ATOM   6658  C CB  . ASP D  2  213 ? 195.755 29.351 2.770   1.00 122.53 ? 223  ASP D CB  1 
ATOM   6659  C CG  . ASP D  2  213 ? 196.002 27.888 3.065   1.00 122.44 ? 223  ASP D CG  1 
ATOM   6660  O OD1 . ASP D  2  213 ? 195.534 27.026 2.293   1.00 122.45 ? 223  ASP D OD1 1 
ATOM   6661  O OD2 . ASP D  2  213 ? 196.661 27.526 4.061   1.00 122.37 ? 223  ASP D OD2 1 
ATOM   6662  N N   . LYS D  2  214 ? 198.684 29.103 3.480   1.00 122.29 ? 224  LYS D N   1 
ATOM   6663  C CA  . LYS D  2  214 ? 200.095 28.959 3.140   1.00 122.20 ? 224  LYS D CA  1 
ATOM   6664  C C   . LYS D  2  214 ? 200.279 27.979 1.983   1.00 122.22 ? 224  LYS D C   1 
ATOM   6665  O O   . LYS D  2  214 ? 199.333 27.304 1.576   1.00 122.24 ? 224  LYS D O   1 
ATOM   6666  C CB  . LYS D  2  214 ? 200.880 28.484 4.364   1.00 122.13 ? 224  LYS D CB  1 
ATOM   6667  C CG  . LYS D  2  214 ? 200.619 29.304 5.625   1.00 121.90 ? 224  LYS D CG  1 
ATOM   6668  C CD  . LYS D  2  214 ? 201.016 30.763 5.455   1.00 121.55 ? 224  LYS D CD  1 
ATOM   6669  C CE  . LYS D  2  214 ? 200.659 31.587 6.684   1.00 121.31 ? 224  LYS D CE  1 
ATOM   6670  N NZ  . LYS D  2  214 ? 201.328 31.091 7.917   1.00 121.13 ? 224  LYS D NZ  1 
ATOM   6671  N N   . TRP D  2  215 ? 201.499 27.906 1.456   1.00 122.22 ? 225  TRP D N   1 
ATOM   6672  C CA  . TRP D  2  215 ? 201.809 27.010 0.344   1.00 122.21 ? 225  TRP D CA  1 
ATOM   6673  C C   . TRP D  2  215 ? 203.326 26.874 0.176   1.00 122.43 ? 225  TRP D C   1 
ATOM   6674  O O   . TRP D  2  215 ? 203.994 27.823 -0.233  1.00 122.38 ? 225  TRP D O   1 
ATOM   6675  C CB  . TRP D  2  215 ? 201.178 27.545 -0.943  1.00 122.10 ? 225  TRP D CB  1 
ATOM   6676  C CG  . TRP D  2  215 ? 201.303 26.635 -2.132  1.00 121.70 ? 225  TRP D CG  1 
ATOM   6677  C CD1 . TRP D  2  215 ? 202.447 26.299 -2.792  1.00 121.44 ? 225  TRP D CD1 1 
ATOM   6678  C CD2 . TRP D  2  215 ? 200.238 25.965 -2.816  1.00 121.37 ? 225  TRP D CD2 1 
ATOM   6679  N NE1 . TRP D  2  215 ? 202.163 25.456 -3.840  1.00 121.28 ? 225  TRP D NE1 1 
ATOM   6680  C CE2 . TRP D  2  215 ? 200.812 25.236 -3.878  1.00 121.28 ? 225  TRP D CE2 1 
ATOM   6681  C CE3 . TRP D  2  215 ? 198.852 25.903 -2.638  1.00 121.24 ? 225  TRP D CE3 1 
ATOM   6682  C CZ2 . TRP D  2  215 ? 200.053 24.459 -4.752  1.00 121.24 ? 225  TRP D CZ2 1 
ATOM   6683  C CZ3 . TRP D  2  215 ? 198.101 25.133 -3.505  1.00 121.21 ? 225  TRP D CZ3 1 
ATOM   6684  C CH2 . TRP D  2  215 ? 198.702 24.422 -4.550  1.00 121.17 ? 225  TRP D CH2 1 
ATOM   6685  N N   . PRO D  2  216 ? 203.869 25.699 0.509   1.00 122.68 ? 226  PRO D N   1 
ATOM   6686  C CA  . PRO D  2  216 ? 205.308 25.422 0.403   1.00 122.88 ? 226  PRO D CA  1 
ATOM   6687  C C   . PRO D  2  216 ? 205.824 25.238 -1.029  1.00 123.12 ? 226  PRO D C   1 
ATOM   6688  O O   . PRO D  2  216 ? 205.086 25.454 -1.988  1.00 123.12 ? 226  PRO D O   1 
ATOM   6689  C CB  . PRO D  2  216 ? 205.452 24.134 1.216   1.00 122.83 ? 226  PRO D CB  1 
ATOM   6690  C CG  . PRO D  2  216 ? 204.163 23.450 0.988   1.00 122.72 ? 226  PRO D CG  1 
ATOM   6691  C CD  . PRO D  2  216 ? 203.157 24.559 1.110   1.00 122.69 ? 226  PRO D CD  1 
ATOM   6692  N N   . GLU D  2  217 ? 207.093 24.851 -1.156  1.00 123.40 ? 227  GLU D N   1 
ATOM   6693  C CA  . GLU D  2  217 ? 207.734 24.653 -2.459  1.00 123.61 ? 227  GLU D CA  1 
ATOM   6694  C C   . GLU D  2  217 ? 207.836 25.965 -3.233  1.00 123.79 ? 227  GLU D C   1 
ATOM   6695  O O   . GLU D  2  217 ? 207.647 27.047 -2.674  1.00 123.83 ? 227  GLU D O   1 
ATOM   6696  C CB  . GLU D  2  217 ? 206.971 23.621 -3.300  1.00 123.62 ? 227  GLU D CB  1 
ATOM   6697  C CG  . GLU D  2  217 ? 206.904 22.229 -2.696  1.00 123.53 ? 227  GLU D CG  1 
ATOM   6698  C CD  . GLU D  2  217 ? 205.965 22.152 -1.514  1.00 123.44 ? 227  GLU D CD  1 
ATOM   6699  O OE1 . GLU D  2  217 ? 204.768 22.463 -1.691  1.00 123.29 ? 227  GLU D OE1 1 
ATOM   6700  O OE2 . GLU D  2  217 ? 206.424 21.785 -0.412  1.00 123.27 ? 227  GLU D OE2 1 
ATOM   6701  N N   . GLY D  2  218 ? 208.136 25.862 -4.523  1.00 123.98 ? 228  GLY D N   1 
ATOM   6702  C CA  . GLY D  2  218 ? 208.244 27.035 -5.368  1.00 124.11 ? 228  GLY D CA  1 
ATOM   6703  C C   . GLY D  2  218 ? 207.088 27.106 -6.347  1.00 124.23 ? 228  GLY D C   1 
ATOM   6704  O O   . GLY D  2  218 ? 207.108 26.440 -7.382  1.00 124.23 ? 228  GLY D O   1 
ATOM   6705  N N   . SER D  2  219 ? 206.078 27.908 -6.015  1.00 124.36 ? 229  SER D N   1 
ATOM   6706  C CA  . SER D  2  219 ? 204.900 28.071 -6.866  1.00 124.47 ? 229  SER D CA  1 
ATOM   6707  C C   . SER D  2  219 ? 203.832 28.930 -6.180  1.00 124.54 ? 229  SER D C   1 
ATOM   6708  O O   . SER D  2  219 ? 203.523 28.715 -5.007  1.00 124.53 ? 229  SER D O   1 
ATOM   6709  C CB  . SER D  2  219 ? 204.311 26.705 -7.217  1.00 124.50 ? 229  SER D CB  1 
ATOM   6710  O OG  . SER D  2  219 ? 204.077 25.938 -6.048  1.00 124.58 ? 229  SER D OG  1 
ATOM   6711  N N   . PRO D  2  220 ? 203.281 29.912 -6.900  1.00 124.63 ? 230  PRO D N   1 
ATOM   6712  C CA  . PRO D  2  220 ? 202.237 30.788 -6.357  1.00 124.67 ? 230  PRO D CA  1 
ATOM   6713  C C   . PRO D  2  220 ? 201.037 30.010 -5.833  1.00 124.71 ? 230  PRO D C   1 
ATOM   6714  O O   . PRO D  2  220 ? 200.620 29.028 -6.447  1.00 124.74 ? 230  PRO D O   1 
ATOM   6715  C CB  . PRO D  2  220 ? 201.866 31.655 -7.561  1.00 124.66 ? 230  PRO D CB  1 
ATOM   6716  C CG  . PRO D  2  220 ? 203.140 31.741 -8.314  1.00 124.65 ? 230  PRO D CG  1 
ATOM   6717  C CD  . PRO D  2  220 ? 203.649 30.321 -8.266  1.00 124.65 ? 230  PRO D CD  1 
ATOM   6718  N N   . LYS D  2  221 ? 200.495 30.442 -4.699  1.00 124.73 ? 231  LYS D N   1 
ATOM   6719  C CA  . LYS D  2  221 ? 199.357 29.759 -4.095  1.00 124.76 ? 231  LYS D CA  1 
ATOM   6720  C C   . LYS D  2  221 ? 198.043 30.114 -4.793  1.00 124.70 ? 231  LYS D C   1 
ATOM   6721  O O   . LYS D  2  221 ? 197.669 31.285 -4.862  1.00 124.71 ? 231  LYS D O   1 
ATOM   6722  C CB  . LYS D  2  221 ? 199.254 30.101 -2.607  1.00 124.80 ? 231  LYS D CB  1 
ATOM   6723  C CG  . LYS D  2  221 ? 198.211 29.269 -1.868  1.00 124.93 ? 231  LYS D CG  1 
ATOM   6724  C CD  . LYS D  2  221 ? 198.068 29.680 -0.413  1.00 125.07 ? 231  LYS D CD  1 
ATOM   6725  C CE  . LYS D  2  221 ? 197.423 31.047 -0.280  1.00 125.15 ? 231  LYS D CE  1 
ATOM   6726  N NZ  . LYS D  2  221 ? 196.054 31.071 -0.863  1.00 125.21 ? 231  LYS D NZ  1 
ATOM   6727  N N   . PRO D  2  222 ? 197.360 29.108 -5.340  1.00 124.58 ? 232  PRO D N   1 
ATOM   6728  C CA  . PRO D  2  222 ? 196.074 29.311 -6.011  1.00 124.41 ? 232  PRO D CA  1 
ATOM   6729  C C   . PRO D  2  222 ? 195.016 29.910 -5.092  1.00 124.23 ? 232  PRO D C   1 
ATOM   6730  O O   . PRO D  2  222 ? 194.251 29.185 -4.458  1.00 124.22 ? 232  PRO D O   1 
ATOM   6731  C CB  . PRO D  2  222 ? 195.699 27.894 -6.451  1.00 124.40 ? 232  PRO D CB  1 
ATOM   6732  C CG  . PRO D  2  222 ? 197.011 27.253 -6.661  1.00 124.51 ? 232  PRO D CG  1 
ATOM   6733  C CD  . PRO D  2  222 ? 197.805 27.711 -5.473  1.00 124.58 ? 232  PRO D CD  1 
ATOM   6734  N N   . VAL D  2  223 ? 194.990 31.235 -5.023  1.00 123.99 ? 233  VAL D N   1 
ATOM   6735  C CA  . VAL D  2  223 ? 194.019 31.941 -4.196  1.00 123.79 ? 233  VAL D CA  1 
ATOM   6736  C C   . VAL D  2  223 ? 192.652 31.927 -4.884  1.00 123.63 ? 233  VAL D C   1 
ATOM   6737  O O   . VAL D  2  223 ? 192.388 31.070 -5.727  1.00 123.59 ? 233  VAL D O   1 
ATOM   6738  C CB  . VAL D  2  223 ? 194.459 33.396 -3.936  1.00 123.77 ? 233  VAL D CB  1 
ATOM   6739  C CG1 . VAL D  2  223 ? 195.683 33.422 -3.040  1.00 123.77 ? 233  VAL D CG1 1 
ATOM   6740  C CG2 . VAL D  2  223 ? 194.749 34.109 -5.247  1.00 123.68 ? 233  VAL D CG2 1 
ATOM   6741  N N   . THR D  2  224 ? 191.788 32.875 -4.531  1.00 123.38 ? 234  THR D N   1 
ATOM   6742  C CA  . THR D  2  224 ? 190.462 32.963 -5.138  1.00 123.13 ? 234  THR D CA  1 
ATOM   6743  C C   . THR D  2  224 ? 190.560 33.674 -6.486  1.00 122.86 ? 234  THR D C   1 
ATOM   6744  O O   . THR D  2  224 ? 189.748 34.544 -6.806  1.00 122.83 ? 234  THR D O   1 
ATOM   6745  C CB  . THR D  2  224 ? 189.500 33.740 -4.230  1.00 123.15 ? 234  THR D CB  1 
ATOM   6746  O OG1 . THR D  2  224 ? 189.547 33.211 -2.897  1.00 123.20 ? 234  THR D OG1 1 
ATOM   6747  C CG2 . THR D  2  224 ? 188.053 33.569 -4.705  1.00 123.16 ? 234  THR D CG2 1 
ATOM   6748  N N   . GLN D  2  225 ? 191.564 33.297 -7.270  1.00 122.54 ? 235  GLN D N   1 
ATOM   6749  C CA  . GLN D  2  225 ? 191.810 33.902 -8.574  1.00 122.23 ? 235  GLN D CA  1 
ATOM   6750  C C   . GLN D  2  225 ? 190.719 33.586 -9.594  1.00 122.08 ? 235  GLN D C   1 
ATOM   6751  O O   . GLN D  2  225 ? 189.796 32.820 -9.321  1.00 122.08 ? 235  GLN D O   1 
ATOM   6752  C CB  . GLN D  2  225 ? 193.170 33.447 -9.110  1.00 122.13 ? 235  GLN D CB  1 
ATOM   6753  C CG  . GLN D  2  225 ? 193.291 31.947 -9.317  1.00 121.79 ? 235  GLN D CG  1 
ATOM   6754  C CD  . GLN D  2  225 ? 194.695 31.522 -9.680  1.00 121.48 ? 235  GLN D CD  1 
ATOM   6755  O OE1 . GLN D  2  225 ? 195.258 31.994 -10.664 1.00 121.37 ? 235  GLN D OE1 1 
ATOM   6756  N NE2 . GLN D  2  225 ? 195.267 30.630 -8.883  1.00 121.33 ? 235  GLN D NE2 1 
ATOM   6757  N N   . ASN D  2  226 ? 190.839 34.194 -10.770 1.00 121.85 ? 236  ASN D N   1 
ATOM   6758  C CA  . ASN D  2  226 ? 189.884 34.005 -11.852 1.00 121.64 ? 236  ASN D CA  1 
ATOM   6759  C C   . ASN D  2  226 ? 190.611 33.921 -13.193 1.00 121.51 ? 236  ASN D C   1 
ATOM   6760  O O   . ASN D  2  226 ? 190.532 34.845 -14.002 1.00 121.48 ? 236  ASN D O   1 
ATOM   6761  C CB  . ASN D  2  226 ? 188.890 35.171 -11.891 1.00 121.64 ? 236  ASN D CB  1 
ATOM   6762  C CG  . ASN D  2  226 ? 188.055 35.280 -10.625 1.00 121.61 ? 236  ASN D CG  1 
ATOM   6763  O OD1 . ASN D  2  226 ? 188.587 35.384 -9.520  1.00 121.63 ? 236  ASN D OD1 1 
ATOM   6764  N ND2 . ASN D  2  226 ? 186.736 35.268 -10.784 1.00 121.48 ? 236  ASN D ND2 1 
ATOM   6765  N N   . ILE D  2  227 ? 191.328 32.823 -13.423 1.00 121.37 ? 237  ILE D N   1 
ATOM   6766  C CA  . ILE D  2  227 ? 192.051 32.639 -14.681 1.00 121.29 ? 237  ILE D CA  1 
ATOM   6767  C C   . ILE D  2  227 ? 191.090 32.910 -15.835 1.00 121.51 ? 237  ILE D C   1 
ATOM   6768  O O   . ILE D  2  227 ? 189.886 32.692 -15.699 1.00 121.54 ? 237  ILE D O   1 
ATOM   6769  C CB  . ILE D  2  227 ? 192.605 31.206 -14.799 1.00 121.12 ? 237  ILE D CB  1 
ATOM   6770  C CG1 . ILE D  2  227 ? 193.519 30.880 -13.616 1.00 120.81 ? 237  ILE D CG1 1 
ATOM   6771  C CG2 . ILE D  2  227 ? 193.366 31.044 -16.106 1.00 120.93 ? 237  ILE D CG2 1 
ATOM   6772  C CD1 . ILE D  2  227 ? 194.774 31.715 -13.558 1.00 120.57 ? 237  ILE D CD1 1 
ATOM   6773  N N   . SER D  2  228 ? 191.607 33.384 -16.967 1.00 121.73 ? 238  SER D N   1 
ATOM   6774  C CA  . SER D  2  228 ? 190.740 33.692 -18.106 1.00 121.91 ? 238  SER D CA  1 
ATOM   6775  C C   . SER D  2  228 ? 191.429 33.655 -19.472 1.00 122.18 ? 238  SER D C   1 
ATOM   6776  O O   . SER D  2  228 ? 192.635 33.435 -19.575 1.00 122.18 ? 238  SER D O   1 
ATOM   6777  C CB  . SER D  2  228 ? 190.092 35.062 -17.903 1.00 121.89 ? 238  SER D CB  1 
ATOM   6778  O OG  . SER D  2  228 ? 191.070 36.077 -17.764 1.00 121.81 ? 238  SER D OG  1 
ATOM   6779  N N   . ALA D  2  229 ? 190.628 33.871 -20.514 1.00 122.57 ? 239  ALA D N   1 
ATOM   6780  C CA  . ALA D  2  229 ? 191.089 33.887 -21.897 1.00 122.91 ? 239  ALA D CA  1 
ATOM   6781  C C   . ALA D  2  229 ? 190.047 34.643 -22.721 1.00 123.32 ? 239  ALA D C   1 
ATOM   6782  O O   . ALA D  2  229 ? 188.852 34.382 -22.593 1.00 123.33 ? 239  ALA D O   1 
ATOM   6783  C CB  . ALA D  2  229 ? 191.247 32.467 -22.417 1.00 122.85 ? 239  ALA D CB  1 
ATOM   6784  N N   . GLU D  2  230 ? 190.490 35.578 -23.558 1.00 123.85 ? 240  GLU D N   1 
ATOM   6785  C CA  . GLU D  2  230 ? 189.559 36.383 -24.355 1.00 124.32 ? 240  GLU D CA  1 
ATOM   6786  C C   . GLU D  2  230 ? 189.782 36.318 -25.861 1.00 124.87 ? 240  GLU D C   1 
ATOM   6787  O O   . GLU D  2  230 ? 190.818 35.857 -26.339 1.00 124.92 ? 240  GLU D O   1 
ATOM   6788  C CB  . GLU D  2  230 ? 189.589 37.851 -23.903 1.00 124.24 ? 240  GLU D CB  1 
ATOM   6789  C CG  . GLU D  2  230 ? 190.945 38.551 -24.007 1.00 124.02 ? 240  GLU D CG  1 
ATOM   6790  C CD  . GLU D  2  230 ? 191.245 39.093 -25.395 1.00 123.77 ? 240  GLU D CD  1 
ATOM   6791  O OE1 . GLU D  2  230 ? 190.431 39.878 -25.923 1.00 123.62 ? 240  GLU D OE1 1 
ATOM   6792  O OE2 . GLU D  2  230 ? 192.307 38.742 -25.953 1.00 123.56 ? 240  GLU D OE2 1 
ATOM   6793  N N   . ALA D  2  231 ? 188.782 36.801 -26.594 1.00 125.54 ? 241  ALA D N   1 
ATOM   6794  C CA  . ALA D  2  231 ? 188.813 36.847 -28.047 1.00 126.09 ? 241  ALA D CA  1 
ATOM   6795  C C   . ALA D  2  231 ? 188.603 38.297 -28.472 1.00 126.59 ? 241  ALA D C   1 
ATOM   6796  O O   . ALA D  2  231 ? 188.305 39.153 -27.639 1.00 126.64 ? 241  ALA D O   1 
ATOM   6797  C CB  . ALA D  2  231 ? 187.722 35.959 -28.624 1.00 126.09 ? 241  ALA D CB  1 
ATOM   6798  N N   . TRP D  2  232 ? 188.754 38.574 -29.762 1.00 127.16 ? 242  TRP D N   1 
ATOM   6799  C CA  . TRP D  2  232 ? 188.576 39.932 -30.269 1.00 127.62 ? 242  TRP D CA  1 
ATOM   6800  C C   . TRP D  2  232 ? 187.776 39.925 -31.568 1.00 127.82 ? 242  TRP D C   1 
ATOM   6801  O O   . TRP D  2  232 ? 187.377 38.868 -32.056 1.00 127.87 ? 242  TRP D O   1 
ATOM   6802  C CB  . TRP D  2  232 ? 189.936 40.596 -30.490 1.00 127.76 ? 242  TRP D CB  1 
ATOM   6803  C CG  . TRP D  2  232 ? 189.996 42.021 -30.042 1.00 128.25 ? 242  TRP D CG  1 
ATOM   6804  C CD1 . TRP D  2  232 ? 189.177 43.042 -30.431 1.00 128.64 ? 242  TRP D CD1 1 
ATOM   6805  C CD2 . TRP D  2  232 ? 190.930 42.589 -29.119 1.00 128.70 ? 242  TRP D CD2 1 
ATOM   6806  N NE1 . TRP D  2  232 ? 189.541 44.209 -29.804 1.00 128.79 ? 242  TRP D NE1 1 
ATOM   6807  C CE2 . TRP D  2  232 ? 190.616 43.959 -28.992 1.00 128.83 ? 242  TRP D CE2 1 
ATOM   6808  C CE3 . TRP D  2  232 ? 192.005 42.078 -28.382 1.00 128.87 ? 242  TRP D CE3 1 
ATOM   6809  C CZ2 . TRP D  2  232 ? 191.334 44.819 -28.162 1.00 128.89 ? 242  TRP D CZ2 1 
ATOM   6810  C CZ3 . TRP D  2  232 ? 192.718 42.935 -27.557 1.00 128.94 ? 242  TRP D CZ3 1 
ATOM   6811  C CH2 . TRP D  2  232 ? 192.378 44.290 -27.454 1.00 128.90 ? 242  TRP D CH2 1 
ATOM   6812  N N   . GLY D  2  233 ? 187.545 41.110 -32.125 1.00 128.02 ? 243  GLY D N   1 
ATOM   6813  C CA  . GLY D  2  233 ? 186.796 41.235 -33.360 1.00 128.17 ? 243  GLY D CA  1 
ATOM   6814  C C   . GLY D  2  233 ? 187.704 41.330 -34.571 1.00 128.29 ? 243  GLY D C   1 
ATOM   6815  O O   . GLY D  2  233 ? 188.472 42.281 -34.707 1.00 128.27 ? 243  GLY D O   1 
ATOM   6816  N N   . ARG D  2  234 ? 187.613 40.340 -35.455 1.00 128.44 ? 244  ARG D N   1 
ATOM   6817  C CA  . ARG D  2  234 ? 188.432 40.301 -36.664 1.00 128.56 ? 244  ARG D CA  1 
ATOM   6818  C C   . ARG D  2  234 ? 187.648 40.824 -37.862 1.00 128.48 ? 244  ARG D C   1 
ATOM   6819  O O   . ARG D  2  234 ? 186.417 40.854 -37.841 1.00 128.56 ? 244  ARG D O   1 
ATOM   6820  C CB  . ARG D  2  234 ? 188.906 38.871 -36.948 1.00 128.66 ? 244  ARG D CB  1 
ATOM   6821  C CG  . ARG D  2  234 ? 189.696 38.242 -35.817 1.00 128.97 ? 244  ARG D CG  1 
ATOM   6822  C CD  . ARG D  2  234 ? 188.824 37.881 -34.621 1.00 129.29 ? 244  ARG D CD  1 
ATOM   6823  N NE  . ARG D  2  234 ? 189.606 37.570 -33.431 1.00 129.51 ? 244  ARG D NE  1 
ATOM   6824  C CZ  . ARG D  2  234 ? 190.380 38.442 -32.799 1.00 129.68 ? 244  ARG D CZ  1 
ATOM   6825  N NH1 . ARG D  2  234 ? 190.480 39.691 -33.242 1.00 129.80 ? 244  ARG D NH1 1 
ATOM   6826  N NH2 . ARG D  2  234 ? 191.058 38.070 -31.721 1.00 129.69 ? 244  ARG D NH2 1 
ATOM   6827  N N   . ALA D  2  235 ? 188.369 41.228 -38.906 1.00 128.33 ? 245  ALA D N   1 
ATOM   6828  C CA  . ALA D  2  235 ? 187.749 41.754 -40.119 1.00 128.16 ? 245  ALA D CA  1 
ATOM   6829  C C   . ALA D  2  235 ? 187.526 40.651 -41.150 1.00 127.99 ? 245  ALA D C   1 
ATOM   6830  O O   . ALA D  2  235 ? 188.191 39.615 -41.126 1.00 127.92 ? 245  ALA D O   1 
ATOM   6831  C CB  . ALA D  2  235 ? 188.607 42.862 -40.710 1.00 128.15 ? 245  ALA D CB  1 
ATOM   6832  N N   . ASP D  2  236 ? 186.588 40.892 -42.060 1.00 127.82 ? 246  ASP D N   1 
ATOM   6833  C CA  . ASP D  2  236 ? 186.243 39.931 -43.103 1.00 127.66 ? 246  ASP D CA  1 
ATOM   6834  C C   . ASP D  2  236 ? 187.441 39.519 -43.954 1.00 127.55 ? 246  ASP D C   1 
ATOM   6835  O O   . ASP D  2  236 ? 188.186 40.365 -44.450 1.00 127.53 ? 246  ASP D O   1 
ATOM   6836  C CB  . ASP D  2  236 ? 185.144 40.510 -43.991 1.00 127.64 ? 246  ASP D CB  1 
ATOM   6837  C CG  . ASP D  2  236 ? 183.886 40.833 -43.217 1.00 127.56 ? 246  ASP D CG  1 
ATOM   6838  O OD1 . ASP D  2  236 ? 183.212 39.891 -42.745 1.00 127.35 ? 246  ASP D OD1 1 
ATOM   6839  O OD2 . ASP D  2  236 ? 183.517 42.012 -43.033 1.00 127.51 ? 246  ASP D OD2 1 
ATOM   6840  N N   . CYS D  2  237 ? 187.609 38.207 -44.114 1.00 127.41 ? 247  CYS D N   1 
ATOM   6841  C CA  . CYS D  2  237 ? 188.697 37.636 -44.905 1.00 127.30 ? 247  CYS D CA  1 
ATOM   6842  C C   . CYS D  2  237 ? 190.064 37.923 -44.302 1.00 127.28 ? 247  CYS D C   1 
ATOM   6843  O O   . CYS D  2  237 ? 190.746 36.977 -43.893 1.00 127.25 ? 247  CYS D O   1 
ATOM   6844  C CB  . CYS D  2  237 ? 188.643 38.157 -46.342 1.00 127.26 ? 247  CYS D CB  1 
ATOM   6845  S SG  . CYS D  2  237 ? 187.129 37.710 -47.221 1.00 127.07 ? 247  CYS D SG  1 
ATOM   6846  O OXT . CYS D  2  237 ? 190.465 39.090 -44.242 1.00 127.25 ? 247  CYS D OXT 1 
ATOM   6847  N N   . GLY E  3  1   ? 119.256 17.227 22.508  1.00 23.29  ? 1    GLY H N   1 
ATOM   6848  C CA  . GLY E  3  1   ? 119.248 18.634 21.988  1.00 23.15  ? 1    GLY H CA  1 
ATOM   6849  C C   . GLY E  3  1   ? 118.019 19.414 22.421  1.00 22.95  ? 1    GLY H C   1 
ATOM   6850  O O   . GLY E  3  1   ? 117.185 18.894 23.164  1.00 23.35  ? 1    GLY H O   1 
ATOM   6851  N N   . PRO E  3  2   ? 117.907 20.670 21.995  1.00 22.66  ? 2    PRO H N   1 
ATOM   6852  C CA  . PRO E  3  2   ? 116.746 21.490 22.345  1.00 22.49  ? 2    PRO H CA  1 
ATOM   6853  C C   . PRO E  3  2   ? 115.518 21.125 21.507  1.00 22.08  ? 2    PRO H C   1 
ATOM   6854  O O   . PRO E  3  2   ? 115.650 20.839 20.324  1.00 22.51  ? 2    PRO H O   1 
ATOM   6855  C CB  . PRO E  3  2   ? 117.234 22.894 22.025  1.00 22.45  ? 2    PRO H CB  1 
ATOM   6856  C CG  . PRO E  3  2   ? 118.078 22.664 20.805  1.00 22.64  ? 2    PRO H CG  1 
ATOM   6857  C CD  . PRO E  3  2   ? 118.883 21.444 21.207  1.00 22.76  ? 2    PRO H CD  1 
ATOM   6858  N N   . HIS E  3  3   ? 114.341 21.124 22.124  1.00 21.39  ? 3    HIS H N   1 
ATOM   6859  C CA  . HIS E  3  3   ? 113.097 20.821 21.425  1.00 20.49  ? 3    HIS H CA  1 
ATOM   6860  C C   . HIS E  3  3   ? 112.157 21.988 21.616  1.00 18.91  ? 3    HIS H C   1 
ATOM   6861  O O   . HIS E  3  3   ? 112.324 22.770 22.540  1.00 19.15  ? 3    HIS H O   1 
ATOM   6862  C CB  . HIS E  3  3   ? 112.456 19.557 21.991  1.00 21.11  ? 3    HIS H CB  1 
ATOM   6863  C CG  . HIS E  3  3   ? 113.432 18.448 22.191  1.00 23.21  ? 3    HIS H CG  1 
ATOM   6864  N ND1 . HIS E  3  3   ? 114.009 17.772 21.137  1.00 24.82  ? 3    HIS H ND1 1 
ATOM   6865  C CD2 . HIS E  3  3   ? 113.994 17.948 23.316  1.00 24.37  ? 3    HIS H CD2 1 
ATOM   6866  C CE1 . HIS E  3  3   ? 114.875 16.892 21.607  1.00 25.80  ? 3    HIS H CE1 1 
ATOM   6867  N NE2 . HIS E  3  3   ? 114.885 16.980 22.926  1.00 25.63  ? 3    HIS H NE2 1 
ATOM   6868  N N   . SER E  3  4   ? 111.170 22.100 20.740  1.00 17.29  ? 4    SER H N   1 
ATOM   6869  C CA  . SER E  3  4   ? 110.193 23.162 20.819  1.00 15.41  ? 4    SER H CA  1 
ATOM   6870  C C   . SER E  3  4   ? 108.786 22.641 20.495  1.00 14.55  ? 4    SER H C   1 
ATOM   6871  O O   . SER E  3  4   ? 108.616 21.624 19.841  1.00 13.83  ? 4    SER H O   1 
ATOM   6872  C CB  . SER E  3  4   ? 110.568 24.285 19.873  1.00 15.08  ? 4    SER H CB  1 
ATOM   6873  O OG  . SER E  3  4   ? 110.350 23.888 18.536  1.00 16.16  ? 4    SER H OG  1 
ATOM   6874  N N   . LEU E  3  5   ? 107.789 23.347 21.018  1.00 13.98  ? 5    LEU H N   1 
ATOM   6875  C CA  . LEU E  3  5   ? 106.386 23.066 20.803  1.00 13.14  ? 5    LEU H CA  1 
ATOM   6876  C C   . LEU E  3  5   ? 105.860 24.422 20.373  1.00 13.56  ? 5    LEU H C   1 
ATOM   6877  O O   . LEU E  3  5   ? 106.072 25.418 21.089  1.00 13.34  ? 5    LEU H O   1 
ATOM   6878  C CB  . LEU E  3  5   ? 105.727 22.671 22.109  1.00 12.53  ? 5    LEU H CB  1 
ATOM   6879  C CG  . LEU E  3  5   ? 104.543 21.727 22.142  1.00 10.56  ? 5    LEU H CG  1 
ATOM   6880  C CD1 . LEU E  3  5   ? 103.718 22.089 23.370  1.00 8.23   ? 5    LEU H CD1 1 
ATOM   6881  C CD2 . LEU E  3  5   ? 103.700 21.782 20.891  1.00 10.15  ? 5    LEU H CD2 1 
ATOM   6882  N N   . ARG E  3  6   ? 105.190 24.482 19.225  1.00 13.34  ? 6    ARG H N   1 
ATOM   6883  C CA  . ARG E  3  6   ? 104.709 25.761 18.718  1.00 13.97  ? 6    ARG H CA  1 
ATOM   6884  C C   . ARG E  3  6   ? 103.426 25.678 17.893  1.00 13.39  ? 6    ARG H C   1 
ATOM   6885  O O   . ARG E  3  6   ? 103.298 24.815 17.033  1.00 14.18  ? 6    ARG H O   1 
ATOM   6886  C CB  . ARG E  3  6   ? 105.766 26.388 17.818  1.00 14.61  ? 6    ARG H CB  1 
ATOM   6887  C CG  . ARG E  3  6   ? 107.184 26.392 18.316  1.00 16.42  ? 6    ARG H CG  1 
ATOM   6888  C CD  . ARG E  3  6   ? 108.073 27.052 17.267  1.00 19.05  ? 6    ARG H CD  1 
ATOM   6889  N NE  . ARG E  3  6   ? 109.337 26.364 17.018  1.00 21.13  ? 6    ARG H NE  1 
ATOM   6890  C CZ  . ARG E  3  6   ? 110.509 26.732 17.514  1.00 21.96  ? 6    ARG H CZ  1 
ATOM   6891  N NH1 . ARG E  3  6   ? 110.599 27.776 18.321  1.00 22.20  ? 6    ARG H NH1 1 
ATOM   6892  N NH2 . ARG E  3  6   ? 111.601 26.045 17.208  1.00 23.04  ? 6    ARG H NH2 1 
ATOM   6893  N N   . TYR E  3  7   ? 102.499 26.601 18.120  1.00 12.26  ? 7    TYR H N   1 
ATOM   6894  C CA  . TYR E  3  7   ? 101.273 26.645 17.332  1.00 11.56  ? 7    TYR H CA  1 
ATOM   6895  C C   . TYR E  3  7   ? 101.275 27.890 16.455  1.00 11.93  ? 7    TYR H C   1 
ATOM   6896  O O   . TYR E  3  7   ? 101.560 28.993 16.925  1.00 12.76  ? 7    TYR H O   1 
ATOM   6897  C CB  . TYR E  3  7   ? 100.022 26.624 18.226  1.00 11.00  ? 7    TYR H CB  1 
ATOM   6898  C CG  . TYR E  3  7   ? 99.869  25.321 18.978  1.00 9.01   ? 7    TYR H CG  1 
ATOM   6899  C CD1 . TYR E  3  7   ? 100.522 25.115 20.179  1.00 9.20   ? 7    TYR H CD1 1 
ATOM   6900  C CD2 . TYR E  3  7   ? 99.112  24.285 18.462  1.00 7.94   ? 7    TYR H CD2 1 
ATOM   6901  C CE1 . TYR E  3  7   ? 100.415 23.917 20.856  1.00 8.95   ? 7    TYR H CE1 1 
ATOM   6902  C CE2 . TYR E  3  7   ? 98.989  23.092 19.127  1.00 7.48   ? 7    TYR H CE2 1 
ATOM   6903  C CZ  . TYR E  3  7   ? 99.646  22.908 20.326  1.00 9.09   ? 7    TYR H CZ  1 
ATOM   6904  O OH  . TYR E  3  7   ? 99.545  21.714 21.006  1.00 8.83   ? 7    TYR H OH  1 
ATOM   6905  N N   . PHE E  3  8   ? 100.970 27.708 15.175  1.00 11.50  ? 8    PHE H N   1 
ATOM   6906  C CA  . PHE E  3  8   ? 100.913 28.807 14.236  1.00 11.17  ? 8    PHE H CA  1 
ATOM   6907  C C   . PHE E  3  8   ? 99.434  29.067 14.013  1.00 11.23  ? 8    PHE H C   1 
ATOM   6908  O O   . PHE E  3  8   ? 98.704  28.174 13.578  1.00 11.20  ? 8    PHE H O   1 
ATOM   6909  C CB  . PHE E  3  8   ? 101.620 28.432 12.931  1.00 11.25  ? 8    PHE H CB  1 
ATOM   6910  C CG  . PHE E  3  8   ? 103.130 28.464 13.020  1.00 10.64  ? 8    PHE H CG  1 
ATOM   6911  C CD1 . PHE E  3  8   ? 103.796 27.921 14.115  1.00 10.69  ? 8    PHE H CD1 1 
ATOM   6912  C CD2 . PHE E  3  8   ? 103.888 29.040 12.002  1.00 11.06  ? 8    PHE H CD2 1 
ATOM   6913  C CE1 . PHE E  3  8   ? 105.193 27.946 14.192  1.00 8.31   ? 8    PHE H CE1 1 
ATOM   6914  C CE2 . PHE E  3  8   ? 105.282 29.077 12.078  1.00 10.21  ? 8    PHE H CE2 1 
ATOM   6915  C CZ  . PHE E  3  8   ? 105.931 28.532 13.181  1.00 9.21   ? 8    PHE H CZ  1 
ATOM   6916  N N   . VAL E  3  9   ? 99.001  30.290 14.321  1.00 10.74  ? 9    VAL H N   1 
ATOM   6917  C CA  . VAL E  3  9   ? 97.597  30.671 14.244  1.00 10.83  ? 9    VAL H CA  1 
ATOM   6918  C C   . VAL E  3  9   ? 97.316  31.754 13.207  1.00 11.57  ? 9    VAL H C   1 
ATOM   6919  O O   . VAL E  3  9   ? 97.928  32.833 13.213  1.00 11.68  ? 9    VAL H O   1 
ATOM   6920  C CB  . VAL E  3  9   ? 97.102  31.156 15.630  1.00 10.12  ? 9    VAL H CB  1 
ATOM   6921  C CG1 . VAL E  3  9   ? 95.676  31.568 15.578  1.00 9.31   ? 9    VAL H CG1 1 
ATOM   6922  C CG2 . VAL E  3  9   ? 97.296  30.077 16.667  1.00 10.34  ? 9    VAL H CG2 1 
ATOM   6923  N N   . THR E  3  10  ? 96.344  31.468 12.349  1.00 12.25  ? 10   THR H N   1 
ATOM   6924  C CA  . THR E  3  10  ? 95.969  32.368 11.265  1.00 12.92  ? 10   THR H CA  1 
ATOM   6925  C C   . THR E  3  10  ? 94.468  32.656 11.217  1.00 13.16  ? 10   THR H C   1 
ATOM   6926  O O   . THR E  3  10  ? 93.634  31.756 11.349  1.00 11.86  ? 10   THR H O   1 
ATOM   6927  C CB  . THR E  3  10  ? 96.381  31.747 9.939   1.00 13.36  ? 10   THR H CB  1 
ATOM   6928  O OG1 . THR E  3  10  ? 97.714  31.227 10.054  1.00 15.17  ? 10   THR H OG1 1 
ATOM   6929  C CG2 . THR E  3  10  ? 96.405  32.798 8.830   1.00 13.85  ? 10   THR H CG2 1 
ATOM   6930  N N   . ALA E  3  11  ? 94.132  33.921 11.019  1.00 14.47  ? 11   ALA H N   1 
ATOM   6931  C CA  . ALA E  3  11  ? 92.736  34.322 10.901  1.00 16.16  ? 11   ALA H CA  1 
ATOM   6932  C C   . ALA E  3  11  ? 92.656  35.363 9.810   1.00 17.70  ? 11   ALA H C   1 
ATOM   6933  O O   . ALA E  3  11  ? 93.322  36.394 9.886   1.00 17.91  ? 11   ALA H O   1 
ATOM   6934  C CB  . ALA E  3  11  ? 92.217  34.896 12.209  1.00 15.65  ? 11   ALA H CB  1 
ATOM   6935  N N   . VAL E  3  12  ? 91.870  35.098 8.778   1.00 19.72  ? 12   VAL H N   1 
ATOM   6936  C CA  . VAL E  3  12  ? 91.748  36.074 7.719   1.00 21.29  ? 12   VAL H CA  1 
ATOM   6937  C C   . VAL E  3  12  ? 90.280  36.330 7.482   1.00 23.21  ? 12   VAL H C   1 
ATOM   6938  O O   . VAL E  3  12  ? 89.508  35.404 7.263   1.00 23.95  ? 12   VAL H O   1 
ATOM   6939  C CB  . VAL E  3  12  ? 92.492  35.646 6.415   1.00 21.12  ? 12   VAL H CB  1 
ATOM   6940  C CG1 . VAL E  3  12  ? 93.716  34.841 6.750   1.00 19.96  ? 12   VAL H CG1 1 
ATOM   6941  C CG2 . VAL E  3  12  ? 91.591  34.900 5.478   1.00 20.98  ? 12   VAL H CG2 1 
ATOM   6942  N N   . SER E  3  13  ? 89.897  37.597 7.572   1.00 25.60  ? 13   SER H N   1 
ATOM   6943  C CA  . SER E  3  13  ? 88.513  38.002 7.376   1.00 27.43  ? 13   SER H CA  1 
ATOM   6944  C C   . SER E  3  13  ? 88.203  38.060 5.895   1.00 29.34  ? 13   SER H C   1 
ATOM   6945  O O   . SER E  3  13  ? 89.005  38.549 5.107   1.00 29.56  ? 13   SER H O   1 
ATOM   6946  C CB  . SER E  3  13  ? 88.288  39.383 7.969   1.00 27.36  ? 13   SER H CB  1 
ATOM   6947  O OG  . SER E  3  13  ? 89.178  40.308 7.370   1.00 26.80  ? 13   SER H OG  1 
ATOM   6948  N N   . ARG E  3  14  ? 87.034  37.566 5.514   1.00 31.62  ? 14   ARG H N   1 
ATOM   6949  C CA  . ARG E  3  14  ? 86.629  37.588 4.119   1.00 33.53  ? 14   ARG H CA  1 
ATOM   6950  C C   . ARG E  3  14  ? 85.295  38.326 3.997   1.00 34.52  ? 14   ARG H C   1 
ATOM   6951  O O   . ARG E  3  14  ? 84.244  37.695 3.926   1.00 34.75  ? 14   ARG H O   1 
ATOM   6952  C CB  . ARG E  3  14  ? 86.533  36.158 3.585   1.00 33.92  ? 14   ARG H CB  1 
ATOM   6953  C CG  . ARG E  3  14  ? 86.164  35.130 4.627   1.00 35.36  ? 14   ARG H CG  1 
ATOM   6954  C CD  . ARG E  3  14  ? 85.591  33.866 4.018   1.00 37.54  ? 14   ARG H CD  1 
ATOM   6955  N NE  . ARG E  3  14  ? 86.597  33.027 3.374   1.00 38.12  ? 14   ARG H NE  1 
ATOM   6956  C CZ  . ARG E  3  14  ? 87.024  31.874 3.867   1.00 38.81  ? 14   ARG H CZ  1 
ATOM   6957  N NH1 . ARG E  3  14  ? 86.544  31.422 5.017   1.00 39.23  ? 14   ARG H NH1 1 
ATOM   6958  N NH2 . ARG E  3  14  ? 87.937  31.169 3.217   1.00 40.11  ? 14   ARG H NH2 1 
ATOM   6959  N N   . PRO E  3  15  ? 85.341  39.662 3.966   1.00 35.90  ? 15   PRO H N   1 
ATOM   6960  C CA  . PRO E  3  15  ? 84.140  40.498 3.888   1.00 37.03  ? 15   PRO H CA  1 
ATOM   6961  C C   . PRO E  3  15  ? 83.282  40.131 2.690   1.00 37.83  ? 15   PRO H C   1 
ATOM   6962  O O   . PRO E  3  15  ? 83.794  39.922 1.593   1.00 37.66  ? 15   PRO H O   1 
ATOM   6963  C CB  . PRO E  3  15  ? 84.714  41.915 3.753   1.00 37.21  ? 15   PRO H CB  1 
ATOM   6964  C CG  . PRO E  3  15  ? 86.042  41.818 4.393   1.00 37.15  ? 15   PRO H CG  1 
ATOM   6965  C CD  . PRO E  3  15  ? 86.555  40.491 3.922   1.00 36.28  ? 15   PRO H CD  1 
ATOM   6966  N N   . GLY E  3  16  ? 81.979  40.044 2.909   1.00 39.12  ? 16   GLY H N   1 
ATOM   6967  C CA  . GLY E  3  16  ? 81.075  39.645 1.851   1.00 40.35  ? 16   GLY H CA  1 
ATOM   6968  C C   . GLY E  3  16  ? 81.147  38.131 1.754   1.00 41.31  ? 16   GLY H C   1 
ATOM   6969  O O   . GLY E  3  16  ? 80.126  37.449 1.659   1.00 41.70  ? 16   GLY H O   1 
ATOM   6970  N N   . LEU E  3  17  ? 82.374  37.615 1.807   1.00 42.17  ? 17   LEU H N   1 
ATOM   6971  C CA  . LEU E  3  17  ? 82.643  36.183 1.736   1.00 42.72  ? 17   LEU H CA  1 
ATOM   6972  C C   . LEU E  3  17  ? 82.158  35.428 2.983   1.00 42.46  ? 17   LEU H C   1 
ATOM   6973  O O   . LEU E  3  17  ? 82.160  34.199 2.994   1.00 42.63  ? 17   LEU H O   1 
ATOM   6974  C CB  . LEU E  3  17  ? 84.141  35.943 1.524   1.00 43.16  ? 17   LEU H CB  1 
ATOM   6975  C CG  . LEU E  3  17  ? 84.781  36.497 0.246   1.00 44.73  ? 17   LEU H CG  1 
ATOM   6976  C CD1 . LEU E  3  17  ? 86.299  36.450 0.351   1.00 45.88  ? 17   LEU H CD1 1 
ATOM   6977  C CD2 . LEU E  3  17  ? 84.323  35.723 -0.969  1.00 45.53  ? 17   LEU H CD2 1 
ATOM   6978  N N   . GLY E  3  18  ? 81.747  36.151 4.027   1.00 42.13  ? 18   GLY H N   1 
ATOM   6979  C CA  . GLY E  3  18  ? 81.239  35.508 5.237   1.00 41.39  ? 18   GLY H CA  1 
ATOM   6980  C C   . GLY E  3  18  ? 82.158  35.579 6.450   1.00 40.74  ? 18   GLY H C   1 
ATOM   6981  O O   . GLY E  3  18  ? 82.876  36.565 6.616   1.00 40.70  ? 18   GLY H O   1 
ATOM   6982  N N   . GLU E  3  19  ? 82.122  34.542 7.298   1.00 39.55  ? 19   GLU H N   1 
ATOM   6983  C CA  . GLU E  3  19  ? 82.958  34.472 8.512   1.00 38.81  ? 19   GLU H CA  1 
ATOM   6984  C C   . GLU E  3  19  ? 84.419  34.124 8.193   1.00 36.49  ? 19   GLU H C   1 
ATOM   6985  O O   . GLU E  3  19  ? 84.696  33.352 7.284   1.00 36.44  ? 19   GLU H O   1 
ATOM   6986  C CB  . GLU E  3  19  ? 82.371  33.471 9.521   1.00 39.71  ? 19   GLU H CB  1 
ATOM   6987  C CG  . GLU E  3  19  ? 81.470  34.112 10.583  1.00 42.20  ? 19   GLU H CG  1 
ATOM   6988  C CD  . GLU E  3  19  ? 80.063  33.533 10.607  1.00 45.19  ? 19   GLU H CD  1 
ATOM   6989  O OE1 . GLU E  3  19  ? 79.788  32.580 9.848   1.00 46.99  ? 19   GLU H OE1 1 
ATOM   6990  O OE2 . GLU E  3  19  ? 79.220  34.037 11.382  1.00 47.23  ? 19   GLU H OE2 1 
ATOM   6991  N N   . PRO E  3  20  ? 85.357  34.670 8.963   1.00 34.06  ? 20   PRO H N   1 
ATOM   6992  C CA  . PRO E  3  20  ? 86.785  34.444 8.715   1.00 32.25  ? 20   PRO H CA  1 
ATOM   6993  C C   . PRO E  3  20  ? 87.208  32.980 8.682   1.00 30.11  ? 20   PRO H C   1 
ATOM   6994  O O   . PRO E  3  20  ? 86.609  32.137 9.342   1.00 29.96  ? 20   PRO H O   1 
ATOM   6995  C CB  . PRO E  3  20  ? 87.456  35.166 9.887   1.00 32.41  ? 20   PRO H CB  1 
ATOM   6996  C CG  . PRO E  3  20  ? 86.464  36.177 10.317  1.00 33.06  ? 20   PRO H CG  1 
ATOM   6997  C CD  . PRO E  3  20  ? 85.150  35.482 10.174  1.00 33.96  ? 20   PRO H CD  1 
ATOM   6998  N N   . ARG E  3  21  ? 88.238  32.696 7.894   1.00 27.69  ? 21   ARG H N   1 
ATOM   6999  C CA  . ARG E  3  21  ? 88.804  31.362 7.817   1.00 25.99  ? 21   ARG H CA  1 
ATOM   7000  C C   . ARG E  3  21  ? 89.760  31.332 9.003   1.00 23.95  ? 21   ARG H C   1 
ATOM   7001  O O   . ARG E  3  21  ? 90.582  32.242 9.162   1.00 23.58  ? 21   ARG H O   1 
ATOM   7002  C CB  . ARG E  3  21  ? 89.566  31.166 6.502   1.00 26.11  ? 21   ARG H CB  1 
ATOM   7003  C CG  . ARG E  3  21  ? 89.802  29.710 6.107   1.00 27.36  ? 21   ARG H CG  1 
ATOM   7004  C CD  . ARG E  3  21  ? 91.277  29.337 6.099   1.00 29.26  ? 21   ARG H CD  1 
ATOM   7005  N NE  . ARG E  3  21  ? 91.537  27.943 5.749   1.00 31.03  ? 21   ARG H NE  1 
ATOM   7006  C CZ  . ARG E  3  21  ? 91.420  27.428 4.530   1.00 31.71  ? 21   ARG H CZ  1 
ATOM   7007  N NH1 . ARG E  3  21  ? 91.026  28.182 3.512   1.00 31.90  ? 21   ARG H NH1 1 
ATOM   7008  N NH2 . ARG E  3  21  ? 91.700  26.147 4.325   1.00 32.11  ? 21   ARG H NH2 1 
ATOM   7009  N N   . TYR E  3  22  ? 89.640  30.316 9.849   1.00 21.57  ? 22   TYR H N   1 
ATOM   7010  C CA  . TYR E  3  22  ? 90.463  30.219 11.048  1.00 19.79  ? 22   TYR H CA  1 
ATOM   7011  C C   . TYR E  3  22  ? 91.257  28.923 10.970  1.00 18.99  ? 22   TYR H C   1 
ATOM   7012  O O   . TYR E  3  22  ? 90.736  27.907 10.535  1.00 19.14  ? 22   TYR H O   1 
ATOM   7013  C CB  . TYR E  3  22  ? 89.574  30.255 12.313  1.00 18.71  ? 22   TYR H CB  1 
ATOM   7014  C CG  . TYR E  3  22  ? 90.351  30.153 13.605  1.00 17.97  ? 22   TYR H CG  1 
ATOM   7015  C CD1 . TYR E  3  22  ? 91.093  31.221 14.087  1.00 16.91  ? 22   TYR H CD1 1 
ATOM   7016  C CD2 . TYR E  3  22  ? 90.377  28.968 14.327  1.00 17.63  ? 22   TYR H CD2 1 
ATOM   7017  C CE1 . TYR E  3  22  ? 91.840  31.106 15.267  1.00 15.59  ? 22   TYR H CE1 1 
ATOM   7018  C CE2 . TYR E  3  22  ? 91.111  28.850 15.497  1.00 15.77  ? 22   TYR H CE2 1 
ATOM   7019  C CZ  . TYR E  3  22  ? 91.836  29.916 15.960  1.00 14.34  ? 22   TYR H CZ  1 
ATOM   7020  O OH  . TYR E  3  22  ? 92.590  29.769 17.097  1.00 11.79  ? 22   TYR H OH  1 
ATOM   7021  N N   . MET E  3  23  ? 92.511  28.946 11.402  1.00 18.03  ? 23   MET H N   1 
ATOM   7022  C CA  . MET E  3  23  ? 93.335  27.752 11.320  1.00 17.34  ? 23   MET H CA  1 
ATOM   7023  C C   . MET E  3  23  ? 94.411  27.707 12.410  1.00 15.78  ? 23   MET H C   1 
ATOM   7024  O O   . MET E  3  23  ? 95.058  28.718 12.697  1.00 15.39  ? 23   MET H O   1 
ATOM   7025  C CB  . MET E  3  23  ? 94.004  27.698 9.934   1.00 18.14  ? 23   MET H CB  1 
ATOM   7026  C CG  . MET E  3  23  ? 94.249  26.299 9.390   1.00 20.21  ? 23   MET H CG  1 
ATOM   7027  S SD  . MET E  3  23  ? 95.154  26.253 7.811   1.00 24.26  ? 23   MET H SD  1 
ATOM   7028  C CE  . MET E  3  23  ? 94.054  27.133 6.741   1.00 25.53  ? 23   MET H CE  1 
ATOM   7029  N N   . GLU E  3  24  ? 94.594  26.529 13.007  1.00 13.36  ? 24   GLU H N   1 
ATOM   7030  C CA  . GLU E  3  24  ? 95.623  26.322 14.002  1.00 11.91  ? 24   GLU H CA  1 
ATOM   7031  C C   . GLU E  3  24  ? 96.504  25.158 13.551  1.00 10.84  ? 24   GLU H C   1 
ATOM   7032  O O   . GLU E  3  24  ? 96.005  24.090 13.221  1.00 10.38  ? 24   GLU H O   1 
ATOM   7033  C CB  . GLU E  3  24  ? 95.016  25.990 15.373  1.00 12.43  ? 24   GLU H CB  1 
ATOM   7034  C CG  . GLU E  3  24  ? 94.172  27.068 16.037  1.00 11.85  ? 24   GLU H CG  1 
ATOM   7035  C CD  . GLU E  3  24  ? 93.914  26.765 17.502  1.00 12.91  ? 24   GLU H CD  1 
ATOM   7036  O OE1 . GLU E  3  24  ? 94.754  26.075 18.104  1.00 15.17  ? 24   GLU H OE1 1 
ATOM   7037  O OE2 . GLU E  3  24  ? 92.892  27.216 18.070  1.00 13.45  ? 24   GLU H OE2 1 
ATOM   7038  N N   . VAL E  3  25  ? 97.817  25.362 13.562  1.00 9.98   ? 25   VAL H N   1 
ATOM   7039  C CA  . VAL E  3  25  ? 98.774  24.332 13.175  1.00 9.18   ? 25   VAL H CA  1 
ATOM   7040  C C   . VAL E  3  25  ? 99.840  24.209 14.253  1.00 9.71   ? 25   VAL H C   1 
ATOM   7041  O O   . VAL E  3  25  ? 100.492 25.185 14.571  1.00 9.49   ? 25   VAL H O   1 
ATOM   7042  C CB  . VAL E  3  25  ? 99.453  24.683 11.847  1.00 7.78   ? 25   VAL H CB  1 
ATOM   7043  C CG1 . VAL E  3  25  ? 100.360 23.567 11.413  1.00 6.52   ? 25   VAL H CG1 1 
ATOM   7044  C CG2 . VAL E  3  25  ? 98.419  24.948 10.798  1.00 7.42   ? 25   VAL H CG2 1 
ATOM   7045  N N   . GLY E  3  26  ? 100.020 23.009 14.804  1.00 11.31  ? 26   GLY H N   1 
ATOM   7046  C CA  . GLY E  3  26  ? 100.996 22.783 15.868  1.00 12.34  ? 26   GLY H CA  1 
ATOM   7047  C C   . GLY E  3  26  ? 102.246 22.098 15.364  1.00 13.26  ? 26   GLY H C   1 
ATOM   7048  O O   . GLY E  3  26  ? 102.164 21.279 14.455  1.00 13.97  ? 26   GLY H O   1 
ATOM   7049  N N   . TYR E  3  27  ? 103.400 22.434 15.942  1.00 14.48  ? 27   TYR H N   1 
ATOM   7050  C CA  . TYR E  3  27  ? 104.678 21.864 15.508  1.00 15.14  ? 27   TYR H CA  1 
ATOM   7051  C C   . TYR E  3  27  ? 105.531 21.426 16.665  1.00 16.81  ? 27   TYR H C   1 
ATOM   7052  O O   . TYR E  3  27  ? 105.701 22.164 17.622  1.00 17.59  ? 27   TYR H O   1 
ATOM   7053  C CB  . TYR E  3  27  ? 105.532 22.886 14.723  1.00 15.03  ? 27   TYR H CB  1 
ATOM   7054  C CG  . TYR E  3  27  ? 104.923 23.443 13.459  1.00 13.19  ? 27   TYR H CG  1 
ATOM   7055  C CD1 . TYR E  3  27  ? 103.931 24.412 13.518  1.00 11.82  ? 27   TYR H CD1 1 
ATOM   7056  C CD2 . TYR E  3  27  ? 105.361 23.019 12.199  1.00 12.99  ? 27   TYR H CD2 1 
ATOM   7057  C CE1 . TYR E  3  27  ? 103.355 24.927 12.360  1.00 10.92  ? 27   TYR H CE1 1 
ATOM   7058  C CE2 . TYR E  3  27  ? 104.796 23.527 11.031  1.00 11.98  ? 27   TYR H CE2 1 
ATOM   7059  C CZ  . TYR E  3  27  ? 103.787 24.478 11.122  1.00 10.98  ? 27   TYR H CZ  1 
ATOM   7060  O OH  . TYR E  3  27  ? 103.209 24.984 9.976   1.00 11.62  ? 27   TYR H OH  1 
ATOM   7061  N N   . VAL E  3  28  ? 106.098 20.232 16.559  1.00 18.47  ? 28   VAL H N   1 
ATOM   7062  C CA  . VAL E  3  28  ? 107.034 19.736 17.554  1.00 19.62  ? 28   VAL H CA  1 
ATOM   7063  C C   . VAL E  3  28  ? 108.363 19.728 16.817  1.00 20.54  ? 28   VAL H C   1 
ATOM   7064  O O   . VAL E  3  28  ? 108.450 19.157 15.728  1.00 21.02  ? 28   VAL H O   1 
ATOM   7065  C CB  . VAL E  3  28  ? 106.675 18.319 18.024  1.00 19.69  ? 28   VAL H CB  1 
ATOM   7066  C CG1 . VAL E  3  28  ? 107.910 17.605 18.564  1.00 20.93  ? 28   VAL H CG1 1 
ATOM   7067  C CG2 . VAL E  3  28  ? 105.597 18.377 19.094  1.00 19.11  ? 28   VAL H CG2 1 
ATOM   7068  N N   . ASP E  3  29  ? 109.381 20.385 17.366  1.00 21.37  ? 29   ASP H N   1 
ATOM   7069  C CA  . ASP E  3  29  ? 110.684 20.450 16.711  1.00 22.15  ? 29   ASP H CA  1 
ATOM   7070  C C   . ASP E  3  29  ? 110.557 20.746 15.212  1.00 22.06  ? 29   ASP H C   1 
ATOM   7071  O O   . ASP E  3  29  ? 111.330 20.225 14.419  1.00 22.54  ? 29   ASP H O   1 
ATOM   7072  C CB  . ASP E  3  29  ? 111.448 19.141 16.914  1.00 22.83  ? 29   ASP H CB  1 
ATOM   7073  C CG  . ASP E  3  29  ? 111.869 18.918 18.362  1.00 25.43  ? 29   ASP H CG  1 
ATOM   7074  O OD1 . ASP E  3  29  ? 111.209 19.453 19.289  1.00 26.91  ? 29   ASP H OD1 1 
ATOM   7075  O OD2 . ASP E  3  29  ? 112.855 18.202 18.647  1.00 28.50  ? 29   ASP H OD2 1 
ATOM   7076  N N   . ASP E  3  30  ? 109.571 21.562 14.835  1.00 21.88  ? 30   ASP H N   1 
ATOM   7077  C CA  . ASP E  3  30  ? 109.353 21.976 13.445  1.00 21.88  ? 30   ASP H CA  1 
ATOM   7078  C C   . ASP E  3  30  ? 108.608 21.008 12.532  1.00 21.28  ? 30   ASP H C   1 
ATOM   7079  O O   . ASP E  3  30  ? 108.483 21.251 11.328  1.00 21.43  ? 30   ASP H O   1 
ATOM   7080  C CB  . ASP E  3  30  ? 110.680 22.354 12.818  1.00 22.44  ? 30   ASP H CB  1 
ATOM   7081  C CG  . ASP E  3  30  ? 111.428 23.344 13.661  1.00 24.10  ? 30   ASP H CG  1 
ATOM   7082  O OD1 . ASP E  3  30  ? 110.853 24.422 13.949  1.00 26.59  ? 30   ASP H OD1 1 
ATOM   7083  O OD2 . ASP E  3  30  ? 112.570 23.103 14.097  1.00 24.96  ? 30   ASP H OD2 1 
ATOM   7084  N N   . THR E  3  31  ? 108.091 19.932 13.107  1.00 20.32  ? 31   THR H N   1 
ATOM   7085  C CA  . THR E  3  31  ? 107.335 18.946 12.358  1.00 18.80  ? 31   THR H CA  1 
ATOM   7086  C C   . THR E  3  31  ? 105.864 19.046 12.750  1.00 17.68  ? 31   THR H C   1 
ATOM   7087  O O   . THR E  3  31  ? 105.506 18.953 13.929  1.00 16.94  ? 31   THR H O   1 
ATOM   7088  C CB  . THR E  3  31  ? 107.861 17.547 12.666  1.00 19.04  ? 31   THR H CB  1 
ATOM   7089  O OG1 . THR E  3  31  ? 109.236 17.453 12.262  1.00 19.20  ? 31   THR H OG1 1 
ATOM   7090  C CG2 . THR E  3  31  ? 107.110 16.497 11.856  1.00 19.12  ? 31   THR H CG2 1 
ATOM   7091  N N   . GLU E  3  32  ? 105.009 19.234 11.756  1.00 16.29  ? 32   GLU H N   1 
ATOM   7092  C CA  . GLU E  3  32  ? 103.580 19.370 11.995  1.00 15.86  ? 32   GLU H CA  1 
ATOM   7093  C C   . GLU E  3  32  ? 102.956 18.112 12.600  1.00 15.19  ? 32   GLU H C   1 
ATOM   7094  O O   . GLU E  3  32  ? 103.163 17.020 12.088  1.00 15.05  ? 32   GLU H O   1 
ATOM   7095  C CB  . GLU E  3  32  ? 102.870 19.703 10.689  1.00 15.49  ? 32   GLU H CB  1 
ATOM   7096  C CG  . GLU E  3  32  ? 101.392 19.990 10.893  1.00 16.98  ? 32   GLU H CG  1 
ATOM   7097  C CD  . GLU E  3  32  ? 100.725 20.450 9.626   1.00 16.10  ? 32   GLU H CD  1 
ATOM   7098  O OE1 . GLU E  3  32  ? 101.366 21.207 8.888   1.00 17.84  ? 32   GLU H OE1 1 
ATOM   7099  O OE2 . GLU E  3  32  ? 99.576  20.053 9.368   1.00 16.47  ? 32   GLU H OE2 1 
ATOM   7100  N N   . PHE E  3  33  ? 102.191 18.262 13.680  1.00 14.36  ? 33   PHE H N   1 
ATOM   7101  C CA  . PHE E  3  33  ? 101.548 17.102 14.298  1.00 13.98  ? 33   PHE H CA  1 
ATOM   7102  C C   . PHE E  3  33  ? 100.025 17.260 14.550  1.00 13.67  ? 33   PHE H C   1 
ATOM   7103  O O   . PHE E  3  33  ? 99.330  16.270 14.766  1.00 13.26  ? 33   PHE H O   1 
ATOM   7104  C CB  . PHE E  3  33  ? 102.321 16.665 15.561  1.00 14.21  ? 33   PHE H CB  1 
ATOM   7105  C CG  . PHE E  3  33  ? 102.139 17.572 16.739  1.00 14.90  ? 33   PHE H CG  1 
ATOM   7106  C CD1 . PHE E  3  33  ? 101.479 17.124 17.873  1.00 16.34  ? 33   PHE H CD1 1 
ATOM   7107  C CD2 . PHE E  3  33  ? 102.621 18.866 16.721  1.00 14.60  ? 33   PHE H CD2 1 
ATOM   7108  C CE1 . PHE E  3  33  ? 101.289 17.959 18.958  1.00 16.47  ? 33   PHE H CE1 1 
ATOM   7109  C CE2 . PHE E  3  33  ? 102.433 19.700 17.801  1.00 14.07  ? 33   PHE H CE2 1 
ATOM   7110  C CZ  . PHE E  3  33  ? 101.769 19.256 18.910  1.00 15.94  ? 33   PHE H CZ  1 
ATOM   7111  N N   . VAL E  3  34  ? 99.507  18.487 14.494  1.00 13.39  ? 34   VAL H N   1 
ATOM   7112  C CA  . VAL E  3  34  ? 98.072  18.738 14.664  1.00 13.29  ? 34   VAL H CA  1 
ATOM   7113  C C   . VAL E  3  34  ? 97.677  19.971 13.845  1.00 13.19  ? 34   VAL H C   1 
ATOM   7114  O O   . VAL E  3  34  ? 98.478  20.885 13.661  1.00 13.37  ? 34   VAL H O   1 
ATOM   7115  C CB  . VAL E  3  34  ? 97.682  18.965 16.159  1.00 13.46  ? 34   VAL H CB  1 
ATOM   7116  C CG1 . VAL E  3  34  ? 97.938  17.715 16.977  1.00 13.55  ? 34   VAL H CG1 1 
ATOM   7117  C CG2 . VAL E  3  34  ? 98.449  20.140 16.754  1.00 12.97  ? 34   VAL H CG2 1 
ATOM   7118  N N   . ARG E  3  35  ? 96.443  19.993 13.360  1.00 12.87  ? 35   ARG H N   1 
ATOM   7119  C CA  . ARG E  3  35  ? 95.944  21.095 12.549  1.00 12.27  ? 35   ARG H CA  1 
ATOM   7120  C C   . ARG E  3  35  ? 94.434  21.196 12.707  1.00 12.86  ? 35   ARG H C   1 
ATOM   7121  O O   . ARG E  3  35  ? 93.751  20.200 12.922  1.00 12.13  ? 35   ARG H O   1 
ATOM   7122  C CB  . ARG E  3  35  ? 96.311  20.897 11.064  1.00 11.73  ? 35   ARG H CB  1 
ATOM   7123  C CG  . ARG E  3  35  ? 95.559  21.808 10.072  1.00 10.11  ? 35   ARG H CG  1 
ATOM   7124  C CD  . ARG E  3  35  ? 95.915  21.560 8.606   1.00 8.93   ? 35   ARG H CD  1 
ATOM   7125  N NE  . ARG E  3  35  ? 97.339  21.778 8.323   1.00 7.04   ? 35   ARG H NE  1 
ATOM   7126  C CZ  . ARG E  3  35  ? 97.863  22.912 7.865   1.00 4.48   ? 35   ARG H CZ  1 
ATOM   7127  N NH1 . ARG E  3  35  ? 97.101  23.963 7.627   1.00 4.80   ? 35   ARG H NH1 1 
ATOM   7128  N NH2 . ARG E  3  35  ? 99.166  23.006 7.663   1.00 3.29   ? 35   ARG H NH2 1 
ATOM   7129  N N   . PHE E  3  36  ? 93.922  22.414 12.614  1.00 13.89  ? 36   PHE H N   1 
ATOM   7130  C CA  . PHE E  3  36  ? 92.495  22.646 12.691  1.00 14.74  ? 36   PHE H CA  1 
ATOM   7131  C C   . PHE E  3  36  ? 92.193  23.670 11.631  1.00 16.13  ? 36   PHE H C   1 
ATOM   7132  O O   . PHE E  3  36  ? 92.871  24.686 11.549  1.00 16.21  ? 36   PHE H O   1 
ATOM   7133  C CB  . PHE E  3  36  ? 92.096  23.199 14.048  1.00 14.49  ? 36   PHE H CB  1 
ATOM   7134  C CG  . PHE E  3  36  ? 90.662  23.631 14.122  1.00 13.57  ? 36   PHE H CG  1 
ATOM   7135  C CD1 . PHE E  3  36  ? 89.672  22.733 14.489  1.00 12.19  ? 36   PHE H CD1 1 
ATOM   7136  C CD2 . PHE E  3  36  ? 90.302  24.942 13.837  1.00 12.08  ? 36   PHE H CD2 1 
ATOM   7137  C CE1 . PHE E  3  36  ? 88.346  23.140 14.572  1.00 12.31  ? 36   PHE H CE1 1 
ATOM   7138  C CE2 . PHE E  3  36  ? 88.980  25.349 13.914  1.00 12.16  ? 36   PHE H CE2 1 
ATOM   7139  C CZ  . PHE E  3  36  ? 88.003  24.452 14.286  1.00 11.98  ? 36   PHE H CZ  1 
ATOM   7140  N N   . ASP E  3  37  ? 91.174  23.408 10.826  1.00 17.57  ? 37   ASP H N   1 
ATOM   7141  C CA  . ASP E  3  37  ? 90.813  24.304 9.755   1.00 19.30  ? 37   ASP H CA  1 
ATOM   7142  C C   . ASP E  3  37  ? 89.303  24.513 9.755   1.00 21.08  ? 37   ASP H C   1 
ATOM   7143  O O   . ASP E  3  37  ? 88.542  23.554 9.622   1.00 21.44  ? 37   ASP H O   1 
ATOM   7144  C CB  . ASP E  3  37  ? 91.234  23.693 8.427   1.00 19.16  ? 37   ASP H CB  1 
ATOM   7145  C CG  . ASP E  3  37  ? 91.186  24.680 7.305   1.00 18.60  ? 37   ASP H CG  1 
ATOM   7146  O OD1 . ASP E  3  37  ? 90.537  25.732 7.459   1.00 16.67  ? 37   ASP H OD1 1 
ATOM   7147  O OD2 . ASP E  3  37  ? 91.797  24.475 6.239   1.00 21.76  ? 37   ASP H OD2 1 
ATOM   7148  N N   . SER E  3  38  ? 88.860  25.759 9.888   1.00 22.72  ? 38   SER H N   1 
ATOM   7149  C CA  . SER E  3  38  ? 87.426  26.026 9.916   1.00 24.35  ? 38   SER H CA  1 
ATOM   7150  C C   . SER E  3  38  ? 86.771  25.699 8.580   1.00 25.69  ? 38   SER H C   1 
ATOM   7151  O O   . SER E  3  38  ? 85.621  25.275 8.534   1.00 26.19  ? 38   SER H O   1 
ATOM   7152  C CB  . SER E  3  38  ? 87.155  27.485 10.279  1.00 24.26  ? 38   SER H CB  1 
ATOM   7153  O OG  . SER E  3  38  ? 87.682  28.358 9.296   1.00 24.02  ? 38   SER H OG  1 
ATOM   7154  N N   . ASP E  3  39  ? 87.512  25.870 7.494   1.00 27.17  ? 39   ASP H N   1 
ATOM   7155  C CA  . ASP E  3  39  ? 86.967  25.652 6.156   1.00 28.30  ? 39   ASP H CA  1 
ATOM   7156  C C   . ASP E  3  39  ? 86.958  24.212 5.653   1.00 29.04  ? 39   ASP H C   1 
ATOM   7157  O O   . ASP E  3  39  ? 86.967  23.971 4.447   1.00 29.53  ? 39   ASP H O   1 
ATOM   7158  C CB  . ASP E  3  39  ? 87.675  26.565 5.164   1.00 28.37  ? 39   ASP H CB  1 
