data_1MWH
# 
_entry.id   1MWH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1MWH         
RCSB  RCSB017247   
WWPDB D_1000017247 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1MUK 
_pdbx_database_related.details        '1muk is the native structure of lambda3' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        1MWH 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2002-09-29 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tao, Y.'        1 
'Farsetta, D.L.' 2 
'Nibert, M.L.'   3 
'Harrison, S.C.' 4 
# 
_citation.id                        primary 
_citation.title                     'RNA Synthesis in a Cage-Structural Studies of Reovirus Polymerase lambda3' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            111 
_citation.page_first                733 
_citation.page_last                 745 
_citation.year                      2002 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12464184 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(02)01110-8' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tao, Y.'        1 
primary 'Farsetta, D.L.' 2 
primary 'Nibert, M.L.'   3 
primary 'Harrison, S.C.' 4 
# 
_cell.entry_id           1MWH 
_cell.length_a           70.891 
_cell.length_b           84.944 
_cell.length_c           249.246 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
# 
_symmetry.entry_id                         1MWH 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'MINOR CORE PROTEIN LAMBDA 3'                     142423.797 1   ? ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'                              54.938     1   ? ? ? ? 
3 non-polymer syn "7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE" 803.440    1   ? ? ? ? 
4 water       nat water                                             18.015     671 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSSMILTQFGPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMLPIPPTIYTKPSHDSYYYIDALNR
VRRKTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIENRAKDGDSQARIATTYGRIAESQARQIKAPLEKFVLALLV
AEAGGSLYDPVLQKYDEIPDLSHNCPLWCFREICRHISGPLPDRAPYLYLSAGVFWLMSPRMTSAIPPLLSDLVNLAILQ
QTAGLDPSLVKLGVQICLHAAASSSYSWFILKTKSIFPQNTLHSMYESLEGGYCPNLEWLEPRSDYKFMYMGVMPLSAKY
ARSAPSNDKKARELGEKYGLSSVVGELRKRTKTYVKHDFASVRYIRDAMACTSGIFLVRTPTETVLQEYTQSPEIKVPIP
QKDWTGPIGEIRILKDTTSSIARYLYRTWYLAAARMAAQPRTWDPLFQAIMRSQYVTARGGSGAALRESLYAINVSLPDF
KGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSAPHTLTADYINYHMNLSPTSG
SAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLSVIMAAIHEGVASSSIGKPFMGVPASIVNDESVVGVRAARP
ISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWGPEHTDDPDVLRLM
KSLTIQRNYVCQGDDGLMIIDGTTAGKVNSETIQNDLELISKYGEEFGWKYDIAYDGTAEYLKLYFIFGCRIPNLSRHPI
VGKERANSSAEEPWPAILDQIMGVFFNGVHDGLQWQRWIRYSWALCCAFSRQRTMIGESVGYLQYPMWSFVYWGLPLVKA
FGSDPWIFSWYMPTGDLGMYSWISLIRPLMTRWMVANGYVTDRCSTVFGNADYRRCFNELKLYQGYYMAQLPRNPKKSGR
AASREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHNPPSLFDVPHKWYQGAQEAAIATREELAEMDETLMR
ARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPMLQSTRKYFAQTLFMAKTVSGLD
VNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLL
PKDGRHLNTDIPPRMGWLRAILRFLGAGMVMTATGVAVDIYLEDIHGGGRSLGQRFMTWMRQEGRSA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSSMILTQFGPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMLPIPPTIYTKPSHDSYYYIDALNR
VRRKTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIENRAKDGDSQARIATTYGRIAESQARQIKAPLEKFVLALLV
AEAGGSLYDPVLQKYDEIPDLSHNCPLWCFREICRHISGPLPDRAPYLYLSAGVFWLMSPRMTSAIPPLLSDLVNLAILQ
QTAGLDPSLVKLGVQICLHAAASSSYSWFILKTKSIFPQNTLHSMYESLEGGYCPNLEWLEPRSDYKFMYMGVMPLSAKY
ARSAPSNDKKARELGEKYGLSSVVGELRKRTKTYVKHDFASVRYIRDAMACTSGIFLVRTPTETVLQEYTQSPEIKVPIP
QKDWTGPIGEIRILKDTTSSIARYLYRTWYLAAARMAAQPRTWDPLFQAIMRSQYVTARGGSGAALRESLYAINVSLPDF
KGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSAPHTLTADYINYHMNLSPTSG
SAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLSVIMAAIHEGVASSSIGKPFMGVPASIVNDESVVGVRAARP
ISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWGPEHTDDPDVLRLM
KSLTIQRNYVCQGDDGLMIIDGTTAGKVNSETIQNDLELISKYGEEFGWKYDIAYDGTAEYLKLYFIFGCRIPNLSRHPI
VGKERANSSAEEPWPAILDQIMGVFFNGVHDGLQWQRWIRYSWALCCAFSRQRTMIGESVGYLQYPMWSFVYWGLPLVKA
FGSDPWIFSWYMPTGDLGMYSWISLIRPLMTRWMVANGYVTDRCSTVFGNADYRRCFNELKLYQGYYMAQLPRNPKKSGR
AASREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHNPPSLFDVPHKWYQGAQEAAIATREELAEMDETLMR
ARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPMLQSTRKYFAQTLFMAKTVSGLD
VNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLL
PKDGRHLNTDIPPRMGWLRAILRFLGAGMVMTATGVAVDIYLEDIHGGGRSLGQRFMTWMRQEGRSA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    SER n 
1 3    SER n 
1 4    MET n 
1 5    ILE n 
1 6    LEU n 
1 7    THR n 
1 8    GLN n 
1 9    PHE n 
1 10   GLY n 
1 11   PRO n 
1 12   PHE n 
1 13   ILE n 
1 14   GLU n 
1 15   SER n 
1 16   ILE n 
1 17   SER n 
1 18   GLY n 
1 19   ILE n 
1 20   THR n 
1 21   ASP n 
1 22   GLN n 
1 23   SER n 
1 24   ASN n 
1 25   ASP n 
1 26   VAL n 
1 27   PHE n 
1 28   GLU n 
1 29   ASP n 
1 30   ALA n 
1 31   ALA n 
1 32   LYS n 
1 33   ALA n 
1 34   PHE n 
1 35   SER n 
1 36   MET n 
1 37   PHE n 
1 38   THR n 
1 39   ARG n 
1 40   SER n 
1 41   ASP n 
1 42   VAL n 
1 43   TYR n 
1 44   LYS n 
1 45   ALA n 
1 46   LEU n 
1 47   ASP n 
1 48   GLU n 
1 49   ILE n 
1 50   PRO n 
1 51   PHE n 
1 52   SER n 
1 53   ASP n 
1 54   ASP n 
1 55   ALA n 
1 56   MET n 
1 57   LEU n 
1 58   PRO n 
1 59   ILE n 
1 60   PRO n 
1 61   PRO n 
1 62   THR n 
1 63   ILE n 
1 64   TYR n 
1 65   THR n 
1 66   LYS n 
1 67   PRO n 
1 68   SER n 
1 69   HIS n 
1 70   ASP n 
1 71   SER n 
1 72   TYR n 
1 73   TYR n 
1 74   TYR n 
1 75   ILE n 
1 76   ASP n 
1 77   ALA n 
1 78   LEU n 
1 79   ASN n 
1 80   ARG n 
1 81   VAL n 
1 82   ARG n 
1 83   ARG n 
1 84   LYS n 
1 85   THR n 
1 86   TYR n 
1 87   GLN n 
1 88   GLY n 
1 89   PRO n 
1 90   ASP n 
1 91   ASP n 
1 92   VAL n 
1 93   TYR n 
1 94   VAL n 
1 95   PRO n 
1 96   ASN n 
1 97   CYS n 
1 98   SER n 
1 99   ILE n 
1 100  VAL n 
1 101  GLU n 
1 102  LEU n 
1 103  LEU n 
1 104  GLU n 
1 105  PRO n 
1 106  HIS n 
1 107  GLU n 
1 108  THR n 
1 109  LEU n 
1 110  THR n 
1 111  SER n 
1 112  TYR n 
1 113  GLY n 
1 114  ARG n 
1 115  LEU n 
1 116  SER n 
1 117  GLU n 
1 118  ALA n 
1 119  ILE n 
1 120  GLU n 
1 121  ASN n 
1 122  ARG n 
1 123  ALA n 
1 124  LYS n 
1 125  ASP n 
1 126  GLY n 
1 127  ASP n 
1 128  SER n 
1 129  GLN n 
1 130  ALA n 
1 131  ARG n 
1 132  ILE n 
1 133  ALA n 
1 134  THR n 
1 135  THR n 
1 136  TYR n 
1 137  GLY n 
1 138  ARG n 
1 139  ILE n 
1 140  ALA n 
1 141  GLU n 
1 142  SER n 
1 143  GLN n 
1 144  ALA n 
1 145  ARG n 
1 146  GLN n 
1 147  ILE n 
1 148  LYS n 
1 149  ALA n 
1 150  PRO n 
1 151  LEU n 
1 152  GLU n 
1 153  LYS n 
1 154  PHE n 
1 155  VAL n 
1 156  LEU n 
1 157  ALA n 
1 158  LEU n 
1 159  LEU n 
1 160  VAL n 
1 161  ALA n 
1 162  GLU n 
1 163  ALA n 
1 164  GLY n 
1 165  GLY n 
1 166  SER n 
1 167  LEU n 
1 168  TYR n 
1 169  ASP n 
1 170  PRO n 
1 171  VAL n 
1 172  LEU n 
1 173  GLN n 
1 174  LYS n 
1 175  TYR n 
1 176  ASP n 
1 177  GLU n 
1 178  ILE n 
1 179  PRO n 
1 180  ASP n 
1 181  LEU n 
1 182  SER n 
1 183  HIS n 
1 184  ASN n 
1 185  CYS n 
1 186  PRO n 
1 187  LEU n 
1 188  TRP n 
1 189  CYS n 
1 190  PHE n 
1 191  ARG n 
1 192  GLU n 
1 193  ILE n 
1 194  CYS n 
1 195  ARG n 
1 196  HIS n 
1 197  ILE n 
1 198  SER n 
1 199  GLY n 
1 200  PRO n 
1 201  LEU n 
1 202  PRO n 
1 203  ASP n 
1 204  ARG n 
1 205  ALA n 
1 206  PRO n 
1 207  TYR n 
1 208  LEU n 
1 209  TYR n 
1 210  LEU n 
1 211  SER n 
1 212  ALA n 
1 213  GLY n 
1 214  VAL n 
1 215  PHE n 
1 216  TRP n 
1 217  LEU n 
1 218  MET n 
1 219  SER n 
1 220  PRO n 
1 221  ARG n 
1 222  MET n 
1 223  THR n 
1 224  SER n 
1 225  ALA n 
1 226  ILE n 
1 227  PRO n 
1 228  PRO n 
1 229  LEU n 
1 230  LEU n 
1 231  SER n 
1 232  ASP n 
1 233  LEU n 
1 234  VAL n 
1 235  ASN n 
1 236  LEU n 
1 237  ALA n 
1 238  ILE n 
1 239  LEU n 
1 240  GLN n 
1 241  GLN n 
1 242  THR n 
1 243  ALA n 
1 244  GLY n 
1 245  LEU n 
1 246  ASP n 
1 247  PRO n 
1 248  SER n 
1 249  LEU n 
1 250  VAL n 
1 251  LYS n 
1 252  LEU n 
1 253  GLY n 
1 254  VAL n 
1 255  GLN n 
1 256  ILE n 
1 257  CYS n 
1 258  LEU n 
1 259  HIS n 
1 260  ALA n 
1 261  ALA n 
1 262  ALA n 
1 263  SER n 
1 264  SER n 
1 265  SER n 
1 266  TYR n 
1 267  SER n 
1 268  TRP n 
1 269  PHE n 
1 270  ILE n 
1 271  LEU n 
1 272  LYS n 
1 273  THR n 
1 274  LYS n 
1 275  SER n 
1 276  ILE n 
1 277  PHE n 
1 278  PRO n 
1 279  GLN n 
1 280  ASN n 
1 281  THR n 
1 282  LEU n 
1 283  HIS n 
1 284  SER n 
1 285  MET n 
1 286  TYR n 
1 287  GLU n 
1 288  SER n 
1 289  LEU n 
1 290  GLU n 
1 291  GLY n 
1 292  GLY n 
1 293  TYR n 
1 294  CYS n 
1 295  PRO n 
1 296  ASN n 
1 297  LEU n 
1 298  GLU n 
1 299  TRP n 
1 300  LEU n 
1 301  GLU n 
1 302  PRO n 
1 303  ARG n 
1 304  SER n 
1 305  ASP n 
1 306  TYR n 
1 307  LYS n 
1 308  PHE n 
1 309  MET n 
1 310  TYR n 
1 311  MET n 
1 312  GLY n 
1 313  VAL n 
1 314  MET n 
1 315  PRO n 
1 316  LEU n 
1 317  SER n 
1 318  ALA n 
1 319  LYS n 
1 320  TYR n 
1 321  ALA n 
1 322  ARG n 
1 323  SER n 
1 324  ALA n 
1 325  PRO n 
1 326  SER n 
1 327  ASN n 
1 328  ASP n 
1 329  LYS n 
1 330  LYS n 
1 331  ALA n 
1 332  ARG n 
1 333  GLU n 
1 334  LEU n 
1 335  GLY n 
1 336  GLU n 
1 337  LYS n 
1 338  TYR n 
1 339  GLY n 
1 340  LEU n 
1 341  SER n 
1 342  SER n 
1 343  VAL n 
1 344  VAL n 
1 345  GLY n 
1 346  GLU n 
1 347  LEU n 
1 348  ARG n 
1 349  LYS n 
1 350  ARG n 
1 351  THR n 
1 352  LYS n 
1 353  THR n 
1 354  TYR n 
1 355  VAL n 
1 356  LYS n 
1 357  HIS n 
1 358  ASP n 
1 359  PHE n 
1 360  ALA n 
1 361  SER n 
1 362  VAL n 
1 363  ARG n 
1 364  TYR n 
1 365  ILE n 
1 366  ARG n 
1 367  ASP n 
1 368  ALA n 
1 369  MET n 
1 370  ALA n 
1 371  CYS n 
1 372  THR n 
1 373  SER n 
1 374  GLY n 
1 375  ILE n 
1 376  PHE n 
1 377  LEU n 
1 378  VAL n 
1 379  ARG n 
1 380  THR n 
1 381  PRO n 
1 382  THR n 
1 383  GLU n 
1 384  THR n 
1 385  VAL n 
1 386  LEU n 
1 387  GLN n 
1 388  GLU n 
1 389  TYR n 
1 390  THR n 
1 391  GLN n 
1 392  SER n 
1 393  PRO n 
1 394  GLU n 
1 395  ILE n 
1 396  LYS n 
1 397  VAL n 
1 398  PRO n 
1 399  ILE n 
1 400  PRO n 
1 401  GLN n 
1 402  LYS n 
1 403  ASP n 
1 404  TRP n 
1 405  THR n 
1 406  GLY n 
1 407  PRO n 
1 408  ILE n 
1 409  GLY n 
1 410  GLU n 
1 411  ILE n 
1 412  ARG n 
1 413  ILE n 
1 414  LEU n 
1 415  LYS n 
1 416  ASP n 
1 417  THR n 
1 418  THR n 
1 419  SER n 
1 420  SER n 
1 421  ILE n 
1 422  ALA n 
1 423  ARG n 
1 424  TYR n 
1 425  LEU n 
1 426  TYR n 
1 427  ARG n 
1 428  THR n 
1 429  TRP n 
1 430  TYR n 
1 431  LEU n 
1 432  ALA n 
1 433  ALA n 
1 434  ALA n 
1 435  ARG n 
1 436  MET n 
1 437  ALA n 
1 438  ALA n 
1 439  GLN n 
1 440  PRO n 
1 441  ARG n 
1 442  THR n 
1 443  TRP n 
1 444  ASP n 
1 445  PRO n 
1 446  LEU n 
1 447  PHE n 
1 448  GLN n 
1 449  ALA n 
1 450  ILE n 
1 451  MET n 
1 452  ARG n 
1 453  SER n 
1 454  GLN n 
1 455  TYR n 
1 456  VAL n 
1 457  THR n 
1 458  ALA n 
1 459  ARG n 
1 460  GLY n 
1 461  GLY n 
1 462  SER n 
1 463  GLY n 
1 464  ALA n 
1 465  ALA n 
1 466  LEU n 
1 467  ARG n 
1 468  GLU n 
1 469  SER n 
1 470  LEU n 
1 471  TYR n 
1 472  ALA n 
1 473  ILE n 
1 474  ASN n 
1 475  VAL n 
1 476  SER n 
1 477  LEU n 
1 478  PRO n 
1 479  ASP n 
1 480  PHE n 
1 481  LYS n 
1 482  GLY n 
1 483  LEU n 
1 484  PRO n 
1 485  VAL n 
1 486  LYS n 
1 487  ALA n 
1 488  ALA n 
1 489  THR n 
1 490  LYS n 
1 491  ILE n 
1 492  PHE n 
1 493  GLN n 
1 494  ALA n 
1 495  ALA n 
1 496  GLN n 
1 497  LEU n 
1 498  ALA n 
1 499  ASN n 
1 500  LEU n 
1 501  PRO n 
1 502  PHE n 
1 503  SER n 
1 504  HIS n 
1 505  THR n 
1 506  SER n 
1 507  VAL n 
1 508  ALA n 
1 509  ILE n 
1 510  LEU n 
1 511  ALA n 
1 512  ASP n 
1 513  THR n 
1 514  SER n 
1 515  MET n 
1 516  GLY n 
1 517  LEU n 
1 518  ARG n 
1 519  ASN n 
1 520  GLN n 
1 521  VAL n 
1 522  GLN n 
1 523  ARG n 
1 524  ARG n 
1 525  PRO n 
1 526  ARG n 
1 527  SER n 
1 528  ILE n 
1 529  MET n 
1 530  PRO n 
1 531  LEU n 
1 532  ASN n 
1 533  VAL n 
1 534  PRO n 
1 535  GLN n 
1 536  GLN n 
1 537  GLN n 
1 538  VAL n 
1 539  SER n 
1 540  ALA n 
1 541  PRO n 
1 542  HIS n 
1 543  THR n 
1 544  LEU n 
1 545  THR n 
1 546  ALA n 
1 547  ASP n 
1 548  TYR n 
1 549  ILE n 
1 550  ASN n 
1 551  TYR n 
1 552  HIS n 
1 553  MET n 
1 554  ASN n 
1 555  LEU n 
1 556  SER n 
1 557  PRO n 
1 558  THR n 
1 559  SER n 
1 560  GLY n 
1 561  SER n 
1 562  ALA n 
1 563  VAL n 
1 564  ILE n 
1 565  GLU n 
1 566  LYS n 
1 567  VAL n 
1 568  ILE n 
1 569  PRO n 
1 570  LEU n 
1 571  GLY n 
1 572  VAL n 
1 573  TYR n 
1 574  ALA n 
1 575  SER n 
1 576  SER n 
1 577  PRO n 
1 578  PRO n 
1 579  ASN n 
1 580  GLN n 
1 581  SER n 
1 582  ILE n 
1 583  ASN n 
1 584  ILE n 
1 585  ASP n 
1 586  ILE n 
1 587  SER n 
1 588  ALA n 
1 589  CYS n 
1 590  ASP n 
1 591  ALA n 
1 592  SER n 
1 593  ILE n 
1 594  THR n 
1 595  TRP n 
1 596  ASP n 
1 597  PHE n 
1 598  PHE n 
1 599  LEU n 
1 600  SER n 
1 601  VAL n 
1 602  ILE n 
1 603  MET n 
1 604  ALA n 
1 605  ALA n 
1 606  ILE n 
1 607  HIS n 
1 608  GLU n 
1 609  GLY n 
1 610  VAL n 
1 611  ALA n 
1 612  SER n 
1 613  SER n 
1 614  SER n 
1 615  ILE n 
1 616  GLY n 
1 617  LYS n 
1 618  PRO n 
1 619  PHE n 
1 620  MET n 
1 621  GLY n 
1 622  VAL n 
1 623  PRO n 
1 624  ALA n 
1 625  SER n 
1 626  ILE n 
1 627  VAL n 
1 628  ASN n 
1 629  ASP n 
1 630  GLU n 
1 631  SER n 
1 632  VAL n 
1 633  VAL n 
1 634  GLY n 
1 635  VAL n 
1 636  ARG n 
1 637  ALA n 
1 638  ALA n 
1 639  ARG n 
1 640  PRO n 
1 641  ILE n 
1 642  SER n 
1 643  GLY n 
1 644  MET n 
1 645  GLN n 
1 646  ASN n 
1 647  MET n 
1 648  ILE n 
1 649  GLN n 
1 650  HIS n 
1 651  LEU n 
1 652  SER n 
1 653  LYS n 
1 654  LEU n 
1 655  TYR n 
1 656  LYS n 
1 657  ARG n 
1 658  GLY n 
1 659  PHE n 
1 660  SER n 
1 661  TYR n 
1 662  ARG n 
1 663  VAL n 
1 664  ASN n 
1 665  ASP n 
1 666  SER n 
1 667  PHE n 
1 668  SER n 
1 669  PRO n 
1 670  GLY n 
1 671  ASN n 
1 672  ASP n 
1 673  PHE n 
1 674  THR n 
1 675  HIS n 
1 676  MET n 
1 677  THR n 
1 678  THR n 
1 679  THR n 
1 680  PHE n 
1 681  PRO n 
1 682  SER n 
1 683  GLY n 
1 684  SER n 
1 685  THR n 
1 686  ALA n 
1 687  THR n 
1 688  SER n 
1 689  THR n 
1 690  GLU n 
1 691  HIS n 
1 692  THR n 
1 693  ALA n 
1 694  ASN n 
1 695  ASN n 
1 696  SER n 
1 697  THR n 
1 698  MET n 
1 699  MET n 
1 700  GLU n 
1 701  THR n 
1 702  PHE n 
1 703  LEU n 
1 704  THR n 
1 705  VAL n 
1 706  TRP n 
1 707  GLY n 
1 708  PRO n 
1 709  GLU n 
1 710  HIS n 
1 711  THR n 
1 712  ASP n 
1 713  ASP n 
1 714  PRO n 
1 715  ASP n 
1 716  VAL n 
1 717  LEU n 
1 718  ARG n 
1 719  LEU n 
1 720  MET n 
1 721  LYS n 
1 722  SER n 
1 723  LEU n 
1 724  THR n 
1 725  ILE n 
1 726  GLN n 
1 727  ARG n 
1 728  ASN n 
1 729  TYR n 
1 730  VAL n 
1 731  CYS n 
1 732  GLN n 
1 733  GLY n 
1 734  ASP n 
1 735  ASP n 
1 736  GLY n 
1 737  LEU n 
1 738  MET n 
1 739  ILE n 
1 740  ILE n 
1 741  ASP n 
1 742  GLY n 
1 743  THR n 
1 744  THR n 
1 745  ALA n 
1 746  GLY n 
1 747  LYS n 
1 748  VAL n 
1 749  ASN n 
1 750  SER n 
1 751  GLU n 
1 752  THR n 
1 753  ILE n 
1 754  GLN n 
1 755  ASN n 
1 756  ASP n 
1 757  LEU n 
1 758  GLU n 
1 759  LEU n 
1 760  ILE n 
1 761  SER n 
1 762  LYS n 
1 763  TYR n 
1 764  GLY n 
1 765  GLU n 
1 766  GLU n 
1 767  PHE n 
1 768  GLY n 
1 769  TRP n 
1 770  LYS n 
1 771  TYR n 
1 772  ASP n 
1 773  ILE n 
1 774  ALA n 
1 775  TYR n 
1 776  ASP n 
1 777  GLY n 
1 778  THR n 
1 779  ALA n 
1 780  GLU n 
1 781  TYR n 
1 782  LEU n 
1 783  LYS n 
1 784  LEU n 
1 785  TYR n 
1 786  PHE n 
1 787  ILE n 
1 788  PHE n 
1 789  GLY n 
1 790  CYS n 
1 791  ARG n 
1 792  ILE n 
1 793  PRO n 
1 794  ASN n 
1 795  LEU n 
1 796  SER n 
1 797  ARG n 
1 798  HIS n 
1 799  PRO n 
1 800  ILE n 
1 801  VAL n 
1 802  GLY n 
1 803  LYS n 
1 804  GLU n 
1 805  ARG n 
1 806  ALA n 
1 807  ASN n 
1 808  SER n 
1 809  SER n 
1 810  ALA n 
1 811  GLU n 
1 812  GLU n 
1 813  PRO n 
1 814  TRP n 
1 815  PRO n 
1 816  ALA n 
1 817  ILE n 
1 818  LEU n 
1 819  ASP n 
1 820  GLN n 
1 821  ILE n 
1 822  MET n 
1 823  GLY n 
1 824  VAL n 
1 825  PHE n 
1 826  PHE n 
1 827  ASN n 
1 828  GLY n 
1 829  VAL n 
1 830  HIS n 
1 831  ASP n 
1 832  GLY n 
1 833  LEU n 
1 834  GLN n 
1 835  TRP n 
1 836  GLN n 
1 837  ARG n 
1 838  TRP n 
1 839  ILE n 
1 840  ARG n 
1 841  TYR n 
1 842  SER n 
1 843  TRP n 
1 844  ALA n 
1 845  LEU n 
1 846  CYS n 
1 847  CYS n 
1 848  ALA n 
1 849  PHE n 
1 850  SER n 
1 851  ARG n 
1 852  GLN n 
1 853  ARG n 
1 854  THR n 
1 855  MET n 
1 856  ILE n 
1 857  GLY n 
1 858  GLU n 
1 859  SER n 
1 860  VAL n 
1 861  GLY n 
1 862  TYR n 
1 863  LEU n 
1 864  GLN n 
1 865  TYR n 
1 866  PRO n 
1 867  MET n 
1 868  TRP n 
1 869  SER n 
1 870  PHE n 
1 871  VAL n 
1 872  TYR n 
1 873  TRP n 
1 874  GLY n 
1 875  LEU n 
1 876  PRO n 
1 877  LEU n 
1 878  VAL n 
1 879  LYS n 
1 880  ALA n 
1 881  PHE n 
1 882  GLY n 
1 883  SER n 
1 884  ASP n 
1 885  PRO n 
1 886  TRP n 
1 887  ILE n 
1 888  PHE n 
1 889  SER n 
1 890  TRP n 
1 891  TYR n 
1 892  MET n 
1 893  PRO n 
1 894  THR n 
1 895  GLY n 
1 896  ASP n 
1 897  LEU n 
1 898  GLY n 
1 899  MET n 
1 900  TYR n 
1 901  SER n 
1 902  TRP n 
1 903  ILE n 
1 904  SER n 
1 905  LEU n 
1 906  ILE n 
1 907  ARG n 
1 908  PRO n 
1 909  LEU n 
1 910  MET n 
1 911  THR n 
1 912  ARG n 
1 913  TRP n 
1 914  MET n 
1 915  VAL n 
1 916  ALA n 
1 917  ASN n 
1 918  GLY n 
1 919  TYR n 
1 920  VAL n 
1 921  THR n 
1 922  ASP n 
1 923  ARG n 
1 924  CYS n 
1 925  SER n 
1 926  THR n 
1 927  VAL n 
1 928  PHE n 
1 929  GLY n 
1 930  ASN n 
1 931  ALA n 
1 932  ASP n 
1 933  TYR n 
1 934  ARG n 
1 935  ARG n 
1 936  CYS n 
1 937  PHE n 
1 938  ASN n 
1 939  GLU n 
1 940  LEU n 
1 941  LYS n 
1 942  LEU n 
1 943  TYR n 
1 944  GLN n 
1 945  GLY n 
1 946  TYR n 
1 947  TYR n 
1 948  MET n 
1 949  ALA n 
1 950  GLN n 
1 951  LEU n 
1 952  PRO n 
1 953  ARG n 
1 954  ASN n 
1 955  PRO n 
1 956  LYS n 
1 957  LYS n 
1 958  SER n 
1 959  GLY n 
1 960  ARG n 
1 961  ALA n 
1 962  ALA n 
1 963  SER n 
1 964  ARG n 
1 965  GLU n 
1 966  VAL n 
1 967  ARG n 
1 968  GLU n 
1 969  GLN n 
1 970  PHE n 
1 971  THR n 
1 972  GLN n 
1 973  ALA n 
1 974  LEU n 
1 975  SER n 
1 976  ASP n 
1 977  TYR n 
1 978  LEU n 
1 979  MET n 
1 980  GLN n 
1 981  ASN n 
1 982  PRO n 
1 983  GLU n 
1 984  LEU n 
1 985  LYS n 
1 986  SER n 
1 987  ARG n 
1 988  VAL n 
1 989  LEU n 
1 990  ARG n 
1 991  GLY n 
1 992  ARG n 
1 993  SER n 
1 994  GLU n 
1 995  TRP n 
1 996  GLU n 
1 997  LYS n 
1 998  TYR n 
1 999  GLY n 
1 1000 ALA n 
1 1001 GLY n 
1 1002 ILE n 
1 1003 ILE n 
1 1004 HIS n 
1 1005 ASN n 
1 1006 PRO n 
1 1007 PRO n 
1 1008 SER n 
1 1009 LEU n 
1 1010 PHE n 
1 1011 ASP n 
1 1012 VAL n 
1 1013 PRO n 
1 1014 HIS n 
1 1015 LYS n 
1 1016 TRP n 
1 1017 TYR n 
1 1018 GLN n 
1 1019 GLY n 
1 1020 ALA n 
1 1021 GLN n 
1 1022 GLU n 
1 1023 ALA n 
1 1024 ALA n 
1 1025 ILE n 
1 1026 ALA n 
1 1027 THR n 
1 1028 ARG n 
1 1029 GLU n 
1 1030 GLU n 
1 1031 LEU n 
1 1032 ALA n 
1 1033 GLU n 
1 1034 MET n 
1 1035 ASP n 
1 1036 GLU n 
1 1037 THR n 
1 1038 LEU n 
1 1039 MET n 
1 1040 ARG n 
1 1041 ALA n 
1 1042 ARG n 
1 1043 ARG n 
1 1044 HIS n 
1 1045 SER n 
1 1046 TYR n 
1 1047 SER n 
1 1048 SER n 
1 1049 PHE n 
1 1050 SER n 
1 1051 LYS n 
1 1052 LEU n 
1 1053 LEU n 
1 1054 GLU n 
1 1055 ALA n 
1 1056 TYR n 
1 1057 LEU n 
1 1058 LEU n 
1 1059 VAL n 
1 1060 LYS n 
1 1061 TRP n 
1 1062 ARG n 
1 1063 MET n 
1 1064 CYS n 
1 1065 GLU n 
1 1066 ALA n 
1 1067 ARG n 
1 1068 GLU n 
1 1069 PRO n 
1 1070 SER n 
1 1071 VAL n 
1 1072 ASP n 
1 1073 LEU n 
1 1074 ARG n 
1 1075 LEU n 
1 1076 PRO n 
1 1077 LEU n 
1 1078 CYS n 
1 1079 ALA n 
1 1080 GLY n 
1 1081 ILE n 
1 1082 ASP n 
1 1083 PRO n 
1 1084 LEU n 
1 1085 ASN n 
1 1086 SER n 
1 1087 ASP n 
1 1088 PRO n 
1 1089 PHE n 
1 1090 LEU n 
1 1091 LYS n 
1 1092 MET n 
1 1093 VAL n 
1 1094 SER n 
1 1095 VAL n 
1 1096 GLY n 
1 1097 PRO n 
1 1098 MET n 
1 1099 LEU n 
1 1100 GLN n 
1 1101 SER n 
1 1102 THR n 
1 1103 ARG n 
1 1104 LYS n 
1 1105 TYR n 
1 1106 PHE n 
1 1107 ALA n 
1 1108 GLN n 
1 1109 THR n 
1 1110 LEU n 
1 1111 PHE n 
1 1112 MET n 
1 1113 ALA n 
1 1114 LYS n 
1 1115 THR n 
1 1116 VAL n 
1 1117 SER n 
1 1118 GLY n 
1 1119 LEU n 
1 1120 ASP n 
1 1121 VAL n 
1 1122 ASN n 
1 1123 ALA n 
1 1124 ILE n 
1 1125 ASP n 
1 1126 SER n 
1 1127 ALA n 
1 1128 LEU n 
1 1129 LEU n 
1 1130 ARG n 
1 1131 LEU n 
1 1132 ARG n 
1 1133 THR n 
1 1134 LEU n 
1 1135 GLY n 
1 1136 ALA n 
1 1137 ASP n 
1 1138 LYS n 
1 1139 LYS n 
1 1140 ALA n 
1 1141 LEU n 
1 1142 THR n 
1 1143 ALA n 
1 1144 GLN n 
1 1145 LEU n 
1 1146 LEU n 
1 1147 MET n 
1 1148 VAL n 
1 1149 GLY n 
1 1150 LEU n 
1 1151 GLN n 
1 1152 GLU n 
1 1153 SER n 
1 1154 GLU n 
1 1155 ALA n 
1 1156 ASP n 
1 1157 ALA n 
1 1158 LEU n 
1 1159 ALA n 
1 1160 GLY n 
1 1161 LYS n 
1 1162 ILE n 
1 1163 MET n 
1 1164 LEU n 
1 1165 GLN n 
1 1166 ASP n 
1 1167 VAL n 
1 1168 ASN n 
1 1169 THR n 
1 1170 VAL n 
1 1171 GLN n 
1 1172 LEU n 
1 1173 ALA n 
1 1174 ARG n 
1 1175 VAL n 
1 1176 VAL n 
1 1177 ASN n 
1 1178 LEU n 
1 1179 ALA n 
1 1180 VAL n 
1 1181 PRO n 
1 1182 ASP n 
1 1183 THR n 
1 1184 TRP n 
1 1185 MET n 
1 1186 SER n 
1 1187 LEU n 
1 1188 ASP n 
1 1189 PHE n 
1 1190 ASP n 
1 1191 SER n 
1 1192 MET n 
1 1193 PHE n 
1 1194 LYS n 
1 1195 HIS n 
1 1196 HIS n 
1 1197 VAL n 
1 1198 LYS n 
1 1199 LEU n 
1 1200 LEU n 
1 1201 PRO n 
1 1202 LYS n 
1 1203 ASP n 
1 1204 GLY n 
1 1205 ARG n 
1 1206 HIS n 
1 1207 LEU n 
1 1208 ASN n 
1 1209 THR n 
1 1210 ASP n 
1 1211 ILE n 
1 1212 PRO n 
1 1213 PRO n 
1 1214 ARG n 
1 1215 MET n 
1 1216 GLY n 
1 1217 TRP n 
1 1218 LEU n 
1 1219 ARG n 
1 1220 ALA n 
1 1221 ILE n 
1 1222 LEU n 
1 1223 ARG n 
1 1224 PHE n 
1 1225 LEU n 
1 1226 GLY n 
1 1227 ALA n 
1 1228 GLY n 
1 1229 MET n 
1 1230 VAL n 
1 1231 MET n 
1 1232 THR n 
1 1233 ALA n 
1 1234 THR n 
1 1235 GLY n 
1 1236 VAL n 
1 1237 ALA n 
1 1238 VAL n 
1 1239 ASP n 
1 1240 ILE n 
1 1241 TYR n 
1 1242 LEU n 
1 1243 GLU n 
1 1244 ASP n 
1 1245 ILE n 
1 1246 HIS n 
1 1247 GLY n 
1 1248 GLY n 
1 1249 GLY n 
1 1250 ARG n 
1 1251 SER n 
1 1252 LEU n 
1 1253 GLY n 
1 1254 GLN n 
1 1255 ARG n 
1 1256 PHE n 
1 1257 MET n 
1 1258 THR n 
1 1259 TRP n 
1 1260 MET n 
1 1261 ARG n 
1 1262 GLN n 
1 1263 GLU n 
1 1264 GLY n 
1 1265 ARG n 
1 1266 SER n 
1 1267 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 L1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Reovirus sp.' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10891 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            SF21 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          BACULOVIRUS 
_entity_src_gen.pdbx_host_org_vector               PFASTBAC 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VL3_REOVD 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSSMILTQFGPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMLPIPPTIYTKPSHDSYYYIDALNR
VRRKTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIENRAKDGDSQARIATTYGRIAESQARQIKAPLEKFVLALLV
AEAGGSLYDPVLQKYDEIPDLSHNCPLWCFREICRHISGPLPDRAPYLYLSAGVFWLMSPRMTSAIPPLLSDLVNLAILQ
QTAGLDPSLVKLGVQICLHAAASSSYSWFILKTKSIFPQNTLHSMYESLEGGYCPNLEWLEPRSDYKFMYMGVMPLSAKY
ARSAPSNDKKARELGEKYGLSSVVGELRKRTKTYVKHDFASVRYIRDAMACTSGIFLVRTPTETVLQEYTQSPEIKVPIP
QKDWTGPIGEIRILKDTTSSIARYLYRTWYLAAARMAAQPRTWDPLFQAIMRSQYVTARGGSGAALRESLYAINVSLPDF
KGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSAPHTLTADYINYHMNLSPTSG
SAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLSVIMAAIHEGVASSSIGKPFMGVPASIVNDESVVGVRAARP
ISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWGPEHTDDPDVLRLM
KSLTIQRNYVCQGDDGLMIIDGTTAGKVNSETIQNDLELISKYGEEFGWKYDIAYDGTAEYLKLYFIFGCRIPNLSRHPI
VGKERANSSAEEPWPAILDQIMGVFFNGVHDGLQWQRWIRYSWALCCAFSRQRTMIGESVGYLQYPMWSFVYWGLPLVKA
FGSDPWIFSWYMPTGDLGMYSWISLIRPLMTRWMVANGYVTDRCSTVFGNADYRRCFNELKLYQGYYMAQLPRNPKKSGR
AASREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHNPPSLFDVPHKWYQGAQEAAIATREELAEMDETLMR
ARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPMLQSTRKYFAQTLFMAKTVSGLD
VNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLL
PKDGRHLNTDIPPRMGWLRAILRFLGAGMVMTATGVAVDIYLEDIHGGGRSLGQRFMTWMRQEGRSA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_accession          P17378 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1MWH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 1267 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P17378 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1267 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       1267 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                           ?                                 'C3 H7 N O2' 89.093  
ARG 'L-peptide linking' y ARGININE                                          ?                                 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                        ?                                 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                   ?                                 'C4 H7 N O4' 133.103 
CYS 'L-peptide linking' y CYSTEINE                                          ?                                 'C3 H7 N O2 S' 
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                         ?                                 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                   ?                                 'C5 H9 N O4' 147.129 
GLY 'peptide linking'   y GLYCINE                                           ?                                 'C2 H5 N O2' 75.067  
GTG non-polymer         . "7-METHYL-GUANOSINE-5'-TRIPHOSPHATE-5'-GUANOSINE" 'MRNA CAP ANALOG N7-METHYL GPPPG' 
'C21 H30 N10 O18 P3 1' 803.440 
HIS 'L-peptide linking' y HISTIDINE                                         ?                                 'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                             ?                                 'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                        ?                                 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                           ?                                 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                            ?                                 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                        ?                                 'C5 H11 N O2 S' 
149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                              ?                                 'Mn 2' 54.938  
PHE 'L-peptide linking' y PHENYLALANINE                                     ?                                 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                           ?                                 'C5 H9 N O2' 115.130 
SER 'L-peptide linking' y SERINE                                            ?                                 'C3 H7 N O3' 105.093 
THR 'L-peptide linking' y THREONINE                                         ?                                 'C4 H9 N O3' 119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                        ?                                 'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                                          ?                                 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                            ?                                 'C5 H11 N O2' 
117.146 
# 
_exptl.entry_id          1MWH 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.29 
_exptl_crystal.density_Matthews      2.63 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'PEG4000, sodium chloride, HEPES, glycerol, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2000-12-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 14-BM-C' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   14-BM-C 
# 
_reflns.entry_id                     1MWH 
_reflns.d_resolution_high            2.49 
_reflns.d_resolution_low             49.88 
_reflns.limit_h_max                  28 
_reflns.limit_h_min                  0 
_reflns.limit_k_max                  34 
_reflns.limit_k_min                  0 
_reflns.limit_l_max                  99 
_reflns.limit_l_min                  0 
_reflns.number_all                   53049 
_reflns.observed_criterion_sigma_F   .0 
_reflns.observed_criterion_F_max     2281469.39 
_reflns.observed_criterion_F_min     19.900000 
_reflns.B_iso_Wilson_estimate        42.5 
_reflns.observed_criterion_sigma_I   -2.0 
_reflns.number_obs                   49606 
_reflns.percent_possible_obs         93.5 
_reflns.pdbx_Rmerge_I_obs            0.074 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15 
_reflns.pdbx_redundancy              5 
_reflns.R_free_details               ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   81.7 
_reflns_shell.Rmerge_I_obs           0.441 
_reflns_shell.meanI_over_sigI_obs    2 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_redundancy        2 
_reflns_shell.number_unique_all      4223 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1MWH 
_refine.ls_number_reflns_all                     53069 
_refine.ls_number_reflns_obs                     49423 
_refine.ls_percent_reflns_obs                    93.1 
_refine.ls_d_res_high                            2.50 
_refine.ls_d_res_low                             49.88 
_refine.B_iso_min                                12.26 
_refine.B_iso_max                                98.19 
_refine.B_iso_mean                               33.69 
_refine.occupancy_min                            1.00 
_refine.occupancy_max                            1.00 
_refine.aniso_B[1][1]                            -.09 
_refine.aniso_B[2][2]                            .15 
_refine.aniso_B[3][3]                            -.06 
_refine.aniso_B[1][2]                            .00 
_refine.aniso_B[1][3]                            .00 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_param_bsol                 33.302 
_refine.solvent_model_param_ksol                 .364169 
_refine.solvent_model_details                    'CNS bulk solvent model used' 
_refine.ls_R_factor_R_work                       0.209 
_refine.ls_R_factor_R_free                       0.245 
_refine.ls_R_factor_R_free_error                 .005 
_refine.ls_number_reflns_R_free                  2636 
_refine.ls_percent_reflns_R_free                 5.3 
_refine.details                                  ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_R_factor_all                          0.243 
_refine.ls_R_factor_obs                          0.243 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'reovirus polymerase 1MUK' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            'same set of reflections as used in refining the native lambda3 structure' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_isotropic_thermal_model             Overall 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1MWH 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     2.50 
_refine_analyze.Luzzati_coordinate_error_obs    .28 
_refine_analyze.Luzzati_sigma_a_obs             .31 
_refine_analyze.Luzzati_coordinate_error_free   .35 
_refine_analyze.Luzzati_sigma_a_free            .35 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9930 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         53 
_refine_hist.number_atoms_solvent             671 
_refine_hist.number_atoms_total               10654 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        49.88 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d           .009 . ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg        1.5  . ? ? 'X-RAY DIFFRACTION' ? 
x_torsion_deg      22.2 . ? ? 'X-RAY DIFFRACTION' ? 
x_torsion_impr_deg 1.10 . ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.R_factor_all 
2.50 2.61  6524 5226 5071 80.1  0.286 0.285 .023 155 2.4 . . 'X-RAY DIFFRACTION' . 
2.61 2.75  6569 5723 5492 87.1  0.245 0.244 .016 231 3.5 . . 'X-RAY DIFFRACTION' . 
2.75 2.92  6572 5955 5683 90.6  0.233 0.232 .014 272 4.1 . . 'X-RAY DIFFRACTION' . 
2.92 3.15  6562 6044 5682 92.1  0.224 0.224 .012 362 5.5 . . 'X-RAY DIFFRACTION' . 
3.15 3.47  6589 6253 5848 94.9  0.207 0.207 .010 405 6.1 . . 'X-RAY DIFFRACTION' . 
3.47 3.97  6643 6577 6165 99.0  0.197 0.198 .010 412 6.2 . . 'X-RAY DIFFRACTION' . 
3.97 5.00  6704 6701 6307 100.0 0.169 0.17  .009 394 5.9 . . 'X-RAY DIFFRACTION' . 
5.00 49.88 6956 6944 6539 99.8  0.219 0.218 .011 405 5.8 . . 'X-RAY DIFFRACTION' . 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 dna-rna_rep.param dna-rna.top 'X-RAY DIFFRACTION' 
3 water_rep.param   water.top   'X-RAY DIFFRACTION' 
4 mgp.par           mgp.top     'X-RAY DIFFRACTION' 
5 ion.param         ion.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1MWH 
_struct.title                     'REOVIRUS POLYMERASE LAMBDA3 BOUND TO MRNA CAP ANALOG' 
_struct.pdbx_descriptor           'minor core protein lambda 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MWH 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
_struct_keywords.text            'polymerase, polymerase-cap analog complex, right hand configuration, Viral protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               ? 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 2    ? GLY A 10   ? SER A 2    GLY A 10   1 ? 9  
HELX_P HELX_P2  2  PHE A 9    ? ILE A 16   ? PHE A 9    ILE A 16   1 ? 8  
HELX_P HELX_P3  3  SER A 23   ? PHE A 37   ? SER A 23   PHE A 37   1 ? 15 
HELX_P HELX_P4  4  THR A 38   ? GLU A 48   ? THR A 38   GLU A 48   1 ? 11 
HELX_P HELX_P5  5  SER A 52   ? MET A 56   ? SER A 52   MET A 56   5 ? 5  
HELX_P HELX_P6  6  PRO A 60   ? TYR A 64   ? PRO A 60   TYR A 64   5 ? 5  
HELX_P HELX_P7  7  SER A 68   ? SER A 71   ? SER A 68   SER A 71   5 ? 4  
HELX_P HELX_P8  8  ILE A 99   ? GLU A 101  ? ILE A 99   GLU A 101  5 ? 3  
HELX_P HELX_P9  9  SER A 116  ? ASP A 125  ? SER A 116  ASP A 125  1 ? 10 
HELX_P HELX_P10 10 ASP A 127  ? ARG A 145  ? ASP A 127  ARG A 145  1 ? 19 
HELX_P HELX_P11 11 PRO A 150  ? ALA A 163  ? PRO A 150  ALA A 163  1 ? 14 
HELX_P HELX_P12 12 ASP A 180  ? HIS A 183  ? ASP A 180  HIS A 183  5 ? 4  
HELX_P HELX_P13 13 ASN A 184  ? GLY A 199  ? ASN A 184  GLY A 199  1 ? 16 
HELX_P HELX_P14 14 ALA A 225  ? ALA A 243  ? ALA A 225  ALA A 243  1 ? 19 
HELX_P HELX_P15 15 ASP A 246  ? SER A 263  ? ASP A 246  SER A 263  1 ? 18 
HELX_P HELX_P16 16 SER A 265  ? LYS A 274  ? SER A 265  LYS A 274  1 ? 10 
HELX_P HELX_P17 17 SER A 275  ? THR A 281  ? SER A 275  THR A 281  1 ? 7  
HELX_P HELX_P18 18 LEU A 282  ? MET A 285  ? LEU A 282  MET A 285  5 ? 4  
HELX_P HELX_P19 19 PRO A 302  ? TYR A 306  ? PRO A 302  TYR A 306  5 ? 5  
HELX_P HELX_P20 20 SER A 317  ? ALA A 321  ? SER A 317  ALA A 321  5 ? 5  
HELX_P HELX_P21 21 ASN A 327  ? TYR A 338  ? ASN A 327  TYR A 338  1 ? 12 
HELX_P HELX_P22 22 LEU A 340  ? THR A 353  ? LEU A 340  THR A 353  1 ? 14 
HELX_P HELX_P23 23 ASP A 358  ? ALA A 370  ? ASP A 358  ALA A 370  1 ? 13 
HELX_P HELX_P24 24 THR A 380  ? TYR A 389  ? THR A 380  TYR A 389  1 ? 10 
HELX_P HELX_P25 25 PRO A 400  ? LYS A 402  ? PRO A 400  LYS A 402  5 ? 3  
HELX_P HELX_P26 26 ILE A 421  ? GLN A 439  ? ILE A 421  GLN A 439  1 ? 19 
HELX_P HELX_P27 27 PRO A 440  ? TRP A 443  ? PRO A 440  TRP A 443  5 ? 4  
HELX_P HELX_P28 28 ASP A 444  ? GLN A 454  ? ASP A 444  GLN A 454  1 ? 11 
HELX_P HELX_P29 29 SER A 462  ? ALA A 472  ? SER A 462  ALA A 472  1 ? 11 
HELX_P HELX_P30 30 THR A 489  ? ALA A 498  ? THR A 489  ALA A 498  1 ? 10 
HELX_P HELX_P31 31 PRO A 501  ? SER A 506  ? PRO A 501  SER A 506  1 ? 6  
HELX_P HELX_P32 32 VAL A 507  ? ALA A 511  ? VAL A 507  ALA A 511  5 ? 5  
HELX_P HELX_P33 33 ASN A 532  ? SER A 539  ? ASN A 532  SER A 539  1 ? 8  
HELX_P HELX_P34 34 SER A 539  ? MET A 553  ? SER A 539  MET A 553  1 ? 15 
HELX_P HELX_P35 35 ALA A 562  ? LYS A 566  ? ALA A 562  LYS A 566  5 ? 5  
HELX_P HELX_P36 36 VAL A 567  ? SER A 576  ? VAL A 567  SER A 576  1 ? 10 
HELX_P HELX_P37 37 CYS A 589  ? ILE A 593  ? CYS A 589  ILE A 593  5 ? 5  
HELX_P HELX_P38 38 PHE A 597  ? VAL A 610  ? PHE A 597  VAL A 610  1 ? 14 
HELX_P HELX_P39 39 VAL A 610  ? ILE A 615  ? VAL A 610  ILE A 615  1 ? 6  
HELX_P HELX_P40 40 SER A 642  ? GLY A 658  ? SER A 642  GLY A 658  1 ? 17 
HELX_P HELX_P41 41 ALA A 686  ? VAL A 705  ? ALA A 686  VAL A 705  1 ? 20 
HELX_P HELX_P42 42 VAL A 705  ? HIS A 710  ? VAL A 705  HIS A 710  1 ? 6  
HELX_P HELX_P43 43 ASP A 713  ? LEU A 723  ? ASP A 713  LEU A 723  1 ? 11 
HELX_P HELX_P44 44 ASN A 749  ? GLU A 766  ? ASN A 749  GLU A 766  1 ? 18 
HELX_P HELX_P45 45 ASN A 794  ? HIS A 798  ? ASN A 794  HIS A 798  5 ? 5  
HELX_P HELX_P46 46 PRO A 815  ? GLY A 832  ? PRO A 815  GLY A 832  1 ? 18 
HELX_P HELX_P47 47 GLN A 834  ? ALA A 848  ? GLN A 834  ALA A 848  1 ? 15 
HELX_P HELX_P48 48 PRO A 866  ? GLY A 874  ? PRO A 866  GLY A 874  1 ? 9  
HELX_P HELX_P49 49 THR A 894  ? ILE A 906  ? THR A 894  ILE A 906  1 ? 13 
HELX_P HELX_P50 50 ILE A 906  ? ASN A 917  ? ILE A 906  ASN A 917  1 ? 12 
HELX_P HELX_P51 51 ASP A 932  ? LEU A 940  ? ASP A 932  LEU A 940  1 ? 9  
HELX_P HELX_P52 52 LYS A 941  ? ALA A 949  ? LYS A 941  ALA A 949  1 ? 9  
HELX_P HELX_P53 53 GLU A 965  ? MET A 979  ? GLU A 965  MET A 979  1 ? 15 
HELX_P HELX_P54 54 ASN A 981  ? GLY A 999  ? ASN A 981  GLY A 999  1 ? 19 
HELX_P HELX_P55 55 SER A 1008 ? PHE A 1010 ? SER A 1008 PHE A 1010 5 ? 3  
HELX_P HELX_P56 56 ASP A 1011 ? GLU A 1022 ? ASP A 1011 GLU A 1022 1 ? 12 
HELX_P HELX_P57 57 THR A 1027 ? HIS A 1044 ? THR A 1027 HIS A 1044 1 ? 18 
HELX_P HELX_P58 58 SER A 1050 ? LEU A 1057 ? SER A 1050 LEU A 1057 1 ? 8  
HELX_P HELX_P59 59 ASN A 1085 ? GLY A 1096 ? ASN A 1085 GLY A 1096 1 ? 12 
HELX_P HELX_P60 60 SER A 1101 ? ALA A 1107 ? SER A 1101 ALA A 1107 1 ? 7  
HELX_P HELX_P61 61 ASP A 1120 ? LEU A 1134 ? ASP A 1120 LEU A 1134 1 ? 15 
HELX_P HELX_P62 62 ASP A 1137 ? MET A 1147 ? ASP A 1137 MET A 1147 1 ? 11 
HELX_P HELX_P63 63 GLN A 1151 ? GLN A 1165 ? GLN A 1151 GLN A 1165 1 ? 15 
HELX_P HELX_P64 64 ASN A 1168 ? ALA A 1173 ? ASN A 1168 ALA A 1173 1 ? 6  
HELX_P HELX_P65 65 ARG A 1174 ? ASN A 1177 ? ARG A 1174 ASN A 1177 5 ? 4  
HELX_P HELX_P66 66 PRO A 1181 ? MET A 1185 ? PRO A 1181 MET A 1185 5 ? 5  
HELX_P HELX_P67 67 ASP A 1188 ? HIS A 1196 ? ASP A 1188 HIS A 1196 1 ? 9  
HELX_P HELX_P68 68 TRP A 1217 ? ALA A 1233 ? TRP A 1217 ALA A 1233 1 ? 17 
HELX_P HELX_P69 69 GLY A 1247 ? GLU A 1263 ? GLY A 1247 GLU A 1263 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MN . MN ? ? ? 1_555 A ASP 585 OD1 ? ? A MN 1500 A ASP 585  1_555 ? ? ? ? ? ? ? 2.241 ? 
metalc2 metalc ? ? B MN . MN ? ? ? 1_555 A ASP 735 OD1 ? ? A MN 1500 A ASP 735  1_555 ? ? ? ? ? ? ? 1.499 ? 
metalc3 metalc ? ? B MN . MN ? ? ? 1_555 D HOH .   O   ? ? A MN 1500 A HOH 2433 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc4 metalc ? ? B MN . MN ? ? ? 1_555 A ASP 585 OD2 ? ? A MN 1500 A ASP 585  1_555 ? ? ? ? ? ? ? 2.738 ? 
metalc5 metalc ? ? B MN . MN ? ? ? 1_555 A GLU 780 OE1 ? ? A MN 1500 A GLU 780  1_555 ? ? ? ? ? ? ? 1.914 ? 
metalc6 metalc ? ? B MN . MN ? ? ? 1_555 D HOH .   O   ? ? A MN 1500 A HOH 2382 1_555 ? ? ? ? ? ? ? 2.250 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 301 A . ? GLU 301 A PRO 302 A ? PRO 302 A 1 -0.44 
2 TRP 814 A . ? TRP 814 A PRO 815 A ? PRO 815 A 1 0.34  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 2 ? 
D ? 3 ? 
E ? 2 ? 
F ? 3 ? 
G ? 2 ? 
H ? 4 ? 
I ? 2 ? 
J ? 3 ? 
K ? 2 ? 
L ? 2 ? 
M ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 73   ? ILE A 75   ? TYR A 73   ILE A 75   
A 2 VAL A 81   ? ARG A 83   ? VAL A 81   ARG A 83   
B 1 LEU A 103  ? PRO A 105  ? LEU A 103  PRO A 105  
B 2 TYR A 112  ? LEU A 115  ? TYR A 112  LEU A 115  
B 3 VAL A 214  ? LEU A 217  ? VAL A 214  LEU A 217  
B 4 TYR A 207  ? TYR A 209  ? TYR A 207  TYR A 209  
C 1 TYR A 168  ? ASP A 169  ? TYR A 168  ASP A 169  
C 2 LYS A 174  ? TYR A 175  ? LYS A 174  TYR A 175  
D 1 PHE A 308  ? PRO A 315  ? PHE A 308  PRO A 315  
D 2 GLY A 291  ? TRP A 299  ? GLY A 291  TRP A 299  
D 3 LYS A 356  ? HIS A 357  ? LYS A 356  HIS A 357  
E 1 TRP A 404  ? ILE A 408  ? TRP A 404  ILE A 408  
E 2 ILE A 411  ? LEU A 414  ? ILE A 411  LEU A 414  
F 1 THR A 513  ? SER A 514  ? THR A 513  SER A 514  
F 2 PHE A 659  ? ASN A 664  ? PHE A 659  ASN A 664  
F 3 ASP A 672  ? THR A 677  ? ASP A 672  THR A 677  
G 1 GLY A 516  ? GLN A 520  ? GLY A 516  GLN A 520  
G 2 ARG A 523  ? ILE A 528  ? ARG A 523  ILE A 528  
H 1 TYR A 729  ? GLN A 732  ? TYR A 729  GLN A 732  
H 2 ASP A 735  ? ILE A 740  ? ASP A 735  ILE A 740  
H 3 GLN A 580  ? SER A 587  ? GLN A 580  SER A 587  
H 4 LYS A 770  ? ALA A 774  ? LYS A 770  ALA A 774  
I 1 SER A 625  ? ASP A 629  ? SER A 625  ASP A 629  
I 2 ALA A 637  ? ILE A 641  ? ALA A 637  ILE A 641  
J 1 ALA A 779  ? TYR A 781  ? ALA A 779  TYR A 781  
J 2 LEU A 784  ? ILE A 787  ? LEU A 784  ILE A 787  
J 3 CYS A 790  ? ILE A 792  ? CYS A 790  ILE A 792  
K 1 ARG A 851  ? ILE A 856  ? ARG A 851  ILE A 856  
K 2 SER A 859  ? GLN A 864  ? SER A 859  GLN A 864  
L 1 VAL A 920  ? SER A 925  ? VAL A 920  SER A 925  
L 2 GLY A 929  ? ALA A 931  ? GLY A 929  ALA A 931  
M 1 VAL A 1059 ? ALA A 1066 ? VAL A 1059 ALA A 1066 
M 2 VAL A 1238 ? ILE A 1245 ? VAL A 1238 ILE A 1245 
M 3 VAL A 1197 ? LYS A 1198 ? VAL A 1197 LYS A 1198 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 74   ? O TYR A 74   N ARG A 82   ? N ARG A 82   
B 1 2 N GLU A 104  ? N GLU A 104  O ARG A 114  ? O ARG A 114  
B 2 3 O GLY A 113  ? O GLY A 113  N TRP A 216  ? N TRP A 216  
B 3 4 O PHE A 215  ? O PHE A 215  N LEU A 208  ? N LEU A 208  
C 1 2 N ASP A 169  ? N ASP A 169  O LYS A 174  ? O LYS A 174  
D 1 2 N MET A 314  ? N MET A 314  O CYS A 294  ? O CYS A 294  
D 2 3 O GLY A 291  ? O GLY A 291  N HIS A 357  ? N HIS A 357  
E 1 2 N ILE A 408  ? N ILE A 408  O ILE A 411  ? O ILE A 411  
F 1 2 N THR A 513  ? N THR A 513  O SER A 660  ? O SER A 660  
F 2 3 N VAL A 663  ? N VAL A 663  O PHE A 673  ? O PHE A 673  
G 1 2 O GLN A 520  ? O GLN A 520  N ARG A 523  ? N ARG A 523  
H 1 2 N GLN A 732  ? N GLN A 732  O ASP A 735  ? O ASP A 735  
H 2 3 N ILE A 740  ? N ILE A 740  O GLN A 580  ? O GLN A 580  
H 3 4 N SER A 587  ? N SER A 587  O LYS A 770  ? O LYS A 770  
I 1 2 N ASP A 629  ? N ASP A 629  O ALA A 637  ? O ALA A 637  
J 1 2 O TYR A 781  ? O TYR A 781  N LEU A 784  ? N LEU A 784  
J 2 3 N ILE A 787  ? N ILE A 787  O CYS A 790  ? O CYS A 790  
K 1 2 N ILE A 856  ? N ILE A 856  O SER A 859  ? O SER A 859  
L 1 2 N SER A 925  ? N SER A 925  O GLY A 929  ? O GLY A 929  
M 1 2 N CYS A 1064 ? N CYS A 1064 O ASP A 1239 ? O ASP A 1239 
M 2 3 N LEU A 1242 ? N LEU A 1242 O LYS A 1198 ? O LYS A 1198 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN A 1500'  
AC2 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE GTG A 1425' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASP A 585  ? ASP A 585  . ? 1_555 ? 
2  AC1 5  ASP A 735  ? ASP A 735  . ? 1_555 ? 
3  AC1 5  GLU A 780  ? GLU A 780  . ? 1_555 ? 
4  AC1 5  HOH D .    ? HOH A 2382 . ? 1_555 ? 
5  AC1 5  HOH D .    ? HOH A 2433 . ? 1_555 ? 
6  AC2 18 SER A 35   ? SER A 35   . ? 1_555 ? 
7  AC2 18 MET A 36   ? MET A 36   . ? 1_555 ? 
8  AC2 18 SER A 211  ? SER A 211  . ? 1_555 ? 
9  AC2 18 GLU A 811  ? GLU A 811  . ? 1_555 ? 
10 AC2 18 PRO A 813  ? PRO A 813  . ? 1_555 ? 
11 AC2 18 TRP A 814  ? TRP A 814  . ? 1_555 ? 
12 AC2 18 ARG A 851  ? ARG A 851  . ? 1_555 ? 
13 AC2 18 GLN A 852  ? GLN A 852  . ? 1_555 ? 
14 AC2 18 ARG A 853  ? ARG A 853  . ? 1_555 ? 
15 AC2 18 THR A 854  ? THR A 854  . ? 1_555 ? 
16 AC2 18 MET A 855  ? MET A 855  . ? 1_555 ? 
17 AC2 18 TYR A 862  ? TYR A 862  . ? 1_555 ? 
18 AC2 18 LEU A 1031 ? LEU A 1031 . ? 1_555 ? 
19 AC2 18 ASP A 1035 ? ASP A 1035 . ? 1_555 ? 
20 AC2 18 HOH D .    ? HOH A 2032 . ? 1_555 ? 
21 AC2 18 HOH D .    ? HOH A 2450 . ? 1_555 ? 
22 AC2 18 HOH D .    ? HOH A 2591 . ? 1_555 ? 
23 AC2 18 HOH D .    ? HOH A 2615 . ? 1_555 ? 
# 
_atom_sites.entry_id                    1MWH 
_atom_sites.fract_transf_matrix[1][1]   .014106 
_atom_sites.fract_transf_matrix[1][2]   .000000 
_atom_sites.fract_transf_matrix[1][3]   .000000 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .011772 
_atom_sites.fract_transf_matrix[2][3]   .000000 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .004012 
_atom_sites.fract_transf_vector[1]      .000000 
_atom_sites.fract_transf_vector[2]      .000000 
_atom_sites.fract_transf_vector[3]      .000000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . SER A 1 2    ? -30.507 109.313 54.099  1.00 64.30 ? 2    SER A N   1 
ATOM   2     C  CA  . SER A 1 2    ? -31.857 109.544 53.512  1.00 62.94 ? 2    SER A CA  1 
ATOM   3     C  C   . SER A 1 2    ? -32.903 108.665 54.201  1.00 61.24 ? 2    SER A C   1 
ATOM   4     O  O   . SER A 1 2    ? -33.115 107.520 53.803  1.00 62.22 ? 2    SER A O   1 
ATOM   5     C  CB  . SER A 1 2    ? -31.818 109.247 52.007  1.00 64.33 ? 2    SER A CB  1 
ATOM   6     O  OG  . SER A 1 2    ? -30.807 110.015 51.371  1.00 64.64 ? 2    SER A OG  1 
ATOM   7     N  N   . SER A 1 3    ? -33.543 109.218 55.233  1.00 59.22 ? 3    SER A N   1 
ATOM   8     C  CA  . SER A 1 3    ? -34.576 108.526 56.007  1.00 56.39 ? 3    SER A CA  1 
ATOM   9     C  C   . SER A 1 3    ? -34.746 107.068 55.612  1.00 54.17 ? 3    SER A C   1 
ATOM   10    O  O   . SER A 1 3    ? -34.258 106.180 56.303  1.00 54.16 ? 3    SER A O   1 
ATOM   11    C  CB  . SER A 1 3    ? -35.905 109.256 55.871  1.00 56.73 ? 3    SER A CB  1 
ATOM   12    O  OG  . SER A 1 3    ? -35.830 110.520 56.503  1.00 58.22 ? 3    SER A OG  1 
ATOM   13    N  N   . MET A 1 4    ? -35.437 106.819 54.504  1.00 51.22 ? 4    MET A N   1 
ATOM   14    C  CA  . MET A 1 4    ? -35.642 105.453 54.031  1.00 49.15 ? 4    MET A CA  1 
ATOM   15    C  C   . MET A 1 4    ? -34.307 104.693 54.030  1.00 47.53 ? 4    MET A C   1 
ATOM   16    O  O   . MET A 1 4    ? -34.184 103.649 54.668  1.00 46.82 ? 4    MET A O   1 
ATOM   17    C  CB  . MET A 1 4    ? -36.244 105.492 52.626  1.00 50.38 ? 4    MET A CB  1 
ATOM   18    C  CG  . MET A 1 4    ? -36.738 104.159 52.086  1.00 51.34 ? 4    MET A CG  1 
ATOM   19    S  SD  . MET A 1 4    ? -37.632 104.373 50.508  1.00 52.73 ? 4    MET A SD  1 
ATOM   20    C  CE  . MET A 1 4    ? -39.339 104.149 51.049  1.00 53.85 ? 4    MET A CE  1 
ATOM   21    N  N   . ILE A 1 5    ? -33.304 105.232 53.335  1.00 45.68 ? 5    ILE A N   1 
ATOM   22    C  CA  . ILE A 1 5    ? -31.984 104.605 53.271  1.00 43.83 ? 5    ILE A CA  1 
ATOM   23    C  C   . ILE A 1 5    ? -31.236 104.708 54.605  1.00 44.50 ? 5    ILE A C   1 
ATOM   24    O  O   . ILE A 1 5    ? -30.697 103.715 55.116  1.00 43.16 ? 5    ILE A O   1 
ATOM   25    C  CB  . ILE A 1 5    ? -31.104 105.249 52.169  1.00 42.96 ? 5    ILE A CB  1 
ATOM   26    C  CG1 . ILE A 1 5    ? -31.533 104.740 50.797  1.00 41.54 ? 5    ILE A CG1 1 
ATOM   27    C  CG2 . ILE A 1 5    ? -29.642 104.916 52.399  1.00 41.88 ? 5    ILE A CG2 1 
ATOM   28    C  CD1 . ILE A 1 5    ? -31.392 103.246 50.628  1.00 40.97 ? 5    ILE A CD1 1 
ATOM   29    N  N   . LEU A 1 6    ? -31.207 105.920 55.155  1.00 44.88 ? 6    LEU A N   1 
ATOM   30    C  CA  . LEU A 1 6    ? -30.536 106.189 56.421  1.00 44.56 ? 6    LEU A CA  1 
ATOM   31    C  C   . LEU A 1 6    ? -31.143 105.375 57.554  1.00 44.33 ? 6    LEU A C   1 
ATOM   32    O  O   . LEU A 1 6    ? -30.461 105.001 58.472  1.00 44.94 ? 6    LEU A O   1 
ATOM   33    C  CB  . LEU A 1 6    ? -30.633 107.679 56.752  1.00 45.30 ? 6    LEU A CB  1 
ATOM   34    C  CG  . LEU A 1 6    ? -29.481 108.338 57.518  1.00 45.63 ? 6    LEU A CG  1 
ATOM   35    C  CD1 . LEU A 1 6    ? -28.144 108.041 56.852  1.00 43.85 ? 6    LEU A CD1 1 
ATOM   36    C  CD2 . LEU A 1 6    ? -29.733 109.840 57.557  1.00 46.14 ? 6    LEU A CD2 1 
ATOM   37    N  N   . THR A 1 7    ? -32.437 105.102 57.458  1.00 43.87 ? 7    THR A N   1 
ATOM   38    C  CA  . THR A 1 7    ? -33.143 104.335 58.476  1.00 42.54 ? 7    THR A CA  1 
ATOM   39    C  C   . THR A 1 7    ? -32.768 102.864 58.425  1.00 42.06 ? 7    THR A C   1 
ATOM   40    O  O   . THR A 1 7    ? -32.516 102.248 59.456  1.00 43.63 ? 7    THR A O   1 
ATOM   41    C  CB  . THR A 1 7    ? -34.684 104.483 58.319  1.00 43.84 ? 7    THR A CB  1 
ATOM   42    O  OG1 . THR A 1 7    ? -35.092 105.765 58.819  1.00 44.77 ? 7    THR A OG1 1 
ATOM   43    C  CG2 . THR A 1 7    ? -35.429 103.383 59.075  1.00 44.08 ? 7    THR A CG2 1 
ATOM   44    N  N   . GLN A 1 8    ? -32.711 102.298 57.226  1.00 40.87 ? 8    GLN A N   1 
ATOM   45    C  CA  . GLN A 1 8    ? -32.379 100.877 57.090  1.00 38.98 ? 8    GLN A CA  1 
ATOM   46    C  C   . GLN A 1 8    ? -30.913 100.447 57.088  1.00 34.95 ? 8    GLN A C   1 
ATOM   47    O  O   . GLN A 1 8    ? -30.619 99.273  57.319  1.00 34.73 ? 8    GLN A O   1 
ATOM   48    C  CB  . GLN A 1 8    ? -33.054 100.304 55.842  1.00 40.41 ? 8    GLN A CB  1 
ATOM   49    C  CG  . GLN A 1 8    ? -34.435 99.777  56.124  1.00 43.44 ? 8    GLN A CG  1 
ATOM   50    C  CD  . GLN A 1 8    ? -34.609 98.375  55.618  1.00 45.96 ? 8    GLN A CD  1 
ATOM   51    O  OE1 . GLN A 1 8    ? -34.862 98.153  54.432  1.00 47.54 ? 8    GLN A OE1 1 
ATOM   52    N  NE2 . GLN A 1 8    ? -34.455 97.405  56.513  1.00 46.23 ? 8    GLN A NE2 1 
ATOM   53    N  N   . PHE A 1 9    ? -29.995 101.373 56.841  1.00 30.30 ? 9    PHE A N   1 
ATOM   54    C  CA  . PHE A 1 9    ? -28.582 101.008 56.799  1.00 26.51 ? 9    PHE A CA  1 
ATOM   55    C  C   . PHE A 1 9    ? -27.694 101.869 57.717  1.00 25.28 ? 9    PHE A C   1 
ATOM   56    O  O   . PHE A 1 9    ? -26.477 101.763 57.680  1.00 24.35 ? 9    PHE A O   1 
ATOM   57    C  CB  . PHE A 1 9    ? -28.076 101.139 55.356  1.00 23.96 ? 9    PHE A CB  1 
ATOM   58    C  CG  . PHE A 1 9    ? -28.754 100.223 54.377  1.00 22.11 ? 9    PHE A CG  1 
ATOM   59    C  CD1 . PHE A 1 9    ? -28.286 98.922  54.183  1.00 20.87 ? 9    PHE A CD1 1 
ATOM   60    C  CD2 . PHE A 1 9    ? -29.842 100.663 53.628  1.00 19.73 ? 9    PHE A CD2 1 
ATOM   61    C  CE1 . PHE A 1 9    ? -28.880 98.071  53.251  1.00 18.30 ? 9    PHE A CE1 1 
ATOM   62    C  CE2 . PHE A 1 9    ? -30.447 99.820  52.692  1.00 18.91 ? 9    PHE A CE2 1 
ATOM   63    C  CZ  . PHE A 1 9    ? -29.964 98.519  52.507  1.00 19.16 ? 9    PHE A CZ  1 
ATOM   64    N  N   . GLY A 1 10   ? -28.337 102.693 58.552  1.00 24.55 ? 10   GLY A N   1 
ATOM   65    C  CA  . GLY A 1 10   ? -27.665 103.618 59.443  1.00 23.08 ? 10   GLY A CA  1 
ATOM   66    C  C   . GLY A 1 10   ? -26.378 103.096 60.081  1.00 23.67 ? 10   GLY A C   1 
ATOM   67    O  O   . GLY A 1 10   ? -25.304 103.636 59.843  1.00 24.34 ? 10   GLY A O   1 
ATOM   68    N  N   . PRO A 1 11   ? -26.482 102.050 60.927  1.00 23.71 ? 11   PRO A N   1 
ATOM   69    C  CA  . PRO A 1 11   ? -25.260 101.506 61.549  1.00 23.28 ? 11   PRO A CA  1 
ATOM   70    C  C   . PRO A 1 11   ? -24.159 101.038 60.602  1.00 24.75 ? 11   PRO A C   1 
ATOM   71    O  O   . PRO A 1 11   ? -22.965 101.183 60.903  1.00 24.70 ? 11   PRO A O   1 
ATOM   72    C  CB  . PRO A 1 11   ? -25.805 100.387 62.433  1.00 20.89 ? 11   PRO A CB  1 
ATOM   73    C  CG  . PRO A 1 11   ? -27.180 100.878 62.776  1.00 20.50 ? 11   PRO A CG  1 
ATOM   74    C  CD  . PRO A 1 11   ? -27.675 101.384 61.465  1.00 22.00 ? 11   PRO A CD  1 
ATOM   75    N  N   . PHE A 1 12   ? -24.552 100.472 59.462  1.00 24.45 ? 12   PHE A N   1 
ATOM   76    C  CA  . PHE A 1 12   ? -23.582 99.989  58.479  1.00 23.76 ? 12   PHE A CA  1 
ATOM   77    C  C   . PHE A 1 12   ? -22.940 101.193 57.797  1.00 25.43 ? 12   PHE A C   1 
ATOM   78    O  O   . PHE A 1 12   ? -21.730 101.228 57.566  1.00 25.26 ? 12   PHE A O   1 
ATOM   79    C  CB  . PHE A 1 12   ? -24.291 99.118  57.438  1.00 24.68 ? 12   PHE A CB  1 
ATOM   80    C  CG  . PHE A 1 12   ? -23.421 98.720  56.280  1.00 24.78 ? 12   PHE A CG  1 
ATOM   81    C  CD1 . PHE A 1 12   ? -22.324 97.892  56.480  1.00 24.87 ? 12   PHE A CD1 1 
ATOM   82    C  CD2 . PHE A 1 12   ? -23.689 99.182  54.997  1.00 23.54 ? 12   PHE A CD2 1 
ATOM   83    C  CE1 . PHE A 1 12   ? -21.501 97.526  55.421  1.00 24.61 ? 12   PHE A CE1 1 
ATOM   84    C  CE2 . PHE A 1 12   ? -22.873 98.825  53.921  1.00 22.51 ? 12   PHE A CE2 1 
ATOM   85    C  CZ  . PHE A 1 12   ? -21.780 97.999  54.129  1.00 23.87 ? 12   PHE A CZ  1 
ATOM   86    N  N   . ILE A 1 13   ? -23.766 102.186 57.480  1.00 26.59 ? 13   ILE A N   1 
ATOM   87    C  CA  . ILE A 1 13   ? -23.300 103.394 56.811  1.00 27.05 ? 13   ILE A CA  1 
ATOM   88    C  C   . ILE A 1 13   ? -22.182 104.069 57.593  1.00 28.19 ? 13   ILE A C   1 
ATOM   89    O  O   . ILE A 1 13   ? -21.256 104.625 57.008  1.00 29.30 ? 13   ILE A O   1 
ATOM   90    C  CB  . ILE A 1 13   ? -24.451 104.415 56.621  1.00 25.88 ? 13   ILE A CB  1 
ATOM   91    C  CG1 . ILE A 1 13   ? -25.514 103.834 55.690  1.00 25.84 ? 13   ILE A CG1 1 
ATOM   92    C  CG2 . ILE A 1 13   ? -23.907 105.721 56.077  1.00 24.56 ? 13   ILE A CG2 1 
ATOM   93    C  CD1 . ILE A 1 13   ? -26.754 104.716 55.533  1.00 26.50 ? 13   ILE A CD1 1 
ATOM   94    N  N   . GLU A 1 14   ? -22.266 104.022 58.917  1.00 29.28 ? 14   GLU A N   1 
ATOM   95    C  CA  . GLU A 1 14   ? -21.249 104.663 59.734  1.00 30.91 ? 14   GLU A CA  1 
ATOM   96    C  C   . GLU A 1 14   ? -19.999 103.808 59.888  1.00 31.51 ? 14   GLU A C   1 
ATOM   97    O  O   . GLU A 1 14   ? -18.913 104.327 60.152  1.00 32.89 ? 14   GLU A O   1 
ATOM   98    C  CB  . GLU A 1 14   ? -21.814 105.011 61.115  1.00 31.72 ? 14   GLU A CB  1 
ATOM   99    C  CG  . GLU A 1 14   ? -22.904 106.072 61.081  1.00 35.06 ? 14   GLU A CG  1 
ATOM   100   C  CD  . GLU A 1 14   ? -23.193 106.670 62.450  1.00 36.50 ? 14   GLU A CD  1 
ATOM   101   O  OE1 . GLU A 1 14   ? -23.293 105.896 63.426  1.00 36.59 ? 14   GLU A OE1 1 
ATOM   102   O  OE2 . GLU A 1 14   ? -23.325 107.914 62.540  1.00 37.95 ? 14   GLU A OE2 1 
ATOM   103   N  N   . SER A 1 15   ? -20.150 102.501 59.713  1.00 31.30 ? 15   SER A N   1 
ATOM   104   C  CA  . SER A 1 15   ? -19.027 101.593 59.854  1.00 31.09 ? 15   SER A CA  1 
ATOM   105   C  C   . SER A 1 15   ? -18.118 101.622 58.627  1.00 30.94 ? 15   SER A C   1 
ATOM   106   O  O   . SER A 1 15   ? -16.959 101.209 58.697  1.00 30.53 ? 15   SER A O   1 
ATOM   107   C  CB  . SER A 1 15   ? -19.526 100.164 60.096  1.00 30.85 ? 15   SER A CB  1 
ATOM   108   O  OG  . SER A 1 15   ? -20.176 99.642  58.950  1.00 31.20 ? 15   SER A OG  1 
ATOM   109   N  N   . ILE A 1 16   ? -18.644 102.103 57.505  1.00 30.13 ? 16   ILE A N   1 
ATOM   110   C  CA  . ILE A 1 16   ? -17.851 102.162 56.292  1.00 28.86 ? 16   ILE A CA  1 
ATOM   111   C  C   . ILE A 1 16   ? -17.501 103.604 55.953  1.00 28.51 ? 16   ILE A C   1 
ATOM   112   O  O   . ILE A 1 16   ? -16.933 103.895 54.893  1.00 28.36 ? 16   ILE A O   1 
ATOM   113   C  CB  . ILE A 1 16   ? -18.581 101.487 55.105  1.00 29.21 ? 16   ILE A CB  1 
ATOM   114   C  CG1 . ILE A 1 16   ? -19.940 102.140 54.877  1.00 29.62 ? 16   ILE A CG1 1 
ATOM   115   C  CG2 . ILE A 1 16   ? -18.745 99.999  55.378  1.00 29.08 ? 16   ILE A CG2 1 
ATOM   116   C  CD1 . ILE A 1 16   ? -20.665 101.592 53.676  1.00 27.94 ? 16   ILE A CD1 1 
ATOM   117   N  N   . SER A 1 17   ? -17.843 104.508 56.867  1.00 27.99 ? 17   SER A N   1 
ATOM   118   C  CA  . SER A 1 17   ? -17.530 105.916 56.684  1.00 27.89 ? 17   SER A CA  1 
ATOM   119   C  C   . SER A 1 17   ? -16.430 106.355 57.641  1.00 29.30 ? 17   SER A C   1 
ATOM   120   O  O   . SER A 1 17   ? -16.039 107.522 57.644  1.00 31.52 ? 17   SER A O   1 
ATOM   121   C  CB  . SER A 1 17   ? -18.769 106.785 56.884  1.00 26.34 ? 17   SER A CB  1 
ATOM   122   O  OG  . SER A 1 17   ? -19.575 106.791 55.716  1.00 24.64 ? 17   SER A OG  1 
ATOM   123   N  N   . GLY A 1 18   ? -15.931 105.420 58.449  1.00 29.21 ? 18   GLY A N   1 
ATOM   124   C  CA  . GLY A 1 18   ? -14.858 105.741 59.376  1.00 29.92 ? 18   GLY A CA  1 
ATOM   125   C  C   . GLY A 1 18   ? -15.319 106.286 60.716  1.00 30.29 ? 18   GLY A C   1 
ATOM   126   O  O   . GLY A 1 18   ? -14.510 106.730 61.523  1.00 29.23 ? 18   GLY A O   1 
ATOM   127   N  N   . ILE A 1 19   ? -16.621 106.224 60.968  1.00 30.48 ? 19   ILE A N   1 
ATOM   128   C  CA  . ILE A 1 19   ? -17.184 106.731 62.211  1.00 30.41 ? 19   ILE A CA  1 
ATOM   129   C  C   . ILE A 1 19   ? -17.329 105.640 63.266  1.00 30.28 ? 19   ILE A C   1 
ATOM   130   O  O   . ILE A 1 19   ? -17.118 105.879 64.452  1.00 29.48 ? 19   ILE A O   1 
ATOM   131   C  CB  . ILE A 1 19   ? -18.573 107.362 61.941  1.00 29.99 ? 19   ILE A CB  1 
ATOM   132   C  CG1 . ILE A 1 19   ? -18.418 108.573 61.019  1.00 29.25 ? 19   ILE A CG1 1 
ATOM   133   C  CG2 . ILE A 1 19   ? -19.247 107.734 63.248  1.00 28.82 ? 19   ILE A CG2 1 
ATOM   134   C  CD1 . ILE A 1 19   ? -19.537 108.729 60.019  1.00 30.75 ? 19   ILE A CD1 1 
ATOM   135   N  N   . THR A 1 20   ? -17.676 104.446 62.807  1.00 29.57 ? 20   THR A N   1 
ATOM   136   C  CA  . THR A 1 20   ? -17.903 103.289 63.662  1.00 29.60 ? 20   THR A CA  1 
ATOM   137   C  C   . THR A 1 20   ? -17.036 102.105 63.238  1.00 28.76 ? 20   THR A C   1 
ATOM   138   O  O   . THR A 1 20   ? -16.576 102.050 62.105  1.00 29.24 ? 20   THR A O   1 
ATOM   139   C  CB  . THR A 1 20   ? -19.392 102.852 63.558  1.00 30.10 ? 20   THR A CB  1 
ATOM   140   O  OG1 . THR A 1 20   ? -20.220 103.799 64.239  1.00 32.24 ? 20   THR A OG1 1 
ATOM   141   C  CG2 . THR A 1 20   ? -19.600 101.474 64.158  1.00 33.68 ? 20   THR A CG2 1 
ATOM   142   N  N   . ASP A 1 21   ? -16.811 101.158 64.146  1.00 28.06 ? 21   ASP A N   1 
ATOM   143   C  CA  . ASP A 1 21   ? -16.053 99.961  63.803  1.00 26.80 ? 21   ASP A CA  1 
ATOM   144   C  C   . ASP A 1 21   ? -16.944 99.107  62.909  1.00 26.32 ? 21   ASP A C   1 
ATOM   145   O  O   . ASP A 1 21   ? -18.167 99.210  62.960  1.00 26.00 ? 21   ASP A O   1 
ATOM   146   C  CB  . ASP A 1 21   ? -15.710 99.128  65.046  1.00 26.51 ? 21   ASP A CB  1 
ATOM   147   C  CG  . ASP A 1 21   ? -14.528 99.676  65.825  1.00 27.91 ? 21   ASP A CG  1 
ATOM   148   O  OD1 . ASP A 1 21   ? -13.759 100.493 65.284  1.00 29.00 ? 21   ASP A OD1 1 
ATOM   149   O  OD2 . ASP A 1 21   ? -14.350 99.265  66.990  1.00 30.71 ? 21   ASP A OD2 1 
ATOM   150   N  N   . GLN A 1 22   ? -16.333 98.276  62.078  1.00 26.65 ? 22   GLN A N   1 
ATOM   151   C  CA  . GLN A 1 22   ? -17.091 97.372  61.221  1.00 26.67 ? 22   GLN A CA  1 
ATOM   152   C  C   . GLN A 1 22   ? -17.284 96.105  62.052  1.00 26.86 ? 22   GLN A C   1 
ATOM   153   O  O   . GLN A 1 22   ? -16.417 95.728  62.838  1.00 27.25 ? 22   GLN A O   1 
ATOM   154   C  CB  . GLN A 1 22   ? -16.300 97.018  59.958  1.00 26.65 ? 22   GLN A CB  1 
ATOM   155   C  CG  . GLN A 1 22   ? -16.062 98.165  58.998  1.00 27.63 ? 22   GLN A CG  1 
ATOM   156   C  CD  . GLN A 1 22   ? -15.414 97.690  57.716  1.00 28.00 ? 22   GLN A CD  1 
ATOM   157   O  OE1 . GLN A 1 22   ? -16.027 96.969  56.929  1.00 28.43 ? 22   GLN A OE1 1 
ATOM   158   N  NE2 . GLN A 1 22   ? -14.165 98.078  57.502  1.00 25.70 ? 22   GLN A NE2 1 
ATOM   159   N  N   . SER A 1 23   ? -18.414 95.446  61.883  1.00 25.67 ? 23   SER A N   1 
ATOM   160   C  CA  . SER A 1 23   ? -18.685 94.223  62.626  1.00 25.68 ? 23   SER A CA  1 
ATOM   161   C  C   . SER A 1 23   ? -19.582 93.373  61.745  1.00 25.72 ? 23   SER A C   1 
ATOM   162   O  O   . SER A 1 23   ? -20.480 93.895  61.075  1.00 25.02 ? 23   SER A O   1 
ATOM   163   C  CB  . SER A 1 23   ? -19.387 94.544  63.949  1.00 23.80 ? 23   SER A CB  1 
ATOM   164   O  OG  . SER A 1 23   ? -20.515 95.370  63.730  1.00 23.64 ? 23   SER A OG  1 
ATOM   165   N  N   . ASN A 1 24   ? -19.342 92.067  61.749  1.00 26.70 ? 24   ASN A N   1 
ATOM   166   C  CA  . ASN A 1 24   ? -20.132 91.180  60.926  1.00 28.04 ? 24   ASN A CA  1 
ATOM   167   C  C   . ASN A 1 24   ? -21.635 91.284  61.200  1.00 30.24 ? 24   ASN A C   1 
ATOM   168   O  O   . ASN A 1 24   ? -22.450 91.144  60.278  1.00 31.64 ? 24   ASN A O   1 
ATOM   169   C  CB  . ASN A 1 24   ? -19.684 89.745  61.097  1.00 27.73 ? 24   ASN A CB  1 
ATOM   170   C  CG  . ASN A 1 24   ? -20.013 88.924  59.897  1.00 28.64 ? 24   ASN A CG  1 
ATOM   171   O  OD1 . ASN A 1 24   ? -19.499 89.182  58.810  1.00 30.00 ? 24   ASN A OD1 1 
ATOM   172   N  ND2 . ASN A 1 24   ? -20.883 87.944  60.065  1.00 28.34 ? 24   ASN A ND2 1 
ATOM   173   N  N   . ASP A 1 25   ? -22.007 91.526  62.455  1.00 30.58 ? 25   ASP A N   1 
ATOM   174   C  CA  . ASP A 1 25   ? -23.416 91.653  62.791  1.00 30.73 ? 25   ASP A CA  1 
ATOM   175   C  C   . ASP A 1 25   ? -24.067 92.751  61.954  1.00 30.17 ? 25   ASP A C   1 
ATOM   176   O  O   . ASP A 1 25   ? -25.082 92.535  61.302  1.00 30.99 ? 25   ASP A O   1 
ATOM   177   C  CB  . ASP A 1 25   ? -23.593 91.966  64.282  1.00 33.13 ? 25   ASP A CB  1 
ATOM   178   C  CG  . ASP A 1 25   ? -23.708 90.712  65.131  1.00 36.26 ? 25   ASP A CG  1 
ATOM   179   O  OD1 . ASP A 1 25   ? -23.741 89.602  64.547  1.00 34.62 ? 25   ASP A OD1 1 
ATOM   180   O  OD2 . ASP A 1 25   ? -23.779 90.837  66.379  1.00 38.09 ? 25   ASP A OD2 1 
ATOM   181   N  N   . VAL A 1 26   ? -23.480 93.936  61.976  1.00 29.08 ? 26   VAL A N   1 
ATOM   182   C  CA  . VAL A 1 26   ? -24.036 95.029  61.207  1.00 28.41 ? 26   VAL A CA  1 
ATOM   183   C  C   . VAL A 1 26   ? -23.902 94.727  59.721  1.00 28.01 ? 26   VAL A C   1 
ATOM   184   O  O   . VAL A 1 26   ? -24.853 94.908  58.962  1.00 27.51 ? 26   VAL A O   1 
ATOM   185   C  CB  . VAL A 1 26   ? -23.343 96.359  61.572  1.00 28.99 ? 26   VAL A CB  1 
ATOM   186   C  CG1 . VAL A 1 26   ? -23.834 97.492  60.684  1.00 26.99 ? 26   VAL A CG1 1 
ATOM   187   C  CG2 . VAL A 1 26   ? -23.639 96.677  63.027  1.00 27.77 ? 26   VAL A CG2 1 
ATOM   188   N  N   . PHE A 1 27   ? -22.733 94.246  59.308  1.00 26.93 ? 27   PHE A N   1 
ATOM   189   C  CA  . PHE A 1 27   ? -22.516 93.925  57.904  1.00 25.27 ? 27   PHE A CA  1 
ATOM   190   C  C   . PHE A 1 27   ? -23.619 93.004  57.411  1.00 24.59 ? 27   PHE A C   1 
ATOM   191   O  O   . PHE A 1 27   ? -24.251 93.279  56.396  1.00 23.36 ? 27   PHE A O   1 
ATOM   192   C  CB  . PHE A 1 27   ? -21.172 93.226  57.700  1.00 24.72 ? 27   PHE A CB  1 
ATOM   193   C  CG  . PHE A 1 27   ? -20.902 92.828  56.262  1.00 23.94 ? 27   PHE A CG  1 
ATOM   194   C  CD1 . PHE A 1 27   ? -20.481 93.767  55.330  1.00 23.32 ? 27   PHE A CD1 1 
ATOM   195   C  CD2 . PHE A 1 27   ? -21.080 91.506  55.846  1.00 23.37 ? 27   PHE A CD2 1 
ATOM   196   C  CE1 . PHE A 1 27   ? -20.243 93.395  54.008  1.00 22.15 ? 27   PHE A CE1 1 
ATOM   197   C  CE2 . PHE A 1 27   ? -20.848 91.125  54.538  1.00 20.81 ? 27   PHE A CE2 1 
ATOM   198   C  CZ  . PHE A 1 27   ? -20.426 92.071  53.611  1.00 22.45 ? 27   PHE A CZ  1 
ATOM   199   N  N   . GLU A 1 28   ? -23.852 91.914  58.137  1.00 24.22 ? 28   GLU A N   1 
ATOM   200   C  CA  . GLU A 1 28   ? -24.865 90.957  57.728  1.00 24.52 ? 28   GLU A CA  1 
ATOM   201   C  C   . GLU A 1 28   ? -26.282 91.504  57.838  1.00 25.36 ? 28   GLU A C   1 
ATOM   202   O  O   . GLU A 1 28   ? -27.134 91.165  57.025  1.00 25.60 ? 28   GLU A O   1 
ATOM   203   C  CB  . GLU A 1 28   ? -24.708 89.648  58.508  1.00 24.99 ? 28   GLU A CB  1 
ATOM   204   C  CG  . GLU A 1 28   ? -23.412 88.909  58.174  1.00 24.63 ? 28   GLU A CG  1 
ATOM   205   C  CD  . GLU A 1 28   ? -23.360 87.492  58.708  1.00 24.38 ? 28   GLU A CD  1 
ATOM   206   O  OE1 . GLU A 1 28   ? -24.332 87.051  59.363  1.00 26.85 ? 28   GLU A OE1 1 
ATOM   207   O  OE2 . GLU A 1 28   ? -22.333 86.823  58.478  1.00 23.06 ? 28   GLU A OE2 1 
ATOM   208   N  N   . ASP A 1 29   ? -26.542 92.354  58.827  1.00 26.36 ? 29   ASP A N   1 
ATOM   209   C  CA  . ASP A 1 29   ? -27.860 92.951  58.948  1.00 27.46 ? 29   ASP A CA  1 
ATOM   210   C  C   . ASP A 1 29   ? -28.071 93.794  57.695  1.00 26.28 ? 29   ASP A C   1 
ATOM   211   O  O   . ASP A 1 29   ? -29.134 93.745  57.066  1.00 25.24 ? 29   ASP A O   1 
ATOM   212   C  CB  . ASP A 1 29   ? -27.965 93.838  60.193  1.00 32.32 ? 29   ASP A CB  1 
ATOM   213   C  CG  . ASP A 1 29   ? -28.535 93.097  61.394  1.00 38.01 ? 29   ASP A CG  1 
ATOM   214   O  OD1 . ASP A 1 29   ? -29.493 92.306  61.211  1.00 41.21 ? 29   ASP A OD1 1 
ATOM   215   O  OD2 . ASP A 1 29   ? -28.035 93.319  62.524  1.00 39.91 ? 29   ASP A OD2 1 
ATOM   216   N  N   . ALA A 1 30   ? -27.050 94.566  57.334  1.00 24.27 ? 30   ALA A N   1 
ATOM   217   C  CA  . ALA A 1 30   ? -27.111 95.400  56.142  1.00 23.53 ? 30   ALA A CA  1 
ATOM   218   C  C   . ALA A 1 30   ? -27.370 94.498  54.920  1.00 23.37 ? 30   ALA A C   1 
ATOM   219   O  O   . ALA A 1 30   ? -28.173 94.826  54.047  1.00 21.56 ? 30   ALA A O   1 
ATOM   220   C  CB  . ALA A 1 30   ? -25.801 96.147  55.981  1.00 23.52 ? 30   ALA A CB  1 
ATOM   221   N  N   . ALA A 1 31   ? -26.690 93.356  54.865  1.00 22.88 ? 31   ALA A N   1 
ATOM   222   C  CA  . ALA A 1 31   ? -26.877 92.437  53.756  1.00 24.95 ? 31   ALA A CA  1 
ATOM   223   C  C   . ALA A 1 31   ? -28.352 92.018  53.676  1.00 26.81 ? 31   ALA A C   1 
ATOM   224   O  O   . ALA A 1 31   ? -28.962 92.049  52.607  1.00 25.49 ? 31   ALA A O   1 
ATOM   225   C  CB  . ALA A 1 31   ? -25.977 91.220  53.935  1.00 23.42 ? 31   ALA A CB  1 
ATOM   226   N  N   . LYS A 1 32   ? -28.924 91.625  54.807  1.00 28.29 ? 32   LYS A N   1 
ATOM   227   C  CA  . LYS A 1 32   ? -30.329 91.237  54.836  1.00 30.57 ? 32   LYS A CA  1 
ATOM   228   C  C   . LYS A 1 32   ? -31.182 92.393  54.314  1.00 29.84 ? 32   LYS A C   1 
ATOM   229   O  O   . LYS A 1 32   ? -32.139 92.173  53.576  1.00 30.30 ? 32   LYS A O   1 
ATOM   230   C  CB  . LYS A 1 32   ? -30.769 90.889  56.260  1.00 33.68 ? 32   LYS A CB  1 
ATOM   231   C  CG  . LYS A 1 32   ? -30.067 89.665  56.848  1.00 40.24 ? 32   LYS A CG  1 
ATOM   232   C  CD  . LYS A 1 32   ? -30.453 89.432  58.322  1.00 42.91 ? 32   LYS A CD  1 
ATOM   233   C  CE  . LYS A 1 32   ? -29.431 88.545  59.042  1.00 43.66 ? 32   LYS A CE  1 
ATOM   234   N  NZ  . LYS A 1 32   ? -29.965 87.956  60.308  1.00 45.27 ? 32   LYS A NZ  1 
ATOM   235   N  N   . ALA A 1 33   ? -30.817 93.620  54.683  1.00 27.69 ? 33   ALA A N   1 
ATOM   236   C  CA  . ALA A 1 33   ? -31.558 94.809  54.259  1.00 26.10 ? 33   ALA A CA  1 
ATOM   237   C  C   . ALA A 1 33   ? -31.487 95.011  52.756  1.00 27.30 ? 33   ALA A C   1 
ATOM   238   O  O   . ALA A 1 33   ? -32.478 95.405  52.130  1.00 28.57 ? 33   ALA A O   1 
ATOM   239   C  CB  . ALA A 1 33   ? -31.033 96.063  54.979  1.00 23.81 ? 33   ALA A CB  1 
ATOM   240   N  N   . PHE A 1 34   ? -30.323 94.743  52.170  1.00 26.56 ? 34   PHE A N   1 
ATOM   241   C  CA  . PHE A 1 34   ? -30.171 94.903  50.731  1.00 26.18 ? 34   PHE A CA  1 
ATOM   242   C  C   . PHE A 1 34   ? -31.093 93.945  49.975  1.00 27.13 ? 34   PHE A C   1 
ATOM   243   O  O   . PHE A 1 34   ? -31.832 94.349  49.073  1.00 25.68 ? 34   PHE A O   1 
ATOM   244   C  CB  . PHE A 1 34   ? -28.713 94.652  50.297  1.00 24.07 ? 34   PHE A CB  1 
ATOM   245   C  CG  . PHE A 1 34   ? -27.834 95.868  50.369  1.00 21.42 ? 34   PHE A CG  1 
ATOM   246   C  CD1 . PHE A 1 34   ? -28.088 96.979  49.564  1.00 21.35 ? 34   PHE A CD1 1 
ATOM   247   C  CD2 . PHE A 1 34   ? -26.729 95.892  51.221  1.00 21.13 ? 34   PHE A CD2 1 
ATOM   248   C  CE1 . PHE A 1 34   ? -27.257 98.105  49.604  1.00 17.64 ? 34   PHE A CE1 1 
ATOM   249   C  CE2 . PHE A 1 34   ? -25.883 97.014  51.275  1.00 19.59 ? 34   PHE A CE2 1 
ATOM   250   C  CZ  . PHE A 1 34   ? -26.146 98.121  50.462  1.00 18.08 ? 34   PHE A CZ  1 
ATOM   251   N  N   . SER A 1 35   ? -31.045 92.676  50.356  1.00 28.59 ? 35   SER A N   1 
ATOM   252   C  CA  . SER A 1 35   ? -31.831 91.646  49.694  1.00 32.01 ? 35   SER A CA  1 
ATOM   253   C  C   . SER A 1 35   ? -33.336 91.783  49.854  1.00 33.51 ? 35   SER A C   1 
ATOM   254   O  O   . SER A 1 35   ? -34.090 91.245  49.043  1.00 35.71 ? 35   SER A O   1 
ATOM   255   C  CB  . SER A 1 35   ? -31.406 90.276  50.197  1.00 32.13 ? 35   SER A CB  1 
ATOM   256   O  OG  . SER A 1 35   ? -31.436 90.254  51.612  1.00 38.43 ? 35   SER A OG  1 
ATOM   257   N  N   . MET A 1 36   ? -33.775 92.492  50.888  1.00 34.59 ? 36   MET A N   1 
ATOM   258   C  CA  . MET A 1 36   ? -35.206 92.666  51.132  1.00 36.44 ? 36   MET A CA  1 
ATOM   259   C  C   . MET A 1 36   ? -35.755 93.933  50.495  1.00 36.32 ? 36   MET A C   1 
ATOM   260   O  O   . MET A 1 36   ? -36.956 94.186  50.527  1.00 36.03 ? 36   MET A O   1 
ATOM   261   C  CB  . MET A 1 36   ? -35.501 92.683  52.634  1.00 37.95 ? 36   MET A CB  1 
ATOM   262   C  CG  . MET A 1 36   ? -35.215 91.359  53.351  1.00 42.29 ? 36   MET A CG  1 
ATOM   263   S  SD  . MET A 1 36   ? -36.038 91.211  54.948  1.00 49.35 ? 36   MET A SD  1 
ATOM   264   C  CE  . MET A 1 36   ? -35.476 92.601  55.562  1.00 47.29 ? 36   MET A CE  1 
ATOM   265   N  N   . PHE A 1 37   ? -34.856 94.729  49.927  1.00 36.39 ? 37   PHE A N   1 
ATOM   266   C  CA  . PHE A 1 37   ? -35.214 95.966  49.248  1.00 34.71 ? 37   PHE A CA  1 
ATOM   267   C  C   . PHE A 1 37   ? -35.773 95.628  47.869  1.00 35.62 ? 37   PHE A C   1 
ATOM   268   O  O   . PHE A 1 37   ? -35.093 95.004  47.047  1.00 34.87 ? 37   PHE A O   1 
ATOM   269   C  CB  . PHE A 1 37   ? -33.974 96.834  49.063  1.00 33.71 ? 37   PHE A CB  1 
ATOM   270   C  CG  . PHE A 1 37   ? -34.107 98.213  49.620  1.00 32.61 ? 37   PHE A CG  1 
ATOM   271   C  CD1 . PHE A 1 37   ? -34.012 98.436  50.984  1.00 31.45 ? 37   PHE A CD1 1 
ATOM   272   C  CD2 . PHE A 1 37   ? -34.340 99.290  48.777  1.00 31.89 ? 37   PHE A CD2 1 
ATOM   273   C  CE1 . PHE A 1 37   ? -34.143 99.708  51.499  1.00 31.16 ? 37   PHE A CE1 1 
ATOM   274   C  CE2 . PHE A 1 37   ? -34.475 100.572 49.285  1.00 29.98 ? 37   PHE A CE2 1 
ATOM   275   C  CZ  . PHE A 1 37   ? -34.377 100.783 50.650  1.00 30.19 ? 37   PHE A CZ  1 
ATOM   276   N  N   . THR A 1 38   ? -37.010 96.031  47.609  1.00 36.02 ? 38   THR A N   1 
ATOM   277   C  CA  . THR A 1 38   ? -37.607 95.761  46.309  1.00 36.99 ? 38   THR A CA  1 
ATOM   278   C  C   . THR A 1 38   ? -37.101 96.821  45.335  1.00 37.14 ? 38   THR A C   1 
ATOM   279   O  O   . THR A 1 38   ? -36.746 97.938  45.728  1.00 37.65 ? 38   THR A O   1 
ATOM   280   C  CB  . THR A 1 38   ? -39.152 95.832  46.353  1.00 38.32 ? 38   THR A CB  1 
ATOM   281   O  OG1 . THR A 1 38   ? -39.562 97.199  46.448  1.00 39.09 ? 38   THR A OG1 1 
ATOM   282   C  CG2 . THR A 1 38   ? -39.692 95.071  47.553  1.00 37.62 ? 38   THR A CG2 1 
ATOM   283   N  N   . ARG A 1 39   ? -37.076 96.462  44.059  1.00 37.10 ? 39   ARG A N   1 
ATOM   284   C  CA  . ARG A 1 39   ? -36.626 97.364  43.009  1.00 36.41 ? 39   ARG A CA  1 
ATOM   285   C  C   . ARG A 1 39   ? -37.296 98.748  43.089  1.00 35.53 ? 39   ARG A C   1 
ATOM   286   O  O   . ARG A 1 39   ? -36.618 99.781  43.126  1.00 35.99 ? 39   ARG A O   1 
ATOM   287   C  CB  . ARG A 1 39   ? -36.890 96.730  41.645  1.00 37.21 ? 39   ARG A CB  1 
ATOM   288   C  CG  . ARG A 1 39   ? -35.883 95.696  41.249  1.00 39.84 ? 39   ARG A CG  1 
ATOM   289   C  CD  . ARG A 1 39   ? -35.870 95.492  39.737  1.00 42.68 ? 39   ARG A CD  1 
ATOM   290   N  NE  . ARG A 1 39   ? -35.557 94.123  39.324  1.00 46.84 ? 39   ARG A NE  1 
ATOM   291   C  CZ  . ARG A 1 39   ? -34.493 93.435  39.736  1.00 48.69 ? 39   ARG A CZ  1 
ATOM   292   N  NH1 . ARG A 1 39   ? -33.637 93.982  40.589  1.00 48.58 ? 39   ARG A NH1 1 
ATOM   293   N  NH2 . ARG A 1 39   ? -34.259 92.210  39.271  1.00 47.62 ? 39   ARG A NH2 1 
ATOM   294   N  N   . SER A 1 40   ? -38.624 98.772  43.138  1.00 33.45 ? 40   SER A N   1 
ATOM   295   C  CA  . SER A 1 40   ? -39.336 100.045 43.211  1.00 32.43 ? 40   SER A CA  1 
ATOM   296   C  C   . SER A 1 40   ? -38.922 100.868 44.426  1.00 31.07 ? 40   SER A C   1 
ATOM   297   O  O   . SER A 1 40   ? -38.992 102.093 44.410  1.00 30.83 ? 40   SER A O   1 
ATOM   298   C  CB  . SER A 1 40   ? -40.849 99.816  43.236  1.00 31.61 ? 40   SER A CB  1 
ATOM   299   O  OG  . SER A 1 40   ? -41.306 99.351  41.983  1.00 30.83 ? 40   SER A OG  1 
ATOM   300   N  N   . ASP A 1 41   ? -38.499 100.203 45.490  1.00 30.32 ? 41   ASP A N   1 
ATOM   301   C  CA  . ASP A 1 41   ? -38.076 100.950 46.667  1.00 30.06 ? 41   ASP A CA  1 
ATOM   302   C  C   . ASP A 1 41   ? -36.842 101.772 46.343  1.00 28.14 ? 41   ASP A C   1 
ATOM   303   O  O   . ASP A 1 41   ? -36.688 102.887 46.846  1.00 28.97 ? 41   ASP A O   1 
ATOM   304   C  CB  . ASP A 1 41   ? -37.766 100.025 47.842  1.00 32.48 ? 41   ASP A CB  1 
ATOM   305   C  CG  . ASP A 1 41   ? -39.021 99.549  48.569  1.00 35.61 ? 41   ASP A CG  1 
ATOM   306   O  OD1 . ASP A 1 41   ? -39.918 100.385 48.842  1.00 34.35 ? 41   ASP A OD1 1 
ATOM   307   O  OD2 . ASP A 1 41   ? -39.098 98.333  48.881  1.00 37.25 ? 41   ASP A OD2 1 
ATOM   308   N  N   . VAL A 1 42   ? -35.959 101.223 45.513  1.00 26.26 ? 42   VAL A N   1 
ATOM   309   C  CA  . VAL A 1 42   ? -34.748 101.943 45.138  1.00 25.43 ? 42   VAL A CA  1 
ATOM   310   C  C   . VAL A 1 42   ? -35.147 103.253 44.466  1.00 25.12 ? 42   VAL A C   1 
ATOM   311   O  O   . VAL A 1 42   ? -34.568 104.310 44.736  1.00 24.98 ? 42   VAL A O   1 
ATOM   312   C  CB  . VAL A 1 42   ? -33.889 101.120 44.166  1.00 24.83 ? 42   VAL A CB  1 
ATOM   313   C  CG1 . VAL A 1 42   ? -32.682 101.921 43.733  1.00 22.75 ? 42   VAL A CG1 1 
ATOM   314   C  CG2 . VAL A 1 42   ? -33.455 99.827  44.828  1.00 23.59 ? 42   VAL A CG2 1 
ATOM   315   N  N   . TYR A 1 43   ? -36.134 103.170 43.585  1.00 24.95 ? 43   TYR A N   1 
ATOM   316   C  CA  . TYR A 1 43   ? -36.643 104.346 42.890  1.00 26.15 ? 43   TYR A CA  1 
ATOM   317   C  C   . TYR A 1 43   ? -37.346 105.275 43.878  1.00 27.33 ? 43   TYR A C   1 
ATOM   318   O  O   . TYR A 1 43   ? -37.319 106.507 43.715  1.00 27.89 ? 43   TYR A O   1 
ATOM   319   C  CB  . TYR A 1 43   ? -37.587 103.923 41.763  1.00 23.98 ? 43   TYR A CB  1 
ATOM   320   C  CG  . TYR A 1 43   ? -36.873 103.168 40.669  1.00 23.09 ? 43   TYR A CG  1 
ATOM   321   C  CD1 . TYR A 1 43   ? -36.187 103.844 39.662  1.00 24.48 ? 43   TYR A CD1 1 
ATOM   322   C  CD2 . TYR A 1 43   ? -36.822 101.775 40.672  1.00 23.15 ? 43   TYR A CD2 1 
ATOM   323   C  CE1 . TYR A 1 43   ? -35.467 103.152 38.690  1.00 22.79 ? 43   TYR A CE1 1 
ATOM   324   C  CE2 . TYR A 1 43   ? -36.104 101.075 39.705  1.00 19.74 ? 43   TYR A CE2 1 
ATOM   325   C  CZ  . TYR A 1 43   ? -35.429 101.771 38.722  1.00 22.05 ? 43   TYR A CZ  1 
ATOM   326   O  OH  . TYR A 1 43   ? -34.698 101.100 37.772  1.00 22.35 ? 43   TYR A OH  1 
ATOM   327   N  N   . LYS A 1 44   ? -37.976 104.706 44.899  1.00 28.80 ? 44   LYS A N   1 
ATOM   328   C  CA  . LYS A 1 44   ? -38.610 105.556 45.895  1.00 30.97 ? 44   LYS A CA  1 
ATOM   329   C  C   . LYS A 1 44   ? -37.526 106.283 46.697  1.00 30.52 ? 44   LYS A C   1 
ATOM   330   O  O   . LYS A 1 44   ? -37.689 107.453 47.058  1.00 32.21 ? 44   LYS A O   1 
ATOM   331   C  CB  . LYS A 1 44   ? -39.512 104.737 46.811  1.00 33.10 ? 44   LYS A CB  1 
ATOM   332   C  CG  . LYS A 1 44   ? -40.775 104.242 46.122  1.00 37.12 ? 44   LYS A CG  1 
ATOM   333   C  CD  . LYS A 1 44   ? -41.610 103.382 47.055  1.00 40.48 ? 44   LYS A CD  1 
ATOM   334   C  CE  . LYS A 1 44   ? -42.926 102.987 46.405  1.00 43.35 ? 44   LYS A CE  1 
ATOM   335   N  NZ  . LYS A 1 44   ? -43.678 101.998 47.231  1.00 46.16 ? 44   LYS A NZ  1 
ATOM   336   N  N   . ALA A 1 45   ? -36.426 105.598 46.954  1.00 28.83 ? 45   ALA A N   1 
ATOM   337   C  CA  . ALA A 1 45   ? -35.310 106.200 47.670  1.00 27.96 ? 45   ALA A CA  1 
ATOM   338   C  C   . ALA A 1 45   ? -34.759 107.345 46.812  1.00 27.22 ? 45   ALA A C   1 
ATOM   339   O  O   . ALA A 1 45   ? -34.472 108.425 47.316  1.00 27.99 ? 45   ALA A O   1 
ATOM   340   C  CB  . ALA A 1 45   ? -34.231 105.163 47.945  1.00 26.95 ? 45   ALA A CB  1 
ATOM   341   N  N   . LEU A 1 46   ? -34.630 107.115 45.513  1.00 27.56 ? 46   LEU A N   1 
ATOM   342   C  CA  . LEU A 1 46   ? -34.141 108.154 44.613  1.00 29.68 ? 46   LEU A CA  1 
ATOM   343   C  C   . LEU A 1 46   ? -35.068 109.363 44.651  1.00 31.70 ? 46   LEU A C   1 
ATOM   344   O  O   . LEU A 1 46   ? -34.601 110.498 44.558  1.00 31.60 ? 46   LEU A O   1 
ATOM   345   C  CB  . LEU A 1 46   ? -34.034 107.623 43.178  1.00 28.76 ? 46   LEU A CB  1 
ATOM   346   C  CG  . LEU A 1 46   ? -32.794 106.777 42.857  1.00 28.10 ? 46   LEU A CG  1 
ATOM   347   C  CD1 . LEU A 1 46   ? -32.786 106.422 41.385  1.00 27.41 ? 46   LEU A CD1 1 
ATOM   348   C  CD2 . LEU A 1 46   ? -31.526 107.561 43.183  1.00 27.75 ? 46   LEU A CD2 1 
ATOM   349   N  N   . ASP A 1 47   ? -36.375 109.117 44.788  1.00 33.27 ? 47   ASP A N   1 
ATOM   350   C  CA  . ASP A 1 47   ? -37.366 110.197 44.870  1.00 34.34 ? 47   ASP A CA  1 
ATOM   351   C  C   . ASP A 1 47   ? -37.128 111.128 46.069  1.00 34.84 ? 47   ASP A C   1 
ATOM   352   O  O   . ASP A 1 47   ? -37.436 112.320 46.005  1.00 35.28 ? 47   ASP A O   1 
ATOM   353   C  CB  . ASP A 1 47   ? -38.793 109.640 45.002  1.00 35.20 ? 47   ASP A CB  1 
ATOM   354   C  CG  . ASP A 1 47   ? -39.341 109.057 43.700  1.00 36.58 ? 47   ASP A CG  1 
ATOM   355   O  OD1 . ASP A 1 47   ? -38.922 109.488 42.598  1.00 34.29 ? 47   ASP A OD1 1 
ATOM   356   O  OD2 . ASP A 1 47   ? -40.224 108.170 43.791  1.00 34.98 ? 47   ASP A OD2 1 
ATOM   357   N  N   . GLU A 1 48   ? -36.597 110.581 47.163  1.00 34.16 ? 48   GLU A N   1 
ATOM   358   C  CA  . GLU A 1 48   ? -36.342 111.364 48.369  1.00 34.98 ? 48   GLU A CA  1 
ATOM   359   C  C   . GLU A 1 48   ? -35.185 112.354 48.255  1.00 35.31 ? 48   GLU A C   1 
ATOM   360   O  O   . GLU A 1 48   ? -35.046 113.245 49.094  1.00 36.02 ? 48   GLU A O   1 
ATOM   361   C  CB  . GLU A 1 48   ? -36.079 110.441 49.561  1.00 36.51 ? 48   GLU A CB  1 
ATOM   362   C  CG  . GLU A 1 48   ? -37.192 109.454 49.851  1.00 39.21 ? 48   GLU A CG  1 
ATOM   363   C  CD  . GLU A 1 48   ? -37.016 108.750 51.190  1.00 40.48 ? 48   GLU A CD  1 
ATOM   364   O  OE1 . GLU A 1 48   ? -35.884 108.306 51.492  1.00 39.10 ? 48   GLU A OE1 1 
ATOM   365   O  OE2 . GLU A 1 48   ? -38.015 108.639 51.937  1.00 42.44 ? 48   GLU A OE2 1 
ATOM   366   N  N   . ILE A 1 49   ? -34.350 112.202 47.231  1.00 34.29 ? 49   ILE A N   1 
ATOM   367   C  CA  . ILE A 1 49   ? -33.219 113.102 47.051  1.00 32.95 ? 49   ILE A CA  1 
ATOM   368   C  C   . ILE A 1 49   ? -33.644 114.455 46.467  1.00 33.19 ? 49   ILE A C   1 
ATOM   369   O  O   . ILE A 1 49   ? -34.235 114.523 45.387  1.00 34.47 ? 49   ILE A O   1 
ATOM   370   C  CB  . ILE A 1 49   ? -32.145 112.449 46.147  1.00 32.86 ? 49   ILE A CB  1 
ATOM   371   C  CG1 . ILE A 1 49   ? -31.656 111.152 46.797  1.00 32.25 ? 49   ILE A CG1 1 
ATOM   372   C  CG2 . ILE A 1 49   ? -30.997 113.413 45.906  1.00 30.78 ? 49   ILE A CG2 1 
ATOM   373   C  CD1 . ILE A 1 49   ? -30.894 110.231 45.860  1.00 31.78 ? 49   ILE A CD1 1 
ATOM   374   N  N   . PRO A 1 50   ? -33.342 115.554 47.183  1.00 32.75 ? 50   PRO A N   1 
ATOM   375   C  CA  . PRO A 1 50   ? -33.671 116.924 46.781  1.00 32.13 ? 50   PRO A CA  1 
ATOM   376   C  C   . PRO A 1 50   ? -32.665 117.443 45.765  1.00 32.13 ? 50   PRO A C   1 
ATOM   377   O  O   . PRO A 1 50   ? -31.860 118.326 46.062  1.00 32.30 ? 50   PRO A O   1 
ATOM   378   C  CB  . PRO A 1 50   ? -33.595 117.680 48.101  1.00 31.65 ? 50   PRO A CB  1 
ATOM   379   C  CG  . PRO A 1 50   ? -32.409 117.035 48.738  1.00 32.27 ? 50   PRO A CG  1 
ATOM   380   C  CD  . PRO A 1 50   ? -32.669 115.554 48.497  1.00 32.51 ? 50   PRO A CD  1 
ATOM   381   N  N   . PHE A 1 51   ? -32.716 116.889 44.563  1.00 32.35 ? 51   PHE A N   1 
ATOM   382   C  CA  . PHE A 1 51   ? -31.799 117.290 43.519  1.00 32.75 ? 51   PHE A CA  1 
ATOM   383   C  C   . PHE A 1 51   ? -31.685 118.796 43.365  1.00 33.58 ? 51   PHE A C   1 
ATOM   384   O  O   . PHE A 1 51   ? -32.623 119.529 43.625  1.00 34.56 ? 51   PHE A O   1 
ATOM   385   C  CB  . PHE A 1 51   ? -32.214 116.656 42.199  1.00 32.45 ? 51   PHE A CB  1 
ATOM   386   C  CG  . PHE A 1 51   ? -31.811 115.221 42.075  1.00 33.36 ? 51   PHE A CG  1 
ATOM   387   C  CD1 . PHE A 1 51   ? -30.483 114.873 41.818  1.00 32.12 ? 51   PHE A CD1 1 
ATOM   388   C  CD2 . PHE A 1 51   ? -32.747 114.208 42.238  1.00 32.97 ? 51   PHE A CD2 1 
ATOM   389   C  CE1 . PHE A 1 51   ? -30.099 113.545 41.726  1.00 29.15 ? 51   PHE A CE1 1 
ATOM   390   C  CE2 . PHE A 1 51   ? -32.363 112.869 42.149  1.00 33.01 ? 51   PHE A CE2 1 
ATOM   391   C  CZ  . PHE A 1 51   ? -31.035 112.543 41.890  1.00 30.39 ? 51   PHE A CZ  1 
ATOM   392   N  N   . SER A 1 52   ? -30.507 119.242 42.941  1.00 35.17 ? 52   SER A N   1 
ATOM   393   C  CA  . SER A 1 52   ? -30.206 120.655 42.719  1.00 35.47 ? 52   SER A CA  1 
ATOM   394   C  C   . SER A 1 52   ? -30.416 120.989 41.243  1.00 34.25 ? 52   SER A C   1 
ATOM   395   O  O   . SER A 1 52   ? -30.375 120.098 40.396  1.00 34.94 ? 52   SER A O   1 
ATOM   396   C  CB  . SER A 1 52   ? -28.747 120.943 43.122  1.00 36.47 ? 52   SER A CB  1 
ATOM   397   O  OG  . SER A 1 52   ? -28.353 122.259 42.761  1.00 37.35 ? 52   SER A OG  1 
ATOM   398   N  N   . ASP A 1 53   ? -30.633 122.264 40.932  1.00 32.95 ? 53   ASP A N   1 
ATOM   399   C  CA  . ASP A 1 53   ? -30.847 122.647 39.546  1.00 33.37 ? 53   ASP A CA  1 
ATOM   400   C  C   . ASP A 1 53   ? -29.639 122.313 38.679  1.00 32.41 ? 53   ASP A C   1 
ATOM   401   O  O   . ASP A 1 53   ? -29.783 122.027 37.489  1.00 31.24 ? 53   ASP A O   1 
ATOM   402   C  CB  . ASP A 1 53   ? -31.160 124.146 39.426  1.00 35.24 ? 53   ASP A CB  1 
ATOM   403   C  CG  . ASP A 1 53   ? -32.502 124.515 40.032  1.00 38.95 ? 53   ASP A CG  1 
ATOM   404   O  OD1 . ASP A 1 53   ? -33.449 123.699 39.946  1.00 39.90 ? 53   ASP A OD1 1 
ATOM   405   O  OD2 . ASP A 1 53   ? -32.619 125.628 40.582  1.00 39.11 ? 53   ASP A OD2 1 
ATOM   406   N  N   . ASP A 1 54   ? -28.448 122.335 39.274  1.00 32.46 ? 54   ASP A N   1 
ATOM   407   C  CA  . ASP A 1 54   ? -27.243 122.050 38.506  1.00 31.52 ? 54   ASP A CA  1 
ATOM   408   C  C   . ASP A 1 54   ? -27.117 120.588 38.115  1.00 30.59 ? 54   ASP A C   1 
ATOM   409   O  O   . ASP A 1 54   ? -26.222 120.233 37.348  1.00 31.64 ? 54   ASP A O   1 
ATOM   410   C  CB  . ASP A 1 54   ? -25.976 122.511 39.252  1.00 32.01 ? 54   ASP A CB  1 
ATOM   411   C  CG  . ASP A 1 54   ? -25.818 121.871 40.631  1.00 33.54 ? 54   ASP A CG  1 
ATOM   412   O  OD1 . ASP A 1 54   ? -26.176 120.686 40.818  1.00 33.49 ? 54   ASP A OD1 1 
ATOM   413   O  OD2 . ASP A 1 54   ? -25.301 122.566 41.532  1.00 34.50 ? 54   ASP A OD2 1 
ATOM   414   N  N   . ALA A 1 55   ? -28.005 119.741 38.632  1.00 29.33 ? 55   ALA A N   1 
ATOM   415   C  CA  . ALA A 1 55   ? -27.958 118.320 38.289  1.00 29.29 ? 55   ALA A CA  1 
ATOM   416   C  C   . ALA A 1 55   ? -28.938 118.023 37.163  1.00 30.31 ? 55   ALA A C   1 
ATOM   417   O  O   . ALA A 1 55   ? -29.085 116.878 36.727  1.00 29.94 ? 55   ALA A O   1 
ATOM   418   C  CB  . ALA A 1 55   ? -28.287 117.453 39.505  1.00 27.45 ? 55   ALA A CB  1 
ATOM   419   N  N   . MET A 1 56   ? -29.598 119.066 36.675  1.00 31.70 ? 56   MET A N   1 
ATOM   420   C  CA  . MET A 1 56   ? -30.585 118.895 35.624  1.00 33.31 ? 56   MET A CA  1 
ATOM   421   C  C   . MET A 1 56   ? -30.184 119.443 34.278  1.00 33.43 ? 56   MET A C   1 
ATOM   422   O  O   . MET A 1 56   ? -29.378 120.361 34.173  1.00 34.08 ? 56   MET A O   1 
ATOM   423   C  CB  . MET A 1 56   ? -31.901 119.544 36.039  1.00 34.71 ? 56   MET A CB  1 
ATOM   424   C  CG  . MET A 1 56   ? -32.489 118.987 37.317  1.00 35.57 ? 56   MET A CG  1 
ATOM   425   S  SD  . MET A 1 56   ? -33.981 119.888 37.781  1.00 39.63 ? 56   MET A SD  1 
ATOM   426   C  CE  . MET A 1 56   ? -34.036 119.603 39.584  1.00 36.81 ? 56   MET A CE  1 
ATOM   427   N  N   . LEU A 1 57   ? -30.764 118.860 33.243  1.00 33.38 ? 57   LEU A N   1 
ATOM   428   C  CA  . LEU A 1 57   ? -30.512 119.308 31.888  1.00 33.89 ? 57   LEU A CA  1 
ATOM   429   C  C   . LEU A 1 57   ? -31.697 118.837 31.056  1.00 32.44 ? 57   LEU A C   1 
ATOM   430   O  O   . LEU A 1 57   ? -32.438 117.949 31.466  1.00 32.49 ? 57   LEU A O   1 
ATOM   431   C  CB  . LEU A 1 57   ? -29.180 118.749 31.354  1.00 33.72 ? 57   LEU A CB  1 
ATOM   432   C  CG  . LEU A 1 57   ? -29.086 117.330 30.805  1.00 33.91 ? 57   LEU A CG  1 
ATOM   433   C  CD1 . LEU A 1 57   ? -27.615 116.994 30.581  1.00 31.01 ? 57   LEU A CD1 1 
ATOM   434   C  CD2 . LEU A 1 57   ? -29.702 116.354 31.774  1.00 33.67 ? 57   LEU A CD2 1 
ATOM   435   N  N   . PRO A 1 58   ? -31.907 119.443 29.889  1.00 31.55 ? 58   PRO A N   1 
ATOM   436   C  CA  . PRO A 1 58   ? -33.026 119.075 29.009  1.00 31.86 ? 58   PRO A CA  1 
ATOM   437   C  C   . PRO A 1 58   ? -32.998 117.628 28.529  1.00 31.53 ? 58   PRO A C   1 
ATOM   438   O  O   . PRO A 1 58   ? -32.006 117.172 27.987  1.00 33.04 ? 58   PRO A O   1 
ATOM   439   C  CB  . PRO A 1 58   ? -32.880 120.054 27.847  1.00 31.42 ? 58   PRO A CB  1 
ATOM   440   C  CG  . PRO A 1 58   ? -32.230 121.257 28.508  1.00 31.68 ? 58   PRO A CG  1 
ATOM   441   C  CD  . PRO A 1 58   ? -31.184 120.609 29.363  1.00 30.69 ? 58   PRO A CD  1 
ATOM   442   N  N   . ILE A 1 59   ? -34.087 116.902 28.736  1.00 31.50 ? 59   ILE A N   1 
ATOM   443   C  CA  . ILE A 1 59   ? -34.150 115.525 28.268  1.00 30.48 ? 59   ILE A CA  1 
ATOM   444   C  C   . ILE A 1 59   ? -35.012 115.425 27.004  1.00 30.45 ? 59   ILE A C   1 
ATOM   445   O  O   . ILE A 1 59   ? -36.220 115.619 27.050  1.00 30.84 ? 59   ILE A O   1 
ATOM   446   C  CB  . ILE A 1 59   ? -34.697 114.582 29.353  1.00 28.05 ? 59   ILE A CB  1 
ATOM   447   C  CG1 . ILE A 1 59   ? -33.720 114.541 30.519  1.00 28.15 ? 59   ILE A CG1 1 
ATOM   448   C  CG2 . ILE A 1 59   ? -34.858 113.171 28.800  1.00 26.01 ? 59   ILE A CG2 1 
ATOM   449   C  CD1 . ILE A 1 59   ? -34.156 113.632 31.630  1.00 30.34 ? 59   ILE A CD1 1 
ATOM   450   N  N   . PRO A 1 60   ? -34.383 115.110 25.857  1.00 30.87 ? 60   PRO A N   1 
ATOM   451   C  CA  . PRO A 1 60   ? -35.013 114.967 24.538  1.00 32.17 ? 60   PRO A CA  1 
ATOM   452   C  C   . PRO A 1 60   ? -36.296 114.143 24.591  1.00 33.47 ? 60   PRO A C   1 
ATOM   453   O  O   . PRO A 1 60   ? -36.263 112.948 24.879  1.00 32.94 ? 60   PRO A O   1 
ATOM   454   C  CB  . PRO A 1 60   ? -33.934 114.270 23.706  1.00 30.90 ? 60   PRO A CB  1 
ATOM   455   C  CG  . PRO A 1 60   ? -32.672 114.755 24.329  1.00 30.71 ? 60   PRO A CG  1 
ATOM   456   C  CD  . PRO A 1 60   ? -32.975 114.680 25.807  1.00 30.09 ? 60   PRO A CD  1 
ATOM   457   N  N   . PRO A 1 61   ? -37.445 114.769 24.293  1.00 34.87 ? 61   PRO A N   1 
ATOM   458   C  CA  . PRO A 1 61   ? -38.716 114.029 24.329  1.00 34.66 ? 61   PRO A CA  1 
ATOM   459   C  C   . PRO A 1 61   ? -38.713 112.860 23.343  1.00 33.24 ? 61   PRO A C   1 
ATOM   460   O  O   . PRO A 1 61   ? -39.397 111.864 23.552  1.00 32.15 ? 61   PRO A O   1 
ATOM   461   C  CB  . PRO A 1 61   ? -39.757 115.096 23.958  1.00 34.49 ? 61   PRO A CB  1 
ATOM   462   C  CG  . PRO A 1 61   ? -39.095 116.384 24.383  1.00 35.63 ? 61   PRO A CG  1 
ATOM   463   C  CD  . PRO A 1 61   ? -37.667 116.179 23.930  1.00 35.18 ? 61   PRO A CD  1 
ATOM   464   N  N   . THR A 1 62   ? -37.931 112.991 22.277  1.00 32.69 ? 62   THR A N   1 
ATOM   465   C  CA  . THR A 1 62   ? -37.848 111.958 21.251  1.00 34.10 ? 62   THR A CA  1 
ATOM   466   C  C   . THR A 1 62   ? -37.184 110.665 21.731  1.00 34.52 ? 62   THR A C   1 
ATOM   467   O  O   . THR A 1 62   ? -37.136 109.675 21.006  1.00 34.61 ? 62   THR A O   1 
ATOM   468   C  CB  . THR A 1 62   ? -37.097 112.479 20.004  1.00 34.29 ? 62   THR A CB  1 
ATOM   469   O  OG1 . THR A 1 62   ? -35.716 112.680 20.322  1.00 33.85 ? 62   THR A OG1 1 
ATOM   470   C  CG2 . THR A 1 62   ? -37.691 113.810 19.549  1.00 34.29 ? 62   THR A CG2 1 
ATOM   471   N  N   . ILE A 1 63   ? -36.665 110.671 22.950  1.00 34.72 ? 63   ILE A N   1 
ATOM   472   C  CA  . ILE A 1 63   ? -36.037 109.478 23.491  1.00 34.47 ? 63   ILE A CA  1 
ATOM   473   C  C   . ILE A 1 63   ? -37.101 108.409 23.744  1.00 34.32 ? 63   ILE A C   1 
ATOM   474   O  O   . ILE A 1 63   ? -36.852 107.211 23.596  1.00 33.51 ? 63   ILE A O   1 
ATOM   475   C  CB  . ILE A 1 63   ? -35.315 109.805 24.820  1.00 35.88 ? 63   ILE A CB  1 
ATOM   476   C  CG1 . ILE A 1 63   ? -33.872 110.212 24.533  1.00 36.52 ? 63   ILE A CG1 1 
ATOM   477   C  CG2 . ILE A 1 63   ? -35.384 108.634 25.772  1.00 36.00 ? 63   ILE A CG2 1 
ATOM   478   C  CD1 . ILE A 1 63   ? -33.044 110.371 25.780  1.00 38.78 ? 63   ILE A CD1 1 
ATOM   479   N  N   . TYR A 1 64   ? -38.302 108.862 24.091  1.00 33.69 ? 64   TYR A N   1 
ATOM   480   C  CA  . TYR A 1 64   ? -39.408 107.967 24.430  1.00 33.02 ? 64   TYR A CA  1 
ATOM   481   C  C   . TYR A 1 64   ? -40.341 107.536 23.308  1.00 33.73 ? 64   TYR A C   1 
ATOM   482   O  O   . TYR A 1 64   ? -40.904 106.450 23.352  1.00 34.93 ? 64   TYR A O   1 
ATOM   483   C  CB  . TYR A 1 64   ? -40.252 108.607 25.529  1.00 30.46 ? 64   TYR A CB  1 
ATOM   484   C  CG  . TYR A 1 64   ? -39.450 109.140 26.693  1.00 29.49 ? 64   TYR A CG  1 
ATOM   485   C  CD1 . TYR A 1 64   ? -38.889 108.276 27.633  1.00 27.13 ? 64   TYR A CD1 1 
ATOM   486   C  CD2 . TYR A 1 64   ? -39.289 110.517 26.881  1.00 27.21 ? 64   TYR A CD2 1 
ATOM   487   C  CE1 . TYR A 1 64   ? -38.202 108.769 28.740  1.00 26.40 ? 64   TYR A CE1 1 
ATOM   488   C  CE2 . TYR A 1 64   ? -38.599 111.015 27.979  1.00 25.60 ? 64   TYR A CE2 1 
ATOM   489   C  CZ  . TYR A 1 64   ? -38.060 110.136 28.906  1.00 26.06 ? 64   TYR A CZ  1 
ATOM   490   O  OH  . TYR A 1 64   ? -37.390 110.618 30.006  1.00 24.12 ? 64   TYR A OH  1 
ATOM   491   N  N   . THR A 1 65   ? -40.536 108.382 22.311  1.00 34.09 ? 65   THR A N   1 
ATOM   492   C  CA  . THR A 1 65   ? -41.446 108.024 21.233  1.00 34.85 ? 65   THR A CA  1 
ATOM   493   C  C   . THR A 1 65   ? -40.638 107.540 20.046  1.00 34.42 ? 65   THR A C   1 
ATOM   494   O  O   . THR A 1 65   ? -40.063 108.342 19.319  1.00 34.67 ? 65   THR A O   1 
ATOM   495   C  CB  . THR A 1 65   ? -42.292 109.237 20.823  1.00 35.89 ? 65   THR A CB  1 
ATOM   496   O  OG1 . THR A 1 65   ? -41.442 110.233 20.230  1.00 36.60 ? 65   THR A OG1 1 
ATOM   497   C  CG2 . THR A 1 65   ? -42.970 109.832 22.053  1.00 35.15 ? 65   THR A CG2 1 
ATOM   498   N  N   . LYS A 1 66   ? -40.587 106.229 19.848  1.00 33.56 ? 66   LYS A N   1 
ATOM   499   C  CA  . LYS A 1 66   ? -39.805 105.681 18.743  1.00 33.52 ? 66   LYS A CA  1 
ATOM   500   C  C   . LYS A 1 66   ? -40.587 104.835 17.755  1.00 34.23 ? 66   LYS A C   1 
ATOM   501   O  O   . LYS A 1 66   ? -41.609 104.239 18.096  1.00 36.16 ? 66   LYS A O   1 
ATOM   502   C  CB  . LYS A 1 66   ? -38.618 104.864 19.272  1.00 31.51 ? 66   LYS A CB  1 
ATOM   503   C  CG  . LYS A 1 66   ? -37.454 105.712 19.757  1.00 28.94 ? 66   LYS A CG  1 
ATOM   504   C  CD  . LYS A 1 66   ? -36.939 106.638 18.653  1.00 27.53 ? 66   LYS A CD  1 
ATOM   505   C  CE  . LYS A 1 66   ? -35.752 107.465 19.143  1.00 27.06 ? 66   LYS A CE  1 
ATOM   506   N  NZ  . LYS A 1 66   ? -35.188 108.342 18.091  1.00 25.09 ? 66   LYS A NZ  1 
ATOM   507   N  N   . PRO A 1 67   ? -40.094 104.761 16.505  1.00 34.23 ? 67   PRO A N   1 
ATOM   508   C  CA  . PRO A 1 67   ? -40.698 104.002 15.403  1.00 32.91 ? 67   PRO A CA  1 
ATOM   509   C  C   . PRO A 1 67   ? -40.696 102.497 15.603  1.00 32.35 ? 67   PRO A C   1 
ATOM   510   O  O   . PRO A 1 67   ? -40.055 101.962 16.516  1.00 33.70 ? 67   PRO A O   1 
ATOM   511   C  CB  . PRO A 1 67   ? -39.832 104.384 14.201  1.00 32.14 ? 67   PRO A CB  1 
ATOM   512   C  CG  . PRO A 1 67   ? -39.271 105.712 14.572  1.00 34.14 ? 67   PRO A CG  1 
ATOM   513   C  CD  . PRO A 1 67   ? -38.933 105.527 16.022  1.00 33.59 ? 67   PRO A CD  1 
ATOM   514   N  N   . SER A 1 68   ? -41.407 101.822 14.711  1.00 31.13 ? 68   SER A N   1 
ATOM   515   C  CA  . SER A 1 68   ? -41.487 100.370 14.711  1.00 29.32 ? 68   SER A CA  1 
ATOM   516   C  C   . SER A 1 68   ? -40.167 99.821  14.177  1.00 29.12 ? 68   SER A C   1 
ATOM   517   O  O   . SER A 1 68   ? -39.587 100.367 13.236  1.00 29.47 ? 68   SER A O   1 
ATOM   518   C  CB  . SER A 1 68   ? -42.627 99.902  13.803  1.00 27.40 ? 68   SER A CB  1 
ATOM   519   O  OG  . SER A 1 68   ? -42.634 98.490  13.699  1.00 25.48 ? 68   SER A OG  1 
ATOM   520   N  N   . HIS A 1 69   ? -39.702 98.736  14.773  1.00 28.64 ? 69   HIS A N   1 
ATOM   521   C  CA  . HIS A 1 69   ? -38.463 98.110  14.349  1.00 28.76 ? 69   HIS A CA  1 
ATOM   522   C  C   . HIS A 1 69   ? -38.552 97.661  12.889  1.00 29.91 ? 69   HIS A C   1 
ATOM   523   O  O   . HIS A 1 69   ? -37.538 97.619  12.194  1.00 30.25 ? 69   HIS A O   1 
ATOM   524   C  CB  . HIS A 1 69   ? -38.203 96.861  15.185  1.00 27.99 ? 69   HIS A CB  1 
ATOM   525   C  CG  . HIS A 1 69   ? -39.116 95.726  14.834  1.00 26.87 ? 69   HIS A CG  1 
ATOM   526   N  ND1 . HIS A 1 69   ? -40.457 95.736  15.149  1.00 25.74 ? 69   HIS A ND1 1 
ATOM   527   C  CD2 . HIS A 1 69   ? -38.912 94.614  14.089  1.00 27.40 ? 69   HIS A CD2 1 
ATOM   528   C  CE1 . HIS A 1 69   ? -41.039 94.678  14.606  1.00 28.57 ? 69   HIS A CE1 1 
ATOM   529   N  NE2 . HIS A 1 69   ? -40.123 93.983  13.956  1.00 27.97 ? 69   HIS A NE2 1 
ATOM   530   N  N   . ASP A 1 70   ? -39.759 97.323  12.432  1.00 31.28 ? 70   ASP A N   1 
ATOM   531   C  CA  . ASP A 1 70   ? -39.938 96.781  11.084  1.00 31.61 ? 70   ASP A CA  1 
ATOM   532   C  C   . ASP A 1 70   ? -39.220 97.421  9.883   1.00 31.60 ? 70   ASP A C   1 
ATOM   533   O  O   . ASP A 1 70   ? -38.673 96.701  9.051   1.00 31.74 ? 70   ASP A O   1 
ATOM   534   C  CB  . ASP A 1 70   ? -41.438 96.585  10.789  1.00 32.31 ? 70   ASP A CB  1 
ATOM   535   C  CG  . ASP A 1 70   ? -42.199 97.886  10.627  1.00 33.81 ? 70   ASP A CG  1 
ATOM   536   O  OD1 . ASP A 1 70   ? -41.646 98.971  10.920  1.00 35.89 ? 70   ASP A OD1 1 
ATOM   537   O  OD2 . ASP A 1 70   ? -43.378 97.814  10.205  1.00 33.38 ? 70   ASP A OD2 1 
ATOM   538   N  N   . SER A 1 71   ? -39.177 98.745  9.791   1.00 31.06 ? 71   SER A N   1 
ATOM   539   C  CA  . SER A 1 71   ? -38.511 99.387  8.657   1.00 30.10 ? 71   SER A CA  1 
ATOM   540   C  C   . SER A 1 71   ? -36.989 99.319  8.731   1.00 31.33 ? 71   SER A C   1 
ATOM   541   O  O   . SER A 1 71   ? -36.284 99.792  7.831   1.00 31.17 ? 71   SER A O   1 
ATOM   542   C  CB  . SER A 1 71   ? -38.942 100.845 8.569   1.00 30.13 ? 71   SER A CB  1 
ATOM   543   O  OG  . SER A 1 71   ? -38.918 101.446 9.843   1.00 30.32 ? 71   SER A OG  1 
ATOM   544   N  N   . TYR A 1 72   ? -36.484 98.713  9.804   1.00 30.20 ? 72   TYR A N   1 
ATOM   545   C  CA  . TYR A 1 72   ? -35.050 98.605  10.026  1.00 28.10 ? 72   TYR A CA  1 
ATOM   546   C  C   . TYR A 1 72   ? -34.450 97.267  9.633   1.00 27.83 ? 72   TYR A C   1 
ATOM   547   O  O   . TYR A 1 72   ? -33.253 97.051  9.802   1.00 28.63 ? 72   TYR A O   1 
ATOM   548   C  CB  . TYR A 1 72   ? -34.751 98.907  11.493  1.00 26.28 ? 72   TYR A CB  1 
ATOM   549   C  CG  . TYR A 1 72   ? -34.854 100.379 11.811  1.00 26.87 ? 72   TYR A CG  1 
ATOM   550   C  CD1 . TYR A 1 72   ? -33.851 101.261 11.424  1.00 26.59 ? 72   TYR A CD1 1 
ATOM   551   C  CD2 . TYR A 1 72   ? -35.981 100.905 12.438  1.00 27.34 ? 72   TYR A CD2 1 
ATOM   552   C  CE1 . TYR A 1 72   ? -33.963 102.622 11.643  1.00 26.47 ? 72   TYR A CE1 1 
ATOM   553   C  CE2 . TYR A 1 72   ? -36.104 102.272 12.664  1.00 26.68 ? 72   TYR A CE2 1 
ATOM   554   C  CZ  . TYR A 1 72   ? -35.088 103.123 12.263  1.00 28.06 ? 72   TYR A CZ  1 
ATOM   555   O  OH  . TYR A 1 72   ? -35.195 104.482 12.482  1.00 28.39 ? 72   TYR A OH  1 
ATOM   556   N  N   . TYR A 1 73   ? -35.272 96.369  9.108   1.00 27.94 ? 73   TYR A N   1 
ATOM   557   C  CA  . TYR A 1 73   ? -34.782 95.066  8.693   1.00 27.89 ? 73   TYR A CA  1 
ATOM   558   C  C   . TYR A 1 73   ? -35.361 94.666  7.350   1.00 28.69 ? 73   TYR A C   1 
ATOM   559   O  O   . TYR A 1 73   ? -36.261 95.327  6.827   1.00 27.76 ? 73   TYR A O   1 
ATOM   560   C  CB  . TYR A 1 73   ? -35.157 94.023  9.730   1.00 27.73 ? 73   TYR A CB  1 
ATOM   561   C  CG  . TYR A 1 73   ? -34.543 94.261  11.085  1.00 28.18 ? 73   TYR A CG  1 
ATOM   562   C  CD1 . TYR A 1 73   ? -33.292 93.726  11.406  1.00 27.37 ? 73   TYR A CD1 1 
ATOM   563   C  CD2 . TYR A 1 73   ? -35.210 95.018  12.049  1.00 27.56 ? 73   TYR A CD2 1 
ATOM   564   C  CE1 . TYR A 1 73   ? -32.727 93.934  12.644  1.00 25.95 ? 73   TYR A CE1 1 
ATOM   565   C  CE2 . TYR A 1 73   ? -34.640 95.239  13.299  1.00 27.24 ? 73   TYR A CE2 1 
ATOM   566   C  CZ  . TYR A 1 73   ? -33.404 94.688  13.584  1.00 27.54 ? 73   TYR A CZ  1 
ATOM   567   O  OH  . TYR A 1 73   ? -32.839 94.883  14.818  1.00 28.04 ? 73   TYR A OH  1 
ATOM   568   N  N   . TYR A 1 74   ? -34.824 93.583  6.794   1.00 29.87 ? 74   TYR A N   1 
ATOM   569   C  CA  . TYR A 1 74   ? -35.288 93.056  5.517   1.00 29.98 ? 74   TYR A CA  1 
ATOM   570   C  C   . TYR A 1 74   ? -34.756 91.633  5.365   1.00 30.24 ? 74   TYR A C   1 
ATOM   571   O  O   . TYR A 1 74   ? -34.021 91.147  6.222   1.00 29.82 ? 74   TYR A O   1 
ATOM   572   C  CB  . TYR A 1 74   ? -34.801 93.959  4.367   1.00 30.32 ? 74   TYR A CB  1 
ATOM   573   C  CG  . TYR A 1 74   ? -33.347 93.787  3.969   1.00 31.00 ? 74   TYR A CG  1 
ATOM   574   C  CD1 . TYR A 1 74   ? -32.977 92.907  2.951   1.00 30.72 ? 74   TYR A CD1 1 
ATOM   575   C  CD2 . TYR A 1 74   ? -32.340 94.517  4.600   1.00 31.43 ? 74   TYR A CD2 1 
ATOM   576   C  CE1 . TYR A 1 74   ? -31.642 92.760  2.572   1.00 30.79 ? 74   TYR A CE1 1 
ATOM   577   C  CE2 . TYR A 1 74   ? -31.002 94.375  4.233   1.00 29.93 ? 74   TYR A CE2 1 
ATOM   578   C  CZ  . TYR A 1 74   ? -30.658 93.500  3.219   1.00 31.64 ? 74   TYR A CZ  1 
ATOM   579   O  OH  . TYR A 1 74   ? -29.328 93.357  2.868   1.00 32.41 ? 74   TYR A OH  1 
ATOM   580   N  N   . ILE A 1 75   ? -35.146 90.957  4.288   1.00 31.08 ? 75   ILE A N   1 
ATOM   581   C  CA  . ILE A 1 75   ? -34.677 89.598  4.031   1.00 30.82 ? 75   ILE A CA  1 
ATOM   582   C  C   . ILE A 1 75   ? -33.774 89.674  2.794   1.00 32.30 ? 75   ILE A C   1 
ATOM   583   O  O   . ILE A 1 75   ? -34.196 90.197  1.760   1.00 31.91 ? 75   ILE A O   1 
ATOM   584   C  CB  . ILE A 1 75   ? -35.843 88.655  3.722   1.00 30.28 ? 75   ILE A CB  1 
ATOM   585   C  CG1 . ILE A 1 75   ? -36.911 88.751  4.819   1.00 28.62 ? 75   ILE A CG1 1 
ATOM   586   C  CG2 . ILE A 1 75   ? -35.312 87.235  3.557   1.00 29.83 ? 75   ILE A CG2 1 
ATOM   587   C  CD1 . ILE A 1 75   ? -36.466 88.243  6.182   1.00 26.73 ? 75   ILE A CD1 1 
ATOM   588   N  N   . ASP A 1 76   ? -32.538 89.178  2.877   1.00 32.85 ? 76   ASP A N   1 
ATOM   589   C  CA  . ASP A 1 76   ? -31.661 89.269  1.712   1.00 32.85 ? 76   ASP A CA  1 
ATOM   590   C  C   . ASP A 1 76   ? -31.815 88.104  0.733   1.00 32.23 ? 76   ASP A C   1 
ATOM   591   O  O   . ASP A 1 76   ? -32.634 87.200  0.933   1.00 31.44 ? 76   ASP A O   1 
ATOM   592   C  CB  . ASP A 1 76   ? -30.194 89.401  2.127   1.00 32.37 ? 76   ASP A CB  1 
ATOM   593   C  CG  . ASP A 1 76   ? -29.687 88.198  2.893   1.00 33.32 ? 76   ASP A CG  1 
ATOM   594   O  OD1 . ASP A 1 76   ? -30.123 87.067  2.610   1.00 33.29 ? 76   ASP A OD1 1 
ATOM   595   O  OD2 . ASP A 1 76   ? -28.832 88.387  3.776   1.00 32.45 ? 76   ASP A OD2 1 
ATOM   596   N  N   . ALA A 1 77   ? -31.023 88.144  -0.332  1.00 31.84 ? 77   ALA A N   1 
ATOM   597   C  CA  . ALA A 1 77   ? -31.069 87.107  -1.356  1.00 33.54 ? 77   ALA A CA  1 
ATOM   598   C  C   . ALA A 1 77   ? -30.841 85.693  -0.817  1.00 33.31 ? 77   ALA A C   1 
ATOM   599   O  O   . ALA A 1 77   ? -31.308 84.717  -1.401  1.00 33.46 ? 77   ALA A O   1 
ATOM   600   C  CB  . ALA A 1 77   ? -30.059 87.424  -2.455  1.00 33.59 ? 77   ALA A CB  1 
ATOM   601   N  N   . LEU A 1 78   ? -30.123 85.588  0.294   1.00 33.39 ? 78   LEU A N   1 
ATOM   602   C  CA  . LEU A 1 78   ? -29.849 84.292  0.903   1.00 32.61 ? 78   LEU A CA  1 
ATOM   603   C  C   . LEU A 1 78   ? -30.830 84.012  2.039   1.00 33.01 ? 78   LEU A C   1 
ATOM   604   O  O   . LEU A 1 78   ? -30.598 83.145  2.885   1.00 32.79 ? 78   LEU A O   1 
ATOM   605   C  CB  . LEU A 1 78   ? -28.407 84.254  1.410   1.00 32.89 ? 78   LEU A CB  1 
ATOM   606   C  CG  . LEU A 1 78   ? -27.382 84.652  0.339   1.00 33.76 ? 78   LEU A CG  1 
ATOM   607   C  CD1 . LEU A 1 78   ? -25.966 84.400  0.838   1.00 34.24 ? 78   LEU A CD1 1 
ATOM   608   C  CD2 . LEU A 1 78   ? -27.650 83.860  -0.930  1.00 33.53 ? 78   LEU A CD2 1 
ATOM   609   N  N   . ASN A 1 79   ? -31.929 84.761  2.051   1.00 32.79 ? 79   ASN A N   1 
ATOM   610   C  CA  . ASN A 1 79   ? -32.969 84.599  3.065   1.00 33.03 ? 79   ASN A CA  1 
ATOM   611   C  C   . ASN A 1 79   ? -32.521 84.856  4.514   1.00 32.15 ? 79   ASN A C   1 
ATOM   612   O  O   . ASN A 1 79   ? -33.152 84.369  5.462   1.00 30.42 ? 79   ASN A O   1 
ATOM   613   C  CB  . ASN A 1 79   ? -33.578 83.196  2.949   1.00 34.06 ? 79   ASN A CB  1 
ATOM   614   C  CG  . ASN A 1 79   ? -35.023 83.149  3.423   1.00 35.98 ? 79   ASN A CG  1 
ATOM   615   O  OD1 . ASN A 1 79   ? -35.817 84.034  3.107   1.00 37.08 ? 79   ASN A OD1 1 
ATOM   616   N  ND2 . ASN A 1 79   ? -35.371 82.111  4.176   1.00 37.41 ? 79   ASN A ND2 1 
ATOM   617   N  N   . ARG A 1 80   ? -31.437 85.617  4.676   1.00 31.16 ? 80   ARG A N   1 
ATOM   618   C  CA  . ARG A 1 80   ? -30.916 85.947  5.998   1.00 31.42 ? 80   ARG A CA  1 
ATOM   619   C  C   . ARG A 1 80   ? -31.583 87.240  6.484   1.00 31.49 ? 80   ARG A C   1 
ATOM   620   O  O   . ARG A 1 80   ? -31.634 88.219  5.741   1.00 31.69 ? 80   ARG A O   1 
ATOM   621   C  CB  . ARG A 1 80   ? -29.394 86.195  5.973   1.00 31.08 ? 80   ARG A CB  1 
ATOM   622   C  CG  . ARG A 1 80   ? -28.553 85.357  5.015   1.00 32.87 ? 80   ARG A CG  1 
ATOM   623   C  CD  . ARG A 1 80   ? -27.104 85.271  5.526   1.00 33.59 ? 80   ARG A CD  1 
ATOM   624   N  NE  . ARG A 1 80   ? -26.068 85.352  4.493   1.00 35.92 ? 80   ARG A NE  1 
ATOM   625   C  CZ  . ARG A 1 80   ? -25.868 86.428  3.740   1.00 37.61 ? 80   ARG A CZ  1 
ATOM   626   N  NH1 . ARG A 1 80   ? -26.638 87.488  3.912   1.00 38.22 ? 80   ARG A NH1 1 
ATOM   627   N  NH2 . ARG A 1 80   ? -24.894 86.467  2.843   1.00 36.91 ? 80   ARG A NH2 1 
ATOM   628   N  N   . VAL A 1 81   ? -32.100 87.248  7.711   1.00 30.63 ? 81   VAL A N   1 
ATOM   629   C  CA  . VAL A 1 81   ? -32.687 88.472  8.245   1.00 31.25 ? 81   VAL A CA  1 
ATOM   630   C  C   . VAL A 1 81   ? -31.543 89.478  8.356   1.00 31.67 ? 81   VAL A C   1 
ATOM   631   O  O   . VAL A 1 81   ? -30.558 89.246  9.061   1.00 30.76 ? 81   VAL A O   1 
ATOM   632   C  CB  . VAL A 1 81   ? -33.269 88.289  9.650   1.00 30.33 ? 81   VAL A CB  1 
ATOM   633   C  CG1 . VAL A 1 81   ? -33.773 89.621  10.153  1.00 29.56 ? 81   VAL A CG1 1 
ATOM   634   C  CG2 . VAL A 1 81   ? -34.408 87.273  9.623   1.00 32.03 ? 81   VAL A CG2 1 
ATOM   635   N  N   . ARG A 1 82   ? -31.663 90.598  7.663   1.00 31.85 ? 82   ARG A N   1 
ATOM   636   C  CA  . ARG A 1 82   ? -30.596 91.576  7.705   1.00 32.27 ? 82   ARG A CA  1 
ATOM   637   C  C   . ARG A 1 82   ? -31.050 92.900  8.274   1.00 31.84 ? 82   ARG A C   1 
ATOM   638   O  O   . ARG A 1 82   ? -32.240 93.178  8.392   1.00 32.80 ? 82   ARG A O   1 
ATOM   639   C  CB  . ARG A 1 82   ? -30.019 91.786  6.294   1.00 33.58 ? 82   ARG A CB  1 
ATOM   640   C  CG  . ARG A 1 82   ? -29.178 90.623  5.788   1.00 34.65 ? 82   ARG A CG  1 
ATOM   641   C  CD  . ARG A 1 82   ? -27.819 90.587  6.466   1.00 36.02 ? 82   ARG A CD  1 
ATOM   642   N  NE  . ARG A 1 82   ? -26.970 91.667  5.970   1.00 35.84 ? 82   ARG A NE  1 
ATOM   643   C  CZ  . ARG A 1 82   ? -26.437 91.711  4.751   1.00 36.04 ? 82   ARG A CZ  1 
ATOM   644   N  NH1 . ARG A 1 82   ? -26.653 90.729  3.885   1.00 33.73 ? 82   ARG A NH1 1 
ATOM   645   N  NH2 . ARG A 1 82   ? -25.693 92.749  4.392   1.00 36.02 ? 82   ARG A NH2 1 
ATOM   646   N  N   . ARG A 1 83   ? -30.079 93.719  8.626   1.00 31.77 ? 83   ARG A N   1 
ATOM   647   C  CA  . ARG A 1 83   ? -30.371 95.027  9.149   1.00 31.16 ? 83   ARG A CA  1 
ATOM   648   C  C   . ARG A 1 83   ? -30.384 95.992  7.963   1.00 29.95 ? 83   ARG A C   1 
ATOM   649   O  O   . ARG A 1 83   ? -29.434 96.049  7.184   1.00 28.53 ? 83   ARG A O   1 
ATOM   650   C  CB  . ARG A 1 83   ? -29.295 95.409  10.159  1.00 32.13 ? 83   ARG A CB  1 
ATOM   651   C  CG  . ARG A 1 83   ? -29.423 96.794  10.698  1.00 34.63 ? 83   ARG A CG  1 
ATOM   652   C  CD  . ARG A 1 83   ? -30.634 96.990  11.581  1.00 33.16 ? 83   ARG A CD  1 
ATOM   653   N  NE  . ARG A 1 83   ? -30.451 98.215  12.348  1.00 33.65 ? 83   ARG A NE  1 
ATOM   654   C  CZ  . ARG A 1 83   ? -30.392 99.430  11.821  1.00 32.47 ? 83   ARG A CZ  1 
ATOM   655   N  NH1 . ARG A 1 83   ? -30.515 99.605  10.519  1.00 32.58 ? 83   ARG A NH1 1 
ATOM   656   N  NH2 . ARG A 1 83   ? -30.187 100.476 12.599  1.00 37.57 ? 83   ARG A NH2 1 
ATOM   657   N  N   . LYS A 1 84   ? -31.476 96.731  7.815   1.00 30.71 ? 84   LYS A N   1 
ATOM   658   C  CA  . LYS A 1 84   ? -31.612 97.689  6.724   1.00 31.67 ? 84   LYS A CA  1 
ATOM   659   C  C   . LYS A 1 84   ? -30.860 98.967  7.088   1.00 31.24 ? 84   LYS A C   1 
ATOM   660   O  O   . LYS A 1 84   ? -31.143 99.602  8.106   1.00 30.57 ? 84   LYS A O   1 
ATOM   661   C  CB  . LYS A 1 84   ? -33.089 97.995  6.489   1.00 34.14 ? 84   LYS A CB  1 
ATOM   662   C  CG  . LYS A 1 84   ? -33.448 98.397  5.073   1.00 38.56 ? 84   LYS A CG  1 
ATOM   663   C  CD  . LYS A 1 84   ? -32.971 99.790  4.730   1.00 41.49 ? 84   LYS A CD  1 
ATOM   664   C  CE  . LYS A 1 84   ? -33.663 100.307 3.466   1.00 44.33 ? 84   LYS A CE  1 
ATOM   665   N  NZ  . LYS A 1 84   ? -35.097 100.663 3.738   1.00 45.39 ? 84   LYS A NZ  1 
ATOM   666   N  N   . THR A 1 85   ? -29.908 99.340  6.242   1.00 30.74 ? 85   THR A N   1 
ATOM   667   C  CA  . THR A 1 85   ? -29.085 100.524 6.451   1.00 31.73 ? 85   THR A CA  1 
ATOM   668   C  C   . THR A 1 85   ? -29.667 101.884 6.040   1.00 32.62 ? 85   THR A C   1 
ATOM   669   O  O   . THR A 1 85   ? -30.287 102.008 4.984   1.00 32.86 ? 85   THR A O   1 
ATOM   670   C  CB  . THR A 1 85   ? -27.744 100.338 5.742   1.00 31.54 ? 85   THR A CB  1 
ATOM   671   O  OG1 . THR A 1 85   ? -26.856 99.639  6.627   1.00 30.33 ? 85   THR A OG1 1 
ATOM   672   C  CG2 . THR A 1 85   ? -27.157 101.690 5.311   1.00 30.45 ? 85   THR A CG2 1 
ATOM   673   N  N   . TYR A 1 86   ? -29.435 102.898 6.878   1.00 32.38 ? 86   TYR A N   1 
ATOM   674   C  CA  . TYR A 1 86   ? -29.907 104.262 6.626   1.00 32.50 ? 86   TYR A CA  1 
ATOM   675   C  C   . TYR A 1 86   ? -28.814 105.322 6.839   1.00 33.38 ? 86   TYR A C   1 
ATOM   676   O  O   . TYR A 1 86   ? -28.710 106.284 6.076   1.00 32.78 ? 86   TYR A O   1 
ATOM   677   C  CB  . TYR A 1 86   ? -31.098 104.598 7.539   1.00 33.34 ? 86   TYR A CB  1 
ATOM   678   C  CG  . TYR A 1 86   ? -32.379 103.877 7.179   1.00 32.75 ? 86   TYR A CG  1 
ATOM   679   C  CD1 . TYR A 1 86   ? -33.061 104.182 6.002   1.00 32.55 ? 86   TYR A CD1 1 
ATOM   680   C  CD2 . TYR A 1 86   ? -32.888 102.871 7.996   1.00 32.04 ? 86   TYR A CD2 1 
ATOM   681   C  CE1 . TYR A 1 86   ? -34.227 103.500 5.642   1.00 33.74 ? 86   TYR A CE1 1 
ATOM   682   C  CE2 . TYR A 1 86   ? -34.045 102.182 7.651   1.00 33.32 ? 86   TYR A CE2 1 
ATOM   683   C  CZ  . TYR A 1 86   ? -34.713 102.499 6.468   1.00 33.99 ? 86   TYR A CZ  1 
ATOM   684   O  OH  . TYR A 1 86   ? -35.854 101.811 6.120   1.00 30.38 ? 86   TYR A OH  1 
ATOM   685   N  N   . GLN A 1 87   ? -28.000 105.145 7.873   1.00 34.80 ? 87   GLN A N   1 
ATOM   686   C  CA  . GLN A 1 87   ? -26.960 106.117 8.166   1.00 35.77 ? 87   GLN A CA  1 
ATOM   687   C  C   . GLN A 1 87   ? -25.620 105.715 7.580   1.00 35.29 ? 87   GLN A C   1 
ATOM   688   O  O   . GLN A 1 87   ? -24.649 106.447 7.716   1.00 36.63 ? 87   GLN A O   1 
ATOM   689   C  CB  . GLN A 1 87   ? -26.831 106.318 9.683   1.00 37.81 ? 87   GLN A CB  1 
ATOM   690   C  CG  . GLN A 1 87   ? -27.443 107.638 10.189  1.00 41.14 ? 87   GLN A CG  1 
ATOM   691   C  CD  . GLN A 1 87   ? -29.046 107.546 10.197  1.00 44.05 ? 87   GLN A CD  1 
ATOM   692   O  OE1 . GLN A 1 87   ? -29.575 107.716 9.200   1.00 45.26 ? 87   GLN A OE1 1 
ATOM   693   N  NE2 . GLN A 1 87   ? -29.634 107.288 11.348  1.00 47.21 ? 87   GLN A NE2 1 
ATOM   694   N  N   . GLY A 1 88   ? -25.556 104.551 6.929   1.00 34.28 ? 88   GLY A N   1 
ATOM   695   C  CA  . GLY A 1 88   ? -24.298 104.130 6.339   1.00 34.32 ? 88   GLY A CA  1 
ATOM   696   C  C   . GLY A 1 88   ? -23.879 102.686 6.578   1.00 35.06 ? 88   GLY A C   1 
ATOM   697   O  O   . GLY A 1 88   ? -24.566 101.926 7.258   1.00 35.76 ? 88   GLY A O   1 
ATOM   698   N  N   . PRO A 1 89   ? -22.728 102.285 6.025   1.00 35.87 ? 89   PRO A N   1 
ATOM   699   C  CA  . PRO A 1 89   ? -22.160 100.937 6.136   1.00 36.88 ? 89   PRO A CA  1 
ATOM   700   C  C   . PRO A 1 89   ? -22.094 100.414 7.565   1.00 37.12 ? 89   PRO A C   1 
ATOM   701   O  O   . PRO A 1 89   ? -22.071 99.204  7.785   1.00 38.71 ? 89   PRO A O   1 
ATOM   702   C  CB  . PRO A 1 89   ? -20.763 101.100 5.535   1.00 37.20 ? 89   PRO A CB  1 
ATOM   703   C  CG  . PRO A 1 89   ? -20.953 102.188 4.538   1.00 36.69 ? 89   PRO A CG  1 
ATOM   704   C  CD  . PRO A 1 89   ? -21.812 103.174 5.293   1.00 35.82 ? 89   PRO A CD  1 
ATOM   705   N  N   . ASP A 1 90   ? -22.048 101.327 8.528   1.00 36.54 ? 90   ASP A N   1 
ATOM   706   C  CA  . ASP A 1 90   ? -21.967 100.945 9.930   1.00 36.30 ? 90   ASP A CA  1 
ATOM   707   C  C   . ASP A 1 90   ? -23.317 100.778 10.606  1.00 34.05 ? 90   ASP A C   1 
ATOM   708   O  O   . ASP A 1 90   ? -23.415 100.050 11.589  1.00 32.81 ? 90   ASP A O   1 
ATOM   709   C  CB  . ASP A 1 90   ? -21.167 101.989 10.720  1.00 39.22 ? 90   ASP A CB  1 
ATOM   710   C  CG  . ASP A 1 90   ? -19.683 101.860 10.519  1.00 40.26 ? 90   ASP A CG  1 
ATOM   711   O  OD1 . ASP A 1 90   ? -19.181 100.723 10.578  1.00 43.10 ? 90   ASP A OD1 1 
ATOM   712   O  OD2 . ASP A 1 90   ? -19.018 102.892 10.315  1.00 42.33 ? 90   ASP A OD2 1 
ATOM   713   N  N   . ASP A 1 91   ? -24.335 101.463 10.083  1.00 31.47 ? 91   ASP A N   1 
ATOM   714   C  CA  . ASP A 1 91   ? -25.675 101.445 10.662  1.00 29.82 ? 91   ASP A CA  1 
ATOM   715   C  C   . ASP A 1 91   ? -26.346 100.084 10.587  1.00 29.15 ? 91   ASP A C   1 
ATOM   716   O  O   . ASP A 1 91   ? -27.379 99.888  9.941   1.00 28.94 ? 91   ASP A O   1 
ATOM   717   C  CB  . ASP A 1 91   ? -26.542 102.520 9.997   1.00 28.84 ? 91   ASP A CB  1 
ATOM   718   C  CG  . ASP A 1 91   ? -27.922 102.607 10.605  1.00 25.43 ? 91   ASP A CG  1 
ATOM   719   O  OD1 . ASP A 1 91   ? -28.078 102.219 11.778  1.00 23.85 ? 91   ASP A OD1 1 
ATOM   720   O  OD2 . ASP A 1 91   ? -28.841 103.070 9.904   1.00 25.21 ? 91   ASP A OD2 1 
ATOM   721   N  N   . VAL A 1 92   ? -25.765 99.161  11.335  1.00 27.92 ? 92   VAL A N   1 
ATOM   722   C  CA  . VAL A 1 92   ? -26.201 97.787  11.366  1.00 27.57 ? 92   VAL A CA  1 
ATOM   723   C  C   . VAL A 1 92   ? -26.526 97.254  12.775  1.00 26.62 ? 92   VAL A C   1 
ATOM   724   O  O   . VAL A 1 92   ? -26.994 96.126  12.921  1.00 26.78 ? 92   VAL A O   1 
ATOM   725   C  CB  . VAL A 1 92   ? -25.098 96.946  10.648  1.00 30.19 ? 92   VAL A CB  1 
ATOM   726   C  CG1 . VAL A 1 92   ? -24.697 95.746  11.470  1.00 32.92 ? 92   VAL A CG1 1 
ATOM   727   C  CG2 . VAL A 1 92   ? -25.583 96.544  9.271   1.00 28.92 ? 92   VAL A CG2 1 
ATOM   728   N  N   . TYR A 1 93   ? -26.306 98.064  13.803  1.00 25.52 ? 93   TYR A N   1 
ATOM   729   C  CA  . TYR A 1 93   ? -26.563 97.648  15.188  1.00 24.18 ? 93   TYR A CA  1 
ATOM   730   C  C   . TYR A 1 93   ? -28.059 97.638  15.545  1.00 24.14 ? 93   TYR A C   1 
ATOM   731   O  O   . TYR A 1 93   ? -28.909 97.693  14.668  1.00 24.23 ? 93   TYR A O   1 
ATOM   732   C  CB  . TYR A 1 93   ? -25.779 98.576  16.139  1.00 23.44 ? 93   TYR A CB  1 
ATOM   733   C  CG  . TYR A 1 93   ? -24.286 98.432  15.968  1.00 23.40 ? 93   TYR A CG  1 
ATOM   734   C  CD1 . TYR A 1 93   ? -23.571 97.502  16.706  1.00 24.64 ? 93   TYR A CD1 1 
ATOM   735   C  CD2 . TYR A 1 93   ? -23.608 99.141  14.977  1.00 23.17 ? 93   TYR A CD2 1 
ATOM   736   C  CE1 . TYR A 1 93   ? -22.206 97.265  16.450  1.00 26.17 ? 93   TYR A CE1 1 
ATOM   737   C  CE2 . TYR A 1 93   ? -22.247 98.910  14.719  1.00 24.56 ? 93   TYR A CE2 1 
ATOM   738   C  CZ  . TYR A 1 93   ? -21.563 97.970  15.457  1.00 24.32 ? 93   TYR A CZ  1 
ATOM   739   O  OH  . TYR A 1 93   ? -20.250 97.707  15.193  1.00 27.37 ? 93   TYR A OH  1 
ATOM   740   N  N   . VAL A 1 94   ? -28.375 97.557  16.830  1.00 23.80 ? 94   VAL A N   1 
ATOM   741   C  CA  . VAL A 1 94   ? -29.760 97.562  17.276  1.00 23.35 ? 94   VAL A CA  1 
ATOM   742   C  C   . VAL A 1 94   ? -30.327 98.954  17.126  1.00 22.48 ? 94   VAL A C   1 
ATOM   743   O  O   . VAL A 1 94   ? -29.769 99.910  17.641  1.00 21.83 ? 94   VAL A O   1 
ATOM   744   C  CB  . VAL A 1 94   ? -29.907 97.145  18.774  1.00 24.12 ? 94   VAL A CB  1 
ATOM   745   C  CG1 . VAL A 1 94   ? -31.381 97.088  19.147  1.00 22.11 ? 94   VAL A CG1 1 
ATOM   746   C  CG2 . VAL A 1 94   ? -29.281 95.782  19.011  1.00 22.04 ? 94   VAL A CG2 1 
ATOM   747   N  N   . PRO A 1 95   ? -31.463 99.077  16.426  1.00 22.51 ? 95   PRO A N   1 
ATOM   748   C  CA  . PRO A 1 95   ? -32.116 100.370 16.204  1.00 22.17 ? 95   PRO A CA  1 
ATOM   749   C  C   . PRO A 1 95   ? -32.957 100.820 17.405  1.00 21.94 ? 95   PRO A C   1 
ATOM   750   O  O   . PRO A 1 95   ? -33.434 99.985  18.169  1.00 22.80 ? 95   PRO A O   1 
ATOM   751   C  CB  . PRO A 1 95   ? -32.967 100.095 14.965  1.00 24.14 ? 95   PRO A CB  1 
ATOM   752   C  CG  . PRO A 1 95   ? -33.435 98.681  15.228  1.00 23.66 ? 95   PRO A CG  1 
ATOM   753   C  CD  . PRO A 1 95   ? -32.172 97.994  15.716  1.00 23.13 ? 95   PRO A CD  1 
ATOM   754   N  N   . ASN A 1 96   ? -33.132 102.133 17.564  1.00 20.91 ? 96   ASN A N   1 
ATOM   755   C  CA  . ASN A 1 96   ? -33.924 102.678 18.663  1.00 21.81 ? 96   ASN A CA  1 
ATOM   756   C  C   . ASN A 1 96   ? -35.395 102.681 18.261  1.00 22.91 ? 96   ASN A C   1 
ATOM   757   O  O   . ASN A 1 96   ? -35.880 103.611 17.611  1.00 21.71 ? 96   ASN A O   1 
ATOM   758   C  CB  . ASN A 1 96   ? -33.471 104.095 18.995  1.00 21.73 ? 96   ASN A CB  1 
ATOM   759   C  CG  . ASN A 1 96   ? -31.997 104.161 19.367  1.00 23.29 ? 96   ASN A CG  1 
ATOM   760   O  OD1 . ASN A 1 96   ? -31.292 103.148 19.389  1.00 24.97 ? 96   ASN A OD1 1 
ATOM   761   N  ND2 . ASN A 1 96   ? -31.523 105.361 19.654  1.00 23.78 ? 96   ASN A ND2 1 
ATOM   762   N  N   . CYS A 1 97   ? -36.103 101.639 18.677  1.00 23.42 ? 97   CYS A N   1 
ATOM   763   C  CA  . CYS A 1 97   ? -37.494 101.496 18.308  1.00 25.14 ? 97   CYS A CA  1 
ATOM   764   C  C   . CYS A 1 97   ? -38.382 101.106 19.470  1.00 25.33 ? 97   CYS A C   1 
ATOM   765   O  O   . CYS A 1 97   ? -37.906 100.804 20.574  1.00 26.50 ? 97   CYS A O   1 
ATOM   766   C  CB  . CYS A 1 97   ? -37.612 100.436 17.206  1.00 24.81 ? 97   CYS A CB  1 
ATOM   767   S  SG  . CYS A 1 97   ? -36.227 100.465 16.033  1.00 27.74 ? 97   CYS A SG  1 
ATOM   768   N  N   . SER A 1 98   ? -39.686 101.117 19.200  1.00 25.21 ? 98   SER A N   1 
ATOM   769   C  CA  . SER A 1 98   ? -40.672 100.735 20.196  1.00 26.28 ? 98   SER A CA  1 
ATOM   770   C  C   . SER A 1 98   ? -40.484 99.239  20.426  1.00 26.27 ? 98   SER A C   1 
ATOM   771   O  O   . SER A 1 98   ? -39.845 98.558  19.622  1.00 25.85 ? 98   SER A O   1 
ATOM   772   C  CB  . SER A 1 98   ? -42.085 101.043 19.707  1.00 25.81 ? 98   SER A CB  1 
ATOM   773   O  OG  . SER A 1 98   ? -42.300 100.520 18.409  1.00 30.06 ? 98   SER A OG  1 
ATOM   774   N  N   . ILE A 1 99   ? -41.040 98.722  21.509  1.00 25.68 ? 99   ILE A N   1 
ATOM   775   C  CA  . ILE A 1 99   ? -40.845 97.321  21.820  1.00 25.63 ? 99   ILE A CA  1 
ATOM   776   C  C   . ILE A 1 99   ? -42.086 96.695  22.455  1.00 25.46 ? 99   ILE A C   1 
ATOM   777   O  O   . ILE A 1 99   ? -42.329 95.496  22.309  1.00 24.78 ? 99   ILE A O   1 
ATOM   778   C  CB  . ILE A 1 99   ? -39.616 97.176  22.786  1.00 26.57 ? 99   ILE A CB  1 
ATOM   779   C  CG1 . ILE A 1 99   ? -39.388 95.715  23.178  1.00 27.55 ? 99   ILE A CG1 1 
ATOM   780   C  CG2 . ILE A 1 99   ? -39.834 98.008  24.048  1.00 25.46 ? 99   ILE A CG2 1 
ATOM   781   C  CD1 . ILE A 1 99   ? -38.545 94.936  22.208  1.00 26.90 ? 99   ILE A CD1 1 
ATOM   782   N  N   . VAL A 1 100  ? -42.872 97.508  23.153  1.00 24.56 ? 100  VAL A N   1 
ATOM   783   C  CA  . VAL A 1 100  ? -44.056 96.996  23.819  1.00 26.37 ? 100  VAL A CA  1 
ATOM   784   C  C   . VAL A 1 100  ? -45.037 96.249  22.909  1.00 26.31 ? 100  VAL A C   1 
ATOM   785   O  O   . VAL A 1 100  ? -45.602 95.235  23.320  1.00 26.27 ? 100  VAL A O   1 
ATOM   786   C  CB  . VAL A 1 100  ? -44.809 98.122  24.556  1.00 26.59 ? 100  VAL A CB  1 
ATOM   787   C  CG1 . VAL A 1 100  ? -45.634 98.946  23.578  1.00 28.37 ? 100  VAL A CG1 1 
ATOM   788   C  CG2 . VAL A 1 100  ? -45.669 97.531  25.635  1.00 26.25 ? 100  VAL A CG2 1 
ATOM   789   N  N   . GLU A 1 101  ? -45.227 96.721  21.680  1.00 25.81 ? 101  GLU A N   1 
ATOM   790   C  CA  . GLU A 1 101  ? -46.156 96.069  20.774  1.00 26.79 ? 101  GLU A CA  1 
ATOM   791   C  C   . GLU A 1 101  ? -45.794 94.609  20.434  1.00 28.35 ? 101  GLU A C   1 
ATOM   792   O  O   . GLU A 1 101  ? -46.620 93.867  19.897  1.00 28.93 ? 101  GLU A O   1 
ATOM   793   C  CB  . GLU A 1 101  ? -46.291 96.880  19.482  1.00 26.55 ? 101  GLU A CB  1 
ATOM   794   C  CG  . GLU A 1 101  ? -45.152 96.676  18.499  1.00 28.45 ? 101  GLU A CG  1 
ATOM   795   C  CD  . GLU A 1 101  ? -44.065 97.739  18.607  1.00 28.76 ? 101  GLU A CD  1 
ATOM   796   O  OE1 . GLU A 1 101  ? -43.840 98.264  19.725  1.00 26.33 ? 101  GLU A OE1 1 
ATOM   797   O  OE2 . GLU A 1 101  ? -43.432 98.039  17.566  1.00 28.46 ? 101  GLU A OE2 1 
ATOM   798   N  N   . LEU A 1 102  ? -44.580 94.184  20.762  1.00 28.78 ? 102  LEU A N   1 
ATOM   799   C  CA  . LEU A 1 102  ? -44.151 92.825  20.446  1.00 27.79 ? 102  LEU A CA  1 
ATOM   800   C  C   . LEU A 1 102  ? -44.162 91.862  21.622  1.00 28.87 ? 102  LEU A C   1 
ATOM   801   O  O   . LEU A 1 102  ? -43.768 90.707  21.464  1.00 29.05 ? 102  LEU A O   1 
ATOM   802   C  CB  . LEU A 1 102  ? -42.731 92.854  19.875  1.00 27.20 ? 102  LEU A CB  1 
ATOM   803   C  CG  . LEU A 1 102  ? -42.421 93.071  18.398  1.00 27.41 ? 102  LEU A CG  1 
ATOM   804   C  CD1 . LEU A 1 102  ? -43.545 93.800  17.707  1.00 28.93 ? 102  LEU A CD1 1 
ATOM   805   C  CD2 . LEU A 1 102  ? -41.112 93.833  18.296  1.00 26.56 ? 102  LEU A CD2 1 
ATOM   806   N  N   . LEU A 1 103  ? -44.609 92.315  22.788  1.00 29.80 ? 103  LEU A N   1 
ATOM   807   C  CA  . LEU A 1 103  ? -44.582 91.470  23.988  1.00 32.49 ? 103  LEU A CA  1 
ATOM   808   C  C   . LEU A 1 103  ? -45.920 90.985  24.578  1.00 34.18 ? 103  LEU A C   1 
ATOM   809   O  O   . LEU A 1 103  ? -46.968 91.595  24.370  1.00 34.01 ? 103  LEU A O   1 
ATOM   810   C  CB  . LEU A 1 103  ? -43.805 92.206  25.084  1.00 31.16 ? 103  LEU A CB  1 
ATOM   811   C  CG  . LEU A 1 103  ? -42.625 93.042  24.588  1.00 30.46 ? 103  LEU A CG  1 
ATOM   812   C  CD1 . LEU A 1 103  ? -42.169 93.981  25.686  1.00 29.14 ? 103  LEU A CD1 1 
ATOM   813   C  CD2 . LEU A 1 103  ? -41.500 92.130  24.121  1.00 27.41 ? 103  LEU A CD2 1 
ATOM   814   N  N   . GLU A 1 104  ? -45.856 89.871  25.312  1.00 37.28 ? 104  GLU A N   1 
ATOM   815   C  CA  . GLU A 1 104  ? -47.019 89.284  25.990  1.00 40.15 ? 104  GLU A CA  1 
ATOM   816   C  C   . GLU A 1 104  ? -46.698 89.441  27.466  1.00 40.94 ? 104  GLU A C   1 
ATOM   817   O  O   . GLU A 1 104  ? -45.623 89.038  27.913  1.00 40.23 ? 104  GLU A O   1 
ATOM   818   C  CB  . GLU A 1 104  ? -47.156 87.785  25.707  1.00 42.96 ? 104  GLU A CB  1 
ATOM   819   C  CG  . GLU A 1 104  ? -47.430 87.399  24.265  1.00 48.64 ? 104  GLU A CG  1 
ATOM   820   C  CD  . GLU A 1 104  ? -47.298 85.894  24.028  1.00 52.21 ? 104  GLU A CD  1 
ATOM   821   O  OE1 . GLU A 1 104  ? -46.351 85.288  24.578  1.00 51.94 ? 104  GLU A OE1 1 
ATOM   822   O  OE2 . GLU A 1 104  ? -48.130 85.320  23.283  1.00 53.41 ? 104  GLU A OE2 1 
ATOM   823   N  N   . PRO A 1 105  ? -47.616 90.023  28.244  1.00 41.50 ? 105  PRO A N   1 
ATOM   824   C  CA  . PRO A 1 105  ? -47.365 90.204  29.676  1.00 41.90 ? 105  PRO A CA  1 
ATOM   825   C  C   . PRO A 1 105  ? -46.896 88.923  30.359  1.00 42.62 ? 105  PRO A C   1 
ATOM   826   O  O   . PRO A 1 105  ? -47.311 87.825  29.985  1.00 42.95 ? 105  PRO A O   1 
ATOM   827   C  CB  . PRO A 1 105  ? -48.716 90.668  30.201  1.00 41.46 ? 105  PRO A CB  1 
ATOM   828   C  CG  . PRO A 1 105  ? -49.279 91.420  29.044  1.00 41.32 ? 105  PRO A CG  1 
ATOM   829   C  CD  . PRO A 1 105  ? -48.953 90.510  27.881  1.00 41.77 ? 105  PRO A CD  1 
ATOM   830   N  N   . HIS A 1 106  ? -46.019 89.064  31.348  1.00 43.66 ? 106  HIS A N   1 
ATOM   831   C  CA  . HIS A 1 106  ? -45.525 87.909  32.086  1.00 45.49 ? 106  HIS A CA  1 
ATOM   832   C  C   . HIS A 1 106  ? -46.646 87.450  33.008  1.00 46.22 ? 106  HIS A C   1 
ATOM   833   O  O   . HIS A 1 106  ? -47.453 88.258  33.452  1.00 45.39 ? 106  HIS A O   1 
ATOM   834   C  CB  . HIS A 1 106  ? -44.290 88.279  32.908  1.00 47.06 ? 106  HIS A CB  1 
ATOM   835   C  CG  . HIS A 1 106  ? -43.834 87.193  33.837  1.00 48.77 ? 106  HIS A CG  1 
ATOM   836   N  ND1 . HIS A 1 106  ? -44.344 87.040  35.108  1.00 49.65 ? 106  HIS A ND1 1 
ATOM   837   C  CD2 . HIS A 1 106  ? -42.946 86.190  33.662  1.00 50.02 ? 106  HIS A CD2 1 
ATOM   838   C  CE1 . HIS A 1 106  ? -43.786 85.986  35.678  1.00 50.43 ? 106  HIS A CE1 1 
ATOM   839   N  NE2 . HIS A 1 106  ? -42.935 85.451  34.823  1.00 50.72 ? 106  HIS A NE2 1 
ATOM   840   N  N   . GLU A 1 107  ? -46.694 86.156  33.304  1.00 48.01 ? 107  GLU A N   1 
ATOM   841   C  CA  . GLU A 1 107  ? -47.745 85.639  34.158  1.00 50.74 ? 107  GLU A CA  1 
ATOM   842   C  C   . GLU A 1 107  ? -47.833 86.388  35.492  1.00 51.26 ? 107  GLU A C   1 
ATOM   843   O  O   . GLU A 1 107  ? -48.850 87.030  35.778  1.00 52.42 ? 107  GLU A O   1 
ATOM   844   C  CB  . GLU A 1 107  ? -47.532 84.140  34.414  1.00 53.93 ? 107  GLU A CB  1 
ATOM   845   C  CG  . GLU A 1 107  ? -48.434 83.562  35.498  1.00 58.53 ? 107  GLU A CG  1 
ATOM   846   C  CD  . GLU A 1 107  ? -48.840 82.127  35.214  1.00 60.24 ? 107  GLU A CD  1 
ATOM   847   O  OE1 . GLU A 1 107  ? -49.511 81.517  36.075  1.00 59.87 ? 107  GLU A OE1 1 
ATOM   848   O  OE2 . GLU A 1 107  ? -48.490 81.612  34.131  1.00 62.53 ? 107  GLU A OE2 1 
ATOM   849   N  N   . THR A 1 108  ? -46.775 86.306  36.305  1.00 50.78 ? 108  THR A N   1 
ATOM   850   C  CA  . THR A 1 108  ? -46.763 86.953  37.623  1.00 49.41 ? 108  THR A CA  1 
ATOM   851   C  C   . THR A 1 108  ? -46.498 88.460  37.611  1.00 48.81 ? 108  THR A C   1 
ATOM   852   O  O   . THR A 1 108  ? -47.176 89.218  38.310  1.00 48.42 ? 108  THR A O   1 
ATOM   853   C  CB  . THR A 1 108  ? -45.729 86.269  38.546  1.00 49.45 ? 108  THR A CB  1 
ATOM   854   O  OG1 . THR A 1 108  ? -45.975 84.856  38.579  1.00 49.79 ? 108  THR A OG1 1 
ATOM   855   C  CG2 . THR A 1 108  ? -45.826 86.824  39.960  1.00 49.77 ? 108  THR A CG2 1 
ATOM   856   N  N   . LEU A 1 109  ? -45.516 88.892  36.824  1.00 48.24 ? 109  LEU A N   1 
ATOM   857   C  CA  . LEU A 1 109  ? -45.180 90.309  36.736  1.00 47.34 ? 109  LEU A CA  1 
ATOM   858   C  C   . LEU A 1 109  ? -45.991 90.952  35.627  1.00 46.61 ? 109  LEU A C   1 
ATOM   859   O  O   . LEU A 1 109  ? -45.438 91.395  34.628  1.00 47.32 ? 109  LEU A O   1 
ATOM   860   C  CB  . LEU A 1 109  ? -43.692 90.475  36.452  1.00 48.04 ? 109  LEU A CB  1 
ATOM   861   C  CG  . LEU A 1 109  ? -42.755 89.658  37.348  1.00 49.52 ? 109  LEU A CG  1 
ATOM   862   C  CD1 . LEU A 1 109  ? -41.328 89.721  36.805  1.00 49.67 ? 109  LEU A CD1 1 
ATOM   863   C  CD2 . LEU A 1 109  ? -42.813 90.186  38.777  1.00 49.06 ? 109  LEU A CD2 1 
ATOM   864   N  N   . THR A 1 110  ? -47.302 91.013  35.821  1.00 45.84 ? 110  THR A N   1 
ATOM   865   C  CA  . THR A 1 110  ? -48.224 91.573  34.837  1.00 45.22 ? 110  THR A CA  1 
ATOM   866   C  C   . THR A 1 110  ? -47.812 92.865  34.137  1.00 44.21 ? 110  THR A C   1 
ATOM   867   O  O   . THR A 1 110  ? -48.280 93.132  33.027  1.00 44.79 ? 110  THR A O   1 
ATOM   868   C  CB  . THR A 1 110  ? -49.610 91.801  35.456  1.00 46.15 ? 110  THR A CB  1 
ATOM   869   O  OG1 . THR A 1 110  ? -49.511 92.722  36.558  1.00 47.48 ? 110  THR A OG1 1 
ATOM   870   C  CG2 . THR A 1 110  ? -50.173 90.478  35.947  1.00 46.58 ? 110  THR A CG2 1 
ATOM   871   N  N   . SER A 1 111  ? -46.956 93.668  34.761  1.00 42.51 ? 111  SER A N   1 
ATOM   872   C  CA  . SER A 1 111  ? -46.536 94.920  34.129  1.00 41.18 ? 111  SER A CA  1 
ATOM   873   C  C   . SER A 1 111  ? -45.334 94.780  33.189  1.00 38.43 ? 111  SER A C   1 
ATOM   874   O  O   . SER A 1 111  ? -44.981 95.717  32.473  1.00 36.79 ? 111  SER A O   1 
ATOM   875   C  CB  . SER A 1 111  ? -46.253 95.981  35.193  1.00 43.43 ? 111  SER A CB  1 
ATOM   876   O  OG  . SER A 1 111  ? -47.458 96.625  35.585  1.00 46.21 ? 111  SER A OG  1 
ATOM   877   N  N   . TYR A 1 112  ? -44.719 93.605  33.184  1.00 35.96 ? 112  TYR A N   1 
ATOM   878   C  CA  . TYR A 1 112  ? -43.575 93.347  32.314  1.00 35.86 ? 112  TYR A CA  1 
ATOM   879   C  C   . TYR A 1 112  ? -43.956 92.321  31.263  1.00 35.41 ? 112  TYR A C   1 
ATOM   880   O  O   . TYR A 1 112  ? -44.892 91.545  31.456  1.00 34.60 ? 112  TYR A O   1 
ATOM   881   C  CB  . TYR A 1 112  ? -42.379 92.840  33.138  1.00 33.09 ? 112  TYR A CB  1 
ATOM   882   C  CG  . TYR A 1 112  ? -41.848 93.892  34.078  1.00 30.82 ? 112  TYR A CG  1 
ATOM   883   C  CD1 . TYR A 1 112  ? -40.884 94.809  33.658  1.00 30.41 ? 112  TYR A CD1 1 
ATOM   884   C  CD2 . TYR A 1 112  ? -42.381 94.037  35.362  1.00 29.53 ? 112  TYR A CD2 1 
ATOM   885   C  CE1 . TYR A 1 112  ? -40.466 95.848  34.494  1.00 29.86 ? 112  TYR A CE1 1 
ATOM   886   C  CE2 . TYR A 1 112  ? -41.976 95.072  36.200  1.00 28.98 ? 112  TYR A CE2 1 
ATOM   887   C  CZ  . TYR A 1 112  ? -41.022 95.973  35.762  1.00 29.46 ? 112  TYR A CZ  1 
ATOM   888   O  OH  . TYR A 1 112  ? -40.621 96.992  36.598  1.00 29.40 ? 112  TYR A OH  1 
ATOM   889   N  N   . GLY A 1 113  ? -43.230 92.318  30.150  1.00 35.78 ? 113  GLY A N   1 
ATOM   890   C  CA  . GLY A 1 113  ? -43.528 91.374  29.088  1.00 37.71 ? 113  GLY A CA  1 
ATOM   891   C  C   . GLY A 1 113  ? -42.313 90.889  28.330  1.00 37.96 ? 113  GLY A C   1 
ATOM   892   O  O   . GLY A 1 113  ? -41.279 91.553  28.288  1.00 37.55 ? 113  GLY A O   1 
ATOM   893   N  N   . ARG A 1 114  ? -42.458 89.715  27.722  1.00 39.86 ? 114  ARG A N   1 
ATOM   894   C  CA  . ARG A 1 114  ? -41.398 89.087  26.946  1.00 41.14 ? 114  ARG A CA  1 
ATOM   895   C  C   . ARG A 1 114  ? -41.879 88.998  25.506  1.00 41.37 ? 114  ARG A C   1 
ATOM   896   O  O   . ARG A 1 114  ? -43.055 89.252  25.234  1.00 41.11 ? 114  ARG A O   1 
ATOM   897   C  CB  . ARG A 1 114  ? -41.109 87.685  27.498  1.00 42.23 ? 114  ARG A CB  1 
ATOM   898   C  CG  . ARG A 1 114  ? -39.803 87.080  27.040  1.00 45.75 ? 114  ARG A CG  1 
ATOM   899   C  CD  . ARG A 1 114  ? -39.225 86.112  28.077  1.00 48.71 ? 114  ARG A CD  1 
ATOM   900   N  NE  . ARG A 1 114  ? -37.986 85.474  27.617  1.00 50.49 ? 114  ARG A NE  1 
ATOM   901   C  CZ  . ARG A 1 114  ? -36.846 86.119  27.370  1.00 51.16 ? 114  ARG A CZ  1 
ATOM   902   N  NH1 . ARG A 1 114  ? -36.767 87.434  27.539  1.00 51.53 ? 114  ARG A NH1 1 
ATOM   903   N  NH2 . ARG A 1 114  ? -35.783 85.451  26.931  1.00 50.50 ? 114  ARG A NH2 1 
ATOM   904   N  N   . LEU A 1 115  ? -40.974 88.658  24.586  1.00 42.10 ? 115  LEU A N   1 
ATOM   905   C  CA  . LEU A 1 115  ? -41.325 88.525  23.174  1.00 42.24 ? 115  LEU A CA  1 
ATOM   906   C  C   . LEU A 1 115  ? -42.440 87.495  23.026  1.00 43.05 ? 115  LEU A C   1 
ATOM   907   O  O   . LEU A 1 115  ? -42.317 86.369  23.501  1.00 42.64 ? 115  LEU A O   1 
ATOM   908   C  CB  . LEU A 1 115  ? -40.111 88.082  22.364  1.00 41.43 ? 115  LEU A CB  1 
ATOM   909   C  CG  . LEU A 1 115  ? -40.339 87.987  20.855  1.00 42.08 ? 115  LEU A CG  1 
ATOM   910   C  CD1 . LEU A 1 115  ? -40.928 89.299  20.349  1.00 41.01 ? 115  LEU A CD1 1 
ATOM   911   C  CD2 . LEU A 1 115  ? -39.028 87.670  20.147  1.00 41.49 ? 115  LEU A CD2 1 
ATOM   912   N  N   . SER A 1 116  ? -43.526 87.885  22.369  1.00 43.97 ? 116  SER A N   1 
ATOM   913   C  CA  . SER A 1 116  ? -44.684 87.006  22.177  1.00 46.26 ? 116  SER A CA  1 
ATOM   914   C  C   . SER A 1 116  ? -44.378 85.618  21.622  1.00 47.74 ? 116  SER A C   1 
ATOM   915   O  O   . SER A 1 116  ? -43.826 85.472  20.528  1.00 49.11 ? 116  SER A O   1 
ATOM   916   C  CB  . SER A 1 116  ? -45.718 87.689  21.275  1.00 46.18 ? 116  SER A CB  1 
ATOM   917   O  OG  . SER A 1 116  ? -46.594 86.740  20.688  1.00 46.80 ? 116  SER A OG  1 
ATOM   918   N  N   . GLU A 1 117  ? -44.767 84.601  22.383  1.00 48.93 ? 117  GLU A N   1 
ATOM   919   C  CA  . GLU A 1 117  ? -44.546 83.210  21.997  1.00 49.82 ? 117  GLU A CA  1 
