data_1MZC
# 
_entry.id   1MZC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1MZC         
RCSB  RCSB017326   
WWPDB D_1000017326 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1LD7 'Human Farnesyltransferase with inhibitor compound 66'        unspecified 
PDB 1LD8 'Human Farnesyltransferase with inhibitor compound 49'        unspecified 
PDB 1JCQ 'Human Farnesyltransferase with inhibitor compound L-739,750' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1MZC 
_pdbx_database_status.recvd_initial_deposition_date   2002-10-07 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'deSolms, S.J.'       1  
'Ciccarone, T.M.'     2  
'MacTough, S.C.'      3  
'Shaw, A.W.'          4  
'Buser, C.A.'         5  
'Ellis-Hutchings, M.' 6  
'Fernandes, C.'       7  
'Hamilton, K.A.'      8  
'Huber, H.E.'         9  
'Kohl, N.E.'          10 
'Lobell, R.B.'        11 
'Robinson, R.G.'      12 
'Tsou, N.N.'          13 
'Walsh, E.S.'         14 
'Graham, S.L.'        15 
'Beese, L.S.'         16 
'Taylor, J.S.'        17 
# 
_citation.id                        primary 
_citation.title                     
'Dual Protein Farnesyltransferase-Geranylgeranyltransferase-I Inhibitors as Potential Cancer Chemotherapeutic Agents.' 
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            46 
_citation.page_first                2973 
_citation.page_last                 2984 
_citation.year                      2003 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12825937 
_citation.pdbx_database_id_DOI      10.1021/jm020587n 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'DeSolms, S.J.'       1  ? 
primary 'Ciccarone, T.M.'     2  ? 
primary 'MacTough, S.C.'      3  ? 
primary 'Shaw, A.W.'          4  ? 
primary 'Buser, C.A.'         5  ? 
primary 'Ellis-Hutchings, M.' 6  ? 
primary 'Fernandes, C.'       7  ? 
primary 'Hamilton, K.A.'      8  ? 
primary 'Huber, H.E.'         9  ? 
primary 'Kohl, N.E.'          10 ? 
primary 'Lobell, R.B.'        11 ? 
primary 'Robinson, R.G.'      12 ? 
primary 'Tsou, N.N.'          13 ? 
primary 'Walsh, E.S.'         14 ? 
primary 'Graham, S.L.'        15 ? 
primary 'Beese, L.S.'         16 ? 
primary 'Taylor, J.S.'        17 ? 
# 
_cell.entry_id           1MZC 
_cell.length_a           178.385 
_cell.length_b           178.385 
_cell.length_c           64.579 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1MZC 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein Farnesyltransferase alpha Subunit' 44864.840 1   2.5.1.- ? ? ? 
2 polymer     man 'Protein Farnesyltransferase beta Subunit' 48822.406 1   2.5.1.- ? ? ? 
3 branched    man 'beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose' 342.297   1   ?       ? ? ? 
4 non-polymer syn 'ZINC ION' 65.409    1   ?       ? ? ? 
5 non-polymer syn 'FARNESYL DIPHOSPHATE' 382.326   1   ?       ? ? ? 
6 non-polymer syn 
'2-[3-(3-ETHYL-1-METHYL-2-OXO-AZEPAN-3-YL)-PHENOXY]-4-[1-AMINO-1-(1-METHYL-1H-IMIDIZOL-5-YL)-ETHYL]-BENZONITRILE' 471.594   1   ? 
? ? ? 
7 water       nat water 18.015    703 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'CAAX farnesyltransferase alpha subunit, RAS proteins prenyltransferase alpha, FTase-alpha' 
2 'CAAX farnesyltransferase beta subunit, RAS proteins prenyltransferase beta, FTase-beta'    
3 sucrose                                                                                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQ
NDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIE
EQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYE
DMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQEEF
;
;MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQ
NDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIE
EQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYE
DMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQEEF
;
A ? 
2 'polypeptide(L)' no no 
;MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFH
YLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNAL
CIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGD
PALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPV
YNIGPDKVIQATTYFLQKPVPGFEELKDETSAEPATD
;
;MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFH
YLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNAL
CIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGD
PALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPV
YNIGPDKVIQATTYFLQKPVPGFEELKDETSAEPATD
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ALA n 
1 4   THR n 
1 5   GLU n 
1 6   GLY n 
1 7   VAL n 
1 8   GLY n 
1 9   GLU n 
1 10  ALA n 
1 11  ALA n 
1 12  GLN n 
1 13  GLY n 
1 14  GLY n 
1 15  GLU n 
1 16  PRO n 
1 17  GLY n 
1 18  GLN n 
1 19  PRO n 
1 20  ALA n 
1 21  GLN n 
1 22  PRO n 
1 23  PRO n 
1 24  PRO n 
1 25  GLN n 
1 26  PRO n 
1 27  HIS n 
1 28  PRO n 
1 29  PRO n 
1 30  PRO n 
1 31  PRO n 
1 32  GLN n 
1 33  GLN n 
1 34  GLN n 
1 35  HIS n 
1 36  LYS n 
1 37  GLU n 
1 38  GLU n 
1 39  MET n 
1 40  ALA n 
1 41  ALA n 
1 42  GLU n 
1 43  ALA n 
1 44  GLY n 
1 45  GLU n 
1 46  ALA n 
1 47  VAL n 
1 48  ALA n 
1 49  SER n 
1 50  PRO n 
1 51  MET n 
1 52  ASP n 
1 53  ASP n 
1 54  GLY n 
1 55  PHE n 
1 56  VAL n 
1 57  SER n 
1 58  LEU n 
1 59  ASP n 
1 60  SER n 
1 61  PRO n 
1 62  SER n 
1 63  TYR n 
1 64  VAL n 
1 65  LEU n 
1 66  TYR n 
1 67  ARG n 
1 68  ASP n 
1 69  ARG n 
1 70  ALA n 
1 71  GLU n 
1 72  TRP n 
1 73  ALA n 
1 74  ASP n 
1 75  ILE n 
1 76  ASP n 
1 77  PRO n 
1 78  VAL n 
1 79  PRO n 
1 80  GLN n 
1 81  ASN n 
1 82  ASP n 
1 83  GLY n 
1 84  PRO n 
1 85  ASN n 
1 86  PRO n 
1 87  VAL n 
1 88  VAL n 
1 89  GLN n 
1 90  ILE n 
1 91  ILE n 
1 92  TYR n 
1 93  SER n 
1 94  ASP n 
1 95  LYS n 
1 96  PHE n 
1 97  ARG n 
1 98  ASP n 
1 99  VAL n 
1 100 TYR n 
1 101 ASP n 
1 102 TYR n 
1 103 PHE n 
1 104 ARG n 
1 105 ALA n 
1 106 VAL n 
1 107 LEU n 
1 108 GLN n 
1 109 ARG n 
1 110 ASP n 
1 111 GLU n 
1 112 ARG n 
1 113 SER n 
1 114 GLU n 
1 115 ARG n 
1 116 ALA n 
1 117 PHE n 
1 118 LYS n 
1 119 LEU n 
1 120 THR n 
1 121 ARG n 
1 122 ASP n 
1 123 ALA n 
1 124 ILE n 
1 125 GLU n 
1 126 LEU n 
1 127 ASN n 
1 128 ALA n 
1 129 ALA n 
1 130 ASN n 
1 131 TYR n 
1 132 THR n 
1 133 VAL n 
1 134 TRP n 
1 135 HIS n 
1 136 PHE n 
1 137 ARG n 
1 138 ARG n 
1 139 VAL n 
1 140 LEU n 
1 141 LEU n 
1 142 LYS n 
1 143 SER n 
1 144 LEU n 
1 145 GLN n 
1 146 LYS n 
1 147 ASP n 
1 148 LEU n 
1 149 HIS n 
1 150 GLU n 
1 151 GLU n 
1 152 MET n 
1 153 ASN n 
1 154 TYR n 
1 155 ILE n 
1 156 THR n 
1 157 ALA n 
1 158 ILE n 
1 159 ILE n 
1 160 GLU n 
1 161 GLU n 
1 162 GLN n 
1 163 PRO n 
1 164 LYS n 
1 165 ASN n 
1 166 TYR n 
1 167 GLN n 
1 168 VAL n 
1 169 TRP n 
1 170 HIS n 
1 171 HIS n 
1 172 ARG n 
1 173 ARG n 
1 174 VAL n 
1 175 LEU n 
1 176 VAL n 
1 177 GLU n 
1 178 TRP n 
1 179 LEU n 
1 180 ARG n 
1 181 ASP n 
1 182 PRO n 
1 183 SER n 
1 184 GLN n 
1 185 GLU n 
1 186 LEU n 
1 187 GLU n 
1 188 PHE n 
1 189 ILE n 
1 190 ALA n 
1 191 ASP n 
1 192 ILE n 
1 193 LEU n 
1 194 ASN n 
1 195 GLN n 
1 196 ASP n 
1 197 ALA n 
1 198 LYS n 
1 199 ASN n 
1 200 TYR n 
1 201 HIS n 
1 202 ALA n 
1 203 TRP n 
1 204 GLN n 
1 205 HIS n 
1 206 ARG n 
1 207 GLN n 
1 208 TRP n 
1 209 VAL n 
1 210 ILE n 
1 211 GLN n 
1 212 GLU n 
1 213 PHE n 
1 214 LYS n 
1 215 LEU n 
1 216 TRP n 
1 217 ASP n 
1 218 ASN n 
1 219 GLU n 
1 220 LEU n 
1 221 GLN n 
1 222 TYR n 
1 223 VAL n 
1 224 ASP n 
1 225 GLN n 
1 226 LEU n 
1 227 LEU n 
1 228 LYS n 
1 229 GLU n 
1 230 ASP n 
1 231 VAL n 
1 232 ARG n 
1 233 ASN n 
1 234 ASN n 
1 235 SER n 
1 236 VAL n 
1 237 TRP n 
1 238 ASN n 
1 239 GLN n 
1 240 ARG n 
1 241 TYR n 