ATOM   7159  C CG  . ASP E  3  39  ? 87.214  28.004 5.290   1.00 29.64  ? 39   ASP H CG  1 
ATOM   7160  O OD1 . ASP E  3  39  ? 86.747  28.387 6.389   1.00 30.15  ? 39   ASP H OD1 1 
ATOM   7161  O OD2 . ASP E  3  39  ? 87.282  28.810 4.337   1.00 30.60  ? 39   ASP H OD2 1 
ATOM   7162  N N   . ALA E  3  40  ? 86.918  23.264 6.578   1.00 29.74  ? 40   ALA H N   1 
ATOM   7163  C CA  . ALA E  3  40  ? 86.841  21.856 6.231   1.00 30.22  ? 40   ALA H CA  1 
ATOM   7164  C C   . ALA E  3  40  ? 85.395  21.452 6.457   1.00 30.73  ? 40   ALA H C   1 
ATOM   7165  O O   . ALA E  3  40  ? 84.599  22.251 6.947   1.00 30.31  ? 40   ALA H O   1 
ATOM   7166  C CB  . ALA E  3  40  ? 87.775  21.030 7.106   1.00 30.05  ? 40   ALA H CB  1 
ATOM   7167  N N   . GLU E  3  41  ? 85.049  20.218 6.113   1.00 31.60  ? 41   GLU H N   1 
ATOM   7168  C CA  . GLU E  3  41  ? 83.677  19.759 6.291   1.00 32.50  ? 41   GLU H CA  1 
ATOM   7169  C C   . GLU E  3  41  ? 83.298  19.781 7.772   1.00 31.76  ? 41   GLU H C   1 
ATOM   7170  O O   . GLU E  3  41  ? 82.509  20.624 8.202   1.00 32.03  ? 41   GLU H O   1 
ATOM   7171  C CB  . GLU E  3  41  ? 83.515  18.356 5.712   1.00 33.42  ? 41   GLU H CB  1 
ATOM   7172  C CG  . GLU E  3  41  ? 82.187  18.132 5.013   1.00 35.86  ? 41   GLU H CG  1 
ATOM   7173  C CD  . GLU E  3  41  ? 81.934  19.134 3.898   1.00 38.88  ? 41   GLU H CD  1 
ATOM   7174  O OE1 . GLU E  3  41  ? 82.886  19.830 3.476   1.00 39.95  ? 41   GLU H OE1 1 
ATOM   7175  O OE2 . GLU E  3  41  ? 80.777  19.220 3.431   1.00 41.63  ? 41   GLU H OE2 1 
ATOM   7176  N N   . ASN E  3  42  ? 83.855  18.847 8.542   1.00 30.88  ? 42   ASN H N   1 
ATOM   7177  C CA  . ASN E  3  42  ? 83.633  18.783 9.987   1.00 29.95  ? 42   ASN H CA  1 
ATOM   7178  C C   . ASN E  3  42  ? 84.888  19.326 10.615  1.00 28.27  ? 42   ASN H C   1 
ATOM   7179  O O   . ASN E  3  42  ? 85.806  18.564 10.899  1.00 28.12  ? 42   ASN H O   1 
ATOM   7180  C CB  . ASN E  3  42  ? 83.422  17.343 10.469  1.00 30.58  ? 42   ASN H CB  1 
ATOM   7181  C CG  . ASN E  3  42  ? 83.636  17.186 11.978  1.00 31.46  ? 42   ASN H CG  1 
ATOM   7182  O OD1 . ASN E  3  42  ? 84.530  16.464 12.413  1.00 31.69  ? 42   ASN H OD1 1 
ATOM   7183  N ND2 . ASN E  3  42  ? 82.817  17.865 12.776  1.00 31.82  ? 42   ASN H ND2 1 
ATOM   7184  N N   . PRO E  3  43  ? 84.970  20.637 10.806  1.00 26.64  ? 43   PRO H N   1 
ATOM   7185  C CA  . PRO E  3  43  ? 86.180  21.214 11.390  1.00 25.74  ? 43   PRO H CA  1 
ATOM   7186  C C   . PRO E  3  43  ? 86.459  20.728 12.807  1.00 24.84  ? 43   PRO H C   1 
ATOM   7187  O O   . PRO E  3  43  ? 85.715  21.024 13.743  1.00 25.06  ? 43   PRO H O   1 
ATOM   7188  C CB  . PRO E  3  43  ? 85.901  22.717 11.350  1.00 25.64  ? 43   PRO H CB  1 
ATOM   7189  C CG  . PRO E  3  43  ? 84.867  22.865 10.259  1.00 26.27  ? 43   PRO H CG  1 
ATOM   7190  C CD  . PRO E  3  43  ? 83.985  21.680 10.476  1.00 26.31  ? 43   PRO H CD  1 
ATOM   7191  N N   . ARG E  3  44  ? 87.533  19.962 12.951  1.00 23.48  ? 44   ARG H N   1 
ATOM   7192  C CA  . ARG E  3  44  ? 87.938  19.457 14.249  1.00 22.58  ? 44   ARG H CA  1 
ATOM   7193  C C   . ARG E  3  44  ? 89.455  19.357 14.209  1.00 20.77  ? 44   ARG H C   1 
ATOM   7194  O O   . ARG E  3  44  ? 90.046  19.382 13.131  1.00 20.34  ? 44   ARG H O   1 
ATOM   7195  C CB  . ARG E  3  44  ? 87.307  18.086 14.524  1.00 23.33  ? 44   ARG H CB  1 
ATOM   7196  C CG  . ARG E  3  44  ? 87.820  16.988 13.616  1.00 26.02  ? 44   ARG H CG  1 
ATOM   7197  C CD  . ARG E  3  44  ? 86.985  15.713 13.616  1.00 28.81  ? 44   ARG H CD  1 
ATOM   7198  N NE  . ARG E  3  44  ? 87.579  14.719 12.718  1.00 31.39  ? 44   ARG H NE  1 
ATOM   7199  C CZ  . ARG E  3  44  ? 86.945  14.116 11.720  1.00 33.85  ? 44   ARG H CZ  1 
ATOM   7200  N NH1 . ARG E  3  44  ? 85.667  14.377 11.470  1.00 35.14  ? 44   ARG H NH1 1 
ATOM   7201  N NH2 . ARG E  3  44  ? 87.593  13.241 10.966  1.00 35.52  ? 44   ARG H NH2 1 
ATOM   7202  N N   . TYR E  3  45  ? 90.078  19.282 15.380  1.00 18.60  ? 45   TYR H N   1 
ATOM   7203  C CA  . TYR E  3  45  ? 91.511  19.115 15.484  1.00 17.24  ? 45   TYR H CA  1 
ATOM   7204  C C   . TYR E  3  45  ? 91.749  17.686 15.022  1.00 17.01  ? 45   TYR H C   1 
ATOM   7205  O O   . TYR E  3  45  ? 91.006  16.793 15.414  1.00 16.19  ? 45   TYR H O   1 
ATOM   7206  C CB  . TYR E  3  45  ? 91.958  19.236 16.958  1.00 17.35  ? 45   TYR H CB  1 
ATOM   7207  C CG  . TYR E  3  45  ? 92.927  20.355 17.240  1.00 16.91  ? 45   TYR H CG  1 
ATOM   7208  C CD1 . TYR E  3  45  ? 92.542  21.676 17.113  1.00 16.64  ? 45   TYR H CD1 1 
ATOM   7209  C CD2 . TYR E  3  45  ? 94.240  20.090 17.607  1.00 17.86  ? 45   TYR H CD2 1 
ATOM   7210  C CE1 . TYR E  3  45  ? 93.433  22.709 17.328  1.00 17.18  ? 45   TYR H CE1 1 
ATOM   7211  C CE2 . TYR E  3  45  ? 95.144  21.126 17.826  1.00 17.54  ? 45   TYR H CE2 1 
ATOM   7212  C CZ  . TYR E  3  45  ? 94.728  22.434 17.672  1.00 16.44  ? 45   TYR H CZ  1 
ATOM   7213  O OH  . TYR E  3  45  ? 95.599  23.478 17.863  1.00 15.43  ? 45   TYR H OH  1 
ATOM   7214  N N   . GLU E  3  46  ? 92.758  17.445 14.193  1.00 17.10  ? 46   GLU H N   1 
ATOM   7215  C CA  . GLU E  3  46  ? 93.065  16.070 13.786  1.00 17.31  ? 46   GLU H CA  1 
ATOM   7216  C C   . GLU E  3  46  ? 94.565  15.900 13.762  1.00 16.05  ? 46   GLU H C   1 
ATOM   7217  O O   . GLU E  3  46  ? 95.284  16.872 13.572  1.00 16.37  ? 46   GLU H O   1 
ATOM   7218  C CB  . GLU E  3  46  ? 92.436  15.699 12.426  1.00 18.39  ? 46   GLU H CB  1 
ATOM   7219  C CG  . GLU E  3  46  ? 92.161  16.834 11.448  1.00 21.07  ? 46   GLU H CG  1 
ATOM   7220  C CD  . GLU E  3  46  ? 90.930  16.543 10.587  1.00 25.28  ? 46   GLU H CD  1 
ATOM   7221  O OE1 . GLU E  3  46  ? 90.661  17.284 9.605   1.00 27.69  ? 46   GLU H OE1 1 
ATOM   7222  O OE2 . GLU E  3  46  ? 90.218  15.560 10.899  1.00 26.66  ? 46   GLU H OE2 1 
ATOM   7223  N N   . PRO E  3  47  ? 95.041  14.670 13.938  1.00 14.60  ? 47   PRO H N   1 
ATOM   7224  C CA  . PRO E  3  47  ? 96.478  14.394 13.959  1.00 13.72  ? 47   PRO H CA  1 
ATOM   7225  C C   . PRO E  3  47  ? 97.079  14.526 12.558  1.00 13.53  ? 47   PRO H C   1 
ATOM   7226  O O   . PRO E  3  47  ? 96.438  14.209 11.565  1.00 12.60  ? 47   PRO H O   1 
ATOM   7227  C CB  . PRO E  3  47  ? 96.538  12.952 14.450  1.00 14.31  ? 47   PRO H CB  1 
ATOM   7228  C CG  . PRO E  3  47  ? 95.282  12.337 13.877  1.00 13.85  ? 47   PRO H CG  1 
ATOM   7229  C CD  . PRO E  3  47  ? 94.243  13.431 14.002  1.00 14.06  ? 47   PRO H CD  1 
ATOM   7230  N N   . ARG E  3  48  ? 98.316  14.997 12.506  1.00 13.61  ? 48   ARG H N   1 
ATOM   7231  C CA  . ARG E  3  48  ? 99.009  15.251 11.263  1.00 13.87  ? 48   ARG H CA  1 
ATOM   7232  C C   . ARG E  3  48  ? 100.304 14.473 11.166  1.00 14.18  ? 48   ARG H C   1 
ATOM   7233  O O   . ARG E  3  48  ? 101.020 14.555 10.178  1.00 14.45  ? 48   ARG H O   1 
ATOM   7234  C CB  . ARG E  3  48  ? 99.266  16.740 11.158  1.00 13.72  ? 48   ARG H CB  1 
ATOM   7235  C CG  . ARG E  3  48  ? 97.965  17.509 11.169  1.00 15.15  ? 48   ARG H CG  1 
ATOM   7236  C CD  . ARG E  3  48  ? 97.178  17.310 9.884   1.00 16.43  ? 48   ARG H CD  1 
ATOM   7237  N NE  . ARG E  3  48  ? 97.901  17.930 8.778   1.00 18.09  ? 48   ARG H NE  1 
ATOM   7238  C CZ  . ARG E  3  48  ? 97.448  18.047 7.542   1.00 19.74  ? 48   ARG H CZ  1 
ATOM   7239  N NH1 . ARG E  3  48  ? 96.253  17.585 7.212   1.00 20.50  ? 48   ARG H NH1 1 
ATOM   7240  N NH2 . ARG E  3  48  ? 98.203  18.626 6.623   1.00 21.32  ? 48   ARG H NH2 1 
ATOM   7241  N N   . ALA E  3  49  ? 100.605 13.728 12.215  1.00 14.95  ? 49   ALA H N   1 
ATOM   7242  C CA  . ALA E  3  49  ? 101.764 12.873 12.244  1.00 15.42  ? 49   ALA H CA  1 
ATOM   7243  C C   . ALA E  3  49  ? 101.170 11.604 12.834  1.00 16.15  ? 49   ALA H C   1 
ATOM   7244  O O   . ALA E  3  49  ? 100.359 11.679 13.752  1.00 15.63  ? 49   ALA H O   1 
ATOM   7245  C CB  . ALA E  3  49  ? 102.845 13.451 13.116  1.00 15.26  ? 49   ALA H CB  1 
ATOM   7246  N N   . ARG E  3  50  ? 101.540 10.454 12.285  1.00 17.44  ? 50   ARG H N   1 
ATOM   7247  C CA  . ARG E  3  50  ? 100.983 9.165  12.698  1.00 18.54  ? 50   ARG H CA  1 
ATOM   7248  C C   . ARG E  3  50  ? 101.040 8.856  14.198  1.00 17.93  ? 50   ARG H C   1 
ATOM   7249  O O   . ARG E  3  50  ? 100.129 8.220  14.735  1.00 17.75  ? 50   ARG H O   1 
ATOM   7250  C CB  . ARG E  3  50  ? 101.662 8.042  11.910  1.00 19.73  ? 50   ARG H CB  1 
ATOM   7251  C CG  . ARG E  3  50  ? 100.969 6.690  12.003  1.00 24.01  ? 50   ARG H CG  1 
ATOM   7252  C CD  . ARG E  3  50  ? 99.638  6.629  11.253  1.00 29.11  ? 50   ARG H CD  1 
ATOM   7253  N NE  . ARG E  3  50  ? 99.125  5.258  11.191  1.00 33.33  ? 50   ARG H NE  1 
ATOM   7254  C CZ  . ARG E  3  50  ? 98.080  4.864  10.470  1.00 35.89  ? 50   ARG H CZ  1 
ATOM   7255  N NH1 . ARG E  3  50  ? 97.399  5.728  9.726   1.00 37.23  ? 50   ARG H NH1 1 
ATOM   7256  N NH2 . ARG E  3  50  ? 97.713  3.593  10.493  1.00 37.34  ? 50   ARG H NH2 1 
ATOM   7257  N N   . TRP E  3  51  ? 102.089 9.292  14.883  1.00 17.30  ? 51   TRP H N   1 
ATOM   7258  C CA  . TRP E  3  51  ? 102.194 8.993  16.313  1.00 16.93  ? 51   TRP H CA  1 
ATOM   7259  C C   . TRP E  3  51  ? 101.192 9.751  17.178  1.00 17.35  ? 51   TRP H C   1 
ATOM   7260  O O   . TRP E  3  51  ? 101.065 9.468  18.366  1.00 17.85  ? 51   TRP H O   1 
ATOM   7261  C CB  . TRP E  3  51  ? 103.606 9.250  16.821  1.00 16.24  ? 51   TRP H CB  1 
ATOM   7262  C CG  . TRP E  3  51  ? 104.113 10.605 16.467  1.00 15.24  ? 51   TRP H CG  1 
ATOM   7263  C CD1 . TRP E  3  51  ? 104.797 10.954 15.336  1.00 14.53  ? 51   TRP H CD1 1 
ATOM   7264  C CD2 . TRP E  3  51  ? 103.959 11.804 17.226  1.00 13.34  ? 51   TRP H CD2 1 
ATOM   7265  N NE1 . TRP E  3  51  ? 105.073 12.299 15.346  1.00 13.91  ? 51   TRP H NE1 1 
ATOM   7266  C CE2 . TRP E  3  51  ? 104.570 12.845 16.497  1.00 13.74  ? 51   TRP H CE2 1 
ATOM   7267  C CE3 . TRP E  3  51  ? 103.356 12.111 18.450  1.00 12.22  ? 51   TRP H CE3 1 
ATOM   7268  C CZ2 . TRP E  3  51  ? 104.605 14.168 16.958  1.00 13.87  ? 51   TRP H CZ2 1 
ATOM   7269  C CZ3 . TRP E  3  51  ? 103.393 13.428 18.904  1.00 12.27  ? 51   TRP H CZ3 1 
ATOM   7270  C CH2 . TRP E  3  51  ? 104.013 14.435 18.162  1.00 11.79  ? 51   TRP H CH2 1 
ATOM   7271  N N   . MET E  3  52  ? 100.491 10.718 16.600  1.00 17.66  ? 52   MET H N   1 
ATOM   7272  C CA  . MET E  3  52  ? 99.543  11.501 17.366  1.00 18.14  ? 52   MET H CA  1 
ATOM   7273  C C   . MET E  3  52  ? 98.223  10.758 17.487  1.00 18.99  ? 52   MET H C   1 
ATOM   7274  O O   . MET E  3  52  ? 97.284  11.233 18.126  1.00 18.69  ? 52   MET H O   1 
ATOM   7275  C CB  . MET E  3  52  ? 99.335  12.871 16.725  1.00 18.12  ? 52   MET H CB  1 
ATOM   7276  C CG  . MET E  3  52  ? 100.263 13.961 17.274  1.00 17.76  ? 52   MET H CG  1 
ATOM   7277  S SD  . MET E  3  52  ? 100.091 14.242 19.071  1.00 17.71  ? 52   MET H SD  1 
ATOM   7278  C CE  . MET E  3  52  ? 98.461  15.003 19.144  1.00 18.29  ? 52   MET H CE  1 
ATOM   7279  N N   . GLU E  3  53  ? 98.177  9.577  16.879  1.00 20.04  ? 53   GLU H N   1 
ATOM   7280  C CA  . GLU E  3  53  ? 96.995  8.733  16.886  1.00 20.49  ? 53   GLU H CA  1 
ATOM   7281  C C   . GLU E  3  53  ? 96.870  7.984  18.200  1.00 21.17  ? 53   GLU H C   1 
ATOM   7282  O O   . GLU E  3  53  ? 95.797  7.507  18.550  1.00 21.58  ? 53   GLU H O   1 
ATOM   7283  C CB  . GLU E  3  53  ? 97.040  7.765  15.703  1.00 20.77  ? 53   GLU H CB  1 
ATOM   7284  C CG  . GLU E  3  53  ? 96.294  8.282  14.474  1.00 21.59  ? 53   GLU H CG  1 
ATOM   7285  C CD  . GLU E  3  53  ? 96.660  7.566  13.183  1.00 23.05  ? 53   GLU H CD  1 
ATOM   7286  O OE1 . GLU E  3  53  ? 96.874  6.330  13.198  1.00 23.70  ? 53   GLU H OE1 1 
ATOM   7287  O OE2 . GLU E  3  53  ? 96.729  8.252  12.139  1.00 23.66  ? 53   GLU H OE2 1 
ATOM   7288  N N   . GLN E  3  54  ? 97.958  7.903  18.954  1.00 22.02  ? 54   GLN H N   1 
ATOM   7289  C CA  . GLN E  3  54  ? 97.920  7.211  20.235  1.00 22.51  ? 54   GLN H CA  1 
ATOM   7290  C C   . GLN E  3  54  ? 97.208  8.029  21.301  1.00 21.58  ? 54   GLN H C   1 
ATOM   7291  O O   . GLN E  3  54  ? 97.131  7.623  22.452  1.00 21.59  ? 54   GLN H O   1 
ATOM   7292  C CB  . GLN E  3  54  ? 99.335  6.875  20.706  1.00 23.68  ? 54   GLN H CB  1 
ATOM   7293  C CG  . GLN E  3  54  ? 99.390  6.088  22.037  1.00 26.62  ? 54   GLN H CG  1 
ATOM   7294  C CD  . GLN E  3  54  ? 98.408  4.915  22.106  1.00 28.86  ? 54   GLN H CD  1 
ATOM   7295  O OE1 . GLN E  3  54  ? 97.239  5.091  22.467  1.00 29.90  ? 54   GLN H OE1 1 
ATOM   7296  N NE2 . GLN E  3  54  ? 98.887  3.718  21.777  1.00 30.69  ? 54   GLN H NE2 1 
ATOM   7297  N N   . GLU E  3  55  ? 96.706  9.196  20.928  1.00 20.89  ? 55   GLU H N   1 
ATOM   7298  C CA  . GLU E  3  55  ? 95.984  10.039 21.868  1.00 20.13  ? 55   GLU H CA  1 
ATOM   7299  C C   . GLU E  3  55  ? 94.511  9.712  21.717  1.00 19.16  ? 55   GLU H C   1 
ATOM   7300  O O   . GLU E  3  55  ? 94.007  9.669  20.599  1.00 19.23  ? 55   GLU H O   1 
ATOM   7301  C CB  . GLU E  3  55  ? 96.232  11.513 21.580  1.00 20.03  ? 55   GLU H CB  1 
ATOM   7302  C CG  . GLU E  3  55  ? 97.620  11.992 21.977  1.00 21.35  ? 55   GLU H CG  1 
ATOM   7303  C CD  . GLU E  3  55  ? 97.795  12.110 23.479  1.00 22.18  ? 55   GLU H CD  1 
ATOM   7304  O OE1 . GLU E  3  55  ? 98.890  12.529 23.924  1.00 22.65  ? 55   GLU H OE1 1 
ATOM   7305  O OE2 . GLU E  3  55  ? 96.839  11.788 24.214  1.00 21.88  ? 55   GLU H OE2 1 
ATOM   7306  N N   . GLY E  3  56  ? 93.824  9.486  22.828  1.00 17.94  ? 56   GLY H N   1 
ATOM   7307  C CA  . GLY E  3  56  ? 92.419  9.116  22.779  1.00 17.69  ? 56   GLY H CA  1 
ATOM   7308  C C   . GLY E  3  56  ? 91.430  10.143 22.236  1.00 17.32  ? 56   GLY H C   1 
ATOM   7309  O O   . GLY E  3  56  ? 91.804  11.229 21.819  1.00 17.05  ? 56   GLY H O   1 
ATOM   7310  N N   . PRO E  3  57  ? 90.151  9.771  22.220  1.00 17.16  ? 57   PRO H N   1 
ATOM   7311  C CA  . PRO E  3  57  ? 89.055  10.627 21.740  1.00 16.82  ? 57   PRO H CA  1 
ATOM   7312  C C   . PRO E  3  57  ? 88.934  11.937 22.492  1.00 16.31  ? 57   PRO H C   1 
ATOM   7313  O O   . PRO E  3  57  ? 88.633  12.966 21.916  1.00 15.60  ? 57   PRO H O   1 
ATOM   7314  C CB  . PRO E  3  57  ? 87.828  9.752  21.971  1.00 16.62  ? 57   PRO H CB  1 
ATOM   7315  C CG  . PRO E  3  57  ? 88.370  8.356  21.834  1.00 16.66  ? 57   PRO H CG  1 
ATOM   7316  C CD  . PRO E  3  57  ? 89.665  8.426  22.573  1.00 16.94  ? 57   PRO H CD  1 
ATOM   7317  N N   . GLU E  3  58  ? 89.185  11.880 23.786  1.00 16.69  ? 58   GLU H N   1 
ATOM   7318  C CA  . GLU E  3  58  ? 89.096  13.042 24.650  1.00 16.97  ? 58   GLU H CA  1 
ATOM   7319  C C   . GLU E  3  58  ? 89.992  14.181 24.173  1.00 16.19  ? 58   GLU H C   1 
ATOM   7320  O O   . GLU E  3  58  ? 89.559  15.330 24.089  1.00 16.69  ? 58   GLU H O   1 
ATOM   7321  C CB  . GLU E  3  58  ? 89.485  12.624 26.060  1.00 17.70  ? 58   GLU H CB  1 
ATOM   7322  C CG  . GLU E  3  58  ? 89.100  11.180 26.366  1.00 20.57  ? 58   GLU H CG  1 
ATOM   7323  C CD  . GLU E  3  58  ? 90.082  10.163 25.794  1.00 22.84  ? 58   GLU H CD  1 
ATOM   7324  O OE1 . GLU E  3  58  ? 89.696  8.988  25.638  1.00 25.23  ? 58   GLU H OE1 1 
ATOM   7325  O OE2 . GLU E  3  58  ? 91.245  10.527 25.510  1.00 24.31  ? 58   GLU H OE2 1 
ATOM   7326  N N   . TYR E  3  59  ? 91.241  13.849 23.874  1.00 15.33  ? 59   TYR H N   1 
ATOM   7327  C CA  . TYR E  3  59  ? 92.221  14.819 23.395  1.00 14.99  ? 59   TYR H CA  1 
ATOM   7328  C C   . TYR E  3  59  ? 91.643  15.631 22.256  1.00 14.40  ? 59   TYR H C   1 
ATOM   7329  O O   . TYR E  3  59  ? 91.634  16.861 22.306  1.00 14.21  ? 59   TYR H O   1 
ATOM   7330  C CB  . TYR E  3  59  ? 93.512  14.122 22.913  1.00 14.82  ? 59   TYR H CB  1 
ATOM   7331  C CG  . TYR E  3  59  ? 94.541  15.092 22.346  1.00 14.43  ? 59   TYR H CG  1 
ATOM   7332  C CD1 . TYR E  3  59  ? 95.459  15.734 23.181  1.00 13.25  ? 59   TYR H CD1 1 
ATOM   7333  C CD2 . TYR E  3  59  ? 94.579  15.388 20.979  1.00 14.26  ? 59   TYR H CD2 1 
ATOM   7334  C CE1 . TYR E  3  59  ? 96.381  16.634 22.680  1.00 12.19  ? 59   TYR H CE1 1 
ATOM   7335  C CE2 . TYR E  3  59  ? 95.510  16.299 20.463  1.00 14.20  ? 59   TYR H CE2 1 
ATOM   7336  C CZ  . TYR E  3  59  ? 96.403  16.914 21.323  1.00 13.57  ? 59   TYR H CZ  1 
ATOM   7337  O OH  . TYR E  3  59  ? 97.311  17.819 20.831  1.00 14.30  ? 59   TYR H OH  1 
ATOM   7338  N N   . TRP E  3  60  ? 91.153  14.935 21.234  1.00 13.91  ? 60   TRP H N   1 
ATOM   7339  C CA  . TRP E  3  60  ? 90.605  15.595 20.040  1.00 13.79  ? 60   TRP H CA  1 
ATOM   7340  C C   . TRP E  3  60  ? 89.396  16.457 20.345  1.00 14.39  ? 60   TRP H C   1 
ATOM   7341  O O   . TRP E  3  60  ? 89.219  17.530 19.756  1.00 14.64  ? 60   TRP H O   1 
ATOM   7342  C CB  . TRP E  3  60  ? 90.265  14.555 18.957  1.00 13.57  ? 60   TRP H CB  1 
ATOM   7343  C CG  . TRP E  3  60  ? 91.474  13.757 18.688  1.00 12.13  ? 60   TRP H CG  1 
ATOM   7344  C CD1 . TRP E  3  60  ? 91.693  12.462 19.032  1.00 10.70  ? 60   TRP H CD1 1 
ATOM   7345  C CD2 . TRP E  3  60  ? 92.698  14.244 18.146  1.00 12.26  ? 60   TRP H CD2 1 
ATOM   7346  N NE1 . TRP E  3  60  ? 92.982  12.104 18.728  1.00 11.04  ? 60   TRP H NE1 1 
ATOM   7347  C CE2 . TRP E  3  60  ? 93.620  13.182 18.173  1.00 12.42  ? 60   TRP H CE2 1 
ATOM   7348  C CE3 . TRP E  3  60  ? 93.112  15.479 17.623  1.00 12.11  ? 60   TRP H CE3 1 
ATOM   7349  C CZ2 . TRP E  3  60  ? 94.927  13.312 17.693  1.00 11.41  ? 60   TRP H CZ2 1 
ATOM   7350  C CZ3 . TRP E  3  60  ? 94.410  15.607 17.152  1.00 9.94   ? 60   TRP H CZ3 1 
ATOM   7351  C CH2 . TRP E  3  60  ? 95.298  14.530 17.192  1.00 10.59  ? 60   TRP H CH2 1 
ATOM   7352  N N   . GLU E  3  61  ? 88.561  15.979 21.257  1.00 14.57  ? 61   GLU H N   1 
ATOM   7353  C CA  . GLU E  3  61  ? 87.364  16.701 21.652  1.00 15.29  ? 61   GLU H CA  1 
ATOM   7354  C C   . GLU E  3  61  ? 87.762  17.979 22.361  1.00 15.32  ? 61   GLU H C   1 
ATOM   7355  O O   . GLU E  3  61  ? 87.314  19.074 22.015  1.00 15.66  ? 61   GLU H O   1 
ATOM   7356  C CB  . GLU E  3  61  ? 86.518  15.825 22.582  1.00 15.72  ? 61   GLU H CB  1 
ATOM   7357  C CG  . GLU E  3  61  ? 85.401  16.546 23.312  1.00 16.01  ? 61   GLU H CG  1 
ATOM   7358  C CD  . GLU E  3  61  ? 84.238  16.891 22.414  1.00 17.20  ? 61   GLU H CD  1 
ATOM   7359  O OE1 . GLU E  3  61  ? 83.238  17.433 22.930  1.00 18.01  ? 61   GLU H OE1 1 
ATOM   7360  O OE2 . GLU E  3  61  ? 84.317  16.618 21.199  1.00 18.17  ? 61   GLU H OE2 1 
ATOM   7361  N N   . ARG E  3  62  ? 88.620  17.826 23.355  1.00 15.48  ? 62   ARG H N   1 
ATOM   7362  C CA  . ARG E  3  62  ? 89.086  18.951 24.147  1.00 15.71  ? 62   ARG H CA  1 
ATOM   7363  C C   . ARG E  3  62  ? 89.700  20.029 23.248  1.00 15.48  ? 62   ARG H C   1 
ATOM   7364  O O   . ARG E  3  62  ? 89.268  21.178 23.271  1.00 15.69  ? 62   ARG H O   1 
ATOM   7365  C CB  . ARG E  3  62  ? 90.077  18.422 25.176  1.00 16.28  ? 62   ARG H CB  1 
ATOM   7366  C CG  . ARG E  3  62  ? 90.720  19.414 26.103  1.00 16.92  ? 62   ARG H CG  1 
ATOM   7367  C CD  . ARG E  3  62  ? 91.275  18.693 27.341  1.00 18.93  ? 62   ARG H CD  1 
ATOM   7368  N NE  . ARG E  3  62  ? 92.054  17.489 27.009  1.00 19.09  ? 62   ARG H NE  1 
ATOM   7369  C CZ  . ARG E  3  62  ? 93.234  17.509 26.411  1.00 18.44  ? 62   ARG H CZ  1 
ATOM   7370  N NH1 . ARG E  3  62  ? 93.788  18.662 26.071  1.00 20.61  ? 62   ARG H NH1 1 
ATOM   7371  N NH2 . ARG E  3  62  ? 93.867  16.385 26.155  1.00 18.74  ? 62   ARG H NH2 1 
ATOM   7372  N N   . GLU E  3  63  ? 90.669  19.657 22.421  1.00 14.91  ? 63   GLU H N   1 
ATOM   7373  C CA  . GLU E  3  63  ? 91.299  20.634 21.542  1.00 14.82  ? 63   GLU H CA  1 
ATOM   7374  C C   . GLU E  3  63  ? 90.353  21.261 20.526  1.00 14.35  ? 63   GLU H C   1 
ATOM   7375  O O   . GLU E  3  63  ? 90.563  22.398 20.109  1.00 14.11  ? 63   GLU H O   1 
ATOM   7376  C CB  . GLU E  3  63  ? 92.518  20.030 20.844  1.00 14.77  ? 63   GLU H CB  1 
ATOM   7377  C CG  . GLU E  3  63  ? 93.661  19.774 21.800  1.00 15.44  ? 63   GLU H CG  1 
ATOM   7378  C CD  . GLU E  3  63  ? 94.037  21.023 22.574  1.00 15.96  ? 63   GLU H CD  1 
ATOM   7379  O OE1 . GLU E  3  63  ? 94.895  21.785 22.090  1.00 14.61  ? 63   GLU H OE1 1 
ATOM   7380  O OE2 . GLU E  3  63  ? 93.453  21.254 23.661  1.00 17.02  ? 63   GLU H OE2 1 
ATOM   7381  N N   . THR E  3  64  ? 89.312  20.540 20.127  1.00 14.56  ? 64   THR H N   1 
ATOM   7382  C CA  . THR E  3  64  ? 88.361  21.086 19.147  1.00 14.06  ? 64   THR H CA  1 
ATOM   7383  C C   . THR E  3  64  ? 87.484  22.156 19.769  1.00 13.45  ? 64   THR H C   1 
ATOM   7384  O O   . THR E  3  64  ? 87.261  23.207 19.175  1.00 13.52  ? 64   THR H O   1 
ATOM   7385  C CB  . THR E  3  64  ? 87.492  19.987 18.560  1.00 14.42  ? 64   THR H CB  1 
ATOM   7386  O OG1 . THR E  3  64  ? 88.302  19.132 17.745  1.00 14.99  ? 64   THR H OG1 1 
ATOM   7387  C CG2 . THR E  3  64  ? 86.419  20.569 17.636  1.00 14.47  ? 64   THR H CG2 1 
ATOM   7388  N N   . GLN E  3  65  ? 86.989  21.893 20.972  1.00 13.12  ? 65   GLN H N   1 
ATOM   7389  C CA  . GLN E  3  65  ? 86.160  22.868 21.664  1.00 12.79  ? 65   GLN H CA  1 
ATOM   7390  C C   . GLN E  3  65  ? 87.004  24.119 21.896  1.00 12.61  ? 65   GLN H C   1 
ATOM   7391  O O   . GLN E  3  65  ? 86.546  25.245 21.683  1.00 12.81  ? 65   GLN H O   1 
ATOM   7392  C CB  . GLN E  3  65  ? 85.661  22.330 23.009  1.00 12.65  ? 65   GLN H CB  1 
ATOM   7393  C CG  . GLN E  3  65  ? 84.481  21.380 22.942  1.00 13.95  ? 65   GLN H CG  1 
ATOM   7394  C CD  . GLN E  3  65  ? 83.358  21.907 22.073  1.00 16.29  ? 65   GLN H CD  1 
ATOM   7395  O OE1 . GLN E  3  65  ? 83.304  21.617 20.869  1.00 18.67  ? 65   GLN H OE1 1 
ATOM   7396  N NE2 . GLN E  3  65  ? 82.474  22.701 22.662  1.00 16.51  ? 65   GLN H NE2 1 
ATOM   7397  N N   . LYS E  3  66  ? 88.247  23.909 22.316  1.00 11.72  ? 66   LYS H N   1 
ATOM   7398  C CA  . LYS E  3  66  ? 89.156  25.006 22.587  1.00 11.57  ? 66   LYS H CA  1 
ATOM   7399  C C   . LYS E  3  66  ? 89.370  25.795 21.304  1.00 12.12  ? 66   LYS H C   1 
ATOM   7400  O O   . LYS E  3  66  ? 89.282  27.021 21.294  1.00 12.40  ? 66   LYS H O   1 
ATOM   7401  C CB  . LYS E  3  66  ? 90.501  24.478 23.130  1.00 11.15  ? 66   LYS H CB  1 
ATOM   7402  C CG  . LYS E  3  66  ? 91.461  25.571 23.608  1.00 9.13   ? 66   LYS H CG  1 
ATOM   7403  C CD  . LYS E  3  66  ? 92.854  25.044 24.002  1.00 6.38   ? 66   LYS H CD  1 
ATOM   7404  C CE  . LYS E  3  66  ? 92.838  24.233 25.272  1.00 4.82   ? 66   LYS H CE  1 
ATOM   7405  N NZ  . LYS E  3  66  ? 94.180  23.616 25.544  1.00 4.00   ? 66   LYS H NZ  1 
ATOM   7406  N N   . ALA E  3  67  ? 89.653  25.089 20.214  1.00 12.46  ? 67   ALA H N   1 
ATOM   7407  C CA  . ALA E  3  67  ? 89.875  25.751 18.934  1.00 12.29  ? 67   ALA H CA  1 
ATOM   7408  C C   . ALA E  3  67  ? 88.638  26.533 18.529  1.00 12.17  ? 67   ALA H C   1 
ATOM   7409  O O   . ALA E  3  67  ? 88.738  27.633 17.995  1.00 11.76  ? 67   ALA H O   1 
ATOM   7410  C CB  . ALA E  3  67  ? 90.212  24.746 17.888  1.00 12.52  ? 67   ALA H CB  1 
ATOM   7411  N N   . LYS E  3  68  ? 87.468  25.955 18.780  1.00 12.64  ? 68   LYS H N   1 
ATOM   7412  C CA  . LYS E  3  68  ? 86.205  26.603 18.442  1.00 12.43  ? 68   LYS H CA  1 
ATOM   7413  C C   . LYS E  3  68  ? 86.076  27.869 19.266  1.00 12.32  ? 68   LYS H C   1 
ATOM   7414  O O   . LYS E  3  68  ? 85.454  28.825 18.843  1.00 12.64  ? 68   LYS H O   1 
ATOM   7415  C CB  . LYS E  3  68  ? 85.042  25.681 18.748  1.00 12.96  ? 68   LYS H CB  1 
ATOM   7416  C CG  . LYS E  3  68  ? 84.920  24.504 17.820  1.00 13.94  ? 68   LYS H CG  1 
ATOM   7417  C CD  . LYS E  3  68  ? 84.298  24.920 16.518  1.00 16.03  ? 68   LYS H CD  1 
ATOM   7418  C CE  . LYS E  3  68  ? 83.759  23.735 15.730  1.00 17.34  ? 68   LYS H CE  1 
ATOM   7419  N NZ  . LYS E  3  68  ? 83.202  24.205 14.418  1.00 17.62  ? 68   LYS H NZ  1 
ATOM   7420  N N   . GLY E  3  69  ? 86.681  27.862 20.449  1.00 12.02  ? 69   GLY H N   1 
ATOM   7421  C CA  . GLY E  3  69  ? 86.661  29.015 21.331  1.00 11.59  ? 69   GLY H CA  1 
ATOM   7422  C C   . GLY E  3  69  ? 87.688  30.028 20.879  1.00 11.36  ? 69   GLY H C   1 
ATOM   7423  O O   . GLY E  3  69  ? 87.411  31.219 20.772  1.00 11.41  ? 69   GLY H O   1 
ATOM   7424  N N   . ASN E  3  70  ? 88.892  29.551 20.615  1.00 11.78  ? 70   ASN H N   1 
ATOM   7425  C CA  . ASN E  3  70  ? 89.934  30.415 20.106  1.00 12.48  ? 70   ASN H CA  1 
ATOM   7426  C C   . ASN E  3  70  ? 89.439  31.070 18.818  1.00 13.48  ? 70   ASN H C   1 
ATOM   7427  O O   . ASN E  3  70  ? 89.672  32.249 18.582  1.00 13.52  ? 70   ASN H O   1 
ATOM   7428  C CB  . ASN E  3  70  ? 91.224  29.621 19.888  1.00 12.32  ? 70   ASN H CB  1 
ATOM   7429  C CG  . ASN E  3  70  ? 91.982  29.377 21.198  1.00 12.92  ? 70   ASN H CG  1 
ATOM   7430  O OD1 . ASN E  3  70  ? 91.984  30.233 22.078  1.00 12.40  ? 70   ASN H OD1 1 
ATOM   7431  N ND2 . ASN E  3  70  ? 92.607  28.208 21.334  1.00 11.58  ? 70   ASN H ND2 1 
ATOM   7432  N N   . GLU E  3  71  ? 88.703  30.321 18.002  1.00 14.78  ? 71   GLU H N   1 
ATOM   7433  C CA  . GLU E  3  71  ? 88.179  30.872 16.749  1.00 15.81  ? 71   GLU H CA  1 
ATOM   7434  C C   . GLU E  3  71  ? 87.335  32.147 16.939  1.00 16.19  ? 71   GLU H C   1 
ATOM   7435  O O   . GLU E  3  71  ? 87.550  33.144 16.250  1.00 15.88  ? 71   GLU H O   1 
ATOM   7436  C CB  . GLU E  3  71  ? 87.367  29.823 15.996  1.00 15.86  ? 71   GLU H CB  1 
ATOM   7437  C CG  . GLU E  3  71  ? 86.508  30.412 14.900  1.00 16.66  ? 71   GLU H CG  1 
ATOM   7438  C CD  . GLU E  3  71  ? 85.846  29.344 14.071  1.00 18.64  ? 71   GLU H CD  1 
ATOM   7439  O OE1 . GLU E  3  71  ? 85.373  28.353 14.666  1.00 19.79  ? 71   GLU H OE1 1 
ATOM   7440  O OE2 . GLU E  3  71  ? 85.800  29.492 12.836  1.00 19.57  ? 71   GLU H OE2 1 
ATOM   7441  N N   . GLN E  3  72  ? 86.365  32.107 17.852  1.00 16.62  ? 72   GLN H N   1 
ATOM   7442  C CA  . GLN E  3  72  ? 85.528  33.279 18.105  1.00 17.22  ? 72   GLN H CA  1 
ATOM   7443  C C   . GLN E  3  72  ? 86.368  34.427 18.647  1.00 17.05  ? 72   GLN H C   1 
ATOM   7444  O O   . GLN E  3  72  ? 86.125  35.595 18.344  1.00 16.89  ? 72   GLN H O   1 
ATOM   7445  C CB  . GLN E  3  72  ? 84.424  32.953 19.115  1.00 17.76  ? 72   GLN H CB  1 
ATOM   7446  C CG  . GLN E  3  72  ? 83.393  31.976 18.599  1.00 19.97  ? 72   GLN H CG  1 
ATOM   7447  C CD  . GLN E  3  72  ? 82.905  32.353 17.219  1.00 21.22  ? 72   GLN H CD  1 
ATOM   7448  O OE1 . GLN E  3  72  ? 82.465  33.478 17.007  1.00 24.41  ? 72   GLN H OE1 1 
ATOM   7449  N NE2 . GLN E  3  72  ? 83.000  31.427 16.275  1.00 21.02  ? 72   GLN H NE2 1 
ATOM   7450  N N   . SER E  3  73  ? 87.351  34.083 19.471  1.00 17.05  ? 73   SER H N   1 
ATOM   7451  C CA  . SER E  3  73  ? 88.223  35.073 20.063  1.00 17.03  ? 73   SER H CA  1 
ATOM   7452  C C   . SER E  3  73  ? 88.853  35.925 18.966  1.00 17.05  ? 73   SER H C   1 
ATOM   7453  O O   . SER E  3  73  ? 88.802  37.151 19.016  1.00 16.80  ? 73   SER H O   1 
ATOM   7454  C CB  . SER E  3  73  ? 89.301  34.384 20.883  1.00 17.28  ? 73   SER H CB  1 
ATOM   7455  O OG  . SER E  3  73  ? 90.211  35.319 21.431  1.00 18.49  ? 73   SER H OG  1 
ATOM   7456  N N   . PHE E  3  74  ? 89.439  35.261 17.973  1.00 16.92  ? 74   PHE H N   1 
ATOM   7457  C CA  . PHE E  3  74  ? 90.089  35.940 16.864  1.00 16.99  ? 74   PHE H CA  1 
ATOM   7458  C C   . PHE E  3  74  ? 89.096  36.624 15.938  1.00 17.83  ? 74   PHE H C   1 
ATOM   7459  O O   . PHE E  3  74  ? 89.405  37.639 15.307  1.00 17.96  ? 74   PHE H O   1 
ATOM   7460  C CB  . PHE E  3  74  ? 90.968  34.958 16.091  1.00 16.64  ? 74   PHE H CB  1 
ATOM   7461  C CG  . PHE E  3  74  ? 92.324  34.823 16.668  1.00 15.09  ? 74   PHE H CG  1 
ATOM   7462  C CD1 . PHE E  3  74  ? 92.526  34.111 17.835  1.00 15.83  ? 74   PHE H CD1 1 
ATOM   7463  C CD2 . PHE E  3  74  ? 93.391  35.463 16.091  1.00 14.50  ? 74   PHE H CD2 1 
ATOM   7464  C CE1 . PHE E  3  74  ? 93.788  34.017 18.401  1.00 15.49  ? 74   PHE H CE1 1 
ATOM   7465  C CE2 . PHE E  3  74  ? 94.648  35.380 16.649  1.00 15.00  ? 74   PHE H CE2 1 
ATOM   7466  C CZ  . PHE E  3  74  ? 94.850  34.653 17.801  1.00 15.19  ? 74   PHE H CZ  1 
ATOM   7467  N N   . ARG E  3  75  ? 87.905  36.055 15.850  1.00 18.69  ? 75   ARG H N   1 
ATOM   7468  C CA  . ARG E  3  75  ? 86.847  36.649 15.058  1.00 19.56  ? 75   ARG H CA  1 
ATOM   7469  C C   . ARG E  3  75  ? 86.671  38.086 15.568  1.00 19.26  ? 75   ARG H C   1 
ATOM   7470  O O   . ARG E  3  75  ? 86.524  39.018 14.781  1.00 20.04  ? 75   ARG H O   1 
ATOM   7471  C CB  . ARG E  3  75  ? 85.566  35.843 15.246  1.00 20.31  ? 75   ARG H CB  1 
ATOM   7472  C CG  . ARG E  3  75  ? 84.489  36.072 14.222  1.00 22.32  ? 75   ARG H CG  1 
ATOM   7473  C CD  . ARG E  3  75  ? 83.767  34.776 13.884  1.00 24.67  ? 75   ARG H CD  1 
ATOM   7474  N NE  . ARG E  3  75  ? 84.655  33.868 13.156  1.00 26.46  ? 75   ARG H NE  1 
ATOM   7475  C CZ  . ARG E  3  75  ? 84.368  32.607 12.838  1.00 27.63  ? 75   ARG H CZ  1 
ATOM   7476  N NH1 . ARG E  3  75  ? 83.203  32.072 13.190  1.00 27.84  ? 75   ARG H NH1 1 
ATOM   7477  N NH2 . ARG E  3  75  ? 85.259  31.877 12.170  1.00 26.87  ? 75   ARG H NH2 1 
ATOM   7478  N N   . VAL E  3  76  ? 86.725  38.268 16.888  1.00 18.56  ? 76   VAL H N   1 
ATOM   7479  C CA  . VAL E  3  76  ? 86.556  39.598 17.488  1.00 17.90  ? 76   VAL H CA  1 
ATOM   7480  C C   . VAL E  3  76  ? 87.778  40.505 17.345  1.00 17.55  ? 76   VAL H C   1 
ATOM   7481  O O   . VAL E  3  76  ? 87.621  41.705 17.112  1.00 17.15  ? 76   VAL H O   1 
ATOM   7482  C CB  . VAL E  3  76  ? 86.161  39.514 18.977  1.00 18.09  ? 76   VAL H CB  1 
ATOM   7483  C CG1 . VAL E  3  76  ? 86.081  40.923 19.584  1.00 18.37  ? 76   VAL H CG1 1 
ATOM   7484  C CG2 . VAL E  3  76  ? 84.823  38.795 19.129  1.00 16.84  ? 76   VAL H CG2 1 
ATOM   7485  N N   . SER E  3  77  ? 88.984  39.949 17.479  1.00 17.29  ? 77   SER H N   1 
ATOM   7486  C CA  . SER E  3  77  ? 90.213  40.731 17.311  1.00 17.32  ? 77   SER H CA  1 
ATOM   7487  C C   . SER E  3  77  ? 90.303  41.332 15.917  1.00 17.27  ? 77   SER H C   1 
ATOM   7488  O O   . SER E  3  77  ? 90.760  42.458 15.744  1.00 17.35  ? 77   SER H O   1 
ATOM   7489  C CB  . SER E  3  77  ? 91.446  39.867 17.541  1.00 17.68  ? 77   SER H CB  1 
ATOM   7490  O OG  . SER E  3  77  ? 91.693  39.682 18.917  1.00 19.72  ? 77   SER H OG  1 
ATOM   7491  N N   . LEU E  3  78  ? 89.894  40.561 14.916  1.00 17.50  ? 78   LEU H N   1 
ATOM   7492  C CA  . LEU E  3  78  ? 89.879  41.043 13.547  1.00 17.47  ? 78   LEU H CA  1 
ATOM   7493  C C   . LEU E  3  78  ? 89.105  42.352 13.553  1.00 18.65  ? 78   LEU H C   1 
ATOM   7494  O O   . LEU E  3  78  ? 89.601  43.399 13.117  1.00 19.22  ? 78   LEU H O   1 
ATOM   7495  C CB  . LEU E  3  78  ? 89.200  40.025 12.637  1.00 16.73  ? 78   LEU H CB  1 
ATOM   7496  C CG  . LEU E  3  78  ? 90.126  38.925 12.129  1.00 15.52  ? 78   LEU H CG  1 
ATOM   7497  C CD1 . LEU E  3  78  ? 89.336  37.753 11.627  1.00 14.19  ? 78   LEU H CD1 1 
ATOM   7498  C CD2 . LEU E  3  78  ? 91.025  39.482 11.041  1.00 15.60  ? 78   LEU H CD2 1 
ATOM   7499  N N   . ARG E  3  79  ? 87.892  42.304 14.082  1.00 19.32  ? 79   ARG H N   1 
ATOM   7500  C CA  . ARG E  3  79  ? 87.088  43.510 14.159  1.00 20.07  ? 79   ARG H CA  1 
ATOM   7501  C C   . ARG E  3  79  ? 87.760  44.594 14.983  1.00 20.55  ? 79   ARG H C   1 
ATOM   7502  O O   . ARG E  3  79  ? 87.804  45.746 14.563  1.00 21.18  ? 79   ARG H O   1 
ATOM   7503  C CB  . ARG E  3  79  ? 85.722  43.211 14.748  1.00 20.04  ? 79   ARG H CB  1 
ATOM   7504  C CG  . ARG E  3  79  ? 84.845  42.431 13.825  1.00 19.87  ? 79   ARG H CG  1 
ATOM   7505  C CD  . ARG E  3  79  ? 83.416  42.630 14.162  1.00 19.84  ? 79   ARG H CD  1 
ATOM   7506  N NE  . ARG E  3  79  ? 83.118  42.300 15.550  1.00 19.75  ? 79   ARG H NE  1 
ATOM   7507  C CZ  . ARG E  3  79  ? 82.752  41.106 15.968  1.00 18.87  ? 79   ARG H CZ  1 
ATOM   7508  N NH1 . ARG E  3  79  ? 82.665  40.104 15.108  1.00 19.38  ? 79   ARG H NH1 1 
ATOM   7509  N NH2 . ARG E  3  79  ? 82.456  40.916 17.250  1.00 19.24  ? 79   ARG H NH2 1 
ATOM   7510  N N   . THR E  3  80  ? 88.282  44.238 16.153  1.00 20.93  ? 80   THR H N   1 
ATOM   7511  C CA  . THR E  3  80  ? 88.912  45.233 17.008  1.00 21.36  ? 80   THR H CA  1 
ATOM   7512  C C   . THR E  3  80  ? 90.016  45.965 16.272  1.00 22.40  ? 80   THR H C   1 
ATOM   7513  O O   . THR E  3  80  ? 90.200  47.172 16.440  1.00 22.30  ? 80   THR H O   1 
ATOM   7514  C CB  . THR E  3  80  ? 89.499  44.600 18.273  1.00 21.24  ? 80   THR H CB  1 
ATOM   7515  O OG1 . THR E  3  80  ? 88.448  44.051 19.075  1.00 20.96  ? 80   THR H OG1 1 
ATOM   7516  C CG2 . THR E  3  80  ? 90.166  45.675 19.145  1.00 20.72  ? 80   THR H CG2 1 
ATOM   7517  N N   . LEU E  3  81  ? 90.757  45.228 15.458  1.00 23.71  ? 81   LEU H N   1 
ATOM   7518  C CA  . LEU E  3  81  ? 91.853  45.817 14.703  1.00 24.90  ? 81   LEU H CA  1 
ATOM   7519  C C   . LEU E  3  81  ? 91.415  46.862 13.679  1.00 25.24  ? 81   LEU H C   1 
ATOM   7520  O O   . LEU E  3  81  ? 92.143  47.808 13.425  1.00 25.04  ? 81   LEU H O   1 
ATOM   7521  C CB  . LEU E  3  81  ? 92.671  44.719 14.024  1.00 25.04  ? 81   LEU H CB  1 
ATOM   7522  C CG  . LEU E  3  81  ? 93.559  44.010 15.049  1.00 25.16  ? 81   LEU H CG  1 
ATOM   7523  C CD1 . LEU E  3  81  ? 94.316  42.867 14.411  1.00 24.57  ? 81   LEU H CD1 1 
ATOM   7524  C CD2 . LEU E  3  81  ? 94.517  45.023 15.677  1.00 25.09  ? 81   LEU H CD2 1 
ATOM   7525  N N   . LEU E  3  82  ? 90.242  46.681 13.084  1.00 26.37  ? 82   LEU H N   1 
ATOM   7526  C CA  . LEU E  3  82  ? 89.736  47.631 12.094  1.00 26.99  ? 82   LEU H CA  1 
ATOM   7527  C C   . LEU E  3  82  ? 89.538  48.985 12.748  1.00 28.07  ? 82   LEU H C   1 
ATOM   7528  O O   . LEU E  3  82  ? 89.810  50.018 12.142  1.00 28.25  ? 82   LEU H O   1 
ATOM   7529  C CB  . LEU E  3  82  ? 88.404  47.166 11.520  1.00 26.70  ? 82   LEU H CB  1 
ATOM   7530  C CG  . LEU E  3  82  ? 88.414  45.968 10.581  1.00 26.12  ? 82   LEU H CG  1 
ATOM   7531  C CD1 . LEU E  3  82  ? 86.962  45.631 10.256  1.00 26.21  ? 82   LEU H CD1 1 
ATOM   7532  C CD2 . LEU E  3  82  ? 89.215  46.259 9.299   1.00 25.28  ? 82   LEU H CD2 1 
ATOM   7533  N N   . GLY E  3  83  ? 89.052  48.975 13.987  1.00 29.16  ? 83   GLY H N   1 
ATOM   7534  C CA  . GLY E  3  83  ? 88.863  50.209 14.721  1.00 30.04  ? 83   GLY H CA  1 
ATOM   7535  C C   . GLY E  3  83  ? 90.196  50.846 15.101  1.00 31.23  ? 83   GLY H C   1 
ATOM   7536  O O   . GLY E  3  83  ? 90.386  52.052 14.938  1.00 31.40  ? 83   GLY H O   1 
ATOM   7537  N N   . TYR E  3  84  ? 91.127  50.040 15.604  1.00 32.43  ? 84   TYR H N   1 
ATOM   7538  C CA  . TYR E  3  84  ? 92.439  50.543 16.023  1.00 33.44  ? 84   TYR H CA  1 
ATOM   7539  C C   . TYR E  3  84  ? 93.187  51.233 14.888  1.00 34.12  ? 84   TYR H C   1 
ATOM   7540  O O   . TYR E  3  84  ? 94.056  52.071 15.121  1.00 34.16  ? 84   TYR H O   1 
ATOM   7541  C CB  . TYR E  3  84  ? 93.305  49.395 16.559  1.00 33.50  ? 84   TYR H CB  1 
ATOM   7542  C CG  . TYR E  3  84  ? 92.913  48.865 17.932  1.00 33.54  ? 84   TYR H CG  1 
ATOM   7543  C CD1 . TYR E  3  84  ? 93.534  47.736 18.458  1.00 33.46  ? 84   TYR H CD1 1 
ATOM   7544  C CD2 . TYR E  3  84  ? 91.944  49.495 18.705  1.00 33.71  ? 84   TYR H CD2 1 
ATOM   7545  C CE1 . TYR E  3  84  ? 93.200  47.245 19.705  1.00 33.48  ? 84   TYR H CE1 1 
ATOM   7546  C CE2 . TYR E  3  84  ? 91.600  49.010 19.961  1.00 33.42  ? 84   TYR H CE2 1 
ATOM   7547  C CZ  . TYR E  3  84  ? 92.234  47.886 20.455  1.00 33.77  ? 84   TYR H CZ  1 
ATOM   7548  O OH  . TYR E  3  84  ? 91.911  47.400 21.704  1.00 32.95  ? 84   TYR H OH  1 
ATOM   7549  N N   . TYR E  3  85  ? 92.841  50.875 13.659  1.00 34.96  ? 85   TYR H N   1 
ATOM   7550  C CA  . TYR E  3  85  ? 93.508  51.418 12.490  1.00 35.34  ? 85   TYR H CA  1 
ATOM   7551  C C   . TYR E  3  85  ? 92.532  52.176 11.581  1.00 36.59  ? 85   TYR H C   1 
ATOM   7552  O O   . TYR E  3  85  ? 92.904  52.628 10.489  1.00 36.42  ? 85   TYR H O   1 
ATOM   7553  C CB  . TYR E  3  85  ? 94.150  50.277 11.718  1.00 34.63  ? 85   TYR H CB  1 
ATOM   7554  C CG  . TYR E  3  85  ? 95.337  49.595 12.375  1.00 32.85  ? 85   TYR H CG  1 
ATOM   7555  C CD1 . TYR E  3  85  ? 96.604  50.159 12.320  1.00 32.16  ? 85   TYR H CD1 1 
ATOM   7556  C CD2 . TYR E  3  85  ? 95.207  48.349 12.979  1.00 30.66  ? 85   TYR H CD2 1 
ATOM   7557  C CE1 . TYR E  3  85  ? 97.708  49.514 12.863  1.00 30.81  ? 85   TYR H CE1 1 
ATOM   7558  C CE2 . TYR E  3  85  ? 96.305  47.698 13.526  1.00 29.61  ? 85   TYR H CE2 1 
ATOM   7559  C CZ  . TYR E  3  85  ? 97.555  48.285 13.461  1.00 29.75  ? 85   TYR H CZ  1 
ATOM   7560  O OH  . TYR E  3  85  ? 98.665  47.647 13.982  1.00 28.18  ? 85   TYR H OH  1 
ATOM   7561  N N   . ASN E  3  86  ? 91.295  52.334 12.046  1.00 37.71  ? 86   ASN H N   1 
ATOM   7562  C CA  . ASN E  3  86  ? 90.272  53.014 11.265  1.00 38.70  ? 86   ASN H CA  1 
ATOM   7563  C C   . ASN E  3  86  ? 90.438  52.621 9.805   1.00 38.68  ? 86   ASN H C   1 
ATOM   7564  O O   . ASN E  3  86  ? 90.737  53.461 8.957   1.00 38.94  ? 86   ASN H O   1 
ATOM   7565  C CB  . ASN E  3  86  ? 90.381  54.535 11.418  1.00 39.12  ? 86   ASN H CB  1 
ATOM   7566  C CG  . ASN E  3  86  ? 89.913  55.022 12.776  1.00 40.48  ? 86   ASN H CG  1 
ATOM   7567  O OD1 . ASN E  3  86  ? 88.856  54.615 13.263  1.00 42.36  ? 86   ASN H OD1 1 
ATOM   7568  N ND2 . ASN E  3  86  ? 90.697  55.904 13.397  1.00 41.71  ? 86   ASN H ND2 1 
ATOM   7569  N N   . GLN E  3  87  ? 90.268  51.333 9.527   1.00 38.66  ? 87   GLN H N   1 
ATOM   7570  C CA  . GLN E  3  87  ? 90.411  50.807 8.175   1.00 38.51  ? 87   GLN H CA  1 
ATOM   7571  C C   . GLN E  3  87  ? 89.047  50.496 7.569   1.00 38.61  ? 87   GLN H C   1 
ATOM   7572  O O   . GLN E  3  87  ? 88.033  50.477 8.268   1.00 38.24  ? 87   GLN H O   1 
ATOM   7573  C CB  . GLN E  3  87  ? 91.235  49.517 8.180   1.00 38.24  ? 87   GLN H CB  1 
ATOM   7574  C CG  . GLN E  3  87  ? 92.601  49.606 8.828   1.00 37.78  ? 87   GLN H CG  1 
ATOM   7575  C CD  . GLN E  3  87  ? 93.309  48.261 8.819   1.00 37.24  ? 87   GLN H CD  1 
ATOM   7576  O OE1 . GLN E  3  87  ? 92.740  47.260 9.245   1.00 36.79  ? 87   GLN H OE1 1 
ATOM   7577  N NE2 . GLN E  3  87  ? 94.537  48.231 8.316   1.00 36.92  ? 87   GLN H NE2 1 
ATOM   7578  N N   . SER E  3  88  ? 89.040  50.237 6.265   1.00 38.60  ? 88   SER H N   1 
ATOM   7579  C CA  . SER E  3  88  ? 87.817  49.901 5.550   1.00 38.63  ? 88   SER H CA  1 
ATOM   7580  C C   . SER E  3  88  ? 87.067  48.785 6.257   1.00 38.33  ? 88   SER H C   1 
ATOM   7581  O O   . SER E  3  88  ? 87.640  48.034 7.034   1.00 38.89  ? 88   SER H O   1 
ATOM   7582  C CB  . SER E  3  88  ? 88.140  49.452 4.123   1.00 38.62  ? 88   SER H CB  1 
ATOM   7583  O OG  . SER E  3  88  ? 86.980  48.956 3.479   1.00 38.34  ? 88   SER H OG  1 
ATOM   7584  N N   . ALA E  3  89  ? 85.782  48.668 5.969   1.00 37.96  ? 89   ALA H N   1 
ATOM   7585  C CA  . ALA E  3  89  ? 84.971  47.623 6.570   1.00 37.49  ? 89   ALA H CA  1 
ATOM   7586  C C   . ALA E  3  89  ? 84.976  46.402 5.662   1.00 36.80  ? 89   ALA H C   1 
ATOM   7587  O O   . ALA E  3  89  ? 84.975  45.267 6.134   1.00 37.05  ? 89   ALA H O   1 
ATOM   7588  C CB  . ALA E  3  89  ? 83.548  48.115 6.787   1.00 37.47  ? 89   ALA H CB  1 
ATOM   7589  N N   . GLY E  3  90  ? 84.992  46.638 4.352   1.00 35.92  ? 90   GLY H N   1 
ATOM   7590  C CA  . GLY E  3  90  ? 84.965  45.546 3.392   1.00 35.14  ? 90   GLY H CA  1 
ATOM   7591  C C   . GLY E  3  90  ? 86.308  45.006 2.941   1.00 34.15  ? 90   GLY H C   1 
ATOM   7592  O O   . GLY E  3  90  ? 86.382  44.319 1.922   1.00 34.20  ? 90   GLY H O   1 
ATOM   7593  N N   . GLY E  3  91  ? 87.369  45.296 3.683   1.00 32.78  ? 91   GLY H N   1 
ATOM   7594  C CA  . GLY E  3  91  ? 88.683  44.814 3.302   1.00 31.75  ? 91   GLY H CA  1 
ATOM   7595  C C   . GLY E  3  91  ? 89.066  43.562 4.063   1.00 30.88  ? 91   GLY H C   1 
ATOM   7596  O O   . GLY E  3  91  ? 88.753  43.419 5.246   1.00 31.22  ? 91   GLY H O   1 
ATOM   7597  N N   . SER E  3  92  ? 89.739  42.642 3.380   1.00 29.59  ? 92   SER H N   1 
ATOM   7598  C CA  . SER E  3  92  ? 90.186  41.407 4.008   1.00 27.89  ? 92   SER H CA  1 
ATOM   7599  C C   . SER E  3  92  ? 91.480  41.646 4.756   1.00 26.64  ? 92   SER H C   1 
ATOM   7600  O O   . SER E  3  92  ? 92.369  42.345 4.265   1.00 26.38  ? 92   SER H O   1 
ATOM   7601  C CB  . SER E  3  92  ? 90.430  40.326 2.973   1.00 27.75  ? 92   SER H CB  1 
ATOM   7602  O OG  . SER E  3  92  ? 91.095  39.238 3.581   1.00 26.65  ? 92   SER H OG  1 
ATOM   7603  N N   . HIS E  3  93  ? 91.594  41.049 5.936   1.00 25.15  ? 93   HIS H N   1 
ATOM   7604  C CA  . HIS E  3  93  ? 92.782  41.226 6.752   1.00 23.91  ? 93   HIS H CA  1 
ATOM   7605  C C   . HIS E  3  93  ? 93.284  39.923 7.341   1.00 22.94  ? 93   HIS H C   1 
ATOM   7606  O O   . HIS E  3  93  ? 92.615  38.895 7.264   1.00 23.03  ? 93   HIS H O   1 
ATOM   7607  C CB  . HIS E  3  93  ? 92.505  42.260 7.830   1.00 23.93  ? 93   HIS H CB  1 
ATOM   7608  C CG  . HIS E  3  93  ? 92.404  43.642 7.278   1.00 24.58  ? 93   HIS H CG  1 
ATOM   7609  N ND1 . HIS E  3  93  ? 93.500  44.466 7.142   1.00 24.72  ? 93   HIS H ND1 1 
ATOM   7610  C CD2 . HIS E  3  93  ? 91.359  44.311 6.737   1.00 24.69  ? 93   HIS H CD2 1 
ATOM   7611  C CE1 . HIS E  3  93  ? 93.129  45.594 6.564   1.00 24.96  ? 93   HIS H CE1 1 
ATOM   7612  N NE2 . HIS E  3  93  ? 91.835  45.525 6.307   1.00 24.98  ? 93   HIS H NE2 1 
ATOM   7613  N N   . THR E  3  94  ? 94.482  39.964 7.906   1.00 21.51  ? 94   THR H N   1 
ATOM   7614  C CA  . THR E  3  94  ? 95.071  38.761 8.463   1.00 20.26  ? 94   THR H CA  1 
ATOM   7615  C C   . THR E  3  94  ? 95.792  38.942 9.786   1.00 18.69  ? 94   THR H C   1 
ATOM   7616  O O   . THR E  3  94  ? 96.515  39.916 10.002  1.00 18.67  ? 94   THR H O   1 
ATOM   7617  C CB  . THR E  3  94  ? 96.028  38.148 7.447   1.00 20.35  ? 94   THR H CB  1 
ATOM   7618  O OG1 . THR E  3  94  ? 95.273  37.625 6.343   1.00 22.07  ? 94   THR H OG1 1 
ATOM   7619  C CG2 . THR E  3  94  ? 96.775  36.955 8.045   1.00 19.93  ? 94   THR H CG2 1 
ATOM   7620  N N   . ILE E  3  95  ? 95.566  37.980 10.668  1.00 16.63  ? 95   ILE H N   1 
ATOM   7621  C CA  . ILE E  3  95  ? 96.232  37.942 11.944  1.00 15.22  ? 95   ILE H CA  1 
ATOM   7622  C C   . ILE E  3  95  ? 96.972  36.636 11.996  1.00 14.86  ? 95   ILE H C   1 
ATOM   7623  O O   . ILE E  3  95  ? 96.417  35.579 11.701  1.00 14.54  ? 95   ILE H O   1 
ATOM   7624  C CB  . ILE E  3  95  ? 95.262  37.946 13.125  1.00 14.65  ? 95   ILE H CB  1 
ATOM   7625  C CG1 . ILE E  3  95  ? 94.467  39.239 13.178  1.00 13.19  ? 95   ILE H CG1 1 
ATOM   7626  C CG2 . ILE E  3  95  ? 96.049  37.763 14.423  1.00 13.94  ? 95   ILE H CG2 1 
ATOM   7627  C CD1 . ILE E  3  95  ? 93.356  39.175 14.186  1.00 12.19  ? 95   ILE H CD1 1 
ATOM   7628  N N   . GLN E  3  96  ? 98.221  36.711 12.406  1.00 14.81  ? 96   GLN H N   1 
ATOM   7629  C CA  . GLN E  3  96  ? 99.037  35.531 12.558  1.00 14.92  ? 96   GLN H CA  1 
ATOM   7630  C C   . GLN E  3  96  ? 99.692  35.607 13.926  1.00 15.15  ? 96   GLN H C   1 
ATOM   7631  O O   . GLN E  3  96  ? 100.121 36.664 14.370  1.00 15.20  ? 96   GLN H O   1 
ATOM   7632  C CB  . GLN E  3  96  ? 100.085 35.485 11.458  1.00 14.93  ? 96   GLN H CB  1 
ATOM   7633  C CG  . GLN E  3  96  ? 99.487  35.426 10.066  1.00 14.38  ? 96   GLN H CG  1 
ATOM   7634  C CD  . GLN E  3  96  ? 100.495 35.751 9.000   1.00 14.86  ? 96   GLN H CD  1 
ATOM   7635  O OE1 . GLN E  3  96  ? 100.651 36.942 8.639   1.00 14.96  ? 96   GLN H OE1 1 
ATOM   7636  N NE2 . GLN E  3  96  ? 101.185 34.756 8.499   1.00 13.86  ? 96   GLN H NE2 1 
ATOM   7637  N N   . VAL E  3  97  ? 99.732  34.487 14.619  1.00 15.59  ? 97   VAL H N   1 
ATOM   7638  C CA  . VAL E  3  97  ? 100.370 34.460 15.915  1.00 15.35  ? 97   VAL H CA  1 
ATOM   7639  C C   . VAL E  3  97  ? 101.159 33.182 15.988  1.00 14.82  ? 97   VAL H C   1 
ATOM   7640  O O   . VAL E  3  97  ? 100.711 32.142 15.517  1.00 15.19  ? 97   VAL H O   1 
ATOM   7641  C CB  . VAL E  3  97  ? 99.332  34.579 17.070  1.00 15.58  ? 97   VAL H CB  1 
ATOM   7642  C CG1 . VAL E  3  97  ? 98.039  33.992 16.657  1.00 16.47  ? 97   VAL H CG1 1 
ATOM   7643  C CG2 . VAL E  3  97  ? 99.822  33.916 18.339  1.00 16.17  ? 97   VAL H CG2 1 
ATOM   7644  N N   . ILE E  3  98  ? 102.363 33.282 16.533  1.00 13.86  ? 98   ILE H N   1 
ATOM   7645  C CA  . ILE E  3  98  ? 103.207 32.124 16.728  1.00 12.81  ? 98   ILE H CA  1 
ATOM   7646  C C   . ILE E  3  98  ? 103.373 32.069 18.234  1.00 12.43  ? 98   ILE H C   1 
ATOM   7647  O O   . ILE E  3  98  ? 103.742 33.063 18.854  1.00 12.13  ? 98   ILE H O   1 
ATOM   7648  C CB  . ILE E  3  98  ? 104.552 32.294 16.039  1.00 12.16  ? 98   ILE H CB  1 
ATOM   7649  C CG1 . ILE E  3  98  ? 104.368 32.304 14.525  1.00 12.35  ? 98   ILE H CG1 1 
ATOM   7650  C CG2 . ILE E  3  98  ? 105.474 31.166 16.430  1.00 12.88  ? 98   ILE H CG2 1 
ATOM   7651  C CD1 . ILE E  3  98  ? 105.603 32.710 13.767  1.00 12.90  ? 98   ILE H CD1 1 
ATOM   7652  N N   . SER E  3  99  ? 103.101 30.913 18.821  1.00 11.73  ? 99   SER H N   1 
ATOM   7653  C CA  . SER E  3  99  ? 103.155 30.777 20.264  1.00 11.37  ? 99   SER H CA  1 
ATOM   7654  C C   . SER E  3  99  ? 103.710 29.427 20.657  1.00 11.36  ? 99   SER H C   1 
ATOM   7655  O O   . SER E  3  99  ? 103.262 28.398 20.158  1.00 12.21  ? 99   SER H O   1 
ATOM   7656  C CB  . SER E  3  99  ? 101.758 30.969 20.834  1.00 11.06  ? 99   SER H CB  1 
ATOM   7657  O OG  . SER E  3  99  ? 101.438 29.945 21.735  1.00 12.59  ? 99   SER H OG  1 
ATOM   7658  N N   . GLY E  3  100 ? 104.712 29.417 21.523  1.00 11.02  ? 100  GLY H N   1 
ATOM   7659  C CA  . GLY E  3  100 ? 105.278 28.151 21.930  1.00 11.67  ? 100  GLY H CA  1 
ATOM   7660  C C   . GLY E  3  100 ? 106.466 28.246 22.857  1.00 12.07  ? 100  GLY H C   1 