ATOM   920   C  C   . GLU A 1 117  ? -45.121 82.957  20.605  1.00 47.92 ? 117  GLU A C   1 
ATOM   921   O  O   . GLU A 1 117  ? -44.619 82.129  19.844  1.00 47.55 ? 117  GLU A O   1 
ATOM   922   C  CB  . GLU A 1 117  ? -45.217 82.279  23.006  1.00 52.14 ? 117  GLU A CB  1 
ATOM   923   C  CG  . GLU A 1 117  ? -44.498 80.958  23.194  1.00 55.92 ? 117  GLU A CG  1 
ATOM   924   C  CD  . GLU A 1 117  ? -45.404 79.885  23.774  1.00 58.40 ? 117  GLU A CD  1 
ATOM   925   O  OE1 . GLU A 1 117  ? -46.087 80.156  24.791  1.00 59.10 ? 117  GLU A OE1 1 
ATOM   926   O  OE2 . GLU A 1 117  ? -45.427 78.768  23.208  1.00 60.08 ? 117  GLU A OE2 1 
ATOM   927   N  N   . ALA A 1 118  ? -46.187 83.676  20.283  1.00 46.36 ? 118  ALA A N   1 
ATOM   928   C  CA  . ALA A 1 118  ? -46.817 83.539  18.979  1.00 45.61 ? 118  ALA A CA  1 
ATOM   929   C  C   . ALA A 1 118  ? -45.866 84.023  17.875  1.00 44.46 ? 118  ALA A C   1 
ATOM   930   O  O   . ALA A 1 118  ? -45.628 83.312  16.898  1.00 44.33 ? 118  ALA A O   1 
ATOM   931   C  CB  . ALA A 1 118  ? -48.131 84.331  18.941  1.00 44.81 ? 118  ALA A CB  1 
ATOM   932   N  N   . ILE A 1 119  ? -45.325 85.228  18.036  1.00 42.58 ? 119  ILE A N   1 
ATOM   933   C  CA  . ILE A 1 119  ? -44.408 85.784  17.050  1.00 41.34 ? 119  ILE A CA  1 
ATOM   934   C  C   . ILE A 1 119  ? -43.198 84.881  16.839  1.00 40.54 ? 119  ILE A C   1 
ATOM   935   O  O   . ILE A 1 119  ? -42.778 84.673  15.699  1.00 39.07 ? 119  ILE A O   1 
ATOM   936   C  CB  . ILE A 1 119  ? -43.922 87.205  17.455  1.00 40.82 ? 119  ILE A CB  1 
ATOM   937   C  CG1 . ILE A 1 119  ? -45.103 88.185  17.433  1.00 40.84 ? 119  ILE A CG1 1 
ATOM   938   C  CG2 . ILE A 1 119  ? -42.851 87.696  16.486  1.00 39.97 ? 119  ILE A CG2 1 
ATOM   939   C  CD1 . ILE A 1 119  ? -44.759 89.614  17.837  1.00 41.05 ? 119  ILE A CD1 1 
ATOM   940   N  N   . GLU A 1 120  ? -42.646 84.340  17.926  1.00 40.85 ? 120  GLU A N   1 
ATOM   941   C  CA  . GLU A 1 120  ? -41.473 83.466  17.825  1.00 41.15 ? 120  GLU A CA  1 
ATOM   942   C  C   . GLU A 1 120  ? -41.772 82.153  17.106  1.00 40.82 ? 120  GLU A C   1 
ATOM   943   O  O   . GLU A 1 120  ? -40.994 81.713  16.259  1.00 40.62 ? 120  GLU A O   1 
ATOM   944   C  CB  . GLU A 1 120  ? -40.885 83.147  19.209  1.00 41.20 ? 120  GLU A CB  1 
ATOM   945   C  CG  . GLU A 1 120  ? -39.914 84.176  19.762  1.00 43.72 ? 120  GLU A CG  1 
ATOM   946   C  CD  . GLU A 1 120  ? -38.802 83.542  20.601  1.00 45.89 ? 120  GLU A CD  1 
ATOM   947   O  OE1 . GLU A 1 120  ? -39.075 82.529  21.282  1.00 45.71 ? 120  GLU A OE1 1 
ATOM   948   O  OE2 . GLU A 1 120  ? -37.659 84.065  20.586  1.00 47.97 ? 120  GLU A OE2 1 
ATOM   949   N  N   . ASN A 1 121  ? -42.890 81.523  17.455  1.00 40.57 ? 121  ASN A N   1 
ATOM   950   C  CA  . ASN A 1 121  ? -43.276 80.261  16.834  1.00 39.99 ? 121  ASN A CA  1 
ATOM   951   C  C   . ASN A 1 121  ? -43.614 80.514  15.382  1.00 39.03 ? 121  ASN A C   1 
ATOM   952   O  O   . ASN A 1 121  ? -43.346 79.689  14.508  1.00 37.89 ? 121  ASN A O   1 
ATOM   953   C  CB  . ASN A 1 121  ? -44.480 79.673  17.552  1.00 40.80 ? 121  ASN A CB  1 
ATOM   954   C  CG  . ASN A 1 121  ? -44.114 79.067  18.874  1.00 41.77 ? 121  ASN A CG  1 
ATOM   955   O  OD1 . ASN A 1 121  ? -44.942 79.009  19.785  1.00 42.30 ? 121  ASN A OD1 1 
ATOM   956   N  ND2 . ASN A 1 121  ? -42.865 78.595  18.992  1.00 40.79 ? 121  ASN A ND2 1 
ATOM   957   N  N   . ARG A 1 122  ? -44.211 81.670  15.134  1.00 38.89 ? 122  ARG A N   1 
ATOM   958   C  CA  . ARG A 1 122  ? -44.559 82.046  13.782  1.00 39.81 ? 122  ARG A CA  1 
ATOM   959   C  C   . ARG A 1 122  ? -43.244 82.259  13.033  1.00 40.02 ? 122  ARG A C   1 
ATOM   960   O  O   . ARG A 1 122  ? -43.154 82.043  11.826  1.00 40.64 ? 122  ARG A O   1 
ATOM   961   C  CB  . ARG A 1 122  ? -45.385 83.329  13.796  1.00 40.05 ? 122  ARG A CB  1 
ATOM   962   C  CG  . ARG A 1 122  ? -46.496 83.359  12.772  1.00 40.65 ? 122  ARG A CG  1 
ATOM   963   C  CD  . ARG A 1 122  ? -47.117 84.721  12.728  1.00 42.82 ? 122  ARG A CD  1 
ATOM   964   N  NE  . ARG A 1 122  ? -47.861 84.989  13.947  1.00 45.68 ? 122  ARG A NE  1 
ATOM   965   C  CZ  . ARG A 1 122  ? -47.903 86.178  14.536  1.00 47.17 ? 122  ARG A CZ  1 
ATOM   966   N  NH1 . ARG A 1 122  ? -47.233 87.200  14.010  1.00 47.82 ? 122  ARG A NH1 1 
ATOM   967   N  NH2 . ARG A 1 122  ? -48.611 86.345  15.646  1.00 47.84 ? 122  ARG A NH2 1 
ATOM   968   N  N   . ALA A 1 123  ? -42.214 82.663  13.767  1.00 40.25 ? 123  ALA A N   1 
ATOM   969   C  CA  . ALA A 1 123  ? -40.899 82.895  13.178  1.00 40.04 ? 123  ALA A CA  1 
ATOM   970   C  C   . ALA A 1 123  ? -40.214 81.558  12.914  1.00 40.13 ? 123  ALA A C   1 
ATOM   971   O  O   . ALA A 1 123  ? -39.510 81.399  11.908  1.00 38.63 ? 123  ALA A O   1 
ATOM   972   C  CB  . ALA A 1 123  ? -40.036 83.761  14.120  1.00 38.87 ? 123  ALA A CB  1 
ATOM   973   N  N   . LYS A 1 124  ? -40.434 80.603  13.814  1.00 40.37 ? 124  LYS A N   1 
ATOM   974   C  CA  . LYS A 1 124  ? -39.830 79.284  13.693  1.00 41.27 ? 124  LYS A CA  1 
ATOM   975   C  C   . LYS A 1 124  ? -40.478 78.685  12.462  1.00 42.01 ? 124  LYS A C   1 
ATOM   976   O  O   . LYS A 1 124  ? -39.609 77.870  11.773  1.00 40.85 ? 124  LYS A O   1 
ATOM   977   C  CB  . LYS A 1 124  ? -40.118 78.444  14.942  1.00 42.04 ? 124  LYS A CB  1 
ATOM   978   C  CG  . LYS A 1 124  ? -39.611 79.077  16.248  1.00 43.85 ? 124  LYS A CG  1 
ATOM   979   C  CD  . LYS A 1 124  ? -39.529 78.067  17.389  1.00 45.38 ? 124  LYS A CD  1 
ATOM   980   C  CE  . LYS A 1 124  ? -39.231 78.740  18.734  1.00 46.82 ? 124  LYS A CE  1 
ATOM   981   N  NZ  . LYS A 1 124  ? -37.841 79.253  18.855  1.00 44.74 ? 124  LYS A NZ  1 
ATOM   982   N  N   . ASP A 1 125  ? -41.650 79.059  12.159  1.00 42.39 ? 125  ASP A N   1 
ATOM   983   C  CA  . ASP A 1 125  ? -42.362 78.525  10.996  1.00 44.28 ? 125  ASP A CA  1 
ATOM   984   C  C   . ASP A 1 125  ? -42.076 79.254  9.725   1.00 43.78 ? 125  ASP A C   1 
ATOM   985   O  O   . ASP A 1 125  ? -42.808 79.133  8.714   1.00 44.13 ? 125  ASP A O   1 
ATOM   986   C  CB  . ASP A 1 125  ? -43.818 78.251  11.250  1.00 46.83 ? 125  ASP A CB  1 
ATOM   987   C  CG  . ASP A 1 125  ? -44.016 77.369  12.467  1.00 50.36 ? 125  ASP A CG  1 
ATOM   988   O  OD1 . ASP A 1 125  ? -43.274 76.358  12.582  1.00 52.00 ? 125  ASP A OD1 1 
ATOM   989   O  OD2 . ASP A 1 125  ? -44.885 77.667  13.306  1.00 50.65 ? 125  ASP A OD2 1 
ATOM   990   N  N   . GLY A 1 126  ? -40.882 79.810  9.707   1.00 42.40 ? 126  GLY A N   1 
ATOM   991   C  CA  . GLY A 1 126  ? -40.474 80.535  8.537   1.00 40.95 ? 126  GLY A CA  1 
ATOM   992   C  C   . GLY A 1 126  ? -41.153 81.831  8.128   1.00 40.06 ? 126  GLY A C   1 
ATOM   993   O  O   . GLY A 1 126  ? -40.834 82.356  7.064   1.00 39.51 ? 126  GLY A O   1 
ATOM   994   N  N   . ASP A 1 127  ? -42.066 82.371  8.925   1.00 40.00 ? 127  ASP A N   1 
ATOM   995   C  CA  . ASP A 1 127  ? -42.682 83.621  8.502   1.00 41.16 ? 127  ASP A CA  1 
ATOM   996   C  C   . ASP A 1 127  ? -41.636 84.734  8.478   1.00 41.01 ? 127  ASP A C   1 
ATOM   997   O  O   . ASP A 1 127  ? -40.867 84.897  9.421   1.00 41.92 ? 127  ASP A O   1 
ATOM   998   C  CB  . ASP A 1 127  ? -43.823 84.038  9.422   1.00 40.28 ? 127  ASP A CB  1 
ATOM   999   C  CG  . ASP A 1 127  ? -44.499 85.310  8.941   1.00 41.52 ? 127  ASP A CG  1 
ATOM   1000  O  OD1 . ASP A 1 127  ? -45.425 85.216  8.113   1.00 42.82 ? 127  ASP A OD1 1 
ATOM   1001  O  OD2 . ASP A 1 127  ? -44.088 86.411  9.364   1.00 43.01 ? 127  ASP A OD2 1 
ATOM   1002  N  N   . SER A 1 128  ? -41.620 85.502  7.397   1.00 40.34 ? 128  SER A N   1 
ATOM   1003  C  CA  . SER A 1 128  ? -40.658 86.574  7.249   1.00 40.39 ? 128  SER A CA  1 
ATOM   1004  C  C   . SER A 1 128  ? -40.870 87.722  8.243   1.00 40.22 ? 128  SER A C   1 
ATOM   1005  O  O   . SER A 1 128  ? -39.929 88.147  8.915   1.00 39.38 ? 128  SER A O   1 
ATOM   1006  C  CB  . SER A 1 128  ? -40.703 87.090  5.812   1.00 40.26 ? 128  SER A CB  1 
ATOM   1007  O  OG  . SER A 1 128  ? -40.108 88.361  5.703   1.00 42.61 ? 128  SER A OG  1 
ATOM   1008  N  N   . GLN A 1 129  ? -42.099 88.218  8.356   1.00 39.78 ? 129  GLN A N   1 
ATOM   1009  C  CA  . GLN A 1 129  ? -42.371 89.332  9.267   1.00 38.21 ? 129  GLN A CA  1 
ATOM   1010  C  C   . GLN A 1 129  ? -42.044 88.985  10.725  1.00 36.78 ? 129  GLN A C   1 
ATOM   1011  O  O   . GLN A 1 129  ? -41.533 89.819  11.485  1.00 34.98 ? 129  GLN A O   1 
ATOM   1012  C  CB  . GLN A 1 129  ? -43.834 89.766  9.153   1.00 40.44 ? 129  GLN A CB  1 
ATOM   1013  C  CG  . GLN A 1 129  ? -44.196 90.955  10.044  1.00 44.93 ? 129  GLN A CG  1 
ATOM   1014  C  CD  . GLN A 1 129  ? -45.685 91.282  10.029  1.00 47.81 ? 129  GLN A CD  1 
ATOM   1015  O  OE1 . GLN A 1 129  ? -46.292 91.426  8.965   1.00 51.00 ? 129  GLN A OE1 1 
ATOM   1016  N  NE2 . GLN A 1 129  ? -46.277 91.410  11.211  1.00 48.85 ? 129  GLN A NE2 1 
ATOM   1017  N  N   . ALA A 1 130  ? -42.346 87.752  11.108  1.00 34.46 ? 130  ALA A N   1 
ATOM   1018  C  CA  . ALA A 1 130  ? -42.080 87.306  12.459  1.00 33.55 ? 130  ALA A CA  1 
ATOM   1019  C  C   . ALA A 1 130  ? -40.578 87.081  12.695  1.00 32.67 ? 130  ALA A C   1 
ATOM   1020  O  O   . ALA A 1 130  ? -40.081 87.331  13.792  1.00 32.93 ? 130  ALA A O   1 
ATOM   1021  C  CB  . ALA A 1 130  ? -42.873 86.031  12.752  1.00 32.27 ? 130  ALA A CB  1 
ATOM   1022  N  N   . ARG A 1 131  ? -39.856 86.610  11.680  1.00 30.84 ? 131  ARG A N   1 
ATOM   1023  C  CA  . ARG A 1 131  ? -38.420 86.387  11.830  1.00 30.64 ? 131  ARG A CA  1 
ATOM   1024  C  C   . ARG A 1 131  ? -37.763 87.725  12.151  1.00 30.29 ? 131  ARG A C   1 
ATOM   1025  O  O   . ARG A 1 131  ? -36.887 87.808  13.008  1.00 29.84 ? 131  ARG A O   1 
ATOM   1026  C  CB  . ARG A 1 131  ? -37.812 85.802  10.543  1.00 29.90 ? 131  ARG A CB  1 
ATOM   1027  C  CG  . ARG A 1 131  ? -38.132 84.336  10.300  1.00 31.73 ? 131  ARG A CG  1 
ATOM   1028  C  CD  . ARG A 1 131  ? -37.624 83.883  8.944   1.00 33.45 ? 131  ARG A CD  1 
ATOM   1029  N  NE  . ARG A 1 131  ? -36.165 83.820  8.904   1.00 35.53 ? 131  ARG A NE  1 
ATOM   1030  C  CZ  . ARG A 1 131  ? -35.424 84.071  7.828   1.00 35.14 ? 131  ARG A CZ  1 
ATOM   1031  N  NH1 . ARG A 1 131  ? -35.990 84.412  6.679   1.00 34.85 ? 131  ARG A NH1 1 
ATOM   1032  N  NH2 . ARG A 1 131  ? -34.106 83.988  7.905   1.00 36.85 ? 131  ARG A NH2 1 
ATOM   1033  N  N   . ILE A 1 132  ? -38.207 88.774  11.454  1.00 30.00 ? 132  ILE A N   1 
ATOM   1034  C  CA  . ILE A 1 132  ? -37.658 90.099  11.663  1.00 29.46 ? 132  ILE A CA  1 
ATOM   1035  C  C   . ILE A 1 132  ? -37.963 90.590  13.070  1.00 28.30 ? 132  ILE A C   1 
ATOM   1036  O  O   . ILE A 1 132  ? -37.083 91.108  13.752  1.00 29.89 ? 132  ILE A O   1 
ATOM   1037  C  CB  . ILE A 1 132  ? -38.209 91.107  10.625  1.00 29.54 ? 132  ILE A CB  1 
ATOM   1038  C  CG1 . ILE A 1 132  ? -37.647 90.785  9.239   1.00 29.14 ? 132  ILE A CG1 1 
ATOM   1039  C  CG2 . ILE A 1 132  ? -37.843 92.528  11.038  1.00 29.33 ? 132  ILE A CG2 1 
ATOM   1040  C  CD1 . ILE A 1 132  ? -38.282 91.594  8.122   1.00 28.45 ? 132  ILE A CD1 1 
ATOM   1041  N  N   . ALA A 1 133  ? -39.201 90.411  13.522  1.00 27.35 ? 133  ALA A N   1 
ATOM   1042  C  CA  . ALA A 1 133  ? -39.593 90.853  14.857  1.00 25.38 ? 133  ALA A CA  1 
ATOM   1043  C  C   . ALA A 1 133  ? -38.861 90.058  15.924  1.00 25.04 ? 133  ALA A C   1 
ATOM   1044  O  O   . ALA A 1 133  ? -38.481 90.611  16.956  1.00 26.36 ? 133  ALA A O   1 
ATOM   1045  C  CB  . ALA A 1 133  ? -41.108 90.726  15.044  1.00 23.51 ? 133  ALA A CB  1 
ATOM   1046  N  N   . THR A 1 134  ? -38.665 88.765  15.690  1.00 23.21 ? 134  THR A N   1 
ATOM   1047  C  CA  . THR A 1 134  ? -37.960 87.957  16.664  1.00 23.67 ? 134  THR A CA  1 
ATOM   1048  C  C   . THR A 1 134  ? -36.494 88.375  16.722  1.00 24.06 ? 134  THR A C   1 
ATOM   1049  O  O   . THR A 1 134  ? -35.915 88.468  17.807  1.00 24.83 ? 134  THR A O   1 
ATOM   1050  C  CB  . THR A 1 134  ? -38.074 86.457  16.343  1.00 23.78 ? 134  THR A CB  1 
ATOM   1051  O  OG1 . THR A 1 134  ? -39.435 86.053  16.515  1.00 26.83 ? 134  THR A OG1 1 
ATOM   1052  C  CG2 . THR A 1 134  ? -37.212 85.635  17.269  1.00 21.84 ? 134  THR A CG2 1 
ATOM   1053  N  N   . THR A 1 135  ? -35.893 88.643  15.566  1.00 23.64 ? 135  THR A N   1 
ATOM   1054  C  CA  . THR A 1 135  ? -34.499 89.059  15.533  1.00 22.43 ? 135  THR A CA  1 
ATOM   1055  C  C   . THR A 1 135  ? -34.363 90.330  16.373  1.00 23.40 ? 135  THR A C   1 
ATOM   1056  O  O   . THR A 1 135  ? -33.616 90.358  17.351  1.00 24.75 ? 135  THR A O   1 
ATOM   1057  C  CB  . THR A 1 135  ? -34.018 89.321  14.077  1.00 22.87 ? 135  THR A CB  1 
ATOM   1058  O  OG1 . THR A 1 135  ? -34.065 88.100  13.329  1.00 23.06 ? 135  THR A OG1 1 
ATOM   1059  C  CG2 . THR A 1 135  ? -32.591 89.846  14.063  1.00 18.64 ? 135  THR A CG2 1 
ATOM   1060  N  N   . TYR A 1 136  ? -35.107 91.368  16.006  1.00 22.79 ? 136  TYR A N   1 
ATOM   1061  C  CA  . TYR A 1 136  ? -35.075 92.637  16.733  1.00 22.08 ? 136  TYR A CA  1 
ATOM   1062  C  C   . TYR A 1 136  ? -35.300 92.446  18.221  1.00 22.89 ? 136  TYR A C   1 
ATOM   1063  O  O   . TYR A 1 136  ? -34.599 93.039  19.050  1.00 21.66 ? 136  TYR A O   1 
ATOM   1064  C  CB  . TYR A 1 136  ? -36.150 93.588  16.205  1.00 21.83 ? 136  TYR A CB  1 
ATOM   1065  C  CG  . TYR A 1 136  ? -36.369 94.785  17.097  1.00 20.89 ? 136  TYR A CG  1 
ATOM   1066  C  CD1 . TYR A 1 136  ? -35.391 95.780  17.225  1.00 19.07 ? 136  TYR A CD1 1 
ATOM   1067  C  CD2 . TYR A 1 136  ? -37.555 94.922  17.822  1.00 19.47 ? 136  TYR A CD2 1 
ATOM   1068  C  CE1 . TYR A 1 136  ? -35.594 96.881  18.046  1.00 16.79 ? 136  TYR A CE1 1 
ATOM   1069  C  CE2 . TYR A 1 136  ? -37.767 96.013  18.643  1.00 18.39 ? 136  TYR A CE2 1 
ATOM   1070  C  CZ  . TYR A 1 136  ? -36.787 96.989  18.754  1.00 18.55 ? 136  TYR A CZ  1 
ATOM   1071  O  OH  . TYR A 1 136  ? -37.010 98.061  19.582  1.00 18.61 ? 136  TYR A OH  1 
ATOM   1072  N  N   . GLY A 1 137  ? -36.302 91.637  18.557  1.00 23.05 ? 137  GLY A N   1 
ATOM   1073  C  CA  . GLY A 1 137  ? -36.602 91.386  19.956  1.00 22.52 ? 137  GLY A CA  1 
ATOM   1074  C  C   . GLY A 1 137  ? -35.438 90.735  20.690  1.00 23.31 ? 137  GLY A C   1 
ATOM   1075  O  O   . GLY A 1 137  ? -35.067 91.154  21.778  1.00 21.56 ? 137  GLY A O   1 
ATOM   1076  N  N   . ARG A 1 138  ? -34.860 89.707  20.079  1.00 23.81 ? 138  ARG A N   1 
ATOM   1077  C  CA  . ARG A 1 138  ? -33.733 88.981  20.656  1.00 24.76 ? 138  ARG A CA  1 
ATOM   1078  C  C   . ARG A 1 138  ? -32.455 89.810  20.760  1.00 25.29 ? 138  ARG A C   1 
ATOM   1079  O  O   . ARG A 1 138  ? -31.709 89.683  21.738  1.00 25.27 ? 138  ARG A O   1 
ATOM   1080  C  CB  . ARG A 1 138  ? -33.426 87.727  19.835  1.00 25.39 ? 138  ARG A CB  1 
ATOM   1081  C  CG  . ARG A 1 138  ? -34.341 86.564  20.099  1.00 25.77 ? 138  ARG A CG  1 
ATOM   1082  C  CD  . ARG A 1 138  ? -34.032 85.423  19.142  1.00 29.25 ? 138  ARG A CD  1 
ATOM   1083  N  NE  . ARG A 1 138  ? -34.943 84.298  19.319  1.00 28.90 ? 138  ARG A NE  1 
ATOM   1084  C  CZ  . ARG A 1 138  ? -34.875 83.166  18.630  1.00 29.24 ? 138  ARG A CZ  1 
ATOM   1085  N  NH1 . ARG A 1 138  ? -33.935 83.003  17.719  1.00 27.17 ? 138  ARG A NH1 1 
ATOM   1086  N  NH2 . ARG A 1 138  ? -35.756 82.196  18.848  1.00 31.52 ? 138  ARG A NH2 1 
ATOM   1087  N  N   . ILE A 1 139  ? -32.191 90.644  19.761  1.00 24.68 ? 139  ILE A N   1 
ATOM   1088  C  CA  . ILE A 1 139  ? -30.985 91.454  19.790  1.00 24.07 ? 139  ILE A CA  1 
ATOM   1089  C  C   . ILE A 1 139  ? -31.140 92.627  20.748  1.00 23.60 ? 139  ILE A C   1 
ATOM   1090  O  O   . ILE A 1 139  ? -30.173 93.075  21.358  1.00 23.71 ? 139  ILE A O   1 
ATOM   1091  C  CB  . ILE A 1 139  ? -30.591 91.956  18.365  1.00 23.63 ? 139  ILE A CB  1 
ATOM   1092  C  CG1 . ILE A 1 139  ? -29.108 92.349  18.357  1.00 26.12 ? 139  ILE A CG1 1 
ATOM   1093  C  CG2 . ILE A 1 139  ? -31.418 93.153  17.950  1.00 21.95 ? 139  ILE A CG2 1 
ATOM   1094  C  CD1 . ILE A 1 139  ? -28.152 91.175  18.616  1.00 25.94 ? 139  ILE A CD1 1 
ATOM   1095  N  N   . ALA A 1 140  ? -32.359 93.128  20.902  1.00 23.91 ? 140  ALA A N   1 
ATOM   1096  C  CA  . ALA A 1 140  ? -32.581 94.241  21.824  1.00 23.74 ? 140  ALA A CA  1 
ATOM   1097  C  C   . ALA A 1 140  ? -32.318 93.717  23.236  1.00 23.69 ? 140  ALA A C   1 
ATOM   1098  O  O   . ALA A 1 140  ? -31.712 94.398  24.068  1.00 22.82 ? 140  ALA A O   1 
ATOM   1099  C  CB  . ALA A 1 140  ? -34.002 94.744  21.711  1.00 24.53 ? 140  ALA A CB  1 
ATOM   1100  N  N   . GLU A 1 141  ? -32.776 92.496  23.490  1.00 21.90 ? 141  GLU A N   1 
ATOM   1101  C  CA  . GLU A 1 141  ? -32.582 91.856  24.771  1.00 22.66 ? 141  GLU A CA  1 
ATOM   1102  C  C   . GLU A 1 141  ? -31.081 91.666  25.030  1.00 24.01 ? 141  GLU A C   1 
ATOM   1103  O  O   . GLU A 1 141  ? -30.572 91.998  26.108  1.00 24.97 ? 141  GLU A O   1 
ATOM   1104  C  CB  . GLU A 1 141  ? -33.284 90.499  24.785  1.00 21.73 ? 141  GLU A CB  1 
ATOM   1105  C  CG  . GLU A 1 141  ? -32.843 89.584  25.935  1.00 24.09 ? 141  GLU A CG  1 
ATOM   1106  C  CD  . GLU A 1 141  ? -33.629 88.309  25.989  1.00 26.14 ? 141  GLU A CD  1 
ATOM   1107  O  OE1 . GLU A 1 141  ? -33.636 87.560  24.986  1.00 29.25 ? 141  GLU A OE1 1 
ATOM   1108  O  OE2 . GLU A 1 141  ? -34.249 88.056  27.038  1.00 29.53 ? 141  GLU A OE2 1 
ATOM   1109  N  N   . SER A 1 142  ? -30.386 91.103  24.045  1.00 24.30 ? 142  SER A N   1 
ATOM   1110  C  CA  . SER A 1 142  ? -28.953 90.893  24.158  1.00 24.62 ? 142  SER A CA  1 
ATOM   1111  C  C   . SER A 1 142  ? -28.272 92.200  24.540  1.00 24.74 ? 142  SER A C   1 
ATOM   1112  O  O   . SER A 1 142  ? -27.357 92.217  25.365  1.00 26.31 ? 142  SER A O   1 
ATOM   1113  C  CB  . SER A 1 142  ? -28.388 90.385  22.836  1.00 24.34 ? 142  SER A CB  1 
ATOM   1114  O  OG  . SER A 1 142  ? -27.079 89.912  23.024  1.00 24.83 ? 142  SER A OG  1 
ATOM   1115  N  N   . GLN A 1 143  ? -28.722 93.301  23.952  1.00 24.84 ? 143  GLN A N   1 
ATOM   1116  C  CA  . GLN A 1 143  ? -28.138 94.600  24.282  1.00 25.12 ? 143  GLN A CA  1 
ATOM   1117  C  C   . GLN A 1 143  ? -28.403 94.960  25.751  1.00 25.10 ? 143  GLN A C   1 
ATOM   1118  O  O   . GLN A 1 143  ? -27.520 95.468  26.442  1.00 24.85 ? 143  GLN A O   1 
ATOM   1119  C  CB  . GLN A 1 143  ? -28.685 95.687  23.342  1.00 24.85 ? 143  GLN A CB  1 
ATOM   1120  C  CG  . GLN A 1 143  ? -28.246 97.099  23.676  1.00 23.85 ? 143  GLN A CG  1 
ATOM   1121  C  CD  . GLN A 1 143  ? -28.724 98.124  22.651  1.00 25.13 ? 143  GLN A CD  1 
ATOM   1122  O  OE1 . GLN A 1 143  ? -27.944 98.636  21.865  1.00 25.21 ? 143  GLN A OE1 1 
ATOM   1123  N  NE2 . GLN A 1 143  ? -30.014 98.415  22.656  1.00 26.43 ? 143  GLN A NE2 1 
ATOM   1124  N  N   . ALA A 1 144  ? -29.604 94.676  26.233  1.00 25.31 ? 144  ALA A N   1 
ATOM   1125  C  CA  . ALA A 1 144  ? -29.948 94.986  27.612  1.00 25.82 ? 144  ALA A CA  1 
ATOM   1126  C  C   . ALA A 1 144  ? -29.225 94.083  28.627  1.00 26.00 ? 144  ALA A C   1 
ATOM   1127  O  O   . ALA A 1 144  ? -29.098 94.453  29.801  1.00 27.26 ? 144  ALA A O   1 
ATOM   1128  C  CB  . ALA A 1 144  ? -31.466 94.888  27.804  1.00 25.38 ? 144  ALA A CB  1 
ATOM   1129  N  N   . ARG A 1 145  ? -28.749 92.920  28.185  1.00 25.97 ? 145  ARG A N   1 
ATOM   1130  C  CA  . ARG A 1 145  ? -28.058 91.985  29.075  1.00 26.28 ? 145  ARG A CA  1 
ATOM   1131  C  C   . ARG A 1 145  ? -26.565 92.239  29.284  1.00 25.18 ? 145  ARG A C   1 
ATOM   1132  O  O   . ARG A 1 145  ? -25.934 91.526  30.057  1.00 24.61 ? 145  ARG A O   1 
ATOM   1133  C  CB  . ARG A 1 145  ? -28.178 90.546  28.554  1.00 28.07 ? 145  ARG A CB  1 
ATOM   1134  C  CG  . ARG A 1 145  ? -29.471 89.846  28.831  1.00 31.36 ? 145  ARG A CG  1 
ATOM   1135  C  CD  . ARG A 1 145  ? -29.396 88.440  28.274  1.00 37.21 ? 145  ARG A CD  1 
ATOM   1136  N  NE  . ARG A 1 145  ? -29.023 87.464  29.292  1.00 41.07 ? 145  ARG A NE  1 
ATOM   1137  C  CZ  . ARG A 1 145  ? -28.133 86.492  29.112  1.00 42.59 ? 145  ARG A CZ  1 
ATOM   1138  N  NH1 . ARG A 1 145  ? -27.500 86.357  27.955  1.00 43.04 ? 145  ARG A NH1 1 
ATOM   1139  N  NH2 . ARG A 1 145  ? -27.888 85.629  30.087  1.00 45.87 ? 145  ARG A NH2 1 
ATOM   1140  N  N   . GLN A 1 146  ? -25.988 93.222  28.595  1.00 24.56 ? 146  GLN A N   1 
ATOM   1141  C  CA  . GLN A 1 146  ? -24.545 93.468  28.721  1.00 23.61 ? 146  GLN A CA  1 
ATOM   1142  C  C   . GLN A 1 146  ? -24.097 94.075  30.055  1.00 23.43 ? 146  GLN A C   1 
ATOM   1143  O  O   . GLN A 1 146  ? -23.213 94.937  30.091  1.00 23.84 ? 146  GLN A O   1 
ATOM   1144  C  CB  . GLN A 1 146  ? -24.046 94.353  27.568  1.00 21.71 ? 146  GLN A CB  1 
ATOM   1145  C  CG  . GLN A 1 146  ? -24.190 93.752  26.165  1.00 21.78 ? 146  GLN A CG  1 
ATOM   1146  C  CD  . GLN A 1 146  ? -23.689 92.314  26.048  1.00 21.32 ? 146  GLN A CD  1 
ATOM   1147  O  OE1 . GLN A 1 146  ? -24.479 91.380  26.025  1.00 23.76 ? 146  GLN A OE1 1 
ATOM   1148  N  NE2 . GLN A 1 146  ? -22.383 92.137  25.970  1.00 19.29 ? 146  GLN A NE2 1 
ATOM   1149  N  N   . ILE A 1 147  ? -24.713 93.617  31.143  1.00 21.73 ? 147  ILE A N   1 
ATOM   1150  C  CA  . ILE A 1 147  ? -24.390 94.094  32.478  1.00 19.43 ? 147  ILE A CA  1 
ATOM   1151  C  C   . ILE A 1 147  ? -24.212 92.896  33.407  1.00 20.33 ? 147  ILE A C   1 
ATOM   1152  O  O   . ILE A 1 147  ? -24.660 91.789  33.093  1.00 18.46 ? 147  ILE A O   1 
ATOM   1153  C  CB  . ILE A 1 147  ? -25.482 95.041  33.014  1.00 17.84 ? 147  ILE A CB  1 
ATOM   1154  C  CG1 . ILE A 1 147  ? -26.853 94.371  32.934  1.00 16.53 ? 147  ILE A CG1 1 
ATOM   1155  C  CG2 . ILE A 1 147  ? -25.493 96.345  32.186  1.00 15.67 ? 147  ILE A CG2 1 
ATOM   1156  C  CD1 . ILE A 1 147  ? -27.969 95.167  33.625  1.00 14.65 ? 147  ILE A CD1 1 
ATOM   1157  N  N   . LYS A 1 148  ? -23.533 93.127  34.530  1.00 20.35 ? 148  LYS A N   1 
ATOM   1158  C  CA  . LYS A 1 148  ? -23.239 92.083  35.505  1.00 21.65 ? 148  LYS A CA  1 
ATOM   1159  C  C   . LYS A 1 148  ? -24.427 91.732  36.355  1.00 21.73 ? 148  LYS A C   1 
ATOM   1160  O  O   . LYS A 1 148  ? -24.560 90.600  36.797  1.00 22.16 ? 148  LYS A O   1 
ATOM   1161  C  CB  . LYS A 1 148  ? -22.113 92.524  36.449  1.00 20.70 ? 148  LYS A CB  1 
ATOM   1162  C  CG  . LYS A 1 148  ? -20.839 92.969  35.760  1.00 22.41 ? 148  LYS A CG  1 
ATOM   1163  C  CD  . LYS A 1 148  ? -19.761 93.282  36.790  1.00 21.95 ? 148  LYS A CD  1 
ATOM   1164  C  CE  . LYS A 1 148  ? -18.441 93.638  36.134  1.00 20.50 ? 148  LYS A CE  1 
ATOM   1165  N  NZ  . LYS A 1 148  ? -18.491 94.973  35.521  1.00 18.14 ? 148  LYS A NZ  1 
ATOM   1166  N  N   . ALA A 1 149  ? -25.284 92.718  36.592  1.00 22.18 ? 149  ALA A N   1 
ATOM   1167  C  CA  . ALA A 1 149  ? -26.448 92.531  37.446  1.00 21.73 ? 149  ALA A CA  1 
ATOM   1168  C  C   . ALA A 1 149  ? -27.387 93.711  37.275  1.00 21.44 ? 149  ALA A C   1 
ATOM   1169  O  O   . ALA A 1 149  ? -27.056 94.674  36.592  1.00 19.92 ? 149  ALA A O   1 
ATOM   1170  C  CB  . ALA A 1 149  ? -26.001 92.420  38.917  1.00 19.17 ? 149  ALA A CB  1 
ATOM   1171  N  N   . PRO A 1 150  ? -28.572 93.652  37.902  1.00 22.12 ? 150  PRO A N   1 
ATOM   1172  C  CA  . PRO A 1 150  ? -29.551 94.739  37.804  1.00 21.82 ? 150  PRO A CA  1 
ATOM   1173  C  C   . PRO A 1 150  ? -28.974 96.081  38.239  1.00 21.50 ? 150  PRO A C   1 
ATOM   1174  O  O   . PRO A 1 150  ? -28.312 96.179  39.272  1.00 22.23 ? 150  PRO A O   1 
ATOM   1175  C  CB  . PRO A 1 150  ? -30.673 94.282  38.735  1.00 22.38 ? 150  PRO A CB  1 
ATOM   1176  C  CG  . PRO A 1 150  ? -30.581 92.790  38.681  1.00 22.24 ? 150  PRO A CG  1 
ATOM   1177  C  CD  . PRO A 1 150  ? -29.090 92.555  38.740  1.00 22.77 ? 150  PRO A CD  1 
ATOM   1178  N  N   . LEU A 1 151  ? -29.234 97.118  37.459  1.00 21.39 ? 151  LEU A N   1 
ATOM   1179  C  CA  . LEU A 1 151  ? -28.738 98.443  37.804  1.00 21.41 ? 151  LEU A CA  1 
ATOM   1180  C  C   . LEU A 1 151  ? -29.171 98.895  39.208  1.00 21.35 ? 151  LEU A C   1 
ATOM   1181  O  O   . LEU A 1 151  ? -28.437 99.625  39.878  1.00 21.43 ? 151  LEU A O   1 
ATOM   1182  C  CB  . LEU A 1 151  ? -29.193 99.469  36.761  1.00 18.84 ? 151  LEU A CB  1 
ATOM   1183  C  CG  . LEU A 1 151  ? -28.672 99.196  35.347  1.00 16.99 ? 151  LEU A CG  1 
ATOM   1184  C  CD1 . LEU A 1 151  ? -29.190 100.274 34.397  1.00 13.03 ? 151  LEU A CD1 1 
ATOM   1185  C  CD2 . LEU A 1 151  ? -27.141 99.163  35.348  1.00 12.63 ? 151  LEU A CD2 1 
ATOM   1186  N  N   . GLU A 1 152  ? -30.344 98.457  39.654  1.00 22.80 ? 152  GLU A N   1 
ATOM   1187  C  CA  . GLU A 1 152  ? -30.850 98.832  40.975  1.00 23.13 ? 152  GLU A CA  1 
ATOM   1188  C  C   . GLU A 1 152  ? -29.919 98.448  42.125  1.00 23.63 ? 152  GLU A C   1 
ATOM   1189  O  O   . GLU A 1 152  ? -29.903 99.122  43.150  1.00 23.22 ? 152  GLU A O   1 
ATOM   1190  C  CB  . GLU A 1 152  ? -32.226 98.212  41.218  1.00 24.17 ? 152  GLU A CB  1 
ATOM   1191  C  CG  . GLU A 1 152  ? -33.366 98.836  40.402  1.00 23.02 ? 152  GLU A CG  1 
ATOM   1192  C  CD  . GLU A 1 152  ? -33.638 98.122  39.082  1.00 23.96 ? 152  GLU A CD  1 
ATOM   1193  O  OE1 . GLU A 1 152  ? -33.207 96.955  38.923  1.00 25.07 ? 152  GLU A OE1 1 
ATOM   1194  O  OE2 . GLU A 1 152  ? -34.299 98.725  38.209  1.00 23.61 ? 152  GLU A OE2 1 
ATOM   1195  N  N   . LYS A 1 153  ? -29.160 97.367  41.962  1.00 24.56 ? 153  LYS A N   1 
ATOM   1196  C  CA  . LYS A 1 153  ? -28.214 96.929  42.990  1.00 25.37 ? 153  LYS A CA  1 
ATOM   1197  C  C   . LYS A 1 153  ? -27.099 97.955  43.119  1.00 24.16 ? 153  LYS A C   1 
ATOM   1198  O  O   . LYS A 1 153  ? -26.756 98.376  44.216  1.00 23.14 ? 153  LYS A O   1 
ATOM   1199  C  CB  . LYS A 1 153  ? -27.595 95.569  42.619  1.00 27.53 ? 153  LYS A CB  1 
ATOM   1200  C  CG  . LYS A 1 153  ? -28.478 94.353  42.890  1.00 27.38 ? 153  LYS A CG  1 
ATOM   1201  C  CD  . LYS A 1 153  ? -28.185 93.757  44.251  1.00 28.68 ? 153  LYS A CD  1 
ATOM   1202  C  CE  . LYS A 1 153  ? -29.059 92.549  44.527  1.00 29.07 ? 153  LYS A CE  1 
ATOM   1203  N  NZ  . LYS A 1 153  ? -28.640 91.867  45.776  1.00 30.58 ? 153  LYS A NZ  1 
ATOM   1204  N  N   . PHE A 1 154  ? -26.547 98.350  41.979  1.00 23.29 ? 154  PHE A N   1 
ATOM   1205  C  CA  . PHE A 1 154  ? -25.459 99.322  41.942  1.00 22.21 ? 154  PHE A CA  1 
ATOM   1206  C  C   . PHE A 1 154  ? -25.892 100.687 42.447  1.00 22.29 ? 154  PHE A C   1 
ATOM   1207  O  O   . PHE A 1 154  ? -25.109 101.379 43.097  1.00 22.04 ? 154  PHE A O   1 
ATOM   1208  C  CB  . PHE A 1 154  ? -24.917 99.423  40.526  1.00 20.96 ? 154  PHE A CB  1 
ATOM   1209  C  CG  . PHE A 1 154  ? -24.219 98.184  40.074  1.00 22.92 ? 154  PHE A CG  1 
ATOM   1210  C  CD1 . PHE A 1 154  ? -22.870 97.974  40.377  1.00 23.13 ? 154  PHE A CD1 1 
ATOM   1211  C  CD2 . PHE A 1 154  ? -24.905 97.218  39.352  1.00 22.34 ? 154  PHE A CD2 1 
ATOM   1212  C  CE1 . PHE A 1 154  ? -22.217 96.817  39.968  1.00 23.02 ? 154  PHE A CE1 1 
ATOM   1213  C  CE2 . PHE A 1 154  ? -24.271 96.062  38.941  1.00 23.41 ? 154  PHE A CE2 1 
ATOM   1214  C  CZ  . PHE A 1 154  ? -22.917 95.860  39.246  1.00 23.58 ? 154  PHE A CZ  1 
ATOM   1215  N  N   . VAL A 1 155  ? -27.138 101.071 42.161  1.00 22.91 ? 155  VAL A N   1 
ATOM   1216  C  CA  . VAL A 1 155  ? -27.656 102.359 42.616  1.00 23.33 ? 155  VAL A CA  1 
ATOM   1217  C  C   . VAL A 1 155  ? -27.880 102.308 44.128  1.00 24.54 ? 155  VAL A C   1 
ATOM   1218  O  O   . VAL A 1 155  ? -27.475 103.208 44.860  1.00 24.90 ? 155  VAL A O   1 
ATOM   1219  C  CB  . VAL A 1 155  ? -28.989 102.713 41.928  1.00 23.18 ? 155  VAL A CB  1 
ATOM   1220  C  CG1 . VAL A 1 155  ? -29.544 104.024 42.507  1.00 22.69 ? 155  VAL A CG1 1 
ATOM   1221  C  CG2 . VAL A 1 155  ? -28.777 102.842 40.420  1.00 20.19 ? 155  VAL A CG2 1 
ATOM   1222  N  N   . LEU A 1 156  ? -28.517 101.241 44.595  1.00 24.75 ? 156  LEU A N   1 
ATOM   1223  C  CA  . LEU A 1 156  ? -28.777 101.108 46.008  1.00 23.97 ? 156  LEU A CA  1 
ATOM   1224  C  C   . LEU A 1 156  ? -27.442 101.171 46.753  1.00 24.67 ? 156  LEU A C   1 
ATOM   1225  O  O   . LEU A 1 156  ? -27.305 101.865 47.772  1.00 24.40 ? 156  LEU A O   1 
ATOM   1226  C  CB  . LEU A 1 156  ? -29.509 99.792  46.297  1.00 23.52 ? 156  LEU A CB  1 
ATOM   1227  C  CG  . LEU A 1 156  ? -30.085 99.701  47.715  1.00 24.60 ? 156  LEU A CG  1 
ATOM   1228  C  CD1 . LEU A 1 156  ? -31.030 100.881 47.965  1.00 22.27 ? 156  LEU A CD1 1 
ATOM   1229  C  CD2 . LEU A 1 156  ? -30.801 98.366  47.897  1.00 24.09 ? 156  LEU A CD2 1 
ATOM   1230  N  N   . ALA A 1 157  ? -26.444 100.462 46.246  1.00 23.86 ? 157  ALA A N   1 
ATOM   1231  C  CA  . ALA A 1 157  ? -25.145 100.493 46.906  1.00 23.37 ? 157  ALA A CA  1 
ATOM   1232  C  C   . ALA A 1 157  ? -24.608 101.928 46.934  1.00 22.79 ? 157  ALA A C   1 
ATOM   1233  O  O   . ALA A 1 157  ? -24.075 102.376 47.954  1.00 22.85 ? 157  ALA A O   1 
ATOM   1234  C  CB  . ALA A 1 157  ? -24.149 99.559  46.200  1.00 23.40 ? 157  ALA A CB  1 
ATOM   1235  N  N   . LEU A 1 158  ? -24.755 102.658 45.829  1.00 21.63 ? 158  LEU A N   1 
ATOM   1236  C  CA  . LEU A 1 158  ? -24.269 104.029 45.811  1.00 21.09 ? 158  LEU A CA  1 
ATOM   1237  C  C   . LEU A 1 158  ? -25.024 104.907 46.823  1.00 21.46 ? 158  LEU A C   1 
ATOM   1238  O  O   . LEU A 1 158  ? -24.424 105.751 47.488  1.00 21.97 ? 158  LEU A O   1 
ATOM   1239  C  CB  . LEU A 1 158  ? -24.370 104.618 44.399  1.00 21.65 ? 158  LEU A CB  1 
ATOM   1240  C  CG  . LEU A 1 158  ? -23.861 106.060 44.252  1.00 20.38 ? 158  LEU A CG  1 
ATOM   1241  C  CD1 . LEU A 1 158  ? -22.397 106.141 44.598  1.00 18.35 ? 158  LEU A CD1 1 
ATOM   1242  C  CD2 . LEU A 1 158  ? -24.086 106.539 42.845  1.00 22.27 ? 158  LEU A CD2 1 
ATOM   1243  N  N   . LEU A 1 159  ? -26.333 104.706 46.948  1.00 22.70 ? 159  LEU A N   1 
ATOM   1244  C  CA  . LEU A 1 159  ? -27.112 105.490 47.901  1.00 24.01 ? 159  LEU A CA  1 
ATOM   1245  C  C   . LEU A 1 159  ? -26.667 105.173 49.332  1.00 25.08 ? 159  LEU A C   1 
ATOM   1246  O  O   . LEU A 1 159  ? -26.494 106.068 50.166  1.00 25.88 ? 159  LEU A O   1 
ATOM   1247  C  CB  . LEU A 1 159  ? -28.611 105.191 47.772  1.00 22.14 ? 159  LEU A CB  1 
ATOM   1248  C  CG  . LEU A 1 159  ? -29.364 105.606 46.503  1.00 22.43 ? 159  LEU A CG  1 
ATOM   1249  C  CD1 . LEU A 1 159  ? -30.814 105.150 46.612  1.00 19.32 ? 159  LEU A CD1 1 
ATOM   1250  C  CD2 . LEU A 1 159  ? -29.279 107.113 46.314  1.00 21.60 ? 159  LEU A CD2 1 
ATOM   1251  N  N   . VAL A 1 160  ? -26.476 103.892 49.615  1.00 25.94 ? 160  VAL A N   1 
ATOM   1252  C  CA  . VAL A 1 160  ? -26.079 103.500 50.950  1.00 25.32 ? 160  VAL A CA  1 
ATOM   1253  C  C   . VAL A 1 160  ? -24.704 104.036 51.336  1.00 26.83 ? 160  VAL A C   1 
ATOM   1254  O  O   . VAL A 1 160  ? -24.522 104.539 52.451  1.00 28.25 ? 160  VAL A O   1 
ATOM   1255  C  CB  . VAL A 1 160  ? -26.138 101.960 51.099  1.00 24.54 ? 160  VAL A CB  1 
ATOM   1256  C  CG1 . VAL A 1 160  ? -25.513 101.519 52.425  1.00 23.87 ? 160  VAL A CG1 1 
ATOM   1257  C  CG2 . VAL A 1 160  ? -27.593 101.509 51.029  1.00 22.54 ? 160  VAL A CG2 1 
ATOM   1258  N  N   . ALA A 1 161  ? -23.739 103.986 50.423  1.00 26.07 ? 161  ALA A N   1 
ATOM   1259  C  CA  . ALA A 1 161  ? -22.395 104.433 50.751  1.00 26.48 ? 161  ALA A CA  1 
ATOM   1260  C  C   . ALA A 1 161  ? -22.313 105.952 50.801  1.00 26.91 ? 161  ALA A C   1 
ATOM   1261  O  O   . ALA A 1 161  ? -21.531 106.497 51.616  1.00 26.87 ? 161  ALA A O   1 
ATOM   1262  C  CB  . ALA A 1 161  ? -21.394 103.880 49.750  1.00 26.50 ? 161  ALA A CB  1 
ATOM   1263  N  N   . GLU A 1 162  ? -23.063 106.657 49.964  1.00 26.26 ? 162  GLU A N   1 
ATOM   1264  C  CA  . GLU A 1 162  ? -23.028 108.113 49.937  1.00 24.66 ? 162  GLU A CA  1 
ATOM   1265  C  C   . GLU A 1 162  ? -23.784 108.770 51.077  1.00 23.12 ? 162  GLU A C   1 
ATOM   1266  O  O   . GLU A 1 162  ? -23.554 109.924 51.395  1.00 21.91 ? 162  GLU A O   1 
ATOM   1267  C  CB  . GLU A 1 162  ? -23.535 108.632 48.589  1.00 25.65 ? 162  GLU A CB  1 
ATOM   1268  C  CG  . GLU A 1 162  ? -22.577 108.342 47.432  1.00 24.34 ? 162  GLU A CG  1 
ATOM   1269  C  CD  . GLU A 1 162  ? -21.266 109.091 47.557  1.00 26.13 ? 162  GLU A CD  1 
ATOM   1270  O  OE1 . GLU A 1 162  ? -21.292 110.334 47.457  1.00 26.99 ? 162  GLU A OE1 1 
ATOM   1271  O  OE2 . GLU A 1 162  ? -20.214 108.447 47.761  1.00 23.94 ? 162  GLU A OE2 1 
ATOM   1272  N  N   . ALA A 1 163  ? -24.673 108.028 51.719  1.00 23.42 ? 163  ALA A N   1 
ATOM   1273  C  CA  . ALA A 1 163  ? -25.420 108.595 52.838  1.00 24.02 ? 163  ALA A CA  1 
ATOM   1274  C  C   . ALA A 1 163  ? -24.445 108.874 53.989  1.00 24.48 ? 163  ALA A C   1 
ATOM   1275  O  O   . ALA A 1 163  ? -24.802 109.505 54.986  1.00 22.74 ? 163  ALA A O   1 
ATOM   1276  C  CB  . ALA A 1 163  ? -26.509 107.634 53.288  1.00 20.69 ? 163  ALA A CB  1 
ATOM   1277  N  N   . GLY A 1 164  ? -23.210 108.400 53.829  1.00 26.39 ? 164  GLY A N   1 
ATOM   1278  C  CA  . GLY A 1 164  ? -22.189 108.604 54.841  1.00 26.67 ? 164  GLY A CA  1 
ATOM   1279  C  C   . GLY A 1 164  ? -21.590 109.996 54.773  1.00 27.62 ? 164  GLY A C   1 
ATOM   1280  O  O   . GLY A 1 164  ? -20.852 110.400 55.666  1.00 29.36 ? 164  GLY A O   1 
ATOM   1281  N  N   . GLY A 1 165  ? -21.893 110.732 53.709  1.00 27.13 ? 165  GLY A N   1 
ATOM   1282  C  CA  . GLY A 1 165  ? -21.366 112.079 53.574  1.00 26.30 ? 165  GLY A CA  1 
ATOM   1283  C  C   . GLY A 1 165  ? -19.884 112.149 53.274  1.00 28.15 ? 165  GLY A C   1 
ATOM   1284  O  O   . GLY A 1 165  ? -19.245 111.129 53.009  1.00 28.73 ? 165  GLY A O   1 
ATOM   1285  N  N   . SER A 1 166  ? -19.329 113.359 53.309  1.00 29.25 ? 166  SER A N   1 
ATOM   1286  C  CA  . SER A 1 166  ? -17.914 113.556 53.035  1.00 29.88 ? 166  SER A CA  1 
ATOM   1287  C  C   . SER A 1 166  ? -17.012 112.728 53.928  1.00 28.72 ? 166  SER A C   1 
ATOM   1288  O  O   . SER A 1 166  ? -17.325 112.486 55.090  1.00 27.31 ? 166  SER A O   1 
ATOM   1289  C  CB  . SER A 1 166  ? -17.552 115.028 53.169  1.00 31.92 ? 166  SER A CB  1 
ATOM   1290  O  OG  . SER A 1 166  ? -18.034 115.763 52.050  1.00 37.37 ? 166  SER A OG  1 
ATOM   1291  N  N   . LEU A 1 167  ? -15.885 112.303 53.368  1.00 27.58 ? 167  LEU A N   1 
ATOM   1292  C  CA  . LEU A 1 167  ? -14.925 111.491 54.089  1.00 27.06 ? 167  LEU A CA  1 
ATOM   1293  C  C   . LEU A 1 167  ? -13.676 112.264 54.510  1.00 27.48 ? 167  LEU A C   1 
ATOM   1294  O  O   . LEU A 1 167  ? -13.099 113.031 53.733  1.00 26.96 ? 167  LEU A O   1 
ATOM   1295  C  CB  . LEU A 1 167  ? -14.547 110.276 53.246  1.00 27.58 ? 167  LEU A CB  1 
ATOM   1296  C  CG  . LEU A 1 167  ? -15.319 108.964 53.476  1.00 27.94 ? 167  LEU A CG  1 
ATOM   1297  C  CD1 . LEU A 1 167  ? -16.591 109.217 54.252  1.00 26.89 ? 167  LEU A CD1 1 
ATOM   1298  C  CD2 . LEU A 1 167  ? -15.597 108.285 52.116  1.00 26.90 ? 167  LEU A CD2 1 
ATOM   1299  N  N   . TYR A 1 168  ? -13.268 112.046 55.761  1.00 26.81 ? 168  TYR A N   1 
ATOM   1300  C  CA  . TYR A 1 168  ? -12.103 112.706 56.338  1.00 26.13 ? 168  TYR A CA  1 
ATOM   1301  C  C   . TYR A 1 168  ? -10.831 111.995 55.927  1.00 25.44 ? 168  TYR A C   1 
ATOM   1302  O  O   . TYR A 1 168  ? -10.637 110.835 56.274  1.00 24.38 ? 168  TYR A O   1 
ATOM   1303  C  CB  . TYR A 1 168  ? -12.227 112.694 57.863  1.00 27.60 ? 168  TYR A CB  1 
ATOM   1304  C  CG  . TYR A 1 168  ? -11.151 113.463 58.610  1.00 26.57 ? 168  TYR A CG  1 
ATOM   1305  C  CD1 . TYR A 1 168  ? -11.018 114.849 58.472  1.00 24.53 ? 168  TYR A CD1 1 
ATOM   1306  C  CD2 . TYR A 1 168  ? -10.283 112.802 59.480  1.00 26.45 ? 168  TYR A CD2 1 
ATOM   1307  C  CE1 . TYR A 1 168  ? -10.040 115.553 59.188  1.00 23.84 ? 168  TYR A CE1 1 
ATOM   1308  C  CE2 . TYR A 1 168  ? -9.302  113.497 60.198  1.00 25.90 ? 168  TYR A CE2 1 
ATOM   1309  C  CZ  . TYR A 1 168  ? -9.187  114.867 60.052  1.00 25.52 ? 168  TYR A CZ  1 
ATOM   1310  O  OH  . TYR A 1 168  ? -8.224  115.530 60.775  1.00 24.69 ? 168  TYR A OH  1 
ATOM   1311  N  N   . ASP A 1 169  ? -9.957  112.679 55.192  1.00 26.30 ? 169  ASP A N   1 
ATOM   1312  C  CA  . ASP A 1 169  ? -8.703  112.065 54.758  1.00 25.95 ? 169  ASP A CA  1 
ATOM   1313  C  C   . ASP A 1 169  ? -7.698  112.056 55.906  1.00 26.45 ? 169  ASP A C   1 
ATOM   1314  O  O   . ASP A 1 169  ? -7.294  113.105 56.387  1.00 26.14 ? 169  ASP A O   1 
ATOM   1315  C  CB  . ASP A 1 169  ? -8.106  112.820 53.563  1.00 26.86 ? 169  ASP A CB  1 
ATOM   1316  C  CG  . ASP A 1 169  ? -6.871  112.138 52.996  1.00 28.87 ? 169  ASP A CG  1 
ATOM   1317  O  OD1 . ASP A 1 169  ? -5.885  111.939 53.729  1.00 30.89 ? 169  ASP A OD1 1 
ATOM   1318  O  OD2 . ASP A 1 169  ? -6.880  111.791 51.805  1.00 33.33 ? 169  ASP A OD2 1 
ATOM   1319  N  N   . PRO A 1 170  ? -7.260  110.864 56.336  1.00 27.33 ? 170  PRO A N   1 
ATOM   1320  C  CA  . PRO A 1 170  ? -6.301  110.707 57.431  1.00 28.15 ? 170  PRO A CA  1 
ATOM   1321  C  C   . PRO A 1 170  ? -4.964  111.434 57.214  1.00 28.81 ? 170  PRO A C   1 
ATOM   1322  O  O   . PRO A 1 170  ? -4.337  111.882 58.167  1.00 28.98 ? 170  PRO A O   1 
ATOM   1323  C  CB  . PRO A 1 170  ? -6.102  109.191 57.514  1.00 28.44 ? 170  PRO A CB  1 
ATOM   1324  C  CG  . PRO A 1 170  ? -7.286  108.624 56.766  1.00 29.73 ? 170  PRO A CG  1 
ATOM   1325  C  CD  . PRO A 1 170  ? -7.492  109.574 55.663  1.00 27.75 ? 170  PRO A CD  1 
ATOM   1326  N  N   . VAL A 1 171  ? -4.522  111.544 55.970  1.00 28.91 ? 171  VAL A N   1 
ATOM   1327  C  CA  . VAL A 1 171  ? -3.256  112.212 55.691  1.00 29.72 ? 171  VAL A CA  1 
ATOM   1328  C  C   . VAL A 1 171  ? -3.385  113.721 55.513  1.00 30.34 ? 171  VAL A C   1 
ATOM   1329  O  O   . VAL A 1 171  ? -2.638  114.484 56.124  1.00 30.66 ? 171  VAL A O   1 
ATOM   1330  C  CB  . VAL A 1 171  ? -2.583  111.617 54.436  1.00 29.39 ? 171  VAL A CB  1 
ATOM   1331  C  CG1 . VAL A 1 171  ? -1.344  112.428 54.066  1.00 29.34 ? 171  VAL A CG1 1 
ATOM   1332  C  CG2 . VAL A 1 171  ? -2.202  110.160 54.702  1.00 29.83 ? 171  VAL A CG2 1 
ATOM   1333  N  N   . LEU A 1 172  ? -4.326  114.145 54.673  1.00 30.22 ? 172  LEU A N   1 
ATOM   1334  C  CA  . LEU A 1 172  ? -4.545  115.566 54.411  1.00 30.74 ? 172  LEU A CA  1 
ATOM   1335  C  C   . LEU A 1 172  ? -5.197  116.253 55.600  1.00 30.17 ? 172  LEU A C   1 
ATOM   1336  O  O   . LEU A 1 172  ? -5.179  117.475 55.716  1.00 31.11 ? 172  LEU A O   1 
ATOM   1337  C  CB  . LEU A 1 172  ? -5.436  115.742 53.175  1.00 31.20 ? 172  LEU A CB  1 
ATOM   1338  C  CG  . LEU A 1 172  ? -4.968  115.020 51.912  1.00 30.69 ? 172  LEU A CG  1 
ATOM   1339  C  CD1 . LEU A 1 172  ? -5.982  115.264 50.788  1.00 31.17 ? 172  LEU A CD1 1 
ATOM   1340  C  CD2 . LEU A 1 172  ? -3.581  115.508 51.523  1.00 29.76 ? 172  LEU A CD2 1 
ATOM   1341  N  N   . GLN A 1 173  ? -5.790  115.447 56.465  1.00 29.45 ? 173  GLN A N   1 
ATOM   1342  C  CA  . GLN A 1 173  ? -6.467  115.936 57.648  1.00 29.90 ? 173  GLN A CA  1 
ATOM   1343  C  C   . GLN A 1 173  ? -7.610  116.913 57.371  1.00 29.09 ? 173  GLN A C   1 
ATOM   1344  O  O   . GLN A 1 173  ? -7.748  117.932 58.033  1.00 28.77 ? 173  GLN A O   1 
ATOM   1345  C  CB  . GLN A 1 173  ? -5.445  116.532 58.611  1.00 30.09 ? 173  GLN A CB  1 
ATOM   1346  C  CG  . GLN A 1 173  ? -4.654  115.449 59.328  1.00 32.22 ? 173  GLN A CG  1 
ATOM   1347  C  CD  . GLN A 1 173  ? -3.743  115.982 60.420  1.00 34.35 ? 173  GLN A CD  1 
ATOM   1348  O  OE1 . GLN A 1 173  ? -2.661  116.515 60.144  1.00 35.36 ? 173  GLN A OE1 1 
ATOM   1349  N  NE2 . GLN A 1 173  ? -4.179  115.841 61.670  1.00 32.95 ? 173  GLN A NE2 1 
ATOM   1350  N  N   . LYS A 1 174  ? -8.430  116.573 56.385  1.00 27.87 ? 174  LYS A N   1 
ATOM   1351  C  CA  . LYS A 1 174  ? -9.589  117.372 56.014  1.00 27.34 ? 174  LYS A CA  1 
ATOM   1352  C  C   . LYS A 1 174  ? -10.597 116.528 55.229  1.00 26.65 ? 174  LYS A C   1 
ATOM   1353  O  O   . LYS A 1 174  ? -10.258 115.489 54.661  1.00 25.31 ? 174  LYS A O   1 
ATOM   1354  C  CB  . LYS A 1 174  ? -9.171  118.600 55.196  1.00 27.82 ? 174  LYS A CB  1 
ATOM   1355  C  CG  . LYS A 1 174  ? -8.181  118.321 54.088  1.00 27.98 ? 174  LYS A CG  1 
ATOM   1356  C  CD  . LYS A 1 174  ? -8.636  118.966 52.792  1.00 32.36 ? 174  LYS A CD  1 
ATOM   1357  C  CE  . LYS A 1 174  ? -8.721  120.473 52.896  1.00 32.84 ? 174  LYS A CE  1 
ATOM   1358  N  NZ  . LYS A 1 174  ? -9.760  121.039 51.974  1.00 32.99 ? 174  LYS A NZ  1 
ATOM   1359  N  N   . TYR A 1 175  ? -11.844 116.969 55.226  1.00 25.92 ? 175  TYR A N   1 
ATOM   1360  C  CA  . TYR A 1 175  ? -12.889 116.257 54.509  1.00 26.93 ? 175  TYR A CA  1 
ATOM   1361  C  C   . TYR A 1 175  ? -12.755 116.573 53.029  1.00 26.51 ? 175  TYR A C   1 
ATOM   1362  O  O   . TYR A 1 175  ? -12.310 117.663 52.674  1.00 27.06 ? 175  TYR A O   1 
ATOM   1363  C  CB  . TYR A 1 175  ? -14.262 116.704 55.021  1.00 27.16 ? 175  TYR A CB  1 
ATOM   1364  C  CG  . TYR A 1 175  ? -14.592 116.163 56.391  1.00 28.10 ? 175  TYR A CG  1 
ATOM   1365  C  CD1 . TYR A 1 175  ? -15.202 114.919 56.538  1.00 29.19 ? 175  TYR A CD1 1 
ATOM   1366  C  CD2 . TYR A 1 175  ? -14.277 116.889 57.546  1.00 27.05 ? 175  TYR A CD2 1 
ATOM   1367  C  CE1 . TYR A 1 175  ? -15.494 114.409 57.799  1.00 29.16 ? 175  TYR A CE1 1 
ATOM   1368  C  CE2 . TYR A 1 175  ? -14.558 116.391 58.806  1.00 27.19 ? 175  TYR A CE2 1 
ATOM   1369  C  CZ  . TYR A 1 175  ? -15.167 115.148 58.932  1.00 28.42 ? 175  TYR A CZ  1 
ATOM   1370  O  OH  . TYR A 1 175  ? -15.430 114.629 60.182  1.00 28.77 ? 175  TYR A OH  1 
ATOM   1371  N  N   . ASP A 1 176  ? -13.118 115.626 52.165  1.00 26.21 ? 176  ASP A N   1 
ATOM   1372  C  CA  . ASP A 1 176  ? -13.035 115.866 50.736  1.00 27.36 ? 176  ASP A CA  1 
ATOM   1373  C  C   . ASP A 1 176  ? -14.144 116.840 50.388  1.00 28.79 ? 176  ASP A C   1 
ATOM   1374  O  O   . ASP A 1 176  ? -15.072 117.025 51.170  1.00 28.32 ? 176  ASP A O   1 
ATOM   1375  C  CB  . ASP A 1 176  ? -13.192 114.565 49.955  1.00 27.87 ? 176  ASP A CB  1 
ATOM   1376  C  CG  . ASP A 1 176  ? -14.557 113.943 50.115  1.00 28.37 ? 176  ASP A CG  1 
ATOM   1377  O  OD1 . ASP A 1 176  ? -15.556 114.559 49.694  1.00 30.33 ? 176  ASP A OD1 1 
ATOM   1378  O  OD2 . ASP A 1 176  ? -14.631 112.825 50.657  1.00 30.01 ? 176  ASP A OD2 1 
ATOM   1379  N  N   . GLU A 1 177  ? -14.049 117.485 49.232  1.00 29.88 ? 177  GLU A N   1 
ATOM   1380  C  CA  . GLU A 1 177  ? -15.081 118.439 48.848  1.00 31.86 ? 177  GLU A CA  1 
ATOM   1381  C  C   . GLU A 1 177  ? -15.863 117.948 47.632  1.00 31.23 ? 177  GLU A C   1 
ATOM   1382  O  O   . GLU A 1 177  ? -16.331 118.741 46.815  1.00 31.56 ? 177  GLU A O   1 
ATOM   1383  C  CB  . GLU A 1 177  ? -14.454 119.809 48.574  1.00 35.74 ? 177  GLU A CB  1 
ATOM   1384  C  CG  . GLU A 1 177  ? -13.144 120.021 49.323  1.00 41.25 ? 177  GLU A CG  1 
ATOM   1385  C  CD  . GLU A 1 177  ? -12.772 121.479 49.459  1.00 45.86 ? 177  GLU A CD  1 
ATOM   1386  O  OE1 . GLU A 1 177  ? -13.082 122.254 48.529  1.00 49.19 ? 177  GLU A OE1 1 
ATOM   1387  O  OE2 . GLU A 1 177  ? -12.164 121.850 50.490  1.00 49.62 ? 177  GLU A OE2 1 
ATOM   1388  N  N   . ILE A 1 178  ? -15.993 116.628 47.522  1.00 29.38 ? 178  ILE A N   1 
ATOM   1389  C  CA  . ILE A 1 178  ? -16.737 116.022 46.435  1.00 27.95 ? 178  ILE A CA  1 
ATOM   1390  C  C   . ILE A 1 178  ? -18.225 116.254 46.664  1.00 27.91 ? 178  ILE A C   1 
ATOM   1391  O  O   . ILE A 1 178  ? -18.763 115.883 47.702  1.00 29.15 ? 178  ILE A O   1 
ATOM   1392  C  CB  . ILE A 1 178  ? -16.438 114.523 46.352  1.00 27.66 ? 178  ILE A CB  1 
ATOM   1393  C  CG1 . ILE A 1 178  ? -15.021 114.333 45.806  1.00 26.68 ? 178  ILE A CG1 1 
ATOM   1394  C  CG2 . ILE A 1 178  ? -17.453 113.821 45.454  1.00 25.89 ? 178  ILE A CG2 1 
ATOM   1395  C  CD1 . ILE A 1 178  ? -14.536 112.910 45.869  1.00 25.19 ? 178  ILE A CD1 1 
ATOM   1396  N  N   . PRO A 1 179  ? -18.906 116.885 45.696  1.00 27.24 ? 179  PRO A N   1 
ATOM   1397  C  CA  . PRO A 1 179  ? -20.344 117.185 45.771  1.00 27.39 ? 179  PRO A CA  1 
ATOM   1398  C  C   . PRO A 1 179  ? -21.240 116.014 46.164  1.00 27.48 ? 179  PRO A C   1 
ATOM   1399  O  O   . PRO A 1 179  ? -20.966 114.871 45.811  1.00 28.33 ? 179  PRO A O   1 
ATOM   1400  C  CB  . PRO A 1 179  ? -20.655 117.711 44.373  1.00 27.01 ? 179  PRO A CB  1 
ATOM   1401  C  CG  . PRO A 1 179  ? -19.367 118.416 44.008  1.00 27.95 ? 179  PRO A CG  1 
ATOM   1402  C  CD  . PRO A 1 179  ? -18.320 117.417 44.454  1.00 27.04 ? 179  PRO A CD  1 
ATOM   1403  N  N   . ASP A 1 180  ? -22.316 116.294 46.889  1.00 27.43 ? 180  ASP A N   1 
ATOM   1404  C  CA  . ASP A 1 180  ? -23.213 115.222 47.286  1.00 28.40 ? 180  ASP A CA  1 
ATOM   1405  C  C   . ASP A 1 180  ? -24.164 114.866 46.142  1.00 26.54 ? 180  ASP A C   1 
ATOM   1406  O  O   . ASP A 1 180  ? -24.246 115.585 45.143  1.00 24.26 ? 180  ASP A O   1 
ATOM   1407  C  CB  . ASP A 1 180  ? -23.972 115.589 48.578  1.00 31.83 ? 180  ASP A CB  1 
ATOM   1408  C  CG  . ASP A 1 180  ? -24.942 116.740 48.399  1.00 34.28 ? 180  ASP A CG  1 
ATOM   1409  O  OD1 . ASP A 1 180  ? -25.406 117.273 49.429  1.00 36.11 ? 180  ASP A OD1 1 
ATOM   1410  O  OD2 . ASP A 1 180  ? -25.255 117.100 47.249  1.00 37.12 ? 180  ASP A OD2 1 
ATOM   1411  N  N   . LEU A 1 181  ? -24.867 113.751 46.295  1.00 26.09 ? 181  LEU A N   1 
ATOM   1412  C  CA  . LEU A 1 181  ? -25.770 113.256 45.260  1.00 26.75 ? 181  LEU A CA  1 
ATOM   1413  C  C   . LEU A 1 181  ? -26.798 114.224 44.695  1.00 26.45 ? 181  LEU A C   1 
ATOM   1414  O  O   . LEU A 1 181  ? -27.266 114.027 43.571  1.00 27.01 ? 181  LEU A O   1 
ATOM   1415  C  CB  . LEU A 1 181  ? -26.475 111.979 45.739  1.00 25.00 ? 181  LEU A CB  1 
ATOM   1416  C  CG  . LEU A 1 181  ? -25.551 110.769 45.932  1.00 25.32 ? 181  LEU A CG  1 
ATOM   1417  C  CD1 . LEU A 1 181  ? -26.388 109.533 46.226  1.00 25.11 ? 181  LEU A CD1 1 
ATOM   1418  C  CD2 . LEU A 1 181  ? -24.698 110.553 44.672  1.00 23.59 ? 181  LEU A CD2 1 
ATOM   1419  N  N   . SER A 1 182  ? -27.138 115.272 45.439  1.00 26.28 ? 182  SER A N   1 
ATOM   1420  C  CA  . SER A 1 182  ? -28.126 116.228 44.945  1.00 27.23 ? 182  SER A CA  1 
ATOM   1421  C  C   . SER A 1 182  ? -27.601 116.978 43.720  1.00 27.59 ? 182  SER A C   1 
ATOM   1422  O  O   . SER A 1 182  ? -28.350 117.676 43.047  1.00 27.72 ? 182  SER A O   1 
ATOM   1423  C  CB  . SER A 1 182  ? -28.507 117.232 46.036  1.00 25.90 ? 182  SER A CB  1 
ATOM   1424  O  OG  . SER A 1 182  ? -27.620 118.328 46.049  1.00 27.02 ? 182  SER A OG  1 
ATOM   1425  N  N   . HIS A 1 183  ? -26.313 116.817 43.437  1.00 27.95 ? 183  HIS A N   1 
ATOM   1426  C  CA  . HIS A 1 183  ? -25.660 117.481 42.309  1.00 28.89 ? 183  HIS A CA  1 
ATOM   1427  C  C   . HIS A 1 183  ? -25.245 116.473 41.236  1.00 29.02 ? 183  HIS A C   1 
ATOM   1428  O  O   . HIS A 1 183  ? -24.545 116.821 40.283  1.00 29.45 ? 183  HIS A O   1 
ATOM   1429  C  CB  . HIS A 1 183  ? -24.399 118.199 42.788  1.00 30.19 ? 183  HIS A CB  1 
ATOM   1430  C  CG  . HIS A 1 183  ? -24.647 119.246 43.830  1.00 30.41 ? 183  HIS A CG  1 
ATOM   1431  N  ND1 . HIS A 1 183  ? -25.100 120.510 43.517  1.00 30.52 ? 183  HIS A ND1 1 
ATOM   1432  C  CD2 . HIS A 1 183  ? -24.497 119.219 45.171  1.00 30.34 ? 183  HIS A CD2 1 
ATOM   1433  C  CE1 . HIS A 1 183  ? -25.216 121.220 44.628  1.00 30.35 ? 183  HIS A CE1 1 
ATOM   1434  N  NE2 . HIS A 1 183  ? -24.858 120.458 45.645  1.00 30.62 ? 183  HIS A NE2 1 
ATOM   1435  N  N   . ASN A 1 184  ? -25.676 115.226 41.396  1.00 28.12 ? 184  ASN A N   1 
ATOM   1436  C  CA  . ASN A 1 184  ? -25.320 114.163 40.464  1.00 27.90 ? 184  ASN A CA  1 
ATOM   1437  C  C   . ASN A 1 184  ? -26.306 114.107 39.287  1.00 28.12 ? 184  ASN A C   1 
ATOM   1438  O  O   . ASN A 1 184  ? -27.369 113.485 39.389  1.00 28.28 ? 184  ASN A O   1 
ATOM   1439  C  CB  . ASN A 1 184  ? -25.305 112.842 41.240  1.00 28.50 ? 184  ASN A CB  1 
ATOM   1440  C  CG  . ASN A 1 184  ? -24.489 111.756 40.561  1.00 26.74 ? 184  ASN A CG  1 
ATOM   1441  O  OD1 . ASN A 1 184  ? -24.895 111.204 39.541  1.00 27.61 ? 184  ASN A OD1 1 
ATOM   1442  N  ND2 . ASN A 1 184  ? -23.334 111.438 41.139  1.00 26.98 ? 184  ASN A ND2 1 
ATOM   1443  N  N   . CYS A 1 185  ? -25.949 114.767 38.184  1.00 27.07 ? 185  CYS A N   1 
ATOM   1444  C  CA  . CYS A 1 185  ? -26.786 114.810 36.991  1.00 26.89 ? 185  CYS A CA  1 
ATOM   1445  C  C   . CYS A 1 185  ? -27.075 113.409 36.438  1.00 26.93 ? 185  CYS A C   1 
ATOM   1446  O  O   . CYS A 1 185  ? -28.203 113.108 36.044  1.00 27.08 ? 185  CYS A O   1 
ATOM   1447  C  CB  . CYS A 1 185  ? -26.126 115.680 35.920  1.00 27.78 ? 185  CYS A CB  1 
ATOM   1448  S  SG  . CYS A 1 185  ? -27.048 115.765 34.362  1.00 31.00 ? 185  CYS A SG  1 
ATOM   1449  N  N   . PRO A 1 186  ? -26.054 112.531 36.377  1.00 27.16 ? 186  PRO A N   1 
ATOM   1450  C  CA  . PRO A 1 186  ? -26.391 111.208 35.854  1.00 26.35 ? 186  PRO A CA  1 
ATOM   1451  C  C   . PRO A 1 186  ? -27.556 110.595 36.652  1.00 24.76 ? 186  PRO A C   1 
ATOM   1452  O  O   . PRO A 1 186  ? -28.514 110.106 36.057  1.00 26.09 ? 186  PRO A O   1 
ATOM   1453  C  CB  . PRO A 1 186  ? -25.087 110.433 36.026  1.00 25.34 ? 186  PRO A CB  1 
ATOM   1454  C  CG  . PRO A 1 186  ? -24.054 111.480 35.826  1.00 25.04 ? 186  PRO A CG  1 
ATOM   1455  C  CD  . PRO A 1 186  ? -24.607 112.641 36.621  1.00 25.70 ? 186  PRO A CD  1 
ATOM   1456  N  N   . LEU A 1 187  ? -27.485 110.641 37.986  1.00 23.35 ? 187  LEU A N   1 
ATOM   1457  C  CA  . LEU A 1 187  ? -28.539 110.072 38.838  1.00 23.01 ? 187  LEU A CA  1 
ATOM   1458  C  C   . LEU A 1 187  ? -29.904 110.730 38.626  1.00 23.24 ? 187  LEU A C   1 
ATOM   1459  O  O   . LEU A 1 187  ? -30.930 110.054 38.576  1.00 22.45 ? 187  LEU A O   1 
ATOM   1460  C  CB  . LEU A 1 187  ? -28.178 110.188 40.325  1.00 21.78 ? 187  LEU A CB  1 
ATOM   1461  C  CG  . LEU A 1 187  ? -28.121 108.892 41.146  1.00 22.03 ? 187  LEU A CG  1 
ATOM   1462  C  CD1 . LEU A 1 187  ? -28.403 109.205 42.601  1.00 19.44 ? 187  LEU A CD1 1 
ATOM   1463  C  CD2 . LEU A 1 187  ? -29.122 107.874 40.614  1.00 20.61 ? 187  LEU A CD2 1 
ATOM   1464  N  N   . TRP A 1 188  ? -29.903 112.056 38.524  1.00 23.63 ? 188  TRP A N   1 
ATOM   1465  C  CA  . TRP A 1 188  ? -31.123 112.804 38.304  1.00 25.29 ? 188  TRP A CA  1 
ATOM   1466  C  C   . TRP A 1 188  ? -31.776 112.313 37.011  1.00 26.91 ? 188  TRP A C   1 
ATOM   1467  O  O   . TRP A 1 188  ? -32.998 112.110 36.973  1.00 27.05 ? 188  TRP A O   1 
ATOM   1468  C  CB  . TRP A 1 188  ? -30.834 114.309 38.201  1.00 24.90 ? 188  TRP A CB  1 
ATOM   1469  C  CG  . TRP A 1 188  ? -32.090 115.095 37.977  1.00 26.01 ? 188  TRP A CG  1 
ATOM   1470  C  CD1 . TRP A 1 188  ? -33.037 115.404 38.902  1.00 27.07 ? 188  TRP A CD1 1 
ATOM   1471  C  CD2 . TRP A 1 188  ? -32.589 115.569 36.720  1.00 26.59 ? 188  TRP A CD2 1 
ATOM   1472  N  NE1 . TRP A 1 188  ? -34.104 116.039 38.304  1.00 26.75 ? 188  TRP A NE1 1 
ATOM   1473  C  CE2 . TRP A 1 188  ? -33.856 116.153 36.967  1.00 27.63 ? 188  TRP A CE2 1 
ATOM   1474  C  CE3 . TRP A 1 188  ? -32.090 115.554 35.412  1.00 26.98 ? 188  TRP A CE3 1 
ATOM   1475  C  CZ2 . TRP A 1 188  ? -34.633 116.717 35.949  1.00 27.97 ? 188  TRP A CZ2 1 
ATOM   1476  C  CZ3 . TRP A 1 188  ? -32.859 116.111 34.399  1.00 30.02 ? 188  TRP A CZ3 1 
ATOM   1477  C  CH2 . TRP A 1 188  ? -34.123 116.688 34.674  1.00 29.07 ? 188  TRP A CH2 1 
ATOM   1478  N  N   . CYS A 1 189  ? -30.970 112.137 35.960  1.00 26.66 ? 189  CYS A N   1 
ATOM   1479  C  CA  . CYS A 1 189  ? -31.478 111.651 34.680  1.00 28.52 ? 189  CYS A CA  1 
ATOM   1480  C  C   . CYS A 1 189  ? -32.062 110.259 34.840  1.00 27.08 ? 189  CYS A C   1 
ATOM   1481  O  O   . CYS A 1 189  ? -33.162 109.967 34.368  1.00 27.04 ? 189  CYS A O   1 
ATOM   1482  C  CB  . CYS A 1 189  ? -30.370 111.599 33.626  1.00 31.14 ? 189  CYS A CB  1 
ATOM   1483  S  SG  . CYS A 1 189  ? -30.009 113.168 32.857  1.00 37.75 ? 189  CYS A SG  1 
ATOM   1484  N  N   . PHE A 1 190  ? -31.307 109.388 35.495  1.00 25.83 ? 190  PHE A N   1 
ATOM   1485  C  CA  . PHE A 1 190  ? -31.762 108.021 35.721  1.00 24.86 ? 190  PHE A CA  1 
ATOM   1486  C  C   . PHE A 1 190  ? -33.159 108.073 36.363  1.00 25.92 ? 190  PHE A C   1 
ATOM   1487  O  O   . PHE A 1 190  ? -34.107 107.458 35.875  1.00 25.74 ? 190  PHE A O   1 
ATOM   1488  C  CB  . PHE A 1 190  ? -30.777 107.303 36.650  1.00 22.31 ? 190  PHE A CB  1 
ATOM   1489  C  CG  . PHE A 1 190  ? -31.128 105.873 36.929  1.00 19.54 ? 190  PHE A CG  1 
ATOM   1490  C  CD1 . PHE A 1 190  ? -30.728 104.874 36.069  1.00 18.12 ? 190  PHE A CD1 1 
ATOM   1491  C  CD2 . PHE A 1 190  ? -31.877 105.533 38.053  1.00 19.81 ? 190  PHE A CD2 1 
ATOM   1492  C  CE1 . PHE A 1 190  ? -31.061 103.557 36.310  1.00 18.42 ? 190  PHE A CE1 1 
ATOM   1493  C  CE2 . PHE A 1 190  ? -32.219 104.216 38.307  1.00 19.98 ? 190  PHE A CE2 1 
ATOM   1494  C  CZ  . PHE A 1 190  ? -31.807 103.221 37.428  1.00 18.43 ? 190  PHE A CZ  1 
ATOM   1495  N  N   . ARG A 1 191  ? -33.291 108.815 37.454  1.00 25.63 ? 191  ARG A N   1 
ATOM   1496  C  CA  . ARG A 1 191  ? -34.577 108.906 38.118  1.00 26.82 ? 191  ARG A CA  1 
ATOM   1497  C  C   . ARG A 1 191  ? -35.668 109.499 37.221  1.00 27.16 ? 191  ARG A C   1 
ATOM   1498  O  O   . ARG A 1 191  ? -36.784 108.986 37.190  1.00 27.01 ? 191  ARG A O   1 
ATOM   1499  C  CB  . ARG A 1 191  ? -34.463 109.726 39.411  1.00 26.21 ? 191  ARG A CB  1 
ATOM   1500  C  CG  . ARG A 1 191  ? -35.731 109.676 40.259  1.00 25.09 ? 191  ARG A CG  1 
ATOM   1501  C  CD  . ARG A 1 191  ? -35.678 110.658 41.395  1.00 25.70 ? 191  ARG A CD  1 
ATOM   1502  N  NE  . ARG A 1 191  ? -35.855 112.031 40.932  1.00 28.22 ? 191  ARG A NE  1 
ATOM   1503  C  CZ  . ARG A 1 191  ? -35.889 113.096 41.730  1.00 27.51 ? 191  ARG A CZ  1 
ATOM   1504  N  NH1 . ARG A 1 191  ? -35.754 112.942 43.040  1.00 26.12 ? 191  ARG A NH1 1 
ATOM   1505  N  NH2 . ARG A 1 191  ? -36.071 114.314 41.218  1.00 26.60 ? 191  ARG A NH2 1 
ATOM   1506  N  N   . GLU A 1 192  ? -35.350 110.563 36.486  1.00 28.34 ? 192  GLU A N   1 
ATOM   1507  C  CA  . GLU A 1 192  ? -36.339 111.203 35.615  1.00 30.10 ? 192  GLU A CA  1 
ATOM   1508  C  C   . GLU A 1 192  ? -36.731 110.357 34.419  1.00 29.68 ? 192  GLU A C   1 
ATOM   1509  O  O   . GLU A 1 192  ? -37.925 110.151 34.171  1.00 29.35 ? 192  GLU A O   1 
ATOM   1510  C  CB  . GLU A 1 192  ? -35.828 112.553 35.114  1.00 31.83 ? 192  GLU A CB  1 
ATOM   1511  C  CG  . GLU A 1 192  ? -35.782 113.618 36.182  1.00 37.26 ? 192  GLU A CG  1 
ATOM   1512  C  CD  . GLU A 1 192  ? -37.163 114.035 36.670  1.00 40.51 ? 192  GLU A CD  1 
ATOM   1513  O  OE1 . GLU A 1 192  ? -37.951 114.585 35.860  1.00 42.85 ? 192  GLU A OE1 1 
ATOM   1514  O  OE2 . GLU A 1 192  ? -37.456 113.810 37.867  1.00 42.39 ? 192  GLU A OE2 1 
ATOM   1515  N  N   . ILE A 1 193  ? -35.734 109.874 33.676  1.00 28.40 ? 193  ILE A N   1 
ATOM   1516  C  CA  . ILE A 1 193  ? -36.013 109.058 32.503  1.00 26.61 ? 193  ILE A CA  1 
ATOM   1517  C  C   . ILE A 1 193  ? -36.891 107.883 32.889  1.00 26.02 ? 193  ILE A C   1 
ATOM   1518  O  O   . ILE A 1 193  ? -37.912 107.624 32.243  1.00 26.71 ? 193  ILE A O   1 
ATOM   1519  C  CB  . ILE A 1 193  ? -34.707 108.547 31.846  1.00 26.68 ? 193  ILE A CB  1 
ATOM   1520  C  CG1 . ILE A 1 193  ? -34.034 109.688 31.078  1.00 25.01 ? 193  ILE A CG1 1 
ATOM   1521  C  CG2 . ILE A 1 193  ? -35.023 107.383 30.915  1.00 25.23 ? 193  ILE A CG2 1 
ATOM   1522  C  CD1 . ILE A 1 193  ? -32.546 109.488 30.886  1.00 27.23 ? 193  ILE A CD1 1 
ATOM   1523  N  N   . CYS A 1 194  ? -36.522 107.196 33.963  1.00 26.52 ? 194  CYS A N   1 
ATOM   1524  C  CA  . CYS A 1 194  ? -37.271 106.044 34.455  1.00 27.21 ? 194  CYS A CA  1 
ATOM   1525  C  C   . CYS A 1 194  ? -38.668 106.408 34.942  1.00 28.30 ? 194  CYS A C   1 
ATOM   1526  O  O   . CYS A 1 194  ? -39.638 105.738 34.613  1.00 29.05 ? 194  CYS A O   1 
ATOM   1527  C  CB  . CYS A 1 194  ? -36.491 105.347 35.568  1.00 27.09 ? 194  CYS A CB  1 
ATOM   1528  S  SG  . CYS A 1 194  ? -35.065 104.404 34.944  1.00 28.83 ? 194  CYS A SG  1 
ATOM   1529  N  N   . ARG A 1 195  ? -38.777 107.480 35.712  1.00 29.18 ? 195  ARG A N   1 
ATOM   1530  C  CA  . ARG A 1 195  ? -40.080 107.897 36.205  1.00 31.35 ? 195  ARG A CA  1 
ATOM   1531  C  C   . ARG A 1 195  ? -40.992 108.212 34.998  1.00 31.25 ? 195  ARG A C   1 
ATOM   1532  O  O   . ARG A 1 195  ? -42.164 107.813 34.968  1.00 31.17 ? 195  ARG A O   1 
ATOM   1533  C  CB  . ARG A 1 195  ? -39.934 109.130 37.123  1.00 31.70 ? 195  ARG A CB  1 
ATOM   1534  C  CG  . ARG A 1 195  ? -41.242 109.664 37.696  1.00 34.98 ? 195  ARG A CG  1 
ATOM   1535  C  CD  . ARG A 1 195  ? -41.063 111.021 38.377  1.00 39.00 ? 195  ARG A CD  1 
ATOM   1536  N  NE  . ARG A 1 195  ? -40.261 110.950 39.608  1.00 42.95 ? 195  ARG A NE  1 
ATOM   1537  C  CZ  . ARG A 1 195  ? -39.757 112.011 40.243  1.00 44.38 ? 195  ARG A CZ  1 
ATOM   1538  N  NH1 . ARG A 1 195  ? -39.955 113.237 39.767  1.00 45.16 ? 195  ARG A NH1 1 
ATOM   1539  N  NH2 . ARG A 1 195  ? -39.072 111.854 41.370  1.00 43.35 ? 195  ARG A NH2 1 
ATOM   1540  N  N   . HIS A 1 196  ? -40.453 108.914 34.003  1.00 29.46 ? 196  HIS A N   1 
ATOM   1541  C  CA  . HIS A 1 196  ? -41.242 109.262 32.839  1.00 28.65 ? 196  HIS A CA  1 
ATOM   1542  C  C   . HIS A 1 196  ? -41.740 108.000 32.148  1.00 28.42 ? 196  HIS A C   1 
ATOM   1543  O  O   . HIS A 1 196  ? -42.837 107.973 31.598  1.00 27.54 ? 196  HIS A O   1 
ATOM   1544  C  CB  . HIS A 1 196  ? -40.419 110.087 31.844  1.00 29.09 ? 196  HIS A CB  1 
ATOM   1545  C  CG  . HIS A 1 196  ? -41.213 110.580 30.674  1.00 29.77 ? 196  HIS A CG  1 
ATOM   1546  N  ND1 . HIS A 1 196  ? -41.969 111.731 30.719  1.00 30.08 ? 196  HIS A ND1 1 
ATOM   1547  C  CD2 . HIS A 1 196  ? -41.418 110.046 29.448  1.00 29.88 ? 196  HIS A CD2 1 
ATOM   1548  C  CE1 . HIS A 1 196  ? -42.606 111.885 29.574  1.00 27.91 ? 196  HIS A CE1 1 
ATOM   1549  N  NE2 . HIS A 1 196  ? -42.290 110.874 28.784  1.00 28.38 ? 196  HIS A NE2 1 
ATOM   1550  N  N   . ILE A 1 197  ? -40.938 106.945 32.182  1.00 28.13 ? 197  ILE A N   1 
ATOM   1551  C  CA  . ILE A 1 197  ? -41.331 105.715 31.524  1.00 25.81 ? 197  ILE A CA  1 
ATOM   1552  C  C   . ILE A 1 197  ? -42.390 104.946 32.288  1.00 26.19 ? 197  ILE A C   1 
ATOM   1553  O  O   . ILE A 1 197  ? -43.347 104.455 31.698  1.00 25.83 ? 197  ILE A O   1 
ATOM   1554  C  CB  . ILE A 1 197  ? -40.123 104.787 31.297  1.00 25.26 ? 197  ILE A CB  1 
ATOM   1555  C  CG1 . ILE A 1 197  ? -39.121 105.464 30.366  1.00 23.10 ? 197  ILE A CG1 1 
ATOM   1556  C  CG2 . ILE A 1 197  ? -40.589 103.459 30.706  1.00 22.89 ? 197  ILE A CG2 1 
ATOM   1557  C  CD1 . ILE A 1 197  ? -37.880 104.641 30.102  1.00 22.24 ? 197  ILE A CD1 1 
ATOM   1558  N  N   . SER A 1 198  ? -42.232 104.830 33.598  1.00 25.22 ? 198  SER A N   1 
ATOM   1559  C  CA  . SER A 1 198  ? -43.212 104.080 34.373  1.00 26.68 ? 198  SER A CA  1 
ATOM   1560  C  C   . SER A 1 198  ? -44.562 104.805 34.434  1.00 27.52 ? 198  SER A C   1 
ATOM   1561  O  O   . SER A 1 198  ? -45.620 104.162 34.487  1.00 25.54 ? 198  SER A O   1 
ATOM   1562  C  CB  . SER A 1 198  ? -42.686 103.812 35.792  1.00 26.00 ? 198  SER A CB  1 
ATOM   1563  O  OG  . SER A 1 198  ? -42.340 105.015 36.452  1.00 28.73 ? 198  SER A OG  1 
ATOM   1564  N  N   . GLY A 1 199  ? -44.517 106.140 34.418  1.00 27.68 ? 199  GLY A N   1 
ATOM   1565  C  CA  . GLY A 1 199  ? -45.738 106.920 34.484  1.00 27.93 ? 199  GLY A CA  1 
ATOM   1566  C  C   . GLY A 1 199  ? -46.575 106.575 35.703  1.00 29.08 ? 199  GLY A C   1 
ATOM   1567  O  O   . GLY A 1 199  ? -46.079 106.626 36.827  1.00 28.25 ? 199  GLY A O   1 
ATOM   1568  N  N   . PRO A 1 200  ? -47.846 106.207 35.514  1.00 29.23 ? 200  PRO A N   1 
ATOM   1569  C  CA  . PRO A 1 200  ? -48.711 105.863 36.642  1.00 29.64 ? 200  PRO A CA  1 
ATOM   1570  C  C   . PRO A 1 200  ? -48.500 104.443 37.161  1.00 30.69 ? 200  PRO A C   1 
ATOM   1571  O  O   . PRO A 1 200  ? -49.058 104.065 38.182  1.00 30.89 ? 200  PRO A O   1 
ATOM   1572  C  CB  . PRO A 1 200  ? -50.107 106.055 36.063  1.00 29.41 ? 200  PRO A CB  1 
ATOM   1573  C  CG  . PRO A 1 200  ? -49.926 105.549 34.655  1.00 30.16 ? 200  PRO A CG  1 
ATOM   1574  C  CD  . PRO A 1 200  ? -48.597 106.186 34.245  1.00 30.29 ? 200  PRO A CD  1 
ATOM   1575  N  N   . LEU A 1 201  ? -47.701 103.656 36.453  1.00 30.54 ? 201  LEU A N   1 
ATOM   1576  C  CA  . LEU A 1 201  ? -47.461 102.285 36.864  1.00 30.67 ? 201  LEU A CA  1 
ATOM   1577  C  C   . LEU A 1 201  ? -46.735 102.194 38.204  1.00 31.73 ? 201  LEU A C   1 
ATOM   1578  O  O   . LEU A 1 201  ? -45.811 102.957 38.469  1.00 30.85 ? 201  LEU A O   1 
ATOM   1579  C  CB  . LEU A 1 201  ? -46.665 101.545 35.789  1.00 30.68 ? 201  LEU A CB  1 
ATOM   1580  C  CG  . LEU A 1 201  ? -47.396 101.393 34.452  1.00 30.68 ? 201  LEU A CG  1 
ATOM   1581  C  CD1 . LEU A 1 201  ? -46.497 100.684 33.466  1.00 31.37 ? 201  LEU A CD1 1 
ATOM   1582  C  CD2 . LEU A 1 201  ? -48.701 100.640 34.645  1.00 30.40 ? 201  LEU A CD2 1 
ATOM   1583  N  N   . PRO A 1 202  ? -47.160 101.253 39.071  1.00 32.68 ? 202  PRO A N   1 
ATOM   1584  C  CA  . PRO A 1 202  ? -46.570 101.033 40.397  1.00 32.80 ? 202  PRO A CA  1 
ATOM   1585  C  C   . PRO A 1 202  ? -45.124 100.548 40.274  1.00 32.17 ? 202  PRO A C   1 
ATOM   1586  O  O   . PRO A 1 202  ? -44.283 100.824 41.139  1.00 31.74 ? 202  PRO A O   1 
ATOM   1587  C  CB  . PRO A 1 202  ? -47.482 99.970  41.011  1.00 31.77 ? 202  PRO A CB  1 
ATOM   1588  C  CG  . PRO A 1 202  ? -48.778 100.192 40.316  1.00 33.14 ? 202  PRO A CG  1 
ATOM   1589  C  CD  . PRO A 1 202  ? -48.349 100.406 38.895  1.00 32.15 ? 202  PRO A CD  1 
ATOM   1590  N  N   . ASP A 1 203  ? -44.851 99.801  39.211  1.00 30.22 ? 203  ASP A N   1 
ATOM   1591  C  CA  . ASP A 1 203  ? -43.508 99.306  38.963  1.00 30.73 ? 203  ASP A CA  1 
ATOM   1592  C  C   . ASP A 1 203  ? -42.663 100.463 38.430  1.00 30.42 ? 203  ASP A C   1 
ATOM   1593  O  O   . ASP A 1 203  ? -43.053 101.139 37.476  1.00 31.05 ? 203  ASP A O   1 
ATOM   1594  C  CB  . ASP A 1 203  ? -43.564 98.163  37.962  1.00 31.23 ? 203  ASP A CB  1 
ATOM   1595  C  CG  . ASP A 1 203  ? -44.341 96.980  38.498  1.00 34.53 ? 203  ASP A CG  1 
ATOM   1596  O  OD1 . ASP A 1 203  ? -43.909 96.416  39.532  1.00 35.66 ? 203  ASP A OD1 1 
ATOM   1597  O  OD2 . ASP A 1 203  ? -45.385 96.619  37.901  1.00 33.69 ? 203  ASP A OD2 1 
ATOM   1598  N  N   . ARG A 1 204  ? -41.517 100.695 39.062  1.00 28.39 ? 204  ARG A N   1 
ATOM   1599  C  CA  . ARG A 1 204  ? -40.629 101.788 38.678  1.00 27.59 ? 204  ARG A CA  1 
ATOM   1600  C  C   . ARG A 1 204  ? -39.512 101.384 37.711  1.00 26.76 ? 204  ARG A C   1 
ATOM   1601  O  O   . ARG A 1 204  ? -38.980 102.217 36.995  1.00 27.57 ? 204  ARG A O   1 
ATOM   1602  C  CB  . ARG A 1 204  ? -40.026 102.426 39.937  1.00 27.61 ? 204  ARG A CB  1 
ATOM   1603  C  CG  . ARG A 1 204  ? -41.061 102.909 40.982  1.00 26.35 ? 204  ARG A CG  1 
ATOM   1604  C  CD  . ARG A 1 204  ? -41.792 104.155 40.525  1.00 27.01 ? 204  ARG A CD  1 
ATOM   1605  N  NE  . ARG A 1 204  ? -40.857 105.246 40.261  1.00 29.10 ? 204  ARG A NE  1 
ATOM   1606  C  CZ  . ARG A 1 204  ? -40.465 106.147 41.161  1.00 29.13 ? 204  ARG A CZ  1 
ATOM   1607  N  NH1 . ARG A 1 204  ? -40.934 106.109 42.400  1.00 29.97 ? 204  ARG A NH1 1 
ATOM   1608  N  NH2 . ARG A 1 204  ? -39.579 107.078 40.829  1.00 29.52 ? 204  ARG A NH2 1 
ATOM   1609  N  N   . ALA A 1 205  ? -39.165 100.104 37.690  1.00 26.67 ? 205  ALA A N   1 
ATOM   1610  C  CA  . ALA A 1 205  ? -38.115 99.607  36.805  1.00 26.26 ? 205  ALA A CA  1 
ATOM   1611  C  C   . ALA A 1 205  ? -38.574 99.484  35.359  1.00 27.27 ? 205  ALA A C   1 
ATOM   1612  O  O   . ALA A 1 205  ? -39.549 98.792  35.066  1.00 26.33 ? 205  ALA A O   1 
ATOM   1613  C  CB  . ALA A 1 205  ? -37.616 98.254  37.291  1.00 26.38 ? 205  ALA A CB  1 
ATOM   1614  N  N   . PRO A 1 206  ? -37.874 100.164 34.437  1.00 27.97 ? 206  PRO A N   1 
ATOM   1615  C  CA  . PRO A 1 206  ? -38.181 100.149 33.002  1.00 27.88 ? 206  PRO A CA  1 
ATOM   1616  C  C   . PRO A 1 206  ? -37.946 98.782  32.375  1.00 27.94 ? 206  PRO A C   1 
ATOM   1617  O  O   . PRO A 1 206  ? -38.464 98.495  31.308  1.00 28.47 ? 206  PRO A O   1 
ATOM   1618  C  CB  . PRO A 1 206  ? -37.246 101.211 32.435  1.00 28.70 ? 206  PRO A CB  1 
ATOM   1619  C  CG  . PRO A 1 206  ? -37.131 102.182 33.580  1.00 29.72 ? 206  PRO A CG  1 
ATOM   1620  C  CD  . PRO A 1 206  ? -36.939 101.253 34.758  1.00 27.96 ? 206  PRO A CD  1 
ATOM   1621  N  N   . TYR A 1 207  ? -37.142 97.951  33.028  1.00 27.97 ? 207  TYR A N   1 
ATOM   1622  C  CA  . TYR A 1 207  ? -36.875 96.592  32.547  1.00 28.01 ? 207  TYR A CA  1 
ATOM   1623  C  C   . TYR A 1 207  ? -36.279 95.797  33.697  1.00 28.67 ? 207  TYR A C   1 
ATOM   1624  O  O   . TYR A 1 207  ? -35.680 96.368  34.602  1.00 29.24 ? 207  TYR A O   1 
ATOM   1625  C  CB  . TYR A 1 207  ? -35.900 96.589  31.359  1.00 25.92 ? 207  TYR A CB  1 
ATOM   1626  C  CG  . TYR A 1 207  ? -34.458 96.885  31.705  1.00 26.60 ? 207  TYR A CG  1 
ATOM   1627  C  CD1 . TYR A 1 207  ? -33.484 95.880  31.669  1.00 26.00 ? 207  TYR A CD1 1 
ATOM   1628  C  CD2 . TYR A 1 207  ? -34.048 98.186  32.011  1.00 26.81 ? 207  TYR A CD2 1 
ATOM   1629  C  CE1 . TYR A 1 207  ? -32.131 96.172  31.917  1.00 24.28 ? 207  TYR A CE1 1 
ATOM   1630  C  CE2 . TYR A 1 207  ? -32.701 98.484  32.262  1.00 26.63 ? 207  TYR A CE2 1 
ATOM   1631  C  CZ  . TYR A 1 207  ? -31.752 97.478  32.210  1.00 25.68 ? 207  TYR A CZ  1 
ATOM   1632  O  OH  . TYR A 1 207  ? -30.428 97.805  32.427  1.00 27.19 ? 207  TYR A OH  1 
ATOM   1633  N  N   . LEU A 1 208  ? -36.458 94.484  33.673  1.00 29.13 ? 208  LEU A N   1 
ATOM   1634  C  CA  . LEU A 1 208  ? -35.924 93.640  34.722  1.00 31.01 ? 208  LEU A CA  1 
ATOM   1635  C  C   . LEU A 1 208  ? -34.829 92.765  34.136  1.00 34.18 ? 208  LEU A C   1 
ATOM   1636  O  O   . LEU A 1 208  ? -35.049 92.090  33.121  1.00 34.82 ? 208  LEU A O   1 
ATOM   1637  C  CB  . LEU A 1 208  ? -37.023 92.758  35.307  1.00 30.50 ? 208  LEU A CB  1 
ATOM   1638  C  CG  . LEU A 1 208  ? -38.285 93.478  35.788  1.00 30.26 ? 208  LEU A CG  1 
ATOM   1639  C  CD1 . LEU A 1 208  ? -39.339 92.468  36.218  1.00 28.21 ? 208  LEU A CD1 1 
ATOM   1640  C  CD2 . LEU A 1 208  ? -37.933 94.415  36.941  1.00 29.79 ? 208  LEU A CD2 1 
ATOM   1641  N  N   . TYR A 1 209  ? -33.650 92.801  34.759  1.00 36.27 ? 209  TYR A N   1 
ATOM   1642  C  CA  . TYR A 1 209  ? -32.522 91.993  34.318  1.00 38.12 ? 209  TYR A CA  1 
ATOM   1643  C  C   . TYR A 1 209  ? -32.626 90.624  34.964  1.00 39.03 ? 209  TYR A C   1 
ATOM   1644  O  O   . TYR A 1 209  ? -32.452 90.477  36.169  1.00 38.85 ? 209  TYR A O   1 
ATOM   1645  C  CB  . TYR A 1 209  ? -31.190 92.636  34.722  1.00 39.67 ? 209  TYR A CB  1 
ATOM   1646  C  CG  . TYR A 1 209  ? -30.008 91.711  34.533  1.00 40.60 ? 209  TYR A CG  1 
ATOM   1647  C  CD1 . TYR A 1 209  ? -29.319 91.663  33.323  1.00 40.21 ? 209  TYR A CD1 1 
ATOM   1648  C  CD2 . TYR A 1 209  ? -29.621 90.832  35.551  1.00 40.20 ? 209  TYR A CD2 1 
ATOM   1649  C  CE1 . TYR A 1 209  ? -28.275 90.756  33.125  1.00 40.86 ? 209  TYR A CE1 1 
ATOM   1650  C  CE2 . TYR A 1 209  ? -28.589 89.922  35.365  1.00 41.01 ? 209  TYR A CE2 1 
ATOM   1651  C  CZ  . TYR A 1 209  ? -27.918 89.888  34.151  1.00 41.26 ? 209  TYR A CZ  1 
ATOM   1652  O  OH  . TYR A 1 209  ? -26.909 88.976  33.962  1.00 41.16 ? 209  TYR A OH  1 
ATOM   1653  N  N   . LEU A 1 210  ? -32.897 89.609  34.150  1.00 40.87 ? 210  LEU A N   1 
ATOM   1654  C  CA  . LEU A 1 210  ? -33.022 88.239  34.651  1.00 42.99 ? 210  LEU A CA  1 
ATOM   1655  C  C   . LEU A 1 210  ? -31.776 87.414  34.333  1.00 45.00 ? 210  LEU A C   1 
ATOM   1656  O  O   . LEU A 1 210  ? -30.903 87.847  33.579  1.00 46.28 ? 210  LEU A O   1 
ATOM   1657  C  CB  . LEU A 1 210  ? -34.258 87.563  34.054  1.00 42.82 ? 210  LEU A CB  1 
ATOM   1658  C  CG  . LEU A 1 210  ? -35.613 87.915  34.695  1.00 42.71 ? 210  LEU A CG  1 
ATOM   1659  C  CD1 . LEU A 1 210  ? -36.072 86.792  35.613  1.00 42.53 ? 210  LEU A CD1 1 
ATOM   1660  C  CD2 . LEU A 1 210  ? -35.519 89.223  35.461  1.00 39.06 ? 210  LEU A CD2 1 
ATOM   1661  N  N   . SER A 1 211  ? -31.740 86.204  34.903  1.00 46.71 ? 211  SER A N   1 
ATOM   1662  C  CA  . SER A 1 211  ? -30.625 85.282  34.771  1.00 48.20 ? 211  SER A CA  1 
ATOM   1663  C  C   . SER A 1 211  ? -30.269 84.951  33.323  1.00 48.29 ? 211  SER A C   1 
ATOM   1664  O  O   . SER A 1 211  ? -29.097 84.783  32.997  1.00 48.40 ? 211  SER A O   1 
ATOM   1665  C  CB  . SER A 1 211  ? -30.939 83.979  35.536  1.00 50.38 ? 211  SER A CB  1 
ATOM   1666  O  OG  . SER A 1 211  ? -29.915 83.015  35.344  1.00 52.93 ? 211  SER A OG  1 
ATOM   1667  N  N   . ALA A 1 212  ? -31.277 84.846  32.445  1.00 48.56 ? 212  ALA A N   1 
ATOM   1668  C  CA  . ALA A 1 212  ? -30.989 84.518  31.053  1.00 48.43 ? 212  ALA A CA  1 
ATOM   1669  C  C   . ALA A 1 212  ? -31.549 85.560  30.094  1.00 48.49 ? 212  ALA A C   1 
ATOM   1670  O  O   . ALA A 1 212  ? -31.028 85.756  28.985  1.00 50.35 ? 212  ALA A O   1 
ATOM   1671  C  CB  . ALA A 1 212  ? -31.567 83.146  30.723  1.00 47.38 ? 212  ALA A CB  1 
ATOM   1672  N  N   . GLY A 1 213  ? -32.607 86.240  30.521  1.00 47.27 ? 213  GLY A N   1 
ATOM   1673  C  CA  . GLY A 1 213  ? -33.212 87.229  29.653  1.00 44.56 ? 213  GLY A CA  1 
ATOM   1674  C  C   . GLY A 1 213  ? -33.692 88.477  30.358  1.00 42.40 ? 213  GLY A C   1 
ATOM   1675  O  O   . GLY A 1 213  ? -33.422 88.700  31.537  1.00 42.27 ? 213  GLY A O   1 
ATOM   1676  N  N   . VAL A 1 214  ? -34.425 89.288  29.613  1.00 39.41 ? 214  VAL A N   1 
ATOM   1677  C  CA  . VAL A 1 214  ? -34.945 90.539  30.113  1.00 36.02 ? 214  VAL A CA  1 
ATOM   1678  C  C   . VAL A 1 214  ? -36.445 90.664  29.878  1.00 34.14 ? 214  VAL A C   1 
ATOM   1679  O  O   . VAL A 1 214  ? -37.001 90.044  28.983  1.00 31.18 ? 214  VAL A O   1 
ATOM   1680  C  CB  . VAL A 1 214  ? -34.208 91.713  29.419  1.00 35.55 ? 214  VAL A CB  1 
ATOM   1681  C  CG1 . VAL A 1 214  ? -35.171 92.842  29.078  1.00 33.32 ? 214  VAL A CG1 1 
ATOM   1682  C  CG2 . VAL A 1 214  ? -33.101 92.219  30.332  1.00 35.25 ? 214  VAL A CG2 1 
ATOM   1683  N  N   . PHE A 1 215  ? -37.090 91.459  30.718  1.00 32.75 ? 215  PHE A N   1 
ATOM   1684  C  CA  . PHE A 1 215  ? -38.508 91.726  30.585  1.00 32.23 ? 215  PHE A CA  1 
ATOM   1685  C  C   . PHE A 1 215  ? -38.573 93.228  30.553  1.00 31.18 ? 215  PHE A C   1 
ATOM   1686  O  O   . PHE A 1 215  ? -37.782 93.886  31.216  1.00 31.19 ? 215  PHE A O   1 
ATOM   1687  C  CB  . PHE A 1 215  ? -39.283 91.195  31.778  1.00 34.18 ? 215  PHE A CB  1 
ATOM   1688  C  CG  . PHE A 1 215  ? -39.560 89.731  31.711  1.00 35.62 ? 215  PHE A CG  1 
ATOM   1689  C  CD1 . PHE A 1 215  ? -40.362 89.206  30.698  1.00 37.50 ? 215  PHE A CD1 1 
ATOM   1690  C  CD2 . PHE A 1 215  ? -39.052 88.873  32.678  1.00 36.92 ? 215  PHE A CD2 1 
ATOM   1691  C  CE1 . PHE A 1 215  ? -40.656 87.838  30.650  1.00 38.67 ? 215  PHE A CE1 1 
ATOM   1692  C  CE2 . PHE A 1 215  ? -39.335 87.502  32.646  1.00 38.88 ? 215  PHE A CE2 1 
ATOM   1693  C  CZ  . PHE A 1 215  ? -40.145 86.982  31.628  1.00 39.10 ? 215  PHE A CZ  1 
ATOM   1694  N  N   . TRP A 1 216  ? -39.487 93.778  29.771  1.00 30.47 ? 216  TRP A N   1 
ATOM   1695  C  CA  . TRP A 1 216  ? -39.589 95.222  29.691  1.00 30.44 ? 216  TRP A CA  1 
ATOM   1696  C  C   . TRP A 1 216  ? -40.885 95.691  30.350  1.00 30.73 ? 216  TRP A C   1 
ATOM   1697  O  O   . TRP A 1 216  ? -41.909 95.013  30.295  1.00 32.16 ? 216  TRP A O   1 
ATOM   1698  C  CB  . TRP A 1 216  ? -39.564 95.680  28.219  1.00 29.40 ? 216  TRP A CB  1 
ATOM   1699  C  CG  . TRP A 1 216  ? -38.561 94.971  27.338  1.00 28.42 ? 216  TRP A CG  1 
ATOM   1700  C  CD1 . TRP A 1 216  ? -38.571 93.651  26.981  1.00 27.98 ? 216  TRP A CD1 1 
ATOM   1701  C  CD2 . TRP A 1 216  ? -37.410 95.548  26.693  1.00 27.92 ? 216  TRP A CD2 1 
ATOM   1702  N  NE1 . TRP A 1 216  ? -37.506 93.371  26.166  1.00 27.47 ? 216  TRP A NE1 1 
ATOM   1703  C  CE2 . TRP A 1 216  ? -36.774 94.515  25.977  1.00 27.68 ? 216  TRP A CE2 1 
ATOM   1704  C  CE3 . TRP A 1 216  ? -36.854 96.836  26.664  1.00 27.61 ? 216  TRP A CE3 1 
ATOM   1705  C  CZ2 . TRP A 1 216  ? -35.606 94.729  25.225  1.00 26.08 ? 216  TRP A CZ2 1 
ATOM   1706  C  CZ3 . TRP A 1 216  ? -35.695 97.048  25.915  1.00 27.64 ? 216  TRP A CZ3 1 
ATOM   1707  C  CH2 . TRP A 1 216  ? -35.081 95.995  25.210  1.00 26.86 ? 216  TRP A CH2 1 
ATOM   1708  N  N   . LEU A 1 217  ? -40.834 96.843  30.999  1.00 30.31 ? 217  LEU A N   1 
ATOM   1709  C  CA  . LEU A 1 217  ? -42.028 97.398  31.605  1.00 29.89 ? 217  LEU A CA  1 
ATOM   1710  C  C   . LEU A 1 217  ? -42.934 97.679  30.397  1.00 29.92 ? 217  LEU A C   1 
ATOM   1711  O  O   . LEU A 1 217  ? -42.499 98.275  29.405  1.00 29.17 ? 217  LEU A O   1 
ATOM   1712  C  CB  . LEU A 1 217  ? -41.683 98.694  32.333  1.00 28.80 ? 217  LEU A CB  1 
ATOM   1713  C  CG  . LEU A 1 217  ? -42.846 99.392  33.035  1.00 30.02 ? 217  LEU A CG  1 
ATOM   1714  C  CD1 . LEU A 1 217  ? -43.264 98.581  34.258  1.00 28.99 ? 217  LEU A CD1 1 
ATOM   1715  C  CD2 . LEU A 1 217  ? -42.426 100.813 33.425  1.00 30.20 ? 217  LEU A CD2 1 
ATOM   1716  N  N   . MET A 1 218  ? -44.181 97.228  30.476  1.00 30.14 ? 218  MET A N   1 
ATOM   1717  C  CA  . MET A 1 218  ? -45.144 97.396  29.392  1.00 31.35 ? 218  MET A CA  1 
ATOM   1718  C  C   . MET A 1 218  ? -45.581 98.843  29.176  1.00 31.20 ? 218  MET A C   1 
ATOM   1719  O  O   . MET A 1 218  ? -46.770 99.143  29.205  1.00 31.71 ? 218  MET A O   1 
ATOM   1720  C  CB  . MET A 1 218  ? -46.377 96.549  29.682  1.00 34.45 ? 218  MET A CB  1 
ATOM   1721  C  CG  . MET A 1 218  ? -46.140 95.059  29.627  1.00 36.85 ? 218  MET A CG  1 
ATOM   1722  S  SD  . MET A 1 218  ? -45.753 94.580  27.946  1.00 41.98 ? 218  MET A SD  1 
ATOM   1723  C  CE  . MET A 1 218  ? -47.374 94.064  27.361  1.00 37.45 ? 218  MET A CE  1 
ATOM   1724  N  N   . SER A 1 219  ? -44.627 99.737  28.946  1.00 30.18 ? 219  SER A N   1 
ATOM   1725  C  CA  . SER A 1 219  ? -44.940 101.141 28.744  1.00 29.13 ? 219  SER A CA  1 
ATOM   1726  C  C   . SER A 1 219  ? -44.703 101.530 27.294  1.00 28.28 ? 219  SER A C   1 
ATOM   1727  O  O   . SER A 1 219  ? -43.682 101.170 26.712  1.00 27.72 ? 219  SER A O   1 
ATOM   1728  C  CB  . SER A 1 219  ? -44.068 102.003 29.670  1.00 29.36 ? 219  SER A CB  1 
ATOM   1729  O  OG  . SER A 1 219  ? -44.051 103.365 29.263  1.00 27.70 ? 219  SER A OG  1 
ATOM   1730  N  N   . PRO A 1 220  ? -45.643 102.281 26.696  1.00 26.89 ? 220  PRO A N   1 
ATOM   1731  C  CA  . PRO A 1 220  ? -45.522 102.717 25.300  1.00 26.04 ? 220  PRO A CA  1 
ATOM   1732  C  C   . PRO A 1 220  ? -44.414 103.743 25.165  1.00 25.82 ? 220  PRO A C   1 
ATOM   1733  O  O   . PRO A 1 220  ? -44.115 104.209 24.064  1.00 25.25 ? 220  PRO A O   1 
ATOM   1734  C  CB  . PRO A 1 220  ? -46.893 103.307 25.006  1.00 24.95 ? 220  PRO A CB  1 
ATOM   1735  C  CG  . PRO A 1 220  ? -47.250 103.945 26.301  1.00 25.68 ? 220  PRO A CG  1 
ATOM   1736  C  CD  . PRO A 1 220  ? -46.828 102.886 27.330  1.00 25.84 ? 220  PRO A CD  1 
ATOM   1737  N  N   . ARG A 1 221  ? -43.817 104.091 26.301  1.00 26.28 ? 221  ARG A N   1 
ATOM   1738  C  CA  . ARG A 1 221  ? -42.726 105.058 26.335  1.00 26.87 ? 221  ARG A CA  1 
ATOM   1739  C  C   . ARG A 1 221  ? -41.360 104.369 26.434  1.00 26.34 ? 221  ARG A C   1 
ATOM   1740  O  O   . ARG A 1 221  ? -40.313 105.015 26.408  1.00 25.91 ? 221  ARG A O   1 
ATOM   1741  C  CB  . ARG A 1 221  ? -42.938 106.026 27.503  1.00 26.02 ? 221  ARG A CB  1 
ATOM   1742  C  CG  . ARG A 1 221  ? -43.940 107.110 27.165  1.00 27.34 ? 221  ARG A CG  1 
ATOM   1743  C  CD  . ARG A 1 221  ? -44.385 107.927 28.361  1.00 28.27 ? 221  ARG A CD  1 
ATOM   1744  N  NE  . ARG A 1 221  ? -45.496 107.293 29.072  1.00 29.51 ? 221  ARG A NE  1 
ATOM   1745  C  CZ  . ARG A 1 221  ? -45.355 106.273 29.906  1.00 30.19 ? 221  ARG A CZ  1 
ATOM   1746  N  NH1 . ARG A 1 221  ? -44.150 105.780 30.132  1.00 33.80 ? 221  ARG A NH1 1 
ATOM   1747  N  NH2 . ARG A 1 221  ? -46.407 105.748 30.512  1.00 27.15 ? 221  ARG A NH2 1 
ATOM   1748  N  N   . MET A 1 222  ? -41.383 103.044 26.555  1.00 25.83 ? 222  MET A N   1 
ATOM   1749  C  CA  . MET A 1 222  ? -40.158 102.279 26.641  1.00 25.82 ? 222  MET A CA  1 
ATOM   1750  C  C   . MET A 1 222  ? -39.534 102.125 25.251  1.00 26.30 ? 222  MET A C   1 
ATOM   1751  O  O   . MET A 1 222  ? -40.234 102.054 24.244  1.00 27.26 ? 222  MET A O   1 
ATOM   1752  C  CB  . MET A 1 222  ? -40.422 100.904 27.255  1.00 25.13 ? 222  MET A CB  1 
ATOM   1753  C  CG  . MET A 1 222  ? -39.161 100.122 27.588  1.00 23.71 ? 222  MET A CG  1 
ATOM   1754  S  SD  . MET A 1 222  ? -38.084 100.983 28.741  1.00 25.35 ? 222  MET A SD  1 
ATOM   1755  C  CE  . MET A 1 222  ? -36.764 99.812  28.935  1.00 20.21 ? 222  MET A CE  1 
ATOM   1756  N  N   . THR A 1 223  ? -38.200 102.080 25.216  1.00 25.47 ? 223  THR A N   1 
ATOM   1757  C  CA  . THR A 1 223  ? -37.460 101.967 23.973  1.00 25.21 ? 223  THR A CA  1 
ATOM   1758  C  C   . THR A 1 223  ? -36.321 100.974 24.123  1.00 24.17 ? 223  THR A C   1 
ATOM   1759  O  O   . THR A 1 223  ? -35.861 100.712 25.226  1.00 25.41 ? 223  THR A O   1 
ATOM   1760  C  CB  . THR A 1 223  ? -36.859 103.326 23.601  1.00 26.85 ? 223  THR A CB  1 
ATOM   1761  O  OG1 . THR A 1 223  ? -37.907 104.223 23.193  1.00 28.97 ? 223  THR A OG1 1 
ATOM   1762  C  CG2 . THR A 1 223  ? -35.851 103.176 22.508  1.00 25.63 ? 223  THR A CG2 1 
ATOM   1763  N  N   . SER A 1 224  ? -35.858 100.426 23.006  1.00 23.22 ? 224  SER A N   1 
ATOM   1764  C  CA  . SER A 1 224  ? -34.752 99.469  23.032  1.00 22.52 ? 224  SER A CA  1 
ATOM   1765  C  C   . SER A 1 224  ? -33.470 100.155 23.450  1.00 20.78 ? 224  SER A C   1 
ATOM   1766  O  O   . SER A 1 224  ? -32.503 99.511  23.799  1.00 20.29 ? 224  SER A O   1 
ATOM   1767  C  CB  . SER A 1 224  ? -34.542 98.849  21.659  1.00 23.02 ? 224  SER A CB  1 
ATOM   1768  O  OG  . SER A 1 224  ? -34.212 99.855  20.724  1.00 24.09 ? 224  SER A OG  1 
ATOM   1769  N  N   . ALA A 1 225  ? -33.470 101.475 23.424  1.00 20.85 ? 225  ALA A N   1 
ATOM   1770  C  CA  . ALA A 1 225  ? -32.281 102.231 23.787  1.00 21.23 ? 225  ALA A CA  1 
ATOM   1771  C  C   . ALA A 1 225  ? -32.171 102.564 25.278  1.00 21.99 ? 225  ALA A C   1 
ATOM   1772  O  O   . ALA A 1 225  ? -31.124 103.029 25.746  1.00 23.06 ? 225  ALA A O   1 
ATOM   1773  C  CB  . ALA A 1 225  ? -32.218 103.526 22.956  1.00 19.37 ? 225  ALA A CB  1 
ATOM   1774  N  N   . ILE A 1 226  ? -33.235 102.319 26.032  1.00 21.70 ? 226  ILE A N   1 
ATOM   1775  C  CA  . ILE A 1 226  ? -33.226 102.649 27.450  1.00 22.29 ? 226  ILE A CA  1 
ATOM   1776  C  C   . ILE A 1 226  ? -32.198 101.903 28.319  1.00 22.34 ? 226  ILE A C   1 
ATOM   1777  O  O   . ILE A 1 226  ? -31.520 102.516 29.142  1.00 23.42 ? 226  ILE A O   1 
ATOM   1778  C  CB  . ILE A 1 226  ? -34.649 102.511 28.035  1.00 20.93 ? 226  ILE A CB  1 
ATOM   1779  C  CG1 . ILE A 1 226  ? -35.589 103.442 27.273  1.00 21.31 ? 226  ILE A CG1 1 
ATOM   1780  C  CG2 . ILE A 1 226  ? -34.653 102.858 29.509  1.00 18.51 ? 226  ILE A CG2 1 
ATOM   1781  C  CD1 . ILE A 1 226  ? -35.196 104.922 27.354  1.00 20.03 ? 226  ILE A CD1 1 
ATOM   1782  N  N   . PRO A 1 227  ? -32.067 100.577 28.153  1.00 23.01 ? 227  PRO A N   1 
ATOM   1783  C  CA  . PRO A 1 227  ? -31.079 99.870  28.984  1.00 24.24 ? 227  PRO A CA  1 
ATOM   1784  C  C   . PRO A 1 227  ? -29.654 100.423 28.811  1.00 24.61 ? 227  PRO A C   1 
ATOM   1785  O  O   . PRO A 1 227  ? -28.987 100.741 29.793  1.00 26.29 ? 227  PRO A O   1 
ATOM   1786  C  CB  . PRO A 1 227  ? -31.214 98.418  28.525  1.00 24.02 ? 227  PRO A CB  1 
ATOM   1787  C  CG  . PRO A 1 227  ? -32.690 98.331  28.143  1.00 24.71 ? 227  PRO A CG  1 
ATOM   1788  C  CD  . PRO A 1 227  ? -32.898 99.630  27.385  1.00 23.43 ? 227  PRO A CD  1 
ATOM   1789  N  N   . PRO A 1 228  ? -29.167 100.541 27.562  1.00 24.64 ? 228  PRO A N   1 
ATOM   1790  C  CA  . PRO A 1 228  ? -27.812 101.075 27.402  1.00 23.89 ? 228  PRO A CA  1 
ATOM   1791  C  C   . PRO A 1 228  ? -27.687 102.469 28.020  1.00 23.37 ? 228  PRO A C   1 
ATOM   1792  O  O   . PRO A 1 228  ? -26.727 102.753 28.739  1.00 23.13 ? 228  PRO A O   1 
ATOM   1793  C  CB  . PRO A 1 228  ? -27.624 101.097 25.887  1.00 24.22 ? 228  PRO A CB  1 
ATOM   1794  C  CG  . PRO A 1 228  ? -28.474 99.950  25.419  1.00 25.41 ? 228  PRO A CG  1 
ATOM   1795  C  CD  . PRO A 1 228  ? -29.717 100.098 26.267  1.00 25.02 ? 228  PRO A CD  1 
ATOM   1796  N  N   . LEU A 1 229  ? -28.658 103.331 27.733  1.00 23.72 ? 229  LEU A N   1 
ATOM   1797  C  CA  . LEU A 1 229  ? -28.660 104.688 28.274  1.00 23.93 ? 229  LEU A CA  1 
ATOM   1798  C  C   . LEU A 1 229  ? -28.555 104.674 29.782  1.00 25.03 ? 229  LEU A C   1 
ATOM   1799  O  O   . LEU A 1 229  ? -27.715 105.366 30.372  1.00 26.14 ? 229  LEU A O   1 
ATOM   1800  C  CB  . LEU A 1 229  ? -29.940 105.437 27.908  1.00 22.63 ? 229  LEU A CB  1 
ATOM   1801  C  CG  . LEU A 1 229  ? -29.994 106.824 28.570  1.00 23.03 ? 229  LEU A CG  1 
ATOM   1802  C  CD1 . LEU A 1 229  ? -28.890 107.705 27.994  1.00 21.73 ? 229  LEU A CD1 1 
ATOM   1803  C  CD2 . LEU A 1 229  ? -31.359 107.466 28.343  1.00 23.52 ? 229  LEU A CD2 1 
ATOM   1804  N  N   . LEU A 1 230  ? -29.426 103.886 30.403  1.00 25.26 ? 230  LEU A N   1 
ATOM   1805  C  CA  . LEU A 1 230  ? -29.448 103.770 31.849  1.00 24.21 ? 230  LEU A CA  1 
ATOM   1806  C  C   . LEU A 1 230  ? -28.138 103.235 32.404  1.00 23.78 ? 230  LEU A C   1 
ATOM   1807  O  O   . LEU A 1 230  ? -27.631 103.724 33.414  1.00 25.20 ? 230  LEU A O   1 
ATOM   1808  C  CB  . LEU A 1 230  ? -30.615 102.875 32.283  1.00 24.61 ? 230  LEU A CB  1 
ATOM   1809  C  CG  . LEU A 1 230  ? -32.003 103.469 31.987  1.00 23.81 ? 230  LEU A CG  1 
ATOM   1810  C  CD1 . LEU A 1 230  ? -33.099 102.602 32.604  1.00 24.03 ? 230  LEU A CD1 1 
ATOM   1811  C  CD2 . LEU A 1 230  ? -32.068 104.882 32.550  1.00 20.93 ? 230  LEU A CD2 1 
ATOM   1812  N  N   . SER A 1 231  ? -27.577 102.235 31.742  1.00 22.77 ? 231  SER A N   1 
ATOM   1813  C  CA  . SER A 1 231  ? -26.327 101.657 32.205  1.00 21.57 ? 231  SER A CA  1 
ATOM   1814  C  C   . SER A 1 231  ? -25.202 102.696 32.190  1.00 19.89 ? 231  SER A C   1 
ATOM   1815  O  O   . SER A 1 231  ? -24.379 102.733 33.101  1.00 21.06 ? 231  SER A O   1 
ATOM   1816  C  CB  . SER A 1 231  ? -25.942 100.440 31.352  1.00 21.38 ? 231  SER A CB  1 
ATOM   1817  O  OG  . SER A 1 231  ? -25.215 100.825 30.205  1.00 21.16 ? 231  SER A OG  1 
ATOM   1818  N  N   . ASP A 1 232  ? -25.155 103.536 31.161  1.00 18.38 ? 232  ASP A N   1 
ATOM   1819  C  CA  . ASP A 1 232  ? -24.109 104.555 31.111  1.00 18.02 ? 232  ASP A CA  1 
ATOM   1820  C  C   . ASP A 1 232  ? -24.282 105.524 32.274  1.00 18.83 ? 232  ASP A C   1 
ATOM   1821  O  O   . ASP A 1 232  ? -23.313 105.866 32.964  1.00 19.10 ? 232  ASP A O   1 
ATOM   1822  C  CB  . ASP A 1 232  ? -24.152 105.355 29.804  1.00 16.40 ? 232  ASP A CB  1 
ATOM   1823  C  CG  . ASP A 1 232  ? -23.317 104.732 28.689  1.00 17.00 ? 232  ASP A CG  1 
ATOM   1824  O  OD1 . ASP A 1 232  ? -22.289 104.088 28.975  1.00 14.63 ? 232  ASP A OD1 1 
ATOM   1825  O  OD2 . ASP A 1 232  ? -23.678 104.915 27.507  1.00 16.93 ? 232  ASP A OD2 1 
ATOM   1826  N  N   . LEU A 1 233  ? -25.525 105.959 32.495  1.00 18.46 ? 233  LEU A N   1 
ATOM   1827  C  CA  . LEU A 1 233  ? -25.826 106.903 33.563  1.00 18.22 ? 233  LEU A CA  1 
ATOM   1828  C  C   . LEU A 1 233  ? -25.381 106.404 34.931  1.00 18.12 ? 233  LEU A C   1 
ATOM   1829  O  O   . LEU A 1 233  ? -24.734 107.130 35.671  1.00 19.83 ? 233  LEU A O   1 
ATOM   1830  C  CB  . LEU A 1 233  ? -27.329 107.234 33.567  1.00 17.79 ? 233  LEU A CB  1 
ATOM   1831  C  CG  . LEU A 1 233  ? -27.811 107.964 32.295  1.00 16.80 ? 233  LEU A CG  1 
ATOM   1832  C  CD1 . LEU A 1 233  ? -29.328 108.165 32.291  1.00 16.15 ? 233  LEU A CD1 1 
ATOM   1833  C  CD2 . LEU A 1 233  ? -27.110 109.313 32.206  1.00 13.49 ? 233  LEU A CD2 1 
ATOM   1834  N  N   . VAL A 1 234  ? -25.714 105.163 35.263  1.00 18.71 ? 234  VAL A N   1 
ATOM   1835  C  CA  . VAL A 1 234  ? -25.317 104.608 36.545  1.00 19.88 ? 234  VAL A CA  1 
ATOM   1836  C  C   . VAL A 1 234  ? -23.800 104.637 36.700  1.00 21.03 ? 234  VAL A C   1 
ATOM   1837  O  O   . VAL A 1 234  ? -23.292 105.031 37.765  1.00 21.35 ? 234  VAL A O   1 
ATOM   1838  C  CB  . VAL A 1 234  ? -25.855 103.158 36.735  1.00 20.93 ? 234  VAL A CB  1 
ATOM   1839  C  CG1 . VAL A 1 234  ? -25.152 102.471 37.919  1.00 19.65 ? 234  VAL A CG1 1 
ATOM   1840  C  CG2 . VAL A 1 234  ? -27.370 103.204 36.981  1.00 21.35 ? 234  VAL A CG2 1 
ATOM   1841  N  N   . ASN A 1 235  ? -23.069 104.241 35.658  1.00 20.86 ? 235  ASN A N   1 
ATOM   1842  C  CA  . ASN A 1 235  ? -21.611 104.264 35.741  1.00 21.55 ? 235  ASN A CA  1 
ATOM   1843  C  C   . ASN A 1 235  ? -21.131 105.684 36.008  1.00 21.24 ? 235  ASN A C   1 
ATOM   1844  O  O   . ASN A 1 235  ? -20.273 105.913 36.865  1.00 22.71 ? 235  ASN A O   1 
ATOM   1845  C  CB  . ASN A 1 235  ? -20.954 103.774 34.449  1.00 22.53 ? 235  ASN A CB  1 
ATOM   1846  C  CG  . ASN A 1 235  ? -21.005 102.274 34.296  1.00 23.63 ? 235  ASN A CG  1 
ATOM   1847  O  OD1 . ASN A 1 235  ? -21.055 101.531 35.285  1.00 24.84 ? 235  ASN A OD1 1 
ATOM   1848  N  ND2 . ASN A 1 235  ? -20.973 101.812 33.051  1.00 21.62 ? 235  ASN A ND2 1 
ATOM   1849  N  N   . LEU A 1 236  ? -21.680 106.634 35.259  1.00 19.65 ? 236  LEU A N   1 
ATOM   1850  C  CA  . LEU A 1 236  ? -21.280 108.018 35.421  1.00 19.27 ? 236  LEU A CA  1 
ATOM   1851  C  C   . LEU A 1 236  ? -21.643 108.506 36.808  1.00 20.45 ? 236  LEU A C   1 
ATOM   1852  O  O   . LEU A 1 236  ? -20.893 109.293 37.414  1.00 19.95 ? 236  LEU A O   1 
ATOM   1853  C  CB  . LEU A 1 236  ? -21.932 108.908 34.367  1.00 17.76 ? 236  LEU A CB  1 
ATOM   1854  C  CG  . LEU A 1 236  ? -21.368 108.777 32.950  1.00 18.22 ? 236  LEU A CG  1 
ATOM   1855  C  CD1 . LEU A 1 236  ? -22.160 109.654 31.987  1.00 17.21 ? 236  LEU A CD1 1 
ATOM   1856  C  CD2 . LEU A 1 236  ? -19.897 109.162 32.945  1.00 16.45 ? 236  LEU A CD2 1 
ATOM   1857  N  N   . ALA A 1 237  ? -22.775 108.028 37.324  1.00 20.26 ? 237  ALA A N   1 
ATOM   1858  C  CA  . ALA A 1 237  ? -23.225 108.430 38.656  1.00 20.96 ? 237  ALA A CA  1 
ATOM   1859  C  C   . ALA A 1 237  ? -22.197 108.045 39.735  1.00 21.43 ? 237  ALA A C   1 
ATOM   1860  O  O   . ALA A 1 237  ? -21.806 108.873 40.578  1.00 19.68 ? 237  ALA A O   1 
ATOM   1861  C  CB  . ALA A 1 237  ? -24.555 107.793 38.963  1.00 20.23 ? 237  ALA A CB  1 
ATOM   1862  N  N   . ILE A 1 238  ? -21.780 106.779 39.689  1.00 21.50 ? 238  ILE A N   1 
ATOM   1863  C  CA  . ILE A 1 238  ? -20.798 106.218 40.612  1.00 22.42 ? 238  ILE A CA  1 
ATOM   1864  C  C   . ILE A 1 238  ? -19.416 106.855 40.436  1.00 22.90 ? 238  ILE A C   1 
ATOM   1865  O  O   . ILE A 1 238  ? -18.766 107.197 41.426  1.00 23.59 ? 238  ILE A O   1 
ATOM   1866  C  CB  . ILE A 1 238  ? -20.679 104.680 40.413  1.00 22.02 ? 238  ILE A CB  1 
ATOM   1867  C  CG1 . ILE A 1 238  ? -22.041 104.020 40.664  1.00 22.93 ? 238  ILE A CG1 1 
ATOM   1868  C  CG2 . ILE A 1 238  ? -19.638 104.098 41.343  1.00 19.72 ? 238  ILE A CG2 1 
ATOM   1869  C  CD1 . ILE A 1 238  ? -22.157 102.562 40.146  1.00 22.46 ? 238  ILE A CD1 1 
ATOM   1870  N  N   . LEU A 1 239  ? -18.973 107.027 39.191  1.00 23.11 ? 239  LEU A N   1 
ATOM   1871  C  CA  . LEU A 1 239  ? -17.657 107.617 38.938  1.00 22.78 ? 239  LEU A CA  1 
ATOM   1872  C  C   . LEU A 1 239  ? -17.545 109.060 39.428  1.00 23.52 ? 239  LEU A C   1 
ATOM   1873  O  O   . LEU A 1 239  ? -16.495 109.477 39.905  1.00 23.53 ? 239  LEU A O   1 
ATOM   1874  C  CB  . LEU A 1 239  ? -17.306 107.548 37.449  1.00 22.39 ? 239  LEU A CB  1 
ATOM   1875  C  CG  . LEU A 1 239  ? -17.138 106.160 36.821  1.00 20.74 ? 239  LEU A CG  1 
ATOM   1876  C  CD1 . LEU A 1 239  ? -16.722 106.322 35.373  1.00 20.07 ? 239  LEU A CD1 1 
ATOM   1877  C  CD2 . LEU A 1 239  ? -16.099 105.356 37.572  1.00 21.68 ? 239  LEU A CD2 1 
ATOM   1878  N  N   . GLN A 1 240  ? -18.629 109.823 39.323  1.00 24.42 ? 240  GLN A N   1 
ATOM   1879  C  CA  . GLN A 1 240  ? -18.599 111.202 39.788  1.00 23.28 ? 240  GLN A CA  1 
ATOM   1880  C  C   . GLN A 1 240  ? -18.403 111.221 41.292  1.00 21.96 ? 240  GLN A C   1 
ATOM   1881  O  O   . GLN A 1 240  ? -17.788 112.138 41.833  1.00 22.28 ? 240  GLN A O   1 
ATOM   1882  C  CB  . GLN A 1 240  ? -19.898 111.944 39.437  1.00 23.99 ? 240  GLN A CB  1 
ATOM   1883  C  CG  . GLN A 1 240  ? -19.912 113.376 39.961  1.00 23.17 ? 240  GLN A CG  1 
ATOM   1884  C  CD  . GLN A 1 240  ? -21.017 114.217 39.372  1.00 24.25 ? 240  GLN A CD  1 
ATOM   1885  O  OE1 . GLN A 1 240  ? -21.400 114.033 38.218  1.00 25.85 ? 240  GLN A OE1 1 
ATOM   1886  N  NE2 . GLN A 1 240  ? -21.525 115.168 40.153  1.00 23.16 ? 240  GLN A NE2 1 
ATOM   1887  N  N   . GLN A 1 241  ? -18.930 110.213 41.975  1.00 20.72 ? 241  GLN A N   1 
ATOM   1888  C  CA  . GLN A 1 241  ? -18.777 110.168 43.423  1.00 20.22 ? 241  GLN A CA  1 
ATOM   1889  C  C   . GLN A 1 241  ? -17.488 109.483 43.837  1.00 20.62 ? 241  GLN A C   1 
ATOM   1890  O  O   . GLN A 1 241  ? -16.922 109.812 44.874  1.00 22.28 ? 241  GLN A O   1 
ATOM   1891  C  CB  . GLN A 1 241  ? -19.957 109.440 44.087  1.00 18.12 ? 241  GLN A CB  1 
ATOM   1892  C  CG  . GLN A 1 241  ? -21.326 110.035 43.814  1.00 17.02 ? 241  GLN A CG  1 
ATOM   1893  C  CD  . GLN A 1 241  ? -21.392 111.535 44.046  1.00 17.26 ? 241  GLN A CD  1 
ATOM   1894  O  OE1 . GLN A 1 241  ? -21.357 112.324 43.101  1.00 20.09 ? 241  GLN A OE1 1 
ATOM   1895  N  NE2 . GLN A 1 241  ? -21.479 111.937 45.303  1.00 18.27 ? 241  GLN A NE2 1 
ATOM   1896  N  N   . THR A 1 242  ? -17.014 108.547 43.017  1.00 21.18 ? 242  THR A N   1 
ATOM   1897  C  CA  . THR A 1 242  ? -15.818 107.787 43.352  1.00 21.39 ? 242  THR A CA  1 
ATOM   1898  C  C   . THR A 1 242  ? -14.506 108.181 42.694  1.00 23.27 ? 242  THR A C   1 
ATOM   1899  O  O   . THR A 1 242  ? -13.439 107.752 43.142  1.00 23.36 ? 242  THR A O   1 
ATOM   1900  C  CB  . THR A 1 242  ? -16.041 106.297 43.108  1.00 20.53 ? 242  THR A CB  1 
ATOM   1901  O  OG1 . THR A 1 242  ? -16.454 106.102 41.756  1.00 20.03 ? 242  THR A OG1 1 
ATOM   1902  C  CG2 . THR A 1 242  ? -17.097 105.759 44.058  1.00 18.74 ? 242  THR A CG2 1 
ATOM   1903  N  N   . ALA A 1 243  ? -14.560 108.969 41.629  1.00 23.64 ? 243  ALA A N   1 
ATOM   1904  C  CA  . ALA A 1 243  ? -13.319 109.395 40.998  1.00 23.84 ? 243  ALA A CA  1 
ATOM   1905  C  C   . ALA A 1 243  ? -13.252 110.895 41.174  1.00 23.98 ? 243  ALA A C   1 
ATOM   1906  O  O   . ALA A 1 243  ? -12.268 111.535 40.776  1.00 24.84 ? 243  ALA A O   1 
ATOM   1907  C  CB  . ALA A 1 243  ? -13.306 109.033 39.526  1.00 22.44 ? 243  ALA A CB  1 
ATOM   1908  N  N   . GLY A 1 244  ? -14.312 111.440 41.779  1.00 23.22 ? 244  GLY A N   1 
ATOM   1909  C  CA  . GLY A 1 244  ? -14.402 112.865 42.006  1.00 22.06 ? 244  GLY A CA  1 
ATOM   1910  C  C   . GLY A 1 244  ? -14.442 113.632 40.700  1.00 23.28 ? 244  GLY A C   1 
ATOM   1911  O  O   . GLY A 1 244  ? -14.024 114.784 40.652  1.00 22.54 ? 244  GLY A O   1 
ATOM   1912  N  N   . LEU A 1 245  ? -14.951 112.997 39.644  1.00 23.18 ? 245  LEU A N   1 
ATOM   1913  C  CA  . LEU A 1 245  ? -15.037 113.620 38.329  1.00 24.21 ? 245  LEU A CA  1 
ATOM   1914  C  C   . LEU A 1 245  ? -15.679 114.985 38.401  1.00 25.68 ? 245  LEU A C   1 
ATOM   1915  O  O   . LEU A 1 245  ? -16.672 115.178 39.106  1.00 26.52 ? 245  LEU A O   1 
ATOM   1916  C  CB  . LEU A 1 245  ? -15.873 112.772 37.366  1.00 23.81 ? 245  LEU A CB  1 
ATOM   1917  C  CG  . LEU A 1 245  ? -15.418 111.376 36.950  1.00 24.57 ? 245  LEU A CG  1 
ATOM   1918  C  CD1 . LEU A 1 245  ? -16.464 110.775 36.017  1.00 23.22 ? 245  LEU A CD1 1 
ATOM   1919  C  CD2 . LEU A 1 245  ? -14.045 111.453 36.275  1.00 24.12 ? 245  LEU A CD2 1 
ATOM   1920  N  N   . ASP A 1 246  ? -15.126 115.928 37.649  1.00 27.17 ? 246  ASP A N   1 
ATOM   1921  C  CA  . ASP A 1 246  ? -15.685 117.272 37.604  1.00 27.79 ? 246  ASP A CA  1 
ATOM   1922  C  C   . ASP A 1 246  ? -17.155 117.123 37.191  1.00 28.41 ? 246  ASP A C   1 
ATOM   1923  O  O   . ASP A 1 246  ? -17.456 116.625 36.102  1.00 29.86 ? 246  ASP A O   1 
ATOM   1924  C  CB  . ASP A 1 246  ? -14.937 118.112 36.573  1.00 27.28 ? 246  ASP A CB  1 
ATOM   1925  C  CG  . ASP A 1 246  ? -15.510 119.505 36.435  1.00 29.14 ? 246  ASP A CG  1 
ATOM   1926  O  OD1 . ASP A 1 246  ? -16.678 119.719 36.843  1.00 27.35 ? 246  ASP A OD1 1 
ATOM   1927  O  OD2 . ASP A 1 246  ? -14.797 120.379 35.905  1.00 29.26 ? 246  ASP A OD2 1 
ATOM   1928  N  N   . PRO A 1 247  ? -18.094 117.560 38.046  1.00 28.57 ? 247  PRO A N   1 
ATOM   1929  C  CA  . PRO A 1 247  ? -19.521 117.434 37.709  1.00 27.55 ? 247  PRO A CA  1 
ATOM   1930  C  C   . PRO A 1 247  ? -19.908 118.026 36.355  1.00 28.34 ? 247  PRO A C   1 
ATOM   1931  O  O   . PRO A 1 247  ? -20.797 117.507 35.674  1.00 29.70 ? 247  PRO A O   1 
ATOM   1932  C  CB  . PRO A 1 247  ? -20.221 118.144 38.864  1.00 26.86 ? 247  PRO A CB  1 
ATOM   1933  C  CG  . PRO A 1 247  ? -19.256 117.969 40.009  1.00 28.99 ? 247  PRO A CG  1 
ATOM   1934  C  CD  . PRO A 1 247  ? -17.911 118.213 39.351  1.00 28.23 ? 247  PRO A CD  1 
ATOM   1935  N  N   . SER A 1 248  ? -19.238 119.105 35.966  1.00 28.03 ? 248  SER A N   1 
ATOM   1936  C  CA  . SER A 1 248  ? -19.539 119.777 34.699  1.00 28.99 ? 248  SER A CA  1 
ATOM   1937  C  C   . SER A 1 248  ? -19.102 118.971 33.482  1.00 29.00 ? 248  SER A C   1 
ATOM   1938  O  O   . SER A 1 248  ? -19.748 119.042 32.441  1.00 31.20 ? 248  SER A O   1 
ATOM   1939  C  CB  . SER A 1 248  ? -18.898 121.179 34.654  1.00 28.10 ? 248  SER A CB  1 
ATOM   1940  O  OG  . SER A 1 248  ? -17.516 121.120 34.970  1.00 28.05 ? 248  SER A OG  1 
ATOM   1941  N  N   . LEU A 1 249  ? -18.000 118.228 33.600  1.00 27.63 ? 249  LEU A N   1 
ATOM   1942  C  CA  . LEU A 1 249  ? -17.553 117.397 32.487  1.00 25.95 ? 249  LEU A CA  1 
ATOM   1943  C  C   . LEU A 1 249  ? -18.528 116.238 32.382  1.00 23.85 ? 249  LEU A C   1 
ATOM   1944  O  O   . LEU A 1 249  ? -18.903 115.822 31.293  1.00 22.81 ? 249  LEU A O   1 
ATOM   1945  C  CB  . LEU A 1 249  ? -16.132 116.874 32.717  1.00 26.77 ? 249  LEU A CB  1 
ATOM   1946  C  CG  . LEU A 1 249  ? -15.036 117.844 32.288  1.00 27.15 ? 249  LEU A CG  1 
ATOM   1947  C  CD1 . LEU A 1 249  ? -13.660 117.259 32.594  1.00 28.15 ? 249  LEU A CD1 1 
ATOM   1948  C  CD2 . LEU A 1 249  ? -15.174 118.130 30.808  1.00 27.76 ? 249  LEU A CD2 1 
ATOM   1949  N  N   . VAL A 1 250  ? -18.946 115.731 33.531  1.00 23.03 ? 250  VAL A N   1 
ATOM   1950  C  CA  . VAL A 1 250  ? -19.889 114.636 33.569  1.00 22.69 ? 250  VAL A CA  1 
ATOM   1951  C  C   . VAL A 1 250  ? -21.169 114.992 32.794  1.00 23.71 ? 250  VAL A C   1 
ATOM   1952  O  O   . VAL A 1 250  ? -21.658 114.186 32.010  1.00 25.15 ? 250  VAL A O   1 
ATOM   1953  C  CB  . VAL A 1 250  ? -20.222 114.259 35.031  1.00 22.60 ? 250  VAL A CB  1 
ATOM   1954  C  CG1 . VAL A 1 250  ? -21.132 113.033 35.074  1.00 20.72 ? 250  VAL A CG1 1 
ATOM   1955  C  CG2 . VAL A 1 250  ? -18.935 113.995 35.792  1.00 20.20 ? 250  VAL A CG2 1 
ATOM   1956  N  N   . LYS A 1 251  ? -21.704 116.196 32.986  1.00 24.99 ? 251  LYS A N   1 
ATOM   1957  C  CA  . LYS A 1 251  ? -22.921 116.595 32.270  1.00 25.59 ? 251  LYS A CA  1 
ATOM   1958  C  C   . LYS A 1 251  ? -22.750 116.514 30.759  1.00 25.83 ? 251  LYS A C   1 
ATOM   1959  O  O   . LYS A 1 251  ? -23.687 116.141 30.047  1.00 26.48 ? 251  LYS A O   1 
ATOM   1960  C  CB  . LYS A 1 251  ? -23.368 118.017 32.649  1.00 27.07 ? 251  LYS A CB  1 
ATOM   1961  C  CG  . LYS A 1 251  ? -23.846 118.145 34.082  1.00 30.33 ? 251  LYS A CG  1 
ATOM   1962  C  CD  . LYS A 1 251  ? -24.538 119.471 34.350  1.00 32.25 ? 251  LYS A CD  1 
ATOM   1963  C  CE  . LYS A 1 251  ? -25.849 119.572 33.599  1.00 33.77 ? 251  LYS A CE  1 
ATOM   1964  N  NZ  . LYS A 1 251  ? -26.588 120.793 34.027  1.00 37.44 ? 251  LYS A NZ  1 
ATOM   1965  N  N   . LEU A 1 252  ? -21.572 116.870 30.253  1.00 24.19 ? 252  LEU A N   1 
ATOM   1966  C  CA  . LEU A 1 252  ? -21.354 116.770 28.813  1.00 24.44 ? 252  LEU A CA  1 
ATOM   1967  C  C   . LEU A 1 252  ? -21.567 115.317 28.388  1.00 23.76 ? 252  LEU A C   1 
ATOM   1968  O  O   . LEU A 1 252  ? -22.208 115.032 27.378  1.00 23.12 ? 252  LEU A O   1 
ATOM   1969  C  CB  . LEU A 1 252  ? -19.937 117.220 28.441  1.00 24.77 ? 252  LEU A CB  1 
ATOM   1970  C  CG  . LEU A 1 252  ? -19.580 118.671 28.762  1.00 25.13 ? 252  LEU A CG  1 
ATOM   1971  C  CD1 . LEU A 1 252  ? -18.157 118.939 28.295  1.00 24.01 ? 252  LEU A CD1 1 
ATOM   1972  C  CD2 . LEU A 1 252  ? -20.580 119.618 28.078  1.00 22.02 ? 252  LEU A CD2 1 
ATOM   1973  N  N   . GLY A 1 253  ? -21.016 114.398 29.174  1.00 24.60 ? 253  GLY A N   1 
ATOM   1974  C  CA  . GLY A 1 253  ? -21.154 112.986 28.879  1.00 24.48 ? 253  GLY A CA  1 
ATOM   1975  C  C   . GLY A 1 253  ? -22.609 112.560 28.847  1.00 25.04 ? 253  GLY A C   1 
ATOM   1976  O  O   . GLY A 1 253  ? -23.029 111.843 27.936  1.00 23.82 ? 253  GLY A O   1 
ATOM   1977  N  N   . VAL A 1 254  ? -23.390 112.978 29.842  1.00 25.65 ? 254  VAL A N   1 
ATOM   1978  C  CA  . VAL A 1 254  ? -24.803 112.616 29.842  1.00 25.83 ? 254  VAL A CA  1 
ATOM   1979  C  C   . VAL A 1 254  ? -25.444 113.152 28.566  1.00 25.84 ? 254  VAL A C   1 
ATOM   1980  O  O   . VAL A 1 254  ? -26.223 112.459 27.917  1.00 25.94 ? 254  VAL A O   1 
ATOM   1981  C  CB  . VAL A 1 254  ? -25.535 113.177 31.079  1.00 27.06 ? 254  VAL A CB  1 
ATOM   1982  C  CG1 . VAL A 1 254  ? -27.048 112.955 30.946  1.00 25.96 ? 254  VAL A CG1 1 
ATOM   1983  C  CG2 . VAL A 1 254  ? -25.007 112.482 32.334  1.00 27.29 ? 254  VAL A CG2 1 
ATOM   1984  N  N   . GLN A 1 255  ? -25.102 114.385 28.197  1.00 25.62 ? 255  GLN A N   1 
ATOM   1985  C  CA  . GLN A 1 255  ? -25.635 114.982 26.981  1.00 25.33 ? 255  GLN A CA  1 
ATOM   1986  C  C   . GLN A 1 255  ? -25.411 114.060 25.802  1.00 24.96 ? 255  GLN A C   1 
ATOM   1987  O  O   . GLN A 1 255  ? -26.316 113.833 24.994  1.00 25.01 ? 255  GLN A O   1 
ATOM   1988  C  CB  . GLN A 1 255  ? -24.950 116.307 26.678  1.00 28.90 ? 255  GLN A CB  1 
ATOM   1989  C  CG  . GLN A 1 255  ? -25.780 117.526 26.971  1.00 33.36 ? 255  GLN A CG  1 
ATOM   1990  C  CD  . GLN A 1 255  ? -25.013 118.826 26.767  1.00 35.92 ? 255  GLN A CD  1 
ATOM   1991  O  OE1 . GLN A 1 255  ? -24.686 119.210 25.633  1.00 36.90 ? 255  GLN A OE1 1 
ATOM   1992  N  NE2 . GLN A 1 255  ? -24.725 119.515 27.873  1.00 36.07 ? 255  GLN A NE2 1 
ATOM   1993  N  N   . ILE A 1 256  ? -24.195 113.535 25.696  1.00 23.55 ? 256  ILE A N   1 
ATOM   1994  C  CA  . ILE A 1 256  ? -23.874 112.659 24.588  1.00 22.87 ? 256  ILE A CA  1 
ATOM   1995  C  C   . ILE A 1 256  ? -24.768 111.429 24.598  1.00 22.20 ? 256  ILE A C   1 
ATOM   1996  O  O   . ILE A 1 256  ? -25.350 111.084 23.568  1.00 22.23 ? 256  ILE A O   1 
ATOM   1997  C  CB  . ILE A 1 256  ? -22.365 112.258 24.605  1.00 22.65 ? 256  ILE A CB  1 
ATOM   1998  C  CG1 . ILE A 1 256  ? -21.511 113.529 24.439  1.00 22.36 ? 256  ILE A CG1 1 
ATOM   1999  C  CG2 . ILE A 1 256  ? -22.072 111.210 23.488  1.00 20.29 ? 256  ILE A CG2 1 
ATOM   2000  C  CD1 . ILE A 1 256  ? -20.033 113.291 24.175  1.00 20.46 ? 256  ILE A CD1 1 
ATOM   2001  N  N   . CYS A 1 257  ? -24.899 110.790 25.759  1.00 22.06 ? 257  CYS A N   1 
ATOM   2002  C  CA  . CYS A 1 257  ? -25.722 109.596 25.872  1.00 23.01 ? 257  CYS A CA  1 
ATOM   2003  C  C   . CYS A 1 257  ? -27.173 109.914 25.502  1.00 22.93 ? 257  CYS A C   1 
ATOM   2004  O  O   . CYS A 1 257  ? -27.802 109.171 24.740  1.00 21.72 ? 257  CYS A O   1 
ATOM   2005  C  CB  . CYS A 1 257  ? -25.637 109.019 27.291  1.00 23.54 ? 257  CYS A CB  1 
ATOM   2006  S  SG  . CYS A 1 257  ? -23.988 108.375 27.780  1.00 22.72 ? 257  CYS A SG  1 
ATOM   2007  N  N   . LEU A 1 258  ? -27.699 111.016 26.042  1.00 22.68 ? 258  LEU A N   1 
ATOM   2008  C  CA  . LEU A 1 258  ? -29.063 111.427 25.729  1.00 23.70 ? 258  LEU A CA  1 
ATOM   2009  C  C   . LEU A 1 258  ? -29.212 111.551 24.211  1.00 24.39 ? 258  LEU A C   1 
ATOM   2010  O  O   . LEU A 1 258  ? -30.230 111.131 23.644  1.00 24.30 ? 258  LEU A O   1 
ATOM   2011  C  CB  . LEU A 1 258  ? -29.398 112.754 26.414  1.00 23.04 ? 258  LEU A CB  1 
ATOM   2012  C  CG  . LEU A 1 258  ? -29.676 112.621 27.913  1.00 21.55 ? 258  LEU A CG  1 
ATOM   2013  C  CD1 . LEU A 1 258  ? -29.981 113.973 28.510  1.00 21.29 ? 258  LEU A CD1 1 
ATOM   2014  C  CD2 . LEU A 1 258  ? -30.835 111.674 28.115  1.00 21.96 ? 258  LEU A CD2 1 
ATOM   2015  N  N   . HIS A 1 259  ? -28.189 112.101 23.557  1.00 24.17 ? 259  HIS A N   1 
ATOM   2016  C  CA  . HIS A 1 259  ? -28.214 112.235 22.109  1.00 25.65 ? 259  HIS A CA  1 
ATOM   2017  C  C   . HIS A 1 259  ? -28.186 110.871 21.431  1.00 25.75 ? 259  HIS A C   1 
ATOM   2018  O  O   . HIS A 1 259  ? -28.793 110.692 20.376  1.00 25.23 ? 259  HIS A O   1 
ATOM   2019  C  CB  . HIS A 1 259  ? -27.039 113.069 21.617  1.00 28.63 ? 259  HIS A CB  1 
ATOM   2020  C  CG  . HIS A 1 259  ? -27.342 114.531 21.514  1.00 32.35 ? 259  HIS A CG  1 
ATOM   2021  N  ND1 . HIS A 1 259  ? -27.498 115.340 22.618  1.00 33.57 ? 259  HIS A ND1 1 
ATOM   2022  C  CD2 . HIS A 1 259  ? -27.530 115.322 20.431  1.00 33.35 ? 259  HIS A CD2 1 
ATOM   2023  C  CE1 . HIS A 1 259  ? -27.770 116.572 22.221  1.00 34.31 ? 259  HIS A CE1 1 
ATOM   2024  N  NE2 . HIS A 1 259  ? -27.794 116.587 20.900  1.00 34.77 ? 259  HIS A NE2 1 
ATOM   2025  N  N   . ALA A 1 260  ? -27.492 109.910 22.036  1.00 25.73 ? 260  ALA A N   1 
ATOM   2026  C  CA  . ALA A 1 260  ? -27.423 108.564 21.473  1.00 26.57 ? 260  ALA A CA  1 
ATOM   2027  C  C   . ALA A 1 260  ? -28.809 107.905 21.517  1.00 27.21 ? 260  ALA A C   1 
ATOM   2028  O  O   . ALA A 1 260  ? -29.234 107.253 20.556  1.00 27.65 ? 260  ALA A O   1 
ATOM   2029  C  CB  . ALA A 1 260  ? -26.399 107.710 22.244  1.00 26.86 ? 260  ALA A CB  1 
ATOM   2030  N  N   . ALA A 1 261  ? -29.507 108.083 22.633  1.00 27.26 ? 261  ALA A N   1 
ATOM   2031  C  CA  . ALA A 1 261  ? -30.850 107.522 22.798  1.00 27.61 ? 261  ALA A CA  1 
ATOM   2032  C  C   . ALA A 1 261  ? -31.835 108.270 21.897  1.00 27.55 ? 261  ALA A C   1 
ATOM   2033  O  O   . ALA A 1 261  ? -32.836 107.718 21.457  1.00 28.08 ? 261  ALA A O   1 
ATOM   2034  C  CB  . ALA A 1 261  ? -31.282 107.640 24.253  1.00 28.07 ? 261  ALA A CB  1 
ATOM   2035  N  N   . ALA A 1 262  ? -31.534 109.537 21.632  1.00 27.16 ? 262  ALA A N   1 
ATOM   2036  C  CA  . ALA A 1 262  ? -32.371 110.378 20.781  1.00 26.24 ? 262  ALA A CA  1 
ATOM   2037  C  C   . ALA A 1 262  ? -32.240 110.003 19.303  1.00 26.17 ? 262  ALA A C   1 
ATOM   2038  O  O   . ALA A 1 262  ? -33.154 110.214 18.517  1.00 25.38 ? 262  ALA A O   1 
ATOM   2039  C  CB  . ALA A 1 262  ? -31.994 111.847 20.972  1.00 25.87 ? 262  ALA A CB  1 
ATOM   2040  N  N   . SER A 1 263  ? -31.095 109.442 18.936  1.00 26.25 ? 263  SER A N   1 
ATOM   2041  C  CA  . SER A 1 263  ? -30.834 109.062 17.552  1.00 26.25 ? 263  SER A CA  1 
ATOM   2042  C  C   . SER A 1 263  ? -31.598 107.806 17.173  1.00 25.48 ? 263  SER A C   1 
ATOM   2043  O  O   . SER A 1 263  ? -32.452 107.335 17.930  1.00 24.48 ? 263  SER A O   1 
ATOM   2044  C  CB  . SER A 1 263  ? -29.331 108.834 17.335  1.00 25.65 ? 263  SER A CB  1 
ATOM   2045  O  OG  . SER A 1 263  ? -28.939 107.554 17.787  1.00 25.22 ? 263  SER A OG  1 
ATOM   2046  N  N   . SER A 1 264  ? -31.281 107.261 16.001  1.00 24.81 ? 264  SER A N   1 
ATOM   2047  C  CA  . SER A 1 264  ? -31.947 106.055 15.533  1.00 23.99 ? 264  SER A CA  1 
ATOM   2048  C  C   . SER A 1 264  ? -31.232 104.784 15.985  1.00 23.47 ? 264  SER A C   1 
ATOM   2049  O  O   . SER A 1 264  ? -31.695 103.688 15.696  1.00 22.92 ? 264  SER A O   1 
ATOM   2050  C  CB  . SER A 1 264  ? -32.044 106.079 14.012  1.00 22.91 ? 264  SER A CB  1 
ATOM   2051  O  OG  . SER A 1 264  ? -30.775 106.283 13.422  1.00 23.05 ? 264  SER A OG  1 
ATOM   2052  N  N   . SER A 1 265  ? -30.108 104.929 16.686  1.00 23.40 ? 265  SER A N   1 
ATOM   2053  C  CA  . SER A 1 265  ? -29.360 103.765 17.160  1.00 23.19 ? 265  SER A CA  1 
ATOM   2054  C  C   . SER A 1 265  ? -28.259 104.159 18.147  1.00 24.44 ? 265  SER A C   1 
ATOM   2055  O  O   . SER A 1 265  ? -27.240 104.737 17.780  1.00 23.55 ? 265  SER A O   1 
ATOM   2056  C  CB  . SER A 1 265  ? -28.755 103.026 15.980  1.00 21.79 ? 265  SER A CB  1 
ATOM   2057  O  OG  . SER A 1 265  ? -28.138 101.825 16.391  1.00 21.44 ? 265  SER A OG  1 
ATOM   2058  N  N   . TYR A 1 266  ? -28.491 103.834 19.411  1.00 25.43 ? 266  TYR A N   1 
ATOM   2059  C  CA  . TYR A 1 266  ? -27.576 104.149 20.495  1.00 26.34 ? 266  TYR A CA  1 
ATOM   2060  C  C   . TYR A 1 266  ? -26.159 103.612 20.279  1.00 27.36 ? 266  TYR A C   1 
ATOM   2061  O  O   . TYR A 1 266  ? -25.184 104.365 20.349  1.00 28.39 ? 266  TYR A O   1 
ATOM   2062  C  CB  . TYR A 1 266  ? -28.124 103.577 21.803  1.00 25.58 ? 266  TYR A CB  1 
ATOM   2063  C  CG  . TYR A 1 266  ? -27.486 104.153 23.032  1.00 25.39 ? 266  TYR A CG  1 
ATOM   2064  C  CD1 . TYR A 1 266  ? -28.050 105.252 23.670  1.00 24.96 ? 266  TYR A CD1 1 
ATOM   2065  C  CD2 . TYR A 1 266  ? -26.325 103.593 23.577  1.00 25.41 ? 266  TYR A CD2 1 
ATOM   2066  C  CE1 . TYR A 1 266  ? -27.487 105.785 24.819  1.00 24.59 ? 266  TYR A CE1 1 
ATOM   2067  C  CE2 . TYR A 1 266  ? -25.747 104.125 24.736  1.00 25.17 ? 266  TYR A CE2 1 
ATOM   2068  C  CZ  . TYR A 1 266  ? -26.337 105.224 25.355  1.00 24.19 ? 266  TYR A CZ  1 
ATOM   2069  O  OH  . TYR A 1 266  ? -25.790 105.766 26.503  1.00 19.97 ? 266  TYR A OH  1 
ATOM   2070  N  N   . SER A 1 267  ? -26.047 102.303 20.053  1.00 28.73 ? 267  SER A N   1 
ATOM   2071  C  CA  . SER A 1 267  ? -24.741 101.694 19.841  1.00 28.57 ? 267  SER A CA  1 
ATOM   2072  C  C   . SER A 1 267  ? -24.005 102.347 18.676  1.00 26.68 ? 267  SER A C   1 
ATOM   2073  O  O   . SER A 1 267  ? -22.837 102.711 18.801  1.00 25.88 ? 267  SER A O   1 
ATOM   2074  C  CB  . SER A 1 267  ? -24.884 100.190 19.603  1.00 30.57 ? 267  SER A CB  1 
ATOM   2075  O  OG  . SER A 1 267  ? -23.620 99.582  19.402  1.00 41.86 ? 267  SER A OG  1 
ATOM   2076  N  N   . TRP A 1 268  ? -24.721 102.528 17.563  1.00 25.81 ? 268  TRP A N   1 
ATOM   2077  C  CA  . TRP A 1 268  ? -24.150 103.157 16.369  1.00 24.37 ? 268  TRP A CA  1 
ATOM   2078  C  C   . TRP A 1 268  ? -23.652 104.584 16.664  1.00 23.39 ? 268  TRP A C   1 
ATOM   2079  O  O   . TRP A 1 268  ? -22.523 104.943 16.326  1.00 24.12 ? 268  TRP A O   1 
ATOM   2080  C  CB  . TRP A 1 268  ? -25.194 103.196 15.233  1.00 23.54 ? 268  TRP A CB  1 
ATOM   2081  C  CG  . TRP A 1 268  ? -24.712 103.915 13.986  1.00 24.39 ? 268  TRP A CG  1 
ATOM   2082  C  CD1 . TRP A 1 268  ? -23.845 103.435 13.046  1.00 23.48 ? 268  TRP A CD1 1 
ATOM   2083  C  CD2 . TRP A 1 268  ? -24.989 105.274 13.618  1.00 24.39 ? 268  TRP A CD2 1 
ATOM   2084  N  NE1 . TRP A 1 268  ? -23.559 104.409 12.130  1.00 23.80 ? 268  TRP A NE1 1 
ATOM   2085  C  CE2 . TRP A 1 268  ? -24.247 105.551 12.456  1.00 23.78 ? 268  TRP A CE2 1 
ATOM   2086  C  CE3 . TRP A 1 268  ? -25.785 106.290 14.173  1.00 25.51 ? 268  TRP A CE3 1 
ATOM   2087  C  CZ2 . TRP A 1 268  ? -24.279 106.800 11.818  1.00 24.34 ? 268  TRP A CZ2 1 
ATOM   2088  C  CZ3 . TRP A 1 268  ? -25.808 107.540 13.549  1.00 26.09 ? 268  TRP A CZ3 1 
ATOM   2089  C  CH2 . TRP A 1 268  ? -25.062 107.778 12.374  1.00 24.59 ? 268  TRP A CH2 1 
ATOM   2090  N  N   . PHE A 1 269  ? -24.503 105.383 17.292  1.00 21.46 ? 269  PHE A N   1 
ATOM   2091  C  CA  . PHE A 1 269  ? -24.175 106.762 17.620  1.00 20.93 ? 269  PHE A CA  1 
ATOM   2092  C  C   . PHE A 1 269  ? -22.925 106.854 18.505  1.00 21.45 ? 269  PHE A C   1 
ATOM   2093  O  O   . PHE A 1 269  ? -22.070 107.723 18.308  1.00 19.64 ? 269  PHE A O   1 
ATOM   2094  C  CB  . PHE A 1 269  ? -25.370 107.430 18.321  1.00 19.57 ? 269  PHE A CB  1 
ATOM   2095  C  CG  . PHE A 1 269  ? -25.247 108.924 18.437  1.00 19.37 ? 269  PHE A CG  1 
ATOM   2096  C  CD1 . PHE A 1 269  ? -25.745 109.752 17.433  1.00 19.80 ? 269  PHE A CD1 1 
ATOM   2097  C  CD2 . PHE A 1 269  ? -24.607 109.507 19.537  1.00 20.08 ? 269  PHE A CD2 1 
ATOM   2098  C  CE1 . PHE A 1 269  ? -25.611 111.145 17.511  1.00 20.46 ? 269  PHE A CE1 1 
ATOM   2099  C  CE2 . PHE A 1 269  ? -24.463 110.894 19.629  1.00 20.06 ? 269  PHE A CE2 1 
ATOM   2100  C  CZ  . PHE A 1 269  ? -24.970 111.717 18.613  1.00 20.36 ? 269  PHE A CZ  1 
ATOM   2101  N  N   . ILE A 1 270  ? -22.821 105.950 19.477  1.00 22.53 ? 270  ILE A N   1 
ATOM   2102  C  CA  . ILE A 1 270  ? -21.685 105.925 20.386  1.00 22.07 ? 270  ILE A CA  1 
ATOM   2103  C  C   . ILE A 1 270  ? -20.420 105.537 19.633  1.00 23.54 ? 270  ILE A C   1 
ATOM   2104  O  O   . ILE A 1 270  ? -19.337 106.058 19.904  1.00 23.41 ? 270  ILE A O   1 
ATOM   2105  C  CB  . ILE A 1 270  ? -21.912 104.911 21.530  1.00 21.74 ? 270  ILE A CB  1 
ATOM   2106  C  CG1 . ILE A 1 270  ? -23.087 105.370 22.400  1.00 19.21 ? 270  ILE A CG1 1 
ATOM   2107  C  CG2 . ILE A 1 270  ? -20.623 104.737 22.352  1.00 21.25 ? 270  ILE A CG2 1 
ATOM   2108  C  CD1 . ILE A 1 270  ? -22.865 106.683 23.103  1.00 18.32 ? 270  ILE A CD1 1 
ATOM   2109  N  N   . LEU A 1 271  ? -20.566 104.611 18.691  1.00 24.26 ? 271  LEU A N   1 
ATOM   2110  C  CA  . LEU A 1 271  ? -19.441 104.165 17.887  1.00 24.42 ? 271  LEU A CA  1 
ATOM   2111  C  C   . LEU A 1 271  ? -18.890 105.325 17.039  1.00 25.83 ? 271  LEU A C   1 
ATOM   2112  O  O   . LEU A 1 271  ? -17.673 105.510 16.934  1.00 26.33 ? 271  LEU A O   1 
ATOM   2113  C  CB  . LEU A 1 271  ? -19.881 103.021 16.970  1.00 24.22 ? 271  LEU A CB  1 
ATOM   2114  C  CG  . LEU A 1 271  ? -18.822 102.389 16.059  1.00 23.88 ? 271  LEU A CG  1 
ATOM   2115  C  CD1 . LEU A 1 271  ? -17.775 101.678 16.901  1.00 23.95 ? 271  LEU A CD1 1 
ATOM   2116  C  CD2 . LEU A 1 271  ? -19.492 101.391 15.133  1.00 24.92 ? 271  LEU A CD2 1 
ATOM   2117  N  N   . LYS A 1 272  ? -19.791 106.113 16.454  1.00 24.49 ? 272  LYS A N   1 
ATOM   2118  C  CA  . LYS A 1 272  ? -19.388 107.227 15.605  1.00 24.56 ? 272  LYS A CA  1 
ATOM   2119  C  C   . LYS A 1 272  ? -18.859 108.441 16.341  1.00 24.53 ? 272  LYS A C   1 
ATOM   2120  O  O   . LYS A 1 272  ? -18.161 109.252 15.752  1.00 25.86 ? 272  LYS A O   1 
ATOM   2121  C  CB  . LYS A 1 272  ? -20.564 107.679 14.730  1.00 24.87 ? 272  LYS A CB  1 
ATOM   2122  C  CG  . LYS A 1 272  ? -21.302 106.539 14.033  1.00 26.52 ? 272  LYS A CG  1 
ATOM   2123  C  CD  . LYS A 1 272  ? -20.848 106.317 12.589  1.00 24.87 ? 272  LYS A CD  1 
ATOM   2124  C  CE  . LYS A 1 272  ? -19.436 105.776 12.474  1.00 22.52 ? 272  LYS A CE  1 
ATOM   2125  N  NZ  . LYS A 1 272  ? -19.217 105.379 11.062  1.00 22.54 ? 272  LYS A NZ  1 
ATOM   2126  N  N   . THR A 1 273  ? -19.191 108.581 17.618  1.00 24.10 ? 273  THR A N   1 
ATOM   2127  C  CA  . THR A 1 273  ? -18.758 109.750 18.369  1.00 23.67 ? 273  THR A CA  1 
ATOM   2128  C  C   . THR A 1 273  ? -17.856 109.476 19.569  1.00 23.98 ? 273  THR A C   1 
ATOM   2129  O  O   . THR A 1 273  ? -17.574 110.386 20.340  1.00 22.74 ? 273  THR A O   1 
ATOM   2130  C  CB  . THR A 1 273  ? -19.964 110.526 18.879  1.00 23.40 ? 273  THR A CB  1 
ATOM   2131  O  OG1 . THR A 1 273  ? -20.637 109.750 19.884  1.00 24.40 ? 273  THR A OG1 1 
ATOM   2132  C  CG2 . THR A 1 273  ? -20.923 110.808 17.738  1.00 24.82 ? 273  THR A CG2 1 
ATOM   2133  N  N   . LYS A 1 274  ? -17.396 108.236 19.717  1.00 24.64 ? 274  LYS A N   1 
ATOM   2134  C  CA  . LYS A 1 274  ? -16.541 107.842 20.842  1.00 25.39 ? 274  LYS A CA  1 
ATOM   2135  C  C   . LYS A 1 274  ? -15.224 108.624 20.971  1.00 26.58 ? 274  LYS A C   1 
ATOM   2136  O  O   . LYS A 1 274  ? -14.594 108.610 22.040  1.00 26.16 ? 274  LYS A O   1 
ATOM   2137  C  CB  . LYS A 1 274  ? -16.198 106.353 20.742  1.00 27.46 ? 274  LYS A CB  1 
ATOM   2138  C  CG  . LYS A 1 274  ? -15.274 106.028 19.560  1.00 28.26 ? 274  LYS A CG  1 
ATOM   2139  C  CD  . LYS A 1 274  ? -15.134 104.541 19.330  1.00 30.24 ? 274  LYS A CD  1 
ATOM   2140  C  CE  . LYS A 1 274  ? -14.259 104.263 18.114  1.00 31.82 ? 274  LYS A CE  1 
ATOM   2141  N  NZ  . LYS A 1 274  ? -14.300 102.828 17.730  1.00 36.32 ? 274  LYS A NZ  1 
ATOM   2142  N  N   . SER A 1 275  ? -14.792 109.286 19.902  1.00 24.77 ? 275  SER A N   1 
ATOM   2143  C  CA  . SER A 1 275  ? -13.543 110.019 19.957  1.00 24.16 ? 275  SER A CA  1 
ATOM   2144  C  C   . SER A 1 275  ? -13.681 111.424 20.536  1.00 23.94 ? 275  SER A C   1 
ATOM   2145  O  O   . SER A 1 275  ? -12.679 112.047 20.871  1.00 25.13 ? 275  SER A O   1 
ATOM   2146  C  CB  . SER A 1 275  ? -12.913 110.110 18.559  1.00 24.07 ? 275  SER A CB  1 
ATOM   2147  O  OG  . SER A 1 275  ? -13.395 111.242 17.853  1.00 27.66 ? 275  SER A OG  1 
ATOM   2148  N  N   . ILE A 1 276  ? -14.906 111.921 20.658  1.00 24.21 ? 276  ILE A N   1 
ATOM   2149  C  CA  . ILE A 1 276  ? -15.131 113.275 21.169  1.00 25.62 ? 276  ILE A CA  1 
ATOM   2150  C  C   . ILE A 1 276  ? -14.217 113.714 22.324  1.00 25.64 ? 276  ILE A C   1 
ATOM   2151  O  O   . ILE A 1 276  ? -13.388 114.618 22.166  1.00 25.17 ? 276  ILE A O   1 
ATOM   2152  C  CB  . ILE A 1 276  ? -16.585 113.473 21.645  1.00 27.56 ? 276  ILE A CB  1 
ATOM   2153  C  CG1 . ILE A 1 276  ? -17.571 113.172 20.517  1.00 31.33 ? 276  ILE A CG1 1 
ATOM   2154  C  CG2 . ILE A 1 276  ? -16.778 114.905 22.110  1.00 27.35 ? 276  ILE A CG2 1 
ATOM   2155  C  CD1 . ILE A 1 276  ? -17.930 114.367 19.669  1.00 32.12 ? 276  ILE A CD1 1 
ATOM   2156  N  N   . PHE A 1 277  ? -14.379 113.093 23.484  1.00 24.47 ? 277  PHE A N   1 
ATOM   2157  C  CA  . PHE A 1 277  ? -13.595 113.475 24.649  1.00 24.51 ? 277  PHE A CA  1 
ATOM   2158  C  C   . PHE A 1 277  ? -12.071 113.359 24.530  1.00 24.49 ? 277  PHE A C   1 
ATOM   2159  O  O   . PHE A 1 277  ? -11.354 114.270 24.936  1.00 25.41 ? 277  PHE A O   1 
ATOM   2160  C  CB  . PHE A 1 277  ? -14.105 112.721 25.882  1.00 23.42 ? 277  PHE A CB  1 
ATOM   2161  C  CG  . PHE A 1 277  ? -15.473 113.189 26.351  1.00 24.63 ? 277  PHE A CG  1 
ATOM   2162  C  CD1 . PHE A 1 277  ? -15.670 114.514 26.757  1.00 23.10 ? 277  PHE A CD1 1 
ATOM   2163  C  CD2 . PHE A 1 277  ? -16.559 112.309 26.391  1.00 22.85 ? 277  PHE A CD2 1 
ATOM   2164  C  CE1 . PHE A 1 277  ? -16.923 114.959 27.195  1.00 23.46 ? 277  PHE A CE1 1 
ATOM   2165  C  CE2 . PHE A 1 277  ? -17.826 112.746 26.830  1.00 23.97 ? 277  PHE A CE2 1 
ATOM   2166  C  CZ  . PHE A 1 277  ? -18.006 114.079 27.235  1.00 23.09 ? 277  PHE A CZ  1 
ATOM   2167  N  N   . PRO A 1 278  ? -11.555 112.251 23.972  1.00 23.88 ? 278  PRO A N   1 
ATOM   2168  C  CA  . PRO A 1 278  ? -10.095 112.135 23.854  1.00 24.16 ? 278  PRO A CA  1 
ATOM   2169  C  C   . PRO A 1 278  ? -9.494  113.134 22.866  1.00 24.41 ? 278  PRO A C   1 
ATOM   2170  O  O   . PRO A 1 278  ? -8.474  113.784 23.142  1.00 23.66 ? 278  PRO A O   1 
ATOM   2171  C  CB  . PRO A 1 278  ? -9.900  110.695 23.387  1.00 22.96 ? 278  PRO A CB  1 
ATOM   2172  C  CG  . PRO A 1 278  ? -11.125 109.988 23.866  1.00 22.91 ? 278  PRO A CG  1 
ATOM   2173  C  CD  . PRO A 1 278  ? -12.206 110.980 23.618  1.00 23.19 ? 278  PRO A CD  1 
ATOM   2174  N  N   . GLN A 1 279  ? -10.137 113.247 21.715  1.00 24.07 ? 279  GLN A N   1 
ATOM   2175  C  CA  . GLN A 1 279  ? -9.675  114.130 20.669  1.00 25.48 ? 279  GLN A CA  1 
ATOM   2176  C  C   . GLN A 1 279  ? -9.663  115.585 21.117  1.00 24.75 ? 279  GLN A C   1 
ATOM   2177  O  O   . GLN A 1 279  ? -8.727  116.329 20.812  1.00 24.42 ? 279  GLN A O   1 
ATOM   2178  C  CB  . GLN A 1 279  ? -10.554 113.954 19.425  1.00 27.43 ? 279  GLN A CB  1 
ATOM   2179  C  CG  . GLN A 1 279  ? -10.273 114.936 18.309  1.00 31.77 ? 279  GLN A CG  1 
ATOM   2180  C  CD  . GLN A 1 279  ? -11.112 114.656 17.066  1.00 35.36 ? 279  GLN A CD  1 
ATOM   2181  O  OE1 . GLN A 1 279  ? -12.339 114.560 17.140  1.00 37.54 ? 279  GLN A OE1 1 
ATOM   2182  N  NE2 . GLN A 1 279  ? -10.448 114.524 15.917  1.00 35.77 ? 279  GLN A NE2 1 
ATOM   2183  N  N   . ASN A 1 280  ? -10.673 115.983 21.879  1.00 23.31 ? 280  ASN A N   1 
ATOM   2184  C  CA  . ASN A 1 280  ? -10.755 117.364 22.311  1.00 22.42 ? 280  ASN A CA  1 
ATOM   2185  C  C   . ASN A 1 280  ? -10.066 117.713 23.634  1.00 23.80 ? 280  ASN A C   1 
ATOM   2186  O  O   . ASN A 1 280  ? -10.084 118.874 24.070  1.00 23.37 ? 280  ASN A O   1 
ATOM   2187  C  CB  . ASN A 1 280  ? -12.216 117.787 22.308  1.00 21.82 ? 280  ASN A CB  1 
ATOM   2188  C  CG  . ASN A 1 280  ? -12.814 117.738 20.912  1.00 21.77 ? 280  ASN A CG  1 
ATOM   2189  O  OD1 . ASN A 1 280  ? -12.343 118.423 20.001  1.00 23.07 ? 280  ASN A OD1 1 
ATOM   2190  N  ND2 . ASN A 1 280  ? -13.837 116.918 20.731  1.00 20.06 ? 280  ASN A ND2 1 
ATOM   2191  N  N   . THR A 1 281  ? -9.462  116.707 24.270  1.00 23.69 ? 281  THR A N   1 
ATOM   2192  C  CA  . THR A 1 281  ? -8.717  116.915 25.510  1.00 24.32 ? 281  THR A CA  1 
ATOM   2193  C  C   . THR A 1 281  ? -7.315  116.321 25.333  1.00 23.10 ? 281  THR A C   1 
ATOM   2194  O  O   . THR A 1 281  ? -6.390  117.024 24.946  1.00 21.01 ? 281  THR A O   1 
ATOM   2195  C  CB  . THR A 1 281  ? -9.415  116.256 26.743  1.00 26.72 ? 281  THR A CB  1 
ATOM   2196  O  OG1 . THR A 1 281  ? -9.432  114.829 26.596  1.00 26.01 ? 281  THR A OG1 1 
ATOM   2197  C  CG2 . THR A 1 281  ? -10.840 116.779 26.894  1.00 26.38 ? 281  THR A CG2 1 
ATOM   2198  N  N   . LEU A 1 282  ? -7.175  115.020 25.597  1.00 22.42 ? 282  LEU A N   1 
ATOM   2199  C  CA  . LEU A 1 282  ? -5.895  114.317 25.457  1.00 21.50 ? 282  LEU A CA  1 
ATOM   2200  C  C   . LEU A 1 282  ? -5.095  114.712 24.211  1.00 22.53 ? 282  LEU A C   1 
ATOM   2201  O  O   . LEU A 1 282  ? -3.939  115.102 24.328  1.00 22.82 ? 282  LEU A O   1 
ATOM   2202  C  CB  . LEU A 1 282  ? -6.114  112.798 25.449  1.00 18.39 ? 282  LEU A CB  1 
ATOM   2203  C  CG  . LEU A 1 282  ? -4.905  111.906 25.150  1.00 16.88 ? 282  LEU A CG  1 
ATOM   2204  C  CD1 . LEU A 1 282  ? -3.853  112.038 26.267  1.00 17.13 ? 282  LEU A CD1 1 
ATOM   2205  C  CD2 . LEU A 1 282  ? -5.356  110.465 25.033  1.00 17.12 ? 282  LEU A CD2 1 
ATOM   2206  N  N   . HIS A 1 283  ? -5.719  114.630 23.036  1.00 23.30 ? 283  HIS A N   1 
ATOM   2207  C  CA  . HIS A 1 283  ? -5.065  114.948 21.764  1.00 24.63 ? 283  HIS A CA  1 
ATOM   2208  C  C   . HIS A 1 283  ? -4.967  116.433 21.357  1.00 23.95 ? 283  HIS A C   1 
ATOM   2209  O  O   . HIS A 1 283  ? -4.626  116.730 20.216  1.00 24.21 ? 283  HIS A O   1 
ATOM   2210  C  CB  . HIS A 1 283  ? -5.736  114.177 20.600  1.00 25.37 ? 283  HIS A CB  1 
ATOM   2211  C  CG  . HIS A 1 283  ? -5.846  112.691 20.818  1.00 27.27 ? 283  HIS A CG  1 
ATOM   2212  N  ND1 . HIS A 1 283  ? -4.819  111.927 21.320  1.00 29.92 ? 283  HIS A ND1 1 
ATOM   2213  C  CD2 . HIS A 1 283  ? -6.865  111.835 20.563  1.00 28.62 ? 283  HIS A CD2 1 
ATOM   2214  C  CE1 . HIS A 1 283  ? -5.198  110.658 21.370  1.00 30.37 ? 283  HIS A CE1 1 
ATOM   2215  N  NE2 . HIS A 1 283  ? -6.432  110.576 20.917  1.00 29.12 ? 283  HIS A NE2 1 
ATOM   2216  N  N   . SER A 1 284  ? -5.240  117.359 22.266  1.00 24.55 ? 284  SER A N   1 
ATOM   2217  C  CA  . SER A 1 284  ? -5.183  118.786 21.925  1.00 24.71 ? 284  SER A CA  1 
ATOM   2218  C  C   . SER A 1 284  ? -4.577  119.603 23.054  1.00 26.55 ? 284  SER A C   1 
ATOM   2219  O  O   . SER A 1 284  ? -4.696  120.836 23.085  1.00 27.55 ? 284  SER A O   1 
ATOM   2220  C  CB  . SER A 1 284  ? -6.588  119.331 21.644  1.00 22.66 ? 284  SER A CB  1 
ATOM   2221  O  OG  . SER A 1 284  ? -7.238  118.578 20.653  1.00 22.36 ? 284  SER A OG  1 
ATOM   2222  N  N   . MET A 1 285  ? -3.928  118.918 23.988  1.00 27.32 ? 285  MET A N   1 
ATOM   2223  C  CA  . MET A 1 285  ? -3.335  119.592 25.127  1.00 26.91 ? 285  MET A CA  1 
ATOM   2224  C  C   . MET A 1 285  ? -2.047  120.339 24.826  1.00 28.43 ? 285  MET A C   1 
ATOM   2225  O  O   . MET A 1 285  ? -1.296  119.996 23.910  1.00 27.63 ? 285  MET A O   1 
ATOM   2226  C  CB  . MET A 1 285  ? -3.065  118.580 26.236  1.00 23.98 ? 285  MET A CB  1 
ATOM   2227  C  CG  . MET A 1 285  ? -4.287  117.782 26.670  1.00 24.12 ? 285  MET A CG  1 
ATOM   2228  S  SD  . MET A 1 285  ? -5.455  118.725 27.660  1.00 22.98 ? 285  MET A SD  1 
ATOM   2229  C  CE  . MET A 1 285  ? -4.356  119.376 28.955  1.00 20.69 ? 285  MET A CE  1 
ATOM   2230  N  N   . TYR A 1 286  ? -1.816  121.370 25.624  1.00 28.96 ? 286  TYR A N   1 
ATOM   2231  C  CA  . TYR A 1 286  ? -0.615  122.177 25.555  1.00 29.74 ? 286  TYR A CA  1 
ATOM   2232  C  C   . TYR A 1 286  ? -0.284  122.828 24.225  1.00 32.57 ? 286  TYR A C   1 
ATOM   2233  O  O   . TYR A 1 286  ? 0.837   122.706 23.715  1.00 32.55 ? 286  TYR A O   1 
ATOM   2234  C  CB  . TYR A 1 286  ? 0.560   121.334 26.047  1.00 27.08 ? 286  TYR A CB  1 
ATOM   2235  C  CG  . TYR A 1 286  ? 0.177   120.473 27.238  1.00 25.50 ? 286  TYR A CG  1 
ATOM   2236  C  CD1 . TYR A 1 286  ? -0.532  121.020 28.315  1.00 22.31 ? 286  TYR A CD1 1 
ATOM   2237  C  CD2 . TYR A 1 286  ? 0.517   119.113 27.291  1.00 25.40 ? 286  TYR A CD2 1 
ATOM   2238  C  CE1 . TYR A 1 286  ? -0.894  120.249 29.406  1.00 22.01 ? 286  TYR A CE1 1 
ATOM   2239  C  CE2 . TYR A 1 286  ? 0.153   118.325 28.388  1.00 23.84 ? 286  TYR A CE2 1 
ATOM   2240  C  CZ  . TYR A 1 286  ? -0.547  118.907 29.441  1.00 23.16 ? 286  TYR A CZ  1 
ATOM   2241  O  OH  . TYR A 1 286  ? -0.895  118.160 30.541  1.00 22.57 ? 286  TYR A OH  1 
ATOM   2242  N  N   . GLU A 1 287  ? -1.257  123.527 23.654  1.00 35.67 ? 287  GLU A N   1 
ATOM   2243  C  CA  . GLU A 1 287  ? -0.999  124.231 22.407  1.00 38.37 ? 287  GLU A CA  1 
ATOM   2244  C  C   . GLU A 1 287  ? -0.011  125.320 22.851  1.00 38.63 ? 287  GLU A C   1 
ATOM   2245  O  O   . GLU A 1 287  ? 0.847   125.781 22.086  1.00 39.09 ? 287  GLU A O   1 
ATOM   2246  C  CB  . GLU A 1 287  ? -2.297  124.826 21.856  1.00 41.21 ? 287  GLU A CB  1 
ATOM   2247  C  CG  . GLU A 1 287  ? -2.566  124.460 20.399  1.00 46.34 ? 287  GLU A CG  1 
ATOM   2248  C  CD  . GLU A 1 287  ? -4.055  124.408 20.070  1.00 49.66 ? 287  GLU A CD  1 
ATOM   2249  O  OE1 . GLU A 1 287  ? -4.405  123.908 18.974  1.00 50.19 ? 287  GLU A OE1 1 
ATOM   2250  O  OE2 . GLU A 1 287  ? -4.872  124.868 20.905  1.00 51.75 ? 287  GLU A OE2 1 
ATOM   2251  N  N   . SER A 1 288  ? -0.137  125.706 24.115  1.00 38.05 ? 288  SER A N   1 
ATOM   2252  C  CA  . SER A 1 288  ? 0.758   126.681 24.718  1.00 38.56 ? 288  SER A CA  1 
ATOM   2253  C  C   . SER A 1 288  ? 1.312   126.075 25.997  1.00 37.40 ? 288  SER A C   1 
ATOM   2254  O  O   . SER A 1 288  ? 0.602   125.951 26.979  1.00 40.10 ? 288  SER A O   1 
ATOM   2255  C  CB  . SER A 1 288  ? 0.030   127.988 25.041  1.00 38.09 ? 288  SER A CB  1 
ATOM   2256  O  OG  . SER A 1 288  ? 0.052   128.858 23.918  1.00 40.41 ? 288  SER A OG  1 
ATOM   2257  N  N   . LEU A 1 289  ? 2.569   125.661 25.968  1.00 35.84 ? 289  LEU A N   1 
ATOM   2258  C  CA  . LEU A 1 289  ? 3.188   125.091 27.143  1.00 35.23 ? 289  LEU A CA  1 
ATOM   2259  C  C   . LEU A 1 289  ? 3.991   126.206 27.790  1.00 36.14 ? 289  LEU A C   1 
ATOM   2260  O  O   . LEU A 1 289  ? 4.839   126.839 27.165  1.00 36.07 ? 289  LEU A O   1 
ATOM   2261  C  CB  . LEU A 1 289  ? 4.089   123.922 26.769  1.00 33.26 ? 289  LEU A CB  1 
ATOM   2262  C  CG  . LEU A 1 289  ? 4.617   123.167 27.982  1.00 31.50 ? 289  LEU A CG  1 
ATOM   2263  C  CD1 . LEU A 1 289  ? 3.448   122.725 28.858  1.00 30.35 ? 289  LEU A CD1 1 
ATOM   2264  C  CD2 . LEU A 1 289  ? 5.438   121.974 27.513  1.00 31.34 ? 289  LEU A CD2 1 
ATOM   2265  N  N   . GLU A 1 290  ? 3.719   126.433 29.063  1.00 37.34 ? 290  GLU A N   1 
ATOM   2266  C  CA  . GLU A 1 290  ? 4.350   127.509 29.802  1.00 37.31 ? 290  GLU A CA  1 
ATOM   2267  C  C   . GLU A 1 290  ? 5.149   126.997 31.000  1.00 37.49 ? 290  GLU A C   1 
ATOM   2268  O  O   . GLU A 1 290  ? 5.968   127.730 31.557  1.00 37.48 ? 290  GLU A O   1 
ATOM   2269  C  CB  . GLU A 1 290  ? 3.228   128.442 30.244  1.00 38.24 ? 290  GLU A CB  1 
ATOM   2270  C  CG  . GLU A 1 290  ? 3.594   129.696 30.964  1.00 40.73 ? 290  GLU A CG  1 
ATOM   2271  C  CD  . GLU A 1 290  ? 2.344   130.487 31.312  1.00 41.93 ? 290  GLU A CD  1 
ATOM   2272  O  OE1 . GLU A 1 290  ? 1.612   130.878 30.371  1.00 40.74 ? 290  GLU A OE1 1 
ATOM   2273  O  OE2 . GLU A 1 290  ? 2.091   130.710 32.519  1.00 43.74 ? 290  GLU A OE2 1 
ATOM   2274  N  N   . GLY A 1 291  ? 4.911   125.746 31.397  1.00 37.39 ? 291  GLY A N   1 
ATOM   2275  C  CA  . GLY A 1 291  ? 5.628   125.189 32.531  1.00 36.00 ? 291  GLY A CA  1 
ATOM   2276  C  C   . GLY A 1 291  ? 5.210   123.794 32.969  1.00 36.14 ? 291  GLY A C   1 
ATOM   2277  O  O   . GLY A 1 291  ? 4.408   123.129 32.293  1.00 35.88 ? 291  GLY A O   1 
ATOM   2278  N  N   . GLY A 1 292  ? 5.752   123.364 34.112  1.00 33.80 ? 292  GLY A N   1 
ATOM   2279  C  CA  . GLY A 1 292  ? 5.465   122.040 34.641  1.00 33.16 ? 292  GLY A CA  1 
ATOM   2280  C  C   . GLY A 1 292  ? 6.661   121.105 34.460  1.00 31.80 ? 292  GLY A C   1 
ATOM   2281  O  O   . GLY A 1 292  ? 7.676   121.497 33.896  1.00 32.50 ? 292  GLY A O   1 
ATOM   2282  N  N   . TYR A 1 293  ? 6.546   119.866 34.918  1.00 29.50 ? 293  TYR A N   1 
ATOM   2283  C  CA  . TYR A 1 293  ? 7.636   118.902 34.810  1.00 27.99 ? 293  TYR A CA  1 
ATOM   2284  C  C   . TYR A 1 293  ? 7.191   117.567 34.209  1.00 27.76 ? 293  TYR A C   1 
ATOM   2285  O  O   . TYR A 1 293  ? 6.008   117.225 34.235  1.00 26.95 ? 293  TYR A O   1 
ATOM   2286  C  CB  . TYR A 1 293  ? 8.226   118.651 36.198  1.00 27.35 ? 293  TYR A CB  1 
ATOM   2287  C  CG  . TYR A 1 293  ? 8.673   119.915 36.875  1.00 28.87 ? 293  TYR A CG  1 
ATOM   2288  C  CD1 . TYR A 1 293  ? 9.946   120.441 36.632  1.00 30.14 ? 293  TYR A CD1 1 
ATOM   2289  C  CD2 . TYR A 1 293  ? 7.797   120.639 37.689  1.00 27.55 ? 293  TYR A CD2 1 
ATOM   2290  C  CE1 . TYR A 1 293  ? 10.337  121.658 37.180  1.00 31.36 ? 293  TYR A CE1 1 
ATOM   2291  C  CE2 . TYR A 1 293  ? 8.173   121.854 38.239  1.00 28.94 ? 293  TYR A CE2 1 
ATOM   2292  C  CZ  . TYR A 1 293  ? 9.445   122.361 37.979  1.00 30.88 ? 293  TYR A CZ  1 
ATOM   2293  O  OH  . TYR A 1 293  ? 9.829   123.565 38.514  1.00 33.74 ? 293  TYR A OH  1 
ATOM   2294  N  N   . CYS A 1 294  ? 8.143   116.819 33.660  1.00 27.60 ? 294  CYS A N   1 
ATOM   2295  C  CA  . CYS A 1 294  ? 7.847   115.515 33.089  1.00 27.38 ? 294  CYS A CA  1 
ATOM   2296  C  C   . CYS A 1 294  ? 9.007   114.592 33.445  1.00 27.39 ? 294  CYS A C   1 
ATOM   2297  O  O   . CYS A 1 294  ? 10.110  115.050 33.736  1.00 27.00 ? 294  CYS A O   1 
ATOM   2298  C  CB  . CYS A 1 294  ? 7.666   115.610 31.577  1.00 27.41 ? 294  CYS A CB  1 
ATOM   2299  S  SG  . CYS A 1 294  ? 9.178   115.722 30.587  1.00 33.60 ? 294  CYS A SG  1 
ATOM   2300  N  N   . PRO A 1 295  ? 8.769   113.272 33.434  1.00 27.48 ? 295  PRO A N   1 
ATOM   2301  C  CA  . PRO A 1 295  ? 9.807   112.297 33.767  1.00 27.07 ? 295  PRO A CA  1 
ATOM   2302  C  C   . PRO A 1 295  ? 11.018  112.372 32.853  1.00 27.28 ? 295  PRO A C   1 
ATOM   2303  O  O   . PRO A 1 295  ? 10.927  112.810 31.708  1.00 27.01 ? 295  PRO A O   1 
ATOM   2304  C  CB  . PRO A 1 295  ? 9.098   110.958 33.598  1.00 26.90 ? 295  PRO A CB  1 
ATOM   2305  C  CG  . PRO A 1 295  ? 7.649   111.299 33.642  1.00 28.06 ? 295  PRO A CG  1 
ATOM   2306  C  CD  . PRO A 1 295  ? 7.576   112.591 32.919  1.00 27.03 ? 295  PRO A CD  1 
ATOM   2307  N  N   . ASN A 1 296  ? 12.156  111.943 33.376  1.00 26.85 ? 296  ASN A N   1 
ATOM   2308  C  CA  . ASN A 1 296  ? 13.383  111.880 32.610  1.00 26.10 ? 296  ASN A CA  1 
ATOM   2309  C  C   . ASN A 1 296  ? 13.902  110.481 32.856  1.00 25.25 ? 296  ASN A C   1 
ATOM   2310  O  O   . ASN A 1 296  ? 14.543  110.215 33.878  1.00 26.57 ? 296  ASN A O   1 
ATOM   2311  C  CB  . ASN A 1 296  ? 14.404  112.909 33.086  1.00 27.80 ? 296  ASN A CB  1 
ATOM   2312  C  CG  . ASN A 1 296  ? 15.795  112.645 32.521  1.00 29.79 ? 296  ASN A CG  1 
ATOM   2313  O  OD1 . ASN A 1 296  ? 15.938  112.120 31.417  1.00 29.86 ? 296  ASN A OD1 1 
ATOM   2314  N  ND2 . ASN A 1 296  ? 16.821  113.014 33.275  1.00 31.20 ? 296  ASN A ND2 1 
ATOM   2315  N  N   . LEU A 1 297  ? 13.597  109.588 31.924  1.00 23.72 ? 297  LEU A N   1 
ATOM   2316  C  CA  . LEU A 1 297  ? 14.013  108.201 32.024  1.00 23.56 ? 297  LEU A CA  1 
ATOM   2317  C  C   . LEU A 1 297  ? 15.107  107.818 31.037  1.00 23.50 ? 297  LEU A C   1 
ATOM   2318  O  O   . LEU A 1 297  ? 15.291  108.449 30.005  1.00 21.87 ? 297  LEU A O   1 
ATOM   2319  C  CB  . LEU A 1 297  ? 12.802  107.277 31.815  1.00 21.81 ? 297  LEU A CB  1 
ATOM   2320  C  CG  . LEU A 1 297  ? 11.899  106.906 33.007  1.00 22.49 ? 297  LEU A CG  1 
ATOM   2321  C  CD1 . LEU A 1 297  ? 11.567  108.125 33.850  1.00 20.22 ? 297  LEU A CD1 1 