1 242 PHE n 
1 243 VAL n 
1 244 ILE n 
1 245 SER n 
1 246 ASN n 
1 247 THR n 
1 248 THR n 
1 249 GLY n 
1 250 TYR n 
1 251 ASN n 
1 252 ASP n 
1 253 ARG n 
1 254 ALA n 
1 255 VAL n 
1 256 LEU n 
1 257 GLU n 
1 258 ARG n 
1 259 GLU n 
1 260 VAL n 
1 261 GLN n 
1 262 TYR n 
1 263 THR n 
1 264 LEU n 
1 265 GLU n 
1 266 MET n 
1 267 ILE n 
1 268 LYS n 
1 269 LEU n 
1 270 VAL n 
1 271 PRO n 
1 272 HIS n 
1 273 ASN n 
1 274 GLU n 
1 275 SER n 
1 276 ALA n 
1 277 TRP n 
1 278 ASN n 
1 279 TYR n 
1 280 LEU n 
1 281 LYS n 
1 282 GLY n 
1 283 ILE n 
1 284 LEU n 
1 285 GLN n 
1 286 ASP n 
1 287 ARG n 
1 288 GLY n 
1 289 LEU n 
1 290 SER n 
1 291 LYS n 
1 292 TYR n 
1 293 PRO n 
1 294 ASN n 
1 295 LEU n 
1 296 LEU n 
1 297 ASN n 
1 298 GLN n 
1 299 LEU n 
1 300 LEU n 
1 301 ASP n 
1 302 LEU n 
1 303 GLN n 
1 304 PRO n 
1 305 SER n 
1 306 HIS n 
1 307 SER n 
1 308 SER n 
1 309 PRO n 
1 310 TYR n 
1 311 LEU n 
1 312 ILE n 
1 313 ALA n 
1 314 PHE n 
1 315 LEU n 
1 316 VAL n 
1 317 ASP n 
1 318 ILE n 
1 319 TYR n 
1 320 GLU n 
1 321 ASP n 
1 322 MET n 
1 323 LEU n 
1 324 GLU n 
1 325 ASN n 
1 326 GLN n 
1 327 CYS n 
1 328 ASP n 
1 329 ASN n 
1 330 LYS n 
1 331 GLU n 
1 332 ASP n 
1 333 ILE n 
1 334 LEU n 
1 335 ASN n 
1 336 LYS n 
1 337 ALA n 
1 338 LEU n 
1 339 GLU n 
1 340 LEU n 
1 341 CYS n 
1 342 GLU n 
1 343 ILE n 
1 344 LEU n 
1 345 ALA n 
1 346 LYS n 
1 347 GLU n 
1 348 LYS n 
1 349 ASP n 
1 350 THR n 
1 351 ILE n 
1 352 ARG n 
1 353 LYS n 
1 354 GLU n 
1 355 TYR n 
1 356 TRP n 
1 357 ARG n 
1 358 TYR n 
1 359 ILE n 
1 360 GLY n 
1 361 ARG n 
1 362 SER n 
1 363 LEU n 
1 364 GLN n 
1 365 SER n 
1 366 LYS n 
1 367 HIS n 
1 368 SER n 
1 369 THR n 
1 370 GLU n 
1 371 ASN n 
1 372 ASP n 
1 373 SER n 
1 374 PRO n 
1 375 THR n 
1 376 ASN n 
1 377 VAL n 
1 378 GLN n 
1 379 GLN n 
1 380 GLU n 
1 381 GLU n 
1 382 PHE n 
2 1   MET n 
2 2   ALA n 
2 3   SER n 
2 4   PRO n 
2 5   SER n 
2 6   SER n 
2 7   PHE n 
2 8   THR n 
2 9   TYR n 
2 10  TYR n 
2 11  CYS n 
2 12  PRO n 
2 13  PRO n 
2 14  SER n 
2 15  SER n 
2 16  SER n 
2 17  PRO n 
2 18  VAL n 
2 19  TRP n 
2 20  SER n 
2 21  GLU n 
2 22  PRO n 
2 23  LEU n 
2 24  TYR n 
2 25  SER n 
2 26  LEU n 
2 27  ARG n 
2 28  PRO n 
2 29  GLU n 
2 30  HIS n 
2 31  ALA n 
2 32  ARG n 
2 33  GLU n 
2 34  ARG n 
2 35  LEU n 
2 36  GLN n 
2 37  ASP n 
2 38  ASP n 
2 39  SER n 
2 40  VAL n 
2 41  GLU n 
2 42  THR n 
2 43  VAL n 
2 44  THR n 
2 45  SER n 
2 46  ILE n 
2 47  GLU n 
2 48  GLN n 
2 49  ALA n 
2 50  LYS n 
2 51  VAL n 
2 52  GLU n 
2 53  GLU n 
2 54  LYS n 
2 55  ILE n 
2 56  GLN n 
2 57  GLU n 
2 58  VAL n 
2 59  PHE n 
2 60  SER n 
2 61  SER n 
2 62  TYR n 
2 63  LYS n 
2 64  PHE n 
2 65  ASN n 
2 66  HIS n 
2 67  LEU n 
2 68  VAL n 
2 69  PRO n 
2 70  ARG n 
2 71  LEU n 
2 72  VAL n 
2 73  LEU n 
2 74  GLN n 
2 75  ARG n 
2 76  GLU n 
2 77  LYS n 
2 78  HIS n 
2 79  PHE n 
2 80  HIS n 
2 81  TYR n 
2 82  LEU n 
2 83  LYS n 
2 84  ARG n 
2 85  GLY n 
2 86  LEU n 
2 87  ARG n 
2 88  GLN n 
2 89  LEU n 
2 90  THR n 
2 91  ASP n 
2 92  ALA n 
2 93  TYR n 
2 94  GLU n 
2 95  CYS n 
2 96  LEU n 
2 97  ASP n 
2 98  ALA n 
2 99  SER n 
2 100 ARG n 
2 101 PRO n 
2 102 TRP n 
2 103 LEU n 
2 104 CYS n 
2 105 TYR n 
2 106 TRP n 
2 107 ILE n 
2 108 LEU n 
2 109 HIS n 
2 110 SER n 
2 111 LEU n 
2 112 GLU n 
2 113 LEU n 
2 114 LEU n 
2 115 ASP n 
2 116 GLU n 
2 117 PRO n 
2 118 ILE n 
2 119 PRO n 
2 120 GLN n 
2 121 ILE n 
2 122 VAL n 
2 123 ALA n 
2 124 THR n 
2 125 ASP n 
2 126 VAL n 
2 127 CYS n 
2 128 GLN n 
2 129 PHE n 
2 130 LEU n 
2 131 GLU n 
2 132 LEU n 
2 133 CYS n 
2 134 GLN n 
2 135 SER n 
2 136 PRO n 
2 137 GLU n 
2 138 GLY n 
2 139 GLY n 
2 140 PHE n 
2 141 GLY n 
2 142 GLY n 
2 143 GLY n 
2 144 PRO n 
2 145 GLY n 
2 146 GLN n 
2 147 TYR n 
2 148 PRO n 
2 149 HIS n 
2 150 LEU n 
2 151 ALA n 
2 152 PRO n 
2 153 THR n 
2 154 TYR n 
2 155 ALA n 
2 156 ALA n 
2 157 VAL n 
2 158 ASN n 
2 159 ALA n 
2 160 LEU n 
2 161 CYS n 
2 162 ILE n 
2 163 ILE n 
2 164 GLY n 
2 165 THR n 
2 166 GLU n 
2 167 GLU n 
2 168 ALA n 
2 169 TYR n 
2 170 ASP n 
2 171 ILE n 
2 172 ILE n 
2 173 ASN n 
2 174 ARG n 
2 175 GLU n 
2 176 LYS n 
2 177 LEU n 
2 178 LEU n 
2 179 GLN n 
2 180 TYR n 
2 181 LEU n 
2 182 TYR n 
2 183 SER n 
2 184 LEU n 
2 185 LYS n 
2 186 GLN n 
2 187 PRO n 
2 188 ASP n 
2 189 GLY n 
2 190 SER n 
2 191 PHE n 
2 192 LEU n 
2 193 MET n 
2 194 HIS n 
2 195 VAL n 
2 196 GLY n 
2 197 GLY n 
2 198 GLU n 
2 199 VAL n 
2 200 ASP n 
2 201 VAL n 
2 202 ARG n 
2 203 SER n 
2 204 ALA n 
2 205 TYR n 
2 206 CYS n 
2 207 ALA n 
2 208 ALA n 
2 209 SER n 
2 210 VAL n 
2 211 ALA n 
2 212 SER n 
2 213 LEU n 
2 214 THR n 
2 215 ASN n 
2 216 ILE n 
2 217 ILE n 
2 218 THR n 
2 219 PRO n 
2 220 ASP n 
2 221 LEU n 
2 222 PHE n 
2 223 GLU n 
2 224 GLY n 
2 225 THR n 
2 226 ALA n 
2 227 GLU n 
2 228 TRP n 
2 229 ILE n 
2 230 ALA n 
2 231 ARG n 
2 232 CYS n 
2 233 GLN n 
2 234 ASN n 
2 235 TRP n 
2 236 GLU n 
2 237 GLY n 
2 238 GLY n 
2 239 ILE n 
2 240 GLY n 
2 241 GLY n 
2 242 VAL n 
2 243 PRO n 
2 244 GLY n 
2 245 MET n 
2 246 GLU n 
2 247 ALA n 
2 248 HIS n 
2 249 GLY n 
2 250 GLY n 
2 251 TYR n 
2 252 THR n 
2 253 PHE n 
2 254 CYS n 
2 255 GLY n 
2 256 LEU n 
2 257 ALA n 
2 258 ALA n 
2 259 LEU n 
2 260 VAL n 
2 261 ILE n 
2 262 LEU n 
2 263 LYS n 
2 264 ARG n 
2 265 GLU n 
2 266 ARG n 
2 267 SER n 
2 268 LEU n 
2 269 ASN n 
2 270 LEU n 
2 271 LYS n 
2 272 SER n 
2 273 LEU n 
2 274 LEU n 
2 275 GLN n 
2 276 TRP n 
2 277 VAL n 
2 278 THR n 
2 279 SER n 
2 280 ARG n 
2 281 GLN n 
2 282 MET n 
2 283 ARG n 
2 284 PHE n 
2 285 GLU n 
2 286 GLY n 
2 287 GLY n 
2 288 PHE n 
2 289 GLN n 
2 290 GLY n 
2 291 ARG n 
2 292 CYS n 
2 293 ASN n 
2 294 LYS n 
2 295 LEU n 
2 296 VAL n 
2 297 ASP n 
2 298 GLY n 
2 299 CYS n 
2 300 TYR n 
2 301 SER n 
2 302 PHE n 
2 303 TRP n 
2 304 GLN n 
2 305 ALA n 
2 306 GLY n 
2 307 LEU n 
2 308 LEU n 
2 309 PRO n 
2 310 LEU n 
2 311 LEU n 
2 312 HIS n 
2 313 ARG n 
2 314 ALA n 
2 315 LEU n 
2 316 HIS n 
2 317 ALA n 
2 318 GLN n 
2 319 GLY n 
2 320 ASP n 
2 321 PRO n 
2 322 ALA n 
2 323 LEU n 
2 324 SER n 
2 325 MET n 
2 326 SER n 
2 327 HIS n 
2 328 TRP n 
2 329 MET n 
2 330 PHE n 
2 331 HIS n 
2 332 GLN n 
2 333 GLN n 
2 334 ALA n 
2 335 LEU n 
2 336 GLN n 
2 337 GLU n 
2 338 TYR n 
2 339 ILE n 
2 340 LEU n 
2 341 MET n 
2 342 CYS n 
2 343 CYS n 
2 344 GLN n 
2 345 CYS n 
2 346 PRO n 
2 347 ALA n 
2 348 GLY n 
2 349 GLY n 
2 350 LEU n 
2 351 LEU n 
2 352 ASP n 
2 353 LYS n 
2 354 PRO n 
2 355 GLY n 
2 356 LYS n 
2 357 SER n 
2 358 ARG n 
2 359 ASP n 
2 360 PHE n 
2 361 TYR n 
2 362 HIS n 
2 363 THR n 
2 364 CYS n 
2 365 TYR n 
2 366 CYS n 
2 367 LEU n 
2 368 SER n 
2 369 GLY n 
2 370 LEU n 
2 371 SER n 
2 372 ILE n 
2 373 ALA n 
2 374 GLN n 
2 375 HIS n 
2 376 PHE n 
2 377 GLY n 
2 378 SER n 
2 379 GLY n 
2 380 ALA n 
2 381 MET n 
2 382 LEU n 
2 383 HIS n 
2 384 ASP n 
2 385 VAL n 
2 386 VAL n 
2 387 LEU n 
2 388 GLY n 
2 389 VAL n 
2 390 PRO n 
2 391 GLU n 
2 392 ASN n 
2 393 ALA n 
2 394 LEU n 
2 395 GLN n 
2 396 PRO n 
2 397 THR n 
2 398 HIS n 
2 399 PRO n 
2 400 VAL n 
2 401 TYR n 
2 402 ASN n 
2 403 ILE n 
2 404 GLY n 
2 405 PRO n 
2 406 ASP n 
2 407 LYS n 
2 408 VAL n 
2 409 ILE n 
2 410 GLN n 
2 411 ALA n 
2 412 THR n 
2 413 THR n 
2 414 TYR n 
2 415 PHE n 
2 416 LEU n 
2 417 GLN n 
2 418 LYS n 
2 419 PRO n 
2 420 VAL n 
2 421 PRO n 
2 422 GLY n 
2 423 PHE n 
2 424 GLU n 
2 425 GLU n 
2 426 LEU n 
2 427 LYS n 
2 428 ASP n 
2 429 GLU n 
2 430 THR n 
2 431 SER n 
2 432 ALA n 
2 433 GLU n 
2 434 PRO n 
2 435 ALA n 
2 436 THR n 
2 437 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? ? ? ? ? ? ? ? ? 
? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP PFTA_HUMAN 1 
;MAATEGVGEAAQGGEPGQPAQPPPQPHPPPPQQQHKEEMAAEAGEAVASPMDDGFVSLDSPSYVLYRDRAEWADIDPVPQ
NDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIE
EQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQR
YFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYE
DMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSTENDSPTNVQQ
;
1 P49354 ? 
2 UNP PFTB_HUMAN 2 
;MASPSSFTYYCPPSSSPVWSEPLYSLRPEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREKHFH
YLKRGLRQLTDAYECLDASRPWLCYWILHSLELLDEPIPQIVATDVCQFLELCQSPEGGFGGGPGQYPHLAPTYAAVNAL
CIIGTEEAYDIINREKLLQYLYSLKQPDGSFLMHVGGEVDVRSAYCAASVASLTNIITPDLFEGTAEWIARCQNWEGGIG
GVPGMEAHGGYTFCGLAALVILKRERSLNLKSLLQWVTSRQMRFEGGFQGRCNKLVDGCYSFWQAGLLPLLHRALHAQGD
PALSMSHWMFHQQALQEYILMCCQCPAGGLLDKPGKSRDFYHTCYCLSGLSIAQHFGSGAMLHDVVLGVPENALQPTHPV
YNIGPDKVIQATTYFLQKPVPGFEELKDETSAEPATD
;
1 P49356 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1MZC A 1 ? 379 ? P49354 1 ? 379 ? 1   379 
2 2 1MZC B 1 ? 437 ? P49356 1 ? 437 ? 501 937 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1MZC GLU A 380 ? UNP P49354 ? ? 'cloning artifact' 380 1 
1 1MZC GLU A 381 ? UNP P49354 ? ? 'cloning artifact' 381 2 
1 1MZC PHE A 382 ? UNP P49354 ? ? 'cloning artifact' 382 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
BNE non-polymer                   . 
'2-[3-(3-ETHYL-1-METHYL-2-OXO-AZEPAN-3-YL)-PHENOXY]-4-[1-AMINO-1-(1-METHYL-1H-IMIDIZOL-5-YL)-ETHYL]-BENZONITRILE' ? 
'C28 H33 N5 O2'  471.594 
CYS 'L-peptide linking'           y CYSTEINE ? 'C3 H7 N O2 S'   121.158 
FPP non-polymer                   . 'FARNESYL DIPHOSPHATE' ? 'C15 H28 O7 P2'  382.326 
FRU 'D-saccharide, beta linking'  . beta-D-fructofuranose ? 'C6 H12 O6'      180.156 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose ? 'C6 H12 O6'      180.156 
GLN 'L-peptide linking'           y GLUTAMINE ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking'           y PHENYLALANINE ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE ? 'C5 H11 N O2'    117.146 
ZN  non-polymer                   . 'ZINC ION' ? 'Zn 2'           65.409  
# 
_exptl.entry_id          1MZC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.16 
_exptl_crystal.density_percent_sol   61.13 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            290 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pdbx_details    'PEG8K NH4OAc, pH 5.5, VAPOR DIFFUSION, HANGING DROP, temperature 290K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2000-02-17 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'YALE MIRRORS' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU200' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1MZC 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             36.7 
_reflns.d_resolution_high            2.0 
_reflns.number_obs                   75205 
_reflns.number_all                   75205 
_reflns.percent_possible_obs         94.8 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.078 
_reflns.pdbx_netI_over_sigmaI        14.4 
_reflns.B_iso_Wilson_estimate        14.1 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2 
_reflns_shell.d_res_low              2.03 
_reflns_shell.percent_possible_all   82.1 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.341 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3242 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1MZC 
_refine.ls_number_reflns_obs                     75205 
_refine.ls_number_reflns_all                     75230 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             36.70 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    94.8 
_refine.ls_R_factor_obs                          0.177 
_refine.ls_R_factor_all                          0.177 
_refine.ls_R_factor_R_work                       0.177 
_refine.ls_R_factor_R_free                       0.205 
_refine.ls_R_factor_R_free_error                 .003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  3785 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               21.9 
_refine.aniso_B[1][1]                            .86 
_refine.aniso_B[2][2]                            1.20 
_refine.aniso_B[3][3]                            -2.06 
_refine.aniso_B[1][2]                            2.37 
_refine.aniso_B[1][3]                            .00 
_refine.aniso_B[2][3]                            .00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 .399425 
_refine.solvent_model_param_bsol                 57.8835 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1JCQ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1MZC 
_refine_analyze.Luzzati_coordinate_error_obs    0.20 
_refine_analyze.Luzzati_sigma_a_obs             0.17 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   .23 
_refine_analyze.Luzzati_sigma_a_free            .19 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5877 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         83 
_refine_hist.number_atoms_solvent             703 
_refine_hist.number_atoms_total               6663 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        36.70 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                .006 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      19.7 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      .76  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?    ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             .70  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            1.17 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             1.18 2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            1.85 2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.00 
_refine_ls_shell.d_res_low                        2.13 
_refine_ls_shell.number_reflns_R_work             10613 
_refine_ls_shell.R_factor_R_work                  0.232 
_refine_ls_shell.percent_reflns_obs               85.3 
_refine_ls_shell.R_factor_R_free                  0.261 
_refine_ls_shell.R_factor_R_free_error            .011 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             569 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
3 SUCROSE.PAR       SUCROSE.TOP 'X-RAY DIFFRACTION' 
4 ION.PARAM         ION.TOP     'X-RAY DIFFRACTION' 
5 FPP.PAR           FPP.TOP     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1MZC 
_struct.title                     
'Co-Crystal Structure Of Human Farnesyltransferase With Farnesyldiphosphate and Inhibitor Compound 33a' 
_struct.pdbx_descriptor           
'Protein Farnesyltransferase alpha Subunit (E.C.2.5.1.-)/Protein Farnesyltransferase beta Subunit (E.C.2.5.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1MZC 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'ALPHA-ALPHA BARREL, INHIBITOR, FTASE, PFTASE, FPP, CAAX, RAS, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               'The asymmetric unit contains one complete biological unit (heterodimer)' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LEU A 65  ? ALA A 73  ? LEU A 65  ALA A 73  5 ? 9  
HELX_P HELX_P2  2  SER A 93  ? ASP A 110 ? SER A 93  ASP A 110 1 ? 18 
HELX_P HELX_P3  3  SER A 113 ? ASN A 127 ? SER A 113 ASN A 127 1 ? 15 
HELX_P HELX_P4  4  ASN A 130 ? LEU A 144 ? ASN A 130 LEU A 144 1 ? 15 
HELX_P HELX_P5  5  ASP A 147 ? GLN A 162 ? ASP A 147 GLN A 162 1 ? 16 
HELX_P HELX_P6  6  ASN A 165 ? ARG A 180 ? ASN A 165 ARG A 180 1 ? 16 
HELX_P HELX_P7  7  GLN A 184 ? ASP A 196 ? GLN A 184 ASP A 196 1 ? 13 
HELX_P HELX_P8  8  ASN A 199 ? LYS A 214 ? ASN A 199 LYS A 214 1 ? 16 
HELX_P HELX_P9  9  ASN A 218 ? ASP A 230 ? ASN A 218 ASP A 230 1 ? 13 
HELX_P HELX_P10 10 ASN A 233 ? THR A 247 ? ASN A 233 THR A 247 1 ? 15 
HELX_P HELX_P11 11 ASP A 252 ? VAL A 270 ? ASP A 252 VAL A 270 1 ? 19 
HELX_P HELX_P12 12 ASN A 273 ? GLN A 285 ? ASN A 273 GLN A 285 1 ? 13 
HELX_P HELX_P13 13 GLY A 288 ? LYS A 291 ? GLY A 288 LYS A 291 5 ? 4  
HELX_P HELX_P14 14 TYR A 292 ? GLN A 303 ? TYR A 292 GLN A 303 1 ? 12 
HELX_P HELX_P15 15 SER A 308 ? ASN A 325 ? SER A 308 ASN A 325 1 ? 18 
HELX_P HELX_P16 16 ASN A 329 ? GLU A 347 ? ASN A 329 GLU A 347 1 ? 19 
HELX_P HELX_P17 17 ASP A 349 ? ILE A 351 ? ASP A 349 ILE A 351 5 ? 3  
HELX_P HELX_P18 18 ARG A 352 ? HIS A 367 ? ARG A 352 HIS A 367 1 ? 16 
HELX_P HELX_P19 19 LEU B 23  ? ARG B 34  ? LEU B 523 ARG B 534 5 ? 12 
HELX_P HELX_P20 20 THR B 42  ? SER B 61  ? THR B 542 SER B 561 1 ? 20 
HELX_P HELX_P21 21 GLN B 74  ? LEU B 86  ? GLN B 574 LEU B 586 1 ? 13 
HELX_P HELX_P22 22 THR B 90  ? ASP B 97  ? THR B 590 ASP B 597 5 ? 8  
HELX_P HELX_P23 23 SER B 99  ? LEU B 114 ? SER B 599 LEU B 614 1 ? 16 
HELX_P HELX_P24 24 PRO B 119 ? GLN B 134 ? PRO B 619 GLN B 634 1 ? 16 
HELX_P HELX_P25 25 HIS B 149 ? GLY B 164 ? HIS B 649 GLY B 664 1 ? 16 
HELX_P HELX_P26 26 THR B 165 ? ILE B 172 ? THR B 665 ILE B 672 1 ? 8  
HELX_P HELX_P27 27 ASN B 173 ? SER B 183 ? ASN B 673 SER B 683 1 ? 11 
HELX_P HELX_P28 28 ASP B 200 ? THR B 214 ? ASP B 700 THR B 714 1 ? 15 
HELX_P HELX_P29 29 GLY B 224 ? CYS B 232 ? GLY B 724 CYS B 732 1 ? 9  
HELX_P HELX_P30 30 HIS B 248 ? LYS B 263 ? HIS B 748 LYS B 763 1 ? 16 
HELX_P HELX_P31 31 ARG B 264 ? LEU B 268 ? ARG B 764 LEU B 768 5 ? 5  
HELX_P HELX_P32 32 ASN B 269 ? ARG B 280 ? ASN B 769 ARG B 780 1 ? 12 
HELX_P HELX_P33 33 CYS B 299 ? GLN B 304 ? CYS B 799 GLN B 804 1 ? 6  
HELX_P HELX_P34 34 GLY B 306 ? GLN B 318 ? GLY B 806 GLN B 818 1 ? 13 
HELX_P HELX_P35 35 HIS B 331 ? CYS B 343 ? HIS B 831 CYS B 843 1 ? 13 
HELX_P HELX_P36 36 ASP B 359 ? GLN B 374 ? ASP B 859 GLN B 874 1 ? 16 
HELX_P HELX_P37 37 VAL B 389 ? ALA B 393 ? VAL B 889 ALA B 893 5 ? 5  
HELX_P HELX_P38 38 GLY B 404 ? GLN B 417 ? GLY B 904 GLN B 917 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1 covale both ? C GLC .   C1  ? ? ? 1_555 C FRU . O2 ? ? C GLC 1    C FRU 2    1_555 ? ? ? ? ? ? ? 1.462 sing ? 
metalc1 metalc ?    ? B ASP 297 OD1 ? ? ? 1_555 D ZN  . ZN ? ? B ASP 797  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.554 ?    ? 