ATOM   7661  O O   . GLY E  3  100 ? 106.805 29.322 23.375  1.00 12.09  ? 100  GLY H O   1 
ATOM   7662  N N   . CYS E  3  101 ? 107.120 27.106 23.042  1.00 12.08  ? 101  CYS H N   1 
ATOM   7663  C CA  . CYS E  3  101 ? 108.237 27.019 23.968  1.00 12.18  ? 101  CYS H CA  1 
ATOM   7664  C C   . CYS E  3  101 ? 109.402 26.187 23.466  1.00 12.59  ? 101  CYS H C   1 
ATOM   7665  O O   . CYS E  3  101 ? 109.232 25.143 22.851  1.00 11.98  ? 101  CYS H O   1 
ATOM   7666  C CB  . CYS E  3  101 ? 107.733 26.421 25.281  1.00 12.14  ? 101  CYS H CB  1 
ATOM   7667  S SG  . CYS E  3  101 ? 106.928 24.811 25.049  1.00 10.23  ? 101  CYS H SG  1 
ATOM   7668  N N   . GLU E  3  102 ? 110.602 26.654 23.746  1.00 13.78  ? 102  GLU H N   1 
ATOM   7669  C CA  . GLU E  3  102 ? 111.793 25.908 23.361  1.00 14.95  ? 102  GLU H CA  1 
ATOM   7670  C C   . GLU E  3  102 ? 112.467 25.518 24.667  1.00 14.90  ? 102  GLU H C   1 
ATOM   7671  O O   . GLU E  3  102 ? 112.790 26.380 25.489  1.00 13.73  ? 102  GLU H O   1 
ATOM   7672  C CB  . GLU E  3  102 ? 112.713 26.762 22.484  1.00 15.40  ? 102  GLU H CB  1 
ATOM   7673  C CG  . GLU E  3  102 ? 111.953 27.733 21.587  1.00 18.15  ? 102  GLU H CG  1 
ATOM   7674  C CD  . GLU E  3  102 ? 112.864 28.581 20.716  1.00 20.50  ? 102  GLU H CD  1 
ATOM   7675  O OE1 . GLU E  3  102 ? 113.959 28.935 21.190  1.00 22.87  ? 102  GLU H OE1 1 
ATOM   7676  O OE2 . GLU E  3  102 ? 112.482 28.898 19.569  1.00 20.73  ? 102  GLU H OE2 1 
ATOM   7677  N N   . VAL E  3  103 ? 112.632 24.222 24.899  1.00 15.64  ? 103  VAL H N   1 
ATOM   7678  C CA  . VAL E  3  103 ? 113.266 23.800 26.132  1.00 16.29  ? 103  VAL H CA  1 
ATOM   7679  C C   . VAL E  3  103 ? 114.521 23.013 25.821  1.00 17.63  ? 103  VAL H C   1 
ATOM   7680  O O   . VAL E  3  103 ? 114.616 22.373 24.778  1.00 18.72  ? 103  VAL H O   1 
ATOM   7681  C CB  . VAL E  3  103 ? 112.288 23.019 27.073  1.00 16.07  ? 103  VAL H CB  1 
ATOM   7682  C CG1 . VAL E  3  103 ? 110.917 22.918 26.472  1.00 15.70  ? 103  VAL H CG1 1 
ATOM   7683  C CG2 . VAL E  3  103 ? 112.832 21.682 27.439  1.00 14.86  ? 103  VAL H CG2 1 
ATOM   7684  N N   . GLY E  3  104 ? 115.490 23.076 26.724  1.00 18.38  ? 104  GLY H N   1 
ATOM   7685  C CA  . GLY E  3  104 ? 116.749 22.398 26.511  1.00 19.02  ? 104  GLY H CA  1 
ATOM   7686  C C   . GLY E  3  104 ? 116.755 20.934 26.859  1.00 19.53  ? 104  GLY H C   1 
ATOM   7687  O O   . GLY E  3  104 ? 115.738 20.364 27.248  1.00 19.90  ? 104  GLY H O   1 
ATOM   7688  N N   . SER E  3  105 ? 117.931 20.339 26.695  1.00 20.04  ? 105  SER H N   1 
ATOM   7689  C CA  . SER E  3  105 ? 118.171 18.930 26.961  1.00 20.55  ? 105  SER H CA  1 
ATOM   7690  C C   . SER E  3  105 ? 118.102 18.652 28.450  1.00 19.80  ? 105  SER H C   1 
ATOM   7691  O O   . SER E  3  105 ? 117.988 17.509 28.873  1.00 20.39  ? 105  SER H O   1 
ATOM   7692  C CB  . SER E  3  105 ? 119.558 18.545 26.446  1.00 20.70  ? 105  SER H CB  1 
ATOM   7693  O OG  . SER E  3  105 ? 119.830 19.185 25.207  1.00 22.88  ? 105  SER H OG  1 
ATOM   7694  N N   . ASP E  3  106 ? 118.195 19.708 29.242  1.00 19.04  ? 106  ASP H N   1 
ATOM   7695  C CA  . ASP E  3  106 ? 118.124 19.575 30.687  1.00 18.40  ? 106  ASP H CA  1 
ATOM   7696  C C   . ASP E  3  106 ? 116.717 19.925 31.147  1.00 18.16  ? 106  ASP H C   1 
ATOM   7697  O O   . ASP E  3  106 ? 116.475 20.095 32.331  1.00 18.93  ? 106  ASP H O   1 
ATOM   7698  C CB  . ASP E  3  106 ? 119.147 20.488 31.348  1.00 17.77  ? 106  ASP H CB  1 
ATOM   7699  C CG  . ASP E  3  106 ? 118.941 21.915 30.991  1.00 17.24  ? 106  ASP H CG  1 
ATOM   7700  O OD1 . ASP E  3  106 ? 119.706 22.783 31.483  1.00 16.58  ? 106  ASP H OD1 1 
ATOM   7701  O OD2 . ASP E  3  106 ? 118.008 22.242 30.225  1.00 17.21  ? 106  ASP H OD2 1 
ATOM   7702  N N   . GLY E  3  107 ? 115.795 20.055 30.196  1.00 17.91  ? 107  GLY H N   1 
ATOM   7703  C CA  . GLY E  3  107 ? 114.402 20.348 30.506  1.00 17.76  ? 107  GLY H CA  1 
ATOM   7704  C C   . GLY E  3  107 ? 114.051 21.770 30.892  1.00 17.68  ? 107  GLY H C   1 
ATOM   7705  O O   . GLY E  3  107 ? 112.914 22.051 31.234  1.00 16.17  ? 107  GLY H O   1 
ATOM   7706  N N   . ARG E  3  108 ? 115.022 22.671 30.838  1.00 18.88  ? 108  ARG H N   1 
ATOM   7707  C CA  . ARG E  3  108 ? 114.781 24.059 31.200  1.00 19.71  ? 108  ARG H CA  1 
ATOM   7708  C C   . ARG E  3  108 ? 114.185 24.798 30.013  1.00 18.75  ? 108  ARG H C   1 
ATOM   7709  O O   . ARG E  3  108 ? 114.473 24.476 28.868  1.00 18.23  ? 108  ARG H O   1 
ATOM   7710  C CB  . ARG E  3  108 ? 116.086 24.722 31.611  1.00 21.18  ? 108  ARG H CB  1 
ATOM   7711  C CG  . ARG E  3  108 ? 115.924 25.887 32.560  1.00 26.43  ? 108  ARG H CG  1 
ATOM   7712  C CD  . ARG E  3  108 ? 117.215 26.653 32.753  1.00 32.45  ? 108  ARG H CD  1 
ATOM   7713  N NE  . ARG E  3  108 ? 118.357 25.746 32.749  1.00 36.67  ? 108  ARG H NE  1 
ATOM   7714  C CZ  . ARG E  3  108 ? 119.619 26.117 32.910  1.00 40.17  ? 108  ARG H CZ  1 
ATOM   7715  N NH1 . ARG E  3  108 ? 119.930 27.393 33.107  1.00 41.08  ? 108  ARG H NH1 1 
ATOM   7716  N NH2 . ARG E  3  108 ? 120.578 25.200 32.870  1.00 42.14  ? 108  ARG H NH2 1 
ATOM   7717  N N   . LEU E  3  109 ? 113.340 25.782 30.289  1.00 18.09  ? 109  LEU H N   1 
ATOM   7718  C CA  . LEU E  3  109 ? 112.728 26.565 29.235  1.00 17.22  ? 109  LEU H CA  1 
ATOM   7719  C C   . LEU E  3  109 ? 113.756 27.584 28.725  1.00 17.60  ? 109  LEU H C   1 
ATOM   7720  O O   . LEU E  3  109 ? 114.155 28.484 29.459  1.00 17.79  ? 109  LEU H O   1 
ATOM   7721  C CB  . LEU E  3  109 ? 111.490 27.280 29.776  1.00 16.45  ? 109  LEU H CB  1 
ATOM   7722  C CG  . LEU E  3  109 ? 110.692 28.167 28.822  1.00 14.25  ? 109  LEU H CG  1 
ATOM   7723  C CD1 . LEU E  3  109 ? 109.925 27.341 27.823  1.00 13.68  ? 109  LEU H CD1 1 
ATOM   7724  C CD2 . LEU E  3  109 ? 109.733 29.031 29.624  1.00 13.73  ? 109  LEU H CD2 1 
ATOM   7725  N N   . LEU E  3  110 ? 114.189 27.427 27.475  1.00 17.62  ? 110  LEU H N   1 
ATOM   7726  C CA  . LEU E  3  110 ? 115.149 28.340 26.871  1.00 17.45  ? 110  LEU H CA  1 
ATOM   7727  C C   . LEU E  3  110 ? 114.388 29.534 26.344  1.00 17.71  ? 110  LEU H C   1 
ATOM   7728  O O   . LEU E  3  110 ? 114.867 30.665 26.374  1.00 17.85  ? 110  LEU H O   1 
ATOM   7729  C CB  . LEU E  3  110 ? 115.897 27.674 25.707  1.00 16.90  ? 110  LEU H CB  1 
ATOM   7730  C CG  . LEU E  3  110 ? 116.756 26.445 26.005  1.00 17.44  ? 110  LEU H CG  1 
ATOM   7731  C CD1 . LEU E  3  110 ? 117.123 25.736 24.720  1.00 16.66  ? 110  LEU H CD1 1 
ATOM   7732  C CD2 . LEU E  3  110 ? 118.011 26.846 26.766  1.00 17.61  ? 110  LEU H CD2 1 
ATOM   7733  N N   . ARG E  3  111 ? 113.183 29.279 25.862  1.00 18.16  ? 111  ARG H N   1 
ATOM   7734  C CA  . ARG E  3  111 ? 112.397 30.339 25.272  1.00 18.73  ? 111  ARG H CA  1 
ATOM   7735  C C   . ARG E  3  111 ? 110.917 30.089 25.269  1.00 18.05  ? 111  ARG H C   1 
ATOM   7736  O O   . ARG E  3  111 ? 110.466 28.977 25.056  1.00 18.05  ? 111  ARG H O   1 
ATOM   7737  C CB  . ARG E  3  111 ? 112.850 30.575 23.839  1.00 19.17  ? 111  ARG H CB  1 
ATOM   7738  C CG  . ARG E  3  111 ? 113.855 31.689 23.716  1.00 21.89  ? 111  ARG H CG  1 
ATOM   7739  C CD  . ARG E  3  111 ? 113.207 33.028 23.460  1.00 24.52  ? 111  ARG H CD  1 
ATOM   7740  N NE  . ARG E  3  111 ? 112.349 32.990 22.277  1.00 27.12  ? 111  ARG H NE  1 
ATOM   7741  C CZ  . ARG E  3  111 ? 112.642 32.341 21.150  1.00 27.50  ? 111  ARG H CZ  1 
ATOM   7742  N NH1 . ARG E  3  111 ? 113.777 31.665 21.049  1.00 27.58  ? 111  ARG H NH1 1 
ATOM   7743  N NH2 . ARG E  3  111 ? 111.796 32.362 20.124  1.00 27.60  ? 111  ARG H NH2 1 
ATOM   7744  N N   . GLY E  3  112 ? 110.183 31.170 25.489  1.00 18.00  ? 112  GLY H N   1 
ATOM   7745  C CA  . GLY E  3  112 ? 108.737 31.166 25.480  1.00 17.63  ? 112  GLY H CA  1 
ATOM   7746  C C   . GLY E  3  112 ? 108.376 32.393 24.667  1.00 17.38  ? 112  GLY H C   1 
ATOM   7747  O O   . GLY E  3  112 ? 108.935 33.461 24.867  1.00 16.74  ? 112  GLY H O   1 
ATOM   7748  N N   . TYR E  3  113 ? 107.456 32.257 23.733  1.00 17.94  ? 113  TYR H N   1 
ATOM   7749  C CA  . TYR E  3  113 ? 107.121 33.396 22.899  1.00 18.52  ? 113  TYR H CA  1 
ATOM   7750  C C   . TYR E  3  113 ? 105.710 33.309 22.323  1.00 17.92  ? 113  TYR H C   1 
ATOM   7751  O O   . TYR E  3  113 ? 105.175 32.235 22.050  1.00 16.20  ? 113  TYR H O   1 
ATOM   7752  C CB  . TYR E  3  113 ? 108.176 33.533 21.769  1.00 19.45  ? 113  TYR H CB  1 
ATOM   7753  C CG  . TYR E  3  113 ? 108.410 32.181 21.180  1.00 21.93  ? 113  TYR H CG  1 
ATOM   7754  C CD1 . TYR E  3  113 ? 107.669 31.743 20.090  1.00 24.01  ? 113  TYR H CD1 1 
ATOM   7755  C CD2 . TYR E  3  113 ? 109.251 31.275 21.815  1.00 23.78  ? 113  TYR H CD2 1 
ATOM   7756  C CE1 . TYR E  3  113 ? 107.786 30.448 19.632  1.00 25.58  ? 113  TYR H CE1 1 
ATOM   7757  C CE2 . TYR E  3  113 ? 109.374 29.986 21.368  1.00 25.23  ? 113  TYR H CE2 1 
ATOM   7758  C CZ  . TYR E  3  113 ? 108.640 29.576 20.284  1.00 26.28  ? 113  TYR H CZ  1 
ATOM   7759  O OH  . TYR E  3  113 ? 108.773 28.281 19.860  1.00 28.42  ? 113  TYR H OH  1 
ATOM   7760  N N   . GLN E  3  114 ? 105.118 34.489 22.183  1.00 18.05  ? 114  GLN H N   1 
ATOM   7761  C CA  . GLN E  3  114 ? 103.806 34.656 21.604  1.00 18.15  ? 114  GLN H CA  1 
ATOM   7762  C C   . GLN E  3  114 ? 103.971 35.940 20.825  1.00 18.28  ? 114  GLN H C   1 
ATOM   7763  O O   . GLN E  3  114 ? 104.143 37.023 21.400  1.00 18.70  ? 114  GLN H O   1 
ATOM   7764  C CB  . GLN E  3  114 ? 102.725 34.773 22.670  1.00 18.25  ? 114  GLN H CB  1 
ATOM   7765  C CG  . GLN E  3  114 ? 101.343 34.910 22.081  1.00 18.75  ? 114  GLN H CG  1 
ATOM   7766  C CD  . GLN E  3  114 ? 100.280 34.144 22.836  1.00 19.21  ? 114  GLN H CD  1 
ATOM   7767  O OE1 . GLN E  3  114 ? 100.311 32.915 22.898  1.00 20.05  ? 114  GLN H OE1 1 
ATOM   7768  N NE2 . GLN E  3  114 ? 99.327  34.862 23.396  1.00 20.31  ? 114  GLN H NE2 1 
ATOM   7769  N N   . GLN E  3  115 ? 103.979 35.806 19.510  1.00 18.05  ? 115  GLN H N   1 
ATOM   7770  C CA  . GLN E  3  115 ? 104.178 36.940 18.639  1.00 18.12  ? 115  GLN H CA  1 
ATOM   7771  C C   . GLN E  3  115 ? 102.978 37.130 17.766  1.00 17.23  ? 115  GLN H C   1 
ATOM   7772  O O   . GLN E  3  115 ? 102.423 36.168 17.243  1.00 16.41  ? 115  GLN H O   1 
ATOM   7773  C CB  . GLN E  3  115 ? 105.375 36.695 17.736  1.00 19.28  ? 115  GLN H CB  1 
ATOM   7774  C CG  . GLN E  3  115 ? 106.671 36.442 18.461  1.00 21.31  ? 115  GLN H CG  1 
ATOM   7775  C CD  . GLN E  3  115 ? 107.701 35.868 17.525  1.00 23.96  ? 115  GLN H CD  1 
ATOM   7776  O OE1 . GLN E  3  115 ? 108.898 35.882 17.811  1.00 26.13  ? 115  GLN H OE1 1 
ATOM   7777  N NE2 . GLN E  3  115 ? 107.238 35.356 16.393  1.00 25.21  ? 115  GLN H NE2 1 
ATOM   7778  N N   . TYR E  3  116 ? 102.583 38.381 17.597  1.00 16.76  ? 116  TYR H N   1 
ATOM   7779  C CA  . TYR E  3  116 ? 101.455 38.679 16.745  1.00 16.50  ? 116  TYR H CA  1 
ATOM   7780  C C   . TYR E  3  116 ? 101.872 39.473 15.541  1.00 17.25  ? 116  TYR H C   1 
ATOM   7781  O O   . TYR E  3  116 ? 102.871 40.193 15.561  1.00 17.38  ? 116  TYR H O   1 
ATOM   7782  C CB  . TYR E  3  116 ? 100.411 39.470 17.476  1.00 15.85  ? 116  TYR H CB  1 
ATOM   7783  C CG  . TYR E  3  116 ? 99.441  38.653 18.276  1.00 13.96  ? 116  TYR H CG  1 
ATOM   7784  C CD1 . TYR E  3  116 ? 99.836  38.004 19.444  1.00 12.11  ? 116  TYR H CD1 1 
ATOM   7785  C CD2 . TYR E  3  116 ? 98.112  38.594 17.908  1.00 12.30  ? 116  TYR H CD2 1 
ATOM   7786  C CE1 . TYR E  3  116 ? 98.929  37.315 20.213  1.00 10.90  ? 116  TYR H CE1 1 
ATOM   7787  C CE2 . TYR E  3  116 ? 97.205  37.917 18.671  1.00 12.92  ? 116  TYR H CE2 1 
ATOM   7788  C CZ  . TYR E  3  116 ? 97.615  37.280 19.820  1.00 10.72  ? 116  TYR H CZ  1 
ATOM   7789  O OH  . TYR E  3  116 ? 96.679  36.597 20.548  1.00 11.71  ? 116  TYR H OH  1 
ATOM   7790  N N   . ALA E  3  117 ? 101.080 39.333 14.490  1.00 17.67  ? 117  ALA H N   1 
ATOM   7791  C CA  . ALA E  3  117 ? 101.312 40.046 13.267  1.00 17.86  ? 117  ALA H CA  1 
ATOM   7792  C C   . ALA E  3  117 ? 99.946  40.298 12.661  1.00 18.64  ? 117  ALA H C   1 
ATOM   7793  O O   . ALA E  3  117 ? 99.051  39.466 12.762  1.00 18.37  ? 117  ALA H O   1 
ATOM   7794  C CB  . ALA E  3  117 ? 102.172 39.225 12.342  1.00 17.72  ? 117  ALA H CB  1 
ATOM   7795  N N   . TYR E  3  118 ? 99.781  41.473 12.068  1.00 19.69  ? 118  TYR H N   1 
ATOM   7796  C CA  . TYR E  3  118 ? 98.545  41.831 11.400  1.00 20.56  ? 118  TYR H CA  1 
ATOM   7797  C C   . TYR E  3  118 ? 98.934  42.177 9.975   1.00 21.06  ? 118  TYR H C   1 
ATOM   7798  O O   . TYR E  3  118 ? 99.832  42.984 9.762   1.00 20.95  ? 118  TYR H O   1 
ATOM   7799  C CB  . TYR E  3  118 ? 97.907  43.026 12.082  1.00 20.37  ? 118  TYR H CB  1 
ATOM   7800  C CG  . TYR E  3  118 ? 96.614  43.511 11.463  1.00 20.38  ? 118  TYR H CG  1 
ATOM   7801  C CD1 . TYR E  3  118 ? 95.572  42.632 11.191  1.00 20.21  ? 118  TYR H CD1 1 
ATOM   7802  C CD2 . TYR E  3  118 ? 96.417  44.856 11.202  1.00 20.38  ? 118  TYR H CD2 1 
ATOM   7803  C CE1 . TYR E  3  118 ? 94.381  43.079 10.670  1.00 20.25  ? 118  TYR H CE1 1 
ATOM   7804  C CE2 . TYR E  3  118 ? 95.226  45.311 10.679  1.00 20.54  ? 118  TYR H CE2 1 
ATOM   7805  C CZ  . TYR E  3  118 ? 94.214  44.418 10.414  1.00 20.69  ? 118  TYR H CZ  1 
ATOM   7806  O OH  . TYR E  3  118 ? 93.018  44.862 9.902   1.00 21.80  ? 118  TYR H OH  1 
ATOM   7807  N N   . ASP E  3  119 ? 98.283  41.553 9.004   1.00 22.23  ? 119  ASP H N   1 
ATOM   7808  C CA  . ASP E  3  119 ? 98.610  41.789 7.593   1.00 22.76  ? 119  ASP H CA  1 
ATOM   7809  C C   . ASP E  3  119 ? 100.117 41.716 7.363   1.00 23.01  ? 119  ASP H C   1 
ATOM   7810  O O   . ASP E  3  119 ? 100.704 42.634 6.785   1.00 23.27  ? 119  ASP H O   1 
ATOM   7811  C CB  . ASP E  3  119 ? 98.098  43.158 7.131   1.00 22.82  ? 119  ASP H CB  1 
ATOM   7812  C CG  . ASP E  3  119 ? 96.590  43.225 7.051   1.00 23.09  ? 119  ASP H CG  1 
ATOM   7813  O OD1 . ASP E  3  119 ? 95.938  42.160 6.986   1.00 23.31  ? 119  ASP H OD1 1 
ATOM   7814  O OD2 . ASP E  3  119 ? 95.989  44.319 7.044   1.00 23.84  ? 119  ASP H OD2 1 
ATOM   7815  N N   . GLY E  3  120 ? 100.738 40.637 7.834   1.00 23.38  ? 120  GLY H N   1 
ATOM   7816  C CA  . GLY E  3  120 ? 102.168 40.423 7.662   1.00 23.39  ? 120  GLY H CA  1 
ATOM   7817  C C   . GLY E  3  120 ? 103.082 41.421 8.354   1.00 23.79  ? 120  GLY H C   1 
ATOM   7818  O O   . GLY E  3  120 ? 104.240 41.571 7.969   1.00 23.97  ? 120  GLY H O   1 
ATOM   7819  N N   . CYS E  3  121 ? 102.588 42.090 9.388   1.00 24.10  ? 121  CYS H N   1 
ATOM   7820  C CA  . CYS E  3  121 ? 103.401 43.072 10.095  1.00 24.34  ? 121  CYS H CA  1 
ATOM   7821  C C   . CYS E  3  121 ? 103.363 42.893 11.607  1.00 23.38  ? 121  CYS H C   1 
ATOM   7822  O O   . CYS E  3  121 ? 102.300 42.977 12.216  1.00 23.47  ? 121  CYS H O   1 
ATOM   7823  C CB  . CYS E  3  121 ? 102.932 44.479 9.737   1.00 24.70  ? 121  CYS H CB  1 
ATOM   7824  S SG  . CYS E  3  121 ? 103.040 44.852 7.971   1.00 28.29  ? 121  CYS H SG  1 
ATOM   7825  N N   . ASP E  3  122 ? 104.524 42.659 12.209  1.00 22.47  ? 122  ASP H N   1 
ATOM   7826  C CA  . ASP E  3  122 ? 104.610 42.502 13.659  1.00 22.00  ? 122  ASP H CA  1 
ATOM   7827  C C   . ASP E  3  122 ? 103.654 43.471 14.337  1.00 21.37  ? 122  ASP H C   1 
ATOM   7828  O O   . ASP E  3  122 ? 103.670 44.667 14.055  1.00 21.67  ? 122  ASP H O   1 
ATOM   7829  C CB  . ASP E  3  122 ? 106.029 42.778 14.158  1.00 22.12  ? 122  ASP H CB  1 
ATOM   7830  C CG  . ASP E  3  122 ? 107.018 41.755 13.684  1.00 22.59  ? 122  ASP H CG  1 
ATOM   7831  O OD1 . ASP E  3  122 ? 106.610 40.594 13.489  1.00 23.41  ? 122  ASP H OD1 1 
ATOM   7832  O OD2 . ASP E  3  122 ? 108.215 42.039 13.488  1.00 22.82  ? 122  ASP H OD2 1 
ATOM   7833  N N   . TYR E  3  123 ? 102.824 42.956 15.230  1.00 20.66  ? 123  TYR H N   1 
ATOM   7834  C CA  . TYR E  3  123 ? 101.859 43.779 15.938  1.00 20.34  ? 123  TYR H CA  1 
ATOM   7835  C C   . TYR E  3  123 ? 102.265 43.913 17.408  1.00 20.27  ? 123  TYR H C   1 
ATOM   7836  O O   . TYR E  3  123 ? 102.509 45.009 17.916  1.00 20.09  ? 123  TYR H O   1 
ATOM   7837  C CB  . TYR E  3  123 ? 100.465 43.157 15.803  1.00 20.34  ? 123  TYR H CB  1 
ATOM   7838  C CG  . TYR E  3  123 ? 99.388  43.925 16.528  1.00 19.78  ? 123  TYR H CG  1 
ATOM   7839  C CD1 . TYR E  3  123 ? 99.010  45.194 16.115  1.00 19.11  ? 123  TYR H CD1 1 
ATOM   7840  C CD2 . TYR E  3  123 ? 98.762  43.386 17.641  1.00 19.42  ? 123  TYR H CD2 1 
ATOM   7841  C CE1 . TYR E  3  123 ? 98.025  45.898 16.795  1.00 19.44  ? 123  TYR H CE1 1 
ATOM   7842  C CE2 . TYR E  3  123 ? 97.792  44.083 18.323  1.00 19.45  ? 123  TYR H CE2 1 
ATOM   7843  C CZ  . TYR E  3  123 ? 97.425  45.336 17.897  1.00 18.92  ? 123  TYR H CZ  1 
ATOM   7844  O OH  . TYR E  3  123 ? 96.461  46.021 18.586  1.00 19.43  ? 123  TYR H OH  1 
ATOM   7845  N N   . ILE E  3  124 ? 102.351 42.789 18.096  1.00 20.31  ? 124  ILE H N   1 
ATOM   7846  C CA  . ILE E  3  124 ? 102.765 42.807 19.486  1.00 20.54  ? 124  ILE H CA  1 
ATOM   7847  C C   . ILE E  3  124 ? 103.588 41.563 19.724  1.00 20.25  ? 124  ILE H C   1 
ATOM   7848  O O   . ILE E  3  124 ? 103.675 40.710 18.853  1.00 20.45  ? 124  ILE H O   1 
ATOM   7849  C CB  . ILE E  3  124 ? 101.550 42.879 20.425  1.00 20.72  ? 124  ILE H CB  1 
ATOM   7850  C CG1 . ILE E  3  124 ? 102.012 43.148 21.859  1.00 21.53  ? 124  ILE H CG1 1 
ATOM   7851  C CG2 . ILE E  3  124 ? 100.708 41.618 20.293  1.00 20.60  ? 124  ILE H CG2 1 
ATOM   7852  C CD1 . ILE E  3  124 ? 100.878 43.585 22.799  1.00 22.94  ? 124  ILE H CD1 1 
ATOM   7853  N N   . ALA E  3  125 ? 104.206 41.458 20.891  1.00 20.28  ? 125  ALA H N   1 
ATOM   7854  C CA  . ALA E  3  125 ? 105.025 40.303 21.183  1.00 19.82  ? 125  ALA H CA  1 
ATOM   7855  C C   . ALA E  3  125 ? 105.493 40.299 22.633  1.00 20.17  ? 125  ALA H C   1 
ATOM   7856  O O   . ALA E  3  125 ? 105.803 41.345 23.200  1.00 19.55  ? 125  ALA H O   1 
ATOM   7857  C CB  . ALA E  3  125 ? 106.213 40.276 20.240  1.00 19.70  ? 125  ALA H CB  1 
ATOM   7858  N N   . LEU E  3  126 ? 105.556 39.105 23.220  1.00 20.71  ? 126  LEU H N   1 
ATOM   7859  C CA  . LEU E  3  126 ? 105.974 38.943 24.607  1.00 20.91  ? 126  LEU H CA  1 
ATOM   7860  C C   . LEU E  3  126 ? 107.488 38.960 24.781  1.00 21.97  ? 126  LEU H C   1 
ATOM   7861  O O   . LEU E  3  126 ? 108.187 38.071 24.291  1.00 22.04  ? 126  LEU H O   1 
ATOM   7862  C CB  . LEU E  3  126 ? 105.429 37.629 25.158  1.00 20.35  ? 126  LEU H CB  1 
ATOM   7863  C CG  . LEU E  3  126 ? 105.775 37.353 26.623  1.00 18.74  ? 126  LEU H CG  1 
ATOM   7864  C CD1 . LEU E  3  126 ? 104.855 38.149 27.546  1.00 17.15  ? 126  LEU H CD1 1 
ATOM   7865  C CD2 . LEU E  3  126 ? 105.667 35.860 26.907  1.00 17.08  ? 126  LEU H CD2 1 
ATOM   7866  N N   . ASN E  3  127 ? 107.993 39.959 25.503  1.00 22.94  ? 127  ASN H N   1 
ATOM   7867  C CA  . ASN E  3  127 ? 109.428 40.044 25.760  1.00 23.89  ? 127  ASN H CA  1 
ATOM   7868  C C   . ASN E  3  127 ? 109.910 38.727 26.386  1.00 24.28  ? 127  ASN H C   1 
ATOM   7869  O O   . ASN E  3  127 ? 109.103 37.940 26.878  1.00 24.25  ? 127  ASN H O   1 
ATOM   7870  C CB  . ASN E  3  127 ? 109.743 41.230 26.673  1.00 24.20  ? 127  ASN H CB  1 
ATOM   7871  C CG  . ASN E  3  127 ? 109.409 42.574 26.035  1.00 24.81  ? 127  ASN H CG  1 
ATOM   7872  O OD1 . ASN E  3  127 ? 109.294 43.585 26.726  1.00 25.65  ? 127  ASN H OD1 1 
ATOM   7873  N ND2 . ASN E  3  127 ? 109.255 42.591 24.715  1.00 25.71  ? 127  ASN H ND2 1 
ATOM   7874  N N   . GLU E  3  128 ? 111.217 38.488 26.365  1.00 24.74  ? 128  GLU H N   1 
ATOM   7875  C CA  . GLU E  3  128 ? 111.784 37.248 26.891  1.00 25.39  ? 128  GLU H CA  1 
ATOM   7876  C C   . GLU E  3  128 ? 111.727 37.165 28.423  1.00 24.84  ? 128  GLU H C   1 
ATOM   7877  O O   . GLU E  3  128 ? 112.090 36.146 29.014  1.00 24.75  ? 128  GLU H O   1 
ATOM   7878  C CB  . GLU E  3  128 ? 113.222 37.070 26.379  1.00 26.20  ? 128  GLU H CB  1 
ATOM   7879  C CG  . GLU E  3  128 ? 113.334 37.121 24.851  1.00 28.64  ? 128  GLU H CG  1 
ATOM   7880  C CD  . GLU E  3  128 ? 114.709 36.714 24.315  1.00 31.62  ? 128  GLU H CD  1 
ATOM   7881  O OE1 . GLU E  3  128 ? 114.901 35.523 23.971  1.00 33.13  ? 128  GLU H OE1 1 
ATOM   7882  O OE2 . GLU E  3  128 ? 115.600 37.585 24.210  1.00 32.81  ? 128  GLU H OE2 1 
ATOM   7883  N N   . ASP E  3  129 ? 111.254 38.236 29.053  1.00 24.18  ? 129  ASP H N   1 
ATOM   7884  C CA  . ASP E  3  129 ? 111.110 38.283 30.497  1.00 23.64  ? 129  ASP H CA  1 
ATOM   7885  C C   . ASP E  3  129 ? 109.768 37.645 30.831  1.00 22.96  ? 129  ASP H C   1 
ATOM   7886  O O   . ASP E  3  129 ? 109.423 37.461 31.997  1.00 22.86  ? 129  ASP H O   1 
ATOM   7887  C CB  . ASP E  3  129 ? 111.118 39.728 30.973  1.00 23.79  ? 129  ASP H CB  1 
ATOM   7888  C CG  . ASP E  3  129 ? 109.809 40.416 30.721  1.00 25.37  ? 129  ASP H CG  1 
ATOM   7889  O OD1 . ASP E  3  129 ? 109.227 40.226 29.628  1.00 25.82  ? 129  ASP H OD1 1 
ATOM   7890  O OD2 . ASP E  3  129 ? 109.286 41.152 31.583  1.00 28.49  ? 129  ASP H OD2 1 
ATOM   7891  N N   . LEU E  3  130 ? 109.009 37.332 29.784  1.00 22.40  ? 130  LEU H N   1 
ATOM   7892  C CA  . LEU E  3  130 ? 107.688 36.709 29.908  1.00 22.03  ? 130  LEU H CA  1 
ATOM   7893  C C   . LEU E  3  130 ? 106.822 37.475 30.886  1.00 22.22  ? 130  LEU H C   1 
ATOM   7894  O O   . LEU E  3  130 ? 105.921 36.912 31.494  1.00 21.81  ? 130  LEU H O   1 
ATOM   7895  C CB  . LEU E  3  130 ? 107.800 35.239 30.351  1.00 21.66  ? 130  LEU H CB  1 
ATOM   7896  C CG  . LEU E  3  130 ? 108.751 34.328 29.561  1.00 20.75  ? 130  LEU H CG  1 
ATOM   7897  C CD1 . LEU E  3  130 ? 108.729 32.934 30.156  1.00 19.85  ? 130  LEU H CD1 1 
ATOM   7898  C CD2 . LEU E  3  130 ? 108.377 34.283 28.082  1.00 20.05  ? 130  LEU H CD2 1 
ATOM   7899  N N   . LYS E  3  131 ? 107.114 38.759 31.047  1.00 23.24  ? 131  LYS H N   1 
ATOM   7900  C CA  . LYS E  3  131 ? 106.344 39.606 31.943  1.00 24.12  ? 131  LYS H CA  1 
ATOM   7901  C C   . LYS E  3  131 ? 105.805 40.852 31.254  1.00 24.02  ? 131  LYS H C   1 
ATOM   7902  O O   . LYS E  3  131 ? 104.806 41.406 31.700  1.00 23.41  ? 131  LYS H O   1 
ATOM   7903  C CB  . LYS E  3  131 ? 107.175 40.005 33.159  1.00 25.10  ? 131  LYS H CB  1 
ATOM   7904  C CG  . LYS E  3  131 ? 107.732 38.813 33.933  1.00 27.31  ? 131  LYS H CG  1 
ATOM   7905  C CD  . LYS E  3  131 ? 108.165 39.199 35.335  1.00 30.37  ? 131  LYS H CD  1 
ATOM   7906  C CE  . LYS E  3  131 ? 109.251 38.261 35.854  1.00 32.43  ? 131  LYS H CE  1 
ATOM   7907  N NZ  . LYS E  3  131 ? 109.430 38.360 37.336  1.00 34.17  ? 131  LYS H NZ  1 
ATOM   7908  N N   . THR E  3  132 ? 106.455 41.299 30.176  1.00 24.47  ? 132  THR H N   1 
ATOM   7909  C CA  . THR E  3  132 ? 105.976 42.481 29.448  1.00 25.19  ? 132  THR H CA  1 
ATOM   7910  C C   . THR E  3  132 ? 105.933 42.331 27.943  1.00 25.56  ? 132  THR H C   1 
ATOM   7911  O O   . THR E  3  132 ? 106.585 41.473 27.354  1.00 25.81  ? 132  THR H O   1 
ATOM   7912  C CB  . THR E  3  132 ? 106.806 43.733 29.741  1.00 25.21  ? 132  THR H CB  1 
ATOM   7913  O OG1 . THR E  3  132 ? 108.204 43.453 29.563  1.00 26.42  ? 132  THR H OG1 1 
ATOM   7914  C CG2 . THR E  3  132 ? 106.593 44.192 31.175  1.00 25.58  ? 132  THR H CG2 1 
ATOM   7915  N N   . TRP E  3  133 ? 105.179 43.232 27.330  1.00 25.89  ? 133  TRP H N   1 
ATOM   7916  C CA  . TRP E  3  133 ? 105.001 43.243 25.897  1.00 26.14  ? 133  TRP H CA  1 
ATOM   7917  C C   . TRP E  3  133 ? 105.722 44.392 25.207  1.00 26.91  ? 133  TRP H C   1 
ATOM   7918  O O   . TRP E  3  133 ? 106.044 45.408 25.822  1.00 27.06  ? 133  TRP H O   1 
ATOM   7919  C CB  . TRP E  3  133 ? 103.522 43.367 25.590  1.00 25.79  ? 133  TRP H CB  1 
ATOM   7920  C CG  . TRP E  3  133 ? 102.651 42.553 26.457  1.00 24.23  ? 133  TRP H CG  1 
ATOM   7921  C CD1 . TRP E  3  133 ? 102.059 42.939 27.610  1.00 23.76  ? 133  TRP H CD1 1 
ATOM   7922  C CD2 . TRP E  3  133 ? 102.235 41.207 26.219  1.00 23.57  ? 133  TRP H CD2 1 
ATOM   7923  N NE1 . TRP E  3  133 ? 101.298 41.914 28.123  1.00 23.80  ? 133  TRP H NE1 1 
ATOM   7924  C CE2 . TRP E  3  133 ? 101.386 40.837 27.280  1.00 23.87  ? 133  TRP H CE2 1 
ATOM   7925  C CE3 . TRP E  3  133 ? 102.494 40.274 25.211  1.00 22.52  ? 133  TRP H CE3 1 
ATOM   7926  C CZ2 . TRP E  3  133 ? 100.793 39.576 27.361  1.00 23.68  ? 133  TRP H CZ2 1 
ATOM   7927  C CZ3 . TRP E  3  133 ? 101.907 39.028 25.291  1.00 23.29  ? 133  TRP H CZ3 1 
ATOM   7928  C CH2 . TRP E  3  133 ? 101.072 38.687 26.360  1.00 23.69  ? 133  TRP H CH2 1 
ATOM   7929  N N   . THR E  3  134 ? 105.956 44.219 23.911  1.00 27.89  ? 134  THR H N   1 
ATOM   7930  C CA  . THR E  3  134 ? 106.570 45.249 23.090  1.00 28.51  ? 134  THR H CA  1 
ATOM   7931  C C   . THR E  3  134 ? 105.626 45.512 21.940  1.00 29.38  ? 134  THR H C   1 
ATOM   7932  O O   . THR E  3  134 ? 105.549 44.726 21.001  1.00 29.47  ? 134  THR H O   1 
ATOM   7933  C CB  . THR E  3  134 ? 107.934 44.815 22.535  1.00 28.31  ? 134  THR H CB  1 
ATOM   7934  O OG1 . THR E  3  134 ? 108.940 44.954 23.546  1.00 28.02  ? 134  THR H OG1 1 
ATOM   7935  C CG2 . THR E  3  134 ? 108.372 45.745 21.391  1.00 27.81  ? 134  THR H CG2 1 
ATOM   7936  N N   . ALA E  3  135 ? 104.883 46.605 22.028  1.00 30.79  ? 135  ALA H N   1 
ATOM   7937  C CA  . ALA E  3  135 ? 103.959 46.965 20.970  1.00 31.92  ? 135  ALA H CA  1 
ATOM   7938  C C   . ALA E  3  135 ? 104.795 47.372 19.755  1.00 33.22  ? 135  ALA H C   1 
ATOM   7939  O O   . ALA E  3  135 ? 105.957 47.740 19.895  1.00 33.16  ? 135  ALA H O   1 
ATOM   7940  C CB  . ALA E  3  135 ? 103.065 48.105 21.423  1.00 31.36  ? 135  ALA H CB  1 
ATOM   7941  N N   . ALA E  3  136 ? 104.222 47.277 18.563  1.00 34.70  ? 136  ALA H N   1 
ATOM   7942  C CA  . ALA E  3  136 ? 104.940 47.677 17.366  1.00 35.89  ? 136  ALA H CA  1 
ATOM   7943  C C   . ALA E  3  136 ? 104.536 49.109 17.032  1.00 36.78  ? 136  ALA H C   1 
ATOM   7944  O O   . ALA E  3  136 ? 105.383 49.982 16.861  1.00 36.85  ? 136  ALA H O   1 
ATOM   7945  C CB  . ALA E  3  136 ? 104.619 46.747 16.210  1.00 35.94  ? 136  ALA H CB  1 
ATOM   7946  N N   . ASP E  3  137 ? 103.233 49.347 16.947  1.00 37.75  ? 137  ASP H N   1 
ATOM   7947  C CA  . ASP E  3  137 ? 102.729 50.678 16.627  1.00 38.44  ? 137  ASP H CA  1 
ATOM   7948  C C   . ASP E  3  137 ? 101.739 51.163 17.674  1.00 39.05  ? 137  ASP H C   1 
ATOM   7949  O O   . ASP E  3  137 ? 101.436 50.449 18.625  1.00 39.24  ? 137  ASP H O   1 
ATOM   7950  C CB  . ASP E  3  137 ? 102.078 50.687 15.247  1.00 38.15  ? 137  ASP H CB  1 
ATOM   7951  C CG  . ASP E  3  137 ? 100.993 49.646 15.101  1.00 38.10  ? 137  ASP H CG  1 
ATOM   7952  O OD1 . ASP E  3  137 ? 100.133 49.532 16.002  1.00 38.08  ? 137  ASP H OD1 1 
ATOM   7953  O OD2 . ASP E  3  137 ? 100.938 48.906 14.096  1.00 37.76  ? 137  ASP H OD2 1 
ATOM   7954  N N   . MET E  3  138 ? 101.234 52.380 17.483  1.00 39.87  ? 138  MET H N   1 
ATOM   7955  C CA  . MET E  3  138 ? 100.278 52.993 18.407  1.00 40.22  ? 138  MET H CA  1 
ATOM   7956  C C   . MET E  3  138 ? 98.995  52.186 18.612  1.00 39.37  ? 138  MET H C   1 
ATOM   7957  O O   . MET E  3  138 ? 98.262  52.425 19.570  1.00 39.92  ? 138  MET H O   1 
ATOM   7958  C CB  . MET E  3  138 ? 99.924  54.409 17.945  1.00 41.00  ? 138  MET H CB  1 
ATOM   7959  C CG  . MET E  3  138 ? 100.950 55.456 18.362  1.00 43.23  ? 138  MET H CG  1 
ATOM   7960  S SD  . MET E  3  138 ? 100.452 57.171 18.016  1.00 46.34  ? 138  MET H SD  1 
ATOM   7961  C CE  . MET E  3  138 ? 101.659 57.622 16.737  1.00 47.01  ? 138  MET H CE  1 
ATOM   7962  N N   . ALA E  3  139 ? 98.701  51.250 17.719  1.00 37.88  ? 139  ALA H N   1 
ATOM   7963  C CA  . ALA E  3  139 ? 97.512  50.430 17.896  1.00 36.66  ? 139  ALA H CA  1 
ATOM   7964  C C   . ALA E  3  139 ? 97.878  49.344 18.895  1.00 35.63  ? 139  ALA H C   1 
ATOM   7965  O O   . ALA E  3  139 ? 97.084  48.979 19.757  1.00 35.64  ? 139  ALA H O   1 
ATOM   7966  C CB  . ALA E  3  139 ? 97.068  49.819 16.581  1.00 36.27  ? 139  ALA H CB  1 
ATOM   7967  N N   . ALA E  3  140 ? 99.107  48.851 18.778  1.00 34.39  ? 140  ALA H N   1 
ATOM   7968  C CA  . ALA E  3  140 ? 99.609  47.795 19.645  1.00 33.39  ? 140  ALA H CA  1 
ATOM   7969  C C   . ALA E  3  140 ? 99.711  48.243 21.100  1.00 32.43  ? 140  ALA H C   1 
ATOM   7970  O O   . ALA E  3  140 ? 99.795  47.419 22.005  1.00 31.49  ? 140  ALA H O   1 
ATOM   7971  C CB  . ALA E  3  140 ? 100.954 47.314 19.144  1.00 33.49  ? 140  ALA H CB  1 
ATOM   7972  N N   . LEU E  3  141 ? 99.701  49.551 21.321  1.00 31.98  ? 141  LEU H N   1 
ATOM   7973  C CA  . LEU E  3  141 ? 99.766  50.085 22.672  1.00 31.66  ? 141  LEU H CA  1 
ATOM   7974  C C   . LEU E  3  141 ? 98.452  49.835 23.372  1.00 31.37  ? 141  LEU H C   1 
ATOM   7975  O O   . LEU E  3  141 ? 98.422  49.502 24.554  1.00 31.37  ? 141  LEU H O   1 
ATOM   7976  C CB  . LEU E  3  141 ? 100.024 51.585 22.654  1.00 31.53  ? 141  LEU H CB  1 
ATOM   7977  C CG  . LEU E  3  141 ? 101.445 52.006 22.332  1.00 31.61  ? 141  LEU H CG  1 
ATOM   7978  C CD1 . LEU E  3  141 ? 101.526 53.528 22.342  1.00 31.18  ? 141  LEU H CD1 1 
ATOM   7979  C CD2 . LEU E  3  141 ? 102.396 51.394 23.346  1.00 31.67  ? 141  LEU H CD2 1 
ATOM   7980  N N   . ILE E  3  142 ? 97.364  50.016 22.630  1.00 31.10  ? 142  ILE H N   1 
ATOM   7981  C CA  . ILE E  3  142 ? 96.026  49.834 23.179  1.00 30.93  ? 142  ILE H CA  1 
ATOM   7982  C C   . ILE E  3  142 ? 95.863  48.436 23.729  1.00 30.71  ? 142  ILE H C   1 
ATOM   7983  O O   . ILE E  3  142 ? 95.234  48.242 24.767  1.00 30.98  ? 142  ILE H O   1 
ATOM   7984  C CB  . ILE E  3  142 ? 94.947  50.081 22.119  1.00 30.67  ? 142  ILE H CB  1 
ATOM   7985  C CG1 . ILE E  3  142 ? 95.041  51.507 21.599  1.00 30.95  ? 142  ILE H CG1 1 
ATOM   7986  C CG2 . ILE E  3  142 ? 93.576  49.859 22.719  1.00 30.75  ? 142  ILE H CG2 1 
ATOM   7987  C CD1 . ILE E  3  142 ? 93.959  51.856 20.605  1.00 31.84  ? 142  ILE H CD1 1 
ATOM   7988  N N   . THR E  3  143 ? 96.423  47.460 23.022  1.00 30.36  ? 143  THR H N   1 
ATOM   7989  C CA  . THR E  3  143 ? 96.338  46.071 23.452  1.00 30.07  ? 143  THR H CA  1 
ATOM   7990  C C   . THR E  3  143 ? 97.322  45.798 24.575  1.00 29.55  ? 143  THR H C   1 
ATOM   7991  O O   . THR E  3  143 ? 97.035  45.032 25.490  1.00 29.58  ? 143  THR H O   1 
ATOM   7992  C CB  . THR E  3  143 ? 96.646  45.127 22.292  1.00 30.13  ? 143  THR H CB  1 
ATOM   7993  O OG1 . THR E  3  143 ? 95.595  45.189 21.322  1.00 30.24  ? 143  THR H OG1 1 
ATOM   7994  C CG2 . THR E  3  143 ? 96.689  43.687 22.780  1.00 30.48  ? 143  THR H CG2 1 
ATOM   7995  N N   . LYS E  3  144 ? 98.487  46.421 24.500  1.00 28.99  ? 144  LYS H N   1 
ATOM   7996  C CA  . LYS E  3  144 ? 99.496  46.211 25.516  1.00 29.08  ? 144  LYS H CA  1 
ATOM   7997  C C   . LYS E  3  144 ? 98.894  46.522 26.882  1.00 29.35  ? 144  LYS H C   1 
ATOM   7998  O O   . LYS E  3  144 ? 98.859  45.670 27.760  1.00 29.89  ? 144  LYS H O   1 
ATOM   7999  C CB  . LYS E  3  144 ? 100.720 47.084 25.235  1.00 28.68  ? 144  LYS H CB  1 
ATOM   8000  C CG  . LYS E  3  144 ? 101.849 46.940 26.246  1.00 28.48  ? 144  LYS H CG  1 
ATOM   8001  C CD  . LYS E  3  144 ? 102.984 47.890 25.911  1.00 28.73  ? 144  LYS H CD  1 
ATOM   8002  C CE  . LYS E  3  144 ? 103.916 48.129 27.093  1.00 30.00  ? 144  LYS H CE  1 
ATOM   8003  N NZ  . LYS E  3  144 ? 104.939 47.053 27.288  1.00 30.72  ? 144  LYS H NZ  1 
ATOM   8004  N N   . HIS E  3  145 ? 98.393  47.740 27.043  1.00 29.62  ? 145  HIS H N   1 
ATOM   8005  C CA  . HIS E  3  145 ? 97.800  48.177 28.302  1.00 29.51  ? 145  HIS H CA  1 
ATOM   8006  C C   . HIS E  3  145 ? 96.574  47.354 28.665  1.00 28.77  ? 145  HIS H C   1 
ATOM   8007  O O   . HIS E  3  145 ? 96.356  47.021 29.822  1.00 28.58  ? 145  HIS H O   1 
ATOM   8008  C CB  . HIS E  3  145 ? 97.437  49.659 28.206  1.00 29.91  ? 145  HIS H CB  1 
ATOM   8009  C CG  . HIS E  3  145 ? 98.557  50.505 27.689  1.00 31.00  ? 145  HIS H CG  1 
ATOM   8010  N ND1 . HIS E  3  145 ? 99.797  50.541 28.289  1.00 31.82  ? 145  HIS H ND1 1 
ATOM   8011  C CD2 . HIS E  3  145 ? 98.641  51.314 26.605  1.00 32.42  ? 145  HIS H CD2 1 
ATOM   8012  C CE1 . HIS E  3  145 ? 100.594 51.341 27.604  1.00 32.08  ? 145  HIS H CE1 1 
ATOM   8013  N NE2 . HIS E  3  145 ? 99.917  51.823 26.577  1.00 32.69  ? 145  HIS H NE2 1 
ATOM   8014  N N   . LYS E  3  146 ? 95.767  47.019 27.673  1.00 28.14  ? 146  LYS H N   1 
ATOM   8015  C CA  . LYS E  3  146 ? 94.580  46.238 27.949  1.00 27.81  ? 146  LYS H CA  1 
ATOM   8016  C C   . LYS E  3  146 ? 94.966  44.836 28.433  1.00 27.91  ? 146  LYS H C   1 
ATOM   8017  O O   . LYS E  3  146 ? 94.340  44.286 29.337  1.00 28.24  ? 146  LYS H O   1 
ATOM   8018  C CB  . LYS E  3  146 ? 93.693  46.161 26.715  1.00 27.58  ? 146  LYS H CB  1 
ATOM   8019  C CG  . LYS E  3  146 ? 92.484  45.284 26.930  1.00 26.76  ? 146  LYS H CG  1 
ATOM   8020  C CD  . LYS E  3  146 ? 91.355  45.599 25.985  1.00 26.25  ? 146  LYS H CD  1 
ATOM   8021  C CE  . LYS E  3  146 ? 91.644  45.147 24.582  1.00 25.79  ? 146  LYS H CE  1 
ATOM   8022  N NZ  . LYS E  3  146 ? 90.360  45.110 23.813  1.00 26.11  ? 146  LYS H NZ  1 
ATOM   8023  N N   . TRP E  3  147 ? 96.000  44.252 27.845  1.00 27.61  ? 147  TRP H N   1 
ATOM   8024  C CA  . TRP E  3  147 ? 96.418  42.932 28.285  1.00 27.50  ? 147  TRP H CA  1 
ATOM   8025  C C   . TRP E  3  147 ? 97.049  43.042 29.656  1.00 27.54  ? 147  TRP H C   1 
ATOM   8026  O O   . TRP E  3  147 ? 96.971  42.118 30.461  1.00 27.67  ? 147  TRP H O   1 
ATOM   8027  C CB  . TRP E  3  147 ? 97.395  42.297 27.300  1.00 27.62  ? 147  TRP H CB  1 
ATOM   8028  C CG  . TRP E  3  147 ? 96.725  41.731 26.088  1.00 26.49  ? 147  TRP H CG  1 
ATOM   8029  C CD1 . TRP E  3  147 ? 95.392  41.782 25.785  1.00 26.85  ? 147  TRP H CD1 1 
ATOM   8030  C CD2 . TRP E  3  147 ? 97.354  41.040 25.006  1.00 26.10  ? 147  TRP H CD2 1 
ATOM   8031  N NE1 . TRP E  3  147 ? 95.154  41.166 24.579  1.00 26.30  ? 147  TRP H NE1 1 
ATOM   8032  C CE2 . TRP E  3  147 ? 96.342  40.699 24.079  1.00 25.96  ? 147  TRP H CE2 1 
ATOM   8033  C CE3 . TRP E  3  147 ? 98.675  40.676 24.719  1.00 25.70  ? 147  TRP H CE3 1 
ATOM   8034  C CZ2 . TRP E  3  147 ? 96.610  40.015 22.896  1.00 24.60  ? 147  TRP H CZ2 1 
ATOM   8035  C CZ3 . TRP E  3  147 ? 98.939  39.992 23.538  1.00 24.89  ? 147  TRP H CZ3 1 
ATOM   8036  C CH2 . TRP E  3  147 ? 97.911  39.672 22.643  1.00 24.54  ? 147  TRP H CH2 1 
ATOM   8037  N N   . GLU E  3  148 ? 97.677  44.179 29.925  1.00 27.51  ? 148  GLU H N   1 
ATOM   8038  C CA  . GLU E  3  148 ? 98.287  44.396 31.226  1.00 27.53  ? 148  GLU H CA  1 
ATOM   8039  C C   . GLU E  3  148 ? 97.173  44.633 32.243  1.00 27.34  ? 148  GLU H C   1 
ATOM   8040  O O   . GLU E  3  148 ? 97.360  44.417 33.437  1.00 27.59  ? 148  GLU H O   1 
ATOM   8041  C CB  . GLU E  3  148 ? 99.240  45.592 31.196  1.00 27.48  ? 148  GLU H CB  1 
ATOM   8042  C CG  . GLU E  3  148 ? 100.360 45.470 30.176  1.00 28.26  ? 148  GLU H CG  1 
ATOM   8043  C CD  . GLU E  3  148 ? 101.150 46.761 30.004  1.00 28.47  ? 148  GLU H CD  1 
ATOM   8044  O OE1 . GLU E  3  148 ? 100.547 47.851 30.081  1.00 28.70  ? 148  GLU H OE1 1 
ATOM   8045  O OE2 . GLU E  3  148 ? 102.372 46.685 29.778  1.00 28.84  ? 148  GLU H OE2 1 
ATOM   8046  N N   . GLN E  3  149 ? 96.012  45.073 31.763  1.00 26.87  ? 149  GLN H N   1 
ATOM   8047  C CA  . GLN E  3  149 ? 94.873  45.346 32.636  1.00 26.85  ? 149  GLN H CA  1 
ATOM   8048  C C   . GLN E  3  149 ? 94.150  44.077 33.083  1.00 26.26  ? 149  GLN H C   1 
ATOM   8049  O O   . GLN E  3  149 ? 93.392  44.095 34.056  1.00 26.64  ? 149  GLN H O   1 
ATOM   8050  C CB  . GLN E  3  149 ? 93.865  46.269 31.941  1.00 27.09  ? 149  GLN H CB  1 
ATOM   8051  C CG  . GLN E  3  149 ? 94.278  47.736 31.844  1.00 27.95  ? 149  GLN H CG  1 
ATOM   8052  C CD  . GLN E  3  149 ? 93.168  48.615 31.263  1.00 29.12  ? 149  GLN H CD  1 
ATOM   8053  O OE1 . GLN E  3  149 ? 92.921  48.618 30.049  1.00 28.67  ? 149  GLN H OE1 1 
ATOM   8054  N NE2 . GLN E  3  149 ? 92.491  49.350 32.133  1.00 29.77  ? 149  GLN H NE2 1 
ATOM   8055  N N   . ALA E  3  150 ? 94.365  42.981 32.365  1.00 25.48  ? 150  ALA H N   1 
ATOM   8056  C CA  . ALA E  3  150 ? 93.720  41.718 32.708  1.00 24.34  ? 150  ALA H CA  1 
ATOM   8057  C C   . ALA E  3  150 ? 94.765  40.705 33.137  1.00 23.43  ? 150  ALA H C   1 
ATOM   8058  O O   . ALA E  3  150 ? 94.495  39.508 33.180  1.00 22.86  ? 150  ALA H O   1 
ATOM   8059  C CB  . ALA E  3  150 ? 92.932  41.192 31.528  1.00 24.64  ? 150  ALA H CB  1 
ATOM   8060  N N   . GLY E  3  151 ? 95.962  41.195 33.455  1.00 22.72  ? 151  GLY H N   1 
ATOM   8061  C CA  . GLY E  3  151 ? 97.058  40.335 33.871  1.00 22.42  ? 151  GLY H CA  1 
ATOM   8062  C C   . GLY E  3  151 ? 97.288  39.142 32.950  1.00 21.98  ? 151  GLY H C   1 
ATOM   8063  O O   . GLY E  3  151 ? 97.626  38.057 33.401  1.00 21.95  ? 151  GLY H O   1 
ATOM   8064  N N   . GLU E  3  152 ? 97.102  39.347 31.656  1.00 21.42  ? 152  GLU H N   1 
ATOM   8065  C CA  . GLU E  3  152 ? 97.280  38.293 30.671  1.00 21.37  ? 152  GLU H CA  1 
ATOM   8066  C C   . GLU E  3  152 ? 98.703  37.758 30.698  1.00 20.70  ? 152  GLU H C   1 
ATOM   8067  O O   . GLU E  3  152 ? 98.928  36.571 30.549  1.00 20.47  ? 152  GLU H O   1 
ATOM   8068  C CB  . GLU E  3  152 ? 96.957  38.838 29.280  1.00 21.63  ? 152  GLU H CB  1 
ATOM   8069  C CG  . GLU E  3  152 ? 97.292  37.901 28.132  1.00 23.05  ? 152  GLU H CG  1 
ATOM   8070  C CD  . GLU E  3  152 ? 96.390  36.686 28.071  1.00 23.95  ? 152  GLU H CD  1 
ATOM   8071  O OE1 . GLU E  3  152 ? 95.250  36.748 28.589  1.00 23.93  ? 152  GLU H OE1 1 
ATOM   8072  O OE2 . GLU E  3  152 ? 96.826  35.669 27.495  1.00 23.42  ? 152  GLU H OE2 1 
ATOM   8073  N N   . ALA E  3  153 ? 99.667  38.643 30.898  1.00 20.37  ? 153  ALA H N   1 
ATOM   8074  C CA  . ALA E  3  153 ? 101.064 38.236 30.918  1.00 19.87  ? 153  ALA H CA  1 
ATOM   8075  C C   . ALA E  3  153 ? 101.304 37.095 31.897  1.00 19.34  ? 153  ALA H C   1 
ATOM   8076  O O   . ALA E  3  153 ? 102.019 36.141 31.577  1.00 19.27  ? 153  ALA H O   1 
ATOM   8077  C CB  . ALA E  3  153 ? 101.952 39.416 31.263  1.00 19.78  ? 153  ALA H CB  1 
ATOM   8078  N N   . GLU E  3  154 ? 100.718 37.205 33.087  1.00 18.71  ? 154  GLU H N   1 
ATOM   8079  C CA  . GLU E  3  154 ? 100.881 36.194 34.126  1.00 18.33  ? 154  GLU H CA  1 
ATOM   8080  C C   . GLU E  3  154 ? 100.389 34.835 33.639  1.00 17.76  ? 154  GLU H C   1 
ATOM   8081  O O   . GLU E  3  154 ? 101.070 33.817 33.778  1.00 17.16  ? 154  GLU H O   1 
ATOM   8082  C CB  . GLU E  3  154 ? 100.102 36.579 35.381  1.00 18.56  ? 154  GLU H CB  1 
ATOM   8083  C CG  . GLU E  3  154 ? 100.391 35.691 36.577  1.00 20.45  ? 154  GLU H CG  1 
ATOM   8084  C CD  . GLU E  3  154 ? 99.234  35.620 37.566  1.00 22.78  ? 154  GLU H CD  1 
ATOM   8085  O OE1 . GLU E  3  154 ? 98.424  36.575 37.622  1.00 24.37  ? 154  GLU H OE1 1 
ATOM   8086  O OE2 . GLU E  3  154 ? 99.132  34.605 38.289  1.00 23.83  ? 154  GLU H OE2 1 
ATOM   8087  N N   . ARG E  3  155 ? 99.193  34.812 33.068  1.00 16.98  ? 155  ARG H N   1 
ATOM   8088  C CA  . ARG E  3  155 ? 98.648  33.552 32.602  1.00 16.39  ? 155  ARG H CA  1 
ATOM   8089  C C   . ARG E  3  155 ? 99.344  32.988 31.361  1.00 15.09  ? 155  ARG H C   1 
ATOM   8090  O O   . ARG E  3  155 ? 99.447  31.765 31.215  1.00 14.97  ? 155  ARG H O   1 
ATOM   8091  C CB  . ARG E  3  155 ? 97.141  33.655 32.402  1.00 16.94  ? 155  ARG H CB  1 
ATOM   8092  C CG  . ARG E  3  155 ? 96.664  34.676 31.410  1.00 18.37  ? 155  ARG H CG  1 
ATOM   8093  C CD  . ARG E  3  155 ? 95.130  34.681 31.336  1.00 17.79  ? 155  ARG H CD  1 
ATOM   8094  N NE  . ARG E  3  155 ? 94.648  33.478 30.658  1.00 16.73  ? 155  ARG H NE  1 
ATOM   8095  C CZ  . ARG E  3  155 ? 94.473  33.384 29.352  1.00 14.10  ? 155  ARG H CZ  1 
ATOM   8096  N NH1 . ARG E  3  155 ? 94.722  34.418 28.575  1.00 13.80  ? 155  ARG H NH1 1 
ATOM   8097  N NH2 . ARG E  3  155 ? 94.060  32.253 28.817  1.00 15.16  ? 155  ARG H NH2 1 
ATOM   8098  N N   . LEU E  3  156 ? 99.820  33.850 30.470  1.00 13.71  ? 156  LEU H N   1 
ATOM   8099  C CA  . LEU E  3  156 ? 100.538 33.365 29.291  1.00 12.65  ? 156  LEU H CA  1 
ATOM   8100  C C   . LEU E  3  156 ? 101.819 32.709 29.810  1.00 12.44  ? 156  LEU H C   1 
ATOM   8101  O O   . LEU E  3  156 ? 102.216 31.632 29.374  1.00 12.23  ? 156  LEU H O   1 
ATOM   8102  C CB  . LEU E  3  156 ? 100.908 34.500 28.337  1.00 12.22  ? 156  LEU H CB  1 
ATOM   8103  C CG  . LEU E  3  156 ? 100.910 34.221 26.827  1.00 10.92  ? 156  LEU H CG  1 
ATOM   8104  C CD1 . LEU E  3  156 ? 101.671 35.341 26.121  1.00 8.76   ? 156  LEU H CD1 1 
ATOM   8105  C CD2 . LEU E  3  156 ? 101.484 32.849 26.475  1.00 9.18   ? 156  LEU H CD2 1 
ATOM   8106  N N   . ARG E  3  157 ? 102.457 33.357 30.777  1.00 11.96  ? 157  ARG H N   1 
ATOM   8107  C CA  . ARG E  3  157 ? 103.690 32.814 31.341  1.00 11.40  ? 157  ARG H CA  1 
ATOM   8108  C C   . ARG E  3  157 ? 103.488 31.412 31.931  1.00 10.50  ? 157  ARG H C   1 
ATOM   8109  O O   . ARG E  3  157 ? 104.365 30.538 31.804  1.00 10.32  ? 157  ARG H O   1 
ATOM   8110  C CB  . ARG E  3  157 ? 104.235 33.771 32.396  1.00 12.01  ? 157  ARG H CB  1 
ATOM   8111  C CG  . ARG E  3  157 ? 105.492 33.300 33.087  1.00 14.13  ? 157  ARG H CG  1 
ATOM   8112  C CD  . ARG E  3  157 ? 106.199 34.414 33.820  1.00 15.09  ? 157  ARG H CD  1 
ATOM   8113  N NE  . ARG E  3  157 ? 105.492 34.846 35.016  1.00 17.59  ? 157  ARG H NE  1 
ATOM   8114  C CZ  . ARG E  3  157 ? 104.762 35.952 35.115  1.00 19.16  ? 157  ARG H CZ  1 
ATOM   8115  N NH1 . ARG E  3  157 ? 104.607 36.764 34.071  1.00 20.83  ? 157  ARG H NH1 1 
ATOM   8116  N NH2 . ARG E  3  157 ? 104.172 36.242 36.266  1.00 19.24  ? 157  ARG H NH2 1 
ATOM   8117  N N   . ALA E  3  158 ? 102.337 31.199 32.564  1.00 9.53   ? 158  ALA H N   1 
ATOM   8118  C CA  . ALA E  3  158 ? 102.018 29.930 33.193  1.00 9.61   ? 158  ALA H CA  1 
ATOM   8119  C C   . ALA E  3  158 ? 101.937 28.826 32.136  1.00 9.88   ? 158  ALA H C   1 
ATOM   8120  O O   . ALA E  3  158 ? 102.440 27.728 32.337  1.00 10.63  ? 158  ALA H O   1 
ATOM   8121  C CB  . ALA E  3  158 ? 100.708 30.035 33.950  1.00 9.88   ? 158  ALA H CB  1 
ATOM   8122  N N   . TYR E  3  159 ? 101.302 29.129 31.011  1.00 9.57   ? 159  TYR H N   1 
ATOM   8123  C CA  . TYR E  3  159 ? 101.188 28.192 29.903  1.00 9.49   ? 159  TYR H CA  1 
ATOM   8124  C C   . TYR E  3  159 ? 102.579 27.898 29.356  1.00 9.44   ? 159  TYR H C   1 
ATOM   8125  O O   . TYR E  3  159 ? 103.017 26.747 29.259  1.00 8.92   ? 159  TYR H O   1 
ATOM   8126  C CB  . TYR E  3  159 ? 100.331 28.803 28.784  1.00 9.46   ? 159  TYR H CB  1 
ATOM   8127  C CG  . TYR E  3  159 ? 100.363 28.021 27.483  1.00 10.45  ? 159  TYR H CG  1 
ATOM   8128  C CD1 . TYR E  3  159 ? 99.655  26.832 27.343  1.00 11.41  ? 159  TYR H CD1 1 
ATOM   8129  C CD2 . TYR E  3  159 ? 101.102 28.471 26.393  1.00 10.30  ? 159  TYR H CD2 1 
ATOM   8130  C CE1 . TYR E  3  159 ? 99.706  26.098 26.151  1.00 11.30  ? 159  TYR H CE1 1 
ATOM   8131  C CE2 . TYR E  3  159 ? 101.151 27.751 25.210  1.00 11.39  ? 159  TYR H CE2 1 
ATOM   8132  C CZ  . TYR E  3  159 ? 100.454 26.563 25.096  1.00 10.46  ? 159  TYR H CZ  1 
ATOM   8133  O OH  . TYR E  3  159 ? 100.508 25.848 23.918  1.00 11.36  ? 159  TYR H OH  1 
ATOM   8134  N N   . LEU E  3  160 ? 103.265 28.968 28.993  1.00 9.56   ? 160  LEU H N   1 
ATOM   8135  C CA  . LEU E  3  160 ? 104.599 28.873 28.443  1.00 10.53  ? 160  LEU H CA  1 
ATOM   8136  C C   . LEU E  3  160 ? 105.564 28.091 29.326  1.00 11.36  ? 160  LEU H C   1 
ATOM   8137  O O   . LEU E  3  160 ? 106.277 27.234 28.834  1.00 11.56  ? 160  LEU H O   1 
ATOM   8138  C CB  . LEU E  3  160 ? 105.159 30.272 28.195  1.00 10.22  ? 160  LEU H CB  1 
ATOM   8139  C CG  . LEU E  3  160 ? 104.385 31.141 27.199  1.00 10.59  ? 160  LEU H CG  1 
ATOM   8140  C CD1 . LEU E  3  160 ? 104.891 32.576 27.283  1.00 10.77  ? 160  LEU H CD1 1 
ATOM   8141  C CD2 . LEU E  3  160 ? 104.528 30.605 25.800  1.00 10.71  ? 160  LEU H CD2 1 
ATOM   8142  N N   . GLU E  3  161 ? 105.602 28.376 30.627  1.00 12.92  ? 161  GLU H N   1 
ATOM   8143  C CA  . GLU E  3  161 ? 106.571 27.691 31.488  1.00 13.32  ? 161  GLU H CA  1 
ATOM   8144  C C   . GLU E  3  161 ? 106.079 26.370 32.043  1.00 12.76  ? 161  GLU H C   1 
ATOM   8145  O O   . GLU E  3  161 ? 106.875 25.633 32.632  1.00 13.01  ? 161  GLU H O   1 
ATOM   8146  C CB  . GLU E  3  161 ? 107.013 28.566 32.660  1.00 14.41  ? 161  GLU H CB  1 
ATOM   8147  C CG  . GLU E  3  161 ? 107.351 30.008 32.316  1.00 17.52  ? 161  GLU H CG  1 
ATOM   8148  C CD  . GLU E  3  161 ? 107.698 30.831 33.546  1.00 21.46  ? 161  GLU H CD  1 
ATOM   8149  O OE1 . GLU E  3  161 ? 106.908 30.825 34.514  1.00 23.96  ? 161  GLU H OE1 1 
ATOM   8150  O OE2 . GLU E  3  161 ? 108.758 31.491 33.544  1.00 24.38  ? 161  GLU H OE2 1 
ATOM   8151  N N   . GLY E  3  162 ? 104.797 26.056 31.873  1.00 11.43  ? 162  GLY H N   1 
ATOM   8152  C CA  . GLY E  3  162 ? 104.271 24.817 32.418  1.00 10.74  ? 162  GLY H CA  1 
ATOM   8153  C C   . GLY E  3  162 ? 103.603 23.939 31.392  1.00 9.94   ? 162  GLY H C   1 
ATOM   8154  O O   . GLY E  3  162 ? 104.196 23.025 30.844  1.00 10.26  ? 162  GLY H O   1 
ATOM   8155  N N   . THR E  3  163 ? 102.336 24.213 31.152  1.00 9.80   ? 163  THR H N   1 
ATOM   8156  C CA  . THR E  3  163 ? 101.558 23.480 30.160  1.00 8.50   ? 163  THR H CA  1 
ATOM   8157  C C   . THR E  3  163 ? 102.330 23.166 28.889  1.00 7.67   ? 163  THR H C   1 
ATOM   8158  O O   . THR E  3  163 ? 102.429 21.997 28.508  1.00 6.75   ? 163  THR H O   1 
ATOM   8159  C CB  . THR E  3  163 ? 100.379 24.322 29.785  1.00 8.09   ? 163  THR H CB  1 
ATOM   8160  O OG1 . THR E  3  163 ? 99.753  24.758 30.983  1.00 7.51   ? 163  THR H OG1 1 
ATOM   8161  C CG2 . THR E  3  163 ? 99.360  23.515 28.992  1.00 8.19   ? 163  THR H CG2 1 