ATOM   2322  C  CD2 . LEU A 1 297  ? 10.625  106.242 32.476  1.00 21.87 ? 297  LEU A CD2 1 
ATOM   2323  N  N   . GLU A 1 298  ? 15.847  106.778 31.393  1.00 23.59 ? 298  GLU A N   1 
ATOM   2324  C  CA  . GLU A 1 298  ? 16.882  106.236 30.536  1.00 23.55 ? 298  GLU A CA  1 
ATOM   2325  C  C   . GLU A 1 298  ? 16.439  104.812 30.220  1.00 22.87 ? 298  GLU A C   1 
ATOM   2326  O  O   . GLU A 1 298  ? 16.080  104.054 31.122  1.00 22.68 ? 298  GLU A O   1 
ATOM   2327  C  CB  . GLU A 1 298  ? 18.244  106.226 31.242  1.00 25.56 ? 298  GLU A CB  1 
ATOM   2328  C  CG  . GLU A 1 298  ? 19.201  105.186 30.670  1.00 29.98 ? 298  GLU A CG  1 
ATOM   2329  C  CD  . GLU A 1 298  ? 20.662  105.617 30.683  1.00 33.58 ? 298  GLU A CD  1 
ATOM   2330  O  OE1 . GLU A 1 298  ? 20.974  106.673 30.089  1.00 32.28 ? 298  GLU A OE1 1 
ATOM   2331  O  OE2 . GLU A 1 298  ? 21.498  104.890 31.279  1.00 36.74 ? 298  GLU A OE2 1 
ATOM   2332  N  N   . TRP A 1 299  ? 16.440  104.457 28.940  1.00 23.28 ? 299  TRP A N   1 
ATOM   2333  C  CA  . TRP A 1 299  ? 16.046  103.119 28.526  1.00 23.40 ? 299  TRP A CA  1 
ATOM   2334  C  C   . TRP A 1 299  ? 17.321  102.282 28.577  1.00 23.59 ? 299  TRP A C   1 
ATOM   2335  O  O   . TRP A 1 299  ? 18.224  102.484 27.780  1.00 25.15 ? 299  TRP A O   1 
ATOM   2336  C  CB  . TRP A 1 299  ? 15.484  103.167 27.104  1.00 23.38 ? 299  TRP A CB  1 
ATOM   2337  C  CG  . TRP A 1 299  ? 14.773  101.914 26.672  1.00 25.39 ? 299  TRP A CG  1 
ATOM   2338  C  CD1 . TRP A 1 299  ? 14.729  100.718 27.336  1.00 26.30 ? 299  TRP A CD1 1 
ATOM   2339  C  CD2 . TRP A 1 299  ? 14.001  101.735 25.478  1.00 25.54 ? 299  TRP A CD2 1 
ATOM   2340  N  NE1 . TRP A 1 299  ? 13.975  99.812  26.629  1.00 25.61 ? 299  TRP A NE1 1 
ATOM   2341  C  CE2 . TRP A 1 299  ? 13.520  100.413 25.483  1.00 26.41 ? 299  TRP A CE2 1 
ATOM   2342  C  CE3 . TRP A 1 299  ? 13.676  102.566 24.395  1.00 26.44 ? 299  TRP A CE3 1 
ATOM   2343  C  CZ2 . TRP A 1 299  ? 12.725  99.903  24.454  1.00 27.47 ? 299  TRP A CZ2 1 
ATOM   2344  C  CZ3 . TRP A 1 299  ? 12.890  102.061 23.377  1.00 24.89 ? 299  TRP A CZ3 1 
ATOM   2345  C  CH2 . TRP A 1 299  ? 12.424  100.742 23.413  1.00 26.87 ? 299  TRP A CH2 1 
ATOM   2346  N  N   . LEU A 1 300  ? 17.402  101.366 29.533  1.00 23.63 ? 300  LEU A N   1 
ATOM   2347  C  CA  . LEU A 1 300  ? 18.573  100.505 29.690  1.00 23.12 ? 300  LEU A CA  1 
ATOM   2348  C  C   . LEU A 1 300  ? 18.800  99.552  28.510  1.00 23.90 ? 300  LEU A C   1 
ATOM   2349  O  O   . LEU A 1 300  ? 17.893  99.295  27.721  1.00 22.36 ? 300  LEU A O   1 
ATOM   2350  C  CB  . LEU A 1 300  ? 18.445  99.678  30.980  1.00 22.26 ? 300  LEU A CB  1 
ATOM   2351  C  CG  . LEU A 1 300  ? 19.018  100.211 32.301  1.00 24.16 ? 300  LEU A CG  1 
ATOM   2352  C  CD1 . LEU A 1 300  ? 18.601  101.648 32.515  1.00 25.50 ? 300  LEU A CD1 1 
ATOM   2353  C  CD2 . LEU A 1 300  ? 18.552  99.360  33.451  1.00 21.69 ? 300  LEU A CD2 1 
ATOM   2354  N  N   . GLU A 1 301  ? 20.020  99.029  28.414  1.00 24.56 ? 301  GLU A N   1 
ATOM   2355  C  CA  . GLU A 1 301  ? 20.380  98.083  27.369  1.00 27.39 ? 301  GLU A CA  1 
ATOM   2356  C  C   . GLU A 1 301  ? 20.393  96.697  28.015  1.00 27.06 ? 301  GLU A C   1 
ATOM   2357  O  O   . GLU A 1 301  ? 20.825  96.543  29.153  1.00 27.24 ? 301  GLU A O   1 
ATOM   2358  C  CB  . GLU A 1 301  ? 21.781  98.378  26.826  1.00 30.60 ? 301  GLU A CB  1 
ATOM   2359  C  CG  . GLU A 1 301  ? 21.964  99.727  26.131  1.00 34.87 ? 301  GLU A CG  1 
ATOM   2360  C  CD  . GLU A 1 301  ? 21.163  99.848  24.847  1.00 37.29 ? 301  GLU A CD  1 
ATOM   2361  O  OE1 . GLU A 1 301  ? 20.854  98.801  24.239  1.00 39.72 ? 301  GLU A OE1 1 
ATOM   2362  O  OE2 . GLU A 1 301  ? 20.851  100.988 24.437  1.00 38.99 ? 301  GLU A OE2 1 
ATOM   2363  N  N   . PRO A 1 302  ? 19.905  95.667  27.309  1.00 26.10 ? 302  PRO A N   1 
ATOM   2364  C  CA  . PRO A 1 302  ? 19.329  95.660  25.962  1.00 25.24 ? 302  PRO A CA  1 
ATOM   2365  C  C   . PRO A 1 302  ? 17.925  96.272  26.005  1.00 25.49 ? 302  PRO A C   1 
ATOM   2366  O  O   . PRO A 1 302  ? 17.140  95.954  26.907  1.00 23.51 ? 302  PRO A O   1 
ATOM   2367  C  CB  . PRO A 1 302  ? 19.268  94.167  25.618  1.00 24.28 ? 302  PRO A CB  1 
ATOM   2368  C  CG  . PRO A 1 302  ? 20.146  93.498  26.643  1.00 25.99 ? 302  PRO A CG  1 
ATOM   2369  C  CD  . PRO A 1 302  ? 19.915  94.309  27.869  1.00 25.39 ? 302  PRO A CD  1 
ATOM   2370  N  N   . ARG A 1 303  ? 17.602  97.125  25.038  1.00 26.90 ? 303  ARG A N   1 
ATOM   2371  C  CA  . ARG A 1 303  ? 16.286  97.735  25.008  1.00 28.04 ? 303  ARG A CA  1 
ATOM   2372  C  C   . ARG A 1 303  ? 15.163  96.693  25.095  1.00 28.03 ? 303  ARG A C   1 
ATOM   2373  O  O   . ARG A 1 303  ? 14.079  96.993  25.585  1.00 27.71 ? 303  ARG A O   1 
ATOM   2374  C  CB  . ARG A 1 303  ? 16.124  98.599  23.756  1.00 29.22 ? 303  ARG A CB  1 
ATOM   2375  C  CG  . ARG A 1 303  ? 16.476  100.086 23.953  1.00 30.01 ? 303  ARG A CG  1 
ATOM   2376  C  CD  . ARG A 1 303  ? 16.400  100.829 22.619  1.00 32.40 ? 303  ARG A CD  1 
ATOM   2377  N  NE  . ARG A 1 303  ? 16.328  102.288 22.716  1.00 34.65 ? 303  ARG A NE  1 
ATOM   2378  C  CZ  . ARG A 1 303  ? 17.173  103.040 23.412  1.00 36.45 ? 303  ARG A CZ  1 
ATOM   2379  N  NH1 . ARG A 1 303  ? 18.165  102.474 24.100  1.00 38.41 ? 303  ARG A NH1 1 
ATOM   2380  N  NH2 . ARG A 1 303  ? 17.053  104.366 23.391  1.00 35.41 ? 303  ARG A NH2 1 
ATOM   2381  N  N   . SER A 1 304  ? 15.443  95.466  24.671  1.00 28.60 ? 304  SER A N   1 
ATOM   2382  C  CA  . SER A 1 304  ? 14.450  94.393  24.699  1.00 28.95 ? 304  SER A CA  1 
ATOM   2383  C  C   . SER A 1 304  ? 14.053  93.922  26.098  1.00 29.23 ? 304  SER A C   1 
ATOM   2384  O  O   . SER A 1 304  ? 13.107  93.147  26.255  1.00 30.12 ? 304  SER A O   1 
ATOM   2385  C  CB  . SER A 1 304  ? 14.943  93.191  23.893  1.00 28.47 ? 304  SER A CB  1 
ATOM   2386  O  OG  . SER A 1 304  ? 16.107  92.640  24.481  1.00 31.62 ? 304  SER A OG  1 
ATOM   2387  N  N   . ASP A 1 305  ? 14.782  94.370  27.112  1.00 29.07 ? 305  ASP A N   1 
ATOM   2388  C  CA  . ASP A 1 305  ? 14.451  93.998  28.480  1.00 28.95 ? 305  ASP A CA  1 
ATOM   2389  C  C   . ASP A 1 305  ? 13.360  94.920  29.012  1.00 27.82 ? 305  ASP A C   1 
ATOM   2390  O  O   . ASP A 1 305  ? 12.765  94.645  30.044  1.00 27.91 ? 305  ASP A O   1 
ATOM   2391  C  CB  . ASP A 1 305  ? 15.679  94.103  29.387  1.00 31.04 ? 305  ASP A CB  1 
ATOM   2392  C  CG  . ASP A 1 305  ? 16.522  92.855  29.368  1.00 33.78 ? 305  ASP A CG  1 
ATOM   2393  O  OD1 . ASP A 1 305  ? 16.073  91.852  28.767  1.00 35.99 ? 305  ASP A OD1 1 
ATOM   2394  O  OD2 . ASP A 1 305  ? 17.631  92.874  29.954  1.00 35.57 ? 305  ASP A OD2 1 
ATOM   2395  N  N   . TYR A 1 306  ? 13.120  96.019  28.297  1.00 26.14 ? 306  TYR A N   1 
ATOM   2396  C  CA  . TYR A 1 306  ? 12.107  96.996  28.674  1.00 23.21 ? 306  TYR A CA  1 
ATOM   2397  C  C   . TYR A 1 306  ? 12.304  97.471  30.096  1.00 22.58 ? 306  TYR A C   1 
ATOM   2398  O  O   . TYR A 1 306  ? 11.347  97.648  30.836  1.00 21.87 ? 306  TYR A O   1 
ATOM   2399  C  CB  . TYR A 1 306  ? 10.720  96.391  28.510  1.00 21.43 ? 306  TYR A CB  1 
ATOM   2400  C  CG  . TYR A 1 306  ? 10.416  96.074  27.079  1.00 22.56 ? 306  TYR A CG  1 
ATOM   2401  C  CD1 . TYR A 1 306  ? 10.291  97.102  26.128  1.00 22.88 ? 306  TYR A CD1 1 
ATOM   2402  C  CD2 . TYR A 1 306  ? 10.307  94.752  26.646  1.00 24.61 ? 306  TYR A CD2 1 
ATOM   2403  C  CE1 . TYR A 1 306  ? 10.065  96.818  24.787  1.00 21.03 ? 306  TYR A CE1 1 
ATOM   2404  C  CE2 . TYR A 1 306  ? 10.086  94.457  25.296  1.00 23.36 ? 306  TYR A CE2 1 
ATOM   2405  C  CZ  . TYR A 1 306  ? 9.968   95.492  24.381  1.00 23.17 ? 306  TYR A CZ  1 
ATOM   2406  O  OH  . TYR A 1 306  ? 9.758   95.185  23.065  1.00 24.82 ? 306  TYR A OH  1 
ATOM   2407  N  N   . LYS A 1 307  ? 13.561  97.665  30.469  1.00 22.81 ? 307  LYS A N   1 
ATOM   2408  C  CA  . LYS A 1 307  ? 13.923  98.119  31.805  1.00 24.04 ? 307  LYS A CA  1 
ATOM   2409  C  C   . LYS A 1 307  ? 14.337  99.580  31.710  1.00 23.98 ? 307  LYS A C   1 
ATOM   2410  O  O   . LYS A 1 307  ? 15.130  99.967  30.850  1.00 23.09 ? 307  LYS A O   1 
ATOM   2411  C  CB  . LYS A 1 307  ? 15.075  97.284  32.340  1.00 25.31 ? 307  LYS A CB  1 
ATOM   2412  C  CG  . LYS A 1 307  ? 15.365  97.524  33.789  1.00 31.90 ? 307  LYS A CG  1 
ATOM   2413  C  CD  . LYS A 1 307  ? 16.492  96.628  34.300  1.00 33.35 ? 307  LYS A CD  1 
ATOM   2414  C  CE  . LYS A 1 307  ? 16.811  96.952  35.755  1.00 35.88 ? 307  LYS A CE  1 
ATOM   2415  N  NZ  . LYS A 1 307  ? 17.869  96.066  36.309  1.00 37.77 ? 307  LYS A NZ  1 
ATOM   2416  N  N   . PHE A 1 308  ? 13.781  100.389 32.601  1.00 23.45 ? 308  PHE A N   1 
ATOM   2417  C  CA  . PHE A 1 308  ? 14.043  101.822 32.629  1.00 21.93 ? 308  PHE A CA  1 
ATOM   2418  C  C   . PHE A 1 308  ? 14.512  102.276 34.000  1.00 21.90 ? 308  PHE A C   1 
ATOM   2419  O  O   . PHE A 1 308  ? 14.228  101.631 35.014  1.00 23.53 ? 308  PHE A O   1 
ATOM   2420  C  CB  . PHE A 1 308  ? 12.760  102.569 32.277  1.00 21.28 ? 308  PHE A CB  1 
ATOM   2421  C  CG  . PHE A 1 308  ? 12.219  102.244 30.921  1.00 20.46 ? 308  PHE A CG  1 
ATOM   2422  C  CD1 . PHE A 1 308  ? 12.416  103.118 29.845  1.00 18.39 ? 308  PHE A CD1 1 
ATOM   2423  C  CD2 . PHE A 1 308  ? 11.513  101.062 30.708  1.00 20.24 ? 308  PHE A CD2 1 
ATOM   2424  C  CE1 . PHE A 1 308  ? 11.908  102.822 28.583  1.00 17.00 ? 308  PHE A CE1 1 
ATOM   2425  C  CE2 . PHE A 1 308  ? 11.004  100.760 29.446  1.00 18.38 ? 308  PHE A CE2 1 
ATOM   2426  C  CZ  . PHE A 1 308  ? 11.209  101.645 28.379  1.00 17.99 ? 308  PHE A CZ  1 
ATOM   2427  N  N   . MET A 1 309  ? 15.229  103.393 34.032  1.00 22.58 ? 309  MET A N   1 
ATOM   2428  C  CA  . MET A 1 309  ? 15.699  103.954 35.294  1.00 23.35 ? 309  MET A CA  1 
ATOM   2429  C  C   . MET A 1 309  ? 15.340  105.431 35.332  1.00 23.38 ? 309  MET A C   1 
ATOM   2430  O  O   . MET A 1 309  ? 15.552  106.162 34.365  1.00 22.24 ? 309  MET A O   1 
ATOM   2431  C  CB  . MET A 1 309  ? 17.207  103.761 35.473  1.00 23.03 ? 309  MET A CB  1 
ATOM   2432  C  CG  . MET A 1 309  ? 17.597  102.324 35.763  1.00 24.30 ? 309  MET A CG  1 
ATOM   2433  S  SD  . MET A 1 309  ? 19.216  102.146 36.584  1.00 31.48 ? 309  MET A SD  1 
ATOM   2434  C  CE  . MET A 1 309  ? 18.845  102.881 38.177  1.00 25.51 ? 309  MET A CE  1 
ATOM   2435  N  N   . TYR A 1 310  ? 14.765  105.844 36.455  1.00 24.87 ? 310  TYR A N   1 
ATOM   2436  C  CA  . TYR A 1 310  ? 14.337  107.212 36.666  1.00 25.29 ? 310  TYR A CA  1 
ATOM   2437  C  C   . TYR A 1 310  ? 15.528  108.083 36.990  1.00 27.49 ? 310  TYR A C   1 
ATOM   2438  O  O   . TYR A 1 310  ? 16.277  107.791 37.920  1.00 28.42 ? 310  TYR A O   1 
ATOM   2439  C  CB  . TYR A 1 310  ? 13.351  107.257 37.820  1.00 25.45 ? 310  TYR A CB  1 
ATOM   2440  C  CG  . TYR A 1 310  ? 13.042  108.653 38.318  1.00 27.28 ? 310  TYR A CG  1 
ATOM   2441  C  CD1 . TYR A 1 310  ? 12.172  109.499 37.617  1.00 25.83 ? 310  TYR A CD1 1 
ATOM   2442  C  CD2 . TYR A 1 310  ? 13.608  109.124 39.513  1.00 26.27 ? 310  TYR A CD2 1 
ATOM   2443  C  CE1 . TYR A 1 310  ? 11.869  110.777 38.099  1.00 27.44 ? 310  TYR A CE1 1 
ATOM   2444  C  CE2 . TYR A 1 310  ? 13.314  110.395 40.000  1.00 27.93 ? 310  TYR A CE2 1 
ATOM   2445  C  CZ  . TYR A 1 310  ? 12.442  111.216 39.290  1.00 28.69 ? 310  TYR A CZ  1 
ATOM   2446  O  OH  . TYR A 1 310  ? 12.141  112.471 39.765  1.00 29.56 ? 310  TYR A OH  1 
ATOM   2447  N  N   . MET A 1 311  ? 15.688  109.173 36.245  1.00 29.03 ? 311  MET A N   1 
ATOM   2448  C  CA  . MET A 1 311  ? 16.821  110.063 36.462  1.00 30.09 ? 311  MET A CA  1 
ATOM   2449  C  C   . MET A 1 311  ? 16.473  111.458 36.965  1.00 31.44 ? 311  MET A C   1 
ATOM   2450  O  O   . MET A 1 311  ? 17.373  112.250 37.248  1.00 33.63 ? 311  MET A O   1 
ATOM   2451  C  CB  . MET A 1 311  ? 17.647  110.171 35.180  1.00 29.42 ? 311  MET A CB  1 
ATOM   2452  C  CG  . MET A 1 311  ? 18.250  108.848 34.774  1.00 32.05 ? 311  MET A CG  1 
ATOM   2453  S  SD  . MET A 1 311  ? 19.562  108.998 33.539  1.00 35.78 ? 311  MET A SD  1 
ATOM   2454  C  CE  . MET A 1 311  ? 18.573  109.364 32.031  1.00 35.37 ? 311  MET A CE  1 
ATOM   2455  N  N   . GLY A 1 312  ? 15.181  111.761 37.087  1.00 30.98 ? 312  GLY A N   1 
ATOM   2456  C  CA  . GLY A 1 312  ? 14.788  113.077 37.564  1.00 29.85 ? 312  GLY A CA  1 
ATOM   2457  C  C   . GLY A 1 312  ? 13.652  113.691 36.773  1.00 30.62 ? 312  GLY A C   1 
ATOM   2458  O  O   . GLY A 1 312  ? 12.915  112.996 36.084  1.00 30.51 ? 312  GLY A O   1 
ATOM   2459  N  N   . VAL A 1 313  ? 13.508  115.006 36.863  1.00 31.12 ? 313  VAL A N   1 
ATOM   2460  C  CA  . VAL A 1 313  ? 12.441  115.697 36.144  1.00 31.39 ? 313  VAL A CA  1 
ATOM   2461  C  C   . VAL A 1 313  ? 12.982  116.605 35.045  1.00 32.15 ? 313  VAL A C   1 
ATOM   2462  O  O   . VAL A 1 313  ? 14.064  117.174 35.167  1.00 31.31 ? 313  VAL A O   1 
ATOM   2463  C  CB  . VAL A 1 313  ? 11.603  116.560 37.096  1.00 31.30 ? 313  VAL A CB  1 
ATOM   2464  C  CG1 . VAL A 1 313  ? 11.139  115.727 38.279  1.00 32.40 ? 313  VAL A CG1 1 
ATOM   2465  C  CG2 . VAL A 1 313  ? 12.433  117.741 37.576  1.00 31.72 ? 313  VAL A CG2 1 
ATOM   2466  N  N   . MET A 1 314  ? 12.203  116.732 33.975  1.00 33.07 ? 314  MET A N   1 
ATOM   2467  C  CA  . MET A 1 314  ? 12.537  117.565 32.817  1.00 34.33 ? 314  MET A CA  1 
ATOM   2468  C  C   . MET A 1 314  ? 11.629  118.802 32.834  1.00 33.77 ? 314  MET A C   1 
ATOM   2469  O  O   . MET A 1 314  ? 10.423  118.714 32.583  1.00 33.46 ? 314  MET A O   1 
ATOM   2470  C  CB  . MET A 1 314  ? 12.304  116.767 31.532  1.00 35.79 ? 314  MET A CB  1 
ATOM   2471  C  CG  . MET A 1 314  ? 12.382  117.571 30.244  1.00 39.82 ? 314  MET A CG  1 
ATOM   2472  S  SD  . MET A 1 314  ? 14.063  117.782 29.652  1.00 41.93 ? 314  MET A SD  1 
ATOM   2473  C  CE  . MET A 1 314  ? 14.434  119.400 30.334  1.00 43.95 ? 314  MET A CE  1 
ATOM   2474  N  N   . PRO A 1 315  ? 12.198  119.970 33.142  1.00 32.83 ? 315  PRO A N   1 
ATOM   2475  C  CA  . PRO A 1 315  ? 11.442  121.226 33.197  1.00 32.50 ? 315  PRO A CA  1 
ATOM   2476  C  C   . PRO A 1 315  ? 10.829  121.531 31.846  1.00 31.74 ? 315  PRO A C   1 
ATOM   2477  O  O   . PRO A 1 315  ? 11.528  121.524 30.834  1.00 32.12 ? 315  PRO A O   1 
ATOM   2478  C  CB  . PRO A 1 315  ? 12.503  122.259 33.581  1.00 32.61 ? 315  PRO A CB  1 
ATOM   2479  C  CG  . PRO A 1 315  ? 13.541  121.440 34.303  1.00 33.31 ? 315  PRO A CG  1 
ATOM   2480  C  CD  . PRO A 1 315  ? 13.613  120.192 33.464  1.00 32.54 ? 315  PRO A CD  1 
ATOM   2481  N  N   . LEU A 1 316  ? 9.536   121.808 31.820  1.00 31.44 ? 316  LEU A N   1 
ATOM   2482  C  CA  . LEU A 1 316  ? 8.881   122.096 30.555  1.00 31.70 ? 316  LEU A CA  1 
ATOM   2483  C  C   . LEU A 1 316  ? 8.821   123.591 30.238  1.00 32.17 ? 316  LEU A C   1 
ATOM   2484  O  O   . LEU A 1 316  ? 8.706   124.434 31.135  1.00 31.82 ? 316  LEU A O   1 
ATOM   2485  C  CB  . LEU A 1 316  ? 7.471   121.498 30.557  1.00 29.89 ? 316  LEU A CB  1 
ATOM   2486  C  CG  . LEU A 1 316  ? 7.436   119.989 30.827  1.00 29.53 ? 316  LEU A CG  1 
ATOM   2487  C  CD1 . LEU A 1 316  ? 6.015   119.538 31.146  1.00 29.02 ? 316  LEU A CD1 1 
ATOM   2488  C  CD2 . LEU A 1 316  ? 8.008   119.246 29.630  1.00 30.01 ? 316  LEU A CD2 1 
ATOM   2489  N  N   . SER A 1 317  ? 8.918   123.910 28.952  1.00 32.06 ? 317  SER A N   1 
ATOM   2490  C  CA  . SER A 1 317  ? 8.848   125.294 28.503  1.00 33.75 ? 317  SER A CA  1 
ATOM   2491  C  C   . SER A 1 317  ? 8.069   125.331 27.190  1.00 34.55 ? 317  SER A C   1 
ATOM   2492  O  O   . SER A 1 317  ? 7.369   124.376 26.855  1.00 34.81 ? 317  SER A O   1 
ATOM   2493  C  CB  . SER A 1 317  ? 10.259  125.892 28.323  1.00 33.67 ? 317  SER A CB  1 
ATOM   2494  O  OG  . SER A 1 317  ? 11.020  125.214 27.338  1.00 35.96 ? 317  SER A OG  1 
ATOM   2495  N  N   . ALA A 1 318  ? 8.171   126.431 26.452  1.00 36.28 ? 318  ALA A N   1 
ATOM   2496  C  CA  . ALA A 1 318  ? 7.464   126.570 25.190  1.00 36.94 ? 318  ALA A CA  1 
ATOM   2497  C  C   . ALA A 1 318  ? 8.061   125.667 24.119  1.00 37.94 ? 318  ALA A C   1 
ATOM   2498  O  O   . ALA A 1 318  ? 7.358   125.216 23.215  1.00 37.71 ? 318  ALA A O   1 
ATOM   2499  C  CB  . ALA A 1 318  ? 7.478   128.018 24.730  1.00 34.81 ? 318  ALA A CB  1 
ATOM   2500  N  N   . LYS A 1 319  ? 9.357   125.432 24.221  1.00 40.24 ? 319  LYS A N   1 
ATOM   2501  C  CA  . LYS A 1 319  ? 10.100  124.592 23.288  1.00 42.06 ? 319  LYS A CA  1 
ATOM   2502  C  C   . LYS A 1 319  ? 9.412   123.229 23.101  1.00 41.69 ? 319  LYS A C   1 
ATOM   2503  O  O   . LYS A 1 319  ? 9.631   122.538 22.094  1.00 41.96 ? 319  LYS A O   1 
ATOM   2504  C  CB  . LYS A 1 319  ? 11.528  124.418 23.837  1.00 43.55 ? 319  LYS A CB  1 
ATOM   2505  C  CG  . LYS A 1 319  ? 11.719  123.380 24.926  1.00 47.53 ? 319  LYS A CG  1 
ATOM   2506  C  CD  . LYS A 1 319  ? 13.161  123.427 25.459  1.00 48.64 ? 319  LYS A CD  1 
ATOM   2507  C  CE  . LYS A 1 319  ? 14.165  122.899 24.430  1.00 51.04 ? 319  LYS A CE  1 
ATOM   2508  N  NZ  . LYS A 1 319  ? 15.519  122.610 25.008  1.00 52.27 ? 319  LYS A NZ  1 
ATOM   2509  N  N   . TYR A 1 320  ? 8.564   122.860 24.062  1.00 41.05 ? 320  TYR A N   1 
ATOM   2510  C  CA  . TYR A 1 320  ? 7.869   121.573 24.033  1.00 40.15 ? 320  TYR A CA  1 
ATOM   2511  C  C   . TYR A 1 320  ? 6.364   121.604 23.787  1.00 38.20 ? 320  TYR A C   1 
ATOM   2512  O  O   . TYR A 1 320  ? 5.714   120.569 23.829  1.00 38.09 ? 320  TYR A O   1 
ATOM   2513  C  CB  . TYR A 1 320  ? 8.150   120.822 25.333  1.00 39.86 ? 320  TYR A CB  1 
ATOM   2514  C  CG  . TYR A 1 320  ? 9.608   120.492 25.527  1.00 40.86 ? 320  TYR A CG  1 
ATOM   2515  C  CD1 . TYR A 1 320  ? 10.345  119.890 24.509  1.00 40.77 ? 320  TYR A CD1 1 
ATOM   2516  C  CD2 . TYR A 1 320  ? 10.251  120.766 26.735  1.00 42.43 ? 320  TYR A CD2 1 
ATOM   2517  C  CE1 . TYR A 1 320  ? 11.693  119.568 24.683  1.00 42.34 ? 320  TYR A CE1 1 
ATOM   2518  C  CE2 . TYR A 1 320  ? 11.600  120.449 26.924  1.00 43.12 ? 320  TYR A CE2 1 
ATOM   2519  C  CZ  . TYR A 1 320  ? 12.314  119.847 25.890  1.00 43.33 ? 320  TYR A CZ  1 
ATOM   2520  O  OH  . TYR A 1 320  ? 13.644  119.539 26.056  1.00 45.19 ? 320  TYR A OH  1 
ATOM   2521  N  N   . ALA A 1 321  ? 5.809   122.781 23.530  1.00 36.87 ? 321  ALA A N   1 
ATOM   2522  C  CA  . ALA A 1 321  ? 4.377   122.893 23.279  1.00 37.51 ? 321  ALA A CA  1 
ATOM   2523  C  C   . ALA A 1 321  ? 3.985   121.938 22.149  1.00 37.79 ? 321  ALA A C   1 
ATOM   2524  O  O   . ALA A 1 321  ? 4.839   121.466 21.405  1.00 38.10 ? 321  ALA A O   1 
ATOM   2525  C  CB  . ALA A 1 321  ? 4.015   124.325 22.910  1.00 35.52 ? 321  ALA A CB  1 
ATOM   2526  N  N   . ARG A 1 322  ? 2.691   121.652 22.027  1.00 39.36 ? 322  ARG A N   1 
ATOM   2527  C  CA  . ARG A 1 322  ? 2.199   120.737 20.996  1.00 40.53 ? 322  ARG A CA  1 
ATOM   2528  C  C   . ARG A 1 322  ? 2.693   121.194 19.637  1.00 41.40 ? 322  ARG A C   1 
ATOM   2529  O  O   . ARG A 1 322  ? 2.440   122.328 19.238  1.00 41.51 ? 322  ARG A O   1 
ATOM   2530  C  CB  . ARG A 1 322  ? 0.664   120.701 21.016  1.00 40.31 ? 322  ARG A CB  1 
ATOM   2531  C  CG  . ARG A 1 322  ? 0.031   119.675 20.081  1.00 40.37 ? 322  ARG A CG  1 
ATOM   2532  C  CD  . ARG A 1 322  ? -1.448  119.458 20.409  1.00 39.00 ? 322  ARG A CD  1 
ATOM   2533  N  NE  . ARG A 1 322  ? -1.988  118.293 19.710  1.00 40.03 ? 322  ARG A NE  1 
ATOM   2534  C  CZ  . ARG A 1 322  ? -2.309  118.266 18.420  1.00 40.41 ? 322  ARG A CZ  1 
ATOM   2535  N  NH1 . ARG A 1 322  ? -2.161  119.347 17.665  1.00 40.40 ? 322  ARG A NH1 1 
ATOM   2536  N  NH2 . ARG A 1 322  ? -2.759  117.146 17.873  1.00 40.85 ? 322  ARG A NH2 1 
ATOM   2537  N  N   . SER A 1 323  ? 3.407   120.319 18.934  1.00 41.79 ? 323  SER A N   1 
ATOM   2538  C  CA  . SER A 1 323  ? 3.934   120.653 17.612  1.00 42.81 ? 323  SER A CA  1 
ATOM   2539  C  C   . SER A 1 323  ? 3.295   119.775 16.542  1.00 44.57 ? 323  SER A C   1 
ATOM   2540  O  O   . SER A 1 323  ? 3.419   120.048 15.342  1.00 44.44 ? 323  SER A O   1 
ATOM   2541  C  CB  . SER A 1 323  ? 5.449   120.461 17.573  1.00 41.45 ? 323  SER A CB  1 
ATOM   2542  O  OG  . SER A 1 323  ? 5.776   119.090 17.653  1.00 39.44 ? 323  SER A OG  1 
ATOM   2543  N  N   . ALA A 1 324  ? 2.617   118.714 16.978  1.00 46.06 ? 324  ALA A N   1 
ATOM   2544  C  CA  . ALA A 1 324  ? 1.966   117.805 16.042  1.00 46.75 ? 324  ALA A CA  1 
ATOM   2545  C  C   . ALA A 1 324  ? 0.849   118.531 15.297  1.00 46.84 ? 324  ALA A C   1 
ATOM   2546  O  O   . ALA A 1 324  ? 0.406   119.603 15.713  1.00 46.56 ? 324  ALA A O   1 
ATOM   2547  C  CB  . ALA A 1 324  ? 1.400   116.591 16.789  1.00 46.57 ? 324  ALA A CB  1 
ATOM   2548  N  N   . PRO A 1 325  ? 0.386   117.957 14.177  1.00 46.87 ? 325  PRO A N   1 
ATOM   2549  C  CA  . PRO A 1 325  ? -0.690  118.560 13.381  1.00 47.87 ? 325  PRO A CA  1 
ATOM   2550  C  C   . PRO A 1 325  ? -1.912  118.934 14.238  1.00 48.52 ? 325  PRO A C   1 
ATOM   2551  O  O   . PRO A 1 325  ? -2.199  118.287 15.260  1.00 49.39 ? 325  PRO A O   1 
ATOM   2552  C  CB  . PRO A 1 325  ? -1.012  117.465 12.364  1.00 47.72 ? 325  PRO A CB  1 
ATOM   2553  C  CG  . PRO A 1 325  ? 0.323   116.860 12.119  1.00 46.27 ? 325  PRO A CG  1 
ATOM   2554  C  CD  . PRO A 1 325  ? 0.896   116.738 13.524  1.00 46.81 ? 325  PRO A CD  1 
ATOM   2555  N  N   . SER A 1 326  ? -2.615  119.983 13.823  1.00 47.69 ? 326  SER A N   1 
ATOM   2556  C  CA  . SER A 1 326  ? -3.808  120.442 14.523  1.00 47.14 ? 326  SER A CA  1 
ATOM   2557  C  C   . SER A 1 326  ? -4.974  119.550 14.110  1.00 46.07 ? 326  SER A C   1 
ATOM   2558  O  O   . SER A 1 326  ? -5.021  119.076 12.975  1.00 45.98 ? 326  SER A O   1 
ATOM   2559  C  CB  . SER A 1 326  ? -4.116  121.888 14.133  1.00 49.17 ? 326  SER A CB  1 
ATOM   2560  O  OG  . SER A 1 326  ? -5.415  122.270 14.552  1.00 49.03 ? 326  SER A OG  1 
ATOM   2561  N  N   . ASN A 1 327  ? -5.914  119.313 15.020  1.00 43.56 ? 327  ASN A N   1 
ATOM   2562  C  CA  . ASN A 1 327  ? -7.057  118.471 14.687  1.00 41.37 ? 327  ASN A CA  1 
ATOM   2563  C  C   . ASN A 1 327  ? -8.386  119.208 14.879  1.00 39.87 ? 327  ASN A C   1 
ATOM   2564  O  O   . ASN A 1 327  ? -9.457  118.620 14.779  1.00 39.72 ? 327  ASN A O   1 
ATOM   2565  C  CB  . ASN A 1 327  ? -7.003  117.154 15.489  1.00 40.22 ? 327  ASN A CB  1 
ATOM   2566  C  CG  . ASN A 1 327  ? -6.992  117.369 17.000  1.00 41.68 ? 327  ASN A CG  1 
ATOM   2567  O  OD1 . ASN A 1 327  ? -6.489  118.380 17.506  1.00 41.39 ? 327  ASN A OD1 1 
ATOM   2568  N  ND2 . ASN A 1 327  ? -7.532  116.401 17.726  1.00 39.70 ? 327  ASN A ND2 1 
ATOM   2569  N  N   . ASP A 1 328  ? -8.287  120.512 15.117  1.00 39.22 ? 328  ASP A N   1 
ATOM   2570  C  CA  . ASP A 1 328  ? -9.436  121.398 15.304  1.00 38.93 ? 328  ASP A CA  1 
ATOM   2571  C  C   . ASP A 1 328  ? -10.506 121.249 14.222  1.00 38.54 ? 328  ASP A C   1 
ATOM   2572  O  O   . ASP A 1 328  ? -11.689 121.111 14.527  1.00 38.05 ? 328  ASP A O   1 
ATOM   2573  C  CB  . ASP A 1 328  ? -8.965  122.858 15.330  1.00 37.99 ? 328  ASP A CB  1 
ATOM   2574  C  CG  . ASP A 1 328  ? -10.102 123.840 15.556  1.00 39.25 ? 328  ASP A CG  1 
ATOM   2575  O  OD1 . ASP A 1 328  ? -10.479 124.063 16.729  1.00 38.99 ? 328  ASP A OD1 1 
ATOM   2576  O  OD2 . ASP A 1 328  ? -10.626 124.387 14.556  1.00 40.75 ? 328  ASP A OD2 1 
ATOM   2577  N  N   . LYS A 1 329  ? -10.090 121.287 12.960  1.00 38.30 ? 329  LYS A N   1 
ATOM   2578  C  CA  . LYS A 1 329  ? -11.028 121.173 11.854  1.00 38.51 ? 329  LYS A CA  1 
ATOM   2579  C  C   . LYS A 1 329  ? -11.816 119.866 11.904  1.00 38.09 ? 329  LYS A C   1 
ATOM   2580  O  O   . LYS A 1 329  ? -13.048 119.884 11.958  1.00 38.07 ? 329  LYS A O   1 
ATOM   2581  C  CB  . LYS A 1 329  ? -10.283 121.297 10.519  1.00 40.04 ? 329  LYS A CB  1 
ATOM   2582  C  CG  . LYS A 1 329  ? -11.189 121.509 9.304   1.00 41.48 ? 329  LYS A CG  1 
ATOM   2583  C  CD  . LYS A 1 329  ? -10.414 122.081 8.123   1.00 44.04 ? 329  LYS A CD  1 
ATOM   2584  C  CE  . LYS A 1 329  ? -11.303 122.238 6.898   1.00 45.16 ? 329  LYS A CE  1 
ATOM   2585  N  NZ  . LYS A 1 329  ? -11.630 120.925 6.260   1.00 48.31 ? 329  LYS A NZ  1 
ATOM   2586  N  N   . LYS A 1 330  ? -11.113 118.738 11.890  1.00 38.21 ? 330  LYS A N   1 
ATOM   2587  C  CA  . LYS A 1 330  ? -11.776 117.447 11.934  1.00 38.59 ? 330  LYS A CA  1 
ATOM   2588  C  C   . LYS A 1 330  ? -12.651 117.326 13.190  1.00 37.33 ? 330  LYS A C   1 
ATOM   2589  O  O   . LYS A 1 330  ? -13.814 116.929 13.109  1.00 36.19 ? 330  LYS A O   1 
ATOM   2590  C  CB  . LYS A 1 330  ? -10.739 116.320 11.890  1.00 40.62 ? 330  LYS A CB  1 
ATOM   2591  C  CG  . LYS A 1 330  ? -10.018 116.213 10.558  1.00 44.73 ? 330  LYS A CG  1 
ATOM   2592  C  CD  . LYS A 1 330  ? -8.933  115.147 10.602  1.00 47.31 ? 330  LYS A CD  1 
ATOM   2593  C  CE  . LYS A 1 330  ? -8.058  115.204 9.355   1.00 49.58 ? 330  LYS A CE  1 
ATOM   2594  N  NZ  . LYS A 1 330  ? -6.745  114.529 9.568   1.00 50.65 ? 330  LYS A NZ  1 
ATOM   2595  N  N   . ALA A 1 331  ? -12.081 117.683 14.336  1.00 35.79 ? 331  ALA A N   1 
ATOM   2596  C  CA  . ALA A 1 331  ? -12.787 117.609 15.610  1.00 34.69 ? 331  ALA A CA  1 
ATOM   2597  C  C   . ALA A 1 331  ? -14.134 118.342 15.566  1.00 34.16 ? 331  ALA A C   1 
ATOM   2598  O  O   . ALA A 1 331  ? -15.152 117.809 16.010  1.00 33.75 ? 331  ALA A O   1 
ATOM   2599  C  CB  . ALA A 1 331  ? -11.908 118.178 16.719  1.00 33.57 ? 331  ALA A CB  1 
ATOM   2600  N  N   . ARG A 1 332  ? -14.139 119.561 15.040  1.00 32.90 ? 332  ARG A N   1 
ATOM   2601  C  CA  . ARG A 1 332  ? -15.374 120.327 14.943  1.00 31.68 ? 332  ARG A CA  1 
ATOM   2602  C  C   . ARG A 1 332  ? -16.297 119.779 13.876  1.00 31.44 ? 332  ARG A C   1 
ATOM   2603  O  O   . ARG A 1 332  ? -17.512 119.909 13.993  1.00 32.42 ? 332  ARG A O   1 
ATOM   2604  C  CB  . ARG A 1 332  ? -15.078 121.798 14.674  1.00 28.54 ? 332  ARG A CB  1 
ATOM   2605  C  CG  . ARG A 1 332  ? -14.487 122.493 15.881  1.00 25.99 ? 332  ARG A CG  1 
ATOM   2606  C  CD  . ARG A 1 332  ? -14.054 123.883 15.550  1.00 24.04 ? 332  ARG A CD  1 
ATOM   2607  N  NE  . ARG A 1 332  ? -13.266 124.450 16.631  1.00 22.85 ? 332  ARG A NE  1 
ATOM   2608  C  CZ  . ARG A 1 332  ? -13.794 124.950 17.743  1.00 23.62 ? 332  ARG A CZ  1 
ATOM   2609  N  NH1 . ARG A 1 332  ? -15.113 124.954 17.909  1.00 19.13 ? 332  ARG A NH1 1 
ATOM   2610  N  NH2 . ARG A 1 332  ? -13.001 125.428 18.697  1.00 24.09 ? 332  ARG A NH2 1 
ATOM   2611  N  N   . GLU A 1 333  ? -15.738 119.157 12.843  1.00 31.04 ? 333  GLU A N   1 
ATOM   2612  C  CA  . GLU A 1 333  ? -16.577 118.594 11.798  1.00 32.02 ? 333  GLU A CA  1 
ATOM   2613  C  C   . GLU A 1 333  ? -17.360 117.438 12.385  1.00 31.76 ? 333  GLU A C   1 
ATOM   2614  O  O   . GLU A 1 333  ? -18.566 117.334 12.164  1.00 32.36 ? 333  GLU A O   1 
ATOM   2615  C  CB  . GLU A 1 333  ? -15.740 118.121 10.599  1.00 34.55 ? 333  GLU A CB  1 
ATOM   2616  C  CG  . GLU A 1 333  ? -15.253 119.261 9.690   1.00 40.02 ? 333  GLU A CG  1 
ATOM   2617  C  CD  . GLU A 1 333  ? -14.295 118.790 8.599   1.00 44.18 ? 333  GLU A CD  1 
ATOM   2618  O  OE1 . GLU A 1 333  ? -13.500 117.861 8.864   1.00 47.45 ? 333  GLU A OE1 1 
ATOM   2619  O  OE2 . GLU A 1 333  ? -14.319 119.356 7.482   1.00 45.70 ? 333  GLU A OE2 1 
ATOM   2620  N  N   . LEU A 1 334  ? -16.686 116.570 13.140  1.00 31.52 ? 334  LEU A N   1 
ATOM   2621  C  CA  . LEU A 1 334  ? -17.356 115.415 13.764  1.00 29.99 ? 334  LEU A CA  1 
ATOM   2622  C  C   . LEU A 1 334  ? -18.515 115.876 14.636  1.00 29.00 ? 334  LEU A C   1 
ATOM   2623  O  O   . LEU A 1 334  ? -19.611 115.331 14.559  1.00 28.46 ? 334  LEU A O   1 
ATOM   2624  C  CB  . LEU A 1 334  ? -16.385 114.600 14.628  1.00 29.27 ? 334  LEU A CB  1 
ATOM   2625  C  CG  . LEU A 1 334  ? -17.043 113.391 15.305  1.00 29.80 ? 334  LEU A CG  1 
ATOM   2626  C  CD1 . LEU A 1 334  ? -16.747 112.142 14.498  1.00 30.07 ? 334  LEU A CD1 1 
ATOM   2627  C  CD2 . LEU A 1 334  ? -16.516 113.217 16.720  1.00 32.22 ? 334  LEU A CD2 1 
ATOM   2628  N  N   . GLY A 1 335  ? -18.265 116.885 15.466  1.00 28.98 ? 335  GLY A N   1 
ATOM   2629  C  CA  . GLY A 1 335  ? -19.309 117.412 16.328  1.00 28.94 ? 335  GLY A CA  1 
ATOM   2630  C  C   . GLY A 1 335  ? -20.509 117.961 15.560  1.00 29.22 ? 335  GLY A C   1 
ATOM   2631  O  O   . GLY A 1 335  ? -21.656 117.646 15.885  1.00 29.67 ? 335  GLY A O   1 
ATOM   2632  N  N   . GLU A 1 336  ? -20.242 118.793 14.551  1.00 28.89 ? 336  GLU A N   1 
ATOM   2633  C  CA  . GLU A 1 336  ? -21.284 119.387 13.717  1.00 28.32 ? 336  GLU A CA  1 
ATOM   2634  C  C   . GLU A 1 336  ? -22.152 118.315 13.070  1.00 28.90 ? 336  GLU A C   1 
ATOM   2635  O  O   . GLU A 1 336  ? -23.378 118.432 13.035  1.00 29.68 ? 336  GLU A O   1 
ATOM   2636  C  CB  . GLU A 1 336  ? -20.658 120.244 12.613  1.00 28.97 ? 336  GLU A CB  1 
ATOM   2637  C  CG  . GLU A 1 336  ? -20.251 121.644 13.039  1.00 31.24 ? 336  GLU A CG  1 
ATOM   2638  C  CD  . GLU A 1 336  ? -21.426 122.474 13.532  1.00 33.33 ? 336  GLU A CD  1 
ATOM   2639  O  OE1 . GLU A 1 336  ? -22.593 122.125 13.229  1.00 34.41 ? 336  GLU A OE1 1 
ATOM   2640  O  OE2 . GLU A 1 336  ? -21.170 123.486 14.223  1.00 36.15 ? 336  GLU A OE2 1 
ATOM   2641  N  N   . LYS A 1 337  ? -21.500 117.277 12.555  1.00 28.56 ? 337  LYS A N   1 
ATOM   2642  C  CA  . LYS A 1 337  ? -22.172 116.171 11.890  1.00 28.46 ? 337  LYS A CA  1 
ATOM   2643  C  C   . LYS A 1 337  ? -23.056 115.300 12.793  1.00 28.86 ? 337  LYS A C   1 
ATOM   2644  O  O   . LYS A 1 337  ? -24.030 114.703 12.316  1.00 28.10 ? 337  LYS A O   1 
ATOM   2645  C  CB  . LYS A 1 337  ? -21.137 115.284 11.201  1.00 29.03 ? 337  LYS A CB  1 
ATOM   2646  C  CG  . LYS A 1 337  ? -21.748 114.104 10.471  1.00 30.65 ? 337  LYS A CG  1 
ATOM   2647  C  CD  . LYS A 1 337  ? -20.739 113.341 9.649   1.00 32.00 ? 337  LYS A CD  1 
ATOM   2648  C  CE  . LYS A 1 337  ? -21.467 112.300 8.814   1.00 35.36 ? 337  LYS A CE  1 
ATOM   2649  N  NZ  . LYS A 1 337  ? -20.565 111.623 7.849   1.00 36.43 ? 337  LYS A NZ  1 
ATOM   2650  N  N   . TYR A 1 338  ? -22.725 115.211 14.082  1.00 27.68 ? 338  TYR A N   1 
ATOM   2651  C  CA  . TYR A 1 338  ? -23.530 114.394 15.001  1.00 26.24 ? 338  TYR A CA  1 
ATOM   2652  C  C   . TYR A 1 338  ? -24.266 115.205 16.062  1.00 27.44 ? 338  TYR A C   1 
ATOM   2653  O  O   . TYR A 1 338  ? -24.494 114.729 17.176  1.00 27.53 ? 338  TYR A O   1 
ATOM   2654  C  CB  . TYR A 1 338  ? -22.662 113.319 15.666  1.00 22.81 ? 338  TYR A CB  1 
ATOM   2655  C  CG  . TYR A 1 338  ? -22.141 112.296 14.678  1.00 20.94 ? 338  TYR A CG  1 
ATOM   2656  C  CD1 . TYR A 1 338  ? -22.989 111.330 14.131  1.00 20.69 ? 338  TYR A CD1 1 
ATOM   2657  C  CD2 . TYR A 1 338  ? -20.814 112.327 14.241  1.00 18.00 ? 338  TYR A CD2 1 
ATOM   2658  C  CE1 . TYR A 1 338  ? -22.526 110.421 13.170  1.00 19.71 ? 338  TYR A CE1 1 
ATOM   2659  C  CE2 . TYR A 1 338  ? -20.350 111.432 13.290  1.00 18.37 ? 338  TYR A CE2 1 
ATOM   2660  C  CZ  . TYR A 1 338  ? -21.211 110.484 12.756  1.00 18.91 ? 338  TYR A CZ  1 
ATOM   2661  O  OH  . TYR A 1 338  ? -20.762 109.609 11.800  1.00 19.66 ? 338  TYR A OH  1 
ATOM   2662  N  N   . GLY A 1 339  ? -24.646 116.426 15.707  1.00 28.09 ? 339  GLY A N   1 
ATOM   2663  C  CA  . GLY A 1 339  ? -25.362 117.275 16.638  1.00 28.69 ? 339  GLY A CA  1 
ATOM   2664  C  C   . GLY A 1 339  ? -24.713 117.470 17.996  1.00 29.99 ? 339  GLY A C   1 
ATOM   2665  O  O   . GLY A 1 339  ? -25.422 117.656 18.984  1.00 30.72 ? 339  GLY A O   1 
ATOM   2666  N  N   . LEU A 1 340  ? -23.381 117.462 18.052  1.00 29.87 ? 340  LEU A N   1 
ATOM   2667  C  CA  . LEU A 1 340  ? -22.679 117.630 19.323  1.00 30.62 ? 340  LEU A CA  1 
ATOM   2668  C  C   . LEU A 1 340  ? -21.626 118.746 19.336  1.00 31.21 ? 340  LEU A C   1 
ATOM   2669  O  O   . LEU A 1 340  ? -20.741 118.766 20.207  1.00 30.73 ? 340  LEU A O   1 
ATOM   2670  C  CB  . LEU A 1 340  ? -22.013 116.302 19.706  1.00 29.20 ? 340  LEU A CB  1 
ATOM   2671  C  CG  . LEU A 1 340  ? -22.976 115.114 19.745  1.00 28.28 ? 340  LEU A CG  1 
ATOM   2672  C  CD1 . LEU A 1 340  ? -22.227 113.837 20.069  1.00 26.64 ? 340  LEU A CD1 1 
ATOM   2673  C  CD2 . LEU A 1 340  ? -24.056 115.378 20.784  1.00 29.04 ? 340  LEU A CD2 1 
ATOM   2674  N  N   . SER A 1 341  ? -21.722 119.671 18.386  1.00 30.67 ? 341  SER A N   1 
ATOM   2675  C  CA  . SER A 1 341  ? -20.749 120.756 18.287  1.00 31.65 ? 341  SER A CA  1 
ATOM   2676  C  C   . SER A 1 341  ? -20.596 121.587 19.565  1.00 30.93 ? 341  SER A C   1 
ATOM   2677  O  O   . SER A 1 341  ? -19.521 122.100 19.843  1.00 31.57 ? 341  SER A O   1 
ATOM   2678  C  CB  . SER A 1 341  ? -21.095 121.668 17.095  1.00 32.01 ? 341  SER A CB  1 
ATOM   2679  O  OG  . SER A 1 341  ? -22.201 122.503 17.393  1.00 36.02 ? 341  SER A OG  1 
ATOM   2680  N  N   . SER A 1 342  ? -21.661 121.711 20.347  1.00 31.02 ? 342  SER A N   1 
ATOM   2681  C  CA  . SER A 1 342  ? -21.603 122.485 21.592  1.00 31.28 ? 342  SER A CA  1 
ATOM   2682  C  C   . SER A 1 342  ? -20.651 121.823 22.582  1.00 30.70 ? 342  SER A C   1 
ATOM   2683  O  O   . SER A 1 342  ? -19.952 122.493 23.350  1.00 30.39 ? 342  SER A O   1 
ATOM   2684  C  CB  . SER A 1 342  ? -22.985 122.569 22.224  1.00 31.83 ? 342  SER A CB  1 
ATOM   2685  O  OG  . SER A 1 342  ? -23.498 121.263 22.402  1.00 35.29 ? 342  SER A OG  1 
ATOM   2686  N  N   . VAL A 1 343  ? -20.651 120.498 22.564  1.00 29.17 ? 343  VAL A N   1 
ATOM   2687  C  CA  . VAL A 1 343  ? -19.794 119.713 23.438  1.00 28.21 ? 343  VAL A CA  1 
ATOM   2688  C  C   . VAL A 1 343  ? -18.345 119.786 22.934  1.00 28.39 ? 343  VAL A C   1 
ATOM   2689  O  O   . VAL A 1 343  ? -17.403 119.930 23.716  1.00 28.04 ? 343  VAL A O   1 
ATOM   2690  C  CB  . VAL A 1 343  ? -20.272 118.242 23.470  1.00 26.80 ? 343  VAL A CB  1 
ATOM   2691  C  CG1 . VAL A 1 343  ? -19.257 117.365 24.174  1.00 24.94 ? 343  VAL A CG1 1 
ATOM   2692  C  CG2 . VAL A 1 343  ? -21.613 118.162 24.146  1.00 24.64 ? 343  VAL A CG2 1 
ATOM   2693  N  N   . VAL A 1 344  ? -18.165 119.681 21.625  1.00 28.26 ? 344  VAL A N   1 
ATOM   2694  C  CA  . VAL A 1 344  ? -16.830 119.761 21.070  1.00 29.06 ? 344  VAL A CA  1 
ATOM   2695  C  C   . VAL A 1 344  ? -16.199 121.109 21.421  1.00 30.23 ? 344  VAL A C   1 
ATOM   2696  O  O   . VAL A 1 344  ? -15.101 121.170 21.990  1.00 30.02 ? 344  VAL A O   1 
ATOM   2697  C  CB  . VAL A 1 344  ? -16.847 119.578 19.529  1.00 29.03 ? 344  VAL A CB  1 
ATOM   2698  C  CG1 . VAL A 1 344  ? -15.469 119.877 18.949  1.00 27.73 ? 344  VAL A CG1 1 
ATOM   2699  C  CG2 . VAL A 1 344  ? -17.259 118.148 19.182  1.00 26.97 ? 344  VAL A CG2 1 
ATOM   2700  N  N   . GLY A 1 345  ? -16.907 122.189 21.102  1.00 30.34 ? 345  GLY A N   1 
ATOM   2701  C  CA  . GLY A 1 345  ? -16.400 123.529 21.356  1.00 29.64 ? 345  GLY A CA  1 
ATOM   2702  C  C   . GLY A 1 345  ? -16.168 123.857 22.831  1.00 30.99 ? 345  GLY A C   1 
ATOM   2703  O  O   . GLY A 1 345  ? -15.193 124.552 23.170  1.00 32.57 ? 345  GLY A O   1 
ATOM   2704  N  N   . GLU A 1 346  ? -17.046 123.365 23.707  1.00 31.06 ? 346  GLU A N   1 
ATOM   2705  C  CA  . GLU A 1 346  ? -16.884 123.592 25.148  1.00 31.24 ? 346  GLU A CA  1 
ATOM   2706  C  C   . GLU A 1 346  ? -15.599 122.894 25.601  1.00 30.60 ? 346  GLU A C   1 
ATOM   2707  O  O   . GLU A 1 346  ? -14.815 123.443 26.371  1.00 30.01 ? 346  GLU A O   1 
ATOM   2708  C  CB  . GLU A 1 346  ? -18.078 123.022 25.917  1.00 32.80 ? 346  GLU A CB  1 
ATOM   2709  C  CG  . GLU A 1 346  ? -17.977 123.082 27.443  1.00 36.81 ? 346  GLU A CG  1 
ATOM   2710  C  CD  . GLU A 1 346  ? -17.734 124.489 27.978  1.00 40.29 ? 346  GLU A CD  1 
ATOM   2711  O  OE1 . GLU A 1 346  ? -18.151 125.466 27.308  1.00 42.45 ? 346  GLU A OE1 1 
ATOM   2712  O  OE2 . GLU A 1 346  ? -17.141 124.621 29.078  1.00 40.82 ? 346  GLU A OE2 1 
ATOM   2713  N  N   . LEU A 1 347  ? -15.387 121.675 25.110  1.00 30.56 ? 347  LEU A N   1 
ATOM   2714  C  CA  . LEU A 1 347  ? -14.193 120.911 25.454  1.00 29.04 ? 347  LEU A CA  1 
ATOM   2715  C  C   . LEU A 1 347  ? -12.931 121.577 24.915  1.00 28.63 ? 347  LEU A C   1 
ATOM   2716  O  O   . LEU A 1 347  ? -11.898 121.573 25.586  1.00 27.49 ? 347  LEU A O   1 
ATOM   2717  C  CB  . LEU A 1 347  ? -14.297 119.479 24.914  1.00 28.39 ? 347  LEU A CB  1 
ATOM   2718  C  CG  . LEU A 1 347  ? -15.303 118.567 25.629  1.00 26.98 ? 347  LEU A CG  1 
ATOM   2719  C  CD1 . LEU A 1 347  ? -15.595 117.342 24.793  1.00 26.11 ? 347  LEU A CD1 1 
ATOM   2720  C  CD2 . LEU A 1 347  ? -14.743 118.159 26.989  1.00 26.18 ? 347  LEU A CD2 1 
ATOM   2721  N  N   . ARG A 1 348  ? -13.019 122.152 23.713  1.00 28.41 ? 348  ARG A N   1 
ATOM   2722  C  CA  . ARG A 1 348  ? -11.862 122.812 23.104  1.00 27.16 ? 348  ARG A CA  1 
ATOM   2723  C  C   . ARG A 1 348  ? -11.479 124.039 23.913  1.00 27.34 ? 348  ARG A C   1 
ATOM   2724  O  O   . ARG A 1 348  ? -10.301 124.271 24.214  1.00 26.42 ? 348  ARG A O   1 
ATOM   2725  C  CB  . ARG A 1 348  ? -12.167 123.205 21.661  1.00 26.44 ? 348  ARG A CB  1 
ATOM   2726  C  CG  . ARG A 1 348  ? -12.242 122.018 20.706  1.00 26.49 ? 348  ARG A CG  1 
ATOM   2727  C  CD  . ARG A 1 348  ? -11.226 122.157 19.591  1.00 25.60 ? 348  ARG A CD  1 
ATOM   2728  N  NE  . ARG A 1 348  ? -10.666 120.865 19.229  1.00 27.77 ? 348  ARG A NE  1 
ATOM   2729  C  CZ  . ARG A 1 348  ? -9.431  120.692 18.772  1.00 27.04 ? 348  ARG A CZ  1 
ATOM   2730  N  NH1 . ARG A 1 348  ? -8.620  121.732 18.619  1.00 26.58 ? 348  ARG A NH1 1 
ATOM   2731  N  NH2 . ARG A 1 348  ? -9.008  119.475 18.471  1.00 30.35 ? 348  ARG A NH2 1 
ATOM   2732  N  N   . LYS A 1 349  ? -12.494 124.811 24.285  1.00 27.84 ? 349  LYS A N   1 
ATOM   2733  C  CA  . LYS A 1 349  ? -12.298 126.009 25.079  1.00 27.87 ? 349  LYS A CA  1 
ATOM   2734  C  C   . LYS A 1 349  ? -11.644 125.684 26.423  1.00 27.70 ? 349  LYS A C   1 
ATOM   2735  O  O   . LYS A 1 349  ? -10.691 126.349 26.835  1.00 26.61 ? 349  LYS A O   1 
ATOM   2736  C  CB  . LYS A 1 349  ? -13.632 126.703 25.319  1.00 28.51 ? 349  LYS A CB  1 
ATOM   2737  C  CG  . LYS A 1 349  ? -13.526 127.912 26.219  1.00 31.98 ? 349  LYS A CG  1 
ATOM   2738  C  CD  . LYS A 1 349  ? -14.892 128.559 26.438  1.00 35.89 ? 349  LYS A CD  1 
ATOM   2739  C  CE  . LYS A 1 349  ? -14.831 129.653 27.487  1.00 36.47 ? 349  LYS A CE  1 
ATOM   2740  N  NZ  . LYS A 1 349  ? -16.176 130.220 27.715  1.00 39.27 ? 349  LYS A NZ  1 
ATOM   2741  N  N   . ARG A 1 350  ? -12.151 124.677 27.121  1.00 26.41 ? 350  ARG A N   1 
ATOM   2742  C  CA  . ARG A 1 350  ? -11.552 124.345 28.401  1.00 27.84 ? 350  ARG A CA  1 
ATOM   2743  C  C   . ARG A 1 350  ? -10.117 123.841 28.228  1.00 28.99 ? 350  ARG A C   1 
ATOM   2744  O  O   . ARG A 1 350  ? -9.228  124.221 28.986  1.00 28.06 ? 350  ARG A O   1 
ATOM   2745  C  CB  . ARG A 1 350  ? -12.397 123.308 29.141  1.00 29.36 ? 350  ARG A CB  1 
ATOM   2746  C  CG  . ARG A 1 350  ? -13.807 123.794 29.457  1.00 32.64 ? 350  ARG A CG  1 
ATOM   2747  C  CD  . ARG A 1 350  ? -14.613 122.781 30.220  1.00 33.55 ? 350  ARG A CD  1 
ATOM   2748  N  NE  . ARG A 1 350  ? -13.964 122.439 31.480  1.00 37.46 ? 350  ARG A NE  1 
ATOM   2749  C  CZ  . ARG A 1 350  ? -14.579 121.839 32.491  1.00 37.52 ? 350  ARG A CZ  1 
ATOM   2750  N  NH1 . ARG A 1 350  ? -15.860 121.516 32.385  1.00 37.49 ? 350  ARG A NH1 1 
ATOM   2751  N  NH2 . ARG A 1 350  ? -13.921 121.576 33.612  1.00 36.39 ? 350  ARG A NH2 1 
ATOM   2752  N  N   . THR A 1 351  ? -9.887  123.007 27.221  1.00 28.81 ? 351  THR A N   1 
ATOM   2753  C  CA  . THR A 1 351  ? -8.559  122.475 26.979  1.00 29.81 ? 351  THR A CA  1 
ATOM   2754  C  C   . THR A 1 351  ? -7.475  123.534 26.776  1.00 30.25 ? 351  THR A C   1 
ATOM   2755  O  O   . THR A 1 351  ? -6.376  123.394 27.308  1.00 30.55 ? 351  THR A O   1 
ATOM   2756  C  CB  . THR A 1 351  ? -8.582  121.519 25.780  1.00 30.17 ? 351  THR A CB  1 
ATOM   2757  O  OG1 . THR A 1 351  ? -9.359  120.370 26.135  1.00 33.97 ? 351  THR A OG1 1 
ATOM   2758  C  CG2 . THR A 1 351  ? -7.175  121.085 25.374  1.00 29.16 ? 351  THR A CG2 1 
ATOM   2759  N  N   . LYS A 1 352  ? -7.784  124.590 26.032  1.00 31.28 ? 352  LYS A N   1 
ATOM   2760  C  CA  . LYS A 1 352  ? -6.803  125.629 25.767  1.00 32.30 ? 352  LYS A CA  1 
ATOM   2761  C  C   . LYS A 1 352  ? -6.374  126.372 27.043  1.00 31.68 ? 352  LYS A C   1 
ATOM   2762  O  O   . LYS A 1 352  ? -5.298  126.963 27.072  1.00 33.07 ? 352  LYS A O   1 
ATOM   2763  C  CB  . LYS A 1 352  ? -7.357  126.624 24.734  1.00 34.33 ? 352  LYS A CB  1 
ATOM   2764  C  CG  . LYS A 1 352  ? -7.735  125.976 23.412  1.00 39.22 ? 352  LYS A CG  1 
ATOM   2765  C  CD  . LYS A 1 352  ? -8.298  126.998 22.438  1.00 41.22 ? 352  LYS A CD  1 
ATOM   2766  C  CE  . LYS A 1 352  ? -9.155  126.324 21.371  1.00 41.42 ? 352  LYS A CE  1 
ATOM   2767  N  NZ  . LYS A 1 352  ? -8.375  125.321 20.588  1.00 41.16 ? 352  LYS A NZ  1 
ATOM   2768  N  N   . THR A 1 353  ? -7.207  126.333 28.096  1.00 30.13 ? 353  THR A N   1 
ATOM   2769  C  CA  . THR A 1 353  ? -6.848  127.030 29.331  1.00 29.12 ? 353  THR A CA  1 
ATOM   2770  C  C   . THR A 1 353  ? -5.748  126.350 30.129  1.00 29.16 ? 353  THR A C   1 
ATOM   2771  O  O   . THR A 1 353  ? -5.231  126.936 31.079  1.00 31.09 ? 353  THR A O   1 
ATOM   2772  C  CB  . THR A 1 353  ? -8.043  127.188 30.282  1.00 28.13 ? 353  THR A CB  1 
ATOM   2773  O  OG1 . THR A 1 353  ? -8.316  125.931 30.913  1.00 28.76 ? 353  THR A OG1 1 
ATOM   2774  C  CG2 . THR A 1 353  ? -9.260  127.674 29.530  1.00 27.58 ? 353  THR A CG2 1 
ATOM   2775  N  N   . TYR A 1 354  ? -5.394  125.119 29.774  1.00 27.90 ? 354  TYR A N   1 
ATOM   2776  C  CA  . TYR A 1 354  ? -4.330  124.420 30.499  1.00 26.03 ? 354  TYR A CA  1 
ATOM   2777  C  C   . TYR A 1 354  ? -3.020  124.702 29.792  1.00 26.01 ? 354  TYR A C   1 
ATOM   2778  O  O   . TYR A 1 354  ? -2.703  124.105 28.767  1.00 25.91 ? 354  TYR A O   1 
ATOM   2779  C  CB  . TYR A 1 354  ? -4.612  122.916 30.550  1.00 24.08 ? 354  TYR A CB  1 
ATOM   2780  C  CG  . TYR A 1 354  ? -5.783  122.590 31.450  1.00 22.56 ? 354  TYR A CG  1 
ATOM   2781  C  CD1 . TYR A 1 354  ? -5.608  122.400 32.828  1.00 22.48 ? 354  TYR A CD1 1 
ATOM   2782  C  CD2 . TYR A 1 354  ? -7.079  122.554 30.941  1.00 21.28 ? 354  TYR A CD2 1 
ATOM   2783  C  CE1 . TYR A 1 354  ? -6.686  122.184 33.668  1.00 19.14 ? 354  TYR A CE1 1 
ATOM   2784  C  CE2 . TYR A 1 354  ? -8.172  122.349 31.771  1.00 20.48 ? 354  TYR A CE2 1 
ATOM   2785  C  CZ  . TYR A 1 354  ? -7.972  122.162 33.135  1.00 20.61 ? 354  TYR A CZ  1 
ATOM   2786  O  OH  . TYR A 1 354  ? -9.058  121.952 33.956  1.00 20.19 ? 354  TYR A OH  1 
ATOM   2787  N  N   . VAL A 1 355  ? -2.264  125.641 30.355  1.00 25.62 ? 355  VAL A N   1 
ATOM   2788  C  CA  . VAL A 1 355  ? -0.994  126.054 29.784  1.00 26.66 ? 355  VAL A CA  1 
ATOM   2789  C  C   . VAL A 1 355  ? 0.183   125.469 30.545  1.00 26.67 ? 355  VAL A C   1 
ATOM   2790  O  O   . VAL A 1 355  ? 1.343   125.712 30.228  1.00 27.95 ? 355  VAL A O   1 
ATOM   2791  C  CB  . VAL A 1 355  ? -0.873  127.595 29.741  1.00 25.78 ? 355  VAL A CB  1 
ATOM   2792  C  CG1 . VAL A 1 355  ? -1.991  128.182 28.892  1.00 26.95 ? 355  VAL A CG1 1 
ATOM   2793  C  CG2 . VAL A 1 355  ? -0.909  128.164 31.150  1.00 27.50 ? 355  VAL A CG2 1 
ATOM   2794  N  N   . LYS A 1 356  ? -0.133  124.693 31.572  1.00 26.00 ? 356  LYS A N   1 
ATOM   2795  C  CA  . LYS A 1 356  ? 0.894   124.013 32.341  1.00 27.85 ? 356  LYS A CA  1 
ATOM   2796  C  C   . LYS A 1 356  ? 0.550   122.534 32.431  1.00 25.32 ? 356  LYS A C   1 
ATOM   2797  O  O   . LYS A 1 356  ? -0.613  122.170 32.521  1.00 24.96 ? 356  LYS A O   1 
ATOM   2798  C  CB  . LYS A 1 356  ? 1.011   124.626 33.738  1.00 30.26 ? 356  LYS A CB  1 
ATOM   2799  C  CG  . LYS A 1 356  ? 1.818   125.915 33.762  1.00 35.59 ? 356  LYS A CG  1 
ATOM   2800  C  CD  . LYS A 1 356  ? 1.761   126.575 35.126  1.00 38.38 ? 356  LYS A CD  1 
ATOM   2801  C  CE  . LYS A 1 356  ? 2.424   127.948 35.102  1.00 42.99 ? 356  LYS A CE  1 
ATOM   2802  N  NZ  . LYS A 1 356  ? 2.410   128.592 36.446  1.00 45.44 ? 356  LYS A NZ  1 
ATOM   2803  N  N   . HIS A 1 357  ? 1.577   121.682 32.334  1.00 23.81 ? 357  HIS A N   1 
ATOM   2804  C  CA  . HIS A 1 357  ? 1.375   120.261 32.442  1.00 23.87 ? 357  HIS A CA  1 
ATOM   2805  C  C   . HIS A 1 357  ? 1.587   119.924 33.908  1.00 23.98 ? 357  HIS A C   1 
ATOM   2806  O  O   . HIS A 1 357  ? 2.683   120.087 34.429  1.00 23.88 ? 357  HIS A O   1 
ATOM   2807  C  CB  . HIS A 1 357  ? 2.389   119.508 31.588  1.00 23.81 ? 357  HIS A CB  1 
ATOM   2808  C  CG  . HIS A 1 357  ? 2.436   118.038 31.872  1.00 25.02 ? 357  HIS A CG  1 
ATOM   2809  N  ND1 . HIS A 1 357  ? 1.544   117.139 31.320  1.00 24.00 ? 357  HIS A ND1 1 
ATOM   2810  C  CD2 . HIS A 1 357  ? 3.243   117.311 32.684  1.00 25.01 ? 357  HIS A CD2 1 
ATOM   2811  C  CE1 . HIS A 1 357  ? 1.800   115.932 31.779  1.00 25.26 ? 357  HIS A CE1 1 
ATOM   2812  N  NE2 . HIS A 1 357  ? 2.828   116.007 32.610  1.00 25.86 ? 357  HIS A NE2 1 
ATOM   2813  N  N   . ASP A 1 358  ? 0.527   119.485 34.574  1.00 23.13 ? 358  ASP A N   1 
ATOM   2814  C  CA  . ASP A 1 358  ? 0.613   119.127 35.981  1.00 22.71 ? 358  ASP A CA  1 
ATOM   2815  C  C   . ASP A 1 358  ? -0.555  118.236 36.410  1.00 23.14 ? 358  ASP A C   1 
ATOM   2816  O  O   . ASP A 1 358  ? -1.425  117.909 35.590  1.00 24.07 ? 358  ASP A O   1 
ATOM   2817  C  CB  . ASP A 1 358  ? 0.671   120.390 36.853  1.00 22.47 ? 358  ASP A CB  1 
ATOM   2818  C  CG  . ASP A 1 358  ? -0.523  121.304 36.663  1.00 21.85 ? 358  ASP A CG  1 
ATOM   2819  O  OD1 . ASP A 1 358  ? -1.628  120.831 36.311  1.00 21.25 ? 358  ASP A OD1 1 
ATOM   2820  O  OD2 . ASP A 1 358  ? -0.357  122.512 36.897  1.00 21.74 ? 358  ASP A OD2 1 
ATOM   2821  N  N   . PHE A 1 359  ? -0.572  117.845 37.684  1.00 21.86 ? 359  PHE A N   1 
ATOM   2822  C  CA  . PHE A 1 359  ? -1.640  116.990 38.200  1.00 22.21 ? 359  PHE A CA  1 
ATOM   2823  C  C   . PHE A 1 359  ? -3.000  117.483 37.721  1.00 21.52 ? 359  PHE A C   1 
ATOM   2824  O  O   . PHE A 1 359  ? -3.755  116.737 37.096  1.00 21.40 ? 359  PHE A O   1 
ATOM   2825  C  CB  . PHE A 1 359  ? -1.602  116.959 39.725  1.00 22.96 ? 359  PHE A CB  1 
ATOM   2826  C  CG  . PHE A 1 359  ? -0.305  116.455 40.288  1.00 23.45 ? 359  PHE A CG  1 
ATOM   2827  C  CD1 . PHE A 1 359  ? 0.185   115.211 39.915  1.00 24.46 ? 359  PHE A CD1 1 
ATOM   2828  C  CD2 . PHE A 1 359  ? 0.428   117.220 41.198  1.00 24.44 ? 359  PHE A CD2 1 
ATOM   2829  C  CE1 . PHE A 1 359  ? 1.391   114.725 40.438  1.00 22.78 ? 359  PHE A CE1 1 
ATOM   2830  C  CE2 . PHE A 1 359  ? 1.624   116.752 41.727  1.00 23.68 ? 359  PHE A CE2 1 
ATOM   2831  C  CZ  . PHE A 1 359  ? 2.109   115.498 41.345  1.00 23.28 ? 359  PHE A CZ  1 
ATOM   2832  N  N   . ALA A 1 360  ? -3.293  118.752 37.993  1.00 21.47 ? 360  ALA A N   1 
ATOM   2833  C  CA  . ALA A 1 360  ? -4.557  119.347 37.575  1.00 21.64 ? 360  ALA A CA  1 
ATOM   2834  C  C   . ALA A 1 360  ? -4.919  119.060 36.112  1.00 20.86 ? 360  ALA A C   1 
ATOM   2835  O  O   . ALA A 1 360  ? -6.051  118.672 35.825  1.00 21.63 ? 360  ALA A O   1 
ATOM   2836  C  CB  . ALA A 1 360  ? -4.531  120.848 37.812  1.00 19.75 ? 360  ALA A CB  1 
ATOM   2837  N  N   . SER A 1 361  ? -3.969  119.231 35.193  1.00 19.05 ? 361  SER A N   1 
ATOM   2838  C  CA  . SER A 1 361  ? -4.260  119.013 33.778  1.00 19.68 ? 361  SER A CA  1 
ATOM   2839  C  C   . SER A 1 361  ? -4.489  117.551 33.354  1.00 19.39 ? 361  SER A C   1 
ATOM   2840  O  O   . SER A 1 361  ? -5.404  117.258 32.578  1.00 19.41 ? 361  SER A O   1 
ATOM   2841  C  CB  . SER A 1 361  ? -3.177  119.655 32.885  1.00 18.67 ? 361  SER A CB  1 
ATOM   2842  O  OG  . SER A 1 361  ? -1.898  119.057 33.061  1.00 18.36 ? 361  SER A OG  1 
ATOM   2843  N  N   . VAL A 1 362  ? -3.674  116.631 33.851  1.00 20.01 ? 362  VAL A N   1 
ATOM   2844  C  CA  . VAL A 1 362  ? -3.858  115.242 33.467  1.00 20.11 ? 362  VAL A CA  1 
ATOM   2845  C  C   . VAL A 1 362  ? -5.157  114.713 34.076  1.00 20.80 ? 362  VAL A C   1 
ATOM   2846  O  O   . VAL A 1 362  ? -5.863  113.908 33.456  1.00 21.60 ? 362  VAL A O   1 
ATOM   2847  C  CB  . VAL A 1 362  ? -2.636  114.368 33.875  1.00 20.33 ? 362  VAL A CB  1 
ATOM   2848  C  CG1 . VAL A 1 362  ? -1.428  114.766 33.025  1.00 16.75 ? 362  VAL A CG1 1 
ATOM   2849  C  CG2 . VAL A 1 362  ? -2.330  114.514 35.352  1.00 18.36 ? 362  VAL A CG2 1 
ATOM   2850  N  N   . ARG A 1 363  ? -5.482  115.180 35.278  1.00 22.11 ? 363  ARG A N   1 
ATOM   2851  C  CA  . ARG A 1 363  ? -6.731  114.777 35.936  1.00 23.26 ? 363  ARG A CA  1 
ATOM   2852  C  C   . ARG A 1 363  ? -7.906  115.260 35.079  1.00 23.49 ? 363  ARG A C   1 
ATOM   2853  O  O   . ARG A 1 363  ? -8.918  114.573 34.949  1.00 24.42 ? 363  ARG A O   1 
ATOM   2854  C  CB  . ARG A 1 363  ? -6.839  115.390 37.341  1.00 22.45 ? 363  ARG A CB  1 
ATOM   2855  C  CG  . ARG A 1 363  ? -8.212  115.139 38.019  1.00 22.50 ? 363  ARG A CG  1 
ATOM   2856  C  CD  . ARG A 1 363  ? -8.244  115.620 39.473  1.00 19.82 ? 363  ARG A CD  1 
ATOM   2857  N  NE  . ARG A 1 363  ? -7.474  114.769 40.389  1.00 19.75 ? 363  ARG A NE  1 
ATOM   2858  C  CZ  . ARG A 1 363  ? -7.987  113.766 41.101  1.00 21.25 ? 363  ARG A CZ  1 
ATOM   2859  N  NH1 . ARG A 1 363  ? -9.281  113.476 41.008  1.00 17.49 ? 363  ARG A NH1 1 
ATOM   2860  N  NH2 . ARG A 1 363  ? -7.210  113.053 41.920  1.00 19.50 ? 363  ARG A NH2 1 
ATOM   2861  N  N   . TYR A 1 364  ? -7.749  116.449 34.497  1.00 24.46 ? 364  TYR A N   1 
ATOM   2862  C  CA  . TYR A 1 364  ? -8.772  117.027 33.642  1.00 24.15 ? 364  TYR A CA  1 
ATOM   2863  C  C   . TYR A 1 364  ? -9.032  116.077 32.469  1.00 23.68 ? 364  TYR A C   1 
ATOM   2864  O  O   . TYR A 1 364  ? -10.180 115.762 32.147  1.00 22.99 ? 364  TYR A O   1 
ATOM   2865  C  CB  . TYR A 1 364  ? -8.308  118.393 33.124  1.00 25.56 ? 364  TYR A CB  1 
ATOM   2866  C  CG  . TYR A 1 364  ? -9.065  118.859 31.895  1.00 27.30 ? 364  TYR A CG  1 
ATOM   2867  C  CD1 . TYR A 1 364  ? -10.397 119.251 31.972  1.00 27.41 ? 364  TYR A CD1 1 
ATOM   2868  C  CD2 . TYR A 1 364  ? -8.447  118.871 30.646  1.00 27.33 ? 364  TYR A CD2 1 
ATOM   2869  C  CE1 . TYR A 1 364  ? -11.087 119.640 30.833  1.00 27.97 ? 364  TYR A CE1 1 
ATOM   2870  C  CE2 . TYR A 1 364  ? -9.125  119.255 29.511  1.00 27.67 ? 364  TYR A CE2 1 
ATOM   2871  C  CZ  . TYR A 1 364  ? -10.443 119.635 29.607  1.00 28.13 ? 364  TYR A CZ  1 
ATOM   2872  O  OH  . TYR A 1 364  ? -11.115 119.989 28.461  1.00 26.86 ? 364  TYR A OH  1 
ATOM   2873  N  N   . ILE A 1 365  ? -7.945  115.635 31.840  1.00 21.91 ? 365  ILE A N   1 
ATOM   2874  C  CA  . ILE A 1 365  ? -8.001  114.715 30.708  1.00 20.70 ? 365  ILE A CA  1 
ATOM   2875  C  C   . ILE A 1 365  ? -8.666  113.416 31.159  1.00 21.27 ? 365  ILE A C   1 
ATOM   2876  O  O   . ILE A 1 365  ? -9.608  112.922 30.528  1.00 21.74 ? 365  ILE A O   1 
ATOM   2877  C  CB  . ILE A 1 365  ? -6.567  114.375 30.188  1.00 19.86 ? 365  ILE A CB  1 
ATOM   2878  C  CG1 . ILE A 1 365  ? -5.876  115.637 29.680  1.00 17.34 ? 365  ILE A CG1 1 
ATOM   2879  C  CG2 . ILE A 1 365  ? -6.622  113.312 29.117  1.00 17.55 ? 365  ILE A CG2 1 
ATOM   2880  C  CD1 . ILE A 1 365  ? -4.429  115.420 29.298  1.00 18.69 ? 365  ILE A CD1 1 
ATOM   2881  N  N   . ARG A 1 366  ? -8.169  112.866 32.262  1.00 20.02 ? 366  ARG A N   1 
ATOM   2882  C  CA  . ARG A 1 366  ? -8.700  111.624 32.782  1.00 18.74 ? 366  ARG A CA  1 
ATOM   2883  C  C   . ARG A 1 366  ? -10.195 111.752 33.004  1.00 19.17 ? 366  ARG A C   1 
ATOM   2884  O  O   . ARG A 1 366  ? -10.976 110.920 32.543  1.00 18.03 ? 366  ARG A O   1 
ATOM   2885  C  CB  . ARG A 1 366  ? -7.978  111.249 34.084  1.00 17.35 ? 366  ARG A CB  1 
ATOM   2886  C  CG  . ARG A 1 366  ? -8.562  110.075 34.846  1.00 17.46 ? 366  ARG A CG  1 
ATOM   2887  C  CD  . ARG A 1 366  ? -9.658  110.534 35.806  1.00 20.88 ? 366  ARG A CD  1 
ATOM   2888  N  NE  . ARG A 1 366  ? -9.521  109.806 37.050  1.00 24.05 ? 366  ARG A NE  1 
ATOM   2889  C  CZ  . ARG A 1 366  ? -9.779  110.305 38.242  1.00 26.00 ? 366  ARG A CZ  1 
ATOM   2890  N  NH1 . ARG A 1 366  ? -10.207 111.551 38.371  1.00 24.54 ? 366  ARG A NH1 1 
ATOM   2891  N  NH2 . ARG A 1 366  ? -9.566  109.556 39.310  1.00 30.11 ? 366  ARG A NH2 1 
ATOM   2892  N  N   . ASP A 1 367  ? -10.598 112.804 33.701  1.00 18.94 ? 367  ASP A N   1 
ATOM   2893  C  CA  . ASP A 1 367  ? -12.009 113.014 33.979  1.00 20.11 ? 367  ASP A CA  1 
ATOM   2894  C  C   . ASP A 1 367  ? -12.823 113.021 32.707  1.00 20.61 ? 367  ASP A C   1 
ATOM   2895  O  O   . ASP A 1 367  ? -13.823 112.311 32.598  1.00 20.65 ? 367  ASP A O   1 
ATOM   2896  C  CB  . ASP A 1 367  ? -12.208 114.332 34.723  1.00 20.36 ? 367  ASP A CB  1 
ATOM   2897  C  CG  . ASP A 1 367  ? -11.921 114.204 36.190  1.00 22.35 ? 367  ASP A CG  1 
ATOM   2898  O  OD1 . ASP A 1 367  ? -11.095 113.344 36.547  1.00 25.25 ? 367  ASP A OD1 1 
ATOM   2899  O  OD2 . ASP A 1 367  ? -12.514 114.959 36.986  1.00 24.30 ? 367  ASP A OD2 1 
ATOM   2900  N  N   . ALA A 1 368  ? -12.388 113.825 31.746  1.00 20.53 ? 368  ALA A N   1 
ATOM   2901  C  CA  . ALA A 1 368  ? -13.081 113.940 30.476  1.00 20.82 ? 368  ALA A CA  1 
ATOM   2902  C  C   . ALA A 1 368  ? -13.203 112.580 29.828  1.00 21.02 ? 368  ALA A C   1 
ATOM   2903  O  O   . ALA A 1 368  ? -14.280 112.203 29.382  1.00 20.79 ? 368  ALA A O   1 
ATOM   2904  C  CB  . ALA A 1 368  ? -12.325 114.899 29.545  1.00 21.41 ? 368  ALA A CB  1 
ATOM   2905  N  N   . MET A 1 369  ? -12.102 111.835 29.806  1.00 19.93 ? 369  MET A N   1 
ATOM   2906  C  CA  . MET A 1 369  ? -12.107 110.528 29.174  1.00 20.87 ? 369  MET A CA  1 
ATOM   2907  C  C   . MET A 1 369  ? -12.900 109.472 29.918  1.00 21.57 ? 369  MET A C   1 
ATOM   2908  O  O   . MET A 1 369  ? -13.106 108.366 29.416  1.00 22.79 ? 369  MET A O   1 
ATOM   2909  C  CB  . MET A 1 369  ? -10.667 110.053 28.923  1.00 19.08 ? 369  MET A CB  1 
ATOM   2910  C  CG  . MET A 1 369  ? -10.179 110.379 27.521  1.00 19.56 ? 369  MET A CG  1 
ATOM   2911  S  SD  . MET A 1 369  ? -8.419  110.250 27.309  1.00 22.86 ? 369  MET A SD  1 
ATOM   2912  C  CE  . MET A 1 369  ? -8.226  108.438 27.101  1.00 21.55 ? 369  MET A CE  1 
ATOM   2913  N  N   . ALA A 1 370  ? -13.359 109.809 31.112  1.00 19.98 ? 370  ALA A N   1 
ATOM   2914  C  CA  . ALA A 1 370  ? -14.144 108.864 31.894  1.00 19.95 ? 370  ALA A CA  1 
ATOM   2915  C  C   . ALA A 1 370  ? -15.617 108.990 31.546  1.00 20.61 ? 370  ALA A C   1 
ATOM   2916  O  O   . ALA A 1 370  ? -16.422 108.139 31.920  1.00 20.88 ? 370  ALA A O   1 
ATOM   2917  C  CB  . ALA A 1 370  ? -13.952 109.123 33.375  1.00 17.68 ? 370  ALA A CB  1 
ATOM   2918  N  N   . CYS A 1 371  ? -15.959 110.040 30.809  1.00 20.54 ? 371  CYS A N   1 
ATOM   2919  C  CA  . CYS A 1 371  ? -17.340 110.306 30.479  1.00 21.99 ? 371  CYS A CA  1 
ATOM   2920  C  C   . CYS A 1 371  ? -17.888 109.583 29.266  1.00 22.13 ? 371  CYS A C   1 
ATOM   2921  O  O   . CYS A 1 371  ? -19.097 109.501 29.107  1.00 21.48 ? 371  CYS A O   1 
ATOM   2922  C  CB  . CYS A 1 371  ? -17.540 111.816 30.346  1.00 21.85 ? 371  CYS A CB  1 
ATOM   2923  S  SG  . CYS A 1 371  ? -16.990 112.728 31.823  1.00 26.16 ? 371  CYS A SG  1 
ATOM   2924  N  N   . THR A 1 372  ? -17.000 109.039 28.437  1.00 21.29 ? 372  THR A N   1 
ATOM   2925  C  CA  . THR A 1 372  ? -17.383 108.311 27.226  1.00 19.39 ? 372  THR A CA  1 
ATOM   2926  C  C   . THR A 1 372  ? -18.215 107.093 27.591  1.00 20.46 ? 372  THR A C   1 
ATOM   2927  O  O   . THR A 1 372  ? -17.921 106.390 28.566  1.00 20.23 ? 372  THR A O   1 
ATOM   2928  C  CB  . THR A 1 372  ? -16.122 107.833 26.467  1.00 19.64 ? 372  THR A CB  1 
ATOM   2929  O  OG1 . THR A 1 372  ? -15.169 108.898 26.441  1.00 20.94 ? 372  THR A OG1 1 
ATOM   2930  C  CG2 . THR A 1 372  ? -16.453 107.424 25.045  1.00 17.97 ? 372  THR A CG2 1 
ATOM   2931  N  N   . SER A 1 373  ? -19.252 106.832 26.801  1.00 20.80 ? 373  SER A N   1 
ATOM   2932  C  CA  . SER A 1 373  ? -20.115 105.680 27.053  1.00 21.84 ? 373  SER A CA  1 
ATOM   2933  C  C   . SER A 1 373  ? -19.281 104.422 27.212  1.00 22.71 ? 373  SER A C   1 
ATOM   2934  O  O   . SER A 1 373  ? -18.301 104.222 26.495  1.00 24.01 ? 373  SER A O   1 
ATOM   2935  C  CB  . SER A 1 373  ? -21.092 105.469 25.904  1.00 22.50 ? 373  SER A CB  1 
ATOM   2936  O  OG  . SER A 1 373  ? -21.720 104.203 26.041  1.00 24.30 ? 373  SER A OG  1 
ATOM   2937  N  N   . GLY A 1 374  ? -19.678 103.568 28.144  1.00 24.19 ? 374  GLY A N   1 
ATOM   2938  C  CA  . GLY A 1 374  ? -18.936 102.345 28.375  1.00 24.25 ? 374  GLY A CA  1 
ATOM   2939  C  C   . GLY A 1 374  ? -19.737 101.101 28.048  1.00 24.29 ? 374  GLY A C   1 
ATOM   2940  O  O   . GLY A 1 374  ? -19.568 100.068 28.686  1.00 24.66 ? 374  GLY A O   1 
ATOM   2941  N  N   . ILE A 1 375  ? -20.608 101.176 27.054  1.00 23.05 ? 375  ILE A N   1 
ATOM   2942  C  CA  . ILE A 1 375  ? -21.406 100.011 26.726  1.00 23.47 ? 375  ILE A CA  1 
ATOM   2943  C  C   . ILE A 1 375  ? -20.673 99.019  25.833  1.00 24.09 ? 375  ILE A C   1 
ATOM   2944  O  O   . ILE A 1 375  ? -19.828 99.387  25.011  1.00 21.96 ? 375  ILE A O   1 
ATOM   2945  C  CB  . ILE A 1 375  ? -22.704 100.404 26.020  1.00 22.35 ? 375  ILE A CB  1 
ATOM   2946  C  CG1 . ILE A 1 375  ? -22.383 101.131 24.719  1.00 21.94 ? 375  ILE A CG1 1 
ATOM   2947  C  CG2 . ILE A 1 375  ? -23.546 101.306 26.915  1.00 23.16 ? 375  ILE A CG2 1 
ATOM   2948  C  CD1 . ILE A 1 375  ? -23.516 101.091 23.733  1.00 21.95 ? 375  ILE A CD1 1 
ATOM   2949  N  N   . PHE A 1 376  ? -21.008 97.750  26.004  1.00 24.54 ? 376  PHE A N   1 
ATOM   2950  C  CA  . PHE A 1 376  ? -20.425 96.692  25.191  1.00 25.13 ? 376  PHE A CA  1 
ATOM   2951  C  C   . PHE A 1 376  ? -21.329 96.653  23.970  1.00 24.15 ? 376  PHE A C   1 
ATOM   2952  O  O   . PHE A 1 376  ? -22.423 96.113  24.041  1.00 24.68 ? 376  PHE A O   1 
ATOM   2953  C  CB  . PHE A 1 376  ? -20.499 95.351  25.933  1.00 26.20 ? 376  PHE A CB  1 
ATOM   2954  C  CG  . PHE A 1 376  ? -19.355 95.106  26.876  1.00 26.40 ? 376  PHE A CG  1 
ATOM   2955  C  CD1 . PHE A 1 376  ? -18.136 94.626  26.397  1.00 26.29 ? 376  PHE A CD1 1 
ATOM   2956  C  CD2 . PHE A 1 376  ? -19.505 95.310  28.242  1.00 25.97 ? 376  PHE A CD2 1 
ATOM   2957  C  CE1 . PHE A 1 376  ? -17.077 94.353  27.265  1.00 24.40 ? 376  PHE A CE1 1 
ATOM   2958  C  CE2 . PHE A 1 376  ? -18.450 95.040  29.124  1.00 24.78 ? 376  PHE A CE2 1 
ATOM   2959  C  CZ  . PHE A 1 376  ? -17.238 94.554  28.635  1.00 25.57 ? 376  PHE A CZ  1 
ATOM   2960  N  N   . LEU A 1 377  ? -20.883 97.235  22.865  1.00 23.03 ? 377  LEU A N   1 
ATOM   2961  C  CA  . LEU A 1 377  ? -21.686 97.279  21.657  1.00 22.90 ? 377  LEU A CA  1 
ATOM   2962  C  C   . LEU A 1 377  ? -22.177 95.907  21.230  1.00 22.93 ? 377  LEU A C   1 
ATOM   2963  O  O   . LEU A 1 377  ? -21.461 94.919  21.335  1.00 23.32 ? 377  LEU A O   1 
ATOM   2964  C  CB  . LEU A 1 377  ? -20.896 97.942  20.524  1.00 23.30 ? 377  LEU A CB  1 
ATOM   2965  C  CG  . LEU A 1 377  ? -20.719 99.463  20.637  1.00 22.81 ? 377  LEU A CG  1 
ATOM   2966  C  CD1 . LEU A 1 377  ? -19.693 99.807  21.680  1.00 21.33 ? 377  LEU A CD1 1 
ATOM   2967  C  CD2 . LEU A 1 377  ? -20.299 100.017 19.290  1.00 25.62 ? 377  LEU A CD2 1 
ATOM   2968  N  N   . VAL A 1 378  ? -23.406 95.849  20.736  1.00 23.20 ? 378  VAL A N   1 
ATOM   2969  C  CA  . VAL A 1 378  ? -23.981 94.580  20.312  1.00 22.55 ? 378  VAL A CA  1 
ATOM   2970  C  C   . VAL A 1 378  ? -24.705 94.641  18.977  1.00 20.79 ? 378  VAL A C   1 
ATOM   2971  O  O   . VAL A 1 378  ? -25.330 95.642  18.641  1.00 19.56 ? 378  VAL A O   1 
ATOM   2972  C  CB  . VAL A 1 378  ? -24.978 94.081  21.363  1.00 24.95 ? 378  VAL A CB  1 
ATOM   2973  C  CG1 . VAL A 1 378  ? -26.100 93.281  20.708  1.00 25.64 ? 378  VAL A CG1 1 
ATOM   2974  C  CG2 . VAL A 1 378  ? -24.257 93.248  22.393  1.00 25.51 ? 378  VAL A CG2 1 
ATOM   2975  N  N   . ARG A 1 379  ? -24.602 93.548  18.229  1.00 20.61 ? 379  ARG A N   1 
ATOM   2976  C  CA  . ARG A 1 379  ? -25.276 93.385  16.942  1.00 20.83 ? 379  ARG A CA  1 
ATOM   2977  C  C   . ARG A 1 379  ? -25.349 91.886  16.679  1.00 21.31 ? 379  ARG A C   1 
ATOM   2978  O  O   . ARG A 1 379  ? -24.701 91.096  17.360  1.00 20.25 ? 379  ARG A O   1 
ATOM   2979  C  CB  . ARG A 1 379  ? -24.530 94.106  15.800  1.00 19.86 ? 379  ARG A CB  1 
ATOM   2980  C  CG  . ARG A 1 379  ? -23.140 93.594  15.484  1.00 18.32 ? 379  ARG A CG  1 
ATOM   2981  C  CD  . ARG A 1 379  ? -22.452 94.499  14.487  1.00 17.10 ? 379  ARG A CD  1 
ATOM   2982  N  NE  . ARG A 1 379  ? -21.085 94.062  14.231  1.00 20.74 ? 379  ARG A NE  1 
ATOM   2983  C  CZ  . ARG A 1 379  ? -20.246 94.654  13.386  1.00 22.60 ? 379  ARG A CZ  1 
ATOM   2984  N  NH1 . ARG A 1 379  ? -20.635 95.715  12.698  1.00 24.00 ? 379  ARG A NH1 1 
ATOM   2985  N  NH2 . ARG A 1 379  ? -19.006 94.196  13.245  1.00 26.17 ? 379  ARG A NH2 1 
ATOM   2986  N  N   . THR A 1 380  ? -26.139 91.480  15.700  1.00 22.44 ? 380  THR A N   1 
ATOM   2987  C  CA  . THR A 1 380  ? -26.276 90.055  15.423  1.00 24.21 ? 380  THR A CA  1 
ATOM   2988  C  C   . THR A 1 380  ? -25.005 89.481  14.789  1.00 25.32 ? 380  THR A C   1 
ATOM   2989  O  O   . THR A 1 380  ? -24.275 90.182  14.074  1.00 26.58 ? 380  THR A O   1 
ATOM   2990  C  CB  . THR A 1 380  ? -27.452 89.782  14.476  1.00 21.50 ? 380  THR A CB  1 
ATOM   2991  O  OG1 . THR A 1 380  ? -27.104 90.254  13.180  1.00 24.29 ? 380  THR A OG1 1 
ATOM   2992  C  CG2 . THR A 1 380  ? -28.715 90.498  14.935  1.00 20.15 ? 380  THR A CG2 1 
ATOM   2993  N  N   . PRO A 1 381  ? -24.722 88.190  15.050  1.00 25.64 ? 381  PRO A N   1 
ATOM   2994  C  CA  . PRO A 1 381  ? -23.528 87.552  14.478  1.00 25.61 ? 381  PRO A CA  1 
ATOM   2995  C  C   . PRO A 1 381  ? -23.537 87.658  12.962  1.00 26.35 ? 381  PRO A C   1 
ATOM   2996  O  O   . PRO A 1 381  ? -22.488 87.817  12.331  1.00 28.41 ? 381  PRO A O   1 
ATOM   2997  C  CB  . PRO A 1 381  ? -23.640 86.114  14.964  1.00 24.67 ? 381  PRO A CB  1 
ATOM   2998  C  CG  . PRO A 1 381  ? -24.235 86.300  16.325  1.00 24.90 ? 381  PRO A CG  1 
ATOM   2999  C  CD  . PRO A 1 381  ? -25.338 87.315  16.068  1.00 24.26 ? 381  PRO A CD  1 
ATOM   3000  N  N   . THR A 1 382  ? -24.728 87.577  12.380  1.00 24.63 ? 382  THR A N   1 
ATOM   3001  C  CA  . THR A 1 382  ? -24.854 87.693  10.933  1.00 24.64 ? 382  THR A CA  1 
ATOM   3002  C  C   . THR A 1 382  ? -24.210 88.992  10.454  1.00 24.26 ? 382  THR A C   1 
ATOM   3003  O  O   . THR A 1 382  ? -23.451 88.995  9.484   1.00 26.83 ? 382  THR A O   1 
ATOM   3004  C  CB  . THR A 1 382  ? -26.325 87.714  10.483  1.00 22.63 ? 382  THR A CB  1 
ATOM   3005  O  OG1 . THR A 1 382  ? -26.920 86.442  10.743  1.00 22.53 ? 382  THR A OG1 1 
ATOM   3006  C  CG2 . THR A 1 382  ? -26.421 88.008  9.018   1.00 20.99 ? 382  THR A CG2 1 
ATOM   3007  N  N   . GLU A 1 383  ? -24.522 90.089  11.132  1.00 23.68 ? 383  GLU A N   1 
ATOM   3008  C  CA  . GLU A 1 383  ? -23.981 91.388  10.761  1.00 25.57 ? 383  GLU A CA  1 
ATOM   3009  C  C   . GLU A 1 383  ? -22.466 91.457  10.945  1.00 25.25 ? 383  GLU A C   1 
ATOM   3010  O  O   . GLU A 1 383  ? -21.763 92.010  10.104  1.00 23.45 ? 383  GLU A O   1 
ATOM   3011  C  CB  . GLU A 1 383  ? -24.651 92.501  11.570  1.00 25.84 ? 383  GLU A CB  1 
ATOM   3012  C  CG  . GLU A 1 383  ? -26.151 92.604  11.386  1.00 28.44 ? 383  GLU A CG  1 
ATOM   3013  C  CD  . GLU A 1 383  ? -26.565 92.850  9.945   1.00 31.15 ? 383  GLU A CD  1 
ATOM   3014  O  OE1 . GLU A 1 383  ? -25.722 93.339  9.164   1.00 31.34 ? 383  GLU A OE1 1 
ATOM   3015  O  OE2 . GLU A 1 383  ? -27.740 92.571  9.599   1.00 31.71 ? 383  GLU A OE2 1 
ATOM   3016  N  N   . THR A 1 384  ? -21.969 90.902  12.044  1.00 25.47 ? 384  THR A N   1 
ATOM   3017  C  CA  . THR A 1 384  ? -20.535 90.914  12.292  1.00 26.52 ? 384  THR A CA  1 
ATOM   3018  C  C   . THR A 1 384  ? -19.805 90.122  11.210  1.00 28.29 ? 384  THR A C   1 
ATOM   3019  O  O   . THR A 1 384  ? -18.782 90.568  10.691  1.00 26.79 ? 384  THR A O   1 
ATOM   3020  C  CB  . THR A 1 384  ? -20.192 90.308  13.667  1.00 25.77 ? 384  THR A CB  1 
ATOM   3021  O  OG1 . THR A 1 384  ? -20.815 91.078  14.703  1.00 23.14 ? 384  THR A OG1 1 
ATOM   3022  C  CG2 . THR A 1 384  ? -18.693 90.307  13.880  1.00 23.79 ? 384  THR A CG2 1 
ATOM   3023  N  N   . VAL A 1 385  ? -20.331 88.951  10.868  1.00 30.28 ? 385  VAL A N   1 
ATOM   3024  C  CA  . VAL A 1 385  ? -19.699 88.123  9.848   1.00 32.27 ? 385  VAL A CA  1 
ATOM   3025  C  C   . VAL A 1 385  ? -19.650 88.848  8.506   1.00 33.50 ? 385  VAL A C   1 
ATOM   3026  O  O   . VAL A 1 385  ? -18.607 88.921  7.861   1.00 33.45 ? 385  VAL A O   1 
ATOM   3027  C  CB  . VAL A 1 385  ? -20.464 86.813  9.629   1.00 32.74 ? 385  VAL A CB  1 
ATOM   3028  C  CG1 . VAL A 1 385  ? -19.864 86.047  8.467   1.00 34.64 ? 385  VAL A CG1 1 
ATOM   3029  C  CG2 . VAL A 1 385  ? -20.422 85.986  10.869  1.00 34.39 ? 385  VAL A CG2 1 
ATOM   3030  N  N   . LEU A 1 386  ? -20.791 89.386  8.090   1.00 35.05 ? 386  LEU A N   1 
ATOM   3031  C  CA  . LEU A 1 386  ? -20.875 90.067  6.818   1.00 36.91 ? 386  LEU A CA  1 
ATOM   3032  C  C   . LEU A 1 386  ? -20.067 91.355  6.702   1.00 38.84 ? 386  LEU A C   1 
ATOM   3033  O  O   . LEU A 1 386  ? -19.761 91.785  5.594   1.00 40.00 ? 386  LEU A O   1 
ATOM   3034  C  CB  . LEU A 1 386  ? -22.345 90.322  6.464   1.00 36.03 ? 386  LEU A CB  1 
ATOM   3035  C  CG  . LEU A 1 386  ? -23.175 89.043  6.320   1.00 35.03 ? 386  LEU A CG  1 
ATOM   3036  C  CD1 . LEU A 1 386  ? -24.530 89.381  5.738   1.00 35.17 ? 386  LEU A CD1 1 
ATOM   3037  C  CD2 . LEU A 1 386  ? -22.452 88.048  5.427   1.00 34.65 ? 386  LEU A CD2 1 
ATOM   3038  N  N   . GLN A 1 387  ? -19.707 91.975  7.820   1.00 41.16 ? 387  GLN A N   1 
ATOM   3039  C  CA  . GLN A 1 387  ? -18.922 93.202  7.740   1.00 42.69 ? 387  GLN A CA  1 
ATOM   3040  C  C   . GLN A 1 387  ? -17.421 92.977  7.939   1.00 43.35 ? 387  GLN A C   1 
ATOM   3041  O  O   . GLN A 1 387  ? -16.608 93.675  7.343   1.00 43.34 ? 387  GLN A O   1 
ATOM   3042  C  CB  . GLN A 1 387  ? -19.416 94.245  8.752   1.00 43.16 ? 387  GLN A CB  1 
ATOM   3043  C  CG  . GLN A 1 387  ? -19.302 95.681  8.226   1.00 46.55 ? 387  GLN A CG  1 
ATOM   3044  C  CD  . GLN A 1 387  ? -19.196 96.755  9.317   1.00 47.80 ? 387  GLN A CD  1 
ATOM   3045  O  OE1 . GLN A 1 387  ? -19.175 97.952  9.013   1.00 47.56 ? 387  GLN A OE1 1 
ATOM   3046  N  NE2 . GLN A 1 387  ? -19.120 96.334  10.583  1.00 47.97 ? 387  GLN A NE2 1 
ATOM   3047  N  N   . GLU A 1 388  ? -17.052 91.991  8.751   1.00 45.13 ? 388  GLU A N   1 
ATOM   3048  C  CA  . GLU A 1 388  ? -15.642 91.729  9.038   1.00 47.17 ? 388  GLU A CA  1 
ATOM   3049  C  C   . GLU A 1 388  ? -14.981 90.684  8.153   1.00 48.36 ? 388  GLU A C   1 
ATOM   3050  O  O   . GLU A 1 388  ? -13.782 90.425  8.272   1.00 49.10 ? 388  GLU A O   1 
ATOM   3051  C  CB  . GLU A 1 388  ? -15.478 91.301  10.498  1.00 47.89 ? 388  GLU A CB  1 
ATOM   3052  C  CG  . GLU A 1 388  ? -16.165 92.212  11.509  1.00 50.85 ? 388  GLU A CG  1 
ATOM   3053  C  CD  . GLU A 1 388  ? -15.781 93.683  11.373  1.00 51.89 ? 388  GLU A CD  1 
ATOM   3054  O  OE1 . GLU A 1 388  ? -14.580 94.006  11.490  1.00 51.81 ? 388  GLU A OE1 1 
ATOM   3055  O  OE2 . GLU A 1 388  ? -16.687 94.521  11.156  1.00 52.84 ? 388  GLU A OE2 1 
ATOM   3056  N  N   . TYR A 1 389  ? -15.742 90.076  7.264   1.00 49.42 ? 389  TYR A N   1 
ATOM   3057  C  CA  . TYR A 1 389  ? -15.159 89.063  6.405   1.00 51.05 ? 389  TYR A CA  1 
ATOM   3058  C  C   . TYR A 1 389  ? -15.624 89.322  5.007   1.00 51.85 ? 389  TYR A C   1 
ATOM   3059  O  O   . TYR A 1 389  ? -15.972 88.405  4.287   1.00 50.76 ? 389  TYR A O   1 
ATOM   3060  C  CB  . TYR A 1 389  ? -15.638 87.681  6.847   1.00 51.84 ? 389  TYR A CB  1 
ATOM   3061  C  CG  . TYR A 1 389  ? -15.167 87.291  8.226   1.00 53.22 ? 389  TYR A CG  1 
ATOM   3062  C  CD1 . TYR A 1 389  ? -13.841 86.939  8.449   1.00 54.21 ? 389  TYR A CD1 1 
ATOM   3063  C  CD2 . TYR A 1 389  ? -16.030 87.319  9.317   1.00 53.94 ? 389  TYR A CD2 1 
ATOM   3064  C  CE1 . TYR A 1 389  ? -13.380 86.625  9.719   1.00 55.11 ? 389  TYR A CE1 1 
ATOM   3065  C  CE2 . TYR A 1 389  ? -15.579 87.010  10.601  1.00 54.96 ? 389  TYR A CE2 1 
ATOM   3066  C  CZ  . TYR A 1 389  ? -14.250 86.665  10.792  1.00 55.63 ? 389  TYR A CZ  1 
ATOM   3067  O  OH  . TYR A 1 389  ? -13.782 86.362  12.050  1.00 54.98 ? 389  TYR A OH  1 
ATOM   3068  N  N   . THR A 1 390  ? -15.607 90.546  4.555   1.00 54.10 ? 390  THR A N   1 
ATOM   3069  C  CA  . THR A 1 390  ? -16.188 90.636  3.262   1.00 56.44 ? 390  THR A CA  1 
ATOM   3070  C  C   . THR A 1 390  ? -15.274 91.127  2.168   1.00 58.47 ? 390  THR A C   1 
ATOM   3071  O  O   . THR A 1 390  ? -15.294 90.608  1.043   1.00 59.43 ? 390  THR A O   1 
ATOM   3072  C  CB  . THR A 1 390  ? -17.499 91.420  3.420   1.00 55.69 ? 390  THR A CB  1 
ATOM   3073  O  OG1 . THR A 1 390  ? -18.535 90.727  2.728   1.00 55.64 ? 390  THR A OG1 1 
ATOM   3074  C  CG2 . THR A 1 390  ? -17.358 92.847  2.948   1.00 56.20 ? 390  THR A CG2 1 
ATOM   3075  N  N   . GLN A 1 391  ? -14.406 92.058  2.526   1.00 59.74 ? 391  GLN A N   1 
ATOM   3076  C  CA  . GLN A 1 391  ? -13.489 92.627  1.565   1.00 62.60 ? 391  GLN A CA  1 
ATOM   3077  C  C   . GLN A 1 391  ? -12.037 92.256  1.840   1.00 61.93 ? 391  GLN A C   1 
ATOM   3078  O  O   . GLN A 1 391  ? -11.581 92.216  2.993   1.00 62.73 ? 391  GLN A O   1 
ATOM   3079  C  CB  . GLN A 1 391  ? -13.641 94.158  1.531   1.00 64.91 ? 391  GLN A CB  1 
ATOM   3080  C  CG  . GLN A 1 391  ? -15.075 94.636  1.222   1.00 67.64 ? 391  GLN A CG  1 
ATOM   3081  C  CD  . GLN A 1 391  ? -15.142 96.241  1.204   1.00 69.33 ? 391  GLN A CD  1 
ATOM   3082  O  OE1 . GLN A 1 391  ? -14.479 96.807  1.978   1.00 71.42 ? 391  GLN A OE1 1 
ATOM   3083  N  NE2 . GLN A 1 391  ? -15.937 96.795  0.321   1.00 69.64 ? 391  GLN A NE2 1 
ATOM   3084  N  N   . SER A 1 392  ? -11.331 92.000  0.756   1.00 60.87 ? 392  SER A N   1 
ATOM   3085  C  CA  . SER A 1 392  ? -9.921  91.641  0.780   1.00 60.14 ? 392  SER A CA  1 
ATOM   3086  C  C   . SER A 1 392  ? -9.111  92.935  0.704   1.00 58.70 ? 392  SER A C   1 
ATOM   3087  O  O   . SER A 1 392  ? -9.654  94.001  0.432   1.00 58.72 ? 392  SER A O   1 
ATOM   3088  C  CB  . SER A 1 392  ? -9.589  90.746  -0.422  1.00 60.94 ? 392  SER A CB  1 
ATOM   3089  O  OG  . SER A 1 392  ? -10.339 89.541  -0.398  1.00 61.41 ? 392  SER A OG  1 
ATOM   3090  N  N   . PRO A 1 393  ? -7.800  92.860  0.953   1.00 57.04 ? 393  PRO A N   1 
ATOM   3091  C  CA  . PRO A 1 393  ? -6.978  94.071  0.891   1.00 55.40 ? 393  PRO A CA  1 
ATOM   3092  C  C   . PRO A 1 393  ? -6.677  94.421  -0.562  1.00 53.17 ? 393  PRO A C   1 
ATOM   3093  O  O   . PRO A 1 393  ? -6.649  93.536  -1.421  1.00 53.75 ? 393  PRO A O   1 
ATOM   3094  C  CB  . PRO A 1 393  ? -5.718  93.655  1.643   1.00 56.55 ? 393  PRO A CB  1 
ATOM   3095  C  CG  . PRO A 1 393  ? -5.562  92.217  1.209   1.00 56.22 ? 393  PRO A CG  1 
ATOM   3096  C  CD  . PRO A 1 393  ? -6.988  91.692  1.347   1.00 56.58 ? 393  PRO A CD  1 
ATOM   3097  N  N   . GLU A 1 394  ? -6.461  95.698  -0.849  1.00 50.23 ? 394  GLU A N   1 
ATOM   3098  C  CA  . GLU A 1 394  ? -6.130  96.076  -2.211  1.00 47.00 ? 394  GLU A CA  1 
ATOM   3099  C  C   . GLU A 1 394  ? -4.622  96.120  -2.350  1.00 44.62 ? 394  GLU A C   1 
ATOM   3100  O  O   . GLU A 1 394  ? -3.971  97.032  -1.836  1.00 44.18 ? 394  GLU A O   1 
ATOM   3101  C  CB  . GLU A 1 394  ? -6.697  97.451  -2.568  1.00 47.64 ? 394  GLU A CB  1 
ATOM   3102  C  CG  . GLU A 1 394  ? -6.288  97.921  -3.969  1.00 49.30 ? 394  GLU A CG  1 
ATOM   3103  C  CD  . GLU A 1 394  ? -6.838  99.293  -4.332  1.00 51.82 ? 394  GLU A CD  1 
ATOM   3104  O  OE1 . GLU A 1 394  ? -7.539  99.900  -3.486  1.00 50.66 ? 394  GLU A OE1 1 
ATOM   3105  O  OE2 . GLU A 1 394  ? -6.579  99.753  -5.471  1.00 51.84 ? 394  GLU A OE2 1 
ATOM   3106  N  N   . ILE A 1 395  ? -4.059  95.108  -3.008  1.00 41.69 ? 395  ILE A N   1 
ATOM   3107  C  CA  . ILE A 1 395  ? -2.618  95.083  -3.243  1.00 39.65 ? 395  ILE A CA  1 
ATOM   3108  C  C   . ILE A 1 395  ? -2.313  95.945  -4.456  1.00 38.67 ? 395  ILE A C   1 
ATOM   3109  O  O   . ILE A 1 395  ? -2.502  95.532  -5.591  1.00 38.91 ? 395  ILE A O   1 
ATOM   3110  C  CB  . ILE A 1 395  ? -2.112  93.648  -3.480  1.00 40.24 ? 395  ILE A CB  1 
ATOM   3111  C  CG1 . ILE A 1 395  ? -2.452  92.776  -2.267  1.00 40.73 ? 395  ILE A CG1 1 
ATOM   3112  C  CG2 . ILE A 1 395  ? -0.610  93.670  -3.721  1.00 39.30 ? 395  ILE A CG2 1 
ATOM   3113  C  CD1 . ILE A 1 395  ? -2.140  91.308  -2.469  1.00 42.67 ? 395  ILE A CD1 1 
ATOM   3114  N  N   . LYS A 1 396  ? -1.870  97.185  -4.210  1.00 37.16 ? 396  LYS A N   1 
ATOM   3115  C  CA  . LYS A 1 396  ? -1.612  98.090  -5.310  1.00 35.52 ? 396  LYS A CA  1 
ATOM   3116  C  C   . LYS A 1 396  ? -0.442  97.702  -6.202  1.00 33.92 ? 396  LYS A C   1 
ATOM   3117  O  O   . LYS A 1 396  ? -0.445  98.030  -7.386  1.00 32.44 ? 396  LYS A O   1 
ATOM   3118  C  CB  . LYS A 1 396  ? -1.454  99.522  -4.798  1.00 35.51 ? 396  LYS A CB  1 
ATOM   3119  C  CG  . LYS A 1 396  ? -2.782  100.211 -4.505  1.00 36.20 ? 396  LYS A CG  1 
ATOM   3120  C  CD  . LYS A 1 396  ? -2.562  101.687 -4.196  1.00 37.50 ? 396  LYS A CD  1 
ATOM   3121  C  CE  . LYS A 1 396  ? -3.841  102.493 -4.317  1.00 37.58 ? 396  LYS A CE  1 
ATOM   3122  N  NZ  . LYS A 1 396  ? -3.563  103.955 -4.387  1.00 37.06 ? 396  LYS A NZ  1 
ATOM   3123  N  N   . VAL A 1 397  ? 0.555   97.019  -5.642  1.00 31.75 ? 397  VAL A N   1 
ATOM   3124  C  CA  . VAL A 1 397  ? 1.703   96.556  -6.420  1.00 29.50 ? 397  VAL A CA  1 
ATOM   3125  C  C   . VAL A 1 397  ? 1.843   95.045  -6.201  1.00 28.88 ? 397  VAL A C   1 
ATOM   3126  O  O   . VAL A 1 397  ? 2.691   94.598  -5.442  1.00 28.41 ? 397  VAL A O   1 
ATOM   3127  C  CB  . VAL A 1 397  ? 3.025   97.232  -5.986  1.00 30.53 ? 397  VAL A CB  1 
ATOM   3128  C  CG1 . VAL A 1 397  ? 4.101   97.010  -7.064  1.00 28.40 ? 397  VAL A CG1 1 
ATOM   3129  C  CG2 . VAL A 1 397  ? 2.818   98.708  -5.750  1.00 29.39 ? 397  VAL A CG2 1 
ATOM   3130  N  N   . PRO A 1 398  ? 1.015   94.244  -6.879  1.00 28.37 ? 398  PRO A N   1 
ATOM   3131  C  CA  . PRO A 1 398  ? 1.045   92.784  -6.751  1.00 28.63 ? 398  PRO A CA  1 
ATOM   3132  C  C   . PRO A 1 398  ? 2.397   92.178  -7.075  1.00 29.07 ? 398  PRO A C   1 
ATOM   3133  O  O   . PRO A 1 398  ? 3.255   92.809  -7.698  1.00 28.83 ? 398  PRO A O   1 
ATOM   3134  C  CB  . PRO A 1 398  ? -0.015  92.314  -7.752  1.00 27.64 ? 398  PRO A CB  1 
ATOM   3135  C  CG  . PRO A 1 398  ? -0.900  93.513  -7.937  1.00 28.63 ? 398  PRO A CG  1 
ATOM   3136  C  CD  . PRO A 1 398  ? 0.078   94.653  -7.938  1.00 28.46 ? 398  PRO A CD  1 
ATOM   3137  N  N   . ILE A 1 399  ? 2.586   90.942  -6.649  1.00 29.72 ? 399  ILE A N   1 
ATOM   3138  C  CA  . ILE A 1 399  ? 3.821   90.250  -6.945  1.00 29.81 ? 399  ILE A CA  1 
ATOM   3139  C  C   . ILE A 1 399  ? 3.631   89.710  -8.360  1.00 31.86 ? 399  ILE A C   1 
ATOM   3140  O  O   . ILE A 1 399  ? 2.661   88.999  -8.638  1.00 31.42 ? 399  ILE A O   1 
ATOM   3141  C  CB  . ILE A 1 399  ? 4.061   89.099  -5.951  1.00 27.53 ? 399  ILE A CB  1 
ATOM   3142  C  CG1 . ILE A 1 399  ? 4.293   89.684  -4.550  1.00 25.83 ? 399  ILE A CG1 1 
ATOM   3143  C  CG2 . ILE A 1 399  ? 5.226   88.259  -6.408  1.00 22.02 ? 399  ILE A CG2 1 
ATOM   3144  C  CD1 . ILE A 1 399  ? 4.179   88.672  -3.419  1.00 25.10 ? 399  ILE A CD1 1 
ATOM   3145  N  N   . PRO A 1 400  ? 4.542   90.068  -9.280  1.00 33.36 ? 400  PRO A N   1 
ATOM   3146  C  CA  . PRO A 1 400  ? 4.448   89.608  -10.666 1.00 34.16 ? 400  PRO A CA  1 
ATOM   3147  C  C   . PRO A 1 400  ? 4.267   88.095  -10.711 1.00 35.28 ? 400  PRO A C   1 
ATOM   3148  O  O   . PRO A 1 400  ? 4.898   87.369  -9.946  1.00 35.04 ? 400  PRO A O   1 
ATOM   3149  C  CB  . PRO A 1 400  ? 5.789   90.041  -11.270 1.00 34.65 ? 400  PRO A CB  1 
ATOM   3150  C  CG  . PRO A 1 400  ? 6.128   91.268  -10.500 1.00 33.58 ? 400  PRO A CG  1 
ATOM   3151  C  CD  . PRO A 1 400  ? 5.762   90.871  -9.074  1.00 34.13 ? 400  PRO A CD  1 
ATOM   3152  N  N   . GLN A 1 401  ? 3.402   87.636  -11.609 1.00 36.05 ? 401  GLN A N   1 
ATOM   3153  C  CA  . GLN A 1 401  ? 3.137   86.219  -11.793 1.00 37.25 ? 401  GLN A CA  1 
ATOM   3154  C  C   . GLN A 1 401  ? 4.415   85.479  -12.226 1.00 37.20 ? 401  GLN A C   1 
ATOM   3155  O  O   . GLN A 1 401  ? 4.681   84.355  -11.786 1.00 36.66 ? 401  GLN A O   1 
ATOM   3156  C  CB  . GLN A 1 401  ? 2.052   86.057  -12.852 1.00 39.08 ? 401  GLN A CB  1 
ATOM   3157  C  CG  . GLN A 1 401  ? 1.515   84.659  -13.022 1.00 45.32 ? 401  GLN A CG  1 
ATOM   3158  C  CD  . GLN A 1 401  ? 0.386   84.610  -14.043 1.00 50.36 ? 401  GLN A CD  1 
ATOM   3159  O  OE1 . GLN A 1 401  ? -0.595  85.363  -13.943 1.00 52.80 ? 401  GLN A OE1 1 
ATOM   3160  N  NE2 . GLN A 1 401  ? 0.515   83.724  -15.034 1.00 51.41 ? 401  GLN A NE2 1 
ATOM   3161  N  N   . LYS A 1 402  ? 5.212   86.124  -13.077 1.00 37.08 ? 402  LYS A N   1 
ATOM   3162  C  CA  . LYS A 1 402  ? 6.450   85.528  -13.569 1.00 37.09 ? 402  LYS A CA  1 
ATOM   3163  C  C   . LYS A 1 402  ? 7.535   85.384  -12.512 1.00 35.71 ? 402  LYS A C   1 
ATOM   3164  O  O   . LYS A 1 402  ? 8.565   84.762  -12.770 1.00 35.37 ? 402  LYS A O   1 
ATOM   3165  C  CB  . LYS A 1 402  ? 7.004   86.341  -14.739 1.00 37.18 ? 402  LYS A CB  1 
ATOM   3166  C  CG  . LYS A 1 402  ? 7.327   87.787  -14.399 1.00 39.95 ? 402  LYS A CG  1 
ATOM   3167  C  CD  . LYS A 1 402  ? 8.093   88.466  -15.527 1.00 40.71 ? 402  LYS A CD  1 
ATOM   3168  C  CE  . LYS A 1 402  ? 8.331   89.942  -15.230 1.00 42.87 ? 402  LYS A CE  1 
ATOM   3169  N  NZ  . LYS A 1 402  ? 9.057   90.152  -13.941 1.00 43.20 ? 402  LYS A NZ  1 
ATOM   3170  N  N   . ASP A 1 403  ? 7.318   85.953  -11.328 1.00 34.70 ? 403  ASP A N   1 
ATOM   3171  C  CA  . ASP A 1 403  ? 8.321   85.858  -10.273 1.00 33.58 ? 403  ASP A CA  1 
ATOM   3172  C  C   . ASP A 1 403  ? 8.202   84.592  -9.408  1.00 32.64 ? 403  ASP A C   1 
ATOM   3173  O  O   . ASP A 1 403  ? 8.973   84.393  -8.470  1.00 31.38 ? 403  ASP A O   1 
ATOM   3174  C  CB  . ASP A 1 403  ? 8.297   87.116  -9.397  1.00 34.24 ? 403  ASP A CB  1 
ATOM   3175  C  CG  . ASP A 1 403  ? 8.843   88.339  -10.118 1.00 34.48 ? 403  ASP A CG  1 
ATOM   3176  O  OD1 . ASP A 1 403  ? 9.490   88.173  -11.182 1.00 34.53 ? 403  ASP A OD1 1 
ATOM   3177  O  OD2 . ASP A 1 403  ? 8.633   89.462  -9.615  1.00 33.59 ? 403  ASP A OD2 1 
ATOM   3178  N  N   . TRP A 1 404  ? 7.237   83.737  -9.736  1.00 31.64 ? 404  TRP A N   1 
ATOM   3179  C  CA  . TRP A 1 404  ? 7.057   82.484  -9.015  1.00 30.92 ? 404  TRP A CA  1 
ATOM   3180  C  C   . TRP A 1 404  ? 7.588   81.307  -9.850  1.00 31.32 ? 404  TRP A C   1 
ATOM   3181  O  O   . TRP A 1 404  ? 7.447   81.293  -11.076 1.00 31.33 ? 404  TRP A O   1 
ATOM   3182  C  CB  . TRP A 1 404  ? 5.577   82.240  -8.703  1.00 29.19 ? 404  TRP A CB  1 
ATOM   3183  C  CG  . TRP A 1 404  ? 4.948   83.250  -7.818  1.00 28.14 ? 404  TRP A CG  1 
ATOM   3184  C  CD1 . TRP A 1 404  ? 4.117   84.273  -8.195  1.00 28.16 ? 404  TRP A CD1 1 
ATOM   3185  C  CD2 . TRP A 1 404  ? 5.081   83.348  -6.397  1.00 27.78 ? 404  TRP A CD2 1 
ATOM   3186  N  NE1 . TRP A 1 404  ? 3.722   84.996  -7.097  1.00 26.30 ? 404  TRP A NE1 1 
ATOM   3187  C  CE2 . TRP A 1 404  ? 4.297   84.450  -5.976  1.00 28.58 ? 404  TRP A CE2 1 
ATOM   3188  C  CE3 . TRP A 1 404  ? 5.780   82.609  -5.432  1.00 27.67 ? 404  TRP A CE3 1 
ATOM   3189  C  CZ2 . TRP A 1 404  ? 4.203   84.837  -4.625  1.00 28.09 ? 404  TRP A CZ2 1 
ATOM   3190  C  CZ3 . TRP A 1 404  ? 5.685   82.991  -4.095  1.00 26.75 ? 404  TRP A CZ3 1 
ATOM   3191  C  CH2 . TRP A 1 404  ? 4.902   84.091  -3.704  1.00 26.31 ? 404  TRP A CH2 1 
ATOM   3192  N  N   . THR A 1 405  ? 8.195   80.323  -9.185  1.00 30.50 ? 405  THR A N   1 
ATOM   3193  C  CA  . THR A 1 405  ? 8.704   79.151  -9.884  1.00 30.21 ? 405  THR A CA  1 
ATOM   3194  C  C   . THR A 1 405  ? 7.528   78.212  -10.088 1.00 29.35 ? 405  THR A C   1 
ATOM   3195  O  O   . THR A 1 405  ? 6.387   78.559  -9.778  1.00 25.91 ? 405  THR A O   1 
ATOM   3196  C  CB  . THR A 1 405  ? 9.759   78.371  -9.058  1.00 30.72 ? 405  THR A CB  1 
ATOM   3197  O  OG1 . THR A 1 405  ? 9.136   77.833  -7.882  1.00 33.20 ? 405  THR A OG1 1 
ATOM   3198  C  CG2 . THR A 1 405  ? 10.926  79.262  -8.669  1.00 30.84 ? 405  THR A CG2 1 
ATOM   3199  N  N   . GLY A 1 406  ? 7.816   77.028  -10.620 1.00 30.68 ? 406  GLY A N   1 
ATOM   3200  C  CA  . GLY A 1 406  ? 6.774   76.038  -10.807 1.00 32.33 ? 406  GLY A CA  1 
ATOM   3201  C  C   . GLY A 1 406  ? 6.444   75.569  -9.401  1.00 33.86 ? 406  GLY A C   1 
ATOM   3202  O  O   . GLY A 1 406  ? 7.196   75.880  -8.471  1.00 34.64 ? 406  GLY A O   1 
ATOM   3203  N  N   . PRO A 1 407  ? 5.352   74.819  -9.200  1.00 33.38 ? 407  PRO A N   1 
ATOM   3204  C  CA  . PRO A 1 407  ? 5.003   74.361  -7.855  1.00 34.29 ? 407  PRO A CA  1 
ATOM   3205  C  C   . PRO A 1 407  ? 5.878   73.256  -7.272  1.00 35.04 ? 407  PRO A C   1 
ATOM   3206  O  O   . PRO A 1 407  ? 6.471   72.455  -8.000  1.00 34.93 ? 407  PRO A O   1 
ATOM   3207  C  CB  . PRO A 1 407  ? 3.559   73.881  -8.011  1.00 34.33 ? 407  PRO A CB  1 
ATOM   3208  C  CG  . PRO A 1 407  ? 3.086   74.524  -9.289  1.00 34.76 ? 407  PRO A CG  1 
ATOM   3209  C  CD  . PRO A 1 407  ? 4.298   74.463  -10.158 1.00 33.78 ? 407  PRO A CD  1 
ATOM   3210  N  N   . ILE A 1 408  ? 6.021   73.299  -6.024  1.00 34.67 ? 408  ILE A N   1 
ATOM   3211  C  CA  . ILE A 1 408  ? 6.595   72.247  -5.198  1.00 35.82 ? 408  ILE A CA  1 
ATOM   3212  C  C   . ILE A 1 408  ? 5.541   71.713  -4.217  1.00 35.13 ? 408  ILE A C   1 
ATOM   3213  O  O   . ILE A 1 408  ? 5.407   72.250  -3.162  1.00 37.15 ? 408  ILE A O   1 
ATOM   3214  C  CB  . ILE A 1 408  ? 7.842   72.719  -4.441  1.00 37.46 ? 408  ILE A CB  1 
ATOM   3215  C  CG1 . ILE A 1 408  ? 8.926   73.157  -5.427  1.00 39.58 ? 408  ILE A CG1 1 
ATOM   3216  C  CG2 . ILE A 1 408  ? 8.354   71.614  -3.529  1.00 36.13 ? 408  ILE A CG2 1 
ATOM   3217  C  CD1 . ILE A 1 408  ? 10.105  73.844  -4.775  1.00 41.16 ? 408  ILE A CD1 1 
ATOM   3218  N  N   . GLY A 1 409  ? 4.654   70.951  -4.829  1.00 34.32 ? 409  GLY A N   1 
ATOM   3219  C  CA  . GLY A 1 409  ? 3.496   70.518  -4.083  1.00 32.97 ? 409  GLY A CA  1 
ATOM   3220  C  C   . GLY A 1 409  ? 2.420   71.592  -4.149  1.00 33.76 ? 409  GLY A C   1 
ATOM   3221  O  O   . GLY A 1 409  ? 1.807   71.812  -5.183  1.00 33.77 ? 409  GLY A O   1 
ATOM   3222  N  N   . GLU A 1 410  ? 2.212   72.280  -3.040  1.00 34.06 ? 410  GLU A N   1 
ATOM   3223  C  CA  . GLU A 1 410  ? 1.206   73.324  -2.953  1.00 35.27 ? 410  GLU A CA  1 
ATOM   3224  C  C   . GLU A 1 410  ? 1.811   74.719  -3.056  1.00 35.02 ? 410  GLU A C   1 
ATOM   3225  O  O   . GLU A 1 410  ? 1.104   75.684  -3.328  1.00 35.47 ? 410  GLU A O   1 
ATOM   3226  C  CB  . GLU A 1 410  ? 0.461   73.214  -1.616  1.00 36.03 ? 410  GLU A CB  1 
ATOM   3227  C  CG  . GLU A 1 410  ? -0.427  71.992  -1.456  1.00 37.47 ? 410  GLU A CG  1 
ATOM   3228  C  CD  . GLU A 1 410  ? -1.785  72.170  -2.104  1.00 39.02 ? 410  GLU A CD  1 
ATOM   3229  O  OE1 . GLU A 1 410  ? -2.185  73.334  -2.338  1.00 38.34 ? 410  GLU A OE1 1 
ATOM   3230  O  OE2 . GLU A 1 410  ? -2.460  71.147  -2.359  1.00 39.02 ? 410  GLU A OE2 1 
ATOM   3231  N  N   . ILE A 1 411  ? 3.114   74.828  -2.845  1.00 34.47 ? 411  ILE A N   1 
ATOM   3232  C  CA  . ILE A 1 411  ? 3.758   76.138  -2.875  1.00 34.45 ? 411  ILE A CA  1 
ATOM   3233  C  C   . ILE A 1 411  ? 4.643   76.424  -4.078  1.00 34.63 ? 411  ILE A C   1 
ATOM   3234  O  O   . ILE A 1 411  ? 5.047   75.523  -4.810  1.00 36.44 ? 411  ILE A O   1 
ATOM   3235  C  CB  . ILE A 1 411  ? 4.619   76.340  -1.627  1.00 33.72 ? 411  ILE A CB  1 
ATOM   3236  C  CG1 . ILE A 1 411  ? 5.738   75.302  -1.603  1.00 33.04 ? 411  ILE A CG1 1 
ATOM   3237  C  CG2 . ILE A 1 411  ? 3.782   76.202  -0.382  1.00 33.10 ? 411  ILE A CG2 1 
ATOM   3238  C  CD1 . ILE A 1 411  ? 7.025   75.784  -2.217  1.00 33.60 ? 411  ILE A CD1 1 
ATOM   3239  N  N   . ARG A 1 412  ? 4.950   77.702  -4.249  1.00 34.15 ? 412  ARG A N   1 
ATOM   3240  C  CA  . ARG A 1 412  ? 5.810   78.186  -5.316  1.00 33.53 ? 412  ARG A CA  1 
ATOM   3241  C  C   . ARG A 1 412  ? 6.893   79.054  -4.671  1.00 32.46 ? 412  ARG A C   1 
ATOM   3242  O  O   . ARG A 1 412  ? 6.618   79.839  -3.757  1.00 32.03 ? 412  ARG A O   1 
ATOM   3243  C  CB  . ARG A 1 412  ? 5.009   79.026  -6.308  1.00 34.39 ? 412  ARG A CB  1 
ATOM   3244  C  CG  . ARG A 1 412  ? 4.257   78.236  -7.347  1.00 36.95 ? 412  ARG A CG  1 
ATOM   3245  C  CD  . ARG A 1 412  ? 3.000   78.977  -7.749  1.00 42.23 ? 412  ARG A CD  1 
ATOM   3246  N  NE  . ARG A 1 412  ? 2.156   78.191  -8.643  1.00 47.83 ? 412  ARG A NE  1 
ATOM   3247  C  CZ  . ARG A 1 412  ? 2.450   77.921  -9.912  1.00 51.10 ? 412  ARG A CZ  1 
ATOM   3248  N  NH1 . ARG A 1 412  ? 3.578   78.370  -10.455 1.00 52.27 ? 412  ARG A NH1 1 
ATOM   3249  N  NH2 . ARG A 1 412  ? 1.609   77.200  -10.644 1.00 52.54 ? 412  ARG A NH2 1 
ATOM   3250  N  N   . ILE A 1 413  ? 8.124   78.905  -5.134  1.00 30.64 ? 413  ILE A N   1 
ATOM   3251  C  CA  . ILE A 1 413  ? 9.212   79.691  -4.590  1.00 30.79 ? 413  ILE A CA  1 
ATOM   3252  C  C   . ILE A 1 413  ? 9.260   81.054  -5.276  1.00 30.58 ? 413  ILE A C   1 
ATOM   3253  O  O   . ILE A 1 413  ? 8.989   81.173  -6.472  1.00 28.66 ? 413  ILE A O   1 
ATOM   3254  C  CB  . ILE A 1 413  ? 10.559  78.966  -4.766  1.00 31.05 ? 413  ILE A CB  1 
ATOM   3255  C  CG1 . ILE A 1 413  ? 10.533  77.648  -3.986  1.00 32.94 ? 413  ILE A CG1 1 
ATOM   3256  C  CG2 . ILE A 1 413  ? 11.696  79.848  -4.272  1.00 30.76 ? 413  ILE A CG2 1 
ATOM   3257  C  CD1 . ILE A 1 413  ? 11.785  76.799  -4.152  1.00 32.19 ? 413  ILE A CD1 1 
ATOM   3258  N  N   . LEU A 1 414  ? 9.575   82.083  -4.497  1.00 30.41 ? 414  LEU A N   1 
ATOM   3259  C  CA  . LEU A 1 414  ? 9.678   83.438  -5.010  1.00 32.06 ? 414  LEU A CA  1 
ATOM   3260  C  C   . LEU A 1 414  ? 11.107  83.596  -5.541  1.00 33.28 ? 414  LEU A C   1 
ATOM   3261  O  O   . LEU A 1 414  ? 12.076  83.553  -4.779  1.00 32.96 ? 414  LEU A O   1 
ATOM   3262  C  CB  . LEU A 1 414  ? 9.379   84.429  -3.880  1.00 30.97 ? 414  LEU A CB  1 
ATOM   3263  C  CG  . LEU A 1 414  ? 8.961   85.887  -4.145  1.00 32.44 ? 414  LEU A CG  1 
ATOM   3264  C  CD1 . LEU A 1 414  ? 10.130  86.795  -3.927  1.00 32.92 ? 414  LEU A CD1 1 
ATOM   3265  C  CD2 . LEU A 1 414  ? 8.374   86.052  -5.544  1.00 29.97 ? 414  LEU A CD2 1 
ATOM   3266  N  N   . LYS A 1 415  ? 11.230  83.747  -6.856  1.00 34.98 ? 415  LYS A N   1 
ATOM   3267  C  CA  . LYS A 1 415  ? 12.538  83.885  -7.493  1.00 36.99 ? 415  LYS A CA  1 
ATOM   3268  C  C   . LYS A 1 415  ? 13.392  84.978  -6.860  1.00 37.61 ? 415  LYS A C   1 
ATOM   3269  O  O   . LYS A 1 415  ? 12.849  85.947  -6.301  1.00 36.57 ? 415  LYS A O   1 
ATOM   3270  C  CB  . LYS A 1 415  ? 12.377  84.149  -8.999  1.00 37.02 ? 415  LYS A CB  1 
ATOM   3271  C  CG  . LYS A 1 415  ? 11.661  83.033  -9.752  1.00 38.95 ? 415  LYS A CG  1 
ATOM   3272  C  CD  . LYS A 1 415  ? 11.609  83.290  -11.254 1.00 41.12 ? 415  LYS A CD  1 
ATOM   3273  C  CE  . LYS A 1 415  ? 10.709  82.277  -11.949 1.00 43.72 ? 415  LYS A CE  1 
ATOM   3274  N  NZ  . LYS A 1 415  ? 10.584  82.551  -13.410 1.00 45.45 ? 415  LYS A NZ  1 
ATOM   3275  N  N   . ASP A 1 416  ? 14.706  84.830  -6.909  1.00 40.34 ? 416  ASP A N   1 
ATOM   3276  C  CA  . ASP A 1 416  ? 15.541  85.880  -6.312  1.00 42.77 ? 416  ASP A CA  1 
ATOM   3277  C  C   . ASP A 1 416  ? 15.708  86.953  -7.283  1.00 43.09 ? 416  ASP A C   1 
ATOM   3278  O  O   . ASP A 1 416  ? 16.432  87.887  -7.091  1.00 42.81 ? 416  ASP A O   1 
ATOM   3279  C  CB  . ASP A 1 416  ? 16.976  85.507  -5.930  1.00 45.82 ? 416  ASP A CB  1 
ATOM   3280  C  CG  . ASP A 1 416  ? 17.449  84.230  -6.560  1.00 49.38 ? 416  ASP A CG  1 
ATOM   3281  O  OD1 . ASP A 1 416  ? 16.712  83.226  -6.535  1.00 53.03 ? 416  ASP A OD1 1 
ATOM   3282  O  OD2 . ASP A 1 416  ? 18.588  84.212  -7.069  1.00 49.54 ? 416  ASP A OD2 1 
ATOM   3283  N  N   . THR A 1 417  ? 14.999  86.833  -8.383  1.00 43.63 ? 417  THR A N   1 
ATOM   3284  C  CA  . THR A 1 417  ? 15.177  87.841  -9.381  1.00 42.96 ? 417  THR A CA  1 
ATOM   3285  C  C   . THR A 1 417  ? 14.203  88.893  -9.180  1.00 42.59 ? 417  THR A C   1 
ATOM   3286  O  O   . THR A 1 417  ? 14.256  89.999  -9.700  1.00 43.01 ? 417  THR A O   1 
ATOM   3287  C  CB  . THR A 1 417  ? 14.876  87.249  -10.747 1.00 44.23 ? 417  THR A CB  1 
ATOM   3288  O  OG1 . THR A 1 417  ? 13.521  86.751  -10.772 1.00 44.69 ? 417  THR A OG1 1 
ATOM   3289  C  CG2 . THR A 1 417  ? 15.845  86.111  -11.042 1.00 43.92 ? 417  THR A CG2 1 
ATOM   3290  N  N   . THR A 1 418  ? 13.223  88.481  -8.420  1.00 42.11 ? 418  THR A N   1 
ATOM   3291  C  CA  . THR A 1 418  ? 12.145  89.353  -8.233  1.00 40.81 ? 418  THR A CA  1 
ATOM   3292  C  C   . THR A 1 418  ? 12.541  90.744  -7.819  1.00 40.91 ? 418  THR A C   1 
ATOM   3293  O  O   . THR A 1 418  ? 13.537  90.970  -7.106  1.00 40.94 ? 418  THR A O   1 
ATOM   3294  C  CB  . THR A 1 418  ? 11.178  88.789  -7.232  1.00 40.79 ? 418  THR A CB  1 
ATOM   3295  O  OG1 . THR A 1 418  ? 9.960   89.534  -7.278  1.00 38.75 ? 418  THR A OG1 1 
ATOM   3296  C  CG2 . THR A 1 418  ? 11.775  88.853  -5.838  1.00 39.80 ? 418  THR A CG2 1 
ATOM   3297  N  N   . SER A 1 419  ? 11.722  91.675  -8.269  1.00 39.72 ? 419  SER A N   1 
ATOM   3298  C  CA  . SER A 1 419  ? 11.908  93.071  -7.961  1.00 39.12 ? 419  SER A CA  1 
ATOM   3299  C  C   . SER A 1 419  ? 10.929  93.490  -6.873  1.00 37.80 ? 419  SER A C   1 
ATOM   3300  O  O   . SER A 1 419  ? 11.012  94.619  -6.369  1.00 37.76 ? 419  SER A O   1 
ATOM   3301  C  CB  . SER A 1 419  ? 11.692  93.907  -9.224  1.00 40.30 ? 419  SER A CB  1 
ATOM   3302  O  OG  . SER A 1 419  ? 10.539  93.460  -9.927  1.00 42.20 ? 419  SER A OG  1 
ATOM   3303  N  N   . SER A 1 420  ? 10.036  92.572  -6.520  1.00 36.98 ? 420  SER A N   1 
ATOM   3304  C  CA  . SER A 1 420  ? 9.022   92.814  -5.515  1.00 34.51 ? 420  SER A CA  1 
ATOM   3305  C  C   . SER A 1 420  ? 9.689   93.095  -4.207  1.00 35.02 ? 420  SER A C   1 
ATOM   3306  O  O   . SER A 1 420  ? 10.866  92.773  -3.979  1.00 35.38 ? 420  SER A O   1 
ATOM   3307  C  CB  . SER A 1 420  ? 8.066   91.613  -5.394  1.00 33.94 ? 420  SER A CB  1 
ATOM   3308  O  OG  . SER A 1 420  ? 6.979   91.908  -4.535  1.00 31.73 ? 420  SER A OG  1 
ATOM   3309  N  N   . ILE A 1 421  ? 8.930   93.749  -3.343  1.00 34.58 ? 421  ILE A N   1 
ATOM   3310  C  CA  . ILE A 1 421  ? 9.453   94.080  -2.052  1.00 33.75 ? 421  ILE A CA  1 
ATOM   3311  C  C   . ILE A 1 421  ? 9.171   92.936  -1.141  1.00 33.57 ? 421  ILE A C   1 
ATOM   3312  O  O   . ILE A 1 421  ? 9.603   92.869  0.019   1.00 33.15 ? 421  ILE A O   1 
ATOM   3313  C  CB  . ILE A 1 421  ? 8.899   95.417  -1.549  1.00 34.29 ? 421  ILE A CB  1 
ATOM   3314  C  CG1 . ILE A 1 421  ? 9.652   95.830  -0.296  1.00 34.32 ? 421  ILE A CG1 1 
ATOM   3315  C  CG2 . ILE A 1 421  ? 7.417   95.328  -1.257  1.00 34.20 ? 421  ILE A CG2 1 
ATOM   3316  C  CD1 . ILE A 1 421  ? 9.361   97.241  0.141   1.00 36.83 ? 421  ILE A CD1 1 
ATOM   3317  N  N   . ALA A 1 422  ? 8.435   92.009  -1.750  1.00 32.89 ? 422  ALA A N   1 
ATOM   3318  C  CA  . ALA A 1 422  ? 8.100   90.753  -1.135  1.00 32.54 ? 422  ALA A CA  1 
ATOM   3319  C  C   . ALA A 1 422  ? 9.450   90.061  -0.943  1.00 32.90 ? 422  ALA A C   1 
ATOM   3320  O  O   . ALA A 1 422  ? 9.621   89.236  -0.044  1.00 33.22 ? 422  ALA A O   1 
ATOM   3321  C  CB  . ALA A 1 422  ? 7.201   89.913  -2.045  1.00 32.87 ? 422  ALA A CB  1 
ATOM   3322  N  N   . ARG A 1 423  ? 10.402  90.414  -1.797  1.00 32.16 ? 423  ARG A N   1 
ATOM   3323  C  CA  . ARG A 1 423  ? 11.747  89.880  -1.732  1.00 32.45 ? 423  ARG A CA  1 
ATOM   3324  C  C   . ARG A 1 423  ? 12.256  89.882  -0.286  1.00 31.90 ? 423  ARG A C   1 
ATOM   3325  O  O   . ARG A 1 423  ? 12.771  88.876  0.204   1.00 30.98 ? 423  ARG A O   1 
ATOM   3326  C  CB  . ARG A 1 423  ? 12.631  90.747  -2.631  1.00 36.00 ? 423  ARG A CB  1 
ATOM   3327  C  CG  . ARG A 1 423  ? 14.137  90.527  -2.612  1.00 39.18 ? 423  ARG A CG  1 
ATOM   3328  C  CD  . ARG A 1 423  ? 14.721  91.611  -3.515  1.00 42.20 ? 423  ARG A CD  1 
ATOM   3329  N  NE  . ARG A 1 423  ? 16.173  91.626  -3.620  1.00 48.31 ? 423  ARG A NE  1 
ATOM   3330  C  CZ  . ARG A 1 423  ? 16.851  92.563  -4.287  1.00 52.62 ? 423  ARG A CZ  1 
ATOM   3331  N  NH1 . ARG A 1 423  ? 16.193  93.546  -4.897  1.00 54.00 ? 423  ARG A NH1 1 
ATOM   3332  N  NH2 . ARG A 1 423  ? 18.180  92.527  -4.357  1.00 52.57 ? 423  ARG A NH2 1 
ATOM   3333  N  N   . TYR A 1 424  ? 12.087  91.015  0.395   1.00 30.27 ? 424  TYR A N   1 
ATOM   3334  C  CA  . TYR A 1 424  ? 12.544  91.171  1.773   1.00 27.56 ? 424  TYR A CA  1 
ATOM   3335  C  C   . TYR A 1 424  ? 11.711  90.398  2.789   1.00 26.76 ? 424  TYR A C   1 
ATOM   3336  O  O   . TYR A 1 424  ? 12.261  89.811  3.727   1.00 26.94 ? 424  TYR A O   1 
ATOM   3337  C  CB  . TYR A 1 424  ? 12.594  92.659  2.131   1.00 26.46 ? 424  TYR A CB  1 
ATOM   3338  C  CG  . TYR A 1 424  ? 13.498  93.434  1.196   1.00 26.28 ? 424  TYR A CG  1 
ATOM   3339  C  CD1 . TYR A 1 424  ? 14.890  93.350  1.310   1.00 25.48 ? 424  TYR A CD1 1 
ATOM   3340  C  CD2 . TYR A 1 424  ? 12.964  94.178  0.129   1.00 24.86 ? 424  TYR A CD2 1 
ATOM   3341  C  CE1 . TYR A 1 424  ? 15.727  93.972  0.379   1.00 24.90 ? 424  TYR A CE1 1 
ATOM   3342  C  CE2 . TYR A 1 424  ? 13.788  94.798  -0.804  1.00 23.96 ? 424  TYR A CE2 1 
ATOM   3343  C  CZ  . TYR A 1 424  ? 15.167  94.688  -0.675  1.00 25.43 ? 424  TYR A CZ  1 
ATOM   3344  O  OH  . TYR A 1 424  ? 15.983  95.251  -1.623  1.00 25.97 ? 424  TYR A OH  1 
ATOM   3345  N  N   . LEU A 1 425  ? 10.395  90.402  2.611   1.00 26.59 ? 425  LEU A N   1 
ATOM   3346  C  CA  . LEU A 1 425  ? 9.502   89.667  3.504   1.00 26.03 ? 425  LEU A CA  1 
ATOM   3347  C  C   . LEU A 1 425  ? 9.899   88.194  3.457   1.00 25.66 ? 425  LEU A C   1 
ATOM   3348  O  O   . LEU A 1 425  ? 9.816   87.472  4.448   1.00 25.49 ? 425  LEU A O   1 
ATOM   3349  C  CB  . LEU A 1 425  ? 8.046   89.810  3.047   1.00 23.68 ? 425  LEU A CB  1 
ATOM   3350  C  CG  . LEU A 1 425  ? 7.055   88.945  3.831   1.00 21.90 ? 425  LEU A CG  1 
ATOM   3351  C  CD1 . LEU A 1 425  ? 6.875   89.511  5.217   1.00 21.38 ? 425  LEU A CD1 1 
ATOM   3352  C  CD2 . LEU A 1 425  ? 5.721   88.888  3.090   1.00 22.44 ? 425  LEU A CD2 1 
ATOM   3353  N  N   . TYR A 1 426  ? 10.332  87.757  2.285   1.00 26.79 ? 426  TYR A N   1 
ATOM   3354  C  CA  . TYR A 1 426  ? 10.745  86.381  2.087   1.00 28.21 ? 426  TYR A CA  1 
ATOM   3355  C  C   . TYR A 1 426  ? 12.024  86.070  2.869   1.00 28.83 ? 426  TYR A C   1 
ATOM   3356  O  O   . TYR A 1 426  ? 12.026  85.198  3.734   1.00 28.90 ? 426  TYR A O   1 
ATOM   3357  C  CB  . TYR A 1 426  ? 10.944  86.126  0.591   1.00 27.24 ? 426  TYR A CB  1 
ATOM   3358  C  CG  . TYR A 1 426  ? 11.193  84.683  0.242   1.00 25.80 ? 426  TYR A CG  1 
ATOM   3359  C  CD1 . TYR A 1 426  ? 12.477  84.126  0.339   1.00 25.57 ? 426  TYR A CD1 1 
ATOM   3360  C  CD2 . TYR A 1 426  ? 10.146  83.866  -0.180  1.00 24.24 ? 426  TYR A CD2 1 
ATOM   3361  C  CE1 . TYR A 1 426  ? 12.706  82.785  0.016   1.00 24.43 ? 426  TYR A CE1 1 
ATOM   3362  C  CE2 . TYR A 1 426  ? 10.362  82.530  -0.499  1.00 24.82 ? 426  TYR A CE2 1 
ATOM   3363  C  CZ  . TYR A 1 426  ? 11.641  81.999  -0.400  1.00 24.83 ? 426  TYR A CZ  1 
ATOM   3364  O  OH  . TYR A 1 426  ? 11.835  80.681  -0.713  1.00 25.74 ? 426  TYR A OH  1 
ATOM   3365  N  N   . ARG A 1 427  ? 13.100  86.792  2.574   1.00 31.11 ? 427  ARG A N   1 
ATOM   3366  C  CA  . ARG A 1 427  ? 14.392  86.589  3.243   1.00 34.71 ? 427  ARG A CA  1 
ATOM   3367  C  C   . ARG A 1 427  ? 14.278  86.468  4.765   1.00 33.95 ? 427  ARG A C   1 
ATOM   3368  O  O   . ARG A 1 427  ? 14.825  85.538  5.377   1.00 33.66 ? 427  ARG A O   1 
ATOM   3369  C  CB  . ARG A 1 427  ? 15.361  87.732  2.894   1.00 38.15 ? 427  ARG A CB  1 
ATOM   3370  C  CG  . ARG A 1 427  ? 15.945  87.625  1.481   1.00 46.02 ? 427  ARG A CG  1 
ATOM   3371  C  CD  . ARG A 1 427  ? 16.616  88.926  1.006   1.00 50.95 ? 427  ARG A CD  1 
ATOM   3372  N  NE  . ARG A 1 427  ? 16.993  88.848  -0.407  1.00 54.68 ? 427  ARG A NE  1 
ATOM   3373  C  CZ  . ARG A 1 427  ? 17.521  89.850  -1.107  1.00 55.08 ? 427  ARG A CZ  1 
ATOM   3374  N  NH1 . ARG A 1 427  ? 17.743  91.023  -0.530  1.00 54.91 ? 427  ARG A NH1 1 
ATOM   3375  N  NH2 . ARG A 1 427  ? 17.821  89.675  -2.387  1.00 53.81 ? 427  ARG A NH2 1 
ATOM   3376  N  N   . THR A 1 428  ? 13.564  87.416  5.364   1.00 32.49 ? 428  THR A N   1 
ATOM   3377  C  CA  . THR A 1 428  ? 13.370  87.448  6.799   1.00 30.11 ? 428  THR A CA  1 
ATOM   3378  C  C   . THR A 1 428  ? 12.742  86.174  7.364   1.00 29.45 ? 428  THR A C   1 
ATOM   3379  O  O   . THR A 1 428  ? 13.250  85.613  8.342   1.00 29.35 ? 428  THR A O   1 
ATOM   3380  C  CB  . THR A 1 428  ? 12.521  88.657  7.198   1.00 30.69 ? 428  THR A CB  1 
ATOM   3381  O  OG1 . THR A 1 428  ? 13.265  89.855  6.949   1.00 32.23 ? 428  THR A OG1 1 
ATOM   3382  C  CG2 . THR A 1 428  ? 12.160  88.598  8.665   1.00 28.28 ? 428  THR A CG2 1 
ATOM   3383  N  N   . TRP A 1 429  ? 11.645  85.713  6.768   1.00 27.66 ? 429  TRP A N   1 
ATOM   3384  C  CA  . TRP A 1 429  ? 11.007  84.495  7.257   1.00 26.32 ? 429  TRP A CA  1 
ATOM   3385  C  C   . TRP A 1 429  ? 11.860  83.262  6.944   1.00 26.82 ? 429  TRP A C   1 
ATOM   3386  O  O   . TRP A 1 429  ? 11.895  82.303  7.719   1.00 26.42 ? 429  TRP A O   1 
ATOM   3387  C  CB  . TRP A 1 429  ? 9.611   84.324  6.651   1.00 24.31 ? 429  TRP A CB  1 
ATOM   3388  C  CG  . TRP A 1 429  ? 8.555   85.177  7.289   1.00 21.51 ? 429  TRP A CG  1 
ATOM   3389  C  CD1 . TRP A 1 429  ? 8.284   86.489  7.021   1.00 20.58 ? 429  TRP A CD1 1 
ATOM   3390  C  CD2 . TRP A 1 429  ? 7.639   84.784  8.323   1.00 19.94 ? 429  TRP A CD2 1 
ATOM   3391  N  NE1 . TRP A 1 429  ? 7.258   86.941  7.821   1.00 17.59 ? 429  TRP A NE1 1 
ATOM   3392  C  CE2 . TRP A 1 429  ? 6.846   85.919  8.629   1.00 19.87 ? 429  TRP A CE2 1 
ATOM   3393  C  CE3 . TRP A 1 429  ? 7.413   83.593  9.015   1.00 19.98 ? 429  TRP A CE3 1 
ATOM   3394  C  CZ2 . TRP A 1 429  ? 5.839   85.887  9.600   1.00 19.90 ? 429  TRP A CZ2 1 
ATOM   3395  C  CZ3 . TRP A 1 429  ? 6.404   83.565  9.986   1.00 21.68 ? 429  TRP A CZ3 1 
ATOM   3396  C  CH2 . TRP A 1 429  ? 5.636   84.705  10.266  1.00 21.70 ? 429  TRP A CH2 1 
ATOM   3397  N  N   . TYR A 1 430  ? 12.544  83.292  5.806   1.00 27.05 ? 430  TYR A N   1 
ATOM   3398  C  CA  . TYR A 1 430  ? 13.409  82.188  5.393   1.00 27.14 ? 430  TYR A CA  1 
ATOM   3399  C  C   . TYR A 1 430  ? 14.518  82.050  6.420   1.00 25.68 ? 430  TYR A C   1 
ATOM   3400  O  O   . TYR A 1 430  ? 14.805  80.964  6.909   1.00 24.87 ? 430  TYR A O   1 
ATOM   3401  C  CB  . TYR A 1 430  ? 14.026  82.498  4.024   1.00 28.76 ? 430  TYR A CB  1 
ATOM   3402  C  CG  . TYR A 1 430  ? 15.024  81.479  3.507   1.00 28.70 ? 430  TYR A CG  1 
ATOM   3403  C  CD1 . TYR A 1 430  ? 14.626  80.481  2.623   1.00 28.31 ? 430  TYR A CD1 1 
ATOM   3404  C  CD2 . TYR A 1 430  ? 16.374  81.552  3.857   1.00 29.33 ? 430  TYR A CD2 1 
ATOM   3405  C  CE1 . TYR A 1 430  ? 15.541  79.587  2.081   1.00 30.22 ? 430  TYR A CE1 1 
ATOM   3406  C  CE2 . TYR A 1 430  ? 17.303  80.664  3.328   1.00 31.12 ? 430  TYR A CE2 1 
ATOM   3407  C  CZ  . TYR A 1 430  ? 16.878  79.683  2.437   1.00 32.23 ? 430  TYR A CZ  1 
ATOM   3408  O  OH  . TYR A 1 430  ? 17.800  78.822  1.884   1.00 35.10 ? 430  TYR A OH  1 
ATOM   3409  N  N   . LEU A 1 431  ? 15.143  83.178  6.731   1.00 25.64 ? 431  LEU A N   1 
ATOM   3410  C  CA  . LEU A 1 431  ? 16.232  83.225  7.697   1.00 26.84 ? 431  LEU A CA  1 
ATOM   3411  C  C   . LEU A 1 431  ? 15.783  82.662  9.045   1.00 26.49 ? 431  LEU A C   1 
ATOM   3412  O  O   . LEU A 1 431  ? 16.390  81.730  9.581   1.00 26.35 ? 431  LEU A O   1 
ATOM   3413  C  CB  . LEU A 1 431  ? 16.700  84.669  7.874   1.00 28.73 ? 431  LEU A CB  1 
ATOM   3414  C  CG  . LEU A 1 431  ? 18.079  85.023  7.324   1.00 32.33 ? 431  LEU A CG  1 
ATOM   3415  C  CD1 . LEU A 1 431  ? 19.152  84.336  8.157   1.00 33.00 ? 431  LEU A CD1 1 
ATOM   3416  C  CD2 . LEU A 1 431  ? 18.168  84.586  5.871   1.00 33.17 ? 431  LEU A CD2 1 
ATOM   3417  N  N   . ALA A 1 432  ? 14.711  83.237  9.584   1.00 24.97 ? 432  ALA A N   1 
ATOM   3418  C  CA  . ALA A 1 432  ? 14.177  82.800  10.867  1.00 24.19 ? 432  ALA A CA  1 
ATOM   3419  C  C   . ALA A 1 432  ? 13.862  81.308  10.880  1.00 24.07 ? 432  ALA A C   1 
ATOM   3420  O  O   . ALA A 1 432  ? 14.240  80.605  11.814  1.00 23.27 ? 432  ALA A O   1 
ATOM   3421  C  CB  . ALA A 1 432  ? 12.934  83.599  11.205  1.00 22.99 ? 432  ALA A CB  1 
ATOM   3422  N  N   . ALA A 1 433  ? 13.174  80.830  9.843   1.00 24.69 ? 433  ALA A N   1 
ATOM   3423  C  CA  . ALA A 1 433  ? 12.826  79.413  9.743   1.00 24.71 ? 433  ALA A CA  1 
ATOM   3424  C  C   . ALA A 1 433  ? 14.073  78.541  9.876   1.00 25.35 ? 433  ALA A C   1 
ATOM   3425  O  O   . ALA A 1 433  ? 14.100  77.585  10.663  1.00 26.32 ? 433  ALA A O   1 
ATOM   3426  C  CB  . ALA A 1 433  ? 12.132  79.125  8.426   1.00 22.50 ? 433  ALA A CB  1 
ATOM   3427  N  N   . ALA A 1 434  ? 15.109  78.890  9.122   1.00 25.55 ? 434  ALA A N   1 
ATOM   3428  C  CA  . ALA A 1 434  ? 16.364  78.153  9.152   1.00 25.94 ? 434  ALA A CA  1 
ATOM   3429  C  C   . ALA A 1 434  ? 17.002  78.101  10.538  1.00 25.75 ? 434  ALA A C   1 
ATOM   3430  O  O   . ALA A 1 434  ? 17.427  77.031  10.979  1.00 26.67 ? 434  ALA A O   1 
ATOM   3431  C  CB  . ALA A 1 434  ? 17.346  78.758  8.147   1.00 23.60 ? 434  ALA A CB  1 
ATOM   3432  N  N   . ARG A 1 435  ? 17.084  79.239  11.225  1.00 25.96 ? 435  ARG A N   1 
ATOM   3433  C  CA  . ARG A 1 435  ? 17.698  79.258  12.549  1.00 26.67 ? 435  ARG A CA  1 
ATOM   3434  C  C   . ARG A 1 435  ? 16.805  78.568  13.557  1.00 27.45 ? 435  ARG A C   1 
ATOM   3435  O  O   . ARG A 1 435  ? 17.277  77.898  14.475  1.00 27.01 ? 435  ARG A O   1 
ATOM   3436  C  CB  . ARG A 1 435  ? 17.984  80.689  12.978  1.00 27.09 ? 435  ARG A CB  1 
ATOM   3437  C  CG  . ARG A 1 435  ? 18.892  81.400  11.986  1.00 28.97 ? 435  ARG A CG  1 
ATOM   3438  C  CD  . ARG A 1 435  ? 19.164  82.845  12.340  1.00 28.17 ? 435  ARG A CD  1 
ATOM   3439  N  NE  . ARG A 1 435  ? 20.097  83.409  11.380  1.00 29.14 ? 435  ARG A NE  1 
ATOM   3440  C  CZ  . ARG A 1 435  ? 20.459  84.683  11.353  1.00 30.55 ? 435  ARG A CZ  1 
ATOM   3441  N  NH1 . ARG A 1 435  ? 19.957  85.532  12.237  1.00 32.26 ? 435  ARG A NH1 1 
ATOM   3442  N  NH2 . ARG A 1 435  ? 21.335  85.099  10.453  1.00 31.90 ? 435  ARG A NH2 1 
ATOM   3443  N  N   . MET A 1 436  ? 15.501  78.717  13.361  1.00 28.09 ? 436  MET A N   1 
ATOM   3444  C  CA  . MET A 1 436  ? 14.533  78.089  14.235  1.00 28.50 ? 436  MET A CA  1 
ATOM   3445  C  C   . MET A 1 436  ? 14.727  76.570  14.128  1.00 29.51 ? 436  MET A C   1 
ATOM   3446  O  O   . MET A 1 436  ? 15.045  75.899  15.114  1.00 29.31 ? 436  MET A O   1 
ATOM   3447  C  CB  . MET A 1 436  ? 13.125  78.510  13.803  1.00 29.75 ? 436  MET A CB  1 
ATOM   3448  C  CG  . MET A 1 436  ? 11.981  77.763  14.485  1.00 27.76 ? 436  MET A CG  1 
ATOM   3449  S  SD  . MET A 1 436  ? 11.653  76.119  13.789  1.00 29.24 ? 436  MET A SD  1 
ATOM   3450  C  CE  . MET A 1 436  ? 11.298  75.261  15.245  1.00 29.21 ? 436  MET A CE  1 
ATOM   3451  N  N   . ALA A 1 437  ? 14.567  76.043  12.920  1.00 28.37 ? 437  ALA A N   1 
ATOM   3452  C  CA  . ALA A 1 437  ? 14.717  74.611  12.682  1.00 30.45 ? 437  ALA A CA  1 
ATOM   3453  C  C   . ALA A 1 437  ? 16.087  74.051  13.071  1.00 31.55 ? 437  ALA A C   1 
ATOM   3454  O  O   . ALA A 1 437  ? 16.201  72.862  13.387  1.00 32.21 ? 437  ALA A O   1 
ATOM   3455  C  CB  . ALA A 1 437  ? 14.439  74.292  11.218  1.00 30.16 ? 437  ALA A CB  1 
ATOM   3456  N  N   . ALA A 1 438  ? 17.122  74.885  13.043  1.00 30.05 ? 438  ALA A N   1 
ATOM   3457  C  CA  . ALA A 1 438  ? 18.460  74.408  13.399  1.00 30.90 ? 438  ALA A CA  1 
ATOM   3458  C  C   . ALA A 1 438  ? 18.669  74.267  14.904  1.00 31.38 ? 438  ALA A C   1 
ATOM   3459  O  O   . ALA A 1 438  ? 19.606  73.608  15.343  1.00 32.02 ? 438  ALA A O   1 
ATOM   3460  C  CB  . ALA A 1 438  ? 19.537  75.338  12.817  1.00 30.03 ? 438  ALA A CB  1 
ATOM   3461  N  N   . GLN A 1 439  ? 17.814  74.899  15.699  1.00 32.16 ? 439  GLN A N   1 
ATOM   3462  C  CA  . GLN A 1 439  ? 17.960  74.816  17.144  1.00 31.90 ? 439  GLN A CA  1 
ATOM   3463  C  C   . GLN A 1 439  ? 17.732  73.379  17.570  1.00 32.12 ? 439  GLN A C   1 
ATOM   3464  O  O   . GLN A 1 439  ? 16.727  72.771  17.204  1.00 33.76 ? 439  GLN A O   1 
ATOM   3465  C  CB  . GLN A 1 439  ? 16.952  75.722  17.845  1.00 32.08 ? 439  GLN A CB  1 
ATOM   3466  C  CG  . GLN A 1 439  ? 17.088  77.174  17.497  1.00 33.79 ? 439  GLN A CG  1 
ATOM   3467  C  CD  . GLN A 1 439  ? 16.140  78.023  18.292  1.00 34.90 ? 439  GLN A CD  1 
ATOM   3468  O  OE1 . GLN A 1 439  ? 14.934  77.776  18.299  1.00 36.80 ? 439  GLN A OE1 1 
ATOM   3469  N  NE2 . GLN A 1 439  ? 16.675  79.030  18.973  1.00 34.21 ? 439  GLN A NE2 1 
ATOM   3470  N  N   . PRO A 1 440  ? 18.671  72.811  18.342  1.00 32.36 ? 440  PRO A N   1 
ATOM   3471  C  CA  . PRO A 1 440  ? 18.561  71.431  18.817  1.00 31.60 ? 440  PRO A CA  1 
ATOM   3472  C  C   . PRO A 1 440  ? 17.250  71.205  19.582  1.00 31.75 ? 440  PRO A C   1 
ATOM   3473  O  O   . PRO A 1 440  ? 16.603  70.174  19.438  1.00 29.86 ? 440  PRO A O   1 
ATOM   3474  C  CB  . PRO A 1 440  ? 19.790  71.286  19.708  1.00 31.92 ? 440  PRO A CB  1 
ATOM   3475  C  CG  . PRO A 1 440  ? 20.789  72.186  19.060  1.00 31.64 ? 440  PRO A CG  1 
ATOM   3476  C  CD  . PRO A 1 440  ? 19.962  73.404  18.742  1.00 33.36 ? 440  PRO A CD  1 
ATOM   3477  N  N   . ARG A 1 441  ? 16.862  72.204  20.373  1.00 33.58 ? 441  ARG A N   1 
ATOM   3478  C  CA  . ARG A 1 441  ? 15.653  72.129  21.180  1.00 35.60 ? 441  ARG A CA  1 
ATOM   3479  C  C   . ARG A 1 441  ? 14.420  71.814  20.333  1.00 35.44 ? 441  ARG A C   1 
ATOM   3480  O  O   . ARG A 1 441  ? 13.527  71.101  20.773  1.00 36.21 ? 441  ARG A O   1 
ATOM   3481  C  CB  . ARG A 1 441  ? 15.439  73.446  21.939  1.00 38.96 ? 441  ARG A CB  1 
ATOM   3482  C  CG  . ARG A 1 441  ? 14.312  73.391  22.958  1.00 45.33 ? 441  ARG A CG  1 
ATOM   3483  C  CD  . ARG A 1 441  ? 13.932  74.784  23.432  1.00 50.91 ? 441  ARG A CD  1 
ATOM   3484  N  NE  . ARG A 1 441  ? 13.105  74.742  24.638  1.00 56.59 ? 441  ARG A NE  1 
ATOM   3485  C  CZ  . ARG A 1 441  ? 12.181  75.652  24.941  1.00 58.20 ? 441  ARG A CZ  1 
ATOM   3486  N  NH1 . ARG A 1 441  ? 11.967  76.676  24.121  1.00 58.48 ? 441  ARG A NH1 1 
ATOM   3487  N  NH2 . ARG A 1 441  ? 11.475  75.537  26.059  1.00 58.23 ? 441  ARG A NH2 1 
ATOM   3488  N  N   . THR A 1 442  ? 14.368  72.354  19.119  1.00 34.18 ? 442  THR A N   1 
ATOM   3489  C  CA  . THR A 1 442  ? 13.236  72.097  18.242  1.00 32.68 ? 442  THR A CA  1 
ATOM   3490  C  C   . THR A 1 442  ? 12.984  70.599  18.073  1.00 34.02 ? 442  THR A C   1 
ATOM   3491  O  O   . THR A 1 442  ? 11.832  70.162  17.952  1.00 34.05 ? 442  THR A O   1 
ATOM   3492  C  CB  . THR A 1 442  ? 13.477  72.681  16.852  1.00 29.99 ? 442  THR A CB  1 
ATOM   3493  O  OG1 . THR A 1 442  ? 13.543  74.101  16.944  1.00 28.60 ? 442  THR A OG1 1 
ATOM   3494  C  CG2 . THR A 1 442  ? 12.364  72.273  15.906  1.00 26.94 ? 442  THR A CG2 1 
ATOM   3495  N  N   . TRP A 1 443  ? 14.061  69.816  18.071  1.00 33.66 ? 443  TRP A N   1 
ATOM   3496  C  CA  . TRP A 1 443  ? 13.950  68.372  17.891  1.00 33.34 ? 443  TRP A CA  1 
ATOM   3497  C  C   . TRP A 1 443  ? 13.891  67.581  19.196  1.00 33.90 ? 443  TRP A C   1 
ATOM   3498  O  O   . TRP A 1 443  ? 13.992  66.351  19.195  1.00 33.99 ? 443  TRP A O   1 
ATOM   3499  C  CB  . TRP A 1 443  ? 15.101  67.882  17.003  1.00 33.09 ? 443  TRP A CB  1 
ATOM   3500  C  CG  . TRP A 1 443  ? 15.178  68.688  15.755  1.00 33.84 ? 443  TRP A CG  1 
ATOM   3501  C  CD1 . TRP A 1 443  ? 16.067  69.691  15.473  1.00 33.29 ? 443  TRP A CD1 1 
ATOM   3502  C  CD2 . TRP A 1 443  ? 14.219  68.695  14.697  1.00 33.11 ? 443  TRP A CD2 1 
ATOM   3503  N  NE1 . TRP A 1 443  ? 15.709  70.332  14.307  1.00 33.92 ? 443  TRP A NE1 1 
ATOM   3504  C  CE2 . TRP A 1 443  ? 14.575  69.737  13.810  1.00 33.34 ? 443  TRP A CE2 1 
ATOM   3505  C  CE3 . TRP A 1 443  ? 13.082  67.921  14.410  1.00 32.31 ? 443  TRP A CE3 1 
ATOM   3506  C  CZ2 . TRP A 1 443  ? 13.834  70.031  12.659  1.00 34.04 ? 443  TRP A CZ2 1 
ATOM   3507  C  CZ3 . TRP A 1 443  ? 12.347  68.210  13.273  1.00 33.21 ? 443  TRP A CZ3 1 
ATOM   3508  C  CH2 . TRP A 1 443  ? 12.726  69.258  12.409  1.00 33.59 ? 443  TRP A CH2 1 
ATOM   3509  N  N   . ASP A 1 444  ? 13.731  68.293  20.310  1.00 34.55 ? 444  ASP A N   1 
ATOM   3510  C  CA  . ASP A 1 444  ? 13.621  67.651  21.616  1.00 35.02 ? 444  ASP A CA  1 
ATOM   3511  C  C   . ASP A 1 444  ? 12.163  67.195  21.780  1.00 34.51 ? 444  ASP A C   1 
ATOM   3512  O  O   . ASP A 1 444  ? 11.236  67.985  21.607  1.00 33.43 ? 444  ASP A O   1 
ATOM   3513  C  CB  . ASP A 1 444  ? 13.971  68.639  22.734  1.00 35.80 ? 444  ASP A CB  1 
ATOM   3514  C  CG  . ASP A 1 444  ? 13.944  67.990  24.128  1.00 37.05 ? 444  ASP A CG  1 
ATOM   3515  O  OD1 . ASP A 1 444  ? 13.003  67.217  24.417  1.00 34.31 ? 444  ASP A OD1 1 
ATOM   3516  O  OD2 . ASP A 1 444  ? 14.859  68.273  24.941  1.00 38.59 ? 444  ASP A OD2 1 
ATOM   3517  N  N   . PRO A 1 445  ? 11.947  65.909  22.108  1.00 33.66 ? 445  PRO A N   1 
ATOM   3518  C  CA  . PRO A 1 445  ? 10.607  65.355  22.293  1.00 32.47 ? 445  PRO A CA  1 
ATOM   3519  C  C   . PRO A 1 445  ? 9.738   66.178  23.235  1.00 32.08 ? 445  PRO A C   1 
ATOM   3520  O  O   . PRO A 1 445  ? 8.547   66.346  22.986  1.00 32.53 ? 445  PRO A O   1 
ATOM   3521  C  CB  . PRO A 1 445  ? 10.894  63.959  22.836  1.00 34.13 ? 445  PRO A CB  1 
ATOM   3522  C  CG  . PRO A 1 445  ? 12.140  63.592  22.144  1.00 32.23 ? 445  PRO A CG  1 
ATOM   3523  C  CD  . PRO A 1 445  ? 12.964  64.853  22.250  1.00 33.96 ? 445  PRO A CD  1 
ATOM   3524  N  N   . LEU A 1 446  ? 10.331  66.675  24.322  1.00 30.56 ? 446  LEU A N   1 
ATOM   3525  C  CA  . LEU A 1 446  ? 9.599   67.485  25.290  1.00 29.17 ? 446  LEU A CA  1 
ATOM   3526  C  C   . LEU A 1 446  ? 9.092   68.745  24.635  1.00 28.85 ? 446  LEU A C   1 
ATOM   3527  O  O   . LEU A 1 446  ? 7.944   69.135  24.822  1.00 29.05 ? 446  LEU A O   1 
ATOM   3528  C  CB  . LEU A 1 446  ? 10.486  67.881  26.472  1.00 28.87 ? 446  LEU A CB  1 
ATOM   3529  C  CG  . LEU A 1 446  ? 9.867   68.942  27.398  1.00 29.76 ? 446  LEU A CG  1 
ATOM   3530  C  CD1 . LEU A 1 446  ? 8.595   68.386  28.042  1.00 29.86 ? 446  LEU A CD1 1 
ATOM   3531  C  CD2 . LEU A 1 446  ? 10.861  69.363  28.463  1.00 29.39 ? 446  LEU A CD2 1 
ATOM   3532  N  N   . PHE A 1 447  ? 9.968   69.388  23.881  1.00 28.91 ? 447  PHE A N   1 
ATOM   3533  C  CA  . PHE A 1 447  ? 9.603   70.608  23.197  1.00 28.96 ? 447  PHE A CA  1 
ATOM   3534  C  C   . PHE A 1 447  ? 8.408   70.381  22.286  1.00 29.11 ? 447  PHE A C   1 
ATOM   3535  O  O   . PHE A 1 447  ? 7.488   71.198  22.243  1.00 28.81 ? 447  PHE A O   1 
ATOM   3536  C  CB  . PHE A 1 447  ? 10.759  71.138  22.362  1.00 28.43 ? 447  PHE A CB  1 
ATOM   3537  C  CG  . PHE A 1 447  ? 10.402  72.364  21.589  1.00 28.86 ? 447  PHE A CG  1 
ATOM   3538  C  CD1 . PHE A 1 447  ? 10.087  73.545  22.250  1.00 29.19 ? 447  PHE A CD1 1 
ATOM   3539  C  CD2 . PHE A 1 447  ? 10.341  72.333  20.203  1.00 28.46 ? 447  PHE A CD2 1 
ATOM   3540  C  CE1 . PHE A 1 447  ? 9.717   74.682  21.542  1.00 28.25 ? 447  PHE A CE1 1 
ATOM   3541  C  CE2 . PHE A 1 447  ? 9.976   73.457  19.492  1.00 28.10 ? 447  PHE A CE2 1 
ATOM   3542  C  CZ  . PHE A 1 447  ? 9.664   74.638  20.162  1.00 27.81 ? 447  PHE A CZ  1 
ATOM   3543  N  N   . GLN A 1 448  ? 8.426   69.272  21.554  1.00 29.17 ? 448  GLN A N   1 
ATOM   3544  C  CA  . GLN A 1 448  ? 7.335   68.960  20.647  1.00 29.42 ? 448  GLN A CA  1 
ATOM   3545  C  C   . GLN A 1 448  ? 6.056   68.562  21.377  1.00 29.46 ? 448  GLN A C   1 
ATOM   3546  O  O   . GLN A 1 448  ? 4.963   68.702  20.848  1.00 31.40 ? 448  GLN A O   1 
ATOM   3547  C  CB  . GLN A 1 448  ? 7.756   67.859  19.687  1.00 29.92 ? 448  GLN A CB  1 
ATOM   3548  C  CG  . GLN A 1 448  ? 8.776   68.325  18.685  1.00 30.61 ? 448  GLN A CG  1 
ATOM   3549  C  CD  . GLN A 1 448  ? 9.221   67.224  17.754  1.00 31.13 ? 448  GLN A CD  1 
ATOM   3550  O  OE1 . GLN A 1 448  ? 10.317  67.282  17.191  1.00 31.98 ? 448  GLN A OE1 1 
ATOM   3551  N  NE2 . GLN A 1 448  ? 8.371   66.217  17.573  1.00 31.50 ? 448  GLN A NE2 1 
ATOM   3552  N  N   . ALA A 1 449  ? 6.187   68.045  22.587  1.00 29.54 ? 449  ALA A N   1 
ATOM   3553  C  CA  . ALA A 1 449  ? 5.016   67.688  23.357  1.00 29.58 ? 449  ALA A CA  1 
ATOM   3554  C  C   . ALA A 1 449  ? 4.388   69.025  23.759  1.00 30.07 ? 449  ALA A C   1 
ATOM   3555  O  O   . ALA A 1 449  ? 3.176   69.213  23.658  1.00 30.43 ? 449  ALA A O   1 
ATOM   3556  C  CB  . ALA A 1 449  ? 5.418   66.888  24.596  1.00 28.17 ? 449  ALA A CB  1 
ATOM   3557  N  N   . ILE A 1 450  ? 5.230   69.961  24.193  1.00 29.69 ? 450  ILE A N   1 
ATOM   3558  C  CA  . ILE A 1 450  ? 4.759   71.277  24.619  1.00 30.64 ? 450  ILE A CA  1 
ATOM   3559  C  C   . ILE A 1 450  ? 3.985   71.959  23.491  1.00 30.78 ? 450  ILE A C   1 
ATOM   3560  O  O   . ILE A 1 450  ? 2.919   72.525  23.715  1.00 30.65 ? 450  ILE A O   1 
ATOM   3561  C  CB  . ILE A 1 450  ? 5.952   72.157  25.084  1.00 29.91 ? 450  ILE A CB  1 
ATOM   3562  C  CG1 . ILE A 1 450  ? 6.588   71.521  26.324  1.00 30.88 ? 450  ILE A CG1 1 
ATOM   3563  C  CG2 . ILE A 1 450  ? 5.499   73.564  25.377  1.00 29.21 ? 450  ILE A CG2 1 
ATOM   3564  C  CD1 . ILE A 1 450  ? 7.833   72.249  26.865  1.00 30.73 ? 450  ILE A CD1 1 
ATOM   3565  N  N   . MET A 1 451  ? 4.517   71.882  22.277  1.00 31.09 ? 451  MET A N   1 
ATOM   3566  C  CA  . MET A 1 451  ? 3.862   72.484  21.121  1.00 30.65 ? 451  MET A CA  1 
ATOM   3567  C  C   . MET A 1 451  ? 2.550   71.773  20.807  1.00 31.39 ? 451  MET A C   1 
ATOM   3568  O  O   . MET A 1 451  ? 1.594   72.403  20.357  1.00 31.53 ? 451  MET A O   1 
ATOM   3569  C  CB  . MET A 1 451  ? 4.789   72.446  19.904  1.00 28.98 ? 451  MET A CB  1 
ATOM   3570  C  CG  . MET A 1 451  ? 5.938   73.437  19.971  1.00 26.91 ? 451  MET A CG  1 
ATOM   3571  S  SD  . MET A 1 451  ? 5.363   75.128  20.194  1.00 28.96 ? 451  MET A SD  1 
ATOM   3572  C  CE  . MET A 1 451  ? 4.488   75.407  18.675  1.00 27.20 ? 451  MET A CE  1 
ATOM   3573  N  N   . ARG A 1 452  ? 2.505   70.467  21.057  1.00 32.38 ? 452  ARG A N   1 
ATOM   3574  C  CA  . ARG A 1 452  ? 1.303   69.682  20.814  1.00 32.96 ? 452  ARG A CA  1 
ATOM   3575  C  C   . ARG A 1 452  ? 0.250   69.868  21.908  1.00 33.15 ? 452  ARG A C   1 
ATOM   3576  O  O   . ARG A 1 452  ? -0.920  69.524  21.720  1.00 34.04 ? 452  ARG A O   1 
ATOM   3577  C  CB  . ARG A 1 452  ? 1.654   68.198  20.706  1.00 32.67 ? 452  ARG A CB  1 
ATOM   3578  C  CG  . ARG A 1 452  ? 2.215   67.780  19.366  1.00 35.23 ? 452  ARG A CG  1 
ATOM   3579  C  CD  . ARG A 1 452  ? 2.680   66.333  19.421  1.00 35.29 ? 452  ARG A CD  1 
ATOM   3580  N  NE  . ARG A 1 452  ? 1.655   65.468  19.998  1.00 35.93 ? 452  ARG A NE  1 
ATOM   3581  C  CZ  . ARG A 1 452  ? 0.767   64.788  19.282  1.00 36.02 ? 452  ARG A CZ  1 
ATOM   3582  N  NH1 . ARG A 1 452  ? 0.782   64.870  17.956  1.00 36.08 ? 452  ARG A NH1 1 
ATOM   3583  N  NH2 . ARG A 1 452  ? -0.134  64.025  19.885  1.00 36.12 ? 452  ARG A NH2 1 
ATOM   3584  N  N   . SER A 1 453  ? 0.660   70.409  23.050  1.00 33.20 ? 453  SER A N   1 
ATOM   3585  C  CA  . SER A 1 453  ? -0.262  70.609  24.160  1.00 33.88 ? 453  SER A CA  1 
ATOM   3586  C  C   . SER A 1 453  ? -0.773  72.039  24.208  1.00 33.92 ? 453  SER A C   1 
ATOM   3587  O  O   . SER A 1 453  ? -1.790  72.321  24.839  1.00 35.30 ? 453  SER A O   1 
ATOM   3588  C  CB  . SER A 1 453  ? 0.435   70.302  25.483  1.00 32.24 ? 453  SER A CB  1 
ATOM   3589  O  OG  . SER A 1 453  ? 1.165   71.435  25.931  1.00 33.07 ? 453  SER A OG  1 
ATOM   3590  N  N   . GLN A 1 454  ? -0.063  72.939  23.541  1.00 33.11 ? 454  GLN A N   1 
ATOM   3591  C  CA  . GLN A 1 454  ? -0.426  74.350  23.544  1.00 33.28 ? 454  GLN A CA  1 
ATOM   3592  C  C   . GLN A 1 454  ? -1.902  74.578  23.251  1.00 32.29 ? 454  GLN A C   1 
ATOM   3593  O  O   . GLN A 1 454  ? -2.559  75.374  23.910  1.00 32.75 ? 454  GLN A O   1 
ATOM   3594  C  CB  . GLN A 1 454  ? 0.412   75.101  22.516  1.00 36.13 ? 454  GLN A CB  1 
ATOM   3595  C  CG  . GLN A 1 454  ? 0.374   76.612  22.648  1.00 39.21 ? 454  GLN A CG  1 
ATOM   3596  C  CD  . GLN A 1 454  ? 0.865   77.301  21.388  1.00 41.66 ? 454  GLN A CD  1 
ATOM   3597  O  OE1 . GLN A 1 454  ? 1.508   76.675  20.530  1.00 41.48 ? 454  GLN A OE1 1 
ATOM   3598  N  NE2 . GLN A 1 454  ? 0.573   78.597  21.268  1.00 42.22 ? 454  GLN A NE2 1 
ATOM   3599  N  N   . TYR A 1 455  ? -2.423  73.860  22.265  1.00 31.20 ? 455  TYR A N   1 
ATOM   3600  C  CA  . TYR A 1 455  ? -3.811  74.008  21.870  1.00 30.16 ? 455  TYR A CA  1 
ATOM   3601  C  C   . TYR A 1 455  ? -4.749  72.938  22.400  1.00 30.62 ? 455  TYR A C   1 
ATOM   3602  O  O   . TYR A 1 455  ? -5.867  72.812  21.922  1.00 30.79 ? 455  TYR A O   1 
ATOM   3603  C  CB  . TYR A 1 455  ? -3.890  74.077  20.343  1.00 27.70 ? 455  TYR A CB  1 
ATOM   3604  C  CG  . TYR A 1 455  ? -3.033  73.052  19.647  1.00 26.31 ? 455  TYR A CG  1 
ATOM   3605  C  CD1 . TYR A 1 455  ? -3.470  71.733  19.508  1.00 25.77 ? 455  TYR A CD1 1 
ATOM   3606  C  CD2 . TYR A 1 455  ? -1.776  73.390  19.131  1.00 24.13 ? 455  TYR A CD2 1 
ATOM   3607  C  CE1 . TYR A 1 455  ? -2.688  70.779  18.876  1.00 23.85 ? 455  TYR A CE1 1 
ATOM   3608  C  CE2 . TYR A 1 455  ? -0.981  72.437  18.496  1.00 22.31 ? 455  TYR A CE2 1 
ATOM   3609  C  CZ  . TYR A 1 455  ? -1.446  71.137  18.370  1.00 22.71 ? 455  TYR A CZ  1 
ATOM   3610  O  OH  . TYR A 1 455  ? -0.699  70.193  17.710  1.00 23.32 ? 455  TYR A OH  1 
ATOM   3611  N  N   . VAL A 1 456  ? -4.300  72.166  23.384  1.00 31.26 ? 456  VAL A N   1 
ATOM   3612  C  CA  . VAL A 1 456  ? -5.137  71.125  23.983  1.00 31.62 ? 456  VAL A CA  1 
ATOM   3613  C  C   . VAL A 1 456  ? -5.771  71.781  25.196  1.00 32.33 ? 456  VAL A C   1 
ATOM   3614  O  O   . VAL A 1 456  ? -5.270  71.673  26.310  1.00 33.68 ? 456  VAL A O   1 
ATOM   3615  C  CB  . VAL A 1 456  ? -4.291  69.919  24.437  1.00 32.24 ? 456  VAL A CB  1 
ATOM   3616  C  CG1 . VAL A 1 456  ? -5.164  68.890  25.162  1.00 31.69 ? 456  VAL A CG1 1 
ATOM   3617  C  CG2 . VAL A 1 456  ? -3.606  69.293  23.227  1.00 31.53 ? 456  VAL A CG2 1 
ATOM   3618  N  N   . THR A 1 457  ? -6.878  72.473  24.981  1.00 32.46 ? 457  THR A N   1 
ATOM   3619  C  CA  . THR A 1 457  ? -7.524  73.184  26.077  1.00 32.46 ? 457  THR A CA  1 
ATOM   3620  C  C   . THR A 1 457  ? -9.022  72.927  26.202  1.00 33.75 ? 457  THR A C   1 
ATOM   3621  O  O   . THR A 1 457  ? -9.619  72.181  25.416  1.00 33.03 ? 457  THR A O   1 
ATOM   3622  C  CB  . THR A 1 457  ? -7.314  74.711  25.935  1.00 31.88 ? 457  THR A CB  1 
ATOM   3623  O  OG1 . THR A 1 457  ? -8.077  75.204  24.821  1.00 31.61 ? 457  THR A OG1 1 
ATOM   3624  C  CG2 . THR A 1 457  ? -5.849  75.024  25.713  1.00 29.85 ? 457  THR A CG2 1 
ATOM   3625  N  N   . ALA A 1 458  ? -9.619  73.571  27.202  1.00 34.34 ? 458  ALA A N   1 
ATOM   3626  C  CA  . ALA A 1 458  ? -11.041 73.435  27.481  1.00 35.39 ? 458  ALA A CA  1 
ATOM   3627  C  C   . ALA A 1 458  ? -11.884 74.253  26.516  1.00 35.78 ? 458  ALA A C   1 
ATOM   3628  O  O   . ALA A 1 458  ? -13.099 74.113  26.479  1.00 37.30 ? 458  ALA A O   1 
ATOM   3629  C  CB  . ALA A 1 458  ? -11.327 73.859  28.915  1.00 35.33 ? 458  ALA A CB  1 
ATOM   3630  N  N   . ARG A 1 459  ? -11.235 75.113  25.743  1.00 37.13 ? 459  ARG A N   1 
ATOM   3631  C  CA  . ARG A 1 459  ? -11.942 75.943  24.776  1.00 38.88 ? 459  ARG A CA  1 
ATOM   3632  C  C   . ARG A 1 459  ? -12.359 75.136  23.545  1.00 37.79 ? 459  ARG A C   1 
ATOM   3633  O  O   . ARG A 1 459  ? -11.759 74.101  23.227  1.00 37.43 ? 459  ARG A O   1 
ATOM   3634  C  CB  . ARG A 1 459  ? -11.060 77.104  24.319  1.00 42.81 ? 459  ARG A CB  1 
ATOM   3635  C  CG  . ARG A 1 459  ? -10.730 78.131  25.384  1.00 48.75 ? 459  ARG A CG  1 
ATOM   3636  C  CD  . ARG A 1 459  ? -10.201 79.389  24.707  1.00 54.36 ? 459  ARG A CD  1 
ATOM   3637  N  NE  . ARG A 1 459  ? -9.562  80.317  25.632  1.00 58.85 ? 459  ARG A NE  1 
ATOM   3638  C  CZ  . ARG A 1 459  ? -9.149  81.535  25.293  1.00 61.74 ? 459  ARG A CZ  1 
ATOM   3639  N  NH1 . ARG A 1 459  ? -9.311  81.973  24.043  1.00 61.98 ? 459  ARG A NH1 1 
ATOM   3640  N  NH2 . ARG A 1 459  ? -8.580  82.318  26.203  1.00 62.49 ? 459  ARG A NH2 1 
ATOM   3641  N  N   . GLY A 1 460  ? -13.377 75.627  22.843  1.00 36.86 ? 460  GLY A N   1 
ATOM   3642  C  CA  . GLY A 1 460  ? -13.854 74.946  21.649  1.00 35.30 ? 460  GLY A CA  1 
ATOM   3643  C  C   . GLY A 1 460  ? -12.841 74.969  20.512  1.00 34.74 ? 460  GLY A C   1 
ATOM   3644  O  O   . GLY A 1 460  ? -11.998 75.870  20.420  1.00 33.19 ? 460  GLY A O   1 
ATOM   3645  N  N   . GLY A 1 461  ? -12.924 73.968  19.642  1.00 33.88 ? 461  GLY A N   1 
ATOM   3646  C  CA  . GLY A 1 461  ? -12.018 73.888  18.512  1.00 32.76 ? 461  GLY A CA  1 
ATOM   3647  C  C   . GLY A 1 461  ? -12.743 73.442  17.253  1.00 31.85 ? 461  GLY A C   1 
ATOM   3648  O  O   . GLY A 1 461  ? -12.168 72.740  16.413  1.00 31.00 ? 461  GLY A O   1 
ATOM   3649  N  N   . SER A 1 462  ? -14.005 73.853  17.125  1.00 31.58 ? 462  SER A N   1 
ATOM   3650  C  CA  . SER A 1 462  ? -14.837 73.504  15.972  1.00 31.02 ? 462  SER A CA  1 
ATOM   3651  C  C   . SER A 1 462  ? -15.029 71.990  15.891  1.00 31.80 ? 462  SER A C   1 
ATOM   3652  O  O   . SER A 1 462  ? -14.928 71.398  14.810  1.00 32.13 ? 462  SER A O   1 
ATOM   3653  C  CB  . SER A 1 462  ? -14.200 74.023  14.677  1.00 30.12 ? 462  SER A CB  1 
ATOM   3654  O  OG  . SER A 1 462  ? -14.159 75.439  14.645  1.00 28.01 ? 462  SER A OG  1 
ATOM   3655  N  N   . GLY A 1 463  ? -15.310 71.380  17.044  1.00 32.14 ? 463  GLY A N   1 
ATOM   3656  C  CA  . GLY A 1 463  ? -15.515 69.941  17.129  1.00 32.76 ? 463  GLY A CA  1 
ATOM   3657  C  C   . GLY A 1 463  ? -16.509 69.336  16.149  1.00 32.58 ? 463  GLY A C   1 
ATOM   3658  O  O   . GLY A 1 463  ? -16.226 68.330  15.493  1.00 31.70 ? 463  GLY A O   1 
ATOM   3659  N  N   . ALA A 1 464  ? -17.679 69.950  16.045  1.00 32.88 ? 464  ALA A N   1 
ATOM   3660  C  CA  . ALA A 1 464  ? -18.710 69.464  15.137  1.00 32.93 ? 464  ALA A CA  1 
ATOM   3661  C  C   . ALA A 1 464  ? -18.215 69.296  13.696  1.00 32.68 ? 464  ALA A C   1 
ATOM   3662  O  O   . ALA A 1 464  ? -18.392 68.231  13.083  1.00 30.86 ? 464  ALA A O   1 
ATOM   3663  C  CB  . ALA A 1 464  ? -19.904 70.411  15.165  1.00 32.62 ? 464  ALA A CB  1 
ATOM   3664  N  N   . ALA A 1 465  ? -17.601 70.352  13.162  1.00 32.58 ? 465  ALA A N   1 
ATOM   3665  C  CA  . ALA A 1 465  ? -17.105 70.333  11.790  1.00 34.15 ? 465  ALA A CA  1 
ATOM   3666  C  C   . ALA A 1 465  ? -15.980 69.319  11.565  1.00 34.72 ? 465  ALA A C   1 
ATOM   3667  O  O   . ALA A 1 465  ? -15.908 68.691  10.502  1.00 34.44 ? 465  ALA A O   1 
ATOM   3668  C  CB  . ALA A 1 465  ? -16.648 71.733  11.376  1.00 33.47 ? 465  ALA A CB  1 
ATOM   3669  N  N   . LEU A 1 466  ? -15.107 69.162  12.556  1.00 35.59 ? 466  LEU A N   1 
ATOM   3670  C  CA  . LEU A 1 466  ? -14.008 68.214  12.428  1.00 38.05 ? 466  LEU A CA  1 
ATOM   3671  C  C   . LEU A 1 466  ? -14.557 66.795  12.347  1.00 40.28 ? 466  LEU A C   1 
ATOM   3672  O  O   . LEU A 1 466  ? -14.042 65.957  11.606  1.00 40.54 ? 466  LEU A O   1 
ATOM   3673  C  CB  . LEU A 1 466  ? -13.042 68.334  13.615  1.00 35.67 ? 466  LEU A CB  1 
ATOM   3674  C  CG  . LEU A 1 466  ? -12.012 67.206  13.687  1.00 33.22 ? 466  LEU A CG  1 
ATOM   3675  C  CD1 . LEU A 1 466  ? -10.604 67.783  13.668  1.00 32.92 ? 466  LEU A CD1 1 
ATOM   3676  C  CD2 . LEU A 1 466  ? -12.252 66.376  14.933  1.00 32.04 ? 466  LEU A CD2 1 
ATOM   3677  N  N   . ARG A 1 467  ? -15.612 66.529  13.111  1.00 43.95 ? 467  ARG A N   1 
ATOM   3678  C  CA  . ARG A 1 467  ? -16.227 65.211  13.109  1.00 47.10 ? 467  ARG A CA  1 
ATOM   3679  C  C   . ARG A 1 467  ? -16.936 64.939  11.785  1.00 47.79 ? 467  ARG A C   1 
ATOM   3680  O  O   . ARG A 1 467  ? -17.059 63.787  11.368  1.00 48.31 ? 467  ARG A O   1 
ATOM   3681  C  CB  . ARG A 1 467  ? -17.223 65.079  14.265  1.00 50.24 ? 467  ARG A CB  1 
ATOM   3682  C  CG  . ARG A 1 467  ? -17.885 63.715  14.336  1.00 54.33 ? 467  ARG A CG  1 
ATOM   3683  C  CD  . ARG A 1 467  ? -18.576 63.508  15.669  1.00 58.10 ? 467  ARG A CD  1 
ATOM   3684  N  NE  . ARG A 1 467  ? -18.661 62.086  15.997  1.00 61.03 ? 467  ARG A NE  1 
ATOM   3685  C  CZ  . ARG A 1 467  ? -18.756 61.610  17.236  1.00 61.63 ? 467  ARG A CZ  1 
ATOM   3686  N  NH1 . ARG A 1 467  ? -18.780 62.445  18.269  1.00 60.89 ? 467  ARG A NH1 1 
ATOM   3687  N  NH2 . ARG A 1 467  ? -18.810 60.299  17.440  1.00 62.10 ? 467  ARG A NH2 1 
ATOM   3688  N  N   . GLU A 1 468  ? -17.396 65.998  11.125  1.00 47.86 ? 468  GLU A N   1 
ATOM   3689  C  CA  . GLU A 1 468  ? -18.090 65.858  9.849   1.00 47.62 ? 468  GLU A CA  1 
ATOM   3690  C  C   . GLU A 1 468  ? -17.121 65.682  8.686   1.00 47.76 ? 468  GLU A C   1 
ATOM   3691  O  O   . GLU A 1 468  ? -17.377 64.902  7.768   1.00 47.93 ? 468  GLU A O   1 
ATOM   3692  C  CB  . GLU A 1 468  ? -18.997 67.069  9.609   1.00 48.03 ? 468  GLU A CB  1 
ATOM   3693  C  CG  . GLU A 1 468  ? -20.259 67.039  10.458  1.00 50.46 ? 468  GLU A CG  1 
ATOM   3694  C  CD  . GLU A 1 468  ? -20.893 68.409  10.643  1.00 51.84 ? 468  GLU A CD  1 
ATOM   3695  O  OE1 . GLU A 1 468  ? -21.107 69.122  9.635   1.00 51.72 ? 468  GLU A OE1 1 
ATOM   3696  O  OE2 . GLU A 1 468  ? -21.184 68.761  11.810  1.00 52.44 ? 468  GLU A OE2 1 
ATOM   3697  N  N   . SER A 1 469  ? -16.005 66.402  8.720   1.00 47.81 ? 469  SER A N   1 
ATOM   3698  C  CA  . SER A 1 469  ? -15.023 66.282  7.653   1.00 47.85 ? 469  SER A CA  1 
ATOM   3699  C  C   . SER A 1 469  ? -14.459 64.866  7.672   1.00 47.22 ? 469  SER A C   1 
ATOM   3700  O  O   . SER A 1 469  ? -14.200 64.277  6.627   1.00 46.40 ? 469  SER A O   1 
ATOM   3701  C  CB  . SER A 1 469  ? -13.889 67.296  7.840   1.00 47.10 ? 469  SER A CB  1 
ATOM   3702  O  OG  . SER A 1 469  ? -13.111 66.991  8.983   1.00 48.82 ? 469  SER A OG  1 
ATOM   3703  N  N   . LEU A 1 470  ? -14.282 64.324  8.871   1.00 46.96 ? 470  LEU A N   1 
ATOM   3704  C  CA  . LEU A 1 470  ? -13.743 62.985  9.019   1.00 47.86 ? 470  LEU A CA  1 
ATOM   3705  C  C   . LEU A 1 470  ? -14.806 61.961  8.680   1.00 49.47 ? 470  LEU A C   1 
ATOM   3706  O  O   . LEU A 1 470  ? -14.513 60.915  8.110   1.00 50.35 ? 470  LEU A O   1 
ATOM   3707  C  CB  . LEU A 1 470  ? -13.243 62.777  10.442  1.00 45.98 ? 470  LEU A CB  1 
ATOM   3708  C  CG  . LEU A 1 470  ? -11.732 62.783  10.654  1.00 44.61 ? 470  LEU A CG  1 
ATOM   3709  C  CD1 . LEU A 1 470  ? -11.081 63.933  9.915   1.00 44.44 ? 470  LEU A CD1 1 
ATOM   3710  C  CD2 . LEU A 1 470  ? -11.465 62.888  12.135  1.00 45.31 ? 470  LEU A CD2 1 
ATOM   3711  N  N   . TYR A 1 471  ? -16.051 62.262  9.021   1.00 51.19 ? 471  TYR A N   1 
ATOM   3712  C  CA  . TYR A 1 471  ? -17.128 61.334  8.719   1.00 52.10 ? 471  TYR A CA  1 
ATOM   3713  C  C   . TYR A 1 471  ? -17.219 61.090  7.214   1.00 51.37 ? 471  TYR A C   1 
ATOM   3714  O  O   . TYR A 1 471  ? -17.489 59.972  6.766   1.00 51.26 ? 471  TYR A O   1 
ATOM   3715  C  CB  . TYR A 1 471  ? -18.466 61.872  9.239   1.00 54.86 ? 471  TYR A CB  1 
ATOM   3716  C  CG  . TYR A 1 471  ? -19.524 60.801  9.292   1.00 58.80 ? 471  TYR A CG  1 
ATOM   3717  C  CD1 . TYR A 1 471  ? -20.260 60.470  8.149   1.00 59.18 ? 471  TYR A CD1 1 
ATOM   3718  C  CD2 . TYR A 1 471  ? -19.711 60.035  10.443  1.00 60.64 ? 471  TYR A CD2 1 
ATOM   3719  C  CE1 . TYR A 1 471  ? -21.146 59.398  8.144   1.00 60.96 ? 471  TYR A CE1 1 
ATOM   3720  C  CE2 . TYR A 1 471  ? -20.596 58.959  10.451  1.00 62.14 ? 471  TYR A CE2 1 
ATOM   3721  C  CZ  . TYR A 1 471  ? -21.308 58.646  9.294   1.00 62.42 ? 471  TYR A CZ  1 
ATOM   3722  O  OH  . TYR A 1 471  ? -22.175 57.576  9.282   1.00 62.67 ? 471  TYR A OH  1 
ATOM   3723  N  N   . ALA A 1 472  ? -16.988 62.145  6.442   1.00 50.70 ? 472  ALA A N   1 