metalc2 metalc ?    ? B ASP 297 OD2 ? ? ? 1_555 D ZN  . ZN ? ? B ASP 797  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.059 ?    ? 
metalc3 metalc ?    ? B CYS 299 SG  ? ? ? 1_555 D ZN  . ZN ? ? B CYS 799  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.375 ?    ? 
metalc4 metalc ?    ? B HIS 362 NE2 ? ? ? 1_555 D ZN  . ZN ? ? B HIS 862  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.097 ?    ? 
metalc5 metalc ?    ? D ZN  .   ZN  ? ? ? 1_555 F BNE . NZ ? ? B ZN  1001 B BNE 1003 1_555 ? ? ? ? ? ? ? 1.934 ?    ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 89  ? ILE A 90  ? GLN A 89  ILE A 90  
A 2 GLN B 88  ? LEU B 89  ? GLN B 588 LEU B 589 
B 1 HIS B 375 ? SER B 378 ? HIS B 875 SER B 878 
B 2 MET B 381 ? ASP B 384 ? MET B 881 ASP B 884 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 89  ? N GLN A 89  O LEU B 89  ? O LEU B 589 
B 1 2 N SER B 378 ? N SER B 878 O MET B 381 ? O MET B 881 
# 
_database_PDB_matrix.entry_id          1MZC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       .000000 
_database_PDB_matrix.origx[1][3]       .000000 
_database_PDB_matrix.origx[2][1]       .000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       .000000 
_database_PDB_matrix.origx[3][1]       .000000 
_database_PDB_matrix.origx[3][2]       .000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   .00000 
_database_PDB_matrix.origx_vector[2]   .00000 
_database_PDB_matrix.origx_vector[3]   .00000 
# 
_atom_sites.entry_id                    1MZC 
_atom_sites.fract_transf_matrix[1][1]   .005606 
_atom_sites.fract_transf_matrix[1][2]   .003237 
_atom_sites.fract_transf_matrix[1][3]   .000000 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .006473 
_atom_sites.fract_transf_matrix[2][3]   .000000 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .015485 
_atom_sites.fract_transf_vector[1]      .00000 
_atom_sites.fract_transf_vector[2]      .00000 
_atom_sites.fract_transf_vector[3]      .00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PHE A 1 55  ? 27.645  159.202 -17.234 1.00 46.45 ? 55   PHE A N   1 
ATOM   2    C  CA  . PHE A 1 55  ? 27.518  160.687 -17.152 1.00 46.34 ? 55   PHE A CA  1 
ATOM   3    C  C   . PHE A 1 55  ? 27.237  161.169 -15.735 1.00 45.26 ? 55   PHE A C   1 
ATOM   4    O  O   . PHE A 1 55  ? 28.069  161.842 -15.124 1.00 45.69 ? 55   PHE A O   1 
ATOM   5    C  CB  . PHE A 1 55  ? 26.409  161.180 -18.090 1.00 47.41 ? 55   PHE A CB  1 
ATOM   6    C  CG  . PHE A 1 55  ? 26.890  161.533 -19.472 1.00 48.68 ? 55   PHE A CG  1 
ATOM   7    C  CD1 . PHE A 1 55  ? 26.015  162.083 -20.403 1.00 49.25 ? 55   PHE A CD1 1 
ATOM   8    C  CD2 . PHE A 1 55  ? 28.221  161.337 -19.836 1.00 49.50 ? 55   PHE A CD2 1 
ATOM   9    C  CE1 . PHE A 1 55  ? 26.458  162.436 -21.681 1.00 49.96 ? 55   PHE A CE1 1 
ATOM   10   C  CE2 . PHE A 1 55  ? 28.676  161.687 -21.109 1.00 50.04 ? 55   PHE A CE2 1 
ATOM   11   C  CZ  . PHE A 1 55  ? 27.791  162.239 -22.034 1.00 50.12 ? 55   PHE A CZ  1 
ATOM   12   N  N   . VAL A 1 56  ? 26.061  160.829 -15.218 1.00 43.47 ? 56   VAL A N   1 
ATOM   13   C  CA  . VAL A 1 56  ? 25.683  161.232 -13.871 1.00 41.29 ? 56   VAL A CA  1 
ATOM   14   C  C   . VAL A 1 56  ? 25.008  160.082 -13.129 1.00 39.75 ? 56   VAL A C   1 
ATOM   15   O  O   . VAL A 1 56  ? 24.065  159.472 -13.634 1.00 39.13 ? 56   VAL A O   1 
ATOM   16   C  CB  . VAL A 1 56  ? 24.726  162.445 -13.899 1.00 41.39 ? 56   VAL A CB  1 
ATOM   17   C  CG1 . VAL A 1 56  ? 24.479  162.949 -12.486 1.00 41.03 ? 56   VAL A CG1 1 
ATOM   18   C  CG2 . VAL A 1 56  ? 25.315  163.547 -14.754 1.00 41.61 ? 56   VAL A CG2 1 
ATOM   19   N  N   . SER A 1 57  ? 25.507  159.800 -11.928 1.00 38.12 ? 57   SER A N   1 
ATOM   20   C  CA  . SER A 1 57  ? 24.985  158.733 -11.079 1.00 37.01 ? 57   SER A CA  1 
ATOM   21   C  C   . SER A 1 57  ? 23.715  159.147 -10.341 1.00 35.75 ? 57   SER A C   1 
ATOM   22   O  O   . SER A 1 57  ? 23.429  160.334 -10.193 1.00 35.48 ? 57   SER A O   1 
ATOM   23   C  CB  . SER A 1 57  ? 26.051  158.316 -10.063 1.00 37.34 ? 57   SER A CB  1 
ATOM   24   O  OG  . SER A 1 57  ? 25.480  157.589 -8.987  1.00 39.35 ? 57   SER A OG  1 
ATOM   25   N  N   . LEU A 1 58  ? 22.966  158.155 -9.867  1.00 34.39 ? 58   LEU A N   1 
ATOM   26   C  CA  . LEU A 1 58  ? 21.721  158.394 -9.145  1.00 33.26 ? 58   LEU A CA  1 
ATOM   27   C  C   . LEU A 1 58  ? 21.903  159.174 -7.850  1.00 32.25 ? 58   LEU A C   1 
ATOM   28   O  O   . LEU A 1 58  ? 20.961  159.798 -7.365  1.00 31.73 ? 58   LEU A O   1 
ATOM   29   C  CB  . LEU A 1 58  ? 21.031  157.062 -8.837  1.00 33.62 ? 58   LEU A CB  1 
ATOM   30   C  CG  . LEU A 1 58  ? 20.085  156.530 -9.916  1.00 34.31 ? 58   LEU A CG  1 
ATOM   31   C  CD1 . LEU A 1 58  ? 19.986  155.020 -9.826  1.00 35.21 ? 58   LEU A CD1 1 
ATOM   32   C  CD2 . LEU A 1 58  ? 18.719  157.179 -9.752  1.00 34.17 ? 58   LEU A CD2 1 
ATOM   33   N  N   . ASP A 1 59  ? 23.108  159.133 -7.290  1.00 31.56 ? 59   ASP A N   1 
ATOM   34   C  CA  . ASP A 1 59  ? 23.387  159.834 -6.044  1.00 30.89 ? 59   ASP A CA  1 
ATOM   35   C  C   . ASP A 1 59  ? 24.163  161.129 -6.257  1.00 29.57 ? 59   ASP A C   1 
ATOM   36   O  O   . ASP A 1 59  ? 24.429  161.856 -5.303  1.00 29.75 ? 59   ASP A O   1 
ATOM   37   C  CB  . ASP A 1 59  ? 24.177  158.931 -5.095  1.00 32.89 ? 59   ASP A CB  1 
ATOM   38   C  CG  . ASP A 1 59  ? 23.568  157.551 -4.965  1.00 35.39 ? 59   ASP A CG  1 
ATOM   39   O  OD1 . ASP A 1 59  ? 23.653  156.775 -5.944  1.00 37.27 ? 59   ASP A OD1 1 
ATOM   40   O  OD2 . ASP A 1 59  ? 22.999  157.245 -3.893  1.00 35.58 ? 59   ASP A OD2 1 
ATOM   41   N  N   . SER A 1 60  ? 24.528  161.413 -7.503  1.00 27.67 ? 60   SER A N   1 
ATOM   42   C  CA  . SER A 1 60  ? 25.279  162.625 -7.819  1.00 26.49 ? 60   SER A CA  1 
ATOM   43   C  C   . SER A 1 60  ? 24.470  163.881 -7.508  1.00 24.69 ? 60   SER A C   1 
ATOM   44   O  O   . SER A 1 60  ? 23.260  163.918 -7.722  1.00 24.28 ? 60   SER A O   1 
ATOM   45   C  CB  . SER A 1 60  ? 25.673  162.625 -9.295  1.00 26.79 ? 60   SER A CB  1 
ATOM   46   O  OG  . SER A 1 60  ? 26.463  161.490 -9.602  1.00 28.86 ? 60   SER A OG  1 
ATOM   47   N  N   . PRO A 1 61  ? 25.133  164.935 -7.004  1.00 23.70 ? 61   PRO A N   1 
ATOM   48   C  CA  . PRO A 1 61  ? 24.422  166.175 -6.680  1.00 23.01 ? 61   PRO A CA  1 
ATOM   49   C  C   . PRO A 1 61  ? 23.697  166.807 -7.871  1.00 22.01 ? 61   PRO A C   1 
ATOM   50   O  O   . PRO A 1 61  ? 22.650  167.428 -7.701  1.00 21.79 ? 61   PRO A O   1 
ATOM   51   C  CB  . PRO A 1 61  ? 25.527  167.071 -6.109  1.00 23.42 ? 61   PRO A CB  1 
ATOM   52   C  CG  . PRO A 1 61  ? 26.760  166.574 -6.794  1.00 23.21 ? 61   PRO A CG  1 
ATOM   53   C  CD  . PRO A 1 61  ? 26.576  165.076 -6.742  1.00 23.35 ? 61   PRO A CD  1 
ATOM   54   N  N   . SER A 1 62  ? 24.232  166.627 -9.075  1.00 21.13 ? 62   SER A N   1 
ATOM   55   C  CA  . SER A 1 62  ? 23.610  167.209 -10.259 1.00 20.73 ? 62   SER A CA  1 
ATOM   56   C  C   . SER A 1 62  ? 22.683  166.264 -11.028 1.00 20.40 ? 62   SER A C   1 
ATOM   57   O  O   . SER A 1 62  ? 22.281  166.570 -12.150 1.00 19.61 ? 62   SER A O   1 
ATOM   58   C  CB  . SER A 1 62  ? 24.682  167.757 -11.211 1.00 21.09 ? 62   SER A CB  1 
ATOM   59   O  OG  . SER A 1 62  ? 25.370  166.718 -11.886 1.00 22.29 ? 62   SER A OG  1 