ATOM   8162  N N   . CYS E  3  164 ? 102.861 24.205 28.236  1.00 7.31   ? 164  CYS H N   1 
ATOM   8163  C CA  . CYS E  3  164 ? 103.585 24.030 26.965  1.00 7.03   ? 164  CYS H CA  1 
ATOM   8164  C C   . CYS E  3  164 ? 104.715 23.049 27.151  1.00 7.21   ? 164  CYS H C   1 
ATOM   8165  O O   . CYS E  3  164 ? 104.817 22.068 26.419  1.00 7.83   ? 164  CYS H O   1 
ATOM   8166  C CB  . CYS E  3  164 ? 104.140 25.357 26.417  1.00 6.46   ? 164  CYS H CB  1 
ATOM   8167  S SG  . CYS E  3  164 ? 104.937 25.256 24.765  1.00 8.73   ? 164  CYS H SG  1 
ATOM   8168  N N   . VAL E  3  165 ? 105.570 23.311 28.135  1.00 7.44   ? 165  VAL H N   1 
ATOM   8169  C CA  . VAL E  3  165 ? 106.709 22.449 28.406  1.00 7.38   ? 165  VAL H CA  1 
ATOM   8170  C C   . VAL E  3  165 ? 106.257 21.031 28.771  1.00 8.73   ? 165  VAL H C   1 
ATOM   8171  O O   . VAL E  3  165 ? 106.876 20.043 28.372  1.00 8.36   ? 165  VAL H O   1 
ATOM   8172  C CB  . VAL E  3  165 ? 107.555 23.031 29.534  1.00 7.58   ? 165  VAL H CB  1 
ATOM   8173  C CG1 . VAL E  3  165 ? 108.678 22.096 29.901  1.00 6.88   ? 165  VAL H CG1 1 
ATOM   8174  C CG2 . VAL E  3  165 ? 108.108 24.412 29.131  1.00 7.68   ? 165  VAL H CG2 1 
ATOM   8175  N N   . GLU E  3  166 ? 105.169 20.927 29.523  1.00 9.98   ? 166  GLU H N   1 
ATOM   8176  C CA  . GLU E  3  166 ? 104.683 19.632 29.966  1.00 11.59  ? 166  GLU H CA  1 
ATOM   8177  C C   . GLU E  3  166 ? 104.122 18.826 28.822  1.00 11.86  ? 166  GLU H C   1 
ATOM   8178  O O   . GLU E  3  166 ? 104.313 17.617 28.749  1.00 12.04  ? 166  GLU H O   1 
ATOM   8179  C CB  . GLU E  3  166 ? 103.613 19.810 31.041  1.00 12.58  ? 166  GLU H CB  1 
ATOM   8180  C CG  . GLU E  3  166 ? 103.002 18.499 31.523  1.00 15.97  ? 166  GLU H CG  1 
ATOM   8181  C CD  . GLU E  3  166 ? 101.787 18.725 32.412  1.00 20.80  ? 166  GLU H CD  1 
ATOM   8182  O OE1 . GLU E  3  166 ? 101.065 17.746 32.706  1.00 22.86  ? 166  GLU H OE1 1 
ATOM   8183  O OE2 . GLU E  3  166 ? 101.551 19.893 32.806  1.00 23.51  ? 166  GLU H OE2 1 
ATOM   8184  N N   . TRP E  3  167 ? 103.401 19.481 27.928  1.00 12.45  ? 167  TRP H N   1 
ATOM   8185  C CA  . TRP E  3  167 ? 102.871 18.754 26.787  1.00 12.57  ? 167  TRP H CA  1 
ATOM   8186  C C   . TRP E  3  167 ? 103.965 18.471 25.754  1.00 12.51  ? 167  TRP H C   1 
ATOM   8187  O O   . TRP E  3  167 ? 103.825 17.531 24.963  1.00 12.60  ? 167  TRP H O   1 
ATOM   8188  C CB  . TRP E  3  167 ? 101.666 19.473 26.155  1.00 12.52  ? 167  TRP H CB  1 
ATOM   8189  C CG  . TRP E  3  167 ? 100.385 19.193 26.892  1.00 12.71  ? 167  TRP H CG  1 
ATOM   8190  C CD1 . TRP E  3  167 ? 99.887  19.884 27.962  1.00 14.06  ? 167  TRP H CD1 1 
ATOM   8191  C CD2 . TRP E  3  167 ? 99.453  18.131 26.643  1.00 12.51  ? 167  TRP H CD2 1 
ATOM   8192  N NE1 . TRP E  3  167 ? 98.709  19.319 28.386  1.00 12.15  ? 167  TRP H NE1 1 
ATOM   8193  C CE2 . TRP E  3  167 ? 98.424  18.241 27.595  1.00 11.91  ? 167  TRP H CE2 1 
ATOM   8194  C CE3 . TRP E  3  167 ? 99.387  17.092 25.711  1.00 13.56  ? 167  TRP H CE3 1 
ATOM   8195  C CZ2 . TRP E  3  167 ? 97.352  17.357 27.643  1.00 12.50  ? 167  TRP H CZ2 1 
ATOM   8196  C CZ3 . TRP E  3  167 ? 98.312  16.215 25.761  1.00 12.44  ? 167  TRP H CZ3 1 
ATOM   8197  C CH2 . TRP E  3  167 ? 97.314  16.355 26.717  1.00 11.34  ? 167  TRP H CH2 1 
ATOM   8198  N N   . LEU E  3  168 ? 105.045 19.257 25.748  1.00 12.09  ? 168  LEU H N   1 
ATOM   8199  C CA  . LEU E  3  168 ? 106.125 19.010 24.779  1.00 12.28  ? 168  LEU H CA  1 
ATOM   8200  C C   . LEU E  3  168 ? 106.714 17.654 25.111  1.00 13.83  ? 168  LEU H C   1 
ATOM   8201  O O   . LEU E  3  168 ? 106.857 16.783 24.254  1.00 13.87  ? 168  LEU H O   1 
ATOM   8202  C CB  . LEU E  3  168 ? 107.236 20.073 24.851  1.00 11.22  ? 168  LEU H CB  1 
ATOM   8203  C CG  . LEU E  3  168 ? 108.459 19.811 23.956  1.00 8.92   ? 168  LEU H CG  1 
ATOM   8204  C CD1 . LEU E  3  168 ? 108.030 19.690 22.494  1.00 7.45   ? 168  LEU H CD1 1 
ATOM   8205  C CD2 . LEU E  3  168 ? 109.546 20.884 24.114  1.00 5.55   ? 168  LEU H CD2 1 
ATOM   8206  N N   . ARG E  3  169 ? 107.055 17.507 26.390  1.00 15.92  ? 169  ARG H N   1 
ATOM   8207  C CA  . ARG E  3  169 ? 107.616 16.294 26.957  1.00 17.06  ? 169  ARG H CA  1 
ATOM   8208  C C   . ARG E  3  169 ? 106.773 15.075 26.578  1.00 18.05  ? 169  ARG H C   1 
ATOM   8209  O O   . ARG E  3  169 ? 107.308 14.017 26.238  1.00 18.73  ? 169  ARG H O   1 
ATOM   8210  C CB  . ARG E  3  169 ? 107.680 16.456 28.482  1.00 17.40  ? 169  ARG H CB  1 
ATOM   8211  C CG  . ARG E  3  169 ? 107.860 15.162 29.256  1.00 18.49  ? 169  ARG H CG  1 
ATOM   8212  C CD  . ARG E  3  169 ? 107.639 15.309 30.764  1.00 19.23  ? 169  ARG H CD  1 
ATOM   8213  N NE  . ARG E  3  169 ? 108.702 16.084 31.390  1.00 20.79  ? 169  ARG H NE  1 
ATOM   8214  C CZ  . ARG E  3  169 ? 108.624 17.369 31.699  1.00 18.89  ? 169  ARG H CZ  1 
ATOM   8215  N NH1 . ARG E  3  169 ? 107.533 18.054 31.459  1.00 18.90  ? 169  ARG H NH1 1 
ATOM   8216  N NH2 . ARG E  3  169 ? 109.654 17.973 32.252  1.00 21.01  ? 169  ARG H NH2 1 
ATOM   8217  N N   . ARG E  3  170 ? 105.453 15.227 26.621  1.00 18.71  ? 170  ARG H N   1 
ATOM   8218  C CA  . ARG E  3  170 ? 104.539 14.132 26.284  1.00 19.32  ? 170  ARG H CA  1 
ATOM   8219  C C   . ARG E  3  170 ? 104.546 13.768 24.788  1.00 18.72  ? 170  ARG H C   1 
ATOM   8220  O O   . ARG E  3  170 ? 104.450 12.599 24.423  1.00 19.08  ? 170  ARG H O   1 
ATOM   8221  C CB  . ARG E  3  170 ? 103.126 14.494 26.717  1.00 19.83  ? 170  ARG H CB  1 
ATOM   8222  C CG  . ARG E  3  170 ? 102.079 13.437 26.467  1.00 22.55  ? 170  ARG H CG  1 
ATOM   8223  C CD  . ARG E  3  170 ? 100.752 14.093 26.081  1.00 26.78  ? 170  ARG H CD  1 
ATOM   8224  N NE  . ARG E  3  170 ? 99.569  13.314 26.420  1.00 29.95  ? 170  ARG H NE  1 
ATOM   8225  C CZ  . ARG E  3  170 ? 99.183  13.043 27.660  1.00 32.92  ? 170  ARG H CZ  1 
ATOM   8226  N NH1 . ARG E  3  170 ? 99.895  13.476 28.694  1.00 34.01  ? 170  ARG H NH1 1 
ATOM   8227  N NH2 . ARG E  3  170 ? 98.086  12.333 27.871  1.00 34.24  ? 170  ARG H NH2 1 
ATOM   8228  N N   . TYR E  3  171 ? 104.653 14.750 23.914  1.00 17.46  ? 171  TYR H N   1 
ATOM   8229  C CA  . TYR E  3  171 ? 104.671 14.413 22.503  1.00 16.82  ? 171  TYR H CA  1 
ATOM   8230  C C   . TYR E  3  171 ? 106.015 13.796 22.127  1.00 18.00  ? 171  TYR H C   1 
ATOM   8231  O O   . TYR E  3  171 ? 106.079 12.915 21.272  1.00 18.60  ? 171  TYR H O   1 
ATOM   8232  C CB  . TYR E  3  171 ? 104.367 15.630 21.640  1.00 15.26  ? 171  TYR H CB  1 
ATOM   8233  C CG  . TYR E  3  171 ? 103.050 16.295 21.966  1.00 10.51  ? 171  TYR H CG  1 
ATOM   8234  C CD1 . TYR E  3  171 ? 101.908 15.551 22.246  1.00 7.90   ? 171  TYR H CD1 1 
ATOM   8235  C CD2 . TYR E  3  171 ? 102.947 17.675 21.991  1.00 8.33   ? 171  TYR H CD2 1 
ATOM   8236  C CE1 . TYR E  3  171 ? 100.681 16.187 22.546  1.00 6.95   ? 171  TYR H CE1 1 
ATOM   8237  C CE2 . TYR E  3  171 ? 101.743 18.310 22.278  1.00 7.03   ? 171  TYR H CE2 1 
ATOM   8238  C CZ  . TYR E  3  171 ? 100.619 17.572 22.556  1.00 5.34   ? 171  TYR H CZ  1 
ATOM   8239  O OH  . TYR E  3  171 ? 99.442  18.232 22.839  1.00 3.43   ? 171  TYR H OH  1 
ATOM   8240  N N   . LEU E  3  172 ? 107.085 14.245 22.771  1.00 19.14  ? 172  LEU H N   1 
ATOM   8241  C CA  . LEU E  3  172 ? 108.403 13.693 22.492  1.00 19.88  ? 172  LEU H CA  1 
ATOM   8242  C C   . LEU E  3  172 ? 108.430 12.199 22.771  1.00 21.43  ? 172  LEU H C   1 
ATOM   8243  O O   . LEU E  3  172 ? 109.149 11.453 22.103  1.00 21.79  ? 172  LEU H O   1 
ATOM   8244  C CB  . LEU E  3  172 ? 109.486 14.391 23.314  1.00 19.26  ? 172  LEU H CB  1 
ATOM   8245  C CG  . LEU E  3  172 ? 109.842 15.799 22.833  1.00 18.07  ? 172  LEU H CG  1 
ATOM   8246  C CD1 . LEU E  3  172 ? 111.013 16.332 23.627  1.00 16.77  ? 172  LEU H CD1 1 
ATOM   8247  C CD2 . LEU E  3  172 ? 110.168 15.786 21.345  1.00 17.77  ? 172  LEU H CD2 1 
ATOM   8248  N N   . LYS E  3  173 ? 107.659 11.765 23.765  1.00 23.11  ? 173  LYS H N   1 
ATOM   8249  C CA  . LYS E  3  173 ? 107.593 10.353 24.108  1.00 24.37  ? 173  LYS H CA  1 
ATOM   8250  C C   . LYS E  3  173 ? 107.011 9.593  22.942  1.00 25.49  ? 173  LYS H C   1 
ATOM   8251  O O   . LYS E  3  173 ? 107.641 8.697  22.390  1.00 25.76  ? 173  LYS H O   1 
ATOM   8252  C CB  . LYS E  3  173 ? 106.698 10.108 25.324  1.00 24.39  ? 173  LYS H CB  1 
ATOM   8253  C CG  . LYS E  3  173 ? 107.313 10.462 26.646  1.00 25.13  ? 173  LYS H CG  1 
ATOM   8254  C CD  . LYS E  3  173 ? 106.476 9.925  27.792  1.00 26.67  ? 173  LYS H CD  1 
ATOM   8255  C CE  . LYS E  3  173 ? 107.071 10.283 29.148  1.00 27.31  ? 173  LYS H CE  1 
ATOM   8256  N NZ  . LYS E  3  173 ? 106.405 11.466 29.772  1.00 27.35  ? 173  LYS H NZ  1 
ATOM   8257  N N   . ASN E  3  174 ? 105.791 9.962  22.579  1.00 26.95  ? 174  ASN H N   1 
ATOM   8258  C CA  . ASN E  3  174 ? 105.080 9.316  21.493  1.00 28.25  ? 174  ASN H CA  1 
ATOM   8259  C C   . ASN E  3  174 ? 105.796 9.469  20.164  1.00 30.19  ? 174  ASN H C   1 
ATOM   8260  O O   . ASN E  3  174 ? 105.629 8.649  19.265  1.00 29.97  ? 174  ASN H O   1 
ATOM   8261  C CB  . ASN E  3  174 ? 103.680 9.900  21.375  1.00 27.97  ? 174  ASN H CB  1 
ATOM   8262  C CG  . ASN E  3  174 ? 102.861 9.707  22.634  1.00 27.13  ? 174  ASN H CG  1 
ATOM   8263  O OD1 . ASN E  3  174 ? 101.932 10.463 22.891  1.00 26.55  ? 174  ASN H OD1 1 
ATOM   8264  N ND2 . ASN E  3  174 ? 103.199 8.692  23.421  1.00 25.04  ? 174  ASN H ND2 1 
ATOM   8265  N N   . GLY E  3  175 ? 106.608 10.510 20.044  1.00 32.73  ? 175  GLY H N   1 
ATOM   8266  C CA  . GLY E  3  175 ? 107.298 10.764 18.794  1.00 35.21  ? 175  GLY H CA  1 
ATOM   8267  C C   . GLY E  3  175 ? 108.784 10.495 18.666  1.00 37.38  ? 175  GLY H C   1 
ATOM   8268  O O   . GLY E  3  175 ? 109.290 10.640 17.558  1.00 37.70  ? 175  GLY H O   1 
ATOM   8269  N N   . ASN E  3  176 ? 109.490 10.109 19.733  1.00 40.06  ? 176  ASN H N   1 
ATOM   8270  C CA  . ASN E  3  176 ? 110.931 9.850  19.600  1.00 42.56  ? 176  ASN H CA  1 
ATOM   8271  C C   . ASN E  3  176 ? 111.190 8.936  18.405  1.00 41.41  ? 176  ASN H C   1 
ATOM   8272  O O   . ASN E  3  176 ? 111.967 9.258  17.511  1.00 41.36  ? 176  ASN H O   1 
ATOM   8273  C CB  . ASN E  3  176 ? 111.587 9.322  20.910  1.00 44.67  ? 176  ASN H CB  1 
ATOM   8274  C CG  . ASN E  3  176 ? 111.393 7.813  21.179  1.00 52.69  ? 176  ASN H CG  1 
ATOM   8275  O OD1 . ASN E  3  176 ? 110.374 7.204  20.826  1.00 54.67  ? 176  ASN H OD1 1 
ATOM   8276  N ND2 . ASN E  3  176 ? 112.394 7.250  21.926  1.00 68.45  ? 176  ASN H ND2 1 
ATOM   8277  N N   . ALA E  3  177 ? 110.473 7.826  18.368  1.00 40.32  ? 177  ALA H N   1 
ATOM   8278  C CA  . ALA E  3  177 ? 110.628 6.832  17.318  1.00 39.49  ? 177  ALA H CA  1 
ATOM   8279  C C   . ALA E  3  177 ? 110.455 7.349  15.884  1.00 38.55  ? 177  ALA H C   1 
ATOM   8280  O O   . ALA E  3  177 ? 110.765 6.638  14.932  1.00 38.46  ? 177  ALA H O   1 
ATOM   8281  C CB  . ALA E  3  177 ? 109.666 5.701  17.571  1.00 39.77  ? 177  ALA H CB  1 
ATOM   8282  N N   . THR E  3  178 ? 109.957 8.569  15.724  1.00 37.23  ? 178  THR H N   1 
ATOM   8283  C CA  . THR E  3  178 ? 109.741 9.132  14.393  1.00 35.85  ? 178  THR H CA  1 
ATOM   8284  C C   . THR E  3  178 ? 110.435 10.470 14.261  1.00 34.32  ? 178  THR H C   1 
ATOM   8285  O O   . THR E  3  178 ? 110.948 10.814 13.201  1.00 34.04  ? 178  THR H O   1 
ATOM   8286  C CB  . THR E  3  178 ? 108.243 9.334  14.137  1.00 36.20  ? 178  THR H CB  1 
ATOM   8287  O OG1 . THR E  3  178 ? 107.570 8.067  14.128  1.00 36.90  ? 178  THR H OG1 1 
ATOM   8288  C CG2 . THR E  3  178 ? 108.004 9.956  12.761  1.00 36.48  ? 178  THR H CG2 1 
ATOM   8289  N N   . LEU E  3  179 ? 110.430 11.232 15.346  1.00 32.79  ? 179  LEU H N   1 
ATOM   8290  C CA  . LEU E  3  179 ? 111.057 12.549 15.377  1.00 31.50  ? 179  LEU H CA  1 
ATOM   8291  C C   . LEU E  3  179 ? 112.572 12.531 15.149  1.00 31.05  ? 179  LEU H C   1 
ATOM   8292  O O   . LEU E  3  179 ? 113.142 13.520 14.707  1.00 31.00  ? 179  LEU H O   1 
ATOM   8293  C CB  . LEU E  3  179 ? 110.730 13.225 16.703  1.00 30.94  ? 179  LEU H CB  1 
ATOM   8294  C CG  . LEU E  3  179 ? 109.266 13.674 16.738  1.00 29.35  ? 179  LEU H CG  1 
ATOM   8295  C CD1 . LEU E  3  179 ? 108.844 14.126 18.122  1.00 27.93  ? 179  LEU H CD1 1 
ATOM   8296  C CD2 . LEU E  3  179 ? 109.060 14.784 15.712  1.00 27.77  ? 179  LEU H CD2 1 
ATOM   8297  N N   . LEU E  3  180 ? 113.216 11.406 15.437  1.00 30.33  ? 180  LEU H N   1 
ATOM   8298  C CA  . LEU E  3  180 ? 114.659 11.293 15.270  1.00 29.99  ? 180  LEU H CA  1 
ATOM   8299  C C   . LEU E  3  180 ? 115.049 10.942 13.846  1.00 29.60  ? 180  LEU H C   1 
ATOM   8300  O O   . LEU E  3  180 ? 116.210 11.081 13.477  1.00 29.41  ? 180  LEU H O   1 
ATOM   8301  C CB  . LEU E  3  180 ? 115.222 10.235 16.219  1.00 30.19  ? 180  LEU H CB  1 
ATOM   8302  C CG  . LEU E  3  180 ? 115.206 10.631 17.691  1.00 30.25  ? 180  LEU H CG  1 
ATOM   8303  C CD1 . LEU E  3  180 ? 114.907 9.415  18.523  1.00 30.37  ? 180  LEU H CD1 1 
ATOM   8304  C CD2 . LEU E  3  180 ? 116.520 11.275 18.090  1.00 30.36  ? 180  LEU H CD2 1 
ATOM   8305  N N   . ARG E  3  181 ? 114.083 10.490 13.053  1.00 29.30  ? 181  ARG H N   1 
ATOM   8306  C CA  . ARG E  3  181 ? 114.341 10.122 11.670  1.00 29.23  ? 181  ARG H CA  1 
ATOM   8307  C C   . ARG E  3  181 ? 115.418 11.015 11.072  1.00 29.17  ? 181  ARG H C   1 
ATOM   8308  O O   . ARG E  3  181 ? 115.409 12.230 11.243  1.00 29.03  ? 181  ARG H O   1 
ATOM   8309  C CB  . ARG E  3  181 ? 113.072 10.232 10.814  1.00 29.32  ? 181  ARG H CB  1 
ATOM   8310  C CG  . ARG E  3  181 ? 113.318 9.936  9.326   1.00 30.40  ? 181  ARG H CG  1 
ATOM   8311  C CD  . ARG E  3  181 ? 112.082 10.002 8.438   1.00 31.57  ? 181  ARG H CD  1 
ATOM   8312  N NE  . ARG E  3  181 ? 111.622 11.366 8.182   1.00 33.04  ? 181  ARG H NE  1 
ATOM   8313  C CZ  . ARG E  3  181 ? 110.873 11.724 7.143   1.00 33.19  ? 181  ARG H CZ  1 
ATOM   8314  N NH1 . ARG E  3  181 ? 110.489 10.826 6.242   1.00 33.46  ? 181  ARG H NH1 1 
ATOM   8315  N NH2 . ARG E  3  181 ? 110.498 12.984 7.004   1.00 32.87  ? 181  ARG H NH2 1 
ATOM   8316  N N   . THR E  3  182 ? 116.349 10.401 10.360  1.00 29.06  ? 182  THR H N   1 
ATOM   8317  C CA  . THR E  3  182 ? 117.405 11.149 9.712   1.00 28.93  ? 182  THR H CA  1 
ATOM   8318  C C   . THR E  3  182 ? 117.612 10.515 8.339   1.00 28.32  ? 182  THR H C   1 
ATOM   8319  O O   . THR E  3  182 ? 117.596 9.297  8.216   1.00 28.43  ? 182  THR H O   1 
ATOM   8320  C CB  . THR E  3  182 ? 118.675 11.082 10.554  1.00 28.87  ? 182  THR H CB  1 
ATOM   8321  O OG1 . THR E  3  182 ? 119.634 12.030 10.070  1.00 29.65  ? 182  THR H OG1 1 
ATOM   8322  C CG2 . THR E  3  182 ? 119.330 9.712  10.433  1.00 29.37  ? 182  THR H CG2 1 
ATOM   8323  N N   . ASP E  3  183 ? 117.751 11.328 7.300   1.00 27.64  ? 183  ASP H N   1 
ATOM   8324  C CA  . ASP E  3  183 ? 117.988 10.787 5.962   1.00 27.25  ? 183  ASP H CA  1 
ATOM   8325  C C   . ASP E  3  183 ? 119.077 11.574 5.250   1.00 26.72  ? 183  ASP H C   1 
ATOM   8326  O O   . ASP E  3  183 ? 118.917 12.758 4.973   1.00 26.07  ? 183  ASP H O   1 
ATOM   8327  C CB  . ASP E  3  183 ? 116.712 10.796 5.127   1.00 27.69  ? 183  ASP H CB  1 
ATOM   8328  C CG  . ASP E  3  183 ? 115.715 9.769  5.592   1.00 27.89  ? 183  ASP H CG  1 
ATOM   8329  O OD1 . ASP E  3  183 ? 114.804 10.120 6.366   1.00 28.01  ? 183  ASP H OD1 1 
ATOM   8330  O OD2 . ASP E  3  183 ? 115.800 8.582  5.226   1.00 29.20  ? 183  ASP H OD2 1 
ATOM   8331  N N   . SER E  3  184 ? 120.186 10.896 4.969   1.00 26.17  ? 184  SER H N   1 
ATOM   8332  C CA  . SER E  3  184 ? 121.328 11.504 4.303   1.00 26.01  ? 184  SER H CA  1 
ATOM   8333  C C   . SER E  3  184 ? 121.019 11.895 2.873   1.00 25.66  ? 184  SER H C   1 
ATOM   8334  O O   . SER E  3  184 ? 120.266 11.216 2.179   1.00 25.55  ? 184  SER H O   1 
ATOM   8335  C CB  . SER E  3  184 ? 122.523 10.547 4.309   1.00 25.90  ? 184  SER H CB  1 
ATOM   8336  O OG  . SER E  3  184 ? 123.013 10.349 5.624   1.00 26.93  ? 184  SER H OG  1 
ATOM   8337  N N   . PRO E  3  185 ? 121.581 13.009 2.427   1.00 25.62  ? 185  PRO H N   1 
ATOM   8338  C CA  . PRO E  3  185 ? 121.376 13.425 1.057   1.00 26.21  ? 185  PRO H CA  1 
ATOM   8339  C C   . PRO E  3  185 ? 122.291 12.614 0.173   1.00 26.58  ? 185  PRO H C   1 
ATOM   8340  O O   . PRO E  3  185 ? 123.387 12.237 0.583   1.00 26.64  ? 185  PRO H O   1 
ATOM   8341  C CB  . PRO E  3  185 ? 121.815 14.880 1.093   1.00 25.92  ? 185  PRO H CB  1 
ATOM   8342  C CG  . PRO E  3  185 ? 122.960 14.824 1.991   1.00 25.46  ? 185  PRO H CG  1 
ATOM   8343  C CD  . PRO E  3  185 ? 122.414 13.991 3.137   1.00 25.77  ? 185  PRO H CD  1 
ATOM   8344  N N   . LYS E  3  186 ? 121.823 12.307 -1.019  1.00 27.11  ? 186  LYS H N   1 
ATOM   8345  C CA  . LYS E  3  186 ? 122.652 11.626 -1.974  1.00 27.66  ? 186  LYS H CA  1 
ATOM   8346  C C   . LYS E  3  186 ? 123.070 12.796 -2.835  1.00 27.30  ? 186  LYS H C   1 
ATOM   8347  O O   . LYS E  3  186 ? 122.225 13.483 -3.397  1.00 27.44  ? 186  LYS H O   1 
ATOM   8348  C CB  . LYS E  3  186 ? 121.852 10.594 -2.761  1.00 28.33  ? 186  LYS H CB  1 
ATOM   8349  C CG  . LYS E  3  186 ? 121.590 9.309  -1.986  1.00 30.90  ? 186  LYS H CG  1 
ATOM   8350  C CD  . LYS E  3  186 ? 120.773 8.309  -2.793  1.00 34.19  ? 186  LYS H CD  1 
ATOM   8351  C CE  . LYS E  3  186 ? 121.496 7.853  -4.056  1.00 36.34  ? 186  LYS H CE  1 
ATOM   8352  N NZ  . LYS E  3  186 ? 120.753 6.770  -4.779  1.00 38.04  ? 186  LYS H NZ  1 
ATOM   8353  N N   . ALA E  3  187 ? 124.359 13.077 -2.904  1.00 27.04  ? 187  ALA H N   1 
ATOM   8354  C CA  . ALA E  3  187 ? 124.799 14.219 -3.691  1.00 26.80  ? 187  ALA H CA  1 
ATOM   8355  C C   . ALA E  3  187 ? 125.300 13.811 -5.073  1.00 26.46  ? 187  ALA H C   1 
ATOM   8356  O O   . ALA E  3  187 ? 125.411 12.624 -5.382  1.00 26.23  ? 187  ALA H O   1 
ATOM   8357  C CB  . ALA E  3  187 ? 125.867 14.984 -2.935  1.00 26.74  ? 187  ALA H CB  1 
ATOM   8358  N N   . HIS E  3  188 ? 125.568 14.810 -5.905  1.00 26.26  ? 188  HIS H N   1 
ATOM   8359  C CA  . HIS E  3  188 ? 126.105 14.603 -7.246  1.00 26.45  ? 188  HIS H CA  1 
ATOM   8360  C C   . HIS E  3  188 ? 126.239 15.948 -7.930  1.00 25.96  ? 188  HIS H C   1 
ATOM   8361  O O   . HIS E  3  188 ? 125.573 16.908 -7.556  1.00 25.75  ? 188  HIS H O   1 
ATOM   8362  C CB  . HIS E  3  188 ? 125.252 13.647 -8.083  1.00 26.59  ? 188  HIS H CB  1 
ATOM   8363  C CG  . HIS E  3  188 ? 123.986 14.242 -8.608  1.00 27.74  ? 188  HIS H CG  1 
ATOM   8364  N ND1 . HIS E  3  188 ? 123.830 14.610 -9.927  1.00 28.57  ? 188  HIS H ND1 1 
ATOM   8365  C CD2 . HIS E  3  188 ? 122.794 14.477 -8.009  1.00 28.69  ? 188  HIS H CD2 1 
ATOM   8366  C CE1 . HIS E  3  188 ? 122.604 15.062 -10.116 1.00 28.30  ? 188  HIS H CE1 1 
ATOM   8367  N NE2 . HIS E  3  188 ? 121.955 14.993 -8.967  1.00 29.43  ? 188  HIS H NE2 1 
ATOM   8368  N N   . VAL E  3  189 ? 127.124 16.011 -8.919  1.00 25.64  ? 189  VAL H N   1 
ATOM   8369  C CA  . VAL E  3  189 ? 127.380 17.241 -9.653  1.00 25.03  ? 189  VAL H CA  1 
ATOM   8370  C C   . VAL E  3  189 ? 127.100 17.039 -11.127 1.00 24.81  ? 189  VAL H C   1 
ATOM   8371  O O   . VAL E  3  189 ? 127.430 15.990 -11.683 1.00 24.94  ? 189  VAL H O   1 
ATOM   8372  C CB  . VAL E  3  189 ? 128.832 17.672 -9.497  1.00 24.76  ? 189  VAL H CB  1 
ATOM   8373  C CG1 . VAL E  3  189 ? 129.112 18.916 -10.322 1.00 25.03  ? 189  VAL H CG1 1 
ATOM   8374  C CG2 . VAL E  3  189 ? 129.146 17.914 -8.029  1.00 25.03  ? 189  VAL H CG2 1 
ATOM   8375  N N   . THR E  3  190 ? 126.497 18.049 -11.750 1.00 24.56  ? 190  THR H N   1 
ATOM   8376  C CA  . THR E  3  190 ? 126.179 18.006 -13.175 1.00 24.35  ? 190  THR H CA  1 
ATOM   8377  C C   . THR E  3  190 ? 126.955 19.090 -13.881 1.00 25.06  ? 190  THR H C   1 
ATOM   8378  O O   . THR E  3  190 ? 127.375 20.066 -13.261 1.00 25.57  ? 190  THR H O   1 
ATOM   8379  C CB  . THR E  3  190 ? 124.684 18.224 -13.441 1.00 23.63  ? 190  THR H CB  1 
ATOM   8380  O OG1 . THR E  3  190 ? 124.220 19.364 -12.706 1.00 23.11  ? 190  THR H OG1 1 
ATOM   8381  C CG2 . THR E  3  190 ? 123.864 17.034 -12.976 1.00 22.09  ? 190  THR H CG2 1 
ATOM   8382  N N   . HIS E  3  191 ? 127.113 18.933 -15.187 1.00 25.80  ? 191  HIS H N   1 
ATOM   8383  C CA  . HIS E  3  191 ? 127.893 19.872 -15.980 1.00 26.51  ? 191  HIS H CA  1 
ATOM   8384  C C   . HIS E  3  191 ? 127.050 20.509 -17.080 1.00 26.78  ? 191  HIS H C   1 
ATOM   8385  O O   . HIS E  3  191 ? 126.433 19.812 -17.878 1.00 26.42  ? 191  HIS H O   1 
ATOM   8386  C CB  . HIS E  3  191 ? 129.080 19.122 -16.569 1.00 26.47  ? 191  HIS H CB  1 
ATOM   8387  C CG  . HIS E  3  191 ? 130.083 19.988 -17.257 1.00 27.50  ? 191  HIS H CG  1 
ATOM   8388  N ND1 . HIS E  3  191 ? 129.871 20.522 -18.508 1.00 28.42  ? 191  HIS H ND1 1 
ATOM   8389  C CD2 . HIS E  3  191 ? 131.331 20.368 -16.892 1.00 28.58  ? 191  HIS H CD2 1 
ATOM   8390  C CE1 . HIS E  3  191 ? 130.937 21.208 -18.878 1.00 29.36  ? 191  HIS H CE1 1 
ATOM   8391  N NE2 . HIS E  3  191 ? 131.839 21.130 -17.915 1.00 29.26  ? 191  HIS H NE2 1 
ATOM   8392  N N   . HIS E  3  192 ? 127.031 21.840 -17.109 1.00 27.32  ? 192  HIS H N   1 
ATOM   8393  C CA  . HIS E  3  192 ? 126.253 22.582 -18.089 1.00 27.81  ? 192  HIS H CA  1 
ATOM   8394  C C   . HIS E  3  192 ? 127.091 23.605 -18.833 1.00 28.48  ? 192  HIS H C   1 
ATOM   8395  O O   . HIS E  3  192 ? 127.646 24.524 -18.220 1.00 28.50  ? 192  HIS H O   1 
ATOM   8396  C CB  . HIS E  3  192 ? 125.100 23.285 -17.397 1.00 27.78  ? 192  HIS H CB  1 
ATOM   8397  C CG  . HIS E  3  192 ? 124.278 22.383 -16.539 1.00 27.70  ? 192  HIS H CG  1 
ATOM   8398  N ND1 . HIS E  3  192 ? 123.161 21.729 -17.008 1.00 28.06  ? 192  HIS H ND1 1 
ATOM   8399  C CD2 . HIS E  3  192 ? 124.385 22.057 -15.230 1.00 27.47  ? 192  HIS H CD2 1 
ATOM   8400  C CE1 . HIS E  3  192 ? 122.615 21.037 -16.025 1.00 28.08  ? 192  HIS H CE1 1 
ATOM   8401  N NE2 . HIS E  3  192 ? 123.340 21.217 -14.936 1.00 27.88  ? 192  HIS H NE2 1 
ATOM   8402  N N   . SER E  3  193 ? 127.156 23.438 -20.155 1.00 29.31  ? 193  SER H N   1 
ATOM   8403  C CA  . SER E  3  193 ? 127.935 24.307 -21.038 1.00 30.34  ? 193  SER H CA  1 
ATOM   8404  C C   . SER E  3  193 ? 127.434 25.744 -21.037 1.00 32.20  ? 193  SER H C   1 
ATOM   8405  O O   . SER E  3  193 ? 126.230 26.002 -20.954 1.00 32.16  ? 193  SER H O   1 
ATOM   8406  C CB  . SER E  3  193 ? 127.898 23.770 -22.471 1.00 29.93  ? 193  SER H CB  1 
ATOM   8407  O OG  . SER E  3  193 ? 128.245 22.399 -22.516 1.00 28.48  ? 193  SER H OG  1 
ATOM   8408  N N   . ARG E  3  194 ? 128.371 26.676 -21.156 1.00 34.42  ? 194  ARG H N   1 
ATOM   8409  C CA  . ARG E  3  194 ? 128.060 28.098 -21.135 1.00 36.48  ? 194  ARG H CA  1 
ATOM   8410  C C   . ARG E  3  194 ? 128.858 28.770 -22.248 1.00 37.76  ? 194  ARG H C   1 
ATOM   8411  O O   . ARG E  3  194 ? 129.859 28.214 -22.698 1.00 37.89  ? 194  ARG H O   1 
ATOM   8412  C CB  . ARG E  3  194 ? 128.477 28.659 -19.776 1.00 36.84  ? 194  ARG H CB  1 
ATOM   8413  C CG  . ARG E  3  194 ? 127.693 29.830 -19.243 1.00 37.85  ? 194  ARG H CG  1 
ATOM   8414  C CD  . ARG E  3  194 ? 128.015 30.048 -17.755 1.00 38.67  ? 194  ARG H CD  1 
ATOM   8415  N NE  . ARG E  3  194 ? 127.267 31.137 -17.140 1.00 39.49  ? 194  ARG H NE  1 
ATOM   8416  C CZ  . ARG E  3  194 ? 125.948 31.163 -17.018 1.00 40.42  ? 194  ARG H CZ  1 
ATOM   8417  N NH1 . ARG E  3  194 ? 125.217 30.152 -17.470 1.00 41.33  ? 194  ARG H NH1 1 
ATOM   8418  N NH2 . ARG E  3  194 ? 125.353 32.200 -16.443 1.00 40.53  ? 194  ARG H NH2 1 
ATOM   8419  N N   . PRO E  3  195 ? 128.418 29.932 -22.734 1.00 39.28  ? 195  PRO H N   1 
ATOM   8420  C CA  . PRO E  3  195 ? 129.173 30.621 -23.782 1.00 40.03  ? 195  PRO H CA  1 
ATOM   8421  C C   . PRO E  3  195 ? 130.443 31.208 -23.185 1.00 40.54  ? 195  PRO H C   1 
ATOM   8422  O O   . PRO E  3  195 ? 130.710 30.995 -22.001 1.00 40.66  ? 195  PRO H O   1 
ATOM   8423  C CB  . PRO E  3  195 ? 128.211 31.720 -24.233 1.00 40.17  ? 195  PRO H CB  1 
ATOM   8424  C CG  . PRO E  3  195 ? 127.454 32.035 -22.982 1.00 40.20  ? 195  PRO H CG  1 
ATOM   8425  C CD  . PRO E  3  195 ? 127.168 30.653 -22.425 1.00 39.59  ? 195  PRO H CD  1 
ATOM   8426  N N   . GLU E  3  196 ? 131.207 31.942 -23.985 1.00 40.75  ? 196  GLU H N   1 
ATOM   8427  C CA  . GLU E  3  196 ? 132.457 32.528 -23.512 1.00 41.03  ? 196  GLU H CA  1 
ATOM   8428  C C   . GLU E  3  196 ? 133.357 31.436 -22.961 1.00 40.74  ? 196  GLU H C   1 
ATOM   8429  O O   . GLU E  3  196 ? 134.131 31.663 -22.034 1.00 40.98  ? 196  GLU H O   1 
ATOM   8430  C CB  . GLU E  3  196 ? 132.216 33.581 -22.427 1.00 41.21  ? 196  GLU H CB  1 
ATOM   8431  C CG  . GLU E  3  196 ? 132.373 35.017 -22.896 1.00 41.59  ? 196  GLU H CG  1 
ATOM   8432  C CD  . GLU E  3  196 ? 131.213 35.476 -23.754 1.00 42.05  ? 196  GLU H CD  1 
ATOM   8433  O OE1 . GLU E  3  196 ? 131.449 35.924 -24.900 1.00 42.73  ? 196  GLU H OE1 1 
ATOM   8434  O OE2 . GLU E  3  196 ? 130.063 35.389 -23.276 1.00 41.30  ? 196  GLU H OE2 1 
ATOM   8435  N N   . ASP E  3  197 ? 133.228 30.239 -23.518 1.00 40.18  ? 197  ASP H N   1 
ATOM   8436  C CA  . ASP E  3  197 ? 134.061 29.126 -23.109 1.00 39.58  ? 197  ASP H CA  1 
ATOM   8437  C C   . ASP E  3  197 ? 133.991 28.875 -21.598 1.00 38.49  ? 197  ASP H C   1 
ATOM   8438  O O   . ASP E  3  197 ? 134.943 28.365 -21.008 1.00 38.34  ? 197  ASP H O   1 
ATOM   8439  C CB  . ASP E  3  197 ? 135.501 29.412 -23.529 1.00 40.08  ? 197  ASP H CB  1 
ATOM   8440  C CG  . ASP E  3  197 ? 136.166 28.216 -24.150 1.00 41.18  ? 197  ASP H CG  1 
ATOM   8441  O OD1 . ASP E  3  197 ? 137.353 28.323 -24.532 1.00 42.13  ? 197  ASP H OD1 1 
ATOM   8442  O OD2 . ASP E  3  197 ? 135.554 27.134 -24.291 1.00 42.68  ? 197  ASP H OD2 1 
ATOM   8443  N N   . LYS E  3  198 ? 132.863 29.230 -20.983 1.00 37.02  ? 198  LYS H N   1 
ATOM   8444  C CA  . LYS E  3  198 ? 132.660 29.041 -19.545 1.00 35.99  ? 198  LYS H CA  1 
ATOM   8445  C C   . LYS E  3  198 ? 131.786 27.826 -19.224 1.00 34.57  ? 198  LYS H C   1 
ATOM   8446  O O   . LYS E  3  198 ? 131.270 27.167 -20.129 1.00 34.88  ? 198  LYS H O   1 
ATOM   8447  C CB  . LYS E  3  198 ? 132.054 30.306 -18.934 1.00 36.11  ? 198  LYS H CB  1 
ATOM   8448  C CG  . LYS E  3  198 ? 133.033 31.467 -18.874 1.00 37.48  ? 198  LYS H CG  1 
ATOM   8449  C CD  . LYS E  3  198 ? 132.401 32.751 -18.352 1.00 39.05  ? 198  LYS H CD  1 
ATOM   8450  C CE  . LYS E  3  198 ? 133.390 33.916 -18.455 1.00 40.26  ? 198  LYS H CE  1 
ATOM   8451  N NZ  . LYS E  3  198 ? 132.858 35.221 -17.954 1.00 41.09  ? 198  LYS H NZ  1 
ATOM   8452  N N   . VAL E  3  199 ? 131.616 27.531 -17.936 1.00 32.85  ? 199  VAL H N   1 
ATOM   8453  C CA  . VAL E  3  199 ? 130.826 26.371 -17.521 1.00 31.38  ? 199  VAL H CA  1 
ATOM   8454  C C   . VAL E  3  199 ? 130.143 26.491 -16.148 1.00 29.88  ? 199  VAL H C   1 
ATOM   8455  O O   . VAL E  3  199 ? 130.642 27.154 -15.245 1.00 29.22  ? 199  VAL H O   1 
ATOM   8456  C CB  . VAL E  3  199 ? 131.701 25.093 -17.526 1.00 31.29  ? 199  VAL H CB  1 
ATOM   8457  C CG1 . VAL E  3  199 ? 130.980 23.944 -16.846 1.00 31.77  ? 199  VAL H CG1 1 
ATOM   8458  C CG2 . VAL E  3  199 ? 132.051 24.701 -18.948 1.00 31.27  ? 199  VAL H CG2 1 
ATOM   8459  N N   . THR E  3  200 ? 128.993 25.823 -16.028 1.00 28.53  ? 200  THR H N   1 
ATOM   8460  C CA  . THR E  3  200 ? 128.210 25.765 -14.794 1.00 27.44  ? 200  THR H CA  1 
ATOM   8461  C C   . THR E  3  200 ? 128.324 24.383 -14.174 1.00 26.04  ? 200  THR H C   1 
ATOM   8462  O O   . THR E  3  200 ? 128.097 23.372 -14.828 1.00 26.05  ? 200  THR H O   1 
ATOM   8463  C CB  . THR E  3  200 ? 126.716 26.010 -15.061 1.00 27.59  ? 200  THR H CB  1 
ATOM   8464  O OG1 . THR E  3  200 ? 126.500 27.352 -15.508 1.00 28.73  ? 200  THR H OG1 1 
ATOM   8465  C CG2 . THR E  3  200 ? 125.911 25.875 -13.770 1.00 28.12  ? 200  THR H CG2 1 
ATOM   8466  N N   . LEU E  3  201 ? 128.678 24.343 -12.902 1.00 24.85  ? 201  LEU H N   1 
ATOM   8467  C CA  . LEU E  3  201 ? 128.779 23.084 -12.191 1.00 23.50  ? 201  LEU H CA  1 
ATOM   8468  C C   . LEU E  3  201 ? 127.667 23.110 -11.160 1.00 22.69  ? 201  LEU H C   1 
ATOM   8469  O O   . LEU E  3  201 ? 127.662 23.965 -10.273 1.00 21.94  ? 201  LEU H O   1 
ATOM   8470  C CB  . LEU E  3  201 ? 130.133 22.960 -11.492 1.00 23.44  ? 201  LEU H CB  1 
ATOM   8471  C CG  . LEU E  3  201 ? 131.423 23.067 -12.301 1.00 22.97  ? 201  LEU H CG  1 
ATOM   8472  C CD1 . LEU E  3  201 ? 132.610 23.061 -11.347 1.00 23.68  ? 201  LEU H CD1 1 
ATOM   8473  C CD2 . LEU E  3  201 ? 131.541 21.925 -13.269 1.00 22.89  ? 201  LEU H CD2 1 
ATOM   8474  N N   . ARG E  3  202 ? 126.703 22.208 -11.276 1.00 22.07  ? 202  ARG H N   1 
ATOM   8475  C CA  . ARG E  3  202 ? 125.623 22.204 -10.301 1.00 21.76  ? 202  ARG H CA  1 
ATOM   8476  C C   . ARG E  3  202 ? 125.742 21.000 -9.391  1.00 21.53  ? 202  ARG H C   1 
ATOM   8477  O O   . ARG E  3  202 ? 125.713 19.861 -9.847  1.00 21.37  ? 202  ARG H O   1 
ATOM   8478  C CB  . ARG E  3  202 ? 124.245 22.234 -10.973 1.00 21.82  ? 202  ARG H CB  1 
ATOM   8479  C CG  . ARG E  3  202 ? 123.239 23.142 -10.246 1.00 21.40  ? 202  ARG H CG  1 
ATOM   8480  C CD  . ARG E  3  202 ? 121.821 23.091 -10.798 1.00 20.37  ? 202  ARG H CD  1 
ATOM   8481  N NE  . ARG E  3  202 ? 121.765 23.392 -12.219 1.00 21.09  ? 202  ARG H NE  1 
ATOM   8482  C CZ  . ARG E  3  202 ? 122.003 24.580 -12.757 1.00 21.77  ? 202  ARG H CZ  1 
ATOM   8483  N NH1 . ARG E  3  202 ? 122.311 25.616 -11.999 1.00 21.78  ? 202  ARG H NH1 1 
ATOM   8484  N NH2 . ARG E  3  202 ? 121.942 24.732 -14.075 1.00 23.60  ? 202  ARG H NH2 1 
ATOM   8485  N N   . CYS E  3  203 ? 125.878 21.276 -8.099  1.00 21.25  ? 203  CYS H N   1 
ATOM   8486  C CA  . CYS E  3  203 ? 125.988 20.248 -7.079  1.00 21.26  ? 203  CYS H CA  1 
ATOM   8487  C C   . CYS E  3  203 ? 124.623 20.081 -6.436  1.00 20.88  ? 203  CYS H C   1 
ATOM   8488  O O   . CYS E  3  203 ? 124.055 21.041 -5.908  1.00 20.31  ? 203  CYS H O   1 
ATOM   8489  C CB  . CYS E  3  203 ? 127.008 20.679 -6.031  1.00 21.81  ? 203  CYS H CB  1 
ATOM   8490  S SG  . CYS E  3  203 ? 127.380 19.517 -4.708  1.00 21.75  ? 203  CYS H SG  1 
ATOM   8491  N N   . TRP E  3  204 ? 124.109 18.854 -6.479  1.00 20.28  ? 204  TRP H N   1 
ATOM   8492  C CA  . TRP E  3  204 ? 122.788 18.557 -5.958  1.00 19.78  ? 204  TRP H CA  1 
ATOM   8493  C C   . TRP E  3  204 ? 122.787 17.736 -4.697  1.00 18.66  ? 204  TRP H C   1 
ATOM   8494  O O   . TRP E  3  204 ? 123.587 16.812 -4.540  1.00 18.50  ? 204  TRP H O   1 
ATOM   8495  C CB  . TRP E  3  204 ? 121.997 17.752 -6.964  1.00 20.57  ? 204  TRP H CB  1 
ATOM   8496  C CG  . TRP E  3  204 ? 121.894 18.290 -8.325  1.00 22.43  ? 204  TRP H CG  1 
ATOM   8497  C CD1 . TRP E  3  204 ? 122.863 18.288 -9.290  1.00 23.76  ? 204  TRP H CD1 1 
ATOM   8498  C CD2 . TRP E  3  204 ? 120.720 18.828 -8.930  1.00 24.43  ? 204  TRP H CD2 1 
ATOM   8499  N NE1 . TRP E  3  204 ? 122.360 18.807 -10.460 1.00 25.53  ? 204  TRP H NE1 1 
ATOM   8500  C CE2 . TRP E  3  204 ? 121.044 19.149 -10.264 1.00 25.68  ? 204  TRP H CE2 1 
ATOM   8501  C CE3 . TRP E  3  204 ? 119.418 19.080 -8.476  1.00 25.47  ? 204  TRP H CE3 1 
ATOM   8502  C CZ2 . TRP E  3  204 ? 120.120 19.707 -11.143 1.00 26.84  ? 204  TRP H CZ2 1 
ATOM   8503  C CZ3 . TRP E  3  204 ? 118.498 19.635 -9.350  1.00 26.04  ? 204  TRP H CZ3 1 
ATOM   8504  C CH2 . TRP E  3  204 ? 118.852 19.945 -10.666 1.00 26.53  ? 204  TRP H CH2 1 
ATOM   8505  N N   . ALA E  3  205 ? 121.838 18.058 -3.825  1.00 17.20  ? 205  ALA H N   1 
ATOM   8506  C CA  . ALA E  3  205 ? 121.628 17.333 -2.592  1.00 15.96  ? 205  ALA H CA  1 
ATOM   8507  C C   . ALA E  3  205 ? 120.146 17.001 -2.598  1.00 15.26  ? 205  ALA H C   1 
ATOM   8508  O O   . ALA E  3  205 ? 119.311 17.910 -2.587  1.00 14.15  ? 205  ALA H O   1 
ATOM   8509  C CB  . ALA E  3  205 ? 121.982 18.187 -1.400  1.00 16.29  ? 205  ALA H CB  1 
ATOM   8510  N N   . LEU E  3  206 ? 119.830 15.706 -2.637  1.00 14.50  ? 206  LEU H N   1 
ATOM   8511  C CA  . LEU E  3  206 ? 118.460 15.232 -2.691  1.00 14.38  ? 206  LEU H CA  1 
ATOM   8512  C C   . LEU E  3  206 ? 118.156 14.186 -1.631  1.00 14.97  ? 206  LEU H C   1 
ATOM   8513  O O   . LEU E  3  206 ? 119.048 13.727 -0.925  1.00 15.82  ? 206  LEU H O   1 
ATOM   8514  C CB  . LEU E  3  206 ? 118.205 14.591 -4.045  1.00 14.89  ? 206  LEU H CB  1 
ATOM   8515  C CG  . LEU E  3  206 ? 118.633 15.365 -5.285  1.00 13.51  ? 206  LEU H CG  1 
ATOM   8516  C CD1 . LEU E  3  206 ? 118.681 14.388 -6.430  1.00 12.62  ? 206  LEU H CD1 1 
ATOM   8517  C CD2 . LEU E  3  206 ? 117.658 16.504 -5.540  1.00 11.65  ? 206  LEU H CD2 1 
ATOM   8518  N N   . GLY E  3  207 ? 116.886 13.808 -1.539  1.00 14.90  ? 207  GLY H N   1 
ATOM   8519  C CA  . GLY E  3  207 ? 116.427 12.806 -0.591  1.00 14.89  ? 207  GLY H CA  1 
ATOM   8520  C C   . GLY E  3  207 ? 116.802 12.946 0.873   1.00 15.04  ? 207  GLY H C   1 
ATOM   8521  O O   . GLY E  3  207 ? 116.681 11.974 1.619   1.00 14.85  ? 207  GLY H O   1 
ATOM   8522  N N   . PHE E  3  208 ? 117.228 14.132 1.304   1.00 15.53  ? 208  PHE H N   1 
ATOM   8523  C CA  . PHE E  3  208 ? 117.639 14.319 2.694   1.00 15.44  ? 208  PHE H CA  1 
ATOM   8524  C C   . PHE E  3  208 ? 116.561 14.743 3.680   1.00 15.43  ? 208  PHE H C   1 
ATOM   8525  O O   . PHE E  3  208 ? 115.544 15.300 3.305   1.00 15.50  ? 208  PHE H O   1 
ATOM   8526  C CB  . PHE E  3  208 ? 118.849 15.261 2.796   1.00 15.97  ? 208  PHE H CB  1 
ATOM   8527  C CG  . PHE E  3  208 ? 118.621 16.664 2.270   1.00 15.83  ? 208  PHE H CG  1 
ATOM   8528  C CD1 . PHE E  3  208 ? 118.325 17.704 3.140   1.00 16.20  ? 208  PHE H CD1 1 
ATOM   8529  C CD2 . PHE E  3  208 ? 118.777 16.952 0.921   1.00 15.30  ? 208  PHE H CD2 1 
ATOM   8530  C CE1 . PHE E  3  208 ? 118.153 18.997 2.674   1.00 15.87  ? 208  PHE H CE1 1 
ATOM   8531  C CE2 . PHE E  3  208 ? 118.605 18.242 0.448   1.00 15.22  ? 208  PHE H CE2 1 
ATOM   8532  C CZ  . PHE E  3  208 ? 118.293 19.266 1.317   1.00 15.79  ? 208  PHE H CZ  1 
ATOM   8533  N N   . TYR E  3  209 ? 116.792 14.413 4.952   1.00 15.43  ? 209  TYR H N   1 
ATOM   8534  C CA  . TYR E  3  209 ? 115.901 14.784 6.045   1.00 15.17  ? 209  TYR H CA  1 
ATOM   8535  C C   . TYR E  3  209 ? 116.702 14.872 7.337   1.00 15.71  ? 209  TYR H C   1 
ATOM   8536  O O   . TYR E  3  209 ? 117.515 13.995 7.607   1.00 16.03  ? 209  TYR H O   1 
ATOM   8537  C CB  . TYR E  3  209 ? 114.771 13.762 6.239   1.00 14.60  ? 209  TYR H CB  1 
ATOM   8538  C CG  . TYR E  3  209 ? 113.845 14.178 7.364   1.00 12.64  ? 209  TYR H CG  1 
ATOM   8539  C CD1 . TYR E  3  209 ? 112.722 14.960 7.111   1.00 12.50  ? 209  TYR H CD1 1 
ATOM   8540  C CD2 . TYR E  3  209 ? 114.127 13.849 8.680   1.00 12.14  ? 209  TYR H CD2 1 
ATOM   8541  C CE1 . TYR E  3  209 ? 111.902 15.379 8.134   1.00 12.13  ? 209  TYR H CE1 1 
ATOM   8542  C CE2 . TYR E  3  209 ? 113.305 14.256 9.717   1.00 10.37  ? 209  TYR H CE2 1 
ATOM   8543  C CZ  . TYR E  3  209 ? 112.203 15.022 9.437   1.00 12.25  ? 209  TYR H CZ  1 
ATOM   8544  O OH  . TYR E  3  209 ? 111.395 15.453 10.454  1.00 14.45  ? 209  TYR H OH  1 
ATOM   8545  N N   . PRO E  3  210 ? 116.476 15.907 8.149   1.00 16.44  ? 210  PRO H N   1 
ATOM   8546  C CA  . PRO E  3  210 ? 115.557 17.008 7.859   1.00 16.48  ? 210  PRO H CA  1 
ATOM   8547  C C   . PRO E  3  210 ? 116.141 18.004 6.875   1.00 16.70  ? 210  PRO H C   1 
ATOM   8548  O O   . PRO E  3  210 ? 117.203 17.760 6.299   1.00 17.05  ? 210  PRO H O   1 
ATOM   8549  C CB  . PRO E  3  210 ? 115.358 17.646 9.237   1.00 16.39  ? 210  PRO H CB  1 
ATOM   8550  C CG  . PRO E  3  210 ? 116.624 17.434 9.891   1.00 16.90  ? 210  PRO H CG  1 
ATOM   8551  C CD  . PRO E  3  210 ? 116.966 16.001 9.532   1.00 16.88  ? 210  PRO H CD  1 
ATOM   8552  N N   . ALA E  3  211 ? 115.455 19.129 6.712   1.00 16.49  ? 211  ALA H N   1 
ATOM   8553  C CA  . ALA E  3  211 ? 115.824 20.142 5.748   1.00 16.83  ? 211  ALA H CA  1 
ATOM   8554  C C   . ALA E  3  211 ? 117.149 20.859 5.992   1.00 17.30  ? 211  ALA H C   1 
ATOM   8555  O O   . ALA E  3  211 ? 117.833 21.209 5.039   1.00 16.76  ? 211  ALA H O   1 
ATOM   8556  C CB  . ALA E  3  211 ? 114.689 21.139 5.623   1.00 17.12  ? 211  ALA H CB  1 
ATOM   8557  N N   . ASP E  3  212 ? 117.493 21.107 7.253   1.00 18.56  ? 212  ASP H N   1 
ATOM   8558  C CA  . ASP E  3  212 ? 118.755 21.770 7.590   1.00 19.53  ? 212  ASP H CA  1 
ATOM   8559  C C   . ASP E  3  212 ? 119.901 21.109 6.835   1.00 18.97  ? 212  ASP H C   1 
ATOM   8560  O O   . ASP E  3  212 ? 120.187 19.930 7.023   1.00 19.09  ? 212  ASP H O   1 
ATOM   8561  C CB  . ASP E  3  212 ? 119.036 21.683 9.089   1.00 20.36  ? 212  ASP H CB  1 
ATOM   8562  C CG  . ASP E  3  212 ? 117.805 21.913 9.920   1.00 23.95  ? 212  ASP H CG  1 
ATOM   8563  O OD1 . ASP E  3  212 ? 117.891 22.659 10.921  1.00 29.75  ? 212  ASP H OD1 1 
ATOM   8564  O OD2 . ASP E  3  212 ? 116.710 21.374 9.641   1.00 27.11  ? 212  ASP H OD2 1 
ATOM   8565  N N   . ILE E  3  213 ? 120.555 21.869 5.973   1.00 18.61  ? 213  ILE H N   1 
ATOM   8566  C CA  . ILE E  3  213 ? 121.655 21.343 5.194   1.00 18.25  ? 213  ILE H CA  1 
ATOM   8567  C C   . ILE E  3  213 ? 122.497 22.525 4.796   1.00 18.85  ? 213  ILE H C   1 
ATOM   8568  O O   . ILE E  3  213 ? 122.124 23.665 5.040   1.00 19.48  ? 213  ILE H O   1 
ATOM   8569  C CB  . ILE E  3  213 ? 121.138 20.616 3.947   1.00 17.82  ? 213  ILE H CB  1 
ATOM   8570  C CG1 . ILE E  3  213 ? 122.252 19.772 3.330   1.00 15.70  ? 213  ILE H CG1 1 
ATOM   8571  C CG2 . ILE E  3  213 ? 120.615 21.624 2.938   1.00 17.69  ? 213  ILE H CG2 1 
ATOM   8572  C CD1 . ILE E  3  213 ? 121.781 18.838 2.248   1.00 13.96  ? 213  ILE H CD1 1 
ATOM   8573  N N   . THR E  3  214 ? 123.641 22.266 4.190   1.00 19.56  ? 214  THR H N   1 
ATOM   8574  C CA  . THR E  3  214 ? 124.521 23.341 3.765   1.00 19.90  ? 214  THR H CA  1 
ATOM   8575  C C   . THR E  3  214 ? 125.396 22.871 2.633   1.00 20.03  ? 214  THR H C   1 
ATOM   8576  O O   . THR E  3  214 ? 126.071 21.859 2.745   1.00 19.95  ? 214  THR H O   1 
ATOM   8577  C CB  . THR E  3  214 ? 125.440 23.767 4.910   1.00 19.94  ? 214  THR H CB  1 
ATOM   8578  O OG1 . THR E  3  214 ? 124.674 24.349 5.969   1.00 20.08  ? 214  THR H OG1 1 
ATOM   8579  C CG2 . THR E  3  214 ? 126.400 24.832 4.438   1.00 19.93  ? 214  THR H CG2 1 
ATOM   8580  N N   . LEU E  3  215 ? 125.402 23.625 1.551   1.00 21.03  ? 215  LEU H N   1 
ATOM   8581  C CA  . LEU E  3  215 ? 126.227 23.292 0.407   1.00 21.58  ? 215  LEU H CA  1 
ATOM   8582  C C   . LEU E  3  215 ? 127.190 24.459 0.166   1.00 21.90  ? 215  LEU H C   1 
ATOM   8583  O O   . LEU E  3  215 ? 126.814 25.623 0.329   1.00 21.96  ? 215  LEU H O   1 
ATOM   8584  C CB  . LEU E  3  215 ? 125.350 23.070 -0.825  1.00 21.56  ? 215  LEU H CB  1 
ATOM   8585  C CG  . LEU E  3  215 ? 124.099 22.197 -0.728  1.00 22.67  ? 215  LEU H CG  1 
ATOM   8586  C CD1 . LEU E  3  215 ? 123.376 22.198 -2.067  1.00 23.45  ? 215  LEU H CD1 1 
ATOM   8587  C CD2 . LEU E  3  215 ? 124.435 20.779 -0.338  1.00 24.14  ? 215  LEU H CD2 1 
ATOM   8588  N N   . THR E  3  216 ? 128.431 24.161 -0.202  1.00 22.37  ? 216  THR H N   1 
ATOM   8589  C CA  . THR E  3  216 ? 129.398 25.214 -0.512  1.00 23.05  ? 216  THR H CA  1 
ATOM   8590  C C   . THR E  3  216 ? 130.336 24.742 -1.610  1.00 23.77  ? 216  THR H C   1 
ATOM   8591  O O   . THR E  3  216 ? 130.599 23.549 -1.738  1.00 24.12  ? 216  THR H O   1 
ATOM   8592  C CB  . THR E  3  216 ? 130.279 25.587 0.689   1.00 22.92  ? 216  THR H CB  1 
ATOM   8593  O OG1 . THR E  3  216 ? 131.201 24.521 0.936   1.00 23.61  ? 216  THR H OG1 1 
ATOM   8594  C CG2 . THR E  3  216 ? 129.469 25.782 1.978   1.00 23.01  ? 216  THR H CG2 1 
ATOM   8595  N N   . TRP E  3  217 ? 130.850 25.682 -2.396  1.00 24.46  ? 217  TRP H N   1 
ATOM   8596  C CA  . TRP E  3  217 ? 131.818 25.355 -3.432  1.00 24.97  ? 217  TRP H CA  1 
ATOM   8597  C C   . TRP E  3  217 ? 133.193 25.829 -2.998  1.00 26.42  ? 217  TRP H C   1 
ATOM   8598  O O   . TRP E  3  217 ? 133.330 26.896 -2.403  1.00 25.78  ? 217  TRP H O   1 
ATOM   8599  C CB  . TRP E  3  217 ? 131.453 25.998 -4.775  1.00 24.32  ? 217  TRP H CB  1 
ATOM   8600  C CG  . TRP E  3  217 ? 130.579 25.108 -5.595  1.00 23.14  ? 217  TRP H CG  1 
ATOM   8601  C CD1 . TRP E  3  217 ? 129.238 25.235 -5.801  1.00 22.06  ? 217  TRP H CD1 1 
ATOM   8602  C CD2 . TRP E  3  217 ? 130.979 23.922 -6.282  1.00 21.42  ? 217  TRP H CD2 1 
ATOM   8603  N NE1 . TRP E  3  217 ? 128.779 24.202 -6.583  1.00 22.02  ? 217  TRP H NE1 1 
ATOM   8604  C CE2 . TRP E  3  217 ? 129.830 23.383 -6.895  1.00 21.90  ? 217  TRP H CE2 1 
ATOM   8605  C CE3 . TRP E  3  217 ? 132.198 23.258 -6.444  1.00 21.38  ? 217  TRP H CE3 1 
ATOM   8606  C CZ2 . TRP E  3  217 ? 129.863 22.212 -7.655  1.00 22.20  ? 217  TRP H CZ2 1 
ATOM   8607  C CZ3 . TRP E  3  217 ? 132.233 22.090 -7.197  1.00 20.95  ? 217  TRP H CZ3 1 
ATOM   8608  C CH2 . TRP E  3  217 ? 131.074 21.581 -7.794  1.00 21.58  ? 217  TRP H CH2 1 
ATOM   8609  N N   . GLN E  3  218 ? 134.208 25.038 -3.321  1.00 28.49  ? 218  GLN H N   1 
ATOM   8610  C CA  . GLN E  3  218 ? 135.575 25.371 -2.960  1.00 30.78  ? 218  GLN H CA  1 
ATOM   8611  C C   . GLN E  3  218 ? 136.536 25.545 -4.133  1.00 32.35  ? 218  GLN H C   1 
ATOM   8612  O O   . GLN E  3  218 ? 136.649 24.665 -4.991  1.00 32.77  ? 218  GLN H O   1 
ATOM   8613  C CB  . GLN E  3  218 ? 136.133 24.289 -2.045  1.00 30.92  ? 218  GLN H CB  1 
ATOM   8614  C CG  . GLN E  3  218 ? 135.696 24.432 -0.616  1.00 32.10  ? 218  GLN H CG  1 
ATOM   8615  C CD  . GLN E  3  218 ? 136.371 23.440 0.289   1.00 32.17  ? 218  GLN H CD  1 
ATOM   8616  O OE1 . GLN E  3  218 ? 137.453 22.942 -0.021  1.00 32.78  ? 218  GLN H OE1 1 
ATOM   8617  N NE2 . GLN E  3  218 ? 135.738 23.144 1.413   1.00 32.43  ? 218  GLN H NE2 1 
ATOM   8618  N N   . LEU E  3  219 ? 137.236 26.680 -4.144  1.00 33.91  ? 219  LEU H N   1 
ATOM   8619  C CA  . LEU E  3  219 ? 138.269 26.948 -5.141  1.00 35.32  ? 219  LEU H CA  1 
ATOM   8620  C C   . LEU E  3  219 ? 139.614 26.956 -4.423  1.00 36.96  ? 219  LEU H C   1 
ATOM   8621  O O   . LEU E  3  219 ? 139.948 27.915 -3.724  1.00 36.89  ? 219  LEU H O   1 
ATOM   8622  C CB  . LEU E  3  219 ? 138.069 28.292 -5.835  1.00 34.99  ? 219  LEU H CB  1 
ATOM   8623  C CG  . LEU E  3  219 ? 139.202 28.706 -6.790  1.00 33.99  ? 219  LEU H CG  1 
ATOM   8624  C CD1 . LEU E  3  219 ? 139.514 27.605 -7.789  1.00 32.95  ? 219  LEU H CD1 1 
ATOM   8625  C CD2 . LEU E  3  219 ? 138.827 29.984 -7.518  1.00 33.57  ? 219  LEU H CD2 1 
ATOM   8626  N N   . ASN E  3  220 ? 140.372 25.880 -4.603  1.00 38.88  ? 220  ASN H N   1 
ATOM   8627  C CA  . ASN E  3  220 ? 141.679 25.714 -3.977  1.00 40.64  ? 220  ASN H CA  1 
ATOM   8628  C C   . ASN E  3  220 ? 141.728 26.074 -2.494  1.00 41.75  ? 220  ASN H C   1 
ATOM   8629  O O   . ASN E  3  220 ? 142.447 26.985 -2.098  1.00 41.59  ? 220  ASN H O   1 
ATOM   8630  C CB  . ASN E  3  220 ? 142.765 26.478 -4.750  1.00 40.92  ? 220  ASN H CB  1 
ATOM   8631  C CG  . ASN E  3  220 ? 142.458 27.958 -4.929  1.00 41.76  ? 220  ASN H CG  1 
ATOM   8632  O OD1 . ASN E  3  220 ? 142.635 28.492 -6.043  1.00 42.39  ? 220  ASN H OD1 1 
ATOM   8633  N ND2 . ASN E  3  220 ? 142.040 28.629 -3.879  1.00 41.96  ? 220  ASN H ND2 1 
ATOM   8634  N N   . GLY E  3  221 ? 140.966 25.350 -1.679  1.00 43.38  ? 221  GLY H N   1 
ATOM   8635  C CA  . GLY E  3  221 ? 140.949 25.589 -0.245  1.00 44.72  ? 221  GLY H CA  1 
ATOM   8636  C C   . GLY E  3  221 ? 139.895 26.566 0.245   1.00 46.07  ? 221  GLY H C   1 
ATOM   8637  O O   . GLY E  3  221 ? 139.252 26.321 1.263   1.00 46.31  ? 221  GLY H O   1 
ATOM   8638  N N   . GLU E  3  222 ? 139.726 27.681 -0.457  1.00 47.57  ? 222  GLU H N   1 
ATOM   8639  C CA  . GLU E  3  222 ? 138.744 28.679 -0.057  1.00 48.84  ? 222  GLU H CA  1 
ATOM   8640  C C   . GLU E  3  222 ? 137.396 28.401 -0.706  1.00 49.23  ? 222  GLU H C   1 
ATOM   8641  O O   . GLU E  3  222 ? 137.321 27.951 -1.850  1.00 49.13  ? 222  GLU H O   1 
ATOM   8642  C CB  . GLU E  3  222 ? 139.199 30.092 -0.435  1.00 49.48  ? 222  GLU H CB  1 
ATOM   8643  C CG  . GLU E  3  222 ? 140.524 30.526 0.171   1.00 51.15  ? 222  GLU H CG  1 
ATOM   8644  C CD  . GLU E  3  222 ? 141.713 29.907 -0.526  1.00 52.92  ? 222  GLU H CD  1 
ATOM   8645  O OE1 . GLU E  3  222 ? 141.534 29.371 -1.641  1.00 54.41  ? 222  GLU H OE1 1 
ATOM   8646  O OE2 . GLU E  3  222 ? 142.827 29.960 0.036   1.00 54.23  ? 222  GLU H OE2 1 
ATOM   8647  N N   . GLU E  3  223 ? 136.334 28.688 0.038   1.00 49.74  ? 223  GLU H N   1 
ATOM   8648  C CA  . GLU E  3  223 ? 134.980 28.485 -0.439  1.00 50.18  ? 223  GLU H CA  1 
ATOM   8649  C C   . GLU E  3  223 ? 134.488 29.748 -1.125  1.00 50.62  ? 223  GLU H C   1 
ATOM   8650  O O   . GLU E  3  223 ? 134.519 30.831 -0.545  1.00 50.71  ? 223  GLU H O   1 
ATOM   8651  C CB  . GLU E  3  223 ? 134.050 28.111 0.722   1.00 50.31  ? 223  GLU H CB  1 
ATOM   8652  C CG  . GLU E  3  223 ? 133.753 29.241 1.697   1.00 50.07  ? 223  GLU H CG  1 
ATOM   8653  C CD  . GLU E  3  223 ? 132.989 28.770 2.919   1.00 49.80  ? 223  GLU H CD  1 
ATOM   8654  O OE1 . GLU E  3  223 ? 132.468 29.626 3.663   1.00 49.07  ? 223  GLU H OE1 1 
ATOM   8655  O OE2 . GLU E  3  223 ? 132.912 27.542 3.140   1.00 50.16  ? 223  GLU H OE2 1 
ATOM   8656  N N   . LEU E  3  224 ? 134.028 29.590 -2.362  1.00 51.20  ? 224  LEU H N   1 
ATOM   8657  C CA  . LEU E  3  224 ? 133.538 30.697 -3.176  1.00 51.53  ? 224  LEU H CA  1 
ATOM   8658  C C   . LEU E  3  224 ? 132.214 31.281 -2.682  1.00 52.09  ? 224  LEU H C   1 
ATOM   8659  O O   . LEU E  3  224 ? 131.176 30.628 -2.728  1.00 52.06  ? 224  LEU H O   1 
ATOM   8660  C CB  . LEU E  3  224 ? 133.382 30.226 -4.618  1.00 51.39  ? 224  LEU H CB  1 
ATOM   8661  C CG  . LEU E  3  224 ? 134.622 29.505 -5.149  1.00 50.93  ? 224  LEU H CG  1 
ATOM   8662  C CD1 . LEU E  3  224 ? 134.368 28.951 -6.536  1.00 50.52  ? 224  LEU H CD1 1 