ATOM   3724  C  CA  . ALA A 1 472  ? -17.058 62.086  4.987   1.00 50.39 ? 472  ALA A CA  1 
ATOM   3725  C  C   . ALA A 1 472  ? -16.040 61.143  4.348   1.00 50.06 ? 472  ALA A C   1 
ATOM   3726  O  O   . ALA A 1 472  ? -16.069 60.921  3.136   1.00 50.82 ? 472  ALA A O   1 
ATOM   3727  C  CB  . ALA A 1 472  ? -16.897 63.494  4.408   1.00 49.67 ? 472  ALA A CB  1 
ATOM   3728  N  N   . ILE A 1 473  ? -15.128 60.602  5.147   1.00 49.61 ? 473  ILE A N   1 
ATOM   3729  C  CA  . ILE A 1 473  ? -14.131 59.694  4.605   1.00 48.26 ? 473  ILE A CA  1 
ATOM   3730  C  C   . ILE A 1 473  ? -14.093 58.391  5.383   1.00 49.40 ? 473  ILE A C   1 
ATOM   3731  O  O   . ILE A 1 473  ? -13.122 57.636  5.305   1.00 49.38 ? 473  ILE A O   1 
ATOM   3732  C  CB  . ILE A 1 473  ? -12.723 60.332  4.581   1.00 47.07 ? 473  ILE A CB  1 
ATOM   3733  C  CG1 . ILE A 1 473  ? -12.253 60.653  5.997   1.00 46.30 ? 473  ILE A CG1 1 
ATOM   3734  C  CG2 . ILE A 1 473  ? -12.748 61.597  3.734   1.00 45.43 ? 473  ILE A CG2 1 
ATOM   3735  C  CD1 . ILE A 1 473  ? -10.773 60.939  6.069   1.00 45.10 ? 473  ILE A CD1 1 
ATOM   3736  N  N   . ASN A 1 474  ? -15.163 58.138  6.130   1.00 49.89 ? 474  ASN A N   1 
ATOM   3737  C  CA  . ASN A 1 474  ? -15.301 56.915  6.912   1.00 51.62 ? 474  ASN A CA  1 
ATOM   3738  C  C   . ASN A 1 474  ? -14.260 56.718  8.002   1.00 51.21 ? 474  ASN A C   1 
ATOM   3739  O  O   . ASN A 1 474  ? -13.782 55.608  8.227   1.00 50.90 ? 474  ASN A O   1 
ATOM   3740  C  CB  . ASN A 1 474  ? -15.308 55.705  5.980   1.00 52.73 ? 474  ASN A CB  1 
ATOM   3741  C  CG  . ASN A 1 474  ? -16.422 55.777  4.967   1.00 55.09 ? 474  ASN A CG  1 
ATOM   3742  O  OD1 . ASN A 1 474  ? -17.585 55.992  5.325   1.00 55.86 ? 474  ASN A OD1 1 
ATOM   3743  N  ND2 . ASN A 1 474  ? -16.079 55.605  3.690   1.00 56.12 ? 474  ASN A ND2 1 
ATOM   3744  N  N   . VAL A 1 475  ? -13.906 57.810  8.666   1.00 51.28 ? 475  VAL A N   1 
ATOM   3745  C  CA  . VAL A 1 475  ? -12.963 57.765  9.766   1.00 51.50 ? 475  VAL A CA  1 
ATOM   3746  C  C   . VAL A 1 475  ? -13.772 58.194  10.973  1.00 52.40 ? 475  VAL A C   1 
ATOM   3747  O  O   . VAL A 1 475  ? -13.923 59.394  11.222  1.00 53.41 ? 475  VAL A O   1 
ATOM   3748  C  CB  . VAL A 1 475  ? -11.811 58.754  9.567   1.00 50.63 ? 475  VAL A CB  1 
ATOM   3749  C  CG1 . VAL A 1 475  ? -10.924 58.759  10.805  1.00 50.41 ? 475  VAL A CG1 1 
ATOM   3750  C  CG2 . VAL A 1 475  ? -11.007 58.367  8.336   1.00 50.76 ? 475  VAL A CG2 1 
ATOM   3751  N  N   . SER A 1 476  ? -14.314 57.226  11.709  1.00 52.61 ? 476  SER A N   1 
ATOM   3752  C  CA  . SER A 1 476  ? -15.111 57.558  12.881  1.00 53.65 ? 476  SER A CA  1 
ATOM   3753  C  C   . SER A 1 476  ? -14.259 57.591  14.148  1.00 53.77 ? 476  SER A C   1 
ATOM   3754  O  O   . SER A 1 476  ? -13.451 56.693  14.404  1.00 54.13 ? 476  SER A O   1 
ATOM   3755  C  CB  . SER A 1 476  ? -16.260 56.567  13.043  1.00 54.21 ? 476  SER A CB  1 
ATOM   3756  O  OG  . SER A 1 476  ? -17.293 57.129  13.835  1.00 56.35 ? 476  SER A OG  1 
ATOM   3757  N  N   . LEU A 1 477  ? -14.447 58.650  14.930  1.00 53.56 ? 477  LEU A N   1 
ATOM   3758  C  CA  . LEU A 1 477  ? -13.708 58.848  16.166  1.00 53.53 ? 477  LEU A CA  1 
ATOM   3759  C  C   . LEU A 1 477  ? -14.488 58.294  17.347  1.00 52.89 ? 477  LEU A C   1 
ATOM   3760  O  O   . LEU A 1 477  ? -15.719 58.318  17.348  1.00 53.95 ? 477  LEU A O   1 
ATOM   3761  C  CB  . LEU A 1 477  ? -13.467 60.338  16.393  1.00 53.91 ? 477  LEU A CB  1 
ATOM   3762  C  CG  . LEU A 1 477  ? -12.862 61.166  15.261  1.00 53.56 ? 477  LEU A CG  1 
ATOM   3763  C  CD1 . LEU A 1 477  ? -12.837 62.627  15.695  1.00 54.25 ? 477  LEU A CD1 1 
ATOM   3764  C  CD2 . LEU A 1 477  ? -11.460 60.678  14.921  1.00 52.60 ? 477  LEU A CD2 1 
ATOM   3765  N  N   . PRO A 1 478  ? -13.780 57.795  18.372  1.00 52.05 ? 478  PRO A N   1 
ATOM   3766  C  CA  . PRO A 1 478  ? -14.425 57.242  19.566  1.00 51.45 ? 478  PRO A CA  1 
ATOM   3767  C  C   . PRO A 1 478  ? -15.392 58.266  20.159  1.00 51.21 ? 478  PRO A C   1 
ATOM   3768  O  O   . PRO A 1 478  ? -15.105 59.467  20.178  1.00 50.59 ? 478  PRO A O   1 
ATOM   3769  C  CB  . PRO A 1 478  ? -13.247 56.957  20.492  1.00 51.33 ? 478  PRO A CB  1 
ATOM   3770  C  CG  . PRO A 1 478  ? -12.158 56.627  19.546  1.00 51.89 ? 478  PRO A CG  1 
ATOM   3771  C  CD  . PRO A 1 478  ? -12.317 57.684  18.478  1.00 51.75 ? 478  PRO A CD  1 
ATOM   3772  N  N   . ASP A 1 479  ? -16.535 57.790  20.642  1.00 51.41 ? 479  ASP A N   1 
ATOM   3773  C  CA  . ASP A 1 479  ? -17.542 58.676  21.217  1.00 51.37 ? 479  ASP A CA  1 
ATOM   3774  C  C   . ASP A 1 479  ? -17.405 58.842  22.725  1.00 49.93 ? 479  ASP A C   1 
ATOM   3775  O  O   . ASP A 1 479  ? -17.908 59.814  23.286  1.00 49.49 ? 479  ASP A O   1 
ATOM   3776  C  CB  . ASP A 1 479  ? -18.946 58.159  20.885  1.00 53.02 ? 479  ASP A CB  1 
ATOM   3777  C  CG  . ASP A 1 479  ? -19.125 56.693  21.241  1.00 55.46 ? 479  ASP A CG  1 
ATOM   3778  O  OD1 . ASP A 1 479  ? -18.764 56.290  22.370  1.00 56.84 ? 479  ASP A OD1 1 
ATOM   3779  O  OD2 . ASP A 1 479  ? -19.632 55.939  20.388  1.00 57.60 ? 479  ASP A OD2 1 
ATOM   3780  N  N   . PHE A 1 480  ? -16.722 57.903  23.374  1.00 49.58 ? 480  PHE A N   1 
ATOM   3781  C  CA  . PHE A 1 480  ? -16.552 57.954  24.826  1.00 50.33 ? 480  PHE A CA  1 
ATOM   3782  C  C   . PHE A 1 480  ? -17.929 58.107  25.470  1.00 51.34 ? 480  PHE A C   1 
ATOM   3783  O  O   . PHE A 1 480  ? -18.109 58.877  26.418  1.00 51.15 ? 480  PHE A O   1 
ATOM   3784  C  CB  . PHE A 1 480  ? -15.647 59.131  25.222  1.00 48.49 ? 480  PHE A CB  1 
ATOM   3785  C  CG  . PHE A 1 480  ? -14.240 59.003  24.719  1.00 46.02 ? 480  PHE A CG  1 
ATOM   3786  C  CD1 . PHE A 1 480  ? -13.437 57.954  25.139  1.00 45.31 ? 480  PHE A CD1 1 
ATOM   3787  C  CD2 . PHE A 1 480  ? -13.735 59.902  23.791  1.00 45.31 ? 480  PHE A CD2 1 
ATOM   3788  C  CE1 . PHE A 1 480  ? -12.153 57.797  24.643  1.00 45.38 ? 480  PHE A CE1 1 
ATOM   3789  C  CE2 . PHE A 1 480  ? -12.449 59.753  23.286  1.00 44.75 ? 480  PHE A CE2 1 
ATOM   3790  C  CZ  . PHE A 1 480  ? -11.657 58.698  23.713  1.00 44.61 ? 480  PHE A CZ  1 
ATOM   3791  N  N   . LYS A 1 481  ? -18.897 57.364  24.942  1.00 52.89 ? 481  LYS A N   1 
ATOM   3792  C  CA  . LYS A 1 481  ? -20.265 57.426  25.440  1.00 55.49 ? 481  LYS A CA  1 
ATOM   3793  C  C   . LYS A 1 481  ? -20.350 57.251  26.953  1.00 56.05 ? 481  LYS A C   1 
ATOM   3794  O  O   . LYS A 1 481  ? -19.883 56.252  27.497  1.00 56.22 ? 481  LYS A O   1 
ATOM   3795  C  CB  . LYS A 1 481  ? -21.124 56.363  24.749  1.00 56.32 ? 481  LYS A CB  1 
ATOM   3796  C  CG  . LYS A 1 481  ? -22.611 56.452  25.080  1.00 58.00 ? 481  LYS A CG  1 
ATOM   3797  C  CD  . LYS A 1 481  ? -23.399 55.384  24.348  1.00 59.50 ? 481  LYS A CD  1 
ATOM   3798  C  CE  . LYS A 1 481  ? -24.876 55.436  24.691  1.00 59.46 ? 481  LYS A CE  1 
ATOM   3799  N  NZ  . LYS A 1 481  ? -25.646 54.383  23.966  1.00 60.10 ? 481  LYS A NZ  1 
ATOM   3800  N  N   . GLY A 1 482  ? -20.935 58.234  27.631  1.00 56.25 ? 482  GLY A N   1 
ATOM   3801  C  CA  . GLY A 1 482  ? -21.075 58.134  29.070  1.00 56.36 ? 482  GLY A CA  1 
ATOM   3802  C  C   . GLY A 1 482  ? -20.108 58.926  29.929  1.00 56.53 ? 482  GLY A C   1 
ATOM   3803  O  O   . GLY A 1 482  ? -20.191 58.841  31.155  1.00 56.99 ? 482  GLY A O   1 
ATOM   3804  N  N   . LEU A 1 483  ? -19.197 59.687  29.322  1.00 56.22 ? 483  LEU A N   1 
ATOM   3805  C  CA  . LEU A 1 483  ? -18.245 60.481  30.103  1.00 56.36 ? 483  LEU A CA  1 
ATOM   3806  C  C   . LEU A 1 483  ? -18.741 61.896  30.427  1.00 56.55 ? 483  LEU A C   1 
ATOM   3807  O  O   . LEU A 1 483  ? -19.062 62.675  29.528  1.00 57.46 ? 483  LEU A O   1 
ATOM   3808  C  CB  . LEU A 1 483  ? -16.902 60.576  29.382  1.00 55.86 ? 483  LEU A CB  1 
ATOM   3809  C  CG  . LEU A 1 483  ? -15.807 59.620  29.848  1.00 55.69 ? 483  LEU A CG  1 
ATOM   3810  C  CD1 . LEU A 1 483  ? -14.462 60.233  29.520  1.00 55.95 ? 483  LEU A CD1 1 
ATOM   3811  C  CD2 . LEU A 1 483  ? -15.904 59.392  31.347  1.00 55.15 ? 483  LEU A CD2 1 
ATOM   3812  N  N   . PRO A 1 484  ? -18.795 62.248  31.725  1.00 55.95 ? 484  PRO A N   1 
ATOM   3813  C  CA  . PRO A 1 484  ? -19.245 63.552  32.226  1.00 55.33 ? 484  PRO A CA  1 
ATOM   3814  C  C   . PRO A 1 484  ? -18.359 64.743  31.841  1.00 54.75 ? 484  PRO A C   1 
ATOM   3815  O  O   . PRO A 1 484  ? -18.071 65.605  32.679  1.00 55.64 ? 484  PRO A O   1 
ATOM   3816  C  CB  . PRO A 1 484  ? -19.273 63.349  33.740  1.00 55.49 ? 484  PRO A CB  1 
ATOM   3817  C  CG  . PRO A 1 484  ? -19.473 61.883  33.893  1.00 55.75 ? 484  PRO A CG  1 
ATOM   3818  C  CD  . PRO A 1 484  ? -18.547 61.332  32.850  1.00 55.67 ? 484  PRO A CD  1 
ATOM   3819  N  N   . VAL A 1 485  ? -17.929 64.801  30.585  1.00 52.66 ? 485  VAL A N   1 
ATOM   3820  C  CA  . VAL A 1 485  ? -17.085 65.905  30.150  1.00 49.85 ? 485  VAL A CA  1 
ATOM   3821  C  C   . VAL A 1 485  ? -17.704 66.651  28.978  1.00 48.25 ? 485  VAL A C   1 
ATOM   3822  O  O   . VAL A 1 485  ? -18.434 66.072  28.172  1.00 47.93 ? 485  VAL A O   1 
ATOM   3823  C  CB  . VAL A 1 485  ? -15.692 65.408  29.729  1.00 49.62 ? 485  VAL A CB  1 
ATOM   3824  C  CG1 . VAL A 1 485  ? -15.019 64.700  30.890  1.00 49.36 ? 485  VAL A CG1 1 
ATOM   3825  C  CG2 . VAL A 1 485  ? -15.815 64.481  28.533  1.00 48.48 ? 485  VAL A CG2 1 
ATOM   3826  N  N   . LYS A 1 486  ? -17.418 67.945  28.895  1.00 45.90 ? 486  LYS A N   1 
ATOM   3827  C  CA  . LYS A 1 486  ? -17.919 68.760  27.799  1.00 44.31 ? 486  LYS A CA  1 
ATOM   3828  C  C   . LYS A 1 486  ? -17.216 68.293  26.514  1.00 44.12 ? 486  LYS A C   1 
ATOM   3829  O  O   . LYS A 1 486  ? -16.013 68.513  26.325  1.00 43.57 ? 486  LYS A O   1 
ATOM   3830  C  CB  . LYS A 1 486  ? -17.621 70.236  28.060  1.00 42.98 ? 486  LYS A CB  1 
ATOM   3831  C  CG  . LYS A 1 486  ? -18.065 71.143  26.948  1.00 42.38 ? 486  LYS A CG  1 
ATOM   3832  C  CD  . LYS A 1 486  ? -17.722 72.591  27.235  1.00 41.55 ? 486  LYS A CD  1 
ATOM   3833  C  CE  . LYS A 1 486  ? -17.858 73.424  25.966  1.00 42.40 ? 486  LYS A CE  1 
ATOM   3834  N  NZ  . LYS A 1 486  ? -19.277 73.607  25.553  1.00 43.04 ? 486  LYS A NZ  1 
ATOM   3835  N  N   . ALA A 1 487  ? -17.969 67.629  25.640  1.00 43.38 ? 487  ALA A N   1 
ATOM   3836  C  CA  . ALA A 1 487  ? -17.423 67.121  24.383  1.00 41.37 ? 487  ALA A CA  1 
ATOM   3837  C  C   . ALA A 1 487  ? -16.918 68.232  23.470  1.00 40.33 ? 487  ALA A C   1 
ATOM   3838  O  O   . ALA A 1 487  ? -15.981 68.029  22.701  1.00 40.39 ? 487  ALA A O   1 
ATOM   3839  C  CB  . ALA A 1 487  ? -18.475 66.290  23.660  1.00 39.50 ? 487  ALA A CB  1 
ATOM   3840  N  N   . ALA A 1 488  ? -17.535 69.407  23.557  1.00 39.13 ? 488  ALA A N   1 
ATOM   3841  C  CA  . ALA A 1 488  ? -17.144 70.526  22.714  1.00 38.21 ? 488  ALA A CA  1 
ATOM   3842  C  C   . ALA A 1 488  ? -15.876 71.206  23.212  1.00 37.28 ? 488  ALA A C   1 
ATOM   3843  O  O   . ALA A 1 488  ? -15.842 72.425  23.396  1.00 39.02 ? 488  ALA A O   1 
ATOM   3844  C  CB  . ALA A 1 488  ? -18.283 71.540  22.620  1.00 37.25 ? 488  ALA A CB  1 
ATOM   3845  N  N   . THR A 1 489  ? -14.834 70.416  23.428  1.00 35.68 ? 489  THR A N   1 
ATOM   3846  C  CA  . THR A 1 489  ? -13.559 70.954  23.878  1.00 34.84 ? 489  THR A CA  1 
ATOM   3847  C  C   . THR A 1 489  ? -12.445 70.311  23.065  1.00 34.22 ? 489  THR A C   1 
ATOM   3848  O  O   . THR A 1 489  ? -12.582 69.176  22.604  1.00 33.36 ? 489  THR A O   1 
ATOM   3849  C  CB  . THR A 1 489  ? -13.303 70.626  25.346  1.00 34.95 ? 489  THR A CB  1 
ATOM   3850  O  OG1 . THR A 1 489  ? -13.247 69.202  25.503  1.00 32.96 ? 489  THR A OG1 1 
ATOM   3851  C  CG2 . THR A 1 489  ? -14.413 71.197  26.221  1.00 35.25 ? 489  THR A CG2 1 
ATOM   3852  N  N   . LYS A 1 490  ? -11.344 71.034  22.890  1.00 32.83 ? 490  LYS A N   1 
ATOM   3853  C  CA  . LYS A 1 490  ? -10.215 70.500  22.146  1.00 31.45 ? 490  LYS A CA  1 
ATOM   3854  C  C   . LYS A 1 490  ? -9.578  69.338  22.913  1.00 32.09 ? 490  LYS A C   1 
ATOM   3855  O  O   . LYS A 1 490  ? -8.942  68.469  22.317  1.00 33.27 ? 490  LYS A O   1 
ATOM   3856  C  CB  . LYS A 1 490  ? -9.209  71.616  21.849  1.00 30.26 ? 490  LYS A CB  1 
ATOM   3857  C  CG  . LYS A 1 490  ? -9.624  72.444  20.628  1.00 29.75 ? 490  LYS A CG  1 
ATOM   3858  C  CD  . LYS A 1 490  ? -8.562  73.426  20.229  1.00 30.82 ? 490  LYS A CD  1 
ATOM   3859  C  CE  . LYS A 1 490  ? -8.564  74.628  21.131  1.00 29.89 ? 490  LYS A CE  1 
ATOM   3860  N  NZ  . LYS A 1 490  ? -7.226  75.264  21.132  1.00 34.89 ? 490  LYS A NZ  1 
ATOM   3861  N  N   . ILE A 1 491  ? -9.769  69.315  24.231  1.00 31.57 ? 491  ILE A N   1 
ATOM   3862  C  CA  . ILE A 1 491  ? -9.256  68.232  25.061  1.00 30.44 ? 491  ILE A CA  1 
ATOM   3863  C  C   . ILE A 1 491  ? -9.979  66.958  24.610  1.00 31.13 ? 491  ILE A C   1 
ATOM   3864  O  O   . ILE A 1 491  ? -9.358  65.900  24.435  1.00 31.16 ? 491  ILE A O   1 
ATOM   3865  C  CB  . ILE A 1 491  ? -9.544  68.501  26.557  1.00 29.11 ? 491  ILE A CB  1 
ATOM   3866  C  CG1 . ILE A 1 491  ? -8.625  69.612  27.055  1.00 27.74 ? 491  ILE A CG1 1 
ATOM   3867  C  CG2 . ILE A 1 491  ? -9.367  67.232  27.375  1.00 26.76 ? 491  ILE A CG2 1 
ATOM   3868  C  CD1 . ILE A 1 491  ? -8.899  70.048  28.465  1.00 27.75 ? 491  ILE A CD1 1 
ATOM   3869  N  N   . PHE A 1 492  ? -11.292 67.066  24.412  1.00 29.86 ? 492  PHE A N   1 
ATOM   3870  C  CA  . PHE A 1 492  ? -12.076 65.928  23.956  1.00 30.18 ? 492  PHE A CA  1 
ATOM   3871  C  C   . PHE A 1 492  ? -11.581 65.544  22.561  1.00 30.23 ? 492  PHE A C   1 
ATOM   3872  O  O   . PHE A 1 492  ? -11.427 64.363  22.239  1.00 30.62 ? 492  PHE A O   1 
ATOM   3873  C  CB  . PHE A 1 492  ? -13.558 66.294  23.893  1.00 31.58 ? 492  PHE A CB  1 
ATOM   3874  C  CG  . PHE A 1 492  ? -14.460 65.128  23.598  1.00 32.78 ? 492  PHE A CG  1 
ATOM   3875  C  CD1 . PHE A 1 492  ? -14.846 64.256  24.610  1.00 33.50 ? 492  PHE A CD1 1 
ATOM   3876  C  CD2 . PHE A 1 492  ? -14.920 64.899  22.310  1.00 33.80 ? 492  PHE A CD2 1 
ATOM   3877  C  CE1 . PHE A 1 492  ? -15.681 63.162  24.341  1.00 34.30 ? 492  PHE A CE1 1 
ATOM   3878  C  CE2 . PHE A 1 492  ? -15.758 63.810  22.026  1.00 34.83 ? 492  PHE A CE2 1 
ATOM   3879  C  CZ  . PHE A 1 492  ? -16.138 62.940  23.044  1.00 33.73 ? 492  PHE A CZ  1 
ATOM   3880  N  N   . GLN A 1 493  ? -11.332 66.550  21.731  1.00 30.35 ? 493  GLN A N   1 
ATOM   3881  C  CA  . GLN A 1 493  ? -10.831 66.313  20.384  1.00 29.82 ? 493  GLN A CA  1 
ATOM   3882  C  C   . GLN A 1 493  ? -9.525  65.523  20.421  1.00 29.83 ? 493  GLN A C   1 
ATOM   3883  O  O   . GLN A 1 493  ? -9.338  64.590  19.646  1.00 30.86 ? 493  GLN A O   1 
ATOM   3884  C  CB  . GLN A 1 493  ? -10.594 67.643  19.653  1.00 30.07 ? 493  GLN A CB  1 
ATOM   3885  C  CG  . GLN A 1 493  ? -11.764 68.136  18.838  1.00 29.48 ? 493  GLN A CG  1 
ATOM   3886  C  CD  . GLN A 1 493  ? -11.429 69.357  18.004  1.00 30.07 ? 493  GLN A CD  1 
ATOM   3887  O  OE1 . GLN A 1 493  ? -10.502 69.340  17.185  1.00 31.71 ? 493  GLN A OE1 1 
ATOM   3888  N  NE2 . GLN A 1 493  ? -12.192 70.424  18.196  1.00 29.95 ? 493  GLN A NE2 1 
ATOM   3889  N  N   . ALA A 1 494  ? -8.623  65.905  21.317  1.00 30.36 ? 494  ALA A N   1 
ATOM   3890  C  CA  . ALA A 1 494  ? -7.337  65.228  21.432  1.00 31.84 ? 494  ALA A CA  1 
ATOM   3891  C  C   . ALA A 1 494  ? -7.571  63.761  21.736  1.00 31.99 ? 494  ALA A C   1 
ATOM   3892  O  O   . ALA A 1 494  ? -6.982  62.877  21.109  1.00 32.52 ? 494  ALA A O   1 
ATOM   3893  C  CB  . ALA A 1 494  ? -6.497  65.872  22.535  1.00 31.55 ? 494  ALA A CB  1 
ATOM   3894  N  N   . ALA A 1 495  ? -8.439  63.508  22.705  1.00 32.63 ? 495  ALA A N   1 
ATOM   3895  C  CA  . ALA A 1 495  ? -8.757  62.144  23.086  1.00 33.23 ? 495  ALA A CA  1 
ATOM   3896  C  C   . ALA A 1 495  ? -9.244  61.337  21.880  1.00 33.65 ? 495  ALA A C   1 
ATOM   3897  O  O   . ALA A 1 495  ? -8.832  60.195  21.695  1.00 34.05 ? 495  ALA A O   1 
ATOM   3898  C  CB  . ALA A 1 495  ? -9.815  62.142  24.180  1.00 35.68 ? 495  ALA A CB  1 
ATOM   3899  N  N   . GLN A 1 496  ? -10.115 61.921  21.060  1.00 33.91 ? 496  GLN A N   1 
ATOM   3900  C  CA  . GLN A 1 496  ? -10.638 61.221  19.887  1.00 34.32 ? 496  GLN A CA  1 
ATOM   3901  C  C   . GLN A 1 496  ? -9.596  60.929  18.799  1.00 34.38 ? 496  GLN A C   1 
ATOM   3902  O  O   . GLN A 1 496  ? -9.652  59.889  18.136  1.00 34.10 ? 496  GLN A O   1 
ATOM   3903  C  CB  . GLN A 1 496  ? -11.780 62.020  19.250  1.00 35.37 ? 496  GLN A CB  1 
ATOM   3904  C  CG  . GLN A 1 496  ? -13.011 62.189  20.123  1.00 36.45 ? 496  GLN A CG  1 
ATOM   3905  C  CD  . GLN A 1 496  ? -14.195 62.760  19.351  1.00 37.38 ? 496  GLN A CD  1 
ATOM   3906  O  OE1 . GLN A 1 496  ? -14.164 63.906  18.905  1.00 37.57 ? 496  GLN A OE1 1 
ATOM   3907  N  NE2 . GLN A 1 496  ? -15.241 61.960  19.192  1.00 36.31 ? 496  GLN A NE2 1 
ATOM   3908  N  N   . LEU A 1 497  ? -8.642  61.839  18.622  1.00 34.34 ? 497  LEU A N   1 
ATOM   3909  C  CA  . LEU A 1 497  ? -7.636  61.693  17.584  1.00 33.22 ? 497  LEU A CA  1 
ATOM   3910  C  C   . LEU A 1 497  ? -6.394  60.941  18.023  1.00 33.41 ? 497  LEU A C   1 
ATOM   3911  O  O   . LEU A 1 497  ? -5.728  60.297  17.217  1.00 33.14 ? 497  LEU A O   1 
ATOM   3912  C  CB  . LEU A 1 497  ? -7.261  63.082  17.059  1.00 32.17 ? 497  LEU A CB  1 
ATOM   3913  C  CG  . LEU A 1 497  ? -8.462  63.947  16.641  1.00 30.28 ? 497  LEU A CG  1 
ATOM   3914  C  CD1 . LEU A 1 497  ? -8.059  65.397  16.469  1.00 28.57 ? 497  LEU A CD1 1 
ATOM   3915  C  CD2 . LEU A 1 497  ? -9.049  63.391  15.365  1.00 31.05 ? 497  LEU A CD2 1 
ATOM   3916  N  N   . ALA A 1 498  ? -6.103  61.007  19.312  1.00 35.33 ? 498  ALA A N   1 
ATOM   3917  C  CA  . ALA A 1 498  ? -4.924  60.369  19.907  1.00 36.25 ? 498  ALA A CA  1 
ATOM   3918  C  C   . ALA A 1 498  ? -4.264  59.169  19.209  1.00 37.48 ? 498  ALA A C   1 
ATOM   3919  O  O   . ALA A 1 498  ? -3.045  59.134  19.055  1.00 36.79 ? 498  ALA A O   1 
ATOM   3920  C  CB  . ALA A 1 498  ? -5.233  60.003  21.345  1.00 34.39 ? 498  ALA A CB  1 
ATOM   3921  N  N   . ASN A 1 499  ? -5.042  58.186  18.781  1.00 39.64 ? 499  ASN A N   1 
ATOM   3922  C  CA  . ASN A 1 499  ? -4.429  57.005  18.171  1.00 42.23 ? 499  ASN A CA  1 
ATOM   3923  C  C   . ASN A 1 499  ? -4.605  56.856  16.665  1.00 42.19 ? 499  ASN A C   1 
ATOM   3924  O  O   . ASN A 1 499  ? -4.532  55.747  16.130  1.00 43.26 ? 499  ASN A O   1 
ATOM   3925  C  CB  . ASN A 1 499  ? -4.943  55.733  18.866  1.00 44.25 ? 499  ASN A CB  1 
ATOM   3926  C  CG  . ASN A 1 499  ? -4.628  55.709  20.353  1.00 46.01 ? 499  ASN A CG  1 
ATOM   3927  O  OD1 . ASN A 1 499  ? -3.465  55.571  20.748  1.00 46.32 ? 499  ASN A OD1 1 
ATOM   3928  N  ND2 . ASN A 1 499  ? -5.666  55.847  21.186  1.00 46.01 ? 499  ASN A ND2 1 
ATOM   3929  N  N   . LEU A 1 500  ? -4.825  57.966  15.976  1.00 41.40 ? 500  LEU A N   1 
ATOM   3930  C  CA  . LEU A 1 500  ? -5.004  57.915  14.539  1.00 40.71 ? 500  LEU A CA  1 
ATOM   3931  C  C   . LEU A 1 500  ? -3.791  58.504  13.852  1.00 40.90 ? 500  LEU A C   1 
ATOM   3932  O  O   . LEU A 1 500  ? -3.221  59.490  14.322  1.00 42.69 ? 500  LEU A O   1 
ATOM   3933  C  CB  . LEU A 1 500  ? -6.264  58.684  14.146  1.00 39.43 ? 500  LEU A CB  1 
ATOM   3934  C  CG  . LEU A 1 500  ? -7.564  58.146  14.749  1.00 38.72 ? 500  LEU A CG  1 
ATOM   3935  C  CD1 . LEU A 1 500  ? -8.719  59.098  14.468  1.00 38.53 ? 500  LEU A CD1 1 
ATOM   3936  C  CD2 . LEU A 1 500  ? -7.855  56.784  14.161  1.00 38.51 ? 500  LEU A CD2 1 
ATOM   3937  N  N   . PRO A 1 501  ? -3.349  57.888  12.749  1.00 40.49 ? 501  PRO A N   1 
ATOM   3938  C  CA  . PRO A 1 501  ? -2.178  58.435  12.057  1.00 40.24 ? 501  PRO A CA  1 
ATOM   3939  C  C   . PRO A 1 501  ? -2.526  59.774  11.427  1.00 40.12 ? 501  PRO A C   1 
ATOM   3940  O  O   . PRO A 1 501  ? -3.704  60.080  11.209  1.00 38.25 ? 501  PRO A O   1 
ATOM   3941  C  CB  . PRO A 1 501  ? -1.855  57.364  11.018  1.00 41.34 ? 501  PRO A CB  1 
ATOM   3942  C  CG  . PRO A 1 501  ? -2.259  56.106  11.726  1.00 41.27 ? 501  PRO A CG  1 
ATOM   3943  C  CD  . PRO A 1 501  ? -3.605  56.503  12.327  1.00 40.73 ? 501  PRO A CD  1 
ATOM   3944  N  N   . PHE A 1 502  ? -1.494  60.570  11.156  1.00 39.89 ? 502  PHE A N   1 
ATOM   3945  C  CA  . PHE A 1 502  ? -1.660  61.882  10.552  1.00 39.50 ? 502  PHE A CA  1 
ATOM   3946  C  C   . PHE A 1 502  ? -2.480  61.787  9.270   1.00 40.01 ? 502  PHE A C   1 
ATOM   3947  O  O   . PHE A 1 502  ? -3.345  62.618  9.016   1.00 41.24 ? 502  PHE A O   1 
ATOM   3948  C  CB  . PHE A 1 502  ? -0.291  62.474  10.234  1.00 37.81 ? 502  PHE A CB  1 
ATOM   3949  C  CG  . PHE A 1 502  ? -0.356  63.764  9.474   1.00 37.05 ? 502  PHE A CG  1 
ATOM   3950  C  CD1 . PHE A 1 502  ? -0.825  64.918  10.085  1.00 35.67 ? 502  PHE A CD1 1 
ATOM   3951  C  CD2 . PHE A 1 502  ? 0.039   63.821  8.135   1.00 37.49 ? 502  PHE A CD2 1 
ATOM   3952  C  CE1 . PHE A 1 502  ? -0.915  66.113  9.373   1.00 35.34 ? 502  PHE A CE1 1 
ATOM   3953  C  CE2 . PHE A 1 502  ? -0.048  65.014  7.410   1.00 37.62 ? 502  PHE A CE2 1 
ATOM   3954  C  CZ  . PHE A 1 502  ? -0.523  66.165  8.034   1.00 36.15 ? 502  PHE A CZ  1 
ATOM   3955  N  N   . SER A 1 503  ? -2.205  60.763  8.473   1.00 40.55 ? 503  SER A N   1 
ATOM   3956  C  CA  . SER A 1 503  ? -2.888  60.552  7.196   1.00 41.77 ? 503  SER A CA  1 
ATOM   3957  C  C   . SER A 1 503  ? -4.410  60.399  7.244   1.00 41.76 ? 503  SER A C   1 
ATOM   3958  O  O   . SER A 1 503  ? -5.096  60.699  6.269   1.00 42.96 ? 503  SER A O   1 
ATOM   3959  C  CB  . SER A 1 503  ? -2.278  59.337  6.478   1.00 42.17 ? 503  SER A CB  1 
ATOM   3960  O  OG  . SER A 1 503  ? -1.837  58.352  7.401   1.00 43.28 ? 503  SER A OG  1 
ATOM   3961  N  N   . HIS A 1 504  ? -4.938  59.931  8.366   1.00 42.15 ? 504  HIS A N   1 
ATOM   3962  C  CA  . HIS A 1 504  ? -6.374  59.727  8.505   1.00 41.78 ? 504  HIS A CA  1 
ATOM   3963  C  C   . HIS A 1 504  ? -7.127  60.990  8.863   1.00 41.25 ? 504  HIS A C   1 
ATOM   3964  O  O   . HIS A 1 504  ? -8.295  61.139  8.529   1.00 41.79 ? 504  HIS A O   1 
ATOM   3965  C  CB  . HIS A 1 504  ? -6.641  58.669  9.568   1.00 44.02 ? 504  HIS A CB  1 
ATOM   3966  C  CG  . HIS A 1 504  ? -5.989  57.361  9.276   1.00 47.14 ? 504  HIS A CG  1 
ATOM   3967  N  ND1 . HIS A 1 504  ? -6.704  56.234  8.925   1.00 48.06 ? 504  HIS A ND1 1 
ATOM   3968  C  CD2 . HIS A 1 504  ? -4.681  57.005  9.233   1.00 48.10 ? 504  HIS A CD2 1 
ATOM   3969  C  CE1 . HIS A 1 504  ? -5.866  55.243  8.680   1.00 48.72 ? 504  HIS A CE1 1 
ATOM   3970  N  NE2 . HIS A 1 504  ? -4.631  55.687  8.861   1.00 49.22 ? 504  HIS A NE2 1 
ATOM   3971  N  N   . THR A 1 505  ? -6.456  61.906  9.539   1.00 39.42 ? 505  THR A N   1 
ATOM   3972  C  CA  . THR A 1 505  ? -7.093  63.141  9.956   1.00 38.80 ? 505  THR A CA  1 
ATOM   3973  C  C   . THR A 1 505  ? -6.768  64.321  9.036   1.00 39.05 ? 505  THR A C   1 
ATOM   3974  O  O   . THR A 1 505  ? -7.367  65.386  9.153   1.00 39.80 ? 505  THR A O   1 
ATOM   3975  C  CB  . THR A 1 505  ? -6.664  63.487  11.392  1.00 38.14 ? 505  THR A CB  1 
ATOM   3976  O  OG1 . THR A 1 505  ? -5.236  63.597  11.449  1.00 37.91 ? 505  THR A OG1 1 
ATOM   3977  C  CG2 . THR A 1 505  ? -7.113  62.402  12.360  1.00 37.43 ? 505  THR A CG2 1 
ATOM   3978  N  N   . SER A 1 506  ? -5.824  64.129  8.121   1.00 38.67 ? 506  SER A N   1 
ATOM   3979  C  CA  . SER A 1 506  ? -5.415  65.189  7.201   1.00 38.63 ? 506  SER A CA  1 
ATOM   3980  C  C   . SER A 1 506  ? -6.566  66.032  6.664   1.00 37.73 ? 506  SER A C   1 
ATOM   3981  O  O   . SER A 1 506  ? -6.488  67.257  6.658   1.00 38.05 ? 506  SER A O   1 
ATOM   3982  C  CB  . SER A 1 506  ? -4.664  64.597  6.009   1.00 39.37 ? 506  SER A CB  1 
ATOM   3983  O  OG  . SER A 1 506  ? -3.705  63.655  6.433   1.00 41.09 ? 506  SER A OG  1 
ATOM   3984  N  N   . VAL A 1 507  ? -7.628  65.376  6.211   1.00 36.13 ? 507  VAL A N   1 
ATOM   3985  C  CA  . VAL A 1 507  ? -8.765  66.086  5.640   1.00 35.53 ? 507  VAL A CA  1 
ATOM   3986  C  C   . VAL A 1 507  ? -9.405  67.090  6.589   1.00 34.15 ? 507  VAL A C   1 
ATOM   3987  O  O   . VAL A 1 507  ? -10.036 68.048  6.148   1.00 33.74 ? 507  VAL A O   1 
ATOM   3988  C  CB  . VAL A 1 507  ? -9.869  65.098  5.131   1.00 35.66 ? 507  VAL A CB  1 
ATOM   3989  C  CG1 . VAL A 1 507  ? -9.230  64.006  4.271   1.00 36.21 ? 507  VAL A CG1 1 
ATOM   3990  C  CG2 . VAL A 1 507  ? -10.626 64.487  6.297   1.00 34.79 ? 507  VAL A CG2 1 
ATOM   3991  N  N   . ALA A 1 508  ? -9.248  66.872  7.888   1.00 33.27 ? 508  ALA A N   1 
ATOM   3992  C  CA  . ALA A 1 508  ? -9.835  67.776  8.868   1.00 32.89 ? 508  ALA A CA  1 
ATOM   3993  C  C   . ALA A 1 508  ? -9.197  69.158  8.780   1.00 32.33 ? 508  ALA A C   1 
ATOM   3994  O  O   . ALA A 1 508  ? -9.794  70.147  9.204   1.00 33.05 ? 508  ALA A O   1 
ATOM   3995  C  CB  . ALA A 1 508  ? -9.672  67.205  10.277  1.00 32.40 ? 508  ALA A CB  1 
ATOM   3996  N  N   . ILE A 1 509  ? -7.993  69.222  8.216   1.00 30.91 ? 509  ILE A N   1 
ATOM   3997  C  CA  . ILE A 1 509  ? -7.277  70.483  8.080   1.00 29.65 ? 509  ILE A CA  1 
ATOM   3998  C  C   . ILE A 1 509  ? -8.056  71.455  7.208   1.00 29.67 ? 509  ILE A C   1 
ATOM   3999  O  O   . ILE A 1 509  ? -7.903  72.674  7.323   1.00 30.22 ? 509  ILE A O   1 
ATOM   4000  C  CB  . ILE A 1 509  ? -5.850  70.251  7.517   1.00 28.27 ? 509  ILE A CB  1 
ATOM   4001  C  CG1 . ILE A 1 509  ? -5.055  69.385  8.514   1.00 27.94 ? 509  ILE A CG1 1 
ATOM   4002  C  CG2 . ILE A 1 509  ? -5.128  71.572  7.333   1.00 26.31 ? 509  ILE A CG2 1 
ATOM   4003  C  CD1 . ILE A 1 509  ? -3.690  68.952  8.036   1.00 26.48 ? 509  ILE A CD1 1 
ATOM   4004  N  N   . LEU A 1 510  ? -8.931  70.916  6.364   1.00 30.22 ? 510  LEU A N   1 
ATOM   4005  C  CA  . LEU A 1 510  ? -9.739  71.745  5.479   1.00 29.97 ? 510  LEU A CA  1 
ATOM   4006  C  C   . LEU A 1 510  ? -11.195 71.878  5.933   1.00 29.88 ? 510  LEU A C   1 
ATOM   4007  O  O   . LEU A 1 510  ? -12.006 72.482  5.235   1.00 29.22 ? 510  LEU A O   1 
ATOM   4008  C  CB  . LEU A 1 510  ? -9.690  71.182  4.058   1.00 30.55 ? 510  LEU A CB  1 
ATOM   4009  C  CG  . LEU A 1 510  ? -8.268  70.920  3.539   1.00 33.53 ? 510  LEU A CG  1 
ATOM   4010  C  CD1 . LEU A 1 510  ? -8.300  70.166  2.229   1.00 32.58 ? 510  LEU A CD1 1 
ATOM   4011  C  CD2 . LEU A 1 510  ? -7.553  72.246  3.360   1.00 31.85 ? 510  LEU A CD2 1 
ATOM   4012  N  N   . ALA A 1 511  ? -11.524 71.329  7.100   1.00 29.27 ? 511  ALA A N   1 
ATOM   4013  C  CA  . ALA A 1 511  ? -12.891 71.409  7.617   1.00 30.42 ? 511  ALA A CA  1 
ATOM   4014  C  C   . ALA A 1 511  ? -13.322 72.826  8.022   1.00 30.91 ? 511  ALA A C   1 
ATOM   4015  O  O   . ALA A 1 511  ? -12.486 73.671  8.333   1.00 32.02 ? 511  ALA A O   1 
ATOM   4016  C  CB  . ALA A 1 511  ? -13.046 70.476  8.796   1.00 29.31 ? 511  ALA A CB  1 
ATOM   4017  N  N   . ASP A 1 512  ? -14.633 73.075  8.010   1.00 31.96 ? 512  ASP A N   1 
ATOM   4018  C  CA  . ASP A 1 512  ? -15.190 74.378  8.398   1.00 32.18 ? 512  ASP A CA  1 
ATOM   4019  C  C   . ASP A 1 512  ? -14.694 74.822  9.777   1.00 32.58 ? 512  ASP A C   1 
ATOM   4020  O  O   . ASP A 1 512  ? -14.261 74.008  10.598  1.00 31.36 ? 512  ASP A O   1 
ATOM   4021  C  CB  . ASP A 1 512  ? -16.732 74.341  8.461   1.00 31.68 ? 512  ASP A CB  1 
ATOM   4022  C  CG  . ASP A 1 512  ? -17.389 74.235  7.096   1.00 31.26 ? 512  ASP A CG  1 
ATOM   4023  O  OD1 . ASP A 1 512  ? -16.801 74.680  6.092   1.00 31.12 ? 512  ASP A OD1 1 
ATOM   4024  O  OD2 . ASP A 1 512  ? -18.521 73.721  7.030   1.00 32.92 ? 512  ASP A OD2 1 
ATOM   4025  N  N   . THR A 1 513  ? -14.800 76.123  10.020  1.00 33.69 ? 513  THR A N   1 
ATOM   4026  C  CA  . THR A 1 513  ? -14.401 76.744  11.280  1.00 35.15 ? 513  THR A CA  1 
ATOM   4027  C  C   . THR A 1 513  ? -15.643 77.417  11.887  1.00 36.35 ? 513  THR A C   1 
ATOM   4028  O  O   . THR A 1 513  ? -16.238 78.303  11.269  1.00 36.28 ? 513  THR A O   1 
ATOM   4029  C  CB  . THR A 1 513  ? -13.293 77.805  11.035  1.00 34.77 ? 513  THR A CB  1 
ATOM   4030  O  OG1 . THR A 1 513  ? -12.110 77.159  10.542  1.00 33.74 ? 513  THR A OG1 1 
ATOM   4031  C  CG2 . THR A 1 513  ? -12.961 78.542  12.317  1.00 34.26 ? 513  THR A CG2 1 
ATOM   4032  N  N   . SER A 1 514  ? -16.048 76.989  13.080  1.00 37.50 ? 514  SER A N   1 
ATOM   4033  C  CA  . SER A 1 514  ? -17.230 77.562  13.730  1.00 39.00 ? 514  SER A CA  1 
ATOM   4034  C  C   . SER A 1 514  ? -16.958 78.911  14.372  1.00 38.98 ? 514  SER A C   1 
ATOM   4035  O  O   . SER A 1 514  ? -16.074 79.043  15.212  1.00 39.71 ? 514  SER A O   1 
ATOM   4036  C  CB  . SER A 1 514  ? -17.773 76.604  14.789  1.00 39.39 ? 514  SER A CB  1 
ATOM   4037  O  OG  . SER A 1 514  ? -18.377 75.476  14.179  1.00 43.06 ? 514  SER A OG  1 
ATOM   4038  N  N   . MET A 1 515  ? -17.742 79.910  13.992  1.00 39.31 ? 515  MET A N   1 
ATOM   4039  C  CA  . MET A 1 515  ? -17.552 81.244  14.529  1.00 40.09 ? 515  MET A CA  1 
ATOM   4040  C  C   . MET A 1 515  ? -18.029 81.473  15.954  1.00 39.07 ? 515  MET A C   1 
ATOM   4041  O  O   . MET A 1 515  ? -19.091 81.001  16.357  1.00 38.96 ? 515  MET A O   1 
ATOM   4042  C  CB  . MET A 1 515  ? -18.219 82.288  13.648  1.00 42.73 ? 515  MET A CB  1 
ATOM   4043  C  CG  . MET A 1 515  ? -18.149 83.649  14.292  1.00 47.87 ? 515  MET A CG  1 
ATOM   4044  S  SD  . MET A 1 515  ? -18.946 84.934  13.359  1.00 55.37 ? 515  MET A SD  1 
ATOM   4045  C  CE  . MET A 1 515  ? -17.478 85.643  12.602  1.00 54.01 ? 515  MET A CE  1 
ATOM   4046  N  N   . GLY A 1 516  ? -17.229 82.228  16.696  1.00 38.21 ? 516  GLY A N   1 
ATOM   4047  C  CA  . GLY A 1 516  ? -17.543 82.584  18.065  1.00 36.24 ? 516  GLY A CA  1 
ATOM   4048  C  C   . GLY A 1 516  ? -17.690 84.093  18.098  1.00 35.27 ? 516  GLY A C   1 
ATOM   4049  O  O   . GLY A 1 516  ? -17.528 84.761  17.070  1.00 34.19 ? 516  GLY A O   1 
ATOM   4050  N  N   . LEU A 1 517  ? -17.987 84.648  19.264  1.00 34.58 ? 517  LEU A N   1 
ATOM   4051  C  CA  . LEU A 1 517  ? -18.164 86.085  19.347  1.00 33.76 ? 517  LEU A CA  1 
ATOM   4052  C  C   . LEU A 1 517  ? -17.915 86.617  20.737  1.00 33.72 ? 517  LEU A C   1 
ATOM   4053  O  O   . LEU A 1 517  ? -18.106 85.912  21.725  1.00 35.31 ? 517  LEU A O   1 
ATOM   4054  C  CB  . LEU A 1 517  ? -19.586 86.460  18.911  1.00 33.98 ? 517  LEU A CB  1 
ATOM   4055  C  CG  . LEU A 1 517  ? -19.699 87.536  17.827  1.00 35.75 ? 517  LEU A CG  1 
ATOM   4056  C  CD1 . LEU A 1 517  ? -19.271 86.956  16.497  1.00 33.96 ? 517  LEU A CD1 1 
ATOM   4057  C  CD2 . LEU A 1 517  ? -21.137 88.057  17.742  1.00 37.73 ? 517  LEU A CD2 1 
ATOM   4058  N  N   . ARG A 1 518  ? -17.485 87.871  20.801  1.00 33.21 ? 518  ARG A N   1 
ATOM   4059  C  CA  . ARG A 1 518  ? -17.235 88.532  22.069  1.00 33.49 ? 518  ARG A CA  1 
ATOM   4060  C  C   . ARG A 1 518  ? -17.406 90.025  21.852  1.00 31.06 ? 518  ARG A C   1 
ATOM   4061  O  O   . ARG A 1 518  ? -16.771 90.610  20.974  1.00 30.59 ? 518  ARG A O   1 
ATOM   4062  C  CB  . ARG A 1 518  ? -15.828 88.227  22.560  1.00 36.48 ? 518  ARG A CB  1 
ATOM   4063  C  CG  . ARG A 1 518  ? -15.592 88.642  24.000  1.00 42.40 ? 518  ARG A CG  1 
ATOM   4064  C  CD  . ARG A 1 518  ? -14.126 88.517  24.333  1.00 45.71 ? 518  ARG A CD  1 
ATOM   4065  N  NE  . ARG A 1 518  ? -13.682 87.140  24.171  1.00 49.85 ? 518  ARG A NE  1 
ATOM   4066  C  CZ  . ARG A 1 518  ? -12.420 86.745  24.290  1.00 52.71 ? 518  ARG A CZ  1 
ATOM   4067  N  NH1 . ARG A 1 518  ? -11.473 87.633  24.568  1.00 54.06 ? 518  ARG A NH1 1 
ATOM   4068  N  NH2 . ARG A 1 518  ? -12.108 85.462  24.142  1.00 54.19 ? 518  ARG A NH2 1 
ATOM   4069  N  N   . ASN A 1 519  ? -18.281 90.638  22.642  1.00 28.87 ? 519  ASN A N   1 
ATOM   4070  C  CA  . ASN A 1 519  ? -18.530 92.062  22.514  1.00 27.46 ? 519  ASN A CA  1 
ATOM   4071  C  C   . ASN A 1 519  ? -17.471 92.917  23.216  1.00 27.00 ? 519  ASN A C   1 
ATOM   4072  O  O   . ASN A 1 519  ? -16.759 92.450  24.104  1.00 26.97 ? 519  ASN A O   1 
ATOM   4073  C  CB  . ASN A 1 519  ? -19.941 92.387  23.009  1.00 26.13 ? 519  ASN A CB  1 
ATOM   4074  C  CG  . ASN A 1 519  ? -21.018 91.555  22.297  1.00 25.17 ? 519  ASN A CG  1 
ATOM   4075  O  OD1 . ASN A 1 519  ? -21.010 91.417  21.066  1.00 23.83 ? 519  ASN A OD1 1 
ATOM   4076  N  ND2 . ASN A 1 519  ? -21.947 91.003  23.072  1.00 23.74 ? 519  ASN A ND2 1 
ATOM   4077  N  N   . GLN A 1 520  ? -17.355 94.168  22.790  1.00 26.62 ? 520  GLN A N   1 
ATOM   4078  C  CA  . GLN A 1 520  ? -16.352 95.070  23.338  1.00 27.27 ? 520  GLN A CA  1 
ATOM   4079  C  C   . GLN A 1 520  ? -16.887 96.446  23.698  1.00 25.70 ? 520  GLN A C   1 
ATOM   4080  O  O   . GLN A 1 520  ? -17.871 96.919  23.126  1.00 23.51 ? 520  GLN A O   1 
ATOM   4081  C  CB  . GLN A 1 520  ? -15.221 95.252  22.318  1.00 29.41 ? 520  GLN A CB  1 
ATOM   4082  C  CG  . GLN A 1 520  ? -14.339 94.043  22.144  1.00 34.76 ? 520  GLN A CG  1 
ATOM   4083  C  CD  . GLN A 1 520  ? -13.320 94.218  21.026  1.00 38.70 ? 520  GLN A CD  1 
ATOM   4084  O  OE1 . GLN A 1 520  ? -13.650 94.090  19.837  1.00 40.15 ? 520  GLN A OE1 1 
ATOM   4085  N  NE2 . GLN A 1 520  ? -12.075 94.522  21.401  1.00 37.71 ? 520  GLN A NE2 1 
ATOM   4086  N  N   . VAL A 1 521  ? -16.222 97.100  24.636  1.00 24.04 ? 521  VAL A N   1 
ATOM   4087  C  CA  . VAL A 1 521  ? -16.622 98.438  24.989  1.00 25.07 ? 521  VAL A CA  1 
ATOM   4088  C  C   . VAL A 1 521  ? -16.091 99.367  23.889  1.00 28.41 ? 521  VAL A C   1 
ATOM   4089  O  O   . VAL A 1 521  ? -14.976 99.178  23.386  1.00 29.55 ? 521  VAL A O   1 
ATOM   4090  C  CB  . VAL A 1 521  ? -16.022 98.854  26.338  1.00 24.39 ? 521  VAL A CB  1 
ATOM   4091  C  CG1 . VAL A 1 521  ? -16.356 100.323 26.633  1.00 23.22 ? 521  VAL A CG1 1 
ATOM   4092  C  CG2 . VAL A 1 521  ? -16.542 97.928  27.444  1.00 19.73 ? 521  VAL A CG2 1 
ATOM   4093  N  N   . GLN A 1 522  ? -16.894 100.356 23.502  1.00 30.35 ? 522  GLN A N   1 
ATOM   4094  C  CA  . GLN A 1 522  ? -16.485 101.318 22.479  1.00 32.46 ? 522  GLN A CA  1 
ATOM   4095  C  C   . GLN A 1 522  ? -15.964 100.703 21.186  1.00 34.90 ? 522  GLN A C   1 
ATOM   4096  O  O   . GLN A 1 522  ? -15.192 101.344 20.462  1.00 34.66 ? 522  GLN A O   1 
ATOM   4097  C  CB  . GLN A 1 522  ? -15.408 102.241 23.044  1.00 30.85 ? 522  GLN A CB  1 
ATOM   4098  C  CG  . GLN A 1 522  ? -15.952 103.352 23.872  1.00 32.80 ? 522  GLN A CG  1 
ATOM   4099  C  CD  . GLN A 1 522  ? -14.934 103.909 24.824  1.00 31.10 ? 522  GLN A CD  1 
ATOM   4100  O  OE1 . GLN A 1 522  ? -13.818 104.247 24.437  1.00 31.82 ? 522  GLN A OE1 1 
ATOM   4101  N  NE2 . GLN A 1 522  ? -15.316 104.019 26.085  1.00 31.35 ? 522  GLN A NE2 1 
ATOM   4102  N  N   . ARG A 1 523  ? -16.393 99.481  20.880  1.00 38.07 ? 523  ARG A N   1 
ATOM   4103  C  CA  . ARG A 1 523  ? -15.931 98.797  19.683  1.00 40.27 ? 523  ARG A CA  1 
ATOM   4104  C  C   . ARG A 1 523  ? -16.923 97.754  19.219  1.00 40.25 ? 523  ARG A C   1 
ATOM   4105  O  O   . ARG A 1 523  ? -17.728 97.210  19.962  1.00 41.03 ? 523  ARG A O   1 
ATOM   4106  C  CB  . ARG A 1 523  ? -14.567 98.143  19.958  1.00 43.72 ? 523  ARG A CB  1 
ATOM   4107  C  CG  . ARG A 1 523  ? -13.771 97.739  18.725  1.00 49.79 ? 523  ARG A CG  1 
ATOM   4108  C  CD  . ARG A 1 523  ? -12.437 97.111  19.107  1.00 54.28 ? 523  ARG A CD  1 
ATOM   4109  N  NE  . ARG A 1 523  ? -11.708 96.622  17.935  1.00 57.96 ? 523  ARG A NE  1 
ATOM   4110  C  CZ  . ARG A 1 523  ? -12.098 95.590  17.183  1.00 60.59 ? 523  ARG A CZ  1 
ATOM   4111  N  NH1 . ARG A 1 523  ? -13.216 94.927  17.476  1.00 61.16 ? 523  ARG A NH1 1 
ATOM   4112  N  NH2 . ARG A 1 523  ? -11.374 95.229  16.125  1.00 61.46 ? 523  ARG A NH2 1 
ATOM   4113  N  N   . ARG A 1 524  ? -16.830 97.500  17.908  1.00 41.14 ? 524  ARG A N   1 
ATOM   4114  C  CA  . ARG A 1 524  ? -17.664 96.523  17.200  1.00 42.99 ? 524  ARG A CA  1 
ATOM   4115  C  C   . ARG A 1 524  ? -17.232 95.098  17.582  1.00 42.94 ? 524  ARG A C   1 
ATOM   4116  O  O   . ARG A 1 524  ? -16.034 94.868  17.795  1.00 42.94 ? 524  ARG A O   1 
ATOM   4117  C  CB  . ARG A 1 524  ? -17.534 96.755  15.711  1.00 45.08 ? 524  ARG A CB  1 
ATOM   4118  C  CG  . ARG A 1 524  ? -16.152 96.443  15.176  1.00 49.10 ? 524  ARG A CG  1 
ATOM   4119  C  CD  . ARG A 1 524  ? -16.016 96.899  13.737  1.00 53.43 ? 524  ARG A CD  1 
ATOM   4120  N  NE  . ARG A 1 524  ? -14.717 96.543  13.170  1.00 57.69 ? 524  ARG A NE  1 
ATOM   4121  C  CZ  . ARG A 1 524  ? -14.300 96.923  11.966  1.00 59.93 ? 524  ARG A CZ  1 
ATOM   4122  N  NH1 . ARG A 1 524  ? -15.083 97.676  11.200  1.00 59.78 ? 524  ARG A NH1 1 
ATOM   4123  N  NH2 . ARG A 1 524  ? -13.103 96.553  11.530  1.00 61.40 ? 524  ARG A NH2 1 
ATOM   4124  N  N   . PRO A 1 525  ? -18.186 94.099  17.601  1.00 43.30 ? 525  PRO A N   1 
ATOM   4125  C  CA  . PRO A 1 525  ? -17.812 92.739  17.959  1.00 44.36 ? 525  PRO A CA  1 
ATOM   4126  C  C   . PRO A 1 525  ? -16.589 92.066  17.452  1.00 46.15 ? 525  PRO A C   1 
ATOM   4127  O  O   . PRO A 1 525  ? -16.207 92.217  16.312  1.00 45.52 ? 525  PRO A O   1 
ATOM   4128  C  CB  . PRO A 1 525  ? -19.103 91.957  17.682  1.00 42.62 ? 525  PRO A CB  1 
ATOM   4129  C  CG  . PRO A 1 525  ? -20.146 92.934  18.127  1.00 42.69 ? 525  PRO A CG  1 
ATOM   4130  C  CD  . PRO A 1 525  ? -19.581 94.332  17.941  1.00 42.24 ? 525  PRO A CD  1 
ATOM   4131  N  N   . ARG A 1 526  ? -15.905 91.332  18.325  1.00 48.60 ? 526  ARG A N   1 
ATOM   4132  C  CA  . ARG A 1 526  ? -14.769 90.612  17.791  1.00 50.85 ? 526  ARG A CA  1 
ATOM   4133  C  C   . ARG A 1 526  ? -15.215 89.176  17.409  1.00 51.22 ? 526  ARG A C   1 
ATOM   4134  O  O   . ARG A 1 526  ? -15.866 88.525  18.220  1.00 51.86 ? 526  ARG A O   1 
ATOM   4135  C  CB  . ARG A 1 526  ? -13.636 90.535  18.817  1.00 52.86 ? 526  ARG A CB  1 
ATOM   4136  C  CG  . ARG A 1 526  ? -12.408 89.797  18.302  1.00 56.64 ? 526  ARG A CG  1 
ATOM   4137  C  CD  . ARG A 1 526  ? -11.522 89.289  19.424  1.00 59.57 ? 526  ARG A CD  1 
ATOM   4138  N  NE  . ARG A 1 526  ? -10.808 88.070  19.044  1.00 62.38 ? 526  ARG A NE  1 
ATOM   4139  C  CZ  . ARG A 1 526  ? -9.886  87.481  19.798  1.00 63.89 ? 526  ARG A CZ  1 
ATOM   4140  N  NH1 . ARG A 1 526  ? -9.562  87.999  20.978  1.00 64.81 ? 526  ARG A NH1 1 
ATOM   4141  N  NH2 . ARG A 1 526  ? -9.286  86.374  19.375  1.00 63.62 ? 526  ARG A NH2 1 
ATOM   4142  N  N   . SER A 1 527  ? -14.859 88.699  16.210  1.00 51.24 ? 527  SER A N   1 
ATOM   4143  C  CA  . SER A 1 527  ? -15.180 87.325  15.770  1.00 50.59 ? 527  SER A CA  1 
ATOM   4144  C  C   . SER A 1 527  ? -14.110 86.374  16.291  1.00 49.76 ? 527  SER A C   1 
ATOM   4145  O  O   . SER A 1 527  ? -12.939 86.741  16.387  1.00 49.76 ? 527  SER A O   1 
ATOM   4146  C  CB  . SER A 1 527  ? -15.227 87.232  14.247  1.00 51.53 ? 527  SER A CB  1 
ATOM   4147  O  OG  . SER A 1 527  ? -16.119 88.197  13.723  1.00 54.07 ? 527  SER A OG  1 
ATOM   4148  N  N   . ILE A 1 528  ? -14.518 85.157  16.632  1.00 49.79 ? 528  ILE A N   1 
ATOM   4149  C  CA  . ILE A 1 528  ? -13.592 84.163  17.162  1.00 49.44 ? 528  ILE A CA  1 
ATOM   4150  C  C   . ILE A 1 528  ? -13.574 82.902  16.301  1.00 49.46 ? 528  ILE A C   1 
ATOM   4151  O  O   . ILE A 1 528  ? -14.454 82.054  16.419  1.00 49.59 ? 528  ILE A O   1 
ATOM   4152  C  CB  . ILE A 1 528  ? -13.970 83.792  18.610  1.00 49.36 ? 528  ILE A CB  1 
ATOM   4153  C  CG1 . ILE A 1 528  ? -13.722 84.996  19.520  1.00 49.36 ? 528  ILE A CG1 1 
ATOM   4154  C  CG2 . ILE A 1 528  ? -13.154 82.592  19.077  1.00 48.49 ? 528  ILE A CG2 1 
ATOM   4155  C  CD1 . ILE A 1 528  ? -14.309 84.866  20.908  1.00 50.54 ? 528  ILE A CD1 1 
ATOM   4156  N  N   . MET A 1 529  ? -12.570 82.780  15.433  1.00 48.31 ? 529  MET A N   1 
ATOM   4157  C  CA  . MET A 1 529  ? -12.464 81.613  14.563  1.00 46.98 ? 529  MET A CA  1 
ATOM   4158  C  C   . MET A 1 529  ? -11.455 80.632  15.142  1.00 44.26 ? 529  MET A C   1 
ATOM   4159  O  O   . MET A 1 529  ? -10.256 80.754  14.920  1.00 44.42 ? 529  MET A O   1 
ATOM   4160  C  CB  . MET A 1 529  ? -12.041 82.034  13.156  1.00 50.95 ? 529  MET A CB  1 
ATOM   4161  C  CG  . MET A 1 529  ? -12.788 83.250  12.607  1.00 55.54 ? 529  MET A CG  1 
ATOM   4162  S  SD  . MET A 1 529  ? -14.616 83.202  12.776  1.00 61.75 ? 529  MET A SD  1 
ATOM   4163  C  CE  . MET A 1 529  ? -14.952 81.420  12.668  1.00 59.46 ? 529  MET A CE  1 
ATOM   4164  N  N   . PRO A 1 530  ? -11.938 79.634  15.891  1.00 41.50 ? 530  PRO A N   1 
ATOM   4165  C  CA  . PRO A 1 530  ? -11.155 78.586  16.553  1.00 38.05 ? 530  PRO A CA  1 
ATOM   4166  C  C   . PRO A 1 530  ? -10.843 77.369  15.687  1.00 35.74 ? 530  PRO A C   1 
ATOM   4167  O  O   . PRO A 1 530  ? -11.727 76.580  15.363  1.00 34.66 ? 530  PRO A O   1 
ATOM   4168  C  CB  . PRO A 1 530  ? -12.029 78.195  17.748  1.00 38.56 ? 530  PRO A CB  1 
ATOM   4169  C  CG  . PRO A 1 530  ? -13.359 78.969  17.559  1.00 40.45 ? 530  PRO A CG  1 
ATOM   4170  C  CD  . PRO A 1 530  ? -13.370 79.423  16.134  1.00 40.72 ? 530  PRO A CD  1 
ATOM   4171  N  N   . LEU A 1 531  ? -9.575  77.213  15.331  1.00 33.31 ? 531  LEU A N   1 
ATOM   4172  C  CA  . LEU A 1 531  ? -9.142  76.086  14.519  1.00 29.75 ? 531  LEU A CA  1 
ATOM   4173  C  C   . LEU A 1 531  ? -9.207  74.779  15.309  1.00 27.32 ? 531  LEU A C   1 
ATOM   4174  O  O   . LEU A 1 531  ? -9.202  74.788  16.547  1.00 25.27 ? 531  LEU A O   1 
ATOM   4175  C  CB  . LEU A 1 531  ? -7.714  76.334  14.038  1.00 29.19 ? 531  LEU A CB  1 
ATOM   4176  C  CG  . LEU A 1 531  ? -7.507  77.667  13.312  1.00 28.46 ? 531  LEU A CG  1 
ATOM   4177  C  CD1 . LEU A 1 531  ? -6.123  77.718  12.720  1.00 27.33 ? 531  LEU A CD1 1 
ATOM   4178  C  CD2 . LEU A 1 531  ? -8.551  77.809  12.227  1.00 29.19 ? 531  LEU A CD2 1 
ATOM   4179  N  N   . ASN A 1 532  ? -9.272  73.656  14.599  1.00 25.07 ? 532  ASN A N   1 
ATOM   4180  C  CA  . ASN A 1 532  ? -9.317  72.358  15.274  1.00 25.20 ? 532  ASN A CA  1 
ATOM   4181  C  C   . ASN A 1 532  ? -7.907  71.831  15.551  1.00 24.46 ? 532  ASN A C   1 
ATOM   4182  O  O   . ASN A 1 532  ? -6.921  72.351  15.031  1.00 25.08 ? 532  ASN A O   1 
ATOM   4183  C  CB  . ASN A 1 532  ? -10.116 71.330  14.450  1.00 25.74 ? 532  ASN A CB  1 
ATOM   4184  C  CG  . ASN A 1 532  ? -9.565  71.138  13.049  1.00 25.67 ? 532  ASN A CG  1 
ATOM   4185  O  OD1 . ASN A 1 532  ? -8.390  70.803  12.862  1.00 23.80 ? 532  ASN A OD1 1 
ATOM   4186  N  ND2 . ASN A 1 532  ? -10.419 71.342  12.053  1.00 23.46 ? 532  ASN A ND2 1 
ATOM   4187  N  N   . VAL A 1 533  ? -7.816  70.787  16.364  1.00 23.74 ? 533  VAL A N   1 
ATOM   4188  C  CA  . VAL A 1 533  ? -6.520  70.223  16.712  1.00 23.88 ? 533  VAL A CA  1 
ATOM   4189  C  C   . VAL A 1 533  ? -5.620  69.931  15.498  1.00 24.71 ? 533  VAL A C   1 
ATOM   4190  O  O   . VAL A 1 533  ? -4.468  70.377  15.461  1.00 22.25 ? 533  VAL A O   1 
ATOM   4191  C  CB  . VAL A 1 533  ? -6.689  68.940  17.559  1.00 25.12 ? 533  VAL A CB  1 
ATOM   4192  C  CG1 . VAL A 1 533  ? -5.319  68.394  17.956  1.00 25.78 ? 533  VAL A CG1 1 
ATOM   4193  C  CG2 . VAL A 1 533  ? -7.512  69.247  18.815  1.00 25.30 ? 533  VAL A CG2 1 
ATOM   4194  N  N   . PRO A 1 534  ? -6.120  69.177  14.490  1.00 25.28 ? 534  PRO A N   1 
ATOM   4195  C  CA  . PRO A 1 534  ? -5.254  68.905  13.333  1.00 26.44 ? 534  PRO A CA  1 
ATOM   4196  C  C   . PRO A 1 534  ? -4.801  70.191  12.632  1.00 28.15 ? 534  PRO A C   1 
ATOM   4197  O  O   . PRO A 1 534  ? -3.680  70.265  12.125  1.00 28.28 ? 534  PRO A O   1 
ATOM   4198  C  CB  . PRO A 1 534  ? -6.129  68.025  12.438  1.00 25.28 ? 534  PRO A CB  1 
ATOM   4199  C  CG  . PRO A 1 534  ? -7.004  67.324  13.406  1.00 25.22 ? 534  PRO A CG  1 
ATOM   4200  C  CD  . PRO A 1 534  ? -7.376  68.415  14.388  1.00 25.37 ? 534  PRO A CD  1 
ATOM   4201  N  N   . GLN A 1 535  ? -5.669  71.204  12.605  1.00 29.20 ? 535  GLN A N   1 
ATOM   4202  C  CA  . GLN A 1 535  ? -5.326  72.481  11.975  1.00 29.48 ? 535  GLN A CA  1 
ATOM   4203  C  C   . GLN A 1 535  ? -4.261  73.218  12.790  1.00 29.38 ? 535  GLN A C   1 
ATOM   4204  O  O   . GLN A 1 535  ? -3.340  73.820  12.238  1.00 28.91 ? 535  GLN A O   1 
ATOM   4205  C  CB  . GLN A 1 535  ? -6.565  73.368  11.841  1.00 29.99 ? 535  GLN A CB  1 
ATOM   4206  C  CG  . GLN A 1 535  ? -7.587  72.835  10.862  1.00 30.35 ? 535  GLN A CG  1 
ATOM   4207  C  CD  . GLN A 1 535  ? -8.797  73.736  10.742  1.00 31.14 ? 535  GLN A CD  1 
ATOM   4208  O  OE1 . GLN A 1 535  ? -9.307  74.245  11.735  1.00 32.96 ? 535  GLN A OE1 1 
ATOM   4209  N  NE2 . GLN A 1 535  ? -9.268  73.931  9.520   1.00 32.34 ? 535  GLN A NE2 1 
ATOM   4210  N  N   . GLN A 1 536  ? -4.385  73.168  14.110  1.00 29.03 ? 536  GLN A N   1 
ATOM   4211  C  CA  . GLN A 1 536  ? -3.410  73.826  14.969  1.00 28.30 ? 536  GLN A CA  1 
ATOM   4212  C  C   . GLN A 1 536  ? -2.071  73.109  14.887  1.00 27.61 ? 536  GLN A C   1 
ATOM   4213  O  O   . GLN A 1 536  ? -1.012  73.735  14.930  1.00 28.41 ? 536  GLN A O   1 
ATOM   4214  C  CB  . GLN A 1 536  ? -3.898  73.846  16.415  1.00 26.76 ? 536  GLN A CB  1 
ATOM   4215  C  CG  . GLN A 1 536  ? -5.097  74.741  16.685  1.00 25.33 ? 536  GLN A CG  1 
ATOM   4216  C  CD  . GLN A 1 536  ? -4.728  76.223  16.735  1.00 26.90 ? 536  GLN A CD  1 
ATOM   4217  O  OE1 . GLN A 1 536  ? -5.352  77.006  17.462  1.00 25.58 ? 536  GLN A OE1 1 
ATOM   4218  N  NE2 . GLN A 1 536  ? -3.720  76.619  15.952  1.00 23.13 ? 536  GLN A NE2 1 
ATOM   4219  N  N   . GLN A 1 537  ? -2.123  71.791  14.747  1.00 27.07 ? 537  GLN A N   1 
ATOM   4220  C  CA  . GLN A 1 537  ? -0.908  70.990  14.675  1.00 27.16 ? 537  GLN A CA  1 
ATOM   4221  C  C   . GLN A 1 537  ? -0.079  71.399  13.473  1.00 27.19 ? 537  GLN A C   1 
ATOM   4222  O  O   . GLN A 1 537  ? 1.109   71.698  13.581  1.00 27.57 ? 537  GLN A O   1 
ATOM   4223  C  CB  . GLN A 1 537  ? -1.260  69.503  14.574  1.00 26.10 ? 537  GLN A CB  1 
ATOM   4224  C  CG  . GLN A 1 537  ? -0.069  68.583  14.312  1.00 24.93 ? 537  GLN A CG  1 
ATOM   4225  C  CD  . GLN A 1 537  ? -0.480  67.127  14.157  1.00 25.94 ? 537  GLN A CD  1 
ATOM   4226  O  OE1 . GLN A 1 537  ? -1.523  66.828  13.576  1.00 24.93 ? 537  GLN A OE1 1 
ATOM   4227  N  NE2 . GLN A 1 537  ? 0.347   66.214  14.664  1.00 22.95 ? 537  GLN A NE2 1 
ATOM   4228  N  N   . VAL A 1 538  ? -0.740  71.437  12.326  1.00 28.08 ? 538  VAL A N   1 
ATOM   4229  C  CA  . VAL A 1 538  ? -0.102  71.776  11.069  1.00 27.34 ? 538  VAL A CA  1 
ATOM   4230  C  C   . VAL A 1 538  ? 0.379   73.229  11.010  1.00 27.49 ? 538  VAL A C   1 
ATOM   4231  O  O   . VAL A 1 538  ? 1.265   73.559  10.217  1.00 27.31 ? 538  VAL A O   1 
ATOM   4232  C  CB  . VAL A 1 538  ? -1.067  71.449  9.917   1.00 27.59 ? 538  VAL A CB  1 
ATOM   4233  C  CG1 . VAL A 1 538  ? -1.464  72.693  9.189   1.00 26.20 ? 538  VAL A CG1 1 
ATOM   4234  C  CG2 . VAL A 1 538  ? -0.425  70.426  8.991   1.00 27.92 ? 538  VAL A CG2 1 
ATOM   4235  N  N   . SER A 1 539  ? -0.182  74.080  11.872  1.00 27.01 ? 539  SER A N   1 
ATOM   4236  C  CA  . SER A 1 539  ? 0.196   75.497  11.932  1.00 26.38 ? 539  SER A CA  1 
ATOM   4237  C  C   . SER A 1 539  ? 1.494   75.768  12.710  1.00 26.04 ? 539  SER A C   1 
ATOM   4238  O  O   . SER A 1 539  ? 1.989   76.898  12.721  1.00 25.34 ? 539  SER A O   1 
ATOM   4239  C  CB  . SER A 1 539  ? -0.933  76.306  12.587  1.00 27.13 ? 539  SER A CB  1 
ATOM   4240  O  OG  . SER A 1 539  ? -2.117  76.306  11.798  1.00 29.02 ? 539  SER A OG  1 
ATOM   4241  N  N   . ALA A 1 540  ? 2.047   74.734  13.344  1.00 25.18 ? 540  ALA A N   1 
ATOM   4242  C  CA  . ALA A 1 540  ? 3.238   74.881  14.170  1.00 25.18 ? 540  ALA A CA  1 
ATOM   4243  C  C   . ALA A 1 540  ? 4.450   75.572  13.537  1.00 25.90 ? 540  ALA A C   1 
ATOM   4244  O  O   . ALA A 1 540  ? 5.046   76.475  14.140  1.00 26.07 ? 540  ALA A O   1 
ATOM   4245  C  CB  . ALA A 1 540  ? 3.650   73.520  14.730  1.00 24.89 ? 540  ALA A CB  1 
ATOM   4246  N  N   . PRO A 1 541  ? 4.829   75.164  12.314  1.00 24.85 ? 541  PRO A N   1 
ATOM   4247  C  CA  . PRO A 1 541  ? 5.985   75.773  11.652  1.00 25.38 ? 541  PRO A CA  1 
ATOM   4248  C  C   . PRO A 1 541  ? 5.836   77.281  11.467  1.00 23.88 ? 541  PRO A C   1 
ATOM   4249  O  O   . PRO A 1 541  ? 6.794   78.041  11.571  1.00 23.11 ? 541  PRO A O   1 
ATOM   4250  C  CB  . PRO A 1 541  ? 6.057   75.015  10.324  1.00 25.69 ? 541  PRO A CB  1 
ATOM   4251  C  CG  . PRO A 1 541  ? 5.445   73.683  10.657  1.00 24.44 ? 541  PRO A CG  1 
ATOM   4252  C  CD  . PRO A 1 541  ? 4.261   74.080  11.495  1.00 25.08 ? 541  PRO A CD  1 
ATOM   4253  N  N   . HIS A 1 542  ? 4.605   77.694  11.197  1.00 23.79 ? 542  HIS A N   1 
ATOM   4254  C  CA  . HIS A 1 542  ? 4.263   79.095  10.992  1.00 23.43 ? 542  HIS A CA  1 
ATOM   4255  C  C   . HIS A 1 542  ? 4.453   79.831  12.318  1.00 23.16 ? 542  HIS A C   1 
ATOM   4256  O  O   . HIS A 1 542  ? 5.123   80.865  12.405  1.00 22.99 ? 542  HIS A O   1 
ATOM   4257  C  CB  . HIS A 1 542  ? 2.805   79.171  10.537  1.00 22.82 ? 542  HIS A CB  1 
ATOM   4258  C  CG  . HIS A 1 542  ? 2.373   80.529  10.102  1.00 24.33 ? 542  HIS A CG  1 
ATOM   4259  N  ND1 . HIS A 1 542  ? 1.126   80.765  9.549   1.00 24.33 ? 542  HIS A ND1 1 
ATOM   4260  C  CD2 . HIS A 1 542  ? 3.015   81.717  10.094  1.00 24.55 ? 542  HIS A CD2 1 
ATOM   4261  C  CE1 . HIS A 1 542  ? 1.033   82.036  9.216   1.00 24.58 ? 542  HIS A CE1 1 
ATOM   4262  N  NE2 . HIS A 1 542  ? 2.169   82.638  9.535   1.00 23.98 ? 542  HIS A NE2 1 
ATOM   4263  N  N   . THR A 1 543  ? 3.886   79.256  13.364  1.00 23.82 ? 543  THR A N   1 
ATOM   4264  C  CA  . THR A 1 543  ? 3.960   79.831  14.697  1.00 23.99 ? 543  THR A CA  1 
ATOM   4265  C  C   . THR A 1 543  ? 5.384   79.917  15.255  1.00 22.97 ? 543  THR A C   1 
ATOM   4266  O  O   . THR A 1 543  ? 5.769   80.928  15.844  1.00 21.87 ? 543  THR A O   1 
ATOM   4267  C  CB  . THR A 1 543  ? 3.088   79.009  15.670  1.00 24.73 ? 543  THR A CB  1 
ATOM   4268  O  OG1 . THR A 1 543  ? 1.766   78.892  15.135  1.00 23.43 ? 543  THR A OG1 1 
ATOM   4269  C  CG2 . THR A 1 543  ? 3.041   79.677  17.049  1.00 23.15 ? 543  THR A CG2 1 
ATOM   4270  N  N   . LEU A 1 544  ? 6.151   78.846  15.074  1.00 23.25 ? 544  LEU A N   1 
ATOM   4271  C  CA  . LEU A 1 544  ? 7.521   78.777  15.577  1.00 23.72 ? 544  LEU A CA  1 
ATOM   4272  C  C   . LEU A 1 544  ? 8.436   79.799  14.915  1.00 23.52 ? 544  LEU A C   1 
ATOM   4273  O  O   . LEU A 1 544  ? 9.201   80.492  15.592  1.00 21.19 ? 544  LEU A O   1 
ATOM   4274  C  CB  . LEU A 1 544  ? 8.090   77.365  15.376  1.00 22.99 ? 544  LEU A CB  1 
ATOM   4275  C  CG  . LEU A 1 544  ? 7.428   76.271  16.222  1.00 24.83 ? 544  LEU A CG  1 
ATOM   4276  C  CD1 . LEU A 1 544  ? 7.787   74.903  15.671  1.00 23.29 ? 544  LEU A CD1 1 
ATOM   4277  C  CD2 . LEU A 1 544  ? 7.866   76.407  17.686  1.00 24.96 ? 544  LEU A CD2 1 
ATOM   4278  N  N   . THR A 1 545  ? 8.359   79.890  13.592  1.00 23.34 ? 545  THR A N   1 
ATOM   4279  C  CA  . THR A 1 545  ? 9.190   80.843  12.862  1.00 24.09 ? 545  THR A CA  1 
ATOM   4280  C  C   . THR A 1 545  ? 8.832   82.263  13.308  1.00 23.60 ? 545  THR A C   1 
ATOM   4281  O  O   . THR A 1 545  ? 9.711   83.106  13.483  1.00 23.09 ? 545  THR A O   1 
ATOM   4282  C  CB  . THR A 1 545  ? 8.989   80.724  11.336  1.00 24.16 ? 545  THR A CB  1 
ATOM   4283  O  OG1 . THR A 1 545  ? 9.339   79.402  10.893  1.00 22.13 ? 545  THR A OG1 1 
ATOM   4284  C  CG2 . THR A 1 545  ? 9.869   81.722  10.626  1.00 24.29 ? 545  THR A CG2 1 
ATOM   4285  N  N   . ALA A 1 546  ? 7.537   82.514  13.501  1.00 22.80 ? 546  ALA A N   1 
ATOM   4286  C  CA  . ALA A 1 546  ? 7.076   83.826  13.944  1.00 21.82 ? 546  ALA A CA  1 
ATOM   4287  C  C   . ALA A 1 546  ? 7.642   84.142  15.329  1.00 20.69 ? 546  ALA A C   1 
ATOM   4288  O  O   . ALA A 1 546  ? 8.121   85.238  15.565  1.00 20.30 ? 546  ALA A O   1 
ATOM   4289  C  CB  . ALA A 1 546  ? 5.547   83.876  13.960  1.00 19.62 ? 546  ALA A CB  1 
ATOM   4290  N  N   . ASP A 1 547  ? 7.598   83.178  16.242  1.00 21.07 ? 547  ASP A N   1 
ATOM   4291  C  CA  . ASP A 1 547  ? 8.139   83.394  17.581  1.00 21.08 ? 547  ASP A CA  1 
ATOM   4292  C  C   . ASP A 1 547  ? 9.632   83.679  17.523  1.00 21.27 ? 547  ASP A C   1 
ATOM   4293  O  O   . ASP A 1 547  ? 10.145  84.536  18.240  1.00 21.85 ? 547  ASP A O   1 
ATOM   4294  C  CB  . ASP A 1 547  ? 7.904   82.174  18.475  1.00 20.53 ? 547  ASP A CB  1 
ATOM   4295  C  CG  . ASP A 1 547  ? 6.432   81.978  18.835  1.00 23.05 ? 547  ASP A CG  1 
ATOM   4296  O  OD1 . ASP A 1 547  ? 5.677   82.984  18.878  1.00 22.55 ? 547  ASP A OD1 1 
ATOM   4297  O  OD2 . ASP A 1 547  ? 6.038   80.815  19.094  1.00 23.53 ? 547  ASP A OD2 1 
ATOM   4298  N  N   . TYR A 1 548  ? 10.326  82.950  16.659  1.00 22.02 ? 548  TYR A N   1 
ATOM   4299  C  CA  . TYR A 1 548  ? 11.760  83.127  16.508  1.00 22.95 ? 548  TYR A CA  1 
ATOM   4300  C  C   . TYR A 1 548  ? 12.087  84.564  16.097  1.00 22.71 ? 548  TYR A C   1 
ATOM   4301  O  O   . TYR A 1 548  ? 13.044  85.174  16.603  1.00 23.36 ? 548  TYR A O   1 
ATOM   4302  C  CB  . TYR A 1 548  ? 12.317  82.164  15.452  1.00 22.12 ? 548  TYR A CB  1 
ATOM   4303  C  CG  . TYR A 1 548  ? 13.828  82.160  15.438  1.00 22.67 ? 548  TYR A CG  1 
ATOM   4304  C  CD1 . TYR A 1 548  ? 14.543  81.253  16.212  1.00 23.20 ? 548  TYR A CD1 1 
ATOM   4305  C  CD2 . TYR A 1 548  ? 14.538  83.139  14.746  1.00 22.03 ? 548  TYR A CD2 1 
ATOM   4306  C  CE1 . TYR A 1 548  ? 15.917  81.325  16.310  1.00 22.99 ? 548  TYR A CE1 1 
ATOM   4307  C  CE2 . TYR A 1 548  ? 15.914  83.221  14.837  1.00 22.75 ? 548  TYR A CE2 1 
ATOM   4308  C  CZ  . TYR A 1 548  ? 16.601  82.310  15.621  1.00 24.86 ? 548  TYR A CZ  1 
ATOM   4309  O  OH  . TYR A 1 548  ? 17.972  82.375  15.726  1.00 26.39 ? 548  TYR A OH  1 
ATOM   4310  N  N   . ILE A 1 549  ? 11.295  85.092  15.173  1.00 22.14 ? 549  ILE A N   1 
ATOM   4311  C  CA  . ILE A 1 549  ? 11.474  86.449  14.687  1.00 22.33 ? 549  ILE A CA  1 
ATOM   4312  C  C   . ILE A 1 549  ? 11.258  87.450  15.814  1.00 24.43 ? 549  ILE A C   1 
ATOM   4313  O  O   . ILE A 1 549  ? 12.088  88.338  16.031  1.00 24.68 ? 549  ILE A O   1 
ATOM   4314  C  CB  . ILE A 1 549  ? 10.487  86.751  13.537  1.00 21.42 ? 549  ILE A CB  1 
ATOM   4315  C  CG1 . ILE A 1 549  ? 10.788  85.838  12.348  1.00 19.20 ? 549  ILE A CG1 1 
ATOM   4316  C  CG2 . ILE A 1 549  ? 10.581  88.211  13.121  1.00 20.79 ? 549  ILE A CG2 1 
ATOM   4317  C  CD1 . ILE A 1 549  ? 9.722   85.857  11.283  1.00 19.25 ? 549  ILE A CD1 1 
ATOM   4318  N  N   . ASN A 1 550  ? 10.153  87.296  16.544  1.00 25.87 ? 550  ASN A N   1 
ATOM   4319  C  CA  . ASN A 1 550  ? 9.832   88.210  17.637  1.00 27.61 ? 550  ASN A CA  1 
ATOM   4320  C  C   . ASN A 1 550  ? 10.790  88.075  18.803  1.00 29.20 ? 550  ASN A C   1 
ATOM   4321  O  O   . ASN A 1 550  ? 10.949  89.008  19.601  1.00 30.53 ? 550  ASN A O   1 
ATOM   4322  C  CB  . ASN A 1 550  ? 8.401   87.989  18.133  1.00 25.34 ? 550  ASN A CB  1 
ATOM   4323  C  CG  . ASN A 1 550  ? 7.377   88.200  17.050  1.00 25.26 ? 550  ASN A CG  1 
ATOM   4324  O  OD1 . ASN A 1 550  ? 7.410   89.200  16.327  1.00 23.07 ? 550  ASN A OD1 1 
ATOM   4325  N  ND2 . ASN A 1 550  ? 6.449   87.260  16.935  1.00 25.80 ? 550  ASN A ND2 1 
ATOM   4326  N  N   . TYR A 1 551  ? 11.428  86.918  18.912  1.00 31.53 ? 551  TYR A N   1 
ATOM   4327  C  CA  . TYR A 1 551  ? 12.358  86.716  20.004  1.00 34.22 ? 551  TYR A CA  1 
ATOM   4328  C  C   . TYR A 1 551  ? 13.776  87.168  19.672  1.00 34.30 ? 551  TYR A C   1 
ATOM   4329  O  O   . TYR A 1 551  ? 14.491  87.650  20.545  1.00 34.32 ? 551  TYR A O   1 
ATOM   4330  C  CB  . TYR A 1 551  ? 12.398  85.250  20.422  1.00 36.94 ? 551  TYR A CB  1 
ATOM   4331  C  CG  . TYR A 1 551  ? 13.184  85.035  21.704  1.00 42.61 ? 551  TYR A CG  1 
ATOM   4332  C  CD1 . TYR A 1 551  ? 12.580  85.204  22.958  1.00 43.95 ? 551  TYR A CD1 1 
ATOM   4333  C  CD2 . TYR A 1 551  ? 14.545  84.707  21.668  1.00 44.42 ? 551  TYR A CD2 1 
ATOM   4334  C  CE1 . TYR A 1 551  ? 13.314  85.048  24.146  1.00 45.92 ? 551  TYR A CE1 1 
ATOM   4335  C  CE2 . TYR A 1 551  ? 15.283  84.545  22.845  1.00 45.90 ? 551  TYR A CE2 1 
ATOM   4336  C  CZ  . TYR A 1 551  ? 14.664  84.716  24.081  1.00 46.40 ? 551  TYR A CZ  1 
ATOM   4337  O  OH  . TYR A 1 551  ? 15.376  84.509  25.246  1.00 47.48 ? 551  TYR A OH  1 
ATOM   4338  N  N   . HIS A 1 552  ? 14.180  87.030  18.416  1.00 34.50 ? 552  HIS A N   1 
ATOM   4339  C  CA  . HIS A 1 552  ? 15.544  87.392  18.026  1.00 35.22 ? 552  HIS A CA  1 
ATOM   4340  C  C   . HIS A 1 552  ? 15.703  88.575  17.073  1.00 34.91 ? 552  HIS A C   1 
ATOM   4341  O  O   . HIS A 1 552  ? 16.705  89.284  17.128  1.00 34.66 ? 552  HIS A O   1 
ATOM   4342  C  CB  . HIS A 1 552  ? 16.224  86.189  17.374  1.00 35.84 ? 552  HIS A CB  1 
ATOM   4343  C  CG  . HIS A 1 552  ? 16.288  84.974  18.245  1.00 38.20 ? 552  HIS A CG  1 
ATOM   4344  N  ND1 . HIS A 1 552  ? 17.310  84.757  19.149  1.00 38.55 ? 552  HIS A ND1 1 
ATOM   4345  C  CD2 . HIS A 1 552  ? 15.466  83.903  18.349  1.00 38.37 ? 552  HIS A CD2 1 
ATOM   4346  C  CE1 . HIS A 1 552  ? 17.112  83.606  19.766  1.00 39.10 ? 552  HIS A CE1 1 
ATOM   4347  N  NE2 . HIS A 1 552  ? 15.999  83.068  19.298  1.00 40.09 ? 552  HIS A NE2 1 
ATOM   4348  N  N   . MET A 1 553  ? 14.718  88.804  16.213  1.00 34.09 ? 553  MET A N   1 
ATOM   4349  C  CA  . MET A 1 553  ? 14.856  89.853  15.223  1.00 32.74 ? 553  MET A CA  1 
ATOM   4350  C  C   . MET A 1 553  ? 14.187  91.199  15.425  1.00 32.88 ? 553  MET A C   1 
ATOM   4351  O  O   . MET A 1 553  ? 14.520  92.144  14.712  1.00 32.54 ? 553  MET A O   1 
ATOM   4352  C  CB  . MET A 1 553  ? 14.473  89.281  13.862  1.00 32.55 ? 553  MET A CB  1 
ATOM   4353  C  CG  . MET A 1 553  ? 15.385  88.155  13.453  1.00 32.42 ? 553  MET A CG  1 
ATOM   4354  S  SD  . MET A 1 553  ? 14.841  87.247  12.011  1.00 33.87 ? 553  MET A SD  1 
ATOM   4355  C  CE  . MET A 1 553  ? 15.422  85.610  12.387  1.00 35.49 ? 553  MET A CE  1 
ATOM   4356  N  N   . ASN A 1 554  ? 13.259  91.313  16.373  1.00 32.68 ? 554  ASN A N   1 
ATOM   4357  C  CA  . ASN A 1 554  ? 12.608  92.602  16.590  1.00 32.22 ? 554  ASN A CA  1 
ATOM   4358  C  C   . ASN A 1 554  ? 12.397  92.985  18.033  1.00 32.78 ? 554  ASN A C   1 
ATOM   4359  O  O   . ASN A 1 554  ? 12.775  92.271  18.958  1.00 33.66 ? 554  ASN A O   1 
ATOM   4360  C  CB  . ASN A 1 554  ? 11.251  92.686  15.867  1.00 32.20 ? 554  ASN A CB  1 
ATOM   4361  C  CG  . ASN A 1 554  ? 10.208  91.753  16.452  1.00 31.70 ? 554  ASN A CG  1 
ATOM   4362  O  OD1 . ASN A 1 554  ? 10.142  91.565  17.665  1.00 29.94 ? 554  ASN A OD1 1 
ATOM   4363  N  ND2 . ASN A 1 554  ? 9.363   91.179  15.583  1.00 31.06 ? 554  ASN A ND2 1 
ATOM   4364  N  N   . LEU A 1 555  ? 11.800  94.137  18.197  1.00 33.14 ? 555  LEU A N   1 
ATOM   4365  C  CA  . LEU A 1 555  ? 11.458  94.696  19.456  1.00 33.72 ? 555  LEU A CA  1 
ATOM   4366  C  C   . LEU A 1 555  ? 9.940   94.560  19.665  1.00 33.67 ? 555  LEU A C   1 
ATOM   4367  O  O   . LEU A 1 555  ? 9.191   95.452  19.281  1.00 33.36 ? 555  LEU A O   1 
ATOM   4368  C  CB  . LEU A 1 555  ? 11.865  96.190  19.452  1.00 33.69 ? 555  LEU A CB  1 
ATOM   4369  C  CG  . LEU A 1 555  ? 11.877  96.980  20.768  1.00 34.77 ? 555  LEU A CG  1 
ATOM   4370  C  CD1 . LEU A 1 555  ? 12.818  96.325  21.771  1.00 34.72 ? 555  LEU A CD1 1 
ATOM   4371  C  CD2 . LEU A 1 555  ? 12.255  98.443  20.527  1.00 33.44 ? 555  LEU A CD2 1 
ATOM   4372  N  N   . SER A 1 556  ? 9.434   93.408  20.307  1.00 35.26 ? 556  SER A N   1 
ATOM   4373  C  CA  . SER A 1 556  ? 7.964   93.170  20.553  1.00 36.55 ? 556  SER A CA  1 
ATOM   4374  C  C   . SER A 1 556  ? 7.435   92.693  22.005  1.00 38.67 ? 556  SER A C   1 
ATOM   4375  O  O   . SER A 1 556  ? 8.099   91.897  22.673  1.00 41.14 ? 556  SER A O   1 
ATOM   4376  C  CB  . SER A 1 556  ? 7.479   92.146  19.507  1.00 35.09 ? 556  SER A CB  1 
ATOM   4377  O  OG  . SER A 1 556  ? 8.156   90.905  19.640  1.00 32.26 ? 556  SER A OG  1 
ATOM   4378  N  N   . PRO A 1 557  ? 6.210   93.205  22.442  1.00 41.64 ? 557  PRO A N   1 
ATOM   4379  C  CA  . PRO A 1 557  ? 5.392   92.849  23.663  1.00 42.41 ? 557  PRO A CA  1 
ATOM   4380  C  C   . PRO A 1 557  ? 4.687   91.522  23.566  1.00 44.02 ? 557  PRO A C   1 
ATOM   4381  O  O   . PRO A 1 557  ? 4.353   91.077  22.472  1.00 43.66 ? 557  PRO A O   1 
ATOM   4382  C  CB  . PRO A 1 557  ? 4.390   93.943  23.814  1.00 42.37 ? 557  PRO A CB  1 
ATOM   4383  C  CG  . PRO A 1 557  ? 5.211   95.112  23.464  1.00 42.47 ? 557  PRO A CG  1 
ATOM   4384  C  CD  . PRO A 1 557  ? 6.343   94.652  22.611  1.00 44.70 ? 557  PRO A CD  1 
ATOM   4385  N  N   . THR A 1 558  ? 4.430   90.848  24.634  1.00 46.52 ? 558  THR A N   1 
ATOM   4386  C  CA  . THR A 1 558  ? 3.635   89.626  24.539  1.00 47.92 ? 558  THR A CA  1 
ATOM   4387  C  C   . THR A 1 558  ? 2.707   89.801  25.690  1.00 49.24 ? 558  THR A C   1 
ATOM   4388  O  O   . THR A 1 558  ? 2.668   89.007  26.624  1.00 50.19 ? 558  THR A O   1 
ATOM   4389  C  CB  . THR A 1 558  ? 4.442   88.339  24.649  1.00 47.32 ? 558  THR A CB  1 
ATOM   4390  O  OG1 . THR A 1 558  ? 5.209   88.142  23.452  1.00 46.60 ? 558  THR A OG1 1 
ATOM   4391  C  CG2 . THR A 1 558  ? 3.513   87.156  24.877  1.00 48.44 ? 558  THR A CG2 1 
ATOM   4392  N  N   . SER A 1 559  ? 1.957   90.886  25.603  1.00 50.89 ? 559  SER A N   1 
ATOM   4393  C  CA  . SER A 1 559  ? 1.106   91.322  26.673  1.00 52.67 ? 559  SER A CA  1 
ATOM   4394  C  C   . SER A 1 559  ? -0.286  90.690  26.716  1.00 54.02 ? 559  SER A C   1 
ATOM   4395  O  O   . SER A 1 559  ? -0.775  90.139  25.721  1.00 54.11 ? 559  SER A O   1 
ATOM   4396  C  CB  . SER A 1 559  ? 0.971   92.845  26.627  1.00 52.11 ? 559  SER A CB  1 
ATOM   4397  O  OG  . SER A 1 559  ? 0.195   93.313  27.718  1.00 52.04 ? 559  SER A OG  1 
ATOM   4398  N  N   . GLY A 1 560  ? -0.911  90.781  27.887  1.00 54.88 ? 560  GLY A N   1 
ATOM   4399  C  CA  . GLY A 1 560  ? -2.243  90.241  28.070  1.00 56.73 ? 560  GLY A CA  1 
ATOM   4400  C  C   . GLY A 1 560  ? -3.289  91.343  28.060  1.00 57.90 ? 560  GLY A C   1 
ATOM   4401  O  O   . GLY A 1 560  ? -3.252  92.232  27.211  1.00 59.91 ? 560  GLY A O   1 
ATOM   4402  N  N   . SER A 1 561  ? -4.216  91.297  29.009  1.00 58.31 ? 561  SER A N   1 
ATOM   4403  C  CA  . SER A 1 561  ? -5.275  92.298  29.086  1.00 58.45 ? 561  SER A CA  1 
ATOM   4404  C  C   . SER A 1 561  ? -5.153  93.183  30.333  1.00 58.39 ? 561  SER A C   1 
ATOM   4405  O  O   . SER A 1 561  ? -5.746  94.265  30.399  1.00 57.44 ? 561  SER A O   1 
ATOM   4406  C  CB  . SER A 1 561  ? -6.643  91.600  29.068  1.00 59.21 ? 561  SER A CB  1 
ATOM   4407  O  OG  . SER A 1 561  ? -7.701  92.523  28.863  1.00 58.59 ? 561  SER A OG  1 
ATOM   4408  N  N   . ALA A 1 562  ? -4.381  92.722  31.316  1.00 58.09 ? 562  ALA A N   1 
ATOM   4409  C  CA  . ALA A 1 562  ? -4.187  93.471  32.556  1.00 57.96 ? 562  ALA A CA  1 
ATOM   4410  C  C   . ALA A 1 562  ? -3.197  94.621  32.381  1.00 57.68 ? 562  ALA A C   1 
ATOM   4411  O  O   . ALA A 1 562  ? -2.228  94.508  31.630  1.00 57.01 ? 562  ALA A O   1 
ATOM   4412  C  CB  . ALA A 1 562  ? -3.709  92.532  33.659  1.00 57.29 ? 562  ALA A CB  1 
ATOM   4413  N  N   . VAL A 1 563  ? -3.449  95.724  33.081  1.00 58.04 ? 563  VAL A N   1 
ATOM   4414  C  CA  . VAL A 1 563  ? -2.582  96.898  33.015  1.00 58.90 ? 563  VAL A CA  1 
ATOM   4415  C  C   . VAL A 1 563  ? -1.167  96.536  33.475  1.00 58.11 ? 563  VAL A C   1 
ATOM   4416  O  O   . VAL A 1 563  ? -0.179  97.053  32.950  1.00 57.51 ? 563  VAL A O   1 
ATOM   4417  C  CB  . VAL A 1 563  ? -3.120  98.047  33.918  1.00 59.48 ? 563  VAL A CB  1 
ATOM   4418  C  CG1 . VAL A 1 563  ? -2.226  99.268  33.804  1.00 59.04 ? 563  VAL A CG1 1 
ATOM   4419  C  CG2 . VAL A 1 563  ? -4.542  98.405  33.521  1.00 60.54 ? 563  VAL A CG2 1 
ATOM   4420  N  N   . ILE A 1 564  ? -1.092  95.634  34.451  1.00 57.75 ? 564  ILE A N   1 
ATOM   4421  C  CA  . ILE A 1 564  ? 0.178   95.180  35.025  1.00 57.48 ? 564  ILE A CA  1 
ATOM   4422  C  C   . ILE A 1 564  ? 1.154   94.566  34.022  1.00 56.25 ? 564  ILE A C   1 
ATOM   4423  O  O   . ILE A 1 564  ? 2.363   94.529  34.267  1.00 56.83 ? 564  ILE A O   1 
ATOM   4424  C  CB  . ILE A 1 564  ? -0.062  94.142  36.151  1.00 57.08 ? 564  ILE A CB  1 
ATOM   4425  C  CG1 . ILE A 1 564  ? -0.860  92.954  35.607  1.00 57.19 ? 564  ILE A CG1 1 
ATOM   4426  C  CG2 . ILE A 1 564  ? -0.807  94.790  37.301  1.00 57.01 ? 564  ILE A CG2 1 
ATOM   4427  C  CD1 . ILE A 1 564  ? -1.352  92.004  36.670  1.00 57.40 ? 564  ILE A CD1 1 
ATOM   4428  N  N   . GLU A 1 565  ? 0.637   94.087  32.897  1.00 54.55 ? 565  GLU A N   1 
ATOM   4429  C  CA  . GLU A 1 565  ? 1.488   93.468  31.896  1.00 53.41 ? 565  GLU A CA  1 
ATOM   4430  C  C   . GLU A 1 565  ? 1.591   94.232  30.589  1.00 51.30 ? 565  GLU A C   1 
ATOM   4431  O  O   . GLU A 1 565  ? 2.025   93.674  29.582  1.00 50.89 ? 565  GLU A O   1 
ATOM   4432  C  CB  . GLU A 1 565  ? 1.010   92.039  31.625  1.00 54.74 ? 565  GLU A CB  1 
ATOM   4433  C  CG  . GLU A 1 565  ? -0.489  91.841  31.769  1.00 57.32 ? 565  GLU A CG  1 
ATOM   4434  C  CD  . GLU A 1 565  ? -0.946  90.460  31.321  1.00 59.44 ? 565  GLU A CD  1 
ATOM   4435  O  OE1 . GLU A 1 565  ? -2.173  90.226  31.294  1.00 60.73 ? 565  GLU A OE1 1 
ATOM   4436  O  OE2 . GLU A 1 565  ? -0.088  89.612  30.990  1.00 59.11 ? 565  GLU A OE2 1 
ATOM   4437  N  N   . LYS A 1 566  ? 1.216   95.507  30.599  1.00 49.84 ? 566  LYS A N   1 
ATOM   4438  C  CA  . LYS A 1 566  ? 1.275   96.313  29.376  1.00 48.54 ? 566  LYS A CA  1 
ATOM   4439  C  C   . LYS A 1 566  ? 2.428   97.310  29.324  1.00 46.41 ? 566  LYS A C   1 
ATOM   4440  O  O   . LYS A 1 566  ? 2.268   98.436  28.862  1.00 44.76 ? 566  LYS A O   1 
ATOM   4441  C  CB  . LYS A 1 566  ? -0.055  97.044  29.155  1.00 49.31 ? 566  LYS A CB  1 
ATOM   4442  C  CG  . LYS A 1 566  ? -1.202  96.117  28.771  1.00 48.57 ? 566  LYS A CG  1 
ATOM   4443  C  CD  . LYS A 1 566  ? -2.511  96.866  28.608  1.00 47.80 ? 566  LYS A CD  1 
ATOM   4444  C  CE  . LYS A 1 566  ? -3.638  95.909  28.263  1.00 47.79 ? 566  LYS A CE  1 
ATOM   4445  N  NZ  . LYS A 1 566  ? -4.978  96.543  28.421  1.00 48.94 ? 566  LYS A NZ  1 
ATOM   4446  N  N   . VAL A 1 567  ? 3.585   96.874  29.813  1.00 45.51 ? 567  VAL A N   1 
ATOM   4447  C  CA  . VAL A 1 567  ? 4.814   97.672  29.826  1.00 42.87 ? 567  VAL A CA  1 
ATOM   4448  C  C   . VAL A 1 567  ? 4.629   99.191  29.969  1.00 41.35 ? 567  VAL A C   1 
ATOM   4449  O  O   . VAL A 1 567  ? 5.123   99.965  29.143  1.00 41.90 ? 567  VAL A O   1 
ATOM   4450  C  CB  . VAL A 1 567  ? 5.632   97.390  28.545  1.00 42.77 ? 567  VAL A CB  1 
ATOM   4451  C  CG1 . VAL A 1 567  ? 7.063   97.854  28.729  1.00 41.87 ? 567  VAL A CG1 1 
ATOM   4452  C  CG2 . VAL A 1 567  ? 5.568   95.910  28.206  1.00 41.38 ? 567  VAL A CG2 1 
ATOM   4453  N  N   . ILE A 1 568  ? 3.934   99.613  31.023  1.00 38.83 ? 568  ILE A N   1 
ATOM   4454  C  CA  . ILE A 1 568  ? 3.699   101.031 31.259  1.00 36.78 ? 568  ILE A CA  1 
ATOM   4455  C  C   . ILE A 1 568  ? 4.968   101.893 31.088  1.00 35.56 ? 568  ILE A C   1 
ATOM   4456  O  O   . ILE A 1 568  ? 4.918   102.960 30.468  1.00 35.05 ? 568  ILE A O   1 
ATOM   4457  C  CB  . ILE A 1 568  ? 3.102   101.267 32.674  1.00 36.41 ? 568  ILE A CB  1 
ATOM   4458  C  CG1 . ILE A 1 568  ? 1.809   100.455 32.837  1.00 38.01 ? 568  ILE A CG1 1 
ATOM   4459  C  CG2 . ILE A 1 568  ? 2.807   102.754 32.882  1.00 35.49 ? 568  ILE A CG2 1 
ATOM   4460  C  CD1 . ILE A 1 568  ? 1.096   100.654 34.170  1.00 36.68 ? 568  ILE A CD1 1 
ATOM   4461  N  N   . PRO A 1 569  ? 6.121   101.437 31.622  1.00 33.54 ? 569  PRO A N   1 
ATOM   4462  C  CA  . PRO A 1 569  ? 7.393   102.170 31.527  1.00 32.23 ? 569  PRO A CA  1 
ATOM   4463  C  C   . PRO A 1 569  ? 7.770   102.667 30.134  1.00 30.35 ? 569  PRO A C   1 
ATOM   4464  O  O   . PRO A 1 569  ? 8.332   103.756 29.989  1.00 29.52 ? 569  PRO A O   1 
ATOM   4465  C  CB  . PRO A 1 569  ? 8.406   101.167 32.079  1.00 32.39 ? 569  PRO A CB  1 
ATOM   4466  C  CG  . PRO A 1 569  ? 7.622   100.459 33.109  1.00 32.90 ? 569  PRO A CG  1 
ATOM   4467  C  CD  . PRO A 1 569  ? 6.300   100.205 32.408  1.00 33.19 ? 569  PRO A CD  1 
ATOM   4468  N  N   . LEU A 1 570  ? 7.466   101.868 29.117  1.00 28.10 ? 570  LEU A N   1 
ATOM   4469  C  CA  . LEU A 1 570  ? 7.775   102.249 27.748  1.00 27.25 ? 570  LEU A CA  1 
ATOM   4470  C  C   . LEU A 1 570  ? 6.975   103.491 27.334  1.00 26.43 ? 570  LEU A C   1 
ATOM   4471  O  O   . LEU A 1 570  ? 7.506   104.405 26.719  1.00 25.56 ? 570  LEU A O   1 
ATOM   4472  C  CB  . LEU A 1 570  ? 7.466   101.077 26.809  1.00 27.54 ? 570  LEU A CB  1 
ATOM   4473  C  CG  . LEU A 1 570  ? 7.803   101.228 25.321  1.00 26.21 ? 570  LEU A CG  1 
ATOM   4474  C  CD1 . LEU A 1 570  ? 9.290   101.375 25.145  1.00 23.95 ? 570  LEU A CD1 1 
ATOM   4475  C  CD2 . LEU A 1 570  ? 7.301   100.015 24.564  1.00 24.96 ? 570  LEU A CD2 1 
ATOM   4476  N  N   . GLY A 1 571  ? 5.695   103.512 27.684  1.00 26.74 ? 571  GLY A N   1 
ATOM   4477  C  CA  . GLY A 1 571  ? 4.843   104.642 27.352  1.00 25.46 ? 571  GLY A CA  1 
ATOM   4478  C  C   . GLY A 1 571  ? 5.345   105.931 27.977  1.00 25.34 ? 571  GLY A C   1 
ATOM   4479  O  O   . GLY A 1 571  ? 5.360   106.979 27.330  1.00 26.12 ? 571  GLY A O   1 
ATOM   4480  N  N   . VAL A 1 572  ? 5.755   105.852 29.242  1.00 24.89 ? 572  VAL A N   1 
ATOM   4481  C  CA  . VAL A 1 572  ? 6.278   107.009 29.969  1.00 24.81 ? 572  VAL A CA  1 
ATOM   4482  C  C   . VAL A 1 572  ? 7.460   107.603 29.209  1.00 25.94 ? 572  VAL A C   1 
ATOM   4483  O  O   . VAL A 1 572  ? 7.518   108.805 28.962  1.00 26.19 ? 572  VAL A O   1 
ATOM   4484  C  CB  . VAL A 1 572  ? 6.771   106.619 31.379  1.00 24.86 ? 572  VAL A CB  1 
ATOM   4485  C  CG1 . VAL A 1 572  ? 7.046   107.875 32.186  1.00 22.66 ? 572  VAL A CG1 1 
ATOM   4486  C  CG2 . VAL A 1 572  ? 5.744   105.735 32.071  1.00 22.51 ? 572  VAL A CG2 1 
ATOM   4487  N  N   . TYR A 1 573  ? 8.397   106.733 28.847  1.00 27.34 ? 573  TYR A N   1 
ATOM   4488  C  CA  . TYR A 1 573  ? 9.602   107.112 28.119  1.00 28.64 ? 573  TYR A CA  1 
ATOM   4489  C  C   . TYR A 1 573  ? 9.285   107.781 26.785  1.00 28.84 ? 573  TYR A C   1 
ATOM   4490  O  O   . TYR A 1 573  ? 9.768   108.878 26.485  1.00 27.78 ? 573  TYR A O   1 
ATOM   4491  C  CB  . TYR A 1 573  ? 10.451  105.872 27.840  1.00 29.36 ? 573  TYR A CB  1 
ATOM   4492  C  CG  . TYR A 1 573  ? 11.726  106.160 27.065  1.00 31.11 ? 573  TYR A CG  1 
ATOM   4493  C  CD1 . TYR A 1 573  ? 12.846  106.686 27.705  1.00 31.89 ? 573  TYR A CD1 1 
ATOM   4494  C  CD2 . TYR A 1 573  ? 11.810  105.912 25.692  1.00 31.12 ? 573  TYR A CD2 1 
ATOM   4495  C  CE1 . TYR A 1 573  ? 14.014  106.958 27.000  1.00 30.81 ? 573  TYR A CE1 1 
ATOM   4496  C  CE2 . TYR A 1 573  ? 12.962  106.180 24.988  1.00 30.13 ? 573  TYR A CE2 1 
ATOM   4497  C  CZ  . TYR A 1 573  ? 14.060  106.701 25.649  1.00 31.17 ? 573  TYR A CZ  1 
ATOM   4498  O  OH  . TYR A 1 573  ? 15.217  106.957 24.962  1.00 32.70 ? 573  TYR A OH  1 
ATOM   4499  N  N   . ALA A 1 574  ? 8.480   107.087 25.985  1.00 27.74 ? 574  ALA A N   1 
ATOM   4500  C  CA  . ALA A 1 574  ? 8.106   107.548 24.662  1.00 27.99 ? 574  ALA A CA  1 
ATOM   4501  C  C   . ALA A 1 574  ? 7.334   108.860 24.654  1.00 28.20 ? 574  ALA A C   1 
ATOM   4502  O  O   . ALA A 1 574  ? 7.468   109.660 23.729  1.00 29.14 ? 574  ALA A O   1 
ATOM   4503  C  CB  . ALA A 1 574  ? 7.295   106.451 23.936  1.00 26.74 ? 574  ALA A CB  1 
ATOM   4504  N  N   . SER A 1 575  ? 6.522   109.090 25.675  1.00 27.96 ? 575  SER A N   1 
ATOM   4505  C  CA  . SER A 1 575  ? 5.727   110.307 25.704  1.00 27.48 ? 575  SER A CA  1 
ATOM   4506  C  C   . SER A 1 575  ? 6.425   111.488 26.383  1.00 27.09 ? 575  SER A C   1 
ATOM   4507  O  O   . SER A 1 575  ? 5.967   112.621 26.276  1.00 28.52 ? 575  SER A O   1 
ATOM   4508  C  CB  . SER A 1 575  ? 4.371   110.030 26.386  1.00 27.78 ? 575  SER A CB  1 
ATOM   4509  O  OG  . SER A 1 575  ? 4.532   109.552 27.717  1.00 26.51 ? 575  SER A OG  1 
ATOM   4510  N  N   . SER A 1 576  ? 7.526   111.242 27.073  1.00 26.56 ? 576  SER A N   1 
ATOM   4511  C  CA  . SER A 1 576  ? 8.214   112.324 27.770  1.00 26.65 ? 576  SER A CA  1 
ATOM   4512  C  C   . SER A 1 576  ? 8.975   113.292 26.905  1.00 27.88 ? 576  SER A C   1 
ATOM   4513  O  O   . SER A 1 576  ? 9.917   112.913 26.209  1.00 26.01 ? 576  SER A O   1 
ATOM   4514  C  CB  . SER A 1 576  ? 9.190   111.785 28.810  1.00 25.34 ? 576  SER A CB  1 
ATOM   4515  O  OG  . SER A 1 576  ? 8.494   111.327 29.940  1.00 24.46 ? 576  SER A OG  1 
ATOM   4516  N  N   . PRO A 1 577  ? 8.595   114.564 26.952  1.00 28.93 ? 577  PRO A N   1 
ATOM   4517  C  CA  . PRO A 1 577  ? 9.406   115.421 26.087  1.00 30.89 ? 577  PRO A CA  1 
ATOM   4518  C  C   . PRO A 1 577  ? 10.886  115.101 26.308  1.00 31.68 ? 577  PRO A C   1 
ATOM   4519  O  O   . PRO A 1 577  ? 11.281  114.693 27.415  1.00 32.10 ? 577  PRO A O   1 
ATOM   4520  C  CB  . PRO A 1 577  ? 9.045   116.812 26.557  1.00 31.38 ? 577  PRO A CB  1 
ATOM   4521  C  CG  . PRO A 1 577  ? 7.614   116.645 27.038  1.00 31.72 ? 577  PRO A CG  1 
ATOM   4522  C  CD  . PRO A 1 577  ? 7.648   115.344 27.765  1.00 29.59 ? 577  PRO A CD  1 
ATOM   4523  N  N   . PRO A 1 578  ? 11.695  115.193 25.233  1.00 32.88 ? 578  PRO A N   1 
ATOM   4524  C  CA  . PRO A 1 578  ? 12.574  115.290 24.079  1.00 32.94 ? 578  PRO A CA  1 
ATOM   4525  C  C   . PRO A 1 578  ? 12.101  114.189 23.213  1.00 32.24 ? 578  PRO A C   1 
ATOM   4526  O  O   . PRO A 1 578  ? 12.087  114.308 21.996  1.00 33.16 ? 578  PRO A O   1 
ATOM   4527  C  CB  . PRO A 1 578  ? 13.939  115.059 24.685  1.00 33.36 ? 578  PRO A CB  1 
ATOM   4528  C  CG  . PRO A 1 578  ? 13.864  116.039 25.680  1.00 34.55 ? 578  PRO A CG  1 
ATOM   4529  C  CD  . PRO A 1 578  ? 12.544  115.672 26.341  1.00 34.16 ? 578  PRO A CD  1 
ATOM   4530  N  N   . ASN A 1 579  ? 11.630  113.124 23.841  1.00 30.54 ? 579  ASN A N   1 
ATOM   4531  C  CA  . ASN A 1 579  ? 11.148  112.064 23.009  1.00 30.16 ? 579  ASN A CA  1 
ATOM   4532  C  C   . ASN A 1 579  ? 9.756   112.337 22.446  1.00 30.58 ? 579  ASN A C   1 
ATOM   4533  O  O   . ASN A 1 579  ? 8.953   113.112 22.992  1.00 28.91 ? 579  ASN A O   1 
ATOM   4534  C  CB  . ASN A 1 579  ? 11.165  110.758 23.764  1.00 30.44 ? 579  ASN A CB  1 
ATOM   4535  C  CG  . ASN A 1 579  ? 12.518  110.470 24.385  1.00 32.67 ? 579  ASN A CG  1 
ATOM   4536  O  OD1 . ASN A 1 579  ? 13.575  110.697 23.775  1.00 35.12 ? 579  ASN A OD1 1 
ATOM   4537  N  ND2 . ASN A 1 579  ? 12.496  109.949 25.602  1.00 30.33 ? 579  ASN A ND2 1 
ATOM   4538  N  N   . GLN A 1 580  ? 9.516   111.714 21.303  1.00 32.06 ? 580  GLN A N   1 
ATOM   4539  C  CA  . GLN A 1 580  ? 8.239   111.800 20.610  1.00 33.83 ? 580  GLN A CA  1 
ATOM   4540  C  C   . GLN A 1 580  ? 7.870   110.402 20.138  1.00 33.17 ? 580  GLN A C   1 
ATOM   4541  O  O   . GLN A 1 580  ? 8.748   109.590 19.830  1.00 31.19 ? 580  GLN A O   1 
ATOM   4542  C  CB  . GLN A 1 580  ? 8.323   112.737 19.401  1.00 34.30 ? 580  GLN A CB  1 
ATOM   4543  C  CG  . GLN A 1 580  ? 8.358   114.211 19.757  1.00 33.80 ? 580  GLN A CG  1 
ATOM   4544  C  CD  . GLN A 1 580  ? 8.647   115.091 18.550  1.00 35.53 ? 580  GLN A CD  1 
ATOM   4545  O  OE1 . GLN A 1 580  ? 9.763   115.078 18.017  1.00 36.92 ? 580  GLN A OE1 1 
ATOM   4546  N  NE2 . GLN A 1 580  ? 7.642   115.852 18.103  1.00 33.26 ? 580  GLN A NE2 1 
ATOM   4547  N  N   . SER A 1 581  ? 6.574   110.126 20.085  1.00 33.20 ? 581  SER A N   1 
ATOM   4548  C  CA  . SER A 1 581  ? 6.112   108.824 19.653  1.00 34.23 ? 581  SER A CA  1 
ATOM   4549  C  C   . SER A 1 581  ? 4.955   108.933 18.678  1.00 34.03 ? 581  SER A C   1 
ATOM   4550  O  O   . SER A 1 581  ? 4.059   109.758 18.850  1.00 34.99 ? 581  SER A O   1 
ATOM   4551  C  CB  . SER A 1 581  ? 5.679   107.997 20.862  1.00 35.98 ? 581  SER A CB  1 
ATOM   4552  O  OG  . SER A 1 581  ? 4.645   108.656 21.570  1.00 35.33 ? 581  SER A OG  1 
ATOM   4553  N  N   . ILE A 1 582  ? 4.998   108.095 17.649  1.00 34.18 ? 582  ILE A N   1 
ATOM   4554  C  CA  . ILE A 1 582  ? 3.959   108.035 16.630  1.00 33.58 ? 582  ILE A CA  1 
ATOM   4555  C  C   . ILE A 1 582  ? 3.223   106.742 16.929  1.00 32.39 ? 582  ILE A C   1 
ATOM   4556  O  O   . ILE A 1 582  ? 3.847   105.701 17.077  1.00 31.61 ? 582  ILE A O   1 
ATOM   4557  C  CB  . ILE A 1 582  ? 4.562   107.926 15.191  1.00 33.86 ? 582  ILE A CB  1 
ATOM   4558  C  CG1 . ILE A 1 582  ? 5.639   108.998 14.979  1.00 34.57 ? 582  ILE A CG1 1 
ATOM   4559  C  CG2 . ILE A 1 582  ? 3.465   108.047 14.146  1.00 31.47 ? 582  ILE A CG2 1 
ATOM   4560  C  CD1 . ILE A 1 582  ? 5.104   110.425 14.934  1.00 36.05 ? 582  ILE A CD1 1 
ATOM   4561  N  N   . ASN A 1 583  ? 1.908   106.801 17.036  1.00 32.50 ? 583  ASN A N   1 
ATOM   4562  C  CA  . ASN A 1 583  ? 1.141   105.596 17.299  1.00 33.50 ? 583  ASN A CA  1 
ATOM   4563  C  C   . ASN A 1 583  ? 0.768   105.019 15.933  1.00 34.70 ? 583  ASN A C   1 
ATOM   4564  O  O   . ASN A 1 583  ? -0.100  105.550 15.229  1.00 35.73 ? 583  ASN A O   1 
ATOM   4565  C  CB  . ASN A 1 583  ? -0.089  105.945 18.140  1.00 31.70 ? 583  ASN A CB  1 
ATOM   4566  C  CG  . ASN A 1 583  ? 0.276   106.741 19.383  1.00 30.56 ? 583  ASN A CG  1 
ATOM   4567  O  OD1 . ASN A 1 583  ? 1.217   106.398 20.100  1.00 30.81 ? 583  ASN A OD1 1 
ATOM   4568  N  ND2 . ASN A 1 583  ? -0.464  107.807 19.645  1.00 30.98 ? 583  ASN A ND2 1 
ATOM   4569  N  N   . ILE A 1 584  ? 1.474   103.961 15.538  1.00 36.15 ? 584  ILE A N   1 
ATOM   4570  C  CA  . ILE A 1 584  ? 1.233   103.321 14.251  1.00 36.32 ? 584  ILE A CA  1 
ATOM   4571  C  C   . ILE A 1 584  ? 0.418   102.060 14.418  1.00 36.08 ? 584  ILE A C   1 
ATOM   4572  O  O   . ILE A 1 584  ? 0.744   101.218 15.245  1.00 37.53 ? 584  ILE A O   1 
ATOM   4573  C  CB  . ILE A 1 584  ? 2.555   102.956 13.543  1.00 34.73 ? 584  ILE A CB  1 
ATOM   4574  C  CG1 . ILE A 1 584  ? 3.458   104.184 13.464  1.00 34.40 ? 584  ILE A CG1 1 
ATOM   4575  C  CG2 . ILE A 1 584  ? 2.271   102.428 12.147  1.00 35.20 ? 584  ILE A CG2 1 
ATOM   4576  C  CD1 . ILE A 1 584  ? 4.813   103.902 12.852  1.00 34.51 ? 584  ILE A CD1 1 
ATOM   4577  N  N   . ASP A 1 585  ? -0.640  101.940 13.630  1.00 35.96 ? 585  ASP A N   1 
ATOM   4578  C  CA  . ASP A 1 585  ? -1.484  100.759 13.689  1.00 36.27 ? 585  ASP A CA  1 
ATOM   4579  C  C   . ASP A 1 585  ? -1.856  100.294 12.287  1.00 35.13 ? 585  ASP A C   1 
ATOM   4580  O  O   . ASP A 1 585  ? -1.788  101.058 11.327  1.00 35.31 ? 585  ASP A O   1 
ATOM   4581  C  CB  . ASP A 1 585  ? -2.759  101.046 14.492  1.00 36.50 ? 585  ASP A CB  1 
ATOM   4582  C  CG  . ASP A 1 585  ? -2.473  101.548 15.906  1.00 38.55 ? 585  ASP A CG  1 
ATOM   4583  O  OD1 . ASP A 1 585  ? -1.532  101.043 16.556  1.00 38.51 ? 585  ASP A OD1 1 
ATOM   4584  O  OD2 . ASP A 1 585  ? -3.206  102.445 16.382  1.00 38.58 ? 585  ASP A OD2 1 
ATOM   4585  N  N   . ILE A 1 586  ? -2.224  99.028  12.176  1.00 33.34 ? 586  ILE A N   1 
ATOM   4586  C  CA  . ILE A 1 586  ? -2.646  98.473  10.906  1.00 32.84 ? 586  ILE A CA  1 
ATOM   4587  C  C   . ILE A 1 586  ? -4.101  98.083  11.159  1.00 32.89 ? 586  ILE A C   1 
ATOM   4588  O  O   . ILE A 1 586  ? -4.394  97.316  12.093  1.00 34.83 ? 586  ILE A O   1 
ATOM   4589  C  CB  . ILE A 1 586  ? -1.825  97.219  10.540  1.00 33.30 ? 586  ILE A CB  1 
ATOM   4590  C  CG1 . ILE A 1 586  ? -0.328  97.525  10.624  1.00 32.50 ? 586  ILE A CG1 1 
ATOM   4591  C  CG2 . ILE A 1 586  ? -2.173  96.766  9.136   1.00 32.79 ? 586  ILE A CG2 1 
ATOM   4592  C  CD1 . ILE A 1 586  ? 0.514   96.300  10.903  1.00 36.12 ? 586  ILE A CD1 1 
ATOM   4593  N  N   . SER A 1 587  ? -5.014  98.633  10.361  1.00 30.50 ? 587  SER A N   1 
ATOM   4594  C  CA  . SER A 1 587  ? -6.434  98.329  10.506  1.00 31.12 ? 587  SER A CA  1 
ATOM   4595  C  C   . SER A 1 587  ? -6.834  97.172  9.596   1.00 30.77 ? 587  SER A C   1 
ATOM   4596  O  O   . SER A 1 587  ? -6.283  97.019  8.509   1.00 29.12 ? 587  SER A O   1 
ATOM   4597  C  CB  . SER A 1 587  ? -7.282  99.558  10.169  1.00 33.19 ? 587  SER A CB  1 
ATOM   4598  O  OG  . SER A 1 587  ? -7.175  99.867  8.793   1.00 35.24 ? 587  SER A OG  1 
ATOM   4599  N  N   . ALA A 1 588  ? -7.805  96.371  10.043  1.00 31.30 ? 588  ALA A N   1 
ATOM   4600  C  CA  . ALA A 1 588  ? -8.283  95.211  9.287   1.00 32.09 ? 588  ALA A CA  1 
ATOM   4601  C  C   . ALA A 1 588  ? -7.095  94.285  9.014   1.00 33.48 ? 588  ALA A C   1 
ATOM   4602  O  O   . ALA A 1 588  ? -6.877  93.838  7.886   1.00 34.81 ? 588  ALA A O   1 
ATOM   4603  C  CB  . ALA A 1 588  ? -8.916  95.664  7.985   1.00 31.15 ? 588  ALA A CB  1 
ATOM   4604  N  N   . CYS A 1 589  ? -6.323  94.009  10.060  1.00 33.57 ? 589  CYS A N   1 
ATOM   4605  C  CA  . CYS A 1 589  ? -5.145  93.169  9.935   1.00 34.53 ? 589  CYS A CA  1 
ATOM   4606  C  C   . CYS A 1 589  ? -5.423  91.754  9.427   1.00 33.99 ? 589  CYS A C   1 
ATOM   4607  O  O   . CYS A 1 589  ? -4.811  91.320  8.451   1.00 34.45 ? 589  CYS A O   1 
ATOM   4608  C  CB  . CYS A 1 589  ? -4.390  93.107  11.267  1.00 34.89 ? 589  CYS A CB  1 
ATOM   4609  S  SG  . CYS A 1 589  ? -2.747  92.383  11.084  1.00 38.71 ? 589  CYS A SG  1 
ATOM   4610  N  N   . ASP A 1 590  ? -6.328  91.030  10.087  1.00 33.69 ? 590  ASP A N   1 
ATOM   4611  C  CA  . ASP A 1 590  ? -6.656  89.671  9.658   1.00 34.18 ? 590  ASP A CA  1 
ATOM   4612  C  C   . ASP A 1 590  ? -7.056  89.599  8.194   1.00 34.11 ? 590  ASP A C   1 
ATOM   4613  O  O   . ASP A 1 590  ? -6.655  88.688  7.478   1.00 34.89 ? 590  ASP A O   1 
ATOM   4614  C  CB  . ASP A 1 590  ? -7.787  89.085  10.498  1.00 35.89 ? 590  ASP A CB  1 
ATOM   4615  C  CG  . ASP A 1 590  ? -7.345  88.731  11.903  1.00 38.35 ? 590  ASP A CG  1 
ATOM   4616  O  OD1 . ASP A 1 590  ? -6.236  88.178  12.050  1.00 39.73 ? 590  ASP A OD1 1 
ATOM   4617  O  OD2 . ASP A 1 590  ? -8.108  88.985  12.862  1.00 40.08 ? 590  ASP A OD2 1 
ATOM   4618  N  N   . ALA A 1 591  ? -7.852  90.563  7.747   1.00 34.29 ? 591  ALA A N   1 
ATOM   4619  C  CA  . ALA A 1 591  ? -8.302  90.589  6.361   1.00 34.35 ? 591  ALA A CA  1 
ATOM   4620  C  C   . ALA A 1 591  ? -7.198  91.048  5.413   1.00 34.20 ? 591  ALA A C   1 
ATOM   4621  O  O   . ALA A 1 591  ? -7.359  90.990  4.193   1.00 34.68 ? 591  ALA A O   1 
ATOM   4622  C  CB  . ALA A 1 591  ? -9.529  91.502  6.221   1.00 34.26 ? 591  ALA A CB  1 
ATOM   4623  N  N   . SER A 1 592  ? -6.073  91.491  5.968   1.00 34.15 ? 592  SER A N   1 
ATOM   4624  C  CA  . SER A 1 592  ? -4.965  91.972  5.144   1.00 34.34 ? 592  SER A CA  1 
ATOM   4625  C  C   . SER A 1 592  ? -3.833  90.976  5.032   1.00 33.35 ? 592  SER A C   1 
ATOM   4626  O  O   . SER A 1 592  ? -2.915  91.162  4.250   1.00 34.30 ? 592  SER A O   1 
ATOM   4627  C  CB  . SER A 1 592  ? -4.439  93.307  5.689   1.00 34.51 ? 592  SER A CB  1 
ATOM   4628  O  OG  . SER A 1 592  ? -5.457  94.310  5.675   1.00 36.31 ? 592  SER A OG  1 
ATOM   4629  N  N   . ILE A 1 593  ? -3.891  89.922  5.832   1.00 33.26 ? 593  ILE A N   1 
ATOM   4630  C  CA  . ILE A 1 593  ? -2.867  88.875  5.791   1.00 31.89 ? 593  ILE A CA  1 
ATOM   4631  C  C   . ILE A 1 593  ? -3.492  87.749  4.971   1.00 31.15 ? 593  ILE A C   1 
ATOM   4632  O  O   . ILE A 1 593  ? -4.093  86.823  5.518   1.00 30.96 ? 593  ILE A O   1 
ATOM   4633  C  CB  . ILE A 1 593  ? -2.513  88.339  7.204   1.00 30.45 ? 593  ILE A CB  1 
ATOM   4634  C  CG1 . ILE A 1 593  ? -1.903  89.451  8.052   1.00 29.85 ? 593  ILE A CG1 1 
ATOM   4635  C  CG2 . ILE A 1 593  ? -1.534  87.178  7.092   1.00 29.24 ? 593  ILE A CG2 1 
ATOM   4636  C  CD1 . ILE A 1 593  ? -0.634  90.022  7.492   1.00 28.11 ? 593  ILE A CD1 1 
ATOM   4637  N  N   . THR A 1 594  ? -3.354  87.843  3.654   1.00 30.21 ? 594  THR A N   1 
ATOM   4638  C  CA  . THR A 1 594  ? -3.935  86.851  2.766   1.00 29.55 ? 594  THR A CA  1 
ATOM   4639  C  C   . THR A 1 594  ? -2.883  86.121  1.940   1.00 30.19 ? 594  THR A C   1 
ATOM   4640  O  O   . THR A 1 594  ? -1.685  86.410  2.040   1.00 29.95 ? 594  THR A O   1 
ATOM   4641  C  CB  . THR A 1 594  ? -4.956  87.516  1.836   1.00 29.07 ? 594  THR A CB  1 
ATOM   4642  O  OG1 . THR A 1 594  ? -4.283  88.367  0.908   1.00 28.40 ? 594  THR A OG1 1 
ATOM   4643  C  CG2 . THR A 1 594  ? -5.915  88.368  2.647   1.00 29.11 ? 594  THR A CG2 1 
ATOM   4644  N  N   . TRP A 1 595  ? -3.334  85.179  1.121   1.00 30.32 ? 595  TRP A N   1 
ATOM   4645  C  CA  . TRP A 1 595  ? -2.424  84.392  0.299   1.00 30.63 ? 595  TRP A CA  1 
ATOM   4646  C  C   . TRP A 1 595  ? -1.734  85.162  -0.829  1.00 31.66 ? 595  TRP A C   1 
ATOM   4647  O  O   . TRP A 1 595  ? -0.556  84.945  -1.106  1.00 30.88 ? 595  TRP A O   1 
ATOM   4648  C  CB  . TRP A 1 595  ? -3.167  83.177  -0.275  1.00 29.77 ? 595  TRP A CB  1 
ATOM   4649  C  CG  . TRP A 1 595  ? -2.311  82.297  -1.126  1.00 29.26 ? 595  TRP A CG  1 
ATOM   4650  C  CD1 . TRP A 1 595  ? -2.205  82.323  -2.487  1.00 27.41 ? 595  TRP A CD1 1 
ATOM   4651  C  CD2 . TRP A 1 595  ? -1.415  81.281  -0.672  1.00 29.49 ? 595  TRP A CD2 1 
ATOM   4652  N  NE1 . TRP A 1 595  ? -1.303  81.381  -2.909  1.00 27.76 ? 595  TRP A NE1 1 
ATOM   4653  C  CE2 . TRP A 1 595  ? -0.799  80.721  -1.816  1.00 28.68 ? 595  TRP A CE2 1 
ATOM   4654  C  CE3 . TRP A 1 595  ? -1.067  80.781  0.594   1.00 28.82 ? 595  TRP A CE3 1 
ATOM   4655  C  CZ2 . TRP A 1 595  ? 0.149   79.693  -1.740  1.00 29.02 ? 595  TRP A CZ2 1 
ATOM   4656  C  CZ3 . TRP A 1 595  ? -0.120  79.757  0.676   1.00 29.88 ? 595  TRP A CZ3 1 
ATOM   4657  C  CH2 . TRP A 1 595  ? 0.475   79.220  -0.491  1.00 28.00 ? 595  TRP A CH2 1 
ATOM   4658  N  N   . ASP A 1 596  ? -2.469  86.067  -1.466  1.00 33.00 ? 596  ASP A N   1 
ATOM   4659  C  CA  . ASP A 1 596  ? -1.954  86.854  -2.584  1.00 33.84 ? 596  ASP A CA  1 
ATOM   4660  C  C   . ASP A 1 596  ? -0.603  87.514  -2.368  1.00 32.74 ? 596  ASP A C   1 
ATOM   4661  O  O   . ASP A 1 596  ? 0.207   87.589  -3.289  1.00 33.59 ? 596  ASP A O   1 
ATOM   4662  C  CB  . ASP A 1 596  ? -2.987  87.907  -2.994  1.00 37.07 ? 596  ASP A CB  1 
ATOM   4663  C  CG  . ASP A 1 596  ? -4.033  87.351  -3.939  1.00 39.78 ? 596  ASP A CG  1 
ATOM   4664  O  OD1 . ASP A 1 596  ? -4.226  86.113  -3.966  1.00 40.41 ? 596  ASP A OD1 1 
ATOM   4665  O  OD2 . ASP A 1 596  ? -4.669  88.155  -4.650  1.00 42.81 ? 596  ASP A OD2 1 
ATOM   4666  N  N   . PHE A 1 597  ? -0.352  88.003  -1.163  1.00 30.55 ? 597  PHE A N   1 
ATOM   4667  C  CA  . PHE A 1 597  ? 0.921   88.647  -0.901  1.00 29.04 ? 597  PHE A CA  1 
ATOM   4668  C  C   . PHE A 1 597  ? 1.686   87.985  0.237   1.00 27.79 ? 597  PHE A C   1 
ATOM   4669  O  O   . PHE A 1 597  ? 2.709   87.352  0.020   1.00 28.78 ? 597  PHE A O   1 
ATOM   4670  C  CB  . PHE A 1 597  ? 0.720   90.132  -0.578  1.00 29.03 ? 597  PHE A CB  1 
ATOM   4671  C  CG  . PHE A 1 597  ? 2.005   90.911  -0.513  1.00 28.52 ? 597  PHE A CG  1 
ATOM   4672  C  CD1 . PHE A 1 597  ? 2.620   91.358  -1.684  1.00 28.80 ? 597  PHE A CD1 1 
ATOM   4673  C  CD2 . PHE A 1 597  ? 2.629   91.153  0.712   1.00 28.64 ? 597  PHE A CD2 1 
ATOM   4674  C  CE1 . PHE A 1 597  ? 3.847   92.033  -1.641  1.00 28.96 ? 597  PHE A CE1 1 
ATOM   4675  C  CE2 . PHE A 1 597  ? 3.850   91.824  0.775   1.00 28.14 ? 597  PHE A CE2 1 
ATOM   4676  C  CZ  . PHE A 1 597  ? 4.464   92.267  -0.410  1.00 29.00 ? 597  PHE A CZ  1 
ATOM   4677  N  N   . PHE A 1 598  ? 1.177   88.121  1.452   1.00 26.25 ? 598  PHE A N   1 
ATOM   4678  C  CA  . PHE A 1 598  ? 1.846   87.575  2.621   1.00 25.42 ? 598  PHE A CA  1 
ATOM   4679  C  C   . PHE A 1 598  ? 1.969   86.057  2.730   1.00 24.45 ? 598  PHE A C   1 
ATOM   4680  O  O   . PHE A 1 598  ? 3.065   85.514  2.659   1.00 23.30 ? 598  PHE A O   1 
ATOM   4681  C  CB  . PHE A 1 598  ? 1.179   88.122  3.885   1.00 24.61 ? 598  PHE A CB  1 
ATOM   4682  C  CG  . PHE A 1 598  ? 1.586   89.520  4.219   1.00 24.31 ? 598  PHE A CG  1 
ATOM   4683  C  CD1 . PHE A 1 598  ? 2.779   89.767  4.908   1.00 23.15 ? 598  PHE A CD1 1 
ATOM   4684  C  CD2 . PHE A 1 598  ? 0.810   90.602  3.803   1.00 25.08 ? 598  PHE A CD2 1 
ATOM   4685  C  CE1 . PHE A 1 598  ? 3.196   91.072  5.191   1.00 22.16 ? 598  PHE A CE1 1 
ATOM   4686  C  CE2 . PHE A 1 598  ? 1.215   91.919  4.077   1.00 24.20 ? 598  PHE A CE2 1 
ATOM   4687  C  CZ  . PHE A 1 598  ? 2.419   92.156  4.770   1.00 23.05 ? 598  PHE A CZ  1 
ATOM   4688  N  N   . LEU A 1 599  ? 0.846   85.374  2.905   1.00 24.34 ? 599  LEU A N   1 
ATOM   4689  C  CA  . LEU A 1 599  ? 0.868   83.924  3.086   1.00 25.14 ? 599  LEU A CA  1 
ATOM   4690  C  C   . LEU A 1 599  ? 1.550   83.074  2.021   1.00 25.02 ? 599  LEU A C   1 
ATOM   4691  O  O   . LEU A 1 599  ? 2.195   82.077  2.358   1.00 25.77 ? 599  LEU A O   1 
ATOM   4692  C  CB  . LEU A 1 599  ? -0.553  83.408  3.350   1.00 23.45 ? 599  LEU A CB  1 
ATOM   4693  C  CG  . LEU A 1 599  ? -1.177  83.991  4.630   1.00 23.83 ? 599  LEU A CG  1 
ATOM   4694  C  CD1 . LEU A 1 599  ? -2.604  83.500  4.771   1.00 23.83 ? 599  LEU A CD1 1 
ATOM   4695  C  CD2 . LEU A 1 599  ? -0.352  83.595  5.855   1.00 22.74 ? 599  LEU A CD2 1 
ATOM   4696  N  N   . SER A 1 600  ? 1.415   83.432  0.748   1.00 25.16 ? 600  SER A N   1 
ATOM   4697  C  CA  . SER A 1 600  ? 2.076   82.645  -0.298  1.00 24.98 ? 600  SER A CA  1 
ATOM   4698  C  C   . SER A 1 600  ? 3.595   82.794  -0.132  1.00 25.07 ? 600  SER A C   1 
ATOM   4699  O  O   . SER A 1 600  ? 4.350   81.843  -0.329  1.00 24.26 ? 600  SER A O   1 
ATOM   4700  C  CB  . SER A 1 600  ? 1.647   83.127  -1.681  1.00 25.99 ? 600  SER A CB  1 
ATOM   4701  O  OG  . SER A 1 600  ? 1.970   84.500  -1.871  1.00 28.77 ? 600  SER A OG  1 
ATOM   4702  N  N   . VAL A 1 601  ? 4.035   83.995  0.242   1.00 24.71 ? 601  VAL A N   1 
ATOM   4703  C  CA  . VAL A 1 601  ? 5.454   84.259  0.451   1.00 24.40 ? 601  VAL A CA  1 
ATOM   4704  C  C   . VAL A 1 601  ? 5.961   83.544  1.709   1.00 25.56 ? 601  VAL A C   1 
ATOM   4705  O  O   . VAL A 1 601  ? 6.938   82.791  1.665   1.00 27.34 ? 601  VAL A O   1 
ATOM   4706  C  CB  . VAL A 1 601  ? 5.723   85.788  0.595   1.00 23.89 ? 601  VAL A CB  1 
ATOM   4707  C  CG1 . VAL A 1 601  ? 7.138   86.028  1.099   1.00 22.26 ? 601  VAL A CG1 1 
ATOM   4708  C  CG2 . VAL A 1 601  ? 5.508   86.487  -0.741  1.00 23.22 ? 601  VAL A CG2 1 
ATOM   4709  N  N   . ILE A 1 602  ? 5.277   83.773  2.824   1.00 25.09 ? 602  ILE A N   1 
ATOM   4710  C  CA  . ILE A 1 602  ? 5.653   83.194  4.104   1.00 23.65 ? 602  ILE A CA  1 
ATOM   4711  C  C   . ILE A 1 602  ? 5.685   81.669  4.097   1.00 24.34 ? 602  ILE A C   1 
ATOM   4712  O  O   . ILE A 1 602  ? 6.593   81.055  4.654   1.00 25.27 ? 602  ILE A O   1 
ATOM   4713  C  CB  . ILE A 1 602  ? 4.703   83.717  5.208   1.00 22.73 ? 602  ILE A CB  1 
ATOM   4714  C  CG1 . ILE A 1 602  ? 4.862   85.238  5.327   1.00 18.92 ? 602  ILE A CG1 1 
ATOM   4715  C  CG2 . ILE A 1 602  ? 5.012   83.052  6.538   1.00 19.74 ? 602  ILE A CG2 1 
ATOM   4716  C  CD1 . ILE A 1 602  ? 3.852   85.902  6.245   1.00 18.70 ? 602  ILE A CD1 1 
ATOM   4717  N  N   . MET A 1 603  ? 4.698   81.052  3.463   1.00 24.93 ? 603  MET A N   1 
ATOM   4718  C  CA  . MET A 1 603  ? 4.660   79.596  3.396   1.00 25.87 ? 603  MET A CA  1 
ATOM   4719  C  C   . MET A 1 603  ? 5.873   79.053  2.648   1.00 26.37 ? 603  MET A C   1 
ATOM   4720  O  O   . MET A 1 603  ? 6.456   78.037  3.036   1.00 27.72 ? 603  MET A O   1 
ATOM   4721  C  CB  . MET A 1 603  ? 3.379   79.126  2.711   1.00 26.52 ? 603  MET A CB  1 
ATOM   4722  C  CG  . MET A 1 603  ? 2.119   79.287  3.562   1.00 28.67 ? 603  MET A CG  1 
ATOM   4723  S  SD  . MET A 1 603  ? 2.335   78.636  5.249   1.00 29.03 ? 603  MET A SD  1 
ATOM   4724  C  CE  . MET A 1 603  ? 1.769   77.020  5.047   1.00 31.22 ? 603  MET A CE  1 
ATOM   4725  N  N   . ALA A 1 604  ? 6.263   79.751  1.587   1.00 26.88 ? 604  ALA A N   1 
ATOM   4726  C  CA  . ALA A 1 604  ? 7.398   79.329  0.776   1.00 28.22 ? 604  ALA A CA  1 
ATOM   4727  C  C   . ALA A 1 604  ? 8.731   79.499  1.498   1.00 27.62 ? 604  ALA A C   1 
ATOM   4728  O  O   . ALA A 1 604  ? 9.574   78.594  1.500   1.00 28.05 ? 604  ALA A O   1 
ATOM   4729  C  CB  . ALA A 1 604  ? 7.413   80.103  -0.556  1.00 28.18 ? 604  ALA A CB  1 
ATOM   4730  N  N   . ALA A 1 605  ? 8.911   80.661  2.111   1.00 26.39 ? 605  ALA A N   1 
ATOM   4731  C  CA  . ALA A 1 605  ? 10.141  80.956  2.814   1.00 25.00 ? 605  ALA A CA  1 
ATOM   4732  C  C   . ALA A 1 605  ? 10.379  79.940  3.917   1.00 25.71 ? 605  ALA A C   1 
ATOM   4733  O  O   . ALA A 1 605  ? 11.506  79.466  4.100   1.00 26.89 ? 605  ALA A O   1 
ATOM   4734  C  CB  . ALA A 1 605  ? 10.084  82.370  3.384   1.00 24.45 ? 605  ALA A CB  1 
ATOM   4735  N  N   . ILE A 1 606  ? 9.320   79.595  4.647   1.00 25.19 ? 606  ILE A N   1 
ATOM   4736  C  CA  . ILE A 1 606  ? 9.435   78.629  5.736   1.00 24.23 ? 606  ILE A CA  1 
ATOM   4737  C  C   . ILE A 1 606  ? 9.724   77.242  5.183   1.00 24.04 ? 606  ILE A C   1 
ATOM   4738  O  O   . ILE A 1 606  ? 10.666  76.576  5.605   1.00 22.76 ? 606  ILE A O   1 
ATOM   4739  C  CB  . ILE A 1 606  ? 8.132   78.586  6.587   1.00 24.99 ? 606  ILE A CB  1 
ATOM   4740  C  CG1 . ILE A 1 606  ? 7.924   79.932  7.297   1.00 24.69 ? 606  ILE A CG1 1 
ATOM   4741  C  CG2 . ILE A 1 606  ? 8.212   77.460  7.611   1.00 23.30 ? 606  ILE A CG2 1 
ATOM   4742  C  CD1 . ILE A 1 606  ? 6.619   80.035  8.065   1.00 22.92 ? 606  ILE A CD1 1 
ATOM   4743  N  N   . HIS A 1 607  ? 8.910   76.818  4.226   1.00 25.82 ? 607  HIS A N   1 
ATOM   4744  C  CA  . HIS A 1 607  ? 9.066   75.514  3.602   1.00 27.24 ? 607  HIS A CA  1 
ATOM   4745  C  C   . HIS A 1 607  ? 10.489  75.300  3.092   1.00 27.89 ? 607  HIS A C   1 
ATOM   4746  O  O   . HIS A 1 607  ? 10.996  74.177  3.132   1.00 29.30 ? 607  HIS A O   1 
ATOM   4747  C  CB  . HIS A 1 607  ? 8.063   75.359  2.448   1.00 25.92 ? 607  HIS A CB  1 
ATOM   4748  C  CG  . HIS A 1 607  ? 8.125   74.025  1.767   1.00 25.70 ? 607  HIS A CG  1 
ATOM   4749  N  ND1 . HIS A 1 607  ? 9.057   73.727  0.795   1.00 26.09 ? 607  HIS A ND1 1 
ATOM   4750  C  CD2 . HIS A 1 607  ? 7.403   72.896  1.955   1.00 24.79 ? 607  HIS A CD2 1 
ATOM   4751  C  CE1 . HIS A 1 607  ? 8.906   72.471  0.417   1.00 25.95 ? 607  HIS A CE1 1 
ATOM   4752  N  NE2 . HIS A 1 607  ? 7.911   71.943  1.104   1.00 24.04 ? 607  HIS A NE2 1 
ATOM   4753  N  N   . GLU A 1 608  ? 11.135  76.361  2.615   1.00 27.32 ? 608  GLU A N   1 
ATOM   4754  C  CA  . GLU A 1 608  ? 12.504  76.227  2.112   1.00 28.14 ? 608  GLU A CA  1 
ATOM   4755  C  C   . GLU A 1 608  ? 13.581  76.452  3.178   1.00 28.53 ? 608  GLU A C   1 
ATOM   4756  O  O   . GLU A 1 608  ? 14.546  75.703  3.246   1.00 28.92 ? 608  GLU A O   1 
ATOM   4757  C  CB  . GLU A 1 608  ? 12.728  77.179  0.936   1.00 29.43 ? 608  GLU A CB  1 
ATOM   4758  C  CG  . GLU A 1 608  ? 11.875  76.855  -0.290  1.00 31.01 ? 608  GLU A CG  1 
ATOM   4759  C  CD  . GLU A 1 608  ? 12.213  75.502  -0.920  1.00 31.52 ? 608  GLU A CD  1 
ATOM   4760  O  OE1 . GLU A 1 608  ? 13.304  75.376  -1.517  1.00 30.63 ? 608  GLU A OE1 1 
ATOM   4761  O  OE2 . GLU A 1 608  ? 11.384  74.566  -0.816  1.00 30.35 ? 608  GLU A OE2 1 
ATOM   4762  N  N   . GLY A 1 609  ? 13.398  77.467  4.023   1.00 29.54 ? 609  GLY A N   1 
ATOM   4763  C  CA  . GLY A 1 609  ? 14.379  77.761  5.050   1.00 29.27 ? 609  GLY A CA  1 
ATOM   4764  C  C   . GLY A 1 609  ? 14.542  76.648  6.067   1.00 30.21 ? 609  GLY A C   1 
ATOM   4765  O  O   . GLY A 1 609  ? 15.564  76.523  6.747   1.00 31.53 ? 609  GLY A O   1 
ATOM   4766  N  N   . VAL A 1 610  ? 13.524  75.815  6.146   1.00 30.04 ? 610  VAL A N   1 
ATOM   4767  C  CA  . VAL A 1 610  ? 13.476  74.720  7.084   1.00 29.76 ? 610  VAL A CA  1 
ATOM   4768  C  C   . VAL A 1 610  ? 14.033  73.405  6.527   1.00 30.51 ? 610  VAL A C   1 
ATOM   4769  O  O   . VAL A 1 610  ? 14.364  72.486  7.279   1.00 29.87 ? 610  VAL A O   1 
ATOM   4770  C  CB  . VAL A 1 610  ? 12.001  74.578  7.539   1.00 29.32 ? 610  VAL A CB  1 
ATOM   4771  C  CG1 . VAL A 1 610  ? 11.462  73.215  7.230   1.00 27.35 ? 610  VAL A CG1 1 
ATOM   4772  C  CG2 . VAL A 1 610  ? 11.890  74.917  9.011   1.00 28.93 ? 610  VAL A CG2 1 
ATOM   4773  N  N   . ALA A 1 611  ? 14.162  73.336  5.205   1.00 32.02 ? 611  ALA A N   1 
ATOM   4774  C  CA  . ALA A 1 611  ? 14.639  72.134  4.507   1.00 32.31 ? 611  ALA A CA  1 
ATOM   4775  C  C   . ALA A 1 611  ? 15.821  71.315  5.070   1.00 32.59 ? 611  ALA A C   1 
ATOM   4776  O  O   . ALA A 1 611  ? 15.653  70.143  5.393   1.00 32.57 ? 611  ALA A O   1 
ATOM   4777  C  CB  . ALA A 1 611  ? 14.906  72.474  3.040   1.00 29.46 ? 611  ALA A CB  1 
ATOM   4778  N  N   . SER A 1 612  ? 17.000  71.917  5.191   1.00 32.95 ? 612  SER A N   1 
ATOM   4779  C  CA  . SER A 1 612  ? 18.173  71.184  5.666   1.00 34.77 ? 612  SER A CA  1 
ATOM   4780  C  C   . SER A 1 612  ? 18.160  70.732  7.126   1.00 35.06 ? 612  SER A C   1 
ATOM   4781  O  O   . SER A 1 612  ? 18.561  69.610  7.432   1.00 35.26 ? 612  SER A O   1 
ATOM   4782  C  CB  . SER A 1 612  ? 19.448  71.997  5.396   1.00 33.86 ? 612  SER A CB  1 
ATOM   4783  O  OG  . SER A 1 612  ? 19.406  73.247  6.062   1.00 35.27 ? 612  SER A OG  1 
ATOM   4784  N  N   . SER A 1 613  ? 17.689  71.586  8.025   1.00 35.76 ? 613  SER A N   1 
ATOM   4785  C  CA  . SER A 1 613  ? 17.672  71.269  9.447   1.00 35.12 ? 613  SER A CA  1 
ATOM   4786  C  C   . SER A 1 613  ? 16.689  70.144  9.747   1.00 35.23 ? 613  SER A C   1 
ATOM   4787  O  O   . SER A 1 613  ? 16.947  69.330  10.652  1.00 36.72 ? 613  SER A O   1 
ATOM   4788  C  CB  . SER A 1 613  ? 17.330  72.513  10.269  1.00 37.10 ? 613  SER A CB  1 
ATOM   4789  O  OG  . SER A 1 613  ? 18.323  73.513  10.120  1.00 37.11 ? 613  SER A OG  1 
ATOM   4790  N  N   . SER A 1 614  ? 15.568  70.070  9.050   1.00 34.30 ? 614  SER A N   1 
ATOM   4791  C  CA  . SER A 1 614  ? 14.546  69.054  9.300   1.00 33.62 ? 614  SER A CA  1 
ATOM   4792  C  C   . SER A 1 614  ? 14.619  67.854  8.351   1.00 35.42 ? 614  SER A C   1 
ATOM   4793  O  O   . SER A 1 614  ? 13.829  66.918  8.461   1.00 34.94 ? 614  SER A O   1 
ATOM   4794  C  CB  . SER A 1 614  ? 13.164  69.688  9.182   1.00 33.16 ? 614  SER A CB  1 
ATOM   4795  O  OG  . SER A 1 614  ? 12.909  70.147  7.862   1.00 31.37 ? 614  SER A OG  1 
ATOM   4796  N  N   . ILE A 1 615  ? 15.584  67.900  7.436   1.00 37.02 ? 615  ILE A N   1 
ATOM   4797  C  CA  . ILE A 1 615  ? 15.817  66.888  6.410   1.00 39.09 ? 615  ILE A CA  1 
ATOM   4798  C  C   . ILE A 1 615  ? 15.101  65.531  6.425   1.00 40.96 ? 615  ILE A C   1 
ATOM   4799  O  O   . ILE A 1 615  ? 14.272  65.263  5.545   1.00 43.96 ? 615  ILE A O   1 
ATOM   4800  C  CB  . ILE A 1 615  ? 17.324  66.617  6.251   1.00 39.16 ? 615  ILE A CB  1 
ATOM   4801  C  CG1 . ILE A 1 615  ? 17.552  65.744  5.016   1.00 38.06 ? 615  ILE A CG1 1 
ATOM   4802  C  CG2 . ILE A 1 615  ? 17.887  65.987  7.516   1.00 38.90 ? 615  ILE A CG2 1 
ATOM   4803  C  CD1 . ILE A 1 615  ? 17.090  66.394  3.730   1.00 38.22 ? 615  ILE A CD1 1 
ATOM   4804  N  N   . GLY A 1 616  ? 15.403  64.661  7.383   1.00 40.49 ? 616  GLY A N   1 
ATOM   4805  C  CA  . GLY A 1 616  ? 14.752  63.358  7.364   1.00 40.27 ? 616  GLY A CA  1 
ATOM   4806  C  C   . GLY A 1 616  ? 14.098  62.970  8.668   1.00 40.83 ? 616  GLY A C   1 
ATOM   4807  O  O   . GLY A 1 616  ? 14.426  61.948  9.271   1.00 41.36 ? 616  GLY A O   1 
ATOM   4808  N  N   . LYS A 1 617  ? 13.138  63.774  9.097   1.00 39.10 ? 617  LYS A N   1 
ATOM   4809  C  CA  . LYS A 1 617  ? 12.470  63.518  10.357  1.00 36.73 ? 617  LYS A CA  1 
ATOM   4810  C  C   . LYS A 1 617  ? 11.026  63.984  10.371  1.00 36.28 ? 617  LYS A C   1 
ATOM   4811  O  O   . LYS A 1 617  ? 10.633  64.891  9.636   1.00 36.40 ? 617  LYS A O   1 
ATOM   4812  C  CB  . LYS A 1 617  ? 13.225  64.227  11.484  1.00 35.65 ? 617  LYS A CB  1 
ATOM   4813  C  CG  . LYS A 1 617  ? 14.718  63.955  11.491  1.00 35.64 ? 617  LYS A CG  1 
ATOM   4814  C  CD  . LYS A 1 617  ? 15.467  64.909  12.419  1.00 35.17 ? 617  LYS A CD  1 
ATOM   4815  C  CE  . LYS A 1 617  ? 15.590  66.294  11.809  1.00 35.37 ? 617  LYS A CE  1 
ATOM   4816  N  NZ  . LYS A 1 617  ? 16.223  66.222  10.468  1.00 37.46 ? 617  LYS A NZ  1 
ATOM   4817  N  N   . PRO A 1 618  ? 10.202  63.348  11.205  1.00 35.94 ? 618  PRO A N   1 
ATOM   4818  C  CA  . PRO A 1 618  ? 8.801   63.746  11.293  1.00 34.94 ? 618  PRO A CA  1 
ATOM   4819  C  C   . PRO A 1 618  ? 8.809   64.859  12.333  1.00 34.38 ? 618  PRO A C   1 
ATOM   4820  O  O   . PRO A 1 618  ? 9.810   65.062  13.025  1.00 33.15 ? 618  PRO A O   1 
ATOM   4821  C  CB  . PRO A 1 618  ? 8.137   62.491  11.816  1.00 35.62 ? 618  PRO A CB  1 
ATOM   4822  C  CG  . PRO A 1 618  ? 9.148   62.019  12.811  1.00 34.77 ? 618  PRO A CG  1 
ATOM   4823  C  CD  . PRO A 1 618  ? 10.467  62.181  12.061  1.00 35.11 ? 618  PRO A CD  1 
ATOM   4824  N  N   . PHE A 1 619  ? 7.716   65.592  12.453  1.00 33.81 ? 619  PHE A N   1 
ATOM   4825  C  CA  . PHE A 1 619  ? 7.685   66.653  13.450  1.00 31.77 ? 619  PHE A CA  1 
ATOM   4826  C  C   . PHE A 1 619  ? 6.331   66.711  14.139  1.00 31.63 ? 619  PHE A C   1 
ATOM   4827  O  O   . PHE A 1 619  ? 5.285   66.730  13.491  1.00 31.11 ? 619  PHE A O   1 
ATOM   4828  C  CB  . PHE A 1 619  ? 8.009   68.005  12.815  1.00 28.41 ? 619  PHE A CB  1 
ATOM   4829  C  CG  . PHE A 1 619  ? 8.202   69.112  13.812  1.00 27.00 ? 619  PHE A CG  1 
ATOM   4830  C  CD1 . PHE A 1 619  ? 9.247   69.062  14.728  1.00 26.31 ? 619  PHE A CD1 1 
ATOM   4831  C  CD2 . PHE A 1 619  ? 7.343   70.209  13.838  1.00 24.49 ? 619  PHE A CD2 1 
ATOM   4832  C  CE1 . PHE A 1 619  ? 9.436   70.085  15.647  1.00 24.19 ? 619  PHE A CE1 1 
ATOM   4833  C  CE2 . PHE A 1 619  ? 7.533   71.232  14.756  1.00 22.95 ? 619  PHE A CE2 1 
ATOM   4834  C  CZ  . PHE A 1 619  ? 8.582   71.163  15.661  1.00 22.18 ? 619  PHE A CZ  1 
ATOM   4835  N  N   . MET A 1 620  ? 6.365   66.726  15.467  1.00 32.25 ? 620  MET A N   1 
ATOM   4836  C  CA  . MET A 1 620  ? 5.151   66.785  16.264  1.00 32.04 ? 620  MET A CA  1 
ATOM   4837  C  C   . MET A 1 620  ? 4.082   65.793  15.823  1.00 31.80 ? 620  MET A C   1 
ATOM   4838  O  O   . MET A 1 620  ? 2.891   66.060  15.956  1.00 33.28 ? 620  MET A O   1 
ATOM   4839  C  CB  . MET A 1 620  ? 4.592   68.199  16.229  1.00 31.43 ? 620  MET A CB  1 
ATOM   4840  C  CG  . MET A 1 620  ? 5.529   69.211  16.838  1.00 33.16 ? 620  MET A CG  1 
ATOM   4841  S  SD  . MET A 1 620  ? 4.910   70.871  16.645  1.00 32.85 ? 620  MET A SD  1 
ATOM   4842  C  CE  . MET A 1 620  ? 3.271   70.671  17.447  1.00 32.65 ? 620  MET A CE  1 
ATOM   4843  N  N   . GLY A 1 621  ? 4.507   64.654  15.293  1.00 30.85 ? 621  GLY A N   1 
ATOM   4844  C  CA  . GLY A 1 621  ? 3.548   63.655  14.862  1.00 30.41 ? 621  GLY A CA  1 
ATOM   4845  C  C   . GLY A 1 621  ? 3.302   63.598  13.369  1.00 30.73 ? 621  GLY A C   1 
ATOM   4846  O  O   . GLY A 1 621  ? 2.685   62.659  12.878  1.00 31.95 ? 621  GLY A O   1 
ATOM   4847  N  N   . VAL A 1 622  ? 3.770   64.595  12.631  1.00 29.95 ? 622  VAL A N   1 
ATOM   4848  C  CA  . VAL A 1 622  ? 3.555   64.591  11.195  1.00 28.81 ? 622  VAL A CA  1 
ATOM   4849  C  C   . VAL A 1 622  ? 4.755   63.963  10.500  1.00 30.14 ? 622  VAL A C   1 
ATOM   4850  O  O   . VAL A 1 622  ? 5.904   64.377  10.697  1.00 28.93 ? 622  VAL A O   1 
ATOM   4851  C  CB  . VAL A 1 622  ? 3.317   66.009  10.667  1.00 28.31 ? 622  VAL A CB  1 
ATOM   4852  C  CG1 . VAL A 1 622  ? 2.999   65.965  9.179   1.00 27.61 ? 622  VAL A CG1 1 
ATOM   4853  C  CG2 . VAL A 1 622  ? 2.173   66.644  11.426  1.00 27.62 ? 622  VAL A CG2 1 
ATOM   4854  N  N   . PRO A 1 623  ? 4.499   62.946  9.671   1.00 30.32 ? 623  PRO A N   1 
ATOM   4855  C  CA  . PRO A 1 623  ? 5.516   62.210  8.924   1.00 31.13 ? 623  PRO A CA  1 
ATOM   4856  C  C   . PRO A 1 623  ? 6.076   62.945  7.720   1.00 32.03 ? 623  PRO A C   1 
ATOM   4857  O  O   . PRO A 1 623  ? 5.459   63.880  7.205   1.00 32.56 ? 623  PRO A O   1 
ATOM   4858  C  CB  . PRO A 1 623  ? 4.767   60.963  8.492   1.00 29.14 ? 623  PRO A CB  1 
ATOM   4859  C  CG  . PRO A 1 623  ? 3.433   61.549  8.136   1.00 28.54 ? 623  PRO A CG  1 
ATOM   4860  C  CD  . PRO A 1 623  ? 3.154   62.453  9.326   1.00 29.54 ? 623  PRO A CD  1 
ATOM   4861  N  N   . ALA A 1 624  ? 7.246   62.503  7.274   1.00 31.11 ? 624  ALA A N   1 
ATOM   4862  C  CA  . ALA A 1 624  ? 7.860   63.079  6.094   1.00 31.86 ? 624  ALA A CA  1 
ATOM   4863  C  C   . ALA A 1 624  ? 7.040   62.529  4.929   1.00 32.37 ? 624  ALA A C   1 
ATOM   4864  O  O   . ALA A 1 624  ? 6.168   61.680  5.133   1.00 31.18 ? 624  ALA A O   1 
ATOM   4865  C  CB  . ALA A 1 624  ? 9.308   62.628  5.986   1.00 29.87 ? 624  ALA A CB  1 
ATOM   4866  N  N   . SER A 1 625  ? 7.284   63.027  3.722   1.00 34.19 ? 625  SER A N   1 
ATOM   4867  C  CA  . SER A 1 625  ? 6.566   62.515  2.559   1.00 35.40 ? 625  SER A CA  1 
ATOM   4868  C  C   . SER A 1 625  ? 7.218   62.904  1.244   1.00 35.76 ? 625  SER A C   1 
ATOM   4869  O  O   . SER A 1 625  ? 8.366   63.348  1.209   1.00 36.00 ? 625  SER A O   1 
ATOM   4870  C  CB  . SER A 1 625  ? 5.100   62.961  2.577   1.00 35.46 ? 625  SER A CB  1 
ATOM   4871  O  OG  . SER A 1 625  ? 4.970   64.332  2.259   1.00 39.86 ? 625  SER A OG  1 
ATOM   4872  N  N   . ILE A 1 626  ? 6.479   62.704  0.157   1.00 36.21 ? 626  ILE A N   1 
ATOM   4873  C  CA  . ILE A 1 626  ? 6.971   63.016  -1.174  1.00 36.06 ? 626  ILE A CA  1 
ATOM   4874  C  C   . ILE A 1 626  ? 5.988   63.958  -1.821  1.00 36.50 ? 626  ILE A C   1 
ATOM   4875  O  O   . ILE A 1 626  ? 4.774   63.794  -1.695  1.00 35.39 ? 626  ILE A O   1 
ATOM   4876  C  CB  . ILE A 1 626  ? 7.090   61.751  -2.059  1.00 36.33 ? 626  ILE A CB  1 
ATOM   4877  C  CG1 . ILE A 1 626  ? 7.845   60.651  -1.311  1.00 36.81 ? 626  ILE A CG1 1 
ATOM   4878  C  CG2 . ILE A 1 626  ? 7.833   62.090  -3.345  1.00 36.47 ? 626  ILE A CG2 1 
ATOM   4879  C  CD1 . ILE A 1 626  ? 9.274   61.034  -0.932  1.00 37.84 ? 626  ILE A CD1 1 
ATOM   4880  N  N   . VAL A 1 627  ? 6.524   64.939  -2.531  1.00 37.29 ? 627  VAL A N   1 
ATOM   4881  C  CA  . VAL A 1 627  ? 5.706   65.934  -3.197  1.00 38.45 ? 627  VAL A CA  1 
ATOM   4882  C  C   . VAL A 1 627  ? 6.113   66.123  -4.654  1.00 39.91 ? 627  VAL A C   1 
ATOM   4883  O  O   . VAL A 1 627  ? 7.266   65.904  -5.027  1.00 39.76 ? 627  VAL A O   1 
ATOM   4884  C  CB  . VAL A 1 627  ? 5.784   67.273  -2.415  1.00 37.97 ? 627  VAL A CB  1 
ATOM   4885  C  CG1 . VAL A 1 627  ? 5.887   68.455  -3.352  1.00 38.91 ? 627  VAL A CG1 1 
ATOM   4886  C  CG2 . VAL A 1 627  ? 4.570   67.394  -1.518  1.00 37.08 ? 627  VAL A CG2 1 
ATOM   4887  N  N   . ASN A 1 628  ? 5.140   66.504  -5.474  1.00 41.77 ? 628  ASN A N   1 
ATOM   4888  C  CA  . ASN A 1 628  ? 5.362   66.747  -6.893  1.00 44.08 ? 628  ASN A CA  1 
ATOM   4889  C  C   . ASN A 1 628  ? 6.262   67.972  -7.046  1.00 44.47 ? 628  ASN A C   1 
ATOM   4890  O  O   . ASN A 1 628  ? 6.019   69.009  -6.422  1.00 43.96 ? 628  ASN A O   1 
ATOM   4891  C  CB  . ASN A 1 628  ? 4.015   66.967  -7.579  1.00 46.37 ? 628  ASN A CB  1 
ATOM   4892  C  CG  . ASN A 1 628  ? 4.150   67.292  -9.046  1.00 49.53 ? 628  ASN A CG  1 
ATOM   4893  O  OD1 . ASN A 1 628  ? 4.061   68.454  -9.445  1.00 51.10 ? 628  ASN A OD1 1 
ATOM   4894  N  ND2 . ASN A 1 628  ? 4.370   66.266  -9.865  1.00 50.22 ? 628  ASN A ND2 1 
ATOM   4895  N  N   . ASP A 1 629  ? 7.303   67.848  -7.864  1.00 45.17 ? 629  ASP A N   1 
ATOM   4896  C  CA  . ASP A 1 629  ? 8.246   68.944  -8.046  1.00 46.73 ? 629  ASP A CA  1 
ATOM   4897  C  C   . ASP A 1 629  ? 8.356   69.476  -9.468  1.00 48.58 ? 629  ASP A C   1 
ATOM   4898  O  O   . ASP A 1 629  ? 8.880   68.805  -10.355 1.00 49.30 ? 629  ASP A O   1 
ATOM   4899  C  CB  . ASP A 1 629  ? 9.636   68.514  -7.582  1.00 45.11 ? 629  ASP A CB  1 
ATOM   4900  C  CG  . ASP A 1 629  ? 10.584  69.682  -7.424  1.00 44.38 ? 629  ASP A CG  1 
ATOM   4901  O  OD1 . ASP A 1 629  ? 10.333  70.744  -8.024  1.00 42.13 ? 629  ASP A OD1 1 
ATOM   4902  O  OD2 . ASP A 1 629  ? 11.588  69.535  -6.699  1.00 43.68 ? 629  ASP A OD2 1 
ATOM   4903  N  N   . GLU A 1 630  ? 7.877   70.696  -9.671  1.00 50.25 ? 630  GLU A N   1 
ATOM   4904  C  CA  . GLU A 1 630  ? 7.946   71.331  -10.974 1.00 52.40 ? 630  GLU A CA  1 
ATOM   4905  C  C   . GLU A 1 630  ? 8.667   72.664  -10.802 1.00 53.72 ? 630  GLU A C   1 
ATOM   4906  O  O   . GLU A 1 630  ? 8.457   73.612  -11.555 1.00 53.72 ? 630  GLU A O   1 
ATOM   4907  C  CB  . GLU A 1 630  ? 6.533   71.508  -11.533 1.00 52.62 ? 630  GLU A CB  1 
ATOM   4908  C  CG  . GLU A 1 630  ? 5.920   70.178  -11.969 1.00 54.17 ? 630  GLU A CG  1 
ATOM   4909  C  CD  . GLU A 1 630  ? 4.463   70.278  -12.375 1.00 56.21 ? 630  GLU A CD  1 
ATOM   4910  O  OE1 . GLU A 1 630  ? 3.591   70.420  -11.489 1.00 57.10 ? 630  GLU A OE1 1 
ATOM   4911  O  OE2 . GLU A 1 630  ? 4.190   70.210  -13.589 1.00 58.86 ? 630  GLU A OE2 1 
ATOM   4912  N  N   . SER A 1 631  ? 9.527   72.703  -9.790  1.00 55.80 ? 631  SER A N   1 
ATOM   4913  C  CA  . SER A 1 631  ? 10.324  73.873  -9.438  1.00 58.11 ? 631  SER A CA  1 
ATOM   4914  C  C   . SER A 1 631  ? 11.150  74.368  -10.622 1.00 59.56 ? 631  SER A C   1 
ATOM   4915  O  O   . SER A 1 631  ? 10.836  75.397  -11.229 1.00 59.31 ? 631  SER A O   1 
ATOM   4916  C  CB  . SER A 1 631  ? 11.252  73.517  -8.272  1.00 58.96 ? 631  SER A CB  1 
ATOM   4917  O  OG  . SER A 1 631  ? 12.067  74.614  -7.895  1.00 61.95 ? 631  SER A OG  1 
ATOM   4918  N  N   . VAL A 1 632  ? 12.215  73.634  -10.938 1.00 60.95 ? 632  VAL A N   1 
ATOM   4919  C  CA  . VAL A 1 632  ? 13.084  73.984  -12.056 1.00 61.51 ? 632  VAL A CA  1 
ATOM   4920  C  C   . VAL A 1 632  ? 12.299  73.751  -13.336 1.00 61.83 ? 632  VAL A C   1 
ATOM   4921  O  O   . VAL A 1 632  ? 11.628  72.732  -13.484 1.00 61.19 ? 632  VAL A O   1 
ATOM   4922  C  CB  . VAL A 1 632  ? 14.374  73.114  -12.063 1.00 61.67 ? 632  VAL A CB  1 
ATOM   4923  C  CG1 . VAL A 1 632  ? 15.259  73.488  -13.246 1.00 62.32 ? 632  VAL A CG1 1 
ATOM   4924  C  CG2 . VAL A 1 632  ? 15.136  73.309  -10.756 1.00 61.39 ? 632  VAL A CG2 1 
ATOM   4925  N  N   . VAL A 1 633  ? 12.378  74.707  -14.253 1.00 62.93 ? 633  VAL A N   1 
ATOM   4926  C  CA  . VAL A 1 633  ? 11.656  74.616  -15.517 1.00 63.97 ? 633  VAL A CA  1 
ATOM   4927  C  C   . VAL A 1 633  ? 11.941  73.298  -16.253 1.00 64.39 ? 633  VAL A C   1 
ATOM   4928  O  O   . VAL A 1 633  ? 13.077  72.819  -16.279 1.00 62.92 ? 633  VAL A O   1 
ATOM   4929  C  CB  . VAL A 1 633  ? 12.015  75.809  -16.438 1.00 64.17 ? 633  VAL A CB  1 
ATOM   4930  C  CG1 . VAL A 1 633  ? 11.170  75.766  -17.705 1.00 64.43 ? 633  VAL A CG1 1 
ATOM   4931  C  CG2 . VAL A 1 633  ? 11.806  77.117  -15.693 1.00 63.11 ? 633  VAL A CG2 1 
ATOM   4932  N  N   . GLY A 1 634  ? 10.893  72.719  -16.840 1.00 65.15 ? 634  GLY A N   1 
ATOM   4933  C  CA  . GLY A 1 634  ? 11.033  71.468  -17.566 1.00 65.72 ? 634  GLY A CA  1 
ATOM   4934  C  C   . GLY A 1 634  ? 10.979  70.243  -16.670 1.00 66.24 ? 634  GLY A C   1 
ATOM   4935  O  O   . GLY A 1 634  ? 9.959   69.555  -16.600 1.00 67.17 ? 634  GLY A O   1 
ATOM   4936  N  N   . VAL A 1 635  ? 12.087  69.974  -15.984 1.00 65.71 ? 635  VAL A N   1 
ATOM   4937  C  CA  . VAL A 1 635  ? 12.195  68.836  -15.080 1.00 65.07 ? 635  VAL A CA  1 
ATOM   4938  C  C   . VAL A 1 635  ? 10.987  68.727  -14.154 1.00 64.89 ? 635  VAL A C   1 
ATOM   4939  O  O   . VAL A 1 635  ? 10.420  69.732  -13.722 1.00 65.33 ? 635  VAL A O   1 
ATOM   4940  C  CB  . VAL A 1 635  ? 13.466  68.944  -14.202 1.00 64.84 ? 635  VAL A CB  1 
ATOM   4941  C  CG1 . VAL A 1 635  ? 13.616  67.699  -13.340 1.00 64.84 ? 635  VAL A CG1 1 
ATOM   4942  C  CG2 . VAL A 1 635  ? 14.689  69.137  -15.076 1.00 64.80 ? 635  VAL A CG2 1 
ATOM   4943  N  N   . ARG A 1 636  ? 10.593  67.497  -13.857 1.00 64.28 ? 636  ARG A N   1 
ATOM   4944  C  CA  . ARG A 1 636  ? 9.473   67.254  -12.963 1.00 63.03 ? 636  ARG A CA  1 
ATOM   4945  C  C   . ARG A 1 636  ? 9.706   65.942  -12.241 1.00 61.54 ? 636  ARG A C   1 
ATOM   4946  O  O   . ARG A 1 636  ? 9.527   64.875  -12.821 1.00 61.79 ? 636  ARG A O   1 
ATOM   4947  C  CB  . ARG A 1 636  ? 8.158   67.179  -13.731 1.00 63.85 ? 636  ARG A CB  1 
ATOM   4948  C  CG  . ARG A 1 636  ? 7.029   66.654  -12.870 1.00 66.40 ? 636  ARG A CG  1 
ATOM   4949  C  CD  . ARG A 1 636  ? 5.701   66.649  -13.591 1.00 68.07 ? 636  ARG A CD  1 
ATOM   4950  N  NE  . ARG A 1 636  ? 4.719   65.856  -12.858 1.00 70.23 ? 636  ARG A NE  1 
ATOM   4951  C  CZ  . ARG A 1 636  ? 3.422   65.832  -13.135 1.00 72.16 ? 636  ARG A CZ  1 
ATOM   4952  N  NH1 . ARG A 1 636  ? 2.942   66.561  -14.135 1.00 72.46 ? 636  ARG A NH1 1 
ATOM   4953  N  NH2 . ARG A 1 636  ? 2.604   65.082  -12.409 1.00 72.89 ? 636  ARG A NH2 1 
ATOM   4954  N  N   . ALA A 1 637  ? 10.100  66.026  -10.976 1.00 59.50 ? 637  ALA A N   1 
ATOM   4955  C  CA  . ALA A 1 637  ? 10.368  64.835  -10.190 1.00 58.58 ? 637  ALA A CA  1 
ATOM   4956  C  C   . ALA A 1 637  ? 9.580   64.804  -8.892  1.00 57.19 ? 637  ALA A C   1 
ATOM   4957  O  O   . ALA A 1 637  ? 8.832   65.724  -8.576  1.00 56.39 ? 637  ALA A O   1 
ATOM   4958  C  CB  . ALA A 1 637  ? 11.863  64.741  -9.886  1.00 58.73 ? 637  ALA A CB  1 
ATOM   4959  N  N   . ALA A 1 638  ? 9.754   63.718  -8.150  1.00 55.49 ? 638  ALA A N   1 
ATOM   4960  C  CA  . ALA A 1 638  ? 9.102   63.549  -6.867  1.00 54.04 ? 638  ALA A CA  1 
ATOM   4961  C  C   . ALA A 1 638  ? 10.155  63.975  -5.863  1.00 53.32 ? 638  ALA A C   1 
ATOM   4962  O  O   . ALA A 1 638  ? 11.269  63.452  -5.872  1.00 52.87 ? 638  ALA A O   1 
ATOM   4963  C  CB  . ALA A 1 638  ? 8.730   62.102  -6.659  1.00 54.03 ? 638  ALA A CB  1 
ATOM   4964  N  N   . ARG A 1 639  ? 9.806   64.930  -5.007  1.00 52.23 ? 639  ARG A N   1 
ATOM   4965  C  CA  . ARG A 1 639  ? 10.746  65.443  -4.020  1.00 50.73 ? 639  ARG A CA  1 
ATOM   4966  C  C   . ARG A 1 639  ? 10.440  65.073  -2.574  1.00 48.21 ? 639  ARG A C   1 
ATOM   4967  O  O   . ARG A 1 639  ? 9.332   65.287  -2.084  1.00 48.14 ? 639  ARG A O   1 
ATOM   4968  C  CB  . ARG A 1 639  ? 10.847  66.969  -4.146  1.00 51.41 ? 639  ARG A CB  1 
ATOM   4969  C  CG  . ARG A 1 639  ? 11.566  67.659  -2.981  1.00 55.49 ? 639  ARG A CG  1 
ATOM   4970  C  CD  . ARG A 1 639  ? 12.015  69.072  -3.351  1.00 58.54 ? 639  ARG A CD  1 
ATOM   4971  N  NE  . ARG A 1 639  ? 13.153  69.077  -4.270  1.00 61.82 ? 639  ARG A NE  1 
ATOM   4972  C  CZ  . ARG A 1 639  ? 13.626  70.162  -4.881  1.00 63.52 ? 639  ARG A CZ  1 
ATOM   4973  N  NH1 . ARG A 1 639  ? 13.065  71.350  -4.683  1.00 62.54 ? 639  ARG A NH1 1 
ATOM   4974  N  NH2 . ARG A 1 639  ? 14.673  70.055  -5.692  1.00 64.14 ? 639  ARG A NH2 1 
ATOM   4975  N  N   . PRO A 1 640  ? 11.422  64.483  -1.878  1.00 46.18 ? 640  PRO A N   1 
ATOM   4976  C  CA  . PRO A 1 640  ? 11.227  64.103  -0.476  1.00 44.38 ? 640  PRO A CA  1 
ATOM   4977  C  C   . PRO A 1 640  ? 11.242  65.363  0.391   1.00 42.22 ? 640  PRO A C   1 
ATOM   4978  O  O   . PRO A 1 640  ? 12.063  66.265  0.186   1.00 42.82 ? 640  PRO A O   1 
ATOM   4979  C  CB  . PRO A 1 640  ? 12.433  63.208  -0.185  1.00 43.84 ? 640  PRO A CB  1 
ATOM   4980  C  CG  . PRO A 1 640  ? 12.737  62.611  -1.518  1.00 44.70 ? 640  PRO A CG  1 
ATOM   4981  C  CD  . PRO A 1 640  ? 12.600  63.802  -2.438  1.00 45.05 ? 640  PRO A CD  1 
ATOM   4982  N  N   . ILE A 1 641  ? 10.325  65.431  1.348   1.00 39.48 ? 641  ILE A N   1 
ATOM   4983  C  CA  . ILE A 1 641  ? 10.257  66.580  2.239   1.00 36.32 ? 641  ILE A CA  1 
ATOM   4984  C  C   . ILE A 1 641  ? 10.067  66.065  3.655   1.00 35.04 ? 641  ILE A C   1 
ATOM   4985  O  O   . ILE A 1 641  ? 9.555   64.963  3.850   1.00 34.79 ? 641  ILE A O   1 
ATOM   4986  C  CB  . ILE A 1 641  ? 9.100   67.519  1.858   1.00 35.44 ? 641  ILE A CB  1 
ATOM   4987  C  CG1 . ILE A 1 641  ? 7.793   66.733  1.789   1.00 35.48 ? 641  ILE A CG1 1 
ATOM   4988  C  CG2 . ILE A 1 641  ? 9.392   68.182  0.523   1.00 33.91 ? 641  ILE A CG2 1 
ATOM   4989  C  CD1 . ILE A 1 641  ? 6.568   67.606  1.558   1.00 37.22 ? 641  ILE A CD1 1 
ATOM   4990  N  N   . SER A 1 642  ? 10.481  66.860  4.638   1.00 34.10 ? 642  SER A N   1 
ATOM   4991  C  CA  . SER A 1 642  ? 10.381  66.471  6.043   1.00 33.20 ? 642  SER A CA  1 
ATOM   4992  C  C   . SER A 1 642  ? 8.966   66.576  6.596   1.00 33.27 ? 642  SER A C   1 
ATOM   4993  O  O   . SER A 1 642  ? 8.035   67.021  5.902   1.00 31.79 ? 642  SER A O   1 
ATOM   4994  C  CB  . SER A 1 642  ? 11.297  67.351  6.889   1.00 33.95 ? 642  SER A CB  1 
ATOM   4995  O  OG  . SER A 1 642  ? 10.888  68.710  6.829   1.00 32.81 ? 642  SER A OG  1 
ATOM   4996  N  N   . GLY A 1 643  ? 8.812   66.160  7.853   1.00 31.45 ? 643  GLY A N   1 
ATOM   4997  C  CA  . GLY A 1 643  ? 7.517   66.246  8.497   1.00 30.77 ? 643  GLY A CA  1 
ATOM   4998  C  C   . GLY A 1 643  ? 7.161   67.713  8.665   1.00 29.73 ? 643  GLY A C   1 
ATOM   4999  O  O   . GLY A 1 643  ? 6.034   68.136  8.388   1.00 29.93 ? 643  GLY A O   1 
ATOM   5000  N  N   . MET A 1 644  ? 8.134   68.493  9.119   1.00 28.41 ? 644  MET A N   1 
ATOM   5001  C  CA  . MET A 1 644  ? 7.938   69.918  9.317   1.00 28.56 ? 644  MET A CA  1 
ATOM   5002  C  C   . MET A 1 644  ? 7.454   70.541  8.004   1.00 28.22 ? 644  MET A C   1 
ATOM   5003  O  O   . MET A 1 644  ? 6.528   71.347  7.997   1.00 28.31 ? 644  MET A O   1 
ATOM   5004  C  CB  . MET A 1 644  ? 9.248   70.563  9.791   1.00 26.78 ? 644  MET A CB  1 
ATOM   5005  C  CG  . MET A 1 644  ? 9.128   72.035  10.084  1.00 25.84 ? 644  MET A CG  1 
ATOM   5006  S  SD  . MET A 1 644  ? 10.470  72.687  11.073  1.00 31.97 ? 644  MET A SD  1 
ATOM   5007  C  CE  . MET A 1 644  ? 10.176  71.908  12.626  1.00 27.92 ? 644  MET A CE  1 
ATOM   5008  N  N   . GLN A 1 645  ? 8.073   70.145  6.895   1.00 29.03 ? 645  GLN A N   1 
ATOM   5009  C  CA  . GLN A 1 645  ? 7.702   70.650  5.570   1.00 29.84 ? 645  GLN A CA  1 
ATOM   5010  C  C   . GLN A 1 645  ? 6.323   70.143  5.190   1.00 29.82 ? 645  GLN A C   1 
ATOM   5011  O  O   . GLN A 1 645  ? 5.512   70.867  4.596   1.00 30.22 ? 645  GLN A O   1 
ATOM   5012  C  CB  . GLN A 1 645  ? 8.726   70.205  4.516   1.00 30.20 ? 645  GLN A CB  1 
ATOM   5013  C  CG  . GLN A 1 645  ? 10.099  70.860  4.690   1.00 32.06 ? 645  GLN A CG  1 
ATOM   5014  C  CD  . GLN A 1 645  ? 11.112  70.433  3.635   1.00 32.91 ? 645  GLN A CD  1 
ATOM   5015  O  OE1 . GLN A 1 645  ? 11.399  69.242  3.471   1.00 32.39 ? 645  GLN A OE1 1 
ATOM   5016  N  NE2 . GLN A 1 645  ? 11.672  71.411  2.924   1.00 32.42 ? 645  GLN A NE2 1 
ATOM   5017  N  N   . ASN A 1 646  ? 6.052   68.892  5.541   1.00 30.26 ? 646  ASN A N   1 
ATOM   5018  C  CA  . ASN A 1 646  ? 4.755   68.297  5.230   1.00 29.11 ? 646  ASN A CA  1 
ATOM   5019  C  C   . ASN A 1 646  ? 3.655   69.121  5.886   1.00 28.83 ? 646  ASN A C   1 
ATOM   5020  O  O   . ASN A 1 646  ? 2.566   69.269  5.318   1.00 28.11 ? 646  ASN A O   1 
ATOM   5021  C  CB  . ASN A 1 646  ? 4.694   66.832  5.705   1.00 29.66 ? 646  ASN A CB  1 
ATOM   5022  C  CG  . ASN A 1 646  ? 3.542   66.055  5.075   1.00 28.51 ? 646  ASN A CG  1 
ATOM   5023  O  OD1 . ASN A 1 646  ? 2.879   66.535  4.153   1.00 31.39 ? 646  ASN A OD1 1 
ATOM   5024  N  ND2 . ASN A 1 646  ? 3.304   64.847  5.569   1.00 27.99 ? 646  ASN A ND2 1 
ATOM   5025  N  N   . MET A 1 647  ? 3.934   69.666  7.075   1.00 27.55 ? 647  MET A N   1 
ATOM   5026  C  CA  . MET A 1 647  ? 2.940   70.488  7.768   1.00 26.31 ? 647  MET A CA  1 
ATOM   5027  C  C   . MET A 1 647  ? 2.660   71.737  6.937   1.00 26.96 ? 647  MET A C   1 
ATOM   5028  O  O   . MET A 1 647  ? 1.501   72.045  6.635   1.00 26.23 ? 647  MET A O   1 
ATOM   5029  C  CB  . MET A 1 647  ? 3.431   70.933  9.139   1.00 25.83 ? 647  MET A CB  1 
ATOM   5030  C  CG  . MET A 1 647  ? 3.602   69.853  10.181  1.00 27.59 ? 647  MET A CG  1 
ATOM   5031  S  SD  . MET A 1 647  ? 4.361   70.625  11.633  1.00 28.57 ? 647  MET A SD  1 
ATOM   5032  C  CE  . MET A 1 647  ? 3.440   69.933  12.996  1.00 30.37 ? 647  MET A CE  1 
ATOM   5033  N  N   . ILE A 1 648  ? 3.722   72.454  6.575   1.00 26.95 ? 648  ILE A N   1 
ATOM   5034  C  CA  . ILE A 1 648  ? 3.586   73.672  5.783   1.00 28.24 ? 648  ILE A CA  1 
ATOM   5035  C  C   . ILE A 1 648  ? 2.868   73.347  4.481   1.00 30.58 ? 648  ILE A C   1 
ATOM   5036  O  O   . ILE A 1 648  ? 2.064   74.140  3.975   1.00 30.07 ? 648  ILE A O   1 
ATOM   5037  C  CB  . ILE A 1 648  ? 4.967   74.295  5.465   1.00 27.56 ? 648  ILE A CB  1 
ATOM   5038  C  CG1 . ILE A 1 648  ? 5.557   74.924  6.727   1.00 27.24 ? 648  ILE A CG1 1 
ATOM   5039  C  CG2 . ILE A 1 648  ? 4.839   75.359  4.380   1.00 26.18 ? 648  ILE A CG2 1 
ATOM   5040  C  CD1 . ILE A 1 648  ? 4.746   76.103  7.257   1.00 26.33 ? 648  ILE A CD1 1 
ATOM   5041  N  N   . GLN A 1 649  ? 3.154   72.159  3.958   1.00 32.57 ? 649  GLN A N   1 
ATOM   5042  C  CA  . GLN A 1 649  ? 2.555   71.690  2.719   1.00 33.18 ? 649  GLN A CA  1 
ATOM   5043  C  C   . GLN A 1 649  ? 1.021   71.590  2.862   1.00 32.56 ? 649  GLN A C   1 
ATOM   5044  O  O   . GLN A 1 649  ? 0.279   72.009  1.979   1.00 33.82 ? 649  GLN A O   1 
ATOM   5045  C  CB  . GLN A 1 649  ? 3.179   70.340  2.349   1.00 35.13 ? 649  GLN A CB  1 
ATOM   5046  C  CG  . GLN A 1 649  ? 2.973   69.915  0.907   1.00 36.36 ? 649  GLN A CG  1 
ATOM   5047  C  CD  . GLN A 1 649  ? 3.660   70.823  -0.104  1.00 36.23 ? 649  GLN A CD  1 
ATOM   5048  O  OE1 . GLN A 1 649  ? 3.042   71.227  -1.075  1.00 36.76 ? 649  GLN A OE1 1 
ATOM   5049  N  NE2 . GLN A 1 649  ? 4.938   71.128  0.107   1.00 35.68 ? 649  GLN A NE2 1 
ATOM   5050  N  N   . HIS A 1 650  ? 0.545   71.063  3.983   1.00 32.35 ? 650  HIS A N   1 
ATOM   5051  C  CA  . HIS A 1 650  ? -0.900  70.952  4.213   1.00 31.13 ? 650  HIS A CA  1 
ATOM   5052  C  C   . HIS A 1 650  ? -1.543  72.269  4.646   1.00 30.04 ? 650  HIS A C   1 
ATOM   5053  O  O   . HIS A 1 650  ? -2.715  72.517  4.368   1.00 30.48 ? 650  HIS A O   1 
ATOM   5054  C  CB  . HIS A 1 650  ? -1.203  69.895  5.280   1.00 32.39 ? 650  HIS A CB  1 
ATOM   5055  C  CG  . HIS A 1 650  ? -1.256  68.503  4.750   1.00 34.79 ? 650  HIS A CG  1 
ATOM   5056  N  ND1 . HIS A 1 650  ? -0.122  67.755  4.490   1.00 35.41 ? 650  HIS A ND1 1 
ATOM   5057  C  CD2 . HIS A 1 650  ? -2.309  67.722  4.406   1.00 34.41 ? 650  HIS A CD2 1 
ATOM   5058  C  CE1 . HIS A 1 650  ? -0.479  66.578  4.011   1.00 36.31 ? 650  HIS A CE1 1 
ATOM   5059  N  NE2 . HIS A 1 650  ? -1.800  66.531  3.949   1.00 35.39 ? 650  HIS A NE2 1 
ATOM   5060  N  N   . LEU A 1 651  ? -0.777  73.094  5.350   1.00 29.47 ? 651  LEU A N   1 
ATOM   5061  C  CA  . LEU A 1 651  ? -1.257  74.384  5.831   1.00 28.43 ? 651  LEU A CA  1 
ATOM   5062  C  C   . LEU A 1 651  ? -1.529  75.331  4.663   1.00 28.35 ? 651  LEU A C   1 
ATOM   5063  O  O   . LEU A 1 651  ? -2.517  76.068  4.666   1.00 28.15 ? 651  LEU A O   1 
ATOM   5064  C  CB  . LEU A 1 651  ? -0.209  75.006  6.758   1.00 27.80 ? 651  LEU A CB  1 
ATOM   5065  C  CG  . LEU A 1 651  ? -0.542  76.314  7.479   1.00 26.87 ? 651  LEU A CG  1 
ATOM   5066  C  CD1 . LEU A 1 651  ? -1.746  76.124  8.402   1.00 27.52 ? 651  LEU A CD1 1 
ATOM   5067  C  CD2 . LEU A 1 651  ? 0.655   76.745  8.289   1.00 26.07 ? 651  LEU A CD2 1 
ATOM   5068  N  N   . SER A 1 652  ? -0.636  75.302  3.674   1.00 27.15 ? 652  SER A N   1 
ATOM   5069  C  CA  . SER A 1 652  ? -0.730  76.146  2.482   1.00 26.06 ? 652  SER A CA  1 
ATOM   5070  C  C   . SER A 1 652  ? -2.022  75.910  1.727   1.00 26.48 ? 652  SER A C   1 
ATOM   5071  O  O   . SER A 1 652  ? -2.603  76.843  1.163   1.00 25.86 ? 652  SER A O   1 
ATOM   5072  C  CB  . SER A 1 652  ? 0.452   75.881  1.542   1.00 25.84 ? 652  SER A CB  1 
ATOM   5073  O  OG  . SER A 1 652  ? 1.699   76.192  2.158   1.00 24.61 ? 652  SER A OG  1 
ATOM   5074  N  N   . LYS A 1 653  ? -2.468  74.659  1.719   1.00 26.90 ? 653  LYS A N   1 
ATOM   5075  C  CA  . LYS A 1 653  ? -3.695  74.305  1.023   1.00 27.61 ? 653  LYS A CA  1 
ATOM   5076  C  C   . LYS A 1 653  ? -4.862  75.065  1.640   1.00 27.87 ? 653  LYS A C   1 
ATOM   5077  O  O   . LYS A 1 653  ? -5.680  75.648  0.934   1.00 28.61 ? 653  LYS A O   1 
ATOM   5078  C  CB  . LYS A 1 653  ? -3.931  72.786  1.088   1.00 29.75 ? 653  LYS A CB  1 
ATOM   5079  C  CG  . LYS A 1 653  ? -5.052  72.298  0.185   1.00 32.10 ? 653  LYS A CG  1 
ATOM   5080  C  CD  . LYS A 1 653  ? -5.045  70.783  0.027   1.00 34.50 ? 653  LYS A CD  1 
ATOM   5081  C  CE  . LYS A 1 653  ? -6.094  70.339  -1.000  1.00 37.62 ? 653  LYS A CE  1 
ATOM   5082  N  NZ  . LYS A 1 653  ? -5.630  69.236  -1.906  1.00 41.00 ? 653  LYS A NZ  1 
ATOM   5083  N  N   . LEU A 1 654  ? -4.928  75.064  2.967   1.00 28.11 ? 654  LEU A N   1 
ATOM   5084  C  CA  . LEU A 1 654  ? -5.985  75.774  3.670   1.00 28.40 ? 654  LEU A CA  1 
ATOM   5085  C  C   . LEU A 1 654  ? -5.849  77.278  3.436   1.00 29.21 ? 654  LEU A C   1 
ATOM   5086  O  O   . LEU A 1 654  ? -6.810  77.951  3.047   1.00 27.79 ? 654  LEU A O   1 
ATOM   5087  C  CB  . LEU A 1 654  ? -5.923  75.486  5.183   1.00 26.71 ? 654  LEU A CB  1 
ATOM   5088  C  CG  . LEU A 1 654  ? -6.818  76.357  6.091   1.00 26.16 ? 654  LEU A CG  1 
ATOM   5089  C  CD1 . LEU A 1 654  ? -8.289  76.146  5.740   1.00 21.97 ? 654  LEU A CD1 1 
ATOM   5090  C  CD2 . LEU A 1 654  ? -6.570  76.018  7.564   1.00 24.36 ? 654  LEU A CD2 1 
ATOM   5091  N  N   . TYR A 1 655  ? -4.654  77.805  3.690   1.00 30.92 ? 655  TYR A N   1 
ATOM   5092  C  CA  . TYR A 1 655  ? -4.414  79.236  3.521   1.00 31.77 ? 655  TYR A CA  1 
ATOM   5093  C  C   . TYR A 1 655  ? -4.776  79.682  2.121   1.00 32.51 ? 655  TYR A C   1 
ATOM   5094  O  O   . TYR A 1 655  ? -5.398  80.723  1.931   1.00 32.80 ? 655  TYR A O   1 
ATOM   5095  C  CB  . TYR A 1 655  ? -2.950  79.584  3.789   1.00 30.18 ? 655  TYR A CB  1 
ATOM   5096  C  CG  . TYR A 1 655  ? -2.560  79.645  5.255   1.00 30.12 ? 655  TYR A CG  1 
ATOM   5097  C  CD1 . TYR A 1 655  ? -3.515  79.497  6.274   1.00 29.12 ? 655  TYR A CD1 1 
ATOM   5098  C  CD2 . TYR A 1 655  ? -1.227  79.864  5.623   1.00 29.47 ? 655  TYR A CD2 1 
ATOM   5099  C  CE1 . TYR A 1 655  ? -3.141  79.559  7.624   1.00 28.13 ? 655  TYR A CE1 1 
ATOM   5100  C  CE2 . TYR A 1 655  ? -0.847  79.934  6.966   1.00 28.87 ? 655  TYR A CE2 1 
ATOM   5101  C  CZ  . TYR A 1 655  ? -1.803  79.782  7.960   1.00 28.14 ? 655  TYR A CZ  1 
ATOM   5102  O  OH  . TYR A 1 655  ? -1.411  79.858  9.279   1.00 28.94 ? 655  TYR A OH  1 
ATOM   5103  N  N   . LYS A 1 656  ? -4.386  78.873  1.143   1.00 33.91 ? 656  LYS A N   1 
ATOM   5104  C  CA  . LYS A 1 656  ? -4.644  79.177  -0.251  1.00 35.17 ? 656  LYS A CA  1 
ATOM   5105  C  C   . LYS A 1 656  ? -6.135  79.124  -0.611  1.00 36.34 ? 656  LYS A C   1 
ATOM   5106  O  O   . LYS A 1 656  ? -6.646  80.010  -1.286  1.00 35.97 ? 656  LYS A O   1 
ATOM   5107  C  CB  . LYS A 1 656  ? -3.846  78.207  -1.122  1.00 35.21 ? 656  LYS A CB  1 
ATOM   5108  C  CG  . LYS A 1 656  ? -3.811  78.561  -2.592  1.00 35.41 ? 656  LYS A CG  1 
ATOM   5109  C  CD  . LYS A 1 656  ? -2.651  77.864  -3.307  1.00 35.22 ? 656  LYS A CD  1 
ATOM   5110  C  CE  . LYS A 1 656  ? -2.707  76.350  -3.185  1.00 35.12 ? 656  LYS A CE  1 
ATOM   5111  N  NZ  . LYS A 1 656  ? -1.609  75.719  -3.963  1.00 32.59 ? 656  LYS A NZ  1 
ATOM   5112  N  N   . ARG A 1 657  ? -6.827  78.092  -0.131  1.00 37.91 ? 657  ARG A N   1 
ATOM   5113  C  CA  . ARG A 1 657  ? -8.236  77.906  -0.424  1.00 38.94 ? 657  ARG A CA  1 
ATOM   5114  C  C   . ARG A 1 657  ? -9.100  78.979  0.223   1.00 39.13 ? 657  ARG A C   1 
ATOM   5115  O  O   . ARG A 1 657  ? -10.078 79.448  -0.361  1.00 39.30 ? 657  ARG A O   1 
ATOM   5116  C  CB  . ARG A 1 657  ? -8.695  76.514  0.054   1.00 40.98 ? 657  ARG A CB  1 
ATOM   5117  C  CG  . ARG A 1 657  ? -10.151 76.207  -0.262  1.00 46.54 ? 657  ARG A CG  1 
ATOM   5118  C  CD  . ARG A 1 657  ? -10.795 75.402  0.852   1.00 51.46 ? 657  ARG A CD  1 
ATOM   5119  N  NE  . ARG A 1 657  ? -11.267 74.102  0.382   1.00 55.90 ? 657  ARG A NE  1 
ATOM   5120  C  CZ  . ARG A 1 657  ? -11.840 73.190  1.165   1.00 57.74 ? 657  ARG A CZ  1 
ATOM   5121  N  NH1 . ARG A 1 657  ? -12.015 73.438  2.458   1.00 57.42 ? 657  ARG A NH1 1 
ATOM   5122  N  NH2 . ARG A 1 657  ? -12.241 72.029  0.651   1.00 57.84 ? 657  ARG A NH2 1 
ATOM   5123  N  N   . GLY A 1 658  ? -8.734  79.364  1.438   1.00 38.86 ? 658  GLY A N   1 
ATOM   5124  C  CA  . GLY A 1 658  ? -9.512  80.355  2.151   1.00 37.88 ? 658  GLY A CA  1 
ATOM   5125  C  C   . GLY A 1 658  ? -10.195 79.615  3.279   1.00 38.03 ? 658  GLY A C   1 