ATOM   60   N  N   . TYR A 1 63  ? 22.339  165.126 -10.428 1.00 20.53 ? 63   TYR A N   1 
ATOM   61   C  CA  . TYR A 1 63  ? 21.445  164.167 -11.080 1.00 20.54 ? 63   TYR A CA  1 
ATOM   62   C  C   . TYR A 1 63  ? 20.088  164.822 -11.331 1.00 20.22 ? 63   TYR A C   1 
ATOM   63   O  O   . TYR A 1 63  ? 19.575  165.542 -10.480 1.00 20.78 ? 63   TYR A O   1 
ATOM   64   C  CB  . TYR A 1 63  ? 21.248  162.927 -10.201 1.00 20.36 ? 63   TYR A CB  1 
ATOM   65   C  CG  . TYR A 1 63  ? 20.292  161.896 -10.782 1.00 20.35 ? 63   TYR A CG  1 
ATOM   66   C  CD1 . TYR A 1 63  ? 20.715  160.980 -11.746 1.00 20.08 ? 63   TYR A CD1 1 
ATOM   67   C  CD2 . TYR A 1 63  ? 18.961  161.839 -10.362 1.00 20.00 ? 63   TYR A CD2 1 
ATOM   68   C  CE1 . TYR A 1 63  ? 19.836  160.027 -12.275 1.00 19.52 ? 63   TYR A CE1 1 
ATOM   69   C  CE2 . TYR A 1 63  ? 18.075  160.894 -10.884 1.00 20.11 ? 63   TYR A CE2 1 
ATOM   70   C  CZ  . TYR A 1 63  ? 18.518  159.990 -11.838 1.00 20.83 ? 63   TYR A CZ  1 
ATOM   71   O  OH  . TYR A 1 63  ? 17.643  159.051 -12.344 1.00 19.55 ? 63   TYR A OH  1 
ATOM   72   N  N   . VAL A 1 64  ? 19.511  164.558 -12.497 1.00 19.89 ? 64   VAL A N   1 
ATOM   73   C  CA  . VAL A 1 64  ? 18.216  165.112 -12.871 1.00 19.87 ? 64   VAL A CA  1 
ATOM   74   C  C   . VAL A 1 64  ? 17.269  163.979 -13.263 1.00 20.73 ? 64   VAL A C   1 
ATOM   75   O  O   . VAL A 1 64  ? 17.658  163.074 -14.002 1.00 20.23 ? 64   VAL A O   1 
ATOM   76   C  CB  . VAL A 1 64  ? 18.356  166.076 -14.078 1.00 19.86 ? 64   VAL A CB  1 
ATOM   77   C  CG1 . VAL A 1 64  ? 16.979  166.511 -14.573 1.00 19.86 ? 64   VAL A CG1 1 
ATOM   78   C  CG2 . VAL A 1 64  ? 19.179  167.295 -13.678 1.00 20.14 ? 64   VAL A CG2 1 
ATOM   79   N  N   . LEU A 1 65  ? 16.032  164.033 -12.770 1.00 20.99 ? 65   LEU A N   1 
ATOM   80   C  CA  . LEU A 1 65  ? 15.035  163.013 -13.095 1.00 21.73 ? 65   LEU A CA  1 
ATOM   81   C  C   . LEU A 1 65  ? 14.815  163.000 -14.605 1.00 21.49 ? 65   LEU A C   1 
ATOM   82   O  O   . LEU A 1 65  ? 14.849  164.046 -15.253 1.00 21.66 ? 65   LEU A O   1 
ATOM   83   C  CB  . LEU A 1 65  ? 13.703  163.315 -12.400 1.00 22.48 ? 65   LEU A CB  1 
ATOM   84   C  CG  . LEU A 1 65  ? 13.701  163.449 -10.879 1.00 24.26 ? 65   LEU A CG  1 
ATOM   85   C  CD1 . LEU A 1 65  ? 12.304  163.846 -10.411 1.00 25.24 ? 65   LEU A CD1 1 
ATOM   86   C  CD2 . LEU A 1 65  ? 14.132  162.138 -10.241 1.00 24.65 ? 65   LEU A CD2 1 
ATOM   87   N  N   . TYR A 1 66  ? 14.578  161.819 -15.164 1.00 21.14 ? 66   TYR A N   1 
ATOM   88   C  CA  . TYR A 1 66  ? 14.366  161.707 -16.598 1.00 20.53 ? 66   TYR A CA  1 
ATOM   89   C  C   . TYR A 1 66  ? 13.179  162.527 -17.104 1.00 20.93 ? 66   TYR A C   1 
ATOM   90   O  O   . TYR A 1 66  ? 13.192  163.006 -18.240 1.00 20.52 ? 66   TYR A O   1 
ATOM   91   C  CB  . TYR A 1 66  ? 14.215  160.234 -16.997 1.00 19.49 ? 66   TYR A CB  1 
ATOM   92   C  CG  . TYR A 1 66  ? 15.542  159.500 -17.021 1.00 18.86 ? 66   TYR A CG  1 
ATOM   93   C  CD1 . TYR A 1 66  ? 16.151  159.075 -15.840 1.00 17.87 ? 66   TYR A CD1 1 
ATOM   94   C  CD2 . TYR A 1 66  ? 16.218  159.285 -18.223 1.00 18.82 ? 66   TYR A CD2 1 
ATOM   95   C  CE1 . TYR A 1 66  ? 17.402  158.456 -15.853 1.00 17.27 ? 66   TYR A CE1 1 
ATOM   96   C  CE2 . TYR A 1 66  ? 17.473  158.668 -18.248 1.00 18.49 ? 66   TYR A CE2 1 
ATOM   97   C  CZ  . TYR A 1 66  ? 18.057  158.258 -17.059 1.00 18.33 ? 66   TYR A CZ  1 
ATOM   98   O  OH  . TYR A 1 66  ? 19.299  157.658 -17.076 1.00 17.89 ? 66   TYR A OH  1 
ATOM   99   N  N   . ARG A 1 67  ? 12.159  162.701 -16.268 1.00 20.83 ? 67   ARG A N   1 
ATOM   100  C  CA  . ARG A 1 67  ? 10.996  163.477 -16.684 1.00 22.65 ? 67   ARG A CA  1 
ATOM   101  C  C   . ARG A 1 67  ? 11.352  164.958 -16.854 1.00 23.33 ? 67   ARG A C   1 
ATOM   102  O  O   . ARG A 1 67  ? 10.572  165.726 -17.419 1.00 23.60 ? 67   ARG A O   1 
ATOM   103  C  CB  . ARG A 1 67  ? 9.847   163.335 -15.676 1.00 21.94 ? 67   ARG A CB  1 
ATOM   104  C  CG  . ARG A 1 67  ? 10.122  163.896 -14.286 1.00 22.87 ? 67   ARG A CG  1 
ATOM   105  C  CD  . ARG A 1 67  ? 8.807   164.129 -13.537 1.00 23.80 ? 67   ARG A CD  1 
ATOM   106  N  NE  . ARG A 1 67  ? 8.995   164.578 -12.158 1.00 24.53 ? 67   ARG A NE  1 
ATOM   107  C  CZ  . ARG A 1 67  ? 9.090   163.766 -11.111 1.00 25.33 ? 67   ARG A CZ  1 
ATOM   108  N  NH1 . ARG A 1 67  ? 9.014   162.452 -11.279 1.00 26.39 ? 67   ARG A NH1 1 
ATOM   109  N  NH2 . ARG A 1 67  ? 9.259   164.266 -9.894  1.00 25.64 ? 67   ARG A NH2 1 
ATOM   110  N  N   . ASP A 1 68  ? 12.533  165.346 -16.374 1.00 23.99 ? 68   ASP A N   1 
ATOM   111  C  CA  . ASP A 1 68  ? 12.997  166.731 -16.472 1.00 24.87 ? 68   ASP A CA  1 
ATOM   112  C  C   . ASP A 1 68  ? 14.134  166.918 -17.470 1.00 25.11 ? 68   ASP A C   1 
ATOM   113  O  O   . ASP A 1 68  ? 14.643  168.025 -17.626 1.00 26.06 ? 68   ASP A O   1 
ATOM   114  C  CB  . ASP A 1 68  ? 13.472  167.246 -15.108 1.00 24.13 ? 68   ASP A CB  1 
ATOM   115  C  CG  . ASP A 1 68  ? 12.346  167.370 -14.103 1.00 24.46 ? 68   ASP A CG  1 
ATOM   116  O  OD1 . ASP A 1 68  ? 11.242  167.791 -14.500 1.00 24.90 ? 68   ASP A OD1 1 
ATOM   117  O  OD2 . ASP A 1 68  ? 12.569  167.064 -12.913 1.00 25.00 ? 68   ASP A OD2 1 
ATOM   118  N  N   . ARG A 1 69  ? 14.538  165.843 -18.137 1.00 25.14 ? 69   ARG A N   1 
ATOM   119  C  CA  . ARG A 1 69  ? 15.631  165.917 -19.101 1.00 25.30 ? 69   ARG A CA  1 
ATOM   120  C  C   . ARG A 1 69  ? 15.132  166.248 -20.504 1.00 25.55 ? 69   ARG A C   1 
ATOM   121  O  O   . ARG A 1 69  ? 14.296  165.540 -21.063 1.00 25.30 ? 69   ARG A O   1 
ATOM   122  C  CB  . ARG A 1 69  ? 16.403  164.595 -19.118 1.00 25.07 ? 69   ARG A CB  1 
ATOM   123  C  CG  . ARG A 1 69  ? 16.943  164.189 -17.751 1.00 24.32 ? 69   ARG A CG  1 
ATOM   124  C  CD  . ARG A 1 69  ? 17.893  163.006 -17.846 1.00 24.22 ? 69   ARG A CD  1 
ATOM   125  N  NE  . ARG A 1 69  ? 18.351  162.576 -16.528 1.00 23.43 ? 69   ARG A NE  1 
ATOM   126  C  CZ  . ARG A 1 69  ? 19.335  161.706 -16.324 1.00 23.60 ? 69   ARG A CZ  1 
ATOM   127  N  NH1 . ARG A 1 69  ? 19.972  161.171 -17.356 1.00 23.89 ? 69   ARG A NH1 1 
ATOM   128  N  NH2 . ARG A 1 69  ? 19.684  161.375 -15.090 1.00 23.19 ? 69   ARG A NH2 1 
ATOM   129  N  N   . ALA A 1 70  ? 15.658  167.327 -21.072 1.00 25.72 ? 70   ALA A N   1 
ATOM   130  C  CA  . ALA A 1 70  ? 15.254  167.758 -22.406 1.00 25.80 ? 70   ALA A CA  1 
ATOM   131  C  C   . ALA A 1 70  ? 15.506  166.699 -23.471 1.00 25.81 ? 70   ALA A C   1 
ATOM   132  O  O   . ALA A 1 70  ? 14.722  166.560 -24.407 1.00 25.72 ? 70   ALA A O   1 
ATOM   133  C  CB  . ALA A 1 70  ? 15.971  169.056 -22.775 1.00 25.79 ? 70   ALA A CB  1 
ATOM   134  N  N   . GLU A 1 71  ? 16.594  165.946 -23.334 1.00 26.33 ? 71   GLU A N   1 
ATOM   135  C  CA  . GLU A 1 71  ? 16.915  164.911 -24.314 1.00 26.39 ? 71   GLU A CA  1 
ATOM   136  C  C   . GLU A 1 71  ? 15.948  163.729 -24.245 1.00 26.11 ? 71   GLU A C   1 
ATOM   137  O  O   . GLU A 1 71  ? 16.027  162.808 -25.057 1.00 25.43 ? 71   GLU A O   1 
ATOM   138  C  CB  . GLU A 1 71  ? 18.352  164.403 -24.122 1.00 27.65 ? 71   GLU A CB  1 
ATOM   139  C  CG  . GLU A 1 71  ? 18.602  163.719 -22.785 1.00 28.79 ? 71   GLU A CG  1 