ATOM   8663  C CD2 . LEU E  3  224 ? 135.794 30.467 -5.148  1.00 51.03  ? 224  LEU H CD2 1 
ATOM   8664  N N   . ILE E  3  225 ? 132.269 32.528 -2.226  1.00 52.70  ? 225  ILE H N   1 
ATOM   8665  C CA  . ILE E  3  225 ? 131.097 33.241 -1.726  1.00 53.25  ? 225  ILE H CA  1 
ATOM   8666  C C   . ILE E  3  225 ? 130.517 34.149 -2.810  1.00 53.05  ? 225  ILE H C   1 
ATOM   8667  O O   . ILE E  3  225 ? 129.357 34.552 -2.744  1.00 53.05  ? 225  ILE H O   1 
ATOM   8668  C CB  . ILE E  3  225 ? 131.486 34.091 -0.495  1.00 53.64  ? 225  ILE H CB  1 
ATOM   8669  C CG1 . ILE E  3  225 ? 130.354 35.060 -0.127  1.00 53.98  ? 225  ILE H CG1 1 
ATOM   8670  C CG2 . ILE E  3  225 ? 132.773 34.856 -0.781  1.00 54.43  ? 225  ILE H CG2 1 
ATOM   8671  C CD1 . ILE E  3  225 ? 130.659 35.939 1.071   1.00 54.25  ? 225  ILE H CD1 1 
ATOM   8672  N N   . GLN E  3  226 ? 131.337 34.456 -3.808  1.00 52.95  ? 226  GLN H N   1 
ATOM   8673  C CA  . GLN E  3  226 ? 130.960 35.350 -4.900  1.00 52.68  ? 226  GLN H CA  1 
ATOM   8674  C C   . GLN E  3  226 ? 129.721 34.962 -5.698  1.00 51.95  ? 226  GLN H C   1 
ATOM   8675  O O   . GLN E  3  226 ? 128.633 34.795 -5.152  1.00 52.04  ? 226  GLN H O   1 
ATOM   8676  C CB  . GLN E  3  226 ? 132.137 35.504 -5.865  1.00 53.01  ? 226  GLN H CB  1 
ATOM   8677  C CG  . GLN E  3  226 ? 133.387 36.039 -5.220  1.00 54.15  ? 226  GLN H CG  1 
ATOM   8678  C CD  . GLN E  3  226 ? 133.085 37.128 -4.212  1.00 55.65  ? 226  GLN H CD  1 
ATOM   8679  O OE1 . GLN E  3  226 ? 132.482 38.149 -4.550  1.00 56.57  ? 226  GLN H OE1 1 
ATOM   8680  N NE2 . GLN E  3  226 ? 133.493 36.912 -2.968  1.00 56.35  ? 226  GLN H NE2 1 
ATOM   8681  N N   . ASP E  3  227 ? 129.915 34.848 -7.008  1.00 50.97  ? 227  ASP H N   1 
ATOM   8682  C CA  . ASP E  3  227 ? 128.865 34.545 -7.966  1.00 50.01  ? 227  ASP H CA  1 
ATOM   8683  C C   . ASP E  3  227 ? 128.327 33.126 -7.842  1.00 48.49  ? 227  ASP H C   1 
ATOM   8684  O O   . ASP E  3  227 ? 128.075 32.454 -8.844  1.00 48.47  ? 227  ASP H O   1 
ATOM   8685  C CB  . ASP E  3  227 ? 129.422 34.763 -9.368  1.00 50.44  ? 227  ASP H CB  1 
ATOM   8686  C CG  . ASP E  3  227 ? 130.593 35.721 -9.375  1.00 51.32  ? 227  ASP H CG  1 
ATOM   8687  O OD1 . ASP E  3  227 ? 131.644 35.372 -8.791  1.00 52.24  ? 227  ASP H OD1 1 
ATOM   8688  O OD2 . ASP E  3  227 ? 130.535 36.841 -9.926  1.00 51.77  ? 227  ASP H OD2 1 
ATOM   8689  N N   . MET E  3  228 ? 128.136 32.677 -6.609  1.00 46.45  ? 228  MET H N   1 
ATOM   8690  C CA  . MET E  3  228 ? 127.620 31.343 -6.369  1.00 44.68  ? 228  MET H CA  1 
ATOM   8691  C C   . MET E  3  228 ? 126.138 31.408 -6.023  1.00 42.72  ? 228  MET H C   1 
ATOM   8692  O O   . MET E  3  228 ? 125.737 32.096 -5.081  1.00 42.72  ? 228  MET H O   1 
ATOM   8693  C CB  . MET E  3  228 ? 128.408 30.667 -5.254  1.00 44.85  ? 228  MET H CB  1 
ATOM   8694  C CG  . MET E  3  228 ? 128.014 29.230 -5.044  1.00 45.48  ? 228  MET H CG  1 
ATOM   8695  S SD  . MET E  3  228 ? 126.589 29.077 -3.982  1.00 46.18  ? 228  MET H SD  1 
ATOM   8696  C CE  . MET E  3  228 ? 127.395 28.408 -2.519  1.00 45.18  ? 228  MET H CE  1 
ATOM   8697  N N   . GLU E  3  229 ? 125.330 30.692 -6.801  1.00 40.01  ? 229  GLU H N   1 
ATOM   8698  C CA  . GLU E  3  229 ? 123.890 30.663 -6.605  1.00 37.75  ? 229  GLU H CA  1 
ATOM   8699  C C   . GLU E  3  229 ? 123.392 29.354 -5.994  1.00 35.16  ? 229  GLU H C   1 
ATOM   8700  O O   . GLU E  3  229 ? 123.865 28.266 -6.327  1.00 34.14  ? 229  GLU H O   1 
ATOM   8701  C CB  . GLU E  3  229 ? 123.183 30.910 -7.934  1.00 38.45  ? 229  GLU H CB  1 
ATOM   8702  C CG  . GLU E  3  229 ? 121.706 30.551 -7.918  1.00 39.99  ? 229  GLU H CG  1 
ATOM   8703  C CD  . GLU E  3  229 ? 120.974 31.039 -9.146  1.00 41.45  ? 229  GLU H CD  1 
ATOM   8704  O OE1 . GLU E  3  229 ? 121.396 30.683 -10.272 1.00 42.58  ? 229  GLU H OE1 1 
ATOM   8705  O OE2 . GLU E  3  229 ? 119.980 31.780 -8.977  1.00 42.15  ? 229  GLU H OE2 1 
ATOM   8706  N N   . LEU E  3  230 ? 122.416 29.484 -5.103  1.00 32.41  ? 230  LEU H N   1 
ATOM   8707  C CA  . LEU E  3  230 ? 121.821 28.341 -4.419  1.00 30.25  ? 230  LEU H CA  1 
ATOM   8708  C C   . LEU E  3  230 ? 120.342 28.604 -4.148  1.00 27.69  ? 230  LEU H C   1 
ATOM   8709  O O   . LEU E  3  230 ? 119.982 29.657 -3.618  1.00 27.37  ? 230  LEU H O   1 
ATOM   8710  C CB  . LEU E  3  230 ? 122.554 28.068 -3.100  1.00 30.54  ? 230  LEU H CB  1 
ATOM   8711  C CG  . LEU E  3  230 ? 122.276 28.998 -1.927  1.00 30.66  ? 230  LEU H CG  1 
ATOM   8712  C CD1 . LEU E  3  230 ? 123.206 28.640 -0.765  1.00 30.84  ? 230  LEU H CD1 1 
ATOM   8713  C CD2 . LEU E  3  230 ? 122.468 30.443 -2.346  1.00 30.93  ? 230  LEU H CD2 1 
ATOM   8714  N N   . VAL E  3  231 ? 119.488 27.650 -4.519  1.00 24.57  ? 231  VAL H N   1 
ATOM   8715  C CA  . VAL E  3  231 ? 118.045 27.785 -4.317  1.00 22.05  ? 231  VAL H CA  1 
ATOM   8716  C C   . VAL E  3  231 ? 117.600 27.446 -2.898  1.00 20.49  ? 231  VAL H C   1 
ATOM   8717  O O   . VAL E  3  231 ? 118.298 26.745 -2.185  1.00 20.01  ? 231  VAL H O   1 
ATOM   8718  C CB  . VAL E  3  231 ? 117.252 26.870 -5.262  1.00 21.35  ? 231  VAL H CB  1 
ATOM   8719  C CG1 . VAL E  3  231 ? 117.356 27.364 -6.699  1.00 21.90  ? 231  VAL H CG1 1 
ATOM   8720  C CG2 . VAL E  3  231 ? 117.733 25.436 -5.123  1.00 19.86  ? 231  VAL H CG2 1 
ATOM   8721  N N   . GLU E  3  232 ? 116.428 27.944 -2.510  1.00 19.16  ? 232  GLU H N   1 
ATOM   8722  C CA  . GLU E  3  232 ? 115.846 27.627 -1.214  1.00 18.50  ? 232  GLU H CA  1 
ATOM   8723  C C   . GLU E  3  232 ? 115.734 26.108 -1.182  1.00 16.86  ? 232  GLU H C   1 
ATOM   8724  O O   . GLU E  3  232 ? 115.384 25.494 -2.183  1.00 16.82  ? 232  GLU H O   1 
ATOM   8725  C CB  . GLU E  3  232 ? 114.420 28.181 -1.080  1.00 18.93  ? 232  GLU H CB  1 
ATOM   8726  C CG  . GLU E  3  232 ? 114.232 29.638 -0.672  1.00 21.54  ? 232  GLU H CG  1 
ATOM   8727  C CD  . GLU E  3  232 ? 112.754 29.952 -0.388  1.00 24.78  ? 232  GLU H CD  1 
ATOM   8728  O OE1 . GLU E  3  232 ? 112.198 29.452 0.622   1.00 26.59  ? 232  GLU H OE1 1 
ATOM   8729  O OE2 . GLU E  3  232 ? 112.124 30.677 -1.181  1.00 26.02  ? 232  GLU H OE2 1 
ATOM   8730  N N   . THR E  3  233 ? 116.022 25.491 -0.051  1.00 15.25  ? 233  THR H N   1 
ATOM   8731  C CA  . THR E  3  233 ? 115.854 24.059 0.029   1.00 13.90  ? 233  THR H CA  1 
ATOM   8732  C C   . THR E  3  233 ? 114.385 23.924 -0.271  1.00 13.81  ? 233  THR H C   1 
ATOM   8733  O O   . THR E  3  233 ? 113.612 24.831 0.050   1.00 13.05  ? 233  THR H O   1 
ATOM   8734  C CB  . THR E  3  233 ? 116.069 23.532 1.431   1.00 13.54  ? 233  THR H CB  1 
ATOM   8735  O OG1 . THR E  3  233 ? 117.350 23.937 1.916   1.00 12.54  ? 233  THR H OG1 1 
ATOM   8736  C CG2 . THR E  3  233 ? 116.025 21.996 1.435   1.00 12.64  ? 233  THR H CG2 1 
ATOM   8737  N N   . ARG E  3  234 ? 113.982 22.798 -0.845  1.00 13.24  ? 234  ARG H N   1 
ATOM   8738  C CA  . ARG E  3  234 ? 112.587 22.615 -1.205  1.00 13.28  ? 234  ARG H CA  1 
ATOM   8739  C C   . ARG E  3  234 ? 112.156 21.176 -0.928  1.00 13.21  ? 234  ARG H C   1 
ATOM   8740  O O   . ARG E  3  234 ? 113.005 20.275 -0.850  1.00 13.23  ? 234  ARG H O   1 
ATOM   8741  C CB  . ARG E  3  234 ? 112.392 22.953 -2.687  1.00 13.30  ? 234  ARG H CB  1 
ATOM   8742  C CG  . ARG E  3  234 ? 113.063 21.951 -3.636  1.00 14.09  ? 234  ARG H CG  1 
ATOM   8743  C CD  . ARG E  3  234 ? 113.531 22.540 -4.957  1.00 13.76  ? 234  ARG H CD  1 
ATOM   8744  N NE  . ARG E  3  234 ? 113.957 21.507 -5.912  1.00 13.27  ? 234  ARG H NE  1 
ATOM   8745  C CZ  . ARG E  3  234 ? 114.530 21.759 -7.085  1.00 12.73  ? 234  ARG H CZ  1 
ATOM   8746  N NH1 . ARG E  3  234 ? 114.772 23.007 -7.457  1.00 10.74  ? 234  ARG H NH1 1 
ATOM   8747  N NH2 . ARG E  3  234 ? 114.859 20.762 -7.900  1.00 14.69  ? 234  ARG H NH2 1 
ATOM   8748  N N   . PRO E  3  235 ? 110.855 20.983 -0.701  1.00 13.15  ? 235  PRO H N   1 
ATOM   8749  C CA  . PRO E  3  235 ? 110.237 19.668 -0.464  1.00 13.17  ? 235  PRO H CA  1 
ATOM   8750  C C   . PRO E  3  235 ? 110.092 18.777 -1.695  1.00 13.51  ? 235  PRO H C   1 
ATOM   8751  O O   . PRO E  3  235 ? 109.656 19.215 -2.745  1.00 14.40  ? 235  PRO H O   1 
ATOM   8752  C CB  . PRO E  3  235 ? 108.867 20.041 0.101   1.00 12.61  ? 235  PRO H CB  1 
ATOM   8753  C CG  . PRO E  3  235 ? 108.583 21.350 -0.483  1.00 12.93  ? 235  PRO H CG  1 
ATOM   8754  C CD  . PRO E  3  235 ? 109.903 22.066 -0.413  1.00 13.01  ? 235  PRO H CD  1 
ATOM   8755  N N   . ALA E  3  236 ? 110.495 17.523 -1.565  1.00 14.27  ? 236  ALA H N   1 
ATOM   8756  C CA  . ALA E  3  236 ? 110.390 16.579 -2.656  1.00 14.54  ? 236  ALA H CA  1 
ATOM   8757  C C   . ALA E  3  236 ? 108.909 16.224 -2.783  1.00 15.59  ? 236  ALA H C   1 
ATOM   8758  O O   . ALA E  3  236 ? 108.383 16.047 -3.884  1.00 15.22  ? 236  ALA H O   1 
ATOM   8759  C CB  . ALA E  3  236 ? 111.204 15.353 -2.343  1.00 14.83  ? 236  ALA H CB  1 
ATOM   8760  N N   . GLY E  3  237 ? 108.246 16.149 -1.628  1.00 16.56  ? 237  GLY H N   1 
ATOM   8761  C CA  . GLY E  3  237 ? 106.829 15.849 -1.552  1.00 17.31  ? 237  GLY H CA  1 
ATOM   8762  C C   . GLY E  3  237 ? 106.520 14.595 -0.762  1.00 18.03  ? 237  GLY H C   1 
ATOM   8763  O O   . GLY E  3  237 ? 105.354 14.311 -0.466  1.00 18.32  ? 237  GLY H O   1 
ATOM   8764  N N   . ASP E  3  238 ? 107.567 13.851 -0.420  1.00 18.71  ? 238  ASP H N   1 
ATOM   8765  C CA  . ASP E  3  238 ? 107.441 12.601 0.321   1.00 19.01  ? 238  ASP H CA  1 
ATOM   8766  C C   . ASP E  3  238 ? 108.125 12.679 1.668   1.00 18.99  ? 238  ASP H C   1 
ATOM   8767  O O   . ASP E  3  238 ? 108.478 11.655 2.241   1.00 19.67  ? 238  ASP H O   1 
ATOM   8768  C CB  . ASP E  3  238 ? 108.082 11.464 -0.468  1.00 19.35  ? 238  ASP H CB  1 
ATOM   8769  C CG  . ASP E  3  238 ? 109.547 11.714 -0.774  1.00 21.33  ? 238  ASP H CG  1 
ATOM   8770  O OD1 . ASP E  3  238 ? 110.191 12.562 -0.107  1.00 23.39  ? 238  ASP H OD1 1 
ATOM   8771  O OD2 . ASP E  3  238 ? 110.130 11.083 -1.677  1.00 24.35  ? 238  ASP H OD2 1 
ATOM   8772  N N   . GLY E  3  239 ? 108.344 13.883 2.169   1.00 18.70  ? 239  GLY H N   1 
ATOM   8773  C CA  . GLY E  3  239 ? 109.008 14.020 3.448   1.00 18.40  ? 239  GLY H CA  1 
ATOM   8774  C C   . GLY E  3  239 ? 110.503 14.208 3.312   1.00 18.06  ? 239  GLY H C   1 
ATOM   8775  O O   . GLY E  3  239 ? 111.196 14.401 4.311   1.00 18.11  ? 239  GLY H O   1 
ATOM   8776  N N   . THR E  3  240 ? 111.014 14.146 2.088   1.00 17.51  ? 240  THR H N   1 
ATOM   8777  C CA  . THR E  3  240 ? 112.436 14.391 1.883   1.00 17.59  ? 240  THR H CA  1 
ATOM   8778  C C   . THR E  3  240 ? 112.635 15.757 1.247   1.00 16.74  ? 240  THR H C   1 
ATOM   8779  O O   . THR E  3  240 ? 111.686 16.388 0.785   1.00 16.40  ? 240  THR H O   1 
ATOM   8780  C CB  . THR E  3  240 ? 113.090 13.328 1.019   1.00 18.02  ? 240  THR H CB  1 
ATOM   8781  O OG1 . THR E  3  240 ? 112.413 13.246 -0.245  1.00 20.77  ? 240  THR H OG1 1 
ATOM   8782  C CG2 . THR E  3  240 ? 112.985 11.949 1.676   1.00 18.05  ? 240  THR H CG2 1 
ATOM   8783  N N   . PHE E  3  241 ? 113.878 16.215 1.229   1.00 16.23  ? 241  PHE H N   1 
ATOM   8784  C CA  . PHE E  3  241 ? 114.189 17.528 0.691   1.00 15.94  ? 241  PHE H CA  1 
ATOM   8785  C C   . PHE E  3  241 ? 115.245 17.514 -0.381  1.00 15.70  ? 241  PHE H C   1 
ATOM   8786  O O   . PHE E  3  241 ? 116.015 16.552 -0.517  1.00 15.90  ? 241  PHE H O   1 
ATOM   8787  C CB  . PHE E  3  241 ? 114.594 18.475 1.827   1.00 15.77  ? 241  PHE H CB  1 
ATOM   8788  C CG  . PHE E  3  241 ? 113.442 18.813 2.731   1.00 16.57  ? 241  PHE H CG  1 
ATOM   8789  C CD1 . PHE E  3  241 ? 112.950 17.865 3.629   1.00 15.85  ? 241  PHE H CD1 1 
ATOM   8790  C CD2 . PHE E  3  241 ? 112.775 20.035 2.613   1.00 15.39  ? 241  PHE H CD2 1 
ATOM   8791  C CE1 . PHE E  3  241 ? 111.838 18.141 4.419   1.00 14.23  ? 241  PHE H CE1 1 
ATOM   8792  C CE2 . PHE E  3  241 ? 111.662 20.315 3.407   1.00 14.97  ? 241  PHE H CE2 1 
ATOM   8793  C CZ  . PHE E  3  241 ? 111.197 19.368 4.311   1.00 14.44  ? 241  PHE H CZ  1 
ATOM   8794  N N   . GLN E  3  242 ? 115.266 18.605 -1.138  1.00 15.47  ? 242  GLN H N   1 
ATOM   8795  C CA  . GLN E  3  242 ? 116.227 18.793 -2.209  1.00 15.17  ? 242  GLN H CA  1 
ATOM   8796  C C   . GLN E  3  242 ? 116.847 20.188 -2.148  1.00 15.67  ? 242  GLN H C   1 
ATOM   8797  O O   . GLN E  3  242 ? 116.288 21.115 -1.571  1.00 14.95  ? 242  GLN H O   1 
ATOM   8798  C CB  . GLN E  3  242 ? 115.548 18.634 -3.561  1.00 14.22  ? 242  GLN H CB  1 
ATOM   8799  C CG  . GLN E  3  242 ? 114.370 17.698 -3.582  1.00 13.90  ? 242  GLN H CG  1 
ATOM   8800  C CD  . GLN E  3  242 ? 113.818 17.545 -4.980  1.00 12.08  ? 242  GLN H CD  1 
ATOM   8801  O OE1 . GLN E  3  242 ? 113.968 18.444 -5.791  1.00 14.58  ? 242  GLN H OE1 1 
ATOM   8802  N NE2 . GLN E  3  242 ? 113.177 16.421 -5.263  1.00 11.87  ? 242  GLN H NE2 1 
ATOM   8803  N N   . LYS E  3  243 ? 118.002 20.333 -2.780  1.00 16.63  ? 243  LYS H N   1 
ATOM   8804  C CA  . LYS E  3  243 ? 118.675 21.619 -2.838  1.00 17.28  ? 243  LYS H CA  1 
ATOM   8805  C C   . LYS E  3  243 ? 119.925 21.496 -3.669  1.00 17.84  ? 243  LYS H C   1 
ATOM   8806  O O   . LYS E  3  243 ? 120.605 20.488 -3.617  1.00 18.88  ? 243  LYS H O   1 
ATOM   8807  C CB  . LYS E  3  243 ? 119.077 22.092 -1.447  1.00 17.13  ? 243  LYS H CB  1 
ATOM   8808  C CG  . LYS E  3  243 ? 119.584 23.533 -1.415  1.00 17.08  ? 243  LYS H CG  1 
ATOM   8809  C CD  . LYS E  3  243 ? 120.322 23.837 -0.123  1.00 16.62  ? 243  LYS H CD  1 
ATOM   8810  C CE  . LYS E  3  243 ? 120.345 25.330 0.149   1.00 16.96  ? 243  LYS H CE  1 
ATOM   8811  N NZ  . LYS E  3  243 ? 118.958 25.856 0.454   1.00 17.33  ? 243  LYS H NZ  1 
ATOM   8812  N N   . TRP E  3  244 ? 120.233 22.531 -4.432  1.00 18.36  ? 244  TRP H N   1 
ATOM   8813  C CA  . TRP E  3  244 ? 121.460 22.539 -5.198  1.00 18.28  ? 244  TRP H CA  1 
ATOM   8814  C C   . TRP E  3  244 ? 122.122 23.898 -5.091  1.00 18.10  ? 244  TRP H C   1 
ATOM   8815  O O   . TRP E  3  244 ? 121.513 24.890 -4.658  1.00 17.76  ? 244  TRP H O   1 
ATOM   8816  C CB  . TRP E  3  244 ? 121.229 22.150 -6.660  1.00 18.68  ? 244  TRP H CB  1 
ATOM   8817  C CG  . TRP E  3  244 ? 120.301 23.007 -7.457  1.00 18.83  ? 244  TRP H CG  1 
ATOM   8818  C CD1 . TRP E  3  244 ? 119.043 22.689 -7.851  1.00 19.15  ? 244  TRP H CD1 1 
ATOM   8819  C CD2 . TRP E  3  244 ? 120.584 24.292 -8.018  1.00 20.42  ? 244  TRP H CD2 1 
ATOM   8820  N NE1 . TRP E  3  244 ? 118.513 23.697 -8.619  1.00 19.91  ? 244  TRP H NE1 1 
ATOM   8821  C CE2 . TRP E  3  244 ? 119.438 24.699 -8.735  1.00 20.66  ? 244  TRP H CE2 1 
ATOM   8822  C CE3 . TRP E  3  244 ? 121.694 25.150 -7.982  1.00 20.26  ? 244  TRP H CE3 1 
ATOM   8823  C CZ2 . TRP E  3  244 ? 119.366 25.922 -9.411  1.00 20.91  ? 244  TRP H CZ2 1 
ATOM   8824  C CZ3 . TRP E  3  244 ? 121.627 26.359 -8.653  1.00 20.08  ? 244  TRP H CZ3 1 
ATOM   8825  C CH2 . TRP E  3  244 ? 120.467 26.735 -9.361  1.00 21.36  ? 244  TRP H CH2 1 
ATOM   8826  N N   . ALA E  3  245 ? 123.391 23.914 -5.465  1.00 17.62  ? 245  ALA H N   1 
ATOM   8827  C CA  . ALA E  3  245 ? 124.202 25.103 -5.446  1.00 17.14  ? 245  ALA H CA  1 
ATOM   8828  C C   . ALA E  3  245 ? 125.105 24.983 -6.655  1.00 17.54  ? 245  ALA H C   1 
ATOM   8829  O O   . ALA E  3  245 ? 125.543 23.884 -7.006  1.00 16.56  ? 245  ALA H O   1 
ATOM   8830  C CB  . ALA E  3  245 ? 125.021 25.161 -4.167  1.00 16.61  ? 245  ALA H CB  1 
ATOM   8831  N N   . SER E  3  246 ? 125.392 26.113 -7.280  1.00 18.61  ? 246  SER H N   1 
ATOM   8832  C CA  . SER E  3  246 ? 126.223 26.130 -8.468  1.00 20.03  ? 246  SER H CA  1 
ATOM   8833  C C   . SER E  3  246 ? 127.150 27.336 -8.511  1.00 21.54  ? 246  SER H C   1 
ATOM   8834  O O   . SER E  3  246 ? 126.956 28.336 -7.820  1.00 21.33  ? 246  SER H O   1 
ATOM   8835  C CB  . SER E  3  246 ? 125.339 26.174 -9.713  1.00 19.92  ? 246  SER H CB  1 
ATOM   8836  O OG  . SER E  3  246 ? 124.638 27.405 -9.766  1.00 18.12  ? 246  SER H OG  1 
ATOM   8837  N N   . VAL E  3  247 ? 128.138 27.236 -9.383  1.00 23.57  ? 247  VAL H N   1 
ATOM   8838  C CA  . VAL E  3  247 ? 129.109 28.293 -9.572  1.00 25.04  ? 247  VAL H CA  1 
ATOM   8839  C C   . VAL E  3  247 ? 129.484 28.301 -11.055 1.00 26.54  ? 247  VAL H C   1 
ATOM   8840  O O   . VAL E  3  247 ? 129.336 27.290 -11.739 1.00 26.63  ? 247  VAL H O   1 
ATOM   8841  C CB  . VAL E  3  247 ? 130.343 28.025 -8.697  1.00 24.57  ? 247  VAL H CB  1 
ATOM   8842  C CG1 . VAL E  3  247 ? 130.892 26.654 -9.000  1.00 23.65  ? 247  VAL H CG1 1 
ATOM   8843  C CG2 . VAL E  3  247 ? 131.385 29.082 -8.918  1.00 25.42  ? 247  VAL H CG2 1 
ATOM   8844  N N   . VAL E  3  248 ? 129.938 29.440 -11.561 1.00 29.01  ? 248  VAL H N   1 
ATOM   8845  C CA  . VAL E  3  248 ? 130.376 29.527 -12.959 1.00 30.70  ? 248  VAL H CA  1 
ATOM   8846  C C   . VAL E  3  248 ? 131.904 29.548 -12.988 1.00 31.97  ? 248  VAL H C   1 
ATOM   8847  O O   . VAL E  3  248 ? 132.536 30.421 -12.390 1.00 31.77  ? 248  VAL H O   1 
ATOM   8848  C CB  . VAL E  3  248 ? 129.845 30.790 -13.682 1.00 31.01  ? 248  VAL H CB  1 
ATOM   8849  C CG1 . VAL E  3  248 ? 128.311 30.800 -13.720 1.00 30.45  ? 248  VAL H CG1 1 
ATOM   8850  C CG2 . VAL E  3  248 ? 130.381 32.052 -13.009 1.00 31.86  ? 248  VAL H CG2 1 
ATOM   8851  N N   . VAL E  3  249 ? 132.490 28.571 -13.672 1.00 33.58  ? 249  VAL H N   1 
ATOM   8852  C CA  . VAL E  3  249 ? 133.938 28.465 -13.782 1.00 34.84  ? 249  VAL H CA  1 
ATOM   8853  C C   . VAL E  3  249 ? 134.355 28.436 -15.247 1.00 36.01  ? 249  VAL H C   1 
ATOM   8854  O O   . VAL E  3  249 ? 133.552 28.085 -16.106 1.00 36.48  ? 249  VAL H O   1 
ATOM   8855  C CB  . VAL E  3  249 ? 134.426 27.179 -13.125 1.00 34.72  ? 249  VAL H CB  1 
ATOM   8856  C CG1 . VAL E  3  249 ? 133.907 27.089 -11.713 1.00 34.69  ? 249  VAL H CG1 1 
ATOM   8857  C CG2 . VAL E  3  249 ? 133.961 25.987 -13.915 1.00 34.56  ? 249  VAL H CG2 1 
ATOM   8858  N N   . PRO E  3  250 ? 135.584 28.827 -15.569 1.00 37.34  ? 250  PRO H N   1 
ATOM   8859  C CA  . PRO E  3  250 ? 135.983 28.763 -16.971 1.00 38.28  ? 250  PRO H CA  1 
ATOM   8860  C C   . PRO E  3  250 ? 136.169 27.302 -17.361 1.00 39.08  ? 250  PRO H C   1 
ATOM   8861  O O   . PRO E  3  250 ? 136.470 26.482 -16.489 1.00 39.18  ? 250  PRO H O   1 
ATOM   8862  C CB  . PRO E  3  250 ? 137.299 29.542 -16.988 1.00 38.12  ? 250  PRO H CB  1 
ATOM   8863  C CG  . PRO E  3  250 ? 137.857 29.284 -15.650 1.00 37.76  ? 250  PRO H CG  1 
ATOM   8864  C CD  . PRO E  3  250 ? 136.650 29.427 -14.744 1.00 37.56  ? 250  PRO H CD  1 
ATOM   8865  N N   . LEU E  3  251 ? 135.962 26.973 -18.633 1.00 39.74  ? 251  LEU H N   1 
ATOM   8866  C CA  . LEU E  3  251 ? 136.112 25.596 -19.086 1.00 40.49  ? 251  LEU H CA  1 
ATOM   8867  C C   . LEU E  3  251 ? 137.588 25.213 -19.007 1.00 40.92  ? 251  LEU H C   1 
ATOM   8868  O O   . LEU E  3  251 ? 138.460 26.066 -19.138 1.00 40.86  ? 251  LEU H O   1 
ATOM   8869  C CB  . LEU E  3  251 ? 135.575 25.449 -20.518 1.00 40.89  ? 251  LEU H CB  1 
ATOM   8870  C CG  . LEU E  3  251 ? 135.568 24.075 -21.203 1.00 41.59  ? 251  LEU H CG  1 
ATOM   8871  C CD1 . LEU E  3  251 ? 134.868 23.019 -20.359 1.00 41.92  ? 251  LEU H CD1 1 
ATOM   8872  C CD2 . LEU E  3  251 ? 134.887 24.206 -22.546 1.00 41.87  ? 251  LEU H CD2 1 
ATOM   8873  N N   . GLY E  3  252 ? 137.872 23.937 -18.778 1.00 41.63  ? 252  GLY H N   1 
ATOM   8874  C CA  . GLY E  3  252 ? 139.253 23.491 -18.698 1.00 42.65  ? 252  GLY H CA  1 
ATOM   8875  C C   . GLY E  3  252 ? 139.886 23.688 -17.332 1.00 43.26  ? 252  GLY H C   1 
ATOM   8876  O O   . GLY E  3  252 ? 141.075 23.421 -17.147 1.00 43.37  ? 252  GLY H O   1 
ATOM   8877  N N   . LYS E  3  253 ? 139.097 24.153 -16.370 1.00 43.68  ? 253  LYS H N   1 
ATOM   8878  C CA  . LYS E  3  253 ? 139.614 24.384 -15.035 1.00 44.15  ? 253  LYS H CA  1 
ATOM   8879  C C   . LYS E  3  253 ? 138.518 24.268 -13.978 1.00 44.05  ? 253  LYS H C   1 
ATOM   8880  O O   . LYS E  3  253 ? 138.416 25.099 -13.076 1.00 43.99  ? 253  LYS H O   1 
ATOM   8881  C CB  . LYS E  3  253 ? 140.279 25.756 -14.982 1.00 44.68  ? 253  LYS H CB  1 
ATOM   8882  C CG  . LYS E  3  253 ? 141.364 25.871 -13.925 1.00 46.22  ? 253  LYS H CG  1 
ATOM   8883  C CD  . LYS E  3  253 ? 142.074 27.215 -13.993 1.00 47.90  ? 253  LYS H CD  1 
ATOM   8884  C CE  . LYS E  3  253 ? 142.975 27.418 -12.778 1.00 48.81  ? 253  LYS H CE  1 
ATOM   8885  N NZ  . LYS E  3  253 ? 143.842 28.631 -12.866 1.00 48.79  ? 253  LYS H NZ  1 
ATOM   8886  N N   . GLU E  3  254 ? 137.702 23.224 -14.094 1.00 43.85  ? 254  GLU H N   1 
ATOM   8887  C CA  . GLU E  3  254 ? 136.615 22.990 -13.155 1.00 43.45  ? 254  GLU H CA  1 
ATOM   8888  C C   . GLU E  3  254 ? 137.094 22.024 -12.077 1.00 43.33  ? 254  GLU H C   1 
ATOM   8889  O O   . GLU E  3  254 ? 136.700 22.126 -10.920 1.00 43.01  ? 254  GLU H O   1 
ATOM   8890  C CB  . GLU E  3  254 ? 135.396 22.402 -13.872 1.00 43.37  ? 254  GLU H CB  1 
ATOM   8891  C CG  . GLU E  3  254 ? 134.878 23.229 -15.044 1.00 42.91  ? 254  GLU H CG  1 
ATOM   8892  C CD  . GLU E  3  254 ? 135.752 23.120 -16.278 1.00 41.93  ? 254  GLU H CD  1 
ATOM   8893  O OE1 . GLU E  3  254 ? 135.544 22.176 -17.070 1.00 41.30  ? 254  GLU H OE1 1 
ATOM   8894  O OE2 . GLU E  3  254 ? 136.647 23.976 -16.444 1.00 40.31  ? 254  GLU H OE2 1 
ATOM   8895  N N   . GLN E  3  255 ? 137.960 21.094 -12.473 1.00 43.11  ? 255  GLN H N   1 
ATOM   8896  C CA  . GLN E  3  255 ? 138.508 20.087 -11.562 1.00 42.92  ? 255  GLN H CA  1 
ATOM   8897  C C   . GLN E  3  255 ? 139.229 20.683 -10.357 1.00 41.77  ? 255  GLN H C   1 
ATOM   8898  O O   . GLN E  3  255 ? 139.765 19.956 -9.527  1.00 41.62  ? 255  GLN H O   1 
ATOM   8899  C CB  . GLN E  3  255 ? 139.466 19.168 -12.323 1.00 43.57  ? 255  GLN H CB  1 
ATOM   8900  C CG  . GLN E  3  255 ? 138.778 18.008 -13.021 1.00 45.49  ? 255  GLN H CG  1 
ATOM   8901  C CD  . GLN E  3  255 ? 138.975 16.687 -12.294 1.00 47.42  ? 255  GLN H CD  1 
ATOM   8902  O OE1 . GLN E  3  255 ? 138.549 16.526 -11.151 1.00 48.21  ? 255  GLN H OE1 1 
ATOM   8903  N NE2 . GLN E  3  255 ? 139.629 15.740 -12.957 1.00 48.89  ? 255  GLN H NE2 1 
ATOM   8904  N N   . TYR E  3  256 ? 139.249 22.006 -10.270 1.00 40.55  ? 256  TYR H N   1 
ATOM   8905  C CA  . TYR E  3  256 ? 139.886 22.685 -9.157  1.00 39.51  ? 256  TYR H CA  1 
ATOM   8906  C C   . TYR E  3  256 ? 138.775 23.231 -8.270  1.00 37.59  ? 256  TYR H C   1 
ATOM   8907  O O   . TYR E  3  256 ? 138.992 24.108 -7.431  1.00 37.44  ? 256  TYR H O   1 
ATOM   8908  C CB  . TYR E  3  256 ? 140.806 23.795 -9.664  1.00 40.21  ? 256  TYR H CB  1 
ATOM   8909  C CG  . TYR E  3  256 ? 141.943 23.279 -10.531 1.00 42.77  ? 256  TYR H CG  1 
ATOM   8910  C CD1 . TYR E  3  256 ? 142.699 24.149 -11.306 1.00 45.34  ? 256  TYR H CD1 1 
ATOM   8911  C CD2 . TYR E  3  256 ? 142.251 21.921 -10.586 1.00 44.66  ? 256  TYR H CD2 1 
ATOM   8912  C CE1 . TYR E  3  256 ? 143.738 23.684 -12.115 1.00 46.86  ? 256  TYR H CE1 1 
ATOM   8913  C CE2 . TYR E  3  256 ? 143.281 21.446 -11.389 1.00 46.42  ? 256  TYR H CE2 1 
ATOM   8914  C CZ  . TYR E  3  256 ? 144.021 22.335 -12.153 1.00 47.19  ? 256  TYR H CZ  1 
ATOM   8915  O OH  . TYR E  3  256 ? 145.037 21.885 -12.968 1.00 47.53  ? 256  TYR H OH  1 
ATOM   8916  N N   . TYR E  3  257 ? 137.583 22.669 -8.456  1.00 35.03  ? 257  TYR H N   1 
ATOM   8917  C CA  . TYR E  3  257 ? 136.399 23.068 -7.713  1.00 32.94  ? 257  TYR H CA  1 
ATOM   8918  C C   . TYR E  3  257 ? 135.778 21.887 -6.982  1.00 31.77  ? 257  TYR H C   1 
ATOM   8919  O O   . TYR E  3  257 ? 135.505 20.853 -7.584  1.00 32.28  ? 257  TYR H O   1 
ATOM   8920  C CB  . TYR E  3  257 ? 135.377 23.687 -8.674  1.00 32.29  ? 257  TYR H CB  1 
ATOM   8921  C CG  . TYR E  3  257 ? 135.838 25.016 -9.218  1.00 30.09  ? 257  TYR H CG  1 
ATOM   8922  C CD1 . TYR E  3  257 ? 136.822 25.089 -10.197 1.00 28.76  ? 257  TYR H CD1 1 
ATOM   8923  C CD2 . TYR E  3  257 ? 135.315 26.200 -8.726  1.00 28.45  ? 257  TYR H CD2 1 
ATOM   8924  C CE1 . TYR E  3  257 ? 137.263 26.307 -10.680 1.00 27.96  ? 257  TYR H CE1 1 
ATOM   8925  C CE2 . TYR E  3  257 ? 135.751 27.421 -9.198  1.00 28.46  ? 257  TYR H CE2 1 
ATOM   8926  C CZ  . TYR E  3  257 ? 136.725 27.472 -10.174 1.00 28.00  ? 257  TYR H CZ  1 
ATOM   8927  O OH  . TYR E  3  257 ? 137.154 28.699 -10.635 1.00 27.25  ? 257  TYR H OH  1 
ATOM   8928  N N   . THR E  3  258 ? 135.555 22.035 -5.685  1.00 30.20  ? 258  THR H N   1 
ATOM   8929  C CA  . THR E  3  258 ? 134.948 20.958 -4.908  1.00 29.20  ? 258  THR H CA  1 
ATOM   8930  C C   . THR E  3  258 ? 133.711 21.440 -4.174  1.00 27.61  ? 258  THR H C   1 
ATOM   8931  O O   . THR E  3  258 ? 133.682 22.538 -3.631  1.00 27.15  ? 258  THR H O   1 
ATOM   8932  C CB  . THR E  3  258 ? 135.941 20.361 -3.897  1.00 29.42  ? 258  THR H CB  1 
ATOM   8933  O OG1 . THR E  3  258 ? 136.399 21.382 -3.005  1.00 30.00  ? 258  THR H OG1 1 
ATOM   8934  C CG2 . THR E  3  258 ? 137.185 19.821 -4.612  1.00 29.63  ? 258  THR H CG2 1 
ATOM   8935  N N   . CYS E  3  259 ? 132.681 20.611 -4.184  1.00 26.57  ? 259  CYS H N   1 
ATOM   8936  C CA  . CYS E  3  259 ? 131.435 20.921 -3.506  1.00 25.62  ? 259  CYS H CA  1 
ATOM   8937  C C   . CYS E  3  259 ? 131.447 20.207 -2.168  1.00 25.83  ? 259  CYS H C   1 
ATOM   8938  O O   . CYS E  3  259 ? 131.989 19.111 -2.051  1.00 25.17  ? 259  CYS H O   1 
ATOM   8939  C CB  . CYS E  3  259 ? 130.250 20.432 -4.332  1.00 25.08  ? 259  CYS H CB  1 
ATOM   8940  S SG  . CYS E  3  259 ? 128.615 20.642 -3.570  1.00 23.03  ? 259  CYS H SG  1 
ATOM   8941  N N   . HIS E  3  260 ? 130.849 20.831 -1.162  1.00 26.54  ? 260  HIS H N   1 
ATOM   8942  C CA  . HIS E  3  260 ? 130.770 20.231 0.167   1.00 27.32  ? 260  HIS H CA  1 
ATOM   8943  C C   . HIS E  3  260 ? 129.363 20.302 0.718   1.00 26.88  ? 260  HIS H C   1 
ATOM   8944  O O   . HIS E  3  260 ? 128.775 21.376 0.821   1.00 27.20  ? 260  HIS H O   1 
ATOM   8945  C CB  . HIS E  3  260 ? 131.774 20.886 1.124   1.00 27.82  ? 260  HIS H CB  1 
ATOM   8946  C CG  . HIS E  3  260 ? 133.183 20.466 0.859   1.00 29.70  ? 260  HIS H CG  1 
ATOM   8947  N ND1 . HIS E  3  260 ? 134.147 21.332 0.393   1.00 32.35  ? 260  HIS H ND1 1 
ATOM   8948  C CD2 . HIS E  3  260 ? 133.774 19.250 0.929   1.00 31.39  ? 260  HIS H CD2 1 
ATOM   8949  C CE1 . HIS E  3  260 ? 135.275 20.670 0.203   1.00 32.44  ? 260  HIS H CE1 1 
ATOM   8950  N NE2 . HIS E  3  260 ? 135.075 19.405 0.523   1.00 32.36  ? 260  HIS H NE2 1 
ATOM   8951  N N   . VAL E  3  261 ? 128.830 19.137 1.069   1.00 26.63  ? 261  VAL H N   1 
ATOM   8952  C CA  . VAL E  3  261 ? 127.480 19.022 1.598   1.00 26.02  ? 261  VAL H CA  1 
ATOM   8953  C C   . VAL E  3  261 ? 127.541 18.667 3.077   1.00 26.07  ? 261  VAL H C   1 
ATOM   8954  O O   . VAL E  3  261 ? 128.099 17.640 3.453   1.00 26.26  ? 261  VAL H O   1 
ATOM   8955  C CB  . VAL E  3  261 ? 126.709 17.948 0.834   1.00 25.59  ? 261  VAL H CB  1 
ATOM   8956  C CG1 . VAL E  3  261 ? 125.258 17.916 1.277   1.00 25.72  ? 261  VAL H CG1 1 
ATOM   8957  C CG2 . VAL E  3  261 ? 126.821 18.200 -0.653  1.00 24.19  ? 261  VAL H CG2 1 
ATOM   8958  N N   . TYR E  3  262 ? 126.976 19.533 3.910   1.00 26.34  ? 262  TYR H N   1 
ATOM   8959  C CA  . TYR E  3  262 ? 126.964 19.344 5.357   1.00 26.72  ? 262  TYR H CA  1 
ATOM   8960  C C   . TYR E  3  262 ? 125.554 19.031 5.880   1.00 26.47  ? 262  TYR H C   1 
ATOM   8961  O O   . TYR E  3  262 ? 124.742 19.941 6.034   1.00 26.82  ? 262  TYR H O   1 
ATOM   8962  C CB  . TYR E  3  262 ? 127.474 20.613 6.054   1.00 26.99  ? 262  TYR H CB  1 
ATOM   8963  C CG  . TYR E  3  262 ? 128.839 21.106 5.599   1.00 28.69  ? 262  TYR H CG  1 
ATOM   8964  C CD1 . TYR E  3  262 ? 130.007 20.522 6.074   1.00 30.15  ? 262  TYR H CD1 1 
ATOM   8965  C CD2 . TYR E  3  262 ? 128.956 22.178 4.718   1.00 30.12  ? 262  TYR H CD2 1 
ATOM   8966  C CE1 . TYR E  3  262 ? 131.260 20.983 5.675   1.00 31.04  ? 262  TYR H CE1 1 
ATOM   8967  C CE2 . TYR E  3  262 ? 130.203 22.647 4.309   1.00 30.62  ? 262  TYR H CE2 1 
ATOM   8968  C CZ  . TYR E  3  262 ? 131.353 22.044 4.790   1.00 31.00  ? 262  TYR H CZ  1 
ATOM   8969  O OH  . TYR E  3  262 ? 132.593 22.503 4.392   1.00 30.73  ? 262  TYR H OH  1 
ATOM   8970  N N   . HIS E  3  263 ? 125.271 17.755 6.150   1.00 26.18  ? 263  HIS H N   1 
ATOM   8971  C CA  . HIS E  3  263 ? 123.975 17.326 6.690   1.00 25.74  ? 263  HIS H CA  1 
ATOM   8972  C C   . HIS E  3  263 ? 124.197 16.402 7.887   1.00 25.45  ? 263  HIS H C   1 
ATOM   8973  O O   . HIS E  3  263 ? 125.090 15.551 7.868   1.00 24.87  ? 263  HIS H O   1 
ATOM   8974  C CB  . HIS E  3  263 ? 123.139 16.594 5.634   1.00 26.02  ? 263  HIS H CB  1 
ATOM   8975  C CG  . HIS E  3  263 ? 121.816 16.124 6.146   1.00 26.52  ? 263  HIS H CG  1 
ATOM   8976  N ND1 . HIS E  3  263 ? 120.758 16.979 6.369   1.00 27.83  ? 263  HIS H ND1 1 
ATOM   8977  C CD2 . HIS E  3  263 ? 121.386 14.895 6.514   1.00 27.45  ? 263  HIS H CD2 1 
ATOM   8978  C CE1 . HIS E  3  263 ? 119.734 16.297 6.847   1.00 27.31  ? 263  HIS H CE1 1 
ATOM   8979  N NE2 . HIS E  3  263 ? 120.090 15.029 6.949   1.00 27.21  ? 263  HIS H NE2 1 
ATOM   8980  N N   . GLN E  3  264 ? 123.361 16.555 8.911   1.00 25.30  ? 264  GLN H N   1 
ATOM   8981  C CA  . GLN E  3  264 ? 123.482 15.794 10.159  1.00 25.26  ? 264  GLN H CA  1 
ATOM   8982  C C   . GLN E  3  264 ? 123.325 14.285 10.038  1.00 25.26  ? 264  GLN H C   1 
ATOM   8983  O O   . GLN E  3  264 ? 123.615 13.559 10.987  1.00 25.03  ? 264  GLN H O   1 
ATOM   8984  C CB  . GLN E  3  264 ? 122.472 16.315 11.181  1.00 25.22  ? 264  GLN H CB  1 
ATOM   8985  C CG  . GLN E  3  264 ? 121.037 15.930 10.896  1.00 25.98  ? 264  GLN H CG  1 
ATOM   8986  C CD  . GLN E  3  264 ? 120.047 16.914 11.502  1.00 27.61  ? 264  GLN H CD  1 
ATOM   8987  O OE1 . GLN E  3  264 ? 120.140 18.123 11.271  1.00 28.50  ? 264  GLN H OE1 1 
ATOM   8988  N NE2 . GLN E  3  264 ? 119.101 16.402 12.277  1.00 28.39  ? 264  GLN H NE2 1 
ATOM   8989  N N   . GLY E  3  265 ? 122.868 13.806 8.889   1.00 25.37  ? 265  GLY H N   1 
ATOM   8990  C CA  . GLY E  3  265 ? 122.669 12.378 8.713   1.00 25.51  ? 265  GLY H CA  1 
ATOM   8991  C C   . GLY E  3  265 ? 123.899 11.692 8.158   1.00 25.60  ? 265  GLY H C   1 
ATOM   8992  O O   . GLY E  3  265 ? 123.927 10.467 8.018   1.00 25.48  ? 265  GLY H O   1 
ATOM   8993  N N   . LEU E  3  266 ? 124.919 12.489 7.854   1.00 25.67  ? 266  LEU H N   1 
ATOM   8994  C CA  . LEU E  3  266 ? 126.158 11.980 7.273   1.00 25.52  ? 266  LEU H CA  1 
ATOM   8995  C C   . LEU E  3  266 ? 127.241 11.742 8.306   1.00 26.24  ? 266  LEU H C   1 
ATOM   8996  O O   . LEU E  3  266 ? 127.522 12.604 9.139   1.00 25.93  ? 266  LEU H O   1 
ATOM   8997  C CB  . LEU E  3  266 ? 126.695 12.959 6.231   1.00 24.93  ? 266  LEU H CB  1 
ATOM   8998  C CG  . LEU E  3  266 ? 125.863 13.143 4.970   1.00 23.75  ? 266  LEU H CG  1 
ATOM   8999  C CD1 . LEU E  3  266 ? 126.534 14.177 4.095   1.00 23.70  ? 266  LEU H CD1 1 
ATOM   9000  C CD2 . LEU E  3  266 ? 125.710 11.831 4.233   1.00 23.50  ? 266  LEU H CD2 1 
ATOM   9001  N N   . PRO E  3  267 ? 127.887 10.581 8.247   1.00 27.21  ? 267  PRO H N   1 
ATOM   9002  C CA  . PRO E  3  267 ? 128.945 10.312 9.207   1.00 27.85  ? 267  PRO H CA  1 
ATOM   9003  C C   . PRO E  3  267 ? 129.988 11.396 9.049   1.00 28.46  ? 267  PRO H C   1 
ATOM   9004  O O   . PRO E  3  267 ? 130.666 11.764 10.012  1.00 28.97  ? 267  PRO H O   1 
ATOM   9005  C CB  . PRO E  3  267 ? 129.455 8.940  8.776   1.00 27.84  ? 267  PRO H CB  1 
ATOM   9006  C CG  . PRO E  3  267 ? 129.105 8.874  7.342   1.00 27.57  ? 267  PRO H CG  1 
ATOM   9007  C CD  . PRO E  3  267 ? 127.732 9.462  7.303   1.00 27.16  ? 267  PRO H CD  1 
ATOM   9008  N N   . GLU E  3  268 ? 130.090 11.930 7.835   1.00 28.94  ? 268  GLU H N   1 
ATOM   9009  C CA  . GLU E  3  268 ? 131.027 13.009 7.568   1.00 29.45  ? 268  GLU H CA  1 
ATOM   9010  C C   . GLU E  3  268 ? 130.593 13.847 6.364   1.00 29.37  ? 268  GLU H C   1 
ATOM   9011  O O   . GLU E  3  268 ? 129.893 13.357 5.476   1.00 29.12  ? 268  GLU H O   1 
ATOM   9012  C CB  . GLU E  3  268 ? 132.439 12.455 7.364   1.00 29.94  ? 268  GLU H CB  1 
ATOM   9013  C CG  . GLU E  3  268 ? 132.576 11.435 6.252   1.00 31.17  ? 268  GLU H CG  1 
ATOM   9014  C CD  . GLU E  3  268 ? 134.001 10.932 6.106   1.00 33.42  ? 268  GLU H CD  1 
ATOM   9015  O OE1 . GLU E  3  268 ? 134.909 11.755 5.839   1.00 34.20  ? 268  GLU H OE1 1 
ATOM   9016  O OE2 . GLU E  3  268 ? 134.216 9.710  6.256   1.00 34.70  ? 268  GLU H OE2 1 
ATOM   9017  N N   . PRO E  3  269 ? 131.038 15.104 6.332   1.00 29.23  ? 269  PRO H N   1 
ATOM   9018  C CA  . PRO E  3  269 ? 130.701 16.043 5.267   1.00 29.48  ? 269  PRO H CA  1 
ATOM   9019  C C   . PRO E  3  269 ? 131.129 15.517 3.917   1.00 29.89  ? 269  PRO H C   1 
ATOM   9020  O O   . PRO E  3  269 ? 132.325 15.380 3.671   1.00 30.55  ? 269  PRO H O   1 
ATOM   9021  C CB  . PRO E  3  269 ? 131.518 17.282 5.638   1.00 29.50  ? 269  PRO H CB  1 
ATOM   9022  C CG  . PRO E  3  269 ? 131.718 17.167 7.086   1.00 29.45  ? 269  PRO H CG  1 
ATOM   9023  C CD  . PRO E  3  269 ? 131.970 15.711 7.291   1.00 29.07  ? 269  PRO H CD  1 
ATOM   9024  N N   . LEU E  3  270 ? 130.165 15.210 3.057   1.00 30.08  ? 270  LEU H N   1 
ATOM   9025  C CA  . LEU E  3  270 ? 130.476 14.727 1.722   1.00 30.12  ? 270  LEU H CA  1 
ATOM   9026  C C   . LEU E  3  270 ? 131.363 15.748 1.018   1.00 30.83  ? 270  LEU H C   1 
ATOM   9027  O O   . LEU E  3  270 ? 131.417 16.910 1.401   1.00 31.08  ? 270  LEU H O   1 
ATOM   9028  C CB  . LEU E  3  270 ? 129.199 14.533 0.907   1.00 29.78  ? 270  LEU H CB  1 
ATOM   9029  C CG  . LEU E  3  270 ? 128.330 13.312 1.187   1.00 28.28  ? 270  LEU H CG  1 
ATOM   9030  C CD1 . LEU E  3  270 ? 127.070 13.415 0.356   1.00 26.69  ? 270  LEU H CD1 1 
ATOM   9031  C CD2 . LEU E  3  270 ? 129.090 12.035 0.864   1.00 27.80  ? 270  LEU H CD2 1 
ATOM   9032  N N   . THR E  3  271 ? 132.057 15.312 -0.019  1.00 31.87  ? 271  THR H N   1 
ATOM   9033  C CA  . THR E  3  271 ? 132.926 16.199 -0.775  1.00 32.58  ? 271  THR H CA  1 
ATOM   9034  C C   . THR E  3  271 ? 132.812 15.809 -2.248  1.00 33.20  ? 271  THR H C   1 
ATOM   9035  O O   . THR E  3  271 ? 133.104 14.676 -2.621  1.00 32.64  ? 271  THR H O   1 
ATOM   9036  C CB  . THR E  3  271 ? 134.359 16.064 -0.278  1.00 32.59  ? 271  THR H CB  1 
ATOM   9037  O OG1 . THR E  3  271 ? 135.198 17.028 -0.928  1.00 32.74  ? 271  THR H OG1 1 
ATOM   9038  C CG2 . THR E  3  271 ? 134.918 14.693 -0.633  1.00 33.28  ? 271  THR H CG2 1 
ATOM   9039  N N   . LEU E  3  272 ? 132.363 16.730 -3.090  1.00 34.42  ? 272  LEU H N   1 
ATOM   9040  C CA  . LEU E  3  272 ? 132.182 16.382 -4.497  1.00 35.70  ? 272  LEU H CA  1 
ATOM   9041  C C   . LEU E  3  272 ? 132.993 17.145 -5.527  1.00 36.99  ? 272  LEU H C   1 
ATOM   9042  O O   . LEU E  3  272 ? 133.035 18.371 -5.528  1.00 37.15  ? 272  LEU H O   1 
ATOM   9043  C CB  . LEU E  3  272 ? 130.707 16.462 -4.876  1.00 35.53  ? 272  LEU H CB  1 
ATOM   9044  C CG  . LEU E  3  272 ? 129.822 15.379 -4.275  1.00 35.19  ? 272  LEU H CG  1 
ATOM   9045  C CD1 . LEU E  3  272 ? 129.578 15.648 -2.800  1.00 35.55  ? 272  LEU H CD1 1 
ATOM   9046  C CD2 . LEU E  3  272 ? 128.513 15.353 -5.022  1.00 35.58  ? 272  LEU H CD2 1 
ATOM   9047  N N   . ARG E  3  273 ? 133.603 16.379 -6.424  1.00 38.94  ? 273  ARG H N   1 
ATOM   9048  C CA  . ARG E  3  273 ? 134.415 16.893 -7.520  1.00 40.67  ? 273  ARG H CA  1 
ATOM   9049  C C   . ARG E  3  273 ? 133.794 16.417 -8.836  1.00 42.12  ? 273  ARG H C   1 
ATOM   9050  O O   . ARG E  3  273 ? 133.444 15.243 -8.972  1.00 42.36  ? 273  ARG H O   1 
ATOM   9051  C CB  . ARG E  3  273 ? 135.837 16.363 -7.373  1.00 40.72  ? 273  ARG H CB  1 
ATOM   9052  C CG  . ARG E  3  273 ? 136.718 16.544 -8.585  1.00 41.04  ? 273  ARG H CG  1 
ATOM   9053  C CD  . ARG E  3  273 ? 138.184 16.368 -8.233  1.00 41.49  ? 273  ARG H CD  1 
ATOM   9054  N NE  . ARG E  3  273 ? 138.776 17.608 -7.740  1.00 41.92  ? 273  ARG H NE  1 
ATOM   9055  C CZ  . ARG E  3  273 ? 139.642 17.690 -6.739  1.00 42.42  ? 273  ARG H CZ  1 
ATOM   9056  N NH1 . ARG E  3  273 ? 140.038 16.604 -6.086  1.00 42.85  ? 273  ARG H NH1 1 
ATOM   9057  N NH2 . ARG E  3  273 ? 140.118 18.871 -6.384  1.00 42.81  ? 273  ARG H NH2 1 
ATOM   9058  N N   . TRP E  3  274 ? 133.662 17.322 -9.803  1.00 43.89  ? 274  TRP H N   1 
ATOM   9059  C CA  . TRP E  3  274 ? 132.998 16.997 -11.071 1.00 45.27  ? 274  TRP H CA  1 
ATOM   9060  C C   . TRP E  3  274 ? 133.375 15.641 -11.677 1.00 45.46  ? 274  TRP H C   1 
ATOM   9061  O O   . TRP E  3  274 ? 134.495 15.404 -12.133 1.00 45.49  ? 274  TRP H O   1 
ATOM   9062  C CB  . TRP E  3  274 ? 133.176 18.113 -12.113 1.00 45.89  ? 274  TRP H CB  1 
ATOM   9063  C CG  . TRP E  3  274 ? 132.318 17.826 -13.309 1.00 48.05  ? 274  TRP H CG  1 
ATOM   9064  C CD1 . TRP E  3  274 ? 130.980 17.531 -13.309 1.00 49.51  ? 274  TRP H CD1 1 
ATOM   9065  C CD2 . TRP E  3  274 ? 132.753 17.695 -14.662 1.00 50.02  ? 274  TRP H CD2 1 
ATOM   9066  N NE1 . TRP E  3  274 ? 130.559 17.241 -14.583 1.00 50.72  ? 274  TRP H NE1 1 
ATOM   9067  C CE2 . TRP E  3  274 ? 131.629 17.333 -15.434 1.00 50.72  ? 274  TRP H CE2 1 
ATOM   9068  C CE3 . TRP E  3  274 ? 133.981 17.858 -15.306 1.00 51.00  ? 274  TRP H CE3 1 
ATOM   9069  C CZ2 . TRP E  3  274 ? 131.700 17.133 -16.808 1.00 51.57  ? 274  TRP H CZ2 1 
ATOM   9070  C CZ3 . TRP E  3  274 ? 134.050 17.657 -16.669 1.00 52.06  ? 274  TRP H CZ3 1 
ATOM   9071  C CH2 . TRP E  3  274 ? 132.918 17.300 -17.407 1.00 52.25  ? 274  TRP H CH2 1 
ATOM   9072  N N   . GLY F  3  1   ? 124.720 16.233 17.785  1.00 37.21  ? 1    GLY I N   1 
ATOM   9073  C CA  . GLY F  3  1   ? 125.082 17.225 18.849  1.00 37.05  ? 1    GLY I CA  1 
ATOM   9074  C C   . GLY F  3  1   ? 126.478 17.783 18.636  1.00 36.70  ? 1    GLY I C   1 
ATOM   9075  O O   . GLY F  3  1   ? 127.367 17.057 18.196  1.00 36.94  ? 1    GLY I O   1 
ATOM   9076  N N   . PRO F  3  2   ? 126.716 19.044 18.985  1.00 36.29  ? 2    PRO I N   1 
ATOM   9077  C CA  . PRO F  3  2   ? 128.044 19.606 18.755  1.00 36.35  ? 2    PRO I CA  1 
ATOM   9078  C C   . PRO F  3  2   ? 129.084 18.847 19.579  1.00 36.57  ? 2    PRO I C   1 
ATOM   9079  O O   . PRO F  3  2   ? 128.748 18.211 20.581  1.00 36.35  ? 2    PRO I O   1 
ATOM   9080  C CB  . PRO F  3  2   ? 127.885 21.044 19.232  1.00 36.19  ? 2    PRO I CB  1 
ATOM   9081  C CG  . PRO F  3  2   ? 126.893 20.918 20.312  1.00 35.69  ? 2    PRO I CG  1 
ATOM   9082  C CD  . PRO F  3  2   ? 125.861 19.992 19.720  1.00 35.91  ? 2    PRO I CD  1 
ATOM   9083  N N   . HIS F  3  3   ? 130.329 18.897 19.122  1.00 36.70  ? 3    HIS I N   1 
ATOM   9084  C CA  . HIS F  3  3   ? 131.452 18.239 19.777  1.00 36.71  ? 3    HIS I CA  1 
ATOM   9085  C C   . HIS F  3  3   ? 132.689 19.024 19.430  1.00 36.48  ? 3    HIS I C   1 
ATOM   9086  O O   . HIS F  3  3   ? 132.661 19.938 18.609  1.00 36.14  ? 3    HIS I O   1 
ATOM   9087  C CB  . HIS F  3  3   ? 131.667 16.809 19.279  1.00 37.04  ? 3    HIS I CB  1 
ATOM   9088  C CG  . HIS F  3  3   ? 130.503 15.905 19.506  1.00 37.78  ? 3    HIS I CG  1 
ATOM   9089  N ND1 . HIS F  3  3   ? 129.968 15.682 20.754  1.00 38.78  ? 3    HIS I ND1 1 
ATOM   9090  C CD2 . HIS F  3  3   ? 129.772 15.164 18.642  1.00 38.80  ? 3    HIS I CD2 1 
ATOM   9091  C CE1 . HIS F  3  3   ? 128.950 14.848 20.648  1.00 39.90  ? 3    HIS I CE1 1 
ATOM   9092  N NE2 . HIS F  3  3   ? 128.811 14.518 19.376  1.00 39.88  ? 3    HIS I NE2 1 
ATOM   9093  N N   . SER F  3  4   ? 133.796 18.635 20.030  1.00 36.56  ? 4    SER I N   1 
ATOM   9094  C CA  . SER F  3  4   ? 135.026 19.336 19.778  1.00 36.49  ? 4    SER I CA  1 
ATOM   9095  C C   . SER F  3  4   ? 136.239 18.494 20.097  1.00 37.14  ? 4    SER I C   1 
ATOM   9096  O O   . SER F  3  4   ? 136.148 17.331 20.473  1.00 36.70  ? 4    SER I O   1 
ATOM   9097  C CB  . SER F  3  4   ? 135.052 20.608 20.619  1.00 36.03  ? 4    SER I CB  1 
ATOM   9098  O OG  . SER F  3  4   ? 134.754 20.294 21.958  1.00 33.85  ? 4    SER I OG  1 
ATOM   9099  N N   . LEU F  3  5   ? 137.374 19.125 19.932  1.00 38.09  ? 5    LEU I N   1 
ATOM   9100  C CA  . LEU F  3  5   ? 138.664 18.540 20.220  1.00 38.97  ? 5    LEU I CA  1 
ATOM   9101  C C   . LEU F  3  5   ? 139.598 19.680 20.590  1.00 39.27  ? 5    LEU I C   1 
ATOM   9102  O O   . LEU F  3  5   ? 139.970 20.458 19.719  1.00 39.53  ? 5    LEU I O   1 
ATOM   9103  C CB  . LEU F  3  5   ? 139.183 17.790 18.994  1.00 39.48  ? 5    LEU I CB  1 
ATOM   9104  C CG  . LEU F  3  5   ? 140.462 16.975 19.206  1.00 40.77  ? 5    LEU I CG  1 
ATOM   9105  C CD1 . LEU F  3  5   ? 140.186 15.767 20.089  1.00 41.58  ? 5    LEU I CD1 1 
ATOM   9106  C CD2 . LEU F  3  5   ? 141.041 16.541 17.873  1.00 41.13  ? 5    LEU I CD2 1 
ATOM   9107  N N   . ARG F  3  6   ? 139.866 19.837 21.883  1.00 39.52  ? 6    ARG I N   1 
ATOM   9108  C CA  . ARG F  3  6   ? 140.735 20.914 22.366  1.00 39.51  ? 6    ARG I CA  1 
ATOM   9109  C C   . ARG F  3  6   ? 142.041 20.344 22.891  1.00 39.40  ? 6    ARG I C   1 
ATOM   9110  O O   . ARG F  3  6   ? 142.119 19.173 23.270  1.00 39.51  ? 6    ARG I O   1 
ATOM   9111  C CB  . ARG F  3  6   ? 140.111 21.683 23.526  1.00 39.56  ? 6    ARG I CB  1 
ATOM   9112  C CG  . ARG F  3  6   ? 138.844 22.439 23.262  1.00 40.69  ? 6    ARG I CG  1 
ATOM   9113  C CD  . ARG F  3  6   ? 138.257 22.954 24.572  1.00 41.53  ? 6    ARG I CD  1 
ATOM   9114  N NE  . ARG F  3  6   ? 136.887 23.429 24.447  1.00 41.99  ? 6    ARG I NE  1 
ATOM   9115  C CZ  . ARG F  3  6   ? 136.123 23.783 25.476  1.00 42.31  ? 6    ARG I CZ  1 
ATOM   9116  N NH1 . ARG F  3  6   ? 136.599 23.718 26.718  1.00 41.65  ? 6    ARG I NH1 1 
ATOM   9117  N NH2 . ARG F  3  6   ? 134.881 24.208 25.261  1.00 42.30  ? 6    ARG I NH2 1 
ATOM   9118  N N   . TYR F  3  7   ? 143.060 21.192 22.944  1.00 39.03  ? 7    TYR I N   1 
ATOM   9119  C CA  . TYR F  3  7   ? 144.353 20.791 23.479  1.00 38.31  ? 7    TYR I CA  1 
ATOM   9120  C C   . TYR F  3  7   ? 144.802 21.770 24.525  1.00 38.39  ? 7    TYR I C   1 
ATOM   9121  O O   . TYR F  3  7   ? 144.868 22.973 24.282  1.00 37.94  ? 7    TYR I O   1 
ATOM   9122  C CB  . TYR F  3  7   ? 145.417 20.648 22.379  1.00 37.87  ? 7    TYR I CB  1 
ATOM   9123  C CG  . TYR F  3  7   ? 145.390 19.252 21.820  1.00 36.38  ? 7    TYR I CG  1 
ATOM   9124  C CD1 . TYR F  3  7   ? 144.806 18.989 20.593  1.00 35.09  ? 7    TYR I CD1 1 
ATOM   9125  C CD2 . TYR F  3  7   ? 145.855 18.178 22.570  1.00 34.92  ? 7    TYR I CD2 1 
ATOM   9126  C CE1 . TYR F  3  7   ? 144.711 17.701 20.106  1.00 34.33  ? 7    TYR I CE1 1 
ATOM   9127  C CE2 . TYR F  3  7   ? 145.765 16.882 22.092  1.00 34.76  ? 7    TYR I CE2 1 
ATOM   9128  C CZ  . TYR F  3  7   ? 145.191 16.653 20.856  1.00 34.93  ? 7    TYR I CZ  1 
ATOM   9129  O OH  . TYR F  3  7   ? 145.092 15.374 20.363  1.00 35.81  ? 7    TYR I OH  1 
ATOM   9130  N N   . PHE F  3  8   ? 145.086 21.225 25.701  1.00 38.91  ? 8    PHE I N   1 
ATOM   9131  C CA  . PHE F  3  8   ? 145.560 21.998 26.831  1.00 39.07  ? 8    PHE I CA  1 
ATOM   9132  C C   . PHE F  3  8   ? 147.002 21.575 27.134  1.00 39.20  ? 8    PHE I C   1 
ATOM   9133  O O   . PHE F  3  8   ? 147.259 20.513 27.714  1.00 38.46  ? 8    PHE I O   1 
ATOM   9134  C CB  . PHE F  3  8   ? 144.646 21.783 28.036  1.00 39.23  ? 8    PHE I CB  1 
ATOM   9135  C CG  . PHE F  3  8   ? 143.317 22.489 27.930  1.00 39.21  ? 8    PHE I CG  1 
ATOM   9136  C CD1 . PHE F  3  8   ? 142.359 22.069 27.025  1.00 38.79  ? 8    PHE I CD1 1 
ATOM   9137  C CD2 . PHE F  3  8   ? 143.027 23.576 28.745  1.00 39.37  ? 8    PHE I CD2 1 
ATOM   9138  C CE1 . PHE F  3  8   ? 141.135 22.719 26.936  1.00 38.55  ? 8    PHE I CE1 1 
ATOM   9139  C CE2 . PHE F  3  8   ? 141.808 24.231 28.659  1.00 38.90  ? 8    PHE I CE2 1 
ATOM   9140  C CZ  . PHE F  3  8   ? 140.861 23.801 27.754  1.00 38.54  ? 8    PHE I CZ  1 
ATOM   9141  N N   . VAL F  3  9   ? 147.931 22.425 26.711  1.00 39.48  ? 9    VAL I N   1 
ATOM   9142  C CA  . VAL F  3  9   ? 149.361 22.193 26.868  1.00 40.13  ? 9    VAL I CA  1 
ATOM   9143  C C   . VAL F  3  9   ? 149.931 23.104 27.943  1.00 40.83  ? 9    VAL I C   1 
ATOM   9144  O O   . VAL F  3  9   ? 149.583 24.283 28.011  1.00 40.82  ? 9    VAL I O   1 
ATOM   9145  C CB  . VAL F  3  9   ? 150.091 22.480 25.542  1.00 39.78  ? 9    VAL I CB  1 
ATOM   9146  C CG1 . VAL F  3  9   ? 151.599 22.389 25.715  1.00 39.04  ? 9    VAL I CG1 1 
ATOM   9147  C CG2 . VAL F  3  9   ? 149.601 21.531 24.462  1.00 39.55  ? 9    VAL I CG2 1 
ATOM   9148  N N   . THR F  3  10  ? 150.811 22.569 28.778  1.00 41.59  ? 10   THR I N   1 
ATOM   9149  C CA  . THR F  3  10  ? 151.400 23.390 29.825  1.00 42.73  ? 10   THR I CA  1 
ATOM   9150  C C   . THR F  3  10  ? 152.884 23.138 30.015  1.00 44.00  ? 10   THR I C   1 
ATOM   9151  O O   . THR F  3  10  ? 153.321 21.997 30.119  1.00 44.12  ? 10   THR I O   1 
ATOM   9152  C CB  . THR F  3  10  ? 150.671 23.189 31.154  1.00 42.45  ? 10   THR I CB  1 
ATOM   9153  O OG1 . THR F  3  10  ? 151.224 24.070 32.140  1.00 41.71  ? 10   THR I OG1 1 
ATOM   9154  C CG2 . THR F  3  10  ? 150.890 21.789 31.679  1.00 42.09  ? 10   THR I CG2 1 
ATOM   9155  N N   . ALA F  3  11  ? 153.648 24.222 30.049  1.00 45.60  ? 11   ALA I N   1 
ATOM   9156  C CA  . ALA F  3  11  ? 155.085 24.152 30.245  1.00 47.25  ? 11   ALA I CA  1 
ATOM   9157  C C   . ALA F  3  11  ? 155.464 25.251 31.227  1.00 48.84  ? 11   ALA I C   1 
ATOM   9158  O O   . ALA F  3  11  ? 155.130 26.417 31.019  1.00 49.20  ? 11   ALA I O   1 
ATOM   9159  C CB  . ALA F  3  11  ? 155.821 24.334 28.919  1.00 47.04  ? 11   ALA I CB  1 
ATOM   9160  N N   . VAL F  3  12  ? 156.138 24.879 32.306  1.00 50.51  ? 12   VAL I N   1 
ATOM   9161  C CA  . VAL F  3  12  ? 156.538 25.852 33.308  1.00 52.11  ? 12   VAL I CA  1 
ATOM   9162  C C   . VAL F  3  12  ? 158.031 25.713 33.537  1.00 53.32  ? 12   VAL I C   1 
ATOM   9163  O O   . VAL F  3  12  ? 158.527 24.619 33.778  1.00 53.06  ? 12   VAL I O   1 
ATOM   9164  C CB  . VAL F  3  12  ? 155.774 25.653 34.646  1.00 52.38  ? 12   VAL I CB  1 