ATOM   5126  O  O   . GLY A 1 658  ? -10.100 78.392  3.375   1.00 37.74 ? 658  GLY A O   1 
ATOM   5127  N  N   . PHE A 1 659  ? -10.900 80.336  4.131   1.00 36.90 ? 659  PHE A N   1 
ATOM   5128  C  CA  . PHE A 1 659  ? -11.559 79.702  5.252   1.00 37.01 ? 659  PHE A CA  1 
ATOM   5129  C  C   . PHE A 1 659  ? -13.065 79.681  5.119   1.00 37.68 ? 659  PHE A C   1 
ATOM   5130  O  O   . PHE A 1 659  ? -13.650 80.563  4.495   1.00 38.48 ? 659  PHE A O   1 
ATOM   5131  C  CB  . PHE A 1 659  ? -11.140 80.419  6.531   1.00 35.37 ? 659  PHE A CB  1 
ATOM   5132  C  CG  . PHE A 1 659  ? -9.662  80.401  6.750   1.00 35.28 ? 659  PHE A CG  1 
ATOM   5133  C  CD1 . PHE A 1 659  ? -9.046  79.282  7.301   1.00 34.17 ? 659  PHE A CD1 1 
ATOM   5134  C  CD2 . PHE A 1 659  ? -8.873  81.470  6.339   1.00 34.63 ? 659  PHE A CD2 1 
ATOM   5135  C  CE1 . PHE A 1 659  ? -7.682  79.226  7.440   1.00 32.06 ? 659  PHE A CE1 1 
ATOM   5136  C  CE2 . PHE A 1 659  ? -7.501  81.422  6.474   1.00 34.29 ? 659  PHE A CE2 1 
ATOM   5137  C  CZ  . PHE A 1 659  ? -6.904  80.291  7.026   1.00 34.04 ? 659  PHE A CZ  1 
ATOM   5138  N  N   . SER A 1 660  ? -13.684 78.658  5.700   1.00 37.70 ? 660  SER A N   1 
ATOM   5139  C  CA  . SER A 1 660  ? -15.132 78.521  5.672   1.00 38.86 ? 660  SER A CA  1 
ATOM   5140  C  C   . SER A 1 660  ? -15.679 78.650  7.076   1.00 39.64 ? 660  SER A C   1 
ATOM   5141  O  O   . SER A 1 660  ? -15.496 77.763  7.920   1.00 38.75 ? 660  SER A O   1 
ATOM   5142  C  CB  . SER A 1 660  ? -15.534 77.177  5.082   1.00 39.84 ? 660  SER A CB  1 
ATOM   5143  O  OG  . SER A 1 660  ? -15.303 77.171  3.686   1.00 42.70 ? 660  SER A OG  1 
ATOM   5144  N  N   . TYR A 1 661  ? -16.346 79.772  7.314   1.00 40.19 ? 661  TYR A N   1 
ATOM   5145  C  CA  . TYR A 1 661  ? -16.913 80.057  8.613   1.00 40.79 ? 661  TYR A CA  1 
ATOM   5146  C  C   . TYR A 1 661  ? -18.381 79.709  8.695   1.00 40.35 ? 661  TYR A C   1 
ATOM   5147  O  O   . TYR A 1 661  ? -19.200 80.241  7.949   1.00 39.70 ? 661  TYR A O   1 
ATOM   5148  C  CB  . TYR A 1 661  ? -16.692 81.526  8.958   1.00 43.64 ? 661  TYR A CB  1 
ATOM   5149  C  CG  . TYR A 1 661  ? -15.226 81.871  9.043   1.00 47.92 ? 661  TYR A CG  1 
ATOM   5150  C  CD1 . TYR A 1 661  ? -14.338 81.036  9.731   1.00 50.00 ? 661  TYR A CD1 1 
ATOM   5151  C  CD2 . TYR A 1 661  ? -14.716 83.032  8.461   1.00 49.71 ? 661  TYR A CD2 1 
ATOM   5152  C  CE1 . TYR A 1 661  ? -12.980 81.347  9.843   1.00 50.42 ? 661  TYR A CE1 1 
ATOM   5153  C  CE2 . TYR A 1 661  ? -13.352 83.351  8.566   1.00 51.60 ? 661  TYR A CE2 1 
ATOM   5154  C  CZ  . TYR A 1 661  ? -12.497 82.502  9.260   1.00 51.02 ? 661  TYR A CZ  1 
ATOM   5155  O  OH  . TYR A 1 661  ? -11.162 82.801  9.367   1.00 50.80 ? 661  TYR A OH  1 
ATOM   5156  N  N   . ARG A 1 662  ? -18.698 78.789  9.600   1.00 39.59 ? 662  ARG A N   1 
ATOM   5157  C  CA  . ARG A 1 662  ? -20.070 78.367  9.826   1.00 39.29 ? 662  ARG A CA  1 
ATOM   5158  C  C   . ARG A 1 662  ? -20.692 79.365  10.794  1.00 38.75 ? 662  ARG A C   1 
ATOM   5159  O  O   . ARG A 1 662  ? -20.230 79.536  11.917  1.00 38.20 ? 662  ARG A O   1 
ATOM   5160  C  CB  . ARG A 1 662  ? -20.124 76.968  10.438  1.00 41.06 ? 662  ARG A CB  1 
ATOM   5161  C  CG  . ARG A 1 662  ? -19.792 75.846  9.487   1.00 44.17 ? 662  ARG A CG  1 
ATOM   5162  C  CD  . ARG A 1 662  ? -20.114 74.498  10.115  1.00 44.86 ? 662  ARG A CD  1 
ATOM   5163  N  NE  . ARG A 1 662  ? -19.768 73.397  9.224   1.00 46.30 ? 662  ARG A NE  1 
ATOM   5164  C  CZ  . ARG A 1 662  ? -19.967 72.116  9.512   1.00 49.22 ? 662  ARG A CZ  1 
ATOM   5165  N  NH1 . ARG A 1 662  ? -20.515 71.774  10.676  1.00 48.58 ? 662  ARG A NH1 1 
ATOM   5166  N  NH2 . ARG A 1 662  ? -19.618 71.177  8.639   1.00 49.49 ? 662  ARG A NH2 1 
ATOM   5167  N  N   . VAL A 1 663  ? -21.752 80.018  10.345  1.00 38.02 ? 663  VAL A N   1 
ATOM   5168  C  CA  . VAL A 1 663  ? -22.434 81.012  11.148  1.00 37.24 ? 663  VAL A CA  1 
ATOM   5169  C  C   . VAL A 1 663  ? -23.822 80.555  11.563  1.00 37.27 ? 663  VAL A C   1 
ATOM   5170  O  O   . VAL A 1 663  ? -24.699 80.409  10.728  1.00 36.98 ? 663  VAL A O   1 
ATOM   5171  C  CB  . VAL A 1 663  ? -22.567 82.324  10.364  1.00 36.22 ? 663  VAL A CB  1 
ATOM   5172  C  CG1 . VAL A 1 663  ? -23.325 83.345  11.178  1.00 34.42 ? 663  VAL A CG1 1 
ATOM   5173  C  CG2 . VAL A 1 663  ? -21.183 82.843  9.999   1.00 35.05 ? 663  VAL A CG2 1 
ATOM   5174  N  N   . ASN A 1 664  ? -24.018 80.327  12.859  1.00 37.99 ? 664  ASN A N   1 
ATOM   5175  C  CA  . ASN A 1 664  ? -25.324 79.917  13.395  1.00 37.49 ? 664  ASN A CA  1 
ATOM   5176  C  C   . ASN A 1 664  ? -25.912 81.043  14.238  1.00 36.04 ? 664  ASN A C   1 
ATOM   5177  O  O   . ASN A 1 664  ? -25.880 80.989  15.471  1.00 35.15 ? 664  ASN A O   1 
ATOM   5178  C  CB  . ASN A 1 664  ? -25.184 78.664  14.262  1.00 40.84 ? 664  ASN A CB  1 
ATOM   5179  C  CG  . ASN A 1 664  ? -25.270 77.390  13.451  1.00 43.78 ? 664  ASN A CG  1 
ATOM   5180  O  OD1 . ASN A 1 664  ? -26.329 77.060  12.913  1.00 44.39 ? 664  ASN A OD1 1 
ATOM   5181  N  ND2 . ASN A 1 664  ? -24.154 76.666  13.350  1.00 44.36 ? 664  ASN A ND2 1 
ATOM   5182  N  N   . ASP A 1 665  ? -26.451 82.059  13.568  1.00 33.86 ? 665  ASP A N   1 
ATOM   5183  C  CA  . ASP A 1 665  ? -27.009 83.214  14.260  1.00 31.71 ? 665  ASP A CA  1 
ATOM   5184  C  C   . ASP A 1 665  ? -28.173 82.835  15.183  1.00 31.70 ? 665  ASP A C   1 
ATOM   5185  O  O   . ASP A 1 665  ? -29.305 82.655  14.750  1.00 31.54 ? 665  ASP A O   1 
ATOM   5186  C  CB  . ASP A 1 665  ? -27.446 84.273  13.247  1.00 29.36 ? 665  ASP A CB  1 
ATOM   5187  C  CG  . ASP A 1 665  ? -27.579 85.632  13.866  1.00 28.16 ? 665  ASP A CG  1 
ATOM   5188  O  OD1 . ASP A 1 665  ? -27.950 85.697  15.054  1.00 27.75 ? 665  ASP A OD1 1 
ATOM   5189  O  OD2 . ASP A 1 665  ? -27.329 86.636  13.175  1.00 28.96 ? 665  ASP A OD2 1 
ATOM   5190  N  N   . SER A 1 666  ? -27.873 82.736  16.469  1.00 31.37 ? 666  SER A N   1 
ATOM   5191  C  CA  . SER A 1 666  ? -28.845 82.370  17.473  1.00 32.40 ? 666  SER A CA  1 
ATOM   5192  C  C   . SER A 1 666  ? -29.898 83.459  17.678  1.00 32.27 ? 666  SER A C   1 
ATOM   5193  O  O   . SER A 1 666  ? -31.028 83.180  18.064  1.00 33.15 ? 666  SER A O   1 
ATOM   5194  C  CB  . SER A 1 666  ? -28.113 82.095  18.789  1.00 32.13 ? 666  SER A CB  1 
ATOM   5195  O  OG  . SER A 1 666  ? -28.938 81.388  19.685  1.00 36.04 ? 666  SER A OG  1 
ATOM   5196  N  N   . PHE A 1 667  ? -29.524 84.705  17.426  1.00 32.06 ? 667  PHE A N   1 
ATOM   5197  C  CA  . PHE A 1 667  ? -30.455 85.806  17.616  1.00 31.30 ? 667  PHE A CA  1 
ATOM   5198  C  C   . PHE A 1 667  ? -31.331 86.074  16.390  1.00 31.27 ? 667  PHE A C   1 
ATOM   5199  O  O   . PHE A 1 667  ? -32.298 86.826  16.478  1.00 30.66 ? 667  PHE A O   1 
ATOM   5200  C  CB  . PHE A 1 667  ? -29.677 87.075  17.978  1.00 30.79 ? 667  PHE A CB  1 
ATOM   5201  C  CG  . PHE A 1 667  ? -28.822 86.935  19.206  1.00 30.26 ? 667  PHE A CG  1 
ATOM   5202  C  CD1 . PHE A 1 667  ? -29.342 87.198  20.472  1.00 28.82 ? 667  PHE A CD1 1 
ATOM   5203  C  CD2 . PHE A 1 667  ? -27.502 86.506  19.101  1.00 30.33 ? 667  PHE A CD2 1 
ATOM   5204  C  CE1 . PHE A 1 667  ? -28.556 87.035  21.620  1.00 29.17 ? 667  PHE A CE1 1 
ATOM   5205  C  CE2 . PHE A 1 667  ? -26.709 86.340  20.244  1.00 30.95 ? 667  PHE A CE2 1 
ATOM   5206  C  CZ  . PHE A 1 667  ? -27.241 86.605  21.509  1.00 29.83 ? 667  PHE A CZ  1 
ATOM   5207  N  N   . SER A 1 668  ? -31.003 85.456  15.259  1.00 30.49 ? 668  SER A N   1 
ATOM   5208  C  CA  . SER A 1 668  ? -31.755 85.683  14.029  1.00 30.84 ? 668  SER A CA  1 
ATOM   5209  C  C   . SER A 1 668  ? -32.290 84.377  13.458  1.00 31.47 ? 668  SER A C   1 
ATOM   5210  O  O   . SER A 1 668  ? -31.577 83.665  12.768  1.00 32.54 ? 668  SER A O   1 
ATOM   5211  C  CB  . SER A 1 668  ? -30.862 86.366  12.989  1.00 30.87 ? 668  SER A CB  1 
ATOM   5212  O  OG  . SER A 1 668  ? -30.466 87.661  13.404  1.00 29.20 ? 668  SER A OG  1 
ATOM   5213  N  N   . PRO A 1 669  ? -33.568 84.062  13.720  1.00 32.11 ? 669  PRO A N   1 
ATOM   5214  C  CA  . PRO A 1 669  ? -34.197 82.833  13.234  1.00 32.23 ? 669  PRO A CA  1 
ATOM   5215  C  C   . PRO A 1 669  ? -34.049 82.673  11.735  1.00 32.34 ? 669  PRO A C   1 
ATOM   5216  O  O   . PRO A 1 669  ? -34.450 83.554  10.973  1.00 32.03 ? 669  PRO A O   1 
ATOM   5217  C  CB  . PRO A 1 669  ? -35.663 83.008  13.632  1.00 31.55 ? 669  PRO A CB  1 
ATOM   5218  C  CG  . PRO A 1 669  ? -35.619 83.998  14.765  1.00 31.38 ? 669  PRO A CG  1 
ATOM   5219  C  CD  . PRO A 1 669  ? -34.574 84.960  14.318  1.00 31.70 ? 669  PRO A CD  1 
ATOM   5220  N  N   . GLY A 1 670  ? -33.479 81.552  11.311  1.00 32.17 ? 670  GLY A N   1 
ATOM   5221  C  CA  . GLY A 1 670  ? -33.311 81.318  9.888   1.00 33.26 ? 670  GLY A CA  1 
ATOM   5222  C  C   . GLY A 1 670  ? -31.954 81.712  9.345   1.00 33.94 ? 670  GLY A C   1 
ATOM   5223  O  O   . GLY A 1 670  ? -31.671 81.499  8.177   1.00 34.40 ? 670  GLY A O   1 
ATOM   5224  N  N   . ASN A 1 671  ? -31.110 82.295  10.185  1.00 35.14 ? 671  ASN A N   1 
ATOM   5225  C  CA  . ASN A 1 671  ? -29.776 82.695  9.750   1.00 35.94 ? 671  ASN A CA  1 
ATOM   5226  C  C   . ASN A 1 671  ? -28.720 81.637  10.087  1.00 37.02 ? 671  ASN A C   1 
ATOM   5227  O  O   . ASN A 1 671  ? -28.052 81.699  11.123  1.00 36.81 ? 671  ASN A O   1 
ATOM   5228  C  CB  . ASN A 1 671  ? -29.388 84.048  10.360  1.00 32.82 ? 671  ASN A CB  1 
ATOM   5229  C  CG  . ASN A 1 671  ? -30.157 85.204  9.754   1.00 32.15 ? 671  ASN A CG  1 
ATOM   5230  O  OD1 . ASN A 1 671  ? -29.699 86.341  9.775   1.00 31.85 ? 671  ASN A OD1 1 
ATOM   5231  N  ND2 . ASN A 1 671  ? -31.337 84.923  9.222   1.00 29.04 ? 671  ASN A ND2 1 
ATOM   5232  N  N   . ASP A 1 672  ? -28.596 80.655  9.202   1.00 37.52 ? 672  ASP A N   1 
ATOM   5233  C  CA  . ASP A 1 672  ? -27.618 79.581  9.353   1.00 39.29 ? 672  ASP A CA  1 
ATOM   5234  C  C   . ASP A 1 672  ? -26.920 79.503  8.007   1.00 37.76 ? 672  ASP A C   1 
ATOM   5235  O  O   . ASP A 1 672  ? -27.573 79.319  6.979   1.00 37.85 ? 672  ASP A O   1 
ATOM   5236  C  CB  . ASP A 1 672  ? -28.314 78.249  9.654   1.00 42.57 ? 672  ASP A CB  1 
ATOM   5237  C  CG  . ASP A 1 672  ? -28.994 78.243  11.011  1.00 46.68 ? 672  ASP A CG  1 
ATOM   5238  O  OD1 . ASP A 1 672  ? -28.279 78.350  12.038  1.00 47.69 ? 672  ASP A OD1 1 
ATOM   5239  O  OD2 . ASP A 1 672  ? -30.245 78.141  11.048  1.00 48.96 ? 672  ASP A OD2 1 
ATOM   5240  N  N   . PHE A 1 673  ? -25.605 79.661  7.991   1.00 35.38 ? 673  PHE A N   1 
ATOM   5241  C  CA  . PHE A 1 673  ? -24.905 79.619  6.720   1.00 34.04 ? 673  PHE A CA  1 
ATOM   5242  C  C   . PHE A 1 673  ? -23.405 79.513  6.865   1.00 34.46 ? 673  PHE A C   1 
ATOM   5243  O  O   . PHE A 1 673  ? -22.846 79.814  7.924   1.00 32.60 ? 673  PHE A O   1 
ATOM   5244  C  CB  . PHE A 1 673  ? -25.253 80.867  5.897   1.00 31.88 ? 673  PHE A CB  1 
ATOM   5245  C  CG  . PHE A 1 673  ? -24.875 82.163  6.561   1.00 30.12 ? 673  PHE A CG  1 
ATOM   5246  C  CD1 . PHE A 1 673  ? -23.662 82.777  6.275   1.00 29.76 ? 673  PHE A CD1 1 
ATOM   5247  C  CD2 . PHE A 1 673  ? -25.715 82.757  7.502   1.00 29.19 ? 673  PHE A CD2 1 
ATOM   5248  C  CE1 . PHE A 1 673  ? -23.288 83.962  6.915   1.00 29.24 ? 673  PHE A CE1 1 
ATOM   5249  C  CE2 . PHE A 1 673  ? -25.345 83.943  8.147   1.00 29.83 ? 673  PHE A CE2 1 
ATOM   5250  C  CZ  . PHE A 1 673  ? -24.128 84.544  7.852   1.00 28.34 ? 673  PHE A CZ  1 
ATOM   5251  N  N   . THR A 1 674  ? -22.760 79.054  5.798   1.00 36.03 ? 674  THR A N   1 
ATOM   5252  C  CA  . THR A 1 674  ? -21.317 78.940  5.776   1.00 38.46 ? 674  THR A CA  1 
ATOM   5253  C  C   . THR A 1 674  ? -20.813 80.089  4.898   1.00 40.79 ? 674  THR A C   1 
ATOM   5254  O  O   . THR A 1 674  ? -21.322 80.338  3.797   1.00 39.39 ? 674  THR A O   1 
ATOM   5255  C  CB  . THR A 1 674  ? -20.872 77.588  5.210   1.00 38.65 ? 674  THR A CB  1 
ATOM   5256  O  OG1 . THR A 1 674  ? -21.384 76.545  6.041   1.00 38.54 ? 674  THR A OG1 1 
ATOM   5257  C  CG2 . THR A 1 674  ? -19.348 77.489  5.173   1.00 39.27 ? 674  THR A CG2 1 
ATOM   5258  N  N   . HIS A 1 675  ? -19.820 80.806  5.404   1.00 42.73 ? 675  HIS A N   1 
ATOM   5259  C  CA  . HIS A 1 675  ? -19.277 81.945  4.689   1.00 44.08 ? 675  HIS A CA  1 
ATOM   5260  C  C   . HIS A 1 675  ? -17.801 81.736  4.380   1.00 44.80 ? 675  HIS A C   1 
ATOM   5261  O  O   . HIS A 1 675  ? -16.999 81.464  5.275   1.00 45.02 ? 675  HIS A O   1 
ATOM   5262  C  CB  . HIS A 1 675  ? -19.489 83.200  5.539   1.00 44.80 ? 675  HIS A CB  1 
ATOM   5263  C  CG  . HIS A 1 675  ? -19.100 84.468  4.854   1.00 46.89 ? 675  HIS A CG  1 
ATOM   5264  N  ND1 . HIS A 1 675  ? -17.821 84.972  4.895   1.00 47.72 ? 675  HIS A ND1 1 
ATOM   5265  C  CD2 . HIS A 1 675  ? -19.824 85.329  4.097   1.00 46.90 ? 675  HIS A CD2 1 
ATOM   5266  C  CE1 . HIS A 1 675  ? -17.768 86.094  4.194   1.00 47.65 ? 675  HIS A CE1 1 
ATOM   5267  N  NE2 . HIS A 1 675  ? -18.972 86.328  3.701   1.00 47.69 ? 675  HIS A NE2 1 
ATOM   5268  N  N   . MET A 1 676  ? -17.449 81.843  3.105   1.00 45.69 ? 676  MET A N   1 
ATOM   5269  C  CA  . MET A 1 676  ? -16.065 81.665  2.679   1.00 46.40 ? 676  MET A CA  1 
ATOM   5270  C  C   . MET A 1 676  ? -15.391 83.031  2.676   1.00 44.39 ? 676  MET A C   1 
ATOM   5271  O  O   . MET A 1 676  ? -15.999 84.026  2.284   1.00 44.74 ? 676  MET A O   1 
ATOM   5272  C  CB  . MET A 1 676  ? -16.020 81.039  1.278   1.00 49.99 ? 676  MET A CB  1 
ATOM   5273  C  CG  . MET A 1 676  ? -14.632 80.570  0.828   1.00 55.73 ? 676  MET A CG  1 
ATOM   5274  S  SD  . MET A 1 676  ? -13.948 79.187  1.803   1.00 62.27 ? 676  MET A SD  1 
ATOM   5275  C  CE  . MET A 1 676  ? -14.348 77.778  0.746   1.00 60.75 ? 676  MET A CE  1 
ATOM   5276  N  N   . THR A 1 677  ? -14.144 83.083  3.128   1.00 41.94 ? 677  THR A N   1 
ATOM   5277  C  CA  . THR A 1 677  ? -13.420 84.348  3.172   1.00 40.60 ? 677  THR A CA  1 
ATOM   5278  C  C   . THR A 1 677  ? -11.919 84.108  3.289   1.00 38.80 ? 677  THR A C   1 
ATOM   5279  O  O   . THR A 1 677  ? -11.499 83.072  3.786   1.00 39.01 ? 677  THR A O   1 
ATOM   5280  C  CB  . THR A 1 677  ? -13.900 85.215  4.373   1.00 40.67 ? 677  THR A CB  1 
ATOM   5281  O  OG1 . THR A 1 677  ? -13.297 86.510  4.304   1.00 40.56 ? 677  THR A OG1 1 
ATOM   5282  C  CG2 . THR A 1 677  ? -13.537 84.556  5.693   1.00 39.52 ? 677  THR A CG2 1 
ATOM   5283  N  N   . THR A 1 678  ? -11.116 85.060  2.822   1.00 36.56 ? 678  THR A N   1 
ATOM   5284  C  CA  . THR A 1 678  ? -9.662  84.940  2.899   1.00 34.69 ? 678  THR A CA  1 
ATOM   5285  C  C   . THR A 1 678  ? -9.140  85.539  4.200   1.00 34.62 ? 678  THR A C   1 
ATOM   5286  O  O   . THR A 1 678  ? -7.942  85.486  4.484   1.00 34.50 ? 678  THR A O   1 
ATOM   5287  C  CB  . THR A 1 678  ? -8.975  85.659  1.739   1.00 33.77 ? 678  THR A CB  1 
ATOM   5288  O  OG1 . THR A 1 678  ? -9.296  87.052  1.782   1.00 32.54 ? 678  THR A OG1 1 
ATOM   5289  C  CG2 . THR A 1 678  ? -9.424  85.070  0.424   1.00 33.36 ? 678  THR A CG2 1 
ATOM   5290  N  N   . THR A 1 679  ? -10.050 86.105  4.985   1.00 33.65 ? 679  THR A N   1 
ATOM   5291  C  CA  . THR A 1 679  ? -9.710  86.723  6.254   1.00 33.79 ? 679  THR A CA  1 
ATOM   5292  C  C   . THR A 1 679  ? -9.099  85.700  7.213   1.00 34.82 ? 679  THR A C   1 
ATOM   5293  O  O   . THR A 1 679  ? -9.700  84.670  7.514   1.00 34.57 ? 679  THR A O   1 
ATOM   5294  C  CB  . THR A 1 679  ? -10.962 87.348  6.890   1.00 33.71 ? 679  THR A CB  1 
ATOM   5295  O  OG1 . THR A 1 679  ? -11.552 88.275  5.961   1.00 36.06 ? 679  THR A OG1 1 
ATOM   5296  C  CG2 . THR A 1 679  ? -10.605 88.070  8.187   1.00 30.28 ? 679  THR A CG2 1 
ATOM   5297  N  N   . PHE A 1 680  ? -7.906  86.010  7.709   1.00 34.47 ? 680  PHE A N   1 
ATOM   5298  C  CA  . PHE A 1 680  ? -7.163  85.121  8.604   1.00 33.72 ? 680  PHE A CA  1 
ATOM   5299  C  C   . PHE A 1 680  ? -7.879  84.689  9.900   1.00 33.07 ? 680  PHE A C   1 
ATOM   5300  O  O   . PHE A 1 680  ? -8.624  85.458  10.503  1.00 32.55 ? 680  PHE A O   1 
ATOM   5301  C  CB  . PHE A 1 680  ? -5.819  85.776  8.953   1.00 32.71 ? 680  PHE A CB  1 
ATOM   5302  C  CG  . PHE A 1 680  ? -4.760  84.799  9.327   1.00 34.70 ? 680  PHE A CG  1 
ATOM   5303  C  CD1 . PHE A 1 680  ? -4.035  84.141  8.337   1.00 34.94 ? 680  PHE A CD1 1 
ATOM   5304  C  CD2 . PHE A 1 680  ? -4.505  84.494  10.667  1.00 35.15 ? 680  PHE A CD2 1 
ATOM   5305  C  CE1 . PHE A 1 680  ? -3.071  83.187  8.672   1.00 35.61 ? 680  PHE A CE1 1 
ATOM   5306  C  CE2 . PHE A 1 680  ? -3.544  83.540  11.012  1.00 35.90 ? 680  PHE A CE2 1 
ATOM   5307  C  CZ  . PHE A 1 680  ? -2.826  82.886  10.013  1.00 36.77 ? 680  PHE A CZ  1 
ATOM   5308  N  N   . PRO A 1 681  ? -7.650  83.441  10.346  1.00 33.28 ? 681  PRO A N   1 
ATOM   5309  C  CA  . PRO A 1 681  ? -8.280  82.941  11.574  1.00 33.07 ? 681  PRO A CA  1 
ATOM   5310  C  C   . PRO A 1 681  ? -7.682  83.646  12.783  1.00 32.42 ? 681  PRO A C   1 
ATOM   5311  O  O   . PRO A 1 681  ? -6.466  83.823  12.851  1.00 32.08 ? 681  PRO A O   1 
ATOM   5312  C  CB  . PRO A 1 681  ? -7.916  81.456  11.581  1.00 33.63 ? 681  PRO A CB  1 
ATOM   5313  C  CG  . PRO A 1 681  ? -7.614  81.149  10.174  1.00 33.71 ? 681  PRO A CG  1 
ATOM   5314  C  CD  . PRO A 1 681  ? -6.904  82.365  9.681   1.00 33.98 ? 681  PRO A CD  1 
ATOM   5315  N  N   . SER A 1 682  ? -8.525  84.032  13.738  1.00 30.59 ? 682  SER A N   1 
ATOM   5316  C  CA  . SER A 1 682  ? -8.043  84.710  14.930  1.00 29.19 ? 682  SER A CA  1 
ATOM   5317  C  C   . SER A 1 682  ? -7.704  83.712  16.032  1.00 28.71 ? 682  SER A C   1 
ATOM   5318  O  O   . SER A 1 682  ? -6.981  84.035  16.969  1.00 29.92 ? 682  SER A O   1 
ATOM   5319  C  CB  . SER A 1 682  ? -9.096  85.692  15.437  1.00 30.72 ? 682  SER A CB  1 
ATOM   5320  O  OG  . SER A 1 682  ? -10.224 85.012  15.976  1.00 33.31 ? 682  SER A OG  1 
ATOM   5321  N  N   . GLY A 1 683  ? -8.216  82.493  15.900  1.00 28.60 ? 683  GLY A N   1 
ATOM   5322  C  CA  . GLY A 1 683  ? -7.976  81.457  16.890  1.00 28.27 ? 683  GLY A CA  1 
ATOM   5323  C  C   . GLY A 1 683  ? -6.894  80.454  16.538  1.00 29.57 ? 683  GLY A C   1 
ATOM   5324  O  O   . GLY A 1 683  ? -6.972  79.269  16.900  1.00 30.21 ? 683  GLY A O   1 
ATOM   5325  N  N   . SER A 1 684  ? -5.885  80.920  15.809  1.00 29.11 ? 684  SER A N   1 
ATOM   5326  C  CA  . SER A 1 684  ? -4.757  80.075  15.441  1.00 28.76 ? 684  SER A CA  1 
ATOM   5327  C  C   . SER A 1 684  ? -3.605  80.419  16.370  1.00 27.28 ? 684  SER A C   1 
ATOM   5328  O  O   . SER A 1 684  ? -3.480  81.555  16.810  1.00 26.06 ? 684  SER A O   1 
ATOM   5329  C  CB  . SER A 1 684  ? -4.332  80.331  13.991  1.00 29.56 ? 684  SER A CB  1 
ATOM   5330  O  OG  . SER A 1 684  ? -3.005  79.864  13.748  1.00 28.92 ? 684  SER A OG  1 
ATOM   5331  N  N   . THR A 1 685  ? -2.766  79.437  16.670  1.00 26.91 ? 685  THR A N   1 
ATOM   5332  C  CA  . THR A 1 685  ? -1.619  79.685  17.535  1.00 26.76 ? 685  THR A CA  1 
ATOM   5333  C  C   . THR A 1 685  ? -0.682  80.689  16.851  1.00 26.67 ? 685  THR A C   1 
ATOM   5334  O  O   . THR A 1 685  ? 0.192   81.272  17.483  1.00 26.55 ? 685  THR A O   1 
ATOM   5335  C  CB  . THR A 1 685  ? -0.825  78.400  17.800  1.00 26.43 ? 685  THR A CB  1 
ATOM   5336  O  OG1 . THR A 1 685  ? -0.392  77.845  16.549  1.00 27.71 ? 685  THR A OG1 1 
ATOM   5337  C  CG2 . THR A 1 685  ? -1.675  77.388  18.536  1.00 26.76 ? 685  THR A CG2 1 
ATOM   5338  N  N   . ALA A 1 686  ? -0.881  80.896  15.557  1.00 26.99 ? 686  ALA A N   1 
ATOM   5339  C  CA  . ALA A 1 686  ? -0.032  81.804  14.804  1.00 27.20 ? 686  ALA A CA  1 
ATOM   5340  C  C   . ALA A 1 686  ? -0.514  83.239  14.771  1.00 27.07 ? 686  ALA A C   1 
ATOM   5341  O  O   . ALA A 1 686  ? 0.292   84.155  14.853  1.00 26.47 ? 686  ALA A O   1 
ATOM   5342  C  CB  . ALA A 1 686  ? 0.139   81.285  13.371  1.00 25.58 ? 686  ALA A CB  1 
ATOM   5343  N  N   . THR A 1 687  ? -1.825  83.428  14.672  1.00 28.26 ? 687  THR A N   1 
ATOM   5344  C  CA  . THR A 1 687  ? -2.401  84.763  14.577  1.00 29.07 ? 687  THR A CA  1 
ATOM   5345  C  C   . THR A 1 687  ? -1.545  85.903  15.144  1.00 30.20 ? 687  THR A C   1 
ATOM   5346  O  O   . THR A 1 687  ? -0.837  86.593  14.395  1.00 30.51 ? 687  THR A O   1 
ATOM   5347  C  CB  . THR A 1 687  ? -3.793  84.830  15.230  1.00 28.53 ? 687  THR A CB  1 
ATOM   5348  O  OG1 . THR A 1 687  ? -4.556  83.683  14.838  1.00 27.55 ? 687  THR A OG1 1 
ATOM   5349  C  CG2 . THR A 1 687  ? -4.525  86.097  14.776  1.00 26.46 ? 687  THR A CG2 1 
ATOM   5350  N  N   . SER A 1 688  ? -1.601  86.099  16.458  1.00 29.92 ? 688  SER A N   1 
ATOM   5351  C  CA  . SER A 1 688  ? -0.862  87.186  17.084  1.00 28.57 ? 688  SER A CA  1 
ATOM   5352  C  C   . SER A 1 688  ? 0.633   87.268  16.780  1.00 27.52 ? 688  SER A C   1 
ATOM   5353  O  O   . SER A 1 688  ? 1.129   88.304  16.327  1.00 26.94 ? 688  SER A O   1 
ATOM   5354  C  CB  . SER A 1 688  ? -1.052  87.150  18.596  1.00 28.60 ? 688  SER A CB  1 
ATOM   5355  O  OG  . SER A 1 688  ? -0.322  88.212  19.194  1.00 31.65 ? 688  SER A OG  1 
ATOM   5356  N  N   . THR A 1 689  ? 1.356   86.190  17.041  1.00 27.67 ? 689  THR A N   1 
ATOM   5357  C  CA  . THR A 1 689  ? 2.800   86.190  16.808  1.00 27.36 ? 689  THR A CA  1 
ATOM   5358  C  C   . THR A 1 689  ? 3.166   86.448  15.344  1.00 27.40 ? 689  THR A C   1 
ATOM   5359  O  O   . THR A 1 689  ? 4.163   87.115  15.050  1.00 26.68 ? 689  THR A O   1 
ATOM   5360  C  CB  . THR A 1 689  ? 3.440   84.854  17.267  1.00 27.05 ? 689  THR A CB  1 
ATOM   5361  O  OG1 . THR A 1 689  ? 4.852   84.912  17.053  1.00 28.63 ? 689  THR A OG1 1 
ATOM   5362  C  CG2 . THR A 1 689  ? 2.862   83.680  16.496  1.00 25.03 ? 689  THR A CG2 1 
ATOM   5363  N  N   . GLU A 1 690  ? 2.338   85.915  14.446  1.00 27.18 ? 690  GLU A N   1 
ATOM   5364  C  CA  . GLU A 1 690  ? 2.494   86.025  12.994  1.00 26.76 ? 690  GLU A CA  1 
ATOM   5365  C  C   . GLU A 1 690  ? 2.360   87.490  12.580  1.00 27.04 ? 690  GLU A C   1 
ATOM   5366  O  O   . GLU A 1 690  ? 3.216   88.044  11.872  1.00 26.89 ? 690  GLU A O   1 
ATOM   5367  C  CB  . GLU A 1 690  ? 1.389   85.200  12.331  1.00 27.41 ? 690  GLU A CB  1 
ATOM   5368  C  CG  . GLU A 1 690  ? 1.563   84.847  10.894  1.00 27.03 ? 690  GLU A CG  1 
ATOM   5369  C  CD  . GLU A 1 690  ? 1.146   85.942  9.937   1.00 25.33 ? 690  GLU A CD  1 
ATOM   5370  O  OE1 . GLU A 1 690  ? 0.299   86.787  10.295  1.00 26.19 ? 690  GLU A OE1 1 
ATOM   5371  O  OE2 . GLU A 1 690  ? 1.668   85.934  8.807   1.00 26.97 ? 690  GLU A OE2 1 
ATOM   5372  N  N   . HIS A 1 691  ? 1.265   88.108  13.020  1.00 26.05 ? 691  HIS A N   1 
ATOM   5373  C  CA  . HIS A 1 691  ? 0.997   89.505  12.716  1.00 25.60 ? 691  HIS A CA  1 
ATOM   5374  C  C   . HIS A 1 691  ? 2.099   90.389  13.293  1.00 25.41 ? 691  HIS A C   1 
ATOM   5375  O  O   . HIS A 1 691  ? 2.445   91.427  12.729  1.00 25.92 ? 691  HIS A O   1 
ATOM   5376  C  CB  . HIS A 1 691  ? -0.351  89.919  13.302  1.00 27.83 ? 691  HIS A CB  1 
ATOM   5377  C  CG  . HIS A 1 691  ? -1.530  89.274  12.641  1.00 29.21 ? 691  HIS A CG  1 
ATOM   5378  N  ND1 . HIS A 1 691  ? -1.406  88.296  11.673  1.00 29.03 ? 691  HIS A ND1 1 
ATOM   5379  C  CD2 . HIS A 1 691  ? -2.861  89.452  12.824  1.00 29.10 ? 691  HIS A CD2 1 
ATOM   5380  C  CE1 . HIS A 1 691  ? -2.607  87.899  11.296  1.00 29.17 ? 691  HIS A CE1 1 
ATOM   5381  N  NE2 . HIS A 1 691  ? -3.508  88.586  11.979  1.00 29.19 ? 691  HIS A NE2 1 
ATOM   5382  N  N   . THR A 1 692  ? 2.650   89.978  14.426  1.00 25.08 ? 692  THR A N   1 
ATOM   5383  C  CA  . THR A 1 692  ? 3.710   90.754  15.047  1.00 24.09 ? 692  THR A CA  1 
ATOM   5384  C  C   . THR A 1 692  ? 4.956   90.707  14.177  1.00 24.58 ? 692  THR A C   1 
ATOM   5385  O  O   . THR A 1 692  ? 5.635   91.723  13.989  1.00 26.27 ? 692  THR A O   1 
ATOM   5386  C  CB  . THR A 1 692  ? 4.097   90.208  16.435  1.00 21.86 ? 692  THR A CB  1 
ATOM   5387  O  OG1 . THR A 1 692  ? 2.934   90.130  17.257  1.00 22.98 ? 692  THR A OG1 1 
ATOM   5388  C  CG2 . THR A 1 692  ? 5.120   91.115  17.094  1.00 19.59 ? 692  THR A CG2 1 
ATOM   5389  N  N   . ALA A 1 693  ? 5.252   89.523  13.652  1.00 22.67 ? 693  ALA A N   1 
ATOM   5390  C  CA  . ALA A 1 693  ? 6.430   89.328  12.815  1.00 22.64 ? 693  ALA A CA  1 
ATOM   5391  C  C   . ALA A 1 693  ? 6.380   90.108  11.496  1.00 22.81 ? 693  ALA A C   1 
ATOM   5392  O  O   . ALA A 1 693  ? 7.397   90.680  11.074  1.00 20.19 ? 693  ALA A O   1 
ATOM   5393  C  CB  . ALA A 1 693  ? 6.640   87.836  12.536  1.00 23.48 ? 693  ALA A CB  1 
ATOM   5394  N  N   . ASN A 1 694  ? 5.211   90.126  10.846  1.00 22.09 ? 694  ASN A N   1 
ATOM   5395  C  CA  . ASN A 1 694  ? 5.059   90.857  9.592   1.00 21.84 ? 694  ASN A CA  1 
ATOM   5396  C  C   . ASN A 1 694  ? 5.084   92.344  9.855   1.00 21.61 ? 694  ASN A C   1 
ATOM   5397  O  O   . ASN A 1 694  ? 5.646   93.106  9.072   1.00 22.73 ? 694  ASN A O   1 
ATOM   5398  C  CB  . ASN A 1 694  ? 3.756   90.493  8.883   1.00 21.93 ? 694  ASN A CB  1 
ATOM   5399  C  CG  . ASN A 1 694  ? 3.724   89.056  8.456   1.00 21.87 ? 694  ASN A CG  1 
ATOM   5400  O  OD1 . ASN A 1 694  ? 4.672   88.562  7.851   1.00 22.09 ? 694  ASN A OD1 1 
ATOM   5401  N  ND2 . ASN A 1 694  ? 2.633   88.367  8.765   1.00 21.98 ? 694  ASN A ND2 1 
ATOM   5402  N  N   . ASN A 1 695  ? 4.480   92.757  10.961  1.00 20.24 ? 695  ASN A N   1 
ATOM   5403  C  CA  . ASN A 1 695  ? 4.465   94.169  11.332  1.00 21.61 ? 695  ASN A CA  1 
ATOM   5404  C  C   . ASN A 1 695  ? 5.913   94.700  11.320  1.00 22.51 ? 695  ASN A C   1 
ATOM   5405  O  O   . ASN A 1 695  ? 6.247   95.596  10.540  1.00 23.86 ? 695  ASN A O   1 
ATOM   5406  C  CB  . ASN A 1 695  ? 3.850   94.324  12.729  1.00 21.33 ? 695  ASN A CB  1 
ATOM   5407  C  CG  . ASN A 1 695  ? 3.509   95.763  13.071  1.00 20.17 ? 695  ASN A CG  1 
ATOM   5408  O  OD1 . ASN A 1 695  ? 4.235   96.684  12.717  1.00 20.93 ? 695  ASN A OD1 1 
ATOM   5409  N  ND2 . ASN A 1 695  ? 2.407   95.957  13.795  1.00 20.64 ? 695  ASN A ND2 1 
ATOM   5410  N  N   . SER A 1 696  ? 6.772   94.122  12.162  1.00 22.22 ? 696  SER A N   1 
ATOM   5411  C  CA  . SER A 1 696  ? 8.171   94.541  12.256  1.00 22.69 ? 696  SER A CA  1 
ATOM   5412  C  C   . SER A 1 696  ? 8.970   94.353  10.975  1.00 24.11 ? 696  SER A C   1 
ATOM   5413  O  O   . SER A 1 696  ? 9.833   95.174  10.647  1.00 26.36 ? 696  SER A O   1 
ATOM   5414  C  CB  . SER A 1 696  ? 8.883   93.783  13.374  1.00 22.39 ? 696  SER A CB  1 
ATOM   5415  O  OG  . SER A 1 696  ? 9.082   92.429  13.009  1.00 22.70 ? 696  SER A OG  1 
ATOM   5416  N  N   . THR A 1 697  ? 8.711   93.266  10.257  1.00 24.66 ? 697  THR A N   1 
ATOM   5417  C  CA  . THR A 1 697  ? 9.430   93.006  9.017   1.00 24.39 ? 697  THR A CA  1 
ATOM   5418  C  C   . THR A 1 697  ? 9.130   94.080  7.969   1.00 25.95 ? 697  THR A C   1 
ATOM   5419  O  O   . THR A 1 697  ? 10.035  94.594  7.306   1.00 26.83 ? 697  THR A O   1 
ATOM   5420  C  CB  . THR A 1 697  ? 9.056   91.636  8.447   1.00 23.70 ? 697  THR A CB  1 
ATOM   5421  O  OG1 . THR A 1 697  ? 9.383   90.620  9.399   1.00 23.94 ? 697  THR A OG1 1 
ATOM   5422  C  CG2 . THR A 1 697  ? 9.806   91.373  7.149   1.00 25.14 ? 697  THR A CG2 1 
ATOM   5423  N  N   . MET A 1 698  ? 7.861   94.427  7.816   1.00 25.52 ? 698  MET A N   1 
ATOM   5424  C  CA  . MET A 1 698  ? 7.508   95.439  6.842   1.00 26.79 ? 698  MET A CA  1 
ATOM   5425  C  C   . MET A 1 698  ? 8.035   96.812  7.260   1.00 28.03 ? 698  MET A C   1 
ATOM   5426  O  O   . MET A 1 698  ? 8.517   97.578  6.423   1.00 29.16 ? 698  MET A O   1 
ATOM   5427  C  CB  . MET A 1 698  ? 5.993   95.463  6.650   1.00 26.27 ? 698  MET A CB  1 
ATOM   5428  C  CG  . MET A 1 698  ? 5.455   94.149  6.132   1.00 27.62 ? 698  MET A CG  1 
ATOM   5429  S  SD  . MET A 1 698  ? 6.188   93.644  4.535   1.00 31.33 ? 698  MET A SD  1 
ATOM   5430  C  CE  . MET A 1 698  ? 7.569   92.740  5.037   1.00 32.02 ? 698  MET A CE  1 
ATOM   5431  N  N   . MET A 1 699  ? 7.972   97.120  8.554   1.00 28.98 ? 699  MET A N   1 
ATOM   5432  C  CA  . MET A 1 699  ? 8.451   98.420  9.032   1.00 29.80 ? 699  MET A CA  1 
ATOM   5433  C  C   . MET A 1 699  ? 9.954   98.498  8.809   1.00 31.19 ? 699  MET A C   1 
ATOM   5434  O  O   . MET A 1 699  ? 10.490  99.545  8.440   1.00 31.55 ? 699  MET A O   1 
ATOM   5435  C  CB  . MET A 1 699  ? 8.134   98.613  10.521  1.00 29.01 ? 699  MET A CB  1 
ATOM   5436  C  CG  . MET A 1 699  ? 8.236   100.049 10.999  1.00 27.16 ? 699  MET A CG  1 
ATOM   5437  S  SD  . MET A 1 699  ? 7.599   101.275 9.823   1.00 28.84 ? 699  MET A SD  1 
ATOM   5438  C  CE  . MET A 1 699  ? 5.875   101.448 10.428  1.00 25.12 ? 699  MET A CE  1 
ATOM   5439  N  N   . GLU A 1 700  ? 10.630  97.378  9.031   1.00 31.07 ? 700  GLU A N   1 
ATOM   5440  C  CA  . GLU A 1 700  ? 12.074  97.320  8.838   1.00 31.44 ? 700  GLU A CA  1 
ATOM   5441  C  C   . GLU A 1 700  ? 12.402  97.572  7.356   1.00 29.52 ? 700  GLU A C   1 
ATOM   5442  O  O   . GLU A 1 700  ? 13.260  98.378  7.028   1.00 29.51 ? 700  GLU A O   1 
ATOM   5443  C  CB  . GLU A 1 700  ? 12.582  95.951  9.285   1.00 33.03 ? 700  GLU A CB  1 
ATOM   5444  C  CG  . GLU A 1 700  ? 13.985  95.946  9.808   1.00 39.05 ? 700  GLU A CG  1 
ATOM   5445  C  CD  . GLU A 1 700  ? 14.991  95.490  8.796   1.00 42.01 ? 700  GLU A CD  1 
ATOM   5446  O  OE1 . GLU A 1 700  ? 16.024  94.927  9.226   1.00 44.44 ? 700  GLU A OE1 1 
ATOM   5447  O  OE2 . GLU A 1 700  ? 14.755  95.689  7.584   1.00 45.10 ? 700  GLU A OE2 1 
ATOM   5448  N  N   . THR A 1 701  ? 11.693  96.881  6.470   1.00 27.92 ? 701  THR A N   1 
ATOM   5449  C  CA  . THR A 1 701  ? 11.881  97.025  5.033   1.00 27.31 ? 701  THR A CA  1 
ATOM   5450  C  C   . THR A 1 701  ? 11.665  98.467  4.591   1.00 25.80 ? 701  THR A C   1 
ATOM   5451  O  O   . THR A 1 701  ? 12.351  98.956  3.684   1.00 25.67 ? 701  THR A O   1 
ATOM   5452  C  CB  . THR A 1 701  ? 10.908  96.120  4.258   1.00 27.29 ? 701  THR A CB  1 
ATOM   5453  O  OG1 . THR A 1 701  ? 11.161  94.750  4.594   1.00 28.99 ? 701  THR A OG1 1 
ATOM   5454  C  CG2 . THR A 1 701  ? 11.084  96.306  2.766   1.00 25.79 ? 701  THR A CG2 1 
ATOM   5455  N  N   . PHE A 1 702  ? 10.710  99.138  5.227   1.00 23.97 ? 702  PHE A N   1 
ATOM   5456  C  CA  . PHE A 1 702  ? 10.421  100.527 4.904   1.00 23.66 ? 702  PHE A CA  1 
ATOM   5457  C  C   . PHE A 1 702  ? 11.558  101.452 5.323   1.00 24.09 ? 702  PHE A C   1 
ATOM   5458  O  O   . PHE A 1 702  ? 11.923  102.358 4.588   1.00 25.10 ? 702  PHE A O   1 
ATOM   5459  C  CB  . PHE A 1 702  ? 9.149   100.996 5.602   1.00 23.01 ? 702  PHE A CB  1 
ATOM   5460  C  CG  . PHE A 1 702  ? 9.006   102.487 5.626   1.00 21.59 ? 702  PHE A CG  1 
ATOM   5461  C  CD1 . PHE A 1 702  ? 8.477   103.170 4.526   1.00 20.43 ? 702  PHE A CD1 1 
ATOM   5462  C  CD2 . PHE A 1 702  ? 9.498   103.223 6.711   1.00 20.71 ? 702  PHE A CD2 1 
ATOM   5463  C  CE1 . PHE A 1 702  ? 8.445   104.564 4.500   1.00 20.50 ? 702  PHE A CE1 1 
ATOM   5464  C  CE2 . PHE A 1 702  ? 9.470   104.608 6.694   1.00 19.71 ? 702  PHE A CE2 1 
ATOM   5465  C  CZ  . PHE A 1 702  ? 8.946   105.282 5.585   1.00 20.11 ? 702  PHE A CZ  1 
ATOM   5466  N  N   . LEU A 1 703  ? 12.102  101.233 6.514   1.00 24.41 ? 703  LEU A N   1 
ATOM   5467  C  CA  . LEU A 1 703  ? 13.191  102.067 7.021   1.00 25.88 ? 703  LEU A CA  1 
ATOM   5468  C  C   . LEU A 1 703  ? 14.510  101.808 6.316   1.00 26.90 ? 703  LEU A C   1 
ATOM   5469  O  O   . LEU A 1 703  ? 15.369  102.681 6.252   1.00 27.21 ? 703  LEU A O   1 
ATOM   5470  C  CB  . LEU A 1 703  ? 13.368  101.850 8.525   1.00 23.54 ? 703  LEU A CB  1 
ATOM   5471  C  CG  . LEU A 1 703  ? 12.233  102.352 9.423   1.00 23.68 ? 703  LEU A CG  1 
ATOM   5472  C  CD1 . LEU A 1 703  ? 12.404  101.834 10.844  1.00 19.63 ? 703  LEU A CD1 1 
ATOM   5473  C  CD2 . LEU A 1 703  ? 12.229  103.869 9.387   1.00 21.91 ? 703  LEU A CD2 1 
ATOM   5474  N  N   . THR A 1 704  ? 14.660  100.608 5.774   1.00 28.00 ? 704  THR A N   1 
ATOM   5475  C  CA  . THR A 1 704  ? 15.893  100.228 5.108   1.00 28.26 ? 704  THR A CA  1 
ATOM   5476  C  C   . THR A 1 704  ? 15.871  100.415 3.604   1.00 28.38 ? 704  THR A C   1 
ATOM   5477  O  O   . THR A 1 704  ? 16.828  100.913 3.018   1.00 28.07 ? 704  THR A O   1 
ATOM   5478  C  CB  . THR A 1 704  ? 16.232  98.746  5.376   1.00 29.36 ? 704  THR A CB  1 
ATOM   5479  O  OG1 . THR A 1 704  ? 16.310  98.523  6.789   1.00 31.02 ? 704  THR A OG1 1 
ATOM   5480  C  CG2 . THR A 1 704  ? 17.578  98.374  4.737   1.00 30.97 ? 704  THR A CG2 1 
ATOM   5481  N  N   . VAL A 1 705  ? 14.766  100.045 2.976   1.00 28.58 ? 705  VAL A N   1 
ATOM   5482  C  CA  . VAL A 1 705  ? 14.694  100.113 1.526   1.00 27.59 ? 705  VAL A CA  1 
ATOM   5483  C  C   . VAL A 1 705  ? 13.730  101.107 0.893   1.00 27.06 ? 705  VAL A C   1 
ATOM   5484  O  O   . VAL A 1 705  ? 14.140  102.107 0.311   1.00 26.92 ? 705  VAL A O   1 
ATOM   5485  C  CB  . VAL A 1 705  ? 14.374  98.702  0.963   1.00 27.40 ? 705  VAL A CB  1 
ATOM   5486  C  CG1 . VAL A 1 705  ? 14.455  98.697  -0.550  1.00 29.13 ? 705  VAL A CG1 1 
ATOM   5487  C  CG2 . VAL A 1 705  ? 15.327  97.677  1.570   1.00 25.67 ? 705  VAL A CG2 1 
ATOM   5488  N  N   . TRP A 1 706  ? 12.442  100.811 0.995   1.00 26.22 ? 706  TRP A N   1 
ATOM   5489  C  CA  . TRP A 1 706  ? 11.410  101.635 0.380   1.00 25.31 ? 706  TRP A CA  1 
ATOM   5490  C  C   . TRP A 1 706  ? 11.508  103.125 0.710   1.00 25.83 ? 706  TRP A C   1 
ATOM   5491  O  O   . TRP A 1 706  ? 11.715  103.953 -0.181  1.00 26.68 ? 706  TRP A O   1 
ATOM   5492  C  CB  . TRP A 1 706  ? 10.038  101.098 0.764   1.00 24.40 ? 706  TRP A CB  1 
ATOM   5493  C  CG  . TRP A 1 706  ? 8.966   101.461 -0.189  1.00 24.77 ? 706  TRP A CG  1 
ATOM   5494  C  CD1 . TRP A 1 706  ? 8.510   100.710 -1.231  1.00 25.44 ? 706  TRP A CD1 1 
ATOM   5495  C  CD2 . TRP A 1 706  ? 8.183   102.665 -0.186  1.00 24.56 ? 706  TRP A CD2 1 
ATOM   5496  N  NE1 . TRP A 1 706  ? 7.484   101.363 -1.881  1.00 24.20 ? 706  TRP A NE1 1 
ATOM   5497  C  CE2 . TRP A 1 706  ? 7.265   102.564 -1.263  1.00 25.17 ? 706  TRP A CE2 1 
ATOM   5498  C  CE3 . TRP A 1 706  ? 8.170   103.811 0.614   1.00 23.17 ? 706  TRP A CE3 1 
ATOM   5499  C  CZ2 . TRP A 1 706  ? 6.334   103.579 -1.554  1.00 25.48 ? 706  TRP A CZ2 1 
ATOM   5500  C  CZ3 . TRP A 1 706  ? 7.244   104.821 0.326   1.00 25.12 ? 706  TRP A CZ3 1 
ATOM   5501  C  CH2 . TRP A 1 706  ? 6.336   104.694 -0.751  1.00 25.07 ? 706  TRP A CH2 1 
ATOM   5502  N  N   . GLY A 1 707  ? 11.365  103.469 1.983   1.00 25.18 ? 707  GLY A N   1 
ATOM   5503  C  CA  . GLY A 1 707  ? 11.443  104.861 2.370   1.00 26.76 ? 707  GLY A CA  1 
ATOM   5504  C  C   . GLY A 1 707  ? 12.619  105.572 1.732   1.00 27.67 ? 707  GLY A C   1 
ATOM   5505  O  O   . GLY A 1 707  ? 12.441  106.479 0.923   1.00 27.95 ? 707  GLY A O   1 
ATOM   5506  N  N   . PRO A 1 708  ? 13.844  105.178 2.074   1.00 27.68 ? 708  PRO A N   1 
ATOM   5507  C  CA  . PRO A 1 708  ? 15.044  105.804 1.510   1.00 29.39 ? 708  PRO A CA  1 
ATOM   5508  C  C   . PRO A 1 708  ? 15.028  105.947 -0.025  1.00 29.68 ? 708  PRO A C   1 
ATOM   5509  O  O   . PRO A 1 708  ? 15.565  106.912 -0.572  1.00 30.01 ? 708  PRO A O   1 
ATOM   5510  C  CB  . PRO A 1 708  ? 16.167  104.886 1.996   1.00 28.97 ? 708  PRO A CB  1 
ATOM   5511  C  CG  . PRO A 1 708  ? 15.662  104.435 3.329   1.00 29.14 ? 708  PRO A CG  1 
ATOM   5512  C  CD  . PRO A 1 708  ? 14.197  104.131 3.047   1.00 28.86 ? 708  PRO A CD  1 
ATOM   5513  N  N   . GLU A 1 709  ? 14.412  104.992 -0.717  1.00 29.53 ? 709  GLU A N   1 
ATOM   5514  C  CA  . GLU A 1 709  ? 14.354  105.028 -2.175  1.00 29.28 ? 709  GLU A CA  1 
ATOM   5515  C  C   . GLU A 1 709  ? 13.242  105.909 -2.715  1.00 30.16 ? 709  GLU A C   1 
ATOM   5516  O  O   . GLU A 1 709  ? 13.135  106.104 -3.923  1.00 29.49 ? 709  GLU A O   1 
ATOM   5517  C  CB  . GLU A 1 709  ? 14.172  103.621 -2.742  1.00 28.82 ? 709  GLU A CB  1 
ATOM   5518  C  CG  . GLU A 1 709  ? 15.446  102.808 -2.858  1.00 31.36 ? 709  GLU A CG  1 
ATOM   5519  C  CD  . GLU A 1 709  ? 15.184  101.348 -3.239  1.00 34.43 ? 709  GLU A CD  1 
ATOM   5520  O  OE1 . GLU A 1 709  ? 14.032  101.026 -3.619  1.00 34.97 ? 709  GLU A OE1 1 
ATOM   5521  O  OE2 . GLU A 1 709  ? 16.127  100.519 -3.151  1.00 34.54 ? 709  GLU A OE2 1 
ATOM   5522  N  N   . HIS A 1 710  ? 12.411  106.452 -1.836  1.00 30.91 ? 710  HIS A N   1 
ATOM   5523  C  CA  . HIS A 1 710  ? 11.316  107.274 -2.310  1.00 31.37 ? 710  HIS A CA  1 
ATOM   5524  C  C   . HIS A 1 710  ? 11.386  108.733 -1.914  1.00 32.66 ? 710  HIS A C   1 
ATOM   5525  O  O   . HIS A 1 710  ? 10.395  109.455 -2.009  1.00 34.83 ? 710  HIS A O   1 
ATOM   5526  C  CB  . HIS A 1 710  ? 9.991   106.651 -1.862  1.00 29.78 ? 710  HIS A CB  1 
ATOM   5527  C  CG  . HIS A 1 710  ? 9.647   105.404 -2.612  1.00 28.53 ? 710  HIS A CG  1 
ATOM   5528  N  ND1 . HIS A 1 710  ? 8.818   105.404 -3.710  1.00 28.01 ? 710  HIS A ND1 1 
ATOM   5529  C  CD2 . HIS A 1 710  ? 10.097  104.135 -2.486  1.00 28.42 ? 710  HIS A CD2 1 
ATOM   5530  C  CE1 . HIS A 1 710  ? 8.770   104.191 -4.230  1.00 27.62 ? 710  HIS A CE1 1 
ATOM   5531  N  NE2 . HIS A 1 710  ? 9.540   103.402 -3.505  1.00 27.93 ? 710  HIS A NE2 1 
ATOM   5532  N  N   . THR A 1 711  ? 12.559  109.175 -1.488  1.00 33.01 ? 711  THR A N   1 
ATOM   5533  C  CA  . THR A 1 711  ? 12.725  110.562 -1.106  1.00 35.96 ? 711  THR A CA  1 
ATOM   5534  C  C   . THR A 1 711  ? 14.202  110.916 -1.143  1.00 37.35 ? 711  THR A C   1 
ATOM   5535  O  O   . THR A 1 711  ? 15.060  110.046 -1.006  1.00 36.17 ? 711  THR A O   1 
ATOM   5536  C  CB  . THR A 1 711  ? 12.182  110.813 0.323   1.00 35.67 ? 711  THR A CB  1 
ATOM   5537  O  OG1 . THR A 1 711  ? 12.290  112.206 0.642   1.00 36.33 ? 711  THR A OG1 1 
ATOM   5538  C  CG2 . THR A 1 711  ? 12.984  110.013 1.345   1.00 35.22 ? 711  THR A CG2 1 
ATOM   5539  N  N   . ASP A 1 712  ? 14.494  112.193 -1.355  1.00 40.44 ? 712  ASP A N   1 
ATOM   5540  C  CA  . ASP A 1 712  ? 15.873  112.663 -1.361  1.00 43.01 ? 712  ASP A CA  1 
ATOM   5541  C  C   . ASP A 1 712  ? 16.019  113.707 -0.269  1.00 42.91 ? 712  ASP A C   1 
ATOM   5542  O  O   . ASP A 1 712  ? 17.115  114.218 -0.019  1.00 43.76 ? 712  ASP A O   1 
ATOM   5543  C  CB  . ASP A 1 712  ? 16.257  113.249 -2.718  1.00 46.18 ? 712  ASP A CB  1 
ATOM   5544  C  CG  . ASP A 1 712  ? 17.151  112.310 -3.518  1.00 50.95 ? 712  ASP A CG  1 
ATOM   5545  O  OD1 . ASP A 1 712  ? 17.644  111.313 -2.933  1.00 53.55 ? 712  ASP A OD1 1 
ATOM   5546  O  OD2 . ASP A 1 712  ? 17.374  112.571 -4.726  1.00 53.39 ? 712  ASP A OD2 1 
ATOM   5547  N  N   . ASP A 1 713  ? 14.893  114.005 0.376   1.00 42.90 ? 713  ASP A N   1 
ATOM   5548  C  CA  . ASP A 1 713  ? 14.823  114.961 1.471   1.00 43.20 ? 713  ASP A CA  1 
ATOM   5549  C  C   . ASP A 1 713  ? 15.895  114.565 2.488   1.00 43.31 ? 713  ASP A C   1 
ATOM   5550  O  O   . ASP A 1 713  ? 15.778  113.534 3.152   1.00 44.11 ? 713  ASP A O   1 
ATOM   5551  C  CB  . ASP A 1 713  ? 13.435  114.888 2.104   1.00 43.01 ? 713  ASP A CB  1 
ATOM   5552  C  CG  . ASP A 1 713  ? 13.158  116.042 3.037   1.00 43.63 ? 713  ASP A CG  1 
ATOM   5553  O  OD1 . ASP A 1 713  ? 13.986  116.293 3.946   1.00 43.51 ? 713  ASP A OD1 1 
ATOM   5554  O  OD2 . ASP A 1 713  ? 12.102  116.690 2.856   1.00 43.87 ? 713  ASP A OD2 1 
ATOM   5555  N  N   . PRO A 1 714  ? 16.962  115.372 2.614   1.00 43.57 ? 714  PRO A N   1 
ATOM   5556  C  CA  . PRO A 1 714  ? 18.057  115.087 3.549   1.00 43.47 ? 714  PRO A CA  1 
ATOM   5557  C  C   . PRO A 1 714  ? 17.603  114.752 4.974   1.00 43.43 ? 714  PRO A C   1 
ATOM   5558  O  O   . PRO A 1 714  ? 18.042  113.756 5.557   1.00 44.38 ? 714  PRO A O   1 
ATOM   5559  C  CB  . PRO A 1 714  ? 18.897  116.360 3.485   1.00 43.16 ? 714  PRO A CB  1 
ATOM   5560  C  CG  . PRO A 1 714  ? 18.692  116.814 2.080   1.00 43.32 ? 714  PRO A CG  1 
ATOM   5561  C  CD  . PRO A 1 714  ? 17.200  116.646 1.918   1.00 43.75 ? 714  PRO A CD  1 
ATOM   5562  N  N   . ASP A 1 715  ? 16.726  115.579 5.530   1.00 42.37 ? 715  ASP A N   1 
ATOM   5563  C  CA  . ASP A 1 715  ? 16.236  115.345 6.874   1.00 42.44 ? 715  ASP A CA  1 
ATOM   5564  C  C   . ASP A 1 715  ? 15.455  114.038 7.000   1.00 41.08 ? 715  ASP A C   1 
ATOM   5565  O  O   . ASP A 1 715  ? 15.738  113.220 7.886   1.00 41.00 ? 715  ASP A O   1 
ATOM   5566  C  CB  . ASP A 1 715  ? 15.380  116.528 7.319   1.00 44.31 ? 715  ASP A CB  1 
ATOM   5567  C  CG  . ASP A 1 715  ? 16.142  117.831 7.266   1.00 46.24 ? 715  ASP A CG  1 
ATOM   5568  O  OD1 . ASP A 1 715  ? 17.386  117.787 7.416   1.00 47.19 ? 715  ASP A OD1 1 
ATOM   5569  O  OD2 . ASP A 1 715  ? 15.504  118.889 7.078   1.00 48.16 ? 715  ASP A OD2 1 
ATOM   5570  N  N   . VAL A 1 716  ? 14.480  113.834 6.119   1.00 39.21 ? 716  VAL A N   1 
ATOM   5571  C  CA  . VAL A 1 716  ? 13.692  112.614 6.174   1.00 37.42 ? 716  VAL A CA  1 
ATOM   5572  C  C   . VAL A 1 716  ? 14.617  111.405 6.070   1.00 37.34 ? 716  VAL A C   1 
ATOM   5573  O  O   . VAL A 1 716  ? 14.380  110.364 6.694   1.00 37.94 ? 716  VAL A O   1 
ATOM   5574  C  CB  . VAL A 1 716  ? 12.644  112.564 5.047   1.00 37.80 ? 716  VAL A CB  1 
ATOM   5575  C  CG1 . VAL A 1 716  ? 11.851  111.249 5.127   1.00 36.59 ? 716  VAL A CG1 1 
ATOM   5576  C  CG2 . VAL A 1 716  ? 11.696  113.760 5.174   1.00 37.78 ? 716  VAL A CG2 1 
ATOM   5577  N  N   . LEU A 1 717  ? 15.683  111.541 5.293   1.00 35.64 ? 717  LEU A N   1 
ATOM   5578  C  CA  . LEU A 1 717  ? 16.623  110.439 5.158   1.00 35.56 ? 717  LEU A CA  1 
ATOM   5579  C  C   . LEU A 1 717  ? 17.391  110.252 6.457   1.00 35.76 ? 717  LEU A C   1 
ATOM   5580  O  O   . LEU A 1 717  ? 17.770  109.131 6.796   1.00 35.11 ? 717  LEU A O   1 
ATOM   5581  C  CB  . LEU A 1 717  ? 17.588  110.683 3.998   1.00 34.07 ? 717  LEU A CB  1 
ATOM   5582  C  CG  . LEU A 1 717  ? 16.969  110.443 2.615   1.00 33.94 ? 717  LEU A CG  1 
ATOM   5583  C  CD1 . LEU A 1 717  ? 17.852  111.035 1.520   1.00 31.23 ? 717  LEU A CD1 1 
ATOM   5584  C  CD2 . LEU A 1 717  ? 16.773  108.940 2.405   1.00 31.35 ? 717  LEU A CD2 1 
ATOM   5585  N  N   . ARG A 1 718  ? 17.620  111.341 7.187   1.00 36.06 ? 718  ARG A N   1 
ATOM   5586  C  CA  . ARG A 1 718  ? 18.330  111.235 8.460   1.00 37.69 ? 718  ARG A CA  1 
ATOM   5587  C  C   . ARG A 1 718  ? 17.448  110.563 9.503   1.00 36.64 ? 718  ARG A C   1 
ATOM   5588  O  O   . ARG A 1 718  ? 17.879  109.627 10.173  1.00 36.51 ? 718  ARG A O   1 
ATOM   5589  C  CB  . ARG A 1 718  ? 18.753  112.608 8.982   1.00 40.53 ? 718  ARG A CB  1 
ATOM   5590  C  CG  . ARG A 1 718  ? 20.007  113.131 8.344   1.00 44.60 ? 718  ARG A CG  1 
ATOM   5591  C  CD  . ARG A 1 718  ? 20.688  114.164 9.219   1.00 47.97 ? 718  ARG A CD  1 
ATOM   5592  N  NE  . ARG A 1 718  ? 21.758  114.805 8.470   1.00 51.17 ? 718  ARG A NE  1 
ATOM   5593  C  CZ  . ARG A 1 718  ? 21.554  115.708 7.514   1.00 53.41 ? 718  ARG A CZ  1 
ATOM   5594  N  NH1 . ARG A 1 718  ? 20.316  116.085 7.203   1.00 53.37 ? 718  ARG A NH1 1 
ATOM   5595  N  NH2 . ARG A 1 718  ? 22.589  116.218 6.852   1.00 54.38 ? 718  ARG A NH2 1 
ATOM   5596  N  N   . LEU A 1 719  ? 16.218  111.050 9.638   1.00 34.40 ? 719  LEU A N   1 
ATOM   5597  C  CA  . LEU A 1 719  ? 15.281  110.484 10.591  1.00 33.44 ? 719  LEU A CA  1 
ATOM   5598  C  C   . LEU A 1 719  ? 15.197  108.971 10.371  1.00 34.85 ? 719  LEU A C   1 
ATOM   5599  O  O   . LEU A 1 719  ? 15.417  108.177 11.299  1.00 35.00 ? 719  LEU A O   1 
ATOM   5600  C  CB  . LEU A 1 719  ? 13.902  111.122 10.408  1.00 32.03 ? 719  LEU A CB  1 
ATOM   5601  C  CG  . LEU A 1 719  ? 12.813  110.638 11.363  1.00 30.84 ? 719  LEU A CG  1 
ATOM   5602  C  CD1 . LEU A 1 719  ? 13.291  110.822 12.822  1.00 30.53 ? 719  LEU A CD1 1 
ATOM   5603  C  CD2 . LEU A 1 719  ? 11.524  111.401 11.095  1.00 27.80 ? 719  LEU A CD2 1 
ATOM   5604  N  N   . MET A 1 720  ? 14.883  108.582 9.138   1.00 35.40 ? 720  MET A N   1 
ATOM   5605  C  CA  . MET A 1 720  ? 14.769  107.182 8.767   1.00 35.92 ? 720  MET A CA  1 
ATOM   5606  C  C   . MET A 1 720  ? 16.001  106.384 9.165   1.00 35.84 ? 720  MET A C   1 
ATOM   5607  O  O   . MET A 1 720  ? 15.903  105.335 9.807   1.00 36.63 ? 720  MET A O   1 
ATOM   5608  C  CB  . MET A 1 720  ? 14.560  107.058 7.260   1.00 35.83 ? 720  MET A CB  1 
ATOM   5609  C  CG  . MET A 1 720  ? 13.260  107.633 6.746   1.00 35.89 ? 720  MET A CG  1 
ATOM   5610  S  SD  . MET A 1 720  ? 12.797  106.893 5.163   1.00 34.54 ? 720  MET A SD  1 
ATOM   5611  C  CE  . MET A 1 720  ? 13.785  107.888 4.089   1.00 34.23 ? 720  MET A CE  1 
ATOM   5612  N  N   . LYS A 1 721  ? 17.167  106.889 8.795   1.00 35.94 ? 721  LYS A N   1 
ATOM   5613  C  CA  . LYS A 1 721  ? 18.420  106.200 9.102   1.00 37.04 ? 721  LYS A CA  1 
ATOM   5614  C  C   . LYS A 1 721  ? 18.700  106.031 10.594  1.00 35.74 ? 721  LYS A C   1 
ATOM   5615  O  O   . LYS A 1 721  ? 19.343  105.059 10.990  1.00 36.08 ? 721  LYS A O   1 
ATOM   5616  C  CB  . LYS A 1 721  ? 19.593  106.921 8.436   1.00 39.09 ? 721  LYS A CB  1 
ATOM   5617  C  CG  . LYS A 1 721  ? 20.889  106.138 8.441   1.00 42.35 ? 721  LYS A CG  1 
ATOM   5618  C  CD  . LYS A 1 721  ? 21.955  106.826 7.605   1.00 45.18 ? 721  LYS A CD  1 
ATOM   5619  C  CE  . LYS A 1 721  ? 23.275  106.064 7.615   1.00 45.69 ? 721  LYS A CE  1 
ATOM   5620  N  NZ  . LYS A 1 721  ? 24.335  106.763 6.811   1.00 47.70 ? 721  LYS A NZ  1 
ATOM   5621  N  N   . SER A 1 722  ? 18.216  106.960 11.418  1.00 34.24 ? 722  SER A N   1 
ATOM   5622  C  CA  . SER A 1 722  ? 18.427  106.889 12.865  1.00 33.02 ? 722  SER A CA  1 
ATOM   5623  C  C   . SER A 1 722  ? 17.456  105.928 13.561  1.00 32.51 ? 722  SER A C   1 
ATOM   5624  O  O   . SER A 1 722  ? 17.579  105.683 14.758  1.00 32.01 ? 722  SER A O   1 
ATOM   5625  C  CB  . SER A 1 722  ? 18.286  108.284 13.502  1.00 32.27 ? 722  SER A CB  1 
ATOM   5626  O  OG  . SER A 1 722  ? 16.936  108.727 13.515  1.00 32.43 ? 722  SER A OG  1 
ATOM   5627  N  N   . LEU A 1 723  ? 16.487  105.401 12.821  1.00 31.93 ? 723  LEU A N   1 
ATOM   5628  C  CA  . LEU A 1 723  ? 15.516  104.482 13.406  1.00 31.39 ? 723  LEU A CA  1 
ATOM   5629  C  C   . LEU A 1 723  ? 15.883  103.058 13.055  1.00 32.05 ? 723  LEU A C   1 
ATOM   5630  O  O   . LEU A 1 723  ? 16.524  102.808 12.043  1.00 34.17 ? 723  LEU A O   1 
ATOM   5631  C  CB  . LEU A 1 723  ? 14.103  104.794 12.904  1.00 28.45 ? 723  LEU A CB  1 
ATOM   5632  C  CG  . LEU A 1 723  ? 13.640  106.225 13.171  1.00 26.85 ? 723  LEU A CG  1 
ATOM   5633  C  CD1 . LEU A 1 723  ? 12.276  106.479 12.509  1.00 25.62 ? 723  LEU A CD1 1 
ATOM   5634  C  CD2 . LEU A 1 723  ? 13.594  106.450 14.681  1.00 26.42 ? 723  LEU A CD2 1 
ATOM   5635  N  N   . THR A 1 724  ? 15.477  102.133 13.908  1.00 32.34 ? 724  THR A N   1 
ATOM   5636  C  CA  . THR A 1 724  ? 15.749  100.724 13.718  1.00 33.24 ? 724  THR A CA  1 
ATOM   5637  C  C   . THR A 1 724  ? 14.658  99.941  14.417  1.00 34.15 ? 724  THR A C   1 
ATOM   5638  O  O   . THR A 1 724  ? 14.272  100.287 15.531  1.00 36.54 ? 724  THR A O   1 
ATOM   5639  C  CB  . THR A 1 724  ? 17.098  100.383 14.318  1.00 33.06 ? 724  THR A CB  1 
ATOM   5640  O  OG1 . THR A 1 724  ? 18.111  100.818 13.414  1.00 31.40 ? 724  THR A OG1 1 
ATOM   5641  C  CG2 . THR A 1 724  ? 17.231  98.899  14.567  1.00 35.48 ? 724  THR A CG2 1 
ATOM   5642  N  N   . ILE A 1 725  ? 14.148  98.894  13.774  1.00 34.59 ? 725  ILE A N   1 
ATOM   5643  C  CA  . ILE A 1 725  ? 13.087  98.108  14.391  1.00 34.72 ? 725  ILE A CA  1 
ATOM   5644  C  C   . ILE A 1 725  ? 13.573  97.402  15.640  1.00 34.70 ? 725  ILE A C   1 
ATOM   5645  O  O   . ILE A 1 725  ? 12.788  96.806  16.354  1.00 36.01 ? 725  ILE A O   1 
ATOM   5646  C  CB  . ILE A 1 725  ? 12.492  97.050  13.437  1.00 32.90 ? 725  ILE A CB  1 
ATOM   5647  C  CG1 . ILE A 1 725  ? 13.502  95.944  13.178  1.00 32.57 ? 725  ILE A CG1 1 
ATOM   5648  C  CG2 . ILE A 1 725  ? 12.048  97.710  12.162  1.00 32.66 ? 725  ILE A CG2 1 
ATOM   5649  C  CD1 . ILE A 1 725  ? 12.865  94.648  12.760  1.00 32.41 ? 725  ILE A CD1 1 
ATOM   5650  N  N   . GLN A 1 726  ? 14.868  97.470  15.904  1.00 35.02 ? 726  GLN A N   1 
ATOM   5651  C  CA  . GLN A 1 726  ? 15.411  96.821  17.089  1.00 36.05 ? 726  GLN A CA  1 
ATOM   5652  C  C   . GLN A 1 726  ? 15.505  97.769  18.275  1.00 34.66 ? 726  GLN A C   1 
ATOM   5653  O  O   . GLN A 1 726  ? 15.641  97.329  19.412  1.00 34.15 ? 726  GLN A O   1 
ATOM   5654  C  CB  . GLN A 1 726  ? 16.795  96.251  16.792  1.00 37.31 ? 726  GLN A CB  1 
ATOM   5655  C  CG  . GLN A 1 726  ? 16.769  95.131  15.803  1.00 39.44 ? 726  GLN A CG  1 
ATOM   5656  C  CD  . GLN A 1 726  ? 17.503  95.483  14.537  1.00 41.36 ? 726  GLN A CD  1 
ATOM   5657  O  OE1 . GLN A 1 726  ? 16.926  96.028  13.597  1.00 41.85 ? 726  GLN A OE1 1 
ATOM   5658  N  NE2 . GLN A 1 726  ? 18.794  95.183  14.505  1.00 43.74 ? 726  GLN A NE2 1 
ATOM   5659  N  N   . ARG A 1 727  ? 15.425  99.068  18.004  1.00 33.27 ? 727  ARG A N   1 
ATOM   5660  C  CA  . ARG A 1 727  ? 15.533  100.068 19.056  1.00 32.01 ? 727  ARG A CA  1 
ATOM   5661  C  C   . ARG A 1 727  ? 14.401  101.082 19.134  1.00 30.92 ? 727  ARG A C   1 
ATOM   5662  O  O   . ARG A 1 727  ? 14.034  101.514 20.223  1.00 31.51 ? 727  ARG A O   1 
ATOM   5663  C  CB  . ARG A 1 727  ? 16.838  100.842 18.894  1.00 31.74 ? 727  ARG A CB  1 
ATOM   5664  C  CG  . ARG A 1 727  ? 18.104  100.012 18.991  1.00 32.11 ? 727  ARG A CG  1 
ATOM   5665  C  CD  . ARG A 1 727  ? 19.323  100.869 18.652  1.00 33.25 ? 727  ARG A CD  1 
ATOM   5666  N  NE  . ARG A 1 727  ? 19.393  102.101 19.443  1.00 33.30 ? 727  ARG A NE  1 
ATOM   5667  C  CZ  . ARG A 1 727  ? 19.775  102.154 20.717  1.00 34.88 ? 727  ARG A CZ  1 
ATOM   5668  N  NH1 . ARG A 1 727  ? 20.130  101.047 21.371  1.00 33.99 ? 727  ARG A NH1 1 
ATOM   5669  N  NH2 . ARG A 1 727  ? 19.812  103.320 21.348  1.00 35.27 ? 727  ARG A NH2 1 
ATOM   5670  N  N   . ASN A 1 728  ? 13.845  101.452 17.989  1.00 29.35 ? 728  ASN A N   1 
ATOM   5671  C  CA  . ASN A 1 728  ? 12.816  102.478 17.949  1.00 28.36 ? 728  ASN A CA  1 
ATOM   5672  C  C   . ASN A 1 728  ? 11.398  102.095 17.584  1.00 26.84 ? 728  ASN A C   1 
ATOM   5673  O  O   . ASN A 1 728  ? 10.552  102.979 17.463  1.00 25.50 ? 728  ASN A O   1 
ATOM   5674  C  CB  . ASN A 1 728  ? 13.282  103.571 17.000  1.00 29.53 ? 728  ASN A CB  1 
ATOM   5675  C  CG  . ASN A 1 728  ? 14.599  104.163 17.428  1.00 31.34 ? 728  ASN A CG  1 
ATOM   5676  O  OD1 . ASN A 1 728  ? 14.642  105.061 18.270  1.00 35.32 ? 728  ASN A OD1 1 
ATOM   5677  N  ND2 . ASN A 1 728  ? 15.686  103.646 16.875  1.00 31.57 ? 728  ASN A ND2 1 
ATOM   5678  N  N   . TYR A 1 729  ? 11.137  100.802 17.394  1.00 25.53 ? 729  TYR A N   1 
ATOM   5679  C  CA  . TYR A 1 729  ? 9.806   100.355 17.033  1.00 24.49 ? 729  TYR A CA  1 
ATOM   5680  C  C   . TYR A 1 729  ? 9.394   99.119  17.839  1.00 25.23 ? 729  TYR A C   1 
ATOM   5681  O  O   . TYR A 1 729  ? 10.006  98.052  17.745  1.00 25.25 ? 729  TYR A O   1 
ATOM   5682  C  CB  . TYR A 1 729  ? 9.748   100.069 15.529  1.00 23.60 ? 729  TYR A CB  1 
ATOM   5683  C  CG  . TYR A 1 729  ? 8.358   99.798  15.032  1.00 23.90 ? 729  TYR A CG  1 
ATOM   5684  C  CD1 . TYR A 1 729  ? 7.389   100.793 15.063  1.00 23.86 ? 729  TYR A CD1 1 
ATOM   5685  C  CD2 . TYR A 1 729  ? 7.998   98.538  14.557  1.00 22.28 ? 729  TYR A CD2 1 
ATOM   5686  C  CE1 . TYR A 1 729  ? 6.084   100.541 14.633  1.00 23.71 ? 729  TYR A CE1 1 
ATOM   5687  C  CE2 . TYR A 1 729  ? 6.706   98.276  14.125  1.00 22.70 ? 729  TYR A CE2 1 
ATOM   5688  C  CZ  . TYR A 1 729  ? 5.753   99.282  14.171  1.00 23.37 ? 729  TYR A CZ  1 
ATOM   5689  O  OH  . TYR A 1 729  ? 4.457   99.023  13.788  1.00 19.84 ? 729  TYR A OH  1 
ATOM   5690  N  N   . VAL A 1 730  ? 8.353   99.280  18.644  1.00 25.09 ? 730  VAL A N   1 
ATOM   5691  C  CA  . VAL A 1 730  ? 7.852   98.189  19.460  1.00 24.49 ? 730  VAL A CA  1 
ATOM   5692  C  C   . VAL A 1 730  ? 6.484   97.803  18.937  1.00 24.43 ? 730  VAL A C   1 
ATOM   5693  O  O   . VAL A 1 730  ? 5.616   98.673  18.772  1.00 25.12 ? 730  VAL A O   1 
ATOM   5694  C  CB  . VAL A 1 730  ? 7.695   98.619  20.930  1.00 24.55 ? 730  VAL A CB  1 
ATOM   5695  C  CG1 . VAL A 1 730  ? 7.328   97.420  21.776  1.00 23.44 ? 730  VAL A CG1 1 
ATOM   5696  C  CG2 . VAL A 1 730  ? 8.973   99.270  21.427  1.00 25.02 ? 730  VAL A CG2 1 
ATOM   5697  N  N   . CYS A 1 731  ? 6.272   96.518  18.675  1.00 23.49 ? 731  CYS A N   1 
ATOM   5698  C  CA  . CYS A 1 731  ? 4.963   96.108  18.178  1.00 24.73 ? 731  CYS A CA  1 
ATOM   5699  C  C   . CYS A 1 731  ? 4.437   94.819  18.772  1.00 25.18 ? 731  CYS A C   1 
ATOM   5700  O  O   . CYS A 1 731  ? 5.191   94.037  19.360  1.00 25.69 ? 731  CYS A O   1 
ATOM   5701  C  CB  . CYS A 1 731  ? 4.970   96.001  16.647  1.00 24.57 ? 731  CYS A CB  1 
ATOM   5702  S  SG  . CYS A 1 731  ? 6.257   94.930  15.943  1.00 25.84 ? 731  CYS A SG  1 
ATOM   5703  N  N   . GLN A 1 732  ? 3.126   94.645  18.633  1.00 26.01 ? 732  GLN A N   1 
ATOM   5704  C  CA  . GLN A 1 732  ? 2.399   93.470  19.091  1.00 26.00 ? 732  GLN A CA  1 
ATOM   5705  C  C   . GLN A 1 732  ? 1.116   93.423  18.265  1.00 26.16 ? 732  GLN A C   1 
ATOM   5706  O  O   . GLN A 1 732  ? 0.292   94.330  18.337  1.00 25.23 ? 732  GLN A O   1 
ATOM   5707  C  CB  . GLN A 1 732  ? 2.048   93.574  20.577  1.00 25.39 ? 732  GLN A CB  1 
ATOM   5708  C  CG  . GLN A 1 732  ? 1.384   92.301  21.148  1.00 25.69 ? 732  GLN A CG  1 
ATOM   5709  C  CD  . GLN A 1 732  ? 0.775   92.502  22.542  1.00 28.67 ? 732  GLN A CD  1 
ATOM   5710  O  OE1 . GLN A 1 732  ? 1.472   92.842  23.514  1.00 27.84 ? 732  GLN A OE1 1 
ATOM   5711  N  NE2 . GLN A 1 732  ? -0.535  92.291  22.643  1.00 28.78 ? 732  GLN A NE2 1 
ATOM   5712  N  N   . GLY A 1 733  ? 0.953   92.372  17.472  1.00 26.78 ? 733  GLY A N   1 
ATOM   5713  C  CA  . GLY A 1 733  ? -0.238  92.261  16.654  1.00 28.10 ? 733  GLY A CA  1 
ATOM   5714  C  C   . GLY A 1 733  ? -0.308  93.393  15.651  1.00 29.38 ? 733  GLY A C   1 
ATOM   5715  O  O   . GLY A 1 733  ? 0.610   93.585  14.866  1.00 30.61 ? 733  GLY A O   1 
ATOM   5716  N  N   . ASP A 1 734  ? -1.387  94.163  15.678  1.00 31.89 ? 734  ASP A N   1 
ATOM   5717  C  CA  . ASP A 1 734  ? -1.530  95.254  14.726  1.00 33.48 ? 734  ASP A CA  1 
ATOM   5718  C  C   . ASP A 1 734  ? -1.177  96.605  15.318  1.00 34.02 ? 734  ASP A C   1 
ATOM   5719  O  O   . ASP A 1 734  ? -1.183  97.613  14.617  1.00 35.49 ? 734  ASP A O   1 
ATOM   5720  C  CB  . ASP A 1 734  ? -2.956  95.287  14.140  1.00 33.41 ? 734  ASP A CB  1 
ATOM   5721  C  CG  . ASP A 1 734  ? -4.045  95.256  15.210  1.00 36.68 ? 734  ASP A CG  1 
ATOM   5722  O  OD1 . ASP A 1 734  ? -3.840  95.831  16.313  1.00 37.31 ? 734  ASP A OD1 1 
ATOM   5723  O  OD2 . ASP A 1 734  ? -5.123  94.671  14.937  1.00 37.54 ? 734  ASP A OD2 1 
ATOM   5724  N  N   . ASP A 1 735  ? -0.851  96.633  16.605  1.00 35.08 ? 735  ASP A N   1 
ATOM   5725  C  CA  . ASP A 1 735  ? -0.501  97.902  17.240  1.00 36.03 ? 735  ASP A CA  1 
ATOM   5726  C  C   . ASP A 1 735  ? 1.014   98.106  17.302  1.00 35.90 ? 735  ASP A C   1 
ATOM   5727  O  O   . ASP A 1 735  ? 1.776   97.179  17.592  1.00 35.50 ? 735  ASP A O   1 
ATOM   5728  C  CB  . ASP A 1 735  ? -1.122  97.991  18.641  1.00 35.84 ? 735  ASP A CB  1 
ATOM   5729  C  CG  . ASP A 1 735  ? -1.192  99.431  19.171  1.00 39.07 ? 735  ASP A CG  1 
ATOM   5730  O  OD1 . ASP A 1 735  ? -2.030  100.251 18.704  1.00 40.59 ? 735  ASP A OD1 1 
ATOM   5731  O  OD2 . ASP A 1 735  ? -0.407  99.755  20.077  1.00 40.28 ? 735  ASP A OD2 1 
ATOM   5732  N  N   . GLY A 1 736  ? 1.440   99.331  17.007  1.00 36.17 ? 736  GLY A N   1 
ATOM   5733  C  CA  . GLY A 1 736  ? 2.854   99.649  17.018  1.00 35.23 ? 736  GLY A CA  1 
ATOM   5734  C  C   . GLY A 1 736  ? 3.137   101.030 17.582  1.00 34.92 ? 736  GLY A C   1 
ATOM   5735  O  O   . GLY A 1 736  ? 2.320   101.941 17.478  1.00 35.18 ? 736  GLY A O   1 
ATOM   5736  N  N   . LEU A 1 737  ? 4.303   101.178 18.197  1.00 33.15 ? 737  LEU A N   1 
ATOM   5737  C  CA  . LEU A 1 737  ? 4.708   102.446 18.773  1.00 32.35 ? 737  LEU A CA  1 
ATOM   5738  C  C   . LEU A 1 737  ? 6.064   102.822 18.185  1.00 33.04 ? 737  LEU A C   1 
ATOM   5739  O  O   . LEU A 1 737  ? 7.043   102.090 18.331  1.00 31.99 ? 737  LEU A O   1 
ATOM   5740  C  CB  . LEU A 1 737  ? 4.806   102.324 20.295  1.00 31.62 ? 737  LEU A CB  1 
ATOM   5741  C  CG  . LEU A 1 737  ? 5.182   103.580 21.093  1.00 30.72 ? 737  LEU A CG  1 
ATOM   5742  C  CD1 . LEU A 1 737  ? 4.140   104.661 20.868  1.00 30.55 ? 737  LEU A CD1 1 
ATOM   5743  C  CD2 . LEU A 1 737  ? 5.304   103.247 22.581  1.00 29.17 ? 737  LEU A CD2 1 
ATOM   5744  N  N   . MET A 1 738  ? 6.105   103.958 17.496  1.00 34.57 ? 738  MET A N   1 
ATOM   5745  C  CA  . MET A 1 738  ? 7.330   104.461 16.871  1.00 36.97 ? 738  MET A CA  1 
ATOM   5746  C  C   . MET A 1 738  ? 7.932   105.480 17.835  1.00 37.36 ? 738  MET A C   1 
ATOM   5747  O  O   . MET A 1 738  ? 7.427   106.597 17.971  1.00 37.92 ? 738  MET A O   1 
ATOM   5748  C  CB  . MET A 1 738  ? 7.004   105.141 15.539  1.00 39.63 ? 738  MET A CB  1 
ATOM   5749  C  CG  . MET A 1 738  ? 8.191   105.843 14.883  1.00 42.03 ? 738  MET A CG  1 
ATOM   5750  S  SD  . MET A 1 738  ? 9.532   104.686 14.580  1.00 48.56 ? 738  MET A SD  1 
ATOM   5751  C  CE  . MET A 1 738  ? 8.979   103.912 13.039  1.00 44.94 ? 738  MET A CE  1 
ATOM   5752  N  N   . ILE A 1 739  ? 9.007   105.092 18.509  1.00 36.68 ? 739  ILE A N   1 
ATOM   5753  C  CA  . ILE A 1 739  ? 9.648   105.967 19.483  1.00 36.29 ? 739  ILE A CA  1 
ATOM   5754  C  C   . ILE A 1 739  ? 10.880  106.702 18.943  1.00 36.74 ? 739  ILE A C   1 
ATOM   5755  O  O   . ILE A 1 739  ? 11.915  106.104 18.648  1.00 35.20 ? 739  ILE A O   1 
ATOM   5756  C  CB  . ILE A 1 739  ? 10.039  105.166 20.751  1.00 35.53 ? 739  ILE A CB  1 
ATOM   5757  C  CG1 . ILE A 1 739  ? 8.823   104.392 21.260  1.00 34.35 ? 739  ILE A CG1 1 
ATOM   5758  C  CG2 . ILE A 1 739  ? 10.558  106.108 21.835  1.00 33.67 ? 739  ILE A CG2 1 
ATOM   5759  C  CD1 . ILE A 1 739  ? 9.172   103.168 22.038  1.00 34.61 ? 739  ILE A CD1 1 
ATOM   5760  N  N   . ILE A 1 740  ? 10.762  108.016 18.837  1.00 38.50 ? 740  ILE A N   1 
ATOM   5761  C  CA  . ILE A 1 740  ? 11.849  108.838 18.336  1.00 40.67 ? 740  ILE A CA  1 
ATOM   5762  C  C   . ILE A 1 740  ? 12.547  109.611 19.452  1.00 42.74 ? 740  ILE A C   1 
ATOM   5763  O  O   . ILE A 1 740  ? 12.058  110.641 19.921  1.00 42.89 ? 740  ILE A O   1 
ATOM   5764  C  CB  . ILE A 1 740  ? 11.328  109.828 17.280  1.00 39.94 ? 740  ILE A CB  1 
ATOM   5765  C  CG1 . ILE A 1 740  ? 10.634  109.042 16.161  1.00 40.17 ? 740  ILE A CG1 1 
ATOM   5766  C  CG2 . ILE A 1 740  ? 12.472  110.688 16.745  1.00 38.43 ? 740  ILE A CG2 1 
ATOM   5767  C  CD1 . ILE A 1 740  ? 9.998   109.906 15.098  1.00 38.43 ? 740  ILE A CD1 1 
ATOM   5768  N  N   . ASP A 1 741  ? 13.693  109.094 19.880  1.00 45.08 ? 741  ASP A N   1 
ATOM   5769  C  CA  . ASP A 1 741  ? 14.474  109.744 20.923  1.00 48.23 ? 741  ASP A CA  1 
ATOM   5770  C  C   . ASP A 1 741  ? 14.879  111.146 20.456  1.00 51.44 ? 741  ASP A C   1 
ATOM   5771  O  O   . ASP A 1 741  ? 15.477  111.305 19.393  1.00 52.54 ? 741  ASP A O   1 
ATOM   5772  C  CB  . ASP A 1 741  ? 15.736  108.922 21.229  1.00 47.58 ? 741  ASP A CB  1 
ATOM   5773  C  CG  . ASP A 1 741  ? 15.426  107.559 21.850  1.00 46.37 ? 741  ASP A CG  1 
ATOM   5774  O  OD1 . ASP A 1 741  ? 16.348  106.741 22.007  1.00 47.46 ? 741  ASP A OD1 1 
ATOM   5775  O  OD2 . ASP A 1 741  ? 14.265  107.303 22.199  1.00 46.43 ? 741  ASP A OD2 1 
ATOM   5776  N  N   . GLY A 1 742  ? 14.549  112.165 21.244  1.00 53.99 ? 742  GLY A N   1 
ATOM   5777  C  CA  . GLY A 1 742  ? 14.918  113.525 20.879  1.00 57.48 ? 742  GLY A CA  1 
ATOM   5778  C  C   . GLY A 1 742  ? 16.410  113.723 21.081  1.00 59.83 ? 742  GLY A C   1 
ATOM   5779  O  O   . GLY A 1 742  ? 17.185  112.764 20.971  1.00 59.27 ? 742  GLY A O   1 
ATOM   5780  N  N   . THR A 1 743  ? 16.823  114.949 21.363  1.00 63.47 ? 743  THR A N   1 
ATOM   5781  C  CA  . THR A 1 743  ? 18.217  115.286 21.610  1.00 66.91 ? 743  THR A CA  1 
ATOM   5782  C  C   . THR A 1 743  ? 18.332  116.462 22.564  1.00 67.64 ? 743  THR A C   1 
ATOM   5783  O  O   . THR A 1 743  ? 17.305  116.908 23.107  1.00 67.52 ? 743  THR A O   1 
ATOM   5784  C  CB  . THR A 1 743  ? 18.958  115.632 20.319  1.00 67.84 ? 743  THR A CB  1 
ATOM   5785  O  OG1 . THR A 1 743  ? 18.930  114.510 19.431  1.00 67.24 ? 743  THR A OG1 1 
ATOM   5786  C  CG2 . THR A 1 743  ? 20.400  116.013 20.620  1.00 67.37 ? 743  THR A CG2 1 
ATOM   5787  N  N   . THR A 1 744  ? 19.533  116.966 22.778  1.00 69.25 ? 744  THR A N   1 
ATOM   5788  C  CA  . THR A 1 744  ? 19.707  118.123 23.657  1.00 71.02 ? 744  THR A CA  1 
ATOM   5789  C  C   . THR A 1 744  ? 19.016  119.300 22.956  1.00 70.78 ? 744  THR A C   1 
ATOM   5790  O  O   . THR A 1 744  ? 18.328  120.112 23.593  1.00 71.52 ? 744  THR A O   1 
ATOM   5791  C  CB  . THR A 1 744  ? 21.211  118.467 23.872  1.00 70.67 ? 744  THR A CB  1 
ATOM   5792  O  OG1 . THR A 1 744  ? 21.870  117.370 24.518  1.00 70.19 ? 744  THR A OG1 1 
ATOM   5793  C  CG2 . THR A 1 744  ? 21.358  119.716 24.739  1.00 70.55 ? 744  THR A CG2 1 
ATOM   5794  N  N   . ALA A 1 745  ? 19.199  119.366 21.635  1.00 69.93 ? 745  ALA A N   1 
ATOM   5795  C  CA  . ALA A 1 745  ? 18.609  120.415 20.809  1.00 69.07 ? 745  ALA A CA  1 
ATOM   5796  C  C   . ALA A 1 745  ? 17.086  120.291 20.785  1.00 68.26 ? 745  ALA A C   1 
ATOM   5797  O  O   . ALA A 1 745  ? 16.406  120.949 19.990  1.00 68.76 ? 745  ALA A O   1 
ATOM   5798  C  CB  . ALA A 1 745  ? 19.163  120.331 19.387  1.00 68.69 ? 745  ALA A CB  1 
ATOM   5799  N  N   . GLY A 1 746  ? 16.556  119.442 21.657  1.00 67.32 ? 746  GLY A N   1 
ATOM   5800  C  CA  . GLY A 1 746  ? 15.120  119.252 21.718  1.00 65.37 ? 746  GLY A CA  1 
ATOM   5801  C  C   . GLY A 1 746  ? 14.639  118.099 20.858  1.00 63.88 ? 746  GLY A C   1 
ATOM   5802  O  O   . GLY A 1 746  ? 15.392  117.165 20.556  1.00 64.45 ? 746  GLY A O   1 
ATOM   5803  N  N   . LYS A 1 747  ? 13.379  118.167 20.450  1.00 61.62 ? 747  LYS A N   1 
ATOM   5804  C  CA  . LYS A 1 747  ? 12.796  117.113 19.648  1.00 58.93 ? 747  LYS A CA  1 
ATOM   5805  C  C   . LYS A 1 747  ? 12.949  117.319 18.154  1.00 58.63 ? 747  LYS A C   1 
ATOM   5806  O  O   . LYS A 1 747  ? 13.149  118.442 17.676  1.00 58.68 ? 747  LYS A O   1 
ATOM   5807  C  CB  . LYS A 1 747  ? 11.317  116.943 20.010  1.00 57.35 ? 747  LYS A CB  1 
ATOM   5808  C  CG  . LYS A 1 747  ? 10.529  118.231 20.164  1.00 53.89 ? 747  LYS A CG  1 
ATOM   5809  C  CD  . LYS A 1 747  ? 9.104   117.913 20.596  1.00 51.74 ? 747  LYS A CD  1 
ATOM   5810  C  CE  . LYS A 1 747  ? 8.218   119.147 20.545  1.00 51.34 ? 747  LYS A CE  1 
ATOM   5811  N  NZ  . LYS A 1 747  ? 6.793   118.757 20.622  1.00 49.44 ? 747  LYS A NZ  1 
ATOM   5812  N  N   . VAL A 1 748  ? 12.860  116.207 17.427  1.00 57.55 ? 748  VAL A N   1 
ATOM   5813  C  CA  . VAL A 1 748  ? 12.971  116.194 15.968  1.00 56.29 ? 748  VAL A CA  1 
ATOM   5814  C  C   . VAL A 1 748  ? 11.850  117.019 15.332  1.00 55.36 ? 748  VAL A C   1 
ATOM   5815  O  O   . VAL A 1 748  ? 10.744  117.105 15.873  1.00 55.24 ? 748  VAL A O   1 
ATOM   5816  C  CB  . VAL A 1 748  ? 12.906  114.735 15.441  1.00 55.81 ? 748  VAL A CB  1 
ATOM   5817  C  CG1 . VAL A 1 748  ? 12.652  114.711 13.955  1.00 55.49 ? 748  VAL A CG1 1 
ATOM   5818  C  CG2 . VAL A 1 748  ? 14.198  114.024 15.758  1.00 55.89 ? 748  VAL A CG2 1 
ATOM   5819  N  N   . ASN A 1 749  ? 12.147  117.613 14.178  1.00 54.40 ? 749  ASN A N   1 
ATOM   5820  C  CA  . ASN A 1 749  ? 11.189  118.441 13.450  1.00 53.15 ? 749  ASN A CA  1 
ATOM   5821  C  C   . ASN A 1 749  ? 9.885   117.699 13.116  1.00 52.31 ? 749  ASN A C   1 
ATOM   5822  O  O   . ASN A 1 749  ? 9.911   116.603 12.565  1.00 52.35 ? 749  ASN A O   1 
ATOM   5823  C  CB  . ASN A 1 749  ? 11.833  118.948 12.159  1.00 53.03 ? 749  ASN A CB  1 
ATOM   5824  C  CG  . ASN A 1 749  ? 10.975  119.974 11.445  1.00 52.60 ? 749  ASN A CG  1 
ATOM   5825  O  OD1 . ASN A 1 749  ? 10.996  121.158 11.778  1.00 52.00 ? 749  ASN A OD1 1 
ATOM   5826  N  ND2 . ASN A 1 749  ? 10.198  119.520 10.471  1.00 52.36 ? 749  ASN A ND2 1 
ATOM   5827  N  N   . SER A 1 750  ? 8.754   118.317 13.451  1.00 51.16 ? 750  SER A N   1 
ATOM   5828  C  CA  . SER A 1 750  ? 7.427   117.754 13.215  1.00 50.73 ? 750  SER A CA  1 
ATOM   5829  C  C   . SER A 1 750  ? 7.135   117.537 11.723  1.00 49.97 ? 750  SER A C   1 
ATOM   5830  O  O   . SER A 1 750  ? 6.520   116.545 11.317  1.00 48.84 ? 750  SER A O   1 
ATOM   5831  C  CB  . SER A 1 750  ? 6.370   118.693 13.801  1.00 50.75 ? 750  SER A CB  1 
ATOM   5832  O  OG  . SER A 1 750  ? 5.055   118.226 13.524  1.00 53.25 ? 750  SER A OG  1 
ATOM   5833  N  N   . GLU A 1 751  ? 7.568   118.496 10.919  1.00 49.81 ? 751  GLU A N   1 
ATOM   5834  C  CA  . GLU A 1 751  ? 7.391   118.462 9.477   1.00 49.18 ? 751  GLU A CA  1 
ATOM   5835  C  C   . GLU A 1 751  ? 8.199   117.286 8.895   1.00 47.01 ? 751  GLU A C   1 
ATOM   5836  O  O   . GLU A 1 751  ? 7.711   116.554 8.035   1.00 46.32 ? 751  GLU A O   1 
ATOM   5837  C  CB  . GLU A 1 751  ? 7.875   119.797 8.920   1.00 51.67 ? 751  GLU A CB  1 
ATOM   5838  C  CG  . GLU A 1 751  ? 7.777   120.002 7.436   1.00 56.79 ? 751  GLU A CG  1 
ATOM   5839  C  CD  . GLU A 1 751  ? 8.274   121.383 7.052   1.00 59.96 ? 751  GLU A CD  1 
ATOM   5840  O  OE1 . GLU A 1 751  ? 7.705   122.375 7.559   1.00 62.06 ? 751  GLU A OE1 1 
ATOM   5841  O  OE2 . GLU A 1 751  ? 9.235   121.480 6.256   1.00 60.56 ? 751  GLU A OE2 1 
ATOM   5842  N  N   . THR A 1 752  ? 9.425   117.101 9.379   1.00 44.03 ? 752  THR A N   1 
ATOM   5843  C  CA  . THR A 1 752  ? 10.268  116.011 8.903   1.00 42.78 ? 752  THR A CA  1 
ATOM   5844  C  C   . THR A 1 752  ? 9.604   114.684 9.255   1.00 43.43 ? 752  THR A C   1 
ATOM   5845  O  O   . THR A 1 752  ? 9.696   113.721 8.493   1.00 44.38 ? 752  THR A O   1 
ATOM   5846  C  CB  . THR A 1 752  ? 11.676  116.030 9.555   1.00 41.87 ? 752  THR A CB  1 
ATOM   5847  O  OG1 . THR A 1 752  ? 12.292  117.300 9.345   1.00 39.37 ? 752  THR A OG1 1 
ATOM   5848  C  CG2 . THR A 1 752  ? 12.563  114.952 8.947   1.00 39.41 ? 752  THR A CG2 1 
ATOM   5849  N  N   . ILE A 1 753  ? 8.953   114.638 10.414  1.00 41.97 ? 753  ILE A N   1 
ATOM   5850  C  CA  . ILE A 1 753  ? 8.263   113.439 10.865  1.00 41.50 ? 753  ILE A CA  1 
ATOM   5851  C  C   . ILE A 1 753  ? 7.015   113.211 10.021  1.00 41.65 ? 753  ILE A C   1 
ATOM   5852  O  O   . ILE A 1 753  ? 6.728   112.082 9.617   1.00 41.15 ? 753  ILE A O   1 
ATOM   5853  C  CB  . ILE A 1 753  ? 7.869   113.570 12.344  1.00 41.51 ? 753  ILE A CB  1 
ATOM   5854  C  CG1 . ILE A 1 753  ? 9.124   113.489 13.206  1.00 41.40 ? 753  ILE A CG1 1 
ATOM   5855  C  CG2 . ILE A 1 753  ? 6.870   112.485 12.744  1.00 41.19 ? 753  ILE A CG2 1 
ATOM   5856  C  CD1 . ILE A 1 753  ? 8.864   113.805 14.667  1.00 41.50 ? 753  ILE A CD1 1 
ATOM   5857  N  N   . GLN A 1 754  ? 6.284   114.285 9.741   1.00 41.93 ? 754  GLN A N   1 
ATOM   5858  C  CA  . GLN A 1 754  ? 5.073   114.182 8.942   1.00 43.68 ? 754  GLN A CA  1 
ATOM   5859  C  C   . GLN A 1 754  ? 5.357   113.624 7.546   1.00 44.15 ? 754  GLN A C   1 
ATOM   5860  O  O   . GLN A 1 754  ? 4.598   112.806 7.038   1.00 42.78 ? 754  GLN A O   1 
ATOM   5861  C  CB  . GLN A 1 754  ? 4.404   115.547 8.830   1.00 45.55 ? 754  GLN A CB  1 
ATOM   5862  C  CG  . GLN A 1 754  ? 3.248   115.767 9.800   1.00 49.05 ? 754  GLN A CG  1 
ATOM   5863  C  CD  . GLN A 1 754  ? 2.772   117.210 9.772   1.00 51.26 ? 754  GLN A CD  1 
ATOM   5864  O  OE1 . GLN A 1 754  ? 3.391   118.104 10.337  1.00 51.52 ? 754  GLN A OE1 1 
ATOM   5865  N  NE2 . GLN A 1 754  ? 1.685   117.666 9.156   1.00 52.17 ? 754  GLN A NE2 1 
ATOM   5866  N  N   . ASN A 1 755  ? 6.460   114.052 6.934   1.00 45.14 ? 755  ASN A N   1 
ATOM   5867  C  CA  . ASN A 1 755  ? 6.851   113.600 5.605   1.00 46.98 ? 755  ASN A CA  1 
ATOM   5868  C  C   . ASN A 1 755  ? 7.075   112.075 5.604   1.00 46.45 ? 755  ASN A C   1 
ATOM   5869  O  O   . ASN A 1 755  ? 6.516   111.326 4.803   1.00 45.47 ? 755  ASN A O   1 
ATOM   5870  C  CB  . ASN A 1 755  ? 8.063   114.379 5.121   1.00 50.74 ? 755  ASN A CB  1 
ATOM   5871  C  CG  . ASN A 1 755  ? 7.766   115.867 4.989   1.00 56.64 ? 755  ASN A CG  1 
ATOM   5872  O  OD1 . ASN A 1 755  ? 8.631   116.685 5.300   1.00 58.13 ? 755  ASN A OD1 1 
ATOM   5873  N  ND2 . ASN A 1 755  ? 6.563   116.222 4.552   1.00 58.55 ? 755  ASN A ND2 1 
ATOM   5874  N  N   . ASP A 1 756  ? 7.892   111.654 6.548   1.00 46.34 ? 756  ASP A N   1 
ATOM   5875  C  CA  . ASP A 1 756  ? 8.278   110.291 6.736   1.00 45.73 ? 756  ASP A CA  1 
ATOM   5876  C  C   . ASP A 1 756  ? 7.124   109.364 7.154   1.00 43.55 ? 756  ASP A C   1 
ATOM   5877  O  O   . ASP A 1 756  ? 7.221   108.152 7.014   1.00 44.14 ? 756  ASP A O   1 
ATOM   5878  C  CB  . ASP A 1 756  ? 9.453   110.318 7.703   1.00 48.19 ? 756  ASP A CB  1 
ATOM   5879  C  CG  . ASP A 1 756  ? 9.489   109.073 8.545   1.00 51.58 ? 756  ASP A CG  1 
ATOM   5880  O  OD1 . ASP A 1 756  ? 8.471   108.709 9.152   1.00 56.84 ? 756  ASP A OD1 1 
ATOM   5881  O  OD2 . ASP A 1 756  ? 10.561  108.429 8.598   1.00 52.94 ? 756  ASP A OD2 1 
ATOM   5882  N  N   . LEU A 1 757  ? 6.005   109.933 7.669   1.00 42.01 ? 757  LEU A N   1 
ATOM   5883  C  CA  . LEU A 1 757  ? 4.773   109.190 8.041   1.00 41.42 ? 757  LEU A CA  1 
ATOM   5884  C  C   . LEU A 1 757  ? 3.890   109.038 6.820   1.00 40.65 ? 757  LEU A C   1 
ATOM   5885  O  O   . LEU A 1 757  ? 3.178   108.029 6.684   1.00 40.02 ? 757  LEU A O   1 
ATOM   5886  C  CB  . LEU A 1 757  ? 3.984   109.929 9.127   1.00 41.79 ? 757  LEU A CB  1 
ATOM   5887  C  CG  . LEU A 1 757  ? 4.595   109.923 10.550  1.00 42.68 ? 757  LEU A CG  1 
ATOM   5888  C  CD1 . LEU A 1 757  ? 3.821   110.843 11.474  1.00 42.23 ? 757  LEU A CD1 1 
ATOM   5889  C  CD2 . LEU A 1 757  ? 4.617   108.501 11.107  1.00 43.14 ? 757  LEU A CD2 1 
ATOM   5890  N  N   . GLU A 1 758  ? 3.938   110.035 5.938   1.00 40.47 ? 758  GLU A N   1 
ATOM   5891  C  CA  . GLU A 1 758  ? 3.158   109.985 4.699   1.00 41.26 ? 758  GLU A CA  1 
ATOM   5892  C  C   . GLU A 1 758  ? 3.755   108.916 3.786   1.00 39.92 ? 758  GLU A C   1 
ATOM   5893  O  O   . GLU A 1 758  ? 3.030   108.223 3.075   1.00 38.60 ? 758  GLU A O   1 
ATOM   5894  C  CB  . GLU A 1 758  ? 3.160   111.351 3.997   1.00 44.59 ? 758  GLU A CB  1 
ATOM   5895  C  CG  . GLU A 1 758  ? 2.711   112.499 4.894   1.00 50.37 ? 758  GLU A CG  1 
ATOM   5896  C  CD  . GLU A 1 758  ? 2.867   113.864 4.234   1.00 53.46 ? 758  GLU A CD  1 
ATOM   5897  O  OE1 . GLU A 1 758  ? 3.894   114.083 3.548   1.00 54.15 ? 758  GLU A OE1 1 
ATOM   5898  O  OE2 . GLU A 1 758  ? 1.964   114.722 4.414   1.00 54.66 ? 758  GLU A OE2 1 
ATOM   5899  N  N   . LEU A 1 759  ? 5.080   108.786 3.815   1.00 37.90 ? 759  LEU A N   1 
ATOM   5900  C  CA  . LEU A 1 759  ? 5.758   107.772 3.015   1.00 36.67 ? 759  LEU A CA  1 
ATOM   5901  C  C   . LEU A 1 759  ? 5.342   106.389 3.519   1.00 35.85 ? 759  LEU A C   1 
ATOM   5902  O  O   . LEU A 1 759  ? 5.111   105.468 2.721   1.00 35.22 ? 759  LEU A O   1 
ATOM   5903  C  CB  . LEU A 1 759  ? 7.282   107.915 3.120   1.00 35.94 ? 759  LEU A CB  1 
ATOM   5904  C  CG  . LEU A 1 759  ? 7.880   109.180 2.509   1.00 35.31 ? 759  LEU A CG  1 
ATOM   5905  C  CD1 . LEU A 1 759  ? 9.396   109.158 2.677   1.00 35.75 ? 759  LEU A CD1 1 
ATOM   5906  C  CD2 . LEU A 1 759  ? 7.499   109.267 1.041   1.00 34.58 ? 759  LEU A CD2 1 
ATOM   5907  N  N   . ILE A 1 760  ? 5.254   106.248 4.843   1.00 34.84 ? 760  ILE A N   1 
ATOM   5908  C  CA  . ILE A 1 760  ? 4.847   104.984 5.448   1.00 33.13 ? 760  ILE A CA  1 
ATOM   5909  C  C   . ILE A 1 760  ? 3.450   104.622 4.958   1.00 32.34 ? 760  ILE A C   1 
ATOM   5910  O  O   . ILE A 1 760  ? 3.190   103.481 4.560   1.00 31.27 ? 760  ILE A O   1 
ATOM   5911  C  CB  . ILE A 1 760  ? 4.826   105.078 7.004   1.00 32.96 ? 760  ILE A CB  1 
ATOM   5912  C  CG1 . ILE A 1 760  ? 6.252   104.961 7.550   1.00 30.83 ? 760  ILE A CG1 1 
ATOM   5913  C  CG2 . ILE A 1 760  ? 3.917   103.985 7.608   1.00 30.97 ? 760  ILE A CG2 1 
ATOM   5914  C  CD1 . ILE A 1 760  ? 6.359   105.180 9.041   1.00 28.92 ? 760  ILE A CD1 1 
ATOM   5915  N  N   . SER A 1 761  ? 2.560   105.606 4.986   1.00 31.93 ? 761  SER A N   1 
ATOM   5916  C  CA  . SER A 1 761  ? 1.175   105.409 4.566   1.00 32.45 ? 761  SER A CA  1 
ATOM   5917  C  C   . SER A 1 761  ? 1.078   104.911 3.129   1.00 31.78 ? 761  SER A C   1 
ATOM   5918  O  O   . SER A 1 761  ? 0.408   103.913 2.861   1.00 31.76 ? 761  SER A O   1 
ATOM   5919  C  CB  . SER A 1 761  ? 0.394   106.714 4.722   1.00 32.90 ? 761  SER A CB  1 
ATOM   5920  O  OG  . SER A 1 761  ? -0.991  106.454 4.737   1.00 37.58 ? 761  SER A OG  1 
ATOM   5921  N  N   . LYS A 1 762  ? 1.750   105.594 2.205   1.00 31.41 ? 762  LYS A N   1 
ATOM   5922  C  CA  . LYS A 1 762  ? 1.724   105.182 0.798   1.00 32.76 ? 762  LYS A CA  1 
ATOM   5923  C  C   . LYS A 1 762  ? 2.380   103.809 0.604   1.00 30.84 ? 762  LYS A C   1 
ATOM   5924  O  O   . LYS A 1 762  ? 1.951   103.007 -0.218  1.00 30.27 ? 762  LYS A O   1 
ATOM   5925  C  CB  . LYS A 1 762  ? 2.410   106.245 -0.080  1.00 34.47 ? 762  LYS A CB  1 
ATOM   5926  C  CG  . LYS A 1 762  ? 1.584   107.524 -0.255  1.00 38.67 ? 762  LYS A CG  1 
ATOM   5927  C  CD  . LYS A 1 762  ? 2.463   108.761 -0.494  1.00 42.58 ? 762  LYS A CD  1 
ATOM   5928  C  CE  . LYS A 1 762  ? 3.321   108.641 -1.754  1.00 44.22 ? 762  LYS A CE  1 
ATOM   5929  N  NZ  . LYS A 1 762  ? 4.254   109.801 -1.907  1.00 45.65 ? 762  LYS A NZ  1 
ATOM   5930  N  N   . TYR A 1 763  ? 3.415   103.539 1.383   1.00 30.65 ? 763  TYR A N   1 
ATOM   5931  C  CA  . TYR A 1 763  ? 4.127   102.273 1.307   1.00 29.79 ? 763  TYR A CA  1 
ATOM   5932  C  C   . TYR A 1 763  ? 3.206   101.082 1.612   1.00 29.04 ? 763  TYR A C   1 
ATOM   5933  O  O   . TYR A 1 763  ? 3.278   100.053 0.941   1.00 28.71 ? 763  TYR A O   1 
ATOM   5934  C  CB  . TYR A 1 763  ? 5.307   102.321 2.282   1.00 26.88 ? 763  TYR A CB  1 
ATOM   5935  C  CG  . TYR A 1 763  ? 5.900   100.978 2.666   1.00 27.12 ? 763  TYR A CG  1 
ATOM   5936  C  CD1 . TYR A 1 763  ? 6.612   100.208 1.749   1.00 26.31 ? 763  TYR A CD1 1 
ATOM   5937  C  CD2 . TYR A 1 763  ? 5.793   100.508 3.980   1.00 25.42 ? 763  TYR A CD2 1 
ATOM   5938  C  CE1 . TYR A 1 763  ? 7.216   99.005  2.145   1.00 27.39 ? 763  TYR A CE1 1 
ATOM   5939  C  CE2 . TYR A 1 763  ? 6.386   99.320  4.377   1.00 25.16 ? 763  TYR A CE2 1 
ATOM   5940  C  CZ  . TYR A 1 763  ? 7.095   98.576  3.466   1.00 25.41 ? 763  TYR A CZ  1 
ATOM   5941  O  OH  . TYR A 1 763  ? 7.700   97.419  3.884   1.00 26.67 ? 763  TYR A OH  1 
ATOM   5942  N  N   . GLY A 1 764  ? 2.339   101.238 2.615   1.00 28.61 ? 764  GLY A N   1 
ATOM   5943  C  CA  . GLY A 1 764  ? 1.426   100.169 2.993   1.00 30.04 ? 764  GLY A CA  1 
ATOM   5944  C  C   . GLY A 1 764  ? 0.398   99.787  1.938   1.00 31.15 ? 764  GLY A C   1 
ATOM   5945  O  O   . GLY A 1 764  ? 0.004   98.623  1.851   1.00 31.08 ? 764  GLY A O   1 
ATOM   5946  N  N   . GLU A 1 765  ? -0.042  100.768 1.149   1.00 31.81 ? 765  GLU A N   1 
ATOM   5947  C  CA  . GLU A 1 765  ? -1.021  100.563 0.087   1.00 32.46 ? 765  GLU A CA  1 
ATOM   5948  C  C   . GLU A 1 765  ? -0.460  99.628  -0.977  1.00 32.92 ? 765  GLU A C   1 
ATOM   5949  O  O   . GLU A 1 765  ? -1.197  99.014  -1.738  1.00 32.48 ? 765  GLU A O   1 
ATOM   5950  C  CB  . GLU A 1 765  ? -1.376  101.901 -0.560  1.00 35.00 ? 765  GLU A CB  1 
ATOM   5951  C  CG  . GLU A 1 765  ? -2.312  102.800 0.230   1.00 37.78 ? 765  GLU A CG  1 
ATOM   5952  C  CD  . GLU A 1 765  ? -2.344  104.226 -0.314  1.00 40.58 ? 765  GLU A CD  1 
ATOM   5953  O  OE1 . GLU A 1 765  ? -2.406  104.400 -1.553  1.00 42.82 ? 765  GLU A OE1 1 
ATOM   5954  O  OE2 . GLU A 1 765  ? -2.305  105.179 0.503   1.00 42.36 ? 765  GLU A OE2 1 
ATOM   5955  N  N   . GLU A 1 766  ? 0.858   99.528  -1.023  1.00 33.01 ? 766  GLU A N   1 
ATOM   5956  C  CA  . GLU A 1 766  ? 1.535   98.668  -1.979  1.00 33.40 ? 766  GLU A CA  1 
ATOM   5957  C  C   . GLU A 1 766  ? 1.251   97.193  -1.730  1.00 33.12 ? 766  GLU A C   1 
ATOM   5958  O  O   . GLU A 1 766  ? 1.164   96.406  -2.667  1.00 33.59 ? 766  GLU A O   1 
ATOM   5959  C  CB  . GLU A 1 766  ? 3.037   98.915  -1.904  1.00 35.84 ? 766  GLU A CB  1 
ATOM   5960  C  CG  . GLU A 1 766  ? 3.410   100.339 -2.220  1.00 37.36 ? 766  GLU A CG  1 
ATOM   5961  C  CD  . GLU A 1 766  ? 4.402   100.433 -3.345  1.00 39.02 ? 766  GLU A CD  1 
ATOM   5962  O  OE1 . GLU A 1 766  ? 5.399   99.676  -3.304  1.00 39.40 ? 766  GLU A OE1 1 
ATOM   5963  O  OE2 . GLU A 1 766  ? 4.187   101.262 -4.260  1.00 40.90 ? 766  GLU A OE2 1 
ATOM   5964  N  N   . PHE A 1 767  ? 1.110   96.810  -0.469  1.00 31.68 ? 767  PHE A N   1 
ATOM   5965  C  CA  . PHE A 1 767  ? 0.838   95.418  -0.160  1.00 30.44 ? 767  PHE A CA  1 
ATOM   5966  C  C   . PHE A 1 767  ? -0.468  95.172  0.599   1.00 30.71 ? 767  PHE A C   1 
ATOM   5967  O  O   . PHE A 1 767  ? -0.636  94.153  1.283   1.00 32.06 ? 767  PHE A O   1 
ATOM   5968  C  CB  . PHE A 1 767  ? 2.036   94.802  0.573   1.00 28.65 ? 767  PHE A CB  1 
ATOM   5969  C  CG  . PHE A 1 767  ? 2.648   95.697  1.614   1.00 27.83 ? 767  PHE A CG  1 
ATOM   5970  C  CD1 . PHE A 1 767  ? 2.210   95.651  2.939   1.00 27.45 ? 767  PHE A CD1 1 
ATOM   5971  C  CD2 . PHE A 1 767  ? 3.661   96.587  1.272   1.00 26.56 ? 767  PHE A CD2 1 
ATOM   5972  C  CE1 . PHE A 1 767  ? 2.771   96.478  3.910   1.00 27.04 ? 767  PHE A CE1 1 
ATOM   5973  C  CE2 . PHE A 1 767  ? 4.233   97.425  2.240   1.00 28.34 ? 767  PHE A CE2 1 
ATOM   5974  C  CZ  . PHE A 1 767  ? 3.787   97.369  3.557   1.00 27.23 ? 767  PHE A CZ  1 
ATOM   5975  N  N   . GLY A 1 768  ? -1.395  96.116  0.476   1.00 29.82 ? 768  GLY A N   1 
ATOM   5976  C  CA  . GLY A 1 768  ? -2.696  95.963  1.111   1.00 29.05 ? 768  GLY A CA  1 
ATOM   5977  C  C   . GLY A 1 768  ? -2.895  96.276  2.585   1.00 29.06 ? 768  GLY A C   1 
ATOM   5978  O  O   . GLY A 1 768  ? -3.865  95.828  3.191   1.00 28.83 ? 768  GLY A O   1 
ATOM   5979  N  N   . TRP A 1 769  ? -1.977  97.024  3.180   1.00 29.34 ? 769  TRP A N   1 
ATOM   5980  C  CA  . TRP A 1 769  ? -2.117  97.394  4.585   1.00 28.44 ? 769  TRP A CA  1 
ATOM   5981  C  C   . TRP A 1 769  ? -2.484  98.863  4.669   1.00 29.30 ? 769  TRP A C   1 
ATOM   5982  O  O   . TRP A 1 769  ? -1.857  99.719  4.032   1.00 29.22 ? 769  TRP A O   1 
ATOM   5983  C  CB  . TRP A 1 769  ? -0.817  97.180  5.354   1.00 26.92 ? 769  TRP A CB  1 
ATOM   5984  C  CG  . TRP A 1 769  ? -0.539  95.773  5.773   1.00 27.25 ? 769  TRP A CG  1 
ATOM   5985  C  CD1 . TRP A 1 769  ? -1.179  94.642  5.352   1.00 27.63 ? 769  TRP A CD1 1 
ATOM   5986  C  CD2 . TRP A 1 769  ? 0.484   95.339  6.683   1.00 26.39 ? 769  TRP A CD2 1 
ATOM   5987  N  NE1 . TRP A 1 769  ? -0.620  93.533  5.941   1.00 26.91 ? 769  TRP A NE1 1 
ATOM   5988  C  CE2 . TRP A 1 769  ? 0.401   93.935  6.763   1.00 26.19 ? 769  TRP A CE2 1 
ATOM   5989  C  CE3 . TRP A 1 769  ? 1.460   96.008  7.433   1.00 24.18 ? 769  TRP A CE3 1 
ATOM   5990  C  CZ2 . TRP A 1 769  ? 1.262   93.178  7.568   1.00 26.39 ? 769  TRP A CZ2 1 
ATOM   5991  C  CZ3 . TRP A 1 769  ? 2.315   95.260  8.227   1.00 25.00 ? 769  TRP A CZ3 1 
ATOM   5992  C  CH2 . TRP A 1 769  ? 2.210   93.855  8.289   1.00 25.87 ? 769  TRP A CH2 1 
ATOM   5993  N  N   . LYS A 1 770  ? -3.510  99.146  5.455   1.00 30.53 ? 770  LYS A N   1 
ATOM   5994  C  CA  . LYS A 1 770  ? -3.955  100.511 5.654   1.00 31.83 ? 770  LYS A CA  1 
ATOM   5995  C  C   . LYS A 1 770  ? -3.434  100.906 7.029   1.00 31.45 ? 770  LYS A C   1 
ATOM   5996  O  O   . LYS A 1 770  ? -3.968  100.488 8.044   1.00 31.29 ? 770  LYS A O   1 
ATOM   5997  C  CB  . LYS A 1 770  ? -5.482  100.587 5.639   1.00 34.69 ? 770  LYS A CB  1 
ATOM   5998  C  CG  . LYS A 1 770  ? -6.126  99.853  4.468   1.00 39.11 ? 770  LYS A CG  1 
ATOM   5999  C  CD  . LYS A 1 770  ? -7.602  100.215 4.357   1.00 43.46 ? 770  LYS A CD  1 
ATOM   6000  C  CE  . LYS A 1 770  ? -8.172  99.848  2.987   1.00 45.29 ? 770  LYS A CE  1 
ATOM   6001  N  NZ  . LYS A 1 770  ? -9.587  100.310 2.866   1.00 46.23 ? 770  LYS A NZ  1 
ATOM   6002  N  N   . TYR A 1 771  ? -2.368  101.689 7.057   1.00 31.08 ? 771  TYR A N   1 
ATOM   6003  C  CA  . TYR A 1 771  ? -1.801  102.126 8.315   1.00 31.78 ? 771  TYR A CA  1 
ATOM   6004  C  C   . TYR A 1 771  ? -2.669  103.182 8.938   1.00 32.98 ? 771  TYR A C   1 
ATOM   6005  O  O   . TYR A 1 771  ? -3.097  104.123 8.277   1.00 34.78 ? 771  TYR A O   1 
ATOM   6006  C  CB  . TYR A 1 771  ? -0.406  102.717 8.120   1.00 31.00 ? 771  TYR A CB  1 
ATOM   6007  C  CG  . TYR A 1 771  ? 0.698   101.694 8.000   1.00 30.69 ? 771  TYR A CG  1 
ATOM   6008  C  CD1 . TYR A 1 771  ? 1.055   100.888 9.083   1.00 28.99 ? 771  TYR A CD1 1 
ATOM   6009  C  CD2 . TYR A 1 771  ? 1.398   101.539 6.800   1.00 30.91 ? 771  TYR A CD2 1 
ATOM   6010  C  CE1 . TYR A 1 771  ? 2.078   99.958  8.972   1.00 29.32 ? 771  TYR A CE1 1 
ATOM   6011  C  CE2 . TYR A 1 771  ? 2.418   100.618 6.680   1.00 29.54 ? 771  TYR A CE2 1 
ATOM   6012  C  CZ  . TYR A 1 771  ? 2.754   99.832  7.770   1.00 29.58 ? 771  TYR A CZ  1 
ATOM   6013  O  OH  . TYR A 1 771  ? 3.758   98.916  7.639   1.00 31.22 ? 771  TYR A OH  1 
ATOM   6014  N  N   . ASP A 1 772  ? -2.919  103.027 10.224  1.00 34.03 ? 772  ASP A N   1 
ATOM   6015  C  CA  . ASP A 1 772  ? -3.714  103.979 10.964  1.00 34.43 ? 772  ASP A CA  1 
ATOM   6016  C  C   . ASP A 1 772  ? -2.676  104.669 11.829  1.00 33.18 ? 772  ASP A C   1 
ATOM   6017  O  O   . ASP A 1 772  ? -2.377  104.235 12.941  1.00 32.82 ? 772  ASP A O   1 
ATOM   6018  C  CB  . ASP A 1 772  ? -4.718  103.247 11.831  1.00 38.19 ? 772  ASP A CB  1 
ATOM   6019  C  CG  . ASP A 1 772  ? -5.935  104.078 12.118  1.00 42.74 ? 772  ASP A CG  1 
ATOM   6020  O  OD1 . ASP A 1 772  ? -5.780  105.287 12.408  1.00 43.65 ? 772  ASP A OD1 1 
ATOM   6021  O  OD2 . ASP A 1 772  ? -7.050  103.517 12.048  1.00 47.62 ? 772  ASP A OD2 1 
ATOM   6022  N  N   . ILE A 1 773  ? -2.107  105.736 11.290  1.00 32.13 ? 773  ILE A N   1 
ATOM   6023  C  CA  . ILE A 1 773  ? -1.052  106.476 11.961  1.00 31.50 ? 773  ILE A CA  1 
ATOM   6024  C  C   . ILE A 1 773  ? -1.578  107.705 12.667  1.00 31.22 ? 773  ILE A C   1 
ATOM   6025  O  O   . ILE A 1 773  ? -2.398  108.450 12.131  1.00 31.99 ? 773  ILE A O   1 
ATOM   6026  C  CB  . ILE A 1 773  ? 0.027   106.927 10.946  1.00 30.55 ? 773  ILE A CB  1 
ATOM   6027  C  CG1 . ILE A 1 773  ? 0.652   105.707 10.269  1.00 30.82 ? 773  ILE A CG1 1 
ATOM   6028  C  CG2 . ILE A 1 773  ? 1.097   107.730 11.640  1.00 29.97 ? 773  ILE A CG2 1 
ATOM   6029  C  CD1 . ILE A 1 773  ? 1.635   106.053 9.164   1.00 30.25 ? 773  ILE A CD1 1 
ATOM   6030  N  N   . ALA A 1 774  ? -1.097  107.919 13.877  1.00 30.83 ? 774  ALA A N   1 
ATOM   6031  C  CA  . ALA A 1 774  ? -1.505  109.078 14.647  1.00 31.37 ? 774  ALA A CA  1 
ATOM   6032  C  C   . ALA A 1 774  ? -0.268  109.754 15.218  1.00 31.74 ? 774  ALA A C   1 
ATOM   6033  O  O   . ALA A 1 774  ? 0.584   109.110 15.841  1.00 31.65 ? 774  ALA A O   1 
ATOM   6034  C  CB  . ALA A 1 774  ? -2.459  108.666 15.777  1.00 29.22 ? 774  ALA A CB  1 
ATOM   6035  N  N   . TYR A 1 775  ? -0.162  111.049 14.969  1.00 32.85 ? 775  TYR A N   1 
ATOM   6036  C  CA  . TYR A 1 775  ? 0.942   111.860 15.467  1.00 34.71 ? 775  TYR A CA  1 
ATOM   6037  C  C   . TYR A 1 775  ? 0.201   113.018 16.127  1.00 36.04 ? 775  TYR A C   1 
ATOM   6038  O  O   . TYR A 1 775  ? -0.317  113.913 15.443  1.00 36.19 ? 775  TYR A O   1 
ATOM   6039  C  CB  . TYR A 1 775  ? 1.819   112.323 14.300  1.00 35.58 ? 775  TYR A CB  1 
ATOM   6040  C  CG  . TYR A 1 775  ? 2.924   113.286 14.675  1.00 37.17 ? 775  TYR A CG  1 
ATOM   6041  C  CD1 . TYR A 1 775  ? 3.572   113.198 15.915  1.00 38.37 ? 775  TYR A CD1 1 
ATOM   6042  C  CD2 . TYR A 1 775  ? 3.351   114.270 13.774  1.00 36.64 ? 775  TYR A CD2 1 
ATOM   6043  C  CE1 . TYR A 1 775  ? 4.623   114.075 16.253  1.00 38.74 ? 775  TYR A CE1 1 
ATOM   6044  C  CE2 . TYR A 1 775  ? 4.392   115.145 14.094  1.00 37.80 ? 775  TYR A CE2 1 
ATOM   6045  C  CZ  . TYR A 1 775  ? 5.024   115.045 15.334  1.00 38.23 ? 775  TYR A CZ  1 
ATOM   6046  O  OH  . TYR A 1 775  ? 6.036   115.922 15.655  1.00 38.03 ? 775  TYR A OH  1 
ATOM   6047  N  N   . ASP A 1 776  ? 0.127   112.981 17.456  1.00 37.03 ? 776  ASP A N   1 
ATOM   6048  C  CA  . ASP A 1 776  ? -0.620  113.996 18.199  1.00 37.63 ? 776  ASP A CA  1 
ATOM   6049  C  C   . ASP A 1 776  ? -0.031  114.423 19.534  1.00 36.65 ? 776  ASP A C   1 
ATOM   6050  O  O   . ASP A 1 776  ? -0.753  114.951 20.374  1.00 37.89 ? 776  ASP A O   1 
ATOM   6051  C  CB  . ASP A 1 776  ? -2.049  113.493 18.444  1.00 38.40 ? 776  ASP A CB  1 
ATOM   6052  C  CG  . ASP A 1 776  ? -2.076  112.071 18.968  1.00 39.62 ? 776  ASP A CG  1 
ATOM   6053  O  OD1 . ASP A 1 776  ? -1.151  111.706 19.723  1.00 41.48 ? 776  ASP A OD1 1 
ATOM   6054  O  OD2 . ASP A 1 776  ? -3.012  111.319 18.635  1.00 37.52 ? 776  ASP A OD2 1 
ATOM   6055  N  N   . GLY A 1 777  ? 1.265   114.209 19.726  1.00 36.36 ? 777  GLY A N   1 
ATOM   6056  C  CA  . GLY A 1 777  ? 1.894   114.584 20.980  1.00 35.60 ? 777  GLY A CA  1 
ATOM   6057  C  C   . GLY A 1 777  ? 1.543   113.583 22.061  1.00 35.14 ? 777  GLY A C   1 
ATOM   6058  O  O   . GLY A 1 777  ? 1.906   113.746 23.218  1.00 36.09 ? 777  GLY A O   1 
ATOM   6059  N  N   . THR A 1 778  ? 0.852   112.525 21.665  1.00 34.80 ? 778  THR A N   1 
ATOM   6060  C  CA  . THR A 1 778  ? 0.407   111.484 22.584  1.00 33.53 ? 778  THR A CA  1 
ATOM   6061  C  C   . THR A 1 778  ? 0.955   110.102 22.225  1.00 32.72 ? 778  THR A C   1 
ATOM   6062  O  O   . THR A 1 778  ? 1.331   109.850 21.086  1.00 33.57 ? 778  THR A O   1 
ATOM   6063  C  CB  . THR A 1 778  ? -1.148  111.463 22.592  1.00 34.27 ? 778  THR A CB  1 
ATOM   6064  O  OG1 . THR A 1 778  ? -1.614  112.449 23.524  1.00 34.11 ? 778  THR A OG1 1 
ATOM   6065  C  CG2 . THR A 1 778  ? -1.710  110.072 22.925  1.00 33.81 ? 778  THR A CG2 1 
ATOM   6066  N  N   . ALA A 1 779  ? 1.014   109.216 23.208  1.00 31.52 ? 779  ALA A N   1 
ATOM   6067  C  CA  . ALA A 1 779  ? 1.478   107.852 22.995  1.00 30.97 ? 779  ALA A CA  1 
ATOM   6068  C  C   . ALA A 1 779  ? 0.335   106.909 23.310  1.00 31.49 ? 779  ALA A C   1 
ATOM   6069  O  O   . ALA A 1 779  ? -0.405  107.083 24.266  1.00 31.20 ? 779  ALA A O   1 
ATOM   6070  C  CB  . ALA A 1 779  ? 2.669   107.542 23.899  1.00 29.64 ? 779  ALA A CB  1 
ATOM   6071  N  N   . GLU A 1 780  ? 0.178   105.897 22.456  1.00 32.64 ? 780  GLU A N   1 
ATOM   6072  C  CA  . GLU A 1 780  ? -0.850  104.890 22.646  1.00 33.20 ? 780  GLU A CA  1 
ATOM   6073  C  C   . GLU A 1 780  ? -0.294  103.540 22.269  1.00 32.25 ? 780  GLU A C   1 
ATOM   6074  O  O   . GLU A 1 780  ? 0.263   103.348 21.200  1.00 34.32 ? 780  GLU A O   1 
ATOM   6075  C  CB  . GLU A 1 780  ? -2.084  105.217 21.806  1.00 34.97 ? 780  GLU A CB  1 
ATOM   6076  C  CG  . GLU A 1 780  ? -3.195  104.184 21.916  1.00 39.59 ? 780  GLU A CG  1 
ATOM   6077  C  CD  . GLU A 1 780  ? -2.869  102.897 21.179  1.00 43.20 ? 780  GLU A CD  1 
ATOM   6078  O  OE1 . GLU A 1 780  ? -2.535  102.959 19.972  1.00 44.79 ? 780  GLU A OE1 1 
ATOM   6079  O  OE2 . GLU A 1 780  ? -2.952  101.817 21.806  1.00 45.94 ? 780  GLU A OE2 1 
ATOM   6080  N  N   . TYR A 1 781  ? -0.423  102.582 23.194  1.00 31.63 ? 781  TYR A N   1 
ATOM   6081  C  CA  . TYR A 1 781  ? 0.087   101.263 22.955  1.00 30.85 ? 781  TYR A CA  1 
ATOM   6082  C  C   . TYR A 1 781  ? -0.605  100.305 23.913  1.00 30.27 ? 781  TYR A C   1 
ATOM   6083  O  O   . TYR A 1 781  ? -0.666  100.542 25.120  1.00 30.51 ? 781  TYR A O   1 
ATOM   6084  C  CB  . TYR A 1 781  ? 1.613   101.264 23.157  1.00 29.07 ? 781  TYR A CB  1 
ATOM   6085  C  CG  . TYR A 1 781  ? 2.298   99.985  22.730  1.00 27.44 ? 781  TYR A CG  1 
ATOM   6086  C  CD1 . TYR A 1 781  ? 2.192   99.517  21.419  1.00 25.47 ? 781  TYR A CD1 1 
ATOM   6087  C  CD2 . TYR A 1 781  ? 3.048   99.235  23.642  1.00 25.13 ? 781  TYR A CD2 1 
ATOM   6088  C  CE1 . TYR A 1 781  ? 2.810   98.325  21.027  1.00 25.54 ? 781  TYR A CE1 1 
ATOM   6089  C  CE2 . TYR A 1 781  ? 3.667   98.046  23.264  1.00 24.00 ? 781  TYR A CE2 1 
ATOM   6090  C  CZ  . TYR A 1 781  ? 3.545   97.597  21.956  1.00 25.17 ? 781  TYR A CZ  1 
ATOM   6091  O  OH  . TYR A 1 781  ? 4.134   96.416  21.590  1.00 25.63 ? 781  TYR A OH  1 
ATOM   6092  N  N   . LEU A 1 782  ? -1.141  99.227  23.358  1.00 30.39 ? 782  LEU A N   1 
ATOM   6093  C  CA  . LEU A 1 782  ? -1.836  98.212  24.150  1.00 30.48 ? 782  LEU A CA  1 
ATOM   6094  C  C   . LEU A 1 782  ? -2.980  98.799  24.987  1.00 30.44 ? 782  LEU A C   1 
ATOM   6095  O  O   . LEU A 1 782  ? -3.229  98.365  26.107  1.00 30.89 ? 782  LEU A O   1 
ATOM   6096  C  CB  . LEU A 1 782  ? -0.841  97.477  25.064  1.00 28.17 ? 782  LEU A CB  1 
ATOM   6097  C  CG  . LEU A 1 782  ? 0.455   96.956  24.418  1.00 28.42 ? 782  LEU A CG  1 
ATOM   6098  C  CD1 . LEU A 1 782  ? 1.357   96.376  25.510  1.00 25.05 ? 782  LEU A CD1 1 
ATOM   6099  C  CD2 . LEU A 1 782  ? 0.152   95.915  23.317  1.00 25.81 ? 782  LEU A CD2 1 
ATOM   6100  N  N   . LYS A 1 783  ? -3.665  99.795  24.440  1.00 31.79 ? 783  LYS A N   1 
ATOM   6101  C  CA  . LYS A 1 783  ? -4.805  100.429 25.115  1.00 32.67 ? 783  LYS A CA  1 
ATOM   6102  C  C   . LYS A 1 783  ? -4.530  101.327 26.333  1.00 31.59 ? 783  LYS A C   1 
ATOM   6103  O  O   . LYS A 1 783  ? -5.458  101.694 27.059  1.00 30.72 ? 783  LYS A O   1 
ATOM   6104  C  CB  . LYS A 1 783  ? -5.856  99.368  25.489  1.00 34.18 ? 783  LYS A CB  1 
ATOM   6105  C  CG  . LYS A 1 783  ? -6.401  98.596  24.288  1.00 37.94 ? 783  LYS A CG  1 
ATOM   6106  C  CD  . LYS A 1 783  ? -7.058  99.531  23.276  1.00 38.55 ? 783  LYS A CD  1 
ATOM   6107  C  CE  . LYS A 1 783  ? -7.457  98.791  22.002  1.00 40.56 ? 783  LYS A CE  1 
ATOM   6108  N  NZ  . LYS A 1 783  ? -7.993  99.711  20.951  1.00 39.66 ? 783  LYS A NZ  1 
ATOM   6109  N  N   . LEU A 1 784  ? -3.265  101.661 26.570  1.00 30.52 ? 784  LEU A N   1 
ATOM   6110  C  CA  . LEU A 1 784  ? -2.926  102.566 27.661  1.00 29.05 ? 784  LEU A CA  1 
ATOM   6111  C  C   . LEU A 1 784  ? -2.624  103.899 26.996  1.00 27.74 ? 784  LEU A C   1 
ATOM   6112  O  O   . LEU A 1 784  ? -2.094  103.929 25.887  1.00 27.12 ? 784  LEU A O   1 
ATOM   6113  C  CB  . LEU A 1 784  ? -1.704  102.083 28.428  1.00 29.70 ? 784  LEU A CB  1 
ATOM   6114  C  CG  . LEU A 1 784  ? -1.844  100.726 29.100  1.00 31.86 ? 784  LEU A CG  1 
ATOM   6115  C  CD1 . LEU A 1 784  ? -0.713  100.582 30.116  1.00 34.11 ? 784  LEU A CD1 1 
ATOM   6116  C  CD2 . LEU A 1 784  ? -3.206  100.601 29.782  1.00 32.41 ? 784  LEU A CD2 1 
ATOM   6117  N  N   . TYR A 1 785  ? -2.980  105.000 27.652  1.00 26.97 ? 785  TYR A N   1 
ATOM   6118  C  CA  . TYR A 1 785  ? -2.738  106.311 27.070  1.00 26.58 ? 785  TYR A CA  1 
ATOM   6119  C  C   . TYR A 1 785  ? -1.689  107.068 27.875  1.00 25.56 ? 785  TYR A C   1 
ATOM   6120  O  O   . TYR A 1 785  ? -1.682  107.009 29.113  1.00 26.10 ? 785  TYR A O   1 
ATOM   6121  C  CB  . TYR A 1 785  ? -4.054  107.087 27.000  1.00 28.72 ? 785  TYR A CB  1 
ATOM   6122  C  CG  . TYR A 1 785  ? -5.170  106.290 26.342  1.00 30.65 ? 785  TYR A CG  1 
ATOM   6123  C  CD1 . TYR A 1 785  ? -5.427  106.397 24.971  1.00 30.21 ? 785  TYR A CD1 1 
ATOM   6124  C  CD2 . TYR A 1 785  ? -5.939  105.387 27.090  1.00 30.32 ? 785  TYR A CD2 1 
ATOM   6125  C  CE1 . TYR A 1 785  ? -6.415  105.628 24.368  1.00 32.47 ? 785  TYR A CE1 1 
ATOM   6126  C  CE2 . TYR A 1 785  ? -6.928  104.615 26.496  1.00 32.77 ? 785  TYR A CE2 1 
ATOM   6127  C  CZ  . TYR A 1 785  ? -7.161  104.734 25.140  1.00 32.89 ? 785  TYR A CZ  1 
ATOM   6128  O  OH  . TYR A 1 785  ? -8.130  103.945 24.559  1.00 34.34 ? 785  TYR A OH  1 
ATOM   6129  N  N   . PHE A 1 786  ? -0.799  107.761 27.161  1.00 24.02 ? 786  PHE A N   1 
ATOM   6130  C  CA  . PHE A 1 786  ? 0.283   108.526 27.789  1.00 23.45 ? 786  PHE A CA  1 
ATOM   6131  C  C   . PHE A 1 786  ? 0.488   109.907 27.200  1.00 22.74 ? 786  PHE A C   1 
ATOM   6132  O  O   . PHE A 1 786  ? 0.465   110.069 25.989  1.00 23.52 ? 786  PHE A O   1 
ATOM   6133  C  CB  . PHE A 1 786  ? 1.617   107.788 27.647  1.00 23.85 ? 786  PHE A CB  1 
ATOM   6134  C  CG  . PHE A 1 786  ? 1.626   106.399 28.230  1.00 23.94 ? 786  PHE A CG  1 
ATOM   6135  C  CD1 . PHE A 1 786  ? 1.948   106.193 29.568  1.00 24.03 ? 786  PHE A CD1 1 
ATOM   6136  C  CD2 . PHE A 1 786  ? 1.300   105.296 27.441  1.00 23.92 ? 786  PHE A CD2 1 
ATOM   6137  C  CE1 . PHE A 1 786  ? 1.951   104.911 30.112  1.00 24.87 ? 786  PHE A CE1 1 
ATOM   6138  C  CE2 . PHE A 1 786  ? 1.299   104.013 27.971  1.00 24.90 ? 786  PHE A CE2 1 
ATOM   6139  C  CZ  . PHE A 1 786  ? 1.625   103.819 29.314  1.00 25.72 ? 786  PHE A CZ  1 
ATOM   6140  N  N   . ILE A 1 787  ? 0.700   110.896 28.061  1.00 20.74 ? 787  ILE A N   1 
ATOM   6141  C  CA  . ILE A 1 787  ? 0.993   112.257 27.616  1.00 19.36 ? 787  ILE A CA  1 
ATOM   6142  C  C   . ILE A 1 787  ? 2.092   112.868 28.515  1.00 20.02 ? 787  ILE A C   1 
ATOM   6143  O  O   . ILE A 1 787  ? 1.971   112.920 29.746  1.00 18.32 ? 787  ILE A O   1 
ATOM   6144  C  CB  . ILE A 1 787  ? -0.280  113.169 27.597  1.00 18.88 ? 787  ILE A CB  1 
ATOM   6145  C  CG1 . ILE A 1 787  ? 0.087   114.531 26.995  1.00 16.66 ? 787  ILE A CG1 1 
ATOM   6146  C  CG2 . ILE A 1 787  ? -0.865  113.326 28.999  1.00 15.47 ? 787  ILE A CG2 1 
ATOM   6147  C  CD1 . ILE A 1 787  ? -1.102  115.418 26.658  1.00 16.82 ? 787  ILE A CD1 1 
ATOM   6148  N  N   . PHE A 1 788  ? 3.175   113.315 27.889  1.00 20.62 ? 788  PHE A N   1 
ATOM   6149  C  CA  . PHE A 1 788  ? 4.282   113.898 28.629  1.00 21.01 ? 788  PHE A CA  1 
ATOM   6150  C  C   . PHE A 1 788  ? 4.781   112.987 29.751  1.00 20.37 ? 788  PHE A C   1 
ATOM   6151  O  O   . PHE A 1 788  ? 5.138   113.438 30.824  1.00 20.99 ? 788  PHE A O   1 
ATOM   6152  C  CB  . PHE A 1 788  ? 3.867   115.264 29.175  1.00 23.53 ? 788  PHE A CB  1 
ATOM   6153  C  CG  . PHE A 1 788  ? 3.991   116.380 28.168  1.00 22.94 ? 788  PHE A CG  1 
ATOM   6154  C  CD1 . PHE A 1 788  ? 3.908   116.113 26.808  1.00 24.90 ? 788  PHE A CD1 1 
ATOM   6155  C  CD2 . PHE A 1 788  ? 4.151   117.696 28.579  1.00 22.46 ? 788  PHE A CD2 1 
ATOM   6156  C  CE1 . PHE A 1 788  ? 3.979   117.143 25.863  1.00 23.79 ? 788  PHE A CE1 1 
ATOM   6157  C  CE2 . PHE A 1 788  ? 4.224   118.732 27.652  1.00 22.83 ? 788  PHE A CE2 1 
ATOM   6158  C  CZ  . PHE A 1 788  ? 4.138   118.455 26.294  1.00 23.05 ? 788  PHE A CZ  1 
ATOM   6159  N  N   . GLY A 1 789  ? 4.795   111.690 29.492  1.00 20.53 ? 789  GLY A N   1 
ATOM   6160  C  CA  . GLY A 1 789  ? 5.285   110.761 30.481  1.00 20.12 ? 789  GLY A CA  1 
ATOM   6161  C  C   . GLY A 1 789  ? 4.305   110.376 31.568  1.00 20.60 ? 789  GLY A C   1 
ATOM   6162  O  O   . GLY A 1 789  ? 4.674   109.630 32.478  1.00 19.34 ? 789  GLY A O   1 
ATOM   6163  N  N   . CYS A 1 790  ? 3.076   110.870 31.477  1.00 19.79 ? 790  CYS A N   1 
ATOM   6164  C  CA  . CYS A 1 790  ? 2.051   110.561 32.468  1.00 19.57 ? 790  CYS A CA  1 
ATOM   6165  C  C   . CYS A 1 790  ? 0.966   109.640 31.891  1.00 19.86 ? 790  CYS A C   1 
ATOM   6166  O  O   . CYS A 1 790  ? 0.410   109.896 30.820  1.00 19.38 ? 790  CYS A O   1 
ATOM   6167  C  CB  . CYS A 1 790  ? 1.411   111.854 32.998  1.00 18.28 ? 790  CYS A CB  1 
ATOM   6168  S  SG  . CYS A 1 790  ? 0.115   111.607 34.216  1.00 20.49 ? 790  CYS A SG  1 
ATOM   6169  N  N   . ARG A 1 791  ? 0.678   108.569 32.608  1.00 20.47 ? 791  ARG A N   1 
ATOM   6170  C  CA  . ARG A 1 791  ? -0.347  107.652 32.168  1.00 21.11 ? 791  ARG A CA  1 
ATOM   6171  C  C   . ARG A 1 791  ? -1.709  108.260 32.461  1.00 20.84 ? 791  ARG A C   1 
ATOM   6172  O  O   . ARG A 1 791  ? -1.920  108.874 33.517  1.00 20.76 ? 791  ARG A O   1 
ATOM   6173  C  CB  . ARG A 1 791  ? -0.225  106.313 32.885  1.00 23.82 ? 791  ARG A CB  1 
ATOM   6174  C  CG  . ARG A 1 791  ? -1.186  105.268 32.342  1.00 28.22 ? 791  ARG A CG  1 
ATOM   6175  C  CD  . ARG A 1 791  ? -0.933  103.870 32.900  1.00 31.00 ? 791  ARG A CD  1 
ATOM   6176  N  NE  . ARG A 1 791  ? -2.171  103.257 33.386  1.00 34.90 ? 791  ARG A NE  1 
ATOM   6177  C  CZ  . ARG A 1 791  ? -2.455  103.097 34.673  1.00 35.61 ? 791  ARG A CZ  1 
ATOM   6178  N  NH1 . ARG A 1 791  ? -1.585  103.500 35.591  1.00 38.18 ? 791  ARG A NH1 1 
ATOM   6179  N  NH2 . ARG A 1 791  ? -3.606  102.548 35.039  1.00 38.62 ? 791  ARG A NH2 1 
ATOM   6180  N  N   . ILE A 1 792  ? -2.624  108.090 31.514  1.00 19.34 ? 792  ILE A N   1 
ATOM   6181  C  CA  . ILE A 1 792  ? -3.969  108.594 31.672  1.00 18.89 ? 792  ILE A CA  1 
ATOM   6182  C  C   . ILE A 1 792  ? -4.878  107.384 31.711  1.00 20.39 ? 792  ILE A C   1 
ATOM   6183  O  O   . ILE A 1 792  ? -5.177  106.799 30.670  1.00 20.92 ? 792  ILE A O   1 
ATOM   6184  C  CB  . ILE A 1 792  ? -4.390  109.503 30.489  1.00 17.58 ? 792  ILE A CB  1 
ATOM   6185  C  CG1 . ILE A 1 792  ? -3.362  110.626 30.287  1.00 14.73 ? 792  ILE A CG1 1 
ATOM   6186  C  CG2 . ILE A 1 792  ? -5.759  110.108 30.762  1.00 16.06 ? 792  ILE A CG2 1 
ATOM   6187  C  CD1 . ILE A 1 792  ? -3.226  111.570 31.441  1.00 12.26 ? 792  ILE A CD1 1 
ATOM   6188  N  N   . PRO A 1 793  ? -5.312  106.965 32.914  1.00 19.69 ? 793  PRO A N   1 
ATOM   6189  C  CA  . PRO A 1 793  ? -6.195  105.799 32.958  1.00 19.36 ? 793  PRO A CA  1 
ATOM   6190  C  C   . PRO A 1 793  ? -7.477  106.168 32.223  1.00 20.07 ? 793  PRO A C   1 
ATOM   6191  O  O   . PRO A 1 793  ? -7.947  107.300 32.339  1.00 19.62 ? 793  PRO A O   1 
ATOM   6192  C  CB  . PRO A 1 793  ? -6.414  105.586 34.461  1.00 19.59 ? 793  PRO A CB  1 
ATOM   6193  C  CG  . PRO A 1 793  ? -5.173  106.157 35.080  1.00 17.89 ? 793  PRO A CG  1 
ATOM   6194  C  CD  . PRO A 1 793  ? -4.954  107.412 34.271  1.00 19.40 ? 793  PRO A CD  1 
ATOM   6195  N  N   . ASN A 1 794  ? -8.024  105.226 31.458  1.00 19.76 ? 794  ASN A N   1 
ATOM   6196  C  CA  . ASN A 1 794  ? -9.251  105.460 30.703  1.00 19.59 ? 794  ASN A CA  1 
ATOM   6197  C  C   . ASN A 1 794  ? -10.413 104.729 31.385  1.00 20.21 ? 794  ASN A C   1 
ATOM   6198  O  O   . ASN A 1 794  ? -10.683 103.565 31.106  1.00 20.58 ? 794  ASN A O   1 
ATOM   6199  C  CB  . ASN A 1 794  ? -9.084  104.976 29.264  1.00 19.22 ? 794  ASN A CB  1 
ATOM   6200  C  CG  . ASN A 1 794  ? -10.325 105.257 28.403  1.00 18.81 ? 794  ASN A CG  1 
ATOM   6201  O  OD1 . ASN A 1 794  ? -11.395 105.597 28.911  1.00 17.73 ? 794  ASN A OD1 1 
ATOM   6202  N  ND2 . ASN A 1 794  ? -10.183 105.090 27.100  1.00 19.35 ? 794  ASN A ND2 1 
ATOM   6203  N  N   . LEU A 1 795  ? -11.104 105.440 32.269  1.00 19.96 ? 795  LEU A N   1 
ATOM   6204  C  CA  . LEU A 1 795  ? -12.194 104.877 33.050  1.00 20.26 ? 795  LEU A CA  1 
ATOM   6205  C  C   . LEU A 1 795  ? -13.407 104.364 32.264  1.00 21.52 ? 795  LEU A C   1 
ATOM   6206  O  O   . LEU A 1 795  ? -14.084 103.431 32.692  1.00 20.41 ? 795  LEU A O   1 
ATOM   6207  C  CB  . LEU A 1 795  ? -12.644 105.908 34.096  1.00 18.58 ? 795  LEU A CB  1 
ATOM   6208  C  CG  . LEU A 1 795  ? -11.837 106.002 35.405  1.00 15.74 ? 795  LEU A CG  1 
ATOM   6209  C  CD1 . LEU A 1 795  ? -10.364 106.258 35.133  1.00 15.66 ? 795  LEU A CD1 1 
ATOM   6210  C  CD2 . LEU A 1 795  ? -12.412 107.118 36.261  1.00 12.92 ? 795  LEU A CD2 1 
ATOM   6211  N  N   . SER A 1 796  ? -13.672 104.970 31.115  1.00 23.45 ? 796  SER A N   1 
ATOM   6212  C  CA  . SER A 1 796  ? -14.801 104.590 30.276  1.00 23.85 ? 796  SER A CA  1 
ATOM   6213  C  C   . SER A 1 796  ? -14.689 103.166 29.747  1.00 24.38 ? 796  SER A C   1 
ATOM   6214  O  O   . SER A 1 796  ? -15.709 102.552 29.423  1.00 24.61 ? 796  SER A O   1 
ATOM   6215  C  CB  . SER A 1 796  ? -14.940 105.563 29.090  1.00 23.14 ? 796  SER A CB  1 
ATOM   6216  O  OG  . SER A 1 796  ? -13.817 105.489 28.220  1.00 24.28 ? 796  SER A OG  1 
ATOM   6217  N  N   . ARG A 1 797  ? -13.466 102.645 29.646  1.00 24.89 ? 797  ARG A N   1 
ATOM   6218  C  CA  . ARG A 1 797  ? -13.250 101.281 29.146  1.00 26.11 ? 797  ARG A CA  1 
ATOM   6219  C  C   . ARG A 1 797  ? -13.486 100.207 30.198  1.00 26.35 ? 797  ARG A C   1 
ATOM   6220  O  O   . ARG A 1 797  ? -13.484 99.021  29.879  1.00 25.97 ? 797  ARG A O   1 
ATOM   6221  C  CB  . ARG A 1 797  ? -11.825 101.100 28.613  1.00 27.38 ? 797  ARG A CB  1 
ATOM   6222  C  CG  . ARG A 1 797  ? -11.528 101.794 27.295  1.00 31.91 ? 797  ARG A CG  1 
ATOM   6223  C  CD  . ARG A 1 797  ? -10.172 101.344 26.774  1.00 38.82 ? 797  ARG A CD  1 
ATOM   6224  N  NE  . ARG A 1 797  ? -9.982  101.742 25.384  1.00 44.56 ? 797  ARG A NE  1 
ATOM   6225  C  CZ  . ARG A 1 797  ? -10.795 101.385 24.394  1.00 47.03 ? 797  ARG A CZ  1 
ATOM   6226  N  NH1 . ARG A 1 797  ? -11.850 100.621 24.653  1.00 47.05 ? 797  ARG A NH1 1 
ATOM   6227  N  NH2 . ARG A 1 797  ? -10.558 101.799 23.151  1.00 48.02 ? 797  ARG A NH2 1 
ATOM   6228  N  N   . HIS A 1 798  ? -13.674 100.616 31.449  1.00 25.72 ? 798  HIS A N   1 
ATOM   6229  C  CA  . HIS A 1 798  ? -13.895 99.656  32.523  1.00 25.90 ? 798  HIS A CA  1 
ATOM   6230  C  C   . HIS A 1 798  ? -15.249 99.846  33.220  1.00 23.88 ? 798  HIS A C   1 
ATOM   6231  O  O   . HIS A 1 798  ? -15.322 100.066 34.425  1.00 22.33 ? 798  HIS A O   1 
ATOM   6232  C  CB  . HIS A 1 798  ? -12.743 99.760  33.525  1.00 29.45 ? 798  HIS A CB  1 
ATOM   6233  C  CG  . HIS A 1 798  ? -11.413 99.394  32.948  1.00 33.37 ? 798  HIS A CG  1 
ATOM   6234  N  ND1 . HIS A 1 798  ? -10.260 100.071 33.258  1.00 35.26 ? 798  HIS A ND1 1 
ATOM   6235  C  CD2 . HIS A 1 798  ? -11.060 98.421  32.067  1.00 34.29 ? 798  HIS A CD2 1 
ATOM   6236  C  CE1 . HIS A 1 798  ? -9.245  99.539  32.591  1.00 36.06 ? 798  HIS A CE1 1 
ATOM   6237  N  NE2 . HIS A 1 798  ? -9.707  98.541  31.868  1.00 36.19 ? 798  HIS A NE2 1 
ATOM   6238  N  N   . PRO A 1 799  ? -16.343 99.714  32.456  1.00 23.16 ? 799  PRO A N   1 
ATOM   6239  C  CA  . PRO A 1 799  ? -17.704 99.876  32.976  1.00 20.10 ? 799  PRO A CA  1 
ATOM   6240  C  C   . PRO A 1 799  ? -17.927 99.116  34.276  1.00 19.37 ? 799  PRO A C   1 
ATOM   6241  O  O   . PRO A 1 799  ? -17.805 97.898  34.323  1.00 19.10 ? 799  PRO A O   1 
ATOM   6242  C  CB  . PRO A 1 799  ? -18.570 99.335  31.854  1.00 20.51 ? 799  PRO A CB  1 
ATOM   6243  C  CG  . PRO A 1 799  ? -17.669 99.355  30.656  1.00 22.37 ? 799  PRO A CG  1 
ATOM   6244  C  CD  . PRO A 1 799  ? -16.362 98.991  31.176  1.00 21.05 ? 799  PRO A CD  1 
ATOM   6245  N  N   . ILE A 1 800  ? -18.255 99.843  35.332  1.00 18.89 ? 800  ILE A N   1 
ATOM   6246  C  CA  . ILE A 1 800  ? -18.503 99.218  36.618  1.00 19.86 ? 800  ILE A CA  1 
ATOM   6247  C  C   . ILE A 1 800  ? -19.643 98.210  36.533  1.00 19.30 ? 800  ILE A C   1 
ATOM   6248  O  O   . ILE A 1 800  ? -19.531 97.108  37.051  1.00 19.63 ? 800  ILE A O   1 
ATOM   6249  C  CB  . ILE A 1 800  ? -18.828 100.277 37.705  1.00 21.31 ? 800  ILE A CB  1 
ATOM   6250  C  CG1 . ILE A 1 800  ? -17.543 100.994 38.113  1.00 20.71 ? 800  ILE A CG1 1 
ATOM   6251  C  CG2 . ILE A 1 800  ? -19.470 99.609  38.911  1.00 20.76 ? 800  ILE A CG2 1 
ATOM   6252  C  CD1 . ILE A 1 800  ? -17.757 102.279 38.888  1.00 22.57 ? 800  ILE A CD1 1 
ATOM   6253  N  N   . VAL A 1 801  ? -20.730 98.574  35.863  1.00 18.18 ? 801  VAL A N   1 
ATOM   6254  C  CA  . VAL A 1 801  ? -21.866 97.662  35.754  1.00 19.09 ? 801  VAL A CA  1 
ATOM   6255  C  C   . VAL A 1 801  ? -21.787 96.795  34.508  1.00 20.36 ? 801  VAL A C   1 
ATOM   6256  O  O   . VAL A 1 801  ? -22.514 95.805  34.381  1.00 20.33 ? 801  VAL A O   1 
ATOM   6257  C  CB  . VAL A 1 801  ? -23.230 98.420  35.675  1.00 18.82 ? 801  VAL A CB  1 
ATOM   6258  C  CG1 . VAL A 1 801  ? -23.337 99.413  36.802  1.00 15.30 ? 801  VAL A CG1 1 
ATOM   6259  C  CG2 . VAL A 1 801  ? -23.381 99.122  34.293  1.00 17.70 ? 801  VAL A CG2 1 
ATOM   6260  N  N   . GLY A 1 802  ? -20.907 97.171  33.589  1.00 18.81 ? 802  GLY A N   1 
ATOM   6261  C  CA  . GLY A 1 802  ? -20.814 96.442  32.347  1.00 20.51 ? 802  GLY A CA  1 
ATOM   6262  C  C   . GLY A 1 802  ? -20.304 95.029  32.398  1.00 21.67 ? 802  GLY A C   1 
ATOM   6263  O  O   . GLY A 1 802  ? -19.507 94.667  33.251  1.00 23.31 ? 802  GLY A O   1 
ATOM   6264  N  N   . LYS A 1 803  ? -20.794 94.218  31.471  1.00 23.40 ? 803  LYS A N   1 
ATOM   6265  C  CA  . LYS A 1 803  ? -20.348 92.844  31.332  1.00 25.39 ? 803  LYS A CA  1 
ATOM   6266  C  C   . LYS A 1 803  ? -20.642 92.340  29.937  1.00 26.43 ? 803  LYS A C   1 
ATOM   6267  O  O   . LYS A 1 803  ? -21.721 92.567  29.388  1.00 26.67 ? 803  LYS A O   1 
ATOM   6268  C  CB  . LYS A 1 803  ? -20.995 91.905  32.348  1.00 26.45 ? 803  LYS A CB  1 
ATOM   6269  C  CG  . LYS A 1 803  ? -20.469 90.480  32.183  1.00 25.73 ? 803  LYS A CG  1 
ATOM   6270  C  CD  . LYS A 1 803  ? -20.251 89.762  33.489  1.00 28.48 ? 803  LYS A CD  1 
ATOM   6271  C  CE  . LYS A 1 803  ? -19.587 88.401  33.252  1.00 29.05 ? 803  LYS A CE  1 
ATOM   6272  N  NZ  . LYS A 1 803  ? -18.305 88.516  32.477  1.00 30.87 ? 803  LYS A NZ  1 
ATOM   6273  N  N   . GLU A 1 804  ? -19.657 91.649  29.383  1.00 28.58 ? 804  GLU A N   1 
ATOM   6274  C  CA  . GLU A 1 804  ? -19.719 91.075  28.049  1.00 29.27 ? 804  GLU A CA  1 
ATOM   6275  C  C   . GLU A 1 804  ? -20.505 89.757  28.023  1.00 29.32 ? 804  GLU A C   1 
ATOM   6276  O  O   . GLU A 1 804  ? -20.106 88.793  28.657  1.00 28.66 ? 804  GLU A O   1 
ATOM   6277  C  CB  . GLU A 1 804  ? -18.277 90.854  27.588  1.00 29.89 ? 804  GLU A CB  1 
ATOM   6278  C  CG  . GLU A 1 804  ? -18.062 90.535  26.134  1.00 34.02 ? 804  GLU A CG  1 
ATOM   6279  C  CD  . GLU A 1 804  ? -18.341 89.095  25.792  1.00 35.38 ? 804  GLU A CD  1 
ATOM   6280  O  OE1 . GLU A 1 804  ? -18.186 88.229  26.679  1.00 35.52 ? 804  GLU A OE1 1 
ATOM   6281  O  OE2 . GLU A 1 804  ? -18.700 88.832  24.626  1.00 38.29 ? 804  GLU A OE2 1 
ATOM   6282  N  N   . ARG A 1 805  ? -21.633 89.734  27.322  1.00 30.65 ? 805  ARG A N   1 
ATOM   6283  C  CA  . ARG A 1 805  ? -22.445 88.517  27.178  1.00 33.33 ? 805  ARG A CA  1 
ATOM   6284  C  C   . ARG A 1 805  ? -22.788 88.395  25.694  1.00 34.46 ? 805  ARG A C   1 
ATOM   6285  O  O   . ARG A 1 805  ? -23.793 88.932  25.240  1.00 35.53 ? 805  ARG A O   1 
ATOM   6286  C  CB  . ARG A 1 805  ? -23.748 88.595  27.996  1.00 32.20 ? 805  ARG A CB  1 
ATOM   6287  C  CG  . ARG A 1 805  ? -23.566 88.534  29.512  1.00 30.37 ? 805  ARG A CG  1 
ATOM   6288  C  CD  . ARG A 1 805  ? -24.905 88.603  30.264  1.00 29.12 ? 805  ARG A CD  1 
ATOM   6289  N  NE  . ARG A 1 805  ? -24.706 89.013  31.650  1.00 27.88 ? 805  ARG A NE  1 
ATOM   6290  C  CZ  . ARG A 1 805  ? -24.092 88.267  32.563  1.00 28.61 ? 805  ARG A CZ  1 
ATOM   6291  N  NH1 . ARG A 1 805  ? -23.636 87.065  32.234  1.00 27.91 ? 805  ARG A NH1 1 
ATOM   6292  N  NH2 . ARG A 1 805  ? -23.886 88.744  33.786  1.00 27.57 ? 805  ARG A NH2 1 
ATOM   6293  N  N   . ALA A 1 806  ? -21.959 87.683  24.943  1.00 36.05 ? 806  ALA A N   1 
ATOM   6294  C  CA  . ALA A 1 806  ? -22.178 87.546  23.504  1.00 38.34 ? 806  ALA A CA  1 
ATOM   6295  C  C   . ALA A 1 806  ? -23.162 86.458  23.097  1.00 40.06 ? 806  ALA A C   1 
ATOM   6296  O  O   . ALA A 1 806  ? -23.736 86.515  22.012  1.00 41.64 ? 806  ALA A O   1 
ATOM   6297  C  CB  . ALA A 1 806  ? -20.848 87.325  22.795  1.00 35.35 ? 806  ALA A CB  1 
ATOM   6298  N  N   . ASN A 1 807  ? -23.356 85.466  23.955  1.00 42.83 ? 807  ASN A N   1 
ATOM   6299  C  CA  . ASN A 1 807  ? -24.278 84.372  23.650  1.00 45.31 ? 807  ASN A CA  1 
ATOM   6300  C  C   . ASN A 1 807  ? -25.584 84.524  24.419  1.00 45.68 ? 807  ASN A C   1 
ATOM   6301  O  O   . ASN A 1 807  ? -25.801 85.520  25.112  1.00 45.90 ? 807  ASN A O   1 
ATOM   6302  C  CB  . ASN A 1 807  ? -23.641 83.029  24.007  1.00 47.91 ? 807  ASN A CB  1 
ATOM   6303  C  CG  . ASN A 1 807  ? -23.109 82.999  25.429  1.00 49.90 ? 807  ASN A CG  1 
ATOM   6304  O  OD1 . ASN A 1 807  ? -22.567 81.992  25.877  1.00 52.03 ? 807  ASN A OD1 1 
ATOM   6305  N  ND2 . ASN A 1 807  ? -23.257 84.111  26.146  1.00 50.46 ? 807  ASN A ND2 1 
ATOM   6306  N  N   . SER A 1 808  ? -26.456 83.533  24.308  1.00 46.40 ? 808  SER A N   1 
ATOM   6307  C  CA  . SER A 1 808  ? -27.726 83.608  25.012  1.00 47.15 ? 808  SER A CA  1 
ATOM   6308  C  C   . SER A 1 808  ? -27.704 82.803  26.317  1.00 46.47 ? 808  SER A C   1 
ATOM   6309  O  O   . SER A 1 808  ? -28.613 82.919  27.135  1.00 47.68 ? 808  SER A O   1 
ATOM   6310  C  CB  . SER A 1 808  ? -28.861 83.127  24.097  1.00 48.57 ? 808  SER A CB  1 
ATOM   6311  O  OG  . SER A 1 808  ? -28.912 83.889  22.902  1.00 49.64 ? 808  SER A OG  1 
ATOM   6312  N  N   . SER A 1 809  ? -26.663 82.001  26.514  1.00 44.86 ? 809  SER A N   1 
ATOM   6313  C  CA  . SER A 1 809  ? -26.554 81.211  27.732  1.00 43.93 ? 809  SER A CA  1 
ATOM   6314  C  C   . SER A 1 809  ? -26.735 82.141  28.932  1.00 43.70 ? 809  SER A C   1 
ATOM   6315  O  O   . SER A 1 809  ? -26.467 83.342  28.854  1.00 42.71 ? 809  SER A O   1 
ATOM   6316  C  CB  . SER A 1 809  ? -25.194 80.506  27.800  1.00 43.98 ? 809  SER A CB  1 
ATOM   6317  O  OG  . SER A 1 809  ? -24.127 81.430  27.928  1.00 44.56 ? 809  SER A OG  1 
ATOM   6318  N  N   . ALA A 1 810  ? -27.190 81.581  30.043  1.00 43.55 ? 810  ALA A N   1 
ATOM   6319  C  CA  . ALA A 1 810  ? -27.437 82.367  31.243  1.00 43.59 ? 810  ALA A CA  1 
ATOM   6320  C  C   . ALA A 1 810  ? -26.172 82.675  32.042  1.00 43.63 ? 810  ALA A C   1 
ATOM   6321  O  O   . ALA A 1 810  ? -25.184 81.942  31.970  1.00 43.24 ? 810  ALA A O   1 
ATOM   6322  C  CB  . ALA A 1 810  ? -28.445 81.645  32.121  1.00 43.18 ? 810  ALA A CB  1 
ATOM   6323  N  N   . GLU A 1 811  ? -26.217 83.765  32.802  1.00 43.44 ? 811  GLU A N   1 
ATOM   6324  C  CA  . GLU A 1 811  ? -25.086 84.177  33.624  1.00 44.06 ? 811  GLU A CA  1 
ATOM   6325  C  C   . GLU A 1 811  ? -24.720 83.039  34.566  1.00 43.26 ? 811  GLU A C   1 
ATOM   6326  O  O   . GLU A 1 811  ? -25.557 82.182  34.870  1.00 43.02 ? 811  GLU A O   1 
ATOM   6327  C  CB  . GLU A 1 811  ? -25.456 85.397  34.466  1.00 44.77 ? 811  GLU A CB  1 
ATOM   6328  C  CG  . GLU A 1 811  ? -26.309 85.052  35.681  1.00 46.64 ? 811  GLU A CG  1 
ATOM   6329  C  CD  . GLU A 1 811  ? -26.929 86.268  36.345  1.00 48.61 ? 811  GLU A CD  1 
ATOM   6330  O  OE1 . GLU A 1 811  ? -26.272 87.330  36.408  1.00 50.01 ? 811  GLU A OE1 1 
ATOM   6331  O  OE2 . GLU A 1 811  ? -28.079 86.158  36.816  1.00 50.59 ? 811  GLU A OE2 1 
ATOM   6332  N  N   . GLU A 1 812  ? -23.476 83.043  35.039  1.00 41.97 ? 812  GLU A N   1 
ATOM   6333  C  CA  . GLU A 1 812  ? -23.023 82.020  35.967  1.00 40.80 ? 812  GLU A CA  1 
ATOM   6334  C  C   . GLU A 1 812  ? -23.751 82.224  37.286  1.00 39.29 ? 812  GLU A C   1 
ATOM   6335  O  O   . GLU A 1 812  ? -24.030 83.356  37.680  1.00 39.86 ? 812  GLU A O   1 
ATOM   6336  C  CB  . GLU A 1 812  ? -21.520 82.123  36.179  1.00 41.98 ? 812  GLU A CB  1 
ATOM   6337  C  CG  . GLU A 1 812  ? -20.705 81.979  34.908  1.00 43.53 ? 812  GLU A CG  1 
ATOM   6338  C  CD  . GLU A 1 812  ? -19.247 82.358  35.108  1.00 46.75 ? 812  GLU A CD  1 
ATOM   6339  O  OE1 . GLU A 1 812  ? -18.497 81.584  35.747  1.00 46.75 ? 812  GLU A OE1 1 
ATOM   6340  O  OE2 . GLU A 1 812  ? -18.850 83.446  34.630  1.00 48.94 ? 812  GLU A OE2 1 
ATOM   6341  N  N   . PRO A 1 813  ? -24.064 81.129  37.987  1.00 37.98 ? 813  PRO A N   1 
ATOM   6342  C  CA  . PRO A 1 813  ? -24.771 81.107  39.278  1.00 35.70 ? 813  PRO A CA  1 
ATOM   6343  C  C   . PRO A 1 813  ? -24.050 81.853  40.392  1.00 34.80 ? 813  PRO A C   1 
ATOM   6344  O  O   . PRO A 1 813  ? -22.812 81.925  40.419  1.00 35.22 ? 813  PRO A O   1 
ATOM   6345  C  CB  . PRO A 1 813  ? -24.868 79.618  39.606  1.00 35.88 ? 813  PRO A CB  1 
ATOM   6346  C  CG  . PRO A 1 813  ? -24.688 78.938  38.276  1.00 38.43 ? 813  PRO A CG  1 
ATOM   6347  C  CD  . PRO A 1 813  ? -23.642 79.771  37.609  1.00 38.35 ? 813  PRO A CD  1 
ATOM   6348  N  N   . TRP A 1 814  ? -24.821 82.398  41.321  1.00 31.97 ? 814  TRP A N   1 
ATOM   6349  C  CA  . TRP A 1 814  ? -24.241 83.099  42.459  1.00 31.49 ? 814  TRP A CA  1 
ATOM   6350  C  C   . TRP A 1 814  ? -23.349 82.055  43.138  1.00 31.62 ? 814  TRP A C   1 
ATOM   6351  O  O   . TRP A 1 814  ? -23.674 80.864  43.145  1.00 30.18 ? 814  TRP A O   1 
ATOM   6352  C  CB  . TRP A 1 814  ? -25.345 83.533  43.424  1.00 29.70 ? 814  TRP A CB  1 
ATOM   6353  C  CG  . TRP A 1 814  ? -24.891 84.375  44.566  1.00 27.42 ? 814  TRP A CG  1 
ATOM   6354  C  CD1 . TRP A 1 814  ? -24.821 85.740  44.605  1.00 27.24 ? 814  TRP A CD1 1 
ATOM   6355  C  CD2 . TRP A 1 814  ? -24.475 83.914  45.855  1.00 27.49 ? 814  TRP A CD2 1 
ATOM   6356  N  NE1 . TRP A 1 814  ? -24.393 86.158  45.844  1.00 26.78 ? 814  TRP A NE1 1 
ATOM   6357  C  CE2 . TRP A 1 814  ? -24.171 85.059  46.633  1.00 26.66 ? 814  TRP A CE2 1 
ATOM   6358  C  CE3 . TRP A 1 814  ? -24.330 82.645  46.435  1.00 28.53 ? 814  TRP A CE3 1 
ATOM   6359  C  CZ2 . TRP A 1 814  ? -23.727 84.973  47.961  1.00 26.51 ? 814  TRP A CZ2 1 
ATOM   6360  C  CZ3 . TRP A 1 814  ? -23.886 82.557  47.760  1.00 26.68 ? 814  TRP A CZ3 1 
ATOM   6361  C  CH2 . TRP A 1 814  ? -23.593 83.717  48.504  1.00 27.41 ? 814  TRP A CH2 1 
ATOM   6362  N  N   . PRO A 1 815  ? -22.230 82.482  43.738  1.00 30.78 ? 815  PRO A N   1 
ATOM   6363  C  CA  . PRO A 1 815  ? -21.741 83.857  43.836  1.00 29.80 ? 815  PRO A CA  1 
ATOM   6364  C  C   . PRO A 1 815  ? -20.654 84.270  42.835  1.00 28.51 ? 815  PRO A C   1 
ATOM   6365  O  O   . PRO A 1 815  ? -19.723 84.982  43.215  1.00 28.00 ? 815  PRO A O   1 
ATOM   6366  C  CB  . PRO A 1 815  ? -21.228 83.909  45.265  1.00 29.82 ? 815  PRO A CB  1 
ATOM   6367  C  CG  . PRO A 1 815  ? -20.537 82.586  45.355  1.00 30.53 ? 815  PRO A CG  1 
ATOM   6368  C  CD  . PRO A 1 815  ? -21.524 81.620  44.702  1.00 29.88 ? 815  PRO A CD  1 
ATOM   6369  N  N   . ALA A 1 816  ? -20.746 83.837  41.581  1.00 27.71 ? 816  ALA A N   1 
ATOM   6370  C  CA  . ALA A 1 816  ? -19.727 84.227  40.602  1.00 26.95 ? 816  ALA A CA  1 
ATOM   6371  C  C   . ALA A 1 816  ? -19.661 85.752  40.539  1.00 26.39 ? 816  ALA A C   1 
ATOM   6372  O  O   . ALA A 1 816  ? -18.615 86.331  40.239  1.00 27.23 ? 816  ALA A O   1 
ATOM   6373  C  CB  . ALA A 1 816  ? -20.060 83.666  39.231  1.00 25.82 ? 816  ALA A CB  1 
ATOM   6374  N  N   . ILE A 1 817  ? -20.782 86.394  40.844  1.00 25.35 ? 817  ILE A N   1 
ATOM   6375  C  CA  . ILE A 1 817  ? -20.862 87.844  40.834  1.00 24.38 ? 817  ILE A CA  1 
ATOM   6376  C  C   . ILE A 1 817  ? -19.882 88.458  41.836  1.00 24.34 ? 817  ILE A C   1 
ATOM   6377  O  O   . ILE A 1 817  ? -19.419 89.582  41.648  1.00 23.93 ? 817  ILE A O   1 
ATOM   6378  C  CB  . ILE A 1 817  ? -22.310 88.318  41.166  1.00 24.41 ? 817  ILE A CB  1 
ATOM   6379  C  CG1 . ILE A 1 817  ? -22.397 89.848  41.145  1.00 25.49 ? 817  ILE A CG1 1 
ATOM   6380  C  CG2 . ILE A 1 817  ? -22.739 87.800  42.535  1.00 22.66 ? 817  ILE A CG2 1 
ATOM   6381  C  CD1 . ILE A 1 817  ? -22.265 90.456  39.778  1.00 26.17 ? 817  ILE A CD1 1 
ATOM   6382  N  N   . LEU A 1 818  ? -19.568 87.720  42.901  1.00 24.77 ? 818  LEU A N   1 
ATOM   6383  C  CA  . LEU A 1 818  ? -18.638 88.221  43.904  1.00 25.83 ? 818  LEU A CA  1 
ATOM   6384  C  C   . LEU A 1 818  ? -17.261 88.404  43.281  1.00 27.00 ? 818  LEU A C   1 
ATOM   6385  O  O   . LEU A 1 818  ? -16.622 89.433  43.477  1.00 28.13 ? 818  LEU A O   1 
ATOM   6386  C  CB  . LEU A 1 818  ? -18.550 87.274  45.099  1.00 25.39 ? 818  LEU A CB  1 
ATOM   6387  C  CG  . LEU A 1 818  ? -19.801 87.198  45.988  1.00 26.39 ? 818  LEU A CG  1 
ATOM   6388  C  CD1 . LEU A 1 818  ? -19.477 86.427  47.269  1.00 23.40 ? 818  LEU A CD1 1 
ATOM   6389  C  CD2 . LEU A 1 818  ? -20.284 88.600  46.314  1.00 23.99 ? 818  LEU A CD2 1 
ATOM   6390  N  N   . ASP A 1 819  ? -16.809 87.416  42.512  1.00 26.89 ? 819  ASP A N   1 
ATOM   6391  C  CA  . ASP A 1 819  ? -15.511 87.529  41.861  1.00 27.28 ? 819  ASP A CA  1 
ATOM   6392  C  C   . ASP A 1 819  ? -15.514 88.750  40.941  1.00 27.95 ? 819  ASP A C   1 
ATOM   6393  O  O   . ASP A 1 819  ? -14.522 89.468  40.850  1.00 25.72 ? 819  ASP A O   1 
ATOM   6394  C  CB  . ASP A 1 819  ? -15.185 86.253  41.075  1.00 25.30 ? 819  ASP A CB  1 
ATOM   6395  C  CG  . ASP A 1 819  ? -14.714 85.119  41.984  1.00 28.07 ? 819  ASP A CG  1 
ATOM   6396  O  OD1 . ASP A 1 819  ? -14.293 85.418  43.130  1.00 28.04 ? 819  ASP A OD1 1 
ATOM   6397  O  OD2 . ASP A 1 819  ? -14.750 83.936  41.567  1.00 27.90 ? 819  ASP A OD2 1 
ATOM   6398  N  N   . GLN A 1 820  ? -16.644 88.998  40.281  1.00 27.87 ? 820  GLN A N   1 
ATOM   6399  C  CA  . GLN A 1 820  ? -16.761 90.134  39.381  1.00 27.75 ? 820  GLN A CA  1 
ATOM   6400  C  C   . GLN A 1 820  ? -16.734 91.457  40.125  1.00 27.44 ? 820  GLN A C   1 
ATOM   6401  O  O   . GLN A 1 820  ? -16.207 92.445  39.634  1.00 26.76 ? 820  GLN A O   1 
ATOM   6402  C  CB  . GLN A 1 820  ? -18.047 90.025  38.566  1.00 28.29 ? 820  GLN A CB  1 
ATOM   6403  C  CG  . GLN A 1 820  ? -17.967 89.023  37.432  1.00 30.61 ? 820  GLN A CG  1 
ATOM   6404  C  CD  . GLN A 1 820  ? -19.326 88.487  37.045  1.00 33.65 ? 820  GLN A CD  1 
ATOM   6405  O  OE1 . GLN A 1 820  ? -20.247 89.255  36.746  1.00 34.97 ? 820  GLN A OE1 1 
ATOM   6406  N  NE2 . GLN A 1 820  ? -19.466 87.160  37.049  1.00 33.50 ? 820  GLN A NE2 1 
ATOM   6407  N  N   . ILE A 1 821  ? -17.320 91.483  41.312  1.00 26.87 ? 821  ILE A N   1 
ATOM   6408  C  CA  . ILE A 1 821  ? -17.342 92.708  42.089  1.00 27.09 ? 821  ILE A CA  1 
ATOM   6409  C  C   . ILE A 1 821  ? -15.933 92.987  42.613  1.00 26.59 ? 821  ILE A C   1 
ATOM   6410  O  O   . ILE A 1 821  ? -15.491 94.140  42.636  1.00 27.88 ? 821  ILE A O   1 
ATOM   6411  C  CB  . ILE A 1 821  ? -18.360 92.598  43.243  1.00 28.33 ? 821  ILE A CB  1 
ATOM   6412  C  CG1 . ILE A 1 821  ? -19.750 92.332  42.663  1.00 28.89 ? 821  ILE A CG1 1 
ATOM   6413  C  CG2 . ILE A 1 821  ? -18.393 93.872  44.058  1.00 29.10 ? 821  ILE A CG2 1 
ATOM   6414  C  CD1 . ILE A 1 821  ? -20.212 93.379  41.672  1.00 27.87 ? 821  ILE A CD1 1 
ATOM   6415  N  N   . MET A 1 822  ? -15.229 91.936  43.028  1.00 23.38 ? 822  MET A N   1 
ATOM   6416  C  CA  . MET A 1 822  ? -13.856 92.100  43.498  1.00 23.39 ? 822  MET A CA  1 
ATOM   6417  C  C   . MET A 1 822  ? -12.992 92.579  42.329  1.00 22.38 ? 822  MET A C   1 
ATOM   6418  O  O   . MET A 1 822  ? -12.037 93.333  42.520  1.00 21.46 ? 822  MET A O   1 
ATOM   6419  C  CB  . MET A 1 822  ? -13.297 90.787  44.061  1.00 22.34 ? 822  MET A CB  1 
ATOM   6420  C  CG  . MET A 1 822  ? -13.845 90.439  45.454  1.00 22.27 ? 822  MET A CG  1 
ATOM   6421  S  SD  . MET A 1 822  ? -13.610 91.765  46.707  1.00 20.27 ? 822  MET A SD  1 
ATOM   6422  C  CE  . MET A 1 822  ? -11.801 92.027  46.595  1.00 18.71 ? 822  MET A CE  1 
ATOM   6423  N  N   . GLY A 1 823  ? -13.358 92.150  41.120  1.00 22.35 ? 823  GLY A N   1 
ATOM   6424  C  CA  . GLY A 1 823  ? -12.637 92.549  39.927  1.00 21.70 ? 823  GLY A CA  1 
ATOM   6425  C  C   . GLY A 1 823  ? -12.878 94.027  39.649  1.00 23.88 ? 823  GLY A C   1 
ATOM   6426  O  O   . GLY A 1 823  ? -11.992 94.748  39.157  1.00 23.19 ? 823  GLY A O   1 
ATOM   6427  N  N   . VAL A 1 824  ? -14.105 94.457  39.934  1.00 23.63 ? 824  VAL A N   1 
ATOM   6428  C  CA  . VAL A 1 824  ? -14.444 95.869  39.797  1.00 23.93 ? 824  VAL A CA  1 
ATOM   6429  C  C   . VAL A 1 824  ? -13.638 96.718  40.774  1.00 24.57 ? 824  VAL A C   1 
ATOM   6430  O  O   . VAL A 1 824  ? -13.124 97.751  40.429  1.00 26.99 ? 824  VAL A O   1 
ATOM   6431  C  CB  . VAL A 1 824  ? -15.950 96.109  40.002  1.00 24.48 ? 824  VAL A CB  1 
ATOM   6432  C  CG1 . VAL A 1 824  ? -16.261 97.598  39.975  1.00 23.91 ? 824  VAL A CG1 1 
ATOM   6433  C  CG2 . VAL A 1 824  ? -16.756 95.369  38.945  1.00 24.16 ? 824  VAL A CG2 1 
ATOM   6434  N  N   . PHE A 1 825  ? -13.497 96.190  41.995  1.00 22.98 ? 825  PHE A N   1 
ATOM   6435  C  CA  . PHE A 1 825  ? -12.702 96.867  43.001  1.00 22.27 ? 825  PHE A CA  1 
ATOM   6436  C  C   . PHE A 1 825  ? -11.242 97.001  42.565  1.00 22.57 ? 825  PHE A C   1 
ATOM   6437  O  O   . PHE A 1 825  ? -10.661 98.082  42.669  1.00 23.17 ? 825  PHE A O   1 
ATOM   6438  C  CB  . PHE A 1 825  ? -12.760 96.106  44.329  1.00 20.71 ? 825  PHE A CB  1 
ATOM   6439  C  CG  . PHE A 1 825  ? -11.769 96.597  45.358  1.00 18.76 ? 825  PHE A CG  1 
ATOM   6440  C  CD1 . PHE A 1 825  ? -11.940 97.828  45.987  1.00 17.99 ? 825  PHE A CD1 1 
ATOM   6441  C  CD2 . PHE A 1 825  ? -10.653 95.832  45.679  1.00 18.98 ? 825  PHE A CD2 1 
ATOM   6442  C  CE1 . PHE A 1 825  ? -11.011 98.290  46.913  1.00 19.11 ? 825  PHE A CE1 1 
ATOM   6443  C  CE2 . PHE A 1 825  ? -9.711  96.284  46.614  1.00 17.94 ? 825  PHE A CE2 1 
ATOM   6444  C  CZ  . PHE A 1 825  ? -9.889  97.511  47.232  1.00 17.34 ? 825  PHE A CZ  1 
ATOM   6445  N  N   . PHE A 1 826  ? -10.646 95.916  42.071  1.00 22.39 ? 826  PHE A N   1 
ATOM   6446  C  CA  . PHE A 1 826  ? -9.246  95.986  41.666  1.00 22.85 ? 826  PHE A CA  1 
ATOM   6447  C  C   . PHE A 1 826  ? -9.049  96.918  40.477  1.00 24.08 ? 826  PHE A C   1 
ATOM   6448  O  O   . PHE A 1 826  ? -7.982  97.513  40.336  1.00 24.53 ? 826  PHE A O   1 
ATOM   6449  C  CB  . PHE A 1 826  ? -8.670  94.585  41.377  1.00 21.67 ? 826  PHE A CB  1 
ATOM   6450  C  CG  . PHE A 1 826  ? -8.660  93.656  42.582  1.00 19.69 ? 826  PHE A CG  1 
ATOM   6451  C  CD1 . PHE A 1 826  ? -8.164  94.084  43.815  1.00 20.36 ? 826  PHE A CD1 1 
ATOM   6452  C  CD2 . PHE A 1 826  ? -9.170  92.362  42.491  1.00 18.67 ? 826  PHE A CD2 1 
ATOM   6453  C  CE1 . PHE A 1 826  ? -8.181  93.232  44.941  1.00 19.94 ? 826  PHE A CE1 1 
ATOM   6454  C  CE2 . PHE A 1 826  ? -9.195  91.506  43.604  1.00 18.46 ? 826  PHE A CE2 1 
ATOM   6455  C  CZ  . PHE A 1 826  ? -8.701  91.947  44.831  1.00 19.95 ? 826  PHE A CZ  1 
ATOM   6456  N  N   . ASN A 1 827  ? -10.065 97.070  39.623  1.00 25.27 ? 827  ASN A N   1 
ATOM   6457  C  CA  . ASN A 1 827  ? -9.898  97.984  38.495  1.00 25.92 ? 827  ASN A CA  1 
ATOM   6458  C  C   . ASN A 1 827  ? -9.791  99.395  39.048  1.00 25.80 ? 827  ASN A C   1 
ATOM   6459  O  O   . ASN A 1 827  ? -9.045  100.218 38.526  1.00 26.68 ? 827  ASN A O   1 
ATOM   6460  C  CB  . ASN A 1 827  ? -11.068 97.911  37.503  1.00 28.41 ? 827  ASN A CB  1 
ATOM   6461  C  CG  . ASN A 1 827  ? -10.929 96.768  36.495  1.00 30.39 ? 827  ASN A CG  1 
ATOM   6462  O  OD1 . ASN A 1 827  ? -9.819  96.318  36.168  1.00 31.50 ? 827  ASN A OD1 1 
ATOM   6463  N  ND2 . ASN A 1 827  ? -12.062 96.310  35.980  1.00 30.69 ? 827  ASN A ND2 1 
ATOM   6464  N  N   . GLY A 1 828  ? -10.537 99.669  40.114  1.00 24.62 ? 828  GLY A N   1 
ATOM   6465  C  CA  . GLY A 1 828  ? -10.492 100.987 40.719  1.00 23.83 ? 828  GLY A CA  1 
ATOM   6466  C  C   . GLY A 1 828  ? -9.112  101.304 41.299  1.00 24.01 ? 828  GLY A C   1 
ATOM   6467  O  O   . GLY A 1 828  ? -8.638  102.447 41.197  1.00 23.62 ? 828  GLY A O   1 
ATOM   6468  N  N   . VAL A 1 829  ? -8.477  100.304 41.918  1.00 21.87 ? 829  VAL A N   1 
ATOM   6469  C  CA  . VAL A 1 829  ? -7.155  100.475 42.504  1.00 20.21 ? 829  VAL A CA  1 
ATOM   6470  C  C   . VAL A 1 829  ? -6.162  100.797 41.385  1.00 21.55 ? 829  VAL A C   1 
ATOM   6471  O  O   . VAL A 1 829  ? -5.400  101.766 41.469  1.00 21.47 ? 829  VAL A O   1 
ATOM   6472  C  CB  . VAL A 1 829  ? -6.683  99.190  43.265  1.00 19.68 ? 829  VAL A CB  1 
ATOM   6473  C  CG1 . VAL A 1 829  ? -5.288  99.422  43.859  1.00 17.85 ? 829  VAL A CG1 1 
ATOM   6474  C  CG2 . VAL A 1 829  ? -7.670  98.833  44.392  1.00 15.93 ? 829  VAL A CG2 1 
ATOM   6475  N  N   . HIS A 1 830  ? -6.185  100.002 40.323  1.00 21.91 ? 830  HIS A N   1 
ATOM   6476  C  CA  . HIS A 1 830  ? -5.282  100.237 39.206  1.00 22.78 ? 830  HIS A CA  1 
ATOM   6477  C  C   . HIS A 1 830  ? -5.596  101.545 38.503  1.00 22.61 ? 830  HIS A C   1 
ATOM   6478  O  O   . HIS A 1 830  ? -4.680  102.228 38.075  1.00 23.89 ? 830  HIS A O   1 
ATOM   6479  C  CB  . HIS A 1 830  ? -5.349  99.093  38.186  1.00 23.29 ? 830  HIS A CB  1 
ATOM   6480  C  CG  . HIS A 1 830  ? -4.852  97.787  38.711  1.00 23.74 ? 830  HIS A CG  1 
ATOM   6481  N  ND1 . HIS A 1 830  ? -3.608  97.647  39.285  1.00 24.18 ? 830  HIS A ND1 1 
ATOM   6482  C  CD2 . HIS A 1 830  ? -5.420  96.559  38.742  1.00 23.98 ? 830  HIS A CD2 1 
ATOM   6483  C  CE1 . HIS A 1 830  ? -3.431  96.389  39.645  1.00 23.97 ? 830  HIS A CE1 1 
ATOM   6484  N  NE2 . HIS A 1 830  ? -4.518  95.706  39.327  1.00 23.29 ? 830  HIS A NE2 1 
ATOM   6485  N  N   . ASP A 1 831  ? -6.878  101.885 38.372  1.00 21.77 ? 831  ASP A N   1 
ATOM   6486  C  CA  . ASP A 1 831  ? -7.277  103.128 37.701  1.00 22.26 ? 831  ASP A CA  1 
ATOM   6487  C  C   . ASP A 1 831  ? -7.142  104.380 38.550  1.00 22.15 ? 831  ASP A C   1 
ATOM   6488  O  O   . ASP A 1 831  ? -7.365  105.494 38.066  1.00 21.50 ? 831  ASP A O   1 
ATOM   6489  C  CB  . ASP A 1 831  ? -8.715  103.049 37.181  1.00 22.80 ? 831  ASP A CB  1 
ATOM   6490  C  CG  . ASP A 1 831  ? -8.845  102.158 35.962  1.00 25.88 ? 831  ASP A CG  1 
ATOM   6491  O  OD1 . ASP A 1 831  ? -7.852  102.031 35.197  1.00 28.95 ? 831  ASP A OD1 1 
ATOM   6492  O  OD2 . ASP A 1 831  ? -9.941  101.596 35.760  1.00 26.04 ? 831  ASP A OD2 1 
ATOM   6493  N  N   . GLY A 1 832  ? -6.796  104.193 39.820  1.00 22.73 ? 832  GLY A N   1 
ATOM   6494  C  CA  . GLY A 1 832  ? -6.594  105.321 40.709  1.00 21.82 ? 832  GLY A CA  1 
ATOM   6495  C  C   . GLY A 1 832  ? -7.759  106.189 41.123  1.00 22.26 ? 832  GLY A C   1 
ATOM   6496  O  O   . GLY A 1 832  ? -7.648  107.411 41.112  1.00 23.70 ? 832  GLY A O   1 
ATOM   6497  N  N   . LEU A 1 833  ? -8.870  105.579 41.508  1.00 22.57 ? 833  LEU A N   1 
ATOM   6498  C  CA  . LEU A 1 833  ? -10.021 106.353 41.973  1.00 21.55 ? 833  LEU A CA  1 
ATOM   6499  C  C   . LEU A 1 833  ? -9.706  106.912 43.375  1.00 21.66 ? 833  LEU A C   1 
ATOM   6500  O  O   . LEU A 1 833  ? -8.697  106.531 43.984  1.00 21.28 ? 833  LEU A O   1 
ATOM   6501  C  CB  . LEU A 1 833  ? -11.262 105.457 42.039  1.00 18.83 ? 833  LEU A CB  1 
ATOM   6502  C  CG  . LEU A 1 833  ? -11.567 104.697 40.754  1.00 19.72 ? 833  LEU A CG  1 
ATOM   6503  C  CD1 . LEU A 1 833  ? -12.965 104.106 40.799  1.00 14.73 ? 833  LEU A CD1 1 
ATOM   6504  C  CD2 . LEU A 1 833  ? -11.434 105.663 39.589  1.00 20.55 ? 833  LEU A CD2 1 
ATOM   6505  N  N   . GLN A 1 834  ? -10.551 107.810 43.888  1.00 21.60 ? 834  GLN A N   1 
ATOM   6506  C  CA  . GLN A 1 834  ? -10.324 108.384 45.214  1.00 21.63 ? 834  GLN A CA  1 
ATOM   6507  C  C   . GLN A 1 834  ? -10.419 107.225 46.205  1.00 21.12 ? 834  GLN A C   1 
ATOM   6508  O  O   . GLN A 1 834  ? -11.516 106.713 46.472  1.00 22.21 ? 834  GLN A O   1 
ATOM   6509  C  CB  . GLN A 1 834  ? -11.377 109.454 45.508  1.00 22.31 ? 834  GLN A CB  1 
ATOM   6510  C  CG  . GLN A 1 834  ? -11.296 110.665 44.574  1.00 21.84 ? 834  GLN A CG  1 
ATOM   6511  C  CD  . GLN A 1 834  ? -9.905  111.269 44.523  1.00 22.47 ? 834  GLN A CD  1 
ATOM   6512  O  OE1 . GLN A 1 834  ? -9.399  111.751 45.530  1.00 25.50 ? 834  GLN A OE1 1 
ATOM   6513  N  NE2 . GLN A 1 834  ? -9.281  111.248 43.348  1.00 21.74 ? 834  GLN A NE2 1 
ATOM   6514  N  N   . TRP A 1 835  ? -9.272  106.826 46.763  1.00 19.11 ? 835  TRP A N   1 
ATOM   6515  C  CA  . TRP A 1 835  ? -9.230  105.655 47.632  1.00 18.68 ? 835  TRP A CA  1 
ATOM   6516  C  C   . TRP A 1 835  ? -10.300 105.485 48.703  1.00 18.64 ? 835  TRP A C   1 
ATOM   6517  O  O   . TRP A 1 835  ? -10.909 104.427 48.792  1.00 17.61 ? 835  TRP A O   1 
ATOM   6518  C  CB  . TRP A 1 835  ? -7.820  105.454 48.234  1.00 19.16 ? 835  TRP A CB  1 
ATOM   6519  C  CG  . TRP A 1 835  ? -7.353  106.427 49.304  1.00 18.88 ? 835  TRP A CG  1 
ATOM   6520  C  CD1 . TRP A 1 835  ? -6.874  107.696 49.124  1.00 18.90 ? 835  TRP A CD1 1 
ATOM   6521  C  CD2 . TRP A 1 835  ? -7.259  106.161 50.704  1.00 21.08 ? 835  TRP A CD2 1 
ATOM   6522  N  NE1 . TRP A 1 835  ? -6.481  108.233 50.327  1.00 18.15 ? 835  TRP A NE1 1 
ATOM   6523  C  CE2 . TRP A 1 835  ? -6.711  107.314 51.314  1.00 20.45 ? 835  TRP A CE2 1 
ATOM   6524  C  CE3 . TRP A 1 835  ? -7.581  105.060 51.510  1.00 21.03 ? 835  TRP A CE3 1 
ATOM   6525  C  CZ2 . TRP A 1 835  ? -6.480  107.390 52.688  1.00 19.59 ? 835  TRP A CZ2 1 
ATOM   6526  C  CZ3 . TRP A 1 835  ? -7.346  105.141 52.880  1.00 20.73 ? 835  TRP A CZ3 1 
ATOM   6527  C  CH2 . TRP A 1 835  ? -6.804  106.298 53.451  1.00 19.31 ? 835  TRP A CH2 1 