ATOM   140  C  CD  . GLU A 1 71  ? 19.125  164.668 -21.728 1.00 30.05 ? 71   GLU A CD  1 
ATOM   141  O  OE1 . GLU A 1 71  ? 18.640  165.817 -21.660 1.00 30.64 ? 71   GLU A OE1 1 
ATOM   142  O  OE2 . GLU A 1 71  ? 20.017  164.258 -20.954 1.00 30.58 ? 71   GLU A OE2 1 
ATOM   143  N  N   . TRP A 1 72  ? 15.036  163.757 -23.276 1.00 25.77 ? 72   TRP A N   1 
ATOM   144  C  CA  . TRP A 1 72  ? 14.055  162.686 -23.126 1.00 26.16 ? 72   TRP A CA  1 
ATOM   145  C  C   . TRP A 1 72  ? 12.620  163.183 -23.281 1.00 26.99 ? 72   TRP A C   1 
ATOM   146  O  O   . TRP A 1 72  ? 11.672  162.413 -23.125 1.00 27.30 ? 72   TRP A O   1 
ATOM   147  C  CB  . TRP A 1 72  ? 14.198  162.011 -21.757 1.00 25.18 ? 72   TRP A CB  1 
ATOM   148  C  CG  . TRP A 1 72  ? 15.341  161.042 -21.661 1.00 24.69 ? 72   TRP A CG  1 
ATOM   149  C  CD1 . TRP A 1 72  ? 16.624  161.311 -21.275 1.00 24.00 ? 72   TRP A CD1 1 
ATOM   150  C  CD2 . TRP A 1 72  ? 15.299  159.643 -21.966 1.00 24.01 ? 72   TRP A CD2 1 
ATOM   151  N  NE1 . TRP A 1 72  ? 17.382  160.165 -21.318 1.00 24.06 ? 72   TRP A NE1 1 
ATOM   152  C  CE2 . TRP A 1 72  ? 16.594  159.126 -21.739 1.00 24.06 ? 72   TRP A CE2 1 
ATOM   153  C  CE3 . TRP A 1 72  ? 14.291  158.775 -22.411 1.00 23.88 ? 72   TRP A CE3 1 
ATOM   154  C  CZ2 . TRP A 1 72  ? 16.908  157.777 -21.939 1.00 24.13 ? 72   TRP A CZ2 1 
ATOM   155  C  CZ3 . TRP A 1 72  ? 14.603  157.434 -22.612 1.00 24.01 ? 72   TRP A CZ3 1 
ATOM   156  C  CH2 . TRP A 1 72  ? 15.902  156.949 -22.375 1.00 24.33 ? 72   TRP A CH2 1 
ATOM   157  N  N   . ALA A 1 73  ? 12.462  164.464 -23.598 1.00 27.44 ? 73   ALA A N   1 
ATOM   158  C  CA  . ALA A 1 73  ? 11.137  165.064 -23.744 1.00 27.80 ? 73   ALA A CA  1 
ATOM   159  C  C   . ALA A 1 73  ? 10.273  164.488 -24.867 1.00 28.30 ? 73   ALA A C   1 
ATOM   160  O  O   . ALA A 1 73  ? 9.047   164.521 -24.788 1.00 28.60 ? 73   ALA A O   1 
ATOM   161  C  CB  . ALA A 1 73  ? 11.278  166.575 -23.924 1.00 27.78 ? 73   ALA A CB  1 
ATOM   162  N  N   . ASP A 1 74  ? 10.909  163.955 -25.904 1.00 28.81 ? 74   ASP A N   1 
ATOM   163  C  CA  . ASP A 1 74  ? 10.196  163.400 -27.054 1.00 29.50 ? 74   ASP A CA  1 
ATOM   164  C  C   . ASP A 1 74  ? 9.500   162.062 -26.815 1.00 30.01 ? 74   ASP A C   1 
ATOM   165  O  O   . ASP A 1 74  ? 8.714   161.614 -27.651 1.00 30.09 ? 74   ASP A O   1 
ATOM   166  C  CB  . ASP A 1 74  ? 11.164  163.230 -28.216 1.00 30.48 ? 74   ASP A CB  1 
ATOM   167  C  CG  . ASP A 1 74  ? 12.231  162.203 -27.918 1.00 31.04 ? 74   ASP A CG  1 
ATOM   168  O  OD1 . ASP A 1 74  ? 12.184  161.098 -28.502 1.00 32.00 ? 74   ASP A OD1 1 
ATOM   169  O  OD2 . ASP A 1 74  ? 13.106  162.498 -27.080 1.00 31.61 ? 74   ASP A OD2 1 
ATOM   170  N  N   . ILE A 1 75  ? 9.791   161.410 -25.696 1.00 29.68 ? 75   ILE A N   1 
ATOM   171  C  CA  . ILE A 1 75  ? 9.161   160.124 -25.419 1.00 29.53 ? 75   ILE A CA  1 
ATOM   172  C  C   . ILE A 1 75  ? 8.371   160.162 -24.112 1.00 28.85 ? 75   ILE A C   1 
ATOM   173  O  O   . ILE A 1 75  ? 8.844   160.683 -23.102 1.00 28.11 ? 75   ILE A O   1 
ATOM   174  C  CB  . ILE A 1 75  ? 10.217  158.990 -25.375 1.00 30.44 ? 75   ILE A CB  1 
ATOM   175  C  CG1 . ILE A 1 75  ? 9.520   157.629 -25.312 1.00 31.42 ? 75   ILE A CG1 1 
ATOM   176  C  CG2 . ILE A 1 75  ? 11.142  159.181 -24.186 1.00 30.11 ? 75   ILE A CG2 1 
ATOM   177  C  CD1 . ILE A 1 75  ? 10.464  156.450 -25.462 1.00 31.73 ? 75   ILE A CD1 1 
ATOM   178  N  N   . ASP A 1 76  ? 7.154   159.623 -24.151 1.00 28.17 ? 76   ASP A N   1 
ATOM   179  C  CA  . ASP A 1 76  ? 6.284   159.597 -22.982 1.00 28.01 ? 76   ASP A CA  1 
ATOM   180  C  C   . ASP A 1 76  ? 6.589   158.407 -22.079 1.00 27.48 ? 76   ASP A C   1 
ATOM   181  O  O   . ASP A 1 76  ? 6.733   157.279 -22.546 1.00 27.18 ? 76   ASP A O   1 
ATOM   182  C  CB  . ASP A 1 76  ? 4.815   159.531 -23.410 1.00 29.17 ? 76   ASP A CB  1 
ATOM   183  C  CG  . ASP A 1 76  ? 4.398   160.714 -24.264 1.00 30.91 ? 76   ASP A CG  1 
ATOM   184  O  OD1 . ASP A 1 76  ? 4.595   161.865 -23.825 1.00 31.65 ? 76   ASP A OD1 1 
ATOM   185  O  OD2 . ASP A 1 76  ? 3.869   160.492 -25.374 1.00 32.15 ? 76   ASP A OD2 1 
ATOM   186  N  N   . PRO A 1 77  ? 6.683   158.646 -20.763 1.00 27.05 ? 77   PRO A N   1 
ATOM   187  C  CA  . PRO A 1 77  ? 6.970   157.559 -19.826 1.00 26.63 ? 77   PRO A CA  1 
ATOM   188  C  C   . PRO A 1 77  ? 5.788   156.598 -19.752 1.00 26.64 ? 77   PRO A C   1 
ATOM   189  O  O   . PRO A 1 77  ? 4.646   156.990 -19.994 1.00 26.98 ? 77   PRO A O   1 
ATOM   190  C  CB  . PRO A 1 77  ? 7.202   158.298 -18.513 1.00 26.79 ? 77   PRO A CB  1 
ATOM   191  C  CG  . PRO A 1 77  ? 6.254   159.465 -18.630 1.00 26.52 ? 77   PRO A CG  1 
ATOM   192  C  CD  . PRO A 1 77  ? 6.494   159.922 -20.050 1.00 26.44 ? 77   PRO A CD  1 
ATOM   193  N  N   . VAL A 1 78  ? 6.060   155.338 -19.432 1.00 26.32 ? 78   VAL A N   1 
ATOM   194  C  CA  . VAL A 1 78  ? 4.999   154.346 -19.326 1.00 25.58 ? 78   VAL A CA  1 
ATOM   195  C  C   . VAL A 1 78  ? 4.883   153.864 -17.888 1.00 25.78 ? 78   VAL A C   1 
ATOM   196  O  O   . VAL A 1 78  ? 5.726   153.106 -17.402 1.00 24.94 ? 78   VAL A O   1 
ATOM   197  C  CB  . VAL A 1 78  ? 5.262   153.136 -20.242 1.00 25.77 ? 78   VAL A CB  1 
ATOM   198  C  CG1 . VAL A 1 78  ? 4.213   152.055 -19.992 1.00 25.69 ? 78   VAL A CG1 1 
ATOM   199  C  CG2 . VAL A 1 78  ? 5.229   153.576 -21.697 1.00 25.67 ? 78   VAL A CG2 1 
ATOM   200  N  N   . PRO A 1 79  ? 3.833   154.307 -17.182 1.00 25.58 ? 79   PRO A N   1 
ATOM   201  C  CA  . PRO A 1 79  ? 3.656   153.886 -15.794 1.00 26.00 ? 79   PRO A CA  1 
ATOM   202  C  C   . PRO A 1 79  ? 3.349   152.400 -15.675 1.00 25.85 ? 79   PRO A C   1 
ATOM   203  O  O   . PRO A 1 79  ? 2.818   151.781 -16.597 1.00 24.96 ? 79   PRO A O   1 
ATOM   204  C  CB  . PRO A 1 79  ? 2.502   154.763 -15.311 1.00 26.35 ? 79   PRO A CB  1 
ATOM   205  C  CG  . PRO A 1 79  ? 1.689   154.944 -16.549 1.00 26.72 ? 79   PRO A CG  1 
ATOM   206  C  CD  . PRO A 1 79  ? 2.743   155.204 -17.604 1.00 26.04 ? 79   PRO A CD  1 
ATOM   207  N  N   . GLN A 1 80  ? 3.707   151.831 -14.534 1.00 25.68 ? 80   GLN A N   1 
ATOM   208  C  CA  . GLN A 1 80  ? 3.454   150.425 -14.282 1.00 26.36 ? 80   GLN A CA  1 
ATOM   209  C  C   . GLN A 1 80  ? 1.997   150.272 -13.858 1.00 26.98 ? 80   GLN A C   1 
ATOM   210  O  O   . GLN A 1 80  ? 1.531   150.968 -12.959 1.00 27.22 ? 80   GLN A O   1 
ATOM   211  C  CB  . GLN A 1 80  ? 4.390   149.930 -13.180 1.00 26.18 ? 80   GLN A CB  1 
ATOM   212  C  CG  . GLN A 1 80  ? 4.026   148.588 -12.574 1.00 25.50 ? 80   GLN A CG  1 
ATOM   213  C  CD  . GLN A 1 80  ? 5.061   148.125 -11.572 1.00 24.59 ? 80   GLN A CD  1 
ATOM   214  O  OE1 . GLN A 1 80  ? 6.114   147.606 -11.946 1.00 24.88 ? 80   GLN A OE1 1 
ATOM   215  N  NE2 . GLN A 1 80  ? 4.778   148.327 -10.289 1.00 23.90 ? 80   GLN A NE2 1 
ATOM   216  N  N   . ASN A 1 81  ? 1.272   149.377 -14.516 1.00 27.91 ? 81   ASN A N   1 
ATOM   217  C  CA  . ASN A 1 81  ? -0.123  149.156 -14.163 1.00 28.69 ? 81   ASN A CA  1 
ATOM   218  C  C   . ASN A 1 81  ? -0.255  147.966 -13.220 1.00 28.72 ? 81   ASN A C   1 
ATOM   219  O  O   . ASN A 1 81  ? -0.098  146.816 -13.633 1.00 28.20 ? 81   ASN A O   1 
ATOM   220  C  CB  . ASN A 1 81  ? -0.966  148.918 -15.417 1.00 30.23 ? 81   ASN A CB  1 