ATOM   9165  C CG1 . VAL F  3  12  ? 156.218 24.372 35.343  1.00 52.44  ? 12   VAL I CG1 1 
ATOM   9166  C CG2 . VAL F  3  12  ? 155.969 26.858 35.560  1.00 52.53  ? 12   VAL I CG2 1 
ATOM   9167  N N   . SER F  3  13  ? 158.745 26.826 33.444  1.00 55.28  ? 13   SER I N   1 
ATOM   9168  C CA  . SER F  3  13  ? 160.185 26.817 33.631  1.00 57.04  ? 13   SER I CA  1 
ATOM   9169  C C   . SER F  3  13  ? 160.536 26.566 35.096  1.00 58.69  ? 13   SER I C   1 
ATOM   9170  O O   . SER F  3  13  ? 159.819 26.994 36.000  1.00 58.65  ? 13   SER I O   1 
ATOM   9171  C CB  . SER F  3  13  ? 160.779 28.143 33.163  1.00 57.07  ? 13   SER I CB  1 
ATOM   9172  O OG  . SER F  3  13  ? 160.114 29.235 33.773  1.00 57.41  ? 13   SER I OG  1 
ATOM   9173  N N   . ARG F  3  14  ? 161.639 25.860 35.320  1.00 60.64  ? 14   ARG I N   1 
ATOM   9174  C CA  . ARG F  3  14  ? 162.102 25.559 36.665  1.00 62.30  ? 14   ARG I CA  1 
ATOM   9175  C C   . ARG F  3  14  ? 163.549 26.029 36.786  1.00 63.52  ? 14   ARG I C   1 
ATOM   9176  O O   . ARG F  3  14  ? 164.452 25.218 37.004  1.00 63.71  ? 14   ARG I O   1 
ATOM   9177  C CB  . ARG F  3  14  ? 162.018 24.059 36.924  1.00 62.57  ? 14   ARG I CB  1 
ATOM   9178  C CG  . ARG F  3  14  ? 160.638 23.473 36.731  1.00 63.61  ? 14   ARG I CG  1 
ATOM   9179  C CD  . ARG F  3  14  ? 160.650 21.963 36.818  1.00 65.10  ? 14   ARG I CD  1 
ATOM   9180  N NE  . ARG F  3  14  ? 159.315 21.381 36.820  1.00 66.13  ? 14   ARG I NE  1 
ATOM   9181  C CZ  . ARG F  3  14  ? 159.076 20.082 36.955  1.00 67.26  ? 14   ARG I CZ  1 
ATOM   9182  N NH1 . ARG F  3  14  ? 160.084 19.229 37.096  1.00 67.87  ? 14   ARG I NH1 1 
ATOM   9183  N NH2 . ARG F  3  14  ? 157.833 19.629 36.955  1.00 67.51  ? 14   ARG I NH2 1 
ATOM   9184  N N   . PRO F  3  15  ? 163.774 27.339 36.673  1.00 64.88  ? 15   PRO I N   1 
ATOM   9185  C CA  . PRO F  3  15  ? 165.127 27.894 36.734  1.00 65.71  ? 15   PRO I CA  1 
ATOM   9186  C C   . PRO F  3  15  ? 165.851 27.403 37.981  1.00 66.52  ? 15   PRO I C   1 
ATOM   9187  O O   . PRO F  3  15  ? 165.277 27.392 39.071  1.00 66.41  ? 15   PRO I O   1 
ATOM   9188  C CB  . PRO F  3  15  ? 164.872 29.403 36.787  1.00 65.74  ? 15   PRO I CB  1 
ATOM   9189  C CG  . PRO F  3  15  ? 163.576 29.562 36.088  1.00 65.41  ? 15   PRO I CG  1 
ATOM   9190  C CD  . PRO F  3  15  ? 162.770 28.414 36.607  1.00 65.01  ? 15   PRO I CD  1 
ATOM   9191  N N   . GLY F  3  16  ? 167.100 26.985 37.813  1.00 67.49  ? 16   GLY I N   1 
ATOM   9192  C CA  . GLY F  3  16  ? 167.882 26.483 38.927  1.00 68.26  ? 16   GLY I CA  1 
ATOM   9193  C C   . GLY F  3  16  ? 167.659 24.994 39.120  1.00 68.83  ? 16   GLY I C   1 
ATOM   9194  O O   . GLY F  3  16  ? 168.543 24.278 39.587  1.00 68.79  ? 16   GLY I O   1 
ATOM   9195  N N   . LEU F  3  17  ? 166.469 24.531 38.749  1.00 69.55  ? 17   LEU I N   1 
ATOM   9196  C CA  . LEU F  3  17  ? 166.108 23.126 38.873  1.00 70.06  ? 17   LEU I CA  1 
ATOM   9197  C C   . LEU F  3  17  ? 166.495 22.359 37.614  1.00 70.42  ? 17   LEU I C   1 
ATOM   9198  O O   . LEU F  3  17  ? 166.998 21.237 37.686  1.00 70.52  ? 17   LEU I O   1 
ATOM   9199  C CB  . LEU F  3  17  ? 164.601 22.978 39.112  1.00 70.13  ? 17   LEU I CB  1 
ATOM   9200  C CG  . LEU F  3  17  ? 164.004 23.689 40.327  1.00 70.34  ? 17   LEU I CG  1 
ATOM   9201  C CD1 . LEU F  3  17  ? 164.795 23.333 41.573  1.00 70.62  ? 17   LEU I CD1 1 
ATOM   9202  C CD2 . LEU F  3  17  ? 163.987 25.188 40.123  1.00 70.45  ? 17   LEU I CD2 1 
ATOM   9203  N N   . GLY F  3  18  ? 166.255 22.967 36.458  1.00 70.59  ? 18   GLY I N   1 
ATOM   9204  C CA  . GLY F  3  18  ? 166.567 22.325 35.196  1.00 70.72  ? 18   GLY I CA  1 
ATOM   9205  C C   . GLY F  3  18  ? 165.647 22.830 34.100  1.00 70.64  ? 18   GLY I C   1 
ATOM   9206  O O   . GLY F  3  18  ? 165.253 23.994 34.107  1.00 70.62  ? 18   GLY I O   1 
ATOM   9207  N N   . GLU F  3  19  ? 165.294 21.954 33.166  1.00 70.51  ? 19   GLU I N   1 
ATOM   9208  C CA  . GLU F  3  19  ? 164.421 22.322 32.052  1.00 70.41  ? 19   GLU I CA  1 
ATOM   9209  C C   . GLU F  3  19  ? 162.951 22.395 32.487  1.00 70.11  ? 19   GLU I C   1 
ATOM   9210  O O   . GLU F  3  19  ? 162.573 21.827 33.514  1.00 70.12  ? 19   GLU I O   1 
ATOM   9211  C CB  . GLU F  3  19  ? 164.585 21.311 30.921  1.00 70.51  ? 19   GLU I CB  1 
ATOM   9212  C CG  . GLU F  3  19  ? 166.019 20.852 30.736  1.00 70.75  ? 19   GLU I CG  1 
ATOM   9213  C CD  . GLU F  3  19  ? 166.166 19.811 29.650  1.00 71.19  ? 19   GLU I CD  1 
ATOM   9214  O OE1 . GLU F  3  19  ? 165.345 18.871 29.613  1.00 71.12  ? 19   GLU I OE1 1 
ATOM   9215  O OE2 . GLU F  3  19  ? 167.103 19.936 28.831  1.00 71.63  ? 19   GLU I OE2 1 
ATOM   9216  N N   . PRO F  3  20  ? 162.120 23.091 31.708  1.00 69.67  ? 20   PRO I N   1 
ATOM   9217  C CA  . PRO F  3  20  ? 160.697 23.235 32.028  1.00 69.27  ? 20   PRO I CA  1 
ATOM   9218  C C   . PRO F  3  20  ? 159.967 21.901 32.130  1.00 68.65  ? 20   PRO I C   1 
ATOM   9219  O O   . PRO F  3  20  ? 160.473 20.877 31.671  1.00 68.85  ? 20   PRO I O   1 
ATOM   9220  C CB  . PRO F  3  20  ? 160.168 24.064 30.853  1.00 69.38  ? 20   PRO I CB  1 
ATOM   9221  C CG  . PRO F  3  20  ? 161.358 24.829 30.394  1.00 69.63  ? 20   PRO I CG  1 
ATOM   9222  C CD  . PRO F  3  20  ? 162.457 23.808 30.467  1.00 69.79  ? 20   PRO I CD  1 
ATOM   9223  N N   . ARG F  3  21  ? 158.792 21.913 32.748  1.00 67.73  ? 21   ARG I N   1 
ATOM   9224  C CA  . ARG F  3  21  ? 157.997 20.703 32.870  1.00 66.95  ? 21   ARG I CA  1 
ATOM   9225  C C   . ARG F  3  21  ? 157.010 20.684 31.727  1.00 65.70  ? 21   ARG I C   1 
ATOM   9226  O O   . ARG F  3  21  ? 156.426 21.714 31.394  1.00 65.78  ? 21   ARG I O   1 
ATOM   9227  C CB  . ARG F  3  21  ? 157.227 20.682 34.180  1.00 67.38  ? 21   ARG I CB  1 
ATOM   9228  C CG  . ARG F  3  21  ? 156.304 19.488 34.319  1.00 68.55  ? 21   ARG I CG  1 
ATOM   9229  C CD  . ARG F  3  21  ? 155.377 19.620 35.503  1.00 70.32  ? 21   ARG I CD  1 
ATOM   9230  N NE  . ARG F  3  21  ? 154.826 18.339 35.921  1.00 71.76  ? 21   ARG I NE  1 
ATOM   9231  C CZ  . ARG F  3  21  ? 154.392 18.084 37.149  1.00 72.92  ? 21   ARG I CZ  1 
ATOM   9232  N NH1 . ARG F  3  21  ? 154.444 19.026 38.081  1.00 73.12  ? 21   ARG I NH1 1 
ATOM   9233  N NH2 . ARG F  3  21  ? 153.910 16.885 37.451  1.00 73.71  ? 21   ARG I NH2 1 
ATOM   9234  N N   . TYR F  3  22  ? 156.807 19.520 31.128  1.00 64.09  ? 22   TYR I N   1 
ATOM   9235  C CA  . TYR F  3  22  ? 155.869 19.424 30.021  1.00 62.77  ? 22   TYR I CA  1 
ATOM   9236  C C   . TYR F  3  22  ? 154.827 18.359 30.290  1.00 61.55  ? 22   TYR I C   1 
ATOM   9237  O O   . TYR F  3  22  ? 155.109 17.340 30.921  1.00 61.09  ? 22   TYR I O   1 
ATOM   9238  C CB  . TYR F  3  22  ? 156.599 19.092 28.729  1.00 62.78  ? 22   TYR I CB  1 
ATOM   9239  C CG  . TYR F  3  22  ? 155.874 19.507 27.473  1.00 62.75  ? 22   TYR I CG  1 
ATOM   9240  C CD1 . TYR F  3  22  ? 155.671 20.850 27.179  1.00 62.97  ? 22   TYR I CD1 1 
ATOM   9241  C CD2 . TYR F  3  22  ? 155.425 18.561 26.560  1.00 62.81  ? 22   TYR I CD2 1 
ATOM   9242  C CE1 . TYR F  3  22  ? 155.032 21.240 26.012  1.00 62.97  ? 22   TYR I CE1 1 
ATOM   9243  C CE2 . TYR F  3  22  ? 154.783 18.942 25.386  1.00 62.86  ? 22   TYR I CE2 1 
ATOM   9244  C CZ  . TYR F  3  22  ? 154.590 20.284 25.117  1.00 62.98  ? 22   TYR I CZ  1 
ATOM   9245  O OH  . TYR F  3  22  ? 153.961 20.675 23.953  1.00 62.94  ? 22   TYR I OH  1 
ATOM   9246  N N   . MET F  3  23  ? 153.618 18.607 29.806  1.00 60.03  ? 23   MET I N   1 
ATOM   9247  C CA  . MET F  3  23  ? 152.535 17.663 29.964  1.00 58.91  ? 23   MET I CA  1 
ATOM   9248  C C   . MET F  3  23  ? 151.406 18.043 29.034  1.00 57.63  ? 23   MET I C   1 
ATOM   9249  O O   . MET F  3  23  ? 151.105 19.227 28.849  1.00 57.73  ? 23   MET I O   1 
ATOM   9250  C CB  . MET F  3  23  ? 152.037 17.626 31.411  1.00 59.31  ? 23   MET I CB  1 
ATOM   9251  C CG  . MET F  3  23  ? 151.456 18.923 31.920  1.00 59.87  ? 23   MET I CG  1 
ATOM   9252  S SD  . MET F  3  23  ? 150.735 18.783 33.572  1.00 60.79  ? 23   MET I SD  1 
ATOM   9253  C CE  . MET F  3  23  ? 152.203 18.582 34.582  1.00 60.87  ? 23   MET I CE  1 
ATOM   9254  N N   . GLU F  3  24  ? 150.781 17.035 28.440  1.00 55.76  ? 24   GLU I N   1 
ATOM   9255  C CA  . GLU F  3  24  ? 149.687 17.288 27.524  1.00 54.09  ? 24   GLU I CA  1 
ATOM   9256  C C   . GLU F  3  24  ? 148.407 16.580 27.893  1.00 53.09  ? 24   GLU I C   1 
ATOM   9257  O O   . GLU F  3  24  ? 148.410 15.514 28.508  1.00 52.89  ? 24   GLU I O   1 
ATOM   9258  C CB  . GLU F  3  24  ? 150.080 16.897 26.106  1.00 53.88  ? 24   GLU I CB  1 
ATOM   9259  C CG  . GLU F  3  24  ? 151.067 17.846 25.463  1.00 52.66  ? 24   GLU I CG  1 
ATOM   9260  C CD  . GLU F  3  24  ? 151.134 17.658 23.968  1.00 51.23  ? 24   GLU I CD  1 
ATOM   9261  O OE1 . GLU F  3  24  ? 150.083 17.784 23.309  1.00 50.75  ? 24   GLU I OE1 1 
ATOM   9262  O OE2 . GLU F  3  24  ? 152.228 17.374 23.455  1.00 50.34  ? 24   GLU I OE2 1 
ATOM   9263  N N   . VAL F  3  25  ? 147.309 17.207 27.494  1.00 51.85  ? 25   VAL I N   1 
ATOM   9264  C CA  . VAL F  3  25  ? 145.980 16.690 27.727  1.00 50.87  ? 25   VAL I CA  1 
ATOM   9265  C C   . VAL F  3  25  ? 145.070 17.144 26.590  1.00 50.61  ? 25   VAL I C   1 
ATOM   9266  O O   . VAL F  3  25  ? 144.840 18.341 26.395  1.00 49.55  ? 25   VAL I O   1 
ATOM   9267  C CB  . VAL F  3  25  ? 145.421 17.158 29.089  1.00 50.42  ? 25   VAL I CB  1 
ATOM   9268  C CG1 . VAL F  3  25  ? 146.250 16.582 30.194  1.00 50.06  ? 25   VAL I CG1 1 
ATOM   9269  C CG2 . VAL F  3  25  ? 145.417 18.665 29.193  1.00 50.01  ? 25   VAL I CG2 1 
ATOM   9270  N N   . GLY F  3  26  ? 144.589 16.173 25.822  1.00 50.74  ? 26   GLY I N   1 
ATOM   9271  C CA  . GLY F  3  26  ? 143.680 16.450 24.732  1.00 51.16  ? 26   GLY I CA  1 
ATOM   9272  C C   . GLY F  3  26  ? 142.291 16.368 25.326  1.00 51.40  ? 26   GLY I C   1 
ATOM   9273  O O   . GLY F  3  26  ? 142.029 15.502 26.159  1.00 51.68  ? 26   GLY I O   1 
ATOM   9274  N N   . TYR F  3  27  ? 141.401 17.264 24.926  1.00 51.58  ? 27   TYR I N   1 
ATOM   9275  C CA  . TYR F  3  27  ? 140.059 17.263 25.494  1.00 51.76  ? 27   TYR I CA  1 
ATOM   9276  C C   . TYR F  3  27  ? 138.942 17.053 24.492  1.00 51.95  ? 27   TYR I C   1 
ATOM   9277  O O   . TYR F  3  27  ? 138.499 17.996 23.852  1.00 52.06  ? 27   TYR I O   1 
ATOM   9278  C CB  . TYR F  3  27  ? 139.818 18.561 26.267  1.00 51.63  ? 27   TYR I CB  1 
ATOM   9279  C CG  . TYR F  3  27  ? 140.371 18.502 27.670  1.00 51.43  ? 27   TYR I CG  1 
ATOM   9280  C CD1 . TYR F  3  27  ? 141.179 19.514 28.169  1.00 51.38  ? 27   TYR I CD1 1 
ATOM   9281  C CD2 . TYR F  3  27  ? 140.101 17.416 28.493  1.00 51.13  ? 27   TYR I CD2 1 
ATOM   9282  C CE1 . TYR F  3  27  ? 141.702 19.454 29.455  1.00 51.26  ? 27   TYR I CE1 1 
ATOM   9283  C CE2 . TYR F  3  27  ? 140.616 17.346 29.772  1.00 51.21  ? 27   TYR I CE2 1 
ATOM   9284  C CZ  . TYR F  3  27  ? 141.417 18.365 30.250  1.00 50.99  ? 27   TYR I CZ  1 
ATOM   9285  O OH  . TYR F  3  27  ? 141.943 18.280 31.520  1.00 51.69  ? 27   TYR I OH  1 
ATOM   9286  N N   . VAL F  3  28  ? 138.485 15.811 24.368  1.00 52.13  ? 28   VAL I N   1 
ATOM   9287  C CA  . VAL F  3  28  ? 137.375 15.505 23.485  1.00 52.52  ? 28   VAL I CA  1 
ATOM   9288  C C   . VAL F  3  28  ? 136.096 15.764 24.267  1.00 52.62  ? 28   VAL I C   1 
ATOM   9289  O O   . VAL F  3  28  ? 135.719 14.962 25.124  1.00 52.81  ? 28   VAL I O   1 
ATOM   9290  C CB  . VAL F  3  28  ? 137.379 14.037 23.026  1.00 52.73  ? 28   VAL I CB  1 
ATOM   9291  C CG1 . VAL F  3  28  ? 136.090 13.717 22.293  1.00 52.87  ? 28   VAL I CG1 1 
ATOM   9292  C CG2 . VAL F  3  28  ? 138.560 13.763 22.118  1.00 53.26  ? 28   VAL I CG2 1 
ATOM   9293  N N   . ASP F  3  29  ? 135.439 16.885 23.974  1.00 52.44  ? 29   ASP I N   1 
ATOM   9294  C CA  . ASP F  3  29  ? 134.209 17.274 24.662  1.00 52.16  ? 29   ASP I CA  1 
ATOM   9295  C C   . ASP F  3  29  ? 134.472 17.418 26.150  1.00 52.17  ? 29   ASP I C   1 
ATOM   9296  O O   . ASP F  3  29  ? 133.649 17.023 26.976  1.00 51.95  ? 29   ASP I O   1 
ATOM   9297  C CB  . ASP F  3  29  ? 133.093 16.256 24.434  1.00 51.98  ? 29   ASP I CB  1 
ATOM   9298  C CG  . ASP F  3  29  ? 132.599 16.242 23.013  1.00 51.68  ? 29   ASP I CG  1 
ATOM   9299  O OD1 . ASP F  3  29  ? 132.786 17.253 22.300  1.00 51.42  ? 29   ASP I OD1 1 
ATOM   9300  O OD2 . ASP F  3  29  ? 132.005 15.253 22.542  1.00 51.31  ? 29   ASP I OD2 1 
ATOM   9301  N N   . ASP F  3  30  ? 135.639 17.967 26.473  1.00 52.33  ? 30   ASP I N   1 
ATOM   9302  C CA  . ASP F  3  30  ? 136.054 18.203 27.853  1.00 52.43  ? 30   ASP I CA  1 
ATOM   9303  C C   . ASP F  3  30  ? 136.497 16.948 28.596  1.00 52.51  ? 30   ASP I C   1 
ATOM   9304  O O   . ASP F  3  30  ? 137.118 17.046 29.651  1.00 52.65  ? 30   ASP I O   1 
ATOM   9305  C CB  . ASP F  3  30  ? 134.939 18.895 28.630  1.00 52.44  ? 30   ASP I CB  1 
ATOM   9306  C CG  . ASP F  3  30  ? 134.427 20.116 27.922  1.00 52.54  ? 30   ASP I CG  1 
ATOM   9307  O OD1 . ASP F  3  30  ? 133.731 20.935 28.560  1.00 53.35  ? 30   ASP I OD1 1 
ATOM   9308  O OD2 . ASP F  3  30  ? 134.687 20.319 26.718  1.00 52.05  ? 30   ASP I OD2 1 
ATOM   9309  N N   . THR F  3  31  ? 136.175 15.774 28.061  1.00 52.59  ? 31   THR I N   1 
ATOM   9310  C CA  . THR F  3  31  ? 136.579 14.518 28.688  1.00 52.68  ? 31   THR I CA  1 
ATOM   9311  C C   . THR F  3  31  ? 138.004 14.164 28.275  1.00 52.68  ? 31   THR I C   1 
ATOM   9312  O O   . THR F  3  31  ? 138.235 13.760 27.135  1.00 52.73  ? 31   THR I O   1 
ATOM   9313  C CB  . THR F  3  31  ? 135.655 13.379 28.251  1.00 52.81  ? 31   THR I CB  1 
ATOM   9314  O OG1 . THR F  3  31  ? 134.350 13.552 28.825  1.00 53.07  ? 31   THR I OG1 1 
ATOM   9315  C CG2 . THR F  3  31  ? 136.178 12.035 28.766  1.00 53.17  ? 31   THR I CG2 1 
ATOM   9316  N N   . GLU F  3  32  ? 138.962 14.308 29.187  1.00 52.68  ? 32   GLU I N   1 
ATOM   9317  C CA  . GLU F  3  32  ? 140.351 13.983 28.866  1.00 52.55  ? 32   GLU I CA  1 
ATOM   9318  C C   . GLU F  3  32  ? 140.427 12.567 28.331  1.00 51.99  ? 32   GLU I C   1 
ATOM   9319  O O   . GLU F  3  32  ? 139.734 11.675 28.821  1.00 51.86  ? 32   GLU I O   1 
ATOM   9320  C CB  . GLU F  3  32  ? 141.255 14.091 30.088  1.00 52.86  ? 32   GLU I CB  1 
ATOM   9321  C CG  . GLU F  3  32  ? 142.712 13.754 29.792  1.00 54.27  ? 32   GLU I CG  1 
ATOM   9322  C CD  . GLU F  3  32  ? 143.642 14.101 30.938  1.00 55.37  ? 32   GLU I CD  1 
ATOM   9323  O OE1 . GLU F  3  32  ? 143.640 15.273 31.375  1.00 56.40  ? 32   GLU I OE1 1 
ATOM   9324  O OE2 . GLU F  3  32  ? 144.379 13.207 31.403  1.00 55.82  ? 32   GLU I OE2 1 
ATOM   9325  N N   . PHE F  3  33  ? 141.282 12.363 27.336  1.00 51.20  ? 33   PHE I N   1 
ATOM   9326  C CA  . PHE F  3  33  ? 141.431 11.053 26.722  1.00 50.57  ? 33   PHE I CA  1 
ATOM   9327  C C   . PHE F  3  33  ? 142.888 10.723 26.398  1.00 49.78  ? 33   PHE I C   1 
ATOM   9328  O O   . PHE F  3  33  ? 143.219 9.572  26.129  1.00 49.74  ? 33   PHE I O   1 
ATOM   9329  C CB  . PHE F  3  33  ? 140.577 10.972 25.456  1.00 50.73  ? 33   PHE I CB  1 
ATOM   9330  C CG  . PHE F  3  33  ? 141.117 11.772 24.301  1.00 51.55  ? 33   PHE I CG  1 
ATOM   9331  C CD1 . PHE F  3  33  ? 141.310 11.177 23.060  1.00 52.18  ? 33   PHE I CD1 1 
ATOM   9332  C CD2 . PHE F  3  33  ? 141.432 13.112 24.449  1.00 51.67  ? 33   PHE I CD2 1 
ATOM   9333  C CE1 . PHE F  3  33  ? 141.811 11.905 21.997  1.00 51.79  ? 33   PHE I CE1 1 
ATOM   9334  C CE2 . PHE F  3  33  ? 141.932 13.843 23.387  1.00 51.55  ? 33   PHE I CE2 1 
ATOM   9335  C CZ  . PHE F  3  33  ? 142.122 13.240 22.160  1.00 51.48  ? 33   PHE I CZ  1 
ATOM   9336  N N   . VAL F  3  34  ? 143.752 11.732 26.416  1.00 48.81  ? 34   VAL I N   1 
ATOM   9337  C CA  . VAL F  3  34  ? 145.172 11.528 26.150  1.00 48.10  ? 34   VAL I CA  1 
ATOM   9338  C C   . VAL F  3  34  ? 145.999 12.449 27.028  1.00 47.95  ? 34   VAL I C   1 
ATOM   9339  O O   . VAL F  3  34  ? 145.735 13.651 27.124  1.00 47.02  ? 34   VAL I O   1 
ATOM   9340  C CB  . VAL F  3  34  ? 145.568 11.788 24.668  1.00 47.89  ? 34   VAL I CB  1 
ATOM   9341  C CG1 . VAL F  3  34  ? 144.815 10.848 23.734  1.00 47.69  ? 34   VAL I CG1 1 
ATOM   9342  C CG2 . VAL F  3  34  ? 145.347 13.250 24.295  1.00 47.33  ? 34   VAL I CG2 1 
ATOM   9343  N N   . ARG F  3  35  ? 147.013 11.866 27.657  1.00 48.03  ? 35   ARG I N   1 
ATOM   9344  C CA  . ARG F  3  35  ? 147.886 12.604 28.543  1.00 48.23  ? 35   ARG I CA  1 
ATOM   9345  C C   . ARG F  3  35  ? 149.340 12.195 28.363  1.00 49.08  ? 35   ARG I C   1 
ATOM   9346  O O   . ARG F  3  35  ? 149.663 11.022 28.168  1.00 48.79  ? 35   ARG I O   1 
ATOM   9347  C CB  . ARG F  3  35  ? 147.446 12.372 29.986  1.00 47.89  ? 35   ARG I CB  1 
ATOM   9348  C CG  . ARG F  3  35  ? 148.473 12.699 31.048  1.00 47.02  ? 35   ARG I CG  1 
ATOM   9349  C CD  . ARG F  3  35  ? 148.325 14.100 31.631  1.00 46.27  ? 35   ARG I CD  1 
ATOM   9350  N NE  . ARG F  3  35  ? 146.956 14.420 32.035  1.00 45.20  ? 35   ARG I NE  1 
ATOM   9351  C CZ  . ARG F  3  35  ? 146.619 15.453 32.796  1.00 43.39  ? 35   ARG I CZ  1 
ATOM   9352  N NH1 . ARG F  3  35  ? 147.547 16.277 33.259  1.00 42.12  ? 35   ARG I NH1 1 
ATOM   9353  N NH2 . ARG F  3  35  ? 145.343 15.673 33.081  1.00 43.44  ? 35   ARG I NH2 1 
ATOM   9354  N N   . PHE F  3  36  ? 150.216 13.183 28.417  1.00 50.34  ? 36   PHE I N   1 
ATOM   9355  C CA  . PHE F  3  36  ? 151.637 12.937 28.338  1.00 51.86  ? 36   PHE I CA  1 
ATOM   9356  C C   . PHE F  3  36  ? 152.277 13.879 29.340  1.00 53.05  ? 36   PHE I C   1 
ATOM   9357  O O   . PHE F  3  36  ? 151.853 15.026 29.450  1.00 53.19  ? 36   PHE I O   1 
ATOM   9358  C CB  . PHE F  3  36  ? 152.185 13.223 26.937  1.00 51.98  ? 36   PHE I CB  1 
ATOM   9359  C CG  . PHE F  3  36  ? 153.675 13.407 26.914  1.00 52.25  ? 36   PHE I CG  1 
ATOM   9360  C CD1 . PHE F  3  36  ? 154.515 12.347 27.196  1.00 52.46  ? 36   PHE I CD1 1 
ATOM   9361  C CD2 . PHE F  3  36  ? 154.233 14.653 26.675  1.00 52.76  ? 36   PHE I CD2 1 
ATOM   9362  C CE1 . PHE F  3  36  ? 155.888 12.517 27.219  1.00 53.01  ? 36   PHE I CE1 1 
ATOM   9363  C CE2 . PHE F  3  36  ? 155.611 14.828 26.696  1.00 53.30  ? 36   PHE I CE2 1 
ATOM   9364  C CZ  . PHE F  3  36  ? 156.438 13.753 26.970  1.00 53.50  ? 36   PHE I CZ  1 
ATOM   9365  N N   . ASP F  3  37  ? 153.273 13.406 30.081  1.00 54.46  ? 37   ASP I N   1 
ATOM   9366  C CA  . ASP F  3  37  ? 153.966 14.257 31.046  1.00 55.87  ? 37   ASP I CA  1 
ATOM   9367  C C   . ASP F  3  37  ? 155.456 13.920 31.081  1.00 56.99  ? 37   ASP I C   1 
ATOM   9368  O O   . ASP F  3  37  ? 155.862 12.875 31.597  1.00 56.99  ? 37   ASP I O   1 
ATOM   9369  C CB  . ASP F  3  37  ? 153.349 14.121 32.441  1.00 55.98  ? 37   ASP I CB  1 
ATOM   9370  C CG  . ASP F  3  37  ? 153.971 15.068 33.455  1.00 56.56  ? 37   ASP I CG  1 
ATOM   9371  O OD1 . ASP F  3  37  ? 154.035 16.293 33.201  1.00 57.27  ? 37   ASP I OD1 1 
ATOM   9372  O OD2 . ASP F  3  37  ? 154.411 14.652 34.544  1.00 57.15  ? 37   ASP I OD2 1 
ATOM   9373  N N   . SER F  3  38  ? 156.263 14.819 30.522  1.00 58.39  ? 38   SER I N   1 
ATOM   9374  C CA  . SER F  3  38  ? 157.709 14.651 30.458  1.00 59.44  ? 38   SER I CA  1 
ATOM   9375  C C   . SER F  3  38  ? 158.320 14.772 31.842  1.00 60.54  ? 38   SER I C   1 
ATOM   9376  O O   . SER F  3  38  ? 159.382 15.364 32.015  1.00 60.63  ? 38   SER I O   1 
ATOM   9377  C CB  . SER F  3  38  ? 158.315 15.713 29.544  1.00 59.42  ? 38   SER I CB  1 
ATOM   9378  O OG  . SER F  3  38  ? 158.188 16.998 30.125  1.00 59.65  ? 38   SER I OG  1 
ATOM   9379  N N   . ASP F  3  39  ? 157.625 14.218 32.826  1.00 61.98  ? 39   ASP I N   1 
ATOM   9380  C CA  . ASP F  3  39  ? 158.063 14.230 34.211  1.00 63.13  ? 39   ASP I CA  1 
ATOM   9381  C C   . ASP F  3  39  ? 157.800 12.848 34.790  1.00 64.05  ? 39   ASP I C   1 
ATOM   9382  O O   . ASP F  3  39  ? 158.214 12.540 35.907  1.00 64.18  ? 39   ASP I O   1 
ATOM   9383  C CB  . ASP F  3  39  ? 157.296 15.282 35.010  1.00 63.30  ? 39   ASP I CB  1 
ATOM   9384  C CG  . ASP F  3  39  ? 158.131 16.499 35.330  1.00 63.60  ? 39   ASP I CG  1 
ATOM   9385  O OD1 . ASP F  3  39  ? 158.687 17.122 34.396  1.00 64.10  ? 39   ASP I OD1 1 
ATOM   9386  O OD2 . ASP F  3  39  ? 158.262 16.892 36.507  1.00 63.61  ? 39   ASP I OD2 1 
ATOM   9387  N N   . ALA F  3  40  ? 157.108 12.021 34.011  1.00 65.11  ? 40   ALA I N   1 
ATOM   9388  C CA  . ALA F  3  40  ? 156.767 10.668 34.419  1.00 66.04  ? 40   ALA I CA  1 
ATOM   9389  C C   . ALA F  3  40  ? 157.962 9.731  34.268  1.00 66.91  ? 40   ALA I C   1 
ATOM   9390  O O   . ALA F  3  40  ? 158.938 10.053 33.586  1.00 66.86  ? 40   ALA I O   1 
ATOM   9391  C CB  . ALA F  3  40  ? 155.589 10.157 33.600  1.00 65.97  ? 40   ALA I CB  1 
ATOM   9392  N N   . GLU F  3  41  ? 157.870 8.568  34.911  1.00 67.97  ? 41   GLU I N   1 
ATOM   9393  C CA  . GLU F  3  41  ? 158.921 7.558  34.865  1.00 68.81  ? 41   GLU I CA  1 
ATOM   9394  C C   . GLU F  3  41  ? 159.454 7.417  33.438  1.00 68.95  ? 41   GLU I C   1 
ATOM   9395  O O   . GLU F  3  41  ? 160.629 7.111  33.222  1.00 69.13  ? 41   GLU I O   1 
ATOM   9396  C CB  . GLU F  3  41  ? 158.383 6.211  35.371  1.00 69.13  ? 41   GLU I CB  1 
ATOM   9397  C CG  . GLU F  3  41  ? 157.570 5.413  34.355  1.00 70.18  ? 41   GLU I CG  1 
ATOM   9398  C CD  . GLU F  3  41  ? 156.309 6.122  33.883  1.00 71.16  ? 41   GLU I CD  1 
ATOM   9399  O OE1 . GLU F  3  41  ? 155.664 5.617  32.939  1.00 71.41  ? 41   GLU I OE1 1 
ATOM   9400  O OE2 . GLU F  3  41  ? 155.960 7.181  34.447  1.00 71.69  ? 41   GLU I OE2 1 
ATOM   9401  N N   . ASN F  3  42  ? 158.571 7.648  32.473  1.00 69.00  ? 42   ASN I N   1 
ATOM   9402  C CA  . ASN F  3  42  ? 158.909 7.579  31.059  1.00 68.90  ? 42   ASN I CA  1 
ATOM   9403  C C   . ASN F  3  42  ? 158.051 8.585  30.298  1.00 68.22  ? 42   ASN I C   1 
ATOM   9404  O O   . ASN F  3  42  ? 156.852 8.356  30.126  1.00 68.12  ? 42   ASN I O   1 
ATOM   9405  C CB  . ASN F  3  42  ? 158.643 6.173  30.508  1.00 69.22  ? 42   ASN I CB  1 
ATOM   9406  C CG  . ASN F  3  42  ? 159.567 5.120  31.096  1.00 70.01  ? 42   ASN I CG  1 
ATOM   9407  O OD1 . ASN F  3  42  ? 160.791 5.244  31.031  1.00 70.96  ? 42   ASN I OD1 1 
ATOM   9408  N ND2 . ASN F  3  42  ? 158.983 4.071  31.666  1.00 70.73  ? 42   ASN I ND2 1 
ATOM   9409  N N   . PRO F  3  43  ? 158.618 9.726  29.899  1.00 67.44  ? 43   PRO I N   1 
ATOM   9410  C CA  . PRO F  3  43  ? 157.844 10.700 29.133  1.00 66.88  ? 43   PRO I CA  1 
ATOM   9411  C C   . PRO F  3  43  ? 157.267 10.065 27.874  1.00 66.06  ? 43   PRO I C   1 
ATOM   9412  O O   . PRO F  3  43  ? 157.936 9.961  26.848  1.00 66.06  ? 43   PRO I O   1 
ATOM   9413  C CB  . PRO F  3  43  ? 158.875 11.780 28.819  1.00 66.98  ? 43   PRO I CB  1 
ATOM   9414  C CG  . PRO F  3  43  ? 159.759 11.742 30.002  1.00 67.18  ? 43   PRO I CG  1 
ATOM   9415  C CD  . PRO F  3  43  ? 159.953 10.258 30.226  1.00 67.45  ? 43   PRO I CD  1 
ATOM   9416  N N   . ARG F  3  44  ? 156.013 9.640  27.971  1.00 65.00  ? 44   ARG I N   1 
ATOM   9417  C CA  . ARG F  3  44  ? 155.348 8.976  26.867  1.00 64.15  ? 44   ARG I CA  1 
ATOM   9418  C C   . ARG F  3  44  ? 153.854 9.270  26.908  1.00 62.94  ? 44   ARG I C   1 
ATOM   9419  O O   . ARG F  3  44  ? 153.249 9.333  27.983  1.00 62.80  ? 44   ARG I O   1 
ATOM   9420  C CB  . ARG F  3  44  ? 155.593 7.469  26.974  1.00 64.48  ? 44   ARG I CB  1 
ATOM   9421  C CG  . ARG F  3  44  ? 155.322 6.651  25.728  1.00 65.26  ? 44   ARG I CG  1 
ATOM   9422  C CD  . ARG F  3  44  ? 155.690 5.179  25.951  1.00 66.26  ? 44   ARG I CD  1 
ATOM   9423  N NE  . ARG F  3  44  ? 155.599 4.351  24.751  1.00 66.97  ? 44   ARG I NE  1 
ATOM   9424  C CZ  . ARG F  3  44  ? 154.495 4.190  24.031  1.00 67.32  ? 44   ARG I CZ  1 
ATOM   9425  N NH1 . ARG F  3  44  ? 153.374 4.808  24.376  1.00 67.34  ? 44   ARG I NH1 1 
ATOM   9426  N NH2 . ARG F  3  44  ? 154.510 3.409  22.959  1.00 67.53  ? 44   ARG I NH2 1 
ATOM   9427  N N   . TYR F  3  45  ? 153.270 9.472  25.734  1.00 61.25  ? 45   TYR I N   1 
ATOM   9428  C CA  . TYR F  3  45  ? 151.848 9.725  25.632  1.00 59.98  ? 45   TYR I CA  1 
ATOM   9429  C C   . TYR F  3  45  ? 151.130 8.477  26.120  1.00 58.58  ? 45   TYR I C   1 
ATOM   9430  O O   . TYR F  3  45  ? 151.559 7.365  25.825  1.00 58.49  ? 45   TYR I O   1 
ATOM   9431  C CB  . TYR F  3  45  ? 151.462 10.015 24.184  1.00 60.14  ? 45   TYR I CB  1 
ATOM   9432  C CG  . TYR F  3  45  ? 150.970 11.424 23.946  1.00 60.64  ? 45   TYR I CG  1 
ATOM   9433  C CD1 . TYR F  3  45  ? 151.856 12.492 23.869  1.00 60.91  ? 45   TYR I CD1 1 
ATOM   9434  C CD2 . TYR F  3  45  ? 149.612 11.685 23.798  1.00 61.13  ? 45   TYR I CD2 1 
ATOM   9435  C CE1 . TYR F  3  45  ? 151.398 13.787 23.654  1.00 61.13  ? 45   TYR I CE1 1 
ATOM   9436  C CE2 . TYR F  3  45  ? 149.147 12.970 23.580  1.00 61.34  ? 45   TYR I CE2 1 
ATOM   9437  C CZ  . TYR F  3  45  ? 150.040 14.016 23.509  1.00 61.34  ? 45   TYR I CZ  1 
ATOM   9438  O OH  . TYR F  3  45  ? 149.560 15.286 23.293  1.00 61.34  ? 45   TYR I OH  1 
ATOM   9439  N N   . GLU F  3  46  ? 150.049 8.655  26.871  1.00 56.94  ? 46   GLU I N   1 
ATOM   9440  C CA  . GLU F  3  46  ? 149.297 7.523  27.394  1.00 55.59  ? 46   GLU I CA  1 
ATOM   9441  C C   . GLU F  3  46  ? 147.805 7.795  27.224  1.00 54.59  ? 46   GLU I C   1 
ATOM   9442  O O   . GLU F  3  46  ? 147.365 8.941  27.316  1.00 54.52  ? 46   GLU I O   1 
ATOM   9443  C CB  . GLU F  3  46  ? 149.629 7.311  28.876  1.00 55.62  ? 46   GLU I CB  1 
ATOM   9444  C CG  . GLU F  3  46  ? 149.885 5.861  29.277  1.00 55.25  ? 46   GLU I CG  1 
ATOM   9445  C CD  . GLU F  3  46  ? 151.266 5.372  28.880  1.00 55.22  ? 46   GLU I CD  1 
ATOM   9446  O OE1 . GLU F  3  46  ? 152.263 5.955  29.352  1.00 55.88  ? 46   GLU I OE1 1 
ATOM   9447  O OE2 . GLU F  3  46  ? 151.359 4.399  28.102  1.00 55.29  ? 46   GLU I OE2 1 
ATOM   9448  N N   . PRO F  3  47  ? 147.016 6.749  26.989  1.00 53.44  ? 47   PRO I N   1 
ATOM   9449  C CA  . PRO F  3  47  ? 145.574 6.908  26.798  1.00 52.72  ? 47   PRO I CA  1 
ATOM   9450  C C   . PRO F  3  47  ? 144.851 7.187  28.109  1.00 52.27  ? 47   PRO I C   1 
ATOM   9451  O O   . PRO F  3  47  ? 145.125 6.535  29.118  1.00 52.21  ? 47   PRO I O   1 
ATOM   9452  C CB  . PRO F  3  47  ? 145.173 5.551  26.228  1.00 52.72  ? 47   PRO I CB  1 
ATOM   9453  C CG  . PRO F  3  47  ? 146.068 4.615  26.957  1.00 52.81  ? 47   PRO I CG  1 
ATOM   9454  C CD  . PRO F  3  47  ? 147.405 5.328  26.907  1.00 53.29  ? 47   PRO I CD  1 
ATOM   9455  N N   . ARG F  3  48  ? 143.941 8.155  28.098  1.00 51.73  ? 48   ARG I N   1 
ATOM   9456  C CA  . ARG F  3  48  ? 143.186 8.481  29.302  1.00 51.02  ? 48   ARG I CA  1 
ATOM   9457  C C   . ARG F  3  48  ? 141.817 7.863  29.197  1.00 51.51  ? 48   ARG I C   1 
ATOM   9458  O O   . ARG F  3  48  ? 140.860 8.358  29.778  1.00 51.76  ? 48   ARG I O   1 
ATOM   9459  C CB  . ARG F  3  48  ? 143.069 9.991  29.525  1.00 50.25  ? 48   ARG I CB  1 
ATOM   9460  C CG  . ARG F  3  48  ? 144.404 10.705 29.632  1.00 48.10  ? 48   ARG I CG  1 
ATOM   9461  C CD  . ARG F  3  48  ? 145.522 9.812  30.130  1.00 46.04  ? 48   ARG I CD  1 
ATOM   9462  N NE  . ARG F  3  48  ? 145.970 10.124 31.486  1.00 45.64  ? 48   ARG I NE  1 
ATOM   9463  C CZ  . ARG F  3  48  ? 145.439 9.642  32.603  1.00 44.80  ? 48   ARG I CZ  1 
ATOM   9464  N NH1 . ARG F  3  48  ? 144.404 8.815  32.564  1.00 44.35  ? 48   ARG I NH1 1 
ATOM   9465  N NH2 . ARG F  3  48  ? 145.951 9.994  33.775  1.00 44.85  ? 48   ARG I NH2 1 
ATOM   9466  N N   . ALA F  3  49  ? 141.732 6.770  28.449  1.00 52.06  ? 49   ALA I N   1 
ATOM   9467  C CA  . ALA F  3  49  ? 140.471 6.079  28.259  1.00 52.68  ? 49   ALA I CA  1 
ATOM   9468  C C   . ALA F  3  49  ? 140.706 4.701  27.648  1.00 53.44  ? 49   ALA I C   1 
ATOM   9469  O O   . ALA F  3  49  ? 141.509 4.549  26.727  1.00 53.04  ? 49   ALA I O   1 
ATOM   9470  C CB  . ALA F  3  49  ? 139.548 6.912  27.371  1.00 52.64  ? 49   ALA I CB  1 
ATOM   9471  N N   . ARG F  3  50  ? 139.990 3.704  28.164  1.00 54.57  ? 50   ARG I N   1 
ATOM   9472  C CA  . ARG F  3  50  ? 140.101 2.333  27.674  1.00 55.54  ? 50   ARG I CA  1 
ATOM   9473  C C   . ARG F  3  50  ? 139.947 2.270  26.152  1.00 56.11  ? 50   ARG I C   1 
ATOM   9474  O O   . ARG F  3  50  ? 140.568 1.438  25.501  1.00 56.23  ? 50   ARG I O   1 
ATOM   9475  C CB  . ARG F  3  50  ? 139.050 1.432  28.333  1.00 55.74  ? 50   ARG I CB  1 
ATOM   9476  C CG  . ARG F  3  50  ? 139.523 -0.002 28.525  1.00 56.42  ? 50   ARG I CG  1 
ATOM   9477  C CD  . ARG F  3  50  ? 140.482 -0.134 29.704  1.00 57.57  ? 50   ARG I CD  1 
ATOM   9478  N NE  . ARG F  3  50  ? 141.616 -1.027 29.458  1.00 58.43  ? 50   ARG I NE  1 
ATOM   9479  C CZ  . ARG F  3  50  ? 141.536 -2.347 29.313  1.00 58.76  ? 50   ARG I CZ  1 
ATOM   9480  N NH1 . ARG F  3  50  ? 140.364 -2.969 29.367  1.00 58.77  ? 50   ARG I NH1 1 
ATOM   9481  N NH2 . ARG F  3  50  ? 142.641 -3.051 29.104  1.00 58.93  ? 50   ARG I NH2 1 
ATOM   9482  N N   . TRP F  3  51  ? 139.119 3.143  25.583  1.00 56.64  ? 51   TRP I N   1 
ATOM   9483  C CA  . TRP F  3  51  ? 138.932 3.162  24.133  1.00 57.09  ? 51   TRP I CA  1 
ATOM   9484  C C   . TRP F  3  51  ? 140.120 3.819  23.428  1.00 57.39  ? 51   TRP I C   1 
ATOM   9485  O O   . TRP F  3  51  ? 140.333 3.613  22.232  1.00 57.32  ? 51   TRP I O   1 
ATOM   9486  C CB  . TRP F  3  51  ? 137.636 3.884  23.748  1.00 57.10  ? 51   TRP I CB  1 
ATOM   9487  C CG  . TRP F  3  51  ? 137.482 5.249  24.357  1.00 57.25  ? 51   TRP I CG  1 
ATOM   9488  C CD1 . TRP F  3  51  ? 136.807 5.561  25.503  1.00 57.38  ? 51   TRP I CD1 1 
ATOM   9489  C CD2 . TRP F  3  51  ? 138.008 6.486  23.856  1.00 57.09  ? 51   TRP I CD2 1 
ATOM   9490  N NE1 . TRP F  3  51  ? 136.885 6.911  25.747  1.00 57.22  ? 51   TRP I NE1 1 
ATOM   9491  C CE2 . TRP F  3  51  ? 137.616 7.503  24.751  1.00 56.97  ? 51   TRP I CE2 1 
ATOM   9492  C CE3 . TRP F  3  51  ? 138.772 6.840  22.740  1.00 56.94  ? 51   TRP I CE3 1 
ATOM   9493  C CZ2 . TRP F  3  51  ? 137.961 8.840  24.565  1.00 56.46  ? 51   TRP I CZ2 1 
ATOM   9494  C CZ3 . TRP F  3  51  ? 139.110 8.172  22.558  1.00 56.40  ? 51   TRP I CZ3 1 
ATOM   9495  C CH2 . TRP F  3  51  ? 138.706 9.151  23.465  1.00 56.10  ? 51   TRP I CH2 1 
ATOM   9496  N N   . MET F  3  52  ? 140.894 4.608  24.166  1.00 57.69  ? 52   MET I N   1 
ATOM   9497  C CA  . MET F  3  52  ? 142.057 5.268  23.584  1.00 57.92  ? 52   MET I CA  1 
ATOM   9498  C C   . MET F  3  52  ? 143.205 4.273  23.425  1.00 58.14  ? 52   MET I C   1 
ATOM   9499  O O   . MET F  3  52  ? 144.308 4.635  23.010  1.00 58.07  ? 52   MET I O   1 
ATOM   9500  C CB  . MET F  3  52  ? 142.491 6.463  24.432  1.00 57.93  ? 52   MET I CB  1 
ATOM   9501  C CG  . MET F  3  52  ? 142.305 7.802  23.740  1.00 58.01  ? 52   MET I CG  1 
ATOM   9502  S SD  . MET F  3  52  ? 143.175 7.889  22.154  1.00 57.79  ? 52   MET I SD  1 
ATOM   9503  C CE  . MET F  3  52  ? 141.858 7.468  21.014  1.00 57.78  ? 52   MET I CE  1 
ATOM   9504  N N   . GLU F  3  53  ? 142.927 3.012  23.742  1.00 58.35  ? 53   GLU I N   1 
ATOM   9505  C CA  . GLU F  3  53  ? 143.916 1.953  23.620  1.00 58.42  ? 53   GLU I CA  1 
ATOM   9506  C C   . GLU F  3  53  ? 143.582 1.095  22.407  1.00 58.23  ? 53   GLU I C   1 
ATOM   9507  O O   . GLU F  3  53  ? 144.195 0.057  22.179  1.00 58.30  ? 53   GLU I O   1 
ATOM   9508  C CB  . GLU F  3  53  ? 143.939 1.080  24.874  1.00 58.59  ? 53   GLU I CB  1 
ATOM   9509  C CG  . GLU F  3  53  ? 142.757 0.135  24.990  1.00 58.89  ? 53   GLU I CG  1 
ATOM   9510  C CD  . GLU F  3  53  ? 142.978 -0.953 26.019  1.00 59.28  ? 53   GLU I CD  1 
ATOM   9511  O OE1 . GLU F  3  53  ? 142.005 -1.652 26.366  1.00 59.68  ? 53   GLU I OE1 1 
ATOM   9512  O OE2 . GLU F  3  53  ? 144.129 -1.115 26.473  1.00 59.89  ? 53   GLU I OE2 1 
ATOM   9513  N N   . GLN F  3  54  ? 142.581 1.523  21.649  1.00 58.00  ? 54   GLN I N   1 
ATOM   9514  C CA  . GLN F  3  54  ? 142.188 0.831  20.434  1.00 57.79  ? 54   GLN I CA  1 
ATOM   9515  C C   . GLN F  3  54  ? 143.103 1.349  19.327  1.00 57.43  ? 54   GLN I C   1 
ATOM   9516  O O   . GLN F  3  54  ? 143.222 0.744  18.260  1.00 57.47  ? 54   GLN I O   1 
ATOM   9517  C CB  . GLN F  3  54  ? 140.728 1.133  20.103  1.00 57.84  ? 54   GLN I CB  1 
ATOM   9518  C CG  . GLN F  3  54  ? 140.192 0.385  18.894  1.00 58.33  ? 54   GLN I CG  1 
ATOM   9519  C CD  . GLN F  3  54  ? 140.032 -1.109 19.134  1.00 58.49  ? 54   GLN I CD  1 
ATOM   9520  O OE1 . GLN F  3  54  ? 139.812 -1.872 18.191  1.00 58.29  ? 54   GLN I OE1 1 
ATOM   9521  N NE2 . GLN F  3  54  ? 140.128 -1.527 20.391  1.00 58.26  ? 54   GLN I NE2 1 
ATOM   9522  N N   . GLU F  3  55  ? 143.755 2.477  19.610  1.00 57.02  ? 55   GLU I N   1 
ATOM   9523  C CA  . GLU F  3  55  ? 144.676 3.127  18.689  1.00 56.55  ? 55   GLU I CA  1 
ATOM   9524  C C   . GLU F  3  55  ? 145.925 2.282  18.586  1.00 56.55  ? 55   GLU I C   1 
ATOM   9525  O O   . GLU F  3  55  ? 145.889 1.092  18.870  1.00 56.32  ? 55   GLU I O   1 
ATOM   9526  C CB  . GLU F  3  55  ? 145.047 4.522  19.197  1.00 56.23  ? 55   GLU I CB  1 
ATOM   9527  C CG  . GLU F  3  55  ? 143.959 5.567  19.030  1.00 56.04  ? 55   GLU I CG  1 
ATOM   9528  C CD  . GLU F  3  55  ? 143.951 6.209  17.654  1.00 56.00  ? 55   GLU I CD  1 
ATOM   9529  O OE1 . GLU F  3  55  ? 144.829 7.060  17.386  1.00 56.17  ? 55   GLU I OE1 1 
ATOM   9530  O OE2 . GLU F  3  55  ? 143.060 5.874  16.843  1.00 55.10  ? 55   GLU I OE2 1 
ATOM   9531  N N   . GLY F  3  56  ? 147.034 2.898  18.189  1.00 56.57  ? 56   GLY I N   1 
ATOM   9532  C CA  . GLY F  3  56  ? 148.270 2.160  18.035  1.00 56.19  ? 56   GLY I CA  1 
ATOM   9533  C C   . GLY F  3  56  ? 149.520 2.806  18.580  1.00 56.02  ? 56   GLY I C   1 
ATOM   9534  O O   . GLY F  3  56  ? 149.672 4.023  18.540  1.00 55.87  ? 56   GLY I O   1 
ATOM   9535  N N   . PRO F  3  57  ? 150.382 1.990  19.182  1.00 55.83  ? 57   PRO I N   1 
ATOM   9536  C CA  . PRO F  3  57  ? 151.676 2.432  19.689  1.00 55.59  ? 57   PRO I CA  1 
ATOM   9537  C C   . PRO F  3  57  ? 152.575 2.927  18.578  1.00 55.08  ? 57   PRO I C   1 
ATOM   9538  O O   . PRO F  3  57  ? 153.755 3.178  18.788  1.00 55.07  ? 57   PRO I O   1 
ATOM   9539  C CB  . PRO F  3  57  ? 152.210 1.179  20.379  1.00 55.78  ? 57   PRO I CB  1 
ATOM   9540  C CG  . PRO F  3  57  ? 150.971 0.536  20.884  1.00 55.84  ? 57   PRO I CG  1 
ATOM   9541  C CD  . PRO F  3  57  ? 150.062 0.649  19.682  1.00 56.01  ? 57   PRO I CD  1 
ATOM   9542  N N   . GLU F  3  58  ? 151.987 3.052  17.396  1.00 54.75  ? 58   GLU I N   1 
ATOM   9543  C CA  . GLU F  3  58  ? 152.647 3.611  16.238  1.00 54.27  ? 58   GLU I CA  1 
ATOM   9544  C C   . GLU F  3  58  ? 152.222 5.054  16.385  1.00 53.77  ? 58   GLU I C   1 
ATOM   9545  O O   . GLU F  3  58  ? 153.025 5.978  16.322  1.00 53.68  ? 58   GLU I O   1 
ATOM   9546  C CB  . GLU F  3  58  ? 152.060 3.052  14.944  1.00 54.47  ? 58   GLU I CB  1 
ATOM   9547  C CG  . GLU F  3  58  ? 151.851 1.549  14.915  1.00 55.00  ? 58   GLU I CG  1 
ATOM   9548  C CD  . GLU F  3  58  ? 150.645 1.152  14.078  1.00 55.59  ? 58   GLU I CD  1 
ATOM   9549  O OE1 . GLU F  3  58  ? 149.545 1.693  14.329  1.00 56.42  ? 58   GLU I OE1 1 
ATOM   9550  O OE2 . GLU F  3  58  ? 150.786 0.304  13.172  1.00 55.44  ? 58   GLU I OE2 1 
ATOM   9551  N N   . TYR F  3  59  ? 150.916 5.204  16.601  1.00 53.34  ? 59   TYR I N   1 
ATOM   9552  C CA  . TYR F  3  59  ? 150.250 6.477  16.834  1.00 53.03  ? 59   TYR I CA  1 
ATOM   9553  C C   . TYR F  3  59  ? 150.780 7.014  18.149  1.00 52.36  ? 59   TYR I C   1 
ATOM   9554  O O   . TYR F  3  59  ? 151.060 8.203  18.287  1.00 52.04  ? 59   TYR I O   1 
ATOM   9555  C CB  . TYR F  3  59  ? 148.736 6.228  16.908  1.00 53.45  ? 59   TYR I CB  1 
ATOM   9556  C CG  . TYR F  3  59  ? 147.899 7.189  17.735  1.00 54.44  ? 59   TYR I CG  1 
ATOM   9557  C CD1 . TYR F  3  59  ? 147.596 8.465  17.270  1.00 55.47  ? 59   TYR I CD1 1 
ATOM   9558  C CD2 . TYR F  3  59  ? 147.350 6.789  18.951  1.00 55.22  ? 59   TYR I CD2 1 
ATOM   9559  C CE1 . TYR F  3  59  ? 146.791 9.327  18.007  1.00 55.60  ? 59   TYR I CE1 1 
ATOM   9560  C CE2 . TYR F  3  59  ? 146.544 7.643  19.695  1.00 55.45  ? 59   TYR I CE2 1 
ATOM   9561  C CZ  . TYR F  3  59  ? 146.268 8.908  19.215  1.00 55.57  ? 59   TYR I CZ  1 
ATOM   9562  O OH  . TYR F  3  59  ? 145.473 9.764  19.940  1.00 55.91  ? 59   TYR I OH  1 
ATOM   9563  N N   . TRP F  3  60  ? 150.931 6.117  19.116  1.00 51.67  ? 60   TRP I N   1 
ATOM   9564  C CA  . TRP F  3  60  ? 151.461 6.494  20.414  1.00 51.44  ? 60   TRP I CA  1 
ATOM   9565  C C   . TRP F  3  60  ? 152.917 6.883  20.258  1.00 51.42  ? 60   TRP I C   1 
ATOM   9566  O O   . TRP F  3  60  ? 153.376 7.850  20.864  1.00 51.33  ? 60   TRP I O   1 
ATOM   9567  C CB  . TRP F  3  60  ? 151.306 5.354  21.413  1.00 51.29  ? 60   TRP I CB  1 
ATOM   9568  C CG  . TRP F  3  60  ? 149.907 5.261  21.884  1.00 50.75  ? 60   TRP I CG  1 
ATOM   9569  C CD1 . TRP F  3  60  ? 149.038 4.221  21.711  1.00 50.39  ? 60   TRP I CD1 1 
ATOM   9570  C CD2 . TRP F  3  60  ? 149.183 6.280  22.569  1.00 49.97  ? 60   TRP I CD2 1 
ATOM   9571  N NE1 . TRP F  3  60  ? 147.818 4.530  22.264  1.00 50.47  ? 60   TRP I NE1 1 
ATOM   9572  C CE2 . TRP F  3  60  ? 147.881 5.793  22.797  1.00 50.38  ? 60   TRP I CE2 1 
ATOM   9573  C CE3 . TRP F  3  60  ? 149.506 7.564  23.019  1.00 49.24  ? 60   TRP I CE3 1 
ATOM   9574  C CZ2 . TRP F  3  60  ? 146.908 6.542  23.455  1.00 49.75  ? 60   TRP I CZ2 1 
ATOM   9575  C CZ3 . TRP F  3  60  ? 148.541 8.304  23.671  1.00 49.10  ? 60   TRP I CZ3 1 
ATOM   9576  C CH2 . TRP F  3  60  ? 147.259 7.793  23.885  1.00 49.47  ? 60   TRP I CH2 1 
ATOM   9577  N N   . GLU F  3  61  ? 153.643 6.129  19.441  1.00 51.23  ? 61   GLU I N   1 
ATOM   9578  C CA  . GLU F  3  61  ? 155.022 6.469  19.177  1.00 51.50  ? 61   GLU I CA  1 
ATOM   9579  C C   . GLU F  3  61  ? 154.928 7.804  18.477  1.00 51.39  ? 61   GLU I C   1 
ATOM   9580  O O   . GLU F  3  61  ? 155.564 8.784  18.871  1.00 51.47  ? 61   GLU I O   1 
ATOM   9581  C CB  . GLU F  3  61  ? 155.695 5.445  18.255  1.00 51.86  ? 61   GLU I CB  1 
ATOM   9582  C CG  . GLU F  3  61  ? 156.555 4.417  18.976  1.00 52.35  ? 61   GLU I CG  1 
ATOM   9583  C CD  . GLU F  3  61  ? 157.721 5.044  19.722  1.00 53.16  ? 61   GLU I CD  1 
ATOM   9584  O OE1 . GLU F  3  61  ? 158.633 5.581  19.062  1.00 54.08  ? 61   GLU I OE1 1 
ATOM   9585  O OE2 . GLU F  3  61  ? 157.727 5.003  20.972  1.00 53.63  ? 61   GLU I OE2 1 
ATOM   9586  N N   . ARG F  3  62  ? 154.090 7.823  17.445  1.00 51.01  ? 62   ARG I N   1 
ATOM   9587  C CA  . ARG F  3  62  ? 153.859 9.002  16.631  1.00 50.92  ? 62   ARG I CA  1 
ATOM   9588  C C   . ARG F  3  62  ? 153.633 10.238 17.497  1.00 50.56  ? 62   ARG I C   1 
ATOM   9589  O O   . ARG F  3  62  ? 154.417 11.183 17.454  1.00 50.38  ? 62   ARG I O   1 
ATOM   9590  C CB  . ARG F  3  62  ? 152.666 8.753  15.707  1.00 51.20  ? 62   ARG I CB  1 
ATOM   9591  C CG  . ARG F  3  62  ? 152.668 9.591  14.447  1.00 52.51  ? 62   ARG I CG  1 
ATOM   9592  C CD  . ARG F  3  62  ? 151.834 10.834 14.586  1.00 53.66  ? 62   ARG I CD  1 
ATOM   9593  N NE  . ARG F  3  62  ? 150.413 10.518 14.520  1.00 54.91  ? 62   ARG I NE  1 
ATOM   9594  C CZ  . ARG F  3  62  ? 149.451 11.377 14.809  1.00 56.34  ? 62   ARG I CZ  1 
ATOM   9595  N NH1 . ARG F  3  62  ? 149.760 12.610 15.187  1.00 56.78  ? 62   ARG I NH1 1 
ATOM   9596  N NH2 . ARG F  3  62  ? 148.179 11.012 14.715  1.00 56.92  ? 62   ARG I NH2 1 
ATOM   9597  N N   . GLU F  3  63  ? 152.574 10.220 18.299  1.00 50.33  ? 63   GLU I N   1 
ATOM   9598  C CA  . GLU F  3  63  ? 152.250 11.349 19.164  1.00 50.07  ? 63   GLU I CA  1 
ATOM   9599  C C   . GLU F  3  63  ? 153.335 11.645 20.200  1.00 50.11  ? 63   GLU I C   1 
ATOM   9600  O O   . GLU F  3  63  ? 153.763 12.795 20.338  1.00 49.87  ? 63   GLU I O   1 
ATOM   9601  C CB  . GLU F  3  63  ? 150.908 11.120 19.851  1.00 50.11  ? 63   GLU I CB  1 
ATOM   9602  C CG  . GLU F  3  63  ? 149.721 11.542 18.994  1.00 50.13  ? 63   GLU I CG  1 
ATOM   9603  C CD  . GLU F  3  63  ? 149.807 12.999 18.566  1.00 49.82  ? 63   GLU I CD  1 
ATOM   9604  O OE1 . GLU F  3  63  ? 149.530 13.894 19.394  1.00 49.94  ? 63   GLU I OE1 1 
ATOM   9605  O OE2 . GLU F  3  63  ? 150.172 13.250 17.400  1.00 49.09  ? 63   GLU I OE2 1 
ATOM   9606  N N   . THR F  3  64  ? 153.778 10.617 20.921  1.00 49.98  ? 64   THR I N   1 
ATOM   9607  C CA  . THR F  3  64  ? 154.818 10.791 21.930  1.00 50.20  ? 64   THR I CA  1 
ATOM   9608  C C   . THR F  3  64  ? 156.003 11.540 21.341  1.00 50.05  ? 64   THR I C   1 
ATOM   9609  O O   . THR F  3  64  ? 156.625 12.365 22.010  1.00 50.08  ? 64   THR I O   1 
ATOM   9610  C CB  . THR F  3  64  ? 155.318 9.443  22.445  1.00 50.53  ? 64   THR I CB  1 
ATOM   9611  O OG1 . THR F  3  64  ? 154.290 8.798  23.209  1.00 51.15  ? 64   THR I OG1 1 
ATOM   9612  C CG2 . THR F  3  64  ? 156.507 9.638  23.399  1.00 50.98  ? 64   THR I CG2 1 
ATOM   9613  N N   . GLN F  3  65  ? 156.316 11.234 20.086  1.00 49.63  ? 65   GLN I N   1 
ATOM   9614  C CA  . GLN F  3  65  ? 157.415 11.885 19.393  1.00 49.24  ? 65   GLN I CA  1 
ATOM   9615  C C   . GLN F  3  65  ? 157.087 13.354 19.106  1.00 48.62  ? 65   GLN I C   1 
ATOM   9616  O O   . GLN F  3  65  ? 157.930 14.231 19.318  1.00 48.55  ? 65   GLN I O   1 
ATOM   9617  C CB  . GLN F  3  65  ? 157.738 11.145 18.091  1.00 49.47  ? 65   GLN I CB  1 
ATOM   9618  C CG  . GLN F  3  65  ? 158.386 9.771  18.285  1.00 49.69  ? 65   GLN I CG  1 
ATOM   9619  C CD  . GLN F  3  65  ? 159.707 9.836  19.032  1.00 50.00  ? 65   GLN I CD  1 
ATOM   9620  O OE1 . GLN F  3  65  ? 160.563 10.667 18.722  1.00 50.54  ? 65   GLN I OE1 1 
ATOM   9621  N NE2 . GLN F  3  65  ? 159.878 8.957  20.013  1.00 49.66  ? 65   GLN I NE2 1 
ATOM   9622  N N   . LYS F  3  66  ? 155.870 13.616 18.621  1.00 47.78  ? 66   LYS I N   1 
ATOM   9623  C CA  . LYS F  3  66  ? 155.436 14.981 18.325  1.00 46.93  ? 66   LYS I CA  1 
ATOM   9624  C C   . LYS F  3  66  ? 155.595 15.790 19.583  1.00 46.37  ? 66   LYS I C   1 
ATOM   9625  O O   . LYS F  3  66  ? 156.145 16.895 19.570  1.00 46.17  ? 66   LYS I O   1 
ATOM   9626  C CB  . LYS F  3  66  ? 153.964 15.026 17.926  1.00 46.97  ? 66   LYS I CB  1 
ATOM   9627  C CG  . LYS F  3  66  ? 153.465 16.421 17.538  1.00 47.12  ? 66   LYS I CG  1 
ATOM   9628  C CD  . LYS F  3  66  ? 151.975 16.430 17.249  1.00 47.22  ? 66   LYS I CD  1 
ATOM   9629  C CE  . LYS F  3  66  ? 151.635 15.599 16.027  1.00 47.43  ? 66   LYS I CE  1 
ATOM   9630  N NZ  . LYS F  3  66  ? 150.171 15.385 15.888  1.00 47.88  ? 66   LYS I NZ  1 
ATOM   9631  N N   . ALA F  3  67  ? 155.081 15.211 20.667  1.00 45.62  ? 67   ALA I N   1 
ATOM   9632  C CA  . ALA F  3  67  ? 155.140 15.800 21.990  1.00 44.86  ? 67   ALA I CA  1 
ATOM   9633  C C   . ALA F  3  67  ? 156.555 16.271 22.315  1.00 44.15  ? 67   ALA I C   1 
ATOM   9634  O O   . ALA F  3  67  ? 156.758 17.399 22.766  1.00 44.02  ? 67   ALA I O   1 
ATOM   9635  C CB  . ALA F  3  67  ? 154.672 14.784 23.026  1.00 44.62  ? 67   ALA I CB  1 
ATOM   9636  N N   . LYS F  3  68  ? 157.536 15.414 22.077  1.00 43.34  ? 68   LYS I N   1 
ATOM   9637  C CA  . LYS F  3  68  ? 158.912 15.775 22.386  1.00 43.21  ? 68   LYS I CA  1 
ATOM   9638  C C   . LYS F  3  68  ? 159.360 16.976 21.577  1.00 42.51  ? 68   LYS I C   1 
ATOM   9639  O O   . LYS F  3  68  ? 160.078 17.840 22.082  1.00 42.34  ? 68   LYS I O   1 
ATOM   9640  C CB  . LYS F  3  68  ? 159.850 14.595 22.159  1.00 43.58  ? 68   LYS I CB  1 
ATOM   9641  C CG  . LYS F  3  68  ? 159.728 13.531 23.237  1.00 44.62  ? 68   LYS I CG  1 
ATOM   9642  C CD  . LYS F  3  68  ? 160.163 14.060 24.604  1.00 45.57  ? 68   LYS I CD  1 
ATOM   9643  C CE  . LYS F  3  68  ? 159.944 13.027 25.700  1.00 45.78  ? 68   LYS I CE  1 
ATOM   9644  N NZ  . LYS F  3  68  ? 160.640 13.407 26.959  1.00 45.93  ? 68   LYS I NZ  1 
ATOM   9645  N N   . GLY F  3  69  ? 158.934 17.032 20.323  1.00 41.73  ? 69   GLY I N   1 
ATOM   9646  C CA  . GLY F  3  69  ? 159.287 18.150 19.483  1.00 41.36  ? 69   GLY I CA  1 
ATOM   9647  C C   . GLY F  3  69  ? 158.695 19.437 20.022  1.00 41.56  ? 69   GLY I C   1 
ATOM   9648  O O   . GLY F  3  69  ? 159.423 20.389 20.304  1.00 40.87  ? 69   GLY I O   1 
ATOM   9649  N N   . ASN F  3  70  ? 157.370 19.475 20.177  1.00 42.26  ? 70   ASN I N   1 
ATOM   9650  C CA  . ASN F  3  70  ? 156.711 20.683 20.671  1.00 42.93  ? 70   ASN I CA  1 
ATOM   9651  C C   . ASN F  3  70  ? 157.131 21.010 22.105  1.00 43.09  ? 70   ASN I C   1 
ATOM   9652  O O   . ASN F  3  70  ? 156.837 22.092 22.605  1.00 43.11  ? 70   ASN I O   1 
ATOM   9653  C CB  . ASN F  3  70  ? 155.183 20.586 20.603  1.00 43.61  ? 70   ASN I CB  1 
ATOM   9654  C CG  . ASN F  3  70  ? 154.689 19.606 19.551  1.00 44.74  ? 70   ASN I CG  1 
ATOM   9655  O OD1 . ASN F  3  70  ? 155.244 19.506 18.461  1.00 46.52  ? 70   ASN I OD1 1 
ATOM   9656  N ND2 . ASN F  3  70  ? 153.624 18.881 19.881  1.00 45.95  ? 70   ASN I ND2 1 
ATOM   9657  N N   . GLU F  3  71  ? 157.796 20.074 22.775  1.00 43.18  ? 71   GLU I N   1 
ATOM   9658  C CA  . GLU F  3  71  ? 158.281 20.342 24.121  1.00 43.69  ? 71   GLU I CA  1 
ATOM   9659  C C   . GLU F  3  71  ? 159.400 21.387 24.008  1.00 44.38  ? 71   GLU I C   1 
ATOM   9660  O O   . GLU F  3  71  ? 159.404 22.398 24.715  1.00 44.64  ? 71   GLU I O   1 
ATOM   9661  C CB  . GLU F  3  71  ? 158.810 19.073 24.803  1.00 43.31  ? 71   GLU I CB  1 
ATOM   9662  C CG  . GLU F  3  71  ? 159.739 19.373 25.976  1.00 42.41  ? 71   GLU I CG  1 
ATOM   9663  C CD  . GLU F  3  71  ? 160.015 18.176 26.873  1.00 41.17  ? 71   GLU I CD  1 
ATOM   9664  O OE1 . GLU F  3  71  ? 160.220 17.060 26.357  1.00 40.63  ? 71   GLU I OE1 1 
ATOM   9665  O OE2 . GLU F  3  71  ? 160.037 18.361 28.106  1.00 39.65  ? 71   GLU I OE2 1 