ATOM   6528  N  N   . GLN A 1 836  ? -10.549 106.497 49.521  1.00 19.40 ? 836  GLN A N   1 
ATOM   6529  C  CA  . GLN A 1 836  ? -11.571 106.332 50.540  1.00 18.93 ? 836  GLN A CA  1 
ATOM   6530  C  C   . GLN A 1 836  ? -12.959 106.145 49.936  1.00 18.81 ? 836  GLN A C   1 
ATOM   6531  O  O   . GLN A 1 836  ? -13.631 105.165 50.243  1.00 16.61 ? 836  GLN A O   1 
ATOM   6532  C  CB  . GLN A 1 836  ? -11.567 107.507 51.524  1.00 19.44 ? 836  GLN A CB  1 
ATOM   6533  C  CG  . GLN A 1 836  ? -10.450 107.420 52.562  1.00 20.21 ? 836  GLN A CG  1 
ATOM   6534  C  CD  . GLN A 1 836  ? -10.286 108.681 53.384  1.00 18.22 ? 836  GLN A CD  1 
ATOM   6535  O  OE1 . GLN A 1 836  ? -9.893  109.734 52.873  1.00 18.61 ? 836  GLN A OE1 1 
ATOM   6536  N  NE2 . GLN A 1 836  ? -10.580 108.582 54.669  1.00 19.41 ? 836  GLN A NE2 1 
ATOM   6537  N  N   . ARG A 1 837  ? -13.384 107.055 49.067  1.00 18.43 ? 837  ARG A N   1 
ATOM   6538  C  CA  . ARG A 1 837  ? -14.709 106.926 48.466  1.00 20.41 ? 837  ARG A CA  1 
ATOM   6539  C  C   . ARG A 1 837  ? -14.854 105.582 47.762  1.00 20.44 ? 837  ARG A C   1 
ATOM   6540  O  O   . ARG A 1 837  ? -15.918 104.960 47.823  1.00 19.51 ? 837  ARG A O   1 
ATOM   6541  C  CB  . ARG A 1 837  ? -14.980 108.059 47.466  1.00 20.50 ? 837  ARG A CB  1 
ATOM   6542  C  CG  . ARG A 1 837  ? -14.605 109.438 47.975  1.00 24.76 ? 837  ARG A CG  1 
ATOM   6543  C  CD  . ARG A 1 837  ? -15.601 109.953 48.978  1.00 25.57 ? 837  ARG A CD  1 
ATOM   6544  N  NE  . ARG A 1 837  ? -16.915 110.110 48.374  1.00 28.02 ? 837  ARG A NE  1 
ATOM   6545  C  CZ  . ARG A 1 837  ? -17.731 111.129 48.614  1.00 26.86 ? 837  ARG A CZ  1 
ATOM   6546  N  NH1 . ARG A 1 837  ? -17.370 112.090 49.445  1.00 23.19 ? 837  ARG A NH1 1 
ATOM   6547  N  NH2 . ARG A 1 837  ? -18.898 111.201 47.994  1.00 27.71 ? 837  ARG A NH2 1 
ATOM   6548  N  N   . TRP A 1 838  ? -13.785 105.129 47.104  1.00 19.73 ? 838  TRP A N   1 
ATOM   6549  C  CA  . TRP A 1 838  ? -13.832 103.859 46.398  1.00 19.70 ? 838  TRP A CA  1 
ATOM   6550  C  C   . TRP A 1 838  ? -13.941 102.673 47.359  1.00 19.95 ? 838  TRP A C   1 
ATOM   6551  O  O   . TRP A 1 838  ? -14.742 101.760 47.134  1.00 20.80 ? 838  TRP A O   1 
ATOM   6552  C  CB  . TRP A 1 838  ? -12.598 103.691 45.511  1.00 18.68 ? 838  TRP A CB  1 
ATOM   6553  C  CG  . TRP A 1 838  ? -12.695 102.491 44.607  1.00 18.94 ? 838  TRP A CG  1 
ATOM   6554  C  CD1 . TRP A 1 838  ? -11.830 101.438 44.545  1.00 18.63 ? 838  TRP A CD1 1 
ATOM   6555  C  CD2 . TRP A 1 838  ? -13.700 102.243 43.622  1.00 19.49 ? 838  TRP A CD2 1 
ATOM   6556  N  NE1 . TRP A 1 838  ? -12.228 100.554 43.581  1.00 18.59 ? 838  TRP A NE1 1 
ATOM   6557  C  CE2 . TRP A 1 838  ? -13.375 101.021 42.994  1.00 20.28 ? 838  TRP A CE2 1 
ATOM   6558  C  CE3 . TRP A 1 838  ? -14.847 102.933 43.207  1.00 19.71 ? 838  TRP A CE3 1 
ATOM   6559  C  CZ2 . TRP A 1 838  ? -14.150 100.475 41.961  1.00 20.76 ? 838  TRP A CZ2 1 
ATOM   6560  C  CZ3 . TRP A 1 838  ? -15.620 102.392 42.182  1.00 20.53 ? 838  TRP A CZ3 1 
ATOM   6561  C  CH2 . TRP A 1 838  ? -15.266 101.173 41.569  1.00 20.51 ? 838  TRP A CH2 1 
ATOM   6562  N  N   . ILE A 1 839  ? -13.144 102.684 48.424  1.00 19.31 ? 839  ILE A N   1 
ATOM   6563  C  CA  . ILE A 1 839  ? -13.179 101.603 49.390  1.00 19.02 ? 839  ILE A CA  1 
ATOM   6564  C  C   . ILE A 1 839  ? -14.564 101.496 50.018  1.00 20.19 ? 839  ILE A C   1 
ATOM   6565  O  O   . ILE A 1 839  ? -15.132 100.408 50.069  1.00 19.10 ? 839  ILE A O   1 
ATOM   6566  C  CB  . ILE A 1 839  ? -12.103 101.798 50.490  1.00 18.60 ? 839  ILE A CB  1 
ATOM   6567  C  CG1 . ILE A 1 839  ? -10.716 101.515 49.901  1.00 17.30 ? 839  ILE A CG1 1 
ATOM   6568  C  CG2 . ILE A 1 839  ? -12.363 100.869 51.680  1.00 16.81 ? 839  ILE A CG2 1 
ATOM   6569  C  CD1 . ILE A 1 839  ? -9.565  101.910 50.817  1.00 18.86 ? 839  ILE A CD1 1 
ATOM   6570  N  N   . ARG A 1 840  ? -15.105 102.624 50.478  1.00 21.34 ? 840  ARG A N   1 
ATOM   6571  C  CA  . ARG A 1 840  ? -16.423 102.640 51.103  1.00 21.34 ? 840  ARG A CA  1 
ATOM   6572  C  C   . ARG A 1 840  ? -17.457 102.116 50.119  1.00 22.23 ? 840  ARG A C   1 
ATOM   6573  O  O   . ARG A 1 840  ? -18.273 101.263 50.470  1.00 22.49 ? 840  ARG A O   1 
ATOM   6574  C  CB  . ARG A 1 840  ? -16.828 104.052 51.554  1.00 21.28 ? 840  ARG A CB  1 
ATOM   6575  C  CG  . ARG A 1 840  ? -18.275 104.117 52.112  1.00 20.43 ? 840  ARG A CG  1 
ATOM   6576  C  CD  . ARG A 1 840  ? -18.658 105.514 52.595  1.00 20.98 ? 840  ARG A CD  1 
ATOM   6577  N  NE  . ARG A 1 840  ? -18.627 106.524 51.535  1.00 20.39 ? 840  ARG A NE  1 
ATOM   6578  C  CZ  . ARG A 1 840  ? -18.905 107.816 51.720  1.00 20.78 ? 840  ARG A CZ  1 
ATOM   6579  N  NH1 . ARG A 1 840  ? -19.232 108.251 52.936  1.00 18.27 ? 840  ARG A NH1 1 
ATOM   6580  N  NH2 . ARG A 1 840  ? -18.868 108.674 50.692  1.00 18.75 ? 840  ARG A NH2 1 
ATOM   6581  N  N   . TYR A 1 841  ? -17.435 102.615 48.891  1.00 21.92 ? 841  TYR A N   1 
ATOM   6582  C  CA  . TYR A 1 841  ? -18.392 102.135 47.915  1.00 21.60 ? 841  TYR A CA  1 
ATOM   6583  C  C   . TYR A 1 841  ? -18.303 100.614 47.751  1.00 22.35 ? 841  TYR A C   1 
ATOM   6584  O  O   . TYR A 1 841  ? -19.320 99.919  47.886  1.00 23.18 ? 841  TYR A O   1 
ATOM   6585  C  CB  . TYR A 1 841  ? -18.190 102.814 46.560  1.00 21.09 ? 841  TYR A CB  1 
ATOM   6586  C  CG  . TYR A 1 841  ? -19.186 102.327 45.546  1.00 20.72 ? 841  TYR A CG  1 
ATOM   6587  C  CD1 . TYR A 1 841  ? -20.540 102.620 45.684  1.00 21.12 ? 841  TYR A CD1 1 
ATOM   6588  C  CD2 . TYR A 1 841  ? -18.796 101.495 44.500  1.00 19.37 ? 841  TYR A CD2 1 
ATOM   6589  C  CE1 . TYR A 1 841  ? -21.473 102.099 44.815  1.00 19.39 ? 841  TYR A CE1 1 
ATOM   6590  C  CE2 . TYR A 1 841  ? -19.722 100.961 43.632  1.00 17.73 ? 841  TYR A CE2 1 
ATOM   6591  C  CZ  . TYR A 1 841  ? -21.063 101.269 43.797  1.00 19.28 ? 841  TYR A CZ  1 
ATOM   6592  O  OH  . TYR A 1 841  ? -21.994 100.738 42.940  1.00 17.24 ? 841  TYR A OH  1 
ATOM   6593  N  N   . SER A 1 842  ? -17.104 100.096 47.471  1.00 21.83 ? 842  SER A N   1 
ATOM   6594  C  CA  . SER A 1 842  ? -16.910 98.648  47.293  1.00 20.98 ? 842  SER A CA  1 
ATOM   6595  C  C   . SER A 1 842  ? -17.522 97.852  48.435  1.00 20.39 ? 842  SER A C   1 
ATOM   6596  O  O   . SER A 1 842  ? -18.129 96.805  48.218  1.00 21.63 ? 842  SER A O   1 
ATOM   6597  C  CB  . SER A 1 842  ? -15.421 98.291  47.187  1.00 19.90 ? 842  SER A CB  1 
ATOM   6598  O  OG  . SER A 1 842  ? -14.822 98.936  46.082  1.00 18.15 ? 842  SER A OG  1 
ATOM   6599  N  N   . TRP A 1 843  ? -17.352 98.344  49.654  1.00 19.28 ? 843  TRP A N   1 
ATOM   6600  C  CA  . TRP A 1 843  ? -17.911 97.658  50.807  1.00 21.80 ? 843  TRP A CA  1 
ATOM   6601  C  C   . TRP A 1 843  ? -19.431 97.578  50.718  1.00 21.84 ? 843  TRP A C   1 
ATOM   6602  O  O   . TRP A 1 843  ? -20.024 96.554  51.067  1.00 22.76 ? 843  TRP A O   1 
ATOM   6603  C  CB  . TRP A 1 843  ? -17.497 98.350  52.110  1.00 21.52 ? 843  TRP A CB  1 
ATOM   6604  C  CG  . TRP A 1 843  ? -16.255 97.778  52.698  1.00 21.52 ? 843  TRP A CG  1 
ATOM   6605  C  CD1 . TRP A 1 843  ? -15.030 98.372  52.775  1.00 22.14 ? 843  TRP A CD1 1 
ATOM   6606  C  CD2 . TRP A 1 843  ? -16.103 96.466  53.254  1.00 21.82 ? 843  TRP A CD2 1 
ATOM   6607  N  NE1 . TRP A 1 843  ? -14.118 97.511  53.343  1.00 22.17 ? 843  TRP A NE1 1 
ATOM   6608  C  CE2 . TRP A 1 843  ? -14.750 96.338  53.650  1.00 22.60 ? 843  TRP A CE2 1 
ATOM   6609  C  CE3 . TRP A 1 843  ? -16.979 95.392  53.462  1.00 21.53 ? 843  TRP A CE3 1 
ATOM   6610  C  CZ2 . TRP A 1 843  ? -14.252 95.165  54.239  1.00 21.90 ? 843  TRP A CZ2 1 
ATOM   6611  C  CZ3 . TRP A 1 843  ? -16.480 94.227  54.050  1.00 20.59 ? 843  TRP A CZ3 1 
ATOM   6612  C  CH2 . TRP A 1 843  ? -15.131 94.127  54.432  1.00 20.79 ? 843  TRP A CH2 1 
ATOM   6613  N  N   . ALA A 1 844  ? -20.055 98.655  50.254  1.00 20.21 ? 844  ALA A N   1 
ATOM   6614  C  CA  . ALA A 1 844  ? -21.500 98.682  50.114  1.00 19.94 ? 844  ALA A CA  1 
ATOM   6615  C  C   . ALA A 1 844  ? -21.881 97.711  49.008  1.00 20.97 ? 844  ALA A C   1 
ATOM   6616  O  O   . ALA A 1 844  ? -22.830 96.938  49.154  1.00 20.70 ? 844  ALA A O   1 
ATOM   6617  C  CB  . ALA A 1 844  ? -21.965 100.081 49.772  1.00 17.49 ? 844  ALA A CB  1 
ATOM   6618  N  N   . LEU A 1 845  ? -21.125 97.747  47.911  1.00 21.04 ? 845  LEU A N   1 
ATOM   6619  C  CA  . LEU A 1 845  ? -21.376 96.879  46.772  1.00 20.52 ? 845  LEU A CA  1 
ATOM   6620  C  C   . LEU A 1 845  ? -21.251 95.418  47.159  1.00 21.19 ? 845  LEU A C   1 
ATOM   6621  O  O   . LEU A 1 845  ? -22.130 94.620  46.838  1.00 19.07 ? 845  LEU A O   1 
ATOM   6622  C  CB  . LEU A 1 845  ? -20.404 97.182  45.630  1.00 20.27 ? 845  LEU A CB  1 
ATOM   6623  C  CG  . LEU A 1 845  ? -20.958 97.355  44.203  1.00 21.48 ? 845  LEU A CG  1 
ATOM   6624  C  CD1 . LEU A 1 845  ? -20.059 96.619  43.215  1.00 18.02 ? 845  LEU A CD1 1 
ATOM   6625  C  CD2 . LEU A 1 845  ? -22.381 96.833  44.098  1.00 21.16 ? 845  LEU A CD2 1 
ATOM   6626  N  N   . CYS A 1 846  ? -20.167 95.064  47.846  1.00 21.86 ? 846  CYS A N   1 
ATOM   6627  C  CA  . CYS A 1 846  ? -19.961 93.672  48.268  1.00 23.68 ? 846  CYS A CA  1 
ATOM   6628  C  C   . CYS A 1 846  ? -21.098 93.233  49.180  1.00 24.29 ? 846  CYS A C   1 
ATOM   6629  O  O   . CYS A 1 846  ? -21.706 92.178  48.973  1.00 26.40 ? 846  CYS A O   1 
ATOM   6630  C  CB  . CYS A 1 846  ? -18.625 93.499  49.002  1.00 23.25 ? 846  CYS A CB  1 
ATOM   6631  S  SG  . CYS A 1 846  ? -17.176 93.377  47.914  1.00 23.76 ? 846  CYS A SG  1 
ATOM   6632  N  N   . CYS A 1 847  ? -21.390 94.051  50.187  1.00 23.73 ? 847  CYS A N   1 
ATOM   6633  C  CA  . CYS A 1 847  ? -22.462 93.736  51.108  1.00 24.36 ? 847  CYS A CA  1 
ATOM   6634  C  C   . CYS A 1 847  ? -23.782 93.465  50.360  1.00 23.74 ? 847  CYS A C   1 
ATOM   6635  O  O   . CYS A 1 847  ? -24.536 92.567  50.733  1.00 23.46 ? 847  CYS A O   1 
ATOM   6636  C  CB  . CYS A 1 847  ? -22.644 94.886  52.102  1.00 25.03 ? 847  CYS A CB  1 
ATOM   6637  S  SG  . CYS A 1 847  ? -24.070 94.699  53.226  1.00 26.14 ? 847  CYS A SG  1 
ATOM   6638  N  N   . ALA A 1 848  ? -24.038 94.227  49.298  1.00 22.72 ? 848  ALA A N   1 
ATOM   6639  C  CA  . ALA A 1 848  ? -25.265 94.087  48.517  1.00 22.58 ? 848  ALA A CA  1 
ATOM   6640  C  C   . ALA A 1 848  ? -25.351 92.806  47.693  1.00 22.74 ? 848  ALA A C   1 
ATOM   6641  O  O   . ALA A 1 848  ? -26.414 92.490  47.153  1.00 21.53 ? 848  ALA A O   1 
ATOM   6642  C  CB  . ALA A 1 848  ? -25.450 95.293  47.607  1.00 21.65 ? 848  ALA A CB  1 
ATOM   6643  N  N   . PHE A 1 849  ? -24.242 92.074  47.588  1.00 23.83 ? 849  PHE A N   1 
ATOM   6644  C  CA  . PHE A 1 849  ? -24.225 90.821  46.832  1.00 24.61 ? 849  PHE A CA  1 
ATOM   6645  C  C   . PHE A 1 849  ? -23.801 89.639  47.701  1.00 25.64 ? 849  PHE A C   1 
ATOM   6646  O  O   . PHE A 1 849  ? -23.724 88.508  47.217  1.00 25.45 ? 849  PHE A O   1 
ATOM   6647  C  CB  . PHE A 1 849  ? -23.255 90.914  45.654  1.00 23.55 ? 849  PHE A CB  1 
ATOM   6648  C  CG  . PHE A 1 849  ? -23.777 91.681  44.490  1.00 22.14 ? 849  PHE A CG  1 
ATOM   6649  C  CD1 . PHE A 1 849  ? -24.710 91.108  43.630  1.00 20.96 ? 849  PHE A CD1 1 
ATOM   6650  C  CD2 . PHE A 1 849  ? -23.354 92.986  44.257  1.00 21.59 ? 849  PHE A CD2 1 
ATOM   6651  C  CE1 . PHE A 1 849  ? -25.214 91.818  42.547  1.00 20.01 ? 849  PHE A CE1 1 
ATOM   6652  C  CE2 . PHE A 1 849  ? -23.852 93.703  43.179  1.00 22.04 ? 849  PHE A CE2 1 
ATOM   6653  C  CZ  . PHE A 1 849  ? -24.792 93.114  42.322  1.00 22.00 ? 849  PHE A CZ  1 
ATOM   6654  N  N   . SER A 1 850  ? -23.530 89.903  48.974  1.00 26.93 ? 850  SER A N   1 
ATOM   6655  C  CA  . SER A 1 850  ? -23.065 88.871  49.906  1.00 28.58 ? 850  SER A CA  1 
ATOM   6656  C  C   . SER A 1 850  ? -24.130 87.895  50.418  1.00 30.42 ? 850  SER A C   1 
ATOM   6657  O  O   . SER A 1 850  ? -23.802 86.938  51.124  1.00 30.06 ? 850  SER A O   1 
ATOM   6658  C  CB  . SER A 1 850  ? -22.389 89.538  51.109  1.00 27.33 ? 850  SER A CB  1 
ATOM   6659  O  OG  . SER A 1 850  ? -23.281 90.433  51.753  1.00 26.99 ? 850  SER A OG  1 
ATOM   6660  N  N   . ARG A 1 851  ? -25.389 88.124  50.057  1.00 31.14 ? 851  ARG A N   1 
ATOM   6661  C  CA  . ARG A 1 851  ? -26.472 87.274  50.529  1.00 32.80 ? 851  ARG A CA  1 
ATOM   6662  C  C   . ARG A 1 851  ? -27.289 86.703  49.379  1.00 34.03 ? 851  ARG A C   1 
ATOM   6663  O  O   . ARG A 1 851  ? -27.700 87.427  48.483  1.00 34.52 ? 851  ARG A O   1 
ATOM   6664  C  CB  . ARG A 1 851  ? -27.382 88.090  51.461  1.00 33.82 ? 851  ARG A CB  1 
ATOM   6665  C  CG  . ARG A 1 851  ? -28.302 87.272  52.354  1.00 33.01 ? 851  ARG A CG  1 
ATOM   6666  C  CD  . ARG A 1 851  ? -29.178 88.198  53.178  1.00 33.54 ? 851  ARG A CD  1 
ATOM   6667  N  NE  . ARG A 1 851  ? -30.062 87.470  54.082  1.00 32.06 ? 851  ARG A NE  1 
ATOM   6668  C  CZ  . ARG A 1 851  ? -29.680 86.896  55.219  1.00 31.97 ? 851  ARG A CZ  1 
ATOM   6669  N  NH1 . ARG A 1 851  ? -28.418 86.961  55.607  1.00 30.66 ? 851  ARG A NH1 1 
ATOM   6670  N  NH2 . ARG A 1 851  ? -30.567 86.256  55.971  1.00 30.75 ? 851  ARG A NH2 1 
ATOM   6671  N  N   . GLN A 1 852  ? -27.525 85.398  49.410  1.00 36.16 ? 852  GLN A N   1 
ATOM   6672  C  CA  . GLN A 1 852  ? -28.307 84.740  48.371  1.00 38.57 ? 852  GLN A CA  1 
ATOM   6673  C  C   . GLN A 1 852  ? -29.244 83.740  49.053  1.00 41.61 ? 852  GLN A C   1 
ATOM   6674  O  O   . GLN A 1 852  ? -28.954 83.062  49.953  1.00 41.43 ? 852  GLN A O   1 
ATOM   6675  C  CB  . GLN A 1 852  ? -27.381 83.980  47.412  1.00 36.92 ? 852  GLN A CB  1 
ATOM   6676  C  CG  . GLN A 1 852  ? -28.114 83.091  46.424  1.00 35.81 ? 852  GLN A CG  1 
ATOM   6677  C  CD  . GLN A 1 852  ? -29.032 83.883  45.504  1.00 35.57 ? 852  GLN A CD  1 
ATOM   6678  O  OE1 . GLN A 1 852  ? -30.172 83.539  45.357  1.00 35.00 ? 852  GLN A OE1 1 
ATOM   6679  N  NE2 . GLN A 1 852  ? -28.535 84.940  44.900  1.00 34.82 ? 852  GLN A NE2 1 
ATOM   6680  N  N   . ARG A 1 853  ? -30.492 83.712  48.520  1.00 45.70 ? 853  ARG A N   1 
ATOM   6681  C  CA  . ARG A 1 853  ? -31.541 82.842  48.972  1.00 51.91 ? 853  ARG A CA  1 
ATOM   6682  C  C   . ARG A 1 853  ? -31.338 81.395  48.467  1.00 54.45 ? 853  ARG A C   1 
ATOM   6683  O  O   . ARG A 1 853  ? -31.248 81.126  47.306  1.00 53.61 ? 853  ARG A O   1 
ATOM   6684  C  CB  . ARG A 1 853  ? -32.842 83.397  48.344  1.00 54.18 ? 853  ARG A CB  1 
ATOM   6685  C  CG  . ARG A 1 853  ? -34.106 82.718  48.850  1.00 58.69 ? 853  ARG A CG  1 
ATOM   6686  C  CD  . ARG A 1 853  ? -35.213 82.769  47.813  1.00 62.04 ? 853  ARG A CD  1 
ATOM   6687  N  NE  . ARG A 1 853  ? -36.353 81.940  48.192  1.00 66.31 ? 853  ARG A NE  1 
ATOM   6688  C  CZ  . ARG A 1 853  ? -37.522 81.945  47.555  1.00 68.66 ? 853  ARG A CZ  1 
ATOM   6689  N  NH1 . ARG A 1 853  ? -37.704 82.738  46.504  1.00 69.54 ? 853  ARG A NH1 1 
ATOM   6690  N  NH2 . ARG A 1 853  ? -38.509 81.157  47.969  1.00 69.60 ? 853  ARG A NH2 1 
ATOM   6691  N  N   . THR A 1 854  ? -31.237 80.440  49.394  1.00 58.40 ? 854  THR A N   1 
ATOM   6692  C  CA  . THR A 1 854  ? -31.105 79.033  48.979  1.00 62.72 ? 854  THR A CA  1 
ATOM   6693  C  C   . THR A 1 854  ? -32.397 78.230  49.183  1.00 65.91 ? 854  THR A C   1 
ATOM   6694  O  O   . THR A 1 854  ? -33.049 78.316  50.229  1.00 65.54 ? 854  THR A O   1 
ATOM   6695  C  CB  . THR A 1 854  ? -30.001 78.306  49.761  1.00 62.75 ? 854  THR A CB  1 
ATOM   6696  O  OG1 . THR A 1 854  ? -29.931 76.945  49.315  1.00 64.04 ? 854  THR A OG1 1 
ATOM   6697  C  CG2 . THR A 1 854  ? -30.280 78.334  51.249  1.00 63.22 ? 854  THR A CG2 1 
ATOM   6698  N  N   . MET A 1 855  ? -32.740 77.441  48.165  1.00 70.40 ? 855  MET A N   1 
ATOM   6699  C  CA  . MET A 1 855  ? -33.933 76.597  48.159  1.00 74.20 ? 855  MET A CA  1 
ATOM   6700  C  C   . MET A 1 855  ? -33.513 75.153  48.366  1.00 75.49 ? 855  MET A C   1 
ATOM   6701  O  O   . MET A 1 855  ? -32.587 74.660  47.701  1.00 75.40 ? 855  MET A O   1 
ATOM   6702  C  CB  . MET A 1 855  ? -34.687 76.727  46.823  1.00 76.04 ? 855  MET A CB  1 
ATOM   6703  C  CG  . MET A 1 855  ? -35.580 77.955  46.746  1.00 79.35 ? 855  MET A CG  1 
ATOM   6704  S  SD  . MET A 1 855  ? -36.896 77.859  48.004  1.00 82.45 ? 855  MET A SD  1 
ATOM   6705  C  CE  . MET A 1 855  ? -38.109 76.696  47.180  1.00 81.90 ? 855  MET A CE  1 
ATOM   6706  N  N   . ILE A 1 856  ? -34.186 74.486  49.302  1.00 77.14 ? 856  ILE A N   1 
ATOM   6707  C  CA  . ILE A 1 856  ? -33.906 73.088  49.631  1.00 78.33 ? 856  ILE A CA  1 
ATOM   6708  C  C   . ILE A 1 856  ? -35.224 72.367  49.953  1.00 79.43 ? 856  ILE A C   1 
ATOM   6709  O  O   . ILE A 1 856  ? -35.526 72.060  51.122  1.00 79.92 ? 856  ILE A O   1 
ATOM   6710  C  CB  . ILE A 1 856  ? -32.922 72.999  50.836  1.00 77.67 ? 856  ILE A CB  1 
ATOM   6711  C  CG1 . ILE A 1 856  ? -31.616 73.720  50.481  1.00 77.03 ? 856  ILE A CG1 1 
ATOM   6712  C  CG2 . ILE A 1 856  ? -32.654 71.544  51.217  1.00 76.82 ? 856  ILE A CG2 1 
ATOM   6713  C  CD1 . ILE A 1 856  ? -31.603 75.186  50.852  1.00 76.90 ? 856  ILE A CD1 1 
ATOM   6714  N  N   . GLY A 1 857  ? -36.017 72.120  48.910  1.00 80.23 ? 857  GLY A N   1 
ATOM   6715  C  CA  . GLY A 1 857  ? -37.300 71.463  49.097  1.00 81.62 ? 857  GLY A CA  1 
ATOM   6716  C  C   . GLY A 1 857  ? -38.158 72.130  50.172  1.00 82.38 ? 857  GLY A C   1 
ATOM   6717  O  O   . GLY A 1 857  ? -38.202 71.665  51.323  1.00 82.78 ? 857  GLY A O   1 
ATOM   6718  N  N   . GLU A 1 858  ? -38.830 73.224  49.802  1.00 82.56 ? 858  GLU A N   1 
ATOM   6719  C  CA  . GLU A 1 858  ? -39.712 73.974  50.708  1.00 82.32 ? 858  GLU A CA  1 
ATOM   6720  C  C   . GLU A 1 858  ? -39.006 74.613  51.911  1.00 81.88 ? 858  GLU A C   1 
ATOM   6721  O  O   . GLU A 1 858  ? -39.626 75.367  52.674  1.00 82.30 ? 858  GLU A O   1 
ATOM   6722  C  CB  . GLU A 1 858  ? -40.854 73.070  51.209  1.00 82.54 ? 858  GLU A CB  1 
ATOM   6723  C  CG  . GLU A 1 858  ? -42.030 73.823  51.831  1.00 83.21 ? 858  GLU A CG  1 
ATOM   6724  C  CD  . GLU A 1 858  ? -42.996 72.912  52.576  1.00 83.52 ? 858  GLU A CD  1 
ATOM   6725  O  OE1 . GLU A 1 858  ? -43.977 73.434  53.154  1.00 82.85 ? 858  GLU A OE1 1 
ATOM   6726  O  OE2 . GLU A 1 858  ? -42.776 71.679  52.582  1.00 83.33 ? 858  GLU A OE2 1 
ATOM   6727  N  N   . SER A 1 859  ? -37.716 74.320  52.075  1.00 80.64 ? 859  SER A N   1 
ATOM   6728  C  CA  . SER A 1 859  ? -36.932 74.874  53.181  1.00 78.48 ? 859  SER A CA  1 
ATOM   6729  C  C   . SER A 1 859  ? -36.190 76.139  52.717  1.00 76.60 ? 859  SER A C   1 
ATOM   6730  O  O   . SER A 1 859  ? -35.168 76.062  52.023  1.00 76.65 ? 859  SER A O   1 
ATOM   6731  C  CB  . SER A 1 859  ? -35.933 73.822  53.688  1.00 79.02 ? 859  SER A CB  1 
ATOM   6732  O  OG  . SER A 1 859  ? -35.373 74.199  54.938  1.00 79.00 ? 859  SER A OG  1 
ATOM   6733  N  N   . VAL A 1 860  ? -36.713 77.302  53.102  1.00 73.77 ? 860  VAL A N   1 
ATOM   6734  C  CA  . VAL A 1 860  ? -36.114 78.578  52.715  1.00 70.95 ? 860  VAL A CA  1 
ATOM   6735  C  C   . VAL A 1 860  ? -34.990 79.040  53.655  1.00 68.10 ? 860  VAL A C   1 
ATOM   6736  O  O   . VAL A 1 860  ? -35.237 79.384  54.817  1.00 68.96 ? 860  VAL A O   1 
ATOM   6737  C  CB  . VAL A 1 860  ? -37.195 79.690  52.639  1.00 71.53 ? 860  VAL A CB  1 
ATOM   6738  C  CG1 . VAL A 1 860  ? -36.542 81.059  52.676  1.00 71.42 ? 860  VAL A CG1 1 
ATOM   6739  C  CG2 . VAL A 1 860  ? -38.013 79.531  51.365  1.00 71.37 ? 860  VAL A CG2 1 
ATOM   6740  N  N   . GLY A 1 861  ? -33.761 79.050  53.137  1.00 64.13 ? 861  GLY A N   1 
ATOM   6741  C  CA  . GLY A 1 861  ? -32.609 79.479  53.915  1.00 57.88 ? 861  GLY A CA  1 
ATOM   6742  C  C   . GLY A 1 861  ? -31.803 80.551  53.188  1.00 54.24 ? 861  GLY A C   1 
ATOM   6743  O  O   . GLY A 1 861  ? -32.212 81.053  52.138  1.00 53.22 ? 861  GLY A O   1 
ATOM   6744  N  N   . TYR A 1 862  ? -30.645 80.904  53.730  1.00 50.67 ? 862  TYR A N   1 
ATOM   6745  C  CA  . TYR A 1 862  ? -29.822 81.928  53.104  1.00 47.33 ? 862  TYR A CA  1 
ATOM   6746  C  C   . TYR A 1 862  ? -28.318 81.742  53.296  1.00 44.55 ? 862  TYR A C   1 
ATOM   6747  O  O   . TYR A 1 862  ? -27.845 81.509  54.414  1.00 45.18 ? 862  TYR A O   1 
ATOM   6748  C  CB  . TYR A 1 862  ? -30.233 83.308  53.631  1.00 48.58 ? 862  TYR A CB  1 
ATOM   6749  C  CG  . TYR A 1 862  ? -31.599 83.757  53.165  1.00 50.03 ? 862  TYR A CG  1 
ATOM   6750  C  CD1 . TYR A 1 862  ? -31.760 84.397  51.944  1.00 51.10 ? 862  TYR A CD1 1 
ATOM   6751  C  CD2 . TYR A 1 862  ? -32.749 83.472  53.919  1.00 50.62 ? 862  TYR A CD2 1 
ATOM   6752  C  CE1 . TYR A 1 862  ? -33.014 84.716  51.482  1.00 51.26 ? 862  TYR A CE1 1 
ATOM   6753  C  CE2 . TYR A 1 862  ? -34.016 83.813  53.471  1.00 51.03 ? 862  TYR A CE2 1 
ATOM   6754  C  CZ  . TYR A 1 862  ? -34.144 84.429  52.254  1.00 51.21 ? 862  TYR A CZ  1 
ATOM   6755  O  OH  . TYR A 1 862  ? -35.407 84.783  51.814  1.00 53.52 ? 862  TYR A OH  1 
ATOM   6756  N  N   . LEU A 1 863  ? -27.579 81.839  52.190  1.00 40.25 ? 863  LEU A N   1 
ATOM   6757  C  CA  . LEU A 1 863  ? -26.124 81.732  52.204  1.00 35.67 ? 863  LEU A CA  1 
ATOM   6758  C  C   . LEU A 1 863  ? -25.658 83.165  52.473  1.00 33.17 ? 863  LEU A C   1 
ATOM   6759  O  O   . LEU A 1 863  ? -26.156 84.111  51.870  1.00 32.95 ? 863  LEU A O   1 
ATOM   6760  C  CB  . LEU A 1 863  ? -25.619 81.259  50.842  1.00 35.88 ? 863  LEU A CB  1 
ATOM   6761  C  CG  . LEU A 1 863  ? -26.405 80.096  50.226  1.00 37.18 ? 863  LEU A CG  1 
ATOM   6762  C  CD1 . LEU A 1 863  ? -26.189 80.069  48.724  1.00 37.17 ? 863  LEU A CD1 1 
ATOM   6763  C  CD2 . LEU A 1 863  ? -25.980 78.784  50.868  1.00 35.77 ? 863  LEU A CD2 1 
ATOM   6764  N  N   . GLN A 1 864  ? -24.718 83.333  53.388  1.00 29.62 ? 864  GLN A N   1 
ATOM   6765  C  CA  . GLN A 1 864  ? -24.253 84.665  53.731  1.00 25.66 ? 864  GLN A CA  1 
ATOM   6766  C  C   . GLN A 1 864  ? -22.747 84.699  53.965  1.00 24.67 ? 864  GLN A C   1 
ATOM   6767  O  O   . GLN A 1 864  ? -22.252 84.063  54.907  1.00 23.89 ? 864  GLN A O   1 
ATOM   6768  C  CB  . GLN A 1 864  ? -24.977 85.130  55.000  1.00 24.07 ? 864  GLN A CB  1 
ATOM   6769  C  CG  . GLN A 1 864  ? -24.447 86.412  55.597  1.00 20.96 ? 864  GLN A CG  1 
ATOM   6770  C  CD  . GLN A 1 864  ? -24.726 87.604  54.716  1.00 23.52 ? 864  GLN A CD  1 
ATOM   6771  O  OE1 . GLN A 1 864  ? -25.883 87.950  54.466  1.00 25.78 ? 864  GLN A OE1 1 
ATOM   6772  N  NE2 . GLN A 1 864  ? -23.670 88.246  54.236  1.00 22.77 ? 864  GLN A NE2 1 
ATOM   6773  N  N   . TYR A 1 865  ? -22.031 85.435  53.114  1.00 22.09 ? 865  TYR A N   1 
ATOM   6774  C  CA  . TYR A 1 865  ? -20.589 85.572  53.242  1.00 22.39 ? 865  TYR A CA  1 
ATOM   6775  C  C   . TYR A 1 865  ? -20.314 86.678  54.253  1.00 22.16 ? 865  TYR A C   1 
ATOM   6776  O  O   . TYR A 1 865  ? -20.799 87.805  54.096  1.00 22.93 ? 865  TYR A O   1 
ATOM   6777  C  CB  . TYR A 1 865  ? -19.961 85.953  51.895  1.00 22.59 ? 865  TYR A CB  1 
ATOM   6778  C  CG  . TYR A 1 865  ? -19.570 84.785  51.017  1.00 22.65 ? 865  TYR A CG  1 
ATOM   6779  C  CD1 . TYR A 1 865  ? -18.352 84.129  51.202  1.00 21.52 ? 865  TYR A CD1 1 
ATOM   6780  C  CD2 . TYR A 1 865  ? -20.395 84.366  49.968  1.00 22.42 ? 865  TYR A CD2 1 
ATOM   6781  C  CE1 . TYR A 1 865  ? -17.955 83.081  50.353  1.00 23.73 ? 865  TYR A CE1 1 
ATOM   6782  C  CE2 . TYR A 1 865  ? -20.008 83.321  49.113  1.00 24.33 ? 865  TYR A CE2 1 
ATOM   6783  C  CZ  . TYR A 1 865  ? -18.783 82.689  49.311  1.00 24.06 ? 865  TYR A CZ  1 
ATOM   6784  O  OH  . TYR A 1 865  ? -18.357 81.706  48.445  1.00 27.29 ? 865  TYR A OH  1 
ATOM   6785  N  N   . PRO A 1 866  ? -19.554 86.370  55.323  1.00 21.83 ? 866  PRO A N   1 
ATOM   6786  C  CA  . PRO A 1 866  ? -19.248 87.392  56.329  1.00 20.90 ? 866  PRO A CA  1 
ATOM   6787  C  C   . PRO A 1 866  ? -18.340 88.460  55.718  1.00 20.82 ? 866  PRO A C   1 
ATOM   6788  O  O   . PRO A 1 866  ? -17.645 88.196  54.740  1.00 20.82 ? 866  PRO A O   1 
ATOM   6789  C  CB  . PRO A 1 866  ? -18.513 86.606  57.420  1.00 20.92 ? 866  PRO A CB  1 
ATOM   6790  C  CG  . PRO A 1 866  ? -18.982 85.195  57.228  1.00 21.19 ? 866  PRO A CG  1 
ATOM   6791  C  CD  . PRO A 1 866  ? -19.030 85.054  55.731  1.00 21.32 ? 866  PRO A CD  1 
ATOM   6792  N  N   . MET A 1 867  ? -18.334 89.654  56.297  1.00 20.69 ? 867  MET A N   1 
ATOM   6793  C  CA  . MET A 1 867  ? -17.495 90.743  55.803  1.00 21.57 ? 867  MET A CA  1 
ATOM   6794  C  C   . MET A 1 867  ? -16.037 90.299  55.704  1.00 21.78 ? 867  MET A C   1 
ATOM   6795  O  O   . MET A 1 867  ? -15.296 90.747  54.834  1.00 22.29 ? 867  MET A O   1 
ATOM   6796  C  CB  . MET A 1 867  ? -17.567 91.934  56.751  1.00 23.02 ? 867  MET A CB  1 
ATOM   6797  C  CG  . MET A 1 867  ? -17.113 91.600  58.162  1.00 24.44 ? 867  MET A CG  1 
ATOM   6798  S  SD  . MET A 1 867  ? -17.018 93.015  59.265  1.00 27.50 ? 867  MET A SD  1 
ATOM   6799  C  CE  . MET A 1 867  ? -15.327 93.552  58.918  1.00 26.23 ? 867  MET A CE  1 
ATOM   6800  N  N   . TRP A 1 868  ? -15.628 89.421  56.611  1.00 20.87 ? 868  TRP A N   1 
ATOM   6801  C  CA  . TRP A 1 868  ? -14.262 88.944  56.625  1.00 22.96 ? 868  TRP A CA  1 
ATOM   6802  C  C   . TRP A 1 868  ? -13.840 88.177  55.365  1.00 24.21 ? 868  TRP A C   1 
ATOM   6803  O  O   . TRP A 1 868  ? -12.645 88.075  55.066  1.00 24.80 ? 868  TRP A O   1 
ATOM   6804  C  CB  . TRP A 1 868  ? -14.029 88.091  57.875  1.00 24.62 ? 868  TRP A CB  1 
ATOM   6805  C  CG  . TRP A 1 868  ? -14.426 88.802  59.139  1.00 25.72 ? 868  TRP A CG  1 
ATOM   6806  C  CD1 . TRP A 1 868  ? -15.513 88.541  59.919  1.00 25.66 ? 868  TRP A CD1 1 
ATOM   6807  C  CD2 . TRP A 1 868  ? -13.747 89.911  59.752  1.00 26.35 ? 868  TRP A CD2 1 
ATOM   6808  N  NE1 . TRP A 1 868  ? -15.555 89.412  60.976  1.00 26.52 ? 868  TRP A NE1 1 
ATOM   6809  C  CE2 . TRP A 1 868  ? -14.484 90.261  60.898  1.00 27.72 ? 868  TRP A CE2 1 
ATOM   6810  C  CE3 . TRP A 1 868  ? -12.593 90.636  59.441  1.00 24.93 ? 868  TRP A CE3 1 
ATOM   6811  C  CZ2 . TRP A 1 868  ? -14.093 91.312  61.739  1.00 28.29 ? 868  TRP A CZ2 1 
ATOM   6812  C  CZ3 . TRP A 1 868  ? -12.209 91.671  60.273  1.00 24.97 ? 868  TRP A CZ3 1 
ATOM   6813  C  CH2 . TRP A 1 868  ? -12.954 92.000  61.409  1.00 26.69 ? 868  TRP A CH2 1 
ATOM   6814  N  N   . SER A 1 869  ? -14.796 87.642  54.614  1.00 24.35 ? 869  SER A N   1 
ATOM   6815  C  CA  . SER A 1 869  ? -14.427 86.919  53.401  1.00 25.44 ? 869  SER A CA  1 
ATOM   6816  C  C   . SER A 1 869  ? -13.890 87.899  52.364  1.00 24.96 ? 869  SER A C   1 
ATOM   6817  O  O   . SER A 1 869  ? -13.005 87.570  51.569  1.00 23.53 ? 869  SER A O   1 
ATOM   6818  C  CB  . SER A 1 869  ? -15.627 86.172  52.822  1.00 26.34 ? 869  SER A CB  1 
ATOM   6819  O  OG  . SER A 1 869  ? -15.978 85.079  53.652  1.00 28.29 ? 869  SER A OG  1 
ATOM   6820  N  N   . PHE A 1 870  ? -14.436 89.110  52.375  1.00 24.78 ? 870  PHE A N   1 
ATOM   6821  C  CA  . PHE A 1 870  ? -14.004 90.137  51.432  1.00 23.51 ? 870  PHE A CA  1 
ATOM   6822  C  C   . PHE A 1 870  ? -12.628 90.677  51.810  1.00 23.90 ? 870  PHE A C   1 
ATOM   6823  O  O   . PHE A 1 870  ? -11.844 91.089  50.941  1.00 24.52 ? 870  PHE A O   1 
ATOM   6824  C  CB  . PHE A 1 870  ? -15.035 91.262  51.387  1.00 21.39 ? 870  PHE A CB  1 
ATOM   6825  C  CG  . PHE A 1 870  ? -16.349 90.822  50.840  1.00 21.90 ? 870  PHE A CG  1 
ATOM   6826  C  CD1 . PHE A 1 870  ? -16.583 90.835  49.467  1.00 19.41 ? 870  PHE A CD1 1 
ATOM   6827  C  CD2 . PHE A 1 870  ? -17.332 90.314  51.682  1.00 21.83 ? 870  PHE A CD2 1 
ATOM   6828  C  CE1 . PHE A 1 870  ? -17.764 90.346  48.934  1.00 19.03 ? 870  PHE A CE1 1 
ATOM   6829  C  CE2 . PHE A 1 870  ? -18.526 89.818  51.148  1.00 21.00 ? 870  PHE A CE2 1 
ATOM   6830  C  CZ  . PHE A 1 870  ? -18.734 89.837  49.771  1.00 18.54 ? 870  PHE A CZ  1 
ATOM   6831  N  N   . VAL A 1 871  ? -12.326 90.667  53.102  1.00 22.59 ? 871  VAL A N   1 
ATOM   6832  C  CA  . VAL A 1 871  ? -11.035 91.150  53.535  1.00 22.71 ? 871  VAL A CA  1 
ATOM   6833  C  C   . VAL A 1 871  ? -10.012 90.193  52.969  1.00 22.73 ? 871  VAL A C   1 
ATOM   6834  O  O   . VAL A 1 871  ? -9.019  90.612  52.376  1.00 23.88 ? 871  VAL A O   1 
ATOM   6835  C  CB  . VAL A 1 871  ? -10.935 91.190  55.069  1.00 24.39 ? 871  VAL A CB  1 
ATOM   6836  C  CG1 . VAL A 1 871  ? -9.491  91.514  55.498  1.00 22.56 ? 871  VAL A CG1 1 
ATOM   6837  C  CG2 . VAL A 1 871  ? -11.936 92.232  55.621  1.00 24.60 ? 871  VAL A CG2 1 
ATOM   6838  N  N   . TYR A 1 872  ? -10.277 88.900  53.140  1.00 22.24 ? 872  TYR A N   1 
ATOM   6839  C  CA  . TYR A 1 872  ? -9.391  87.859  52.632  1.00 22.14 ? 872  TYR A CA  1 
ATOM   6840  C  C   . TYR A 1 872  ? -9.174  88.017  51.126  1.00 22.38 ? 872  TYR A C   1 
ATOM   6841  O  O   . TYR A 1 872  ? -8.052  87.869  50.648  1.00 23.95 ? 872  TYR A O   1 
ATOM   6842  C  CB  . TYR A 1 872  ? -9.981  86.481  52.896  1.00 20.67 ? 872  TYR A CB  1 
ATOM   6843  C  CG  . TYR A 1 872  ? -9.101  85.330  52.475  1.00 20.70 ? 872  TYR A CG  1 
ATOM   6844  C  CD1 . TYR A 1 872  ? -8.114  84.829  53.335  1.00 18.88 ? 872  TYR A CD1 1 
ATOM   6845  C  CD2 . TYR A 1 872  ? -9.275  84.711  51.225  1.00 19.57 ? 872  TYR A CD2 1 
ATOM   6846  C  CE1 . TYR A 1 872  ? -7.320  83.745  52.964  1.00 19.04 ? 872  TYR A CE1 1 
ATOM   6847  C  CE2 . TYR A 1 872  ? -8.488  83.616  50.843  1.00 19.10 ? 872  TYR A CE2 1 
ATOM   6848  C  CZ  . TYR A 1 872  ? -7.514  83.137  51.718  1.00 19.03 ? 872  TYR A CZ  1 
ATOM   6849  O  OH  . TYR A 1 872  ? -6.744  82.052  51.363  1.00 19.49 ? 872  TYR A OH  1 
ATOM   6850  N  N   . TRP A 1 873  ? -10.245 88.309  50.390  1.00 20.86 ? 873  TRP A N   1 
ATOM   6851  C  CA  . TRP A 1 873  ? -10.160 88.482  48.939  1.00 20.03 ? 873  TRP A CA  1 
ATOM   6852  C  C   . TRP A 1 873  ? -9.368  89.715  48.524  1.00 19.70 ? 873  TRP A C   1 
ATOM   6853  O  O   . TRP A 1 873  ? -8.982  89.846  47.368  1.00 19.44 ? 873  TRP A O   1 
ATOM   6854  C  CB  . TRP A 1 873  ? -11.569 88.514  48.305  1.00 18.82 ? 873  TRP A CB  1 
ATOM   6855  C  CG  . TRP A 1 873  ? -12.268 87.169  48.362  1.00 19.55 ? 873  TRP A CG  1 
ATOM   6856  C  CD1 . TRP A 1 873  ? -11.675 85.936  48.267  1.00 16.23 ? 873  TRP A CD1 1 
ATOM   6857  C  CD2 . TRP A 1 873  ? -13.684 86.923  48.469  1.00 20.71 ? 873  TRP A CD2 1 
ATOM   6858  N  NE1 . TRP A 1 873  ? -12.623 84.953  48.306  1.00 18.30 ? 873  TRP A NE1 1 
ATOM   6859  C  CE2 . TRP A 1 873  ? -13.865 85.519  48.426  1.00 19.01 ? 873  TRP A CE2 1 
ATOM   6860  C  CE3 . TRP A 1 873  ? -14.811 87.749  48.595  1.00 21.06 ? 873  TRP A CE3 1 
ATOM   6861  C  CZ2 . TRP A 1 873  ? -15.138 84.911  48.498  1.00 18.75 ? 873  TRP A CZ2 1 
ATOM   6862  C  CZ3 . TRP A 1 873  ? -16.087 87.147  48.672  1.00 21.56 ? 873  TRP A CZ3 1 
ATOM   6863  C  CH2 . TRP A 1 873  ? -16.234 85.734  48.621  1.00 20.03 ? 873  TRP A CH2 1 
ATOM   6864  N  N   . GLY A 1 874  ? -9.132  90.620  49.470  1.00 20.07 ? 874  GLY A N   1 
ATOM   6865  C  CA  . GLY A 1 874  ? -8.349  91.809  49.177  1.00 19.64 ? 874  GLY A CA  1 
ATOM   6866  C  C   . GLY A 1 874  ? -8.951  93.145  49.553  1.00 19.28 ? 874  GLY A C   1 
ATOM   6867  O  O   . GLY A 1 874  ? -8.300  94.168  49.402  1.00 19.51 ? 874  GLY A O   1 
ATOM   6868  N  N   . LEU A 1 875  ? -10.187 93.150  50.038  1.00 18.93 ? 875  LEU A N   1 
ATOM   6869  C  CA  . LEU A 1 875  ? -10.844 94.406  50.399  1.00 18.55 ? 875  LEU A CA  1 
ATOM   6870  C  C   . LEU A 1 875  ? -10.394 94.881  51.789  1.00 18.53 ? 875  LEU A C   1 
ATOM   6871  O  O   . LEU A 1 875  ? -10.682 94.238  52.804  1.00 19.66 ? 875  LEU A O   1 
ATOM   6872  C  CB  . LEU A 1 875  ? -12.366 94.223  50.354  1.00 17.78 ? 875  LEU A CB  1 
ATOM   6873  C  CG  . LEU A 1 875  ? -13.234 95.478  50.453  1.00 17.19 ? 875  LEU A CG  1 
ATOM   6874  C  CD1 . LEU A 1 875  ? -12.958 96.402  49.258  1.00 13.60 ? 875  LEU A CD1 1 
ATOM   6875  C  CD2 . LEU A 1 875  ? -14.693 95.076  50.495  1.00 15.22 ? 875  LEU A CD2 1 
ATOM   6876  N  N   . PRO A 1 876  ? -9.682  96.014  51.852  1.00 18.18 ? 876  PRO A N   1 
ATOM   6877  C  CA  . PRO A 1 876  ? -9.197  96.549  53.135  1.00 18.62 ? 876  PRO A CA  1 
ATOM   6878  C  C   . PRO A 1 876  ? -10.291 97.030  54.082  1.00 21.62 ? 876  PRO A C   1 
ATOM   6879  O  O   . PRO A 1 876  ? -11.340 97.518  53.652  1.00 22.47 ? 876  PRO A O   1 
ATOM   6880  C  CB  . PRO A 1 876  ? -8.269  97.681  52.707  1.00 17.21 ? 876  PRO A CB  1 
ATOM   6881  C  CG  . PRO A 1 876  ? -8.939  98.204  51.465  1.00 16.24 ? 876  PRO A CG  1 
ATOM   6882  C  CD  . PRO A 1 876  ? -9.328  96.915  50.741  1.00 17.91 ? 876  PRO A CD  1 
ATOM   6883  N  N   . LEU A 1 877  ? -10.029 96.884  55.375  1.00 22.12 ? 877  LEU A N   1 
ATOM   6884  C  CA  . LEU A 1 877  ? -10.945 97.305  56.418  1.00 21.32 ? 877  LEU A CA  1 
ATOM   6885  C  C   . LEU A 1 877  ? -10.923 98.816  56.517  1.00 22.75 ? 877  LEU A C   1 
ATOM   6886  O  O   . LEU A 1 877  ? -9.907  99.447  56.223  1.00 22.88 ? 877  LEU A O   1 
ATOM   6887  C  CB  . LEU A 1 877  ? -10.519 96.710  57.763  1.00 18.38 ? 877  LEU A CB  1 
ATOM   6888  C  CG  . LEU A 1 877  ? -10.690 95.199  57.962  1.00 17.98 ? 877  LEU A CG  1 
ATOM   6889  C  CD1 . LEU A 1 877  ? -9.873  94.744  59.176  1.00 15.19 ? 877  LEU A CD1 1 
ATOM   6890  C  CD2 . LEU A 1 877  ? -12.166 94.850  58.111  1.00 14.08 ? 877  LEU A CD2 1 
ATOM   6891  N  N   . VAL A 1 878  ? -12.051 99.391  56.923  1.00 23.01 ? 878  VAL A N   1 
ATOM   6892  C  CA  . VAL A 1 878  ? -12.181 100.832 57.088  1.00 23.63 ? 878  VAL A CA  1 
ATOM   6893  C  C   . VAL A 1 878  ? -11.819 101.189 58.533  1.00 25.01 ? 878  VAL A C   1 
ATOM   6894  O  O   . VAL A 1 878  ? -11.132 102.182 58.786  1.00 25.17 ? 878  VAL A O   1 
ATOM   6895  C  CB  . VAL A 1 878  ? -13.632 101.306 56.819  1.00 23.29 ? 878  VAL A CB  1 
ATOM   6896  C  CG1 . VAL A 1 878  ? -13.734 102.814 57.006  1.00 21.44 ? 878  VAL A CG1 1 
ATOM   6897  C  CG2 . VAL A 1 878  ? -14.056 100.914 55.404  1.00 24.15 ? 878  VAL A CG2 1 
ATOM   6898  N  N   . LYS A 1 879  ? -12.278 100.364 59.476  1.00 25.92 ? 879  LYS A N   1 
ATOM   6899  C  CA  . LYS A 1 879  ? -12.020 100.596 60.893  1.00 25.18 ? 879  LYS A CA  1 
ATOM   6900  C  C   . LYS A 1 879  ? -12.568 99.428  61.706  1.00 25.64 ? 879  LYS A C   1 
ATOM   6901  O  O   . LYS A 1 879  ? -13.713 99.030  61.533  1.00 25.42 ? 879  LYS A O   1 
ATOM   6902  C  CB  . LYS A 1 879  ? -12.697 101.902 61.321  1.00 25.06 ? 879  LYS A CB  1 
ATOM   6903  C  CG  . LYS A 1 879  ? -12.555 102.287 62.786  1.00 24.52 ? 879  LYS A CG  1 
ATOM   6904  C  CD  . LYS A 1 879  ? -13.672 103.269 63.175  1.00 23.11 ? 879  LYS A CD  1 
ATOM   6905  C  CE  . LYS A 1 879  ? -13.389 104.027 64.467  1.00 22.31 ? 879  LYS A CE  1 
ATOM   6906  N  NZ  . LYS A 1 879  ? -12.970 103.171 65.615  1.00 22.71 ? 879  LYS A NZ  1 
ATOM   6907  N  N   . ALA A 1 880  ? -11.731 98.870  62.613  1.00 25.95 ? 880  ALA A N   1 
ATOM   6908  C  CA  . ALA A 1 880  ? -12.157 97.748  63.434  1.00 25.54 ? 880  ALA A CA  1 
ATOM   6909  C  C   . ALA A 1 880  ? -11.372 97.688  64.737  1.00 24.87 ? 880  ALA A C   1 
ATOM   6910  O  O   . ALA A 1 880  ? -10.350 98.321  64.926  1.00 25.16 ? 880  ALA A O   1 
ATOM   6911  C  CB  . ALA A 1 880  ? -12.013 96.445  62.667  1.00 26.08 ? 880  ALA A CB  1 
ATOM   6912  N  N   . PHE A 1 881  ? -11.905 96.856  65.664  1.00 25.12 ? 881  PHE A N   1 
ATOM   6913  C  CA  . PHE A 1 881  ? -11.320 96.624  66.981  1.00 24.75 ? 881  PHE A CA  1 
ATOM   6914  C  C   . PHE A 1 881  ? -10.920 97.915  67.699  1.00 24.80 ? 881  PHE A C   1 
ATOM   6915  O  O   . PHE A 1 881  ? -9.940  97.938  68.446  1.00 23.64 ? 881  PHE A O   1 
ATOM   6916  C  CB  . PHE A 1 881  ? -10.110 95.692  66.848  1.00 23.30 ? 881  PHE A CB  1 
ATOM   6917  C  CG  . PHE A 1 881  ? -10.472 94.308  66.387  1.00 23.62 ? 881  PHE A CG  1 
ATOM   6918  C  CD1 . PHE A 1 881  ? -11.206 93.459  67.213  1.00 21.46 ? 881  PHE A CD1 1 
ATOM   6919  C  CD2 . PHE A 1 881  ? -10.129 93.867  65.104  1.00 23.00 ? 881  PHE A CD2 1 
ATOM   6920  C  CE1 . PHE A 1 881  ? -11.617 92.195  66.768  1.00 21.40 ? 881  PHE A CE1 1 
ATOM   6921  C  CE2 . PHE A 1 881  ? -10.537 92.601  64.647  1.00 22.81 ? 881  PHE A CE2 1 
ATOM   6922  C  CZ  . PHE A 1 881  ? -11.280 91.764  65.486  1.00 21.99 ? 881  PHE A CZ  1 
ATOM   6923  N  N   . GLY A 1 882  ? -11.681 98.983  67.457  1.00 24.06 ? 882  GLY A N   1 
ATOM   6924  C  CA  . GLY A 1 882  ? -11.403 100.267 68.083  1.00 24.21 ? 882  GLY A CA  1 
ATOM   6925  C  C   . GLY A 1 882  ? -10.254 101.081 67.489  1.00 24.96 ? 882  GLY A C   1 
ATOM   6926  O  O   . GLY A 1 882  ? -9.794  102.038 68.104  1.00 26.46 ? 882  GLY A O   1 
ATOM   6927  N  N   . SER A 1 883  ? -9.789  100.725 66.296  1.00 24.23 ? 883  SER A N   1 
ATOM   6928  C  CA  . SER A 1 883  ? -8.678  101.445 65.665  1.00 22.63 ? 883  SER A CA  1 
ATOM   6929  C  C   . SER A 1 883  ? -9.077  102.789 65.078  1.00 21.76 ? 883  SER A C   1 
ATOM   6930  O  O   . SER A 1 883  ? -10.249 103.151 65.062  1.00 20.84 ? 883  SER A O   1 
ATOM   6931  C  CB  . SER A 1 883  ? -8.087  100.615 64.531  1.00 21.80 ? 883  SER A CB  1 
ATOM   6932  O  OG  . SER A 1 883  ? -8.898  100.738 63.373  1.00 22.40 ? 883  SER A OG  1 
ATOM   6933  N  N   . ASP A 1 884  ? -8.083  103.525 64.597  1.00 20.51 ? 884  ASP A N   1 
ATOM   6934  C  CA  . ASP A 1 884  ? -8.362  104.797 63.951  1.00 21.58 ? 884  ASP A CA  1 
ATOM   6935  C  C   . ASP A 1 884  ? -8.955  104.410 62.601  1.00 21.37 ? 884  ASP A C   1 
ATOM   6936  O  O   . ASP A 1 884  ? -8.748  103.294 62.109  1.00 20.45 ? 884  ASP A O   1 
ATOM   6937  C  CB  . ASP A 1 884  ? -7.092  105.626 63.701  1.00 24.18 ? 884  ASP A CB  1 
ATOM   6938  C  CG  . ASP A 1 884  ? -6.405  106.091 64.992  1.00 26.40 ? 884  ASP A CG  1 
ATOM   6939  O  OD1 . ASP A 1 884  ? -7.086  106.282 66.028  1.00 27.31 ? 884  ASP A OD1 1 
ATOM   6940  O  OD2 . ASP A 1 884  ? -5.167  106.282 64.949  1.00 28.17 ? 884  ASP A OD2 1 
ATOM   6941  N  N   . PRO A 1 885  ? -9.713  105.321 61.987  1.00 21.09 ? 885  PRO A N   1 
ATOM   6942  C  CA  . PRO A 1 885  ? -10.311 105.014 60.685  1.00 19.90 ? 885  PRO A CA  1 
ATOM   6943  C  C   . PRO A 1 885  ? -9.351  105.215 59.516  1.00 19.79 ? 885  PRO A C   1 
ATOM   6944  O  O   . PRO A 1 885  ? -8.468  106.066 59.556  1.00 21.80 ? 885  PRO A O   1 
ATOM   6945  C  CB  . PRO A 1 885  ? -11.499 105.970 60.622  1.00 19.61 ? 885  PRO A CB  1 
ATOM   6946  C  CG  . PRO A 1 885  ? -10.956 107.192 61.348  1.00 19.29 ? 885  PRO A CG  1 
ATOM   6947  C  CD  . PRO A 1 885  ? -10.207 106.605 62.524  1.00 19.82 ? 885  PRO A CD  1 
ATOM   6948  N  N   . TRP A 1 886  ? -9.540  104.408 58.477  1.00 21.10 ? 886  TRP A N   1 
ATOM   6949  C  CA  . TRP A 1 886  ? -8.766  104.471 57.232  1.00 20.34 ? 886  TRP A CA  1 
ATOM   6950  C  C   . TRP A 1 886  ? -7.266  104.260 57.320  1.00 21.03 ? 886  TRP A C   1 
ATOM   6951  O  O   . TRP A 1 886  ? -6.497  104.858 56.557  1.00 19.77 ? 886  TRP A O   1 
ATOM   6952  C  CB  . TRP A 1 886  ? -9.047  105.791 56.516  1.00 18.43 ? 886  TRP A CB  1 
ATOM   6953  C  CG  . TRP A 1 886  ? -10.490 106.052 56.358  1.00 17.10 ? 886  TRP A CG  1 
ATOM   6954  C  CD1 . TRP A 1 886  ? -11.236 106.916 57.084  1.00 17.05 ? 886  TRP A CD1 1 
ATOM   6955  C  CD2 . TRP A 1 886  ? -11.375 105.448 55.410  1.00 18.53 ? 886  TRP A CD2 1 
ATOM   6956  N  NE1 . TRP A 1 886  ? -12.535 106.905 56.654  1.00 17.49 ? 886  TRP A NE1 1 
ATOM   6957  C  CE2 . TRP A 1 886  ? -12.655 106.010 55.627  1.00 19.37 ? 886  TRP A CE2 1 
ATOM   6958  C  CE3 . TRP A 1 886  ? -11.220 104.491 54.396  1.00 16.58 ? 886  TRP A CE3 1 
ATOM   6959  C  CZ2 . TRP A 1 886  ? -13.778 105.644 54.865  1.00 17.84 ? 886  TRP A CZ2 1 
ATOM   6960  C  CZ3 . TRP A 1 886  ? -12.327 104.128 53.643  1.00 16.70 ? 886  TRP A CZ3 1 
ATOM   6961  C  CH2 . TRP A 1 886  ? -13.595 104.705 53.883  1.00 18.12 ? 886  TRP A CH2 1 
ATOM   6962  N  N   . ILE A 1 887  ? -6.844  103.398 58.235  1.00 21.61 ? 887  ILE A N   1 
ATOM   6963  C  CA  . ILE A 1 887  ? -5.432  103.129 58.381  1.00 21.59 ? 887  ILE A CA  1 
ATOM   6964  C  C   . ILE A 1 887  ? -4.991  102.048 57.417  1.00 22.89 ? 887  ILE A C   1 
ATOM   6965  O  O   . ILE A 1 887  ? -3.806  101.832 57.225  1.00 24.82 ? 887  ILE A O   1 
ATOM   6966  C  CB  . ILE A 1 887  ? -5.096  102.701 59.819  1.00 22.09 ? 887  ILE A CB  1 
ATOM   6967  C  CG1 . ILE A 1 887  ? -6.089  101.640 60.302  1.00 20.71 ? 887  ILE A CG1 1 
ATOM   6968  C  CG2 . ILE A 1 887  ? -5.119  103.920 60.735  1.00 21.72 ? 887  ILE A CG2 1 
ATOM   6969  C  CD1 . ILE A 1 887  ? -5.687  100.994 61.599  1.00 19.35 ? 887  ILE A CD1 1 
ATOM   6970  N  N   . PHE A 1 888  ? -5.950  101.379 56.791  1.00 22.11 ? 888  PHE A N   1 
ATOM   6971  C  CA  . PHE A 1 888  ? -5.622  100.306 55.858  1.00 21.17 ? 888  PHE A CA  1 
ATOM   6972  C  C   . PHE A 1 888  ? -5.735  100.747 54.406  1.00 21.40 ? 888  PHE A C   1 
ATOM   6973  O  O   . PHE A 1 888  ? -6.758  101.310 53.986  1.00 22.01 ? 888  PHE A O   1 
ATOM   6974  C  CB  . PHE A 1 888  ? -6.523  99.099  56.123  1.00 19.64 ? 888  PHE A CB  1 
ATOM   6975  C  CG  . PHE A 1 888  ? -6.445  98.585  57.535  1.00 21.18 ? 888  PHE A CG  1 
ATOM   6976  C  CD1 . PHE A 1 888  ? -5.239  98.157  58.068  1.00 20.40 ? 888  PHE A CD1 1 
ATOM   6977  C  CD2 . PHE A 1 888  ? -7.581  98.530  58.333  1.00 22.08 ? 888  PHE A CD2 1 
ATOM   6978  C  CE1 . PHE A 1 888  ? -5.158  97.684  59.377  1.00 21.53 ? 888  PHE A CE1 1 
ATOM   6979  C  CE2 . PHE A 1 888  ? -7.512  98.058  59.653  1.00 23.17 ? 888  PHE A CE2 1 
ATOM   6980  C  CZ  . PHE A 1 888  ? -6.301  97.632  60.172  1.00 23.20 ? 888  PHE A CZ  1 
ATOM   6981  N  N   . SER A 1 889  ? -4.670  100.478 53.650  1.00 21.39 ? 889  SER A N   1 
ATOM   6982  C  CA  . SER A 1 889  ? -4.575  100.843 52.243  1.00 19.63 ? 889  SER A CA  1 
ATOM   6983  C  C   . SER A 1 889  ? -5.112  99.740  51.331  1.00 19.88 ? 889  SER A C   1 
ATOM   6984  O  O   . SER A 1 889  ? -5.214  98.583  51.748  1.00 20.09 ? 889  SER A O   1 
ATOM   6985  C  CB  . SER A 1 889  ? -3.106  101.141 51.916  1.00 19.09 ? 889  SER A CB  1 
ATOM   6986  O  OG  . SER A 1 889  ? -2.872  101.217 50.516  1.00 17.10 ? 889  SER A OG  1 
ATOM   6987  N  N   . TRP A 1 890  ? -5.459  100.080 50.094  1.00 19.51 ? 890  TRP A N   1 
ATOM   6988  C  CA  . TRP A 1 890  ? -5.949  99.050  49.185  1.00 21.34 ? 890  TRP A CA  1 
ATOM   6989  C  C   . TRP A 1 890  ? -4.796  98.207  48.627  1.00 21.83 ? 890  TRP A C   1 
ATOM   6990  O  O   . TRP A 1 890  ? -5.013  97.309  47.829  1.00 22.72 ? 890  TRP A O   1 
ATOM   6991  C  CB  . TRP A 1 890  ? -6.794  99.641  48.036  1.00 21.74 ? 890  TRP A CB  1 
ATOM   6992  C  CG  . TRP A 1 890  ? -6.106  100.642 47.114  1.00 22.32 ? 890  TRP A CG  1 
ATOM   6993  C  CD1 . TRP A 1 890  ? -4.754  100.742 46.837  1.00 23.39 ? 890  TRP A CD1 1 
ATOM   6994  C  CD2 . TRP A 1 890  ? -6.752  101.628 46.294  1.00 21.51 ? 890  TRP A CD2 1 
ATOM   6995  N  NE1 . TRP A 1 890  ? -4.533  101.722 45.895  1.00 22.15 ? 890  TRP A NE1 1 
ATOM   6996  C  CE2 . TRP A 1 890  ? -5.739  102.282 45.542  1.00 22.53 ? 890  TRP A CE2 1 
ATOM   6997  C  CE3 . TRP A 1 890  ? -8.090  102.027 46.118  1.00 20.80 ? 890  TRP A CE3 1 
ATOM   6998  C  CZ2 . TRP A 1 890  ? -6.025  103.310 44.627  1.00 20.72 ? 890  TRP A CZ2 1 
ATOM   6999  C  CZ3 . TRP A 1 890  ? -8.377  103.053 45.211  1.00 19.84 ? 890  TRP A CZ3 1 
ATOM   7000  C  CH2 . TRP A 1 890  ? -7.345  103.682 44.476  1.00 20.86 ? 890  TRP A CH2 1 
ATOM   7001  N  N   . TYR A 1 891  ? -3.572  98.506  49.044  1.00 21.25 ? 891  TYR A N   1 
ATOM   7002  C  CA  . TYR A 1 891  ? -2.421  97.734  48.597  1.00 20.05 ? 891  TYR A CA  1 
ATOM   7003  C  C   . TYR A 1 891  ? -2.200  96.579  49.580  1.00 20.17 ? 891  TYR A C   1 
ATOM   7004  O  O   . TYR A 1 891  ? -1.184  95.874  49.525  1.00 18.32 ? 891  TYR A O   1 
ATOM   7005  C  CB  . TYR A 1 891  ? -1.168  98.608  48.514  1.00 19.80 ? 891  TYR A CB  1 
ATOM   7006  C  CG  . TYR A 1 891  ? -1.222  99.658  47.425  1.00 20.18 ? 891  TYR A CG  1 
ATOM   7007  C  CD1 . TYR A 1 891  ? -1.286  99.298  46.078  1.00 19.37 ? 891  TYR A CD1 1 
ATOM   7008  C  CD2 . TYR A 1 891  ? -1.226  101.014 47.745  1.00 20.42 ? 891  TYR A CD2 1 
ATOM   7009  C  CE1 . TYR A 1 891  ? -1.354  100.267 45.079  1.00 20.34 ? 891  TYR A CE1 1 
ATOM   7010  C  CE2 . TYR A 1 891  ? -1.302  101.986 46.760  1.00 20.11 ? 891  TYR A CE2 1 
ATOM   7011  C  CZ  . TYR A 1 891  ? -1.362  101.611 45.432  1.00 21.67 ? 891  TYR A CZ  1 
ATOM   7012  O  OH  . TYR A 1 891  ? -1.433  102.589 44.461  1.00 24.43 ? 891  TYR A OH  1 
ATOM   7013  N  N   . MET A 1 892  ? -3.147  96.399  50.495  1.00 19.70 ? 892  MET A N   1 
ATOM   7014  C  CA  . MET A 1 892  ? -3.047  95.292  51.432  1.00 20.39 ? 892  MET A CA  1 
ATOM   7015  C  C   . MET A 1 892  ? -3.077  94.027  50.593  1.00 21.19 ? 892  MET A C   1 
ATOM   7016  O  O   . MET A 1 892  ? -3.949  93.869  49.750  1.00 22.12 ? 892  MET A O   1 
ATOM   7017  C  CB  . MET A 1 892  ? -4.235  95.262  52.387  1.00 20.00 ? 892  MET A CB  1 
ATOM   7018  C  CG  . MET A 1 892  ? -4.402  93.911  53.091  1.00 19.74 ? 892  MET A CG  1 
ATOM   7019  S  SD  . MET A 1 892  ? -5.973  93.716  53.931  1.00 20.78 ? 892  MET A SD  1 
ATOM   7020  C  CE  . MET A 1 892  ? -7.105  93.678  52.517  1.00 20.63 ? 892  MET A CE  1 
ATOM   7021  N  N   . PRO A 1 893  ? -2.129  93.106  50.813  1.00 21.90 ? 893  PRO A N   1 
ATOM   7022  C  CA  . PRO A 1 893  ? -2.082  91.858  50.046  1.00 23.13 ? 893  PRO A CA  1 
ATOM   7023  C  C   . PRO A 1 893  ? -3.375  91.054  50.151  1.00 23.37 ? 893  PRO A C   1 
ATOM   7024  O  O   . PRO A 1 893  ? -4.277  91.391  50.908  1.00 22.88 ? 893  PRO A O   1 
ATOM   7025  C  CB  . PRO A 1 893  ? -0.906  91.102  50.677  1.00 21.44 ? 893  PRO A CB  1 
ATOM   7026  C  CG  . PRO A 1 893  ? -0.039  92.178  51.182  1.00 22.33 ? 893  PRO A CG  1 
ATOM   7027  C  CD  . PRO A 1 893  ? -1.027  93.154  51.784  1.00 22.31 ? 893  PRO A CD  1 
ATOM   7028  N  N   . THR A 1 894  ? -3.438  89.969  49.395  1.00 24.84 ? 894  THR A N   1 
ATOM   7029  C  CA  . THR A 1 894  ? -4.599  89.096  49.398  1.00 25.18 ? 894  THR A CA  1 
ATOM   7030  C  C   . THR A 1 894  ? -4.307  87.868  50.282  1.00 24.60 ? 894  THR A C   1 
ATOM   7031  O  O   . THR A 1 894  ? -3.161  87.638  50.694  1.00 24.56 ? 894  THR A O   1 
ATOM   7032  C  CB  . THR A 1 894  ? -4.918  88.669  47.935  1.00 26.50 ? 894  THR A CB  1 
ATOM   7033  O  OG1 . THR A 1 894  ? -6.332  88.660  47.746  1.00 28.59 ? 894  THR A OG1 1 
ATOM   7034  C  CG2 . THR A 1 894  ? -4.336  87.314  47.605  1.00 23.54 ? 894  THR A CG2 1 
ATOM   7035  N  N   . GLY A 1 895  ? -5.342  87.096  50.588  1.00 24.80 ? 895  GLY A N   1 
ATOM   7036  C  CA  . GLY A 1 895  ? -5.159  85.901  51.396  1.00 25.03 ? 895  GLY A CA  1 
ATOM   7037  C  C   . GLY A 1 895  ? -4.329  86.009  52.673  1.00 25.05 ? 895  GLY A C   1 
ATOM   7038  O  O   . GLY A 1 895  ? -4.316  87.041  53.360  1.00 25.11 ? 895  GLY A O   1 
ATOM   7039  N  N   . ASP A 1 896  ? -3.631  84.933  53.007  1.00 24.52 ? 896  ASP A N   1 
ATOM   7040  C  CA  . ASP A 1 896  ? -2.830  84.916  54.225  1.00 23.58 ? 896  ASP A CA  1 
ATOM   7041  C  C   . ASP A 1 896  ? -1.900  86.110  54.431  1.00 23.27 ? 896  ASP A C   1 
ATOM   7042  O  O   . ASP A 1 896  ? -1.841  86.669  55.534  1.00 22.69 ? 896  ASP A O   1 
ATOM   7043  C  CB  . ASP A 1 896  ? -2.031  83.616  54.308  1.00 24.92 ? 896  ASP A CB  1 
ATOM   7044  C  CG  . ASP A 1 896  ? -2.848  82.477  54.877  1.00 26.18 ? 896  ASP A CG  1 
ATOM   7045  O  OD1 . ASP A 1 896  ? -3.934  82.753  55.438  1.00 25.37 ? 896  ASP A OD1 1 
ATOM   7046  O  OD2 . ASP A 1 896  ? -2.406  81.311  54.778  1.00 27.59 ? 896  ASP A OD2 1 
ATOM   7047  N  N   . LEU A 1 897  ? -1.184  86.511  53.383  1.00 21.32 ? 897  LEU A N   1 
ATOM   7048  C  CA  . LEU A 1 897  ? -0.270  87.638  53.512  1.00 20.76 ? 897  LEU A CA  1 
ATOM   7049  C  C   . LEU A 1 897  ? -1.004  88.919  53.910  1.00 20.05 ? 897  LEU A C   1 
ATOM   7050  O  O   . LEU A 1 897  ? -0.504  89.706  54.718  1.00 21.13 ? 897  LEU A O   1 
ATOM   7051  C  CB  . LEU A 1 897  ? 0.510   87.853  52.212  1.00 18.62 ? 897  LEU A CB  1 
ATOM   7052  C  CG  . LEU A 1 897  ? 1.483   89.032  52.290  1.00 17.35 ? 897  LEU A CG  1 
ATOM   7053  C  CD1 . LEU A 1 897  ? 2.494   88.786  53.426  1.00 17.41 ? 897  LEU A CD1 1 
ATOM   7054  C  CD2 . LEU A 1 897  ? 2.180   89.220  50.943  1.00 13.50 ? 897  LEU A CD2 1 
ATOM   7055  N  N   . GLY A 1 898  ? -2.190  89.117  53.351  1.00 19.32 ? 898  GLY A N   1 
ATOM   7056  C  CA  . GLY A 1 898  ? -2.960  90.298  53.680  1.00 19.46 ? 898  GLY A CA  1 
ATOM   7057  C  C   . GLY A 1 898  ? -3.525  90.192  55.082  1.00 18.66 ? 898  GLY A C   1 
ATOM   7058  O  O   . GLY A 1 898  ? -3.495  91.173  55.847  1.00 19.73 ? 898  GLY A O   1 
ATOM   7059  N  N   . MET A 1 899  ? -4.052  89.014  55.417  1.00 18.44 ? 899  MET A N   1 
ATOM   7060  C  CA  . MET A 1 899  ? -4.604  88.776  56.754  1.00 17.25 ? 899  MET A CA  1 
ATOM   7061  C  C   . MET A 1 899  ? -3.524  89.027  57.802  1.00 18.84 ? 899  MET A C   1 
ATOM   7062  O  O   . MET A 1 899  ? -3.779  89.645  58.847  1.00 19.17 ? 899  MET A O   1 
ATOM   7063  C  CB  . MET A 1 899  ? -5.138  87.354  56.869  1.00 16.20 ? 899  MET A CB  1 
ATOM   7064  C  CG  . MET A 1 899  ? -6.338  87.069  55.988  1.00 15.41 ? 899  MET A CG  1 
ATOM   7065  S  SD  . MET A 1 899  ? -7.838  87.917  56.565  1.00 18.18 ? 899  MET A SD  1 
ATOM   7066  C  CE  . MET A 1 899  ? -8.096  87.171  58.119  1.00 16.16 ? 899  MET A CE  1 
ATOM   7067  N  N   . TYR A 1 900  ? -2.317  88.580  57.501  1.00 19.11 ? 900  TYR A N   1 
ATOM   7068  C  CA  . TYR A 1 900  ? -1.197  88.787  58.390  1.00 17.72 ? 900  TYR A CA  1 
ATOM   7069  C  C   . TYR A 1 900  ? -0.880  90.266  58.505  1.00 18.91 ? 900  TYR A C   1 
ATOM   7070  O  O   . TYR A 1 900  ? -0.603  90.773  59.600  1.00 18.46 ? 900  TYR A O   1 
ATOM   7071  C  CB  . TYR A 1 900  ? 0.041   88.075  57.873  1.00 17.71 ? 900  TYR A CB  1 
ATOM   7072  C  CG  . TYR A 1 900  ? 1.292   88.508  58.593  1.00 18.85 ? 900  TYR A CG  1 
ATOM   7073  C  CD1 . TYR A 1 900  ? 1.581   88.044  59.885  1.00 19.28 ? 900  TYR A CD1 1 
ATOM   7074  C  CD2 . TYR A 1 900  ? 2.169   89.422  58.001  1.00 19.32 ? 900  TYR A CD2 1 
ATOM   7075  C  CE1 . TYR A 1 900  ? 2.714   88.491  60.567  1.00 19.39 ? 900  TYR A CE1 1 
ATOM   7076  C  CE2 . TYR A 1 900  ? 3.293   89.875  58.666  1.00 20.14 ? 900  TYR A CE2 1 
ATOM   7077  C  CZ  . TYR A 1 900  ? 3.564   89.407  59.950  1.00 20.20 ? 900  TYR A CZ  1 
ATOM   7078  O  OH  . TYR A 1 900  ? 4.674   89.873  60.617  1.00 20.53 ? 900  TYR A OH  1 
ATOM   7079  N  N   . SER A 1 901  ? -0.906  90.966  57.376  1.00 17.51 ? 901  SER A N   1 
ATOM   7080  C  CA  . SER A 1 901  ? -0.590  92.381  57.402  1.00 16.71 ? 901  SER A CA  1 
ATOM   7081  C  C   . SER A 1 901  ? -1.541  93.228  58.243  1.00 16.56 ? 901  SER A C   1 
ATOM   7082  O  O   . SER A 1 901  ? -1.101  93.920  59.147  1.00 15.65 ? 901  SER A O   1 
ATOM   7083  C  CB  . SER A 1 901  ? -0.510  92.939  55.973  1.00 16.61 ? 901  SER A CB  1 
ATOM   7084  O  OG  . SER A 1 901  ? 0.693   92.556  55.343  1.00 18.75 ? 901  SER A OG  1 
ATOM   7085  N  N   . TRP A 1 902  ? -2.841  93.176  57.971  1.00 17.30 ? 902  TRP A N   1 
ATOM   7086  C  CA  . TRP A 1 902  ? -3.741  94.014  58.754  1.00 19.16 ? 902  TRP A CA  1 
ATOM   7087  C  C   . TRP A 1 902  ? -3.794  93.611  60.213  1.00 19.49 ? 902  TRP A C   1 
ATOM   7088  O  O   . TRP A 1 902  ? -3.882  94.474  61.084  1.00 20.38 ? 902  TRP A O   1 
ATOM   7089  C  CB  . TRP A 1 902  ? -5.152  94.083  58.132  1.00 17.53 ? 902  TRP A CB  1 
ATOM   7090  C  CG  . TRP A 1 902  ? -5.999  92.863  58.260  1.00 18.72 ? 902  TRP A CG  1 
ATOM   7091  C  CD1 . TRP A 1 902  ? -6.169  91.873  57.326  1.00 18.03 ? 902  TRP A CD1 1 
ATOM   7092  C  CD2 . TRP A 1 902  ? -6.867  92.528  59.359  1.00 18.65 ? 902  TRP A CD2 1 
ATOM   7093  N  NE1 . TRP A 1 902  ? -7.092  90.959  57.773  1.00 18.52 ? 902  TRP A NE1 1 
ATOM   7094  C  CE2 . TRP A 1 902  ? -7.535  91.336  59.010  1.00 17.47 ? 902  TRP A CE2 1 
ATOM   7095  C  CE3 . TRP A 1 902  ? -7.139  93.130  60.597  1.00 18.86 ? 902  TRP A CE3 1 
ATOM   7096  C  CZ2 . TRP A 1 902  ? -8.465  90.729  59.855  1.00 19.06 ? 902  TRP A CZ2 1 
ATOM   7097  C  CZ3 . TRP A 1 902  ? -8.064  92.527  61.437  1.00 18.38 ? 902  TRP A CZ3 1 
ATOM   7098  C  CH2 . TRP A 1 902  ? -8.718  91.337  61.063  1.00 19.76 ? 902  TRP A CH2 1 
ATOM   7099  N  N   . ILE A 1 903  ? -3.724  92.315  60.496  1.00 19.73 ? 903  ILE A N   1 
ATOM   7100  C  CA  . ILE A 1 903  ? -3.723  91.876  61.892  1.00 20.50 ? 903  ILE A CA  1 
ATOM   7101  C  C   . ILE A 1 903  ? -2.484  92.427  62.629  1.00 23.25 ? 903  ILE A C   1 
ATOM   7102  O  O   . ILE A 1 903  ? -2.615  93.043  63.690  1.00 25.31 ? 903  ILE A O   1 
ATOM   7103  C  CB  . ILE A 1 903  ? -3.775  90.332  61.992  1.00 19.11 ? 903  ILE A CB  1 
ATOM   7104  C  CG1 . ILE A 1 903  ? -5.187  89.851  61.648  1.00 17.54 ? 903  ILE A CG1 1 
ATOM   7105  C  CG2 . ILE A 1 903  ? -3.407  89.865  63.387  1.00 16.52 ? 903  ILE A CG2 1 
ATOM   7106  C  CD1 . ILE A 1 903  ? -5.294  88.355  61.476  1.00 16.12 ? 903  ILE A CD1 1 
ATOM   7107  N  N   . SER A 1 904  ? -1.296  92.246  62.060  1.00 22.73 ? 904  SER A N   1 
ATOM   7108  C  CA  . SER A 1 904  ? -0.075  92.754  62.687  1.00 23.23 ? 904  SER A CA  1 
ATOM   7109  C  C   . SER A 1 904  ? -0.133  94.263  62.945  1.00 24.55 ? 904  SER A C   1 
ATOM   7110  O  O   . SER A 1 904  ? 0.411   94.757  63.941  1.00 25.23 ? 904  SER A O   1 
ATOM   7111  C  CB  . SER A 1 904  ? 1.143   92.459  61.811  1.00 23.23 ? 904  SER A CB  1 
ATOM   7112  O  OG  . SER A 1 904  ? 1.361   91.071  61.719  1.00 24.41 ? 904  SER A OG  1 
ATOM   7113  N  N   . LEU A 1 905  ? -0.772  94.999  62.042  1.00 24.32 ? 905  LEU A N   1 
ATOM   7114  C  CA  . LEU A 1 905  ? -0.879  96.440  62.193  1.00 23.97 ? 905  LEU A CA  1 
ATOM   7115  C  C   . LEU A 1 905  ? -1.645  96.850  63.449  1.00 25.45 ? 905  LEU A C   1 
ATOM   7116  O  O   . LEU A 1 905  ? -1.340  97.869  64.062  1.00 25.23 ? 905  LEU A O   1 
ATOM   7117  C  CB  . LEU A 1 905  ? -1.563  97.047  60.972  1.00 24.24 ? 905  LEU A CB  1 
ATOM   7118  C  CG  . LEU A 1 905  ? -0.701  97.246  59.734  1.00 24.99 ? 905  LEU A CG  1 
ATOM   7119  C  CD1 . LEU A 1 905  ? -1.565  97.630  58.539  1.00 26.48 ? 905  LEU A CD1 1 
ATOM   7120  C  CD2 . LEU A 1 905  ? 0.311   98.311  60.029  1.00 24.18 ? 905  LEU A CD2 1 
ATOM   7121  N  N   . ILE A 1 906  ? -2.655  96.076  63.831  1.00 25.78 ? 906  ILE A N   1 
ATOM   7122  C  CA  . ILE A 1 906  ? -3.416  96.430  65.018  1.00 26.80 ? 906  ILE A CA  1 
ATOM   7123  C  C   . ILE A 1 906  ? -3.512  95.281  66.035  1.00 29.32 ? 906  ILE A C   1 
ATOM   7124  O  O   . ILE A 1 906  ? -4.489  95.186  66.790  1.00 30.46 ? 906  ILE A O   1 
ATOM   7125  C  CB  . ILE A 1 906  ? -4.838  96.909  64.642  1.00 24.03 ? 906  ILE A CB  1 
ATOM   7126  C  CG1 . ILE A 1 906  ? -5.541  95.858  63.781  1.00 23.18 ? 906  ILE A CG1 1 
ATOM   7127  C  CG2 . ILE A 1 906  ? -4.753  98.232  63.927  1.00 23.54 ? 906  ILE A CG2 1 
ATOM   7128  C  CD1 . ILE A 1 906  ? -7.010  96.115  63.576  1.00 21.95 ? 906  ILE A CD1 1 
ATOM   7129  N  N   . ARG A 1 907  ? -2.492  94.423  66.064  1.00 29.35 ? 907  ARG A N   1 
ATOM   7130  C  CA  . ARG A 1 907  ? -2.486  93.290  66.982  1.00 30.83 ? 907  ARG A CA  1 
ATOM   7131  C  C   . ARG A 1 907  ? -2.720  93.687  68.451  1.00 29.80 ? 907  ARG A C   1 
ATOM   7132  O  O   . ARG A 1 907  ? -3.633  93.166  69.096  1.00 29.73 ? 907  ARG A O   1 
ATOM   7133  C  CB  . ARG A 1 907  ? -1.171  92.516  66.844  1.00 30.52 ? 907  ARG A CB  1 
ATOM   7134  C  CG  . ARG A 1 907  ? -1.115  91.254  67.666  1.00 34.46 ? 907  ARG A CG  1 
ATOM   7135  C  CD  . ARG A 1 907  ? 0.261   90.607  67.588  1.00 39.50 ? 907  ARG A CD  1 
ATOM   7136  N  NE  . ARG A 1 907  ? 1.301   91.441  68.178  1.00 41.83 ? 907  ARG A NE  1 
ATOM   7137  C  CZ  . ARG A 1 907  ? 1.338   91.792  69.462  1.00 44.99 ? 907  ARG A CZ  1 
ATOM   7138  N  NH1 . ARG A 1 907  ? 0.386   91.379  70.308  1.00 42.97 ? 907  ARG A NH1 1 
ATOM   7139  N  NH2 . ARG A 1 907  ? 2.327   92.568  69.899  1.00 45.40 ? 907  ARG A NH2 1 
ATOM   7140  N  N   . PRO A 1 908  ? -1.904  94.607  68.995  1.00 29.94 ? 908  PRO A N   1 
ATOM   7141  C  CA  . PRO A 1 908  ? -2.087  95.019  70.389  1.00 29.53 ? 908  PRO A CA  1 
ATOM   7142  C  C   . PRO A 1 908  ? -3.532  95.464  70.610  1.00 30.17 ? 908  PRO A C   1 
ATOM   7143  O  O   . PRO A 1 908  ? -4.170  95.080  71.585  1.00 30.32 ? 908  PRO A O   1 
ATOM   7144  C  CB  . PRO A 1 908  ? -1.104  96.182  70.543  1.00 28.71 ? 908  PRO A CB  1 
ATOM   7145  C  CG  . PRO A 1 908  ? -0.023  95.860  69.582  1.00 29.65 ? 908  PRO A CG  1 
ATOM   7146  C  CD  . PRO A 1 908  ? -0.807  95.371  68.370  1.00 31.16 ? 908  PRO A CD  1 
ATOM   7147  N  N   . LEU A 1 909  ? -4.032  96.280  69.684  1.00 30.42 ? 909  LEU A N   1 
ATOM   7148  C  CA  . LEU A 1 909  ? -5.390  96.792  69.739  1.00 29.82 ? 909  LEU A CA  1 
ATOM   7149  C  C   . LEU A 1 909  ? -6.409  95.667  69.820  1.00 29.77 ? 909  LEU A C   1 
ATOM   7150  O  O   . LEU A 1 909  ? -7.317  95.691  70.643  1.00 30.70 ? 909  LEU A O   1 
ATOM   7151  C  CB  . LEU A 1 909  ? -5.683  97.632  68.499  1.00 30.31 ? 909  LEU A CB  1 
ATOM   7152  C  CG  . LEU A 1 909  ? -5.883  99.138  68.664  1.00 31.72 ? 909  LEU A CG  1 
ATOM   7153  C  CD1 . LEU A 1 909  ? -6.082  99.774  67.279  1.00 30.57 ? 909  LEU A CD1 1 
ATOM   7154  C  CD2 . LEU A 1 909  ? -7.095  99.400  69.540  1.00 33.00 ? 909  LEU A CD2 1 
ATOM   7155  N  N   . MET A 1 910  ? -6.262  94.683  68.943  1.00 29.92 ? 910  MET A N   1 
ATOM   7156  C  CA  . MET A 1 910  ? -7.173  93.552  68.909  1.00 30.40 ? 910  MET A CA  1 
ATOM   7157  C  C   . MET A 1 910  ? -7.193  92.830  70.254  1.00 31.24 ? 910  MET A C   1 
ATOM   7158  O  O   . MET A 1 910  ? -8.262  92.507  70.782  1.00 28.92 ? 910  MET A O   1 
ATOM   7159  C  CB  . MET A 1 910  ? -6.756  92.583  67.801  1.00 30.68 ? 910  MET A CB  1 
ATOM   7160  C  CG  . MET A 1 910  ? -6.897  93.153  66.405  1.00 29.74 ? 910  MET A CG  1 
ATOM   7161  S  SD  . MET A 1 910  ? -6.098  92.132  65.142  1.00 29.06 ? 910  MET A SD  1 
ATOM   7162  C  CE  . MET A 1 910  ? -7.370  90.857  64.904  1.00 24.34 ? 910  MET A CE  1 
ATOM   7163  N  N   . THR A 1 911  ? -6.005  92.567  70.794  1.00 32.08 ? 911  THR A N   1 
ATOM   7164  C  CA  . THR A 1 911  ? -5.896  91.899  72.078  1.00 33.19 ? 911  THR A CA  1 
ATOM   7165  C  C   . THR A 1 911  ? -6.643  92.740  73.122  1.00 34.06 ? 911  THR A C   1 
ATOM   7166  O  O   . THR A 1 911  ? -7.523  92.252  73.842  1.00 34.27 ? 911  THR A O   1 
ATOM   7167  C  CB  . THR A 1 911  ? -4.404  91.738  72.493  1.00 32.84 ? 911  THR A CB  1 
ATOM   7168  O  OG1 . THR A 1 911  ? -3.783  90.739  71.672  1.00 34.18 ? 911  THR A OG1 1 
ATOM   7169  C  CG2 . THR A 1 911  ? -4.282  91.328  73.957  1.00 31.85 ? 911  THR A CG2 1 
ATOM   7170  N  N   . ARG A 1 912  ? -6.305  94.020  73.181  1.00 34.43 ? 912  ARG A N   1 
ATOM   7171  C  CA  . ARG A 1 912  ? -6.924  94.918  74.142  1.00 36.33 ? 912  ARG A CA  1 
ATOM   7172  C  C   . ARG A 1 912  ? -8.443  94.925  74.000  1.00 35.56 ? 912  ARG A C   1 
ATOM   7173  O  O   . ARG A 1 912  ? -9.168  94.979  74.991  1.00 36.21 ? 912  ARG A O   1 
ATOM   7174  C  CB  . ARG A 1 912  ? -6.377  96.338  73.956  1.00 39.46 ? 912  ARG A CB  1 
ATOM   7175  C  CG  . ARG A 1 912  ? -6.556  97.250  75.167  1.00 44.22 ? 912  ARG A CG  1 
ATOM   7176  C  CD  . ARG A 1 912  ? -6.277  98.701  74.793  1.00 48.69 ? 912  ARG A CD  1 
ATOM   7177  N  NE  . ARG A 1 912  ? -7.406  99.272  74.060  1.00 51.36 ? 912  ARG A NE  1 
ATOM   7178  C  CZ  . ARG A 1 912  ? -7.340  100.356 73.292  1.00 53.48 ? 912  ARG A CZ  1 
ATOM   7179  N  NH1 . ARG A 1 912  ? -6.189  101.009 73.139  1.00 52.47 ? 912  ARG A NH1 1 
ATOM   7180  N  NH2 . ARG A 1 912  ? -8.434  100.784 72.672  1.00 54.42 ? 912  ARG A NH2 1 
ATOM   7181  N  N   . TRP A 1 913  ? -8.918  94.867  72.763  1.00 33.73 ? 913  TRP A N   1 
ATOM   7182  C  CA  . TRP A 1 913  ? -10.348 94.889  72.502  1.00 31.72 ? 913  TRP A CA  1 
ATOM   7183  C  C   . TRP A 1 913  ? -11.060 93.606  72.922  1.00 32.23 ? 913  TRP A C   1 
ATOM   7184  O  O   . TRP A 1 913  ? -12.176 93.650  73.457  1.00 32.58 ? 913  TRP A O   1 
ATOM   7185  C  CB  . TRP A 1 913  ? -10.615 95.132  71.017  1.00 29.18 ? 913  TRP A CB  1 
ATOM   7186  C  CG  . TRP A 1 913  ? -12.076 95.193  70.698  1.00 26.73 ? 913  TRP A CG  1 
ATOM   7187  C  CD1 . TRP A 1 913  ? -12.857 96.313  70.632  1.00 26.36 ? 913  TRP A CD1 1 
ATOM   7188  C  CD2 . TRP A 1 913  ? -12.945 94.086  70.443  1.00 25.74 ? 913  TRP A CD2 1 
ATOM   7189  N  NE1 . TRP A 1 913  ? -14.164 95.970  70.355  1.00 26.11 ? 913  TRP A NE1 1 
ATOM   7190  C  CE2 . TRP A 1 913  ? -14.246 94.606  70.240  1.00 25.92 ? 913  TRP A CE2 1 
ATOM   7191  C  CE3 . TRP A 1 913  ? -12.753 92.696  70.378  1.00 25.22 ? 913  TRP A CE3 1 
ATOM   7192  C  CZ2 . TRP A 1 913  ? -15.348 93.793  69.962  1.00 24.54 ? 913  TRP A CZ2 1 
ATOM   7193  C  CZ3 . TRP A 1 913  ? -13.847 91.883  70.102  1.00 25.33 ? 913  TRP A CZ3 1 
ATOM   7194  C  CH2 . TRP A 1 913  ? -15.131 92.437  69.902  1.00 25.71 ? 913  TRP A CH2 1 
ATOM   7195  N  N   . MET A 1 914  ? -10.429 92.466  72.662  1.00 31.83 ? 914  MET A N   1 
ATOM   7196  C  CA  . MET A 1 914  ? -11.031 91.186  72.996  1.00 32.76 ? 914  MET A CA  1 
ATOM   7197  C  C   . MET A 1 914  ? -11.225 91.010  74.488  1.00 33.09 ? 914  MET A C   1 
ATOM   7198  O  O   . MET A 1 914  ? -12.248 90.485  74.937  1.00 35.28 ? 914  MET A O   1 
ATOM   7199  C  CB  . MET A 1 914  ? -10.196 90.030  72.430  1.00 32.75 ? 914  MET A CB  1 
ATOM   7200  C  CG  . MET A 1 914  ? -10.267 89.915  70.911  1.00 33.40 ? 914  MET A CG  1 
ATOM   7201  S  SD  . MET A 1 914  ? -9.400  88.478  70.272  1.00 33.67 ? 914  MET A SD  1 
ATOM   7202  C  CE  . MET A 1 914  ? -7.848  89.212  69.762  1.00 34.90 ? 914  MET A CE  1 
ATOM   7203  N  N   . VAL A 1 915  ? -10.246 91.455  75.261  1.00 32.27 ? 915  VAL A N   1 
ATOM   7204  C  CA  . VAL A 1 915  ? -10.341 91.348  76.706  1.00 31.97 ? 915  VAL A CA  1 
ATOM   7205  C  C   . VAL A 1 915  ? -11.433 92.288  77.196  1.00 31.53 ? 915  VAL A C   1 
ATOM   7206  O  O   . VAL A 1 915  ? -12.315 91.894  77.956  1.00 31.01 ? 915  VAL A O   1 
ATOM   7207  C  CB  . VAL A 1 915  ? -9.006  91.715  77.363  1.00 32.24 ? 915  VAL A CB  1 
ATOM   7208  C  CG1 . VAL A 1 915  ? -9.192  91.877  78.858  1.00 31.78 ? 915  VAL A CG1 1 
ATOM   7209  C  CG2 . VAL A 1 915  ? -7.979  90.627  77.067  1.00 30.75 ? 915  VAL A CG2 1 
ATOM   7210  N  N   . ALA A 1 916  ? -11.376 93.532  76.735  1.00 31.70 ? 916  ALA A N   1 
ATOM   7211  C  CA  . ALA A 1 916  ? -12.358 94.537  77.115  1.00 31.70 ? 916  ALA A CA  1 
ATOM   7212  C  C   . ALA A 1 916  ? -13.774 94.060  76.842  1.00 33.32 ? 916  ALA A C   1 
ATOM   7213  O  O   . ALA A 1 916  ? -14.724 94.602  77.393  1.00 35.17 ? 916  ALA A O   1 
ATOM   7214  C  CB  . ALA A 1 916  ? -12.099 95.826  76.364  1.00 32.15 ? 916  ALA A CB  1 
ATOM   7215  N  N   . ASN A 1 917  ? -13.926 93.052  75.986  1.00 34.50 ? 917  ASN A N   1 
ATOM   7216  C  CA  . ASN A 1 917  ? -15.260 92.539  75.669  1.00 33.87 ? 917  ASN A CA  1 
ATOM   7217  C  C   . ASN A 1 917  ? -15.548 91.137  76.184  1.00 33.88 ? 917  ASN A C   1 
ATOM   7218  O  O   . ASN A 1 917  ? -16.418 90.454  75.660  1.00 33.51 ? 917  ASN A O   1 
ATOM   7219  C  CB  . ASN A 1 917  ? -15.521 92.574  74.157  1.00 33.92 ? 917  ASN A CB  1 
ATOM   7220  C  CG  . ASN A 1 917  ? -15.975 93.937  73.675  1.00 33.51 ? 917  ASN A CG  1 
ATOM   7221  O  OD1 . ASN A 1 917  ? -15.160 94.829  73.426  1.00 32.78 ? 917  ASN A OD1 1 
ATOM   7222  N  ND2 . ASN A 1 917  ? -17.287 94.110  73.558  1.00 31.29 ? 917  ASN A ND2 1 
ATOM   7223  N  N   . GLY A 1 918  ? -14.821 90.708  77.209  1.00 34.58 ? 918  GLY A N   1 
ATOM   7224  C  CA  . GLY A 1 918  ? -15.053 89.388  77.771  1.00 34.55 ? 918  GLY A CA  1 
ATOM   7225  C  C   . GLY A 1 918  ? -14.259 88.224  77.200  1.00 34.95 ? 918  GLY A C   1 
ATOM   7226  O  O   . GLY A 1 918  ? -14.340 87.112  77.731  1.00 35.30 ? 918  GLY A O   1 
ATOM   7227  N  N   . TYR A 1 919  ? -13.500 88.458  76.133  1.00 34.86 ? 919  TYR A N   1 
ATOM   7228  C  CA  . TYR A 1 919  ? -12.705 87.399  75.534  1.00 35.77 ? 919  TYR A CA  1 
ATOM   7229  C  C   . TYR A 1 919  ? -11.331 87.299  76.208  1.00 37.80 ? 919  TYR A C   1 
ATOM   7230  O  O   . TYR A 1 919  ? -10.312 87.708  75.646  1.00 37.52 ? 919  TYR A O   1 
ATOM   7231  C  CB  . TYR A 1 919  ? -12.549 87.667  74.046  1.00 35.71 ? 919  TYR A CB  1 
ATOM   7232  C  CG  . TYR A 1 919  ? -13.862 87.738  73.301  1.00 36.57 ? 919  TYR A CG  1 
ATOM   7233  C  CD1 . TYR A 1 919  ? -14.618 86.586  73.067  1.00 36.52 ? 919  TYR A CD1 1 
ATOM   7234  C  CD2 . TYR A 1 919  ? -14.339 88.952  72.806  1.00 35.72 ? 919  TYR A CD2 1 
ATOM   7235  C  CE1 . TYR A 1 919  ? -15.811 86.635  72.360  1.00 34.27 ? 919  TYR A CE1 1 
ATOM   7236  C  CE2 . TYR A 1 919  ? -15.536 89.016  72.093  1.00 34.77 ? 919  TYR A CE2 1 
ATOM   7237  C  CZ  . TYR A 1 919  ? -16.264 87.851  71.870  1.00 35.37 ? 919  TYR A CZ  1 
ATOM   7238  O  OH  . TYR A 1 919  ? -17.422 87.906  71.126  1.00 32.64 ? 919  TYR A OH  1 
ATOM   7239  N  N   . VAL A 1 920  ? -11.316 86.729  77.413  1.00 40.36 ? 920  VAL A N   1 
ATOM   7240  C  CA  . VAL A 1 920  ? -10.094 86.586  78.198  1.00 42.33 ? 920  VAL A CA  1 
ATOM   7241  C  C   . VAL A 1 920  ? -9.908  85.135  78.649  1.00 43.32 ? 920  VAL A C   1 
ATOM   7242  O  O   . VAL A 1 920  ? -10.851 84.380  78.800  1.00 43.21 ? 920  VAL A O   1 
ATOM   7243  C  CB  . VAL A 1 920  ? -10.098 87.535  79.413  1.00 41.64 ? 920  VAL A CB  1 
ATOM   7244  C  CG1 . VAL A 1 920  ? -11.181 87.129  80.402  1.00 41.61 ? 920  VAL A CG1 1 
ATOM   7245  C  CG2 . VAL A 1 920  ? -8.734  87.554  80.084  1.00 41.65 ? 920  VAL A CG2 1 
ATOM   7246  N  N   . THR A 1 921  ? -8.645  84.761  78.848  1.00 44.32 ? 921  THR A N   1 
ATOM   7247  C  CA  . THR A 1 921  ? -8.342  83.433  79.280  1.00 47.28 ? 921  THR A CA  1 
ATOM   7248  C  C   . THR A 1 921  ? -7.139  83.535  80.130  1.00 48.12 ? 921  THR A C   1 
ATOM   7249  O  O   . THR A 1 921  ? -6.366  84.490  80.106  1.00 47.74 ? 921  THR A O   1 
ATOM   7250  C  CB  . THR A 1 921  ? -7.966  82.485  78.118  1.00 47.53 ? 921  THR A CB  1 
ATOM   7251  O  OG1 . THR A 1 921  ? -6.854  83.029  77.394  1.00 48.46 ? 921  THR A OG1 1 
ATOM   7252  C  CG2 . THR A 1 921  ? -9.146  82.306  77.171  1.00 49.69 ? 921  THR A CG2 1 
ATOM   7253  N  N   . ASP A 1 922  ? -6.985  82.516  80.948  1.00 49.61 ? 922  ASP A N   1 
ATOM   7254  C  CA  . ASP A 1 922  ? -5.797  82.528  81.699  1.00 50.83 ? 922  ASP A CA  1 
ATOM   7255  C  C   . ASP A 1 922  ? -4.743  81.988  80.721  1.00 51.31 ? 922  ASP A C   1 
ATOM   7256  O  O   . ASP A 1 922  ? -3.570  82.331  80.833  1.00 51.51 ? 922  ASP A O   1 
ATOM   7257  C  CB  . ASP A 1 922  ? -6.013  81.733  82.972  1.00 51.37 ? 922  ASP A CB  1 
ATOM   7258  C  CG  . ASP A 1 922  ? -7.341  82.087  83.609  1.00 52.16 ? 922  ASP A CG  1 
ATOM   7259  O  OD1 . ASP A 1 922  ? -7.594  83.304  83.801  1.00 55.04 ? 922  ASP A OD1 1 
ATOM   7260  O  OD2 . ASP A 1 922  ? -8.146  81.175  83.886  1.00 51.80 ? 922  ASP A OD2 1 
ATOM   7261  N  N   . ARG A 1 923  ? -5.138  81.190  79.734  1.00 52.17 ? 923  ARG A N   1 
ATOM   7262  C  CA  . ARG A 1 923  ? -4.135  80.723  78.748  1.00 52.94 ? 923  ARG A CA  1 
ATOM   7263  C  C   . ARG A 1 923  ? -3.490  81.911  77.850  1.00 52.98 ? 923  ARG A C   1 
ATOM   7264  O  O   . ARG A 1 923  ? -4.239  82.502  77.044  1.00 53.65 ? 923  ARG A O   1 
ATOM   7265  C  CB  . ARG A 1 923  ? -4.772  79.594  77.880  1.00 54.55 ? 923  ARG A CB  1 
ATOM   7266  C  CG  . ARG A 1 923  ? -5.861  78.739  78.585  1.00 56.08 ? 923  ARG A CG  1 
ATOM   7267  C  CD  . ARG A 1 923  ? -6.268  77.495  77.770  1.00 57.41 ? 923  ARG A CD  1 
ATOM   7268  N  NE  . ARG A 1 923  ? -5.102  76.677  77.448  1.00 59.47 ? 923  ARG A NE  1 
ATOM   7269  C  CZ  . ARG A 1 923  ? -4.991  75.947  76.342  1.00 60.14 ? 923  ARG A CZ  1 
ATOM   7270  N  NH1 . ARG A 1 923  ? -5.978  75.952  75.452  1.00 59.81 ? 923  ARG A NH1 1 
ATOM   7271  N  NH2 . ARG A 1 923  ? -3.877  75.274  76.095  1.00 61.09 ? 923  ARG A NH2 1 
ATOM   7272  N  N   . CYS A 1 924  ? -2.191  82.249  78.011  1.00 52.17 ? 924  CYS A N   1 
ATOM   7273  C  CA  . CYS A 1 924  ? -1.430  83.354  77.268  1.00 51.61 ? 924  CYS A CA  1 
ATOM   7274  C  C   . CYS A 1 924  ? -0.886  82.923  75.893  1.00 50.91 ? 924  CYS A C   1 
ATOM   7275  O  O   . CYS A 1 924  ? -0.220  81.897  75.755  1.00 51.10 ? 924  CYS A O   1 
ATOM   7276  C  CB  . CYS A 1 924  ? -0.261  83.964  78.101  1.00 52.72 ? 924  CYS A CB  1 
ATOM   7277  S  SG  . CYS A 1 924  ? 0.419   85.530  77.442  1.00 55.06 ? 924  CYS A SG  1 
ATOM   7278  N  N   . SER A 1 925  ? -1.210  83.757  74.897  1.00 48.88 ? 925  SER A N   1 
ATOM   7279  C  CA  . SER A 1 925  ? -0.893  83.547  73.485  1.00 47.14 ? 925  SER A CA  1 
ATOM   7280  C  C   . SER A 1 925  ? 0.317   84.336  73.049  1.00 46.81 ? 925  SER A C   1 
ATOM   7281  O  O   . SER A 1 925  ? 0.469   85.508  73.383  1.00 46.25 ? 925  SER A O   1 
ATOM   7282  C  CB  . SER A 1 925  ? -2.098  83.959  72.630  1.00 46.33 ? 925  SER A CB  1 
ATOM   7283  O  OG  . SER A 1 925  ? -1.728  84.041  71.261  1.00 44.83 ? 925  SER A OG  1 
ATOM   7284  N  N   . THR A 1 926  ? 1.221   83.693  72.284  1.00 45.56 ? 926  THR A N   1 
ATOM   7285  C  CA  . THR A 1 926  ? 2.404   84.396  71.813  1.00 45.69 ? 926  THR A CA  1 
ATOM   7286  C  C   . THR A 1 926  ? 2.028   85.517  70.860  1.00 43.48 ? 926  THR A C   1 
ATOM   7287  O  O   . THR A 1 926  ? 2.822   86.400  70.574  1.00 43.84 ? 926  THR A O   1 
ATOM   7288  C  CB  . THR A 1 926  ? 3.380   83.460  71.101  1.00 47.46 ? 926  THR A CB  1 
ATOM   7289  O  OG1 . THR A 1 926  ? 3.810   82.435  72.004  1.00 49.85 ? 926  THR A OG1 1 
ATOM   7290  C  CG2 . THR A 1 926  ? 4.586   84.236  70.593  1.00 49.39 ? 926  THR A CG2 1 
ATOM   7291  N  N   . VAL A 1 927  ? 0.783   85.456  70.383  1.00 41.08 ? 927  VAL A N   1 
ATOM   7292  C  CA  . VAL A 1 927  ? 0.285   86.442  69.429  1.00 39.31 ? 927  VAL A CA  1 
ATOM   7293  C  C   . VAL A 1 927  ? -0.740  87.410  70.012  1.00 38.17 ? 927  VAL A C   1 
ATOM   7294  O  O   . VAL A 1 927  ? -0.613  88.627  69.863  1.00 38.50 ? 927  VAL A O   1 
ATOM   7295  C  CB  . VAL A 1 927  ? -0.367  85.747  68.196  1.00 38.49 ? 927  VAL A CB  1 
ATOM   7296  C  CG1 . VAL A 1 927  ? -0.836  86.787  67.186  1.00 37.26 ? 927  VAL A CG1 1 
ATOM   7297  C  CG2 . VAL A 1 927  ? 0.632   84.794  67.547  1.00 37.87 ? 927  VAL A CG2 1 
ATOM   7298  N  N   . PHE A 1 928  ? -1.753  86.866  70.671  1.00 36.10 ? 928  PHE A N   1 
ATOM   7299  C  CA  . PHE A 1 928  ? -2.807  87.690  71.232  1.00 35.87 ? 928  PHE A CA  1 
ATOM   7300  C  C   . PHE A 1 928  ? -2.823  87.727  72.765  1.00 35.69 ? 928  PHE A C   1 
ATOM   7301  O  O   . PHE A 1 928  ? -3.781  88.202  73.374  1.00 35.53 ? 928  PHE A O   1 
ATOM   7302  C  CB  . PHE A 1 928  ? -4.154  87.204  70.687  1.00 35.36 ? 928  PHE A CB  1 
ATOM   7303  C  CG  . PHE A 1 928  ? -4.248  87.239  69.190  1.00 33.26 ? 928  PHE A CG  1 
ATOM   7304  C  CD1 . PHE A 1 928  ? -4.387  88.447  68.515  1.00 33.20 ? 928  PHE A CD1 1 
ATOM   7305  C  CD2 . PHE A 1 928  ? -4.174  86.072  68.453  1.00 32.41 ? 928  PHE A CD2 1 
ATOM   7306  C  CE1 . PHE A 1 928  ? -4.463  88.491  67.120  1.00 32.11 ? 928  PHE A CE1 1 
ATOM   7307  C  CE2 . PHE A 1 928  ? -4.247  86.108  67.062  1.00 33.78 ? 928  PHE A CE2 1 
ATOM   7308  C  CZ  . PHE A 1 928  ? -4.390  87.320  66.393  1.00 32.26 ? 928  PHE A CZ  1 
ATOM   7309  N  N   . GLY A 1 929  ? -1.757  87.232  73.383  1.00 36.31 ? 929  GLY A N   1 
ATOM   7310  C  CA  . GLY A 1 929  ? -1.675  87.227  74.834  1.00 37.13 ? 929  GLY A CA  1 
ATOM   7311  C  C   . GLY A 1 929  ? -2.846  86.568  75.551  1.00 38.63 ? 929  GLY A C   1 
ATOM   7312  O  O   . GLY A 1 929  ? -3.271  85.463  75.195  1.00 38.66 ? 929  GLY A O   1 
ATOM   7313  N  N   . ASN A 1 930  ? -3.372  87.259  76.560  1.00 39.48 ? 930  ASN A N   1 
ATOM   7314  C  CA  . ASN A 1 930  ? -4.484  86.761  77.367  1.00 40.65 ? 930  ASN A CA  1 
ATOM   7315  C  C   . ASN A 1 930  ? -5.845  86.897  76.681  1.00 39.84 ? 930  ASN A C   1 
ATOM   7316  O  O   . ASN A 1 930  ? -6.890  86.748  77.318  1.00 38.84 ? 930  ASN A O   1 
ATOM   7317  C  CB  . ASN A 1 930  ? -4.517  87.502  78.711  1.00 42.42 ? 930  ASN A CB  1 
ATOM   7318  C  CG  . ASN A 1 930  ? -3.194  87.394  79.488  1.00 44.99 ? 930  ASN A CG  1 
ATOM   7319  O  OD1 . ASN A 1 930  ? -2.946  88.172  80.416  1.00 46.37 ? 930  ASN A OD1 1 
ATOM   7320  N  ND2 . ASN A 1 930  ? -2.351  86.428  79.119  1.00 44.55 ? 930  ASN A ND2 1 
ATOM   7321  N  N   . ALA A 1 931  ? -5.844  87.176  75.386  1.00 39.16 ? 931  ALA A N   1 
ATOM   7322  C  CA  . ALA A 1 931  ? -7.110  87.320  74.684  1.00 38.40 ? 931  ALA A CA  1 
ATOM   7323  C  C   . ALA A 1 931  ? -7.612  85.967  74.209  1.00 37.13 ? 931  ALA A C   1 
ATOM   7324  O  O   . ALA A 1 931  ? -6.862  85.178  73.641  1.00 36.25 ? 931  ALA A O   1 
ATOM   7325  C  CB  . ALA A 1 931  ? -6.958  88.262  73.505  1.00 38.84 ? 931  ALA A CB  1 
ATOM   7326  N  N   . ASP A 1 932  ? -8.886  85.700  74.460  1.00 36.97 ? 932  ASP A N   1 
ATOM   7327  C  CA  . ASP A 1 932  ? -9.485  84.449  74.038  1.00 36.47 ? 932  ASP A CA  1 
ATOM   7328  C  C   . ASP A 1 932  ? -9.861  84.621  72.564  1.00 36.44 ? 932  ASP A C   1 
ATOM   7329  O  O   . ASP A 1 932  ? -11.033 84.719  72.204  1.00 35.99 ? 932  ASP A O   1 
ATOM   7330  C  CB  . ASP A 1 932  ? -10.719 84.144  74.883  1.00 34.60 ? 932  ASP A CB  1 
ATOM   7331  C  CG  . ASP A 1 932  ? -11.354 82.829  74.508  1.00 34.09 ? 932  ASP A CG  1 
ATOM   7332  O  OD1 . ASP A 1 932  ? -10.725 82.076  73.733  1.00 33.79 ? 932  ASP A OD1 1 
ATOM   7333  O  OD2 . ASP A 1 932  ? -12.471 82.546  74.983  1.00 35.04 ? 932  ASP A OD2 1 
ATOM   7334  N  N   . TYR A 1 933  ? -8.843  84.646  71.714  1.00 36.23 ? 933  TYR A N   1 
ATOM   7335  C  CA  . TYR A 1 933  ? -9.039  84.849  70.285  1.00 36.17 ? 933  TYR A CA  1 
ATOM   7336  C  C   . TYR A 1 933  ? -9.868  83.775  69.596  1.00 36.43 ? 933  TYR A C   1 
ATOM   7337  O  O   . TYR A 1 933  ? -10.644 84.080  68.688  1.00 36.89 ? 933  TYR A O   1 
ATOM   7338  C  CB  . TYR A 1 933  ? -7.679  84.991  69.597  1.00 35.76 ? 933  TYR A CB  1 
ATOM   7339  C  CG  . TYR A 1 933  ? -6.843  83.746  69.650  1.00 37.29 ? 933  TYR A CG  1 
ATOM   7340  C  CD1 . TYR A 1 933  ? -6.887  82.813  68.619  1.00 37.08 ? 933  TYR A CD1 1 
ATOM   7341  C  CD2 . TYR A 1 933  ? -6.030  83.475  70.754  1.00 38.40 ? 933  TYR A CD2 1 
ATOM   7342  C  CE1 . TYR A 1 933  ? -6.145  81.637  68.686  1.00 39.12 ? 933  TYR A CE1 1 
ATOM   7343  C  CE2 . TYR A 1 933  ? -5.282  82.293  70.831  1.00 39.55 ? 933  TYR A CE2 1 
ATOM   7344  C  CZ  . TYR A 1 933  ? -5.347  81.379  69.797  1.00 39.59 ? 933  TYR A CZ  1 
ATOM   7345  O  OH  . TYR A 1 933  ? -4.644  80.192  69.885  1.00 40.58 ? 933  TYR A OH  1 
ATOM   7346  N  N   . ARG A 1 934  ? -9.719  82.526  70.028  1.00 36.04 ? 934  ARG A N   1 
ATOM   7347  C  CA  . ARG A 1 934  ? -10.457 81.427  69.410  1.00 35.88 ? 934  ARG A CA  1 
ATOM   7348  C  C   . ARG A 1 934  ? -11.967 81.608  69.516  1.00 34.24 ? 934  ARG A C   1 
ATOM   7349  O  O   . ARG A 1 934  ? -12.696 81.462  68.540  1.00 33.47 ? 934  ARG A O   1 
ATOM   7350  C  CB  . ARG A 1 934  ? -10.048 80.091  70.030  1.00 37.87 ? 934  ARG A CB  1 
ATOM   7351  C  CG  . ARG A 1 934  ? -8.647  79.645  69.655  1.00 40.54 ? 934  ARG A CG  1 
ATOM   7352  C  CD  . ARG A 1 934  ? -8.382  78.247  70.162  1.00 44.69 ? 934  ARG A CD  1 
ATOM   7353  N  NE  . ARG A 1 934  ? -7.006  77.810  69.942  1.00 47.70 ? 934  ARG A NE  1 
ATOM   7354  C  CZ  . ARG A 1 934  ? -6.579  76.571  70.180  1.00 50.78 ? 934  ARG A CZ  1 
ATOM   7355  N  NH1 . ARG A 1 934  ? -7.427  75.654  70.644  1.00 51.55 ? 934  ARG A NH1 1 
ATOM   7356  N  NH2 . ARG A 1 934  ? -5.312  76.241  69.949  1.00 51.00 ? 934  ARG A NH2 1 
ATOM   7357  N  N   . ARG A 1 935  ? -12.436 81.937  70.705  1.00 33.03 ? 935  ARG A N   1 
ATOM   7358  C  CA  . ARG A 1 935  ? -13.857 82.139  70.900  1.00 32.64 ? 935  ARG A CA  1 
ATOM   7359  C  C   . ARG A 1 935  ? -14.306 83.454  70.252  1.00 32.39 ? 935  ARG A C   1 
ATOM   7360  O  O   . ARG A 1 935  ? -15.468 83.599  69.858  1.00 32.56 ? 935  ARG A O   1 
ATOM   7361  C  CB  . ARG A 1 935  ? -14.162 82.156  72.388  1.00 32.66 ? 935  ARG A CB  1 
ATOM   7362  C  CG  . ARG A 1 935  ? -15.611 82.349  72.720  1.00 32.66 ? 935  ARG A CG  1 
ATOM   7363  C  CD  . ARG A 1 935  ? -15.749 82.715  74.192  1.00 32.72 ? 935  ARG A CD  1 
ATOM   7364  N  NE  . ARG A 1 935  ? -16.872 83.615  74.373  1.00 33.45 ? 935  ARG A NE  1 
ATOM   7365  C  CZ  . ARG A 1 935  ? -16.846 84.687  75.148  1.00 33.44 ? 935  ARG A CZ  1 
ATOM   7366  N  NH1 . ARG A 1 935  ? -15.748 84.997  75.827  1.00 32.21 ? 935  ARG A NH1 1 
ATOM   7367  N  NH2 . ARG A 1 935  ? -17.916 85.462  75.217  1.00 35.83 ? 935  ARG A NH2 1 
ATOM   7368  N  N   . CYS A 1 936  ? -13.387 84.410  70.130  1.00 30.82 ? 936  CYS A N   1 
ATOM   7369  C  CA  . CYS A 1 936  ? -13.729 85.687  69.523  1.00 28.86 ? 936  CYS A CA  1 
ATOM   7370  C  C   . CYS A 1 936  ? -13.863 85.554  68.020  1.00 29.23 ? 936  CYS A C   1 
ATOM   7371  O  O   . CYS A 1 936  ? -14.882 85.936  67.437  1.00 29.60 ? 936  CYS A O   1 
ATOM   7372  C  CB  . CYS A 1 936  ? -12.678 86.748  69.829  1.00 28.68 ? 936  CYS A CB  1 
ATOM   7373  S  SG  . CYS A 1 936  ? -13.138 88.382  69.213  1.00 26.07 ? 936  CYS A SG  1 
ATOM   7374  N  N   . PHE A 1 937  ? -12.842 84.998  67.383  1.00 28.26 ? 937  PHE A N   1 
ATOM   7375  C  CA  . PHE A 1 937  ? -12.894 84.856  65.937  1.00 27.99 ? 937  PHE A CA  1 
ATOM   7376  C  C   . PHE A 1 937  ? -14.037 83.947  65.464  1.00 28.12 ? 937  PHE A C   1 
ATOM   7377  O  O   . PHE A 1 937  ? -14.471 84.049  64.320  1.00 29.71 ? 937  PHE A O   1 
ATOM   7378  C  CB  . PHE A 1 937  ? -11.531 84.380  65.395  1.00 25.70 ? 937  PHE A CB  1 
ATOM   7379  C  CG  . PHE A 1 937  ? -10.374 85.267  65.799  1.00 22.17 ? 937  PHE A CG  1 
ATOM   7380  C  CD1 . PHE A 1 937  ? -10.602 86.505  66.404  1.00 18.79 ? 937  PHE A CD1 1 
ATOM   7381  C  CD2 . PHE A 1 937  ? -9.056  84.863  65.572  1.00 21.35 ? 937  PHE A CD2 1 
ATOM   7382  C  CE1 . PHE A 1 937  ? -9.545  87.324  66.777  1.00 17.19 ? 937  PHE A CE1 1 
ATOM   7383  C  CE2 . PHE A 1 937  ? -7.975  85.679  65.943  1.00 19.40 ? 937  PHE A CE2 1 
ATOM   7384  C  CZ  . PHE A 1 937  ? -8.225  86.914  66.548  1.00 19.65 ? 937  PHE A CZ  1 
ATOM   7385  N  N   . ASN A 1 938  ? -14.536 83.067  66.323  1.00 28.49 ? 938  ASN A N   1 
ATOM   7386  C  CA  . ASN A 1 938  ? -15.646 82.215  65.910  1.00 27.89 ? 938  ASN A CA  1 
ATOM   7387  C  C   . ASN A 1 938  ? -16.938 83.014  65.999  1.00 29.57 ? 938  ASN A C   1 
ATOM   7388  O  O   . ASN A 1 938  ? -17.718 83.046  65.043  1.00 28.27 ? 938  ASN A O   1 
ATOM   7389  C  CB  . ASN A 1 938  ? -15.759 80.972  66.786  1.00 25.96 ? 938  ASN A CB  1 
ATOM   7390  C  CG  . ASN A 1 938  ? -14.960 79.813  66.249  1.00 23.89 ? 938  ASN A CG  1 
ATOM   7391  O  OD1 . ASN A 1 938  ? -15.265 79.274  65.190  1.00 23.53 ? 938  ASN A OD1 1 
ATOM   7392  N  ND2 . ASN A 1 938  ? -13.929 79.419  66.980  1.00 22.47 ? 938  ASN A ND2 1 
ATOM   7393  N  N   . GLU A 1 939  ? -17.155 83.673  67.144  1.00 32.02 ? 939  GLU A N   1 
ATOM   7394  C  CA  . GLU A 1 939  ? -18.367 84.467  67.337  1.00 32.76 ? 939  GLU A CA  1 
ATOM   7395  C  C   . GLU A 1 939  ? -18.518 85.570  66.300  1.00 33.48 ? 939  GLU A C   1 
ATOM   7396  O  O   . GLU A 1 939  ? -19.611 85.759  65.776  1.00 35.03 ? 939  GLU A O   1 
ATOM   7397  C  CB  . GLU A 1 939  ? -18.426 85.071  68.741  1.00 34.10 ? 939  GLU A CB  1 
ATOM   7398  C  CG  . GLU A 1 939  ? -18.508 84.039  69.856  1.00 36.40 ? 939  GLU A CG  1 
ATOM   7399  C  CD  . GLU A 1 939  ? -19.068 84.602  71.166  1.00 38.17 ? 939  GLU A CD  1 
ATOM   7400  O  OE1 . GLU A 1 939  ? -18.927 85.819  71.432  1.00 39.52 ? 939  GLU A OE1 1 
ATOM   7401  O  OE2 . GLU A 1 939  ? -19.641 83.812  71.944  1.00 38.63 ? 939  GLU A OE2 1 
ATOM   7402  N  N   . LEU A 1 940  ? -17.453 86.296  65.959  1.00 32.61 ? 940  LEU A N   1 
ATOM   7403  C  CA  . LEU A 1 940  ? -17.634 87.354  64.960  1.00 33.10 ? 940  LEU A CA  1 
ATOM   7404  C  C   . LEU A 1 940  ? -17.456 86.823  63.536  1.00 31.22 ? 940  LEU A C   1 
ATOM   7405  O  O   . LEU A 1 940  ? -17.304 87.618  62.580  1.00 31.45 ? 940  LEU A O   1 
ATOM   7406  C  CB  . LEU A 1 940  ? -16.655 88.506  65.210  1.00 33.54 ? 940  LEU A CB  1 
ATOM   7407  C  CG  . LEU A 1 940  ? -15.941 88.516  66.563  1.00 35.34 ? 940  LEU A CG  1 
ATOM   7408  C  CD1 . LEU A 1 940  ? -14.490 88.943  66.403  1.00 34.78 ? 940  LEU A CD1 1 
ATOM   7409  C  CD2 . LEU A 1 940  ? -16.661 89.430  67.544  1.00 36.12 ? 940  LEU A CD2 1 
ATOM   7410  N  N   . LYS A 1 941  ? -17.525 85.506  63.353  1.00 29.76 ? 941  LYS A N   1 
ATOM   7411  C  CA  . LYS A 1 941  ? -17.405 84.843  62.049  1.00 28.92 ? 941  LYS A CA  1 
ATOM   7412  C  C   . LYS A 1 941  ? -16.126 85.160  61.270  1.00 28.09 ? 941  LYS A C   1 
ATOM   7413  O  O   . LYS A 1 941  ? -16.095 85.046  60.041  1.00 25.74 ? 941  LYS A O   1 
ATOM   7414  C  CB  . LYS A 1 941  ? -18.601 85.182  61.164  1.00 30.95 ? 941  LYS A CB  1 
ATOM   7415  C  CG  . LYS A 1 941  ? -19.943 84.844  61.751  1.00 35.28 ? 941  LYS A CG  1 
ATOM   7416  C  CD  . LYS A 1 941  ? -20.177 83.348  61.807  1.00 38.61 ? 941  LYS A CD  1 
ATOM   7417  C  CE  . LYS A 1 941  ? -21.585 83.053  62.346  1.00 41.29 ? 941  LYS A CE  1 
ATOM   7418  N  NZ  . LYS A 1 941  ? -21.789 81.595  62.605  1.00 43.85 ? 941  LYS A NZ  1 
ATOM   7419  N  N   . LEU A 1 942  ? -15.070 85.541  61.986  1.00 26.71 ? 942  LEU A N   1 
ATOM   7420  C  CA  . LEU A 1 942  ? -13.808 85.853  61.340  1.00 25.55 ? 942  LEU A CA  1 
ATOM   7421  C  C   . LEU A 1 942  ? -13.188 84.583  60.762  1.00 25.91 ? 942  LEU A C   1 
ATOM   7422  O  O   . LEU A 1 942  ? -12.649 84.601  59.657  1.00 26.53 ? 942  LEU A O   1 
ATOM   7423  C  CB  . LEU A 1 942  ? -12.858 86.518  62.335  1.00 23.54 ? 942  LEU A CB  1 
ATOM   7424  C  CG  . LEU A 1 942  ? -11.594 87.156  61.754  1.00 22.74 ? 942  LEU A CG  1 
ATOM   7425  C  CD1 . LEU A 1 942  ? -11.071 88.254  62.686  1.00 21.02 ? 942  LEU A CD1 1 
ATOM   7426  C  CD2 . LEU A 1 942  ? -10.552 86.084  61.546  1.00 23.30 ? 942  LEU A CD2 1 
ATOM   7427  N  N   . TYR A 1 943  ? -13.259 83.483  61.507  1.00 25.57 ? 943  TYR A N   1 
ATOM   7428  C  CA  . TYR A 1 943  ? -12.711 82.222  61.028  1.00 25.04 ? 943  TYR A CA  1 
ATOM   7429  C  C   . TYR A 1 943  ? -13.581 81.713  59.881  1.00 24.79 ? 943  TYR A C   1 
ATOM   7430  O  O   . TYR A 1 943  ? -13.085 81.274  58.846  1.00 25.55 ? 943  TYR A O   1 
ATOM   7431  C  CB  . TYR A 1 943  ? -12.693 81.169  62.137  1.00 25.70 ? 943  TYR A CB  1 
ATOM   7432  C  CG  . TYR A 1 943  ? -11.511 81.218  63.074  1.00 25.41 ? 943  TYR A CG  1 
ATOM   7433  C  CD1 . TYR A 1 943  ? -10.240 81.579  62.625  1.00 26.99 ? 943  TYR A CD1 1 
ATOM   7434  C  CD2 . TYR A 1 943  ? -11.650 80.836  64.403  1.00 25.72 ? 943  TYR A CD2 1 
ATOM   7435  C  CE1 . TYR A 1 943  ? -9.130  81.549  63.485  1.00 26.72 ? 943  TYR A CE1 1 
ATOM   7436  C  CE2 . TYR A 1 943  ? -10.559 80.801  65.264  1.00 25.96 ? 943  TYR A CE2 1 
ATOM   7437  C  CZ  . TYR A 1 943  ? -9.307  81.157  64.803  1.00 27.62 ? 943  TYR A CZ  1 
ATOM   7438  O  OH  . TYR A 1 943  ? -8.243  81.117  65.674  1.00 29.46 ? 943  TYR A OH  1 
ATOM   7439  N  N   . GLN A 1 944  ? -14.888 81.778  60.078  1.00 24.52 ? 944  GLN A N   1 
ATOM   7440  C  CA  . GLN A 1 944  ? -15.845 81.340  59.073  1.00 25.19 ? 944  GLN A CA  1 
ATOM   7441  C  C   . GLN A 1 944  ? -15.622 82.053  57.725  1.00 25.04 ? 944  GLN A C   1 
ATOM   7442  O  O   . GLN A 1 944  ? -15.490 81.418  56.668  1.00 22.66 ? 944  GLN A O   1 
ATOM   7443  C  CB  . GLN A 1 944  ? -17.259 81.604  59.587  1.00 25.97 ? 944  GLN A CB  1 
ATOM   7444  C  CG  . GLN A 1 944  ? -17.708 80.718  60.757  1.00 27.36 ? 944  GLN A CG  1 
ATOM   7445  C  CD  . GLN A 1 944  ? -16.788 80.780  61.964  1.00 29.09 ? 944  GLN A CD  1 
ATOM   7446  O  OE1 . GLN A 1 944  ? -16.298 81.844  62.340  1.00 29.24 ? 944  GLN A OE1 1 
ATOM   7447  N  NE2 . GLN A 1 944  ? -16.566 79.632  62.594  1.00 30.44 ? 944  GLN A NE2 1 
ATOM   7448  N  N   . GLY A 1 945  ? -15.573 83.378  57.773  1.00 24.98 ? 945  GLY A N   1 
ATOM   7449  C  CA  . GLY A 1 945  ? -15.363 84.138  56.555  1.00 24.89 ? 945  GLY A CA  1 
ATOM   7450  C  C   . GLY A 1 945  ? -14.038 83.801  55.892  1.00 24.44 ? 945  GLY A C   1 
ATOM   7451  O  O   . GLY A 1 945  ? -13.950 83.694  54.663  1.00 23.51 ? 945  GLY A O   1 
ATOM   7452  N  N   . TYR A 1 946  ? -13.010 83.639  56.718  1.00 23.39 ? 946  TYR A N   1 
ATOM   7453  C  CA  . TYR A 1 946  ? -11.659 83.309  56.268  1.00 23.22 ? 946  TYR A CA  1 
ATOM   7454  C  C   . TYR A 1 946  ? -11.649 81.980  55.514  1.00 23.71 ? 946  TYR A C   1 
ATOM   7455  O  O   . TYR A 1 946  ? -11.054 81.864  54.445  1.00 24.22 ? 946  TYR A O   1 
ATOM   7456  C  CB  . TYR A 1 946  ? -10.738 83.230  57.485  1.00 22.77 ? 946  TYR A CB  1 
ATOM   7457  C  CG  . TYR A 1 946  ? -9.371  82.636  57.232  1.00 21.37 ? 946  TYR A CG  1 
ATOM   7458  C  CD1 . TYR A 1 946  ? -8.311  83.428  56.783  1.00 20.20 ? 946  TYR A CD1 1 
ATOM   7459  C  CD2 . TYR A 1 946  ? -9.129  81.278  57.477  1.00 21.12 ? 946  TYR A CD2 1 
ATOM   7460  C  CE1 . TYR A 1 946  ? -7.037  82.884  56.590  1.00 21.95 ? 946  TYR A CE1 1 
ATOM   7461  C  CE2 . TYR A 1 946  ? -7.872  80.723  57.294  1.00 20.44 ? 946  TYR A CE2 1 
ATOM   7462  C  CZ  . TYR A 1 946  ? -6.825  81.528  56.852  1.00 22.24 ? 946  TYR A CZ  1 
ATOM   7463  O  OH  . TYR A 1 946  ? -5.567  80.980  56.706  1.00 22.33 ? 946  TYR A OH  1 
ATOM   7464  N  N   . TYR A 1 947  ? -12.325 80.984  56.075  1.00 24.50 ? 947  TYR A N   1 
ATOM   7465  C  CA  . TYR A 1 947  ? -12.405 79.666  55.461  1.00 24.68 ? 947  TYR A CA  1 
ATOM   7466  C  C   . TYR A 1 947  ? -13.438 79.579  54.340  1.00 25.17 ? 947  TYR A C   1 
ATOM   7467  O  O   . TYR A 1 947  ? -13.286 78.784  53.416  1.00 25.11 ? 947  TYR A O   1 
ATOM   7468  C  CB  . TYR A 1 947  ? -12.673 78.613  56.547  1.00 23.35 ? 947  TYR A CB  1 
ATOM   7469  C  CG  . TYR A 1 947  ? -11.426 78.323  57.335  1.00 23.20 ? 947  TYR A CG  1 
ATOM   7470  C  CD1 . TYR A 1 947  ? -10.313 77.774  56.703  1.00 23.37 ? 947  TYR A CD1 1 
ATOM   7471  C  CD2 . TYR A 1 947  ? -11.328 78.640  58.694  1.00 22.34 ? 947  TYR A CD2 1 
ATOM   7472  C  CE1 . TYR A 1 947  ? -9.132  77.541  57.386  1.00 22.61 ? 947  TYR A CE1 1 
ATOM   7473  C  CE2 . TYR A 1 947  ? -10.149 78.411  59.400  1.00 22.47 ? 947  TYR A CE2 1 
ATOM   7474  C  CZ  . TYR A 1 947  ? -9.050  77.862  58.731  1.00 23.50 ? 947  TYR A CZ  1 
ATOM   7475  O  OH  . TYR A 1 947  ? -7.854  77.644  59.369  1.00 21.95 ? 947  TYR A OH  1 
ATOM   7476  N  N   . MET A 1 948  ? -14.488 80.389  54.415  1.00 26.14 ? 948  MET A N   1 
ATOM   7477  C  CA  . MET A 1 948  ? -15.493 80.370  53.357  1.00 27.60 ? 948  MET A CA  1 
ATOM   7478  C  C   . MET A 1 948  ? -14.936 81.003  52.092  1.00 28.03 ? 948  MET A C   1 
ATOM   7479  O  O   . MET A 1 948  ? -15.258 80.583  50.986  1.00 27.98 ? 948  MET A O   1 
ATOM   7480  C  CB  . MET A 1 948  ? -16.747 81.127  53.779  1.00 27.90 ? 948  MET A CB  1 
ATOM   7481  C  CG  . MET A 1 948  ? -17.681 80.332  54.662  1.00 30.03 ? 948  MET A CG  1 
ATOM   7482  S  SD  . MET A 1 948  ? -19.147 81.290  55.051  1.00 32.88 ? 948  MET A SD  1 
ATOM   7483  C  CE  . MET A 1 948  ? -18.761 81.734  56.683  1.00 31.99 ? 948  MET A CE  1 
ATOM   7484  N  N   . ALA A 1 949  ? -14.090 82.013  52.265  1.00 28.26 ? 949  ALA A N   1 
ATOM   7485  C  CA  . ALA A 1 949  ? -13.484 82.715  51.140  1.00 28.28 ? 949  ALA A CA  1 
ATOM   7486  C  C   . ALA A 1 949  ? -12.615 81.792  50.292  1.00 27.68 ? 949  ALA A C   1 
ATOM   7487  O  O   . ALA A 1 949  ? -12.342 82.077  49.121  1.00 25.75 ? 949  ALA A O   1 
ATOM   7488  C  CB  . ALA A 1 949  ? -12.642 83.892  51.654  1.00 28.19 ? 949  ALA A CB  1 
ATOM   7489  N  N   . GLN A 1 950  ? -12.193 80.682  50.886  1.00 27.10 ? 950  GLN A N   1 
ATOM   7490  C  CA  . GLN A 1 950  ? -11.321 79.735  50.199  1.00 28.22 ? 950  GLN A CA  1 
ATOM   7491  C  C   . GLN A 1 950  ? -12.022 78.586  49.513  1.00 29.67 ? 950  GLN A C   1 
ATOM   7492  O  O   . GLN A 1 950  ? -11.372 77.679  49.016  1.00 31.42 ? 950  GLN A O   1 
ATOM   7493  C  CB  . GLN A 1 950  ? -10.296 79.178  51.176  1.00 26.03 ? 950  GLN A CB  1 
ATOM   7494  C  CG  . GLN A 1 950  ? -9.414  80.243  51.793  1.00 26.35 ? 950  GLN A CG  1 
ATOM   7495  C  CD  . GLN A 1 950  ? -8.569  79.690  52.911  1.00 25.30 ? 950  GLN A CD  1 
ATOM   7496  O  OE1 . GLN A 1 950  ? -7.827  78.729  52.716  1.00 26.95 ? 950  GLN A OE1 1 
ATOM   7497  N  NE2 . GLN A 1 950  ? -8.673  80.290  54.087  1.00 22.50 ? 950  GLN A NE2 1 
ATOM   7498  N  N   . LEU A 1 951  ? -13.345 78.608  49.495  1.00 31.22 ? 951  LEU A N   1 
ATOM   7499  C  CA  . LEU A 1 951  ? -14.096 77.553  48.831  1.00 32.55 ? 951  LEU A CA  1 
ATOM   7500  C  C   . LEU A 1 951  ? -14.404 77.993  47.407  1.00 34.63 ? 951  LEU A C   1 
ATOM   7501  O  O   . LEU A 1 951  ? -14.486 79.196  47.120  1.00 34.96 ? 951  LEU A O   1 
ATOM   7502  C  CB  . LEU A 1 951  ? -15.399 77.264  49.568  1.00 32.17 ? 951  LEU A CB  1 
ATOM   7503  C  CG  . LEU A 1 951  ? -15.249 76.698  50.987  1.00 31.47 ? 951  LEU A CG  1 
ATOM   7504  C  CD1 . LEU A 1 951  ? -16.614 76.573  51.633  1.00 31.25 ? 951  LEU A CD1 1 
ATOM   7505  C  CD2 . LEU A 1 951  ? -14.548 75.350  50.938  1.00 29.41 ? 951  LEU A CD2 1 
ATOM   7506  N  N   . PRO A 1 952  ? -14.550 77.028  46.485  1.00 36.08 ? 952  PRO A N   1 
ATOM   7507  C  CA  . PRO A 1 952  ? -14.849 77.374  45.093  1.00 36.39 ? 952  PRO A CA  1 
ATOM   7508  C  C   . PRO A 1 952  ? -16.199 78.057  45.004  1.00 36.79 ? 952  PRO A C   1 
ATOM   7509  O  O   . PRO A 1 952  ? -17.132 77.661  45.699  1.00 37.09 ? 952  PRO A O   1 
ATOM   7510  C  CB  . PRO A 1 952  ? -14.819 76.020  44.379  1.00 36.62 ? 952  PRO A CB  1 
ATOM   7511  C  CG  . PRO A 1 952  ? -15.155 75.033  45.477  1.00 36.81 ? 952  PRO A CG  1 
ATOM   7512  C  CD  . PRO A 1 952  ? -14.365 75.573  46.641  1.00 36.00 ? 952  PRO A CD  1 
ATOM   7513  N  N   . ARG A 1 953  ? -16.295 79.087  44.165  1.00 37.33 ? 953  ARG A N   1 
ATOM   7514  C  CA  . ARG A 1 953  ? -17.533 79.838  44.003  1.00 37.90 ? 953  ARG A CA  1 
ATOM   7515  C  C   . ARG A 1 953  ? -18.341 79.395  42.776  1.00 39.09 ? 953  ARG A C   1 
ATOM   7516  O  O   . ARG A 1 953  ? -19.054 80.197  42.178  1.00 37.80 ? 953  ARG A O   1 
ATOM   7517  C  CB  . ARG A 1 953  ? -17.220 81.336  43.909  1.00 36.40 ? 953  ARG A CB  1 
ATOM   7518  C  CG  . ARG A 1 953  ? -16.685 81.952  45.202  1.00 36.35 ? 953  ARG A CG  1 
ATOM   7519  C  CD  . ARG A 1 953  ? -15.536 82.920  44.929  1.00 36.69 ? 953  ARG A CD  1 
ATOM   7520  N  NE  . ARG A 1 953  ? -14.374 82.609  45.755  1.00 38.78 ? 953  ARG A NE  1 
ATOM   7521  C  CZ  . ARG A 1 953  ? -13.126 82.974  45.474  1.00 40.69 ? 953  ARG A CZ  1 
ATOM   7522  N  NH1 . ARG A 1 953  ? -12.861 83.671  44.382  1.00 40.49 ? 953  ARG A NH1 1 
ATOM   7523  N  NH2 . ARG A 1 953  ? -12.135 82.637  46.287  1.00 42.48 ? 953  ARG A NH2 1 
ATOM   7524  N  N   . ASN A 1 954  ? -18.234 78.112  42.428  1.00 41.14 ? 954  ASN A N   1 
ATOM   7525  C  CA  . ASN A 1 954  ? -18.945 77.532  41.278  1.00 43.68 ? 954  ASN A CA  1 
ATOM   7526  C  C   . ASN A 1 954  ? -19.078 76.005  41.360  1.00 45.54 ? 954  ASN A C   1 
ATOM   7527  O  O   . ASN A 1 954  ? -18.103 75.302  41.623  1.00 45.40 ? 954  ASN A O   1 
ATOM   7528  C  CB  . ASN A 1 954  ? -18.220 77.896  39.986  1.00 43.95 ? 954  ASN A CB  1 
ATOM   7529  C  CG  . ASN A 1 954  ? -16.820 77.334  39.925  1.00 44.54 ? 954  ASN A CG  1 
ATOM   7530  O  OD1 . ASN A 1 954  ? -16.602 76.216  39.451  1.00 45.16 ? 954  ASN A OD1 1 
ATOM   7531  N  ND2 . ASN A 1 954  ? -15.858 78.108  40.412  1.00 45.85 ? 954  ASN A ND2 1 
ATOM   7532  N  N   . PRO A 1 955  ? -20.281 75.473  41.102  1.00 47.40 ? 955  PRO A N   1 
ATOM   7533  C  CA  . PRO A 1 955  ? -20.510 74.024  41.156  1.00 49.15 ? 955  PRO A CA  1 
ATOM   7534  C  C   . PRO A 1 955  ? -19.388 73.219  40.498  1.00 50.17 ? 955  PRO A C   1 
ATOM   7535  O  O   . PRO A 1 955  ? -18.662 73.729  39.647  1.00 50.41 ? 955  PRO A O   1 
ATOM   7536  C  CB  . PRO A 1 955  ? -21.839 73.868  40.429  1.00 49.37 ? 955  PRO A CB  1 
ATOM   7537  C  CG  . PRO A 1 955  ? -22.549 75.116  40.809  1.00 49.73 ? 955  PRO A CG  1 
ATOM   7538  C  CD  . PRO A 1 955  ? -21.483 76.172  40.624  1.00 48.18 ? 955  PRO A CD  1 
ATOM   7539  N  N   . LYS A 1 956  ? -19.251 71.962  40.903  1.00 52.06 ? 956  LYS A N   1 
ATOM   7540  C  CA  . LYS A 1 956  ? -18.227 71.085  40.356  1.00 54.32 ? 956  LYS A CA  1 
ATOM   7541  C  C   . LYS A 1 956  ? -18.813 69.736  39.962  1.00 55.21 ? 956  LYS A C   1 
ATOM   7542  O  O   . LYS A 1 956  ? -18.425 69.153  38.943  1.00 55.39 ? 956  LYS A O   1 
ATOM   7543  C  CB  . LYS A 1 956  ? -17.090 70.897  41.362  1.00 54.53 ? 956  LYS A CB  1 
ATOM   7544  C  CG  . LYS A 1 956  ? -17.468 70.060  42.574  1.00 55.57 ? 956  LYS A CG  1 
ATOM   7545  C  CD  . LYS A 1 956  ? -16.299 69.924  43.537  1.00 57.79 ? 956  LYS A CD  1 
ATOM   7546  C  CE  . LYS A 1 956  ? -16.680 69.095  44.754  1.00 58.79 ? 956  LYS A CE  1 
ATOM   7547  N  NZ  . LYS A 1 956  ? -15.544 68.952  45.706  1.00 59.25 ? 956  LYS A NZ  1 
ATOM   7548  N  N   . GLU A 1 965  ? -15.330 52.697  33.120  1.00 72.06 ? 965  GLU A N   1 
ATOM   7549  C  CA  . GLU A 1 965  ? -14.329 52.079  32.252  1.00 71.79 ? 965  GLU A CA  1 
ATOM   7550  C  C   . GLU A 1 965  ? -13.962 53.033  31.132  1.00 70.68 ? 965  GLU A C   1 
ATOM   7551  O  O   . GLU A 1 965  ? -12.799 53.148  30.732  1.00 71.12 ? 965  GLU A O   1 
ATOM   7552  C  CB  . GLU A 1 965  ? -14.857 50.787  31.628  1.00 73.10 ? 965  GLU A CB  1 
ATOM   7553  C  CG  . GLU A 1 965  ? -13.872 50.184  30.632  1.00 74.76 ? 965  GLU A CG  1 
ATOM   7554  C  CD  . GLU A 1 965  ? -14.385 48.925  29.970  1.00 75.90 ? 965  GLU A CD  1 
ATOM   7555  O  OE1 . GLU A 1 965  ? -14.606 47.933  30.694  1.00 76.63 ? 965  GLU A OE1 1 
ATOM   7556  O  OE2 . GLU A 1 965  ? -14.565 48.927  28.729  1.00 76.97 ? 965  GLU A OE2 1 
ATOM   7557  N  N   . VAL A 1 966  ? -14.970 53.705  30.599  1.00 68.53 ? 966  VAL A N   1 
ATOM   7558  C  CA  . VAL A 1 966  ? -14.704 54.643  29.540  1.00 66.52 ? 966  VAL A CA  1 
ATOM   7559  C  C   . VAL A 1 966  ? -13.794 55.722  30.122  1.00 65.77 ? 966  VAL A C   1 
ATOM   7560  O  O   . VAL A 1 966  ? -13.236 56.532  29.382  1.00 66.09 ? 966  VAL A O   1 
ATOM   7561  C  CB  . VAL A 1 966  ? -16.004 55.262  28.997  1.00 66.07 ? 966  VAL A CB  1 
ATOM   7562  C  CG1 . VAL A 1 966  ? -16.622 56.193  30.024  1.00 65.50 ? 966  VAL A CG1 1 
ATOM   7563  C  CG2 . VAL A 1 966  ? -15.717 55.988  27.716  1.00 65.55 ? 966  VAL A CG2 1 
ATOM   7564  N  N   . ARG A 1 967  ? -13.647 55.738  31.442  1.00 64.43 ? 967  ARG A N   1 
ATOM   7565  C  CA  . ARG A 1 967  ? -12.774 56.720  32.078  1.00 63.25 ? 967  ARG A CA  1 
ATOM   7566  C  C   . ARG A 1 967  ? -11.314 56.371  31.807  1.00 61.95 ? 967  ARG A C   1 
ATOM   7567  O  O   . ARG A 1 967  ? -10.540 57.228  31.383  1.00 61.24 ? 967  ARG A O   1 
ATOM   7568  C  CB  . ARG A 1 967  ? -13.049 56.798  33.575  1.00 64.90 ? 967  ARG A CB  1 
ATOM   7569  C  CG  . ARG A 1 967  ? -12.731 58.154  34.185  1.00 67.18 ? 967  ARG A CG  1 
ATOM   7570  C  CD  . ARG A 1 967  ? -12.414 58.029  35.665  1.00 69.07 ? 967  ARG A CD  1 
ATOM   7571  N  NE  . ARG A 1 967  ? -12.143 59.328  36.277  1.00 71.93 ? 967  ARG A NE  1 
ATOM   7572  C  CZ  . ARG A 1 967  ? -11.621 59.486  37.489  1.00 72.95 ? 967  ARG A CZ  1 
ATOM   7573  N  NH1 . ARG A 1 967  ? -11.314 58.423  38.223  1.00 73.41 ? 967  ARG A NH1 1 
ATOM   7574  N  NH2 . ARG A 1 967  ? -11.408 60.706  37.967  1.00 72.35 ? 967  ARG A NH2 1 
ATOM   7575  N  N   . GLU A 1 968  ? -10.927 55.112  32.050  1.00 61.23 ? 968  GLU A N   1 
ATOM   7576  C  CA  . GLU A 1 968  ? -9.563  54.704  31.748  1.00 61.21 ? 968  GLU A CA  1 
ATOM   7577  C  C   . GLU A 1 968  ? -9.279  55.015  30.261  1.00 59.84 ? 968  GLU A C   1 
ATOM   7578  O  O   . GLU A 1 968  ? -8.228  55.575  29.915  1.00 59.80 ? 968  GLU A O   1 
ATOM   7579  C  CB  . GLU A 1 968  ? -9.374  53.184  32.006  1.00 62.03 ? 968  GLU A CB  1 
ATOM   7580  C  CG  . GLU A 1 968  ? -9.763  52.714  33.414  1.00 63.49 ? 968  GLU A CG  1 
ATOM   7581  C  CD  . GLU A 1 968  ? -9.634  51.211  33.602  1.00 64.64 ? 968  GLU A CD  1 
ATOM   7582  O  OE1 . GLU A 1 968  ? -10.240 50.456  32.813  1.00 65.00 ? 968  GLU A OE1 1 
ATOM   7583  O  OE2 . GLU A 1 968  ? -8.920  50.787  34.537  1.00 64.83 ? 968  GLU A OE2 1 
ATOM   7584  N  N   . GLN A 1 969  ? -10.248 54.681  29.408  1.00 58.13 ? 969  GLN A N   1 
ATOM   7585  C  CA  . GLN A 1 969  ? -10.152 54.851  27.955  1.00 55.87 ? 969  GLN A CA  1 
ATOM   7586  C  C   . GLN A 1 969  ? -9.831  56.263  27.517  1.00 53.52 ? 969  GLN A C   1 
ATOM   7587  O  O   . GLN A 1 969  ? -8.995  56.477  26.640  1.00 51.91 ? 969  GLN A O   1 
ATOM   7588  C  CB  . GLN A 1 969  ? -11.455 54.433  27.279  1.00 57.02 ? 969  GLN A CB  1 
ATOM   7589  C  CG  . GLN A 1 969  ? -11.669 52.899  27.155  1.00 59.16 ? 969  GLN A CG  1 
ATOM   7590  C  CD  . GLN A 1 969  ? -13.158 52.575  26.602  1.00 60.41 ? 969  GLN A CD  1 
ATOM   7591  O  OE1 . GLN A 1 969  ? -13.660 53.389  25.946  1.00 60.79 ? 969  GLN A OE1 1 
ATOM   7592  N  NE2 . GLN A 1 969  ? -13.683 51.421  26.939  1.00 60.71 ? 969  GLN A NE2 1 
ATOM   7593  N  N   . PHE A 1 970  ? -10.531 57.215  28.125  1.00 51.11 ? 970  PHE A N   1 
ATOM   7594  C  CA  . PHE A 1 970  ? -10.353 58.626  27.831  1.00 49.30 ? 970  PHE A CA  1 
ATOM   7595  C  C   . PHE A 1 970  ? -8.954  59.056  28.262  1.00 48.36 ? 970  PHE A C   1 
ATOM   7596  O  O   . PHE A 1 970  ? -8.093  59.366  27.432  1.00 48.24 ? 970  PHE A O   1 
ATOM   7597  C  CB  . PHE A 1 970  ? -11.389 59.439  28.595  1.00 48.50 ? 970  PHE A CB  1 
ATOM   7598  C  CG  . PHE A 1 970  ? -11.566 60.833  28.076  1.00 48.10 ? 970  PHE A CG  1 
ATOM   7599  C  CD1 . PHE A 1 970  ? -12.123 61.051  26.822  1.00 47.45 ? 970  PHE A CD1 1 
ATOM   7600  C  CD2 . PHE A 1 970  ? -11.202 61.928  28.853  1.00 47.11 ? 970  PHE A CD2 1 
ATOM   7601  C  CE1 . PHE A 1 970  ? -12.304 62.347  26.341  1.00 47.54 ? 970  PHE A CE1 1 
ATOM   7602  C  CE2 . PHE A 1 970  ? -11.376 63.224  28.387  1.00 46.42 ? 970  PHE A CE2 1 
ATOM   7603  C  CZ  . PHE A 1 970  ? -11.935 63.436  27.129  1.00 46.65 ? 970  PHE A CZ  1 
ATOM   7604  N  N   . THR A 1 971  ? -8.740  59.065  29.573  1.00 47.08 ? 971  THR A N   1 
ATOM   7605  C  CA  . THR A 1 971  ? -7.460  59.451  30.151  1.00 45.66 ? 971  THR A CA  1 
ATOM   7606  C  C   . THR A 1 971  ? -6.306  58.788  29.411  1.00 44.50 ? 971  THR A C   1 
ATOM   7607  O  O   . THR A 1 971  ? -5.249  59.385  29.235  1.00 44.11 ? 971  THR A O   1 
ATOM   7608  C  CB  . THR A 1 971  ? -7.407  59.075  31.640  1.00 45.49 ? 971  THR A CB  1 
ATOM   7609  O  OG1 . THR A 1 971  ? -8.520  59.672  32.313  1.00 44.51 ? 971  THR A OG1 1 
ATOM   7610  C  CG2 . THR A 1 971  ? -6.121  59.586  32.281  1.00 46.81 ? 971  THR A CG2 1 
ATOM   7611  N  N   . GLN A 1 972  ? -6.515  57.556  28.966  1.00 43.69 ? 972  GLN A N   1 
ATOM   7612  C  CA  . GLN A 1 972  ? -5.483  56.841  28.227  1.00 42.40 ? 972  GLN A CA  1 
ATOM   7613  C  C   . GLN A 1 972  ? -5.273  57.475  26.846  1.00 41.42 ? 972  GLN A C   1 
ATOM   7614  O  O   . GLN A 1 972  ? -4.135  57.609  26.377  1.00 41.01 ? 972  GLN A O   1 
ATOM   7615  C  CB  . GLN A 1 972  ? -5.867  55.369  28.065  1.00 43.70 ? 972  GLN A CB  1 
ATOM   7616  C  CG  . GLN A 1 972  ? -4.836  54.539  27.308  1.00 45.16 ? 972  GLN A CG  1 
ATOM   7617  C  CD  . GLN A 1 972  ? -3.518  54.465  28.044  1.00 45.66 ? 972  GLN A CD  1 
ATOM   7618  O  OE1 . GLN A 1 972  ? -3.454  53.965  29.166  1.00 47.06 ? 972  GLN A OE1 1 
ATOM   7619  N  NE2 . GLN A 1 972  ? -2.455  54.971  27.421  1.00 46.59 ? 972  GLN A NE2 1 
ATOM   7620  N  N   . ALA A 1 973  ? -6.372  57.857  26.196  1.00 40.49 ? 973  ALA A N   1 
ATOM   7621  C  CA  . ALA A 1 973  ? -6.292  58.490  24.882  1.00 38.95 ? 973  ALA A CA  1 
ATOM   7622  C  C   . ALA A 1 973  ? -5.447  59.750  25.025  1.00 38.75 ? 973  ALA A C   1 
ATOM   7623  O  O   . ALA A 1 973  ? -4.494  59.959  24.280  1.00 37.89 ? 973  ALA A O   1 
ATOM   7624  C  CB  . ALA A 1 973  ? -7.682  58.838  24.376  1.00 37.32 ? 973  ALA A CB  1 
ATOM   7625  N  N   . LEU A 1 974  ? -5.792  60.579  26.003  1.00 38.40 ? 974  LEU A N   1 
ATOM   7626  C  CA  . LEU A 1 974  ? -5.051  61.806  26.251  1.00 39.08 ? 974  LEU A CA  1 
ATOM   7627  C  C   . LEU A 1 974  ? -3.596  61.441  26.497  1.00 40.02 ? 974  LEU A C   1 
ATOM   7628  O  O   . LEU A 1 974  ? -2.687  62.056  25.939  1.00 41.25 ? 974  LEU A O   1 
ATOM   7629  C  CB  . LEU A 1 974  ? -5.637  62.537  27.457  1.00 37.10 ? 974  LEU A CB  1 
ATOM   7630  C  CG  . LEU A 1 974  ? -7.087  62.967  27.210  1.00 38.12 ? 974  LEU A CG  1 
ATOM   7631  C  CD1 . LEU A 1 974  ? -7.746  63.390  28.509  1.00 37.92 ? 974  LEU A CD1 1 
ATOM   7632  C  CD2 . LEU A 1 974  ? -7.114  64.098  26.182  1.00 38.58 ? 974  LEU A CD2 1 
ATOM   7633  N  N   . SER A 1 975  ? -3.373  60.421  27.315  1.00 40.13 ? 975  SER A N   1 
ATOM   7634  C  CA  . SER A 1 975  ? -2.017  59.994  27.609  1.00 40.57 ? 975  SER A CA  1 
ATOM   7635  C  C   . SER A 1 975  ? -1.228  59.634  26.344  1.00 41.42 ? 975  SER A C   1 
ATOM   7636  O  O   . SER A 1 975  ? -0.062  59.991  26.222  1.00 41.34 ? 975  SER A O   1 
ATOM   7637  C  CB  . SER A 1 975  ? -2.037  58.803  28.566  1.00 40.67 ? 975  SER A CB  1 
ATOM   7638  O  OG  . SER A 1 975  ? -0.727  58.498  29.009  1.00 41.68 ? 975  SER A OG  1 
ATOM   7639  N  N   . ASP A 1 976  ? -1.852  58.929  25.404  1.00 42.92 ? 976  ASP A N   1 
ATOM   7640  C  CA  . ASP A 1 976  ? -1.155  58.556  24.172  1.00 44.06 ? 976  ASP A CA  1 
ATOM   7641  C  C   . ASP A 1 976  ? -0.823  59.813  23.368  1.00 44.90 ? 976  ASP A C   1 
ATOM   7642  O  O   . ASP A 1 976  ? 0.235   59.907  22.735  1.00 45.33 ? 976  ASP A O   1 
ATOM   7643  C  CB  . ASP A 1 976  ? -2.011  57.627  23.302  1.00 45.54 ? 976  ASP A CB  1 
ATOM   7644  C  CG  . ASP A 1 976  ? -2.173  56.242  23.898  1.00 47.28 ? 976  ASP A CG  1 
ATOM   7645  O  OD1 . ASP A 1 976  ? -1.256  55.787  24.618  1.00 48.66 ? 976  ASP A OD1 1 
ATOM   7646  O  OD2 . ASP A 1 976  ? -3.214  55.601  23.627  1.00 47.11 ? 976  ASP A OD2 1 
ATOM   7647  N  N   . TYR A 1 977  ? -1.740  60.775  23.395  1.00 43.89 ? 977  TYR A N   1 
ATOM   7648  C  CA  . TYR A 1 977  ? -1.552  62.019  22.669  1.00 43.50 ? 977  TYR A CA  1 
ATOM   7649  C  C   . TYR A 1 977  ? -0.267  62.703  23.120  1.00 44.20 ? 977  TYR A C   1 
ATOM   7650  O  O   . TYR A 1 977  ? 0.590   63.046  22.304  1.00 43.32 ? 977  TYR A O   1 
ATOM   7651  C  CB  . TYR A 1 977  ? -2.736  62.955  22.915  1.00 42.06 ? 977  TYR A CB  1 
ATOM   7652  C  CG  . TYR A 1 977  ? -2.661  64.249  22.140  1.00 41.27 ? 977  TYR A CG  1 
ATOM   7653  C  CD1 . TYR A 1 977  ? -3.086  64.314  20.812  1.00 40.77 ? 977  TYR A CD1 1 
ATOM   7654  C  CD2 . TYR A 1 977  ? -2.127  65.402  22.719  1.00 40.75 ? 977  TYR A CD2 1 
ATOM   7655  C  CE1 . TYR A 1 977  ? -2.979  65.494  20.078  1.00 38.91 ? 977  TYR A CE1 1 
ATOM   7656  C  CE2 . TYR A 1 977  ? -2.014  66.586  21.991  1.00 40.03 ? 977  TYR A CE2 1 
ATOM   7657  C  CZ  . TYR A 1 977  ? -2.439  66.624  20.673  1.00 39.67 ? 977  TYR A CZ  1 
ATOM   7658  O  OH  . TYR A 1 977  ? -2.292  67.780  19.943  1.00 39.27 ? 977  TYR A OH  1 
ATOM   7659  N  N   . LEU A 1 978  ? -0.145  62.895  24.429  1.00 44.54 ? 978  LEU A N   1 
ATOM   7660  C  CA  . LEU A 1 978  ? 1.015   63.555  25.011  1.00 46.29 ? 978  LEU A CA  1 
ATOM   7661  C  C   . LEU A 1 978  ? 2.275   62.687  24.935  1.00 47.41 ? 978  LEU A C   1 
ATOM   7662  O  O   . LEU A 1 978  ? 3.329   63.143  24.481  1.00 47.28 ? 978  LEU A O   1 
ATOM   7663  C  CB  . LEU A 1 978  ? 0.716   63.920  26.468  1.00 45.22 ? 978  LEU A CB  1 
ATOM   7664  C  CG  . LEU A 1 978  ? 1.736   64.788  27.203  1.00 44.21 ? 978  LEU A CG  1 
ATOM   7665  C  CD1 . LEU A 1 978  ? 1.763   66.167  26.582  1.00 43.82 ? 978  LEU A CD1 1 
ATOM   7666  C  CD2 . LEU A 1 978  ? 1.358   64.884  28.676  1.00 44.56 ? 978  LEU A CD2 1 
ATOM   7667  N  N   . MET A 1 979  ? 2.154   61.436  25.373  1.00 48.71 ? 979  MET A N   1 
ATOM   7668  C  CA  . MET A 1 979  ? 3.276   60.497  25.369  1.00 49.81 ? 979  MET A CA  1 
ATOM   7669  C  C   . MET A 1 979  ? 3.467   59.832  24.017  1.00 49.89 ? 979  MET A C   1 
ATOM   7670  O  O   . MET A 1 979  ? 3.988   58.721  23.927  1.00 50.93 ? 979  MET A O   1 
ATOM   7671  C  CB  . MET A 1 979  ? 3.069   59.415  26.427  1.00 51.03 ? 979  MET A CB  1 
ATOM   7672  C  CG  . MET A 1 979  ? 3.136   59.912  27.845  1.00 51.73 ? 979  MET A CG  1 
ATOM   7673  S  SD  . MET A 1 979  ? 4.601   60.888  28.097  1.00 54.91 ? 979  MET A SD  1 
ATOM   7674  C  CE  . MET A 1 979  ? 4.158   61.772  29.567  1.00 54.52 ? 979  MET A CE  1 
ATOM   7675  N  N   . GLN A 1 980  ? 3.048   60.516  22.963  1.00 50.35 ? 980  GLN A N   1 
ATOM   7676  C  CA  . GLN A 1 980  ? 3.171   59.986  21.613  1.00 50.39 ? 980  GLN A CA  1 
ATOM   7677  C  C   . GLN A 1 980  ? 4.584   59.462  21.358  1.00 49.83 ? 980  GLN A C   1 
ATOM   7678  O  O   . GLN A 1 980  ? 4.769   58.311  20.970  1.00 49.97 ? 980  GLN A O   1 
ATOM   7679  C  CB  . GLN A 1 980  ? 2.842   61.077  20.598  1.00 50.42 ? 980  GLN A CB  1 
ATOM   7680  C  CG  . GLN A 1 980  ? 2.244   60.555  19.316  1.00 52.12 ? 980  GLN A CG  1 
ATOM   7681  C  CD  . GLN A 1 980  ? 2.358   61.551  18.188  1.00 53.55 ? 980  GLN A CD  1 
ATOM   7682  O  OE1 . GLN A 1 980  ? 1.576   61.520  17.238  1.00 54.12 ? 980  GLN A OE1 1 
ATOM   7683  N  NE2 . GLN A 1 980  ? 3.346   62.440  18.278  1.00 53.19 ? 980  GLN A NE2 1 
ATOM   7684  N  N   . ASN A 1 981  ? 5.580   60.309  21.592  1.00 48.98 ? 981  ASN A N   1 
ATOM   7685  C  CA  . ASN A 1 981  ? 6.970   59.927  21.377  1.00 47.48 ? 981  ASN A CA  1 
ATOM   7686  C  C   . ASN A 1 981  ? 7.504   59.067  22.527  1.00 46.78 ? 981  ASN A C   1 
ATOM   7687  O  O   . ASN A 1 981  ? 7.477   59.480  23.676  1.00 46.32 ? 981  ASN A O   1 
ATOM   7688  C  CB  . ASN A 1 981  ? 7.830   61.173  21.213  1.00 46.53 ? 981  ASN A CB  1 
ATOM   7689  C  CG  . ASN A 1 981  ? 9.255   60.839  20.843  1.00 46.85 ? 981  ASN A CG  1 
ATOM   7690  O  OD1 . ASN A 1 981  ? 9.918   60.050  21.522  1.00 46.86 ? 981  ASN A OD1 1 
ATOM   7691  N  ND2 . ASN A 1 981  ? 9.740   61.437  19.760  1.00 46.13 ? 981  ASN A ND2 1 
ATOM   7692  N  N   . PRO A 1 982  ? 7.987   57.849  22.222  1.00 46.44 ? 982  PRO A N   1 
ATOM   7693  C  CA  . PRO A 1 982  ? 8.530   56.911  23.209  1.00 45.89 ? 982  PRO A CA  1 
ATOM   7694  C  C   . PRO A 1 982  ? 9.676   57.459  24.070  1.00 46.34 ? 982  PRO A C   1 
ATOM   7695  O  O   . PRO A 1 982  ? 9.828   57.073  25.231  1.00 45.65 ? 982  PRO A O   1 
ATOM   7696  C  CB  . PRO A 1 982  ? 8.981   55.732  22.345  1.00 45.97 ? 982  PRO A CB  1 
ATOM   7697  C  CG  . PRO A 1 982  ? 8.032   55.761  21.213  1.00 46.16 ? 982  PRO A CG  1 
ATOM   7698  C  CD  . PRO A 1 982  ? 7.969   57.233  20.884  1.00 46.17 ? 982  PRO A CD  1 
ATOM   7699  N  N   . GLU A 1 983  ? 10.482  58.352  23.500  1.00 46.15 ? 983  GLU A N   1 
ATOM   7700  C  CA  . GLU A 1 983  ? 11.616  58.928  24.219  1.00 46.64 ? 983  GLU A CA  1 
ATOM   7701  C  C   . GLU A 1 983  ? 11.175  59.756  25.429  1.00 45.78 ? 983  GLU A C   1 
ATOM   7702  O  O   . GLU A 1 983  ? 11.864  59.798  26.452  1.00 45.44 ? 983  GLU A O   1 
ATOM   7703  C  CB  . GLU A 1 983  ? 12.443  59.806  23.276  1.00 48.57 ? 983  GLU A CB  1 
ATOM   7704  C  CG  . GLU A 1 983  ? 13.832  60.153  23.800  1.00 50.87 ? 983  GLU A CG  1 
ATOM   7705  C  CD  . GLU A 1 983  ? 14.617  61.051  22.845  1.00 52.95 ? 983  GLU A CD  1 
ATOM   7706  O  OE1 . GLU A 1 983  ? 14.481  60.871  21.608  1.00 52.99 ? 983  GLU A OE1 1 
ATOM   7707  O  OE2 . GLU A 1 983  ? 15.376  61.928  23.334  1.00 52.88 ? 983  GLU A OE2 1 
ATOM   7708  N  N   . LEU A 1 984  ? 10.035  60.427  25.299  1.00 44.69 ? 984  LEU A N   1 
ATOM   7709  C  CA  . LEU A 1 984  ? 9.509   61.258  26.375  1.00 44.53 ? 984  LEU A CA  1 
ATOM   7710  C  C   . LEU A 1 984  ? 9.072   60.354  27.533  1.00 45.34 ? 984  LEU A C   1 
ATOM   7711  O  O   . LEU A 1 984  ? 9.455   60.579  28.688  1.00 45.09 ? 984  LEU A O   1 
ATOM   7712  C  CB  . LEU A 1 984  ? 8.328   62.099  25.862  1.00 42.97 ? 984  LEU A CB  1 
ATOM   7713  C  CG  . LEU A 1 984  ? 8.210   63.615  26.117  1.00 41.48 ? 984  LEU A CG  1 
ATOM   7714  C  CD1 . LEU A 1 984  ? 6.754   63.986  26.223  1.00 38.19 ? 984  LEU A CD1 1 
ATOM   7715  C  CD2 . LEU A 1 984  ? 8.934   64.008  27.385  1.00 39.49 ? 984  LEU A CD2 1 
ATOM   7716  N  N   . LYS A 1 985  ? 8.296   59.317  27.213  1.00 45.75 ? 985  LYS A N   1 
ATOM   7717  C  CA  . LYS A 1 985  ? 7.819   58.380  28.226  1.00 45.82 ? 985  LYS A CA  1 
ATOM   7718  C  C   . LYS A 1 985  ? 8.995   57.801  29.014  1.00 45.29 ? 985  LYS A C   1 
ATOM   7719  O  O   . LYS A 1 985  ? 8.985   57.776  30.245  1.00 45.49 ? 985  LYS A O   1 
ATOM   7720  C  CB  . LYS A 1 985  ? 7.026   57.246  27.569  1.00 46.93 ? 985  LYS A CB  1 
ATOM   7721  C  CG  . LYS A 1 985  ? 6.329   56.333  28.565  1.00 48.73 ? 985  LYS A CG  1 
ATOM   7722  C  CD  . LYS A 1 985  ? 5.237   55.501  27.917  1.00 50.38 ? 985  LYS A CD  1 
ATOM   7723  C  CE  . LYS A 1 985  ? 4.447   54.734  28.971  1.00 52.22 ? 985  LYS A CE  1 
ATOM   7724  N  NZ  . LYS A 1 985  ? 3.346   53.925  28.355  1.00 54.20 ? 985  LYS A NZ  1 
ATOM   7725  N  N   . SER A 1 986  ? 10.011  57.344  28.291  1.00 44.99 ? 986  SER A N   1 
ATOM   7726  C  CA  . SER A 1 986  ? 11.195  56.766  28.909  1.00 44.31 ? 986  SER A CA  1 
ATOM   7727  C  C   . SER A 1 986  ? 11.813  57.741  29.893  1.00 44.01 ? 986  SER A C   1 
ATOM   7728  O  O   . SER A 1 986  ? 12.335  57.336  30.931  1.00 44.14 ? 986  SER A O   1 
ATOM   7729  C  CB  . SER A 1 986  ? 12.220  56.405  27.840  1.00 44.20 ? 986  SER A CB  1 
ATOM   7730  O  OG  . SER A 1 986  ? 11.642  55.538  26.885  1.00 47.79 ? 986  SER A OG  1 
ATOM   7731  N  N   . ARG A 1 987  ? 11.768  59.027  29.562  1.00 43.02 ? 987  ARG A N   1 
ATOM   7732  C  CA  . ARG A 1 987  ? 12.321  60.039  30.445  1.00 42.19 ? 987  ARG A CA  1 
ATOM   7733  C  C   . ARG A 1 987  ? 11.531  60.107  31.748  1.00 41.61 ? 987  ARG A C   1 
ATOM   7734  O  O   . ARG A 1 987  ? 12.100  60.032  32.841  1.00 41.58 ? 987  ARG A O   1 
ATOM   7735  C  CB  . ARG A 1 987  ? 12.295  61.407  29.767  1.00 41.05 ? 987  ARG A CB  1 
ATOM   7736  C  CG  . ARG A 1 987  ? 13.303  61.571  28.665  1.00 38.47 ? 987  ARG A CG  1 
ATOM   7737  C  CD  . ARG A 1 987  ? 13.191  62.946  28.059  1.00 37.09 ? 987  ARG A CD  1 
ATOM   7738  N  NE  . ARG A 1 987  ? 14.174  63.154  27.006  1.00 37.34 ? 987  ARG A NE  1 
ATOM   7739  C  CZ  . ARG A 1 987  ? 14.276  64.278  26.308  1.00 37.47 ? 987  ARG A CZ  1 
ATOM   7740  N  NH1 . ARG A 1 987  ? 13.450  65.283  26.563  1.00 36.72 ? 987  ARG A NH1 1 
ATOM   7741  N  NH2 . ARG A 1 987  ? 15.188  64.393  25.350  1.00 38.50 ? 987  ARG A NH2 1 
ATOM   7742  N  N   . VAL A 1 988  ? 10.215  60.246  31.616  1.00 41.94 ? 988  VAL A N   1 
ATOM   7743  C  CA  . VAL A 1 988  ? 9.327   60.349  32.768  1.00 42.86 ? 988  VAL A CA  1 
ATOM   7744  C  C   . VAL A 1 988  ? 9.397   59.119  33.671  1.00 43.10 ? 988  VAL A C   1 
ATOM   7745  O  O   . VAL A 1 988  ? 9.380   59.240  34.898  1.00 43.36 ? 988  VAL A O   1 
ATOM   7746  C  CB  . VAL A 1 988  ? 7.875   60.585  32.317  1.00 42.32 ? 988  VAL A CB  1 
ATOM   7747  C  CG1 . VAL A 1 988  ? 6.957   60.665  33.521  1.00 42.22 ? 988  VAL A CG1 1 
ATOM   7748  C  CG2 . VAL A 1 988  ? 7.797   61.873  31.516  1.00 42.55 ? 988  VAL A CG2 1 
ATOM   7749  N  N   . LEU A 1 989  ? 9.481   57.939  33.067  1.00 42.42 ? 989  LEU A N   1 
ATOM   7750  C  CA  . LEU A 1 989  ? 9.582   56.705  33.832  1.00 41.48 ? 989  LEU A CA  1 
ATOM   7751  C  C   . LEU A 1 989  ? 10.905  56.700  34.592  1.00 41.24 ? 989  LEU A C   1 
ATOM   7752  O  O   . LEU A 1 989  ? 10.958  56.325  35.759  1.00 42.03 ? 989  LEU A O   1 
ATOM   7753  C  CB  . LEU A 1 989  ? 9.497   55.496  32.898  1.00 41.44 ? 989  LEU A CB  1 
ATOM   7754  C  CG  . LEU A 1 989  ? 8.084   55.256  32.358  1.00 42.68 ? 989  LEU A CG  1 
ATOM   7755  C  CD1 . LEU A 1 989  ? 8.092   54.291  31.177  1.00 42.62 ? 989  LEU A CD1 1 
ATOM   7756  C  CD2 . LEU A 1 989  ? 7.227   54.723  33.492  1.00 42.79 ? 989  LEU A CD2 1 
ATOM   7757  N  N   . ARG A 1 990  ? 11.974  57.130  33.936  1.00 40.92 ? 990  ARG A N   1 
ATOM   7758  C  CA  . ARG A 1 990  ? 13.284  57.169  34.578  1.00 41.85 ? 990  ARG A CA  1 
ATOM   7759  C  C   . ARG A 1 990  ? 13.149  58.064  35.797  1.00 42.30 ? 990  ARG A C   1 
ATOM   7760  O  O   . ARG A 1 990  ? 13.669  57.762  36.872  1.00 42.01 ? 990  ARG A O   1 
ATOM   7761  C  CB  . ARG A 1 990  ? 14.329  57.751  33.624  1.00 42.57 ? 990  ARG A CB  1 
ATOM   7762  C  CG  . ARG A 1 990  ? 15.688  57.083  33.701  1.00 46.10 ? 990  ARG A CG  1 
ATOM   7763  C  CD  . ARG A 1 990  ? 16.466  57.454  34.950  1.00 49.04 ? 990  ARG A CD  1 
ATOM   7764  N  NE  . ARG A 1 990  ? 17.660  56.624  35.097  1.00 52.13 ? 990  ARG A NE  1 
ATOM   7765  C  CZ  . ARG A 1 990  ? 18.654  56.886  35.941  1.00 54.75 ? 990  ARG A CZ  1 
ATOM   7766  N  NH1 . ARG A 1 990  ? 18.597  57.964  36.716  1.00 56.28 ? 990  ARG A NH1 1 
ATOM   7767  N  NH2 . ARG A 1 990  ? 19.703  56.070  36.020  1.00 54.00 ? 990  ARG A NH2 1 
ATOM   7768  N  N   . GLY A 1 991  ? 12.437  59.172  35.623  1.00 42.82 ? 991  GLY A N   1 
ATOM   7769  C  CA  . GLY A 1 991  ? 12.244  60.088  36.725  1.00 43.67 ? 991  GLY A CA  1 
ATOM   7770  C  C   . GLY A 1 991  ? 11.491  59.397  37.850  1.00 44.84 ? 991  GLY A C   1 
ATOM   7771  O  O   . GLY A 1 991  ? 11.853  59.537  39.027  1.00 45.14 ? 991  GLY A O   1 
ATOM   7772  N  N   . ARG A 1 992  ? 10.456  58.639  37.497  1.00 43.74 ? 992  ARG A N   1 
ATOM   7773  C  CA  . ARG A 1 992  ? 9.659   57.949  38.501  1.00 45.38 ? 992  ARG A CA  1 
ATOM   7774  C  C   . ARG A 1 992  ? 10.426  56.941  39.359  1.00 45.73 ? 992  ARG A C   1 
ATOM   7775  O  O   . ARG A 1 992  ? 10.377  57.001  40.592  1.00 45.54 ? 992  ARG A O   1 
ATOM   7776  C  CB  . ARG A 1 992  ? 8.450   57.290  37.843  1.00 46.01 ? 992  ARG A CB  1 
ATOM   7777  C  CG  . ARG A 1 992  ? 7.186   58.081  38.069  1.00 48.51 ? 992  ARG A CG  1 
ATOM   7778  C  CD  . ARG A 1 992  ? 6.078   57.732  37.097  1.00 51.16 ? 992  ARG A CD  1 
ATOM   7779  N  NE  . ARG A 1 992  ? 5.741   56.311  37.100  1.00 53.58 ? 992  ARG A NE  1 
ATOM   7780  C  CZ  . ARG A 1 992  ? 4.511   55.837  37.275  1.00 54.47 ? 992  ARG A CZ  1 
ATOM   7781  N  NH1 . ARG A 1 992  ? 3.497   56.669  37.471  1.00 53.91 ? 992  ARG A NH1 1 
ATOM   7782  N  NH2 . ARG A 1 992  ? 4.289   54.531  37.237  1.00 55.55 ? 992  ARG A NH2 1 
ATOM   7783  N  N   . SER A 1 993  ? 11.139  56.019  38.725  1.00 46.00 ? 993  SER A N   1 
ATOM   7784  C  CA  . SER A 1 993  ? 11.905  55.045  39.486  1.00 46.72 ? 993  SER A CA  1 
ATOM   7785  C  C   . SER A 1 993  ? 13.014  55.788  40.232  1.00 46.34 ? 993  SER A C   1 
ATOM   7786  O  O   . SER A 1 993  ? 13.549  55.295  41.219  1.00 47.48 ? 993  SER A O   1 
ATOM   7787  C  CB  . SER A 1 993  ? 12.506  53.970  38.557  1.00 47.23 ? 993  SER A CB  1 
ATOM   7788  O  OG  . SER A 1 993  ? 13.561  54.479  37.753  1.00 48.91 ? 993  SER A OG  1 
ATOM   7789  N  N   . GLU A 1 994  ? 13.361  56.977  39.755  1.00 45.73 ? 994  GLU A N   1 
ATOM   7790  C  CA  . GLU A 1 994  ? 14.403  57.765  40.398  1.00 46.44 ? 994  GLU A CA  1 
ATOM   7791  C  C   . GLU A 1 994  ? 13.799  58.496  41.584  1.00 46.38 ? 994  GLU A C   1 
ATOM   7792  O  O   . GLU A 1 994  ? 14.449  58.710  42.606  1.00 46.02 ? 994  GLU A O   1 
ATOM   7793  C  CB  . GLU A 1 994  ? 14.993  58.775  39.410  1.00 47.49 ? 994  GLU A CB  1 
ATOM   7794  C  CG  . GLU A 1 994  ? 16.174  58.237  38.633  1.00 49.33 ? 994  GLU A CG  1 
ATOM   7795  C  CD  . GLU A 1 994  ? 17.471  58.329  39.420  1.00 51.06 ? 994  GLU A CD  1 
ATOM   7796  O  OE1 . GLU A 1 994  ? 17.972  59.461  39.610  1.00 52.04 ? 994  GLU A OE1 1 
ATOM   7797  O  OE2 . GLU A 1 994  ? 17.989  57.278  39.853  1.00 50.16 ? 994  GLU A OE2 1 
ATOM   7798  N  N   . TRP A 1 995  ? 12.536  58.872  41.446  1.00 45.76 ? 995  TRP A N   1 
ATOM   7799  C  CA  . TRP A 1 995  ? 11.850  59.589  42.506  1.00 44.59 ? 995  TRP A CA  1 
ATOM   7800  C  C   . TRP A 1 995  ? 11.733  58.716  43.746  1.00 45.50 ? 995  TRP A C   1 
ATOM   7801  O  O   . TRP A 1 995  ? 11.847  59.218  44.862  1.00 45.80 ? 995  TRP A O   1 
ATOM   7802  C  CB  . TRP A 1 995  ? 10.465  60.044  42.030  1.00 41.97 ? 995  TRP A CB  1 
ATOM   7803  C  CG  . TRP A 1 995  ? 9.724   60.918  43.003  1.00 39.33 ? 995  TRP A CG  1 
ATOM   7804  C  CD1 . TRP A 1 995  ? 8.597   60.586  43.703  1.00 38.20 ? 995  TRP A CD1 1 
ATOM   7805  C  CD2 . TRP A 1 995  ? 10.052  62.262  43.389  1.00 37.20 ? 995  TRP A CD2 1 
ATOM   7806  N  NE1 . TRP A 1 995  ? 8.204   61.635  44.497  1.00 37.27 ? 995  TRP A NE1 1 
ATOM   7807  C  CE2 . TRP A 1 995  ? 9.079   62.680  44.326  1.00 36.90 ? 995  TRP A CE2 1 
ATOM   7808  C  CE3 . TRP A 1 995  ? 11.073  63.158  43.032  1.00 36.21 ? 995  TRP A CE3 1 
ATOM   7809  C  CZ2 . TRP A 1 995  ? 9.097   63.955  44.920  1.00 34.80 ? 995  TRP A CZ2 1 
ATOM   7810  C  CZ3 . TRP A 1 995  ? 11.089  64.429  43.624  1.00 34.95 ? 995  TRP A CZ3 1 
ATOM   7811  C  CH2 . TRP A 1 995  ? 10.105  64.812  44.555  1.00 35.63 ? 995  TRP A CH2 1 
ATOM   7812  N  N   . GLU A 1 996  ? 11.519  57.414  43.556  1.00 46.02 ? 996  GLU A N   1 
ATOM   7813  C  CA  . GLU A 1 996  ? 11.396  56.497  44.690  1.00 46.40 ? 996  GLU A CA  1 
ATOM   7814  C  C   . GLU A 1 996  ? 12.640  56.485  45.568  1.00 46.45 ? 996  GLU A C   1 
ATOM   7815  O  O   . GLU A 1 996  ? 12.546  56.556  46.794  1.00 46.53 ? 996  GLU A O   1 
ATOM   7816  C  CB  . GLU A 1 996  ? 11.115  55.070  44.208  1.00 48.20 ? 996  GLU A CB  1 
ATOM   7817  C  CG  . GLU A 1 996  ? 9.741   54.872  43.614  1.00 48.99 ? 996  GLU A CG  1 
ATOM   7818  C  CD  . GLU A 1 996  ? 8.680   55.570  44.435  1.00 52.06 ? 996  GLU A CD  1 
ATOM   7819  O  OE1 . GLU A 1 996  ? 8.644   55.377  45.675  1.00 52.69 ? 996  GLU A OE1 1 
ATOM   7820  O  OE2 . GLU A 1 996  ? 7.881   56.320  43.838  1.00 53.99 ? 996  GLU A OE2 1 
ATOM   7821  N  N   . LYS A 1 997  ? 13.808  56.418  44.938  1.00 46.13 ? 997  LYS A N   1 
ATOM   7822  C  CA  . LYS A 1 997  ? 15.067  56.363  45.667  1.00 46.01 ? 997  LYS A CA  1 
ATOM   7823  C  C   . LYS A 1 997  ? 15.508  57.674  46.325  1.00 46.21 ? 997  LYS A C   1 
ATOM   7824  O  O   . LYS A 1 997  ? 15.949  57.661  47.478  1.00 45.69 ? 997  LYS A O   1 
ATOM   7825  C  CB  . LYS A 1 997  ? 16.176  55.859  44.736  1.00 47.64 ? 997  LYS A CB  1 
ATOM   7826  C  CG  . LYS A 1 997  ? 15.768  54.656  43.892  1.00 49.67 ? 997  LYS A CG  1 
ATOM   7827  C  CD  . LYS A 1 997  ? 16.803  54.325  42.823  1.00 50.59 ? 997  LYS A CD  1 
ATOM   7828  C  CE  . LYS A 1 997  ? 16.335  53.146  41.968  1.00 52.60 ? 997  LYS A CE  1 
ATOM   7829  N  NZ  . LYS A 1 997  ? 17.258  52.809  40.847  1.00 52.72 ? 997  LYS A NZ  1 
ATOM   7830  N  N   . TYR A 1 998  ? 15.379  58.800  45.621  1.00 45.45 ? 998  TYR A N   1 
ATOM   7831  C  CA  . TYR A 1 998  ? 15.828  60.075  46.175  1.00 44.51 ? 998  TYR A CA  1 
ATOM   7832  C  C   . TYR A 1 998  ? 14.789  61.147  46.579  1.00 43.47 ? 998  TYR A C   1 
ATOM   7833  O  O   . TYR A 1 998  ? 15.051  61.937  47.489  1.00 42.74 ? 998  TYR A O   1 
ATOM   7834  C  CB  . TYR A 1 998  ? 16.858  60.708  45.223  1.00 45.76 ? 998  TYR A CB  1 
ATOM   7835  C  CG  . TYR A 1 998  ? 17.943  59.757  44.754  1.00 47.96 ? 998  TYR A CG  1 
ATOM   7836  C  CD1 . TYR A 1 998  ? 17.706  58.852  43.718  1.00 48.82 ? 998  TYR A CD1 1 
ATOM   7837  C  CD2 . TYR A 1 998  ? 19.200  59.737  45.366  1.00 49.31 ? 998  TYR A CD2 1 
ATOM   7838  C  CE1 . TYR A 1 998  ? 18.691  57.952  43.302  1.00 50.53 ? 998  TYR A CE1 1 
ATOM   7839  C  CE2 . TYR A 1 998  ? 20.195  58.840  44.958  1.00 50.29 ? 998  TYR A CE2 1 
ATOM   7840  C  CZ  . TYR A 1 998  ? 19.935  57.949  43.930  1.00 50.95 ? 998  TYR A CZ  1 
ATOM   7841  O  OH  . TYR A 1 998  ? 20.918  57.060  43.539  1.00 51.47 ? 998  TYR A OH  1 
ATOM   7842  N  N   . GLY A 1 999  ? 13.616  61.180  45.945  1.00 42.59 ? 999  GLY A N   1 
ATOM   7843  C  CA  . GLY A 1 999  ? 12.645  62.213  46.286  1.00 42.25 ? 999  GLY A CA  1 
ATOM   7844  C  C   . GLY A 1 999  ? 11.367  61.952  47.087  1.00 42.83 ? 999  GLY A C   1 
ATOM   7845  O  O   . GLY A 1 999  ? 10.893  62.843  47.795  1.00 43.47 ? 999  GLY A O   1 
ATOM   7846  N  N   . ALA A 1 1000 ? 10.803  60.753  46.986  1.00 42.42 ? 1000 ALA A N   1 
ATOM   7847  C  CA  . ALA A 1 1000 ? 9.567   60.389  47.697  1.00 43.19 ? 1000 ALA A CA  1 
ATOM   7848  C  C   . ALA A 1 1000 ? 9.601   60.599  49.227  1.00 42.85 ? 1000 ALA A C   1 
ATOM   7849  O  O   . ALA A 1 1000 ? 10.564  60.223  49.886  1.00 42.60 ? 1000 ALA A O   1 
ATOM   7850  C  CB  . ALA A 1 1000 ? 9.230   58.931  47.382  1.00 44.05 ? 1000 ALA A CB  1 
ATOM   7851  N  N   . GLY A 1 1001 ? 8.538   61.168  49.795  1.00 42.20 ? 1001 GLY A N   1 
ATOM   7852  C  CA  . GLY A 1 1001 ? 8.519   61.408  51.233  1.00 41.96 ? 1001 GLY A CA  1 
ATOM   7853  C  C   . GLY A 1 1001 ? 8.972   62.815  51.572  1.00 40.71 ? 1001 GLY A C   1 
ATOM   7854  O  O   . GLY A 1 1001 ? 8.458   63.444  52.501  1.00 42.77 ? 1001 GLY A O   1 
ATOM   7855  N  N   . ILE A 1 1002 ? 9.948   63.312  50.820  1.00 39.54 ? 1002 ILE A N   1 
ATOM   7856  C  CA  . ILE A 1 1002 ? 10.448  64.666  51.032  1.00 38.41 ? 1002 ILE A CA  1 
ATOM   7857  C  C   . ILE A 1 1002 ? 9.318   65.656  50.717  1.00 38.16 ? 1002 ILE A C   1 
ATOM   7858  O  O   . ILE A 1 1002 ? 9.002   66.531  51.524  1.00 38.65 ? 1002 ILE A O   1 
ATOM   7859  C  CB  . ILE A 1 1002 ? 11.669  64.938  50.160  1.00 37.55 ? 1002 ILE A CB  1 
ATOM   7860  C  CG1 . ILE A 1 1002 ? 12.693  63.828  50.383  1.00 37.21 ? 1002 ILE A CG1 1 
ATOM   7861  C  CG2 . ILE A 1 1002 ? 12.276  66.284  50.514  1.00 37.57 ? 1002 ILE A CG2 1 
ATOM   7862  C  CD1 . ILE A 1 1002 ? 13.909  63.913  49.494  1.00 39.34 ? 1002 ILE A CD1 1 
ATOM   7863  N  N   . ILE A 1 1003 ? 8.717   65.536  49.541  1.00 37.49 ? 1003 ILE A N   1 
ATOM   7864  C  CA  . ILE A 1 1003 ? 7.571   66.377  49.214  1.00 37.66 ? 1003 ILE A CA  1 
ATOM   7865  C  C   . ILE A 1 1003 ? 6.533   65.424  48.653  1.00 37.57 ? 1003 ILE A C   1 
ATOM   7866  O  O   . ILE A 1 1003 ? 6.869   64.310  48.257  1.00 36.71 ? 1003 ILE A O   1 
ATOM   7867  C  CB  . ILE A 1 1003 ? 7.876   67.475  48.169  1.00 36.95 ? 1003 ILE A CB  1 
ATOM   7868  C  CG1 . ILE A 1 1003 ? 8.363   66.853  46.857  1.00 37.57 ? 1003 ILE A CG1 1 
ATOM   7869  C  CG2 . ILE A 1 1003 ? 8.850   68.457  48.750  1.00 34.20 ? 1003 ILE A CG2 1 
ATOM   7870  C  CD1 . ILE A 1 1003 ? 8.196   67.771  45.655  1.00 35.22 ? 1003 ILE A CD1 1 
ATOM   7871  N  N   . HIS A 1 1004 ? 5.278   65.848  48.628  1.00 38.96 ? 1004 HIS A N   1 
ATOM   7872  C  CA  . HIS A 1 1004 ? 4.206   65.001  48.126  1.00 40.92 ? 1004 HIS A CA  1 
ATOM   7873  C  C   . HIS A 1 1004 ? 3.503   65.637  46.939  1.00 41.35 ? 1004 HIS A C   1 
ATOM   7874  O  O   . HIS A 1 1004 ? 2.528   65.106  46.434  1.00 43.52 ? 1004 HIS A O   1 
ATOM   7875  C  CB  . HIS A 1 1004 ? 3.215   64.716  49.264  1.00 42.52 ? 1004 HIS A CB  1 
ATOM   7876  C  CG  . HIS A 1 1004 ? 3.792   63.867  50.359  1.00 45.26 ? 1004 HIS A CG  1 
ATOM   7877  N  ND1 . HIS A 1 1004 ? 3.583   62.505  50.435  1.00 46.54 ? 1004 HIS A ND1 1 
ATOM   7878  C  CD2 . HIS A 1 1004 ? 4.636   64.173  51.374  1.00 45.43 ? 1004 HIS A CD2 1 
ATOM   7879  C  CE1 . HIS A 1 1004 ? 4.276   62.011  51.445  1.00 45.94 ? 1004 HIS A CE1 1 
ATOM   7880  N  NE2 . HIS A 1 1004 ? 4.924   63.002  52.032  1.00 45.44 ? 1004 HIS A NE2 1 
ATOM   7881  N  N   . ASN A 1 1005 ? 4.041   66.763  46.485  1.00 42.99 ? 1005 ASN A N   1 
ATOM   7882  C  CA  . ASN A 1 1005 ? 3.528   67.550  45.354  1.00 43.37 ? 1005 ASN A CA  1 
ATOM   7883  C  C   . ASN A 1 1005 ? 4.257   67.340  44.018  1.00 42.59 ? 1005 ASN A C   1 
ATOM   7884  O  O   . ASN A 1 1005 ? 4.154   68.194  43.133  1.00 43.07 ? 1005 ASN A O   1 
ATOM   7885  C  CB  . ASN A 1 1005 ? 3.672   69.035  45.666  1.00 44.25 ? 1005 ASN A CB  1 
ATOM   7886  C  CG  . ASN A 1 1005 ? 2.465   69.617  46.300  1.00 45.03 ? 1005 ASN A CG  1 
ATOM   7887  O  OD1 . ASN A 1 1005 ? 1.341   69.270  45.945  1.00 47.91 ? 1005 ASN A OD1 1 
ATOM   7888  N  ND2 . ASN A 1 1005 ? 2.672   70.538  47.228  1.00 45.90 ? 1005 ASN A ND2 1 
ATOM   7889  N  N   . PRO A 1 1006 ? 4.982   66.218  43.839  1.00 41.53 ? 1006 PRO A N   1 
ATOM   7890  C  CA  . PRO A 1 1006 ? 5.706   66.008  42.578  1.00 39.52 ? 1006 PRO A CA  1 
ATOM   7891  C  C   . PRO A 1 1006 ? 4.921   66.228  41.292  1.00 37.73 ? 1006 PRO A C   1 
ATOM   7892  O  O   . PRO A 1 1006 ? 4.017   65.457  40.972  1.00 37.04 ? 1006 PRO A O   1 
ATOM   7893  C  CB  . PRO A 1 1006 ? 6.186   64.558  42.674  1.00 40.05 ? 1006 PRO A CB  1 
ATOM   7894  C  CG  . PRO A 1 1006 ? 6.071   64.218  44.130  1.00 41.22 ? 1006 PRO A CG  1 
ATOM   7895  C  CD  . PRO A 1 1006 ? 4.844   64.944  44.560  1.00 41.31 ? 1006 PRO A CD  1 
ATOM   7896  N  N   . PRO A 1 1007 ? 5.241   67.304  40.552  1.00 36.68 ? 1007 PRO A N   1 
ATOM   7897  C  CA  . PRO A 1 1007 ? 4.560   67.599  39.285  1.00 35.32 ? 1007 PRO A CA  1 
ATOM   7898  C  C   . PRO A 1 1007 ? 5.049   66.529  38.301  1.00 35.10 ? 1007 PRO A C   1 
ATOM   7899  O  O   . PRO A 1 1007 ? 6.206   66.100  38.363  1.00 34.67 ? 1007 PRO A O   1 
ATOM   7900  C  CB  . PRO A 1 1007 ? 5.078   68.986  38.928  1.00 35.08 ? 1007 PRO A CB  1 
ATOM   7901  C  CG  . PRO A 1 1007 ? 5.369   69.591  40.272  1.00 36.51 ? 1007 PRO A CG  1 
ATOM   7902  C  CD  . PRO A 1 1007 ? 6.048   68.456  40.991  1.00 36.52 ? 1007 PRO A CD  1 
ATOM   7903  N  N   . SER A 1 1008 ? 4.185   66.077  37.405  1.00 35.41 ? 1008 SER A N   1 
ATOM   7904  C  CA  . SER A 1 1008 ? 4.601   65.036  36.464  1.00 35.82 ? 1008 SER A CA  1 
ATOM   7905  C  C   . SER A 1 1008 ? 3.785   65.005  35.175  1.00 35.78 ? 1008 SER A C   1 
ATOM   7906  O  O   . SER A 1 1008 ? 2.588   65.269  35.190  1.00 35.95 ? 1008 SER A O   1 
ATOM   7907  C  CB  . SER A 1 1008 ? 4.517   63.667  37.142  1.00 34.60 ? 1008 SER A CB  1 
ATOM   7908  O  OG  . SER A 1 1008 ? 4.626   62.616  36.197  1.00 36.95 ? 1008 SER A OG  1 
ATOM   7909  N  N   . LEU A 1 1009 ? 4.434   64.681  34.061  1.00 35.42 ? 1009 LEU A N   1 
ATOM   7910  C  CA  . LEU A 1 1009 ? 3.723   64.610  32.797  1.00 35.08 ? 1009 LEU A CA  1 
ATOM   7911  C  C   . LEU A 1 1009 ? 2.603   63.587  32.899  1.00 35.16 ? 1009 LEU A C   1 
ATOM   7912  O  O   . LEU A 1 1009 ? 1.552   63.779  32.291  1.00 36.55 ? 1009 LEU A O   1 
ATOM   7913  C  CB  . LEU A 1 1009 ? 4.659   64.258  31.637  1.00 34.59 ? 1009 LEU A CB  1 
ATOM   7914  C  CG  . LEU A 1 1009 ? 5.731   65.303  31.281  1.00 36.60 ? 1009 LEU A CG  1 
ATOM   7915  C  CD1 . LEU A 1 1009 ? 6.300   64.976  29.912  1.00 35.51 ? 1009 LEU A CD1 1 
ATOM   7916  C  CD2 . LEU A 1 1009 ? 5.152   66.715  31.276  1.00 35.74 ? 1009 LEU A CD2 1 
ATOM   7917  N  N   . PHE A 1 1010 ? 2.803   62.515  33.670  1.00 34.22 ? 1010 PHE A N   1 
ATOM   7918  C  CA  . PHE A 1 1010 ? 1.751   61.502  33.824  1.00 35.04 ? 1010 PHE A CA  1 
ATOM   7919  C  C   . PHE A 1 1010 ? 0.502   62.090  34.479  1.00 35.33 ? 1010 PHE A C   1 
ATOM   7920  O  O   . PHE A 1 1010 ? -0.546  61.442  34.515  1.00 35.34 ? 1010 PHE A O   1 
ATOM   7921  C  CB  . PHE A 1 1010 ? 2.232   60.312  34.663  1.00 35.20 ? 1010 PHE A CB  1 
ATOM   7922  C  CG  . PHE A 1 1010 ? 3.248   59.441  33.977  1.00 35.32 ? 1010 PHE A CG  1 
ATOM   7923  C  CD1 . PHE A 1 1010 ? 3.545   59.605  32.633  1.00 36.83 ? 1010 PHE A CD1 1 
ATOM   7924  C  CD2 . PHE A 1 1010 ? 3.899   58.437  34.683  1.00 37.15 ? 1010 PHE A CD2 1 
ATOM   7925  C  CE1 . PHE A 1 1010 ? 4.485   58.784  31.994  1.00 38.79 ? 1010 PHE A CE1 1 
ATOM   7926  C  CE2 . PHE A 1 1010 ? 4.844   57.607  34.062  1.00 37.84 ? 1010 PHE A CE2 1 
ATOM   7927  C  CZ  . PHE A 1 1010 ? 5.136   57.779  32.712  1.00 38.78 ? 1010 PHE A CZ  1 
ATOM   7928  N  N   . ASP A 1 1011 ? 0.612   63.309  35.002  1.00 36.62 ? 1011 ASP A N   1 
ATOM   7929  C  CA  . ASP A 1 1011 ? -0.525  63.976  35.640  1.00 38.63 ? 1011 ASP A CA  1 