ATOM   221  C  CG  . ASN A 1 81  ? -2.402  148.553 -15.087 1.00 31.56 ? 81   ASN A CG  1 
ATOM   222  O  OD1 . ASN A 1 81  ? -3.044  149.195 -14.251 1.00 32.06 ? 81   ASN A OD1 1 
ATOM   223  N  ND2 . ASN A 1 81  ? -2.916  147.520 -15.747 1.00 32.19 ? 81   ASN A ND2 1 
ATOM   224  N  N   . ASP A 1 82  ? -0.536  148.254 -11.952 1.00 28.63 ? 82   ASP A N   1 
ATOM   225  C  CA  . ASP A 1 82  ? -0.697  147.216 -10.944 1.00 29.09 ? 82   ASP A CA  1 
ATOM   226  C  C   . ASP A 1 82  ? -2.156  146.833 -10.747 1.00 29.30 ? 82   ASP A C   1 
ATOM   227  O  O   . ASP A 1 82  ? -2.478  146.034 -9.867  1.00 29.32 ? 82   ASP A O   1 
ATOM   228  C  CB  . ASP A 1 82  ? -0.114  147.665 -9.602  1.00 28.80 ? 82   ASP A CB  1 
ATOM   229  C  CG  . ASP A 1 82  ? 1.392   147.535 -9.548  1.00 28.81 ? 82   ASP A CG  1 
ATOM   230  O  OD1 . ASP A 1 82  ? 1.922   146.559 -10.115 1.00 27.62 ? 82   ASP A OD1 1 
ATOM   231  O  OD2 . ASP A 1 82  ? 2.046   148.396 -8.923  1.00 30.37 ? 82   ASP A OD2 1 
ATOM   232  N  N   . GLY A 1 83  ? -3.035  147.404 -11.564 1.00 29.46 ? 83   GLY A N   1 
ATOM   233  C  CA  . GLY A 1 83  ? -4.449  147.098 -11.446 1.00 29.56 ? 83   GLY A CA  1 
ATOM   234  C  C   . GLY A 1 83  ? -5.152  148.041 -10.487 1.00 29.79 ? 83   GLY A C   1 
ATOM   235  O  O   . GLY A 1 83  ? -4.493  148.794 -9.769  1.00 29.57 ? 83   GLY A O   1 
ATOM   236  N  N   . PRO A 1 84  ? -6.495  148.016 -10.446 1.00 30.30 ? 84   PRO A N   1 
ATOM   237  C  CA  . PRO A 1 84  ? -7.298  148.876 -9.569  1.00 30.56 ? 84   PRO A CA  1 
ATOM   238  C  C   . PRO A 1 84  ? -7.129  148.619 -8.073  1.00 30.68 ? 84   PRO A C   1 
ATOM   239  O  O   . PRO A 1 84  ? -7.158  149.558 -7.278  1.00 31.10 ? 84   PRO A O   1 
ATOM   240  C  CB  . PRO A 1 84  ? -8.724  148.613 -10.049 1.00 30.59 ? 84   PRO A CB  1 
ATOM   241  C  CG  . PRO A 1 84  ? -8.669  147.179 -10.472 1.00 30.88 ? 84   PRO A CG  1 
ATOM   242  C  CD  . PRO A 1 84  ? -7.365  147.132 -11.244 1.00 30.70 ? 84   PRO A CD  1 
ATOM   243  N  N   . ASN A 1 85  ? -6.953  147.357 -7.689  1.00 30.29 ? 85   ASN A N   1 
ATOM   244  C  CA  . ASN A 1 85  ? -6.784  147.002 -6.278  1.00 29.95 ? 85   ASN A CA  1 
ATOM   245  C  C   . ASN A 1 85  ? -5.474  146.243 -6.086  1.00 29.12 ? 85   ASN A C   1 
ATOM   246  O  O   . ASN A 1 85  ? -5.465  145.022 -5.939  1.00 28.61 ? 85   ASN A O   1 
ATOM   247  C  CB  . ASN A 1 85  ? -7.956  146.137 -5.817  1.00 30.99 ? 85   ASN A CB  1 
ATOM   248  C  CG  . ASN A 1 85  ? -9.292  146.686 -6.270  1.00 32.12 ? 85   ASN A CG  1 
ATOM   249  O  OD1 . ASN A 1 85  ? -9.651  147.817 -5.948  1.00 33.05 ? 85   ASN A OD1 1 
ATOM   250  N  ND2 . ASN A 1 85  ? -10.034 145.888 -7.032  1.00 32.65 ? 85   ASN A ND2 1 
ATOM   251  N  N   . PRO A 1 86  ? -4.348  146.971 -6.072  1.00 28.46 ? 86   PRO A N   1 
ATOM   252  C  CA  . PRO A 1 86  ? -2.991  146.437 -5.912  1.00 27.50 ? 86   PRO A CA  1 
ATOM   253  C  C   . PRO A 1 86  ? -2.712  145.564 -4.689  1.00 26.15 ? 86   PRO A C   1 
ATOM   254  O  O   . PRO A 1 86  ? -3.326  145.719 -3.631  1.00 25.96 ? 86   PRO A O   1 
ATOM   255  C  CB  . PRO A 1 86  ? -2.122  147.698 -5.910  1.00 28.35 ? 86   PRO A CB  1 
ATOM   256  C  CG  . PRO A 1 86  ? -2.911  148.658 -6.747  1.00 28.60 ? 86   PRO A CG  1 
ATOM   257  C  CD  . PRO A 1 86  ? -4.311  148.435 -6.234  1.00 28.52 ? 86   PRO A CD  1 
ATOM   258  N  N   . VAL A 1 87  ? -1.771  144.640 -4.865  1.00 24.23 ? 87   VAL A N   1 
ATOM   259  C  CA  . VAL A 1 87  ? -1.321  143.746 -3.806  1.00 22.15 ? 87   VAL A CA  1 
ATOM   260  C  C   . VAL A 1 87  ? 0.200   143.829 -3.852  1.00 21.10 ? 87   VAL A C   1 
ATOM   261  O  O   . VAL A 1 87  ? 0.767   144.177 -4.891  1.00 19.59 ? 87   VAL A O   1 
ATOM   262  C  CB  . VAL A 1 87  ? -1.783  142.291 -4.031  1.00 22.53 ? 87   VAL A CB  1 
ATOM   263  C  CG1 . VAL A 1 87  ? -3.292  142.195 -3.826  1.00 22.00 ? 87   VAL A CG1 1 
ATOM   264  C  CG2 . VAL A 1 87  ? -1.399  141.823 -5.425  1.00 21.59 ? 87   VAL A CG2 1 
ATOM   265  N  N   . VAL A 1 88  ? 0.850   143.519 -2.732  1.00 20.24 ? 88   VAL A N   1 
ATOM   266  C  CA  . VAL A 1 88  ? 2.303   143.602 -2.618  1.00 19.87 ? 88   VAL A CA  1 
ATOM   267  C  C   . VAL A 1 88  ? 2.807   144.827 -3.384  1.00 20.37 ? 88   VAL A C   1 
ATOM   268  O  O   . VAL A 1 88  ? 3.794   144.770 -4.115  1.00 19.27 ? 88   VAL A O   1 
ATOM   269  C  CB  . VAL A 1 88  ? 3.004   142.306 -3.129  1.00 19.56 ? 88   VAL A CB  1 
ATOM   270  C  CG1 . VAL A 1 88  ? 2.637   141.141 -2.224  1.00 18.69 ? 88   VAL A CG1 1 
ATOM   271  C  CG2 . VAL A 1 88  ? 2.618   142.005 -4.572  1.00 17.90 ? 88   VAL A CG2 1 
ATOM   272  N  N   . GLN A 1 89  ? 2.099   145.938 -3.200  1.00 21.58 ? 89   GLN A N   1 
ATOM   273  C  CA  . GLN A 1 89  ? 2.426   147.193 -3.860  1.00 23.51 ? 89   GLN A CA  1 
ATOM   274  C  C   . GLN A 1 89  ? 3.570   147.907 -3.158  1.00 23.97 ? 89   GLN A C   1 
ATOM   275  O  O   . GLN A 1 89  ? 3.462   148.284 -1.987  1.00 23.99 ? 89   GLN A O   1 
ATOM   276  C  CB  . GLN A 1 89  ? 1.193   148.096 -3.893  1.00 25.50 ? 89   GLN A CB  1 
ATOM   277  C  CG  . GLN A 1 89  ? 1.428   149.454 -4.526  1.00 27.45 ? 89   GLN A CG  1 
ATOM   278  C  CD  . GLN A 1 89  ? 0.153   150.267 -4.628  1.00 29.07 ? 89   GLN A CD  1 
ATOM   279  O  OE1 . GLN A 1 89  ? -0.588  150.406 -3.653  1.00 30.21 ? 89   GLN A OE1 1 
ATOM   280  N  NE2 . GLN A 1 89  ? -0.109  150.813 -5.809  1.00 29.91 ? 89   GLN A NE2 1 
ATOM   281  N  N   . ILE A 1 90  ? 4.667   148.090 -3.884  1.00 24.11 ? 90   ILE A N   1 
ATOM   282  C  CA  . ILE A 1 90  ? 5.850   148.749 -3.343  1.00 24.23 ? 90   ILE A CA  1 
ATOM   283  C  C   . ILE A 1 90  ? 5.741   150.260 -3.530  1.00 24.66 ? 90   ILE A C   1 
ATOM   284  O  O   . ILE A 1 90  ? 5.537   150.744 -4.643  1.00 24.13 ? 90   ILE A O   1 
ATOM   285  C  CB  . ILE A 1 90  ? 7.133   148.243 -4.049  1.00 24.11 ? 90   ILE A CB  1 
ATOM   286  C  CG1 . ILE A 1 90  ? 7.192   146.712 -3.990  1.00 23.20 ? 90   ILE A CG1 1 
ATOM   287  C  CG2 . ILE A 1 90  ? 8.371   148.843 -3.384  1.00 24.18 ? 90   ILE A CG2 1 
ATOM   288  C  CD1 . ILE A 1 90  ? 8.344   146.112 -4.761  1.00 21.66 ? 90   ILE A CD1 1 
ATOM   289  N  N   . ILE A 1 91  ? 5.869   151.002 -2.436  1.00 25.60 ? 91   ILE A N   1 
ATOM   290  C  CA  . ILE A 1 91  ? 5.795   152.456 -2.504  1.00 26.67 ? 91   ILE A CA  1 
ATOM   291  C  C   . ILE A 1 91  ? 7.162   152.969 -2.944  1.00 25.95 ? 91   ILE A C   1 
ATOM   292  O  O   . ILE A 1 91  ? 7.980   153.377 -2.122  1.00 26.09 ? 91   ILE A O   1 
ATOM   293  C  CB  . ILE A 1 91  ? 5.435   153.065 -1.133  1.00 27.60 ? 91   ILE A CB  1 
ATOM   294  C  CG1 . ILE A 1 91  ? 4.173   152.393 -0.581  1.00 28.49 ? 91   ILE A CG1 1 
ATOM   295  C  CG2 . ILE A 1 91  ? 5.202   154.567 -1.279  1.00 28.23 ? 91   ILE A CG2 1 
ATOM   296  C  CD1 . ILE A 1 91  ? 2.952   152.520 -1.484  1.00 28.39 ? 91   ILE A CD1 1 
ATOM   297  N  N   . TYR A 1 92  ? 7.395   152.936 -4.251  1.00 25.38 ? 92   TYR A N   1 
ATOM   298  C  CA  . TYR A 1 92  ? 8.663   153.364 -4.836  1.00 25.06 ? 92   TYR A CA  1 
ATOM   299  C  C   . TYR A 1 92  ? 9.045   154.805 -4.540  1.00 24.78 ? 92   TYR A C   1 
ATOM   300  O  O   . TYR A 1 92  ? 8.184   155.675 -4.419  1.00 24.47 ? 92   TYR A O   1 
ATOM   301  C  CB  . TYR A 1 92  ? 8.628   153.205 -6.359  1.00 24.78 ? 92   TYR A CB  1 