ATOM   9666  N N   . GLN F  3  72  ? 160.348 21.123 23.114  1.00 45.03  ? 72   GLN I N   1 
ATOM   9667  C CA  . GLN F  3  72  ? 161.447 22.045 22.857  1.00 45.81  ? 72   GLN I CA  1 
ATOM   9668  C C   . GLN F  3  72  ? 160.851 23.361 22.393  1.00 46.10  ? 72   GLN I C   1 
ATOM   9669  O O   . GLN F  3  72  ? 161.158 24.429 22.921  1.00 46.10  ? 72   GLN I O   1 
ATOM   9670  C CB  . GLN F  3  72  ? 162.367 21.495 21.763  1.00 46.03  ? 72   GLN I CB  1 
ATOM   9671  C CG  . GLN F  3  72  ? 163.262 20.356 22.211  1.00 46.50  ? 72   GLN I CG  1 
ATOM   9672  C CD  . GLN F  3  72  ? 164.292 20.802 23.226  1.00 47.06  ? 72   GLN I CD  1 
ATOM   9673  O OE1 . GLN F  3  72  ? 164.944 19.976 23.869  1.00 47.61  ? 72   GLN I OE1 1 
ATOM   9674  N NE2 . GLN F  3  72  ? 164.442 22.114 23.375  1.00 47.28  ? 72   GLN I NE2 1 
ATOM   9675  N N   . SER F  3  73  ? 159.988 23.266 21.389  1.00 46.69  ? 73   SER I N   1 
ATOM   9676  C CA  . SER F  3  73  ? 159.310 24.427 20.856  1.00 47.07  ? 73   SER I CA  1 
ATOM   9677  C C   . SER F  3  73  ? 158.937 25.339 22.006  1.00 47.87  ? 73   SER I C   1 
ATOM   9678  O O   . SER F  3  73  ? 159.179 26.544 21.957  1.00 48.04  ? 73   SER I O   1 
ATOM   9679  C CB  . SER F  3  73  ? 158.050 24.002 20.118  1.00 46.95  ? 73   SER I CB  1 
ATOM   9680  O OG  . SER F  3  73  ? 157.307 25.134 19.705  1.00 46.86  ? 73   SER I OG  1 
ATOM   9681  N N   . PHE F  3  74  ? 158.349 24.749 23.045  1.00 48.66  ? 74   PHE I N   1 
ATOM   9682  C CA  . PHE F  3  74  ? 157.930 25.506 24.219  1.00 49.36  ? 74   PHE I CA  1 
ATOM   9683  C C   . PHE F  3  74  ? 159.074 25.927 25.129  1.00 49.87  ? 74   PHE I C   1 
ATOM   9684  O O   . PHE F  3  74  ? 158.996 26.969 25.769  1.00 49.56  ? 74   PHE I O   1 
ATOM   9685  C CB  . PHE F  3  74  ? 156.870 24.738 25.007  1.00 49.41  ? 74   PHE I CB  1 
ATOM   9686  C CG  . PHE F  3  74  ? 155.479 25.068 24.570  1.00 49.72  ? 74   PHE I CG  1 
ATOM   9687  C CD1 . PHE F  3  74  ? 154.580 24.074 24.224  1.00 50.06  ? 74   PHE I CD1 1 
ATOM   9688  C CD2 . PHE F  3  74  ? 155.091 26.397 24.445  1.00 49.53  ? 74   PHE I CD2 1 
ATOM   9689  C CE1 . PHE F  3  74  ? 153.311 24.400 23.775  1.00 50.15  ? 74   PHE I CE1 1 
ATOM   9690  C CE2 . PHE F  3  74  ? 153.829 26.730 23.998  1.00 49.62  ? 74   PHE I CE2 1 
ATOM   9691  C CZ  . PHE F  3  74  ? 152.936 25.733 23.664  1.00 49.91  ? 74   PHE I CZ  1 
ATOM   9692  N N   . ARG F  3  75  ? 160.131 25.132 25.195  1.00 50.89  ? 75   ARG I N   1 
ATOM   9693  C CA  . ARG F  3  75  ? 161.266 25.504 26.026  1.00 52.00  ? 75   ARG I CA  1 
ATOM   9694  C C   . ARG F  3  75  ? 161.850 26.805 25.483  1.00 52.47  ? 75   ARG I C   1 
ATOM   9695  O O   . ARG F  3  75  ? 162.304 27.665 26.241  1.00 52.30  ? 75   ARG I O   1 
ATOM   9696  C CB  . ARG F  3  75  ? 162.334 24.417 26.016  1.00 52.36  ? 75   ARG I CB  1 
ATOM   9697  C CG  . ARG F  3  75  ? 163.553 24.753 26.860  1.00 53.42  ? 75   ARG I CG  1 
ATOM   9698  C CD  . ARG F  3  75  ? 164.569 23.636 26.868  1.00 54.65  ? 75   ARG I CD  1 
ATOM   9699  N NE  . ARG F  3  75  ? 163.970 22.372 27.289  1.00 55.52  ? 75   ARG I NE  1 
ATOM   9700  C CZ  . ARG F  3  75  ? 164.618 21.216 27.313  1.00 56.50  ? 75   ARG I CZ  1 
ATOM   9701  N NH1 . ARG F  3  75  ? 165.892 21.165 26.943  1.00 57.11  ? 75   ARG I NH1 1 
ATOM   9702  N NH2 . ARG F  3  75  ? 163.999 20.109 27.708  1.00 56.32  ? 75   ARG I NH2 1 
ATOM   9703  N N   . VAL F  3  76  ? 161.829 26.938 24.159  1.00 53.05  ? 76   VAL I N   1 
ATOM   9704  C CA  . VAL F  3  76  ? 162.353 28.129 23.508  1.00 53.47  ? 76   VAL I CA  1 
ATOM   9705  C C   . VAL F  3  76  ? 161.308 29.236 23.514  1.00 53.41  ? 76   VAL I C   1 
ATOM   9706  O O   . VAL F  3  76  ? 161.638 30.409 23.695  1.00 53.37  ? 76   VAL I O   1 
ATOM   9707  C CB  . VAL F  3  76  ? 162.795 27.842 22.070  1.00 53.76  ? 76   VAL I CB  1 
ATOM   9708  C CG1 . VAL F  3  76  ? 163.503 29.059 21.490  1.00 54.01  ? 76   VAL I CG1 1 
ATOM   9709  C CG2 . VAL F  3  76  ? 163.718 26.637 22.040  1.00 54.32  ? 76   VAL I CG2 1 
ATOM   9710  N N   . SER F  3  77  ? 160.048 28.876 23.307  1.00 53.42  ? 77   SER I N   1 
ATOM   9711  C CA  . SER F  3  77  ? 159.001 29.878 23.373  1.00 53.53  ? 77   SER I CA  1 
ATOM   9712  C C   . SER F  3  77  ? 159.221 30.548 24.731  1.00 54.01  ? 77   SER I C   1 
ATOM   9713  O O   . SER F  3  77  ? 159.340 31.765 24.822  1.00 54.15  ? 77   SER I O   1 
ATOM   9714  C CB  . SER F  3  77  ? 157.628 29.241 23.292  1.00 53.13  ? 77   SER I CB  1 
ATOM   9715  N N   . LEU F  3  78  ? 159.321 29.734 25.780  1.00 54.39  ? 78   LEU I N   1 
ATOM   9716  C CA  . LEU F  3  78  ? 159.561 30.238 27.129  1.00 55.03  ? 78   LEU I CA  1 
ATOM   9717  C C   . LEU F  3  78  ? 160.691 31.250 27.138  1.00 55.60  ? 78   LEU I C   1 
ATOM   9718  O O   . LEU F  3  78  ? 160.503 32.433 27.416  1.00 55.35  ? 78   LEU I O   1 
ATOM   9719  C CB  . LEU F  3  78  ? 159.949 29.096 28.070  1.00 54.87  ? 78   LEU I CB  1 
ATOM   9720  C CG  . LEU F  3  78  ? 158.943 28.658 29.128  1.00 54.98  ? 78   LEU I CG  1 
ATOM   9721  C CD1 . LEU F  3  78  ? 159.614 27.645 30.044  1.00 55.30  ? 78   LEU I CD1 1 
ATOM   9722  C CD2 . LEU F  3  78  ? 158.414 29.844 29.930  1.00 54.48  ? 78   LEU I CD2 1 
ATOM   9723  N N   . ARG F  3  79  ? 161.877 30.741 26.845  1.00 56.65  ? 79   ARG I N   1 
ATOM   9724  C CA  . ARG F  3  79  ? 163.094 31.532 26.779  1.00 57.61  ? 79   ARG I CA  1 
ATOM   9725  C C   . ARG F  3  79  ? 162.880 32.794 25.962  1.00 58.70  ? 79   ARG I C   1 
ATOM   9726  O O   . ARG F  3  79  ? 163.336 33.877 26.336  1.00 58.88  ? 79   ARG I O   1 
ATOM   9727  C CB  . ARG F  3  79  ? 164.171 30.676 26.131  1.00 57.39  ? 79   ARG I CB  1 
ATOM   9728  C CG  . ARG F  3  79  ? 165.443 31.360 25.734  1.00 56.88  ? 79   ARG I CG  1 
ATOM   9729  C CD  . ARG F  3  79  ? 166.285 30.383 24.943  1.00 56.67  ? 79   ARG I CD  1 
ATOM   9730  N NE  . ARG F  3  79  ? 166.293 29.080 25.616  1.00 56.33  ? 79   ARG I NE  1 
ATOM   9731  C CZ  . ARG F  3  79  ? 166.624 27.928 25.046  1.00 55.64  ? 79   ARG I CZ  1 
ATOM   9732  N NH1 . ARG F  3  79  ? 166.988 27.889 23.771  1.00 55.42  ? 79   ARG I NH1 1 
ATOM   9733  N NH2 . ARG F  3  79  ? 166.591 26.807 25.759  1.00 55.03  ? 79   ARG I NH2 1 
ATOM   9734  N N   . THR F  3  80  ? 162.181 32.639 24.843  1.00 59.87  ? 80   THR I N   1 
ATOM   9735  C CA  . THR F  3  80  ? 161.911 33.745 23.941  1.00 61.10  ? 80   THR I CA  1 
ATOM   9736  C C   . THR F  3  80  ? 160.943 34.746 24.553  1.00 62.00  ? 80   THR I C   1 
ATOM   9737  O O   . THR F  3  80  ? 161.187 35.950 24.537  1.00 62.12  ? 80   THR I O   1 
ATOM   9738  C CB  . THR F  3  80  ? 161.326 33.221 22.618  1.00 61.24  ? 80   THR I CB  1 
ATOM   9739  O OG1 . THR F  3  80  ? 162.229 32.282 22.016  1.00 61.30  ? 80   THR I OG1 1 
ATOM   9740  C CG2 . THR F  3  80  ? 161.169 34.352 21.611  1.00 61.18  ? 80   THR I CG2 1 
ATOM   9741  N N   . LEU F  3  81  ? 159.840 34.243 25.088  1.00 63.26  ? 81   LEU I N   1 
ATOM   9742  C CA  . LEU F  3  81  ? 158.836 35.104 25.690  1.00 64.21  ? 81   LEU I CA  1 
ATOM   9743  C C   . LEU F  3  81  ? 159.453 35.909 26.821  1.00 65.38  ? 81   LEU I C   1 
ATOM   9744  O O   . LEU F  3  81  ? 159.188 37.102 26.960  1.00 65.59  ? 81   LEU I O   1 
ATOM   9745  C CB  . LEU F  3  81  ? 157.679 34.270 26.220  1.00 64.13  ? 81   LEU I CB  1 
ATOM   9746  C CG  . LEU F  3  81  ? 157.097 33.265 25.225  1.00 64.10  ? 81   LEU I CG  1 
ATOM   9747  C CD1 . LEU F  3  81  ? 155.973 32.497 25.886  1.00 63.98  ? 81   LEU I CD1 1 
ATOM   9748  C CD2 . LEU F  3  81  ? 156.619 33.954 23.957  1.00 63.95  ? 81   LEU I CD2 1 
ATOM   9749  N N   . LEU F  3  82  ? 160.280 35.251 27.626  1.00 66.57  ? 82   LEU I N   1 
ATOM   9750  C CA  . LEU F  3  82  ? 160.941 35.918 28.733  1.00 67.65  ? 82   LEU I CA  1 
ATOM   9751  C C   . LEU F  3  82  ? 161.392 37.299 28.286  1.00 68.46  ? 82   LEU I C   1 
ATOM   9752  O O   . LEU F  3  82  ? 160.769 38.309 28.615  1.00 68.69  ? 82   LEU I O   1 
ATOM   9753  C CB  . LEU F  3  82  ? 162.166 35.124 29.195  1.00 67.89  ? 82   LEU I CB  1 
ATOM   9754  C CG  . LEU F  3  82  ? 161.971 33.758 29.846  1.00 68.40  ? 82   LEU I CG  1 
ATOM   9755  C CD1 . LEU F  3  82  ? 163.325 33.099 30.036  1.00 68.28  ? 82   LEU I CD1 1 
ATOM   9756  C CD2 . LEU F  3  82  ? 161.252 33.900 31.174  1.00 68.99  ? 82   LEU I CD2 1 
ATOM   9757  N N   . GLY F  3  83  ? 162.479 37.325 27.522  1.00 69.33  ? 83   GLY I N   1 
ATOM   9758  C CA  . GLY F  3  83  ? 163.046 38.565 27.031  1.00 70.16  ? 83   GLY I CA  1 
ATOM   9759  C C   . GLY F  3  83  ? 162.034 39.587 26.553  1.00 71.03  ? 83   GLY I C   1 
ATOM   9760  O O   . GLY F  3  83  ? 162.176 40.776 26.841  1.00 71.07  ? 83   GLY I O   1 
ATOM   9761  N N   . TYR F  3  84  ? 161.012 39.137 25.829  1.00 72.03  ? 84   TYR I N   1 
ATOM   9762  C CA  . TYR F  3  84  ? 159.998 40.048 25.294  1.00 72.90  ? 84   TYR I CA  1 
ATOM   9763  C C   . TYR F  3  84  ? 159.625 41.156 26.272  1.00 73.49  ? 84   TYR I C   1 
ATOM   9764  O O   . TYR F  3  84  ? 159.432 42.303 25.872  1.00 73.52  ? 84   TYR I O   1 
ATOM   9765  C CB  . TYR F  3  84  ? 158.726 39.293 24.903  1.00 73.10  ? 84   TYR I CB  1 
ATOM   9766  C CG  . TYR F  3  84  ? 158.823 38.465 23.634  1.00 73.58  ? 84   TYR I CG  1 
ATOM   9767  C CD1 . TYR F  3  84  ? 157.693 37.848 23.104  1.00 73.75  ? 84   TYR I CD1 1 
ATOM   9768  C CD2 . TYR F  3  84  ? 160.036 38.283 22.976  1.00 73.54  ? 84   TYR I CD2 1 
ATOM   9769  C CE1 . TYR F  3  84  ? 157.768 37.075 21.955  1.00 74.00  ? 84   TYR I CE1 1 
ATOM   9770  C CE2 . TYR F  3  84  ? 160.119 37.509 21.825  1.00 73.72  ? 84   TYR I CE2 1 
ATOM   9771  C CZ  . TYR F  3  84  ? 158.980 36.908 21.319  1.00 73.82  ? 84   TYR I CZ  1 
ATOM   9772  O OH  . TYR F  3  84  ? 159.043 36.130 20.182  1.00 73.20  ? 84   TYR I OH  1 
ATOM   9773  N N   . TYR F  3  85  ? 159.529 40.809 27.552  1.00 74.26  ? 85   TYR I N   1 
ATOM   9774  C CA  . TYR F  3  85  ? 159.119 41.764 28.575  1.00 74.85  ? 85   TYR I CA  1 
ATOM   9775  C C   . TYR F  3  85  ? 160.244 42.142 29.524  1.00 75.17  ? 85   TYR I C   1 
ATOM   9776  O O   . TYR F  3  85  ? 160.009 42.789 30.544  1.00 75.09  ? 85   TYR I O   1 
ATOM   9777  C CB  . TYR F  3  85  ? 157.966 41.170 29.376  1.00 75.01  ? 85   TYR I CB  1 
ATOM   9778  C CG  . TYR F  3  85  ? 157.122 40.218 28.564  1.00 75.37  ? 85   TYR I CG  1 
ATOM   9779  C CD1 . TYR F  3  85  ? 156.186 40.690 27.655  1.00 75.98  ? 85   TYR I CD1 1 
ATOM   9780  C CD2 . TYR F  3  85  ? 157.278 38.845 28.691  1.00 75.82  ? 85   TYR I CD2 1 
ATOM   9781  C CE1 . TYR F  3  85  ? 155.422 39.816 26.901  1.00 76.26  ? 85   TYR I CE1 1 
ATOM   9782  C CE2 . TYR F  3  85  ? 156.520 37.965 27.944  1.00 75.99  ? 85   TYR I CE2 1 
ATOM   9783  C CZ  . TYR F  3  85  ? 155.594 38.453 27.051  1.00 76.25  ? 85   TYR I CZ  1 
ATOM   9784  O OH  . TYR F  3  85  ? 154.842 37.573 26.310  1.00 76.26  ? 85   TYR I OH  1 
ATOM   9785  N N   . ASN F  3  86  ? 161.463 41.742 29.189  1.00 75.70  ? 86   ASN I N   1 
ATOM   9786  C CA  . ASN F  3  86  ? 162.613 42.034 30.033  1.00 76.24  ? 86   ASN I CA  1 
ATOM   9787  C C   . ASN F  3  86  ? 162.448 41.359 31.392  1.00 76.36  ? 86   ASN I C   1 
ATOM   9788  O O   . ASN F  3  86  ? 162.807 41.913 32.434  1.00 76.29  ? 86   ASN I O   1 
ATOM   9789  C CB  . ASN F  3  86  ? 162.797 43.546 30.188  1.00 76.47  ? 86   ASN I CB  1 
ATOM   9790  C CG  . ASN F  3  86  ? 163.351 44.199 28.929  1.00 76.91  ? 86   ASN I CG  1 
ATOM   9791  O OD1 . ASN F  3  86  ? 163.605 45.404 28.901  1.00 77.51  ? 86   ASN I OD1 1 
ATOM   9792  N ND2 . ASN F  3  86  ? 163.544 43.403 27.882  1.00 77.30  ? 86   ASN I ND2 1 
ATOM   9793  N N   . GLN F  3  87  ? 161.886 40.154 31.361  1.00 76.52  ? 87   GLN I N   1 
ATOM   9794  C CA  . GLN F  3  87  ? 161.681 39.360 32.561  1.00 76.64  ? 87   GLN I CA  1 
ATOM   9795  C C   . GLN F  3  87  ? 163.036 38.823 33.006  1.00 76.54  ? 87   GLN I C   1 
ATOM   9796  O O   . GLN F  3  87  ? 163.513 37.822 32.472  1.00 76.57  ? 87   GLN I O   1 
ATOM   9797  C CB  . GLN F  3  87  ? 160.748 38.182 32.265  1.00 76.77  ? 87   GLN I CB  1 
ATOM   9798  C CG  . GLN F  3  87  ? 159.377 38.561 31.716  1.00 77.31  ? 87   GLN I CG  1 
ATOM   9799  C CD  . GLN F  3  87  ? 158.308 38.682 32.791  1.00 77.84  ? 87   GLN I CD  1 
ATOM   9800  O OE1 . GLN F  3  87  ? 157.140 38.927 32.482  1.00 78.33  ? 87   GLN I OE1 1 
ATOM   9801  N NE2 . GLN F  3  87  ? 158.698 38.505 34.048  1.00 77.96  ? 87   GLN I NE2 1 
ATOM   9802  N N   . SER F  3  88  ? 163.670 39.492 33.965  1.00 76.34  ? 88   SER I N   1 
ATOM   9803  C CA  . SER F  3  88  ? 164.964 39.034 34.458  1.00 76.12  ? 88   SER I CA  1 
ATOM   9804  C C   . SER F  3  88  ? 164.807 37.617 34.986  1.00 75.75  ? 88   SER I C   1 
ATOM   9805  O O   . SER F  3  88  ? 164.074 37.388 35.947  1.00 75.74  ? 88   SER I O   1 
ATOM   9806  C CB  . SER F  3  88  ? 165.495 39.949 35.564  1.00 76.20  ? 88   SER I CB  1 
ATOM   9807  O OG  . SER F  3  88  ? 166.442 40.872 35.054  1.00 76.33  ? 88   SER I OG  1 
ATOM   9808  N N   . ALA F  3  89  ? 165.492 36.673 34.346  1.00 75.31  ? 89   ALA I N   1 
ATOM   9809  C CA  . ALA F  3  89  ? 165.437 35.264 34.725  1.00 74.94  ? 89   ALA I CA  1 
ATOM   9810  C C   . ALA F  3  89  ? 165.623 35.061 36.228  1.00 74.45  ? 89   ALA I C   1 
ATOM   9811  O O   . ALA F  3  89  ? 165.650 36.021 37.001  1.00 74.58  ? 89   ALA I O   1 
ATOM   9812  C CB  . ALA F  3  89  ? 166.490 34.480 33.953  1.00 74.98  ? 89   ALA I CB  1 
ATOM   9813  N N   . GLY F  3  90  ? 165.757 33.804 36.638  1.00 73.60  ? 90   GLY I N   1 
ATOM   9814  C CA  . GLY F  3  90  ? 165.932 33.487 38.041  1.00 72.66  ? 90   GLY I CA  1 
ATOM   9815  C C   . GLY F  3  90  ? 164.694 32.821 38.600  1.00 71.82  ? 90   GLY I C   1 
ATOM   9816  O O   . GLY F  3  90  ? 164.794 31.865 39.367  1.00 71.74  ? 90   GLY I O   1 
ATOM   9817  N N   . GLY F  3  91  ? 163.524 33.319 38.203  1.00 70.76  ? 91   GLY I N   1 
ATOM   9818  C CA  . GLY F  3  91  ? 162.259 32.777 38.675  1.00 69.79  ? 91   GLY I CA  1 
ATOM   9819  C C   . GLY F  3  91  ? 161.544 31.910 37.653  1.00 68.76  ? 91   GLY I C   1 
ATOM   9820  O O   . GLY F  3  91  ? 161.895 31.906 36.476  1.00 68.96  ? 91   GLY I O   1 
ATOM   9821  N N   . SER F  3  92  ? 160.521 31.190 38.110  1.00 67.35  ? 92   SER I N   1 
ATOM   9822  C CA  . SER F  3  92  ? 159.750 30.280 37.260  1.00 66.07  ? 92   SER I CA  1 
ATOM   9823  C C   . SER F  3  92  ? 158.549 30.917 36.574  1.00 64.63  ? 92   SER I C   1 
ATOM   9824  O O   . SER F  3  92  ? 157.826 31.713 37.165  1.00 64.45  ? 92   SER I O   1 
ATOM   9825  C CB  . SER F  3  92  ? 159.261 29.089 38.088  1.00 66.26  ? 92   SER I CB  1 
ATOM   9826  O OG  . SER F  3  92  ? 158.305 28.326 37.367  1.00 66.25  ? 92   SER I OG  1 
ATOM   9827  N N   . HIS F  3  93  ? 158.333 30.526 35.323  1.00 63.07  ? 93   HIS I N   1 
ATOM   9828  C CA  . HIS F  3  93  ? 157.215 31.022 34.531  1.00 61.77  ? 93   HIS I CA  1 
ATOM   9829  C C   . HIS F  3  93  ? 156.460 29.859 33.883  1.00 60.16  ? 93   HIS I C   1 
ATOM   9830  O O   . HIS F  3  93  ? 157.024 28.787 33.680  1.00 59.90  ? 93   HIS I O   1 
ATOM   9831  C CB  . HIS F  3  93  ? 157.727 32.001 33.481  1.00 61.98  ? 93   HIS I CB  1 
ATOM   9832  C CG  . HIS F  3  93  ? 158.076 33.347 34.040  1.00 62.73  ? 93   HIS I CG  1 
ATOM   9833  N ND1 . HIS F  3  93  ? 158.922 34.225 33.399  1.00 63.21  ? 93   HIS I ND1 1 
ATOM   9834  C CD2 . HIS F  3  93  ? 157.676 33.971 35.173  1.00 63.07  ? 93   HIS I CD2 1 
ATOM   9835  C CE1 . HIS F  3  93  ? 159.027 35.332 34.112  1.00 63.46  ? 93   HIS I CE1 1 
ATOM   9836  N NE2 . HIS F  3  93  ? 158.281 35.203 35.194  1.00 63.19  ? 93   HIS I NE2 1 
ATOM   9837  N N   . THR F  3  94  ? 155.188 30.081 33.560  1.00 58.29  ? 94   THR I N   1 
ATOM   9838  C CA  . THR F  3  94  ? 154.335 29.039 32.987  1.00 56.79  ? 94   THR I CA  1 
ATOM   9839  C C   . THR F  3  94  ? 153.870 29.343 31.558  1.00 55.45  ? 94   THR I C   1 
ATOM   9840  O O   . THR F  3  94  ? 154.077 30.443 31.051  1.00 55.36  ? 94   THR I O   1 
ATOM   9841  C CB  . THR F  3  94  ? 153.095 28.850 33.888  1.00 56.71  ? 94   THR I CB  1 
ATOM   9842  O OG1 . THR F  3  94  ? 153.505 28.520 35.221  1.00 56.53  ? 94   THR I OG1 1 
ATOM   9843  C CG2 . THR F  3  94  ? 152.234 27.682 33.420  1.00 56.74  ? 94   THR I CG2 1 
ATOM   9844  N N   . ILE F  3  95  ? 153.248 28.346 30.922  1.00 53.85  ? 95   ILE I N   1 
ATOM   9845  C CA  . ILE F  3  95  ? 152.691 28.462 29.573  1.00 52.53  ? 95   ILE I CA  1 
ATOM   9846  C C   . ILE F  3  95  ? 151.509 27.502 29.468  1.00 51.33  ? 95   ILE I C   1 
ATOM   9847  O O   . ILE F  3  95  ? 151.616 26.354 29.889  1.00 51.42  ? 95   ILE I O   1 
ATOM   9848  C CB  . ILE F  3  95  ? 153.697 28.050 28.498  1.00 52.60  ? 95   ILE I CB  1 
ATOM   9849  C CG1 . ILE F  3  95  ? 155.125 28.383 28.911  1.00 52.43  ? 95   ILE I CG1 1 
ATOM   9850  C CG2 . ILE F  3  95  ? 153.358 28.736 27.187  1.00 52.60  ? 95   ILE I CG2 1 
ATOM   9851  C CD1 . ILE F  3  95  ? 156.150 27.657 28.084  1.00 52.13  ? 95   ILE I CD1 1 
ATOM   9852  N N   . GLN F  3  96  ? 150.401 27.965 28.892  1.00 49.63  ? 96   GLN I N   1 
ATOM   9853  C CA  . GLN F  3  96  ? 149.195 27.153 28.743  1.00 47.92  ? 96   GLN I CA  1 
ATOM   9854  C C   . GLN F  3  96  ? 148.595 27.384 27.368  1.00 47.00  ? 96   GLN I C   1 
ATOM   9855  O O   . GLN F  3  96  ? 148.449 28.531 26.950  1.00 46.72  ? 96   GLN I O   1 
ATOM   9856  C CB  . GLN F  3  96  ? 148.158 27.554 29.782  1.00 47.91  ? 96   GLN I CB  1 
ATOM   9857  C CG  . GLN F  3  96  ? 148.738 28.175 31.033  1.00 47.29  ? 96   GLN I CG  1 
ATOM   9858  C CD  . GLN F  3  96  ? 147.702 28.372 32.116  1.00 46.30  ? 96   GLN I CD  1 
ATOM   9859  O OE1 . GLN F  3  96  ? 146.788 27.568 32.261  1.00 46.17  ? 96   GLN I OE1 1 
ATOM   9860  N NE2 . GLN F  3  96  ? 147.846 29.438 32.883  1.00 46.11  ? 96   GLN I NE2 1 
ATOM   9861  N N   . VAL F  3  97  ? 148.203 26.311 26.681  1.00 45.87  ? 97   VAL I N   1 
ATOM   9862  C CA  . VAL F  3  97  ? 147.666 26.443 25.319  1.00 44.88  ? 97   VAL I CA  1 
ATOM   9863  C C   . VAL F  3  97  ? 146.191 26.059 25.099  1.00 43.78  ? 97   VAL I C   1 
ATOM   9864  O O   . VAL F  3  97  ? 145.763 24.952 25.415  1.00 43.97  ? 97   VAL I O   1 
ATOM   9865  C CB  . VAL F  3  97  ? 148.525 25.656 24.332  1.00 44.91  ? 97   VAL I CB  1 
ATOM   9866  C CG1 . VAL F  3  97  ? 148.322 26.191 22.929  1.00 45.22  ? 97   VAL I CG1 1 
ATOM   9867  C CG2 . VAL F  3  97  ? 149.983 25.751 24.726  1.00 45.16  ? 97   VAL I CG2 1 
ATOM   9868  N N   . ILE F  3  98  ? 145.433 26.996 24.534  1.00 42.28  ? 98   ILE I N   1 
ATOM   9869  C CA  . ILE F  3  98  ? 144.019 26.801 24.219  1.00 40.90  ? 98   ILE I CA  1 
ATOM   9870  C C   . ILE F  3  98  ? 143.867 26.673 22.713  1.00 39.43  ? 98   ILE I C   1 
ATOM   9871  O O   . ILE F  3  98  ? 143.757 27.679 22.023  1.00 38.92  ? 98   ILE I O   1 
ATOM   9872  C CB  . ILE F  3  98  ? 143.167 28.009 24.691  1.00 40.87  ? 98   ILE I CB  1 
ATOM   9873  C CG1 . ILE F  3  98  ? 143.218 28.146 26.211  1.00 41.12  ? 98   ILE I CG1 1 
ATOM   9874  C CG2 . ILE F  3  98  ? 141.710 27.845 24.251  1.00 40.89  ? 98   ILE I CG2 1 
ATOM   9875  C CD1 . ILE F  3  98  ? 142.717 26.914 26.961  1.00 41.16  ? 98   ILE I CD1 1 
ATOM   9876  N N   . SER F  3  99  ? 143.876 25.447 22.204  1.00 38.06  ? 99   SER I N   1 
ATOM   9877  C CA  . SER F  3  99  ? 143.743 25.233 20.767  1.00 37.26  ? 99   SER I CA  1 
ATOM   9878  C C   . SER F  3  99  ? 142.876 24.014 20.465  1.00 37.04  ? 99   SER I C   1 
ATOM   9879  O O   . SER F  3  99  ? 143.092 22.934 21.020  1.00 36.93  ? 99   SER I O   1 
ATOM   9880  C CB  . SER F  3  99  ? 145.126 25.091 20.107  1.00 36.89  ? 99   SER I CB  1 
ATOM   9881  O OG  . SER F  3  99  ? 145.401 23.755 19.719  1.00 34.22  ? 99   SER I OG  1 
ATOM   9882  N N   . GLY F  3  100 ? 141.893 24.200 19.584  1.00 36.49  ? 100  GLY I N   1 
ATOM   9883  C CA  . GLY F  3  100 ? 140.991 23.121 19.210  1.00 35.68  ? 100  GLY I CA  1 
ATOM   9884  C C   . GLY F  3  100 ? 139.920 23.518 18.204  1.00 35.05  ? 100  GLY I C   1 
ATOM   9885  O O   . GLY F  3  100 ? 139.890 24.649 17.707  1.00 34.27  ? 100  GLY I O   1 
ATOM   9886  N N   . CYS F  3  101 ? 139.028 22.573 17.914  1.00 34.61  ? 101  CYS I N   1 
ATOM   9887  C CA  . CYS F  3  101 ? 137.942 22.784 16.965  1.00 34.03  ? 101  CYS I CA  1 
ATOM   9888  C C   . CYS F  3  101 ? 136.554 22.412 17.506  1.00 33.70  ? 101  CYS I C   1 
ATOM   9889  O O   . CYS F  3  101 ? 136.388 21.418 18.201  1.00 33.36  ? 101  CYS I O   1 
ATOM   9890  C CB  . CYS F  3  101 ? 138.215 21.972 15.708  1.00 33.93  ? 101  CYS I CB  1 
ATOM   9891  S SG  . CYS F  3  101 ? 138.689 20.257 16.034  1.00 34.91  ? 101  CYS I SG  1 
ATOM   9892  N N   . GLU F  3  102 ? 135.559 23.215 17.145  1.00 33.18  ? 102  GLU I N   1 
ATOM   9893  C CA  . GLU F  3  102 ? 134.178 22.980 17.533  1.00 32.71  ? 102  GLU I CA  1 
ATOM   9894  C C   . GLU F  3  102 ? 133.347 22.666 16.298  1.00 31.63  ? 102  GLU I C   1 
ATOM   9895  O O   . GLU F  3  102 ? 133.000 23.569 15.544  1.00 31.26  ? 102  GLU I O   1 
ATOM   9896  C CB  . GLU F  3  102 ? 133.598 24.219 18.215  1.00 33.27  ? 102  GLU I CB  1 
ATOM   9897  C CG  . GLU F  3  102 ? 134.126 24.434 19.616  1.00 34.68  ? 102  GLU I CG  1 
ATOM   9898  C CD  . GLU F  3  102 ? 133.315 25.441 20.394  1.00 36.86  ? 102  GLU I CD  1 
ATOM   9899  O OE1 . GLU F  3  102 ? 132.067 25.316 20.428  1.00 38.09  ? 102  GLU I OE1 1 
ATOM   9900  O OE2 . GLU F  3  102 ? 133.934 26.355 20.977  1.00 39.13  ? 102  GLU I OE2 1 
ATOM   9901  N N   . VAL F  3  103 ? 133.028 21.395 16.089  1.00 30.41  ? 103  VAL I N   1 
ATOM   9902  C CA  . VAL F  3  103 ? 132.254 21.016 14.925  1.00 30.01  ? 103  VAL I CA  1 
ATOM   9903  C C   . VAL F  3  103 ? 130.812 20.776 15.353  1.00 29.85  ? 103  VAL I C   1 
ATOM   9904  O O   . VAL F  3  103 ? 130.560 20.214 16.412  1.00 29.94  ? 103  VAL I O   1 
ATOM   9905  C CB  . VAL F  3  103 ? 132.840 19.756 14.201  1.00 29.94  ? 103  VAL I CB  1 
ATOM   9906  C CG1 . VAL F  3  103 ? 134.353 19.875 14.047  1.00 29.84  ? 103  VAL I CG1 1 
ATOM   9907  C CG2 . VAL F  3  103 ? 132.499 18.480 14.938  1.00 30.07  ? 103  VAL I CG2 1 
ATOM   9908  N N   . GLY F  3  104 ? 129.867 21.217 14.531  1.00 29.75  ? 104  GLY I N   1 
ATOM   9909  C CA  . GLY F  3  104 ? 128.464 21.037 14.833  1.00 29.42  ? 104  GLY I CA  1 
ATOM   9910  C C   . GLY F  3  104 ? 128.011 19.672 14.364  1.00 29.84  ? 104  GLY I C   1 
ATOM   9911  O O   . GLY F  3  104 ? 128.776 18.935 13.748  1.00 29.44  ? 104  GLY I O   1 
ATOM   9912  N N   . SER F  3  105 ? 126.759 19.339 14.655  1.00 30.47  ? 105  SER I N   1 
ATOM   9913  C CA  . SER F  3  105 ? 126.181 18.052 14.278  1.00 31.04  ? 105  SER I CA  1 
ATOM   9914  C C   . SER F  3  105 ? 126.250 17.799 12.781  1.00 30.81  ? 105  SER I C   1 
ATOM   9915  O O   . SER F  3  105 ? 126.295 16.656 12.342  1.00 30.56  ? 105  SER I O   1 
ATOM   9916  C CB  . SER F  3  105 ? 124.716 17.982 14.728  1.00 31.37  ? 105  SER I CB  1 
ATOM   9917  O OG  . SER F  3  105 ? 124.598 18.193 16.126  1.00 32.46  ? 105  SER I OG  1 
ATOM   9918  N N   . ASP F  3  106 ? 126.237 18.868 11.994  1.00 31.17  ? 106  ASP I N   1 
ATOM   9919  C CA  . ASP F  3  106 ? 126.280 18.734 10.543  1.00 31.28  ? 106  ASP I CA  1 
ATOM   9920  C C   . ASP F  3  106 ? 127.716 18.564 10.038  1.00 31.87  ? 106  ASP I C   1 
ATOM   9921  O O   . ASP F  3  106 ? 127.938 18.300 8.853   1.00 31.17  ? 106  ASP I O   1 
ATOM   9922  C CB  . ASP F  3  106 ? 125.620 19.940 9.885   1.00 31.05  ? 106  ASP I CB  1 
ATOM   9923  C CG  . ASP F  3  106 ? 126.284 21.240 10.264  1.00 30.74  ? 106  ASP I CG  1 
ATOM   9924  O OD1 . ASP F  3  106 ? 125.782 22.308 9.836   1.00 29.89  ? 106  ASP I OD1 1 
ATOM   9925  O OD2 . ASP F  3  106 ? 127.306 21.266 10.990  1.00 28.35  ? 106  ASP I OD2 1 
ATOM   9926  N N   . GLY F  3  107 ? 128.683 18.719 10.940  1.00 32.67  ? 107  GLY I N   1 
ATOM   9927  C CA  . GLY F  3  107 ? 130.083 18.566 10.584  1.00 33.90  ? 107  GLY I CA  1 
ATOM   9928  C C   . GLY F  3  107 ? 130.750 19.872 10.196  1.00 34.97  ? 107  GLY I C   1 
ATOM   9929  O O   . GLY F  3  107 ? 131.919 19.888 9.834   1.00 34.94  ? 107  GLY I O   1 
ATOM   9930  N N   . ARG F  3  108 ? 130.002 20.967 10.271  1.00 36.69  ? 108  ARG I N   1 
ATOM   9931  C CA  . ARG F  3  108 ? 130.520 22.283 9.932   1.00 37.82  ? 108  ARG I CA  1 
ATOM   9932  C C   . ARG F  3  108 ? 131.499 22.702 11.020  1.00 38.69  ? 108  ARG I C   1 
ATOM   9933  O O   . ARG F  3  108 ? 131.967 21.868 11.792  1.00 39.22  ? 108  ARG I O   1 
ATOM   9934  C CB  . ARG F  3  108 ? 129.372 23.294 9.857   1.00 38.14  ? 108  ARG I CB  1 
ATOM   9935  C CG  . ARG F  3  108 ? 129.566 24.405 8.840   1.00 39.45  ? 108  ARG I CG  1 
ATOM   9936  C CD  . ARG F  3  108 ? 129.439 23.905 7.404   1.00 40.55  ? 108  ARG I CD  1 
ATOM   9937  N NE  . ARG F  3  108 ? 129.632 24.946 6.392   1.00 41.12  ? 108  ARG I NE  1 
ATOM   9938  C CZ  . ARG F  3  108 ? 130.740 25.666 6.247   1.00 40.91  ? 108  ARG I CZ  1 
ATOM   9939  N NH1 . ARG F  3  108 ? 131.772 25.480 7.055   1.00 41.66  ? 108  ARG I NH1 1 
ATOM   9940  N NH2 . ARG F  3  108 ? 130.816 26.583 5.296   1.00 40.69  ? 108  ARG I NH2 1 
ATOM   9941  N N   . LEU F  3  109 ? 131.801 23.995 11.078  1.00 39.35  ? 109  LEU I N   1 
ATOM   9942  C CA  . LEU F  3  109 ? 132.694 24.544 12.084  1.00 39.77  ? 109  LEU I CA  1 
ATOM   9943  C C   . LEU F  3  109 ? 131.973 25.694 12.753  1.00 40.34  ? 109  LEU I C   1 
ATOM   9944  O O   . LEU F  3  109 ? 131.558 26.641 12.092  1.00 40.22  ? 109  LEU I O   1 
ATOM   9945  C CB  . LEU F  3  109 ? 133.977 25.074 11.451  1.00 40.05  ? 109  LEU I CB  1 
ATOM   9946  C CG  . LEU F  3  109 ? 134.919 25.752 12.455  1.00 40.10  ? 109  LEU I CG  1 
ATOM   9947  C CD1 . LEU F  3  109 ? 135.635 24.693 13.291  1.00 40.48  ? 109  LEU I CD1 1 
ATOM   9948  C CD2 . LEU F  3  109 ? 135.926 26.635 11.738  1.00 40.46  ? 109  LEU I CD2 1 
ATOM   9949  N N   . LEU F  3  110 ? 131.822 25.622 14.063  1.00 41.17  ? 110  LEU I N   1 
ATOM   9950  C CA  . LEU F  3  110 ? 131.134 26.682 14.777  1.00 41.96  ? 110  LEU I CA  1 
ATOM   9951  C C   . LEU F  3  110 ? 132.120 27.785 15.121  1.00 43.07  ? 110  LEU I C   1 
ATOM   9952  O O   . LEU F  3  110 ? 131.795 28.968 15.039  1.00 43.26  ? 110  LEU I O   1 
ATOM   9953  C CB  . LEU F  3  110 ? 130.477 26.140 16.046  1.00 41.62  ? 110  LEU I CB  1 
ATOM   9954  C CG  . LEU F  3  110 ? 129.722 24.820 15.860  1.00 40.98  ? 110  LEU I CG  1 
ATOM   9955  C CD1 . LEU F  3  110 ? 128.940 24.482 17.117  1.00 40.21  ? 110  LEU I CD1 1 
ATOM   9956  C CD2 . LEU F  3  110 ? 128.795 24.908 14.656  1.00 40.33  ? 110  LEU I CD2 1 
ATOM   9957  N N   . ARG F  3  111 ? 133.329 27.393 15.507  1.00 44.54  ? 111  ARG I N   1 
ATOM   9958  C CA  . ARG F  3  111 ? 134.350 28.365 15.871  1.00 45.77  ? 111  ARG I CA  1 
ATOM   9959  C C   . ARG F  3  111 ? 135.722 27.739 16.048  1.00 46.01  ? 111  ARG I C   1 
ATOM   9960  O O   . ARG F  3  111 ? 135.858 26.632 16.573  1.00 46.01  ? 111  ARG I O   1 
ATOM   9961  C CB  . ARG F  3  111 ? 133.959 29.088 17.155  1.00 46.38  ? 111  ARG I CB  1 
ATOM   9962  C CG  . ARG F  3  111 ? 134.796 30.323 17.425  1.00 48.54  ? 111  ARG I CG  1 
ATOM   9963  C CD  . ARG F  3  111 ? 134.365 31.058 18.681  1.00 50.87  ? 111  ARG I CD  1 
ATOM   9964  N NE  . ARG F  3  111 ? 134.816 30.391 19.900  1.00 52.09  ? 111  ARG I NE  1 
ATOM   9965  C CZ  . ARG F  3  111 ? 134.580 30.843 21.129  1.00 52.91  ? 111  ARG I CZ  1 
ATOM   9966  N NH1 . ARG F  3  111 ? 133.894 31.965 21.308  1.00 52.83  ? 111  ARG I NH1 1 
ATOM   9967  N NH2 . ARG F  3  111 ? 135.029 30.174 22.182  1.00 53.12  ? 111  ARG I NH2 1 
ATOM   9968  N N   . GLY F  3  112 ? 136.736 28.464 15.591  1.00 46.46  ? 112  GLY I N   1 
ATOM   9969  C CA  . GLY F  3  112 ? 138.109 28.026 15.712  1.00 47.01  ? 112  GLY I CA  1 
ATOM   9970  C C   . GLY F  3  112 ? 138.829 29.040 16.579  1.00 47.59  ? 112  GLY I C   1 
ATOM   9971  O O   . GLY F  3  112 ? 138.952 30.204 16.207  1.00 47.49  ? 112  GLY I O   1 
ATOM   9972  N N   . TYR F  3  113 ? 139.284 28.613 17.750  1.00 48.48  ? 113  TYR I N   1 
ATOM   9973  C CA  . TYR F  3  113 ? 139.965 29.524 18.665  1.00 49.08  ? 113  TYR I CA  1 
ATOM   9974  C C   . TYR F  3  113 ? 141.434 29.190 18.842  1.00 49.40  ? 113  TYR I C   1 
ATOM   9975  O O   . TYR F  3  113 ? 141.893 28.109 18.467  1.00 49.44  ? 113  TYR I O   1 
ATOM   9976  C CB  . TYR F  3  113 ? 139.269 29.558 20.029  1.00 49.16  ? 113  TYR I CB  1 
ATOM   9977  C CG  . TYR F  3  113 ? 138.690 28.241 20.494  1.00 49.77  ? 113  TYR I CG  1 
ATOM   9978  C CD1 . TYR F  3  113 ? 139.397 27.053 20.352  1.00 50.38  ? 113  TYR I CD1 1 
ATOM   9979  C CD2 . TYR F  3  113 ? 137.434 28.190 21.094  1.00 50.62  ? 113  TYR I CD2 1 
ATOM   9980  C CE1 . TYR F  3  113 ? 138.867 25.844 20.790  1.00 50.98  ? 113  TYR I CE1 1 
ATOM   9981  C CE2 . TYR F  3  113 ? 136.892 26.986 21.535  1.00 50.86  ? 113  TYR I CE2 1 
ATOM   9982  C CZ  . TYR F  3  113 ? 137.616 25.816 21.380  1.00 50.94  ? 113  TYR I CZ  1 
ATOM   9983  O OH  . TYR F  3  113 ? 137.093 24.617 21.809  1.00 51.26  ? 113  TYR I OH  1 
ATOM   9984  N N   . GLN F  3  114 ? 142.169 30.137 19.407  1.00 49.78  ? 114  GLN I N   1 
ATOM   9985  C CA  . GLN F  3  114 ? 143.592 29.953 19.649  1.00 50.35  ? 114  GLN I CA  1 
ATOM   9986  C C   . GLN F  3  114 ? 144.065 31.044 20.592  1.00 50.82  ? 114  GLN I C   1 
ATOM   9987  O O   . GLN F  3  114 ? 143.940 32.235 20.296  1.00 50.75  ? 114  GLN I O   1 
ATOM   9988  C CB  . GLN F  3  114 ? 144.371 29.991 18.334  1.00 50.26  ? 114  GLN I CB  1 
ATOM   9989  C CG  . GLN F  3  114 ? 145.780 29.438 18.425  1.00 49.74  ? 114  GLN I CG  1 
ATOM   9990  C CD  . GLN F  3  114 ? 146.829 30.522 18.484  1.00 49.31  ? 114  GLN I CD  1 
ATOM   9991  O OE1 . GLN F  3  114 ? 148.002 30.265 18.235  1.00 49.02  ? 114  GLN I OE1 1 
ATOM   9992  N NE2 . GLN F  3  114 ? 146.413 31.737 18.806  1.00 49.63  ? 114  GLN I NE2 1 
ATOM   9993  N N   . GLN F  3  115 ? 144.585 30.621 21.740  1.00 51.44  ? 115  GLN I N   1 
ATOM   9994  C CA  . GLN F  3  115 ? 145.056 31.540 22.764  1.00 51.94  ? 115  GLN I CA  1 
ATOM   9995  C C   . GLN F  3  115 ? 146.176 30.886 23.582  1.00 53.03  ? 115  GLN I C   1 
ATOM   9996  O O   . GLN F  3  115 ? 146.249 29.659 23.695  1.00 52.99  ? 115  GLN I O   1 
ATOM   9997  C CB  . GLN F  3  115 ? 143.887 31.923 23.670  1.00 51.52  ? 115  GLN I CB  1 
ATOM   9998  C CG  . GLN F  3  115 ? 142.667 32.426 22.910  1.00 50.38  ? 115  GLN I CG  1 
ATOM   9999  C CD  . GLN F  3  115 ? 141.361 32.127 23.618  1.00 49.25  ? 115  GLN I CD  1 
ATOM   10000 O OE1 . GLN F  3  115 ? 141.126 32.598 24.727  1.00 47.91  ? 115  GLN I OE1 1 
ATOM   10001 N NE2 . GLN F  3  115 ? 140.504 31.346 22.972  1.00 48.69  ? 115  GLN I NE2 1 
ATOM   10002 N N   . TYR F  3  116 ? 147.059 31.712 24.135  1.00 54.25  ? 116  TYR I N   1 
ATOM   10003 C CA  . TYR F  3  116 ? 148.161 31.220 24.953  1.00 55.29  ? 116  TYR I CA  1 
ATOM   10004 C C   . TYR F  3  116 ? 148.137 31.876 26.322  1.00 55.69  ? 116  TYR I C   1 
ATOM   10005 O O   . TYR F  3  116 ? 147.755 33.035 26.459  1.00 55.96  ? 116  TYR I O   1 
ATOM   10006 C CB  . TYR F  3  116 ? 149.503 31.512 24.285  1.00 55.70  ? 116  TYR I CB  1 
ATOM   10007 C CG  . TYR F  3  116 ? 149.863 30.570 23.162  1.00 56.52  ? 116  TYR I CG  1 
ATOM   10008 C CD1 . TYR F  3  116 ? 149.060 30.463 22.034  1.00 57.51  ? 116  TYR I CD1 1 
ATOM   10009 C CD2 . TYR F  3  116 ? 151.015 29.794 23.225  1.00 57.26  ? 116  TYR I CD2 1 
ATOM   10010 C CE1 . TYR F  3  116 ? 149.392 29.605 20.999  1.00 57.80  ? 116  TYR I CE1 1 
ATOM   10011 C CE2 . TYR F  3  116 ? 151.357 28.933 22.193  1.00 57.54  ? 116  TYR I CE2 1 
ATOM   10012 C CZ  . TYR F  3  116 ? 150.540 28.844 21.085  1.00 57.62  ? 116  TYR I CZ  1 
ATOM   10013 O OH  . TYR F  3  116 ? 150.870 27.995 20.058  1.00 57.90  ? 116  TYR I OH  1 
ATOM   10014 N N   . ALA F  3  117 ? 148.556 31.136 27.338  1.00 56.11  ? 117  ALA I N   1 
ATOM   10015 C CA  . ALA F  3  117 ? 148.577 31.682 28.681  1.00 56.58  ? 117  ALA I CA  1 
ATOM   10016 C C   . ALA F  3  117 ? 150.007 31.850 29.178  1.00 57.10  ? 117  ALA I C   1 
ATOM   10017 O O   . ALA F  3  117 ? 150.735 30.874 29.360  1.00 57.00  ? 117  ALA I O   1 
ATOM   10018 C CB  . ALA F  3  117 ? 147.775 30.803 29.623  1.00 56.31  ? 117  ALA I CB  1 
ATOM   10019 N N   . TYR F  3  118 ? 150.396 33.106 29.380  1.00 57.96  ? 118  TYR I N   1 
ATOM   10020 C CA  . TYR F  3  118 ? 151.718 33.448 29.892  1.00 58.64  ? 118  TYR I CA  1 
ATOM   10021 C C   . TYR F  3  118 ? 151.576 33.819 31.364  1.00 58.98  ? 118  TYR I C   1 
ATOM   10022 O O   . TYR F  3  118 ? 150.905 34.794 31.700  1.00 58.91  ? 118  TYR I O   1 
ATOM   10023 C CB  . TYR F  3  118 ? 152.311 34.628 29.111  1.00 58.83  ? 118  TYR I CB  1 
ATOM   10024 C CG  . TYR F  3  118 ? 153.611 35.149 29.697  1.00 59.31  ? 118  TYR I CG  1 
ATOM   10025 C CD1 . TYR F  3  118 ? 154.719 34.319 29.820  1.00 59.62  ? 118  TYR I CD1 1 
ATOM   10026 C CD2 . TYR F  3  118 ? 153.725 36.466 30.143  1.00 59.56  ? 118  TYR I CD2 1 
ATOM   10027 C CE1 . TYR F  3  118 ? 155.905 34.779 30.363  1.00 59.71  ? 118  TYR I CE1 1 
ATOM   10028 C CE2 . TYR F  3  118 ? 154.912 36.936 30.690  1.00 59.62  ? 118  TYR I CE2 1 
ATOM   10029 C CZ  . TYR F  3  118 ? 155.997 36.085 30.796  1.00 59.77  ? 118  TYR I CZ  1 
ATOM   10030 O OH  . TYR F  3  118 ? 157.181 36.527 31.337  1.00 60.17  ? 118  TYR I OH  1 
ATOM   10031 N N   . ASP F  3  119 ? 152.198 33.035 32.237  1.00 59.66  ? 119  ASP I N   1 
ATOM   10032 C CA  . ASP F  3  119 ? 152.128 33.266 33.680  1.00 60.29  ? 119  ASP I CA  1 
ATOM   10033 C C   . ASP F  3  119 ? 150.695 33.471 34.173  1.00 61.08  ? 119  ASP I C   1 
ATOM   10034 O O   . ASP F  3  119 ? 150.479 33.885 35.308  1.00 61.32  ? 119  ASP I O   1 
ATOM   10035 C CB  . ASP F  3  119 ? 152.989 34.469 34.083  1.00 60.01  ? 119  ASP I CB  1 
ATOM   10036 C CG  . ASP F  3  119 ? 154.476 34.191 33.982  1.00 59.53  ? 119  ASP I CG  1 
ATOM   10037 O OD1 . ASP F  3  119 ? 154.883 33.006 34.016  1.00 58.06  ? 119  ASP I OD1 1 
ATOM   10038 O OD2 . ASP F  3  119 ? 155.300 35.122 33.875  1.00 59.13  ? 119  ASP I OD2 1 
ATOM   10039 N N   . GLY F  3  120 ? 149.713 33.186 33.328  1.00 62.13  ? 120  GLY I N   1 
ATOM   10040 C CA  . GLY F  3  120 ? 148.331 33.333 33.741  1.00 62.86  ? 120  GLY I CA  1 
ATOM   10041 C C   . GLY F  3  120 ? 147.521 34.326 32.939  1.00 63.61  ? 120  GLY I C   1 
ATOM   10042 O O   . GLY F  3  120 ? 146.440 34.721 33.367  1.00 63.80  ? 120  GLY I O   1 
ATOM   10043 N N   . CYS F  3  121 ? 148.023 34.729 31.778  1.00 64.54  ? 121  CYS I N   1 
ATOM   10044 C CA  . CYS F  3  121 ? 147.301 35.689 30.947  1.00 65.32  ? 121  CYS I CA  1 
ATOM   10045 C C   . CYS F  3  121 ? 147.411 35.399 29.453  1.00 65.99  ? 121  CYS I C   1 
ATOM   10046 O O   . CYS F  3  121 ? 148.397 34.834 28.980  1.00 65.83  ? 121  CYS I O   1 
ATOM   10047 C CB  . CYS F  3  121 ? 147.782 37.110 31.247  1.00 65.32  ? 121  CYS I CB  1 
ATOM   10048 S SG  . CYS F  3  121 ? 147.312 37.683 32.895  1.00 65.12  ? 121  CYS I SG  1 
ATOM   10049 N N   . ASP F  3  122 ? 146.382 35.798 28.716  1.00 66.92  ? 122  ASP I N   1 
ATOM   10050 C CA  . ASP F  3  122 ? 146.352 35.571 27.281  1.00 67.82  ? 122  ASP I CA  1 
ATOM   10051 C C   . ASP F  3  122 ? 147.474 36.299 26.564  1.00 68.44  ? 122  ASP I C   1 
ATOM   10052 O O   . ASP F  3  122 ? 147.956 37.335 27.018  1.00 68.57  ? 122  ASP I O   1 
ATOM   10053 C CB  . ASP F  3  122 ? 145.001 35.971 26.686  1.00 67.95  ? 122  ASP I CB  1 
ATOM   10054 C CG  . ASP F  3  122 ? 144.406 37.191 27.340  1.00 68.47  ? 122  ASP I CG  1 
ATOM   10055 O OD1 . ASP F  3  122 ? 145.150 38.174 27.567  1.00 69.33  ? 122  ASP I OD1 1 
ATOM   10056 O OD2 . ASP F  3  122 ? 143.192 37.233 27.649  1.00 68.47  ? 122  ASP I OD2 1 
ATOM   10057 N N   . TYR F  3  123 ? 147.882 35.735 25.436  1.00 69.29  ? 123  TYR I N   1 
ATOM   10058 C CA  . TYR F  3  123 ? 148.937 36.297 24.614  1.00 70.00  ? 123  TYR I CA  1 
ATOM   10059 C C   . TYR F  3  123 ? 148.265 37.012 23.454  1.00 70.10  ? 123  TYR I C   1 
ATOM   10060 O O   . TYR F  3  123 ? 148.075 38.226 23.482  1.00 70.15  ? 123  TYR I O   1 
ATOM   10061 C CB  . TYR F  3  123 ? 149.820 35.170 24.094  1.00 70.39  ? 123  TYR I CB  1 
ATOM   10062 C CG  . TYR F  3  123 ? 151.148 35.602 23.521  1.00 71.46  ? 123  TYR I CG  1 
ATOM   10063 C CD1 . TYR F  3  123 ? 152.057 36.324 24.286  1.00 72.24  ? 123  TYR I CD1 1 
ATOM   10064 C CD2 . TYR F  3  123 ? 151.510 35.256 22.226  1.00 72.47  ? 123  TYR I CD2 1 
ATOM   10065 C CE1 . TYR F  3  123 ? 153.291 36.699 23.769  1.00 72.89  ? 123  TYR I CE1 1 
ATOM   10066 C CE2 . TYR F  3  123 ? 152.741 35.625 21.701  1.00 73.05  ? 123  TYR I CE2 1 
ATOM   10067 C CZ  . TYR F  3  123 ? 153.626 36.344 22.477  1.00 73.01  ? 123  TYR I CZ  1 
ATOM   10068 O OH  . TYR F  3  123 ? 154.843 36.715 21.956  1.00 73.07  ? 123  TYR I OH  1 
ATOM   10069 N N   . ILE F  3  124 ? 147.898 36.244 22.435  1.00 70.31  ? 124  ILE I N   1 
ATOM   10070 C CA  . ILE F  3  124 ? 147.192 36.778 21.280  1.00 70.41  ? 124  ILE I CA  1 
ATOM   10071 C C   . ILE F  3  124 ? 146.054 35.823 20.978  1.00 70.14  ? 124  ILE I C   1 
ATOM   10072 O O   . ILE F  3  124 ? 146.195 34.610 21.134  1.00 69.98  ? 124  ILE I O   1 
ATOM   10073 C CB  . ILE F  3  124 ? 148.102 36.894 20.043  1.00 70.58  ? 124  ILE I CB  1 
ATOM   10074 C CG1 . ILE F  3  124 ? 147.367 37.640 18.923  1.00 71.01  ? 124  ILE I CG1 1 
ATOM   10075 C CG2 . ILE F  3  124 ? 148.539 35.511 19.565  1.00 70.64  ? 124  ILE I CG2 1 
ATOM   10076 C CD1 . ILE F  3  124 ? 146.960 39.060 19.283  1.00 71.14  ? 124  ILE I CD1 1 
ATOM   10077 N N   . ALA F  3  125 ? 144.924 36.369 20.551  1.00 69.88  ? 125  ALA I N   1 
ATOM   10078 C CA  . ALA F  3  125 ? 143.770 35.543 20.237  1.00 69.64  ? 125  ALA I CA  1 
ATOM   10079 C C   . ALA F  3  125 ? 143.392 35.684 18.773  1.00 69.24  ? 125  ALA I C   1 
ATOM   10080 O O   . ALA F  3  125 ? 143.322 36.792 18.246  1.00 69.22  ? 125  ALA I O   1 
ATOM   10081 C CB  . ALA F  3  125 ? 142.593 35.927 21.121  1.00 69.62  ? 125  ALA I CB  1 
ATOM   10082 N N   . LEU F  3  126 ? 143.161 34.556 18.115  1.00 68.79  ? 126  LEU I N   1 
ATOM   10083 C CA  . LEU F  3  126 ? 142.737 34.579 16.728  1.00 68.44  ? 126  LEU I CA  1 
ATOM   10084 C C   . LEU F  3  126 ? 141.264 34.956 16.727  1.00 68.19  ? 126  LEU I C   1 
ATOM   10085 O O   . LEU F  3  126 ? 140.504 34.476 17.566  1.00 68.22  ? 126  LEU I O   1 
ATOM   10086 C CB  . LEU F  3  126 ? 142.925 33.211 16.079  1.00 68.31  ? 126  LEU I CB  1 
ATOM   10087 C CG  . LEU F  3  126 ? 142.561 33.158 14.595  1.00 68.05  ? 126  LEU I CG  1 
ATOM   10088 C CD1 . LEU F  3  126 ? 143.327 34.231 13.826  1.00 67.85  ? 126  LEU I CD1 1 
ATOM   10089 C CD2 . LEU F  3  126 ? 142.862 31.778 14.040  1.00 67.79  ? 126  LEU I CD2 1 
ATOM   10090 N N   . ASN F  3  127 ? 140.858 35.820 15.803  1.00 67.99  ? 127  ASN I N   1 
ATOM   10091 C CA  . ASN F  3  127 ? 139.463 36.252 15.738  1.00 67.83  ? 127  ASN I CA  1 
ATOM   10092 C C   . ASN F  3  127 ? 138.563 35.181 15.123  1.00 67.38  ? 127  ASN I C   1 
ATOM   10093 O O   . ASN F  3  127 ? 139.020 34.086 14.785  1.00 67.29  ? 127  ASN I O   1 
ATOM   10094 C CB  . ASN F  3  127 ? 139.327 37.547 14.936  1.00 67.93  ? 127  ASN I CB  1 
ATOM   10095 C CG  . ASN F  3  127 ? 140.165 38.680 15.495  1.00 68.19  ? 127  ASN I CG  1 
ATOM   10096 O OD1 . ASN F  3  127 ? 140.102 39.806 15.005  1.00 68.41  ? 127  ASN I OD1 1 
ATOM   10097 N ND2 . ASN F  3  127 ? 140.961 38.387 16.517  1.00 68.47  ? 127  ASN I ND2 1 
ATOM   10098 N N   . GLU F  3  128 ? 137.285 35.522 14.969  1.00 66.84  ? 128  GLU I N   1 
ATOM   10099 C CA  . GLU F  3  128 ? 136.281 34.614 14.420  1.00 66.35  ? 128  GLU I CA  1 
ATOM   10100 C C   . GLU F  3  128 ? 136.169 34.699 12.899  1.00 65.70  ? 128  GLU I C   1 
ATOM   10101 O O   . GLU F  3  128 ? 135.164 34.302 12.316  1.00 65.77  ? 128  GLU I O   1 
ATOM   10102 C CB  . GLU F  3  128 ? 134.923 34.922 15.040  1.00 66.51  ? 128  GLU I CB  1 
ATOM   10103 C CG  . GLU F  3  128 ? 133.915 33.800 14.900  1.00 67.07  ? 128  GLU I CG  1 
ATOM   10104 C CD  . GLU F  3  128 ? 132.524 34.232 15.305  1.00 67.77  ? 128  GLU I CD  1 
ATOM   10105 O OE1 . GLU F  3  128 ? 132.380 34.787 16.414  1.00 68.28  ? 128  GLU I OE1 1 
ATOM   10106 O OE2 . GLU F  3  128 ? 131.578 34.022 14.515  1.00 68.26  ? 128  GLU I OE2 1 
ATOM   10107 N N   . ASP F  3  129 ? 137.195 35.240 12.262  1.00 64.87  ? 129  ASP I N   1 
ATOM   10108 C CA  . ASP F  3  129 ? 137.224 35.330 10.815  1.00 64.17  ? 129  ASP I CA  1 
ATOM   10109 C C   . ASP F  3  129 ? 138.341 34.409 10.405  1.00 63.48  ? 129  ASP I C   1 
ATOM   10110 O O   . ASP F  3  129 ? 138.534 34.112 9.229   1.00 63.33  ? 129  ASP I O   1 
ATOM   10111 C CB  . ASP F  3  129 ? 137.505 36.761 10.349  1.00 64.24  ? 129  ASP I CB  1 
ATOM   10112 C CG  . ASP F  3  129 ? 138.621 37.421 11.127  1.00 64.16  ? 129  ASP I CG  1 
ATOM   10113 O OD1 . ASP F  3  129 ? 138.412 37.746 12.317  1.00 63.79  ? 129  ASP I OD1 1 
ATOM   10114 O OD2 . ASP F  3  129 ? 139.733 37.651 10.611  1.00 63.56  ? 129  ASP I OD2 1 
ATOM   10115 N N   . LEU F  3  130 ? 139.078 33.952 11.410  1.00 62.79  ? 130  LEU I N   1 
ATOM   10116 C CA  . LEU F  3  130 ? 140.185 33.062 11.176  1.00 62.33  ? 130  LEU I CA  1 
ATOM   10117 C C   . LEU F  3  130 ? 141.064 33.777 10.171  1.00 62.59  ? 130  LEU I C   1 
ATOM   10118 O O   . LEU F  3  130 ? 141.701 33.156 9.321   1.00 62.48  ? 130  LEU I O   1 
ATOM   10119 C CB  . LEU F  3  130 ? 139.668 31.736 10.621  1.00 61.92  ? 130  LEU I CB  1 
ATOM   10120 C CG  . LEU F  3  130 ? 138.841 30.906 11.605  1.00 60.67  ? 130  LEU I CG  1 
ATOM   10121 C CD1 . LEU F  3  130 ? 139.717 30.468 12.765  1.00 59.91  ? 130  LEU I CD1 1 
ATOM   10122 C CD2 . LEU F  3  130 ? 137.638 31.690 12.105  1.00 59.59  ? 130  LEU I CD2 1 
ATOM   10123 N N   . LYS F  3  131 ? 141.073 35.104 10.274  1.00 62.76  ? 131  LYS I N   1 
ATOM   10124 C CA  . LYS F  3  131 ? 141.846 35.940 9.366   1.00 62.81  ? 131  LYS I CA  1 
ATOM   10125 C C   . LYS F  3  131 ? 142.691 37.001 10.074  1.00 62.73  ? 131  LYS I C   1 
ATOM   10126 O O   . LYS F  3  131 ? 143.795 37.308 9.631   1.00 62.55  ? 131  LYS I O   1 
ATOM   10127 C CB  . LYS F  3  131 ? 140.917 36.591 8.345   1.00 63.00  ? 131  LYS I CB  1 
ATOM   10128 C CG  . LYS F  3  131 ? 140.265 35.587 7.412   1.00 63.53  ? 131  LYS I CG  1 
ATOM   10129 C CD  . LYS F  3  131 ? 139.434 36.269 6.355   1.00 64.39  ? 131  LYS I CD  1 
ATOM   10130 C CE  . LYS F  3  131 ? 138.851 35.257 5.394   1.00 65.01  ? 131  LYS I CE  1 
ATOM   10131 N NZ  . LYS F  3  131 ? 138.160 35.922 4.257   1.00 65.63  ? 131  LYS I NZ  1 
ATOM   10132 N N   . THR F  3  132 ? 142.182 37.557 11.168  1.00 62.85  ? 132  THR I N   1 
ATOM   10133 C CA  . THR F  3  132 ? 142.910 38.592 11.896  1.00 62.98  ? 132  THR I CA  1 
ATOM   10134 C C   . THR F  3  132 ? 142.993 38.297 13.385  1.00 63.24  ? 132  THR I C   1 
ATOM   10135 O O   . THR F  3  132 ? 142.169 37.570 13.934  1.00 63.14  ? 132  THR I O   1 
ATOM   10136 C CB  . THR F  3  132 ? 142.234 39.960 11.721  1.00 62.98  ? 132  THR I CB  1 
ATOM   10137 O OG1 . THR F  3  132 ? 142.119 40.280 10.328  1.00 62.86  ? 132  THR I OG1 1 
ATOM   10138 C CG2 . THR F  3  132 ? 143.094 41.067 12.343  1.00 62.97  ? 132  THR I CG2 1 
ATOM   10139 N N   . TRP F  3  133 ? 143.998 38.878 14.031  1.00 63.61  ? 133  TRP I N   1 
ATOM   10140 C CA  . TRP F  3  133 ? 144.189 38.713 15.461  1.00 63.78  ? 133  TRP I CA  1 
ATOM   10141 C C   . TRP F  3  133 ? 143.643 39.949 16.159  1.00 64.44  ? 133  TRP I C   1 
ATOM   10142 O O   . TRP F  3  133 ? 143.195 40.895 15.507  1.00 64.57  ? 133  TRP I O   1 
ATOM   10143 C CB  . TRP F  3  133 ? 145.669 38.573 15.799  1.00 63.45  ? 133  TRP I CB  1 
ATOM   10144 C CG  . TRP F  3  133 ? 146.403 37.568 14.986  1.00 62.61  ? 133  TRP I CG  1 
ATOM   10145 C CD1 . TRP F  3  133 ? 146.967 37.758 13.761  1.00 61.97  ? 133  TRP I CD1 1 
ATOM   10146 C CD2 . TRP F  3  133 ? 146.679 36.215 15.350  1.00 61.98  ? 133  TRP I CD2 1 
ATOM   10147 N NE1 . TRP F  3  133 ? 147.575 36.602 13.337  1.00 62.04  ? 133  TRP I NE1 1 
ATOM   10148 C CE2 . TRP F  3  133 ? 147.412 35.637 14.296  1.00 61.64  ? 133  TRP I CE2 1 
ATOM   10149 C CE3 . TRP F  3  133 ? 146.379 35.427 16.466  1.00 61.68  ? 133  TRP I CE3 1 
ATOM   10150 C CZ2 . TRP F  3  133 ? 147.842 34.315 14.321  1.00 61.40  ? 133  TRP I CZ2 1 
ATOM   10151 C CZ3 . TRP F  3  133 ? 146.809 34.115 16.490  1.00 61.46  ? 133  TRP I CZ3 1 
ATOM   10152 C CH2 . TRP F  3  133 ? 147.530 33.572 15.424  1.00 61.40  ? 133  TRP I CH2 1 
ATOM   10153 N N   . THR F  3  134 ? 143.687 39.942 17.485  1.00 65.00  ? 134  THR I N   1 
ATOM   10154 C CA  . THR F  3  134 ? 143.220 41.078 18.265  1.00 65.50  ? 134  THR I CA  1 
ATOM   10155 C C   . THR F  3  134 ? 143.796 41.020 19.669  1.00 65.70  ? 134  THR I C   1 
ATOM   10156 O O   . THR F  3  134 ? 143.856 39.949 20.279  1.00 65.75  ? 134  THR I O   1 
ATOM   10157 C CB  . THR F  3  134 ? 141.689 41.096 18.349  1.00 65.69  ? 134  THR I CB  1 
ATOM   10158 O OG1 . THR F  3  134 ? 141.127 41.290 17.043  1.00 66.15  ? 134  THR I OG1 1 
ATOM   10159 C CG2 . THR F  3  134 ? 141.211 42.283 19.193  1.00 65.84  ? 134  THR I CG2 1 
ATOM   10160 N N   . ALA F  3  135 ? 144.209 42.175 20.184  1.00 65.78  ? 135  ALA I N   1 
ATOM   10161 C CA  . ALA F  3  135 ? 144.782 42.239 21.522  1.00 65.80  ? 135  ALA I CA  1 
ATOM   10162 C C   . ALA F  3  135 ? 145.015 43.669 22.003  1.00 65.75  ? 135  ALA I C   1 
ATOM   10163 O O   . ALA F  3  135 ? 145.001 44.615 21.219  1.00 65.74  ? 135  ALA I O   1 
ATOM   10164 C CB  . ALA F  3  135 ? 146.085 41.463 21.552  1.00 65.73  ? 135  ALA I CB  1 
ATOM   10165 N N   . ALA F  3  136 ? 145.228 43.802 23.309  1.00 65.82  ? 136  ALA I N   1 
ATOM   10166 C CA  . ALA F  3  136 ? 145.515 45.081 23.946  1.00 65.87  ? 136  ALA I CA  1 
ATOM   10167 C C   . ALA F  3  136 ? 146.936 44.958 24.492  1.00 65.74  ? 136  ALA I C   1 