ATOM   7930  C  C   . ASP A 1 1011 ? -1.377  64.703  34.610  1.00 38.60 ? 1011 ASP A C   1 
ATOM   7931  O  O   . ASP A 1 1011 ? -2.595  64.801  34.755  1.00 40.36 ? 1011 ASP A O   1 
ATOM   7932  C  CB  . ASP A 1 1011 ? -0.074  65.019  36.678  1.00 39.21 ? 1011 ASP A CB  1 
ATOM   7933  C  CG  . ASP A 1 1011 ? 0.526   64.402  37.916  1.00 41.17 ? 1011 ASP A CG  1 
ATOM   7934  O  OD1 . ASP A 1 1011 ? 0.245   63.214  38.189  1.00 42.06 ? 1011 ASP A OD1 1 
ATOM   7935  O  OD2 . ASP A 1 1011 ? 1.267   65.119  38.626  1.00 40.81 ? 1011 ASP A OD2 1 
ATOM   7936  N  N   . VAL A 1 1012 ? -0.733  65.208  33.568  1.00 37.89 ? 1012 VAL A N   1 
ATOM   7937  C  CA  . VAL A 1 1012 ? -1.433  65.970  32.544  1.00 37.58 ? 1012 VAL A CA  1 
ATOM   7938  C  C   . VAL A 1 1012 ? -2.738  65.356  32.071  1.00 36.75 ? 1012 VAL A C   1 
ATOM   7939  O  O   . VAL A 1 1012 ? -3.765  66.027  32.021  1.00 37.14 ? 1012 VAL A O   1 
ATOM   7940  C  CB  . VAL A 1 1012 ? -0.500  66.242  31.343  1.00 37.51 ? 1012 VAL A CB  1 
ATOM   7941  C  CG1 . VAL A 1 1012 ? -1.220  67.064  30.280  1.00 37.16 ? 1012 VAL A CG1 1 
ATOM   7942  C  CG2 . VAL A 1 1012 ? 0.743   66.983  31.832  1.00 36.65 ? 1012 VAL A CG2 1 
ATOM   7943  N  N   . PRO A 1 1013 ? -2.725  64.065  31.726  1.00 36.66 ? 1013 PRO A N   1 
ATOM   7944  C  CA  . PRO A 1 1013 ? -3.988  63.478  31.269  1.00 35.99 ? 1013 PRO A CA  1 
ATOM   7945  C  C   . PRO A 1 1013 ? -5.121  63.661  32.292  1.00 36.46 ? 1013 PRO A C   1 
ATOM   7946  O  O   . PRO A 1 1013 ? -6.280  63.895  31.924  1.00 34.58 ? 1013 PRO A O   1 
ATOM   7947  C  CB  . PRO A 1 1013 ? -3.619  62.013  31.041  1.00 35.54 ? 1013 PRO A CB  1 
ATOM   7948  C  CG  . PRO A 1 1013 ? -2.172  62.082  30.653  1.00 34.31 ? 1013 PRO A CG  1 
ATOM   7949  C  CD  . PRO A 1 1013 ? -1.620  63.094  31.636  1.00 35.36 ? 1013 PRO A CD  1 
ATOM   7950  N  N   . HIS A 1 1014 ? -4.785  63.569  33.578  1.00 36.29 ? 1014 HIS A N   1 
ATOM   7951  C  CA  . HIS A 1 1014 ? -5.799  63.736  34.613  1.00 37.06 ? 1014 HIS A CA  1 
ATOM   7952  C  C   . HIS A 1 1014 ? -6.194  65.200  34.745  1.00 35.79 ? 1014 HIS A C   1 
ATOM   7953  O  O   . HIS A 1 1014 ? -7.360  65.523  34.955  1.00 35.40 ? 1014 HIS A O   1 
ATOM   7954  C  CB  . HIS A 1 1014 ? -5.295  63.188  35.952  1.00 37.69 ? 1014 HIS A CB  1 
ATOM   7955  C  CG  . HIS A 1 1014 ? -4.864  61.757  35.885  1.00 39.42 ? 1014 HIS A CG  1 
ATOM   7956  N  ND1 . HIS A 1 1014 ? -3.603  61.376  35.467  1.00 40.46 ? 1014 HIS A ND1 1 
ATOM   7957  C  CD2 . HIS A 1 1014 ? -5.539  60.609  36.127  1.00 39.48 ? 1014 HIS A CD2 1 
ATOM   7958  C  CE1 . HIS A 1 1014 ? -3.525  60.057  35.453  1.00 40.85 ? 1014 HIS A CE1 1 
ATOM   7959  N  NE2 . HIS A 1 1014 ? -4.688  59.568  35.850  1.00 40.81 ? 1014 HIS A NE2 1 
ATOM   7960  N  N   . LYS A 1 1015 ? -5.219  66.085  34.616  1.00 35.81 ? 1015 LYS A N   1 
ATOM   7961  C  CA  . LYS A 1 1015 ? -5.491  67.509  34.697  1.00 38.28 ? 1015 LYS A CA  1 
ATOM   7962  C  C   . LYS A 1 1015 ? -6.406  67.895  33.534  1.00 37.90 ? 1015 LYS A C   1 
ATOM   7963  O  O   . LYS A 1 1015 ? -7.332  68.691  33.705  1.00 38.14 ? 1015 LYS A O   1 
ATOM   7964  C  CB  . LYS A 1 1015 ? -4.183  68.310  34.627  1.00 40.98 ? 1015 LYS A CB  1 
ATOM   7965  C  CG  . LYS A 1 1015 ? -3.301  68.226  35.883  1.00 44.58 ? 1015 LYS A CG  1 
ATOM   7966  C  CD  . LYS A 1 1015 ? -3.966  68.891  37.091  1.00 47.56 ? 1015 LYS A CD  1 
ATOM   7967  C  CE  . LYS A 1 1015 ? -3.029  68.974  38.300  1.00 49.15 ? 1015 LYS A CE  1 
ATOM   7968  N  NZ  . LYS A 1 1015 ? -2.628  67.629  38.815  1.00 48.85 ? 1015 LYS A NZ  1 
ATOM   7969  N  N   . TRP A 1 1016 ? -6.147  67.322  32.358  1.00 36.73 ? 1016 TRP A N   1 
ATOM   7970  C  CA  . TRP A 1 1016 ? -6.949  67.612  31.175  1.00 37.38 ? 1016 TRP A CA  1 
ATOM   7971  C  C   . TRP A 1 1016 ? -8.377  67.085  31.325  1.00 39.49 ? 1016 TRP A C   1 
ATOM   7972  O  O   . TRP A 1 1016 ? -9.341  67.791  31.014  1.00 40.18 ? 1016 TRP A O   1 
ATOM   7973  C  CB  . TRP A 1 1016 ? -6.303  67.012  29.915  1.00 35.95 ? 1016 TRP A CB  1 
ATOM   7974  C  CG  . TRP A 1 1016 ? -5.145  67.807  29.364  1.00 33.29 ? 1016 TRP A CG  1 
ATOM   7975  C  CD1 . TRP A 1 1016 ? -4.789  69.085  29.703  1.00 34.02 ? 1016 TRP A CD1 1 
ATOM   7976  C  CD2 . TRP A 1 1016 ? -4.234  67.401  28.334  1.00 31.73 ? 1016 TRP A CD2 1 
ATOM   7977  N  NE1 . TRP A 1 1016 ? -3.718  69.498  28.944  1.00 33.09 ? 1016 TRP A NE1 1 
ATOM   7978  C  CE2 . TRP A 1 1016 ? -3.361  68.487  28.093  1.00 31.32 ? 1016 TRP A CE2 1 
ATOM   7979  C  CE3 . TRP A 1 1016 ? -4.080  66.228  27.581  1.00 31.24 ? 1016 TRP A CE3 1 
ATOM   7980  C  CZ2 . TRP A 1 1016 ? -2.339  68.432  27.135  1.00 31.42 ? 1016 TRP A CZ2 1 
ATOM   7981  C  CZ3 . TRP A 1 1016 ? -3.063  66.174  26.626  1.00 30.88 ? 1016 TRP A CZ3 1 
ATOM   7982  C  CH2 . TRP A 1 1016 ? -2.207  67.272  26.411  1.00 30.31 ? 1016 TRP A CH2 1 
ATOM   7983  N  N   . TYR A 1 1017 ? -8.510  65.848  31.798  1.00 40.84 ? 1017 TYR A N   1 
ATOM   7984  C  CA  . TYR A 1 1017 ? -9.819  65.244  31.999  1.00 42.65 ? 1017 TYR A CA  1 
ATOM   7985  C  C   . TYR A 1 1017 ? -10.655 66.106  32.932  1.00 43.62 ? 1017 TYR A C   1 
ATOM   7986  O  O   . TYR A 1 1017 ? -11.835 66.358  32.685  1.00 43.47 ? 1017 TYR A O   1 
ATOM   7987  C  CB  . TYR A 1 1017 ? -9.661  63.847  32.591  1.00 44.22 ? 1017 TYR A CB  1 
ATOM   7988  C  CG  . TYR A 1 1017 ? -10.964 63.197  32.976  1.00 45.77 ? 1017 TYR A CG  1 
ATOM   7989  C  CD1 . TYR A 1 1017 ? -11.165 62.696  34.259  1.00 47.99 ? 1017 TYR A CD1 1 
ATOM   7990  C  CD2 . TYR A 1 1017 ? -12.005 63.091  32.061  1.00 47.64 ? 1017 TYR A CD2 1 
ATOM   7991  C  CE1 . TYR A 1 1017 ? -12.376 62.103  34.619  1.00 48.85 ? 1017 TYR A CE1 1 
ATOM   7992  C  CE2 . TYR A 1 1017 ? -13.219 62.501  32.411  1.00 48.20 ? 1017 TYR A CE2 1 
ATOM   7993  C  CZ  . TYR A 1 1017 ? -13.396 62.012  33.686  1.00 48.67 ? 1017 TYR A CZ  1 
ATOM   7994  O  OH  . TYR A 1 1017 ? -14.592 61.432  34.025  1.00 49.27 ? 1017 TYR A OH  1 
ATOM   7995  N  N   . GLN A 1 1018 ? -10.018 66.512  34.022  1.00 44.79 ? 1018 GLN A N   1 
ATOM   7996  C  CA  . GLN A 1 1018 ? -10.660 67.379  35.001  1.00 45.53 ? 1018 GLN A CA  1 
ATOM   7997  C  C   . GLN A 1 1018 ? -11.121 68.685  34.364  1.00 44.10 ? 1018 GLN A C   1 
ATOM   7998  O  O   . GLN A 1 1018 ? -12.199 69.178  34.630  1.00 43.61 ? 1018 GLN A O   1 
ATOM   7999  C  CB  . GLN A 1 1018 ? -9.714  67.657  36.171  1.00 48.61 ? 1018 GLN A CB  1 
ATOM   8000  C  CG  . GLN A 1 1018 ? -9.285  66.412  36.928  1.00 54.37 ? 1018 GLN A CG  1 
ATOM   8001  C  CD  . GLN A 1 1018 ? -8.350  66.724  38.079  1.00 56.56 ? 1018 GLN A CD  1 
ATOM   8002  O  OE1 . GLN A 1 1018 ? -8.007  67.882  38.318  1.00 59.61 ? 1018 GLN A OE1 1 
ATOM   8003  N  NE2 . GLN A 1 1018 ? -7.816  65.845  38.922  1.00 56.66 ? 1018 GLN A NE2 1 
ATOM   8004  N  N   . GLY A 1 1019 ? -10.272 69.197  33.470  1.00 43.83 ? 1019 GLY A N   1 
ATOM   8005  C  CA  . GLY A 1 1019 ? -10.594 70.433  32.781  1.00 43.78 ? 1019 GLY A CA  1 
ATOM   8006  C  C   . GLY A 1 1019 ? -11.780 70.299  31.847  1.00 44.21 ? 1019 GLY A C   1 
ATOM   8007  O  O   . GLY A 1 1019 ? -12.593 71.211  31.740  1.00 45.09 ? 1019 GLY A O   1 
ATOM   8008  N  N   . ALA A 1 1020 ? -11.882 69.168  31.157  1.00 43.94 ? 1020 ALA A N   1 
ATOM   8009  C  CA  . ALA A 1 1020 ? -12.987 68.946  30.240  1.00 43.60 ? 1020 ALA A CA  1 
ATOM   8010  C  C   . ALA A 1 1020 ? -14.261 68.769  31.048  1.00 45.17 ? 1020 ALA A C   1 
ATOM   8011  O  O   . ALA A 1 1020 ? -15.362 69.042  30.565  1.00 45.66 ? 1020 ALA A O   1 
ATOM   8012  C  CB  . ALA A 1 1020 ? -12.729 67.719  29.395  1.00 43.53 ? 1020 ALA A CB  1 
ATOM   8013  N  N   . GLN A 1 1021 ? -14.113 68.298  32.280  1.00 46.07 ? 1021 GLN A N   1 
ATOM   8014  C  CA  . GLN A 1 1021 ? -15.266 68.111  33.149  1.00 47.67 ? 1021 GLN A CA  1 
ATOM   8015  C  C   . GLN A 1 1021 ? -15.769 69.443  33.671  1.00 47.69 ? 1021 GLN A C   1 
ATOM   8016  O  O   . GLN A 1 1021 ? -16.937 69.779  33.491  1.00 48.58 ? 1021 GLN A O   1 
ATOM   8017  C  CB  . GLN A 1 1021 ? -14.925 67.214  34.338  1.00 48.66 ? 1021 GLN A CB  1 
ATOM   8018  C  CG  . GLN A 1 1021 ? -15.099 65.733  34.077  1.00 51.73 ? 1021 GLN A CG  1 
ATOM   8019  C  CD  . GLN A 1 1021 ? -15.281 64.941  35.360  1.00 54.07 ? 1021 GLN A CD  1 
ATOM   8020  O  OE1 . GLN A 1 1021 ? -14.368 64.853  36.183  1.00 54.92 ? 1021 GLN A OE1 1 
ATOM   8021  N  NE2 . GLN A 1 1021 ? -16.472 64.366  35.542  1.00 54.87 ? 1021 GLN A NE2 1 
ATOM   8022  N  N   . GLU A 1 1022 ? -14.880 70.200  34.312  1.00 47.44 ? 1022 GLU A N   1 
ATOM   8023  C  CA  . GLU A 1 1022 ? -15.242 71.490  34.881  1.00 47.39 ? 1022 GLU A CA  1 
ATOM   8024  C  C   . GLU A 1 1022 ? -15.723 72.463  33.814  1.00 46.84 ? 1022 GLU A C   1 
ATOM   8025  O  O   . GLU A 1 1022 ? -16.158 73.572  34.121  1.00 47.57 ? 1022 GLU A O   1 
ATOM   8026  C  CB  . GLU A 1 1022 ? -14.052 72.087  35.643  1.00 48.21 ? 1022 GLU A CB  1 
ATOM   8027  C  CG  . GLU A 1 1022 ? -13.831 71.476  37.017  1.00 50.71 ? 1022 GLU A CG  1 
ATOM   8028  C  CD  . GLU A 1 1022 ? -12.480 71.838  37.605  1.00 52.15 ? 1022 GLU A CD  1 
ATOM   8029  O  OE1 . GLU A 1 1022 ? -12.051 73.002  37.442  1.00 53.43 ? 1022 GLU A OE1 1 
ATOM   8030  O  OE2 . GLU A 1 1022 ? -11.847 70.958  38.229  1.00 51.00 ? 1022 GLU A OE2 1 
ATOM   8031  N  N   . ALA A 1 1023 ? -15.666 72.034  32.553  1.00 46.34 ? 1023 ALA A N   1 
ATOM   8032  C  CA  . ALA A 1 1023 ? -16.085 72.882  31.444  1.00 44.72 ? 1023 ALA A CA  1 
ATOM   8033  C  C   . ALA A 1 1023 ? -17.549 72.659  31.095  1.00 43.82 ? 1023 ALA A C   1 
ATOM   8034  O  O   . ALA A 1 1023 ? -18.190 73.512  30.481  1.00 42.37 ? 1023 ALA A O   1 
ATOM   8035  C  CB  . ALA A 1 1023 ? -15.200 72.614  30.225  1.00 43.31 ? 1023 ALA A CB  1 
ATOM   8036  N  N   . ALA A 1 1024 ? -18.067 71.501  31.489  1.00 43.20 ? 1024 ALA A N   1 
ATOM   8037  C  CA  . ALA A 1 1024 ? -19.454 71.162  31.226  1.00 43.34 ? 1024 ALA A CA  1 
ATOM   8038  C  C   . ALA A 1 1024 ? -20.349 72.058  32.082  1.00 43.51 ? 1024 ALA A C   1 
ATOM   8039  O  O   . ALA A 1 1024 ? -19.870 72.709  33.015  1.00 42.98 ? 1024 ALA A O   1 
ATOM   8040  C  CB  . ALA A 1 1024 ? -19.700 69.699  31.557  1.00 42.97 ? 1024 ALA A CB  1 
ATOM   8041  N  N   . ILE A 1 1025 ? -21.641 72.108  31.756  1.00 43.50 ? 1025 ILE A N   1 
ATOM   8042  C  CA  . ILE A 1 1025 ? -22.571 72.926  32.521  1.00 44.07 ? 1025 ILE A CA  1 
ATOM   8043  C  C   . ILE A 1 1025 ? -22.997 72.185  33.797  1.00 43.06 ? 1025 ILE A C   1 
ATOM   8044  O  O   . ILE A 1 1025 ? -23.248 70.981  33.769  1.00 41.95 ? 1025 ILE A O   1 
ATOM   8045  C  CB  . ILE A 1 1025 ? -23.800 73.329  31.700  1.00 46.03 ? 1025 ILE A CB  1 
ATOM   8046  C  CG1 . ILE A 1 1025 ? -23.377 74.152  30.482  1.00 47.94 ? 1025 ILE A CG1 1 
ATOM   8047  C  CG2 . ILE A 1 1025 ? -24.779 74.109  32.565  1.00 46.22 ? 1025 ILE A CG2 1 
ATOM   8048  C  CD1 . ILE A 1 1025 ? -24.495 74.406  29.496  1.00 49.75 ? 1025 ILE A CD1 1 
ATOM   8049  N  N   . ALA A 1 1026 ? -23.046 72.926  34.895  1.00 41.72 ? 1026 ALA A N   1 
ATOM   8050  C  CA  . ALA A 1 1026 ? -23.406 72.377  36.191  1.00 40.78 ? 1026 ALA A CA  1 
ATOM   8051  C  C   . ALA A 1 1026 ? -24.858 71.939  36.263  1.00 40.44 ? 1026 ALA A C   1 
ATOM   8052  O  O   . ALA A 1 1026 ? -25.736 72.525  35.634  1.00 38.87 ? 1026 ALA A O   1 
ATOM   8053  C  CB  . ALA A 1 1026 ? -23.123 73.406  37.288  1.00 40.63 ? 1026 ALA A CB  1 
ATOM   8054  N  N   . THR A 1 1027 ? -25.097 70.895  37.043  1.00 41.06 ? 1027 THR A N   1 
ATOM   8055  C  CA  . THR A 1 1027 ? -26.436 70.375  37.236  1.00 41.97 ? 1027 THR A CA  1 
ATOM   8056  C  C   . THR A 1 1027 ? -27.018 71.009  38.501  1.00 42.50 ? 1027 THR A C   1 
ATOM   8057  O  O   . THR A 1 1027 ? -26.284 71.356  39.422  1.00 42.77 ? 1027 THR A O   1 
ATOM   8058  C  CB  . THR A 1 1027 ? -26.406 68.848  37.386  1.00 41.62 ? 1027 THR A CB  1 
ATOM   8059  O  OG1 . THR A 1 1027 ? -27.695 68.316  37.064  1.00 44.79 ? 1027 THR A OG1 1 
ATOM   8060  C  CG2 . THR A 1 1027 ? -26.043 68.454  38.810  1.00 40.23 ? 1027 THR A CG2 1 
ATOM   8061  N  N   . ARG A 1 1028 ? -28.336 71.161  38.530  1.00 43.44 ? 1028 ARG A N   1 
ATOM   8062  C  CA  . ARG A 1 1028 ? -29.037 71.759  39.665  1.00 44.27 ? 1028 ARG A CA  1 
ATOM   8063  C  C   . ARG A 1 1028 ? -28.546 71.210  41.000  1.00 42.43 ? 1028 ARG A C   1 
ATOM   8064  O  O   . ARG A 1 1028 ? -28.326 71.963  41.946  1.00 41.26 ? 1028 ARG A O   1 
ATOM   8065  C  CB  . ARG A 1 1028 ? -30.543 71.513  39.520  1.00 48.18 ? 1028 ARG A CB  1 
ATOM   8066  C  CG  . ARG A 1 1028 ? -31.420 72.202  40.563  1.00 54.59 ? 1028 ARG A CG  1 
ATOM   8067  C  CD  . ARG A 1 1028 ? -32.906 71.907  40.308  1.00 61.00 ? 1028 ARG A CD  1 
ATOM   8068  N  NE  . ARG A 1 1028 ? -33.794 72.621  41.232  1.00 65.58 ? 1028 ARG A NE  1 
ATOM   8069  C  CZ  . ARG A 1 1028 ? -35.122 72.511  41.231  1.00 67.89 ? 1028 ARG A CZ  1 
ATOM   8070  N  NH1 . ARG A 1 1028 ? -35.725 71.717  40.351  1.00 68.93 ? 1028 ARG A NH1 1 
ATOM   8071  N  NH2 . ARG A 1 1028 ? -35.850 73.189  42.115  1.00 68.48 ? 1028 ARG A NH2 1 
ATOM   8072  N  N   . GLU A 1 1029 ? -28.377 69.893  41.066  1.00 41.65 ? 1029 GLU A N   1 
ATOM   8073  C  CA  . GLU A 1 1029 ? -27.904 69.229  42.275  1.00 41.15 ? 1029 GLU A CA  1 
ATOM   8074  C  C   . GLU A 1 1029 ? -26.504 69.712  42.612  1.00 40.11 ? 1029 GLU A C   1 
ATOM   8075  O  O   . GLU A 1 1029 ? -26.207 70.015  43.758  1.00 40.32 ? 1029 GLU A O   1 
ATOM   8076  C  CB  . GLU A 1 1029 ? -27.858 67.708  42.087  1.00 43.69 ? 1029 GLU A CB  1 
ATOM   8077  C  CG  . GLU A 1 1029 ? -29.159 67.088  41.603  1.00 47.88 ? 1029 GLU A CG  1 
ATOM   8078  C  CD  . GLU A 1 1029 ? -29.572 67.595  40.227  1.00 49.85 ? 1029 GLU A CD  1 
ATOM   8079  O  OE1 . GLU A 1 1029 ? -28.728 67.528  39.298  1.00 52.84 ? 1029 GLU A OE1 1 
ATOM   8080  O  OE2 . GLU A 1 1029 ? -30.729 68.060  40.082  1.00 51.11 ? 1029 GLU A OE2 1 
ATOM   8081  N  N   . GLU A 1 1030 ? -25.642 69.775  41.606  1.00 39.60 ? 1030 GLU A N   1 
ATOM   8082  C  CA  . GLU A 1 1030 ? -24.274 70.208  41.808  1.00 37.80 ? 1030 GLU A CA  1 
ATOM   8083  C  C   . GLU A 1 1030 ? -24.205 71.574  42.449  1.00 36.76 ? 1030 GLU A C   1 
ATOM   8084  O  O   . GLU A 1 1030 ? -23.354 71.823  43.302  1.00 36.11 ? 1030 GLU A O   1 
ATOM   8085  C  CB  . GLU A 1 1030 ? -23.524 70.191  40.481  1.00 38.10 ? 1030 GLU A CB  1 
ATOM   8086  C  CG  . GLU A 1 1030 ? -23.062 68.795  40.096  1.00 40.07 ? 1030 GLU A CG  1 
ATOM   8087  C  CD  . GLU A 1 1030 ? -22.500 68.711  38.691  1.00 42.67 ? 1030 GLU A CD  1 
ATOM   8088  O  OE1 . GLU A 1 1030 ? -21.482 68.010  38.514  1.00 44.16 ? 1030 GLU A OE1 1 
ATOM   8089  O  OE2 . GLU A 1 1030 ? -23.077 69.329  37.765  1.00 41.95 ? 1030 GLU A OE2 1 
ATOM   8090  N  N   . LEU A 1 1031 ? -25.097 72.466  42.037  1.00 36.32 ? 1031 LEU A N   1 
ATOM   8091  C  CA  . LEU A 1 1031 ? -25.133 73.807  42.602  1.00 36.44 ? 1031 LEU A CA  1 
ATOM   8092  C  C   . LEU A 1 1031 ? -25.438 73.736  44.092  1.00 36.44 ? 1031 LEU A C   1 
ATOM   8093  O  O   . LEU A 1 1031 ? -24.895 74.500  44.891  1.00 35.57 ? 1031 LEU A O   1 
ATOM   8094  C  CB  . LEU A 1 1031 ? -26.184 74.655  41.885  1.00 36.12 ? 1031 LEU A CB  1 
ATOM   8095  C  CG  . LEU A 1 1031 ? -26.363 76.093  42.401  1.00 36.52 ? 1031 LEU A CG  1 
ATOM   8096  C  CD1 . LEU A 1 1031 ? -25.073 76.876  42.242  1.00 33.87 ? 1031 LEU A CD1 1 
ATOM   8097  C  CD2 . LEU A 1 1031 ? -27.495 76.783  41.654  1.00 35.16 ? 1031 LEU A CD2 1 
ATOM   8098  N  N   . ALA A 1 1032 ? -26.292 72.792  44.459  1.00 37.05 ? 1032 ALA A N   1 
ATOM   8099  C  CA  . ALA A 1 1032 ? -26.675 72.586  45.846  1.00 37.33 ? 1032 ALA A CA  1 
ATOM   8100  C  C   . ALA A 1 1032 ? -25.477 72.145  46.676  1.00 37.61 ? 1032 ALA A C   1 
ATOM   8101  O  O   . ALA A 1 1032 ? -25.284 72.620  47.793  1.00 38.06 ? 1032 ALA A O   1 
ATOM   8102  C  CB  . ALA A 1 1032 ? -27.778 71.547  45.941  1.00 38.08 ? 1032 ALA A CB  1 
ATOM   8103  N  N   . GLU A 1 1033 ? -24.671 71.239  46.134  1.00 37.67 ? 1033 GLU A N   1 
ATOM   8104  C  CA  . GLU A 1 1033 ? -23.504 70.756  46.859  1.00 38.61 ? 1033 GLU A CA  1 
ATOM   8105  C  C   . GLU A 1 1033 ? -22.553 71.892  47.176  1.00 37.40 ? 1033 GLU A C   1 
ATOM   8106  O  O   . GLU A 1 1033 ? -21.949 71.931  48.247  1.00 37.26 ? 1033 GLU A O   1 
ATOM   8107  C  CB  . GLU A 1 1033 ? -22.784 69.672  46.054  1.00 42.25 ? 1033 GLU A CB  1 
ATOM   8108  C  CG  . GLU A 1 1033 ? -23.435 68.296  46.158  1.00 47.96 ? 1033 GLU A CG  1 
ATOM   8109  C  CD  . GLU A 1 1033 ? -23.033 67.376  45.020  1.00 50.48 ? 1033 GLU A CD  1 
ATOM   8110  O  OE1 . GLU A 1 1033 ? -21.836 67.375  44.650  1.00 51.66 ? 1033 GLU A OE1 1 
ATOM   8111  O  OE2 . GLU A 1 1033 ? -23.913 66.656  44.499  1.00 52.17 ? 1033 GLU A OE2 1 
ATOM   8112  N  N   . MET A 1 1034 ? -22.427 72.827  46.241  1.00 36.67 ? 1034 MET A N   1 
ATOM   8113  C  CA  . MET A 1 1034 ? -21.561 73.984  46.431  1.00 35.00 ? 1034 MET A CA  1 
ATOM   8114  C  C   . MET A 1 1034 ? -22.102 74.828  47.594  1.00 33.93 ? 1034 MET A C   1 
ATOM   8115  O  O   . MET A 1 1034 ? -21.342 75.284  48.448  1.00 35.17 ? 1034 MET A O   1 
ATOM   8116  C  CB  . MET A 1 1034 ? -21.509 74.825  45.153  1.00 33.07 ? 1034 MET A CB  1 
ATOM   8117  C  CG  . MET A 1 1034 ? -20.636 76.053  45.282  1.00 31.74 ? 1034 MET A CG  1 
ATOM   8118  S  SD  . MET A 1 1034 ? -20.981 77.328  44.077  1.00 31.75 ? 1034 MET A SD  1 
ATOM   8119  C  CE  . MET A 1 1034 ? -22.495 78.047  44.736  1.00 32.41 ? 1034 MET A CE  1 
ATOM   8120  N  N   . ASP A 1 1035 ? -23.417 75.024  47.621  1.00 32.36 ? 1035 ASP A N   1 
ATOM   8121  C  CA  . ASP A 1 1035 ? -24.049 75.800  48.676  1.00 32.56 ? 1035 ASP A CA  1 
ATOM   8122  C  C   . ASP A 1 1035 ? -23.894 75.082  50.009  1.00 32.77 ? 1035 ASP A C   1 
ATOM   8123  O  O   . ASP A 1 1035 ? -23.531 75.700  51.007  1.00 30.49 ? 1035 ASP A O   1 
ATOM   8124  C  CB  . ASP A 1 1035 ? -25.535 76.025  48.385  1.00 30.09 ? 1035 ASP A CB  1 
ATOM   8125  C  CG  . ASP A 1 1035 ? -25.766 76.974  47.238  1.00 30.13 ? 1035 ASP A CG  1 
ATOM   8126  O  OD1 . ASP A 1 1035 ? -24.801 77.592  46.766  1.00 30.83 ? 1035 ASP A OD1 1 
ATOM   8127  O  OD2 . ASP A 1 1035 ? -26.924 77.101  46.815  1.00 30.47 ? 1035 ASP A OD2 1 
ATOM   8128  N  N   . GLU A 1 1036 ? -24.162 73.780  50.024  1.00 34.67 ? 1036 GLU A N   1 
ATOM   8129  C  CA  . GLU A 1 1036 ? -24.034 73.006  51.255  1.00 36.33 ? 1036 GLU A CA  1 
ATOM   8130  C  C   . GLU A 1 1036 ? -22.595 73.088  51.776  1.00 34.91 ? 1036 GLU A C   1 
ATOM   8131  O  O   . GLU A 1 1036 ? -22.376 73.152  52.977  1.00 35.07 ? 1036 GLU A O   1 
ATOM   8132  C  CB  . GLU A 1 1036 ? -24.433 71.548  51.012  1.00 38.82 ? 1036 GLU A CB  1 
ATOM   8133  C  CG  . GLU A 1 1036 ? -24.637 70.742  52.286  1.00 45.69 ? 1036 GLU A CG  1 
ATOM   8134  C  CD  . GLU A 1 1036 ? -25.613 71.409  53.263  1.00 49.86 ? 1036 GLU A CD  1 
ATOM   8135  O  OE1 . GLU A 1 1036 ? -26.679 71.887  52.805  1.00 50.45 ? 1036 GLU A OE1 1 
ATOM   8136  O  OE2 . GLU A 1 1036 ? -25.311 71.445  54.486  1.00 51.07 ? 1036 GLU A OE2 1 
ATOM   8137  N  N   . THR A 1 1037 ? -21.623 73.100  50.868  1.00 33.79 ? 1037 THR A N   1 
ATOM   8138  C  CA  . THR A 1 1037 ? -20.221 73.193  51.256  1.00 34.27 ? 1037 THR A CA  1 
ATOM   8139  C  C   . THR A 1 1037 ? -19.989 74.537  51.936  1.00 35.27 ? 1037 THR A C   1 
ATOM   8140  O  O   . THR A 1 1037 ? -19.245 74.630  52.909  1.00 34.69 ? 1037 THR A O   1 
ATOM   8141  C  CB  . THR A 1 1037 ? -19.277 73.085  50.033  1.00 34.16 ? 1037 THR A CB  1 
ATOM   8142  O  OG1 . THR A 1 1037 ? -19.419 71.796  49.419  1.00 32.73 ? 1037 THR A OG1 1 
ATOM   8143  C  CG2 . THR A 1 1037 ? -17.819 73.272  50.463  1.00 32.15 ? 1037 THR A CG2 1 
ATOM   8144  N  N   . LEU A 1 1038 ? -20.633 75.576  51.411  1.00 37.17 ? 1038 LEU A N   1 
ATOM   8145  C  CA  . LEU A 1 1038 ? -20.530 76.922  51.971  1.00 37.76 ? 1038 LEU A CA  1 
ATOM   8146  C  C   . LEU A 1 1038 ? -21.197 76.996  53.344  1.00 38.20 ? 1038 LEU A C   1 
ATOM   8147  O  O   . LEU A 1 1038 ? -20.642 77.594  54.270  1.00 38.38 ? 1038 LEU A O   1 
ATOM   8148  C  CB  . LEU A 1 1038 ? -21.194 77.946  51.046  1.00 39.08 ? 1038 LEU A CB  1 
ATOM   8149  C  CG  . LEU A 1 1038 ? -20.345 78.626  49.969  1.00 41.50 ? 1038 LEU A CG  1 
ATOM   8150  C  CD1 . LEU A 1 1038 ? -21.215 79.640  49.242  1.00 41.34 ? 1038 LEU A CD1 1 
ATOM   8151  C  CD2 . LEU A 1 1038 ? -19.137 79.338  50.588  1.00 40.97 ? 1038 LEU A CD2 1 
ATOM   8152  N  N   . MET A 1 1039 ? -22.386 76.402  53.472  1.00 38.45 ? 1039 MET A N   1 
ATOM   8153  C  CA  . MET A 1 1039 ? -23.110 76.403  54.744  1.00 39.32 ? 1039 MET A CA  1 
ATOM   8154  C  C   . MET A 1 1039 ? -22.378 75.589  55.810  1.00 39.30 ? 1039 MET A C   1 
ATOM   8155  O  O   . MET A 1 1039 ? -22.401 75.924  56.989  1.00 38.88 ? 1039 MET A O   1 
ATOM   8156  C  CB  . MET A 1 1039 ? -24.527 75.847  54.565  1.00 40.21 ? 1039 MET A CB  1 
ATOM   8157  C  CG  . MET A 1 1039 ? -25.457 76.762  53.790  1.00 43.07 ? 1039 MET A CG  1 
ATOM   8158  S  SD  . MET A 1 1039 ? -25.323 78.492  54.307  1.00 49.21 ? 1039 MET A SD  1 
ATOM   8159  C  CE  . MET A 1 1039 ? -26.453 78.523  55.775  1.00 49.52 ? 1039 MET A CE  1 
ATOM   8160  N  N   . ARG A 1 1040 ? -21.720 74.518  55.395  1.00 39.26 ? 1040 ARG A N   1 
ATOM   8161  C  CA  . ARG A 1 1040 ? -21.011 73.697  56.342  1.00 39.49 ? 1040 ARG A CA  1 
ATOM   8162  C  C   . ARG A 1 1040 ? -19.870 74.497  56.935  1.00 38.62 ? 1040 ARG A C   1 
ATOM   8163  O  O   . ARG A 1 1040 ? -19.658 74.488  58.152  1.00 38.87 ? 1040 ARG A O   1 
ATOM   8164  C  CB  . ARG A 1 1040 ? -20.476 72.445  55.659  1.00 41.83 ? 1040 ARG A CB  1 
ATOM   8165  C  CG  . ARG A 1 1040 ? -20.032 71.339  56.617  1.00 46.77 ? 1040 ARG A CG  1 
ATOM   8166  C  CD  . ARG A 1 1040 ? -19.676 70.097  55.838  1.00 51.81 ? 1040 ARG A CD  1 
ATOM   8167  N  NE  . ARG A 1 1040 ? -20.556 69.965  54.677  1.00 54.65 ? 1040 ARG A NE  1 
ATOM   8168  C  CZ  . ARG A 1 1040 ? -20.314 69.173  53.637  1.00 55.92 ? 1040 ARG A CZ  1 
ATOM   8169  N  NH1 . ARG A 1 1040 ? -19.215 68.427  53.610  1.00 55.51 ? 1040 ARG A NH1 1 
ATOM   8170  N  NH2 . ARG A 1 1040 ? -21.162 69.145  52.616  1.00 56.40 ? 1040 ARG A NH2 1 
ATOM   8171  N  N   . ALA A 1 1041 ? -19.137 75.201  56.077  1.00 37.27 ? 1041 ALA A N   1 
ATOM   8172  C  CA  . ALA A 1 1041 ? -18.011 75.998  56.535  1.00 35.74 ? 1041 ALA A CA  1 
ATOM   8173  C  C   . ALA A 1 1041 ? -18.449 77.130  57.459  1.00 34.94 ? 1041 ALA A C   1 
ATOM   8174  O  O   . ALA A 1 1041 ? -17.709 77.511  58.359  1.00 33.70 ? 1041 ALA A O   1 
ATOM   8175  C  CB  . ALA A 1 1041 ? -17.243 76.561  55.341  1.00 37.17 ? 1041 ALA A CB  1 
ATOM   8176  N  N   . ARG A 1 1042 ? -19.647 77.664  57.236  1.00 34.29 ? 1042 ARG A N   1 
ATOM   8177  C  CA  . ARG A 1 1042 ? -20.158 78.752  58.070  1.00 34.91 ? 1042 ARG A CA  1 
ATOM   8178  C  C   . ARG A 1 1042 ? -20.645 78.229  59.422  1.00 36.02 ? 1042 ARG A C   1 
ATOM   8179  O  O   . ARG A 1 1042 ? -20.565 78.936  60.432  1.00 37.34 ? 1042 ARG A O   1 
ATOM   8180  C  CB  . ARG A 1 1042 ? -21.312 79.484  57.365  1.00 33.59 ? 1042 ARG A CB  1 
ATOM   8181  C  CG  . ARG A 1 1042 ? -21.765 80.748  58.064  1.00 31.07 ? 1042 ARG A CG  1 
ATOM   8182  C  CD  . ARG A 1 1042 ? -23.092 81.244  57.514  1.00 31.25 ? 1042 ARG A CD  1 
ATOM   8183  N  NE  . ARG A 1 1042 ? -23.736 82.210  58.411  1.00 30.63 ? 1042 ARG A NE  1 
ATOM   8184  C  CZ  . ARG A 1 1042 ? -23.430 83.504  58.479  1.00 31.30 ? 1042 ARG A CZ  1 
ATOM   8185  N  NH1 . ARG A 1 1042 ? -22.485 84.019  57.697  1.00 28.09 ? 1042 ARG A NH1 1 
ATOM   8186  N  NH2 . ARG A 1 1042 ? -24.062 84.285  59.346  1.00 32.23 ? 1042 ARG A NH2 1 
ATOM   8187  N  N   . ARG A 1 1043 ? -21.146 76.991  59.440  1.00 36.57 ? 1043 ARG A N   1 
ATOM   8188  C  CA  . ARG A 1 1043 ? -21.642 76.394  60.677  1.00 36.78 ? 1043 ARG A CA  1 
ATOM   8189  C  C   . ARG A 1 1043 ? -20.546 75.802  61.554  1.00 35.10 ? 1043 ARG A C   1 
ATOM   8190  O  O   . ARG A 1 1043 ? -20.681 75.784  62.769  1.00 33.99 ? 1043 ARG A O   1 
ATOM   8191  C  CB  . ARG A 1 1043 ? -22.691 75.320  60.371  1.00 39.64 ? 1043 ARG A CB  1 
ATOM   8192  C  CG  . ARG A 1 1043 ? -23.960 75.867  59.732  1.00 45.77 ? 1043 ARG A CG  1 
ATOM   8193  C  CD  . ARG A 1 1043 ? -25.076 74.835  59.746  1.00 49.15 ? 1043 ARG A CD  1 
ATOM   8194  N  NE  . ARG A 1 1043 ? -24.666 73.594  59.092  1.00 52.65 ? 1043 ARG A NE  1 
ATOM   8195  C  CZ  . ARG A 1 1043 ? -25.073 73.207  57.886  1.00 53.43 ? 1043 ARG A CZ  1 
ATOM   8196  N  NH1 . ARG A 1 1043 ? -25.914 73.963  57.188  1.00 53.33 ? 1043 ARG A NH1 1 
ATOM   8197  N  NH2 . ARG A 1 1043 ? -24.636 72.062  57.383  1.00 53.26 ? 1043 ARG A NH2 1 
ATOM   8198  N  N   . HIS A 1 1044 ? -19.466 75.336  60.934  1.00 33.54 ? 1044 HIS A N   1 
ATOM   8199  C  CA  . HIS A 1 1044 ? -18.340 74.732  61.646  1.00 34.34 ? 1044 HIS A CA  1 
ATOM   8200  C  C   . HIS A 1 1044 ? -17.611 75.783  62.480  1.00 33.50 ? 1044 HIS A C   1 
ATOM   8201  O  O   . HIS A 1 1044 ? -17.651 76.965  62.164  1.00 33.45 ? 1044 HIS A O   1 
ATOM   8202  C  CB  . HIS A 1 1044 ? -17.387 74.081  60.619  1.00 37.53 ? 1044 HIS A CB  1 
ATOM   8203  C  CG  . HIS A 1 1044 ? -16.259 73.287  61.221  1.00 41.62 ? 1044 HIS A CG  1 
ATOM   8204  N  ND1 . HIS A 1 1044 ? -15.027 73.834  61.504  1.00 42.66 ? 1044 HIS A ND1 1 
ATOM   8205  C  CD2 . HIS A 1 1044 ? -16.177 71.973  61.560  1.00 41.92 ? 1044 HIS A CD2 1 
ATOM   8206  C  CE1 . HIS A 1 1044 ? -14.229 72.894  61.989  1.00 43.21 ? 1044 HIS A CE1 1 
ATOM   8207  N  NE2 . HIS A 1 1044 ? -14.902 71.759  62.033  1.00 43.30 ? 1044 HIS A NE2 1 
ATOM   8208  N  N   . SER A 1 1045 ? -16.958 75.350  63.553  1.00 32.73 ? 1045 SER A N   1 
ATOM   8209  C  CA  . SER A 1 1045 ? -16.213 76.257  64.424  1.00 32.49 ? 1045 SER A CA  1 
ATOM   8210  C  C   . SER A 1 1045 ? -14.736 75.882  64.405  1.00 31.18 ? 1045 SER A C   1 
ATOM   8211  O  O   . SER A 1 1045 ? -14.398 74.738  64.658  1.00 32.97 ? 1045 SER A O   1 
ATOM   8212  C  CB  . SER A 1 1045 ? -16.758 76.165  65.845  1.00 32.63 ? 1045 SER A CB  1 
ATOM   8213  O  OG  . SER A 1 1045 ? -15.726 75.901  66.775  1.00 34.44 ? 1045 SER A OG  1 
ATOM   8214  N  N   . TYR A 1 1046 ? -13.855 76.837  64.122  1.00 30.53 ? 1046 TYR A N   1 
ATOM   8215  C  CA  . TYR A 1 1046 ? -12.411 76.554  64.045  1.00 29.07 ? 1046 TYR A CA  1 
ATOM   8216  C  C   . TYR A 1 1046 ? -11.604 77.019  65.258  1.00 28.43 ? 1046 TYR A C   1 
ATOM   8217  O  O   . TYR A 1 1046 ? -12.099 77.752  66.109  1.00 29.56 ? 1046 TYR A O   1 
ATOM   8218  C  CB  . TYR A 1 1046 ? -11.822 77.209  62.791  1.00 28.43 ? 1046 TYR A CB  1 
ATOM   8219  C  CG  . TYR A 1 1046 ? -12.627 76.970  61.538  1.00 27.92 ? 1046 TYR A CG  1 
ATOM   8220  C  CD1 . TYR A 1 1046 ? -12.312 75.923  60.670  1.00 27.15 ? 1046 TYR A CD1 1 
ATOM   8221  C  CD2 . TYR A 1 1046 ? -13.746 77.752  61.252  1.00 27.94 ? 1046 TYR A CD2 1 
ATOM   8222  C  CE1 . TYR A 1 1046 ? -13.096 75.656  59.557  1.00 26.85 ? 1046 TYR A CE1 1 
ATOM   8223  C  CE2 . TYR A 1 1046 ? -14.542 77.494  60.143  1.00 27.14 ? 1046 TYR A CE2 1 
ATOM   8224  C  CZ  . TYR A 1 1046 ? -14.212 76.441  59.306  1.00 27.61 ? 1046 TYR A CZ  1 
ATOM   8225  O  OH  . TYR A 1 1046 ? -15.028 76.146  58.245  1.00 27.73 ? 1046 TYR A OH  1 
ATOM   8226  N  N   . SER A 1 1047 ? -10.342 76.611  65.316  1.00 27.30 ? 1047 SER A N   1 
ATOM   8227  C  CA  . SER A 1 1047 ? -9.483  77.000  66.425  1.00 28.10 ? 1047 SER A CA  1 
ATOM   8228  C  C   . SER A 1 1047 ? -8.146  77.611  65.955  1.00 28.78 ? 1047 SER A C   1 
ATOM   8229  O  O   . SER A 1 1047 ? -7.219  77.807  66.755  1.00 29.85 ? 1047 SER A O   1 
ATOM   8230  C  CB  . SER A 1 1047 ? -9.234  75.780  67.307  1.00 26.63 ? 1047 SER A CB  1 
ATOM   8231  O  OG  . SER A 1 1047 ? -8.851  74.689  66.497  1.00 26.64 ? 1047 SER A OG  1 
ATOM   8232  N  N   . SER A 1 1048 ? -8.045  77.918  64.666  1.00 28.10 ? 1048 SER A N   1 
ATOM   8233  C  CA  . SER A 1 1048 ? -6.818  78.508  64.133  1.00 27.68 ? 1048 SER A CA  1 
ATOM   8234  C  C   . SER A 1 1048 ? -6.928  78.822  62.641  1.00 27.77 ? 1048 SER A C   1 
ATOM   8235  O  O   . SER A 1 1048 ? -7.869  78.383  61.973  1.00 28.26 ? 1048 SER A O   1 
ATOM   8236  C  CB  . SER A 1 1048 ? -5.638  77.555  64.348  1.00 26.95 ? 1048 SER A CB  1 
ATOM   8237  O  OG  . SER A 1 1048 ? -5.627  76.542  63.362  1.00 25.56 ? 1048 SER A OG  1 
ATOM   8238  N  N   . PHE A 1 1049 ? -5.975  79.601  62.131  1.00 27.23 ? 1049 PHE A N   1 
ATOM   8239  C  CA  . PHE A 1 1049 ? -5.933  79.946  60.711  1.00 25.82 ? 1049 PHE A CA  1 
ATOM   8240  C  C   . PHE A 1 1049 ? -5.105  78.865  60.000  1.00 25.64 ? 1049 PHE A C   1 
ATOM   8241  O  O   . PHE A 1 1049 ? -4.779  77.834  60.597  1.00 24.23 ? 1049 PHE A O   1 
ATOM   8242  C  CB  . PHE A 1 1049 ? -5.252  81.301  60.514  1.00 24.18 ? 1049 PHE A CB  1 
ATOM   8243  C  CG  . PHE A 1 1049 ? -6.037  82.460  61.031  1.00 23.82 ? 1049 PHE A CG  1 
ATOM   8244  C  CD1 . PHE A 1 1049 ? -7.220  82.837  60.420  1.00 22.34 ? 1049 PHE A CD1 1 
ATOM   8245  C  CD2 . PHE A 1 1049 ? -5.595  83.174  62.140  1.00 23.07 ? 1049 PHE A CD2 1 
ATOM   8246  C  CE1 . PHE A 1 1049 ? -7.947  83.913  60.898  1.00 21.72 ? 1049 PHE A CE1 1 
ATOM   8247  C  CE2 . PHE A 1 1049 ? -6.313  84.248  62.626  1.00 21.95 ? 1049 PHE A CE2 1 
ATOM   8248  C  CZ  . PHE A 1 1049 ? -7.498  84.617  62.007  1.00 21.97 ? 1049 PHE A CZ  1 
ATOM   8249  N  N   . SER A 1 1050 ? -4.762  79.113  58.738  1.00 25.56 ? 1050 SER A N   1 
ATOM   8250  C  CA  . SER A 1 1050 ? -3.935  78.181  57.967  1.00 26.10 ? 1050 SER A CA  1 
ATOM   8251  C  C   . SER A 1 1050 ? -2.612  77.980  58.706  1.00 27.09 ? 1050 SER A C   1 
ATOM   8252  O  O   . SER A 1 1050 ? -2.213  78.819  59.516  1.00 27.21 ? 1050 SER A O   1 
ATOM   8253  C  CB  . SER A 1 1050 ? -3.627  78.746  56.576  1.00 25.30 ? 1050 SER A CB  1 
ATOM   8254  O  OG  . SER A 1 1050 ? -2.531  79.648  56.612  1.00 19.49 ? 1050 SER A OG  1 
ATOM   8255  N  N   . LYS A 1 1051 ? -1.919  76.886  58.424  1.00 28.10 ? 1051 LYS A N   1 
ATOM   8256  C  CA  . LYS A 1 1051 ? -0.652  76.649  59.096  1.00 29.21 ? 1051 LYS A CA  1 
ATOM   8257  C  C   . LYS A 1 1051 ? 0.365   77.718  58.750  1.00 28.32 ? 1051 LYS A C   1 
ATOM   8258  O  O   . LYS A 1 1051 ? 1.177   78.088  59.593  1.00 29.67 ? 1051 LYS A O   1 
ATOM   8259  C  CB  . LYS A 1 1051 ? -0.116  75.259  58.756  1.00 32.40 ? 1051 LYS A CB  1 
ATOM   8260  C  CG  . LYS A 1 1051 ? -0.871  74.146  59.473  1.00 34.10 ? 1051 LYS A CG  1 
ATOM   8261  C  CD  . LYS A 1 1051 ? -0.449  72.777  58.975  1.00 37.73 ? 1051 LYS A CD  1 
ATOM   8262  C  CE  . LYS A 1 1051 ? -0.850  71.689  59.968  1.00 39.88 ? 1051 LYS A CE  1 
ATOM   8263  N  NZ  . LYS A 1 1051 ? -0.747  70.332  59.361  1.00 39.23 ? 1051 LYS A NZ  1 
ATOM   8264  N  N   . LEU A 1 1052 ? 0.316   78.235  57.526  1.00 27.31 ? 1052 LEU A N   1 
ATOM   8265  C  CA  . LEU A 1 1052 ? 1.254   79.277  57.109  1.00 25.81 ? 1052 LEU A CA  1 
ATOM   8266  C  C   . LEU A 1 1052 ? 0.992   80.591  57.840  1.00 25.58 ? 1052 LEU A C   1 
ATOM   8267  O  O   . LEU A 1 1052 ? 1.921   81.241  58.309  1.00 24.98 ? 1052 LEU A O   1 
ATOM   8268  C  CB  . LEU A 1 1052 ? 1.171   79.494  55.592  1.00 26.00 ? 1052 LEU A CB  1 
ATOM   8269  C  CG  . LEU A 1 1052 ? 2.328   79.010  54.701  1.00 27.21 ? 1052 LEU A CG  1 
ATOM   8270  C  CD1 . LEU A 1 1052 ? 3.272   78.079  55.457  1.00 26.61 ? 1052 LEU A CD1 1 
ATOM   8271  C  CD2 . LEU A 1 1052 ? 1.755   78.330  53.493  1.00 24.49 ? 1052 LEU A CD2 1 
ATOM   8272  N  N   . LEU A 1 1053 ? -0.275  80.982  57.939  1.00 24.99 ? 1053 LEU A N   1 
ATOM   8273  C  CA  . LEU A 1 1053 ? -0.622  82.216  58.628  1.00 25.53 ? 1053 LEU A CA  1 
ATOM   8274  C  C   . LEU A 1 1053 ? -0.292  82.131  60.129  1.00 25.63 ? 1053 LEU A C   1 
ATOM   8275  O  O   . LEU A 1 1053 ? 0.124   83.128  60.738  1.00 24.93 ? 1053 LEU A O   1 
ATOM   8276  C  CB  . LEU A 1 1053 ? -2.105  82.553  58.400  1.00 24.57 ? 1053 LEU A CB  1 
ATOM   8277  C  CG  . LEU A 1 1053 ? -2.657  83.845  59.037  1.00 25.02 ? 1053 LEU A CG  1 
ATOM   8278  C  CD1 . LEU A 1 1053 ? -1.706  85.038  58.810  1.00 23.57 ? 1053 LEU A CD1 1 
ATOM   8279  C  CD2 . LEU A 1 1053 ? -4.035  84.133  58.459  1.00 23.37 ? 1053 LEU A CD2 1 
ATOM   8280  N  N   . GLU A 1 1054 ? -0.470  80.954  60.729  1.00 25.57 ? 1054 GLU A N   1 
ATOM   8281  C  CA  . GLU A 1 1054 ? -0.135  80.802  62.140  1.00 26.19 ? 1054 GLU A CA  1 
ATOM   8282  C  C   . GLU A 1 1054 ? 1.371   81.001  62.330  1.00 26.54 ? 1054 GLU A C   1 
ATOM   8283  O  O   . GLU A 1 1054 ? 1.817   81.497  63.367  1.00 27.98 ? 1054 GLU A O   1 
ATOM   8284  C  CB  . GLU A 1 1054 ? -0.553  79.423  62.669  1.00 26.89 ? 1054 GLU A CB  1 
ATOM   8285  C  CG  . GLU A 1 1054 ? -2.058  79.246  62.876  1.00 26.06 ? 1054 GLU A CG  1 
ATOM   8286  C  CD  . GLU A 1 1054 ? -2.635  80.196  63.912  1.00 28.19 ? 1054 GLU A CD  1 
ATOM   8287  O  OE1 . GLU A 1 1054 ? -1.856  80.801  64.674  1.00 28.73 ? 1054 GLU A OE1 1 
ATOM   8288  O  OE2 . GLU A 1 1054 ? -3.875  80.336  63.978  1.00 29.22 ? 1054 GLU A OE2 1 
ATOM   8289  N  N   . ALA A 1 1055 ? 2.150   80.633  61.319  1.00 26.59 ? 1055 ALA A N   1 
ATOM   8290  C  CA  . ALA A 1 1055 ? 3.596   80.795  61.387  1.00 26.40 ? 1055 ALA A CA  1 
ATOM   8291  C  C   . ALA A 1 1055 ? 4.045   82.241  61.141  1.00 26.63 ? 1055 ALA A C   1 
ATOM   8292  O  O   . ALA A 1 1055 ? 5.006   82.707  61.762  1.00 26.02 ? 1055 ALA A O   1 
ATOM   8293  C  CB  . ALA A 1 1055 ? 4.261   79.870  60.394  1.00 26.06 ? 1055 ALA A CB  1 
ATOM   8294  N  N   . TYR A 1 1056 ? 3.365   82.960  60.245  1.00 26.79 ? 1056 TYR A N   1 
ATOM   8295  C  CA  . TYR A 1 1056 ? 3.753   84.353  59.973  1.00 26.79 ? 1056 TYR A CA  1 
ATOM   8296  C  C   . TYR A 1 1056 ? 3.518   85.209  61.214  1.00 26.68 ? 1056 TYR A C   1 
ATOM   8297  O  O   . TYR A 1 1056 ? 4.336   86.071  61.551  1.00 27.23 ? 1056 TYR A O   1 
ATOM   8298  C  CB  . TYR A 1 1056 ? 2.948   84.967  58.820  1.00 26.50 ? 1056 TYR A CB  1 
ATOM   8299  C  CG  . TYR A 1 1056 ? 3.073   84.272  57.481  1.00 26.64 ? 1056 TYR A CG  1 
ATOM   8300  C  CD1 . TYR A 1 1056 ? 4.277   83.686  57.079  1.00 26.54 ? 1056 TYR A CD1 1 
ATOM   8301  C  CD2 . TYR A 1 1056 ? 2.000   84.262  56.582  1.00 26.82 ? 1056 TYR A CD2 1 
ATOM   8302  C  CE1 . TYR A 1 1056 ? 4.409   83.108  55.815  1.00 26.54 ? 1056 TYR A CE1 1 
ATOM   8303  C  CE2 . TYR A 1 1056 ? 2.121   83.698  55.327  1.00 27.66 ? 1056 TYR A CE2 1 
ATOM   8304  C  CZ  . TYR A 1 1056 ? 3.331   83.122  54.943  1.00 27.69 ? 1056 TYR A CZ  1 
ATOM   8305  O  OH  . TYR A 1 1056 ? 3.459   82.586  53.680  1.00 30.34 ? 1056 TYR A OH  1 
ATOM   8306  N  N   . LEU A 1 1057 ? 2.393   84.958  61.886  1.00 24.86 ? 1057 LEU A N   1 
ATOM   8307  C  CA  . LEU A 1 1057 ? 2.009   85.697  63.086  1.00 24.44 ? 1057 LEU A CA  1 
ATOM   8308  C  C   . LEU A 1 1057 ? 3.010   85.637  64.235  1.00 24.81 ? 1057 LEU A C   1 
ATOM   8309  O  O   . LEU A 1 1057 ? 2.894   86.389  65.197  1.00 25.09 ? 1057 LEU A O   1 
ATOM   8310  C  CB  . LEU A 1 1057 ? 0.640   85.220  63.574  1.00 22.04 ? 1057 LEU A CB  1 
ATOM   8311  C  CG  . LEU A 1 1057 ? -0.516  85.717  62.712  1.00 22.15 ? 1057 LEU A CG  1 
ATOM   8312  C  CD1 . LEU A 1 1057 ? -1.796  84.983  63.064  1.00 19.68 ? 1057 LEU A CD1 1 
ATOM   8313  C  CD2 . LEU A 1 1057 ? -0.665  87.218  62.907  1.00 21.51 ? 1057 LEU A CD2 1 
ATOM   8314  N  N   . LEU A 1 1058 ? 3.971   84.725  64.155  1.00 24.76 ? 1058 LEU A N   1 
ATOM   8315  C  CA  . LEU A 1 1058 ? 4.999   84.623  65.187  1.00 25.86 ? 1058 LEU A CA  1 
ATOM   8316  C  C   . LEU A 1 1058 ? 6.024   85.731  64.968  1.00 26.06 ? 1058 LEU A C   1 
ATOM   8317  O  O   . LEU A 1 1058 ? 6.797   86.054  65.858  1.00 27.37 ? 1058 LEU A O   1 
ATOM   8318  C  CB  . LEU A 1 1058 ? 5.720   83.272  65.108  1.00 23.99 ? 1058 LEU A CB  1 
ATOM   8319  C  CG  . LEU A 1 1058 ? 4.869   82.022  65.323  1.00 25.11 ? 1058 LEU A CG  1 
ATOM   8320  C  CD1 . LEU A 1 1058 ? 5.741   80.794  65.154  1.00 21.37 ? 1058 LEU A CD1 1 
ATOM   8321  C  CD2 . LEU A 1 1058 ? 4.222   82.072  66.712  1.00 23.45 ? 1058 LEU A CD2 1 
ATOM   8322  N  N   . VAL A 1 1059 ? 6.015   86.300  63.765  1.00 26.52 ? 1059 VAL A N   1 
ATOM   8323  C  CA  . VAL A 1 1059 ? 6.947   87.353  63.378  1.00 26.56 ? 1059 VAL A CA  1 
ATOM   8324  C  C   . VAL A 1 1059 ? 6.409   88.752  63.648  1.00 27.54 ? 1059 VAL A C   1 
ATOM   8325  O  O   . VAL A 1 1059 ? 5.342   89.115  63.174  1.00 27.12 ? 1059 VAL A O   1 
ATOM   8326  C  CB  . VAL A 1 1059 ? 7.282   87.233  61.892  1.00 25.83 ? 1059 VAL A CB  1 
ATOM   8327  C  CG1 . VAL A 1 1059 ? 8.415   88.165  61.526  1.00 21.78 ? 1059 VAL A CG1 1 
ATOM   8328  C  CG2 . VAL A 1 1059 ? 7.624   85.796  61.583  1.00 26.19 ? 1059 VAL A CG2 1 
ATOM   8329  N  N   . LYS A 1 1060 ? 7.179   89.531  64.406  1.00 28.99 ? 1060 LYS A N   1 
ATOM   8330  C  CA  . LYS A 1 1060 ? 6.819   90.894  64.781  1.00 29.68 ? 1060 LYS A CA  1 
ATOM   8331  C  C   . LYS A 1 1060 ? 7.806   91.907  64.197  1.00 29.03 ? 1060 LYS A C   1 
ATOM   8332  O  O   . LYS A 1 1060 ? 8.979   91.596  63.989  1.00 29.21 ? 1060 LYS A O   1 
ATOM   8333  C  CB  . LYS A 1 1060 ? 6.788   91.004  66.307  1.00 32.26 ? 1060 LYS A CB  1 
ATOM   8334  C  CG  . LYS A 1 1060 ? 5.756   90.089  66.972  1.00 34.39 ? 1060 LYS A CG  1 
ATOM   8335  C  CD  . LYS A 1 1060 ? 6.421   88.874  67.626  1.00 36.79 ? 1060 LYS A CD  1 
ATOM   8336  C  CE  . LYS A 1 1060 ? 5.426   88.046  68.447  1.00 37.52 ? 1060 LYS A CE  1 
ATOM   8337  N  NZ  . LYS A 1 1060 ? 4.784   88.852  69.522  1.00 38.10 ? 1060 LYS A NZ  1 
ATOM   8338  N  N   . TRP A 1 1061 ? 7.335   93.124  63.946  1.00 27.98 ? 1061 TRP A N   1 
ATOM   8339  C  CA  . TRP A 1 1061 ? 8.180   94.165  63.369  1.00 27.27 ? 1061 TRP A CA  1 
ATOM   8340  C  C   . TRP A 1 1061 ? 8.056   95.515  64.062  1.00 28.37 ? 1061 TRP A C   1 
ATOM   8341  O  O   . TRP A 1 1061 ? 7.194   95.722  64.912  1.00 27.66 ? 1061 TRP A O   1 
ATOM   8342  C  CB  . TRP A 1 1061 ? 7.829   94.383  61.898  1.00 25.57 ? 1061 TRP A CB  1 
ATOM   8343  C  CG  . TRP A 1 1061 ? 7.818   93.155  61.077  1.00 23.76 ? 1061 TRP A CG  1 
ATOM   8344  C  CD1 . TRP A 1 1061 ? 6.872   92.163  61.091  1.00 22.08 ? 1061 TRP A CD1 1 
ATOM   8345  C  CD2 . TRP A 1 1061 ? 8.811   92.760  60.126  1.00 21.86 ? 1061 TRP A CD2 1 
ATOM   8346  N  NE1 . TRP A 1 1061 ? 7.221   91.172  60.204  1.00 22.11 ? 1061 TRP A NE1 1 
ATOM   8347  C  CE2 . TRP A 1 1061 ? 8.405   91.509  59.597  1.00 22.20 ? 1061 TRP A CE2 1 
ATOM   8348  C  CE3 . TRP A 1 1061 ? 10.004  93.333  59.673  1.00 21.09 ? 1061 TRP A CE3 1 
ATOM   8349  C  CZ2 . TRP A 1 1061 ? 9.155   90.826  58.627  1.00 21.65 ? 1061 TRP A CZ2 1 
ATOM   8350  C  CZ3 . TRP A 1 1061 ? 10.750  92.656  58.713  1.00 21.94 ? 1061 TRP A CZ3 1 
ATOM   8351  C  CH2 . TRP A 1 1061 ? 10.323  91.414  58.200  1.00 22.75 ? 1061 TRP A CH2 1 
ATOM   8352  N  N   . ARG A 1 1062 ? 8.945   96.425  63.679  1.00 29.80 ? 1062 ARG A N   1 
ATOM   8353  C  CA  . ARG A 1 1062 ? 8.946   97.790  64.175  1.00 31.82 ? 1062 ARG A CA  1 
ATOM   8354  C  C   . ARG A 1 1062 ? 8.955   98.705  62.963  1.00 31.50 ? 1062 ARG A C   1 
ATOM   8355  O  O   . ARG A 1 1062 ? 9.856   98.639  62.128  1.00 30.22 ? 1062 ARG A O   1 
ATOM   8356  C  CB  . ARG A 1 1062 ? 10.177  98.079  65.030  1.00 34.63 ? 1062 ARG A CB  1 
ATOM   8357  C  CG  . ARG A 1 1062 ? 10.066  97.629  66.472  1.00 38.50 ? 1062 ARG A CG  1 
ATOM   8358  C  CD  . ARG A 1 1062 ? 11.336  97.993  67.229  1.00 41.90 ? 1062 ARG A CD  1 
ATOM   8359  N  NE  . ARG A 1 1062 ? 11.540  99.438  67.310  1.00 43.55 ? 1062 ARG A NE  1 
ATOM   8360  C  CZ  . ARG A 1 1062 ? 12.610  100.008 67.857  1.00 45.37 ? 1062 ARG A CZ  1 
ATOM   8361  N  NH1 . ARG A 1 1062 ? 13.584  99.253  68.366  1.00 44.27 ? 1062 ARG A NH1 1 
ATOM   8362  N  NH2 . ARG A 1 1062 ? 12.705  101.333 67.908  1.00 44.58 ? 1062 ARG A NH2 1 
ATOM   8363  N  N   . MET A 1 1063 ? 7.936   99.548  62.867  1.00 31.92 ? 1063 MET A N   1 
ATOM   8364  C  CA  . MET A 1 1063 ? 7.826   100.487 61.767  1.00 32.08 ? 1063 MET A CA  1 
ATOM   8365  C  C   . MET A 1 1063 ? 8.503   101.788 62.162  1.00 31.96 ? 1063 MET A C   1 
ATOM   8366  O  O   . MET A 1 1063 ? 8.189   102.373 63.193  1.00 31.50 ? 1063 MET A O   1 
ATOM   8367  C  CB  . MET A 1 1063 ? 6.352   100.670 61.417  1.00 32.53 ? 1063 MET A CB  1 
ATOM   8368  C  CG  . MET A 1 1063 ? 5.744   99.330  61.063  1.00 35.30 ? 1063 MET A CG  1 
ATOM   8369  S  SD  . MET A 1 1063 ? 4.321   99.334  59.998  1.00 36.03 ? 1063 MET A SD  1 
ATOM   8370  C  CE  . MET A 1 1063 ? 3.170   98.563  61.074  1.00 39.30 ? 1063 MET A CE  1 
ATOM   8371  N  N   . CYS A 1 1064 ? 9.443   102.230 61.338  1.00 31.53 ? 1064 CYS A N   1 
ATOM   8372  C  CA  . CYS A 1 1064 ? 10.196  103.428 61.645  1.00 32.35 ? 1064 CYS A CA  1 
ATOM   8373  C  C   . CYS A 1 1064 ? 10.088  104.564 60.633  1.00 32.96 ? 1064 CYS A C   1 
ATOM   8374  O  O   . CYS A 1 1064 ? 9.021   104.816 60.087  1.00 32.35 ? 1064 CYS A O   1 
ATOM   8375  C  CB  . CYS A 1 1064 ? 11.662  103.050 61.871  1.00 31.92 ? 1064 CYS A CB  1 
ATOM   8376  S  SG  . CYS A 1 1064 ? 11.866  101.696 63.079  1.00 32.89 ? 1064 CYS A SG  1 
ATOM   8377  N  N   . GLU A 1 1065 ? 11.205  105.245 60.398  1.00 35.43 ? 1065 GLU A N   1 
ATOM   8378  C  CA  . GLU A 1 1065 ? 11.250  106.388 59.500  1.00 37.97 ? 1065 GLU A CA  1 
ATOM   8379  C  C   . GLU A 1 1065 ? 10.589  106.157 58.143  1.00 37.82 ? 1065 GLU A C   1 
ATOM   8380  O  O   . GLU A 1 1065 ? 10.757  105.105 57.519  1.00 38.80 ? 1065 GLU A O   1 
ATOM   8381  C  CB  . GLU A 1 1065 ? 12.701  106.832 59.254  1.00 40.74 ? 1065 GLU A CB  1 
ATOM   8382  C  CG  . GLU A 1 1065 ? 13.691  106.597 60.399  1.00 46.29 ? 1065 GLU A CG  1 
ATOM   8383  C  CD  . GLU A 1 1065 ? 14.107  105.136 60.537  1.00 48.06 ? 1065 GLU A CD  1 
ATOM   8384  O  OE1 . GLU A 1 1065 ? 14.493  104.514 59.515  1.00 49.16 ? 1065 GLU A OE1 1 
ATOM   8385  O  OE2 . GLU A 1 1065 ? 14.058  104.615 61.673  1.00 51.32 ? 1065 GLU A OE2 1 
ATOM   8386  N  N   . ALA A 1 1066 ? 9.838   107.153 57.692  1.00 35.54 ? 1066 ALA A N   1 
ATOM   8387  C  CA  . ALA A 1 1066 ? 9.195   107.081 56.388  1.00 34.74 ? 1066 ALA A CA  1 
ATOM   8388  C  C   . ALA A 1 1066 ? 10.335  107.149 55.378  1.00 33.49 ? 1066 ALA A C   1 
ATOM   8389  O  O   . ALA A 1 1066 ? 11.386  107.728 55.663  1.00 32.76 ? 1066 ALA A O   1 
ATOM   8390  C  CB  . ALA A 1 1066 ? 8.254   108.262 56.197  1.00 32.91 ? 1066 ALA A CB  1 
ATOM   8391  N  N   . ARG A 1 1067 ? 10.141  106.542 54.214  1.00 33.04 ? 1067 ARG A N   1 
ATOM   8392  C  CA  . ARG A 1 1067 ? 11.167  106.560 53.179  1.00 32.54 ? 1067 ARG A CA  1 
ATOM   8393  C  C   . ARG A 1 1067 ? 11.203  107.923 52.486  1.00 32.93 ? 1067 ARG A C   1 
ATOM   8394  O  O   . ARG A 1 1067 ? 10.204  108.623 52.422  1.00 31.34 ? 1067 ARG A O   1 
ATOM   8395  C  CB  . ARG A 1 1067 ? 10.888  105.490 52.120  1.00 31.33 ? 1067 ARG A CB  1 
ATOM   8396  C  CG  . ARG A 1 1067 ? 10.915  104.054 52.609  1.00 30.75 ? 1067 ARG A CG  1 
ATOM   8397  C  CD  . ARG A 1 1067 ? 10.594  103.073 51.464  1.00 26.37 ? 1067 ARG A CD  1 
ATOM   8398  N  NE  . ARG A 1 1067 ? 11.428  103.295 50.284  1.00 25.19 ? 1067 ARG A NE  1 
ATOM   8399  C  CZ  . ARG A 1 1067 ? 11.409  102.526 49.199  1.00 25.63 ? 1067 ARG A CZ  1 
ATOM   8400  N  NH1 . ARG A 1 1067 ? 10.592  101.483 49.150  1.00 27.19 ? 1067 ARG A NH1 1 
ATOM   8401  N  NH2 . ARG A 1 1067 ? 12.209  102.785 48.171  1.00 21.80 ? 1067 ARG A NH2 1 
ATOM   8402  N  N   . GLU A 1 1068 ? 12.375  108.298 51.983  1.00 33.79 ? 1068 GLU A N   1 
ATOM   8403  C  CA  . GLU A 1 1068 ? 12.538  109.550 51.263  1.00 34.14 ? 1068 GLU A CA  1 
ATOM   8404  C  C   . GLU A 1 1068 ? 11.893  109.331 49.906  1.00 32.19 ? 1068 GLU A C   1 
ATOM   8405  O  O   . GLU A 1 1068 ? 11.745  108.197 49.456  1.00 33.44 ? 1068 GLU A O   1 
ATOM   8406  C  CB  . GLU A 1 1068 ? 14.022  109.864 51.076  1.00 37.61 ? 1068 GLU A CB  1 
ATOM   8407  C  CG  . GLU A 1 1068 ? 14.689  110.458 52.292  1.00 40.97 ? 1068 GLU A CG  1 
ATOM   8408  C  CD  . GLU A 1 1068 ? 14.172  111.846 52.585  1.00 43.89 ? 1068 GLU A CD  1 
ATOM   8409  O  OE1 . GLU A 1 1068 ? 14.387  112.750 51.738  1.00 45.64 ? 1068 GLU A OE1 1 
ATOM   8410  O  OE2 . GLU A 1 1068 ? 13.548  112.028 53.658  1.00 45.56 ? 1068 GLU A OE2 1 
ATOM   8411  N  N   . PRO A 1 1069 ? 11.496  110.406 49.232  1.00 30.75 ? 1069 PRO A N   1 
ATOM   8412  C  CA  . PRO A 1 1069 ? 10.870  110.221 47.919  1.00 30.68 ? 1069 PRO A CA  1 
ATOM   8413  C  C   . PRO A 1 1069 ? 11.802  109.525 46.922  1.00 29.33 ? 1069 PRO A C   1 
ATOM   8414  O  O   . PRO A 1 1069 ? 13.006  109.786 46.913  1.00 28.60 ? 1069 PRO A O   1 
ATOM   8415  C  CB  . PRO A 1 1069 ? 10.540  111.651 47.482  1.00 31.07 ? 1069 PRO A CB  1 
ATOM   8416  C  CG  . PRO A 1 1069 ? 10.354  112.385 48.798  1.00 31.85 ? 1069 PRO A CG  1 
ATOM   8417  C  CD  . PRO A 1 1069 ? 11.479  111.820 49.639  1.00 30.85 ? 1069 PRO A CD  1 
ATOM   8418  N  N   . SER A 1 1070 ? 11.240  108.640 46.098  1.00 27.04 ? 1070 SER A N   1 
ATOM   8419  C  CA  . SER A 1 1070 ? 12.014  107.935 45.084  1.00 26.01 ? 1070 SER A CA  1 
ATOM   8420  C  C   . SER A 1 1070 ? 11.878  108.743 43.806  1.00 25.51 ? 1070 SER A C   1 
ATOM   8421  O  O   . SER A 1 1070 ? 12.714  108.648 42.898  1.00 26.18 ? 1070 SER A O   1 
ATOM   8422  C  CB  . SER A 1 1070 ? 11.465  106.526 44.847  1.00 26.91 ? 1070 SER A CB  1 
ATOM   8423  O  OG  . SER A 1 1070 ? 11.322  105.807 46.059  1.00 29.73 ? 1070 SER A OG  1 
ATOM   8424  N  N   . VAL A 1 1071 ? 10.806  109.526 43.738  1.00 23.67 ? 1071 VAL A N   1 
ATOM   8425  C  CA  . VAL A 1 1071 ? 10.538  110.388 42.590  1.00 24.59 ? 1071 VAL A CA  1 
ATOM   8426  C  C   . VAL A 1 1071 ? 9.983   111.744 43.045  1.00 25.97 ? 1071 VAL A C   1 
ATOM   8427  O  O   . VAL A 1 1071 ? 9.390   111.871 44.118  1.00 25.69 ? 1071 VAL A O   1 
ATOM   8428  C  CB  . VAL A 1 1071 ? 9.532   109.742 41.597  1.00 25.74 ? 1071 VAL A CB  1 
ATOM   8429  C  CG1 . VAL A 1 1071 ? 10.016  108.368 41.182  1.00 25.21 ? 1071 VAL A CG1 1 
ATOM   8430  C  CG2 . VAL A 1 1071 ? 8.156   109.644 42.232  1.00 24.52 ? 1071 VAL A CG2 1 
ATOM   8431  N  N   . ASP A 1 1072 ? 10.191  112.756 42.211  1.00 27.30 ? 1072 ASP A N   1 
ATOM   8432  C  CA  . ASP A 1 1072 ? 9.746   114.122 42.475  1.00 27.34 ? 1072 ASP A CA  1 
ATOM   8433  C  C   . ASP A 1 1072 ? 8.241   114.244 42.768  1.00 27.56 ? 1072 ASP A C   1 
ATOM   8434  O  O   . ASP A 1 1072 ? 7.407   113.687 42.048  1.00 26.82 ? 1072 ASP A O   1 
ATOM   8435  C  CB  . ASP A 1 1072 ? 10.117  114.991 41.274  1.00 27.69 ? 1072 ASP A CB  1 
ATOM   8436  C  CG  . ASP A 1 1072 ? 10.112  116.464 41.596  1.00 28.94 ? 1072 ASP A CG  1 
ATOM   8437  O  OD1 . ASP A 1 1072 ? 9.039   116.992 41.962  1.00 27.75 ? 1072 ASP A OD1 1 
ATOM   8438  O  OD2 . ASP A 1 1072 ? 11.184  117.094 41.481  1.00 31.73 ? 1072 ASP A OD2 1 
ATOM   8439  N  N   . LEU A 1 1073 ? 7.905   114.992 43.818  1.00 28.28 ? 1073 LEU A N   1 
ATOM   8440  C  CA  . LEU A 1 1073 ? 6.515   115.192 44.229  1.00 27.70 ? 1073 LEU A CA  1 
ATOM   8441  C  C   . LEU A 1 1073 ? 5.653   116.050 43.309  1.00 27.94 ? 1073 LEU A C   1 
ATOM   8442  O  O   . LEU A 1 1073 ? 4.435   116.109 43.499  1.00 27.55 ? 1073 LEU A O   1 
ATOM   8443  C  CB  . LEU A 1 1073 ? 6.462   115.785 45.631  1.00 30.34 ? 1073 LEU A CB  1 
ATOM   8444  C  CG  . LEU A 1 1073 ? 6.722   114.851 46.812  1.00 32.82 ? 1073 LEU A CG  1 
ATOM   8445  C  CD1 . LEU A 1 1073 ? 7.865   113.895 46.509  1.00 32.82 ? 1073 LEU A CD1 1 
ATOM   8446  C  CD2 . LEU A 1 1073 ? 7.039   115.697 48.037  1.00 34.03 ? 1073 LEU A CD2 1 
ATOM   8447  N  N   . ARG A 1 1074 ? 6.259   116.724 42.335  1.00 27.26 ? 1074 ARG A N   1 
ATOM   8448  C  CA  . ARG A 1 1074 ? 5.484   117.549 41.399  1.00 28.78 ? 1074 ARG A CA  1 
ATOM   8449  C  C   . ARG A 1 1074 ? 5.252   116.763 40.105  1.00 28.21 ? 1074 ARG A C   1 
ATOM   8450  O  O   . ARG A 1 1074 ? 4.603   117.240 39.175  1.00 29.50 ? 1074 ARG A O   1 
ATOM   8451  C  CB  . ARG A 1 1074 ? 6.240   118.842 41.027  1.00 29.69 ? 1074 ARG A CB  1 
ATOM   8452  C  CG  . ARG A 1 1074 ? 6.681   119.725 42.182  1.00 31.11 ? 1074 ARG A CG  1 
ATOM   8453  C  CD  . ARG A 1 1074 ? 8.195   119.690 42.346  1.00 31.09 ? 1074 ARG A CD  1 
ATOM   8454  N  NE  . ARG A 1 1074 ? 8.894   120.573 41.420  1.00 30.72 ? 1074 ARG A NE  1 
ATOM   8455  C  CZ  . ARG A 1 1074 ? 10.210  120.532 41.193  1.00 31.82 ? 1074 ARG A CZ  1 
ATOM   8456  N  NH1 . ARG A 1 1074 ? 10.971  119.647 41.815  1.00 31.38 ? 1074 ARG A NH1 1 
ATOM   8457  N  NH2 . ARG A 1 1074 ? 10.771  121.383 40.352  1.00 32.51 ? 1074 ARG A NH2 1 
ATOM   8458  N  N   . LEU A 1 1075 ? 5.776   115.548 40.063  1.00 27.79 ? 1075 LEU A N   1 
ATOM   8459  C  CA  . LEU A 1 1075 ? 5.711   114.725 38.870  1.00 26.51 ? 1075 LEU A CA  1 
ATOM   8460  C  C   . LEU A 1 1075 ? 4.492   113.848 38.652  1.00 25.64 ? 1075 LEU A C   1 
ATOM   8461  O  O   . LEU A 1 1075 ? 4.241   112.917 39.413  1.00 26.85 ? 1075 LEU A O   1 
ATOM   8462  C  CB  . LEU A 1 1075 ? 6.963   113.861 38.825  1.00 26.35 ? 1075 LEU A CB  1 
ATOM   8463  C  CG  . LEU A 1 1075 ? 7.253   113.029 37.597  1.00 27.56 ? 1075 LEU A CG  1 
ATOM   8464  C  CD1 . LEU A 1 1075 ? 7.011   113.835 36.310  1.00 28.39 ? 1075 LEU A CD1 1 
ATOM   8465  C  CD2 . LEU A 1 1075 ? 8.697   112.596 37.689  1.00 28.59 ? 1075 LEU A CD2 1 
ATOM   8466  N  N   . PRO A 1 1076 ? 3.725   114.129 37.591  1.00 24.97 ? 1076 PRO A N   1 
ATOM   8467  C  CA  . PRO A 1 1076 ? 2.522   113.355 37.257  1.00 25.30 ? 1076 PRO A CA  1 
ATOM   8468  C  C   . PRO A 1 1076 ? 2.893   112.008 36.609  1.00 26.07 ? 1076 PRO A C   1 
ATOM   8469  O  O   . PRO A 1 1076 ? 3.464   111.967 35.519  1.00 26.37 ? 1076 PRO A O   1 
ATOM   8470  C  CB  . PRO A 1 1076 ? 1.771   114.265 36.268  1.00 24.74 ? 1076 PRO A CB  1 
ATOM   8471  C  CG  . PRO A 1 1076 ? 2.374   115.641 36.491  1.00 24.31 ? 1076 PRO A CG  1 
ATOM   8472  C  CD  . PRO A 1 1076 ? 3.818   115.342 36.761  1.00 24.01 ? 1076 PRO A CD  1 
ATOM   8473  N  N   . LEU A 1 1077 ? 2.586   110.905 37.281  1.00 27.61 ? 1077 LEU A N   1 
ATOM   8474  C  CA  . LEU A 1 1077 ? 2.889   109.594 36.713  1.00 27.91 ? 1077 LEU A CA  1 
ATOM   8475  C  C   . LEU A 1 1077 ? 1.594   108.919 36.268  1.00 26.93 ? 1077 LEU A C   1 
ATOM   8476  O  O   . LEU A 1 1077 ? 1.540   108.261 35.228  1.00 24.85 ? 1077 LEU A O   1 
ATOM   8477  C  CB  . LEU A 1 1077 ? 3.622   108.713 37.736  1.00 30.08 ? 1077 LEU A CB  1 
ATOM   8478  C  CG  . LEU A 1 1077 ? 5.114   108.979 37.955  1.00 30.68 ? 1077 LEU A CG  1 
ATOM   8479  C  CD1 . LEU A 1 1077 ? 5.808   109.124 36.597  1.00 30.72 ? 1077 LEU A CD1 1 
ATOM   8480  C  CD2 . LEU A 1 1077 ? 5.306   110.225 38.779  1.00 32.44 ? 1077 LEU A CD2 1 
ATOM   8481  N  N   . CYS A 1 1078 ? 0.550   109.100 37.067  1.00 26.16 ? 1078 CYS A N   1 
ATOM   8482  C  CA  . CYS A 1 1078 ? -0.750  108.529 36.763  1.00 26.11 ? 1078 CYS A CA  1 
ATOM   8483  C  C   . CYS A 1 1078 ? -1.843  109.530 37.100  1.00 25.67 ? 1078 CYS A C   1 
ATOM   8484  O  O   . CYS A 1 1078 ? -2.013  109.896 38.266  1.00 25.55 ? 1078 CYS A O   1 
ATOM   8485  C  CB  . CYS A 1 1078 ? -0.966  107.244 37.561  1.00 27.94 ? 1078 CYS A CB  1 
ATOM   8486  S  SG  . CYS A 1 1078 ? -2.544  106.457 37.191  1.00 27.53 ? 1078 CYS A SG  1 
ATOM   8487  N  N   . ALA A 1 1079 ? -2.569  109.981 36.075  1.00 25.00 ? 1079 ALA A N   1 
ATOM   8488  C  CA  . ALA A 1 1079 ? -3.630  110.954 36.278  1.00 23.83 ? 1079 ALA A CA  1 
ATOM   8489  C  C   . ALA A 1 1079 ? -4.610  110.385 37.289  1.00 23.64 ? 1079 ALA A C   1 
ATOM   8490  O  O   . ALA A 1 1079 ? -4.988  109.215 37.214  1.00 23.38 ? 1079 ALA A O   1 
ATOM   8491  C  CB  . ALA A 1 1079 ? -4.318  111.270 34.966  1.00 22.74 ? 1079 ALA A CB  1 
ATOM   8492  N  N   . GLY A 1 1080 ? -4.996  111.216 38.253  1.00 24.20 ? 1080 GLY A N   1 
ATOM   8493  C  CA  . GLY A 1 1080 ? -5.915  110.781 39.292  1.00 24.04 ? 1080 GLY A CA  1 
ATOM   8494  C  C   . GLY A 1 1080 ? -5.112  110.452 40.531  1.00 23.40 ? 1080 GLY A C   1 
ATOM   8495  O  O   . GLY A 1 1080 ? -5.621  110.511 41.644  1.00 23.47 ? 1080 GLY A O   1 
ATOM   8496  N  N   . ILE A 1 1081 ? -3.848  110.093 40.339  1.00 24.27 ? 1081 ILE A N   1 
ATOM   8497  C  CA  . ILE A 1 1081 ? -2.987  109.792 41.463  1.00 23.69 ? 1081 ILE A CA  1 
ATOM   8498  C  C   . ILE A 1 1081 ? -2.145  111.031 41.712  1.00 24.29 ? 1081 ILE A C   1 
ATOM   8499  O  O   . ILE A 1 1081 ? -1.024  111.150 41.234  1.00 23.57 ? 1081 ILE A O   1 
ATOM   8500  C  CB  . ILE A 1 1081 ? -2.087  108.576 41.184  1.00 24.08 ? 1081 ILE A CB  1 
ATOM   8501  C  CG1 . ILE A 1 1081 ? -2.945  107.317 41.072  1.00 22.92 ? 1081 ILE A CG1 1 
ATOM   8502  C  CG2 . ILE A 1 1081 ? -1.090  108.380 42.327  1.00 20.73 ? 1081 ILE A CG2 1 
ATOM   8503  C  CD1 . ILE A 1 1081 ? -2.148  106.052 40.769  1.00 22.42 ? 1081 ILE A CD1 1 
ATOM   8504  N  N   . ASP A 1 1082 ? -2.718  111.951 42.480  1.00 25.36 ? 1082 ASP A N   1 
ATOM   8505  C  CA  . ASP A 1 1082 ? -2.078  113.218 42.821  1.00 25.97 ? 1082 ASP A CA  1 
ATOM   8506  C  C   . ASP A 1 1082 ? -2.278  113.551 44.310  1.00 24.72 ? 1082 ASP A C   1 
ATOM   8507  O  O   . ASP A 1 1082 ? -2.871  112.774 45.053  1.00 24.74 ? 1082 ASP A O   1 
ATOM   8508  C  CB  . ASP A 1 1082 ? -2.693  114.322 41.965  1.00 26.69 ? 1082 ASP A CB  1 
ATOM   8509  C  CG  . ASP A 1 1082 ? -4.202  114.265 41.957  1.00 25.84 ? 1082 ASP A CG  1 
ATOM   8510  O  OD1 . ASP A 1 1082 ? -4.792  113.973 43.022  1.00 25.78 ? 1082 ASP A OD1 1 
ATOM   8511  O  OD2 . ASP A 1 1082 ? -4.805  114.516 40.890  1.00 27.94 ? 1082 ASP A OD2 1 
ATOM   8512  N  N   . PRO A 1 1083 ? -1.804  114.723 44.751  1.00 23.62 ? 1083 PRO A N   1 
ATOM   8513  C  CA  . PRO A 1 1083 ? -1.949  115.115 46.153  1.00 23.58 ? 1083 PRO A CA  1 
ATOM   8514  C  C   . PRO A 1 1083 ? -3.374  115.060 46.692  1.00 24.34 ? 1083 PRO A C   1 
ATOM   8515  O  O   . PRO A 1 1083 ? -3.585  115.153 47.901  1.00 25.06 ? 1083 PRO A O   1 
ATOM   8516  C  CB  . PRO A 1 1083 ? -1.363  116.520 46.171  1.00 23.81 ? 1083 PRO A CB  1 
ATOM   8517  C  CG  . PRO A 1 1083 ? -0.280  116.438 45.126  1.00 23.78 ? 1083 PRO A CG  1 
ATOM   8518  C  CD  . PRO A 1 1083 ? -0.978  115.701 44.017  1.00 25.09 ? 1083 PRO A CD  1 
ATOM   8519  N  N   . LEU A 1 1084 ? -4.353  114.907 45.801  1.00 24.33 ? 1084 LEU A N   1 
ATOM   8520  C  CA  . LEU A 1 1084 ? -5.755  114.824 46.213  1.00 22.60 ? 1084 LEU A CA  1 
ATOM   8521  C  C   . LEU A 1 1084 ? -6.173  113.375 46.521  1.00 23.27 ? 1084 LEU A C   1 
ATOM   8522  O  O   . LEU A 1 1084 ? -7.261  113.139 47.057  1.00 21.69 ? 1084 LEU A O   1 
ATOM   8523  C  CB  . LEU A 1 1084 ? -6.659  115.404 45.121  1.00 22.83 ? 1084 LEU A CB  1 
ATOM   8524  C  CG  . LEU A 1 1084 ? -6.331  116.837 44.683  1.00 23.81 ? 1084 LEU A CG  1 
ATOM   8525  C  CD1 . LEU A 1 1084 ? -7.123  117.205 43.434  1.00 19.14 ? 1084 LEU A CD1 1 
ATOM   8526  C  CD2 . LEU A 1 1084 ? -6.642  117.796 45.839  1.00 23.62 ? 1084 LEU A CD2 1 
ATOM   8527  N  N   . ASN A 1 1085 ? -5.321  112.411 46.158  1.00 22.17 ? 1085 ASN A N   1 
ATOM   8528  C  CA  . ASN A 1 1085 ? -5.592  110.993 46.417  1.00 22.40 ? 1085 ASN A CA  1 
ATOM   8529  C  C   . ASN A 1 1085 ? -4.422  110.505 47.292  1.00 22.72 ? 1085 ASN A C   1 
ATOM   8530  O  O   . ASN A 1 1085 ? -3.584  109.724 46.840  1.00 23.79 ? 1085 ASN A O   1 
ATOM   8531  C  CB  . ASN A 1 1085 ? -5.651  110.228 45.094  1.00 21.69 ? 1085 ASN A CB  1 
ATOM   8532  C  CG  . ASN A 1 1085 ? -6.510  108.978 45.173  1.00 21.71 ? 1085 ASN A CG  1 
ATOM   8533  O  OD1 . ASN A 1 1085 ? -7.069  108.647 46.227  1.00 21.73 ? 1085 ASN A OD1 1 
ATOM   8534  N  ND2 . ASN A 1 1085 ? -6.617  108.271 44.050  1.00 19.18 ? 1085 ASN A ND2 1 
ATOM   8535  N  N   . SER A 1 1086 ? -4.400  110.983 48.543  1.00 22.71 ? 1086 SER A N   1 
ATOM   8536  C  CA  . SER A 1 1086 ? -3.344  110.726 49.526  1.00 22.71 ? 1086 SER A CA  1 
ATOM   8537  C  C   . SER A 1 1086 ? -2.622  109.381 49.577  1.00 22.93 ? 1086 SER A C   1 
ATOM   8538  O  O   . SER A 1 1086 ? -1.409  109.323 49.356  1.00 22.96 ? 1086 SER A O   1 
ATOM   8539  C  CB  . SER A 1 1086 ? -3.853  111.063 50.930  1.00 22.60 ? 1086 SER A CB  1 
ATOM   8540  O  OG  . SER A 1 1086 ? -4.898  110.198 51.324  1.00 25.28 ? 1086 SER A OG  1 
ATOM   8541  N  N   . ASP A 1 1087 ? -3.342  108.302 49.871  1.00 23.21 ? 1087 ASP A N   1 
ATOM   8542  C  CA  . ASP A 1 1087 ? -2.698  106.995 49.974  1.00 22.66 ? 1087 ASP A CA  1 
ATOM   8543  C  C   . ASP A 1 1087 ? -2.000  106.547 48.685  1.00 22.37 ? 1087 ASP A C   1 
ATOM   8544  O  O   . ASP A 1 1087 ? -0.804  106.262 48.706  1.00 22.11 ? 1087 ASP A O   1 
ATOM   8545  C  CB  . ASP A 1 1087 ? -3.691  105.924 50.451  1.00 21.83 ? 1087 ASP A CB  1 
ATOM   8546  C  CG  . ASP A 1 1087 ? -3.053  104.540 50.562  1.00 23.19 ? 1087 ASP A CG  1 
ATOM   8547  O  OD1 . ASP A 1 1087 ? -2.036  104.392 51.284  1.00 23.45 ? 1087 ASP A OD1 1 
ATOM   8548  O  OD2 . ASP A 1 1087 ? -3.568  103.598 49.917  1.00 22.98 ? 1087 ASP A OD2 1 
ATOM   8549  N  N   . PRO A 1 1088 ? -2.723  106.485 47.552  1.00 22.18 ? 1088 PRO A N   1 
ATOM   8550  C  CA  . PRO A 1 1088 ? -2.095  106.061 46.296  1.00 22.50 ? 1088 PRO A CA  1 
ATOM   8551  C  C   . PRO A 1 1088 ? -0.912  106.941 45.898  1.00 22.80 ? 1088 PRO A C   1 
ATOM   8552  O  O   . PRO A 1 1088 ? 0.074   106.447 45.379  1.00 21.92 ? 1088 PRO A O   1 
ATOM   8553  C  CB  . PRO A 1 1088 ? -3.232  106.162 45.278  1.00 21.67 ? 1088 PRO A CB  1 
ATOM   8554  C  CG  . PRO A 1 1088 ? -4.448  105.938 46.102  1.00 22.79 ? 1088 PRO A CG  1 
ATOM   8555  C  CD  . PRO A 1 1088 ? -4.167  106.712 47.363  1.00 23.60 ? 1088 PRO A CD  1 
ATOM   8556  N  N   . PHE A 1 1089 ? -1.017  108.243 46.149  1.00 22.68 ? 1089 PHE A N   1 
ATOM   8557  C  CA  . PHE A 1 1089 ? 0.035   109.196 45.783  1.00 23.21 ? 1089 PHE A CA  1 
ATOM   8558  C  C   . PHE A 1 1089 ? 1.326   109.023 46.591  1.00 22.84 ? 1089 PHE A C   1 
ATOM   8559  O  O   . PHE A 1 1089 ? 2.424   109.016 46.038  1.00 22.22 ? 1089 PHE A O   1 
ATOM   8560  C  CB  . PHE A 1 1089 ? -0.472  110.640 45.950  1.00 20.87 ? 1089 PHE A CB  1 
ATOM   8561  C  CG  . PHE A 1 1089 ? 0.539   111.683 45.566  1.00 20.25 ? 1089 PHE A CG  1 
ATOM   8562  C  CD1 . PHE A 1 1089 ? 0.966   111.799 44.248  1.00 20.52 ? 1089 PHE A CD1 1 
ATOM   8563  C  CD2 . PHE A 1 1089 ? 1.097   112.522 46.527  1.00 19.86 ? 1089 PHE A CD2 1 
ATOM   8564  C  CE1 . PHE A 1 1089 ? 1.927   112.733 43.885  1.00 18.28 ? 1089 PHE A CE1 1 
ATOM   8565  C  CE2 . PHE A 1 1089 ? 2.068   113.470 46.176  1.00 18.57 ? 1089 PHE A CE2 1 
ATOM   8566  C  CZ  . PHE A 1 1089 ? 2.485   113.572 44.854  1.00 20.79 ? 1089 PHE A CZ  1 
ATOM   8567  N  N   . LEU A 1 1090 ? 1.177   108.918 47.905  1.00 22.39 ? 1090 LEU A N   1 
ATOM   8568  C  CA  . LEU A 1 1090 ? 2.318   108.758 48.781  1.00 23.02 ? 1090 LEU A CA  1 
ATOM   8569  C  C   . LEU A 1 1090 ? 2.978   107.403 48.516  1.00 24.58 ? 1090 LEU A C   1 
ATOM   8570  O  O   . LEU A 1 1090 ? 4.210   107.280 48.547  1.00 24.59 ? 1090 LEU A O   1 
ATOM   8571  C  CB  . LEU A 1 1090 ? 1.879   108.906 50.244  1.00 22.41 ? 1090 LEU A CB  1 
ATOM   8572  C  CG  . LEU A 1 1090 ? 1.276   110.284 50.577  1.00 20.72 ? 1090 LEU A CG  1 
ATOM   8573  C  CD1 . LEU A 1 1090 ? 0.844   110.338 52.040  1.00 18.16 ? 1090 LEU A CD1 1 
ATOM   8574  C  CD2 . LEU A 1 1090 ? 2.287   111.376 50.278  1.00 19.07 ? 1090 LEU A CD2 1 
ATOM   8575  N  N   . LYS A 1 1091 ? 2.168   106.391 48.215  1.00 25.46 ? 1091 LYS A N   1 
ATOM   8576  C  CA  . LYS A 1 1091 ? 2.710   105.070 47.932  1.00 24.59 ? 1091 LYS A CA  1 
ATOM   8577  C  C   . LYS A 1 1091 ? 3.529   105.149 46.655  1.00 25.54 ? 1091 LYS A C   1 
ATOM   8578  O  O   . LYS A 1 1091 ? 4.625   104.594 46.570  1.00 28.35 ? 1091 LYS A O   1 
ATOM   8579  C  CB  . LYS A 1 1091 ? 1.584   104.055 47.769  1.00 24.53 ? 1091 LYS A CB  1 
ATOM   8580  C  CG  . LYS A 1 1091 ? 0.983   103.537 49.072  1.00 24.27 ? 1091 LYS A CG  1 
ATOM   8581  C  CD  . LYS A 1 1091 ? 1.954   102.631 49.800  1.00 26.46 ? 1091 LYS A CD  1 
ATOM   8582  C  CE  . LYS A 1 1091 ? 1.300   101.954 51.017  1.00 29.25 ? 1091 LYS A CE  1 
ATOM   8583  N  NZ  . LYS A 1 1091 ? 0.531   102.892 51.887  1.00 30.28 ? 1091 LYS A NZ  1 
ATOM   8584  N  N   . MET A 1 1092 ? 2.992   105.847 45.660  1.00 25.46 ? 1092 MET A N   1 
ATOM   8585  C  CA  . MET A 1 1092 ? 3.676   106.016 44.387  1.00 25.68 ? 1092 MET A CA  1 
ATOM   8586  C  C   . MET A 1 1092 ? 5.009   106.734 44.593  1.00 26.04 ? 1092 MET A C   1 
ATOM   8587  O  O   . MET A 1 1092 ? 6.052   106.298 44.106  1.00 24.02 ? 1092 MET A O   1 
ATOM   8588  C  CB  . MET A 1 1092 ? 2.800   106.833 43.432  1.00 27.99 ? 1092 MET A CB  1 
ATOM   8589  C  CG  . MET A 1 1092 ? 3.502   107.316 42.158  1.00 31.20 ? 1092 MET A CG  1 
ATOM   8590  S  SD  . MET A 1 1092 ? 3.931   105.957 41.079  1.00 34.89 ? 1092 MET A SD  1 
ATOM   8591  C  CE  . MET A 1 1092 ? 2.321   105.642 40.321  1.00 36.61 ? 1092 MET A CE  1 
ATOM   8592  N  N   . VAL A 1 1093 ? 4.946   107.835 45.331  1.00 25.17 ? 1093 VAL A N   1 
ATOM   8593  C  CA  . VAL A 1 1093 ? 6.102   108.661 45.611  1.00 25.84 ? 1093 VAL A CA  1 
ATOM   8594  C  C   . VAL A 1 1093 ? 7.155   107.997 46.478  1.00 24.07 ? 1093 VAL A C   1 
ATOM   8595  O  O   . VAL A 1 1093 ? 8.326   107.998 46.130  1.00 23.13 ? 1093 VAL A O   1 
ATOM   8596  C  CB  . VAL A 1 1093 ? 5.662   109.973 46.263  1.00 27.13 ? 1093 VAL A CB  1 
ATOM   8597  C  CG1 . VAL A 1 1093 ? 6.869   110.792 46.647  1.00 28.92 ? 1093 VAL A CG1 1 
ATOM   8598  C  CG2 . VAL A 1 1093 ? 4.789   110.752 45.283  1.00 25.33 ? 1093 VAL A CG2 1 
ATOM   8599  N  N   . SER A 1 1094 ? 6.739   107.418 47.597  1.00 24.41 ? 1094 SER A N   1 
ATOM   8600  C  CA  . SER A 1 1094 ? 7.673   106.766 48.507  1.00 23.62 ? 1094 SER A CA  1 
ATOM   8601  C  C   . SER A 1 1094 ? 8.227   105.455 47.961  1.00 24.94 ? 1094 SER A C   1 
ATOM   8602  O  O   . SER A 1 1094 ? 9.441   105.227 47.982  1.00 25.04 ? 1094 SER A O   1 
ATOM   8603  C  CB  . SER A 1 1094 ? 7.009   106.509 49.865  1.00 22.38 ? 1094 SER A CB  1 
ATOM   8604  O  OG  . SER A 1 1094 ? 5.882   105.668 49.741  1.00 21.32 ? 1094 SER A OG  1 
ATOM   8605  N  N   . VAL A 1 1095 ? 7.340   104.595 47.474  1.00 25.83 ? 1095 VAL A N   1 
ATOM   8606  C  CA  . VAL A 1 1095 ? 7.756   103.306 46.937  1.00 26.21 ? 1095 VAL A CA  1 
ATOM   8607  C  C   . VAL A 1 1095 ? 8.436   103.445 45.586  1.00 25.12 ? 1095 VAL A C   1 
ATOM   8608  O  O   . VAL A 1 1095 ? 9.482   102.843 45.342  1.00 26.10 ? 1095 VAL A O   1 
ATOM   8609  C  CB  . VAL A 1 1095 ? 6.545   102.353 46.795  1.00 26.95 ? 1095 VAL A CB  1 
ATOM   8610  C  CG1 . VAL A 1 1095 ? 6.964   101.072 46.097  1.00 25.98 ? 1095 VAL A CG1 1 
ATOM   8611  C  CG2 . VAL A 1 1095 ? 5.964   102.050 48.168  1.00 24.58 ? 1095 VAL A CG2 1 
ATOM   8612  N  N   . GLY A 1 1096 ? 7.831   104.239 44.709  1.00 25.11 ? 1096 GLY A N   1 
ATOM   8613  C  CA  . GLY A 1 1096 ? 8.383   104.440 43.385  1.00 23.47 ? 1096 GLY A CA  1 
ATOM   8614  C  C   . GLY A 1 1096 ? 7.694   103.560 42.359  1.00 22.89 ? 1096 GLY A C   1 
ATOM   8615  O  O   . GLY A 1 1096 ? 7.274   102.447 42.677  1.00 22.67 ? 1096 GLY A O   1 
ATOM   8616  N  N   . PRO A 1 1097 ? 7.573   104.022 41.106  1.00 23.54 ? 1097 PRO A N   1 
ATOM   8617  C  CA  . PRO A 1 1097 ? 6.913   103.195 40.086  1.00 24.08 ? 1097 PRO A CA  1 
ATOM   8618  C  C   . PRO A 1 1097 ? 7.758   101.996 39.638  1.00 24.29 ? 1097 PRO A C   1 
ATOM   8619  O  O   . PRO A 1 1097 ? 8.981   102.019 39.736  1.00 25.30 ? 1097 PRO A O   1 
ATOM   8620  C  CB  . PRO A 1 1097 ? 6.701   104.183 38.943  1.00 23.42 ? 1097 PRO A CB  1 
ATOM   8621  C  CG  . PRO A 1 1097 ? 7.964   105.022 39.027  1.00 23.68 ? 1097 PRO A CG  1 
ATOM   8622  C  CD  . PRO A 1 1097 ? 8.082   105.282 40.524  1.00 22.43 ? 1097 PRO A CD  1 
ATOM   8623  N  N   . MET A 1 1098 ? 7.085   100.953 39.163  1.00 25.19 ? 1098 MET A N   1 
ATOM   8624  C  CA  . MET A 1 1098 ? 7.748   99.766  38.641  1.00 26.07 ? 1098 MET A CA  1 
ATOM   8625  C  C   . MET A 1 1098 ? 8.246   100.186 37.244  1.00 26.44 ? 1098 MET A C   1 
ATOM   8626  O  O   . MET A 1 1098 ? 7.448   100.355 36.318  1.00 27.05 ? 1098 MET A O   1 
ATOM   8627  C  CB  . MET A 1 1098 ? 6.735   98.614  38.518  1.00 27.03 ? 1098 MET A CB  1 
ATOM   8628  C  CG  . MET A 1 1098 ? 7.232   97.423  37.721  1.00 28.33 ? 1098 MET A CG  1 
ATOM   8629  S  SD  . MET A 1 1098 ? 8.754   96.713  38.383  1.00 30.34 ? 1098 MET A SD  1 
ATOM   8630  C  CE  . MET A 1 1098 ? 8.675   95.041  37.667  1.00 29.31 ? 1098 MET A CE  1 
ATOM   8631  N  N   . LEU A 1 1099 ? 9.554   100.351 37.086  1.00 23.87 ? 1099 LEU A N   1 
ATOM   8632  C  CA  . LEU A 1 1099 ? 10.081  100.790 35.807  1.00 22.39 ? 1099 LEU A CA  1 
ATOM   8633  C  C   . LEU A 1 1099 ? 10.543  99.714  34.825  1.00 22.43 ? 1099 LEU A C   1 
ATOM   8634  O  O   . LEU A 1 1099 ? 11.295  99.990  33.889  1.00 20.81 ? 1099 LEU A O   1 
ATOM   8635  C  CB  . LEU A 1 1099 ? 11.187  101.813 36.044  1.00 22.11 ? 1099 LEU A CB  1 
ATOM   8636  C  CG  . LEU A 1 1099 ? 10.705  103.131 36.665  1.00 20.97 ? 1099 LEU A CG  1 
ATOM   8637  C  CD1 . LEU A 1 1099 ? 11.899  103.980 37.014  1.00 21.45 ? 1099 LEU A CD1 1 
ATOM   8638  C  CD2 . LEU A 1 1099 ? 9.799   103.863 35.690  1.00 17.47 ? 1099 LEU A CD2 1 
ATOM   8639  N  N   . GLN A 1 1100 ? 10.069  98.489  35.020  1.00 22.30 ? 1100 GLN A N   1 
ATOM   8640  C  CA  . GLN A 1 1100 ? 10.411  97.411  34.102  1.00 21.37 ? 1100 GLN A CA  1 
ATOM   8641  C  C   . GLN A 1 1100 ? 9.201   96.568  33.749  1.00 20.87 ? 1100 GLN A C   1 
ATOM   8642  O  O   . GLN A 1 1100 ? 8.286   96.410  34.552  1.00 21.54 ? 1100 GLN A O   1 
ATOM   8643  C  CB  . GLN A 1 1100 ? 11.494  96.504  34.698  1.00 21.90 ? 1100 GLN A CB  1 
ATOM   8644  C  CG  . GLN A 1 1100 ? 11.583  95.136  33.994  1.00 24.06 ? 1100 GLN A CG  1 
ATOM   8645  C  CD  . GLN A 1 1100 ? 12.857  94.344  34.311  1.00 25.58 ? 1100 GLN A CD  1 
ATOM   8646  O  OE1 . GLN A 1 1100 ? 13.192  94.089  35.476  1.00 25.07 ? 1100 GLN A OE1 1 
ATOM   8647  N  NE2 . GLN A 1 1100 ? 13.567  93.945  33.262  1.00 23.26 ? 1100 GLN A NE2 1 
ATOM   8648  N  N   . SER A 1 1101 ? 9.198   96.029  32.538  1.00 21.81 ? 1101 SER A N   1 
ATOM   8649  C  CA  . SER A 1 1101 ? 8.117   95.157  32.113  1.00 22.41 ? 1101 SER A CA  1 
ATOM   8650  C  C   . SER A 1 1101 ? 8.008   94.043  33.144  1.00 22.57 ? 1101 SER A C   1 
ATOM   8651  O  O   . SER A 1 1101 ? 8.993   93.369  33.440  1.00 24.96 ? 1101 SER A O   1 
ATOM   8652  C  CB  . SER A 1 1101 ? 8.434   94.552  30.751  1.00 23.01 ? 1101 SER A CB  1 
ATOM   8653  O  OG  . SER A 1 1101 ? 7.797   93.296  30.597  1.00 23.83 ? 1101 SER A OG  1 
ATOM   8654  N  N   . THR A 1 1102 ? 6.815   93.847  33.687  1.00 23.25 ? 1102 THR A N   1 
ATOM   8655  C  CA  . THR A 1 1102 ? 6.591   92.814  34.681  1.00 23.47 ? 1102 THR A CA  1 
ATOM   8656  C  C   . THR A 1 1102 ? 6.786   91.399  34.127  1.00 24.93 ? 1102 THR A C   1 
ATOM   8657  O  O   . THR A 1 1102 ? 7.060   90.459  34.871  1.00 23.95 ? 1102 THR A O   1 
ATOM   8658  C  CB  . THR A 1 1102 ? 5.187   92.951  35.265  1.00 24.19 ? 1102 THR A CB  1 
ATOM   8659  O  OG1 . THR A 1 1102 ? 4.213   92.857  34.219  1.00 24.49 ? 1102 THR A OG1 1 
ATOM   8660  C  CG2 . THR A 1 1102 ? 5.045   94.292  35.955  1.00 24.67 ? 1102 THR A CG2 1 
ATOM   8661  N  N   . ARG A 1 1103 ? 6.661   91.246  32.815  1.00 28.40 ? 1103 ARG A N   1 
ATOM   8662  C  CA  . ARG A 1 1103 ? 6.839   89.939  32.199  1.00 30.54 ? 1103 ARG A CA  1 
ATOM   8663  C  C   . ARG A 1 1103 ? 8.323   89.589  32.218  1.00 30.30 ? 1103 ARG A C   1 
ATOM   8664  O  O   . ARG A 1 1103 ? 8.708   88.460  32.532  1.00 30.71 ? 1103 ARG A O   1 
ATOM   8665  C  CB  . ARG A 1 1103 ? 6.326   89.948  30.756  1.00 34.63 ? 1103 ARG A CB  1 
ATOM   8666  C  CG  . ARG A 1 1103 ? 6.321   88.576  30.112  1.00 40.64 ? 1103 ARG A CG  1 
ATOM   8667  C  CD  . ARG A 1 1103 ? 5.988   88.656  28.618  1.00 46.25 ? 1103 ARG A CD  1 
ATOM   8668  N  NE  . ARG A 1 1103 ? 5.679   87.344  28.039  1.00 51.63 ? 1103 ARG A NE  1 
ATOM   8669  C  CZ  . ARG A 1 1103 ? 4.591   86.632  28.331  1.00 53.45 ? 1103 ARG A CZ  1 
ATOM   8670  N  NH1 . ARG A 1 1103 ? 3.698   87.104  29.199  1.00 54.08 ? 1103 ARG A NH1 1 
ATOM   8671  N  NH2 . ARG A 1 1103 ? 4.397   85.447  27.756  1.00 52.99 ? 1103 ARG A NH2 1 
ATOM   8672  N  N   . LYS A 1 1104 ? 9.153   90.569  31.884  1.00 29.01 ? 1104 LYS A N   1 
ATOM   8673  C  CA  . LYS A 1 1104 ? 10.590  90.355  31.860  1.00 30.01 ? 1104 LYS A CA  1 
ATOM   8674  C  C   . LYS A 1 1104 ? 11.135  90.214  33.269  1.00 29.84 ? 1104 LYS A C   1 
ATOM   8675  O  O   . LYS A 1 1104 ? 12.113  89.500  33.493  1.00 31.67 ? 1104 LYS A O   1 
ATOM   8676  C  CB  . LYS A 1 1104 ? 11.292  91.514  31.147  1.00 31.88 ? 1104 LYS A CB  1 
ATOM   8677  C  CG  . LYS A 1 1104 ? 11.239  91.457  29.625  1.00 35.70 ? 1104 LYS A CG  1 
ATOM   8678  C  CD  . LYS A 1 1104 ? 12.214  90.439  29.045  1.00 38.18 ? 1104 LYS A CD  1 
ATOM   8679  C  CE  . LYS A 1 1104 ? 12.124  90.434  27.520  1.00 41.16 ? 1104 LYS A CE  1 
ATOM   8680  N  NZ  . LYS A 1 1104 ? 13.397  89.980  26.879  1.00 43.68 ? 1104 LYS A NZ  1 
ATOM   8681  N  N   . TYR A 1 1105 ? 10.517  90.902  34.221  1.00 26.99 ? 1105 TYR A N   1 
ATOM   8682  C  CA  . TYR A 1 1105 ? 10.971  90.807  35.594  1.00 25.33 ? 1105 TYR A CA  1 
ATOM   8683  C  C   . TYR A 1 1105 ? 10.705  89.399  36.139  1.00 26.20 ? 1105 TYR A C   1 
ATOM   8684  O  O   . TYR A 1 1105 ? 11.626  88.695  36.568  1.00 23.19 ? 1105 TYR A O   1 
ATOM   8685  C  CB  . TYR A 1 1105 ? 10.244  91.818  36.471  1.00 25.47 ? 1105 TYR A CB  1 
ATOM   8686  C  CG  . TYR A 1 1105 ? 10.617  91.701  37.928  1.00 24.33 ? 1105 TYR A CG  1 
ATOM   8687  C  CD1 . TYR A 1 1105 ? 11.765  92.322  38.419  1.00 24.39 ? 1105 TYR A CD1 1 
ATOM   8688  C  CD2 . TYR A 1 1105 ? 9.867   90.919  38.797  1.00 22.63 ? 1105 TYR A CD2 1 
ATOM   8689  C  CE1 . TYR A 1 1105 ? 12.159  92.168  39.731  1.00 23.46 ? 1105 TYR A CE1 1 
ATOM   8690  C  CE2 . TYR A 1 1105 ? 10.250  90.755  40.113  1.00 22.98 ? 1105 TYR A CE2 1 
ATOM   8691  C  CZ  . TYR A 1 1105 ? 11.399  91.380  40.580  1.00 24.52 ? 1105 TYR A CZ  1 
ATOM   8692  O  OH  . TYR A 1 1105 ? 11.794  91.202  41.893  1.00 24.33 ? 1105 TYR A OH  1 
ATOM   8693  N  N   . PHE A 1 1106 ? 9.436   88.996  36.122  1.00 26.63 ? 1106 PHE A N   1 
ATOM   8694  C  CA  . PHE A 1 1106 ? 9.058   87.685  36.632  1.00 28.03 ? 1106 PHE A CA  1 
ATOM   8695  C  C   . PHE A 1 1106 ? 9.603   86.511  35.835  1.00 28.80 ? 1106 PHE A C   1 
ATOM   8696  O  O   . PHE A 1 1106 ? 9.683   85.400  36.356  1.00 28.62 ? 1106 PHE A O   1 
ATOM   8697  C  CB  . PHE A 1 1106 ? 7.533   87.587  36.762  1.00 27.77 ? 1106 PHE A CB  1 
ATOM   8698  C  CG  . PHE A 1 1106 ? 6.977   88.383  37.908  1.00 28.00 ? 1106 PHE A CG  1 
ATOM   8699  C  CD1 . PHE A 1 1106 ? 7.079   87.916  39.208  1.00 27.31 ? 1106 PHE A CD1 1 
ATOM   8700  C  CD2 . PHE A 1 1106 ? 6.391   89.625  37.692  1.00 28.04 ? 1106 PHE A CD2 1 
ATOM   8701  C  CE1 . PHE A 1 1106 ? 6.601   88.670  40.273  1.00 27.99 ? 1106 PHE A CE1 1 
ATOM   8702  C  CE2 . PHE A 1 1106 ? 5.911   90.385  38.754  1.00 28.05 ? 1106 PHE A CE2 1 
ATOM   8703  C  CZ  . PHE A 1 1106 ? 6.022   89.905  40.047  1.00 27.70 ? 1106 PHE A CZ  1 
ATOM   8704  N  N   . ALA A 1 1107 ? 9.981   86.740  34.580  1.00 30.56 ? 1107 ALA A N   1 
ATOM   8705  C  CA  . ALA A 1 1107 ? 10.545  85.661  33.782  1.00 32.50 ? 1107 ALA A CA  1 
ATOM   8706  C  C   . ALA A 1 1107 ? 11.929  85.316  34.361  1.00 33.56 ? 1107 ALA A C   1 
ATOM   8707  O  O   . ALA A 1 1107 ? 12.538  84.296  34.007  1.00 34.80 ? 1107 ALA A O   1 
ATOM   8708  C  CB  . ALA A 1 1107 ? 10.666  86.083  32.339  1.00 31.26 ? 1107 ALA A CB  1 
ATOM   8709  N  N   . GLN A 1 1108 ? 12.412  86.163  35.268  1.00 32.87 ? 1108 GLN A N   1 
ATOM   8710  C  CA  . GLN A 1 1108 ? 13.709  85.941  35.893  1.00 33.44 ? 1108 GLN A CA  1 
ATOM   8711  C  C   . GLN A 1 1108 ? 13.574  85.241  37.238  1.00 33.12 ? 1108 GLN A C   1 
ATOM   8712  O  O   . GLN A 1 1108 ? 14.565  85.049  37.946  1.00 33.76 ? 1108 GLN A O   1 
ATOM   8713  C  CB  . GLN A 1 1108 ? 14.450  87.273  36.083  1.00 35.70 ? 1108 GLN A CB  1 
ATOM   8714  C  CG  . GLN A 1 1108 ? 14.852  87.962  34.777  1.00 39.09 ? 1108 GLN A CG  1 
ATOM   8715  C  CD  . GLN A 1 1108 ? 15.819  87.119  33.940  1.00 41.49 ? 1108 GLN A CD  1 
ATOM   8716  O  OE1 . GLN A 1 1108 ? 16.931  86.808  34.374  1.00 41.85 ? 1108 GLN A OE1 1 
ATOM   8717  N  NE2 . GLN A 1 1108 ? 15.391  86.743  32.742  1.00 41.73 ? 1108 GLN A NE2 1 
ATOM   8718  N  N   . THR A 1 1109 ? 12.353  84.860  37.600  1.00 32.01 ? 1109 THR A N   1 
ATOM   8719  C  CA  . THR A 1 1109 ? 12.132  84.182  38.878  1.00 30.40 ? 1109 THR A CA  1 
ATOM   8720  C  C   . THR A 1 1109 ? 11.778  82.696  38.718  1.00 30.09 ? 1109 THR A C   1 
ATOM   8721  O  O   . THR A 1 1109 ? 11.218  82.072  39.624  1.00 30.22 ? 1109 THR A O   1 
ATOM   8722  C  CB  . THR A 1 1109 ? 11.008  84.858  39.669  1.00 29.80 ? 1109 THR A CB  1 
ATOM   8723  O  OG1 . THR A 1 1109 ? 9.819   84.886  38.869  1.00 29.50 ? 1109 THR A OG1 1 
ATOM   8724  C  CG2 . THR A 1 1109 ? 11.405  86.260  40.062  1.00 27.19 ? 1109 THR A CG2 1 
ATOM   8725  N  N   . LEU A 1 1110 ? 12.110  82.130  37.569  1.00 29.02 ? 1110 LEU A N   1 
ATOM   8726  C  CA  . LEU A 1 1110 ? 11.811  80.737  37.299  1.00 29.83 ? 1110 LEU A CA  1 
ATOM   8727  C  C   . LEU A 1 1110 ? 12.985  80.041  36.647  1.00 30.37 ? 1110 LEU A C   1 
ATOM   8728  O  O   . LEU A 1 1110 ? 13.694  80.631  35.833  1.00 31.41 ? 1110 LEU A O   1 
ATOM   8729  C  CB  . LEU A 1 1110 ? 10.599  80.642  36.370  1.00 30.66 ? 1110 LEU A CB  1 
ATOM   8730  C  CG  . LEU A 1 1110 ? 9.249   81.074  36.959  1.00 31.83 ? 1110 LEU A CG  1 
ATOM   8731  C  CD1 . LEU A 1 1110 ? 8.251   81.303  35.834  1.00 29.52 ? 1110 LEU A CD1 1 
ATOM   8732  C  CD2 . LEU A 1 1110 ? 8.747   80.006  37.938  1.00 29.89 ? 1110 LEU A CD2 1 
ATOM   8733  N  N   . PHE A 1 1111 ? 13.198  78.778  36.988  1.00 30.16 ? 1111 PHE A N   1 
ATOM   8734  C  CA  . PHE A 1 1111 ? 14.289  78.057  36.363  1.00 29.98 ? 1111 PHE A CA  1 
ATOM   8735  C  C   . PHE A 1 1111 ? 13.905  77.686  34.945  1.00 30.46 ? 1111 PHE A C   1 
ATOM   8736  O  O   . PHE A 1 1111 ? 14.762  77.632  34.075  1.00 32.29 ? 1111 PHE A O   1 
ATOM   8737  C  CB  . PHE A 1 1111 ? 14.649  76.814  37.164  1.00 28.41 ? 1111 PHE A CB  1 
ATOM   8738  C  CG  . PHE A 1 1111 ? 15.260  77.121  38.484  1.00 26.73 ? 1111 PHE A CG  1 
ATOM   8739  C  CD1 . PHE A 1 1111 ? 16.458  77.823  38.555  1.00 25.09 ? 1111 PHE A CD1 1 
ATOM   8740  C  CD2 . PHE A 1 1111 ? 14.647  76.710  39.663  1.00 26.18 ? 1111 PHE A CD2 1 
ATOM   8741  C  CE1 . PHE A 1 1111 ? 17.038  78.114  39.781  1.00 26.59 ? 1111 PHE A CE1 1 
ATOM   8742  C  CE2 . PHE A 1 1111 ? 15.222  76.997  40.897  1.00 26.47 ? 1111 PHE A CE2 1 
ATOM   8743  C  CZ  . PHE A 1 1111 ? 16.421  77.701  40.955  1.00 26.57 ? 1111 PHE A CZ  1 
ATOM   8744  N  N   . MET A 1 1112 ? 12.613  77.454  34.721  1.00 32.00 ? 1112 MET A N   1 
ATOM   8745  C  CA  . MET A 1 1112 ? 12.077  77.093  33.402  1.00 33.29 ? 1112 MET A CA  1 
ATOM   8746  C  C   . MET A 1 1112 ? 10.870  77.952  33.027  1.00 34.03 ? 1112 MET A C   1 
ATOM   8747  O  O   . MET A 1 1112 ? 9.865   77.967  33.733  1.00 33.69 ? 1112 MET A O   1 
ATOM   8748  C  CB  . MET A 1 1112 ? 11.643  75.631  33.371  1.00 34.73 ? 1112 MET A CB  1 
ATOM   8749  C  CG  . MET A 1 1112 ? 12.774  74.622  33.429  1.00 38.59 ? 1112 MET A CG  1 
ATOM   8750  S  SD  . MET A 1 1112 ? 12.124  72.989  33.837  1.00 42.36 ? 1112 MET A SD  1 
ATOM   8751  C  CE  . MET A 1 1112 ? 11.512  72.445  32.227  1.00 43.84 ? 1112 MET A CE  1 
ATOM   8752  N  N   . ALA A 1 1113 ? 10.979  78.647  31.900  1.00 33.74 ? 1113 ALA A N   1 
ATOM   8753  C  CA  . ALA A 1 1113 ? 9.923   79.522  31.393  1.00 33.30 ? 1113 ALA A CA  1 
ATOM   8754  C  C   . ALA A 1 1113 ? 8.609   78.812  31.066  1.00 33.00 ? 1113 ALA A C   1 
ATOM   8755  O  O   . ALA A 1 1113 ? 7.536   79.251  31.466  1.00 33.12 ? 1113 ALA A O   1 
ATOM   8756  C  CB  . ALA A 1 1113 ? 10.424  80.249  30.147  1.00 34.91 ? 1113 ALA A CB  1 
ATOM   8757  N  N   . LYS A 1 1114 ? 8.685   77.722  30.321  1.00 33.01 ? 1114 LYS A N   1 
ATOM   8758  C  CA  . LYS A 1 1114 ? 7.469   77.023  29.959  1.00 33.17 ? 1114 LYS A CA  1 
ATOM   8759  C  C   . LYS A 1 1114 ? 7.521   75.515  30.145  1.00 31.46 ? 1114 LYS A C   1 
ATOM   8760  O  O   . LYS A 1 1114 ? 8.579   74.946  30.404  1.00 31.32 ? 1114 LYS A O   1 
ATOM   8761  C  CB  . LYS A 1 1114 ? 7.072   77.375  28.507  1.00 35.83 ? 1114 LYS A CB  1 
ATOM   8762  C  CG  . LYS A 1 1114 ? 8.176   77.278  27.450  1.00 37.21 ? 1114 LYS A CG  1 
ATOM   8763  C  CD  . LYS A 1 1114 ? 7.619   77.530  26.042  1.00 40.16 ? 1114 LYS A CD  1 
ATOM   8764  C  CE  . LYS A 1 1114 ? 8.686   77.268  24.946  1.00 42.10 ? 1114 LYS A CE  1 
ATOM   8765  N  NZ  . LYS A 1 1114 ? 8.208   77.485  23.522  1.00 41.11 ? 1114 LYS A NZ  1 
ATOM   8766  N  N   . THR A 1 1115 ? 6.357   74.880  30.038  1.00 29.29 ? 1115 THR A N   1 
ATOM   8767  C  CA  . THR A 1 1115 ? 6.248   73.437  30.174  1.00 27.27 ? 1115 THR A CA  1 
ATOM   8768  C  C   . THR A 1 1115 ? 4.977   72.988  29.471  1.00 28.07 ? 1115 THR A C   1 
ATOM   8769  O  O   . THR A 1 1115 ? 4.311   73.775  28.811  1.00 26.95 ? 1115 THR A O   1 
ATOM   8770  C  CB  . THR A 1 1115 ? 6.171   73.009  31.654  1.00 27.73 ? 1115 THR A CB  1 
ATOM   8771  O  OG1 . THR A 1 1115 ? 6.153   71.579  31.742  1.00 25.18 ? 1115 THR A OG1 1 
ATOM   8772  C  CG2 . THR A 1 1115 ? 4.908   73.578  32.313  1.00 27.93 ? 1115 THR A CG2 1 
ATOM   8773  N  N   . VAL A 1 1116 ? 4.635   71.718  29.615  1.00 28.69 ? 1116 VAL A N   1 
ATOM   8774  C  CA  . VAL A 1 1116 ? 3.432   71.203  28.989  1.00 30.77 ? 1116 VAL A CA  1 
ATOM   8775  C  C   . VAL A 1 1116 ? 2.208   71.948  29.495  1.00 31.99 ? 1116 VAL A C   1 
ATOM   8776  O  O   . VAL A 1 1116 ? 2.099   72.229  30.686  1.00 32.65 ? 1116 VAL A O   1 
ATOM   8777  C  CB  . VAL A 1 1116 ? 3.257   69.707  29.297  1.00 31.45 ? 1116 VAL A CB  1 
ATOM   8778  C  CG1 . VAL A 1 1116 ? 1.818   69.293  29.101  1.00 32.80 ? 1116 VAL A CG1 1 
ATOM   8779  C  CG2 . VAL A 1 1116 ? 4.171   68.889  28.405  1.00 30.43 ? 1116 VAL A CG2 1 
ATOM   8780  N  N   . SER A 1 1117 ? 1.293   72.278  28.590  1.00 33.76 ? 1117 SER A N   1 
ATOM   8781  C  CA  . SER A 1 1117 ? 0.066   72.956  28.992  1.00 34.99 ? 1117 SER A CA  1 
ATOM   8782  C  C   . SER A 1 1117 ? -0.636  71.935  29.862  1.00 35.16 ? 1117 SER A C   1 
ATOM   8783  O  O   . SER A 1 1117 ? -0.910  70.821  29.414  1.00 36.40 ? 1117 SER A O   1 
ATOM   8784  C  CB  . SER A 1 1117 ? -0.805  73.275  27.776  1.00 36.72 ? 1117 SER A CB  1 
ATOM   8785  O  OG  . SER A 1 1117 ? -1.979  73.968  28.161  1.00 38.08 ? 1117 SER A OG  1 
ATOM   8786  N  N   . GLY A 1 1118 ? -0.916  72.305  31.105  1.00 35.02 ? 1118 GLY A N   1 
ATOM   8787  C  CA  . GLY A 1 1118 ? -1.554  71.374  32.014  1.00 34.14 ? 1118 GLY A CA  1 
ATOM   8788  C  C   . GLY A 1 1118 ? -0.788  71.319  33.326  1.00 34.60 ? 1118 GLY A C   1 
ATOM   8789  O  O   . GLY A 1 1118 ? -1.319  70.854  34.346  1.00 35.25 ? 1118 GLY A O   1 
ATOM   8790  N  N   . LEU A 1 1119 ? 0.471   71.760  33.298  1.00 33.00 ? 1119 LEU A N   1 
ATOM   8791  C  CA  . LEU A 1 1119 ? 1.285   71.805  34.506  1.00 31.98 ? 1119 LEU A CA  1 
ATOM   8792  C  C   . LEU A 1 1119 ? 1.587   73.271  34.768  1.00 30.78 ? 1119 LEU A C   1 
ATOM   8793  O  O   . LEU A 1 1119 ? 1.526   74.094  33.866  1.00 29.01 ? 1119 LEU A O   1 
ATOM   8794  C  CB  . LEU A 1 1119 ? 2.589   71.010  34.343  1.00 30.83 ? 1119 LEU A CB  1 
ATOM   8795  C  CG  . LEU A 1 1119 ? 2.440   69.512  34.057  1.00 31.51 ? 1119 LEU A CG  1 
ATOM   8796  C  CD1 . LEU A 1 1119 ? 3.808   68.870  33.972  1.00 30.37 ? 1119 LEU A CD1 1 
ATOM   8797  C  CD2 . LEU A 1 1119 ? 1.621   68.852  35.141  1.00 28.54 ? 1119 LEU A CD2 1 
ATOM   8798  N  N   . ASP A 1 1120 ? 1.905   73.595  36.010  1.00 31.50 ? 1120 ASP A N   1 
ATOM   8799  C  CA  . ASP A 1 1120 ? 2.192   74.970  36.379  1.00 31.80 ? 1120 ASP A CA  1 
ATOM   8800  C  C   . ASP A 1 1120 ? 3.692   75.191  36.567  1.00 31.74 ? 1120 ASP A C   1 
ATOM   8801  O  O   . ASP A 1 1120 ? 4.321   74.576  37.437  1.00 31.24 ? 1120 ASP A O   1 
ATOM   8802  C  CB  . ASP A 1 1120 ? 1.446   75.314  37.673  1.00 31.87 ? 1120 ASP A CB  1 
ATOM   8803  C  CG  . ASP A 1 1120 ? 1.500   76.794  38.010  1.00 34.24 ? 1120 ASP A CG  1 
ATOM   8804  O  OD1 . ASP A 1 1120 ? 2.393   77.511  37.497  1.00 35.02 ? 1120 ASP A OD1 1 
ATOM   8805  O  OD2 . ASP A 1 1120 ? 0.649   77.243  38.804  1.00 35.71 ? 1120 ASP A OD2 1 
ATOM   8806  N  N   . VAL A 1 1121 ? 4.258   76.070  35.748  1.00 31.18 ? 1121 VAL A N   1 
ATOM   8807  C  CA  . VAL A 1 1121 ? 5.677   76.382  35.838  1.00 30.65 ? 1121 VAL A CA  1 
ATOM   8808  C  C   . VAL A 1 1121 ? 6.028   76.824  37.263  1.00 29.45 ? 1121 VAL A C   1 
ATOM   8809  O  O   . VAL A 1 1121 ? 7.094   76.482  37.772  1.00 29.70 ? 1121 VAL A O   1 
ATOM   8810  C  CB  . VAL A 1 1121 ? 6.070   77.497  34.823  1.00 30.85 ? 1121 VAL A CB  1 
ATOM   8811  C  CG1 . VAL A 1 1121 ? 7.488   77.950  35.076  1.00 33.95 ? 1121 VAL A CG1 1 
ATOM   8812  C  CG2 . VAL A 1 1121 ? 5.971   76.973  33.402  1.00 29.30 ? 1121 VAL A CG2 1 
ATOM   8813  N  N   . ASN A 1 1122 ? 5.132   77.576  37.906  1.00 28.01 ? 1122 ASN A N   1 
ATOM   8814  C  CA  . ASN A 1 1122 ? 5.381   78.038  39.268  1.00 27.74 ? 1122 ASN A CA  1 
ATOM   8815  C  C   . ASN A 1 1122 ? 5.333   76.872  40.238  1.00 27.17 ? 1122 ASN A C   1 
ATOM   8816  O  O   . ASN A 1 1122 ? 5.975   76.906  41.293  1.00 27.00 ? 1122 ASN A O   1 
ATOM   8817  C  CB  . ASN A 1 1122 ? 4.350   79.076  39.717  1.00 29.31 ? 1122 ASN A CB  1 
ATOM   8818  C  CG  . ASN A 1 1122 ? 4.475   80.388  38.982  1.00 31.04 ? 1122 ASN A CG  1 
ATOM   8819  O  OD1 . ASN A 1 1122 ? 5.578   80.883  38.737  1.00 33.44 ? 1122 ASN A OD1 1 
ATOM   8820  N  ND2 . ASN A 1 1122 ? 3.337   80.978  38.646  1.00 29.59 ? 1122 ASN A ND2 1 
ATOM   8821  N  N   . ALA A 1 1123 ? 4.564   75.845  39.893  1.00 25.51 ? 1123 ALA A N   1 
ATOM   8822  C  CA  . ALA A 1 1123 ? 4.457   74.680  40.756  1.00 25.44 ? 1123 ALA A CA  1 
ATOM   8823  C  C   . ALA A 1 1123 ? 5.749   73.873  40.677  1.00 27.15 ? 1123 ALA A C   1 
ATOM   8824  O  O   . ALA A 1 1123 ? 6.281   73.430  41.702  1.00 25.22 ? 1123 ALA A O   1 
ATOM   8825  C  CB  . ALA A 1 1123 ? 3.271   73.819  40.350  1.00 24.67 ? 1123 ALA A CB  1 
ATOM   8826  N  N   . ILE A 1 1124 ? 6.254   73.692  39.458  1.00 27.08 ? 1124 ILE A N   1 
ATOM   8827  C  CA  . ILE A 1 1124 ? 7.483   72.953  39.259  1.00 28.32 ? 1124 ILE A CA  1 
ATOM   8828  C  C   . ILE A 1 1124 ? 8.619   73.696  39.944  1.00 28.82 ? 1124 ILE A C   1 
ATOM   8829  O  O   . ILE A 1 1124 ? 9.459   73.091  40.626  1.00 29.07 ? 1124 ILE A O   1 
ATOM   8830  C  CB  . ILE A 1 1124 ? 7.794   72.792  37.759  1.00 28.89 ? 1124 ILE A CB  1 
ATOM   8831  C  CG1 . ILE A 1 1124 ? 6.653   72.012  37.085  1.00 28.94 ? 1124 ILE A CG1 1 
ATOM   8832  C  CG2 . ILE A 1 1124 ? 9.126   72.056  37.568  1.00 25.93 ? 1124 ILE A CG2 1 
ATOM   8833  C  CD1 . ILE A 1 1124 ? 6.855   71.754  35.615  1.00 28.21 ? 1124 ILE A CD1 1 
ATOM   8834  N  N   . ASP A 1 1125 ? 8.627   75.015  39.789  1.00 28.52 ? 1125 ASP A N   1 
ATOM   8835  C  CA  . ASP A 1 1125 ? 9.674   75.819  40.399  1.00 28.30 ? 1125 ASP A CA  1 
ATOM   8836  C  C   . ASP A 1 1125 ? 9.576   75.686  41.913  1.00 28.38 ? 1125 ASP A C   1 
ATOM   8837  O  O   . ASP A 1 1125 ? 10.587  75.712  42.611  1.00 28.82 ? 1125 ASP A O   1 
ATOM   8838  C  CB  . ASP A 1 1125 ? 9.543   77.284  39.976  1.00 27.06 ? 1125 ASP A CB  1 
ATOM   8839  C  CG  . ASP A 1 1125 ? 10.842  78.057  40.140  1.00 27.97 ? 1125 ASP A CG  1 
ATOM   8840  O  OD1 . ASP A 1 1125 ? 11.719  77.948  39.259  1.00 27.87 ? 1125 ASP A OD1 1 
ATOM   8841  O  OD2 . ASP A 1 1125 ? 10.992  78.772  41.157  1.00 29.61 ? 1125 ASP A OD2 1 
ATOM   8842  N  N   . SER A 1 1126 ? 8.356   75.523  42.415  1.00 28.71 ? 1126 SER A N   1 
ATOM   8843  C  CA  . SER A 1 1126 ? 8.147   75.383  43.852  1.00 29.02 ? 1126 SER A CA  1 
ATOM   8844  C  C   . SER A 1 1126 ? 8.607   74.011  44.351  1.00 27.76 ? 1126 SER A C   1 
ATOM   8845  O  O   . SER A 1 1126 ? 9.211   73.904  45.419  1.00 27.22 ? 1126 SER A O   1 
ATOM   8846  C  CB  . SER A 1 1126 ? 6.665   75.590  44.203  1.00 28.36 ? 1126 SER A CB  1 
ATOM   8847  O  OG  . SER A 1 1126 ? 6.468   75.552  45.606  1.00 29.37 ? 1126 SER A OG  1 
ATOM   8848  N  N   . ALA A 1 1127 ? 8.320   72.971  43.577  1.00 26.83 ? 1127 ALA A N   1 
ATOM   8849  C  CA  . ALA A 1 1127 ? 8.707   71.621  43.961  1.00 26.20 ? 1127 ALA A CA  1 
ATOM   8850  C  C   . ALA A 1 1127 ? 10.231  71.497  44.058  1.00 26.50 ? 1127 ALA A C   1 
ATOM   8851  O  O   . ALA A 1 1127 ? 10.757  70.923  45.013  1.00 25.70 ? 1127 ALA A O   1 
ATOM   8852  C  CB  . ALA A 1 1127 ? 8.157   70.619  42.957  1.00 25.97 ? 1127 ALA A CB  1 
ATOM   8853  N  N   . LEU A 1 1128 ? 10.931  72.047  43.073  1.00 26.01 ? 1128 LEU A N   1 
ATOM   8854  C  CA  . LEU A 1 1128 ? 12.385  72.007  43.038  1.00 26.69 ? 1128 LEU A CA  1 
ATOM   8855  C  C   . LEU A 1 1128 ? 12.988  72.747  44.219  1.00 26.80 ? 1128 LEU A C   1 
ATOM   8856  O  O   . LEU A 1 1128 ? 13.899  72.243  44.894  1.00 28.15 ? 1128 LEU A O   1 
ATOM   8857  C  CB  . LEU A 1 1128 ? 12.887  72.638  41.740  1.00 27.71 ? 1128 LEU A CB  1 
ATOM   8858  C  CG  . LEU A 1 1128 ? 12.553  71.863  40.468  1.00 29.27 ? 1128 LEU A CG  1 
ATOM   8859  C  CD1 . LEU A 1 1128 ? 12.466  72.809  39.273  1.00 26.78 ? 1128 LEU A CD1 1 
ATOM   8860  C  CD2 . LEU A 1 1128 ? 13.631  70.782  40.273  1.00 29.59 ? 1128 LEU A CD2 1 
ATOM   8861  N  N   . LEU A 1 1129 ? 12.486  73.949  44.469  1.00 25.56 ? 1129 LEU A N   1 
ATOM   8862  C  CA  . LEU A 1 1129 ? 13.008  74.734  45.561  1.00 25.46 ? 1129 LEU A CA  1 
ATOM   8863  C  C   . LEU A 1 1129 ? 12.682  74.103  46.913  1.00 26.15 ? 1129 LEU A C   1 
ATOM   8864  O  O   . LEU A 1 1129 ? 13.501  74.170  47.851  1.00 24.19 ? 1129 LEU A O   1 
ATOM   8865  C  CB  . LEU A 1 1129 ? 12.492  76.175  45.466  1.00 25.94 ? 1129 LEU A CB  1 
ATOM   8866  C  CG  . LEU A 1 1129 ? 13.240  76.975  44.399  1.00 26.53 ? 1129 LEU A CG  1 
ATOM   8867  C  CD1 . LEU A 1 1129 ? 12.436  78.171  43.963  1.00 28.17 ? 1129 LEU A CD1 1 
ATOM   8868  C  CD2 . LEU A 1 1129 ? 14.598  77.398  44.958  1.00 28.61 ? 1129 LEU A CD2 1 
ATOM   8869  N  N   . ARG A 1 1130 ? 11.513  73.474  47.019  1.00 25.07 ? 1130 ARG A N   1 
ATOM   8870  C  CA  . ARG A 1 1130 ? 11.153  72.855  48.283  1.00 27.15 ? 1130 ARG A CA  1 
ATOM   8871  C  C   . ARG A 1 1130 ? 12.047  71.645  48.574  1.00 28.34 ? 1130 ARG A C   1 
ATOM   8872  O  O   . ARG A 1 1130 ? 12.507  71.468  49.706  1.00 27.53 ? 1130 ARG A O   1 
ATOM   8873  C  CB  . ARG A 1 1130 ? 9.674   72.472  48.291  1.00 27.10 ? 1130 ARG A CB  1 
ATOM   8874  C  CG  . ARG A 1 1130 ? 8.755   73.684  48.436  1.00 28.24 ? 1130 ARG A CG  1 
ATOM   8875  C  CD  . ARG A 1 1130 ? 7.295   73.301  48.557  1.00 28.97 ? 1130 ARG A CD  1 
ATOM   8876  N  NE  . ARG A 1 1130 ? 6.777   72.750  47.312  1.00 30.86 ? 1130 ARG A NE  1 
ATOM   8877  C  CZ  . ARG A 1 1130 ? 6.202   71.555  47.203  1.00 32.72 ? 1130 ARG A CZ  1 
ATOM   8878  N  NH1 . ARG A 1 1130 ? 6.065   70.775  48.267  1.00 34.62 ? 1130 ARG A NH1 1 
ATOM   8879  N  NH2 . ARG A 1 1130 ? 5.774   71.131  46.024  1.00 32.72 ? 1130 ARG A NH2 1 
ATOM   8880  N  N   . LEU A 1 1131 ? 12.319  70.832  47.556  1.00 29.15 ? 1131 LEU A N   1 
ATOM   8881  C  CA  . LEU A 1 1131 ? 13.183  69.676  47.744  1.00 29.92 ? 1131 LEU A CA  1 
ATOM   8882  C  C   . LEU A 1 1131 ? 14.532  70.168  48.235  1.00 30.20 ? 1131 LEU A C   1 
ATOM   8883  O  O   . LEU A 1 1131 ? 15.109  69.577  49.148  1.00 30.51 ? 1131 LEU A O   1 
ATOM   8884  C  CB  . LEU A 1 1131 ? 13.366  68.907  46.428  1.00 29.84 ? 1131 LEU A CB  1 
ATOM   8885  C  CG  . LEU A 1 1131 ? 12.163  68.135  45.887  1.00 28.83 ? 1131 LEU A CG  1 
ATOM   8886  C  CD1 . LEU A 1 1131 ? 12.353  67.837  44.410  1.00 28.55 ? 1131 LEU A CD1 1 
ATOM   8887  C  CD2 . LEU A 1 1131 ? 11.975  66.859  46.698  1.00 29.81 ? 1131 LEU A CD2 1 
ATOM   8888  N  N   . ARG A 1 1132 ? 15.031  71.254  47.639  1.00 29.79 ? 1132 ARG A N   1 
ATOM   8889  C  CA  . ARG A 1 1132 ? 16.320  71.800  48.046  1.00 29.76 ? 1132 ARG A CA  1 
ATOM   8890  C  C   . ARG A 1 1132 ? 16.291  72.266  49.494  1.00 30.76 ? 1132 ARG A C   1 
ATOM   8891  O  O   . ARG A 1 1132 ? 17.200  71.969  50.272  1.00 32.07 ? 1132 ARG A O   1 
ATOM   8892  C  CB  . ARG A 1 1132 ? 16.730  72.976  47.168  1.00 29.53 ? 1132 ARG A CB  1 
ATOM   8893  C  CG  . ARG A 1 1132 ? 18.118  73.469  47.524  1.00 29.81 ? 1132 ARG A CG  1 
ATOM   8894  C  CD  . ARG A 1 1132 ? 18.594  74.605  46.652  1.00 30.45 ? 1132 ARG A CD  1 
ATOM   8895  N  NE  . ARG A 1 1132 ? 18.158  75.894  47.168  1.00 31.68 ? 1132 ARG A NE  1 
ATOM   8896  C  CZ  . ARG A 1 1132 ? 18.583  77.060  46.697  1.00 31.93 ? 1132 ARG A CZ  1 
ATOM   8897  N  NH1 . ARG A 1 1132 ? 19.455  77.086  45.692  1.00 32.39 ? 1132 ARG A NH1 1 
ATOM   8898  N  NH2 . ARG A 1 1132 ? 18.157  78.196  47.240  1.00 31.68 ? 1132 ARG A NH2 1 
ATOM   8899  N  N   . THR A 1 1133 ? 15.243  72.998  49.854  1.00 30.96 ? 1133 THR A N   1 
ATOM   8900  C  CA  . THR A 1 1133 ? 15.096  73.507  51.213  1.00 30.04 ? 1133 THR A CA  1 
ATOM   8901  C  C   . THR A 1 1133 ? 14.947  72.355  52.210  1.00 30.48 ? 1133 THR A C   1 
ATOM   8902  O  O   . THR A 1 1133 ? 15.541  72.367  53.294  1.00 30.83 ? 1133 THR A O   1 
ATOM   8903  C  CB  . THR A 1 1133 ? 13.867  74.426  51.312  1.00 29.12 ? 1133 THR A CB  1 
ATOM   8904  O  OG1 . THR A 1 1133 ? 13.964  75.444  50.308  1.00 28.30 ? 1133 THR A OG1 1 
ATOM   8905  C  CG2 . THR A 1 1133 ? 13.784  75.078  52.679  1.00 25.96 ? 1133 THR A CG2 1 
ATOM   8906  N  N   . LEU A 1 1134 ? 14.162  71.357  51.827  1.00 29.68 ? 1134 LEU A N   1 
ATOM   8907  C  CA  . LEU A 1 1134 ? 13.935  70.209  52.680  1.00 29.61 ? 1134 LEU A CA  1 
ATOM   8908  C  C   . LEU A 1 1134 ? 15.137  69.271  52.777  1.00 31.06 ? 1134 LEU A C   1 
ATOM   8909  O  O   . LEU A 1 1134 ? 15.026  68.170  53.316  1.00 32.12 ? 1134 LEU A O   1 
ATOM   8910  C  CB  . LEU A 1 1134 ? 12.688  69.458  52.211  1.00 27.68 ? 1134 LEU A CB  1 
ATOM   8911  C  CG  . LEU A 1 1134 ? 11.400  70.279  52.439  1.00 27.71 ? 1134 LEU A CG  1 
ATOM   8912  C  CD1 . LEU A 1 1134 ? 10.200  69.629  51.756  1.00 25.62 ? 1134 LEU A CD1 1 
ATOM   8913  C  CD2 . LEU A 1 1134 ? 11.148  70.418  53.942  1.00 26.28 ? 1134 LEU A CD2 1 
ATOM   8914  N  N   . GLY A 1 1135 ? 16.285  69.718  52.273  1.00 30.77 ? 1135 GLY A N   1 
ATOM   8915  C  CA  . GLY A 1 1135 ? 17.495  68.918  52.350  1.00 31.89 ? 1135 GLY A CA  1 
ATOM   8916  C  C   . GLY A 1 1135 ? 17.648  67.769  51.363  1.00 33.47 ? 1135 GLY A C   1 
ATOM   8917  O  O   . GLY A 1 1135 ? 18.617  67.017  51.448  1.00 33.36 ? 1135 GLY A O   1 
ATOM   8918  N  N   . ALA A 1 1136 ? 16.718  67.621  50.426  1.00 33.72 ? 1136 ALA A N   1 
ATOM   8919  C  CA  . ALA A 1 1136 ? 16.814  66.539  49.461  1.00 34.80 ? 1136 ALA A CA  1 
ATOM   8920  C  C   . ALA A 1 1136 ? 18.112  66.657  48.687  1.00 36.35 ? 1136 ALA A C   1 
ATOM   8921  O  O   . ALA A 1 1136 ? 18.710  67.739  48.595  1.00 36.92 ? 1136 ALA A O   1 
ATOM   8922  C  CB  . ALA A 1 1136 ? 15.633  66.562  48.506  1.00 33.76 ? 1136 ALA A CB  1 
ATOM   8923  N  N   . ASP A 1 1137 ? 18.542  65.531  48.129  1.00 38.56 ? 1137 ASP A N   1 
ATOM   8924  C  CA  . ASP A 1 1137 ? 19.774  65.482  47.357  1.00 38.85 ? 1137 ASP A CA  1 
ATOM   8925  C  C   . ASP A 1 1137 ? 19.592  65.935  45.910  1.00 38.55 ? 1137 ASP A C   1 
ATOM   8926  O  O   . ASP A 1 1137 ? 18.497  65.855  45.352  1.00 38.14 ? 1137 ASP A O   1 
ATOM   8927  C  CB  . ASP A 1 1137 ? 20.334  64.065  47.363  1.00 41.65 ? 1137 ASP A CB  1 
ATOM   8928  C  CG  . ASP A 1 1137 ? 21.580  63.943  46.522  1.00 43.81 ? 1137 ASP A CG  1 
ATOM   8929  O  OD1 . ASP A 1 1137 ? 22.514  64.753  46.734  1.00 44.65 ? 1137 ASP A OD1 1 
ATOM   8930  O  OD2 . ASP A 1 1137 ? 21.618  63.051  45.649  1.00 43.16 ? 1137 ASP A OD2 1 
ATOM   8931  N  N   . LYS A 1 1138 ? 20.681  66.405  45.309  1.00 37.38 ? 1138 LYS A N   1 
ATOM   8932  C  CA  . LYS A 1 1138 ? 20.676  66.854  43.924  1.00 36.54 ? 1138 LYS A CA  1 
ATOM   8933  C  C   . LYS A 1 1138 ? 19.915  65.884  43.017  1.00 35.99 ? 1138 LYS A C   1 
ATOM   8934  O  O   . LYS A 1 1138 ? 19.040  66.279  42.265  1.00 36.06 ? 1138 LYS A O   1 
ATOM   8935  C  CB  . LYS A 1 1138 ? 22.124  67.003  43.437  1.00 37.01 ? 1138 LYS A CB  1 
ATOM   8936  C  CG  . LYS A 1 1138 ? 22.299  67.396  41.976  1.00 37.48 ? 1138 LYS A CG  1 
ATOM   8937  C  CD  . LYS A 1 1138 ? 23.766  67.253  41.583  1.00 39.21 ? 1138 LYS A CD  1 
ATOM   8938  C  CE  . LYS A 1 1138 ? 23.984  67.423  40.094  1.00 39.29 ? 1138 LYS A CE  1 
ATOM   8939  N  NZ  . LYS A 1 1138 ? 25.418  67.245  39.731  1.00 40.25 ? 1138 LYS A NZ  1 
ATOM   8940  N  N   . LYS A 1 1139 ? 20.242  64.604  43.119  1.00 36.15 ? 1139 LYS A N   1 
ATOM   8941  C  CA  . LYS A 1 1139 ? 19.619  63.599  42.281  1.00 36.93 ? 1139 LYS A CA  1 
ATOM   8942  C  C   . LYS A 1 1139 ? 18.103  63.605  42.398  1.00 37.25 ? 1139 LYS A C   1 
ATOM   8943  O  O   . LYS A 1 1139 ? 17.405  63.126  41.504  1.00 37.47 ? 1139 LYS A O   1 
ATOM   8944  C  CB  . LYS A 1 1139 ? 20.183  62.212  42.624  1.00 38.55 ? 1139 LYS A CB  1 
ATOM   8945  C  CG  . LYS A 1 1139 ? 21.553  61.943  42.016  1.00 40.53 ? 1139 LYS A CG  1 
ATOM   8946  C  CD  . LYS A 1 1139 ? 22.092  60.590  42.454  1.00 43.50 ? 1139 LYS A CD  1 
ATOM   8947  C  CE  . LYS A 1 1139 ? 22.768  60.684  43.814  1.00 45.48 ? 1139 LYS A CE  1 
ATOM   8948  N  NZ  . LYS A 1 1139 ? 23.486  59.425  44.165  1.00 47.62 ? 1139 LYS A NZ  1 
ATOM   8949  N  N   . ALA A 1 1140 ? 17.590  64.144  43.510  1.00 36.41 ? 1140 ALA A N   1 
ATOM   8950  C  CA  . ALA A 1 1140 ? 16.148  64.218  43.712  1.00 35.12 ? 1140 ALA A CA  1 
ATOM   8951  C  C   . ALA A 1 1140 ? 15.580  65.291  42.774  1.00 34.76 ? 1140 ALA A C   1 
ATOM   8952  O  O   . ALA A 1 1140 ? 14.543  65.082  42.142  1.00 34.83 ? 1140 ALA A O   1 
ATOM   8953  C  CB  . ALA A 1 1140 ? 15.846  64.563  45.156  1.00 35.08 ? 1140 ALA A CB  1 
ATOM   8954  N  N   . LEU A 1 1141 ? 16.256  66.441  42.679  1.00 33.57 ? 1141 LEU A N   1 
ATOM   8955  C  CA  . LEU A 1 1141 ? 15.787  67.494  41.787  1.00 31.51 ? 1141 LEU A CA  1 
ATOM   8956  C  C   . LEU A 1 1141 ? 15.916  66.978  40.370  1.00 31.45 ? 1141 LEU A C   1 
ATOM   8957  O  O   . LEU A 1 1141 ? 15.082  67.294  39.505  1.00 31.72 ? 1141 LEU A O   1 
ATOM   8958  C  CB  . LEU A 1 1141 ? 16.586  68.780  41.954  1.00 29.34 ? 1141 LEU A CB  1 
ATOM   8959  C  CG  . LEU A 1 1141 ? 16.096  69.687  43.087  1.00 27.87 ? 1141 LEU A CG  1 
ATOM   8960  C  CD1 . LEU A 1 1141 ? 16.442  69.070  44.437  1.00 26.85 ? 1141 LEU A CD1 1 
ATOM   8961  C  CD2 . LEU A 1 1141 ? 16.744  71.058  42.963  1.00 28.54 ? 1141 LEU A CD2 1 
ATOM   8962  N  N   . THR A 1 1142 ? 16.942  66.160  40.139  1.00 29.68 ? 1142 THR A N   1 
ATOM   8963  C  CA  . THR A 1 1142 ? 17.153  65.581  38.822  1.00 29.03 ? 1142 THR A CA  1 
ATOM   8964  C  C   . THR A 1 1142 ? 15.975  64.683  38.490  1.00 27.99 ? 1142 THR A C   1 
ATOM   8965  O  O   . THR A 1 1142 ? 15.501  64.661  37.364  1.00 28.65 ? 1142 THR A O   1 
ATOM   8966  C  CB  . THR A 1 1142 ? 18.427  64.755  38.779  1.00 29.33 ? 1142 THR A CB  1 
ATOM   8967  O  OG1 . THR A 1 1142 ? 19.537  65.598  39.109  1.00 29.45 ? 1142 THR A OG1 1 
ATOM   8968  C  CG2 . THR A 1 1142 ? 18.622  64.140  37.390  1.00 27.21 ? 1142 THR A CG2 1 
ATOM   8969  N  N   . ALA A 1 1143 ? 15.498  63.941  39.476  1.00 27.73 ? 1143 ALA A N   1 
ATOM   8970  C  CA  . ALA A 1 1143 ? 14.353  63.067  39.253  1.00 26.86 ? 1143 ALA A CA  1 
ATOM   8971  C  C   . ALA A 1 1143 ? 13.109  63.899  38.915  1.00 26.63 ? 1143 ALA A C   1 
ATOM   8972  O  O   . ALA A 1 1143 ? 12.329  63.546  38.021  1.00 25.85 ? 1143 ALA A O   1 
ATOM   8973  C  CB  . ALA A 1 1143 ? 14.086  62.221  40.492  1.00 26.20 ? 1143 ALA A CB  1 
ATOM   8974  N  N   . GLN A 1 1144 ? 12.932  65.007  39.632  1.00 25.31 ? 1144 GLN A N   1 
ATOM   8975  C  CA  . GLN A 1 1144 ? 11.780  65.865  39.416  1.00 25.28 ? 1144 GLN A CA  1 
ATOM   8976  C  C   . GLN A 1 1144 ? 11.765  66.427  38.001  1.00 24.85 ? 1144 GLN A C   1 
ATOM   8977  O  O   . GLN A 1 1144 ? 10.712  66.473  37.368  1.00 24.40 ? 1144 GLN A O   1 
ATOM   8978  C  CB  . GLN A 1 1144 ? 11.777  67.008  40.436  1.00 25.39 ? 1144 GLN A CB  1 
ATOM   8979  C  CG  . GLN A 1 1144 ? 10.767  68.117  40.156  1.00 25.96 ? 1144 GLN A CG  1 
ATOM   8980  C  CD  . GLN A 1 1144 ? 9.323   67.718  40.449  1.00 26.91 ? 1144 GLN A CD  1 
ATOM   8981  O  OE1 . GLN A 1 1144 ? 8.928   67.548  41.612  1.00 27.21 ? 1144 GLN A OE1 1 
ATOM   8982  N  NE2 . GLN A 1 1144 ? 8.526   67.561  39.393  1.00 26.59 ? 1144 GLN A NE2 1 
ATOM   8983  N  N   . LEU A 1 1145 ? 12.932  66.843  37.510  1.00 24.82 ? 1145 LEU A N   1 
ATOM   8984  C  CA  . LEU A 1 1145 ? 13.056  67.414  36.168  1.00 24.13 ? 1145 LEU A CA  1 
ATOM   8985  C  C   . LEU A 1 1145 ? 12.869  66.369  35.062  1.00 24.96 ? 1145 LEU A C   1 
ATOM   8986  O  O   . LEU A 1 1145 ? 12.460  66.701  33.941  1.00 24.76 ? 1145 LEU A O   1 
ATOM   8987  C  CB  . LEU A 1 1145 ? 14.412  68.105  36.012  1.00 23.28 ? 1145 LEU A CB  1 
ATOM   8988  C  CG  . LEU A 1 1145 ? 14.686  69.306  36.928  1.00 24.29 ? 1145 LEU A CG  1 
ATOM   8989  C  CD1 . LEU A 1 1145 ? 16.147  69.718  36.853  1.00 23.51 ? 1145 LEU A CD1 1 
ATOM   8990  C  CD2 . LEU A 1 1145 ? 13.786  70.470  36.504  1.00 24.97 ? 1145 LEU A CD2 1 
ATOM   8991  N  N   . LEU A 1 1146 ? 13.164  65.109  35.374  1.00 24.83 ? 1146 LEU A N   1 
ATOM   8992  C  CA  . LEU A 1 1146 ? 12.995  64.044  34.399  1.00 25.37 ? 1146 LEU A CA  1 
ATOM   8993  C  C   . LEU A 1 1146 ? 11.513  63.759  34.294  1.00 26.86 ? 1146 LEU A C   1 
ATOM   8994  O  O   . LEU A 1 1146 ? 10.996  63.470  33.217  1.00 27.65 ? 1146 LEU A O   1 
ATOM   8995  C  CB  . LEU A 1 1146 ? 13.724  62.777  34.845  1.00 24.99 ? 1146 LEU A CB  1 
ATOM   8996  C  CG  . LEU A 1 1146 ? 15.236  62.707  34.642  1.00 24.72 ? 1146 LEU A CG  1 
ATOM   8997  C  CD1 . LEU A 1 1146 ? 15.837  61.740  35.642  1.00 23.24 ? 1146 LEU A CD1 1 
ATOM   8998  C  CD2 . LEU A 1 1146 ? 15.536  62.280  33.210  1.00 24.59 ? 1146 LEU A CD2 1 
ATOM   8999  N  N   . MET A 1 1147 ? 10.823  63.838  35.426  1.00 28.86 ? 1147 MET A N   1 
ATOM   9000  C  CA  . MET A 1 1147 ? 9.391   63.587  35.427  1.00 29.60 ? 1147 MET A CA  1 
ATOM   9001  C  C   . MET A 1 1147 ? 8.605   64.659  34.657  1.00 30.17 ? 1147 MET A C   1 
ATOM   9002  O  O   . MET A 1 1147 ? 7.434   64.452  34.326  1.00 29.32 ? 1147 MET A O   1 
ATOM   9003  C  CB  . MET A 1 1147 ? 8.867   63.460  36.861  1.00 28.86 ? 1147 MET A CB  1 
ATOM   9004  C  CG  . MET A 1 1147 ? 9.409   62.241  37.598  1.00 30.34 ? 1147 MET A CG  1 
ATOM   9005  S  SD  . MET A 1 1147 ? 8.676   61.991  39.235  1.00 31.93 ? 1147 MET A SD  1 
ATOM   9006  C  CE  . MET A 1 1147 ? 7.040   61.433  38.777  1.00 32.12 ? 1147 MET A CE  1 
ATOM   9007  N  N   . VAL A 1 1148 ? 9.235   65.798  34.362  1.00 30.53 ? 1148 VAL A N   1 
ATOM   9008  C  CA  . VAL A 1 1148 ? 8.534   66.825  33.601  1.00 30.84 ? 1148 VAL A CA  1 
ATOM   9009  C  C   . VAL A 1 1148 ? 8.991   66.897  32.139  1.00 30.95 ? 1148 VAL A C   1 
ATOM   9010  O  O   . VAL A 1 1148 ? 8.767   67.897  31.456  1.00 30.96 ? 1148 VAL A O   1 
ATOM   9011  C  CB  . VAL A 1 1148 ? 8.621   68.225  34.284  1.00 30.51 ? 1148 VAL A CB  1 
ATOM   9012  C  CG1 . VAL A 1 1148 ? 7.821   68.203  35.580  1.00 29.73 ? 1148 VAL A CG1 1 
ATOM   9013  C  CG2 . VAL A 1 1148 ? 10.072  68.612  34.559  1.00 31.67 ? 1148 VAL A CG2 1 
ATOM   9014  N  N   . GLY A 1 1149 ? 9.628   65.825  31.662  1.00 31.41 ? 1149 GLY A N   1 
ATOM   9015  C  CA  . GLY A 1 1149 ? 10.046  65.779  30.271  1.00 31.80 ? 1149 GLY A CA  1 
ATOM   9016  C  C   . GLY A 1 1149 ? 11.495  66.011  29.899  1.00 31.46 ? 1149 GLY A C   1 
ATOM   9017  O  O   . GLY A 1 1149 ? 11.885  65.698  28.782  1.00 31.55 ? 1149 GLY A O   1 
ATOM   9018  N  N   . LEU A 1 1150 ? 12.295  66.553  30.805  1.00 31.47 ? 1150 LEU A N   1 
ATOM   9019  C  CA  . LEU A 1 1150 ? 13.697  66.812  30.499  1.00 32.08 ? 1150 LEU A CA  1 
ATOM   9020  C  C   . LEU A 1 1150 ? 14.562  65.586  30.278  1.00 32.93 ? 1150 LEU A C   1 
ATOM   9021  O  O   . LEU A 1 1150 ? 14.280  64.495  30.758  1.00 33.07 ? 1150 LEU A O   1 
ATOM   9022  C  CB  . LEU A 1 1150 ? 14.350  67.656  31.592  1.00 31.14 ? 1150 LEU A CB  1 
ATOM   9023  C  CG  . LEU A 1 1150 ? 14.142  69.157  31.473  1.00 31.53 ? 1150 LEU A CG  1 
ATOM   9024  C  CD1 . LEU A 1 1150 ? 12.683  69.486  31.753  1.00 31.28 ? 1150 LEU A CD1 1 
ATOM   9025  C  CD2 . LEU A 1 1150 ? 15.077  69.872  32.444  1.00 29.28 ? 1150 LEU A CD2 1 
ATOM   9026  N  N   . GLN A 1 1151 ? 15.638  65.805  29.540  1.00 35.08 ? 1151 GLN A N   1 
ATOM   9027  C  CA  . GLN A 1 1151 ? 16.620  64.784  29.224  1.00 36.22 ? 1151 GLN A CA  1 
ATOM   9028  C  C   . GLN A 1 1151 ? 17.565  64.719  30.425  1.00 36.75 ? 1151 GLN A C   1 
ATOM   9029  O  O   . GLN A 1 1151 ? 17.820  65.742  31.063  1.00 36.82 ? 1151 GLN A O   1 
ATOM   9030  C  CB  . GLN A 1 1151 ? 17.363  65.219  27.963  1.00 36.08 ? 1151 GLN A CB  1 
ATOM   9031  C  CG  . GLN A 1 1151 ? 18.163  64.163  27.260  1.00 37.75 ? 1151 GLN A CG  1 
ATOM   9032  C  CD  . GLN A 1 1151 ? 19.421  64.747  26.655  1.00 39.39 ? 1151 GLN A CD  1 
ATOM   9033  O  OE1 . GLN A 1 1151 ? 20.423  64.945  27.349  1.00 41.00 ? 1151 GLN A OE1 1 
ATOM   9034  N  NE2 . GLN A 1 1151 ? 19.374  65.049  25.362  1.00 40.08 ? 1151 GLN A NE2 1 
ATOM   9035  N  N   . GLU A 1 1152 ? 18.065  63.523  30.740  1.00 37.58 ? 1152 GLU A N   1 
ATOM   9036  C  CA  . GLU A 1 1152 ? 18.972  63.344  31.878  1.00 38.81 ? 1152 GLU A CA  1 
ATOM   9037  C  C   . GLU A 1 1152 ? 20.114  64.347  31.932  1.00 37.57 ? 1152 GLU A C   1 
ATOM   9038  O  O   . GLU A 1 1152 ? 20.379  64.920  32.984  1.00 37.32 ? 1152 GLU A O   1 
ATOM   9039  C  CB  . GLU A 1 1152 ? 19.536  61.919  31.911  1.00 42.10 ? 1152 GLU A CB  1 
ATOM   9040  C  CG  . GLU A 1 1152 ? 18.756  60.980  32.832  1.00 47.43 ? 1152 GLU A CG  1 
ATOM   9041  C  CD  . GLU A 1 1152 ? 19.412  59.613  33.011  1.00 51.23 ? 1152 GLU A CD  1 
ATOM   9042  O  OE1 . GLU A 1 1152 ? 19.504  58.851  32.021  1.00 54.17 ? 1152 GLU A OE1 1 
ATOM   9043  O  OE2 . GLU A 1 1152 ? 19.832  59.297  34.148  1.00 52.23 ? 1152 GLU A OE2 1 
ATOM   9044  N  N   . SER A 1 1153 ? 20.783  64.569  30.806  1.00 37.53 ? 1153 SER A N   1 
ATOM   9045  C  CA  . SER A 1 1153 ? 21.887  65.528  30.755  1.00 38.04 ? 1153 SER A CA  1 
ATOM   9046  C  C   . SER A 1 1153 ? 21.432  66.897  31.251  1.00 38.05 ? 1153 SER A C   1 
ATOM   9047  O  O   . SER A 1 1153 ? 22.096  67.517  32.083  1.00 36.61 ? 1153 SER A O   1 
ATOM   9048  C  CB  . SER A 1 1153 ? 22.407  65.686  29.325  1.00 37.94 ? 1153 SER A CB  1 
ATOM   9049  O  OG  . SER A 1 1153 ? 22.670  64.437  28.716  1.00 40.92 ? 1153 SER A OG  1 
ATOM   9050  N  N   . GLU A 1 1154 ? 20.305  67.369  30.723  1.00 38.09 ? 1154 GLU A N   1 
ATOM   9051  C  CA  . GLU A 1 1154 ? 19.773  68.673  31.104  1.00 39.14 ? 1154 GLU A CA  1 
ATOM   9052  C  C   . GLU A 1 1154 ? 19.331  68.659  32.547  1.00 38.00 ? 1154 GLU A C   1 
ATOM   9053  O  O   . GLU A 1 1154 ? 19.629  69.588  33.312  1.00 38.10 ? 1154 GLU A O   1 
ATOM   9054  C  CB  . GLU A 1 1154 ? 18.583  69.059  30.230  1.00 42.15 ? 1154 GLU A CB  1 
ATOM   9055  C  CG  . GLU A 1 1154 ? 18.928  69.412  28.809  1.00 45.88 ? 1154 GLU A CG  1 
ATOM   9056  C  CD  . GLU A 1 1154 ? 17.752  70.036  28.096  1.00 50.54 ? 1154 GLU A CD  1 
ATOM   9057  O  OE1 . GLU A 1 1154 ? 17.365  71.165  28.485  1.00 52.16 ? 1154 GLU A OE1 1 
ATOM   9058  O  OE2 . GLU A 1 1154 ? 17.204  69.398  27.161  1.00 51.62 ? 1154 GLU A OE2 1 
ATOM   9059  N  N   . ALA A 1 1155 ? 18.616  67.599  32.909  1.00 36.02 ? 1155 ALA A N   1 
ATOM   9060  C  CA  . ALA A 1 1155 ? 18.121  67.430  34.268  1.00 34.85 ? 1155 ALA A CA  1 
ATOM   9061  C  C   . ALA A 1 1155 ? 19.253  67.621  35.264  1.00 33.48 ? 1155 ALA A C   1 
ATOM   9062  O  O   . ALA A 1 1155 ? 19.219  68.536  36.085  1.00 32.30 ? 1155 ALA A O   1 
ATOM   9063  C  CB  . ALA A 1 1155 ? 17.522  66.053  34.435  1.00 35.59 ? 1155 ALA A CB  1 
ATOM   9064  N  N   . ASP A 1 1156 ? 20.257  66.752  35.171  1.00 32.87 ? 1156 ASP A N   1 
ATOM   9065  C  CA  . ASP A 1 1156 ? 21.416  66.792  36.060  1.00 32.50 ? 1156 ASP A CA  1 
ATOM   9066  C  C   . ASP A 1 1156 ? 22.083  68.163  36.076  1.00 32.02 ? 1156 ASP A C   1 
ATOM   9067  O  O   . ASP A 1 1156 ? 22.563  68.617  37.125  1.00 33.21 ? 1156 ASP A O   1 
ATOM   9068  C  CB  . ASP A 1 1156 ? 22.437  65.731  35.636  1.00 32.43 ? 1156 ASP A CB  1 
ATOM   9069  C  CG  . ASP A 1 1156 ? 23.749  65.830  36.409  1.00 33.27 ? 1156 ASP A CG  1 
ATOM   9070  O  OD1 . ASP A 1 1156 ? 23.839  65.282  37.532  1.00 31.93 ? 1156 ASP A OD1 1 
ATOM   9071  O  OD2 . ASP A 1 1156 ? 24.689  66.470  35.889  1.00 31.75 ? 1156 ASP A OD2 1 
ATOM   9072  N  N   . ALA A 1 1157 ? 22.111  68.825  34.923  1.00 30.56 ? 1157 ALA A N   1 
ATOM   9073  C  CA  . ALA A 1 1157 ? 22.742  70.135  34.851  1.00 29.91 ? 1157 ALA A CA  1 
ATOM   9074  C  C   . ALA A 1 1157 ? 21.901  71.189  35.560  1.00 28.96 ? 1157 ALA A C   1 
ATOM   9075  O  O   . ALA A 1 1157 ? 22.390  71.859  36.464  1.00 28.40 ? 1157 ALA A O   1 
ATOM   9076  C  CB  . ALA A 1 1157 ? 22.981  70.530  33.403  1.00 29.56 ? 1157 ALA A CB  1 
ATOM   9077  N  N   . LEU A 1 1158 ? 20.638  71.341  35.165  1.00 27.96 ? 1158 LEU A N   1 
ATOM   9078  C  CA  . LEU A 1 1158 ? 19.797  72.333  35.831  1.00 27.99 ? 1158 LEU A CA  1 
ATOM   9079  C  C   . LEU A 1 1158 ? 19.711  72.026  37.330  1.00 27.75 ? 1158 LEU A C   1 
ATOM   9080  O  O   . LEU A 1 1158 ? 19.852  72.929  38.167  1.00 28.35 ? 1158 LEU A O   1 
ATOM   9081  C  CB  . LEU A 1 1158 ? 18.391  72.382  35.219  1.00 25.70 ? 1158 LEU A CB  1 
ATOM   9082  C  CG  . LEU A 1 1158 ? 17.432  73.346  35.934  1.00 26.16 ? 1158 LEU A CG  1 
ATOM   9083  C  CD1 . LEU A 1 1158 ? 18.054  74.716  35.996  1.00 23.10 ? 1158 LEU A CD1 1 
ATOM   9084  C  CD2 . LEU A 1 1158 ? 16.078  73.397  35.227  1.00 22.84 ? 1158 LEU A CD2 1 
ATOM   9085  N  N   . ALA A 1 1159 ? 19.518  70.753  37.672  1.00 27.70 ? 1159 ALA A N   1 
ATOM   9086  C  CA  . ALA A 1 1159 ? 19.433  70.358  39.076  1.00 28.42 ? 1159 ALA A CA  1 
ATOM   9087  C  C   . ALA A 1 1159 ? 20.694  70.766  39.853  1.00 29.34 ? 1159 ALA A C   1 
ATOM   9088  O  O   . ALA A 1 1159 ? 20.606  71.293  40.978  1.00 29.03 ? 1159 ALA A O   1 
ATOM   9089  C  CB  . ALA A 1 1159 ? 19.212  68.859  39.189  1.00 26.75 ? 1159 ALA A CB  1 
ATOM   9090  N  N   . GLY A 1 1160 ? 21.856  70.527  39.245  1.00 30.09 ? 1160 GLY A N   1 
ATOM   9091  C  CA  . GLY A 1 1160 ? 23.114  70.871  39.882  1.00 30.73 ? 1160 GLY A CA  1 
ATOM   9092  C  C   . GLY A 1 1160 ? 23.291  72.368  39.971  1.00 30.30 ? 1160 GLY A C   1 
ATOM   9093  O  O   . GLY A 1 1160 ? 23.968  72.877  40.848  1.00 31.04 ? 1160 GLY A O   1 
ATOM   9094  N  N   . LYS A 1 1161 ? 22.669  73.078  39.047  1.00 31.59 ? 1161 LYS A N   1 
ATOM   9095  C  CA  . LYS A 1 1161 ? 22.748  74.525  39.020  1.00 32.35 ? 1161 LYS A CA  1 
ATOM   9096  C  C   . LYS A 1 1161 ? 21.868  75.085  40.130  1.00 32.89 ? 1161 LYS A C   1 
ATOM   9097  O  O   . LYS A 1 1161 ? 22.240  76.040  40.820  1.00 32.56 ? 1161 LYS A O   1 
ATOM   9098  C  CB  . LYS A 1 1161 ? 22.273  75.030  37.659  1.00 33.17 ? 1161 LYS A CB  1 
ATOM   9099  C  CG  . LYS A 1 1161 ? 22.328  76.535  37.487  1.00 35.78 ? 1161 LYS A CG  1 
ATOM   9100  C  CD  . LYS A 1 1161 ? 21.639  76.938  36.196  1.00 37.95 ? 1161 LYS A CD  1 
ATOM   9101  C  CE  . LYS A 1 1161 ? 21.331  78.424  36.180  1.00 39.44 ? 1161 LYS A CE  1 
ATOM   9102  N  NZ  . LYS A 1 1161 ? 20.666  78.797  34.899  1.00 41.53 ? 1161 LYS A NZ  1 
ATOM   9103  N  N   . ILE A 1 1162 ? 20.696  74.475  40.296  1.00 32.91 ? 1162 ILE A N   1 
ATOM   9104  C  CA  . ILE A 1 1162 ? 19.753  74.895  41.313  1.00 32.61 ? 1162 ILE A CA  1 
ATOM   9105  C  C   . ILE A 1 1162 ? 20.352  74.700  42.708  1.00 33.12 ? 1162 ILE A C   1 
ATOM   9106  O  O   . ILE A 1 1162 ? 20.193  75.560  43.581  1.00 33.10 ? 1162 ILE A O   1 
ATOM   9107  C  CB  . ILE A 1 1162 ? 18.431  74.103  41.186  1.00 32.16 ? 1162 ILE A CB  1 
ATOM   9108  C  CG1 . ILE A 1 1162 ? 17.745  74.481  39.873  1.00 30.38 ? 1162 ILE A CG1 1 
ATOM   9109  C  CG2 . ILE A 1 1162 ? 17.531  74.374  42.382  1.00 30.70 ? 1162 ILE A CG2 1 
ATOM   9110  C  CD1 . ILE A 1 1162 ? 16.641  73.548  39.465  1.00 29.73 ? 1162 ILE A CD1 1 
ATOM   9111  N  N   . MET A 1 1163 ? 21.054  73.587  42.910  1.00 32.64 ? 1163 MET A N   1 
ATOM   9112  C  CA  . MET A 1 1163 ? 21.653  73.314  44.210  1.00 32.26 ? 1163 MET A CA  1 
ATOM   9113  C  C   . MET A 1 1163 ? 22.623  74.398  44.664  1.00 32.68 ? 1163 MET A C   1 
ATOM   9114  O  O   . MET A 1 1163 ? 22.810  74.609  45.855  1.00 32.49 ? 1163 MET A O   1 
ATOM   9115  C  CB  . MET A 1 1163 ? 22.398  71.985  44.182  1.00 33.21 ? 1163 MET A CB  1 
ATOM   9116  C  CG  . MET A 1 1163 ? 21.530  70.771  43.978  1.00 34.41 ? 1163 MET A CG  1 
ATOM   9117  S  SD  . MET A 1 1163 ? 20.302  70.571  45.266  1.00 35.99 ? 1163 MET A SD  1 
ATOM   9118  C  CE  . MET A 1 1163 ? 21.361  70.213  46.707  1.00 31.17 ? 1163 MET A CE  1 
ATOM   9119  N  N   . LEU A 1 1164 ? 23.242  75.093  43.721  1.00 34.07 ? 1164 LEU A N   1 
ATOM   9120  C  CA  . LEU A 1 1164 ? 24.218  76.113  44.084  1.00 33.90 ? 1164 LEU A CA  1 
ATOM   9121  C  C   . LEU A 1 1164 ? 23.755  77.546  43.909  1.00 33.62 ? 1164 LEU A C   1 
ATOM   9122  O  O   . LEU A 1 1164 ? 24.457  78.472  44.296  1.00 32.28 ? 1164 LEU A O   1 
ATOM   9123  C  CB  . LEU A 1 1164 ? 25.500  75.910  43.268  1.00 33.92 ? 1164 LEU A CB  1 
ATOM   9124  C  CG  . LEU A 1 1164 ? 26.188  74.554  43.427  1.00 34.58 ? 1164 LEU A CG  1 
ATOM   9125  C  CD1 . LEU A 1 1164 ? 27.401  74.489  42.505  1.00 34.47 ? 1164 LEU A CD1 1 
ATOM   9126  C  CD2 . LEU A 1 1164 ? 26.600  74.351  44.890  1.00 33.25 ? 1164 LEU A CD2 1 
ATOM   9127  N  N   . GLN A 1 1165 ? 22.579  77.740  43.332  1.00 34.76 ? 1165 GLN A N   1 
ATOM   9128  C  CA  . GLN A 1 1165 ? 22.105  79.099  43.080  1.00 34.65 ? 1165 GLN A CA  1 
ATOM   9129  C  C   . GLN A 1 1165 ? 21.541  79.902  44.238  1.00 33.51 ? 1165 GLN A C   1 
ATOM   9130  O  O   . GLN A 1 1165 ? 20.893  79.372  45.136  1.00 34.86 ? 1165 GLN A O   1 
ATOM   9131  C  CB  . GLN A 1 1165 ? 21.089  79.078  41.938  1.00 34.96 ? 1165 GLN A CB  1 
ATOM   9132  C  CG  . GLN A 1 1165 ? 20.718  80.439  41.392  1.00 37.41 ? 1165 GLN A CG  1 
ATOM   9133  C  CD  . GLN A 1 1165 ? 20.129  80.353  39.993  1.00 38.57 ? 1165 GLN A CD  1 
ATOM   9134  O  OE1 . GLN A 1 1165 ? 18.916  80.453  39.809  1.00 38.80 ? 1165 GLN A OE1 1 
ATOM   9135  N  NE2 . GLN A 1 1165 ? 20.990  80.172  39.000  1.00 40.55 ? 1165 GLN A NE2 1 
ATOM   9136  N  N   . ASP A 1 1166 ? 21.829  81.195  44.193  1.00 32.54 ? 1166 ASP A N   1 
ATOM   9137  C  CA  . ASP A 1 1166 ? 21.347  82.168  45.161  1.00 32.75 ? 1166 ASP A CA  1 
ATOM   9138  C  C   . ASP A 1 1166 ? 20.006  82.644  44.615  1.00 32.49 ? 1166 ASP A C   1 
ATOM   9139  O  O   . ASP A 1 1166 ? 19.958  83.512  43.743  1.00 30.69 ? 1166 ASP A O   1 
ATOM   9140  C  CB  . ASP A 1 1166 ? 22.284  83.363  45.222  1.00 34.91 ? 1166 ASP A CB  1 
ATOM   9141  C  CG  . ASP A 1 1166 ? 23.213  83.308  46.396  1.00 38.87 ? 1166 ASP A CG  1 
ATOM   9142  O  OD1 . ASP A 1 1166 ? 22.726  83.017  47.512  1.00 41.85 ? 1166 ASP A OD1 1 
ATOM   9143  O  OD2 . ASP A 1 1166 ? 24.423  83.558  46.211  1.00 39.61 ? 1166 ASP A OD2 1 
ATOM   9144  N  N   . VAL A 1 1167 ? 18.924  82.074  45.125  1.00 32.08 ? 1167 VAL A N   1 
ATOM   9145  C  CA  . VAL A 1 1167 ? 17.589  82.417  44.666  1.00 32.48 ? 1167 VAL A CA  1 
ATOM   9146  C  C   . VAL A 1 1167 ? 17.107  83.768  45.204  1.00 32.80 ? 1167 VAL A C   1 
ATOM   9147  O  O   . VAL A 1 1167 ? 17.180  84.028  46.407  1.00 33.17 ? 1167 VAL A O   1 
ATOM   9148  C  CB  . VAL A 1 1167 ? 16.617  81.302  45.062  1.00 32.71 ? 1167 VAL A CB  1 
ATOM   9149  C  CG1 . VAL A 1 1167 ? 15.240  81.562  44.479  1.00 32.68 ? 1167 VAL A CG1 1 
ATOM   9150  C  CG2 . VAL A 1 1167 ? 17.161  79.966  44.570  1.00 33.03 ? 1167 VAL A CG2 1 
ATOM   9151  N  N   . ASN A 1 1168 ? 16.616  84.626  44.307  1.00 32.93 ? 1168 ASN A N   1 
ATOM   9152  C  CA  . ASN A 1 1168 ? 16.149  85.949  44.697  1.00 33.54 ? 1168 ASN A CA  1 
ATOM   9153  C  C   . ASN A 1 1168 ? 14.861  85.864  45.505  1.00 30.92 ? 1168 ASN A C   1 
ATOM   9154  O  O   . ASN A 1 1168 ? 14.149  84.863  45.450  1.00 30.30 ? 1168 ASN A O   1 
ATOM   9155  C  CB  . ASN A 1 1168 ? 15.949  86.830  43.463  1.00 38.92 ? 1168 ASN A CB  1 
ATOM   9156  C  CG  . ASN A 1 1168 ? 14.759  86.401  42.629  1.00 45.49 ? 1168 ASN A CG  1 
ATOM   9157  O  OD1 . ASN A 1 1168 ? 14.064  85.444  42.969  1.00 50.15 ? 1168 ASN A OD1 1 
ATOM   9158  N  ND2 . ASN A 1 1168 ? 14.520  87.110  41.532  1.00 48.15 ? 1168 ASN A ND2 1 
ATOM   9159  N  N   . THR A 1 1169 ? 14.572  86.931  46.238  1.00 27.48 ? 1169 THR A N   1 
ATOM   9160  C  CA  . THR A 1 1169 ? 13.405  87.005  47.108  1.00 27.08 ? 1169 THR A CA  1 
ATOM   9161  C  C   . THR A 1 1169 ? 12.081  86.475  46.571  1.00 27.11 ? 1169 THR A C   1 
ATOM   9162  O  O   . THR A 1 1169 ? 11.446  85.632  47.200  1.00 26.92 ? 1169 THR A O   1 
ATOM   9163  C  CB  . THR A 1 1169 ? 13.191  88.432  47.566  1.00 26.34 ? 1169 THR A CB  1 
ATOM   9164  O  OG1 . THR A 1 1169 ? 14.345  88.867  48.294  1.00 24.50 ? 1169 THR A OG1 1 
ATOM   9165  C  CG2 . THR A 1 1169 ? 11.965  88.516  48.437  1.00 25.95 ? 1169 THR A CG2 1 
ATOM   9166  N  N   . VAL A 1 1170 ? 11.667  86.974  45.413  1.00 25.77 ? 1170 VAL A N   1 
ATOM   9167  C  CA  . VAL A 1 1170 ? 10.417  86.555  44.801  1.00 25.59 ? 1170 VAL A CA  1 
ATOM   9168  C  C   . VAL A 1 1170 ? 10.364  85.080  44.417  1.00 24.97 ? 1170 VAL A C   1 
ATOM   9169  O  O   . VAL A 1 1170 ? 9.390   84.393  44.695  1.00 23.82 ? 1170 VAL A O   1 
ATOM   9170  C  CB  . VAL A 1 1170 ? 10.121  87.411  43.543  1.00 25.92 ? 1170 VAL A CB  1 
ATOM   9171  C  CG1 . VAL A 1 1170 ? 9.030   86.780  42.696  1.00 24.66 ? 1170 VAL A CG1 1 
ATOM   9172  C  CG2 . VAL A 1 1170 ? 9.708   88.794  43.973  1.00 25.78 ? 1170 VAL A CG2 1 
ATOM   9173  N  N   . GLN A 1 1171 ? 11.404  84.589  43.773  1.00 24.08 ? 1171 GLN A N   1 
ATOM   9174  C  CA  . GLN A 1 1171 ? 11.386  83.204  43.351  1.00 25.48 ? 1171 GLN A CA  1 
ATOM   9175  C  C   . GLN A 1 1171 ? 11.395  82.219  44.502  1.00 24.75 ? 1171 GLN A C   1 
ATOM   9176  O  O   . GLN A 1 1171 ? 10.675  81.221  44.470  1.00 24.59 ? 1171 GLN A O   1 
ATOM   9177  C  CB  . GLN A 1 1171 ? 12.556  82.922  42.406  1.00 25.43 ? 1171 GLN A CB  1 
ATOM   9178  C  CG  . GLN A 1 1171 ? 12.764  81.457  42.103  1.00 26.65 ? 1171 GLN A CG  1 
ATOM   9179  C  CD  . GLN A 1 1171 ? 13.690  81.233  40.932  1.00 25.37 ? 1171 GLN A CD  1 
ATOM   9180  O  OE1 . GLN A 1 1171 ? 14.578  82.035  40.664  1.00 27.96 ? 1171 GLN A OE1 1 
ATOM   9181  N  NE2 . GLN A 1 1171 ? 13.499  80.125  40.241  1.00 26.64 ? 1171 GLN A NE2 1 
ATOM   9182  N  N   . LEU A 1 1172 ? 12.193  82.506  45.524  1.00 24.14 ? 1172 LEU A N   1 
ATOM   9183  C  CA  . LEU A 1 1172 ? 12.295  81.606  46.663  1.00 23.53 ? 1172 LEU A CA  1 
ATOM   9184  C  C   . LEU A 1 1172 ? 11.044  81.643  47.524  1.00 24.06 ? 1172 LEU A C   1 
ATOM   9185  O  O   . LEU A 1 1172 ? 10.644  80.627  48.113  1.00 22.82 ? 1172 LEU A O   1 
ATOM   9186  C  CB  . LEU A 1 1172 ? 13.529  81.971  47.491  1.00 23.83 ? 1172 LEU A CB  1 
ATOM   9187  C  CG  . LEU A 1 1172 ? 14.045  80.965  48.524  1.00 24.57 ? 1172 LEU A CG  1 
ATOM   9188  C  CD1 . LEU A 1 1172 ? 14.100  79.555  47.938  1.00 22.34 ? 1172 LEU A CD1 1 
ATOM   9189  C  CD2 . LEU A 1 1172 ? 15.418  81.424  48.985  1.00 23.78 ? 1172 LEU A CD2 1 
ATOM   9190  N  N   . ALA A 1 1173 ? 10.415  82.815  47.583  1.00 24.10 ? 1173 ALA A N   1 
ATOM   9191  C  CA  . ALA A 1 1173 ? 9.203   82.988  48.378  1.00 24.48 ? 1173 ALA A CA  1 
ATOM   9192  C  C   . ALA A 1 1173 ? 8.095   82.012  47.974  1.00 25.35 ? 1173 ALA A C   1 
ATOM   9193  O  O   . ALA A 1 1173 ? 7.151   81.798  48.741  1.00 25.42 ? 1173 ALA A O   1 
ATOM   9194  C  CB  . ALA A 1 1173 ? 8.697   84.426  48.272  1.00 24.95 ? 1173 ALA A CB  1 
ATOM   9195  N  N   . ARG A 1 1174 ? 8.195   81.425  46.782  1.00 24.55 ? 1174 ARG A N   1 
ATOM   9196  C  CA  . ARG A 1 1174 ? 7.173   80.485  46.350  1.00 24.75 ? 1174 ARG A CA  1 
ATOM   9197  C  C   . ARG A 1 1174 ? 7.163   79.190  47.172  1.00 25.60 ? 1174 ARG A C   1 
ATOM   9198  O  O   . ARG A 1 1174 ? 6.194   78.430  47.116  1.00 25.52 ? 1174 ARG A O   1 
ATOM   9199  C  CB  . ARG A 1 1174 ? 7.335   80.120  44.869  1.00 23.13 ? 1174 ARG A CB  1 
ATOM   9200  C  CG  . ARG A 1 1174 ? 7.095   81.253  43.914  1.00 22.07 ? 1174 ARG A CG  1 
ATOM   9201  C  CD  . ARG A 1 1174 ? 6.544   80.779  42.585  1.00 21.65 ? 1174 ARG A CD  1 
ATOM   9202  N  NE  . ARG A 1 1174 ? 6.506   81.890  41.640  1.00 22.91 ? 1174 ARG A NE  1 
ATOM   9203  C  CZ  . ARG A 1 1174 ? 7.570   82.345  40.978  1.00 23.83 ? 1174 ARG A CZ  1 
ATOM   9204  N  NH1 . ARG A 1 1174 ? 8.763   81.770  41.146  1.00 24.50 ? 1174 ARG A NH1 1 
ATOM   9205  N  NH2 . ARG A 1 1174 ? 7.457   83.403  40.179  1.00 21.37 ? 1174 ARG A NH2 1 
ATOM   9206  N  N   . VAL A 1 1175 ? 8.226   78.928  47.933  1.00 25.19 ? 1175 VAL A N   1 
ATOM   9207  C  CA  . VAL A 1 1175 ? 8.266   77.694  48.725  1.00 25.44 ? 1175 VAL A CA  1 
ATOM   9208  C  C   . VAL A 1 1175 ? 7.087   77.632  49.666  1.00 25.12 ? 1175 VAL A C   1 
ATOM   9209  O  O   . VAL A 1 1175 ? 6.656   76.557  50.082  1.00 26.13 ? 1175 VAL A O   1 
ATOM   9210  C  CB  . VAL A 1 1175 ? 9.534   77.566  49.597  1.00 25.89 ? 1175 VAL A CB  1 
ATOM   9211  C  CG1 . VAL A 1 1175 ? 10.761  77.328  48.724  1.00 25.88 ? 1175 VAL A CG1 1 
ATOM   9212  C  CG2 . VAL A 1 1175 ? 9.687   78.793  50.460  1.00 28.18 ? 1175 VAL A CG2 1 
ATOM   9213  N  N   . VAL A 1 1176 ? 6.563   78.802  50.020  1.00 22.90 ? 1176 VAL A N   1 
ATOM   9214  C  CA  . VAL A 1 1176 ? 5.426   78.859  50.917  1.00 22.52 ? 1176 VAL A CA  1 
ATOM   9215  C  C   . VAL A 1 1176 ? 4.246   79.581  50.264  1.00 24.50 ? 1176 VAL A C   1 
ATOM   9216  O  O   . VAL A 1 1176 ? 3.420   80.219  50.931  1.00 24.57 ? 1176 VAL A O   1 
ATOM   9217  C  CB  . VAL A 1 1176 ? 5.791   79.546  52.250  1.00 20.76 ? 1176 VAL A CB  1 
ATOM   9218  C  CG1 . VAL A 1 1176 ? 6.731   78.653  53.057  1.00 21.57 ? 1176 VAL A CG1 1 
ATOM   9219  C  CG2 . VAL A 1 1176 ? 6.424   80.900  51.991  1.00 19.78 ? 1176 VAL A CG2 1 
ATOM   9220  N  N   . ASN A 1 1177 ? 4.183   79.474  48.950  1.00 24.83 ? 1177 ASN A N   1 
ATOM   9221  C  CA  . ASN A 1 1177 ? 3.117   80.076  48.160  1.00 25.31 ? 1177 ASN A CA  1 
ATOM   9222  C  C   . ASN A 1 1177 ? 2.908   81.584  48.278  1.00 25.02 ? 1177 ASN A C   1 
ATOM   9223  O  O   . ASN A 1 1177 ? 1.777   82.055  48.207  1.00 25.99 ? 1177 ASN A O   1 
ATOM   9224  C  CB  . ASN A 1 1177 ? 1.789   79.364  48.449  1.00 24.31 ? 1177 ASN A CB  1 
ATOM   9225  C  CG  . ASN A 1 1177 ? 1.774   77.924  47.947  1.00 25.80 ? 1177 ASN A CG  1 
ATOM   9226  O  OD1 . ASN A 1 1177 ? 2.598   77.531  47.112  1.00 27.91 ? 1177 ASN A OD1 1 
ATOM   9227  N  ND2 . ASN A 1 1177 ? 0.820   77.137  48.437  1.00 24.17 ? 1177 ASN A ND2 1 
ATOM   9228  N  N   . LEU A 1 1178 ? 3.980   82.342  48.463  1.00 23.79 ? 1178 LEU A N   1 
ATOM   9229  C  CA  . LEU A 1 1178 ? 3.837   83.792  48.537  1.00 23.46 ? 1178 LEU A CA  1 
ATOM   9230  C  C   . LEU A 1 1178 ? 4.051   84.360  47.132  1.00 22.36 ? 1178 LEU A C   1 
ATOM   9231  O  O   . LEU A 1 1178 ? 5.000   83.998  46.435  1.00 22.94 ? 1178 LEU A O   1 
ATOM   9232  C  CB  . LEU A 1 1178 ? 4.844   84.400  49.525  1.00 21.70 ? 1178 LEU A CB  1 
ATOM   9233  C  CG  . LEU A 1 1178 ? 4.471   84.253  51.005  1.00 22.18 ? 1178 LEU A CG  1 
ATOM   9234  C  CD1 . LEU A 1 1178 ? 5.652   84.594  51.885  1.00 20.06 ? 1178 LEU A CD1 1 
ATOM   9235  C  CD2 . LEU A 1 1178 ? 3.299   85.176  51.325  1.00 23.67 ? 1178 LEU A CD2 1 
ATOM   9236  N  N   . ALA A 1 1179 ? 3.152   85.244  46.719  1.00 21.49 ? 1179 ALA A N   1 
ATOM   9237  C  CA  . ALA A 1 1179 ? 3.228   85.850  45.395  1.00 20.56 ? 1179 ALA A CA  1 
ATOM   9238  C  C   . ALA A 1 1179 ? 3.159   87.367  45.489  1.00 20.33 ? 1179 ALA A C   1 
ATOM   9239  O  O   . ALA A 1 1179 ? 2.509   87.912  46.387  1.00 19.96 ? 1179 ALA A O   1 
ATOM   9240  C  CB  . ALA A 1 1179 ? 2.085   85.324  44.521  1.00 19.03 ? 1179 ALA A CB  1 
ATOM   9241  N  N   . VAL A 1 1180 ? 3.838   88.059  44.581  1.00 20.80 ? 1180 VAL A N   1 
ATOM   9242  C  CA  . VAL A 1 1180 ? 3.786   89.517  44.590  1.00 20.97 ? 1180 VAL A CA  1 
ATOM   9243  C  C   . VAL A 1 1180 ? 2.330   89.864  44.282  1.00 21.39 ? 1180 VAL A C   1 
ATOM   9244  O  O   . VAL A 1 1180 ? 1.758   89.352  43.320  1.00 21.12 ? 1180 VAL A O   1 
ATOM   9245  C  CB  . VAL A 1 1180 ? 4.684   90.144  43.503  1.00 19.73 ? 1180 VAL A CB  1 
ATOM   9246  C  CG1 . VAL A 1 1180 ? 4.503   91.653  43.499  1.00 20.18 ? 1180 VAL A CG1 1 
ATOM   9247  C  CG2 . VAL A 1 1180 ? 6.130   89.801  43.765  1.00 18.70 ? 1180 VAL A CG2 1 
ATOM   9248  N  N   . PRO A 1 1181 ? 1.699   90.711  45.112  1.00 22.23 ? 1181 PRO A N   1 
ATOM   9249  C  CA  . PRO A 1 1181 ? 0.301   91.100  44.902  1.00 22.25 ? 1181 PRO A CA  1 
ATOM   9250  C  C   . PRO A 1 1181 ? 0.053   91.827  43.580  1.00 22.81 ? 1181 PRO A C   1 
ATOM   9251  O  O   . PRO A 1 1181 ? 0.841   92.670  43.161  1.00 23.37 ? 1181 PRO A O   1 
ATOM   9252  C  CB  . PRO A 1 1181 ? 0.017   92.001  46.109  1.00 22.44 ? 1181 PRO A CB  1 
ATOM   9253  C  CG  . PRO A 1 1181 ? 0.933   91.486  47.159  1.00 19.56 ? 1181 PRO A CG  1 
ATOM   9254  C  CD  . PRO A 1 1181 ? 2.203   91.254  46.386  1.00 21.41 ? 1181 PRO A CD  1 
ATOM   9255  N  N   . ASP A 1 1182 ? -1.055  91.514  42.924  1.00 24.26 ? 1182 ASP A N   1 
ATOM   9256  C  CA  . ASP A 1 1182 ? -1.387  92.172  41.666  1.00 24.55 ? 1182 ASP A CA  1 
ATOM   9257  C  C   . ASP A 1 1182 ? -1.394  93.685  41.815  1.00 24.74 ? 1182 ASP A C   1 
ATOM   9258  O  O   . ASP A 1 1182 ? -0.867  94.395  40.951  1.00 24.07 ? 1182 ASP A O   1 
ATOM   9259  C  CB  . ASP A 1 1182 ? -2.744  91.706  41.149  1.00 27.88 ? 1182 ASP A CB  1 
ATOM   9260  C  CG  . ASP A 1 1182 ? -2.621  90.798  39.949  1.00 32.06 ? 1182 ASP A CG  1 
ATOM   9261  O  OD1 . ASP A 1 1182 ? -1.888  89.785  40.030  1.00 33.83 ? 1182 ASP A OD1 1 
ATOM   9262  O  OD2 . ASP A 1 1182 ? -3.258  91.099  38.913  1.00 37.80 ? 1182 ASP A OD2 1 
ATOM   9263  N  N   . THR A 1 1183 ? -1.957  94.181  42.915  1.00 23.07 ? 1183 THR A N   1 
ATOM   9264  C  CA  . THR A 1 1183 ? -2.014  95.615  43.127  1.00 22.65 ? 1183 THR A CA  1 
ATOM   9265  C  C   . THR A 1 1183 ? -0.649  96.311  43.261  1.00 22.85 ? 1183 THR A C   1 
ATOM   9266  O  O   . THR A 1 1183 ? -0.549  97.515  43.040  1.00 23.74 ? 1183 THR A O   1 
ATOM   9267  C  CB  . THR A 1 1183 ? -2.919  95.968  44.352  1.00 23.31 ? 1183 THR A CB  1 
ATOM   9268  O  OG1 . THR A 1 1183 ? -2.484  95.262  45.522  1.00 20.87 ? 1183 THR A OG1 1 
ATOM   9269  C  CG2 . THR A 1 1183 ? -4.367  95.620  44.053  1.00 21.88 ? 1183 THR A CG2 1 
ATOM   9270  N  N   . TRP A 1 1184 ? 0.401   95.557  43.580  1.00 22.40 ? 1184 TRP A N   1 
ATOM   9271  C  CA  . TRP A 1 1184 ? 1.741   96.126  43.747  1.00 23.13 ? 1184 TRP A CA  1 
ATOM   9272  C  C   . TRP A 1 1184 ? 2.517   96.234  42.436  1.00 23.45 ? 1184 TRP A C   1 
ATOM   9273  O  O   . TRP A 1 1184 ? 3.488   96.979  42.344  1.00 24.71 ? 1184 TRP A O   1 
ATOM   9274  C  CB  . TRP A 1 1184 ? 2.590   95.255  44.693  1.00 23.10 ? 1184 TRP A CB  1 
ATOM   9275  C  CG  . TRP A 1 1184 ? 2.151   95.147  46.131  1.00 22.31 ? 1184 TRP A CG  1 
ATOM   9276  C  CD1 . TRP A 1 1184 ? 0.949   95.501  46.658  1.00 20.74 ? 1184 TRP A CD1 1 
ATOM   9277  C  CD2 . TRP A 1 1184 ? 2.912   94.571  47.208  1.00 21.94 ? 1184 TRP A CD2 1 
ATOM   9278  N  NE1 . TRP A 1 1184 ? 0.907   95.177  47.997  1.00 22.92 ? 1184 TRP A NE1 1 
ATOM   9279  C  CE2 . TRP A 1 1184 ? 2.099   94.603  48.358  1.00 21.95 ? 1184 TRP A CE2 1 
ATOM   9280  C  CE3 . TRP A 1 1184 ? 4.202   94.029  47.307  1.00 20.93 ? 1184 TRP A CE3 1 
ATOM   9281  C  CZ2 . TRP A 1 1184 ? 2.528   94.116  49.597  1.00 22.05 ? 1184 TRP A CZ2 1 
ATOM   9282  C  CZ3 . TRP A 1 1184 ? 4.634   93.547  48.540  1.00 22.13 ? 1184 TRP A CZ3 1 
ATOM   9283  C  CH2 . TRP A 1 1184 ? 3.794   93.594  49.671  1.00 22.66 ? 1184 TRP A CH2 1 
ATOM   9284  N  N   . MET A 1 1185 ? 2.109   95.455  41.444  1.00 24.88 ? 1185 MET A N   1 
ATOM   9285  C  CA  . MET A 1 1185 ? 2.786   95.410  40.147  1.00 26.45 ? 1185 MET A CA  1 
ATOM   9286  C  C   . MET A 1 1185 ? 3.148   96.763  39.518  1.00 26.68 ? 1185 MET A C   1 
ATOM   9287  O  O   . MET A 1 1185 ? 4.047   96.842  38.670  1.00 28.61 ? 1185 MET A O   1 
ATOM   9288  C  CB  . MET A 1 1185 ? 1.938   94.615  39.139  1.00 27.47 ? 1185 MET A CB  1 
ATOM   9289  C  CG  . MET A 1 1185 ? 1.543   93.209  39.578  1.00 27.94 ? 1185 MET A CG  1 
ATOM   9290  S  SD  . MET A 1 1185 ? 2.880   92.032  39.474  1.00 29.29 ? 1185 MET A SD  1 
ATOM   9291  C  CE  . MET A 1 1185 ? 2.079   90.477  39.974  1.00 28.46 ? 1185 MET A CE  1 
ATOM   9292  N  N   . SER A 1 1186 ? 2.454   97.829  39.893  1.00 25.47 ? 1186 SER A N   1 
ATOM   9293  C  CA  . SER A 1 1186 ? 2.781   99.122  39.291  1.00 25.04 ? 1186 SER A CA  1 
ATOM   9294  C  C   . SER A 1 1186 ? 3.822   99.889  40.098  1.00 23.97 ? 1186 SER A C   1 
ATOM   9295  O  O   . SER A 1 1186 ? 4.271   100.951 39.692  1.00 23.47 ? 1186 SER A O   1 
ATOM   9296  C  CB  . SER A 1 1186 ? 1.508   99.974  39.110  1.00 26.23 ? 1186 SER A CB  1 
ATOM   9297  O  OG  . SER A 1 1186 ? 0.859   100.249 40.354  1.00 28.33 ? 1186 SER A OG  1 
ATOM   9298  N  N   . LEU A 1 1187 ? 4.209   99.339  41.239  1.00 23.47 ? 1187 LEU A N   1 
ATOM   9299  C  CA  . LEU A 1 1187 ? 5.197   99.984  42.088  1.00 22.79 ? 1187 LEU A CA  1 
ATOM   9300  C  C   . LEU A 1 1187 ? 6.514   99.199  42.124  1.00 22.73 ? 1187 LEU A C   1 
ATOM   9301  O  O   . LEU A 1 1187 ? 6.550   98.016  41.782  1.00 23.32 ? 1187 LEU A O   1 
ATOM   9302  C  CB  . LEU A 1 1187 ? 4.630   100.123 43.496  1.00 21.66 ? 1187 LEU A CB  1 
ATOM   9303  C  CG  . LEU A 1 1187 ? 3.326   100.919 43.567  1.00 20.84 ? 1187 LEU A CG  1 
ATOM   9304  C  CD1 . LEU A 1 1187 ? 2.536   100.529 44.812  1.00 19.91 ? 1187 LEU A CD1 1 
ATOM   9305  C  CD2 . LEU A 1 1187 ? 3.647   102.390 43.568  1.00 19.32 ? 1187 LEU A CD2 1 
ATOM   9306  N  N   . ASP A 1 1188 ? 7.584   99.856  42.560  1.00 21.70 ? 1188 ASP A N   1 
ATOM   9307  C  CA  . ASP A 1 1188 ? 8.889   99.219  42.636  1.00 21.98 ? 1188 ASP A CA  1 
ATOM   9308  C  C   . ASP A 1 1188 ? 9.026   98.320  43.872  1.00 22.42 ? 1188 ASP A C   1 
ATOM   9309  O  O   . ASP A 1 1188 ? 9.780   98.643  44.812  1.00 21.94 ? 1188 ASP A O   1 
ATOM   9310  C  CB  . ASP A 1 1188 ? 9.981   100.296 42.621  1.00 23.22 ? 1188 ASP A CB  1 
ATOM   9311  C  CG  . ASP A 1 1188 ? 11.391  99.718  42.633  1.00 24.13 ? 1188 ASP A CG  1 
ATOM   9312  O  OD1 . ASP A 1 1188 ? 11.558  98.484  42.496  1.00 22.97 ? 1188 ASP A OD1 1 
ATOM   9313  O  OD2 . ASP A 1 1188 ? 12.344  100.520 42.777  1.00 23.89 ? 1188 ASP A OD2 1 
ATOM   9314  N  N   . PHE A 1 1189 ? 8.323   97.185  43.854  1.00 22.48 ? 1189 PHE A N   1 
ATOM   9315  C  CA  . PHE A 1 1189 ? 8.370   96.252  44.978  1.00 22.51 ? 1189 PHE A CA  1 
ATOM   9316  C  C   . PHE A 1 1189 ? 9.747   95.616  45.162  1.00 22.53 ? 1189 PHE A C   1 
ATOM   9317  O  O   . PHE A 1 1189 ? 10.153  95.318  46.287  1.00 22.29 ? 1189 PHE A O   1 
ATOM   9318  C  CB  . PHE A 1 1189 ? 7.292   95.173  44.823  1.00 18.53 ? 1189 PHE A CB  1 
ATOM   9319  C  CG  . PHE A 1 1189 ? 7.393   94.390  43.547  1.00 19.50 ? 1189 PHE A CG  1 
ATOM   9320  C  CD1 . PHE A 1 1189 ? 8.222   93.269  43.461  1.00 17.64 ? 1189 PHE A CD1 1 
ATOM   9321  C  CD2 . PHE A 1 1189 ? 6.659   94.774  42.417  1.00 17.79 ? 1189 PHE A CD2 1 
ATOM   9322  C  CE1 . PHE A 1 1189 ? 8.322   92.540  42.263  1.00 17.52 ? 1189 PHE A CE1 1 
ATOM   9323  C  CE2 . PHE A 1 1189 ? 6.753   94.057  41.225  1.00 16.08 ? 1189 PHE A CE2 1 
ATOM   9324  C  CZ  . PHE A 1 1189 ? 7.585   92.936  41.150  1.00 17.50 ? 1189 PHE A CZ  1 
ATOM   9325  N  N   . ASP A 1 1190 ? 10.471  95.428  44.062  1.00 24.59 ? 1190 ASP A N   1 
ATOM   9326  C  CA  . ASP A 1 1190 ? 11.805  94.837  44.116  1.00 24.74 ? 1190 ASP A CA  1 
ATOM   9327  C  C   . ASP A 1 1190 ? 12.659  95.656  45.076  1.00 24.74 ? 1190 ASP A C   1 
ATOM   9328  O  O   . ASP A 1 1190 ? 13.337  95.113  45.947  1.00 24.51 ? 1190 ASP A O   1 
ATOM   9329  C  CB  . ASP A 1 1190 ? 12.441  94.843  42.722  1.00 27.43 ? 1190 ASP A CB  1 
ATOM   9330  C  CG  . ASP A 1 1190 ? 13.781  94.113  42.677  1.00 28.36 ? 1190 ASP A CG  1 
ATOM   9331  O  OD1 . ASP A 1 1190 ? 13.791  92.867  42.634  1.00 28.78 ? 1190 ASP A OD1 1 