ATOM   10168 O O   . ALA F  3  136 ? 147.415 45.800 25.256  1.00 65.90  ? 136  ALA I O   1 
ATOM   10169 C CB  . ALA F  3  136 ? 144.523 45.344 25.074  1.00 65.86  ? 136  ALA I CB  1 
ATOM   10170 N N   . ASP F  3  137 ? 147.599 43.891 24.057  1.00 65.44  ? 137  ASP I N   1 
ATOM   10171 C CA  . ASP F  3  137 ? 148.946 43.533 24.483  1.00 65.06  ? 137  ASP I CA  1 
ATOM   10172 C C   . ASP F  3  137 ? 150.000 43.682 23.380  1.00 64.16  ? 137  ASP I C   1 
ATOM   10173 O O   . ASP F  3  137 ? 149.873 43.094 22.307  1.00 64.09  ? 137  ASP I O   1 
ATOM   10174 C CB  . ASP F  3  137 ? 148.906 42.078 24.943  1.00 65.37  ? 137  ASP I CB  1 
ATOM   10175 C CG  . ASP F  3  137 ? 148.067 41.210 24.023  1.00 66.05  ? 137  ASP I CG  1 
ATOM   10176 O OD1 . ASP F  3  137 ? 148.540 40.875 22.912  1.00 67.07  ? 137  ASP I OD1 1 
ATOM   10177 O OD2 . ASP F  3  137 ? 146.910 40.848 24.335  1.00 66.32  ? 137  ASP I OD2 1 
ATOM   10178 N N   . MET F  3  138 ? 151.043 44.462 23.648  1.00 63.07  ? 138  MET I N   1 
ATOM   10179 C CA  . MET F  3  138 ? 152.127 44.623 22.685  1.00 62.05  ? 138  MET I CA  1 
ATOM   10180 C C   . MET F  3  138 ? 152.914 43.332 22.743  1.00 61.59  ? 138  MET I C   1 
ATOM   10181 O O   . MET F  3  138 ? 153.647 42.982 21.822  1.00 61.29  ? 138  MET I O   1 
ATOM   10182 C CB  . MET F  3  138 ? 153.026 45.801 23.054  1.00 61.73  ? 138  MET I CB  1 
ATOM   10183 C CG  . MET F  3  138 ? 152.512 47.139 22.566  1.00 60.73  ? 138  MET I CG  1 
ATOM   10184 S SD  . MET F  3  138 ? 150.730 47.274 22.740  1.00 59.47  ? 138  MET I SD  1 
ATOM   10185 C CE  . MET F  3  138 ? 150.215 47.026 21.059  1.00 58.87  ? 138  MET I CE  1 
ATOM   10186 N N   . ALA F  3  139 ? 152.737 42.634 23.861  1.00 61.18  ? 139  ALA I N   1 
ATOM   10187 C CA  . ALA F  3  139 ? 153.379 41.356 24.124  1.00 60.77  ? 139  ALA I CA  1 
ATOM   10188 C C   . ALA F  3  139 ? 153.352 40.461 22.892  1.00 60.26  ? 139  ALA I C   1 
ATOM   10189 O O   . ALA F  3  139 ? 154.354 40.313 22.192  1.00 60.35  ? 139  ALA I O   1 
ATOM   10190 C CB  . ALA F  3  139 ? 152.670 40.663 25.279  1.00 60.74  ? 139  ALA I CB  1 
ATOM   10191 N N   . ALA F  3  140 ? 152.187 39.876 22.639  1.00 59.51  ? 140  ALA I N   1 
ATOM   10192 C CA  . ALA F  3  140 ? 151.979 38.971 21.515  1.00 58.91  ? 140  ALA I CA  1 
ATOM   10193 C C   . ALA F  3  140 ? 152.267 39.585 20.149  1.00 57.95  ? 140  ALA I C   1 
ATOM   10194 O O   . ALA F  3  140 ? 152.420 38.859 19.173  1.00 57.70  ? 140  ALA I O   1 
ATOM   10195 C CB  . ALA F  3  140 ? 150.561 38.439 21.549  1.00 59.20  ? 140  ALA I CB  1 
ATOM   10196 N N   . LEU F  3  141 ? 152.329 40.912 20.080  1.00 56.93  ? 141  LEU I N   1 
ATOM   10197 C CA  . LEU F  3  141 ? 152.602 41.603 18.823  1.00 56.06  ? 141  LEU I CA  1 
ATOM   10198 C C   . LEU F  3  141 ? 153.930 41.157 18.240  1.00 55.42  ? 141  LEU I C   1 
ATOM   10199 O O   . LEU F  3  141 ? 154.061 40.997 17.031  1.00 55.30  ? 141  LEU I O   1 
ATOM   10200 C CB  . LEU F  3  141 ? 152.638 43.118 19.023  1.00 55.82  ? 141  LEU I CB  1 
ATOM   10201 C CG  . LEU F  3  141 ? 151.361 43.871 18.659  1.00 55.53  ? 141  LEU I CG  1 
ATOM   10202 C CD1 . LEU F  3  141 ? 150.199 43.409 19.515  1.00 55.09  ? 141  LEU I CD1 1 
ATOM   10203 C CD2 . LEU F  3  141 ? 151.595 45.353 18.825  1.00 55.26  ? 141  LEU I CD2 1 
ATOM   10204 N N   . ILE F  3  142 ? 154.918 40.964 19.105  1.00 54.82  ? 142  ILE I N   1 
ATOM   10205 C CA  . ILE F  3  142 ? 156.238 40.533 18.654  1.00 54.25  ? 142  ILE I CA  1 
ATOM   10206 C C   . ILE F  3  142 ? 156.109 39.212 17.898  1.00 53.73  ? 142  ILE I C   1 
ATOM   10207 O O   . ILE F  3  142 ? 156.809 38.980 16.909  1.00 53.61  ? 142  ILE I O   1 
ATOM   10208 C CB  . ILE F  3  142 ? 157.209 40.362 19.836  1.00 54.18  ? 142  ILE I CB  1 
ATOM   10209 C CG1 . ILE F  3  142 ? 157.420 41.705 20.541  1.00 54.06  ? 142  ILE I CG1 1 
ATOM   10210 C CG2 . ILE F  3  142 ? 158.547 39.815 19.339  1.00 54.05  ? 142  ILE I CG2 1 
ATOM   10211 C CD1 . ILE F  3  142 ? 158.255 41.618 21.812  1.00 54.11  ? 142  ILE I CD1 1 
ATOM   10212 N N   . THR F  3  143 ? 155.205 38.357 18.375  1.00 52.96  ? 143  THR I N   1 
ATOM   10213 C CA  . THR F  3  143 ? 154.955 37.055 17.758  1.00 52.38  ? 143  THR I CA  1 
ATOM   10214 C C   . THR F  3  143 ? 153.737 37.099 16.831  1.00 51.52  ? 143  THR I C   1 
ATOM   10215 O O   . THR F  3  143 ? 153.504 36.183 16.043  1.00 51.09  ? 143  THR I O   1 
ATOM   10216 C CB  . THR F  3  143 ? 154.743 35.977 18.831  1.00 52.47  ? 143  THR I CB  1 
ATOM   10217 O OG1 . THR F  3  143 ? 155.991 35.657 19.467  1.00 52.72  ? 143  THR I OG1 1 
ATOM   10218 C CG2 . THR F  3  143 ? 154.260 34.701 18.188  1.00 52.51  ? 143  THR I CG2 1 
ATOM   10219 N N   . LYS F  3  144 ? 152.963 38.171 16.943  1.00 50.74  ? 144  LYS I N   1 
ATOM   10220 C CA  . LYS F  3  144 ? 151.803 38.374 16.099  1.00 50.16  ? 144  LYS I CA  1 
ATOM   10221 C C   . LYS F  3  144 ? 152.370 38.491 14.698  1.00 50.54  ? 144  LYS I C   1 
ATOM   10222 O O   . LYS F  3  144 ? 151.955 37.796 13.769  1.00 50.15  ? 144  LYS I O   1 
ATOM   10223 C CB  . LYS F  3  144 ? 151.106 39.673 16.511  1.00 49.73  ? 144  LYS I CB  1 
ATOM   10224 C CG  . LYS F  3  144 ? 150.021 40.191 15.585  1.00 48.69  ? 144  LYS I CG  1 
ATOM   10225 C CD  . LYS F  3  144 ? 149.428 41.472 16.179  1.00 47.09  ? 144  LYS I CD  1 
ATOM   10226 C CE  . LYS F  3  144 ? 148.464 42.180 15.250  1.00 45.97  ? 144  LYS I CE  1 
ATOM   10227 N NZ  . LYS F  3  144 ? 147.292 41.343 14.918  1.00 45.00  ? 144  LYS I NZ  1 
ATOM   10228 N N   . HIS F  3  145 ? 153.371 39.355 14.587  1.00 51.02  ? 145  HIS I N   1 
ATOM   10229 C CA  . HIS F  3  145 ? 154.051 39.635 13.338  1.00 51.68  ? 145  HIS I CA  1 
ATOM   10230 C C   . HIS F  3  145 ? 154.989 38.509 12.920  1.00 52.36  ? 145  HIS I C   1 
ATOM   10231 O O   . HIS F  3  145 ? 155.208 38.298 11.733  1.00 52.31  ? 145  HIS I O   1 
ATOM   10232 C CB  . HIS F  3  145 ? 154.817 40.952 13.470  1.00 51.63  ? 145  HIS I CB  1 
ATOM   10233 C CG  . HIS F  3  145 ? 153.935 42.133 13.740  1.00 51.95  ? 145  HIS I CG  1 
ATOM   10234 N ND1 . HIS F  3  145 ? 152.662 42.005 14.253  1.00 52.10  ? 145  HIS I ND1 1 
ATOM   10235 C CD2 . HIS F  3  145 ? 154.140 43.462 13.573  1.00 52.60  ? 145  HIS I CD2 1 
ATOM   10236 C CE1 . HIS F  3  145 ? 152.121 43.202 14.390  1.00 52.22  ? 145  HIS I CE1 1 
ATOM   10237 N NE2 . HIS F  3  145 ? 152.996 44.104 13.984  1.00 52.50  ? 145  HIS I NE2 1 
ATOM   10238 N N   . LYS F  3  146 ? 155.531 37.777 13.888  1.00 53.53  ? 146  LYS I N   1 
ATOM   10239 C CA  . LYS F  3  146 ? 156.436 36.667 13.589  1.00 54.62  ? 146  LYS I CA  1 
ATOM   10240 C C   . LYS F  3  146 ? 155.684 35.562 12.840  1.00 55.66  ? 146  LYS I C   1 
ATOM   10241 O O   . LYS F  3  146 ? 156.270 34.557 12.439  1.00 56.07  ? 146  LYS I O   1 
ATOM   10242 C CB  . LYS F  3  146 ? 157.053 36.113 14.876  1.00 54.50  ? 146  LYS I CB  1 
ATOM   10243 C CG  . LYS F  3  146 ? 158.320 35.289 14.673  1.00 54.25  ? 146  LYS I CG  1 
ATOM   10244 C CD  . LYS F  3  146 ? 159.136 35.214 15.962  1.00 54.22  ? 146  LYS I CD  1 
ATOM   10245 C CE  . LYS F  3  146 ? 160.396 34.379 15.805  1.00 54.54  ? 146  LYS I CE  1 
ATOM   10246 N NZ  . LYS F  3  146 ? 161.287 34.844 14.700  1.00 54.79  ? 146  LYS I NZ  1 
ATOM   10247 N N   . TRP F  3  147 ? 154.377 35.756 12.677  1.00 56.59  ? 147  TRP I N   1 
ATOM   10248 C CA  . TRP F  3  147 ? 153.514 34.836 11.956  1.00 57.21  ? 147  TRP I CA  1 
ATOM   10249 C C   . TRP F  3  147 ? 152.879 35.702 10.873  1.00 57.88  ? 147  TRP I C   1 
ATOM   10250 O O   . TRP F  3  147 ? 152.798 35.325 9.702   1.00 58.06  ? 147  TRP I O   1 
ATOM   10251 C CB  . TRP F  3  147 ? 152.414 34.274 12.865  1.00 57.18  ? 147  TRP I CB  1 
ATOM   10252 C CG  . TRP F  3  147 ? 152.887 33.617 14.137  1.00 57.05  ? 147  TRP I CG  1 
ATOM   10253 C CD1 . TRP F  3  147 ? 154.175 33.451 14.555  1.00 56.49  ? 147  TRP I CD1 1 
ATOM   10254 C CD2 . TRP F  3  147 ? 152.058 33.058 15.171  1.00 56.64  ? 147  TRP I CD2 1 
ATOM   10255 N NE1 . TRP F  3  147 ? 154.197 32.822 15.775  1.00 56.06  ? 147  TRP I NE1 1 
ATOM   10256 C CE2 . TRP F  3  147 ? 152.912 32.571 16.178  1.00 56.14  ? 147  TRP I CE2 1 
ATOM   10257 C CE3 . TRP F  3  147 ? 150.675 32.918 15.346  1.00 56.40  ? 147  TRP I CE3 1 
ATOM   10258 C CZ2 . TRP F  3  147 ? 152.430 31.961 17.342  1.00 56.04  ? 147  TRP I CZ2 1 
ATOM   10259 C CZ3 . TRP F  3  147 ? 150.201 32.310 16.503  1.00 55.88  ? 147  TRP I CZ3 1 
ATOM   10260 C CH2 . TRP F  3  147 ? 151.077 31.841 17.482  1.00 55.85  ? 147  TRP I CH2 1 
ATOM   10261 N N   . GLU F  3  148 ? 152.455 36.891 11.295  1.00 58.51  ? 148  GLU I N   1 
ATOM   10262 C CA  . GLU F  3  148 ? 151.841 37.884 10.427  1.00 58.96  ? 148  GLU I CA  1 
ATOM   10263 C C   . GLU F  3  148 ? 152.894 38.439 9.481   1.00 59.20  ? 148  GLU I C   1 
ATOM   10264 O O   . GLU F  3  148 ? 152.755 39.537 8.945   1.00 59.43  ? 148  GLU I O   1 
ATOM   10265 C CB  . GLU F  3  148 ? 151.276 39.009 11.286  1.00 59.15  ? 148  GLU I CB  1 
ATOM   10266 C CG  . GLU F  3  148 ? 150.353 39.978 10.586  1.00 59.37  ? 148  GLU I CG  1 
ATOM   10267 C CD  . GLU F  3  148 ? 149.703 40.914 11.580  1.00 60.22  ? 148  GLU I CD  1 
ATOM   10268 O OE1 . GLU F  3  148 ? 148.835 41.718 11.178  1.00 59.79  ? 148  GLU I OE1 1 
ATOM   10269 O OE2 . GLU F  3  148 ? 150.071 40.839 12.777  1.00 60.60  ? 148  GLU I OE2 1 
ATOM   10270 N N   . GLN F  3  149 ? 153.956 37.661 9.302   1.00 59.30  ? 149  GLN I N   1 
ATOM   10271 C CA  . GLN F  3  149 ? 155.071 37.994 8.430   1.00 59.40  ? 149  GLN I CA  1 
ATOM   10272 C C   . GLN F  3  149 ? 155.769 36.683 8.077   1.00 59.26  ? 149  GLN I C   1 
ATOM   10273 O O   . GLN F  3  149 ? 156.798 36.672 7.400   1.00 59.38  ? 149  GLN I O   1 
ATOM   10274 C CB  . GLN F  3  149 ? 156.042 38.948 9.129   1.00 59.46  ? 149  GLN I CB  1 
ATOM   10275 C CG  . GLN F  3  149 ? 155.546 40.385 9.197   1.00 59.76  ? 149  GLN I CG  1 
ATOM   10276 C CD  . GLN F  3  149 ? 156.353 41.256 10.140  1.00 60.34  ? 149  GLN I CD  1 
ATOM   10277 O OE1 . GLN F  3  149 ? 157.582 41.305 10.062  1.00 60.27  ? 149  GLN I OE1 1 
ATOM   10278 N NE2 . GLN F  3  149 ? 155.661 41.958 11.031  1.00 60.66  ? 149  GLN I NE2 1 
ATOM   10279 N N   . ALA F  3  150 ? 155.193 35.579 8.550   1.00 58.88  ? 150  ALA I N   1 
ATOM   10280 C CA  . ALA F  3  150 ? 155.719 34.244 8.303   1.00 58.62  ? 150  ALA I CA  1 
ATOM   10281 C C   . ALA F  3  150 ? 154.591 33.341 7.810   1.00 58.27  ? 150  ALA I C   1 
ATOM   10282 O O   . ALA F  3  150 ? 154.750 32.125 7.710   1.00 58.34  ? 150  ALA I O   1 
ATOM   10283 C CB  . ALA F  3  150 ? 156.329 33.675 9.569   1.00 58.58  ? 150  ALA I CB  1 
ATOM   10284 N N   . GLY F  3  151 ? 153.442 33.941 7.522   1.00 57.71  ? 151  GLY I N   1 
ATOM   10285 C CA  . GLY F  3  151 ? 152.301 33.188 7.029   1.00 57.28  ? 151  GLY I CA  1 
ATOM   10286 C C   . GLY F  3  151 ? 151.796 32.076 7.939   1.00 56.65  ? 151  GLY I C   1 
ATOM   10287 O O   . GLY F  3  151 ? 151.081 31.179 7.483   1.00 56.78  ? 151  GLY I O   1 
ATOM   10288 N N   . GLU F  3  152 ? 152.153 32.128 9.222   1.00 55.62  ? 152  GLU I N   1 
ATOM   10289 C CA  . GLU F  3  152 ? 151.707 31.118 10.182  1.00 54.47  ? 152  GLU I CA  1 
ATOM   10290 C C   . GLU F  3  152 ? 150.251 31.382 10.584  1.00 54.02  ? 152  GLU I C   1 
ATOM   10291 O O   . GLU F  3  152 ? 149.468 30.448 10.771  1.00 53.84  ? 152  GLU I O   1 
ATOM   10292 C CB  . GLU F  3  152 ? 152.614 31.108 11.425  1.00 53.98  ? 152  GLU I CB  1 
ATOM   10293 C CG  . GLU F  3  152 ? 152.256 30.061 12.479  1.00 51.94  ? 152  GLU I CG  1 
ATOM   10294 C CD  . GLU F  3  152 ? 152.721 28.660 12.118  1.00 49.83  ? 152  GLU I CD  1 
ATOM   10295 O OE1 . GLU F  3  152 ? 152.963 28.397 10.919  1.00 48.48  ? 152  GLU I OE1 1 
ATOM   10296 O OE2 . GLU F  3  152 ? 152.834 27.818 13.035  1.00 47.00  ? 152  GLU I OE2 1 
ATOM   10297 N N   . ALA F  3  153 ? 149.890 32.658 10.706  1.00 53.32  ? 153  ALA I N   1 
ATOM   10298 C CA  . ALA F  3  153 ? 148.527 33.035 11.072  1.00 52.82  ? 153  ALA I CA  1 
ATOM   10299 C C   . ALA F  3  153 ? 147.532 32.467 10.069  1.00 52.48  ? 153  ALA I C   1 
ATOM   10300 O O   . ALA F  3  153 ? 146.339 32.753 10.129  1.00 52.36  ? 153  ALA I O   1 
ATOM   10301 C CB  . ALA F  3  153 ? 148.396 34.549 11.130  1.00 52.90  ? 153  ALA I CB  1 
ATOM   10302 N N   . GLU F  3  154 ? 148.038 31.668 9.138   1.00 51.96  ? 154  GLU I N   1 
ATOM   10303 C CA  . GLU F  3  154 ? 147.216 31.058 8.113   1.00 51.39  ? 154  GLU I CA  1 
ATOM   10304 C C   . GLU F  3  154 ? 147.481 29.553 8.081   1.00 50.63  ? 154  GLU I C   1 
ATOM   10305 O O   . GLU F  3  154 ? 146.773 28.809 7.416   1.00 50.65  ? 154  GLU I O   1 
ATOM   10306 C CB  . GLU F  3  154 ? 147.518 31.715 6.760   1.00 51.68  ? 154  GLU I CB  1 
ATOM   10307 C CG  . GLU F  3  154 ? 146.805 31.109 5.563   1.00 52.17  ? 154  GLU I CG  1 
ATOM   10308 C CD  . GLU F  3  154 ? 147.549 29.927 4.973   1.00 52.58  ? 154  GLU I CD  1 
ATOM   10309 O OE1 . GLU F  3  154 ? 147.058 29.334 3.989   1.00 53.31  ? 154  GLU I OE1 1 
ATOM   10310 O OE2 . GLU F  3  154 ? 148.629 29.590 5.495   1.00 52.81  ? 154  GLU I OE2 1 
ATOM   10311 N N   . ARG F  3  155 ? 148.502 29.105 8.809   1.00 50.00  ? 155  ARG I N   1 
ATOM   10312 C CA  . ARG F  3  155 ? 148.836 27.682 8.870   1.00 49.22  ? 155  ARG I CA  1 
ATOM   10313 C C   . ARG F  3  155 ? 147.922 26.967 9.864   1.00 48.57  ? 155  ARG I C   1 
ATOM   10314 O O   . ARG F  3  155 ? 147.868 25.736 9.898   1.00 48.32  ? 155  ARG I O   1 
ATOM   10315 C CB  . ARG F  3  155 ? 150.293 27.464 9.288   1.00 49.06  ? 155  ARG I CB  1 
ATOM   10316 C CG  . ARG F  3  155 ? 150.662 25.981 9.389   1.00 48.53  ? 155  ARG I CG  1 
ATOM   10317 C CD  . ARG F  3  155 ? 151.923 25.716 10.173  1.00 47.24  ? 155  ARG I CD  1 
ATOM   10318 N NE  . ARG F  3  155 ? 151.983 24.350 10.679  1.00 45.94  ? 155  ARG I NE  1 
ATOM   10319 C CZ  . ARG F  3  155 ? 152.652 23.996 11.772  1.00 44.60  ? 155  ARG I CZ  1 
ATOM   10320 N NH1 . ARG F  3  155 ? 153.317 24.908 12.468  1.00 43.40  ? 155  ARG I NH1 1 
ATOM   10321 N NH2 . ARG F  3  155 ? 152.650 22.735 12.179  1.00 43.63  ? 155  ARG I NH2 1 
ATOM   10322 N N   . LEU F  3  156 ? 147.222 27.743 10.684  1.00 47.83  ? 156  LEU I N   1 
ATOM   10323 C CA  . LEU F  3  156 ? 146.300 27.175 11.658  1.00 47.44  ? 156  LEU I CA  1 
ATOM   10324 C C   . LEU F  3  156 ? 145.186 26.456 10.933  1.00 47.06  ? 156  LEU I C   1 
ATOM   10325 O O   . LEU F  3  156 ? 144.866 25.307 11.239  1.00 46.43  ? 156  LEU I O   1 
ATOM   10326 C CB  . LEU F  3  156 ? 145.691 28.264 12.545  1.00 47.35  ? 156  LEU I CB  1 
ATOM   10327 C CG  . LEU F  3  156 ? 146.475 28.602 13.810  1.00 47.01  ? 156  LEU I CG  1 
ATOM   10328 C CD1 . LEU F  3  156 ? 145.733 29.654 14.615  1.00 47.04  ? 156  LEU I CD1 1 
ATOM   10329 C CD2 . LEU F  3  156 ? 146.672 27.347 14.637  1.00 46.65  ? 156  LEU I CD2 1 
ATOM   10330 N N   . ARG F  3  157 ? 144.602 27.157 9.967   1.00 47.07  ? 157  ARG I N   1 
ATOM   10331 C CA  . ARG F  3  157 ? 143.503 26.622 9.176   1.00 46.96  ? 157  ARG I CA  1 
ATOM   10332 C C   . ARG F  3  157 ? 143.688 25.131 8.911   1.00 45.54  ? 157  ARG I C   1 
ATOM   10333 O O   . ARG F  3  157 ? 142.889 24.317 9.362   1.00 45.19  ? 157  ARG I O   1 
ATOM   10334 C CB  . ARG F  3  157 ? 143.396 27.366 7.852   1.00 48.11  ? 157  ARG I CB  1 
ATOM   10335 C CG  . ARG F  3  157 ? 143.222 28.867 7.976   1.00 51.25  ? 157  ARG I CG  1 
ATOM   10336 C CD  . ARG F  3  157 ? 143.212 29.551 6.618   1.00 54.56  ? 157  ARG I CD  1 
ATOM   10337 N NE  . ARG F  3  157 ? 143.047 30.997 6.717   1.00 56.85  ? 157  ARG I NE  1 
ATOM   10338 C CZ  . ARG F  3  157 ? 142.864 31.797 5.676   1.00 58.30  ? 157  ARG I CZ  1 
ATOM   10339 N NH1 . ARG F  3  157 ? 142.823 31.291 4.449   1.00 59.04  ? 157  ARG I NH1 1 
ATOM   10340 N NH2 . ARG F  3  157 ? 142.721 33.104 5.860   1.00 58.96  ? 157  ARG I NH2 1 
ATOM   10341 N N   . ALA F  3  158 ? 144.744 24.780 8.183   1.00 44.08  ? 158  ALA I N   1 
ATOM   10342 C CA  . ALA F  3  158 ? 145.025 23.386 7.832   1.00 42.87  ? 158  ALA I CA  1 
ATOM   10343 C C   . ALA F  3  158 ? 144.675 22.399 8.946   1.00 41.73  ? 158  ALA I C   1 
ATOM   10344 O O   . ALA F  3  158 ? 143.815 21.531 8.778   1.00 41.41  ? 158  ALA I O   1 
ATOM   10345 C CB  . ALA F  3  158 ? 146.476 23.238 7.456   1.00 42.97  ? 158  ALA I CB  1 
ATOM   10346 N N   . TYR F  3  159 ? 145.366 22.525 10.073  1.00 40.30  ? 159  TYR I N   1 
ATOM   10347 C CA  . TYR F  3  159 ? 145.132 21.674 11.229  1.00 39.22  ? 159  TYR I CA  1 
ATOM   10348 C C   . TYR F  3  159 ? 143.710 21.878 11.733  1.00 38.15  ? 159  TYR I C   1 
ATOM   10349 O O   . TYR F  3  159 ? 142.941 20.927 11.857  1.00 37.79  ? 159  TYR I O   1 
ATOM   10350 C CB  . TYR F  3  159 ? 146.121 22.048 12.327  1.00 39.49  ? 159  TYR I CB  1 
ATOM   10351 C CG  . TYR F  3  159 ? 145.905 21.405 13.675  1.00 39.95  ? 159  TYR I CG  1 
ATOM   10352 C CD1 . TYR F  3  159 ? 146.058 20.037 13.852  1.00 40.95  ? 159  TYR I CD1 1 
ATOM   10353 C CD2 . TYR F  3  159 ? 145.607 22.180 14.790  1.00 40.97  ? 159  TYR I CD2 1 
ATOM   10354 C CE1 . TYR F  3  159 ? 145.898 19.450 15.107  1.00 41.51  ? 159  TYR I CE1 1 
ATOM   10355 C CE2 . TYR F  3  159 ? 145.445 21.606 16.046  1.00 40.98  ? 159  TYR I CE2 1 
ATOM   10356 C CZ  . TYR F  3  159 ? 145.591 20.241 16.197  1.00 41.50  ? 159  TYR I CZ  1 
ATOM   10357 O OH  . TYR F  3  159 ? 145.441 19.673 17.445  1.00 43.26  ? 159  TYR I OH  1 
ATOM   10358 N N   . LEU F  3  160 ? 143.376 23.134 12.020  1.00 36.79  ? 160  LEU I N   1 
ATOM   10359 C CA  . LEU F  3  160 ? 142.062 23.491 12.529  1.00 36.07  ? 160  LEU I CA  1 
ATOM   10360 C C   . LEU F  3  160 ? 140.895 23.079 11.622  1.00 35.76  ? 160  LEU I C   1 
ATOM   10361 O O   . LEU F  3  160 ? 139.971 22.418 12.083  1.00 35.74  ? 160  LEU I O   1 
ATOM   10362 C CB  . LEU F  3  160 ? 141.991 24.998 12.817  1.00 35.86  ? 160  LEU I CB  1 
ATOM   10363 C CG  . LEU F  3  160 ? 142.793 25.566 13.993  1.00 35.46  ? 160  LEU I CG  1 
ATOM   10364 C CD1 . LEU F  3  160 ? 142.341 26.994 14.288  1.00 34.85  ? 160  LEU I CD1 1 
ATOM   10365 C CD2 . LEU F  3  160 ? 142.611 24.713 15.228  1.00 35.29  ? 160  LEU I CD2 1 
ATOM   10366 N N   . GLU F  3  161 ? 140.917 23.478 10.351  1.00 35.39  ? 161  GLU I N   1 
ATOM   10367 C CA  . GLU F  3  161 ? 139.823 23.146 9.440   1.00 35.14  ? 161  GLU I CA  1 
ATOM   10368 C C   . GLU F  3  161 ? 139.951 21.716 8.940   1.00 35.51  ? 161  GLU I C   1 
ATOM   10369 O O   . GLU F  3  161 ? 138.954 21.096 8.543   1.00 35.28  ? 161  GLU I O   1 
ATOM   10370 C CB  . GLU F  3  161 ? 139.778 24.114 8.250   1.00 35.27  ? 161  GLU I CB  1 
ATOM   10371 C CG  . GLU F  3  161 ? 139.299 25.531 8.588   1.00 35.14  ? 161  GLU I CG  1 
ATOM   10372 C CD  . GLU F  3  161 ? 139.282 26.472 7.387   1.00 34.96  ? 161  GLU I CD  1 
ATOM   10373 O OE1 . GLU F  3  161 ? 138.801 27.621 7.530   1.00 33.79  ? 161  GLU I OE1 1 
ATOM   10374 O OE2 . GLU F  3  161 ? 139.754 26.069 6.302   1.00 35.41  ? 161  GLU I OE2 1 
ATOM   10375 N N   . GLY F  3  162 ? 141.173 21.189 8.974   1.00 35.61  ? 162  GLY I N   1 
ATOM   10376 C CA  . GLY F  3  162 ? 141.425 19.837 8.503   1.00 35.93  ? 162  GLY I CA  1 
ATOM   10377 C C   . GLY F  3  162 ? 141.815 18.842 9.578   1.00 36.07  ? 162  GLY I C   1 
ATOM   10378 O O   . GLY F  3  162 ? 140.959 18.193 10.176  1.00 36.16  ? 162  GLY I O   1 
ATOM   10379 N N   . THR F  3  163 ? 143.118 18.720 9.814   1.00 36.19  ? 163  THR I N   1 
ATOM   10380 C CA  . THR F  3  163 ? 143.653 17.787 10.800  1.00 36.13  ? 163  THR I CA  1 
ATOM   10381 C C   . THR F  3  163 ? 142.765 17.658 12.045  1.00 36.30  ? 163  THR I C   1 
ATOM   10382 O O   . THR F  3  163 ? 142.373 16.550 12.415  1.00 36.26  ? 163  THR I O   1 
ATOM   10383 C CB  . THR F  3  163 ? 145.082 18.216 11.221  1.00 36.38  ? 163  THR I CB  1 
ATOM   10384 O OG1 . THR F  3  163 ? 145.977 18.175 10.092  1.00 35.65  ? 163  THR I OG1 1 
ATOM   10385 C CG2 . THR F  3  163 ? 145.650 17.251 12.249  1.00 36.28  ? 163  THR I CG2 1 
ATOM   10386 N N   . CYS F  3  164 ? 142.452 18.781 12.689  1.00 36.30  ? 164  CYS I N   1 
ATOM   10387 C CA  . CYS F  3  164 ? 141.634 18.764 13.904  1.00 36.92  ? 164  CYS I CA  1 
ATOM   10388 C C   . CYS F  3  164 ? 140.326 18.025 13.667  1.00 37.26  ? 164  CYS I C   1 
ATOM   10389 O O   . CYS F  3  164 ? 140.170 16.859 14.052  1.00 37.43  ? 164  CYS I O   1 
ATOM   10390 C CB  . CYS F  3  164 ? 141.326 20.187 14.382  1.00 36.94  ? 164  CYS I CB  1 
ATOM   10391 S SG  . CYS F  3  164 ? 140.730 20.273 16.095  1.00 36.59  ? 164  CYS I SG  1 
ATOM   10392 N N   . VAL F  3  165 ? 139.382 18.725 13.045  1.00 37.24  ? 165  VAL I N   1 
ATOM   10393 C CA  . VAL F  3  165 ? 138.092 18.156 12.716  1.00 37.08  ? 165  VAL I CA  1 
ATOM   10394 C C   . VAL F  3  165 ? 138.298 16.708 12.283  1.00 37.86  ? 165  VAL I C   1 
ATOM   10395 O O   . VAL F  3  165 ? 137.562 15.821 12.704  1.00 38.40  ? 165  VAL I O   1 
ATOM   10396 C CB  . VAL F  3  165 ? 137.417 18.961 11.579  1.00 36.84  ? 165  VAL I CB  1 
ATOM   10397 C CG1 . VAL F  3  165 ? 136.027 18.421 11.277  1.00 35.95  ? 165  VAL I CG1 1 
ATOM   10398 C CG2 . VAL F  3  165 ? 137.356 20.445 11.945  1.00 35.84  ? 165  VAL I CG2 1 
ATOM   10399 N N   . GLU F  3  166 ? 139.319 16.471 11.457  1.00 38.53  ? 166  GLU I N   1 
ATOM   10400 C CA  . GLU F  3  166 ? 139.619 15.128 10.959  1.00 39.07  ? 166  GLU I CA  1 
ATOM   10401 C C   . GLU F  3  166 ? 139.769 14.109 12.088  1.00 38.66  ? 166  GLU I C   1 
ATOM   10402 O O   . GLU F  3  166 ? 139.188 13.028 12.041  1.00 38.35  ? 166  GLU I O   1 
ATOM   10403 C CB  . GLU F  3  166 ? 140.903 15.132 10.120  1.00 39.84  ? 166  GLU I CB  1 
ATOM   10404 C CG  . GLU F  3  166 ? 140.789 15.802 8.751   1.00 42.33  ? 166  GLU I CG  1 
ATOM   10405 C CD  . GLU F  3  166 ? 142.079 15.718 7.935   1.00 44.40  ? 166  GLU I CD  1 
ATOM   10406 O OE1 . GLU F  3  166 ? 142.103 16.229 6.794   1.00 46.14  ? 166  GLU I OE1 1 
ATOM   10407 O OE2 . GLU F  3  166 ? 143.072 15.137 8.428   1.00 44.78  ? 166  GLU I OE2 1 
ATOM   10408 N N   . TRP F  3  167 ? 140.563 14.451 13.096  1.00 38.48  ? 167  TRP I N   1 
ATOM   10409 C CA  . TRP F  3  167 ? 140.805 13.536 14.207  1.00 38.60  ? 167  TRP I CA  1 
ATOM   10410 C C   . TRP F  3  167 ? 139.661 13.451 15.205  1.00 38.14  ? 167  TRP I C   1 
ATOM   10411 O O   . TRP F  3  167 ? 139.309 12.356 15.645  1.00 38.27  ? 167  TRP I O   1 
ATOM   10412 C CB  . TRP F  3  167 ? 142.121 13.874 14.917  1.00 38.75  ? 167  TRP I CB  1 
ATOM   10413 C CG  . TRP F  3  167 ? 143.292 13.307 14.176  1.00 39.35  ? 167  TRP I CG  1 
ATOM   10414 C CD1 . TRP F  3  167 ? 144.102 13.966 13.299  1.00 40.59  ? 167  TRP I CD1 1 
ATOM   10415 C CD2 . TRP F  3  167 ? 143.753 11.950 14.201  1.00 39.97  ? 167  TRP I CD2 1 
ATOM   10416 N NE1 . TRP F  3  167 ? 145.045 13.109 12.786  1.00 39.89  ? 167  TRP I NE1 1 
ATOM   10417 C CE2 . TRP F  3  167 ? 144.856 11.864 13.326  1.00 40.50  ? 167  TRP I CE2 1 
ATOM   10418 C CE3 . TRP F  3  167 ? 143.353 10.796 14.885  1.00 40.89  ? 167  TRP I CE3 1 
ATOM   10419 C CZ2 . TRP F  3  167 ? 145.559 10.676 13.114  1.00 40.66  ? 167  TRP I CZ2 1 
ATOM   10420 C CZ3 . TRP F  3  167 ? 144.053 9.614  14.673  1.00 41.08  ? 167  TRP I CZ3 1 
ATOM   10421 C CH2 . TRP F  3  167 ? 145.143 9.566  13.794  1.00 41.05  ? 167  TRP I CH2 1 
ATOM   10422 N N   . LEU F  3  168 ? 139.086 14.596 15.563  1.00 37.66  ? 168  LEU I N   1 
ATOM   10423 C CA  . LEU F  3  168 ? 137.954 14.620 16.484  1.00 36.96  ? 168  LEU I CA  1 
ATOM   10424 C C   . LEU F  3  168 ? 136.987 13.520 16.099  1.00 37.43  ? 168  LEU I C   1 
ATOM   10425 O O   . LEU F  3  168 ? 136.429 12.841 16.956  1.00 37.29  ? 168  LEU I O   1 
ATOM   10426 C CB  . LEU F  3  168 ? 137.245 15.969 16.428  1.00 36.25  ? 168  LEU I CB  1 
ATOM   10427 C CG  . LEU F  3  168 ? 135.815 15.985 16.961  1.00 35.08  ? 168  LEU I CG  1 
ATOM   10428 C CD1 . LEU F  3  168 ? 135.804 15.534 18.403  1.00 34.60  ? 168  LEU I CD1 1 
ATOM   10429 C CD2 . LEU F  3  168 ? 135.206 17.371 16.825  1.00 33.46  ? 168  LEU I CD2 1 
ATOM   10430 N N   . ARG F  3  169 ? 136.813 13.339 14.794  1.00 38.27  ? 169  ARG I N   1 
ATOM   10431 C CA  . ARG F  3  169 ? 135.903 12.333 14.260  1.00 39.05  ? 169  ARG I CA  1 
ATOM   10432 C C   . ARG F  3  169 ? 136.330 10.909 14.596  1.00 39.72  ? 169  ARG I C   1 
ATOM   10433 O O   . ARG F  3  169 ? 135.486 10.040 14.816  1.00 40.18  ? 169  ARG I O   1 
ATOM   10434 C CB  . ARG F  3  169 ? 135.797 12.479 12.744  1.00 38.97  ? 169  ARG I CB  1 
ATOM   10435 C CG  . ARG F  3  169 ? 134.803 11.528 12.103  1.00 39.49  ? 169  ARG I CG  1 
ATOM   10436 C CD  . ARG F  3  169 ? 134.942 11.482 10.604  1.00 40.51  ? 169  ARG I CD  1 
ATOM   10437 N NE  . ARG F  3  169 ? 135.028 12.828 10.036  1.00 41.36  ? 169  ARG I NE  1 
ATOM   10438 C CZ  . ARG F  3  169 ? 135.915 13.195 9.119   1.00 41.57  ? 169  ARG I CZ  1 
ATOM   10439 N NH1 . ARG F  3  169 ? 136.794 12.317 8.647   1.00 41.44  ? 169  ARG I NH1 1 
ATOM   10440 N NH2 . ARG F  3  169 ? 135.928 14.444 8.671   1.00 41.95  ? 169  ARG I NH2 1 
ATOM   10441 N N   . ARG F  3  170 ? 137.632 10.658 14.617  1.00 40.54  ? 170  ARG I N   1 
ATOM   10442 C CA  . ARG F  3  170 ? 138.123 9.316  14.915  1.00 41.22  ? 170  ARG I CA  1 
ATOM   10443 C C   . ARG F  3  170 ? 137.915 8.951  16.371  1.00 41.37  ? 170  ARG I C   1 
ATOM   10444 O O   . ARG F  3  170 ? 137.364 7.900  16.680  1.00 41.64  ? 170  ARG I O   1 
ATOM   10445 C CB  . ARG F  3  170 ? 139.605 9.174  14.578  1.00 41.49  ? 170  ARG I CB  1 
ATOM   10446 C CG  . ARG F  3  170 ? 140.117 7.763  14.806  1.00 42.25  ? 170  ARG I CG  1 
ATOM   10447 C CD  . ARG F  3  170 ? 139.409 6.744  13.921  1.00 43.41  ? 170  ARG I CD  1 
ATOM   10448 N NE  . ARG F  3  170 ? 139.593 5.351  14.332  1.00 43.12  ? 170  ARG I NE  1 
ATOM   10449 C CZ  . ARG F  3  170 ? 140.764 4.771  14.529  1.00 42.71  ? 170  ARG I CZ  1 
ATOM   10450 N NH1 . ARG F  3  170 ? 141.885 5.461  14.377  1.00 43.18  ? 170  ARG I NH1 1 
ATOM   10451 N NH2 . ARG F  3  170 ? 140.815 3.494  14.883  1.00 42.76  ? 170  ARG I NH2 1 
ATOM   10452 N N   . TYR F  3  171 ? 138.376 9.812  17.268  1.00 41.70  ? 171  TYR I N   1 
ATOM   10453 C CA  . TYR F  3  171 ? 138.226 9.553  18.691  1.00 42.25  ? 171  TYR I CA  1 
ATOM   10454 C C   . TYR F  3  171 ? 136.779 9.167  18.964  1.00 43.28  ? 171  TYR I C   1 
ATOM   10455 O O   . TYR F  3  171 ? 136.503 8.137  19.583  1.00 43.39  ? 171  TYR I O   1 
ATOM   10456 C CB  . TYR F  3  171 ? 138.626 10.786 19.495  1.00 41.83  ? 171  TYR I CB  1 
ATOM   10457 C CG  . TYR F  3  171 ? 140.042 11.268 19.200  1.00 40.75  ? 171  TYR I CG  1 
ATOM   10458 C CD1 . TYR F  3  171 ? 141.090 10.365 19.026  1.00 39.66  ? 171  TYR I CD1 1 
ATOM   10459 C CD2 . TYR F  3  171 ? 140.330 12.619 19.106  1.00 39.69  ? 171  TYR I CD2 1 
ATOM   10460 C CE1 . TYR F  3  171 ? 142.385 10.805 18.765  1.00 39.30  ? 171  TYR I CE1 1 
ATOM   10461 C CE2 . TYR F  3  171 ? 141.621 13.065 18.846  1.00 39.11  ? 171  TYR I CE2 1 
ATOM   10462 C CZ  . TYR F  3  171 ? 142.640 12.156 18.673  1.00 39.06  ? 171  TYR I CZ  1 
ATOM   10463 O OH  . TYR F  3  171 ? 143.918 12.604 18.416  1.00 39.12  ? 171  TYR I OH  1 
ATOM   10464 N N   . LEU F  3  172 ? 135.868 9.997  18.459  1.00 44.55  ? 172  LEU I N   1 
ATOM   10465 C CA  . LEU F  3  172 ? 134.434 9.795  18.597  1.00 45.25  ? 172  LEU I CA  1 
ATOM   10466 C C   . LEU F  3  172 ? 134.048 8.436  18.061  1.00 46.54  ? 172  LEU I C   1 
ATOM   10467 O O   . LEU F  3  172 ? 133.201 7.750  18.632  1.00 46.84  ? 172  LEU I O   1 
ATOM   10468 C CB  . LEU F  3  172 ? 133.678 10.873 17.813  1.00 45.01  ? 172  LEU I CB  1 
ATOM   10469 C CG  . LEU F  3  172 ? 133.322 12.169 18.542  1.00 44.41  ? 172  LEU I CG  1 
ATOM   10470 C CD1 . LEU F  3  172 ? 134.394 12.547 19.542  1.00 44.55  ? 172  LEU I CD1 1 
ATOM   10471 C CD2 . LEU F  3  172 ? 133.120 13.281 17.530  1.00 44.02  ? 172  LEU I CD2 1 
ATOM   10472 N N   . LYS F  3  173 ? 134.674 8.053  16.954  1.00 47.80  ? 173  LYS I N   1 
ATOM   10473 C CA  . LYS F  3  173 ? 134.393 6.772  16.319  1.00 49.07  ? 173  LYS I CA  1 
ATOM   10474 C C   . LYS F  3  173 ? 134.506 5.593  17.294  1.00 49.59  ? 173  LYS I C   1 
ATOM   10475 O O   . LYS F  3  173 ? 133.627 4.729  17.334  1.00 49.79  ? 173  LYS I O   1 
ATOM   10476 C CB  . LYS F  3  173 ? 135.337 6.561  15.134  1.00 49.46  ? 173  LYS I CB  1 
ATOM   10477 C CG  . LYS F  3  173 ? 135.126 5.254  14.388  1.00 50.40  ? 173  LYS I CG  1 
ATOM   10478 C CD  . LYS F  3  173 ? 136.255 5.008  13.402  1.00 51.63  ? 173  LYS I CD  1 
ATOM   10479 C CE  . LYS F  3  173 ? 136.023 3.747  12.587  1.00 52.28  ? 173  LYS I CE  1 
ATOM   10480 N NZ  . LYS F  3  173 ? 137.176 3.438  11.695  1.00 52.81  ? 173  LYS I NZ  1 
ATOM   10481 N N   . ASN F  3  174 ? 135.584 5.562  18.074  1.00 50.19  ? 174  ASN I N   1 
ATOM   10482 C CA  . ASN F  3  174 ? 135.825 4.475  19.025  1.00 50.69  ? 174  ASN I CA  1 
ATOM   10483 C C   . ASN F  3  174 ? 135.281 4.745  20.423  1.00 51.01  ? 174  ASN I C   1 
ATOM   10484 O O   . ASN F  3  174 ? 134.648 3.877  21.032  1.00 51.16  ? 174  ASN I O   1 
ATOM   10485 C CB  . ASN F  3  174 ? 137.321 4.179  19.108  1.00 50.77  ? 174  ASN I CB  1 
ATOM   10486 C CG  . ASN F  3  174 ? 137.841 3.475  17.871  1.00 51.01  ? 174  ASN I CG  1 
ATOM   10487 O OD1 . ASN F  3  174 ? 138.819 3.903  17.262  1.00 51.03  ? 174  ASN I OD1 1 
ATOM   10488 N ND2 . ASN F  3  174 ? 137.182 2.386  17.491  1.00 51.35  ? 174  ASN I ND2 1 
ATOM   10489 N N   . GLY F  3  175 ? 135.528 5.942  20.940  1.00 51.08  ? 175  GLY I N   1 
ATOM   10490 C CA  . GLY F  3  175 ? 135.040 6.280  22.262  1.00 51.13  ? 175  GLY I CA  1 
ATOM   10491 C C   . GLY F  3  175 ? 133.580 6.698  22.261  1.00 51.15  ? 175  GLY I C   1 
ATOM   10492 O O   . GLY F  3  175 ? 133.110 7.286  23.231  1.00 51.25  ? 175  GLY I O   1 
ATOM   10493 N N   . ASN F  3  176 ? 132.854 6.405  21.185  1.00 51.02  ? 176  ASN I N   1 
ATOM   10494 C CA  . ASN F  3  176 ? 131.448 6.792  21.112  1.00 51.02  ? 176  ASN I CA  1 
ATOM   10495 C C   . ASN F  3  176 ? 130.689 6.412  22.380  1.00 50.69  ? 176  ASN I C   1 
ATOM   10496 O O   . ASN F  3  176 ? 130.409 7.261  23.220  1.00 50.54  ? 176  ASN I O   1 
ATOM   10497 C CB  . ASN F  3  176 ? 130.761 6.160  19.902  1.00 51.24  ? 176  ASN I CB  1 
ATOM   10498 C CG  . ASN F  3  176 ? 129.289 6.532  19.810  1.00 51.81  ? 176  ASN I CG  1 
ATOM   10499 O OD1 . ASN F  3  176 ? 128.618 6.721  20.827  1.00 52.62  ? 176  ASN I OD1 1 
ATOM   10500 N ND2 . ASN F  3  176 ? 128.778 6.628  18.587  1.00 52.04  ? 176  ASN I ND2 1 
ATOM   10501 N N   . ALA F  3  177 ? 130.349 5.133  22.509  1.00 50.50  ? 177  ALA I N   1 
ATOM   10502 C CA  . ALA F  3  177 ? 129.604 4.650  23.670  1.00 50.29  ? 177  ALA I CA  1 
ATOM   10503 C C   . ALA F  3  177 ? 130.070 5.336  24.955  1.00 49.94  ? 177  ALA I C   1 
ATOM   10504 O O   . ALA F  3  177 ? 129.257 5.810  25.755  1.00 50.18  ? 177  ALA I O   1 
ATOM   10505 C CB  . ALA F  3  177 ? 129.749 3.136  23.797  1.00 50.21  ? 177  ALA I CB  1 
ATOM   10506 N N   . THR F  3  178 ? 131.385 5.391  25.138  1.00 49.15  ? 178  THR I N   1 
ATOM   10507 C CA  . THR F  3  178 ? 131.973 5.998  26.326  1.00 48.47  ? 178  THR I CA  1 
ATOM   10508 C C   . THR F  3  178 ? 131.593 7.460  26.520  1.00 48.06  ? 178  THR I C   1 
ATOM   10509 O O   . THR F  3  178 ? 130.913 7.794  27.482  1.00 47.84  ? 178  THR I O   1 
ATOM   10510 C CB  . THR F  3  178 ? 133.500 5.887  26.276  1.00 48.30  ? 178  THR I CB  1 
ATOM   10511 O OG1 . THR F  3  178 ? 133.883 4.505  26.246  1.00 48.29  ? 178  THR I OG1 1 
ATOM   10512 C CG2 . THR F  3  178 ? 134.121 6.483  27.539  1.00 47.93  ? 178  THR I CG2 1 
ATOM   10513 N N   . LEU F  3  179 ? 132.049 8.331  25.624  1.00 47.73  ? 179  LEU I N   1 
ATOM   10514 C CA  . LEU F  3  179 ? 131.776 9.765  25.747  1.00 47.60  ? 179  LEU I CA  1 
ATOM   10515 C C   . LEU F  3  179 ? 130.306 10.075 25.988  1.00 47.27  ? 179  LEU I C   1 
ATOM   10516 O O   . LEU F  3  179 ? 129.968 10.825 26.901  1.00 47.23  ? 179  LEU I O   1 
ATOM   10517 C CB  . LEU F  3  179 ? 132.266 10.521 24.514  1.00 47.65  ? 179  LEU I CB  1 
ATOM   10518 C CG  . LEU F  3  179 ? 133.774 10.770 24.482  1.00 47.83  ? 179  LEU I CG  1 
ATOM   10519 C CD1 . LEU F  3  179 ? 134.198 11.159 23.087  1.00 48.17  ? 179  LEU I CD1 1 
ATOM   10520 C CD2 . LEU F  3  179 ? 134.160 11.843 25.488  1.00 47.54  ? 179  LEU I CD2 1 
ATOM   10521 N N   . LEU F  3  180 ? 129.432 9.504  25.170  1.00 46.93  ? 180  LEU I N   1 
ATOM   10522 C CA  . LEU F  3  180 ? 128.006 9.746  25.333  1.00 46.60  ? 180  LEU I CA  1 
ATOM   10523 C C   . LEU F  3  180 ? 127.411 8.784  26.360  1.00 46.06  ? 180  LEU I C   1 
ATOM   10524 O O   . LEU F  3  180 ? 126.912 7.712  26.014  1.00 46.49  ? 180  LEU I O   1 
ATOM   10525 C CB  . LEU F  3  180 ? 127.275 9.636  23.990  1.00 46.73  ? 180  LEU I CB  1 
ATOM   10526 C CG  . LEU F  3  180 ? 127.596 10.731 22.957  1.00 47.00  ? 180  LEU I CG  1 
ATOM   10527 C CD1 . LEU F  3  180 ? 127.661 12.078 23.659  1.00 46.80  ? 180  LEU I CD1 1 
ATOM   10528 C CD2 . LEU F  3  180 ? 128.902 10.466 22.218  1.00 46.51  ? 180  LEU I CD2 1 
ATOM   10529 N N   . ARG F  3  181 ? 127.484 9.175  27.628  1.00 44.76  ? 181  ARG I N   1 
ATOM   10530 C CA  . ARG F  3  181 ? 126.947 8.381  28.720  1.00 43.59  ? 181  ARG I CA  1 
ATOM   10531 C C   . ARG F  3  181 ? 126.612 9.348  29.842  1.00 41.74  ? 181  ARG I C   1 
ATOM   10532 O O   . ARG F  3  181 ? 127.399 10.241 30.149  1.00 41.39  ? 181  ARG I O   1 
ATOM   10533 C CB  . ARG F  3  181 ? 127.970 7.352  29.197  1.00 44.10  ? 181  ARG I CB  1 
ATOM   10534 C CG  . ARG F  3  181 ? 129.191 7.961  29.871  1.00 45.76  ? 181  ARG I CG  1 
ATOM   10535 C CD  . ARG F  3  181 ? 129.195 7.810  31.389  1.00 47.29  ? 181  ARG I CD  1 
ATOM   10536 N NE  . ARG F  3  181 ? 130.236 8.627  32.010  1.00 48.68  ? 181  ARG I NE  1 
ATOM   10537 C CZ  . ARG F  3  181 ? 130.521 8.633  33.308  1.00 49.40  ? 181  ARG I CZ  1 
ATOM   10538 N NH1 . ARG F  3  181 ? 129.851 7.854  34.147  1.00 49.95  ? 181  ARG I NH1 1 
ATOM   10539 N NH2 . ARG F  3  181 ? 131.479 9.425  33.771  1.00 48.88  ? 181  ARG I NH2 1 
ATOM   10540 N N   . THR F  3  182 ? 125.448 9.172  30.454  1.00 39.48  ? 182  THR I N   1 
ATOM   10541 C CA  . THR F  3  182 ? 125.026 10.069 31.517  1.00 37.81  ? 182  THR I CA  1 
ATOM   10542 C C   . THR F  3  182 ? 124.636 9.383  32.815  1.00 36.42  ? 182  THR I C   1 
ATOM   10543 O O   . THR F  3  182 ? 124.140 8.262  32.817  1.00 36.46  ? 182  THR I O   1 
ATOM   10544 C CB  . THR F  3  182 ? 123.839 10.922 31.054  1.00 37.75  ? 182  THR I CB  1 
ATOM   10545 O OG1 . THR F  3  182 ? 122.899 10.105 30.344  1.00 37.28  ? 182  THR I OG1 1 
ATOM   10546 C CG2 . THR F  3  182 ? 124.291 12.006 30.076  1.00 37.65  ? 182  THR I CG2 1 
ATOM   10547 N N   . ASP F  3  183 ? 124.877 10.082 33.920  1.00 34.71  ? 183  ASP I N   1 
ATOM   10548 C CA  . ASP F  3  183 ? 124.484 9.624  35.241  1.00 33.29  ? 183  ASP I CA  1 
ATOM   10549 C C   . ASP F  3  183 ? 123.518 10.671 35.760  1.00 31.92  ? 183  ASP I C   1 
ATOM   10550 O O   . ASP F  3  183 ? 123.896 11.831 35.944  1.00 31.40  ? 183  ASP I O   1 
ATOM   10551 C CB  . ASP F  3  183 ? 125.675 9.530  36.191  1.00 33.37  ? 183  ASP I CB  1 
ATOM   10552 C CG  . ASP F  3  183 ? 126.647 8.455  35.805  1.00 33.60  ? 183  ASP I CG  1 
ATOM   10553 O OD1 . ASP F  3  183 ? 126.227 7.294  35.633  1.00 33.51  ? 183  ASP I OD1 1 
ATOM   10554 O OD2 . ASP F  3  183 ? 127.860 8.706  35.662  1.00 35.35  ? 183  ASP I OD2 1 
ATOM   10555 N N   . SER F  3  184 ? 122.270 10.269 35.964  1.00 30.64  ? 184  SER I N   1 
ATOM   10556 C CA  . SER F  3  184 ? 121.254 11.171 36.481  1.00 29.64  ? 184  SER I CA  1 
ATOM   10557 C C   . SER F  3  184 ? 121.634 11.514 37.901  1.00 28.96  ? 184  SER I C   1 
ATOM   10558 O O   . SER F  3  184 ? 122.254 10.707 38.590  1.00 28.48  ? 184  SER I O   1 
ATOM   10559 C CB  . SER F  3  184 ? 119.880 10.507 36.485  1.00 29.78  ? 184  SER I CB  1 
ATOM   10560 O OG  . SER F  3  184 ? 119.183 10.729 35.276  1.00 29.97  ? 184  SER I OG  1 
ATOM   10561 N N   . PRO F  3  185 ? 121.349 12.736 38.329  1.00 28.14  ? 185  PRO I N   1 
ATOM   10562 C CA  . PRO F  3  185 ? 121.647 13.103 39.703  1.00 27.79  ? 185  PRO I CA  1 
ATOM   10563 C C   . PRO F  3  185 ? 120.537 12.626 40.627  1.00 27.66  ? 185  PRO I C   1 
ATOM   10564 O O   . PRO F  3  185 ? 119.411 12.387 40.196  1.00 28.00  ? 185  PRO I O   1 
ATOM   10565 C CB  . PRO F  3  185 ? 121.709 14.625 39.632  1.00 27.63  ? 185  PRO I CB  1 
ATOM   10566 C CG  . PRO F  3  185 ? 120.680 14.949 38.610  1.00 27.45  ? 185  PRO I CG  1 
ATOM   10567 C CD  . PRO F  3  185 ? 120.928 13.909 37.543  1.00 27.78  ? 185  PRO I CD  1 
ATOM   10568 N N   . LYS F  3  186 ? 120.871 12.451 41.891  1.00 27.54  ? 186  LYS I N   1 
ATOM   10569 C CA  . LYS F  3  186 ? 119.899 12.034 42.870  1.00 27.64  ? 186  LYS I CA  1 
ATOM   10570 C C   . LYS F  3  186 ? 119.875 13.199 43.833  1.00 26.60  ? 186  LYS I C   1 
ATOM   10571 O O   . LYS F  3  186 ? 120.926 13.636 44.300  1.00 26.71  ? 186  LYS I O   1 
ATOM   10572 C CB  . LYS F  3  186 ? 120.322 10.723 43.545  1.00 28.46  ? 186  LYS I CB  1 
ATOM   10573 C CG  . LYS F  3  186 ? 120.263 9.513  42.598  1.00 30.79  ? 186  LYS I CG  1 
ATOM   10574 C CD  . LYS F  3  186 ? 120.639 8.190  43.264  1.00 33.23  ? 186  LYS I CD  1 
ATOM   10575 C CE  . LYS F  3  186 ? 122.113 8.136  43.623  1.00 35.09  ? 186  LYS I CE  1 
ATOM   10576 N NZ  . LYS F  3  186 ? 123.009 8.345  42.447  1.00 36.57  ? 186  LYS I NZ  1 
ATOM   10577 N N   . ALA F  3  187 ? 118.687 13.731 44.095  1.00 25.63  ? 187  ALA I N   1 
ATOM   10578 C CA  . ALA F  3  187 ? 118.559 14.896 44.961  1.00 24.70  ? 187  ALA I CA  1 
ATOM   10579 C C   . ALA F  3  187 ? 117.711 14.662 46.202  1.00 24.16  ? 187  ALA I C   1 
ATOM   10580 O O   . ALA F  3  187 ? 116.823 13.821 46.225  1.00 24.01  ? 187  ALA I O   1 
ATOM   10581 C CB  . ALA F  3  187 ? 118.002 16.070 44.166  1.00 24.22  ? 187  ALA I CB  1 
ATOM   10582 N N   . HIS F  3  188 ? 118.003 15.443 47.231  1.00 23.86  ? 188  HIS I N   1 
ATOM   10583 C CA  . HIS F  3  188 ? 117.298 15.384 48.497  1.00 23.65  ? 188  HIS I CA  1 
ATOM   10584 C C   . HIS F  3  188 ? 117.538 16.740 49.125  1.00 23.86  ? 188  HIS I C   1 
ATOM   10585 O O   . HIS F  3  188 ? 118.463 17.448 48.729  1.00 23.89  ? 188  HIS I O   1 
ATOM   10586 C CB  . HIS F  3  188 ? 117.872 14.284 49.388  1.00 23.37  ? 188  HIS I CB  1 
ATOM   10587 C CG  . HIS F  3  188 ? 119.238 14.586 49.915  1.00 22.54  ? 188  HIS I CG  1 
ATOM   10588 N ND1 . HIS F  3  188 ? 119.447 15.285 51.083  1.00 22.82  ? 188  HIS I ND1 1 
ATOM   10589 C CD2 . HIS F  3  188 ? 120.467 14.278 49.437  1.00 22.30  ? 188  HIS I CD2 1 
ATOM   10590 C CE1 . HIS F  3  188 ? 120.746 15.390 51.306  1.00 22.16  ? 188  HIS I CE1 1 
ATOM   10591 N NE2 . HIS F  3  188 ? 121.387 14.787 50.322  1.00 22.28  ? 188  HIS I NE2 1 
ATOM   10592 N N   . VAL F  3  189 ? 116.711 17.116 50.090  1.00 24.00  ? 189  VAL I N   1 
ATOM   10593 C CA  . VAL F  3  189 ? 116.882 18.404 50.737  1.00 24.16  ? 189  VAL I CA  1 
ATOM   10594 C C   . VAL F  3  189 ? 117.109 18.207 52.224  1.00 24.28  ? 189  VAL I C   1 
ATOM   10595 O O   . VAL F  3  189 ? 116.523 17.320 52.825  1.00 24.02  ? 189  VAL I O   1 
ATOM   10596 C CB  . VAL F  3  189 ? 115.660 19.333 50.502  1.00 24.15  ? 189  VAL I CB  1 
ATOM   10597 C CG1 . VAL F  3  189 ? 115.436 19.576 49.002  1.00 23.75  ? 189  VAL I CG1 1 
ATOM   10598 C CG2 . VAL F  3  189 ? 114.432 18.727 51.082  1.00 24.88  ? 189  VAL I CG2 1 
ATOM   10599 N N   . THR F  3  190 ? 117.974 19.039 52.799  1.00 24.57  ? 190  THR I N   1 
ATOM   10600 C CA  . THR F  3  190 ? 118.264 19.005 54.227  1.00 24.74  ? 190  THR I CA  1 
ATOM   10601 C C   . THR F  3  190 ? 117.801 20.299 54.883  1.00 25.73  ? 190  THR I C   1 
ATOM   10602 O O   . THR F  3  190 ? 117.926 21.384 54.310  1.00 25.06  ? 190  THR I O   1 
ATOM   10603 C CB  . THR F  3  190 ? 119.768 18.845 54.502  1.00 24.43  ? 190  THR I CB  1 
ATOM   10604 O OG1 . THR F  3  190 ? 120.510 19.797 53.728  1.00 24.03  ? 190  THR I OG1 1 
ATOM   10605 C CG2 . THR F  3  190 ? 120.255 17.469 54.098  1.00 23.07  ? 190  THR I CG2 1 
ATOM   10606 N N   . HIS F  3  191 ? 117.288 20.169 56.102  1.00 26.95  ? 191  HIS I N   1 
ATOM   10607 C CA  . HIS F  3  191 ? 116.783 21.297 56.873  1.00 27.68  ? 191  HIS I CA  1 
ATOM   10608 C C   . HIS F  3  191 ? 117.896 21.693 57.825  1.00 28.41  ? 191  HIS I C   1 
ATOM   10609 O O   . HIS F  3  191 ? 118.564 20.821 58.371  1.00 28.42  ? 191  HIS I O   1 
ATOM   10610 C CB  . HIS F  3  191 ? 115.543 20.839 57.649  1.00 27.82  ? 191  HIS I CB  1 
ATOM   10611 C CG  . HIS F  3  191 ? 114.766 21.943 58.303  1.00 28.28  ? 191  HIS I CG  1 
ATOM   10612 N ND1 . HIS F  3  191 ? 115.282 22.727 59.313  1.00 29.38  ? 191  HIS I ND1 1 
ATOM   10613 C CD2 . HIS F  3  191 ? 113.490 22.358 58.122  1.00 27.10  ? 191  HIS I CD2 1 
ATOM   10614 C CE1 . HIS F  3  191 ? 114.363 23.588 59.713  1.00 29.13  ? 191  HIS I CE1 1 
ATOM   10615 N NE2 . HIS F  3  191 ? 113.267 23.385 59.006  1.00 28.13  ? 191  HIS I NE2 1 
ATOM   10616 N N   . HIS F  3  192 ? 118.104 22.992 58.023  1.00 29.32  ? 192  HIS I N   1 
ATOM   10617 C CA  . HIS F  3  192 ? 119.144 23.470 58.935  1.00 30.47  ? 192  HIS I CA  1 
ATOM   10618 C C   . HIS F  3  192 ? 118.665 24.634 59.791  1.00 32.05  ? 192  HIS I C   1 
ATOM   10619 O O   . HIS F  3  192 ? 118.277 25.683 59.269  1.00 32.42  ? 192  HIS I O   1 
ATOM   10620 C CB  . HIS F  3  192 ? 120.394 23.879 58.160  1.00 30.34  ? 192  HIS I CB  1 
ATOM   10621 C CG  . HIS F  3  192 ? 121.067 22.728 57.485  1.00 29.47  ? 192  HIS I CG  1 
ATOM   10622 N ND1 . HIS F  3  192 ? 120.851 22.412 56.164  1.00 28.45  ? 192  HIS I ND1 1 
ATOM   10623 C CD2 . HIS F  3  192 ? 121.911 21.786 57.965  1.00 28.83  ? 192  HIS I CD2 1 
ATOM   10624 C CE1 . HIS F  3  192 ? 121.543 21.330 55.856  1.00 28.17  ? 192  HIS I CE1 1 
ATOM   10625 N NE2 . HIS F  3  192 ? 122.195 20.931 56.931  1.00 27.61  ? 192  HIS I NE2 1 
ATOM   10626 N N   . SER F  3  193 ? 118.713 24.443 61.109  1.00 33.54  ? 193  SER I N   1 
ATOM   10627 C CA  . SER F  3  193 ? 118.259 25.451 62.057  1.00 34.75  ? 193  SER I CA  1 
ATOM   10628 C C   . SER F  3  193 ? 119.114 26.693 62.016  1.00 36.37  ? 193  SER I C   1 
ATOM   10629 O O   . SER F  3  193 ? 120.319 26.633 61.801  1.00 36.84  ? 193  SER I O   1 
ATOM   10630 C CB  . SER F  3  193 ? 118.240 24.888 63.471  1.00 34.55  ? 193  SER I CB  1 
ATOM   10631 O OG  . SER F  3  193 ? 117.310 23.828 63.557  1.00 33.67  ? 193  SER I OG  1 
ATOM   10632 N N   . ARG F  3  194 ? 118.470 27.825 62.234  1.00 38.34  ? 194  ARG I N   1 
ATOM   10633 C CA  . ARG F  3  194 ? 119.146 29.103 62.202  1.00 40.13  ? 194  ARG I CA  1 
ATOM   10634 C C   . ARG F  3  194 ? 118.484 30.036 63.216  1.00 40.20  ? 194  ARG I C   1 
ATOM   10635 O O   . ARG F  3  194 ? 117.355 29.792 63.630  1.00 40.22  ? 194  ARG I O   1 
ATOM   10636 C CB  . ARG F  3  194 ? 119.047 29.674 60.789  1.00 41.00  ? 194  ARG I CB  1 
ATOM   10637 C CG  . ARG F  3  194 ? 119.544 31.084 60.657  1.00 44.69  ? 194  ARG I CG  1 
ATOM   10638 C CD  . ARG F  3  194 ? 119.465 31.627 59.256  1.00 49.05  ? 194  ARG I CD  1 
ATOM   10639 N NE  . ARG F  3  194 ? 120.353 32.778 59.100  1.00 52.90  ? 194  ARG I NE  1 
ATOM   10640 C CZ  . ARG F  3  194 ? 120.460 33.502 57.994  1.00 56.00  ? 194  ARG I CZ  1 
ATOM   10641 N NH1 . ARG F  3  194 ? 119.730 33.202 56.939  1.00 57.31  ? 194  ARG I NH1 1 
ATOM   10642 N NH2 . ARG F  3  194 ? 121.305 34.523 57.935  1.00 57.16  ? 194  ARG I NH2 1 
ATOM   10643 N N   . PRO F  3  195 ? 119.180 31.080 63.658  1.00 40.72  ? 195  PRO I N   1 
ATOM   10644 C CA  . PRO F  3  195 ? 118.574 32.012 64.608  1.00 40.96  ? 195  PRO I CA  1 
ATOM   10645 C C   . PRO F  3  195 ? 117.355 32.734 64.029  1.00 40.98  ? 195  PRO I C   1 
ATOM   10646 O O   . PRO F  3  195 ? 116.948 32.466 62.901  1.00 41.10  ? 195  PRO I O   1 
ATOM   10647 C CB  . PRO F  3  195 ? 119.720 32.985 64.910  1.00 41.07  ? 195  PRO I CB  1 
ATOM   10648 C CG  . PRO F  3  195 ? 120.601 32.887 63.702  1.00 41.07  ? 195  PRO I CG  1 
ATOM   10649 C CD  . PRO F  3  195 ? 120.596 31.420 63.417  1.00 40.77  ? 195  PRO I CD  1 
ATOM   10650 N N   . GLU F  3  196 ? 116.770 33.626 64.821  1.00 40.85  ? 196  GLU I N   1 
ATOM   10651 C CA  . GLU F  3  196 ? 115.603 34.401 64.409  1.00 40.62  ? 196  GLU I CA  1 
ATOM   10652 C C   . GLU F  3  196 ? 114.470 33.563 63.812  1.00 39.74  ? 196  GLU I C   1 
ATOM   10653 O O   . GLU F  3  196 ? 113.752 34.032 62.934  1.00 39.51  ? 196  GLU I O   1 
ATOM   10654 C CB  . GLU F  3  196 ? 116.014 35.477 63.399  1.00 41.17  ? 196  GLU I CB  1 
ATOM   10655 C CG  . GLU F  3  196 ? 117.383 36.095 63.630  1.00 42.44  ? 196  GLU I CG  1 
ATOM   10656 C CD  . GLU F  3  196 ? 117.561 36.684 65.016  1.00 43.90  ? 196  GLU I CD  1 
ATOM   10657 O OE1 . GLU F  3  196 ? 118.691 37.119 65.314  1.00 44.62  ? 196  GLU I OE1 1 
ATOM   10658 O OE2 . GLU F  3  196 ? 116.589 36.717 65.805  1.00 45.06  ? 196  GLU I OE2 1 
ATOM   10659 N N   . ASP F  3  197 ? 114.305 32.331 64.277  1.00 38.66  ? 197  ASP I N   1 
ATOM   10660 C CA  . ASP F  3  197 ? 113.227 31.490 63.775  1.00 37.91  ? 197  ASP I CA  1 
ATOM   10661 C C   . ASP F  3  197 ? 113.347 31.243 62.278  1.00 36.54  ? 197  ASP I C   1 
ATOM   10662 O O   . ASP F  3  197 ? 112.344 31.174 61.572  1.00 36.49  ? 197  ASP I O   1 
ATOM   10663 C CB  . ASP F  3  197 ? 111.883 32.152 64.058  1.00 38.57  ? 197  ASP I CB  1 
ATOM   10664 C CG  . ASP F  3  197 ? 111.651 32.375 65.523  1.00 40.03  ? 197  ASP I CG  1 
ATOM   10665 O OD1 . ASP F  3  197 ? 111.317 31.395 66.222  1.00 42.07  ? 197  ASP I OD1 1 
ATOM   10666 O OD2 . ASP F  3  197 ? 111.790 33.501 66.047  1.00 41.66  ? 197  ASP I OD2 1 
ATOM   10667 N N   . LYS F  3  198 ? 114.571 31.121 61.787  1.00 35.01  ? 198  LYS I N   1 
ATOM   10668 C CA  . LYS F  3  198 ? 114.787 30.863 60.369  1.00 33.39  ? 198  LYS I