ATOM   9332  O  OD2 . ASP A 1 1190 ? 14.825  94.791  42.693  1.00 28.43 ? 1190 ASP A OD2 1 
ATOM   9333  N  N   . SER A 1 1191 ? 12.618  96.975  44.922  1.00 25.38 ? 1191 SER A N   1 
ATOM   9334  C  CA  . SER A 1 1191 ? 13.392  97.855  45.795  1.00 26.08 ? 1191 SER A CA  1 
ATOM   9335  C  C   . SER A 1 1191 ? 12.940  97.766  47.241  1.00 26.58 ? 1191 SER A C   1 
ATOM   9336  O  O   . SER A 1 1191 ? 13.759  97.816  48.156  1.00 27.22 ? 1191 SER A O   1 
ATOM   9337  C  CB  . SER A 1 1191 ? 13.302  99.305  45.330  1.00 26.71 ? 1191 SER A CB  1 
ATOM   9338  O  OG  . SER A 1 1191 ? 14.062  99.489  44.155  1.00 29.44 ? 1191 SER A OG  1 
ATOM   9339  N  N   . MET A 1 1192 ? 11.638  97.648  47.456  1.00 25.67 ? 1192 MET A N   1 
ATOM   9340  C  CA  . MET A 1 1192 ? 11.157  97.540  48.808  1.00 26.51 ? 1192 MET A CA  1 
ATOM   9341  C  C   . MET A 1 1192 ? 11.747  96.309  49.492  1.00 27.15 ? 1192 MET A C   1 
ATOM   9342  O  O   . MET A 1 1192 ? 12.266  96.409  50.592  1.00 28.11 ? 1192 MET A O   1 
ATOM   9343  C  CB  . MET A 1 1192 ? 9.638   97.467  48.835  1.00 25.80 ? 1192 MET A CB  1 
ATOM   9344  C  CG  . MET A 1 1192 ? 9.106   97.221  50.227  1.00 25.12 ? 1192 MET A CG  1 
ATOM   9345  S  SD  . MET A 1 1192 ? 7.356   97.498  50.272  1.00 25.78 ? 1192 MET A SD  1 
ATOM   9346  C  CE  . MET A 1 1192 ? 6.837   96.417  48.888  1.00 24.94 ? 1192 MET A CE  1 
ATOM   9347  N  N   . PHE A 1 1193 ? 11.655  95.147  48.852  1.00 28.46 ? 1193 PHE A N   1 
ATOM   9348  C  CA  . PHE A 1 1193 ? 12.201  93.930  49.445  1.00 29.80 ? 1193 PHE A CA  1 
ATOM   9349  C  C   . PHE A 1 1193 ? 13.696  94.078  49.723  1.00 32.27 ? 1193 PHE A C   1 
ATOM   9350  O  O   . PHE A 1 1193 ? 14.160  93.710  50.795  1.00 33.74 ? 1193 PHE A O   1 
ATOM   9351  C  CB  . PHE A 1 1193 ? 12.023  92.709  48.525  1.00 28.65 ? 1193 PHE A CB  1 
ATOM   9352  C  CG  . PHE A 1 1193 ? 10.588  92.291  48.288  1.00 27.33 ? 1193 PHE A CG  1 
ATOM   9353  C  CD1 . PHE A 1 1193 ? 9.678   92.183  49.341  1.00 27.24 ? 1193 PHE A CD1 1 
ATOM   9354  C  CD2 . PHE A 1 1193 ? 10.175  91.921  47.015  1.00 25.13 ? 1193 PHE A CD2 1 
ATOM   9355  C  CE1 . PHE A 1 1193 ? 8.384   91.706  49.129  1.00 24.06 ? 1193 PHE A CE1 1 
ATOM   9356  C  CE2 . PHE A 1 1193 ? 8.887   91.444  46.794  1.00 27.48 ? 1193 PHE A CE2 1 
ATOM   9357  C  CZ  . PHE A 1 1193 ? 7.987   91.335  47.861  1.00 25.51 ? 1193 PHE A CZ  1 
ATOM   9358  N  N   . LYS A 1 1194 ? 14.447  94.622  48.766  1.00 33.62 ? 1194 LYS A N   1 
ATOM   9359  C  CA  . LYS A 1 1194 ? 15.902  94.746  48.913  1.00 34.84 ? 1194 LYS A CA  1 
ATOM   9360  C  C   . LYS A 1 1194 ? 16.500  95.776  49.865  1.00 35.70 ? 1194 LYS A C   1 
ATOM   9361  O  O   . LYS A 1 1194 ? 17.457  95.480  50.586  1.00 37.32 ? 1194 LYS A O   1 
ATOM   9362  C  CB  . LYS A 1 1194 ? 16.559  94.977  47.551  1.00 35.69 ? 1194 LYS A CB  1 
ATOM   9363  C  CG  . LYS A 1 1194 ? 16.654  93.763  46.647  1.00 37.80 ? 1194 LYS A CG  1 
ATOM   9364  C  CD  . LYS A 1 1194 ? 17.608  94.037  45.486  1.00 38.61 ? 1194 LYS A CD  1 
ATOM   9365  C  CE  . LYS A 1 1194 ? 17.710  92.850  44.536  1.00 39.51 ? 1194 LYS A CE  1 
ATOM   9366  N  NZ  . LYS A 1 1194 ? 16.469  92.678  43.722  1.00 38.69 ? 1194 LYS A NZ  1 
ATOM   9367  N  N   . HIS A 1 1195 ? 15.954  96.987  49.868  1.00 35.19 ? 1195 HIS A N   1 
ATOM   9368  C  CA  . HIS A 1 1195 ? 16.519  98.046  50.691  1.00 34.49 ? 1195 HIS A CA  1 
ATOM   9369  C  C   . HIS A 1 1195 ? 15.629  98.626  51.775  1.00 33.27 ? 1195 HIS A C   1 
ATOM   9370  O  O   . HIS A 1 1195 ? 16.071  99.470  52.546  1.00 33.55 ? 1195 HIS A O   1 
ATOM   9371  C  CB  . HIS A 1 1195 ? 16.984  99.185  49.779  1.00 35.49 ? 1195 HIS A CB  1 
ATOM   9372  C  CG  . HIS A 1 1195 ? 17.939  98.756  48.704  1.00 36.56 ? 1195 HIS A CG  1 
ATOM   9373  N  ND1 . HIS A 1 1195 ? 19.196  98.263  48.976  1.00 36.57 ? 1195 HIS A ND1 1 
ATOM   9374  C  CD2 . HIS A 1 1195 ? 17.821  98.764  47.354  1.00 36.29 ? 1195 HIS A CD2 1 
ATOM   9375  C  CE1 . HIS A 1 1195 ? 19.815  97.988  47.840  1.00 36.29 ? 1195 HIS A CE1 1 
ATOM   9376  N  NE2 . HIS A 1 1195 ? 19.005  98.284  46.843  1.00 35.97 ? 1195 HIS A NE2 1 
ATOM   9377  N  N   . HIS A 1 1196 ? 14.392  98.169  51.876  1.00 31.22 ? 1196 HIS A N   1 
ATOM   9378  C  CA  . HIS A 1 1196 ? 13.531  98.781  52.861  1.00 29.73 ? 1196 HIS A CA  1 
ATOM   9379  C  C   . HIS A 1 1196 ? 12.786  97.888  53.851  1.00 29.57 ? 1196 HIS A C   1 
ATOM   9380  O  O   . HIS A 1 1196 ? 11.862  98.322  54.538  1.00 28.02 ? 1196 HIS A O   1 
ATOM   9381  C  CB  . HIS A 1 1196 ? 12.628  99.745  52.104  1.00 29.24 ? 1196 HIS A CB  1 
ATOM   9382  C  CG  . HIS A 1 1196 ? 13.402  100.820 51.406  1.00 27.76 ? 1196 HIS A CG  1 
ATOM   9383  N  ND1 . HIS A 1 1196 ? 13.875  101.945 52.058  1.00 26.34 ? 1196 HIS A ND1 1 
ATOM   9384  C  CD2 . HIS A 1 1196 ? 13.889  100.894 50.144  1.00 26.06 ? 1196 HIS A CD2 1 
ATOM   9385  C  CE1 . HIS A 1 1196 ? 14.614  102.656 51.228  1.00 24.77 ? 1196 HIS A CE1 1 
ATOM   9386  N  NE2 . HIS A 1 1196 ? 14.639  102.040 50.060  1.00 24.11 ? 1196 HIS A NE2 1 
ATOM   9387  N  N   . VAL A 1 1197 ? 13.237  96.645  53.945  1.00 30.17 ? 1197 VAL A N   1 
ATOM   9388  C  CA  . VAL A 1 1197 ? 12.694  95.687  54.902  1.00 31.28 ? 1197 VAL A CA  1 
ATOM   9389  C  C   . VAL A 1 1197 ? 13.941  95.149  55.587  1.00 32.27 ? 1197 VAL A C   1 
ATOM   9390  O  O   . VAL A 1 1197 ? 14.552  94.205  55.103  1.00 33.10 ? 1197 VAL A O   1 
ATOM   9391  C  CB  . VAL A 1 1197 ? 11.948  94.509  54.215  1.00 30.61 ? 1197 VAL A CB  1 
ATOM   9392  C  CG1 . VAL A 1 1197 ? 11.384  93.560  55.277  1.00 27.75 ? 1197 VAL A CG1 1 
ATOM   9393  C  CG2 . VAL A 1 1197 ? 10.821  95.048  53.321  1.00 27.77 ? 1197 VAL A CG2 1 
ATOM   9394  N  N   . LYS A 1 1198 ? 14.331  95.777  56.693  1.00 32.50 ? 1198 LYS A N   1 
ATOM   9395  C  CA  . LYS A 1 1198 ? 15.520  95.370  57.423  1.00 31.49 ? 1198 LYS A CA  1 
ATOM   9396  C  C   . LYS A 1 1198 ? 15.274  94.154  58.306  1.00 30.28 ? 1198 LYS A C   1 
ATOM   9397  O  O   . LYS A 1 1198 ? 14.338  94.132  59.097  1.00 29.66 ? 1198 LYS A O   1 
ATOM   9398  C  CB  . LYS A 1 1198 ? 16.034  96.527  58.287  1.00 33.19 ? 1198 LYS A CB  1 
ATOM   9399  C  CG  . LYS A 1 1198 ? 16.708  97.667  57.524  1.00 33.44 ? 1198 LYS A CG  1 
ATOM   9400  C  CD  . LYS A 1 1198 ? 15.707  98.438  56.679  1.00 33.39 ? 1198 LYS A CD  1 
ATOM   9401  C  CE  . LYS A 1 1198 ? 16.278  99.776  56.256  1.00 34.67 ? 1198 LYS A CE  1 
ATOM   9402  N  NZ  . LYS A 1 1198 ? 17.537  99.644  55.472  1.00 32.80 ? 1198 LYS A NZ  1 
ATOM   9403  N  N   . LEU A 1 1199 ? 16.129  93.149  58.170  1.00 29.76 ? 1199 LEU A N   1 
ATOM   9404  C  CA  . LEU A 1 1199 ? 16.018  91.932  58.957  1.00 30.04 ? 1199 LEU A CA  1 
ATOM   9405  C  C   . LEU A 1 1199 ? 16.970  91.951  60.157  1.00 31.71 ? 1199 LEU A C   1 
ATOM   9406  O  O   . LEU A 1 1199 ? 17.040  90.986  60.918  1.00 33.40 ? 1199 LEU A O   1 
ATOM   9407  C  CB  . LEU A 1 1199 ? 16.292  90.729  58.067  1.00 27.89 ? 1199 LEU A CB  1 
ATOM   9408  C  CG  . LEU A 1 1199 ? 15.478  90.770  56.765  1.00 26.94 ? 1199 LEU A CG  1 
ATOM   9409  C  CD1 . LEU A 1 1199 ? 15.784  89.532  55.932  1.00 23.85 ? 1199 LEU A CD1 1 
ATOM   9410  C  CD2 . LEU A 1 1199 ? 13.987  90.863  57.071  1.00 24.08 ? 1199 LEU A CD2 1 
ATOM   9411  N  N   . LEU A 1 1200 ? 17.703  93.053  60.316  1.00 33.06 ? 1200 LEU A N   1 
ATOM   9412  C  CA  . LEU A 1 1200 ? 18.619  93.229  61.443  1.00 34.31 ? 1200 LEU A CA  1 
ATOM   9413  C  C   . LEU A 1 1200 ? 17.892  94.226  62.322  1.00 35.07 ? 1200 LEU A C   1 
ATOM   9414  O  O   . LEU A 1 1200 ? 17.862  95.410  62.005  1.00 36.31 ? 1200 LEU A O   1 
ATOM   9415  C  CB  . LEU A 1 1200 ? 19.950  93.824  60.974  1.00 34.86 ? 1200 LEU A CB  1 
ATOM   9416  C  CG  . LEU A 1 1200 ? 21.057  94.107  62.008  1.00 36.83 ? 1200 LEU A CG  1 
ATOM   9417  C  CD1 . LEU A 1 1200 ? 22.353  94.458  61.267  1.00 35.62 ? 1200 LEU A CD1 1 
ATOM   9418  C  CD2 . LEU A 1 1200 ? 20.659  95.256  62.946  1.00 37.19 ? 1200 LEU A CD2 1 
ATOM   9419  N  N   . PRO A 1 1201 ? 17.301  93.765  63.433  1.00 36.21 ? 1201 PRO A N   1 
ATOM   9420  C  CA  . PRO A 1 1201 ? 16.555  94.631  64.355  1.00 37.37 ? 1201 PRO A CA  1 
ATOM   9421  C  C   . PRO A 1 1201 ? 17.068  96.062  64.439  1.00 38.21 ? 1201 PRO A C   1 
ATOM   9422  O  O   . PRO A 1 1201 ? 18.266  96.324  64.283  1.00 38.28 ? 1201 PRO A O   1 
ATOM   9423  C  CB  . PRO A 1 1201 ? 16.644  93.881  65.677  1.00 37.37 ? 1201 PRO A CB  1 
ATOM   9424  C  CG  . PRO A 1 1201 ? 16.547  92.461  65.222  1.00 37.10 ? 1201 PRO A CG  1 
ATOM   9425  C  CD  . PRO A 1 1201 ? 17.500  92.431  64.029  1.00 36.84 ? 1201 PRO A CD  1 
ATOM   9426  N  N   . LYS A 1 1202 ? 16.144  96.987  64.668  1.00 38.62 ? 1202 LYS A N   1 
ATOM   9427  C  CA  . LYS A 1 1202 ? 16.480  98.398  64.755  1.00 40.34 ? 1202 LYS A CA  1 
ATOM   9428  C  C   . LYS A 1 1202 ? 17.694  98.655  65.654  1.00 41.55 ? 1202 LYS A C   1 
ATOM   9429  O  O   . LYS A 1 1202 ? 18.551  99.483  65.329  1.00 39.41 ? 1202 LYS A O   1 
ATOM   9430  C  CB  . LYS A 1 1202 ? 15.266  99.184  65.266  1.00 41.32 ? 1202 LYS A CB  1 
ATOM   9431  C  CG  . LYS A 1 1202 ? 15.445  100.693 65.270  1.00 43.23 ? 1202 LYS A CG  1 
ATOM   9432  C  CD  . LYS A 1 1202 ? 15.740  101.225 63.875  1.00 44.55 ? 1202 LYS A CD  1 
ATOM   9433  C  CE  . LYS A 1 1202 ? 15.735  102.750 63.838  1.00 46.32 ? 1202 LYS A CE  1 
ATOM   9434  N  NZ  . LYS A 1 1202 ? 16.208  103.258 62.513  1.00 46.92 ? 1202 LYS A NZ  1 
ATOM   9435  N  N   . ASP A 1 1203 ? 17.775  97.926  66.767  1.00 43.32 ? 1203 ASP A N   1 
ATOM   9436  C  CA  . ASP A 1 1203 ? 18.869  98.094  67.722  1.00 44.51 ? 1203 ASP A CA  1 
ATOM   9437  C  C   . ASP A 1 1203 ? 19.877  96.951  67.787  1.00 44.81 ? 1203 ASP A C   1 
ATOM   9438  O  O   . ASP A 1 1203 ? 20.383  96.637  68.858  1.00 44.00 ? 1203 ASP A O   1 
ATOM   9439  C  CB  . ASP A 1 1203 ? 18.293  98.311  69.117  1.00 45.38 ? 1203 ASP A CB  1 
ATOM   9440  C  CG  . ASP A 1 1203 ? 17.336  97.208  69.522  1.00 46.78 ? 1203 ASP A CG  1 
ATOM   9441  O  OD1 . ASP A 1 1203 ? 17.451  96.092  68.973  1.00 48.20 ? 1203 ASP A OD1 1 
ATOM   9442  O  OD2 . ASP A 1 1203 ? 16.475  97.452  70.390  1.00 48.13 ? 1203 ASP A OD2 1 
ATOM   9443  N  N   . GLY A 1 1204 ? 20.165  96.322  66.654  1.00 45.59 ? 1204 GLY A N   1 
ATOM   9444  C  CA  . GLY A 1 1204 ? 21.138  95.245  66.659  1.00 45.90 ? 1204 GLY A CA  1 
ATOM   9445  C  C   . GLY A 1 1204 ? 20.593  93.835  66.567  1.00 46.27 ? 1204 GLY A C   1 
ATOM   9446  O  O   . GLY A 1 1204 ? 19.423  93.625  66.279  1.00 46.37 ? 1204 GLY A O   1 
ATOM   9447  N  N   . ARG A 1 1205 ? 21.458  92.861  66.826  1.00 47.11 ? 1205 ARG A N   1 
ATOM   9448  C  CA  . ARG A 1 1205 ? 21.088  91.456  66.757  1.00 47.36 ? 1205 ARG A CA  1 
ATOM   9449  C  C   . ARG A 1 1205 ? 20.314  90.938  67.962  1.00 47.13 ? 1205 ARG A C   1 
ATOM   9450  O  O   . ARG A 1 1205 ? 20.634  91.246  69.111  1.00 47.97 ? 1205 ARG A O   1 
ATOM   9451  C  CB  . ARG A 1 1205 ? 22.340  90.602  66.551  1.00 48.02 ? 1205 ARG A CB  1 
ATOM   9452  C  CG  . ARG A 1 1205 ? 22.919  90.695  65.152  1.00 49.95 ? 1205 ARG A CG  1 
ATOM   9453  C  CD  . ARG A 1 1205 ? 24.151  89.825  65.018  1.00 51.19 ? 1205 ARG A CD  1 
ATOM   9454  N  NE  . ARG A 1 1205 ? 23.907  88.471  65.509  1.00 53.03 ? 1205 ARG A NE  1 
ATOM   9455  C  CZ  . ARG A 1 1205 ? 24.864  87.582  65.750  1.00 53.07 ? 1205 ARG A CZ  1 
ATOM   9456  N  NH1 . ARG A 1 1205 ? 26.134  87.903  65.545  1.00 53.62 ? 1205 ARG A NH1 1 
ATOM   9457  N  NH2 . ARG A 1 1205 ? 24.555  86.374  66.199  1.00 52.98 ? 1205 ARG A NH2 1 
ATOM   9458  N  N   . HIS A 1 1206 ? 19.291  90.144  67.678  1.00 45.98 ? 1206 HIS A N   1 
ATOM   9459  C  CA  . HIS A 1 1206 ? 18.460  89.545  68.707  1.00 46.10 ? 1206 HIS A CA  1 
ATOM   9460  C  C   . HIS A 1 1206 ? 18.627  88.042  68.576  1.00 45.05 ? 1206 HIS A C   1 
ATOM   9461  O  O   . HIS A 1 1206 ? 18.806  87.537  67.467  1.00 45.05 ? 1206 HIS A O   1 
ATOM   9462  C  CB  . HIS A 1 1206 ? 16.991  89.908  68.483  1.00 48.46 ? 1206 HIS A CB  1 
ATOM   9463  C  CG  . HIS A 1 1206 ? 16.664  91.341  68.767  1.00 49.97 ? 1206 HIS A CG  1 
ATOM   9464  N  ND1 . HIS A 1 1206 ? 15.422  91.886  68.515  1.00 51.51 ? 1206 HIS A ND1 1 
ATOM   9465  C  CD2 . HIS A 1 1206 ? 17.412  92.341  69.290  1.00 50.87 ? 1206 HIS A CD2 1 
ATOM   9466  C  CE1 . HIS A 1 1206 ? 15.417  93.156  68.870  1.00 51.49 ? 1206 HIS A CE1 1 
ATOM   9467  N  NE2 . HIS A 1 1206 ? 16.614  93.459  69.344  1.00 52.19 ? 1206 HIS A NE2 1 
ATOM   9468  N  N   . LEU A 1 1207 ? 18.567  87.328  69.693  1.00 44.63 ? 1207 LEU A N   1 
ATOM   9469  C  CA  . LEU A 1 1207 ? 18.704  85.879  69.661  1.00 44.39 ? 1207 LEU A CA  1 
ATOM   9470  C  C   . LEU A 1 1207 ? 17.641  85.264  68.755  1.00 43.50 ? 1207 LEU A C   1 
ATOM   9471  O  O   . LEU A 1 1207 ? 17.924  84.361  67.962  1.00 42.99 ? 1207 LEU A O   1 
ATOM   9472  C  CB  . LEU A 1 1207 ? 18.569  85.299  71.069  1.00 45.83 ? 1207 LEU A CB  1 
ATOM   9473  C  CG  . LEU A 1 1207 ? 19.849  85.202  71.898  1.00 47.18 ? 1207 LEU A CG  1 
ATOM   9474  C  CD1 . LEU A 1 1207 ? 19.562  84.510  73.225  1.00 47.04 ? 1207 LEU A CD1 1 
ATOM   9475  C  CD2 . LEU A 1 1207 ? 20.896  84.435  71.104  1.00 48.11 ? 1207 LEU A CD2 1 
ATOM   9476  N  N   . ASN A 1 1208 ? 16.418  85.774  68.868  1.00 42.07 ? 1208 ASN A N   1 
ATOM   9477  C  CA  . ASN A 1 1208 ? 15.297  85.275  68.085  1.00 40.27 ? 1208 ASN A CA  1 
ATOM   9478  C  C   . ASN A 1 1208 ? 15.285  85.681  66.621  1.00 38.90 ? 1208 ASN A C   1 
ATOM   9479  O  O   . ASN A 1 1208 ? 14.685  84.992  65.794  1.00 38.93 ? 1208 ASN A O   1 
ATOM   9480  C  CB  . ASN A 1 1208 ? 13.981  85.720  68.715  1.00 41.29 ? 1208 ASN A CB  1 
ATOM   9481  C  CG  . ASN A 1 1208 ? 13.786  85.163  70.107  1.00 41.09 ? 1208 ASN A CG  1 
ATOM   9482  O  OD1 . ASN A 1 1208 ? 14.355  84.131  70.457  1.00 42.25 ? 1208 ASN A OD1 1 
ATOM   9483  N  ND2 . ASN A 1 1208 ? 12.964  85.834  70.906  1.00 40.99 ? 1208 ASN A ND2 1 
ATOM   9484  N  N   . THR A 1 1209 ? 15.934  86.797  66.300  1.00 37.44 ? 1209 THR A N   1 
ATOM   9485  C  CA  . THR A 1 1209 ? 15.953  87.291  64.929  1.00 35.02 ? 1209 THR A CA  1 
ATOM   9486  C  C   . THR A 1 1209 ? 17.059  86.699  64.070  1.00 35.02 ? 1209 THR A C   1 
ATOM   9487  O  O   . THR A 1 1209 ? 16.963  86.719  62.845  1.00 35.86 ? 1209 THR A O   1 
ATOM   9488  C  CB  . THR A 1 1209 ? 16.084  88.817  64.893  1.00 34.54 ? 1209 THR A CB  1 
ATOM   9489  O  OG1 . THR A 1 1209 ? 17.326  89.214  65.482  1.00 34.99 ? 1209 THR A OG1 1 
ATOM   9490  C  CG2 . THR A 1 1209 ? 14.963  89.453  65.663  1.00 34.76 ? 1209 THR A CG2 1 
ATOM   9491  N  N   . ASP A 1 1210 ? 18.115  86.179  64.686  1.00 34.40 ? 1210 ASP A N   1 
ATOM   9492  C  CA  . ASP A 1 1210 ? 19.190  85.610  63.890  1.00 34.49 ? 1210 ASP A CA  1 
ATOM   9493  C  C   . ASP A 1 1210 ? 18.676  84.548  62.941  1.00 33.79 ? 1210 ASP A C   1 
ATOM   9494  O  O   . ASP A 1 1210 ? 17.725  83.836  63.240  1.00 34.61 ? 1210 ASP A O   1 
ATOM   9495  C  CB  . ASP A 1 1210 ? 20.274  84.993  64.771  1.00 36.72 ? 1210 ASP A CB  1 
ATOM   9496  C  CG  . ASP A 1 1210 ? 21.007  86.021  65.614  1.00 37.28 ? 1210 ASP A CG  1 
ATOM   9497  O  OD1 . ASP A 1 1210 ? 21.197  87.163  65.144  1.00 37.39 ? 1210 ASP A OD1 1 
ATOM   9498  O  OD2 . ASP A 1 1210 ? 21.409  85.674  66.745  1.00 38.37 ? 1210 ASP A OD2 1 
ATOM   9499  N  N   . ILE A 1 1211 ? 19.313  84.447  61.789  1.00 33.35 ? 1211 ILE A N   1 
ATOM   9500  C  CA  . ILE A 1 1211 ? 18.927  83.466  60.793  1.00 32.62 ? 1211 ILE A CA  1 
ATOM   9501  C  C   . ILE A 1 1211 ? 19.896  82.300  60.887  1.00 32.74 ? 1211 ILE A C   1 
ATOM   9502  O  O   . ILE A 1 1211 ? 21.104  82.491  60.797  1.00 30.88 ? 1211 ILE A O   1 
ATOM   9503  C  CB  . ILE A 1 1211 ? 19.003  84.068  59.384  1.00 32.27 ? 1211 ILE A CB  1 
ATOM   9504  C  CG1 . ILE A 1 1211 ? 18.104  85.310  59.304  1.00 32.25 ? 1211 ILE A CG1 1 
ATOM   9505  C  CG2 . ILE A 1 1211 ? 18.632  83.030  58.346  1.00 33.50 ? 1211 ILE A CG2 1 
ATOM   9506  C  CD1 . ILE A 1 1211 ? 16.675  85.101  59.788  1.00 26.35 ? 1211 ILE A CD1 1 
ATOM   9507  N  N   . PRO A 1 1212 ? 19.381  81.079  61.118  1.00 34.24 ? 1212 PRO A N   1 
ATOM   9508  C  CA  . PRO A 1 1212 ? 20.264  79.914  61.213  1.00 35.37 ? 1212 PRO A CA  1 
ATOM   9509  C  C   . PRO A 1 1212 ? 21.033  79.744  59.907  1.00 36.79 ? 1212 PRO A C   1 
ATOM   9510  O  O   . PRO A 1 1212 ? 20.501  79.989  58.819  1.00 36.34 ? 1212 PRO A O   1 
ATOM   9511  C  CB  . PRO A 1 1212 ? 19.292  78.768  61.484  1.00 34.19 ? 1212 PRO A CB  1 
ATOM   9512  C  CG  . PRO A 1 1212 ? 18.232  79.430  62.316  1.00 33.79 ? 1212 PRO A CG  1 
ATOM   9513  C  CD  . PRO A 1 1212 ? 18.015  80.732  61.558  1.00 34.76 ? 1212 PRO A CD  1 
ATOM   9514  N  N   . PRO A 1 1213 ? 22.299  79.314  60.001  1.00 38.21 ? 1213 PRO A N   1 
ATOM   9515  C  CA  . PRO A 1 1213 ? 23.192  79.099  58.861  1.00 39.20 ? 1213 PRO A CA  1 
ATOM   9516  C  C   . PRO A 1 1213 ? 22.567  78.430  57.630  1.00 39.54 ? 1213 PRO A C   1 
ATOM   9517  O  O   . PRO A 1 1213 ? 22.783  78.895  56.510  1.00 39.80 ? 1213 PRO A O   1 
ATOM   9518  C  CB  . PRO A 1 1213 ? 24.319  78.254  59.463  1.00 39.87 ? 1213 PRO A CB  1 
ATOM   9519  C  CG  . PRO A 1 1213 ? 24.366  78.734  60.883  1.00 40.60 ? 1213 PRO A CG  1 
ATOM   9520  C  CD  . PRO A 1 1213 ? 22.906  78.805  61.245  1.00 38.95 ? 1213 PRO A CD  1 
ATOM   9521  N  N   . ARG A 1 1214 ? 21.795  77.366  57.821  1.00 38.65 ? 1214 ARG A N   1 
ATOM   9522  C  CA  . ARG A 1 1214 ? 21.221  76.683  56.672  1.00 39.12 ? 1214 ARG A CA  1 
ATOM   9523  C  C   . ARG A 1 1214 ? 19.804  77.136  56.343  1.00 37.21 ? 1214 ARG A C   1 
ATOM   9524  O  O   . ARG A 1 1214 ? 19.135  76.536  55.504  1.00 36.50 ? 1214 ARG A O   1 
ATOM   9525  C  CB  . ARG A 1 1214 ? 21.213  75.165  56.897  1.00 42.95 ? 1214 ARG A CB  1 
ATOM   9526  C  CG  . ARG A 1 1214 ? 22.590  74.537  57.009  1.00 47.17 ? 1214 ARG A CG  1 
ATOM   9527  C  CD  . ARG A 1 1214 ? 22.496  73.023  56.960  1.00 51.43 ? 1214 ARG A CD  1 
ATOM   9528  N  NE  . ARG A 1 1214 ? 23.769  72.384  57.271  1.00 56.59 ? 1214 ARG A NE  1 
ATOM   9529  C  CZ  . ARG A 1 1214 ? 23.972  71.070  57.226  1.00 59.23 ? 1214 ARG A CZ  1 
ATOM   9530  N  NH1 . ARG A 1 1214 ? 22.981  70.256  56.880  1.00 60.82 ? 1214 ARG A NH1 1 
ATOM   9531  N  NH2 . ARG A 1 1214 ? 25.165  70.570  57.523  1.00 59.88 ? 1214 ARG A NH2 1 
ATOM   9532  N  N   . MET A 1 1215 ? 19.337  78.206  57.004  1.00 35.11 ? 1215 MET A N   1 
ATOM   9533  C  CA  . MET A 1 1215 ? 17.983  78.691  56.737  1.00 33.37 ? 1215 MET A CA  1 
ATOM   9534  C  C   . MET A 1 1215 ? 17.985  80.121  56.190  1.00 32.57 ? 1215 MET A C   1 
ATOM   9535  O  O   . MET A 1 1215 ? 17.166  80.956  56.578  1.00 31.42 ? 1215 MET A O   1 
ATOM   9536  C  CB  . MET A 1 1215 ? 17.140  78.614  58.016  1.00 32.25 ? 1215 MET A CB  1 
ATOM   9537  C  CG  . MET A 1 1215 ? 17.084  77.216  58.635  1.00 30.91 ? 1215 MET A CG  1 
ATOM   9538  S  SD  . MET A 1 1215 ? 15.943  77.123  60.043  1.00 30.57 ? 1215 MET A SD  1 
ATOM   9539  C  CE  . MET A 1 1215 ? 16.142  75.391  60.539  1.00 28.34 ? 1215 MET A CE  1 
ATOM   9540  N  N   . GLY A 1 1216 ? 18.918  80.397  55.283  1.00 31.74 ? 1216 GLY A N   1 
ATOM   9541  C  CA  . GLY A 1 1216 ? 19.003  81.722  54.701  1.00 29.78 ? 1216 GLY A CA  1 
ATOM   9542  C  C   . GLY A 1 1216 ? 17.788  82.012  53.838  1.00 28.66 ? 1216 GLY A C   1 
ATOM   9543  O  O   . GLY A 1 1216 ? 17.538  83.161  53.478  1.00 28.30 ? 1216 GLY A O   1 
ATOM   9544  N  N   . TRP A 1 1217 ? 17.033  80.963  53.507  1.00 27.84 ? 1217 TRP A N   1 
ATOM   9545  C  CA  . TRP A 1 1217 ? 15.838  81.103  52.692  1.00 26.43 ? 1217 TRP A CA  1 
ATOM   9546  C  C   . TRP A 1 1217 ? 14.742  81.803  53.469  1.00 26.02 ? 1217 TRP A C   1 
ATOM   9547  O  O   . TRP A 1 1217 ? 13.753  82.229  52.889  1.00 25.25 ? 1217 TRP A O   1 
ATOM   9548  C  CB  . TRP A 1 1217 ? 15.339  79.736  52.203  1.00 26.68 ? 1217 TRP A CB  1 
ATOM   9549  C  CG  . TRP A 1 1217 ? 15.250  78.689  53.254  1.00 27.72 ? 1217 TRP A CG  1 
ATOM   9550  C  CD1 . TRP A 1 1217 ? 16.220  77.800  53.604  1.00 28.35 ? 1217 TRP A CD1 1 
ATOM   9551  C  CD2 . TRP A 1 1217 ? 14.132  78.424  54.118  1.00 30.87 ? 1217 TRP A CD2 1 
ATOM   9552  N  NE1 . TRP A 1 1217 ? 15.783  76.992  54.629  1.00 30.51 ? 1217 TRP A NE1 1 
ATOM   9553  C  CE2 . TRP A 1 1217 ? 14.503  77.351  54.966  1.00 30.93 ? 1217 TRP A CE2 1 
ATOM   9554  C  CE3 . TRP A 1 1217 ? 12.850  78.987  54.257  1.00 30.63 ? 1217 TRP A CE3 1 
ATOM   9555  C  CZ2 . TRP A 1 1217 ? 13.633  76.827  55.945  1.00 31.15 ? 1217 TRP A CZ2 1 
ATOM   9556  C  CZ3 . TRP A 1 1217 ? 11.988  78.464  55.228  1.00 31.14 ? 1217 TRP A CZ3 1 
ATOM   9557  C  CH2 . TRP A 1 1217 ? 12.388  77.393  56.058  1.00 29.84 ? 1217 TRP A CH2 1 
ATOM   9558  N  N   . LEU A 1 1218 ? 14.915  81.916  54.782  1.00 26.46 ? 1218 LEU A N   1 
ATOM   9559  C  CA  . LEU A 1 1218 ? 13.929  82.593  55.622  1.00 26.00 ? 1218 LEU A CA  1 
ATOM   9560  C  C   . LEU A 1 1218 ? 13.791  84.041  55.203  1.00 25.76 ? 1218 LEU A C   1 
ATOM   9561  O  O   . LEU A 1 1218 ? 12.692  84.564  55.079  1.00 26.76 ? 1218 LEU A O   1 
ATOM   9562  C  CB  . LEU A 1 1218 ? 14.350  82.563  57.091  1.00 26.33 ? 1218 LEU A CB  1 
ATOM   9563  C  CG  . LEU A 1 1218 ? 14.069  81.303  57.898  1.00 26.65 ? 1218 LEU A CG  1 
ATOM   9564  C  CD1 . LEU A 1 1218 ? 14.742  81.443  59.259  1.00 26.18 ? 1218 LEU A CD1 1 
ATOM   9565  C  CD2 . LEU A 1 1218 ? 12.553  81.097  58.061  1.00 26.66 ? 1218 LEU A CD2 1 
ATOM   9566  N  N   . ARG A 1 1219 ? 14.931  84.685  54.990  1.00 26.59 ? 1219 ARG A N   1 
ATOM   9567  C  CA  . ARG A 1 1219 ? 14.986  86.088  54.595  1.00 27.53 ? 1219 ARG A CA  1 
ATOM   9568  C  C   . ARG A 1 1219 ? 14.011  86.445  53.492  1.00 26.77 ? 1219 ARG A C   1 
ATOM   9569  O  O   . ARG A 1 1219 ? 13.455  87.546  53.494  1.00 26.25 ? 1219 ARG A O   1 
ATOM   9570  C  CB  . ARG A 1 1219 ? 16.400  86.453  54.148  1.00 28.04 ? 1219 ARG A CB  1 
ATOM   9571  C  CG  . ARG A 1 1219 ? 17.439  86.208  55.219  1.00 30.58 ? 1219 ARG A CG  1 
ATOM   9572  C  CD  . ARG A 1 1219 ? 18.566  87.228  55.150  1.00 34.69 ? 1219 ARG A CD  1 
ATOM   9573  N  NE  . ARG A 1 1219 ? 19.561  86.979  56.185  1.00 37.38 ? 1219 ARG A NE  1 
ATOM   9574  C  CZ  . ARG A 1 1219 ? 20.403  85.946  56.164  1.00 40.19 ? 1219 ARG A CZ  1 
ATOM   9575  N  NH1 . ARG A 1 1219 ? 20.369  85.073  55.151  1.00 39.76 ? 1219 ARG A NH1 1 
ATOM   9576  N  NH2 . ARG A 1 1219 ? 21.276  85.781  57.158  1.00 39.66 ? 1219 ARG A NH2 1 
ATOM   9577  N  N   . ALA A 1 1220 ? 13.816  85.517  52.554  1.00 24.99 ? 1220 ALA A N   1 
ATOM   9578  C  CA  . ALA A 1 1220 ? 12.903  85.736  51.437  1.00 24.43 ? 1220 ALA A CA  1 
ATOM   9579  C  C   . ALA A 1 1220 ? 11.484  85.886  51.966  1.00 24.78 ? 1220 ALA A C   1 
ATOM   9580  O  O   . ALA A 1 1220 ? 10.790  86.858  51.673  1.00 23.84 ? 1220 ALA A O   1 
ATOM   9581  C  CB  . ALA A 1 1220 ? 12.967  84.559  50.459  1.00 24.33 ? 1220 ALA A CB  1 
ATOM   9582  N  N   . ILE A 1 1221 ? 11.067  84.906  52.759  1.00 24.25 ? 1221 ILE A N   1 
ATOM   9583  C  CA  . ILE A 1 1221 ? 9.741   84.901  53.327  1.00 23.26 ? 1221 ILE A CA  1 
ATOM   9584  C  C   . ILE A 1 1221 ? 9.564   86.109  54.234  1.00 24.68 ? 1221 ILE A C   1 
ATOM   9585  O  O   . ILE A 1 1221 ? 8.530   86.799  54.180  1.00 24.81 ? 1221 ILE A O   1 
ATOM   9586  C  CB  . ILE A 1 1221 ? 9.503   83.602  54.126  1.00 22.74 ? 1221 ILE A CB  1 
ATOM   9587  C  CG1 . ILE A 1 1221 ? 9.595   82.397  53.182  1.00 22.14 ? 1221 ILE A CG1 1 
ATOM   9588  C  CG2 . ILE A 1 1221 ? 8.159   83.656  54.834  1.00 21.47 ? 1221 ILE A CG2 1 
ATOM   9589  C  CD1 . ILE A 1 1221 ? 9.487   81.055  53.872  1.00 21.80 ? 1221 ILE A CD1 1 
ATOM   9590  N  N   . LEU A 1 1222 ? 10.576  86.374  55.057  1.00 23.90 ? 1222 LEU A N   1 
ATOM   9591  C  CA  . LEU A 1 1222 ? 10.519  87.485  55.983  1.00 23.55 ? 1222 LEU A CA  1 
ATOM   9592  C  C   . LEU A 1 1222 ? 10.366  88.821  55.262  1.00 24.44 ? 1222 LEU A C   1 
ATOM   9593  O  O   . LEU A 1 1222 ? 9.737   89.748  55.773  1.00 25.43 ? 1222 LEU A O   1 
ATOM   9594  C  CB  . LEU A 1 1222 ? 11.770  87.488  56.873  1.00 23.59 ? 1222 LEU A CB  1 
ATOM   9595  C  CG  . LEU A 1 1222 ? 11.756  86.442  57.993  1.00 23.59 ? 1222 LEU A CG  1 
ATOM   9596  C  CD1 . LEU A 1 1222 ? 13.120  86.326  58.628  1.00 21.37 ? 1222 LEU A CD1 1 
ATOM   9597  C  CD2 . LEU A 1 1222 ? 10.709  86.830  59.033  1.00 23.05 ? 1222 LEU A CD2 1 
ATOM   9598  N  N   . ARG A 1 1223 ? 10.927  88.928  54.066  1.00 25.63 ? 1223 ARG A N   1 
ATOM   9599  C  CA  . ARG A 1 1223 ? 10.830  90.181  53.351  1.00 25.73 ? 1223 ARG A CA  1 
ATOM   9600  C  C   . ARG A 1 1223 ? 9.407   90.451  52.928  1.00 26.32 ? 1223 ARG A C   1 
ATOM   9601  O  O   . ARG A 1 1223 ? 8.945   91.600  52.982  1.00 26.09 ? 1223 ARG A O   1 
ATOM   9602  C  CB  . ARG A 1 1223 ? 11.770  90.185  52.157  1.00 25.50 ? 1223 ARG A CB  1 
ATOM   9603  C  CG  . ARG A 1 1223 ? 13.195  90.504  52.570  1.00 25.26 ? 1223 ARG A CG  1 
ATOM   9604  C  CD  . ARG A 1 1223 ? 14.176  90.279  51.451  1.00 27.17 ? 1223 ARG A CD  1 
ATOM   9605  N  NE  . ARG A 1 1223 ? 15.540  90.332  51.961  1.00 29.09 ? 1223 ARG A NE  1 
ATOM   9606  C  CZ  . ARG A 1 1223 ? 16.512  89.511  51.575  1.00 32.30 ? 1223 ARG A CZ  1 
ATOM   9607  N  NH1 . ARG A 1 1223 ? 16.268  88.570  50.667  1.00 33.30 ? 1223 ARG A NH1 1 
ATOM   9608  N  NH2 . ARG A 1 1223 ? 17.722  89.620  52.107  1.00 32.38 ? 1223 ARG A NH2 1 
ATOM   9609  N  N   . PHE A 1 1224 ? 8.698   89.395  52.534  1.00 26.01 ? 1224 PHE A N   1 
ATOM   9610  C  CA  . PHE A 1 1224 ? 7.310   89.558  52.117  1.00 25.58 ? 1224 PHE A CA  1 
ATOM   9611  C  C   . PHE A 1 1224 ? 6.432   90.021  53.286  1.00 25.46 ? 1224 PHE A C   1 
ATOM   9612  O  O   . PHE A 1 1224 ? 5.596   90.915  53.129  1.00 26.28 ? 1224 PHE A O   1 
ATOM   9613  C  CB  . PHE A 1 1224 ? 6.745   88.251  51.543  1.00 25.72 ? 1224 PHE A CB  1 
ATOM   9614  C  CG  . PHE A 1 1224 ? 6.780   88.171  50.040  1.00 25.30 ? 1224 PHE A CG  1 
ATOM   9615  C  CD1 . PHE A 1 1224 ? 7.945   87.785  49.370  1.00 26.76 ? 1224 PHE A CD1 1 
ATOM   9616  C  CD2 . PHE A 1 1224 ? 5.646   88.468  49.293  1.00 24.45 ? 1224 PHE A CD2 1 
ATOM   9617  C  CE1 . PHE A 1 1224 ? 7.977   87.690  47.976  1.00 26.84 ? 1224 PHE A CE1 1 
ATOM   9618  C  CE2 . PHE A 1 1224 ? 5.663   88.379  47.895  1.00 26.24 ? 1224 PHE A CE2 1 
ATOM   9619  C  CZ  . PHE A 1 1224 ? 6.830   87.991  47.234  1.00 25.91 ? 1224 PHE A CZ  1 
ATOM   9620  N  N   . LEU A 1 1225 ? 6.616   89.414  54.454  1.00 24.86 ? 1225 LEU A N   1 
ATOM   9621  C  CA  . LEU A 1 1225 ? 5.818   89.782  55.623  1.00 24.04 ? 1225 LEU A CA  1 
ATOM   9622  C  C   . LEU A 1 1225 ? 5.993   91.252  55.989  1.00 23.64 ? 1225 LEU A C   1 
ATOM   9623  O  O   . LEU A 1 1225 ? 5.025   91.949  56.263  1.00 21.86 ? 1225 LEU A O   1 
ATOM   9624  C  CB  . LEU A 1 1225 ? 6.187   88.897  56.825  1.00 22.49 ? 1225 LEU A CB  1 
ATOM   9625  C  CG  . LEU A 1 1225 ? 6.077   87.384  56.608  1.00 23.29 ? 1225 LEU A CG  1 
ATOM   9626  C  CD1 . LEU A 1 1225 ? 6.263   86.688  57.926  1.00 20.57 ? 1225 LEU A CD1 1 
ATOM   9627  C  CD2 . LEU A 1 1225 ? 4.721   87.022  56.010  1.00 18.68 ? 1225 LEU A CD2 1 
ATOM   9628  N  N   . GLY A 1 1226 ? 7.235   91.717  55.983  1.00 23.27 ? 1226 GLY A N   1 
ATOM   9629  C  CA  . GLY A 1 1226 ? 7.498   93.103  56.308  1.00 23.41 ? 1226 GLY A CA  1 
ATOM   9630  C  C   . GLY A 1 1226 ? 6.865   94.031  55.287  1.00 23.47 ? 1226 GLY A C   1 
ATOM   9631  O  O   . GLY A 1 1226 ? 6.184   95.002  55.640  1.00 24.46 ? 1226 GLY A O   1 
ATOM   9632  N  N   . ALA A 1 1227 ? 7.096   93.738  54.013  1.00 23.05 ? 1227 ALA A N   1 
ATOM   9633  C  CA  . ALA A 1 1227 ? 6.546   94.557  52.946  1.00 22.40 ? 1227 ALA A CA  1 
ATOM   9634  C  C   . ALA A 1 1227 ? 5.016   94.559  53.046  1.00 23.28 ? 1227 ALA A C   1 
ATOM   9635  O  O   . ALA A 1 1227 ? 4.357   95.551  52.712  1.00 22.94 ? 1227 ALA A O   1 
ATOM   9636  C  CB  . ALA A 1 1227 ? 6.988   94.009  51.590  1.00 20.70 ? 1227 ALA A CB  1 
ATOM   9637  N  N   . GLY A 1 1228 ? 4.461   93.438  53.510  1.00 22.26 ? 1228 GLY A N   1 
ATOM   9638  C  CA  . GLY A 1 1228 ? 3.023   93.321  53.637  1.00 21.10 ? 1228 GLY A CA  1 
ATOM   9639  C  C   . GLY A 1 1228 ? 2.490   94.392  54.554  1.00 20.46 ? 1228 GLY A C   1 
ATOM   9640  O  O   . GLY A 1 1228 ? 1.526   95.068  54.210  1.00 21.87 ? 1228 GLY A O   1 
ATOM   9641  N  N   . MET A 1 1229 ? 3.120   94.552  55.715  1.00 21.32 ? 1229 MET A N   1 
ATOM   9642  C  CA  . MET A 1 1229 ? 2.699   95.547  56.688  1.00 20.71 ? 1229 MET A CA  1 
ATOM   9643  C  C   . MET A 1 1229 ? 2.923   96.969  56.202  1.00 20.73 ? 1229 MET A C   1 
ATOM   9644  O  O   . MET A 1 1229 ? 2.106   97.855  56.451  1.00 20.88 ? 1229 MET A O   1 
ATOM   9645  C  CB  . MET A 1 1229 ? 3.456   95.371  57.992  1.00 22.34 ? 1229 MET A CB  1 
ATOM   9646  C  CG  . MET A 1 1229 ? 3.069   94.160  58.818  1.00 23.52 ? 1229 MET A CG  1 
ATOM   9647  S  SD  . MET A 1 1229 ? 3.956   94.250  60.399  1.00 26.46 ? 1229 MET A SD  1 
ATOM   9648  C  CE  . MET A 1 1229 ? 2.882   95.375  61.324  1.00 21.70 ? 1229 MET A CE  1 
ATOM   9649  N  N   . VAL A 1 1230 ? 4.033   97.188  55.512  1.00 19.40 ? 1230 VAL A N   1 
ATOM   9650  C  CA  . VAL A 1 1230 ? 4.341   98.516  55.028  1.00 18.94 ? 1230 VAL A CA  1 
ATOM   9651  C  C   . VAL A 1 1230 ? 3.339   98.983  53.992  1.00 19.12 ? 1230 VAL A C   1 
ATOM   9652  O  O   . VAL A 1 1230 ? 2.896   100.120 54.025  1.00 18.78 ? 1230 VAL A O   1 
ATOM   9653  C  CB  . VAL A 1 1230 ? 5.778   98.584  54.433  1.00 18.92 ? 1230 VAL A CB  1 
ATOM   9654  C  CG1 . VAL A 1 1230 ? 5.957   99.860  53.609  1.00 16.33 ? 1230 VAL A CG1 1 
ATOM   9655  C  CG2 . VAL A 1 1230 ? 6.801   98.578  55.568  1.00 17.86 ? 1230 VAL A CG2 1 
ATOM   9656  N  N   . MET A 1 1231 ? 2.976   98.091  53.082  1.00 20.13 ? 1231 MET A N   1 
ATOM   9657  C  CA  . MET A 1 1231 ? 2.045   98.412  52.016  1.00 20.70 ? 1231 MET A CA  1 
ATOM   9658  C  C   . MET A 1 1231 ? 0.598   98.505  52.466  1.00 22.29 ? 1231 MET A C   1 
ATOM   9659  O  O   . MET A 1 1231 ? -0.197  99.225  51.860  1.00 23.00 ? 1231 MET A O   1 
ATOM   9660  C  CB  . MET A 1 1231 ? 2.169   97.374  50.908  1.00 19.64 ? 1231 MET A CB  1 
ATOM   9661  C  CG  . MET A 1 1231 ? 3.545   97.331  50.287  1.00 19.18 ? 1231 MET A CG  1 
ATOM   9662  S  SD  . MET A 1 1231 ? 3.914   98.876  49.464  1.00 20.34 ? 1231 MET A SD  1 
ATOM   9663  C  CE  . MET A 1 1231 ? 2.596   98.902  48.233  1.00 17.98 ? 1231 MET A CE  1 
ATOM   9664  N  N   . THR A 1 1232 ? 0.256   97.776  53.525  1.00 23.37 ? 1232 THR A N   1 
ATOM   9665  C  CA  . THR A 1 1232 ? -1.108  97.786  54.054  1.00 22.91 ? 1232 THR A CA  1 
ATOM   9666  C  C   . THR A 1 1232 ? -1.396  99.028  54.901  1.00 23.06 ? 1232 THR A C   1 
ATOM   9667  O  O   . THR A 1 1232 ? -2.549  99.407  55.070  1.00 24.30 ? 1232 THR A O   1 
ATOM   9668  C  CB  . THR A 1 1232 ? -1.369  96.530  54.888  1.00 23.05 ? 1232 THR A CB  1 
ATOM   9669  O  OG1 . THR A 1 1232 ? -1.104  95.374  54.088  1.00 22.91 ? 1232 THR A OG1 1 
ATOM   9670  C  CG2 . THR A 1 1232 ? -2.807  96.481  55.362  1.00 22.00 ? 1232 THR A CG2 1 
ATOM   9671  N  N   . ALA A 1 1233 ? -0.346  99.663  55.418  1.00 22.98 ? 1233 ALA A N   1 
ATOM   9672  C  CA  . ALA A 1 1233 ? -0.492  100.861 56.237  1.00 23.60 ? 1233 ALA A CA  1 
ATOM   9673  C  C   . ALA A 1 1233 ? -0.683  102.126 55.388  1.00 24.62 ? 1233 ALA A C   1 
ATOM   9674  O  O   . ALA A 1 1233 ? 0.197   102.510 54.601  1.00 24.03 ? 1233 ALA A O   1 
ATOM   9675  C  CB  . ALA A 1 1233 ? 0.733   101.020 57.142  1.00 23.83 ? 1233 ALA A CB  1 
ATOM   9676  N  N   . THR A 1 1234 ? -1.825  102.778 55.563  1.00 23.75 ? 1234 THR A N   1 
ATOM   9677  C  CA  . THR A 1 1234 ? -2.131  103.996 54.819  1.00 24.57 ? 1234 THR A CA  1 
ATOM   9678  C  C   . THR A 1 1234 ? -1.013  105.036 54.898  1.00 25.38 ? 1234 THR A C   1 
ATOM   9679  O  O   . THR A 1 1234 ? -0.367  105.187 55.939  1.00 24.37 ? 1234 THR A O   1 
ATOM   9680  C  CB  . THR A 1 1234 ? -3.435  104.640 55.345  1.00 23.62 ? 1234 THR A CB  1 
ATOM   9681  O  OG1 . THR A 1 1234 ? -4.549  103.820 54.972  1.00 27.24 ? 1234 THR A OG1 1 
ATOM   9682  C  CG2 . THR A 1 1234 ? -3.620  106.032 54.781  1.00 24.29 ? 1234 THR A CG2 1 
ATOM   9683  N  N   . GLY A 1 1235 ? -0.792  105.748 53.796  1.00 25.05 ? 1235 GLY A N   1 
ATOM   9684  C  CA  . GLY A 1 1235 ? 0.224   106.788 53.788  1.00 26.30 ? 1235 GLY A CA  1 
ATOM   9685  C  C   . GLY A 1 1235 ? 1.537   106.447 53.112  1.00 27.36 ? 1235 GLY A C   1 
ATOM   9686  O  O   . GLY A 1 1235 ? 1.586   105.607 52.216  1.00 28.69 ? 1235 GLY A O   1 
ATOM   9687  N  N   . VAL A 1 1236 ? 2.614   107.102 53.533  1.00 27.10 ? 1236 VAL A N   1 
ATOM   9688  C  CA  . VAL A 1 1236 ? 3.923   106.849 52.945  1.00 27.44 ? 1236 VAL A CA  1 
ATOM   9689  C  C   . VAL A 1 1236 ? 4.452   105.466 53.293  1.00 27.67 ? 1236 VAL A C   1 
ATOM   9690  O  O   . VAL A 1 1236 ? 4.173   104.935 54.362  1.00 29.06 ? 1236 VAL A O   1 
ATOM   9691  C  CB  . VAL A 1 1236 ? 4.971   107.870 53.434  1.00 27.84 ? 1236 VAL A CB  1 
ATOM   9692  C  CG1 . VAL A 1 1236 ? 4.587   109.272 52.974  1.00 30.26 ? 1236 VAL A CG1 1 
ATOM   9693  C  CG2 . VAL A 1 1236 ? 5.085   107.812 54.966  1.00 26.24 ? 1236 VAL A CG2 1 
ATOM   9694  N  N   . ALA A 1 1237 ? 5.214   104.883 52.381  1.00 27.27 ? 1237 ALA A N   1 
ATOM   9695  C  CA  . ALA A 1 1237 ? 5.813   103.583 52.628  1.00 25.98 ? 1237 ALA A CA  1 
ATOM   9696  C  C   . ALA A 1 1237 ? 6.850   103.910 53.682  1.00 26.25 ? 1237 ALA A C   1 
ATOM   9697  O  O   . ALA A 1 1237 ? 7.575   104.908 53.585  1.00 24.63 ? 1237 ALA A O   1 
ATOM   9698  C  CB  . ALA A 1 1237 ? 6.493   103.052 51.377  1.00 26.77 ? 1237 ALA A CB  1 
ATOM   9699  N  N   . VAL A 1 1238 ? 6.932   103.057 54.683  1.00 25.59 ? 1238 VAL A N   1 
ATOM   9700  C  CA  . VAL A 1 1238 ? 7.842   103.277 55.774  1.00 25.07 ? 1238 VAL A CA  1 
ATOM   9701  C  C   . VAL A 1 1238 ? 8.895   102.170 55.812  1.00 26.14 ? 1238 VAL A C   1 
ATOM   9702  O  O   . VAL A 1 1238 ? 8.682   101.080 55.280  1.00 26.11 ? 1238 VAL A O   1 
ATOM   9703  C  CB  . VAL A 1 1238 ? 6.999   103.323 57.088  1.00 25.14 ? 1238 VAL A CB  1 
ATOM   9704  C  CG1 . VAL A 1 1238 ? 7.556   102.396 58.139  1.00 25.28 ? 1238 VAL A CG1 1 
ATOM   9705  C  CG2 . VAL A 1 1238 ? 6.897   104.745 57.592  1.00 24.37 ? 1238 VAL A CG2 1 
ATOM   9706  N  N   . ASP A 1 1239 ? 10.048  102.466 56.406  1.00 26.71 ? 1239 ASP A N   1 
ATOM   9707  C  CA  . ASP A 1 1239 ? 11.083  101.462 56.557  1.00 26.27 ? 1239 ASP A CA  1 
ATOM   9708  C  C   . ASP A 1 1239 ? 10.628  100.572 57.711  1.00 26.50 ? 1239 ASP A C   1 
ATOM   9709  O  O   . ASP A 1 1239 ? 10.345  101.066 58.808  1.00 26.05 ? 1239 ASP A O   1 
ATOM   9710  C  CB  . ASP A 1 1239 ? 12.418  102.092 56.941  1.00 27.60 ? 1239 ASP A CB  1 
ATOM   9711  C  CG  . ASP A 1 1239 ? 13.267  102.439 55.746  1.00 28.90 ? 1239 ASP A CG  1 
ATOM   9712  O  OD1 . ASP A 1 1239 ? 13.306  101.630 54.792  1.00 30.91 ? 1239 ASP A OD1 1 
ATOM   9713  O  OD2 . ASP A 1 1239 ? 13.911  103.513 55.774  1.00 28.66 ? 1239 ASP A OD2 1 
ATOM   9714  N  N   . ILE A 1 1240 ? 10.554  99.266  57.481  1.00 25.21 ? 1240 ILE A N   1 
ATOM   9715  C  CA  . ILE A 1 1240 ? 10.149  98.384  58.551  1.00 23.81 ? 1240 ILE A CA  1 
ATOM   9716  C  C   . ILE A 1 1240 ? 11.349  97.554  59.049  1.00 25.14 ? 1240 ILE A C   1 
ATOM   9717  O  O   . ILE A 1 1240 ? 12.181  97.087  58.250  1.00 25.09 ? 1240 ILE A O   1 
ATOM   9718  C  CB  . ILE A 1 1240 ? 8.950   97.497  58.104  1.00 21.79 ? 1240 ILE A CB  1 
ATOM   9719  C  CG1 . ILE A 1 1240 ? 8.358   96.778  59.324  1.00 20.94 ? 1240 ILE A CG1 1 
ATOM   9720  C  CG2 . ILE A 1 1240 ? 9.373   96.539  57.016  1.00 19.18 ? 1240 ILE A CG2 1 
ATOM   9721  C  CD1 . ILE A 1 1240 ? 6.937   96.282  59.122  1.00 19.95 ? 1240 ILE A CD1 1 
ATOM   9722  N  N   . TYR A 1 1241 ? 11.451  97.401  60.372  1.00 25.67 ? 1241 TYR A N   1 
ATOM   9723  C  CA  . TYR A 1 1241 ? 12.560  96.657  60.987  1.00 26.90 ? 1241 TYR A CA  1 
ATOM   9724  C  C   . TYR A 1 1241 ? 12.133  95.415  61.770  1.00 27.54 ? 1241 TYR A C   1 
ATOM   9725  O  O   . TYR A 1 1241 ? 11.269  95.491  62.663  1.00 27.00 ? 1241 TYR A O   1 
ATOM   9726  C  CB  . TYR A 1 1241 ? 13.353  97.576  61.922  1.00 26.69 ? 1241 TYR A CB  1 
ATOM   9727  C  CG  . TYR A 1 1241 ? 14.225  98.599  61.223  1.00 29.33 ? 1241 TYR A CG  1 
ATOM   9728  C  CD1 . TYR A 1 1241 ? 15.615  98.429  61.147  1.00 28.57 ? 1241 TYR A CD1 1 
ATOM   9729  C  CD2 . TYR A 1 1241 ? 13.666  99.758  60.660  1.00 29.42 ? 1241 TYR A CD2 1 
ATOM   9730  C  CE1 . TYR A 1 1241 ? 16.431  99.389  60.533  1.00 28.88 ? 1241 TYR A CE1 1 
ATOM   9731  C  CE2 . TYR A 1 1241 ? 14.469  100.728 60.047  1.00 29.08 ? 1241 TYR A CE2 1 
ATOM   9732  C  CZ  . TYR A 1 1241 ? 15.852  100.534 59.983  1.00 29.96 ? 1241 TYR A CZ  1 
ATOM   9733  O  OH  . TYR A 1 1241 ? 16.643  101.466 59.343  1.00 28.66 ? 1241 TYR A OH  1 
ATOM   9734  N  N   . LEU A 1 1242 ? 12.742  94.278  61.441  1.00 28.48 ? 1242 LEU A N   1 
ATOM   9735  C  CA  . LEU A 1 1242 ? 12.408  93.053  62.138  1.00 29.34 ? 1242 LEU A CA  1 
ATOM   9736  C  C   . LEU A 1 1242 ? 12.674  93.245  63.654  1.00 31.77 ? 1242 LEU A C   1 
ATOM   9737  O  O   . LEU A 1 1242 ? 13.802  93.596  64.014  1.00 31.83 ? 1242 LEU A O   1 
ATOM   9738  C  CB  . LEU A 1 1242 ? 13.249  91.867  61.590  1.00 28.41 ? 1242 LEU A CB  1 
ATOM   9739  C  CG  . LEU A 1 1242 ? 13.019  90.472  62.218  1.00 28.10 ? 1242 LEU A CG  1 
ATOM   9740  C  CD1 . LEU A 1 1242 ? 11.566  90.042  62.049  1.00 25.35 ? 1242 LEU A CD1 1 
ATOM   9741  C  CD2 . LEU A 1 1242 ? 13.957  89.453  61.598  1.00 26.13 ? 1242 LEU A CD2 1 
ATOM   9742  N  N   . GLU A 1 1243 ? 11.672  93.035  64.521  1.00 33.71 ? 1243 GLU A N   1 
ATOM   9743  C  CA  . GLU A 1 1243 ? 11.914  93.125  65.973  1.00 36.71 ? 1243 GLU A CA  1 
ATOM   9744  C  C   . GLU A 1 1243 ? 11.904  91.742  66.640  1.00 36.43 ? 1243 GLU A C   1 
ATOM   9745  O  O   . GLU A 1 1243 ? 12.686  91.529  67.568  1.00 35.30 ? 1243 GLU A O   1 
ATOM   9746  C  CB  . GLU A 1 1243 ? 10.906  94.023  66.736  1.00 39.90 ? 1243 GLU A CB  1 
ATOM   9747  C  CG  . GLU A 1 1243 ? 11.449  94.488  68.108  1.00 47.03 ? 1243 GLU A CG  1 
ATOM   9748  C  CD  . GLU A 1 1243 ? 10.406  95.231  68.936  1.00 51.85 ? 1243 GLU A CD  1 
ATOM   9749  O  OE1 . GLU A 1 1243 ? 9.268   94.720  69.038  1.00 54.99 ? 1243 GLU A OE1 1 
ATOM   9750  O  OE2 . GLU A 1 1243 ? 10.714  96.320  69.481  1.00 54.19 ? 1243 GLU A OE2 1 
ATOM   9751  N  N   . ASP A 1 1244 ? 11.086  90.791  66.180  1.00 36.65 ? 1244 ASP A N   1 
ATOM   9752  C  CA  . ASP A 1 1244 ? 11.059  89.514  66.884  1.00 35.71 ? 1244 ASP A CA  1 
ATOM   9753  C  C   . ASP A 1 1244 ? 10.412  88.341  66.156  1.00 34.59 ? 1244 ASP A C   1 
ATOM   9754  O  O   . ASP A 1 1244 ? 9.585   88.516  65.262  1.00 34.31 ? 1244 ASP A O   1 
ATOM   9755  C  CB  . ASP A 1 1244 ? 10.330  89.736  68.208  1.00 35.37 ? 1244 ASP A CB  1 
ATOM   9756  C  CG  . ASP A 1 1244 ? 10.411  88.549  69.135  1.00 37.23 ? 1244 ASP A CG  1 
ATOM   9757  O  OD1 . ASP A 1 1244 ? 9.461   88.342  69.916  1.00 37.21 ? 1244 ASP A OD1 1 
ATOM   9758  O  OD2 . ASP A 1 1244 ? 11.431  87.831  69.099  1.00 39.07 ? 1244 ASP A OD2 1 
ATOM   9759  N  N   . ILE A 1 1245 ? 10.811  87.142  66.562  1.00 33.07 ? 1245 ILE A N   1 
ATOM   9760  C  CA  . ILE A 1 1245 ? 10.274  85.894  66.038  1.00 32.45 ? 1245 ILE A CA  1 
ATOM   9761  C  C   . ILE A 1 1245 ? 10.053  85.053  67.294  1.00 33.79 ? 1245 ILE A C   1 
ATOM   9762  O  O   . ILE A 1 1245 ? 11.010  84.516  67.854  1.00 33.40 ? 1245 ILE A O   1 
ATOM   9763  C  CB  . ILE A 1 1245 ? 11.270  85.164  65.121  1.00 30.87 ? 1245 ILE A CB  1 
ATOM   9764  C  CG1 . ILE A 1 1245 ? 11.596  86.021  63.903  1.00 30.57 ? 1245 ILE A CG1 1 
ATOM   9765  C  CG2 . ILE A 1 1245 ? 10.678  83.845  64.674  1.00 29.52 ? 1245 ILE A CG2 1 
ATOM   9766  C  CD1 . ILE A 1 1245 ? 12.430  85.320  62.871  1.00 29.98 ? 1245 ILE A CD1 1 
ATOM   9767  N  N   . HIS A 1 1246 ? 8.802   84.937  67.734  1.00 33.86 ? 1246 HIS A N   1 
ATOM   9768  C  CA  . HIS A 1 1246 ? 8.496   84.201  68.948  1.00 35.40 ? 1246 HIS A CA  1 
ATOM   9769  C  C   . HIS A 1 1246 ? 9.375   83.013  69.312  1.00 36.25 ? 1246 HIS A C   1 
ATOM   9770  O  O   . HIS A 1 1246 ? 10.072  83.053  70.333  1.00 39.30 ? 1246 HIS A O   1 
ATOM   9771  C  CB  . HIS A 1 1246 ? 7.038   83.751  68.977  1.00 36.06 ? 1246 HIS A CB  1 
ATOM   9772  C  CG  . HIS A 1 1246 ? 6.677   83.011  70.230  1.00 38.00 ? 1246 HIS A CG  1 
ATOM   9773  N  ND1 . HIS A 1 1246 ? 6.555   81.639  70.272  1.00 38.91 ? 1246 HIS A ND1 1 
ATOM   9774  C  CD2 . HIS A 1 1246 ? 6.504   83.446  71.499  1.00 37.77 ? 1246 HIS A CD2 1 
ATOM   9775  C  CE1 . HIS A 1 1246 ? 6.326   81.258  71.517  1.00 38.01 ? 1246 HIS A CE1 1 
ATOM   9776  N  NE2 . HIS A 1 1246 ? 6.291   82.335  72.281  1.00 38.07 ? 1246 HIS A NE2 1 
ATOM   9777  N  N   . GLY A 1 1247 ? 9.357   81.953  68.522  1.00 34.39 ? 1247 GLY A N   1 
ATOM   9778  C  CA  . GLY A 1 1247 ? 10.183  80.812  68.888  1.00 31.74 ? 1247 GLY A CA  1 
ATOM   9779  C  C   . GLY A 1 1247 ? 11.581  80.821  68.298  1.00 30.45 ? 1247 GLY A C   1 
ATOM   9780  O  O   . GLY A 1 1247 ? 12.306  79.828  68.371  1.00 29.31 ? 1247 GLY A O   1 
ATOM   9781  N  N   . GLY A 1 1248 ? 11.962  81.944  67.702  1.00 30.05 ? 1248 GLY A N   1 
ATOM   9782  C  CA  . GLY A 1 1248 ? 13.277  82.043  67.102  1.00 28.68 ? 1248 GLY A CA  1 
ATOM   9783  C  C   . GLY A 1 1248 ? 13.297  81.541  65.667  1.00 28.52 ? 1248 GLY A C   1 
ATOM   9784  O  O   . GLY A 1 1248 ? 12.453  80.730  65.260  1.00 27.60 ? 1248 GLY A O   1 
ATOM   9785  N  N   . GLY A 1 1249 ? 14.277  82.020  64.902  1.00 28.25 ? 1249 GLY A N   1 
ATOM   9786  C  CA  . GLY A 1 1249 ? 14.413  81.634  63.512  1.00 27.87 ? 1249 GLY A CA  1 
ATOM   9787  C  C   . GLY A 1 1249 ? 14.471  80.147  63.245  1.00 27.66 ? 1249 GLY A C   1 
ATOM   9788  O  O   . GLY A 1 1249 ? 13.834  79.657  62.310  1.00 27.07 ? 1249 GLY A O   1 
ATOM   9789  N  N   . ARG A 1 1250 ? 15.224  79.418  64.059  1.00 28.80 ? 1250 ARG A N   1 
ATOM   9790  C  CA  . ARG A 1 1250 ? 15.342  77.984  63.846  1.00 29.12 ? 1250 ARG A CA  1 
ATOM   9791  C  C   . ARG A 1 1250 ? 13.985  77.316  63.917  1.00 29.11 ? 1250 ARG A C   1 
ATOM   9792  O  O   . ARG A 1 1250 ? 13.613  76.547  63.020  1.00 28.48 ? 1250 ARG A O   1 
ATOM   9793  C  CB  . ARG A 1 1250 ? 16.293  77.348  64.866  1.00 28.94 ? 1250 ARG A CB  1 
ATOM   9794  C  CG  . ARG A 1 1250 ? 16.834  76.024  64.392  1.00 29.48 ? 1250 ARG A CG  1 
ATOM   9795  C  CD  . ARG A 1 1250 ? 17.757  75.367  65.391  1.00 33.47 ? 1250 ARG A CD  1 
ATOM   9796  N  NE  . ARG A 1 1250 ? 17.967  73.960  65.042  1.00 36.36 ? 1250 ARG A NE  1 
ATOM   9797  C  CZ  . ARG A 1 1250 ? 18.541  73.058  65.841  1.00 37.21 ? 1250 ARG A CZ  1 
ATOM   9798  N  NH1 . ARG A 1 1250 ? 18.973  73.423  67.043  1.00 36.35 ? 1250 ARG A NH1 1 
ATOM   9799  N  NH2 . ARG A 1 1250 ? 18.661  71.792  65.442  1.00 36.39 ? 1250 ARG A NH2 1 
ATOM   9800  N  N   . SER A 1 1251 ? 13.247  77.620  64.985  1.00 29.27 ? 1251 SER A N   1 
ATOM   9801  C  CA  . SER A 1 1251 ? 11.921  77.047  65.179  1.00 29.45 ? 1251 SER A CA  1 
ATOM   9802  C  C   . SER A 1 1251 ? 10.969  77.481  64.070  1.00 28.92 ? 1251 SER A C   1 
ATOM   9803  O  O   . SER A 1 1251 ? 10.097  76.723  63.640  1.00 29.31 ? 1251 SER A O   1 
ATOM   9804  C  CB  . SER A 1 1251 ? 11.363  77.438  66.548  1.00 30.86 ? 1251 SER A CB  1 
ATOM   9805  O  OG  . SER A 1 1251 ? 12.158  76.906  67.594  1.00 34.11 ? 1251 SER A OG  1 
ATOM   9806  N  N   . LEU A 1 1252 ? 11.171  78.706  63.582  1.00 27.63 ? 1252 LEU A N   1 
ATOM   9807  C  CA  . LEU A 1 1252 ? 10.307  79.202  62.515  1.00 26.33 ? 1252 LEU A CA  1 
ATOM   9808  C  C   . LEU A 1 1252 ? 10.553  78.431  61.214  1.00 26.06 ? 1252 LEU A C   1 
ATOM   9809  O  O   . LEU A 1 1252 ? 9.607   78.047  60.515  1.00 26.37 ? 1252 LEU A O   1 
ATOM   9810  C  CB  . LEU A 1 1252 ? 10.534  80.697  62.294  1.00 25.76 ? 1252 LEU A CB  1 
ATOM   9811  C  CG  . LEU A 1 1252 ? 9.612   81.348  61.245  1.00 25.25 ? 1252 LEU A CG  1 
ATOM   9812  C  CD1 . LEU A 1 1252 ? 8.134   81.199  61.657  1.00 25.94 ? 1252 LEU A CD1 1 
ATOM   9813  C  CD2 . LEU A 1 1252 ? 9.958   82.816  61.104  1.00 24.06 ? 1252 LEU A CD2 1 
ATOM   9814  N  N   . GLY A 1 1253 ? 11.822  78.191  60.900  1.00 23.98 ? 1253 GLY A N   1 
ATOM   9815  C  CA  . GLY A 1 1253 ? 12.148  77.450  59.698  1.00 22.86 ? 1253 GLY A CA  1 
ATOM   9816  C  C   . GLY A 1 1253 ? 11.563  76.046  59.679  1.00 22.72 ? 1253 GLY A C   1 
ATOM   9817  O  O   . GLY A 1 1253 ? 11.020  75.601  58.652  1.00 23.21 ? 1253 GLY A O   1 
ATOM   9818  N  N   . GLN A 1 1254 ? 11.673  75.343  60.804  1.00 22.92 ? 1254 GLN A N   1 
ATOM   9819  C  CA  . GLN A 1 1254 ? 11.142  73.985  60.897  1.00 25.03 ? 1254 GLN A CA  1 
ATOM   9820  C  C   . GLN A 1 1254 ? 9.637   74.030  60.687  1.00 26.02 ? 1254 GLN A C   1 
ATOM   9821  O  O   . GLN A 1 1254 ? 9.060   73.162  60.023  1.00 26.41 ? 1254 GLN A O   1 
ATOM   9822  C  CB  . GLN A 1 1254 ? 11.439  73.348  62.266  1.00 24.10 ? 1254 GLN A CB  1 
ATOM   9823  C  CG  . GLN A 1 1254 ? 12.851  72.850  62.468  1.00 25.26 ? 1254 GLN A CG  1 
ATOM   9824  C  CD  . GLN A 1 1254 ? 13.355  72.019  61.307  1.00 28.49 ? 1254 GLN A CD  1 
ATOM   9825  O  OE1 . GLN A 1 1254 ? 12.698  71.062  60.864  1.00 29.23 ? 1254 GLN A OE1 1 
ATOM   9826  N  NE2 . GLN A 1 1254 ? 14.538  72.371  60.808  1.00 30.88 ? 1254 GLN A NE2 1 
ATOM   9827  N  N   . ARG A 1 1255 ? 9.005   75.052  61.247  1.00 26.86 ? 1255 ARG A N   1 
ATOM   9828  C  CA  . ARG A 1 1255 ? 7.563   75.198  61.121  1.00 28.31 ? 1255 ARG A CA  1 
ATOM   9829  C  C   . ARG A 1 1255 ? 7.172   75.268  59.642  1.00 27.84 ? 1255 ARG A C   1 
ATOM   9830  O  O   . ARG A 1 1255 ? 6.224   74.593  59.221  1.00 30.16 ? 1255 ARG A O   1 
ATOM   9831  C  CB  . ARG A 1 1255 ? 7.095   76.443  61.891  1.00 29.80 ? 1255 ARG A CB  1 
ATOM   9832  C  CG  . ARG A 1 1255 ? 5.660   76.393  62.319  1.00 31.61 ? 1255 ARG A CG  1 
ATOM   9833  C  CD  . ARG A 1 1255 ? 5.429   77.114  63.629  1.00 33.19 ? 1255 ARG A CD  1 
ATOM   9834  N  NE  . ARG A 1 1255 ? 4.025   77.493  63.742  1.00 34.70 ? 1255 ARG A NE  1 
ATOM   9835  C  CZ  . ARG A 1 1255 ? 3.355   77.603  64.884  1.00 35.54 ? 1255 ARG A CZ  1 
ATOM   9836  N  NH1 . ARG A 1 1255 ? 3.951   77.357  66.042  1.00 35.46 ? 1255 ARG A NH1 1 
ATOM   9837  N  NH2 . ARG A 1 1255 ? 2.080   77.963  64.862  1.00 37.68 ? 1255 ARG A NH2 1 
ATOM   9838  N  N   . PHE A 1 1256 ? 7.895   76.062  58.852  1.00 26.03 ? 1256 PHE A N   1 
ATOM   9839  C  CA  . PHE A 1 1256 ? 7.598   76.159  57.414  1.00 25.61 ? 1256 PHE A CA  1 
ATOM   9840  C  C   . PHE A 1 1256 ? 7.985   74.846  56.690  1.00 26.36 ? 1256 PHE A C   1 
ATOM   9841  O  O   . PHE A 1 1256 ? 7.316   74.417  55.732  1.00 26.08 ? 1256 PHE A O   1 
ATOM   9842  C  CB  . PHE A 1 1256 ? 8.367   77.307  56.754  1.00 23.02 ? 1256 PHE A CB  1 
ATOM   9843  C  CG  . PHE A 1 1256 ? 7.983   78.670  57.235  1.00 20.43 ? 1256 PHE A CG  1 
ATOM   9844  C  CD1 . PHE A 1 1256 ? 6.659   79.078  57.232  1.00 20.69 ? 1256 PHE A CD1 1 
ATOM   9845  C  CD2 . PHE A 1 1256 ? 8.963   79.576  57.620  1.00 19.11 ? 1256 PHE A CD2 1 
ATOM   9846  C  CE1 . PHE A 1 1256 ? 6.313   80.370  57.607  1.00 19.11 ? 1256 PHE A CE1 1 
ATOM   9847  C  CE2 . PHE A 1 1256 ? 8.630   80.877  58.001  1.00 18.47 ? 1256 PHE A CE2 1 
ATOM   9848  C  CZ  . PHE A 1 1256 ? 7.297   81.274  57.989  1.00 19.45 ? 1256 PHE A CZ  1 
ATOM   9849  N  N   . MET A 1 1257 ? 9.070   74.214  57.130  1.00 26.05 ? 1257 MET A N   1 
ATOM   9850  C  CA  . MET A 1 1257 ? 9.461   72.965  56.493  1.00 26.73 ? 1257 MET A CA  1 
ATOM   9851  C  C   . MET A 1 1257 ? 8.368   71.908  56.683  1.00 26.50 ? 1257 MET A C   1 
ATOM   9852  O  O   . MET A 1 1257 ? 8.111   71.090  55.781  1.00 25.33 ? 1257 MET A O   1 
ATOM   9853  C  CB  . MET A 1 1257 ? 10.807  72.482  57.032  1.00 27.58 ? 1257 MET A CB  1 
ATOM   9854  C  CG  . MET A 1 1257 ? 11.922  73.414  56.643  1.00 30.02 ? 1257 MET A CG  1 
ATOM   9855  S  SD  . MET A 1 1257 ? 13.576  72.862  57.062  1.00 34.86 ? 1257 MET A SD  1 
ATOM   9856  C  CE  . MET A 1 1257 ? 13.916  71.846  55.662  1.00 33.92 ? 1257 MET A CE  1 
ATOM   9857  N  N   . THR A 1 1258 ? 7.720   71.930  57.845  1.00 25.54 ? 1258 THR A N   1 
ATOM   9858  C  CA  . THR A 1 1258 ? 6.648   70.987  58.101  1.00 26.45 ? 1258 THR A CA  1 
ATOM   9859  C  C   . THR A 1 1258 ? 5.585   71.235  57.031  1.00 27.55 ? 1258 THR A C   1 
ATOM   9860  O  O   . THR A 1 1258 ? 5.125   70.304  56.362  1.00 26.49 ? 1258 THR A O   1 
ATOM   9861  C  CB  . THR A 1 1258 ? 6.055   71.184  59.524  1.00 27.79 ? 1258 THR A CB  1 
ATOM   9862  O  OG1 . THR A 1 1258 ? 6.966   70.646  60.494  1.00 27.17 ? 1258 THR A OG1 1 
ATOM   9863  C  CG2 . THR A 1 1258 ? 4.686   70.498  59.663  1.00 25.84 ? 1258 THR A CG2 1 
ATOM   9864  N  N   . TRP A 1 1259 ? 5.216   72.499  56.848  1.00 28.82 ? 1259 TRP A N   1 
ATOM   9865  C  CA  . TRP A 1 1259 ? 4.225   72.830  55.838  1.00 29.46 ? 1259 TRP A CA  1 
ATOM   9866  C  C   . TRP A 1 1259 ? 4.653   72.344  54.456  1.00 29.91 ? 1259 TRP A C   1 
ATOM   9867  O  O   . TRP A 1 1259 ? 3.870   71.730  53.748  1.00 31.18 ? 1259 TRP A O   1 
ATOM   9868  C  CB  . TRP A 1 1259 ? 3.976   74.337  55.752  1.00 28.21 ? 1259 TRP A CB  1 
ATOM   9869  C  CG  . TRP A 1 1259 ? 2.844   74.643  54.792  1.00 27.53 ? 1259 TRP A CG  1 
ATOM   9870  C  CD1 . TRP A 1 1259 ? 1.508   74.553  55.047  1.00 26.51 ? 1259 TRP A CD1 1 
ATOM   9871  C  CD2 . TRP A 1 1259 ? 2.966   74.996  53.409  1.00 26.23 ? 1259 TRP A CD2 1 
ATOM   9872  N  NE1 . TRP A 1 1259 ? 0.790   74.823  53.910  1.00 25.09 ? 1259 TRP A NE1 1 
ATOM   9873  C  CE2 . TRP A 1 1259 ? 1.654   75.100  52.892  1.00 26.27 ? 1259 TRP A CE2 1 
ATOM   9874  C  CE3 . TRP A 1 1259 ? 4.053   75.235  52.560  1.00 25.30 ? 1259 TRP A CE3 1 
ATOM   9875  C  CZ2 . TRP A 1 1259 ? 1.399   75.433  51.557  1.00 26.22 ? 1259 TRP A CZ2 1 
ATOM   9876  C  CZ3 . TRP A 1 1259 ? 3.802   75.567  51.228  1.00 26.63 ? 1259 TRP A CZ3 1 
ATOM   9877  C  CH2 . TRP A 1 1259 ? 2.480   75.661  50.740  1.00 27.96 ? 1259 TRP A CH2 1 
ATOM   9878  N  N   . MET A 1 1260 ? 5.887   72.643  54.074  1.00 30.35 ? 1260 MET A N   1 
ATOM   9879  C  CA  . MET A 1 1260 ? 6.393   72.246  52.774  1.00 31.23 ? 1260 MET A CA  1 
ATOM   9880  C  C   . MET A 1 1260 ? 6.231   70.763  52.498  1.00 32.84 ? 1260 MET A C   1 
ATOM   9881  O  O   . MET A 1 1260 ? 5.597   70.379  51.510  1.00 33.40 ? 1260 MET A O   1 
ATOM   9882  C  CB  . MET A 1 1260 ? 7.867   72.628  52.635  1.00 29.80 ? 1260 MET A CB  1 
ATOM   9883  C  CG  . MET A 1 1260 ? 8.107   74.118  52.514  1.00 27.65 ? 1260 MET A CG  1 
ATOM   9884  S  SD  . MET A 1 1260 ? 9.854   74.460  52.343  1.00 29.60 ? 1260 MET A SD  1 
ATOM   9885  C  CE  . MET A 1 1260 ? 10.096  75.823  53.473  1.00 23.27 ? 1260 MET A CE  1 
ATOM   9886  N  N   . ARG A 1 1261 ? 6.785   69.923  53.367  1.00 32.74 ? 1261 ARG A N   1 
ATOM   9887  C  CA  . ARG A 1 1261 ? 6.692   68.497  53.135  1.00 33.19 ? 1261 ARG A CA  1 
ATOM   9888  C  C   . ARG A 1 1261 ? 5.300   67.908  53.282  1.00 34.87 ? 1261 ARG A C   1 
ATOM   9889  O  O   . ARG A 1 1261 ? 5.034   66.811  52.803  1.00 35.16 ? 1261 ARG A O   1 
ATOM   9890  C  CB  . ARG A 1 1261 ? 7.670   67.740  54.035  1.00 30.21 ? 1261 ARG A CB  1 
ATOM   9891  C  CG  . ARG A 1 1261 ? 7.330   67.738  55.506  1.00 27.98 ? 1261 ARG A CG  1 
ATOM   9892  C  CD  . ARG A 1 1261 ? 8.192   66.727  56.240  1.00 26.52 ? 1261 ARG A CD  1 
ATOM   9893  N  NE  . ARG A 1 1261 ? 9.606   67.086  56.196  1.00 24.41 ? 1261 ARG A NE  1 
ATOM   9894  C  CZ  . ARG A 1 1261 ? 10.157  68.060  56.926  1.00 26.88 ? 1261 ARG A CZ  1 
ATOM   9895  N  NH1 . ARG A 1 1261 ? 9.423   68.784  57.775  1.00 23.69 ? 1261 ARG A NH1 1 
ATOM   9896  N  NH2 . ARG A 1 1261 ? 11.454  68.324  56.805  1.00 26.44 ? 1261 ARG A NH2 1 
ATOM   9897  N  N   . GLN A 1 1262 ? 4.381   68.633  53.903  1.00 36.79 ? 1262 GLN A N   1 
ATOM   9898  C  CA  . GLN A 1 1262 ? 3.044   68.077  54.112  1.00 38.79 ? 1262 GLN A CA  1 
ATOM   9899  C  C   . GLN A 1 1262 ? 2.016   68.287  52.988  1.00 40.04 ? 1262 GLN A C   1 
ATOM   9900  O  O   . GLN A 1 1262 ? 0.949   67.700  53.014  1.00 40.76 ? 1262 GLN A O   1 
ATOM   9901  C  CB  . GLN A 1 1262 ? 2.451   68.635  55.417  1.00 39.32 ? 1262 GLN A CB  1 
ATOM   9902  C  CG  . GLN A 1 1262 ? 2.341   67.655  56.599  1.00 41.76 ? 1262 GLN A CG  1 
ATOM   9903  C  CD  . GLN A 1 1262 ? 2.165   68.382  58.027  1.00 43.63 ? 1262 GLN A CD  1 
ATOM   9904  O  OE1 . GLN A 1 1262 ? 1.301   69.155  58.117  1.00 44.55 ? 1262 GLN A OE1 1 
ATOM   9905  N  NE2 . GLN A 1 1262 ? 3.007   68.061  58.983  1.00 44.53 ? 1262 GLN A NE2 1 
ATOM   9906  N  N   . GLU A 1 1263 ? 2.330   69.127  51.997  1.00 41.16 ? 1263 GLU A N   1 
ATOM   9907  C  CA  . GLU A 1 1263 ? 1.417   69.471  50.892  1.00 43.52 ? 1263 GLU A CA  1 
ATOM   9908  C  C   . GLU A 1 1263 ? 0.858   68.397  49.963  1.00 45.98 ? 1263 GLU A C   1 
ATOM   9909  O  O   . GLU A 1 1263 ? 1.601   67.803  49.193  1.00 45.28 ? 1263 GLU A O   1 
ATOM   9910  C  CB  . GLU A 1 1263 ? 2.087   70.510  50.035  1.00 43.29 ? 1263 GLU A CB  1 
ATOM   9911  C  CG  . GLU A 1 1263 ? 1.889   71.900  50.557  1.00 43.64 ? 1263 GLU A CG  1 
ATOM   9912  C  CD  . GLU A 1 1263 ? 0.451   72.348  50.418  1.00 44.31 ? 1263 GLU A CD  1 
ATOM   9913  O  OE1 . GLU A 1 1263 ? 0.097   72.831  49.324  1.00 45.74 ? 1263 GLU A OE1 1 
ATOM   9914  O  OE2 . GLU A 1 1263 ? -0.328  72.208  51.392  1.00 43.13 ? 1263 GLU A OE2 1 
ATOM   9915  N  N   . GLY A 1 1264 ? -0.443  68.194  50.010  1.00 48.22 ? 1264 GLY A N   1 
ATOM   9916  C  CA  . GLY A 1 1264 ? -1.014  67.170  49.159  1.00 51.35 ? 1264 GLY A CA  1 
ATOM   9917  C  C   . GLY A 1 1264 ? -0.676  65.976  49.945  1.00 53.78 ? 1264 GLY A C   1 
ATOM   9918  O  O   . GLY A 1 1264 ? 0.280   65.266  49.668  1.00 54.94 ? 1264 GLY A O   1 
ATOM   9919  N  N   . ARG A 1 1265 ? -1.454  65.681  50.960  1.00 55.99 ? 1265 ARG A N   1 
ATOM   9920  C  CA  . ARG A 1 1265 ? -0.924  64.579  51.597  1.00 57.98 ? 1265 ARG A CA  1 
ATOM   9921  C  C   . ARG A 1 1265 ? -1.728  63.270  51.610  1.00 59.73 ? 1265 ARG A C   1 
ATOM   9922  O  O   . ARG A 1 1265 ? -1.338  62.228  51.870  1.00 61.16 ? 1265 ARG A O   1 
ATOM   9923  C  CB  . ARG A 1 1265 ? -0.688  64.939  53.075  1.00 57.95 ? 1265 ARG A CB  1 
ATOM   9924  C  CG  . ARG A 1 1265 ? 0.293   64.034  53.771  1.00 57.96 ? 1265 ARG A CG  1 
ATOM   9925  C  CD  . ARG A 1 1265 ? 1.595   64.745  54.011  1.00 57.85 ? 1265 ARG A CD  1 
ATOM   9926  N  NE  . ARG A 1 1265 ? 2.324   64.094  55.082  1.00 59.45 ? 1265 ARG A NE  1 
ATOM   9927  C  CZ  . ARG A 1 1265 ? 3.447   64.563  55.616  1.00 60.56 ? 1265 ARG A CZ  1 
ATOM   9928  N  NH1 . ARG A 1 1265 ? 3.980   65.677  55.182  1.00 61.31 ? 1265 ARG A NH1 1 
ATOM   9929  N  NH2 . ARG A 1 1265 ? 4.041   63.891  56.587  1.00 60.20 ? 1265 ARG A NH2 1 
HETATM 9930  MN MN  . MN  B 2 .    ? -1.860  101.740 18.660  1.00 54.26 ? 1500 MN  A MN  1 
HETATM 9931  P  PA  . GTG C 3 .    ? -34.122 83.560  41.203  1.00 72.26 ? 1425 GTG A PA  1 
HETATM 9932  O  O1A . GTG C 3 .    ? -35.309 84.412  40.767  1.00 72.24 ? 1425 GTG A O1A 1 
HETATM 9933  O  O2A . GTG C 3 .    ? -34.368 82.022  41.157  1.00 70.94 ? 1425 GTG A O2A 1 
HETATM 9934  O  O3A . GTG C 3 .    ? -33.424 83.454  42.477  1.00 77.65 ? 1425 GTG A O3A 1 
HETATM 9935  P  PB  . GTG C 3 .    ? -34.120 84.215  43.706  1.00 82.39 ? 1425 GTG A PB  1 
HETATM 9936  O  O1B . GTG C 3 .    ? -32.677 84.880  44.102  1.00 81.66 ? 1425 GTG A O1B 1 
HETATM 9937  O  O2B . GTG C 3 .    ? -33.873 83.360  44.871  1.00 82.22 ? 1425 GTG A O2B 1 
HETATM 9938  O  O3B . GTG C 3 .    ? -34.857 85.675  43.448  1.00 85.39 ? 1425 GTG A O3B 1 
HETATM 9939  N  N9A . GTG C 3 .    ? -29.946 81.560  42.976  1.00 48.42 ? 1425 GTG A N9A 1 
HETATM 9940  C  C8A . GTG C 3 .    ? -31.269 81.258  43.180  1.00 47.26 ? 1425 GTG A C8A 1 
HETATM 9941  N  N7A . GTG C 3 .    ? -31.467 80.242  43.952  1.00 46.77 ? 1425 GTG A N7A 1 
HETATM 9942  C  C7X . GTG C 3 .    ? -32.769 79.733  44.314  1.00 45.45 ? 1425 GTG A C7X 1 
HETATM 9943  C  C5A . GTG C 3 .    ? -30.188 79.828  44.294  1.00 46.97 ? 1425 GTG A C5A 1 
HETATM 9944  C  C6A . GTG C 3 .    ? -29.763 78.756  45.122  1.00 45.45 ? 1425 GTG A C6A 1 
HETATM 9945  O  O6A . GTG C 3 .    ? -30.452 77.949  45.724  1.00 46.44 ? 1425 GTG A O6A 1 
HETATM 9946  N  N1A . GTG C 3 .    ? -28.384 78.670  45.215  1.00 44.08 ? 1425 GTG A N1A 1 
HETATM 9947  C  C2A . GTG C 3 .    ? -27.480 79.511  44.589  1.00 44.17 ? 1425 GTG A C2A 1 
HETATM 9948  N  N2A . GTG C 3 .    ? -26.181 79.284  44.788  1.00 43.26 ? 1425 GTG A N2A 1 
HETATM 9949  N  N3A . GTG C 3 .    ? -27.883 80.529  43.804  1.00 44.26 ? 1425 GTG A N3A 1 
HETATM 9950  C  C4A . GTG C 3 .    ? -29.242 80.628  43.702  1.00 46.82 ? 1425 GTG A C4A 1 
HETATM 9951  O  O5D . GTG C 3 .    ? -32.859 83.642  40.634  1.00 69.91 ? 1425 GTG A O5D 1 
HETATM 9952  C  C5D . GTG C 3 .    ? -31.825 84.016  39.787  1.00 65.07 ? 1425 GTG A C5D 1 
HETATM 9953  C  C4D . GTG C 3 .    ? -30.699 83.996  40.670  1.00 60.18 ? 1425 GTG A C4D 1 
HETATM 9954  O  O4D . GTG C 3 .    ? -30.516 83.700  42.035  1.00 57.04 ? 1425 GTG A O4D 1 
HETATM 9955  C  C3D . GTG C 3 .    ? -29.833 83.301  39.771  1.00 59.25 ? 1425 GTG A C3D 1 
HETATM 9956  O  O3D . GTG C 3 .    ? -29.081 83.781  38.769  1.00 62.19 ? 1425 GTG A O3D 1 
HETATM 9957  C  C2D . GTG C 3 .    ? -29.032 82.506  40.565  1.00 55.37 ? 1425 GTG A C2D 1 
HETATM 9958  O  O2D . GTG C 3 .    ? -27.697 82.823  40.296  1.00 53.43 ? 1425 GTG A O2D 1 
HETATM 9959  C  C1D . GTG C 3 .    ? -29.449 82.734  42.089  1.00 53.65 ? 1425 GTG A C1D 1 
HETATM 9960  P  PG  . GTG C 3 .    ? -35.571 86.626  44.630  1.00 88.64 ? 1425 GTG A PG  1 
HETATM 9961  O  O1G . GTG C 3 .    ? -37.007 86.744  43.999  1.00 87.87 ? 1425 GTG A O1G 1 
HETATM 9962  O  O2G . GTG C 3 .    ? -34.398 87.451  44.353  1.00 89.32 ? 1425 GTG A O2G 1 
HETATM 9963  O  O5E . GTG C 3 .    ? -35.133 86.392  46.240  1.00 89.01 ? 1425 GTG A O5E 1 
HETATM 9964  C  C5E . GTG C 3 .    ? -36.426 86.328  46.937  1.00 90.46 ? 1425 GTG A C5E 1 
HETATM 9965  C  C4E . GTG C 3 .    ? -36.978 87.145  48.107  1.00 90.86 ? 1425 GTG A C4E 1 
HETATM 9966  O  O4E . GTG C 3 .    ? -36.401 86.776  49.312  1.00 90.85 ? 1425 GTG A O4E 1 
HETATM 9967  C  C3E . GTG C 3 .    ? -36.746 88.655  47.964  1.00 91.17 ? 1425 GTG A C3E 1 
HETATM 9968  O  O3E . GTG C 3 .    ? -37.643 89.294  47.016  1.00 91.17 ? 1425 GTG A O3E 1 
HETATM 9969  C  C2E . GTG C 3 .    ? -36.901 89.080  49.326  1.00 90.93 ? 1425 GTG A C2E 1 
HETATM 9970  O  O2E . GTG C 3 .    ? -38.240 89.597  49.488  1.00 90.04 ? 1425 GTG A O2E 1 
HETATM 9971  C  C1E . GTG C 3 .    ? -36.674 87.842  50.227  1.00 90.73 ? 1425 GTG A C1E 1 
HETATM 9972  N  N9B . GTG C 3 .    ? -35.484 87.891  51.177  1.00 89.90 ? 1425 GTG A N9B 1 
HETATM 9973  C  C8B . GTG C 3 .    ? -34.129 88.133  50.881  1.00 90.09 ? 1425 GTG A C8B 1 
HETATM 9974  N  N7B . GTG C 3 .    ? -33.269 88.124  51.906  1.00 89.80 ? 1425 GTG A N7B 1 
HETATM 9975  C  C5B . GTG C 3 .    ? -34.130 87.851  52.987  1.00 89.41 ? 1425 GTG A C5B 1 
HETATM 9976  C  C6B . GTG C 3 .    ? -33.803 87.709  54.409  1.00 89.17 ? 1425 GTG A C6B 1 
HETATM 9977  O  O6B . GTG C 3 .    ? -32.696 87.812  54.874  1.00 88.58 ? 1425 GTG A O6B 1 
HETATM 9978  N  N1B . GTG C 3 .    ? -34.947 87.429  55.225  1.00 89.01 ? 1425 GTG A N1B 1 
HETATM 9979  C  C2B . GTG C 3 .    ? -36.278 87.299  54.716  1.00 88.62 ? 1425 GTG A C2B 1 
HETATM 9980  N  N2B . GTG C 3 .    ? -37.270 87.036  55.568  1.00 88.73 ? 1425 GTG A N2B 1 
HETATM 9981  N  N3B . GTG C 3 .    ? -36.565 87.434  53.386  1.00 89.09 ? 1425 GTG A N3B 1 
HETATM 9982  C  C4B . GTG C 3 .    ? -35.475 87.705  52.579  1.00 89.57 ? 1425 GTG A C4B 1 
HETATM 9983  O  O   . HOH D 4 .    ? -18.845 94.912  20.774  1.00 19.51 ? 2001 HOH A O   1 
HETATM 9984  O  O   . HOH D 4 .    ? -14.540 71.475  19.868  1.00 20.66 ? 2002 HOH A O   1 
HETATM 9985  O  O   . HOH D 4 .    ? -9.260  109.259 41.827  1.00 29.24 ? 2003 HOH A O   1 
HETATM 9986  O  O   . HOH D 4 .    ? -22.560 101.291 30.208  1.00 14.33 ? 2004 HOH A O   1 
HETATM 9987  O  O   . HOH D 4 .    ? 18.912  97.238  22.348  1.00 25.97 ? 2005 HOH A O   1 
HETATM 9988  O  O   . HOH D 4 .    ? -19.711 80.009  64.359  1.00 39.52 ? 2006 HOH A O   1 
HETATM 9989  O  O   . HOH D 4 .    ? 15.732  97.677  28.509  1.00 24.34 ? 2007 HOH A O   1 
HETATM 9990  O  O   . HOH D 4 .    ? -15.548 110.419 23.789  1.00 13.26 ? 2008 HOH A O   1 
HETATM 9991  O  O   . HOH D 4 .    ? -10.474 108.139 32.174  1.00 20.23 ? 2009 HOH A O   1 
HETATM 9992  O  O   . HOH D 4 .    ? -7.238  111.243 49.213  1.00 14.45 ? 2010 HOH A O   1 
HETATM 9993  O  O   . HOH D 4 .    ? -16.976 93.068  14.171  1.00 39.87 ? 2011 HOH A O   1 
HETATM 9994  O  O   . HOH D 4 .    ? -22.204 90.716  16.870  1.00 32.50 ? 2012 HOH A O   1 
HETATM 9995  O  O   . HOH D 4 .    ? -29.257 92.406  12.104  1.00 13.08 ? 2013 HOH A O   1 
HETATM 9996  O  O   . HOH D 4 .    ? -14.031 99.703  38.562  1.00 18.68 ? 2014 HOH A O   1 
HETATM 9997  O  O   . HOH D 4 .    ? -26.797 97.799  19.175  1.00 18.25 ? 2015 HOH A O   1 
HETATM 9998  O  O   . HOH D 4 .    ? -23.187 91.256  19.537  1.00 29.09 ? 2016 HOH A O   1 
HETATM 9999  O  O   . HOH D 4 .    ? 6.256   71.673  62.765  1.00 24.67 ? 2017 HOH A O   1 
HETATM 10000 O  O   . HOH D 4 .    ? -22.848 97.273  28.515  1.00 19.96 ? 2018 HOH A O   1 
HETATM 10001 O  O   . HOH D 4 .    ? -23.277 115.900 37.301  1.00 25.99 ? 2019 HOH A O   1 
HETATM 10002 O  O   . HOH D 4 .    ? 13.791  68.472  4.355   1.00 25.06 ? 2020 HOH A O   1 
HETATM 10003 O  O   . HOH D 4 .    ? -5.534  102.622 64.741  1.00 23.80 ? 2021 HOH A O   1 
HETATM 10004 O  O   . HOH D 4 .    ? 13.289  86.077  -3.125  1.00 19.76 ? 2022 HOH A O   1 
HETATM 10005 O  O   . HOH D 4 .    ? 9.406   80.346  65.914  1.00 23.10 ? 2023 HOH A O   1 
HETATM 10006 O  O   . HOH D 4 .    ? -10.985 75.691  3.857   1.00 35.83 ? 2024 HOH A O   1 
HETATM 10007 O  O   . HOH D 4 .    ? -7.633  95.489  56.178  1.00 24.52 ? 2025 HOH A O   1 
HETATM 10008 O  O   . HOH D 4 .    ? -10.145 109.346 58.913  1.00 15.33 ? 2026 HOH A O   1 
HETATM 10009 O  O   . HOH D 4 .    ? -12.870 53.799  34.181  1.00 39.45 ? 2027 HOH A O   1 
HETATM 10010 O  O   . HOH D 4 .    ? -21.457 98.797  30.314  1.00 22.62 ? 2028 HOH A O   1 
HETATM 10011 O  O   . HOH D 4 .    ? -14.675 102.594 35.872  1.00 25.96 ? 2029 HOH A O   1 
HETATM 10012 O  O   . HOH D 4 .    ? 2.243   118.497 38.862  1.00 25.77 ? 2030 HOH A O   1 
HETATM 10013 O  O   . HOH D 4 .    ? 4.414   113.870 33.463  1.00 19.78 ? 2031 HOH A O   1 
HETATM 10014 O  O   . HOH D 4 .    ? -35.788 81.620  44.936  1.00 59.89 ? 2032 HOH A O   1 
HETATM 10015 O  O   . HOH D 4 .    ? -11.276 114.763 39.383  1.00 21.39 ? 2033 HOH A O   1 
HETATM 10016 O  O   . HOH D 4 .    ? -6.056  102.899 49.235  1.00 25.66 ? 2034 HOH A O   1 
HETATM 10017 O  O   . HOH D 4 .    ? -7.456  108.018 37.329  1.00 32.97 ? 2035 HOH A O   1 
HETATM 10018 O  O   . HOH D 4 .    ? -8.140  76.569  18.588  1.00 24.90 ? 2036 HOH A O   1 
HETATM 10019 O  O   . HOH D 4 .    ? 9.604   96.049  41.438  1.00 26.83 ? 2037 HOH A O   1 
HETATM 10020 O  O   . HOH D 4 .    ? 9.430   79.634  42.839  1.00 31.15 ? 2038 HOH A O   1 
HETATM 10021 O  O   . HOH D 4 .    ? -9.308  109.488 50.037  1.00 15.74 ? 2039 HOH A O   1 
HETATM 10022 O  O   . HOH D 4 .    ? -40.845 97.565  17.149  1.00 31.06 ? 2040 HOH A O   1 
HETATM 10023 O  O   . HOH D 4 .    ? 19.601  76.019  4.801   1.00 38.42 ? 2041 HOH A O   1 
HETATM 10024 O  O   . HOH D 4 .    ? -28.116 100.583 19.938  1.00 20.29 ? 2042 HOH A O   1 
HETATM 10025 O  O   . HOH D 4 .    ? -8.240  119.174 37.197  1.00 16.36 ? 2043 HOH A O   1 
HETATM 10026 O  O   . HOH D 4 .    ? 7.513   68.076  59.697  1.00 24.66 ? 2044 HOH A O   1 
HETATM 10027 O  O   . HOH D 4 .    ? -3.757  113.919 38.376  1.00 22.08 ? 2045 HOH A O   1 
HETATM 10028 O  O   . HOH D 4 .    ? -14.800 115.888 18.065  1.00 14.87 ? 2046 HOH A O   1 
HETATM 10029 O  O   . HOH D 4 .    ? -33.991 95.279  36.823  1.00 24.79 ? 2047 HOH A O   1 
HETATM 10030 O  O   . HOH D 4 .    ? -3.967  122.187 27.059  1.00 30.91 ? 2048 HOH A O   1 
HETATM 10031 O  O   . HOH D 4 .    ? 1.782   109.393 55.477  1.00 21.41 ? 2049 HOH A O   1 
HETATM 10032 O  O   . HOH D 4 .    ? -43.747 96.271  15.534  1.00 32.06 ? 2050 HOH A O   1 
HETATM 10033 O  O   . HOH D 4 .    ? 5.049   93.818  31.265  1.00 24.79 ? 2051 HOH A O   1 
HETATM 10034 O  O   . HOH D 4 .    ? 15.941  90.734  26.338  1.00 36.29 ? 2052 HOH A O   1 
HETATM 10035 O  O   . HOH D 4 .    ? -3.096  82.569  66.776  1.00 22.14 ? 2053 HOH A O   1 
HETATM 10036 O  O   . HOH D 4 .    ? -31.483 97.162  24.727  1.00 24.20 ? 2054 HOH A O   1 
HETATM 10037 O  O   . HOH D 4 .    ? -17.838 105.684 31.127  1.00 22.68 ? 2055 HOH A O   1 
HETATM 10038 O  O   . HOH D 4 .    ? 4.191   119.803 36.832  1.00 27.99 ? 2056 HOH A O   1 
HETATM 10039 O  O   . HOH D 4 .    ? 10.654  100.591 46.477  1.00 30.01 ? 2057 HOH A O   1 
HETATM 10040 O  O   . HOH D 4 .    ? -3.508  92.110  44.849  1.00 20.42 ? 2058 HOH A O   1 
HETATM 10041 O  O   . HOH D 4 .    ? 14.972  117.714 14.372  1.00 46.85 ? 2059 HOH A O   1 
HETATM 10042 O  O   . HOH D 4 .    ? -12.511 101.449 37.194  1.00 33.66 ? 2060 HOH A O   1 
HETATM 10043 O  O   . HOH D 4 .    ? -0.163  87.952  47.734  1.00 27.45 ? 2061 HOH A O   1 
HETATM 10044 O  O   . HOH D 4 .    ? -2.365  76.280  26.495  1.00 31.30 ? 2062 HOH A O   1 
HETATM 10045 O  O   . HOH D 4 .    ? -20.605 110.111 26.563  1.00 19.66 ? 2063 HOH A O   1 
HETATM 10046 O  O   . HOH D 4 .    ? -27.140 100.737 13.876  1.00 34.08 ? 2064 HOH A O   1 
HETATM 10047 O  O   . HOH D 4 .    ? -24.519 89.691  21.362  1.00 28.28 ? 2065 HOH A O   1 
HETATM 10048 O  O   . HOH D 4 .    ? -15.687 81.225  48.340  1.00 29.80 ? 2066 HOH A O   1 
HETATM 10049 O  O   . HOH D 4 .    ? -2.258  89.542  46.779  1.00 24.29 ? 2067 HOH A O   1 
HETATM 10050 O  O   . HOH D 4 .    ? -1.824  81.989  69.210  1.00 17.23 ? 2068 HOH A O   1 
HETATM 10051 O  O   . HOH D 4 .    ? 0.689   75.383  16.358  1.00 22.12 ? 2069 HOH A O   1 
HETATM 10052 O  O   . HOH D 4 .    ? -29.473 89.611  11.829  1.00 21.76 ? 2070 HOH A O   1 
HETATM 10053 O  O   . HOH D 4 .    ? 0.747   90.325  -4.651  1.00 30.35 ? 2071 HOH A O   1 
HETATM 10054 O  O   . HOH D 4 .    ? -27.952 93.621  14.137  1.00 21.61 ? 2072 HOH A O   1 
HETATM 10055 O  O   . HOH D 4 .    ? -39.659 104.915 37.783  1.00 30.91 ? 2073 HOH A O   1 
HETATM 10056 O  O   . HOH D 4 .    ? -26.142 88.628  38.708  1.00 32.06 ? 2074 HOH A O   1 
HETATM 10057 O  O   . HOH D 4 .    ? -19.669 87.488  73.873  1.00 32.12 ? 2075 HOH A O   1 
HETATM 10058 O  O   . HOH D 4 .    ? -3.068  75.019  56.681  1.00 25.72 ? 2076 HOH A O   1 
HETATM 10059 O  O   . HOH D 4 .    ? 2.621   105.503 56.385  1.00 30.68 ? 2077 HOH A O   1 
HETATM 10060 O  O   . HOH D 4 .    ? -16.976 109.036 13.232  1.00 32.99 ? 2078 HOH A O   1 
HETATM 10061 O  O   . HOH D 4 .    ? 14.896  104.142 38.772  1.00 29.74 ? 2079 HOH A O   1 
HETATM 10062 O  O   . HOH D 4 .    ? -2.722  101.325 42.302  1.00 25.12 ? 2080 HOH A O   1 
HETATM 10063 O  O   . HOH D 4 .    ? 15.743  103.228 57.643  1.00 47.86 ? 2081 HOH A O   1 
HETATM 10064 O  O   . HOH D 4 .    ? -25.310 98.461  28.549  1.00 25.25 ? 2082 HOH A O   1 
HETATM 10065 O  O   . HOH D 4 .    ? -42.345 100.347 23.372  1.00 29.57 ? 2083 HOH A O   1 
HETATM 10066 O  O   . HOH D 4 .    ? 19.767  89.348  64.648  1.00 29.13 ? 2084 HOH A O   1 
HETATM 10067 O  O   . HOH D 4 .    ? -15.550 109.326 16.975  1.00 24.59 ? 2085 HOH A O   1 
HETATM 10068 O  O   . HOH D 4 .    ? -36.690 116.528 39.360  1.00 35.65 ? 2086 HOH A O   1 
HETATM 10069 O  O   . HOH D 4 .    ? -20.535 104.059 31.170  1.00 27.14 ? 2087 HOH A O   1 
HETATM 10070 O  O   . HOH D 4 .    ? -5.074  117.365 40.549  1.00 25.31 ? 2088 HOH A O   1 
HETATM 10071 O  O   . HOH D 4 .    ? -17.277 114.780 41.772  1.00 29.64 ? 2089 HOH A O   1 
HETATM 10072 O  O   . HOH D 4 .    ? -10.079 98.876  73.857  1.00 44.92 ? 2090 HOH A O   1 
HETATM 10073 O  O   . HOH D 4 .    ? 1.560   123.552 38.556  1.00 35.29 ? 2091 HOH A O   1 
HETATM 10074 O  O   . HOH D 4 .    ? 18.055  75.996  68.544  1.00 38.18 ? 2092 HOH A O   1 
HETATM 10075 O  O   . HOH D 4 .    ? -23.371 85.296  40.211  1.00 29.73 ? 2093 HOH A O   1 
HETATM 10076 O  O   . HOH D 4 .    ? 10.485  67.676  10.043  1.00 32.74 ? 2094 HOH A O   1 
HETATM 10077 O  O   . HOH D 4 .    ? 16.659  102.573 9.303   1.00 28.75 ? 2095 HOH A O   1 
HETATM 10078 O  O   . HOH D 4 .    ? -6.350  95.658  12.640  1.00 35.83 ? 2096 HOH A O   1 
HETATM 10079 O  O   . HOH D 4 .    ? -1.663  89.208  1.353   1.00 27.10 ? 2097 HOH A O   1 
HETATM 10080 O  O   . HOH D 4 .    ? -44.389 105.241 38.346  1.00 38.59 ? 2098 HOH A O   1 
HETATM 10081 O  O   . HOH D 4 .    ? 1.782   70.071  -7.668  1.00 26.20 ? 2099 HOH A O   1 
HETATM 10082 O  O   . HOH D 4 .    ? -17.689 102.651 35.032  1.00 23.87 ? 2100 HOH A O   1 
HETATM 10083 O  O   . HOH D 4 .    ? 3.371   112.652 25.127  1.00 32.05 ? 2101 HOH A O   1 
HETATM 10084 O  O   . HOH D 4 .    ? -12.012 106.336 24.848  1.00 24.45 ? 2102 HOH A O   1 
HETATM 10085 O  O   . HOH D 4 .    ? -36.912 91.206  24.234  1.00 28.65 ? 2103 HOH A O   1 
HETATM 10086 O  O   . HOH D 4 .    ? 10.339  84.228  72.624  1.00 41.00 ? 2104 HOH A O   1 
HETATM 10087 O  O   . HOH D 4 .    ? -12.560 108.241 26.748  1.00 16.33 ? 2105 HOH A O   1 
HETATM 10088 O  O   . HOH D 4 .    ? 1.160   74.614  18.914  1.00 31.92 ? 2106 HOH A O   1 
HETATM 10089 O  O   . HOH D 4 .    ? -0.699  80.825  52.357  1.00 30.99 ? 2107 HOH A O   1 
HETATM 10090 O  O   . HOH D 4 .    ? -14.569 93.239  36.922  1.00 33.54 ? 2108 HOH A O   1 
HETATM 10091 O  O   . HOH D 4 .    ? 12.956  88.831  43.607  1.00 30.34 ? 2109 HOH A O   1 
HETATM 10092 O  O   . HOH D 4 .    ? 0.387   87.979  41.442  1.00 37.26 ? 2110 HOH A O   1 
HETATM 10093 O  O   . HOH D 4 .    ? 14.117  82.119  -3.636  1.00 34.81 ? 2111 HOH A O   1 
HETATM 10094 O  O   . HOH D 4 .    ? -19.527 98.950  12.838  1.00 24.11 ? 2112 HOH A O   1 
HETATM 10095 O  O   . HOH D 4 .    ? 4.558   93.277  64.352  1.00 26.04 ? 2113 HOH A O   1 
HETATM 10096 O  O   . HOH D 4 .    ? 3.624   73.153  47.410  1.00 24.79 ? 2114 HOH A O   1 
HETATM 10097 O  O   . HOH D 4 .    ? 15.999  103.899 53.924  1.00 36.39 ? 2115 HOH A O   1 
HETATM 10098 O  O   . HOH D 4 .    ? 11.627  91.102  21.180  1.00 36.03 ? 2116 HOH A O   1 
HETATM 10099 O  O   . HOH D 4 .    ? 19.376  79.084  52.238  1.00 36.82 ? 2117 HOH A O   1 
HETATM 10100 O  O   . HOH D 4 .    ? -6.482  89.085  53.456  1.00 26.46 ? 2118 HOH A O   1 
HETATM 10101 O  O   . HOH D 4 .    ? -8.001  74.536  29.540  1.00 39.75 ? 2119 HOH A O   1 
HETATM 10102 O  O   . HOH D 4 .    ? -18.209 120.564 16.468  1.00 41.06 ? 2120 HOH A O   1 
HETATM 10103 O  O   . HOH D 4 .    ? 9.138   80.416  -14.232 1.00 45.83 ? 2121 HOH A O   1 
HETATM 10104 O  O   . HOH D 4 .    ? -31.144 104.248 10.811  1.00 31.05 ? 2122 HOH A O   1 
HETATM 10105 O  O   . HOH D 4 .    ? 9.961   70.351  60.350  1.00 27.74 ? 2123 HOH A O   1 
HETATM 10106 O  O   . HOH D 4 .    ? 15.946  92.082  19.089  1.00 35.98 ? 2124 HOH A O   1 
HETATM 10107 O  O   . HOH D 4 .    ? -38.784 84.426  5.779   1.00 25.98 ? 2125 HOH A O   1 
HETATM 10108 O  O   . HOH D 4 .    ? -27.041 94.366  6.770   1.00 30.50 ? 2126 HOH A O   1 
HETATM 10109 O  O   . HOH D 4 .    ? -25.156 97.662  21.973  1.00 27.17 ? 2127 HOH A O   1 
HETATM 10110 O  O   . HOH D 4 .    ? -19.484 69.732  36.363  1.00 36.58 ? 2128 HOH A O   1 
HETATM 10111 O  O   . HOH D 4 .    ? -5.136  97.006  5.954   1.00 45.43 ? 2129 HOH A O   1 
HETATM 10112 O  O   . HOH D 4 .    ? -2.812  67.753  11.310  1.00 31.35 ? 2130 HOH A O   1 
HETATM 10113 O  O   . HOH D 4 .    ? -29.997 95.136  15.197  1.00 32.23 ? 2131 HOH A O   1 
HETATM 10114 O  O   . HOH D 4 .    ? 14.512  80.600  20.492  1.00 34.91 ? 2132 HOH A O   1 
HETATM 10115 O  O   . HOH D 4 .    ? 19.910  103.282 25.852  1.00 46.55 ? 2133 HOH A O   1 
HETATM 10116 O  O   . HOH D 4 .    ? 3.577   117.027 19.094  1.00 35.91 ? 2134 HOH A O   1 
HETATM 10117 O  O   . HOH D 4 .    ? -17.809 72.652  14.807  1.00 38.23 ? 2135 HOH A O   1 
HETATM 10118 O  O   . HOH D 4 .    ? 13.516  96.173  64.846  1.00 25.42 ? 2136 HOH A O   1 
HETATM 10119 O  O   . HOH D 4 .    ? 16.824  82.848  65.932  1.00 34.95 ? 2137 HOH A O   1 
HETATM 10120 O  O   . HOH D 4 .    ? -18.901 95.380  57.672  1.00 28.28 ? 2138 HOH A O   1 
HETATM 10121 O  O   . HOH D 4 .    ? 15.360  89.678  -5.601  1.00 37.03 ? 2139 HOH A O   1 
HETATM 10122 O  O   . HOH D 4 .    ? -8.766  87.978  45.288  1.00 27.30 ? 2140 HOH A O   1 
HETATM 10123 O  O   . HOH D 4 .    ? -28.258 93.072  65.329  1.00 27.54 ? 2141 HOH A O   1 
HETATM 10124 O  O   . HOH D 4 .    ? -41.578 104.464 21.690  1.00 27.19 ? 2142 HOH A O   1 
HETATM 10125 O  O   . HOH D 4 .    ? -3.117  78.825  11.230  1.00 27.38 ? 2143 HOH A O   1 
HETATM 10126 O  O   . HOH D 4 .    ? -17.843 66.524  38.466  1.00 43.37 ? 2144 HOH A O   1 
HETATM 10127 O  O   . HOH D 4 .    ? 1.318   110.348 39.663  1.00 29.75 ? 2145 HOH A O   1 
HETATM 10128 O  O   . HOH D 4 .    ? 4.297   88.658  20.409  1.00 28.34 ? 2146 HOH A O   1 
HETATM 10129 O  O   . HOH D 4 .    ? 16.170  92.551  53.382  1.00 31.14 ? 2147 HOH A O   1 
HETATM 10130 O  O   . HOH D 4 .    ? 0.909   81.154  20.504  1.00 37.65 ? 2148 HOH A O   1 
HETATM 10131 O  O   . HOH D 4 .    ? 20.248  97.947  51.951  1.00 34.89 ? 2149 HOH A O   1 
HETATM 10132 O  O   . HOH D 4 .    ? 12.998  78.172  29.806  1.00 40.44 ? 2150 HOH A O   1 
HETATM 10133 O  O   . HOH D 4 .    ? -1.692  71.410  36.949  1.00 30.81 ? 2151 HOH A O   1 
HETATM 10134 O  O   . HOH D 4 .    ? -18.861 101.932 24.561  1.00 38.57 ? 2152 HOH A O   1 
HETATM 10135 O  O   . HOH D 4 .    ? 3.068   65.094  22.550  1.00 38.79 ? 2153 HOH A O   1 
HETATM 10136 O  O   . HOH D 4 .    ? 17.334  106.508 26.932  1.00 22.76 ? 2154 HOH A O   1 
HETATM 10137 O  O   . HOH D 4 .    ? 11.152  103.604 41.198  1.00 31.53 ? 2155 HOH A O   1 
HETATM 10138 O  O   . HOH D 4 .    ? -38.075 88.753  25.150  1.00 35.07 ? 2156 HOH A O   1 
HETATM 10139 O  O   . HOH D 4 .    ? -9.329  92.233  9.673   1.00 25.29 ? 2157 HOH A O   1 
HETATM 10140 O  O   . HOH D 4 .    ? 13.062  69.471  58.732  1.00 35.42 ? 2158 HOH A O   1 
HETATM 10141 O  O   . HOH D 4 .    ? -20.322 96.903  59.563  1.00 20.29 ? 2159 HOH A O   1 
HETATM 10142 O  O   . HOH D 4 .    ? 4.286   129.909 26.160  1.00 47.44 ? 2160 HOH A O   1 
HETATM 10143 O  O   . HOH D 4 .    ? -18.434 106.409 48.633  1.00 26.15 ? 2161 HOH A O   1 
HETATM 10144 O  O   . HOH D 4 .    ? 12.701  77.295  21.603  1.00 58.03 ? 2162 HOH A O   1 
HETATM 10145 O  O   . HOH D 4 .    ? -3.312  106.000 63.092  1.00 21.83 ? 2163 HOH A O   1 
HETATM 10146 O  O   . HOH D 4 .    ? 14.801  77.592  -2.151  1.00 26.50 ? 2164 HOH A O   1 
HETATM 10147 O  O   . HOH D 4 .    ? -1.396  102.327 4.216   1.00 43.56 ? 2165 HOH A O   1 
HETATM 10148 O  O   . HOH D 4 .    ? -26.835 88.095  25.105  1.00 26.67 ? 2166 HOH A O   1 
HETATM 10149 O  O   . HOH D 4 .    ? -5.671  82.020  65.279  1.00 31.94 ? 2167 HOH A O   1 
HETATM 10150 O  O   . HOH D 4 .    ? 8.598   70.631  31.810  1.00 44.65 ? 2168 HOH A O   1 
HETATM 10151 O  O   . HOH D 4 .    ? -37.363 97.946  52.732  1.00 37.94 ? 2169 HOH A O   1 
HETATM 10152 O  O   . HOH D 4 .    ? 11.536  127.204 25.473  1.00 38.44 ? 2170 HOH A O   1 
HETATM 10153 O  O   . HOH D 4 .    ? -9.291  102.406 70.702  1.00 30.37 ? 2171 HOH A O   1 
HETATM 10154 O  O   . HOH D 4 .    ? -1.032  104.748 58.491  1.00 28.19 ? 2172 HOH A O   1 
HETATM 10155 O  O   . HOH D 4 .    ? -20.407 114.125 49.101  1.00 32.01 ? 2173 HOH A O   1 
HETATM 10156 O  O   . HOH D 4 .    ? -37.853 106.895 38.706  1.00 35.76 ? 2174 HOH A O   1 
HETATM 10157 O  O   . HOH D 4 .    ? -9.903  84.656  83.111  1.00 37.42 ? 2175 HOH A O   1 
HETATM 10158 O  O   . HOH D 4 .    ? -31.977 76.515  53.544  1.00 51.68 ? 2176 HOH A O   1 
HETATM 10159 O  O   . HOH D 4 .    ? -38.024 93.336  40.536  1.00 39.85 ? 2177 HOH A O   1 
HETATM 10160 O  O   . HOH D 4 .    ? 14.521  78.784  67.084  1.00 28.78 ? 2178 HOH A O   1 
HETATM 10161 O  O   . HOH D 4 .    ? -11.425 123.315 33.084  1.00 38.10 ? 2179 HOH A O   1 
HETATM 10162 O  O   . HOH D 4 .    ? -43.189 110.296 26.287  1.00 38.03 ? 2180 HOH A O   1 
HETATM 10163 O  O   . HOH D 4 .    ? -1.107  113.517 49.480  1.00 25.71 ? 2181 HOH A O   1 
HETATM 10164 O  O   . HOH D 4 .    ? 16.045  102.158 47.615  1.00 38.72 ? 2182 HOH A O   1 
HETATM 10165 O  O   . HOH D 4 .    ? -5.441  80.193  19.529  1.00 35.54 ? 2183 HOH A O   1 
HETATM 10166 O  O   . HOH D 4 .    ? -2.012  116.451 22.272  1.00 27.89 ? 2184 HOH A O   1 
HETATM 10167 O  O   . HOH D 4 .    ? -24.548 79.554  31.222  1.00 46.58 ? 2185 HOH A O   1 
HETATM 10168 O  O   . HOH D 4 .    ? -5.622  86.357  -1.528  1.00 43.36 ? 2186 HOH A O   1 
HETATM 10169 O  O   . HOH D 4 .    ? -24.330 120.640 16.770  1.00 27.34 ? 2187 HOH A O   1 
HETATM 10170 O  O   . HOH D 4 .    ? 11.142  91.714  11.421  1.00 23.79 ? 2188 HOH A O   1 
HETATM 10171 O  O   . HOH D 4 .    ? -4.778  83.307  74.128  1.00 32.55 ? 2189 HOH A O   1 
HETATM 10172 O  O   . HOH D 4 .    ? -40.389 102.561 11.746  1.00 46.37 ? 2190 HOH A O   1 
HETATM 10173 O  O   . HOH D 4 .    ? -31.405 85.100  21.698  1.00 32.58 ? 2191 HOH A O   1 
HETATM 10174 O  O   . HOH D 4 .    ? -25.695 117.850 23.825  1.00 61.73 ? 2192 HOH A O   1 
HETATM 10175 O  O   . HOH D 4 .    ? -31.860 108.760 48.990  1.00 52.92 ? 2193 HOH A O   1 
HETATM 10176 O  O   . HOH D 4 .    ? 4.986   75.526  47.836  1.00 44.33 ? 2194 HOH A O   1 
HETATM 10177 O  O   . HOH D 4 .    ? 16.208  61.011  25.823  1.00 38.91 ? 2195 HOH A O   1 
HETATM 10178 O  O   . HOH D 4 .    ? -19.992 62.543  20.628  1.00 41.44 ? 2196 HOH A O   1 
HETATM 10179 O  O   . HOH D 4 .    ? 2.646   76.532  61.555  1.00 27.28 ? 2197 HOH A O   1 
HETATM 10180 O  O   . HOH D 4 .    ? 3.707   97.765  35.859  1.00 28.56 ? 2198 HOH A O   1 
HETATM 10181 O  O   . HOH D 4 .    ? -7.123  121.661 12.120  1.00 26.11 ? 2199 HOH A O   1 
HETATM 10182 O  O   . HOH D 4 .    ? -34.723 106.004 22.384  1.00 26.96 ? 2200 HOH A O   1 
HETATM 10183 O  O   . HOH D 4 .    ? -24.986 121.198 48.357  1.00 32.14 ? 2201 HOH A O   1 
HETATM 10184 O  O   . HOH D 4 .    ? 1.479   86.853  -7.362  1.00 44.64 ? 2202 HOH A O   1 
HETATM 10185 O  O   . HOH D 4 .    ? 19.959  102.697 10.083  1.00 37.78 ? 2203 HOH A O   1 
HETATM 10186 O  O   . HOH D 4 .    ? 18.805  97.956  43.755  1.00 50.20 ? 2204 HOH A O   1 
HETATM 10187 O  O   . HOH D 4 .    ? 8.892   100.448 51.145  1.00 33.62 ? 2205 HOH A O   1 
HETATM 10188 O  O   . HOH D 4 .    ? -35.170 107.839 15.392  1.00 34.80 ? 2206 HOH A O   1 
HETATM 10189 O  O   . HOH D 4 .    ? -23.244 85.302  30.182  1.00 51.76 ? 2207 HOH A O   1 
HETATM 10190 O  O   . HOH D 4 .    ? 10.060  61.694  2.536   1.00 35.07 ? 2208 HOH A O   1 
HETATM 10191 O  O   . HOH D 4 .    ? -35.442 105.118 15.416  1.00 34.64 ? 2209 HOH A O   1 
HETATM 10192 O  O   . HOH D 4 .    ? -18.897 80.942  71.735  1.00 32.67 ? 2210 HOH A O   1 
HETATM 10193 O  O   . HOH D 4 .    ? 0.457   84.136  18.639  1.00 40.27 ? 2211 HOH A O   1 
HETATM 10194 O  O   . HOH D 4 .    ? -3.477  99.170  72.866  1.00 46.59 ? 2212 HOH A O   1 
HETATM 10195 O  O   . HOH D 4 .    ? 1.634   124.808 19.762  1.00 29.06 ? 2213 HOH A O   1 
HETATM 10196 O  O   . HOH D 4 .    ? 4.380   72.448  43.922  1.00 33.91 ? 2214 HOH A O   1 
HETATM 10197 O  O   . HOH D 4 .    ? 11.035  65.259  15.485  1.00 29.73 ? 2215 HOH A O   1 
HETATM 10198 O  O   . HOH D 4 .    ? -23.883 79.776  62.654  1.00 47.66 ? 2216 HOH A O   1 
HETATM 10199 O  O   . HOH D 4 .    ? -13.554 87.229  45.042  1.00 35.95 ? 2217 HOH A O   1 
HETATM 10200 O  O   . HOH D 4 .    ? -42.114 113.411 32.985  1.00 44.12 ? 2218 HOH A O   1 
HETATM 10201 O  O   . HOH D 4 .    ? -29.614 108.758 13.714  1.00 31.44 ? 2219 HOH A O   1 
HETATM 10202 O  O   . HOH D 4 .    ? 10.269  95.688  16.419  1.00 33.42 ? 2220 HOH A O   1 
HETATM 10203 O  O   . HOH D 4 .    ? -6.551  103.134 71.044  1.00 52.20 ? 2221 HOH A O   1 
HETATM 10204 O  O   . HOH D 4 .    ? 6.846   64.551  21.748  1.00 33.68 ? 2222 HOH A O   1 
HETATM 10205 O  O   . HOH D 4 .    ? -21.104 79.825  40.223  1.00 40.08 ? 2223 HOH A O   1 
HETATM 10206 O  O   . HOH D 4 .    ? 11.537  99.539  38.822  1.00 23.08 ? 2224 HOH A O   1 
HETATM 10207 O  O   . HOH D 4 .    ? 22.863  102.663 31.009  1.00 63.04 ? 2225 HOH A O   1 
HETATM 10208 O  O   . HOH D 4 .    ? -46.455 87.412  11.304  1.00 51.98 ? 2226 HOH A O   1 
HETATM 10209 O  O   . HOH D 4 .    ? 21.667  79.479  53.795  1.00 33.63 ? 2227 HOH A O   1 
HETATM 10210 O  O   . HOH D 4 .    ? -15.078 98.178  36.607  1.00 28.50 ? 2228 HOH A O   1 
HETATM 10211 O  O   . HOH D 4 .    ? 4.692   83.087  36.837  1.00 38.05 ? 2229 HOH A O   1 
HETATM 10212 O  O   . HOH D 4 .    ? -21.454 121.186 31.925  1.00 44.36 ? 2230 HOH A O   1 
HETATM 10213 O  O   . HOH D 4 .    ? 2.792   89.835  29.790  1.00 38.58 ? 2231 HOH A O   1 
HETATM 10214 O  O   . HOH D 4 .    ? 6.615   61.872  47.155  1.00 47.89 ? 2232 HOH A O   1 
HETATM 10215 O  O   . HOH D 4 .    ? -21.965 84.298  65.300  1.00 44.35 ? 2233 HOH A O   1 
HETATM 10216 O  O   . HOH D 4 .    ? -0.307  87.894  29.038  1.00 57.00 ? 2234 HOH A O   1 
HETATM 10217 O  O   . HOH D 4 .    ? -20.196 108.067 21.914  1.00 30.68 ? 2235 HOH A O   1 
HETATM 10218 O  O   . HOH D 4 .    ? 18.431  67.900  13.038  1.00 36.47 ? 2236 HOH A O   1 
HETATM 10219 O  O   . HOH D 4 .    ? -22.765 114.745 42.891  1.00 40.34 ? 2237 HOH A O   1 
HETATM 10220 O  O   . HOH D 4 .    ? 20.497  62.607  28.628  1.00 39.83 ? 2238 HOH A O   1 
HETATM 10221 O  O   . HOH D 4 .    ? -1.428  76.712  55.358  1.00 36.41 ? 2239 HOH A O   1 
HETATM 10222 O  O   . HOH D 4 .    ? -7.957  77.590  22.907  1.00 43.81 ? 2240 HOH A O   1 
HETATM 10223 O  O   . HOH D 4 .    ? -4.311  93.954  47.004  1.00 36.66 ? 2241 HOH A O   1 
HETATM 10224 O  O   . HOH D 4 .    ? -38.045 83.976  50.688  1.00 56.80 ? 2242 HOH A O   1 
HETATM 10225 O  O   . HOH D 4 .    ? -2.152  91.877  1.670   1.00 33.13 ? 2243 HOH A O   1 
HETATM 10226 O  O   . HOH D 4 .    ? 8.893   74.506  -14.152 1.00 66.33 ? 2244 HOH A O   1 
HETATM 10227 O  O   . HOH D 4 .    ? -5.641  101.200 33.998  1.00 65.88 ? 2245 HOH A O   1 
HETATM 10228 O  O   . HOH D 4 .    ? -9.693  81.661  46.738  1.00 45.20 ? 2246 HOH A O   1 
HETATM 10229 O  O   . HOH D 4 .    ? -22.732 94.247  8.371   1.00 30.38 ? 2247 HOH A O   1 
HETATM 10230 O  O   . HOH D 4 .    ? -6.769  89.288  15.358  1.00 44.65 ? 2248 HOH A O   1 
HETATM 10231 O  O   . HOH D 4 .    ? 1.342   60.662  38.557  1.00 48.41 ? 2249 HOH A O   1 
HETATM 10232 O  O   . HOH D 4 .    ? -3.659  61.278  53.306  1.00 38.87 ? 2250 HOH A O   1 
HETATM 10233 O  O   . HOH D 4 .    ? -13.955 95.857  25.786  1.00 28.83 ? 2251 HOH A O   1 
HETATM 10234 O  O   . HOH D 4 .    ? -40.289 84.667  24.799  1.00 46.77 ? 2252 HOH A O   1 
HETATM 10235 O  O   . HOH D 4 .    ? 6.019   126.224 21.042  1.00 41.19 ? 2253 HOH A O   1 
HETATM 10236 O  O   . HOH D 4 .    ? -33.855 106.755 10.966  1.00 42.19 ? 2254 HOH A O   1 
HETATM 10237 O  O   . HOH D 4 .    ? -44.753 95.314  10.236  1.00 40.30 ? 2255 HOH A O   1 
HETATM 10238 O  O   . HOH D 4 .    ? -38.066 113.139 30.913  1.00 39.88 ? 2256 HOH A O   1 
HETATM 10239 O  O   . HOH D 4 .    ? 4.014   79.915  -2.549  1.00 24.89 ? 2257 HOH A O   1 
HETATM 10240 O  O   . HOH D 4 .    ? -16.080 70.795  8.408   1.00 43.89 ? 2258 HOH A O   1 
HETATM 10241 O  O   . HOH D 4 .    ? 23.651  78.400  40.298  1.00 37.79 ? 2259 HOH A O   1 
HETATM 10242 O  O   . HOH D 4 .    ? -22.782 87.194  1.360   1.00 38.42 ? 2260 HOH A O   1 
HETATM 10243 O  O   . HOH D 4 .    ? 2.962   61.395  47.870  1.00 52.88 ? 2261 HOH A O   1 
HETATM 10244 O  O   . HOH D 4 .    ? 19.015  80.165  17.253  1.00 34.08 ? 2262 HOH A O   1 
HETATM 10245 O  O   . HOH D 4 .    ? -7.671  120.685 59.050  1.00 28.05 ? 2263 HOH A O   1 
HETATM 10246 O  O   . HOH D 4 .    ? -5.128  89.937  80.487  1.00 47.94 ? 2264 HOH A O   1 
HETATM 10247 O  O   . HOH D 4 .    ? -4.025  65.533  10.050  1.00 38.48 ? 2265 HOH A O   1 
HETATM 10248 O  O   . HOH D 4 .    ? 4.698   97.826  9.953   1.00 34.14 ? 2266 HOH A O   1 
HETATM 10249 O  O   . HOH D 4 .    ? -8.409  81.427  72.339  1.00 49.46 ? 2267 HOH A O   1 
HETATM 10250 O  O   . HOH D 4 .    ? 17.276  94.831  22.408  1.00 37.94 ? 2268 HOH A O   1 
HETATM 10251 O  O   . HOH D 4 .    ? -13.299 84.359  76.821  1.00 43.09 ? 2269 HOH A O   1 
HETATM 10252 O  O   . HOH D 4 .    ? 8.277   110.291 50.586  1.00 40.44 ? 2270 HOH A O   1 
HETATM 10253 O  O   . HOH D 4 .    ? 14.231  106.327 41.966  1.00 48.45 ? 2271 HOH A O   1 
HETATM 10254 O  O   . HOH D 4 .    ? -15.442 73.813  56.282  1.00 38.02 ? 2272 HOH A O   1 
HETATM 10255 O  O   . HOH D 4 .    ? -20.017 85.937  26.441  1.00 32.72 ? 2273 HOH A O   1 
HETATM 10256 O  O   . HOH D 4 .    ? -22.176 60.795  27.614  1.00 45.94 ? 2274 HOH A O   1 
HETATM 10257 O  O   . HOH D 4 .    ? 19.288  111.119 20.582  1.00 48.05 ? 2275 HOH A O   1 
HETATM 10258 O  O   . HOH D 4 .    ? 3.592   74.324  60.180  1.00 43.92 ? 2276 HOH A O   1 
HETATM 10259 O  O   . HOH D 4 .    ? -17.141 91.495  63.519  1.00 30.10 ? 2277 HOH A O   1 
HETATM 10260 O  O   . HOH D 4 .    ? 11.720  72.749  26.839  1.00 51.20 ? 2278 HOH A O   1 
HETATM 10261 O  O   . HOH D 4 .    ? 20.544  85.325  52.522  1.00 44.92 ? 2279 HOH A O   1 
HETATM 10262 O  O   . HOH D 4 .    ? -45.164 90.965  14.185  1.00 50.24 ? 2280 HOH A O   1 
HETATM 10263 O  O   . HOH D 4 .    ? 3.560   117.991 45.184  1.00 44.95 ? 2281 HOH A O   1 
HETATM 10264 O  O   . HOH D 4 .    ? -23.018 121.567 25.660  1.00 40.31 ? 2282 HOH A O   1 
HETATM 10265 O  O   . HOH D 4 .    ? -39.192 115.964 38.105  1.00 40.87 ? 2283 HOH A O   1 
HETATM 10266 O  O   . HOH D 4 .    ? -4.011  95.824  35.799  1.00 46.13 ? 2284 HOH A O   1 
HETATM 10267 O  O   . HOH D 4 .    ? 24.006  93.694  65.760  1.00 45.01 ? 2285 HOH A O   1 
HETATM 10268 O  O   . HOH D 4 .    ? -31.524 87.415  23.260  1.00 29.18 ? 2286 HOH A O   1 
HETATM 10269 O  O   . HOH D 4 .    ? -14.296 114.898 11.323  1.00 33.12 ? 2287 HOH A O   1 
HETATM 10270 O  O   . HOH D 4 .    ? 19.723  96.979  38.091  1.00 49.74 ? 2288 HOH A O   1 
HETATM 10271 O  O   . HOH D 4 .    ? -20.090 125.200 23.334  1.00 37.10 ? 2289 HOH A O   1 
HETATM 10272 O  O   . HOH D 4 .    ? -14.189 109.958 57.217  1.00 31.86 ? 2290 HOH A O   1 
HETATM 10273 O  O   . HOH D 4 .    ? -39.799 113.277 43.883  1.00 38.52 ? 2291 HOH A O   1 
HETATM 10274 O  O   . HOH D 4 .    ? -1.374  88.675  37.248  1.00 56.07 ? 2292 HOH A O   1 
HETATM 10275 O  O   . HOH D 4 .    ? -11.587 120.142 35.396  1.00 27.30 ? 2293 HOH A O   1 
HETATM 10276 O  O   . HOH D 4 .    ? 4.192   102.089 55.466  1.00 34.94 ? 2294 HOH A O   1 
HETATM 10277 O  O   . HOH D 4 .    ? 4.138   83.739  21.467  1.00 44.43 ? 2295 HOH A O   1 
HETATM 10278 O  O   . HOH D 4 .    ? 13.579  87.329  73.331  1.00 48.76 ? 2296 HOH A O   1 
HETATM 10279 O  O   . HOH D 4 .    ? -12.686 120.253 53.797  1.00 38.81 ? 2297 HOH A O   1 
HETATM 10280 O  O   . HOH D 4 .    ? -11.155 112.219 52.159  1.00 37.47 ? 2298 HOH A O   1 
HETATM 10281 O  O   . HOH D 4 .    ? -30.452 105.938 3.631   1.00 46.80 ? 2299 HOH A O   1 
HETATM 10282 O  O   . HOH D 4 .    ? -9.896  83.531  18.163  1.00 46.59 ? 2300 HOH A O   1 
HETATM 10283 O  O   . HOH D 4 .    ? 17.194  80.108  66.244  1.00 32.38 ? 2301 HOH A O   1 
HETATM 10284 O  O   . HOH D 4 .    ? -1.867  102.793 39.000  1.00 30.15 ? 2302 HOH A O   1 
HETATM 10285 O  O   . HOH D 4 .    ? -10.130 86.694  12.439  1.00 45.10 ? 2303 HOH A O   1 
HETATM 10286 O  O   . HOH D 4 .    ? -13.156 71.910  12.257  1.00 30.97 ? 2304 HOH A O   1 
HETATM 10287 O  O   . HOH D 4 .    ? -25.038 121.063 20.081  1.00 38.77 ? 2305 HOH A O   1 
HETATM 10288 O  O   . HOH D 4 .    ? 18.893  109.660 -4.769  1.00 40.30 ? 2306 HOH A O   1 
HETATM 10289 O  O   . HOH D 4 .    ? 15.160  67.769  27.680  1.00 60.51 ? 2307 HOH A O   1 
HETATM 10290 O  O   . HOH D 4 .    ? -11.922 74.915  12.105  1.00 44.31 ? 2308 HOH A O   1 
HETATM 10291 O  O   . HOH D 4 .    ? -22.377 87.408  62.892  1.00 44.20 ? 2309 HOH A O   1 
HETATM 10292 O  O   . HOH D 4 .    ? -4.766  123.550 23.257  1.00 48.33 ? 2310 HOH A O   1 
HETATM 10293 O  O   . HOH D 4 .    ? 4.986   111.633 22.435  1.00 37.80 ? 2311 HOH A O   1 
HETATM 10294 O  O   . HOH D 4 .    ? 0.053   56.635  26.931  1.00 45.18 ? 2312 HOH A O   1 
HETATM 10295 O  O   . HOH D 4 .    ? 14.900  121.592 27.466  1.00 56.34 ? 2313 HOH A O   1 
HETATM 10296 O  O   . HOH D 4 .    ? -10.356 126.110 18.445  1.00 51.47 ? 2314 HOH A O   1 
HETATM 10297 O  O   . HOH D 4 .    ? -44.307 102.361 43.291  1.00 49.57 ? 2315 HOH A O   1 
HETATM 10298 O  O   . HOH D 4 .    ? -5.693  93.537  -4.638  1.00 44.86 ? 2316 HOH A O   1 
HETATM 10299 O  O   . HOH D 4 .    ? 13.621  89.432  69.711  1.00 38.52 ? 2317 HOH A O   1 
HETATM 10300 O  O   . HOH D 4 .    ? -23.270 82.340  2.220   1.00 39.50 ? 2318 HOH A O   1 
HETATM 10301 O  O   . HOH D 4 .    ? -13.339 81.710  42.059  1.00 40.21 ? 2319 HOH A O   1 
HETATM 10302 O  O   . HOH D 4 .    ? 13.684  114.452 40.941  1.00 38.34 ? 2320 HOH A O   1 
HETATM 10303 O  O   . HOH D 4 .    ? 1.323   78.158  -4.921  1.00 30.32 ? 2321 HOH A O   1 
HETATM 10304 O  O   . HOH D 4 .    ? 2.637   66.518  1.249   1.00 39.74 ? 2322 HOH A O   1 
HETATM 10305 O  O   . HOH D 4 .    ? -1.467  99.548  38.268  1.00 42.47 ? 2323 HOH A O   1 
HETATM 10306 O  O   . HOH D 4 .    ? 6.309   114.008 23.695  1.00 30.71 ? 2324 HOH A O   1 
HETATM 10307 O  O   . HOH D 4 .    ? -48.873 88.594  17.159  1.00 37.94 ? 2325 HOH A O   1 
HETATM 10308 O  O   . HOH D 4 .    ? -29.528 87.478  38.693  1.00 44.88 ? 2326 HOH A O   1 
HETATM 10309 O  O   . HOH D 4 .    ? -31.251 103.308 61.850  1.00 49.21 ? 2327 HOH A O   1 
HETATM 10310 O  O   . HOH D 4 .    ? -15.654 55.632  22.379  1.00 48.77 ? 2328 HOH A O   1 
HETATM 10311 O  O   . HOH D 4 .    ? -1.677  102.155 59.487  1.00 36.98 ? 2329 HOH A O   1 
HETATM 10312 O  O   . HOH D 4 .    ? -18.313 110.430 23.234  1.00 27.67 ? 2330 HOH A O   1 
HETATM 10313 O  O   . HOH D 4 .    ? -31.617 79.205  13.211  1.00 50.35 ? 2331 HOH A O   1 
HETATM 10314 O  O   . HOH D 4 .    ? 15.189  91.354  48.056  1.00 34.08 ? 2332 HOH A O   1 
HETATM 10315 O  O   . HOH D 4 .    ? -18.481 127.947 28.470  1.00 42.88 ? 2333 HOH A O   1 
HETATM 10316 O  O   . HOH D 4 .    ? 2.144   63.150  40.376  1.00 44.41 ? 2334 HOH A O   1 
HETATM 10317 O  O   . HOH D 4 .    ? -24.243 119.085 38.788  1.00 46.05 ? 2335 HOH A O   1 
HETATM 10318 O  O   . HOH D 4 .    ? 17.524  78.632  34.775  1.00 42.64 ? 2336 HOH A O   1 
HETATM 10319 O  O   . HOH D 4 .    ? -4.480  99.567  0.375   1.00 43.78 ? 2337 HOH A O   1 
HETATM 10320 O  O   . HOH D 4 .    ? 2.152   88.948  65.588  1.00 36.21 ? 2338 HOH A O   1 
HETATM 10321 O  O   . HOH D 4 .    ? -20.226 69.102  24.444  1.00 33.81 ? 2339 HOH A O   1 
HETATM 10322 O  O   . HOH D 4 .    ? -36.240 102.515 1.825   1.00 47.77 ? 2340 HOH A O   1 
HETATM 10323 O  O   . HOH D 4 .    ? 11.109  79.430  17.915  1.00 35.79 ? 2341 HOH A O   1 
HETATM 10324 O  O   . HOH D 4 .    ? 0.716   59.482  6.634   1.00 44.03 ? 2342 HOH A O   1 
HETATM 10325 O  O   . HOH D 4 .    ? -42.938 84.847  4.782   1.00 45.73 ? 2343 HOH A O   1 
HETATM 10326 O  O   . HOH D 4 .    ? -44.141 107.128 23.483  1.00 33.29 ? 2344 HOH A O   1 
HETATM 10327 O  O   . HOH D 4 .    ? 16.678  74.467  55.582  1.00 43.93 ? 2345 HOH A O   1 
HETATM 10328 O  O   . HOH D 4 .    ? 5.313   118.126 22.840  1.00 48.21 ? 2346 HOH A O   1 
HETATM 10329 O  O   . HOH D 4 .    ? -12.581 111.241 50.089  1.00 29.64 ? 2347 HOH A O   1 
HETATM 10330 O  O   . HOH D 4 .    ? -5.185  109.042 64.823  1.00 40.24 ? 2348 HOH A O   1 
HETATM 10331 O  O   . HOH D 4 .    ? -3.995  105.065 17.990  1.00 45.85 ? 2349 HOH A O   1 
HETATM 10332 O  O   . HOH D 4 .    ? -41.705 83.106  33.678  1.00 52.99 ? 2350 HOH A O   1 
HETATM 10333 O  O   . HOH D 4 .    ? -22.273 86.316  36.248  1.00 48.86 ? 2351 HOH A O   1 
HETATM 10334 O  O   . HOH D 4 .    ? -8.136  91.977  12.144  1.00 40.30 ? 2352 HOH A O   1 
HETATM 10335 O  O   . HOH D 4 .    ? -0.047  74.986  31.856  1.00 34.78 ? 2353 HOH A O   1 
HETATM 10336 O  O   . HOH D 4 .    ? 14.358  98.070  -4.480  1.00 46.76 ? 2354 HOH A O   1 
HETATM 10337 O  O   . HOH D 4 .    ? -33.188 80.413  5.869   1.00 48.05 ? 2355 HOH A O   1 
HETATM 10338 O  O   . HOH D 4 .    ? -20.158 123.345 29.947  1.00 41.28 ? 2356 HOH A O   1 
HETATM 10339 O  O   . HOH D 4 .    ? -49.172 97.002  33.583  1.00 55.28 ? 2357 HOH A O   1 
HETATM 10340 O  O   . HOH D 4 .    ? 16.338  109.930 17.212  1.00 46.49 ? 2358 HOH A O   1 
HETATM 10341 O  O   . HOH D 4 .    ? 12.354  102.989 43.813  1.00 41.52 ? 2359 HOH A O   1 
HETATM 10342 O  O   . HOH D 4 .    ? 6.596   101.975 -6.148  1.00 42.69 ? 2360 HOH A O   1 
HETATM 10343 O  O   . HOH D 4 .    ? 6.930   85.441  45.141  1.00 40.52 ? 2361 HOH A O   1 
HETATM 10344 O  O   . HOH D 4 .    ? -7.948  67.927  -1.278  1.00 40.96 ? 2362 HOH A O   1 
HETATM 10345 O  O   . HOH D 4 .    ? -18.475 57.508  7.418   1.00 59.53 ? 2363 HOH A O   1 
HETATM 10346 O  O   . HOH D 4 .    ? -8.129  84.891  21.264  1.00 48.45 ? 2364 HOH A O   1 
HETATM 10347 O  O   . HOH D 4 .    ? 4.608   110.753 0.576   1.00 46.67 ? 2365 HOH A O   1 
HETATM 10348 O  O   . HOH D 4 .    ? -11.883 126.913 14.754  1.00 43.84 ? 2366 HOH A O   1 
HETATM 10349 O  O   . HOH D 4 .    ? -14.623 97.625  4.539   1.00 31.86 ? 2367 HOH A O   1 
HETATM 10350 O  O   . HOH D 4 .    ? -11.643 109.134 48.656  1.00 28.91 ? 2368 HOH A O   1 
HETATM 10351 O  O   . HOH D 4 .    ? -20.684 86.019  29.479  1.00 36.30 ? 2369 HOH A O   1 
HETATM 10352 O  O   . HOH D 4 .    ? 15.481  98.214  11.347  1.00 44.68 ? 2370 HOH A O   1 
HETATM 10353 O  O   . HOH D 4 .    ? -16.265 102.907 66.188  1.00 46.91 ? 2371 HOH A O   1 
HETATM 10354 O  O   . HOH D 4 .    ? -43.909 105.901 17.537  1.00 40.96 ? 2372 HOH A O   1 
HETATM 10355 O  O   . HOH D 4 .    ? -31.124 85.989  47.167  1.00 54.05 ? 2373 HOH A O   1 
HETATM 10356 O  O   . HOH D 4 .    ? 19.384  119.679 6.212   1.00 47.24 ? 2374 HOH A O   1 
HETATM 10357 O  O   . HOH D 4 .    ? 10.874  90.880  -11.311 1.00 33.41 ? 2375 HOH A O   1 
HETATM 10358 O  O   . HOH D 4 .    ? -18.531 124.023 13.850  1.00 41.93 ? 2376 HOH A O   1 
HETATM 10359 O  O   . HOH D 4 .    ? -27.624 90.128  61.241  1.00 39.25 ? 2377 HOH A O   1 
HETATM 10360 O  O   . HOH D 4 .    ? 20.125  97.402  13.593  1.00 36.08 ? 2378 HOH A O   1 
HETATM 10361 O  O   . HOH D 4 .    ? -4.952  129.624 31.330  1.00 37.73 ? 2379 HOH A O   1 
HETATM 10362 O  O   . HOH D 4 .    ? 7.884   123.929 5.193   1.00 42.48 ? 2380 HOH A O   1 
HETATM 10363 O  O   . HOH D 4 .    ? 2.705   76.929  33.471  1.00 41.00 ? 2381 HOH A O   1 
HETATM 10364 O  O   . HOH D 4 .    ? 0.325   102.058 19.093  1.00 37.49 ? 2382 HOH A O   1 
HETATM 10365 O  O   . HOH D 4 .    ? 15.215  85.482  -2.374  1.00 36.67 ? 2383 HOH A O   1 
HETATM 10366 O  O   . HOH D 4 .    ? -10.615 117.915 36.361  1.00 22.77 ? 2384 HOH A O   1 
HETATM 10367 O  O   . HOH D 4 .    ? -12.756 109.724 59.827  1.00 24.92 ? 2385 HOH A O   1 
HETATM 10368 O  O   . HOH D 4 .    ? -28.987 96.496  30.102  1.00 41.11 ? 2386 HOH A O   1 
HETATM 10369 O  O   . HOH D 4 .    ? -19.446 71.924  36.089  1.00 37.79 ? 2387 HOH A O   1 
HETATM 10370 O  O   . HOH D 4 .    ? 7.017   112.707 51.388  1.00 29.72 ? 2388 HOH A O   1 
HETATM 10371 O  O   . HOH D 4 .    ? -19.690 108.891 24.794  1.00 27.23 ? 2389 HOH A O   1 
HETATM 10372 O  O   . HOH D 4 .    ? -0.012  103.574 36.930  1.00 33.04 ? 2390 HOH A O   1 
HETATM 10373 O  O   . HOH D 4 .    ? -4.731  78.108  21.345  1.00 33.52 ? 2391 HOH A O   1 
HETATM 10374 O  O   . HOH D 4 .    ? 9.861   67.926  61.441  1.00 31.51 ? 2392 HOH A O   1 
HETATM 10375 O  O   . HOH D 4 .    ? -14.946 53.002  35.139  1.00 36.06 ? 2393 HOH A O   1 
HETATM 10376 O  O   . HOH D 4 .    ? -3.501  119.178 42.367  1.00 31.31 ? 2394 HOH A O   1 
HETATM 10377 O  O   . HOH D 4 .    ? -3.177  84.165  78.579  1.00 75.30 ? 2395 HOH A O   1 
HETATM 10378 O  O   . HOH D 4 .    ? 0.595   115.143 50.091  1.00 48.15 ? 2396 HOH A O   1 
HETATM 10379 O  O   . HOH D 4 .    ? -29.530 87.436  25.254  1.00 31.64 ? 2397 HOH A O   1 
HETATM 10380 O  O   . HOH D 4 .    ? -1.006  84.907  50.678  1.00 39.62 ? 2398 HOH A O   1 
HETATM 10381 O  O   . HOH D 4 .    ? 13.483  105.214 40.268  1.00 50.39 ? 2399 HOH A O   1 
HETATM 10382 O  O   . HOH D 4 .    ? 17.631  75.487  4.294   1.00 37.15 ? 2400 HOH A O   1 
HETATM 10383 O  O   . HOH D 4 .    ? 9.326   99.922  53.569  1.00 36.88 ? 2401 HOH A O   1 
HETATM 10384 O  O   . HOH D 4 .    ? 5.363   86.439  42.814  1.00 32.79 ? 2402 HOH A O   1 
HETATM 10385 O  O   . HOH D 4 .    ? -19.783 78.020  64.159  1.00 67.28 ? 2403 HOH A O   1 
HETATM 10386 O  O   . HOH D 4 .    ? -14.323 100.210 16.102  1.00 35.46 ? 2404 HOH A O   1 
HETATM 10387 O  O   . HOH D 4 .    ? -13.110 95.977  28.528  1.00 31.71 ? 2405 HOH A O   1 
HETATM 10388 O  O   . HOH D 4 .    ? -40.243 94.408  40.119  1.00 44.26 ? 2406 HOH A O   1 
HETATM 10389 O  O   . HOH D 4 .    ? -17.237 103.509 32.736  1.00 29.79 ? 2407 HOH A O   1 
HETATM 10390 O  O   . HOH D 4 .    ? -15.365 111.723 47.979  1.00 75.63 ? 2408 HOH A O   1 
HETATM 10391 O  O   . HOH D 4 .    ? 15.245  87.732  71.843  1.00 37.77 ? 2409 HOH A O   1 
HETATM 10392 O  O   . HOH D 4 .    ? 2.372   80.186  -4.613  1.00 41.15 ? 2410 HOH A O   1 
HETATM 10393 O  O   . HOH D 4 .    ? -47.439 106.752 28.869  1.00 40.98 ? 2411 HOH A O   1 
HETATM 10394 O  O   . HOH D 4 .    ? -22.052 84.731  2.844   1.00 41.45 ? 2412 HOH A O   1 
HETATM 10395 O  O   . HOH D 4 .    ? -17.420 64.483  40.607  1.00 43.76 ? 2413 HOH A O   1 
HETATM 10396 O  O   . HOH D 4 .    ? 13.908  66.915  10.579  1.00 59.34 ? 2414 HOH A O   1 
HETATM 10397 O  O   . HOH D 4 .    ? -21.664 101.746 62.836  1.00 41.12 ? 2415 HOH A O   1 
HETATM 10398 O  O   . HOH D 4 .    ? -2.795  126.226 33.412  1.00 35.05 ? 2416 HOH A O   1 
HETATM 10399 O  O   . HOH D 4 .    ? -14.027 125.684 21.962  1.00 43.66 ? 2417 HOH A O   1 
HETATM 10400 O  O   . HOH D 4 .    ? -8.989  121.359 36.187  1.00 32.18 ? 2418 HOH A O   1 
HETATM 10401 O  O   . HOH D 4 .    ? -29.228 117.064 26.472  1.00 31.15 ? 2419 HOH A O   1 
HETATM 10402 O  O   . HOH D 4 .    ? -37.586 98.074  50.274  1.00 44.92 ? 2420 HOH A O   1 
HETATM 10403 O  O   . HOH D 4 .    ? -15.260 95.592  35.707  1.00 37.46 ? 2421 HOH A O   1 
HETATM 10404 O  O   . HOH D 4 .    ? 2.784   120.049 43.414  1.00 39.73 ? 2422 HOH A O   1 
HETATM 10405 O  O   . HOH D 4 .    ? -1.814  98.248  20.807  1.00 50.06 ? 2423 HOH A O   1 
HETATM 10406 O  O   . HOH D 4 .    ? 7.698   65.168  -0.482  1.00 76.82 ? 2424 HOH A O   1 
HETATM 10407 O  O   . HOH D 4 .    ? 13.558  92.046  10.879  1.00 27.33 ? 2425 HOH A O   1 
HETATM 10408 O  O   . HOH D 4 .    ? 3.050   103.415 58.664  1.00 33.57 ? 2426 HOH A O   1 
HETATM 10409 O  O   . HOH D 4 .    ? 14.964  76.922  22.622  1.00 52.29 ? 2427 HOH A O   1 
HETATM 10410 O  O   . HOH D 4 .    ? -36.646 114.851 21.483  1.00 45.12 ? 2428 HOH A O   1 
HETATM 10411 O  O   . HOH D 4 .    ? 0.564   85.204  48.283  1.00 34.19 ? 2429 HOH A O   1 
HETATM 10412 O  O   . HOH D 4 .    ? 20.046  89.432  57.964  1.00 34.20 ? 2430 HOH A O   1 
HETATM 10413 O  O   . HOH D 4 .    ? -8.010  110.075 60.261  1.00 43.97 ? 2431 HOH A O   1 
HETATM 10414 O  O   . HOH D 4 .    ? 19.664  87.047  51.348  1.00 40.80 ? 2432 HOH A O   1 
HETATM 10415 O  O   . HOH D 4 .    ? -3.977  101.007 19.037  1.00 58.32 ? 2433 HOH A O   1 
HETATM 10416 O  O   . HOH D 4 .    ? -33.419 74.637  52.560  1.00 81.84 ? 2434 HOH A O   1 
HETATM 10417 O  O   . HOH D 4 .    ? -30.374 90.539  60.664  1.00 75.75 ? 2435 HOH A O   1 
HETATM 10418 O  O   . HOH D 4 .    ? -6.264  99.415  1.747   1.00 56.31 ? 2436 HOH A O   1 
HETATM 10419 O  O   . HOH D 4 .    ? -3.245  107.939 9.240   1.00 34.10 ? 2437 HOH A O   1 
HETATM 10420 O  O   . HOH D 4 .    ? -22.599 85.154  62.844  1.00 56.52 ? 2438 HOH A O   1 
HETATM 10421 O  O   . HOH D 4 .    ? -8.481  102.188 55.753  1.00 36.07 ? 2439 HOH A O   1 
HETATM 10422 O  O   . HOH D 4 .    ? 19.062  105.556 25.793  1.00 40.48 ? 2440 HOH A O   1 
HETATM 10423 O  O   . HOH D 4 .    ? 0.043   104.421 43.753  1.00 38.20 ? 2441 HOH A O   1 
HETATM 10424 O  O   . HOH D 4 .    ? 7.345   117.088 21.854  1.00 68.96 ? 2442 HOH A O   1 
HETATM 10425 O  O   . HOH D 4 .    ? 15.679  115.887 14.865  1.00 58.67 ? 2443 HOH A O   1 
HETATM 10426 O  O   . HOH D 4 .    ? -22.443 85.340  34.460  1.00 42.39 ? 2444 HOH A O   1 
HETATM 10427 O  O   . HOH D 4 .    ? 1.819   81.887  52.092  1.00 50.83 ? 2445 HOH A O   1 
HETATM 10428 O  O   . HOH D 4 .    ? 1.747   121.016 40.646  1.00 33.53 ? 2446 HOH A O   1 
HETATM 10429 O  O   . HOH D 4 .    ? -15.789 66.003  39.778  1.00 39.79 ? 2447 HOH A O   1 
HETATM 10430 O  O   . HOH D 4 .    ? 18.247  61.554  40.062  1.00 46.99 ? 2448 HOH A O   1 
HETATM 10431 O  O   . HOH D 4 .    ? -22.662 88.350  36.267  1.00 45.64 ? 2449 HOH A O   1 
HETATM 10432 O  O   . HOH D 4 .    ? -37.431 85.356  43.297  1.00 67.69 ? 2450 HOH A O   1 
HETATM 10433 O  O   . HOH D 4 .    ? -41.897 111.350 24.169  1.00 45.91 ? 2451 HOH A O   1 
HETATM 10434 O  O   . HOH D 4 .    ? -7.423  118.793 39.817  1.00 33.21 ? 2452 HOH A O   1 
HETATM 10435 O  O   . HOH D 4 .    ? -4.218  67.758  -3.006  1.00 40.75 ? 2453 HOH A O   1 
HETATM 10436 O  O   . HOH D 4 .    ? 5.295   69.142  47.338  1.00 68.17 ? 2454 HOH A O   1 
HETATM 10437 O  O   . HOH D 4 .    ? -42.318 107.462 16.235  1.00 46.22 ? 2455 HOH A O   1 
HETATM 10438 O  O   . HOH D 4 .    ? -11.358 112.377 47.758  1.00 32.93 ? 2456 HOH A O   1 
HETATM 10439 O  O   . HOH D 4 .    ? -19.943 80.792  66.680  1.00 46.68 ? 2457 HOH A O   1 
HETATM 10440 O  O   . HOH D 4 .    ? 2.568   93.690  65.521  1.00 51.72 ? 2458 HOH A O   1 
HETATM 10441 O  O   . HOH D 4 .    ? 3.947   91.053  68.939  1.00 56.14 ? 2459 HOH A O   1 
HETATM 10442 O  O   . HOH D 4 .    ? -18.644 73.147  17.528  1.00 43.33 ? 2460 HOH A O   1 
HETATM 10443 O  O   . HOH D 4 .    ? 11.578  66.839  -9.491  1.00 67.53 ? 2461 HOH A O   1 
HETATM 10444 O  O   . HOH D 4 .    ? -5.439  90.929  43.022  1.00 34.40 ? 2462 HOH A O   1 
HETATM 10445 O  O   . HOH D 4 .    ? -35.541 71.724  53.298  1.00 68.71 ? 2463 HOH A O   1 
HETATM 10446 O  O   . HOH D 4 .    ? -4.846  79.324  67.462  1.00 34.50 ? 2464 HOH A O   1 
HETATM 10447 O  O   . HOH D 4 .    ? 4.482   100.039 35.630  1.00 37.91 ? 2465 HOH A O   1 
HETATM 10448 O  O   . HOH D 4 .    ? -7.985  119.479 11.512  1.00 50.83 ? 2466 HOH A O   1 
HETATM 10449 O  O   . HOH D 4 .    ? 15.001  65.960  23.512  1.00 62.17 ? 2467 HOH A O   1 
HETATM 10450 O  O   . HOH D 4 .    ? 2.694   89.941  63.633  1.00 66.67 ? 2468 HOH A O   1 
HETATM 10451 O  O   . HOH D 4 .    ? 20.292  96.617  20.687  1.00 44.33 ? 2469 HOH A O   1 
HETATM 10452 O  O   . HOH D 4 .    ? -16.827 110.401 57.630  1.00 41.22 ? 2470 HOH A O   1 
HETATM 10453 O  O   . HOH D 4 .    ? 14.544  108.864 13.269  1.00 82.29 ? 2471 HOH A O   1 
HETATM 10454 O  O   . HOH D 4 .    ? -26.350 93.877  65.211  1.00 45.23 ? 2472 HOH A O   1 
HETATM 10455 O  O   . HOH D 4 .    ? -18.336 88.224  75.393  1.00 47.26 ? 2473 HOH A O   1 
HETATM 10456 O  O   . HOH D 4 .    ? 14.489  119.933 23.880  1.00 91.27 ? 2474 HOH A O   1 
HETATM 10457 O  O   . HOH D 4 .    ? -43.743 102.694 22.233  1.00 36.76 ? 2475 HOH A O   1 
HETATM 10458 O  O   . HOH D 4 .    ? -2.722  110.802 44.378  1.00 79.36 ? 2476 HOH A O   1 
HETATM 10459 O  O   . HOH D 4 .    ? -11.539 87.429  43.905  1.00 33.31 ? 2477 HOH A O   1 
HETATM 10460 O  O   . HOH D 4 .    ? -3.906  104.616 29.734  1.00 38.18 ? 2478 HOH A O   1 
HETATM 10461 O  O   . HOH D 4 .    ? 13.031  76.576  18.451  1.00 42.93 ? 2479 HOH A O   1 
HETATM 10462 O  O   . HOH D 4 .    ? 5.334   69.547  63.915  1.00 37.10 ? 2480 HOH A O   1 
HETATM 10463 O  O   . HOH D 4 .    ? 11.677  97.050  -4.679  1.00 51.58 ? 2481 HOH A O   1 
HETATM 10464 O  O   . HOH D 4 .    ? -37.742 114.872 45.225  1.00 35.21 ? 2482 HOH A O   1 
HETATM 10465 O  O   . HOH D 4 .    ? 7.138   89.342  21.094  1.00 34.90 ? 2483 HOH A O   1 
HETATM 10466 O  O   . HOH D 4 .    ? -17.425 115.066 62.467  1.00 35.26 ? 2484 HOH A O   1 
HETATM 10467 O  O   . HOH D 4 .    ? -18.386 127.407 24.120  1.00 48.59 ? 2485 HOH A O   1 
HETATM 10468 O  O   . HOH D 4 .    ? 14.342  60.574  32.782  1.00 66.37 ? 2486 HOH A O   1 
HETATM 10469 O  O   . HOH D 4 .    ? 6.731   64.460  52.290  1.00 64.04 ? 2487 HOH A O   1 
HETATM 10470 O  O   . HOH D 4 .    ? -4.271  113.857 31.582  1.00 72.86 ? 2488 HOH A O   1 
HETATM 10471 O  O   . HOH D 4 .    ? -19.110 60.520  14.547  1.00 49.96 ? 2489 HOH A O   1 
HETATM 10472 O  O   . HOH D 4 .    ? 19.324  115.857 9.007   1.00 56.81 ? 2490 HOH A O   1 
HETATM 10473 O  O   . HOH D 4 .    ? -9.443  62.288  10.241  1.00 78.32 ? 2491 HOH A O   1 
HETATM 10474 O  O   . HOH D 4 .    ? -44.066 104.329 42.988  1.00 36.43 ? 2492 HOH A O   1 
HETATM 10475 O  O   . HOH D 4 .    ? -33.433 80.464  13.292  1.00 66.01 ? 2493 HOH A O   1 
HETATM 10476 O  O   . HOH D 4 .    ? 18.165  102.480 47.285  1.00 47.72 ? 2494 HOH A O   1 
HETATM 10477 O  O   . HOH D 4 .    ? 11.163  99.642  -3.453  1.00 39.08 ? 2495 HOH A O   1 
HETATM 10478 O  O   . HOH D 4 .    ? 19.277  110.038 16.835  1.00 47.18 ? 2496 HOH A O   1 
HETATM 10479 O  O   . HOH D 4 .    ? -9.696  99.134  25.211  1.00 58.44 ? 2497 HOH A O   1 
HETATM 10480 O  O   . HOH D 4 .    ? 16.984  98.076  -3.925  1.00 42.06 ? 2498 HOH A O   1 
HETATM 10481 O  O   . HOH D 4 .    ? 9.141   83.002  -14.887 1.00 53.81 ? 2499 HOH A O   1 
HETATM 10482 O  O   . HOH D 4 .    ? 11.509  114.078 19.144  1.00 42.57 ? 2500 HOH A O   1 
HETATM 10483 O  O   . HOH D 4 .    ? -25.260 96.151  14.341  1.00 81.47 ? 2501 HOH A O   1 
HETATM 10484 O  O   . HOH D 4 .    ? -11.361 125.495 32.788  1.00 35.44 ? 2502 HOH A O   1 
HETATM 10485 O  O   . HOH D 4 .    ? -31.383 96.726  35.287  1.00 27.86 ? 2503 HOH A O   1 
HETATM 10486 O  O   . HOH D 4 .    ? -44.207 102.298 13.381  1.00 44.32 ? 2504 HOH A O   1 
HETATM 10487 O  O   . HOH D 4 .    ? -2.731  124.818 25.185  1.00 59.08 ? 2505 HOH A O   1 
HETATM 10488 O  O   . HOH D 4 .    ? 0.288   85.879  -5.798  1.00 40.53 ? 2506 HOH A O   1 
HETATM 10489 O  O   . HOH D 4 .    ? -5.015  103.110 67.132  1.00 38.12 ? 2507 HOH A O   1 
HETATM 10490 O  O   . HOH D 4 .    ? -24.126 84.856  4.216   1.00 49.26 ? 2508 HOH A O   1 
HETATM 10491 O  O   . HOH D 4 .    ? -24.812 80.815  61.065  1.00 45.73 ? 2509 HOH A O   1 
HETATM 10492 O  O   . HOH D 4 .    ? 21.302  118.892 4.417   1.00 45.14 ? 2510 HOH A O   1 
HETATM 10493 O  O   . HOH D 4 .    ? 18.017  64.046  46.463  1.00 90.21 ? 2511 HOH A O   1 
HETATM 10494 O  O   . HOH D 4 .    ? -3.705  118.248 48.476  1.00 33.75 ? 2512 HOH A O   1 
HETATM 10495 O  O   . HOH D 4 .    ? 17.264  109.227 -2.909  1.00 48.42 ? 2513 HOH A O   1 
HETATM 10496 O  O   . HOH D 4 .    ? -17.145 97.119  5.774   1.00 49.43 ? 2514 HOH A O   1 
HETATM 10497 O  O   . HOH D 4 .    ? 19.735  78.681  15.739  1.00 44.92 ? 2515 HOH A O   1 
HETATM 10498 O  O   . HOH D 4 .    ? -13.001 55.030  24.309  1.00 54.95 ? 2516 HOH A O   1 
HETATM 10499 O  O   . HOH D 4 .    ? -2.278  73.554  55.429  1.00 41.55 ? 2517 HOH A O   1 
HETATM 10500 O  O   . HOH D 4 .    ? 17.309  105.684 58.356  1.00 43.98 ? 2518 HOH A O   1 
HETATM 10501 O  O   . HOH D 4 .    ? 16.719  76.858  0.000   1.00 32.37 ? 2519 HOH A O   1 
HETATM 10502 O  O   . HOH D 4 .    ? -10.135 128.798 26.143  1.00 42.25 ? 2520 HOH A O   1 
HETATM 10503 O  O   . HOH D 4 .    ? -7.774  63.505  7.218   1.00 67.08 ? 2521 HOH A O   1 
HETATM 10504 O  O   . HOH D 4 .    ? 9.534   72.681  -14.816 1.00 66.57 ? 2522 HOH A O   1 
HETATM 10505 O  O   . HOH D 4 .    ? 6.512   123.791 19.247  1.00 44.43 ? 2523 HOH A O   1 
HETATM 10506 O  O   . HOH D 4 .    ? -12.286 56.443  11.365  1.00 64.98 ? 2524 HOH A O   1 
HETATM 10507 O  O   . HOH D 4 .    ? 3.447   91.941  28.791  1.00 70.34 ? 2525 HOH A O   1 
HETATM 10508 O  O   . HOH D 4 .    ? 2.749   69.985  -9.635  1.00 72.91 ? 2526 HOH A O   1 
HETATM 10509 O  O   . HOH D 4 .    ? -1.660  67.700  17.676  1.00 40.83 ? 2527 HOH A O   1 
HETATM 10510 O  O   . HOH D 4 .    ? -3.583  108.514 19.876  1.00 32.37 ? 2528 HOH A O   1 
HETATM 10511 O  O   . HOH D 4 .    ? -39.309 79.404  45.506  1.00 47.83 ? 2529 HOH A O   1 
HETATM 10512 O  O   . HOH D 4 .    ? -1.955  76.648  31.066  1.00 37.38 ? 2530 HOH A O   1 
HETATM 10513 O  O   . HOH D 4 .    ? -12.072 85.284  13.553  1.00 68.75 ? 2531 HOH A O   1 
HETATM 10514 O  O   . HOH D 4 .    ? 18.224  89.601  28.490  1.00 49.38 ? 2532 HOH A O   1 
HETATM 10515 O  O   . HOH D 4 .    ? 11.787  81.441  20.515  1.00 36.92 ? 2533 HOH A O   1 
HETATM 10516 O  O   . HOH D 4 .    ? 16.368  77.251  69.474  1.00 45.06 ? 2534 HOH A O   1 
HETATM 10517 O  O   . HOH D 4 .    ? 21.065  103.370 28.272  1.00 38.23 ? 2536 HOH A O   1 
HETATM 10518 O  O   . HOH D 4 .    ? -23.165 92.500  53.201  1.00 76.28 ? 2537 HOH A O   1 
HETATM 10519 O  O   . HOH D 4 .    ? -27.861 111.195 13.956  1.00 50.12 ? 2538 HOH A O   1 
HETATM 10520 O  O   . HOH D 4 .    ? 0.265   117.170 23.373  1.00 45.94 ? 2539 HOH A O   1 
HETATM 10521 O  O   . HOH D 4 .    ? -33.651 97.814  35.593  1.00 37.61 ? 2540 HOH A O   1 
HETATM 10522 O  O   . HOH D 4 .    ? -38.661 90.558  40.911  1.00 43.63 ? 2541 HOH A O   1 
HETATM 10523 O  O   . HOH D 4 .    ? -1.264  112.729 38.201  1.00 41.52 ? 2542 HOH A O   1 
HETATM 10524 O  O   . HOH D 4 .    ? 11.399  94.972  58.991  1.00 87.85 ? 2543 HOH A O   1 
HETATM 10525 O  O   . HOH D 4 .    ? 11.846  71.773  -1.670  1.00 45.46 ? 2544 HOH A O   1 
HETATM 10526 O  O   . HOH D 4 .    ? -13.574 110.754 25.707  1.00 83.92 ? 2545 HOH A O   1 
HETATM 10527 O  O   . HOH D 4 .    ? -46.333 78.989  11.691  1.00 47.98 ? 2546 HOH A O   1 
HETATM 10528 O  O   . HOH D 4 .    ? 13.637  73.388  59.183  1.00 76.70 ? 2547 HOH A O   1 
HETATM 10529 O  O   . HOH D 4 .    ? -9.743  97.285  19.630  1.00 52.82 ? 2548 HOH A O   1 
HETATM 10530 O  O   . HOH D 4 .    ? 20.423  55.389  40.214  1.00 46.07 ? 2549 HOH A O   1 
HETATM 10531 O  O   . HOH D 4 .    ? -46.100 88.645  14.959  1.00 73.84 ? 2550 HOH A O   1 
HETATM 10532 O  O   . HOH D 4 .    ? 21.955  100.762 30.320  1.00 49.42 ? 2551 HOH A O   1 
HETATM 10533 O  O   . HOH D 4 .    ? 14.479  76.090  -13.486 1.00 52.71 ? 2552 HOH A O   1 
HETATM 10534 O  O   . HOH D 4 .    ? -18.832 118.679 52.731  1.00 46.05 ? 2553 HOH A O   1 
HETATM 10535 O  O   . HOH D 4 .    ? -49.001 97.874  31.771  1.00 31.04 ? 2554 HOH A O   1 
HETATM 10536 O  O   . HOH D 4 .    ? 7.256   87.299  69.660  1.00 77.23 ? 2555 HOH A O   1 
HETATM 10537 O  O   . HOH D 4 .    ? 16.124  110.128 25.175  1.00 46.02 ? 2556 HOH A O   1 
HETATM 10538 O  O   . HOH D 4 .    ? 15.091  84.080  -4.674  1.00 67.54 ? 2557 HOH A O   1 
HETATM 10539 O  O   . HOH D 4 .    ? 11.436  119.498 39.654  1.00 62.90 ? 2558 HOH A O   1 
HETATM 10540 O  O   . HOH D 4 .    ? -44.398 93.431  11.737  1.00 40.42 ? 2559 HOH A O   1 
HETATM 10541 O  O   . HOH D 4 .    ? -22.361 121.541 41.536  1.00 55.16 ? 2560 HOH A O   1 
HETATM 10542 O  O   . HOH D 4 .    ? -1.644  119.924 38.846  1.00 64.14 ? 2561 HOH A O   1 
HETATM 10543 O  O   . HOH D 4 .    ? -36.994 108.681 14.113  1.00 46.31 ? 2562 HOH A O   1 
HETATM 10544 O  O   . HOH D 4 .    ? 2.354   66.997  33.647  1.00 79.99 ? 2563 HOH A O   1 
HETATM 10545 O  O   . HOH D 4 .    ? 0.403   102.767 41.117  1.00 45.19 ? 2564 HOH A O   1 
HETATM 10546 O  O   . HOH D 4 .    ? 5.503   116.093 19.311  1.00 75.40 ? 2565 HOH A O   1 
HETATM 10547 O  O   . HOH D 4 .    ? 9.638   76.017  35.805  1.00 51.12 ? 2566 HOH A O   1 
HETATM 10548 O  O   . HOH D 4 .    ? 16.340  93.926  36.590  1.00 50.89 ? 2567 HOH A O   1 
HETATM 10549 O  O   . HOH D 4 .    ? 0.699   133.010 31.358  1.00 47.76 ? 2568 HOH A O   1 
HETATM 10550 O  O   . HOH D 4 .    ? -19.771 118.550 9.467   1.00 46.51 ? 2569 HOH A O   1 
HETATM 10551 O  O   . HOH D 4 .    ? -30.090 80.207  5.463   1.00 57.85 ? 2570 HOH A O   1 
HETATM 10552 O  O   . HOH D 4 .    ? -38.010 115.790 32.184  1.00 41.13 ? 2571 HOH A O   1 
HETATM 10553 O  O   . HOH D 4 .    ? -6.634  95.029  47.050  1.00 43.53 ? 2572 HOH A O   1 
HETATM 10554 O  O   . HOH D 4 .    ? 6.673   63.280  15.440  1.00 40.07 ? 2573 HOH A O   1 
HETATM 10555 O  O   . HOH D 4 .    ? 13.770  74.172  -6.853  1.00 50.06 ? 2574 HOH A O   1 
HETATM 10556 O  O   . HOH D 4 .    ? 15.043  81.821  -8.042  1.00 37.05 ? 2575 HOH A O   1 
HETATM 10557 O  O   . HOH D 4 .    ? -5.840  76.115  29.902  1.00 43.84 ? 2576 HOH A O   1 
HETATM 10558 O  O   . HOH D 4 .    ? -24.803 81.815  25.551  1.00 65.59 ? 2577 HOH A O   1 
HETATM 10559 O  O   . HOH D 4 .    ? -35.950 77.810  50.466  1.00 71.99 ? 2578 HOH A O   1 
HETATM 10560 O  O   . HOH D 4 .    ? 12.366  74.306  29.038  1.00 58.41 ? 2579 HOH A O   1 
HETATM 10561 O  O   . HOH D 4 .    ? 10.810  78.100  25.660  1.00 60.07 ? 2580 HOH A O   1 
HETATM 10562 O  O   . HOH D 4 .    ? 17.066  94.643  20.024  1.00 47.09 ? 2581 HOH A O   1 
HETATM 10563 O  O   . HOH D 4 .    ? 6.237   107.426 -2.248  1.00 58.10 ? 2582 HOH A O   1 
HETATM 10564 O  O   . HOH D 4 .    ? -4.923  52.938  14.688  1.00 60.45 ? 2583 HOH A O   1 
HETATM 10565 O  O   . HOH D 4 .    ? -1.947  90.701  20.408  1.00 38.87 ? 2584 HOH A O   1 
HETATM 10566 O  O   . HOH D 4 .    ? -26.584 87.893  41.749  1.00 46.72 ? 2585 HOH A O   1 
HETATM 10567 O  O   . HOH D 4 .    ? 14.652  80.326  -1.301  1.00 48.66 ? 2586 HOH A O   1 
HETATM 10568 O  O   . HOH D 4 .    ? -49.668 83.168  14.731  1.00 51.29 ? 2587 HOH A O   1 
HETATM 10569 O  O   . HOH D 4 .    ? 15.960  103.956 21.649  1.00 62.36 ? 2588 HOH A O   1 
HETATM 10570 O  O   . HOH D 4 .    ? 1.430   73.515  47.829  1.00 51.79 ? 2589 HOH A O   1 
HETATM 10571 O  O   . HOH D 4 .    ? -8.531  88.248  -0.623  1.00 61.78 ? 2590 HOH A O   1 
HETATM 10572 O  O   . HOH D 4 .    ? -28.776 85.700  40.888  1.00 54.83 ? 2591 HOH A O   1 
HETATM 10573 O  O   . HOH D 4 .    ? -7.774  70.579  24.138  1.00 80.60 ? 2592 HOH A O   1 
HETATM 10574 O  O   . HOH D 4 .    ? -40.322 105.757 28.433  1.00 73.71 ? 2593 HOH A O   1 
HETATM 10575 O  O   . HOH D 4 .    ? 2.669   107.584 57.741  1.00 37.41 ? 2594 HOH A O   1 
HETATM 10576 O  O   . HOH D 4 .    ? -49.223 88.311  10.504  1.00 45.44 ? 2595 HOH A O   1 
HETATM 10577 O  O   . HOH D 4 .    ? -9.117  84.912  24.843  1.00 50.53 ? 2596 HOH A O   1 
HETATM 10578 O  O   . HOH D 4 .    ? -14.224 113.280 17.246  1.00 67.28 ? 2597 HOH A O   1 
HETATM 10579 O  O   . HOH D 4 .    ? 13.268  75.797  -10.399 1.00 58.14 ? 2598 HOH A O   1 
HETATM 10580 O  O   . HOH D 4 .    ? 4.333   68.291  49.446  1.00 40.21 ? 2599 HOH A O   1 
HETATM 10581 O  O   . HOH D 4 .    ? 6.077   88.737  25.777  1.00 80.93 ? 2600 HOH A O   1 
HETATM 10582 O  O   . HOH D 4 .    ? -6.822  79.733  25.253  1.00 45.18 ? 2601 HOH A O   1 
HETATM 10583 O  O   . HOH D 4 .    ? 8.736   74.675  -17.863 1.00 44.08 ? 2602 HOH A O   1 
HETATM 10584 O  O   . HOH D 4 .    ? -1.977  100.178 40.550  1.00 67.11 ? 2603 HOH A O   1 
HETATM 10585 O  O   . HOH D 4 .    ? -11.856 98.552  16.003  1.00 43.17 ? 2604 HOH A O   1 
HETATM 10586 O  O   . HOH D 4 .    ? -31.791 107.608 4.173   1.00 44.53 ? 2605 HOH A O   1 
HETATM 10587 O  O   . HOH D 4 .    ? -26.109 100.493 17.146  1.00 95.79 ? 2606 HOH A O   1 
HETATM 10588 O  O   . HOH D 4 .    ? -5.391  63.222  52.340  1.00 49.96 ? 2607 HOH A O   1 
HETATM 10589 O  O   . HOH D 4 .    ? -5.519  84.753  -0.320  1.00 69.51 ? 2608 HOH A O   1 
HETATM 10590 O  O   . HOH D 4 .    ? -0.444  59.553  32.880  1.00 55.72 ? 2609 HOH A O   1 
HETATM 10591 O  O   . HOH D 4 .    ? 15.465  96.370  5.269   1.00 59.46 ? 2610 HOH A O   1 
HETATM 10592 O  O   . HOH D 4 .    ? 3.469   89.756  47.526  1.00 72.56 ? 2611 HOH A O   1 
HETATM 10593 O  O   . HOH D 4 .    ? -9.063  114.995 48.383  1.00 37.90 ? 2612 HOH A O   1 
HETATM 10594 O  O   . HOH D 4 .    ? -36.049 98.682  40.945  1.00 69.88 ? 2613 HOH A O   1 
HETATM 10595 O  O   . HOH D 4 .    ? 1.914   97.766  33.477  1.00 68.80 ? 2614 HOH A O   1 
HETATM 10596 O  O   . HOH D 4 .    ? -37.731 84.766  48.607  1.00 68.41 ? 2615 HOH A O   1 
HETATM 10597 O  O   . HOH D 4 .    ? -16.957 101.532 8.768   1.00 54.00 ? 2616 HOH A O   1 
HETATM 10598 O  O   . HOH D 4 .    ? 17.292  63.137  48.608  1.00 43.18 ? 2617 HOH A O   1 
HETATM 10599 O  O   . HOH D 4 .    ? -3.917  93.071  36.319  1.00 64.16 ? 2618 HOH A O   1 
HETATM 10600 O  O   . HOH D 4 .    ? -7.387  98.149  29.116  1.00 55.18 ? 2619 HOH A O   1 
HETATM 10601 O  O   . HOH D 4 .    ? 22.508  114.201 5.847   1.00 61.75 ? 2620 HOH A O   1 
HETATM 10602 O  O   . HOH D 4 .    ? 11.689  109.629 30.460  1.00 47.68 ? 2621 HOH A O   1 
HETATM 10603 O  O   . HOH D 4 .    ? -3.028  89.843  77.374  1.00 50.68 ? 2622 HOH A O   1 
HETATM 10604 O  O   . HOH D 4 .    ? -0.428  117.376 61.912  1.00 34.86 ? 2623 HOH A O   1 
HETATM 10605 O  O   . HOH D 4 .    ? -7.906  100.984 28.076  1.00 41.91 ? 2624 HOH A O   1 
HETATM 10606 O  O   . HOH D 4 .    ? -5.610  54.928  23.772  1.00 43.91 ? 2625 HOH A O   1 
HETATM 10607 O  O   . HOH D 4 .    ? 5.074   62.970  23.332  1.00 55.33 ? 2626 HOH A O   1 
HETATM 10608 O  O   . HOH D 4 .    ? -2.303  116.648 58.171  1.00 71.25 ? 2627 HOH A O   1 
HETATM 10609 O  O   . HOH D 4 .    ? -12.485 73.491  32.675  1.00 38.04 ? 2628 HOH A O   1 
HETATM 10610 O  O   . HOH D 4 .    ? -37.817 112.192 43.478  1.00 74.54 ? 2629 HOH A O   1 
HETATM 10611 O  O   . HOH D 4 .    ? 14.931  96.212  -3.699  1.00 54.14 ? 2630 HOH A O   1 
HETATM 10612 O  O   . HOH D 4 .    ? -36.064 123.351 39.071  1.00 50.88 ? 2631 HOH A O   1 
HETATM 10613 O  O   . HOH D 4 .    ? 18.217  72.375  57.444  1.00 59.76 ? 2632 HOH A O   1 
HETATM 10614 O  O   . HOH D 4 .    ? -36.307 74.826  47.759  1.00 72.20 ? 2633 HOH A O   1 
HETATM 10615 O  O   . HOH D 4 .    ? 9.845   71.346  18.497  1.00 85.54 ? 2634 HOH A O   1 
HETATM 10616 O  O   . HOH D 4 .    ? 3.756   112.537 19.365  1.00 37.31 ? 2635 HOH A O   1 
HETATM 10617 O  O   . HOH D 4 .    ? -31.299 74.023  53.590  1.00 46.60 ? 2636 HOH A O   1 
HETATM 10618 O  O   . HOH D 4 .    ? -43.160 101.494 49.811  1.00 39.14 ? 2637 HOH A O   1 
HETATM 10619 O  O   . HOH D 4 .    ? 17.132  101.461 54.211  1.00 64.09 ? 2638 HOH A O   1 
HETATM 10620 O  O   . HOH D 4 .    ? -36.309 92.880  22.242  1.00 87.34 ? 2639 HOH A O   1 
HETATM 10621 O  O   . HOH D 4 .    ? 3.664   82.022  44.743  1.00 37.50 ? 2640 HOH A O   1 
HETATM 10622 O  O   . HOH D 4 .    ? -5.996  98.162  -6.876  1.00 57.48 ? 2641 HOH A O   1 
HETATM 10623 O  O   . HOH D 4 .    ? 2.099   110.949 1.550   1.00 61.49 ? 2642 HOH A O   1 
HETATM 10624 O  O   . HOH D 4 .    ? -7.968  98.194  67.124  1.00 93.44 ? 2643 HOH A O   1 
HETATM 10625 O  O   . HOH D 4 .    ? -35.362 112.990 38.625  1.00 74.00 ? 2644 HOH A O   1 
HETATM 10626 O  O   . HOH D 4 .    ? 7.090   120.598 19.333  1.00 72.36 ? 2645 HOH A O   1 
HETATM 10627 O  O   . HOH D 4 .    ? -7.247  68.747  0.684   1.00 79.36 ? 2646 HOH A O   1 
HETATM 10628 O  O   . HOH D 4 .    ? -40.238 94.290  8.187   1.00 44.44 ? 2647 HOH A O   1 
HETATM 10629 O  O   . HOH D 4 .    ? -12.640 114.556 19.475  1.00 62.01 ? 2648 HOH A O   1 
HETATM 10630 O  O   . HOH D 4 .    ? 18.108  107.751 -0.454  1.00 53.52 ? 2649 HOH A O   1 
HETATM 10631 O  O   . HOH D 4 .    ? -11.169 104.134 63.109  1.00 74.27 ? 2650 HOH A O   1 
HETATM 10632 O  O   . HOH D 4 .    ? 15.753  99.349  67.882  1.00 73.35 ? 2651 HOH A O   1 
HETATM 10633 O  O   . HOH D 4 .    ? 5.612   111.216 36.218  1.00 88.05 ? 2652 HOH A O   1 
HETATM 10634 O  O   . HOH D 4 .    ? 14.753  106.470 52.386  1.00 43.49 ? 2653 HOH A O   1 
HETATM 10635 O  O   . HOH D 4 .    ? 13.721  116.707 41.613  1.00 40.21 ? 2654 HOH A O   1 
HETATM 10636 O  O   . HOH D 4 .    ? 14.048  63.195  43.839  1.00 91.53 ? 2655 HOH A O   1 
HETATM 10637 O  O   . HOH D 4 .    ? 16.852  76.574  49.685  1.00 45.42 ? 2656 HOH A O   1 
HETATM 10638 O  O   . HOH D 4 .    ? -31.545 100.582 20.692  1.00 38.44 ? 2657 HOH A O   1 
HETATM 10639 O  O   . HOH D 4 .    ? 3.877   78.656  20.951  1.00 42.94 ? 2658 HOH A O   1 
HETATM 10640 O  O   . HOH D 4 .    ? -47.018 108.273 26.857  1.00 39.04 ? 2659 HOH A O   1 
HETATM 10641 O  O   . HOH D 4 .    ? 2.954   95.562  36.764  1.00 74.78 ? 2660 HOH A O   1 
HETATM 10642 O  O   . HOH D 4 .    ? -6.696  123.746 22.253  1.00 69.62 ? 2661 HOH A O   1 
HETATM 10643 O  O   . HOH D 4 .    ? 17.264  95.989  53.280  1.00 47.84 ? 2662 HOH A O   1 
HETATM 10644 O  O   . HOH D 4 .    ? 1.634   89.360  -13.011 1.00 36.97 ? 2663 HOH A O   1 
HETATM 10645 O  O   . HOH D 4 .    ? 19.087  56.905  32.358  1.00 59.41 ? 2664 HOH A O   1 
HETATM 10646 O  O   . HOH D 4 .    ? -15.199 97.605  7.015   1.00 44.62 ? 2665 HOH A O   1 
HETATM 10647 O  O   . HOH D 4 .    ? -42.270 113.452 38.545  1.00 55.40 ? 2666 HOH A O   1 
HETATM 10648 O  O   . HOH D 4 .    ? 10.057  70.475  33.651  1.00 63.68 ? 2667 HOH A O   1 
HETATM 10649 O  O   . HOH D 4 .    ? -30.753 116.172 20.466  1.00 43.23 ? 2668 HOH A O   1 
HETATM 10650 O  O   . HOH D 4 .    ? -10.224 77.390  5.245   1.00 98.19 ? 2669 HOH A O   1 
HETATM 10651 O  O   . HOH D 4 .    ? 24.164  59.707  46.644  1.00 45.85 ? 2670 HOH A O   1 
HETATM 10652 O  O   . HOH D 4 .    ? -21.919 89.448  1.760   1.00 55.64 ? 2671 HOH A O   1 
HETATM 10653 O  O   . HOH D 4 .    ? 9.452   86.124  72.281  1.00 48.84 ? 2672 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1    MET 1    1    ?    ?   ?   A . n 
A 1 2    SER 2    2    2    SER SER A . n 
A 1 3    SER 3    3    3    SER SER A . n 
A 1 4    MET 4    4    4    MET MET A . n 
A 1 5    ILE 5    5    5    ILE ILE A . n 
A 1 6    LEU 6    6    6    LEU LEU A . n 
A 1 7    THR 7    7    7    THR THR A . n 
A 1 8    GLN 8    8    8    GLN GLN A . n 
A 1 9    PHE 9    9    9    PHE PHE A . n 
A 1 10   GLY 10   10   10   GLY GLY A . n 
A 1 11   PRO 11   11   11   PRO PRO A . n 
A 1 12   PHE 12   12   12   PHE PHE A . n 
A 1 13   ILE 13   13   13   ILE ILE A . n 
A 1 14   GLU 14   14   14   GLU GLU A . n 
A 1 15   SER 15   15   15   SER SER A . n 
A 1 16   ILE 16   16   16   ILE ILE A . n 
A 1 17   SER 17   17   17   SER SER A . n 
A 1 18   GLY 18   18   18   GLY GLY A . n 
A 1 19   ILE 19   19   19   ILE ILE A . n 
A 1 20   THR 20   20   20   THR THR A . n 
A 1 21   ASP 21   21   21   ASP ASP A . n 
A 1 22   GLN 22   22   22   GLN GLN A . n 
A 1 23   SER 23   23   23   SER SER A . n 
A 1 24   ASN 24   24   24   ASN ASN A . n 
A 1 25   ASP 25   25   25   ASP ASP A . n 
A 1 26   VAL 26   26   26   VAL VAL A . n 
A 1 27   PHE 27   27   27   PHE PHE A . n 
A 1 28   GLU 28   28   28   GLU GLU A . n 
A 1 29   ASP 29   29   29   ASP ASP A . n 
A 1 30   ALA 30   30   30   ALA ALA A . n 
A 1 31   ALA 31   31   31   ALA ALA A . n 
A 1 32   LYS 32   32   32   LYS LYS A . n 
A 1 33   ALA 33   33   33   ALA ALA A . n 
A 1 34   PHE 34   34   34   PHE PHE A . n 
A 1 35   SER 35   35   35   SER SER A . n 
A 1 36   MET 36   36   36   MET MET A . n 
A 1 37   PHE 37   37   37   PHE PHE A . n 
A 1 38   THR 38   38   38   THR THR A . n 
A 1 39   ARG 39   39   39   ARG ARG A . n 
A 1 40   SER 40   40   40   SER SER A . n 
A 1 41   ASP 41   41   41   ASP ASP A . n 
A 1 42   VAL 42   42   42   VAL VAL A . n 
A 1 43   TYR 43   43   43   TYR TYR A . n 
A 1 44   LYS 44   44   44   LYS LYS A . n 
A 1 45   ALA 45   45   45   ALA ALA A . n 
A 1 46   LEU 46   46   46   LEU LEU A . n 
A 1 47   ASP 47   47   47   ASP ASP A . n 
A 1 48   GLU 48   48   48   GLU GLU A . n 
A 1 49   ILE 49   49   49   ILE ILE A . n 
A 1 50   PRO 50   50   50   PRO PRO A . n 
A 1 51   PHE 51   51   51   PHE PHE A . n 
A 1 52   SER 52   52   52   SER SER A . n 
A 1 53   ASP 53   53   53   ASP ASP A . n 
A 1 54   ASP 54   54   54   ASP ASP A . n 
A 1 55   ALA 55   55   55   ALA ALA A . n 
A 1 56   MET 56   56   56   MET MET A . n 
A 1 57   LEU 57   57   57   LEU LEU A . n 
A 1 58   PRO 58   58   58   PRO PRO A . n 
A 1 59   ILE 59   59   59   ILE ILE A . n 
A 1 60   PRO 60   60   60   PRO PRO A . n 
A 1 61   PRO 61   61   61   PRO PRO A . n 
A 1 62   THR 62   62   62   THR THR A . n 
A 1 63   ILE 63   63   63   ILE ILE A . n 
A 1 64   TYR 64   64   64   TYR TYR A . n 
A 1 65   THR 65   65   65   THR THR A . n 
A 1 66   LYS 66   66   66   LYS LYS A . n 
A 1 67   PRO 67   67   67   PRO PRO A . n 
A 1 68   SER 68   68   68   SER SER A . n 
A 1 69   HIS 69   69   69   HIS HIS A . n 
A 1 70   ASP 70   70   70   ASP ASP A . n 
A 1 71   SER 71   71   71   SER SER A . n 
A 1 72   TYR 72   72   72   TYR TYR A . n 
A 1 73   TYR 73   73   73   TYR TYR A . n 
A 1 74   TYR 74   74   74   TYR TYR A . n 
A 1 75   ILE 75   75   75   ILE ILE A . n 
A 1 76   ASP 76   76   76   ASP ASP A . n 
A 1 77   ALA 77   77   77   ALA ALA A . n 
A 1 78   LEU 78   78   78   LEU LEU A . n 
A 1 79   ASN 79   79   79   ASN ASN A . n 
A 1 80   ARG 80   80   80   ARG ARG A . n 
A 1 81   VAL 81   81   81   VAL VAL A . n 
A 1 82   ARG 82   82   82   ARG ARG A . n 
A 1 83   ARG 83   83   83   ARG ARG A . n 
A 1 84   LYS 84   84   84   LYS LYS A . n 
A 1 85   THR 85   85   85   THR THR A . n 
A 1 86   TYR 86   86   86   TYR TYR A . n 
A 1 87   GLN 87   87   87   GLN GLN A . n 
A 1 88   GLY 88   88   88   GLY GLY A . n 
A 1 89   PRO 89   89   89   PRO PRO A . n 
A 1 90   ASP 90   90   90   ASP ASP A . n 
A 1 91   ASP 91   91   91   ASP ASP A . n 
A 1 92   VAL 92   92   92   VAL VAL A . n 
A 1 93   TYR 93   93   93   TYR TYR A . n 
A 1 94   VAL 94   94   94   VAL VAL A . n 
A 1 95   PRO 95   95   95   PRO PRO A . n 
A 1 96   ASN 96   96   96   ASN ASN A . n 
A 1 97   CYS 97   97   97   CYS CYS A . n 
A 1 98   SER 98   98   98   SER SER A . n 
A 1 99   ILE 99   99   99   ILE ILE A . n 
A 1 100  VAL 100  100  100  VAL VAL A . n 
A 1 101  GLU 101  101  101  GLU GLU A . n 
A 1 102  LEU 102  102  102  LEU LEU A . n 
A 1 103  LEU 103  103  103  LEU LEU A . n 
A 1 104  GLU 104  104  104  GLU GLU A . n 
A 1 105  PRO 105  105  105  PRO PRO A . n 
A 1 106  HIS 106  106  106  HIS HIS A . n 
A 1 107  GLU 107  107  107  GLU GLU A . n 
A 1 108  THR 108  108  108  THR THR A . n 
A 1 109  LEU 109  109  109  LEU LEU A . n 
A 1 110  THR 110  110  110  THR THR A . n 
A 1 111  SER 111  111  111  SER SER A . n 
A 1 112  TYR 112  112  112  TYR TYR A . n 
A 1 113  GLY 113  113  113  GLY GLY A . n 
A 1 114  ARG 114  114  114  ARG ARG A . n 
A 1 115  LEU 115  115  115  LEU LEU A . n 
A 1 116  SER 116  116  116  SER SER A . n 
A 1 117  GLU 117  117  117  GLU GLU A . n 
A 1 118  ALA 118  118  118  ALA ALA A . n 
A 1 119  ILE 119  119  119  ILE ILE A . n 
A 1 120  GLU 120  120  120  GLU GLU A . n 
A 1 121  ASN 121  121  121  ASN ASN A . n 
A 1 122  ARG 122  122  122  ARG ARG A . n 
A 1 123  ALA 123  123  123  ALA ALA A . n 
A 1 124  LYS 124  124  124  LYS LYS A . n 
A 1 125  ASP 125  125  125  ASP ASP A . n 
A 1 126  GLY 126  126  126  GLY GLY A . n 
A 1 127  ASP 127  127  127  ASP ASP A . n 
A 1 128  SER 128  128  128  SER SER A . n 
A 1 129  GLN 129  129  129  GLN GLN A . n 
A 1 130  ALA 130  130  130  ALA ALA A . n 
A 1 131  ARG 131  131  131  ARG ARG A . n 
A 1 132  ILE 132  132  132  ILE ILE A . n 
A 1 133  ALA 133  133  133  ALA ALA A . n 
A 1 134  THR 134  134  134  THR THR A . n 
A 1 135  THR 135  135  135  THR THR A . n 
A 1 136  TYR 136  136  136  TYR TYR A . n 
A 1 137  GLY 137  137  137  GLY GLY A . n 
A 1 138  ARG 138  138  138  ARG ARG A . n 
A 1 139  ILE 139  139  139  ILE ILE A . n 
A 1 140  ALA 140  140  140  ALA ALA A . n 
A 1 141  GLU 141  141  141  GLU GLU A . n 
A 1 142  SER 142  142  142  SER SER A . n 
A 1 143  GLN 143  143  143  GLN GLN A . n 
A 1 144  ALA 144  144  144  ALA ALA A . n 
A 1 145  ARG 145  145  145  ARG ARG A . n 
A 1 146  GLN 146  146  146  GLN GLN A . n 
A 1 147  ILE 147  147  147  ILE ILE A . n 
A 1 148  LYS 148  148  148  LYS LYS A . n 
A 1 149  ALA 149  149  149  ALA ALA A . n 
A 1 150  PRO 150  150  150  PRO PRO A . n 
A 1 151  LEU 151  151  151  LEU LEU A . n 
A 1 152  GLU 152  152  152  GLU GLU A . n 
A 1 153  LYS 153  153  153  LYS LYS A . n 
A 1 154  PHE 154  154  154  PHE PHE A . n 
A 1 155  VAL 155  155  155  VAL VAL A . n 
A 1 156  LEU 156  156  156  LEU LEU A . n 
A 1 157  ALA 157  157  157  ALA ALA A . n 
A 1 158  LEU 158  158  158  LEU LEU A . n 
A 1 159  LEU 159  159  159  LEU LEU A . n 
A 1 160  VAL 160  160  160  VAL VAL A . n 
A 1 161  ALA 161  161  161  ALA ALA A . n 
A 1 162  GLU 162  162  162  GLU GLU A . n 
A 1 163  ALA 163  163  163  ALA ALA A . n 
A 1 164  GLY 164  164  164  GLY GLY A . n 
A 1 165  GLY 165  165  165  GLY GLY A . n 
A 1 166  SER 166  166  166  SER SER A . n 
A 1 167  LEU 167  167  167  LEU LEU A . n 
A 1 168  TYR 168  168  168  TYR TYR A . n 
A 1 169  ASP 169  169  169  ASP ASP A . n 
A 1 170  PRO 170  170  170  PRO PRO A . n 
A 1 171  VAL 171  171  171  VAL VAL A . n 
A 1 172  LEU 1