ATOM   302  C  CG  . TYR A 1 92  ? 8.141   151.863 -6.853  1.00 24.51 ? 92   TYR A CG  1 
ATOM   303  C  CD1 . TYR A 1 92  ? 6.893   151.737 -7.461  1.00 24.84 ? 92   TYR A CD1 1 
ATOM   304  C  CD2 . TYR A 1 92  ? 8.938   150.723 -6.737  1.00 24.43 ? 92   TYR A CD2 1 
ATOM   305  C  CE1 . TYR A 1 92  ? 6.448   150.505 -7.947  1.00 24.41 ? 92   TYR A CE1 1 
ATOM   306  C  CE2 . TYR A 1 92  ? 8.503   149.488 -7.218  1.00 24.06 ? 92   TYR A CE2 1 
ATOM   307  C  CZ  . TYR A 1 92  ? 7.258   149.388 -7.823  1.00 23.91 ? 92   TYR A CZ  1 
ATOM   308  O  OH  . TYR A 1 92  ? 6.827   148.177 -8.316  1.00 23.46 ? 92   TYR A OH  1 
ATOM   309  N  N   . SER A 1 93  ? 10.346  155.056 -4.437  1.00 24.30 ? 93   SER A N   1 
ATOM   310  C  CA  . SER A 1 93  ? 10.821  156.413 -4.222  1.00 23.90 ? 93   SER A CA  1 
ATOM   311  C  C   . SER A 1 93  ? 10.541  157.107 -5.553  1.00 23.95 ? 93   SER A C   1 
ATOM   312  O  O   . SER A 1 93  ? 10.289  156.442 -6.564  1.00 22.79 ? 93   SER A O   1 
ATOM   313  C  CB  . SER A 1 93  ? 12.322  156.424 -3.935  1.00 24.21 ? 93   SER A CB  1 
ATOM   314  O  OG  . SER A 1 93  ? 13.058  156.011 -5.074  1.00 24.57 ? 93   SER A OG  1 
ATOM   315  N  N   . ASP A 1 94  ? 10.577  158.434 -5.564  1.00 23.94 ? 94   ASP A N   1 
ATOM   316  C  CA  . ASP A 1 94  ? 10.312  159.176 -6.788  1.00 24.27 ? 94   ASP A CA  1 
ATOM   317  C  C   . ASP A 1 94  ? 11.380  158.877 -7.844  1.00 23.50 ? 94   ASP A C   1 
ATOM   318  O  O   . ASP A 1 94  ? 11.065  158.720 -9.023  1.00 23.44 ? 94   ASP A O   1 
ATOM   319  C  CB  . ASP A 1 94  ? 10.247  160.679 -6.479  1.00 26.42 ? 94   ASP A CB  1 
ATOM   320  C  CG  . ASP A 1 94  ? 9.794   161.507 -7.672  1.00 28.66 ? 94   ASP A CG  1 
ATOM   321  O  OD1 . ASP A 1 94  ? 8.902   161.049 -8.418  1.00 29.53 ? 94   ASP A OD1 1 
ATOM   322  O  OD2 . ASP A 1 94  ? 10.319  162.629 -7.856  1.00 30.78 ? 94   ASP A OD2 1 
ATOM   323  N  N   . LYS A 1 95  ? 12.636  158.776 -7.419  1.00 22.83 ? 95   LYS A N   1 
ATOM   324  C  CA  . LYS A 1 95  ? 13.724  158.492 -8.350  1.00 23.10 ? 95   LYS A CA  1 
ATOM   325  C  C   . LYS A 1 95  ? 13.595  157.101 -8.974  1.00 22.00 ? 95   LYS A C   1 
ATOM   326  O  O   . LYS A 1 95  ? 13.844  156.922 -10.165 1.00 21.27 ? 95   LYS A O   1 
ATOM   327  C  CB  . LYS A 1 95  ? 15.083  158.615 -7.651  1.00 23.94 ? 95   LYS A CB  1 
ATOM   328  C  CG  . LYS A 1 95  ? 15.441  160.035 -7.233  1.00 26.96 ? 95   LYS A CG  1 
ATOM   329  C  CD  . LYS A 1 95  ? 16.890  160.377 -7.557  1.00 27.70 ? 95   LYS A CD  1 
ATOM   330  C  CE  . LYS A 1 95  ? 17.880  159.559 -6.742  1.00 28.54 ? 95   LYS A CE  1 
ATOM   331  N  NZ  . LYS A 1 95  ? 17.916  159.977 -5.320  1.00 29.07 ? 95   LYS A NZ  1 
ATOM   332  N  N   . PHE A 1 96  ? 13.204  156.121 -8.165  1.00 21.26 ? 96   PHE A N   1 
ATOM   333  C  CA  . PHE A 1 96  ? 13.043  154.751 -8.645  1.00 20.59 ? 96   PHE A CA  1 
ATOM   334  C  C   . PHE A 1 96  ? 11.965  154.685 -9.725  1.00 20.59 ? 96   PHE A C   1 
ATOM   335  O  O   . PHE A 1 96  ? 12.209  154.202 -10.829 1.00 20.48 ? 96   PHE A O   1 
ATOM   336  C  CB  . PHE A 1 96  ? 12.661  153.826 -7.484  1.00 20.11 ? 96   PHE A CB  1 
ATOM   337  C  CG  . PHE A 1 96  ? 12.658  152.361 -7.844  1.00 19.62 ? 96   PHE A CG  1 
ATOM   338  C  CD1 . PHE A 1 96  ? 13.716  151.538 -7.470  1.00 19.35 ? 96   PHE A CD1 1 
ATOM   339  C  CD2 . PHE A 1 96  ? 11.594  151.805 -8.549  1.00 19.46 ? 96   PHE A CD2 1 
ATOM   340  C  CE1 . PHE A 1 96  ? 13.714  150.181 -7.787  1.00 18.86 ? 96   PHE A CE1 1 
ATOM   341  C  CE2 . PHE A 1 96  ? 11.583  150.444 -8.873  1.00 19.63 ? 96   PHE A CE2 1 
ATOM   342  C  CZ  . PHE A 1 96  ? 12.646  149.634 -8.488  1.00 18.70 ? 96   PHE A CZ  1 
ATOM   343  N  N   . ARG A 1 97  ? 10.774  155.181 -9.405  1.00 21.05 ? 97   ARG A N   1 
ATOM   344  C  CA  . ARG A 1 97  ? 9.665   155.164 -10.351 1.00 21.21 ? 97   ARG A CA  1 
ATOM   345  C  C   . ARG A 1 97  ? 9.982   155.929 -11.632 1.00 20.60 ? 97   ARG A C   1 
ATOM   346  O  O   . ARG A 1 97  ? 9.630   155.492 -12.727 1.00 20.48 ? 97   ARG A O   1 
ATOM   347  C  CB  . ARG A 1 97  ? 8.405   155.754 -9.711  1.00 22.46 ? 97   ARG A CB  1 
ATOM   348  C  CG  . ARG A 1 97  ? 7.194   155.694 -10.628 1.00 24.99 ? 97   ARG A CG  1 
ATOM   349  C  CD  . ARG A 1 97  ? 5.965   156.369 -10.031 1.00 28.05 ? 97   ARG A CD  1 
ATOM   350  N  NE  . ARG A 1 97  ? 5.597   155.803 -8.738  1.00 30.71 ? 97   ARG A NE  1 
ATOM   351  C  CZ  . ARG A 1 97  ? 5.944   156.328 -7.566  1.00 33.00 ? 97   ARG A CZ  1 
ATOM   352  N  NH1 . ARG A 1 97  ? 6.668   157.441 -7.523  1.00 34.17 ? 97   ARG A NH1 1 
ATOM   353  N  NH2 . ARG A 1 97  ? 5.568   155.738 -6.435  1.00 33.32 ? 97   ARG A NH2 1 
ATOM   354  N  N   . ASP A 1 98  ? 10.638  157.076 -11.490 1.00 20.22 ? 98   ASP A N   1 
ATOM   355  C  CA  . ASP A 1 98  ? 11.000  157.900 -12.640 1.00 19.61 ? 98   ASP A CA  1 
ATOM   356  C  C   . ASP A 1 98  ? 11.794  157.087 -13.660 1.00 19.38 ? 98   ASP A C   1 
ATOM   357  O  O   . ASP A 1 98  ? 11.440  157.028 -14.839 1.00 19.42 ? 98   ASP A O   1 
ATOM   358  C  CB  . ASP A 1 98  ? 11.826  159.106 -12.178 1.00 20.14 ? 98   ASP A CB  1 
ATOM   359  C  CG  . ASP A 1 98  ? 12.429  159.880 -13.334 1.00 19.65 ? 98   ASP A CG  1 
ATOM   360  O  OD1 . ASP A 1 98  ? 11.680  160.546 -14.078 1.00 19.71 ? 98   ASP A OD1 1 
ATOM   361  O  OD2 . ASP A 1 98  ? 13.661  159.813 -13.500 1.00 20.57 ? 98   ASP A OD2 1 
ATOM   362  N  N   . VAL A 1 99  ? 12.866  156.452 -13.201 1.00 18.62 ? 99   VAL A N   1 
ATOM   363  C  CA  . VAL A 1 99  ? 13.698  155.648 -14.084 1.00 18.42 ? 99   VAL A CA  1 
ATOM   364  C  C   . VAL A 1 99  ? 12.939  154.487 -14.721 1.00 18.22 ? 99   VAL A C   1 
ATOM   365  O  O   . VAL A 1 99  ? 13.056  154.250 -15.924 1.00 17.29 ? 99   VAL A O   1 
ATOM   366  C  CB  . VAL A 1 99  ? 14.919  155.076 -13.335 1.00 19.13 ? 99   VAL A CB  1 
ATOM   367  C  CG1 . VAL A 1 99  ? 15.555  153.946 -14.147 1.00 18.13 ? 99   VAL A CG1 1 
ATOM   368  C  CG2 . VAL A 1 99  ? 15.942  156.188 -13.096 1.00 18.94 ? 99   VAL A CG2 1 
ATOM   369  N  N   . TYR A 1 100 ? 12.164  153.762 -13.922 1.00 17.72 ? 100  TYR A N   1 
ATOM   370  C  CA  . TYR A 1 100 ? 11.437  152.625 -14.466 1.00 18.42 ? 100  TYR A CA  1 
ATOM   371  C  C   . TYR A 1 100 ? 10.270  152.985 -15.375 1.00 18.83 ? 100  TYR A C   1 
ATOM   372  O  O   . TYR A 1 100 ? 9.883   152.185 -16.233 1.00 18.32 ? 100  TYR A O   1 
ATOM   373  C  CB  . TYR A 1 100 ? 11.018  151.670 -13.342 1.00 17.72 ? 100  TYR A CB  1 
ATOM   374  C  CG  . TYR A 1 100 ? 12.151  150.731 -12.992 1.00 17.82 ? 100  TYR A CG  1 
ATOM   375  C  CD1 . TYR A 1 100 ? 13.096  151.067 -12.017 1.00 16.63 ? 100  TYR A CD1 1 
ATOM   376  C  CD2 . TYR A 1 100 ? 12.354  149.562 -13.727 1.00 17.27 ? 100  TYR A CD2 1 
ATOM   377  C  CE1 . TYR A 1 100 ? 14.216  150.265 -11.794 1.00 17.33 ? 100  TYR A CE1 1 
ATOM   378  C  CE2 . TYR A 1 100 ? 13.474  148.753 -13.511 1.00 17.69 ? 100  TYR A CE2 1 
ATOM   379  C  CZ  . TYR A 1 100 ? 14.399  149.112 -12.548 1.00 16.64 ? 100  TYR A CZ  1 
ATOM   380  O  OH  . TYR A 1 100 ? 15.513  148.328 -12.354 1.00 17.13 ? 100  TYR A OH  1 
ATOM   381  N  N   . ASP A 1 101 ? 9.720   154.187 -15.211 1.00 19.25 ? 101  ASP A N   1 
ATOM   382  C  CA  . ASP A 1 101 ? 8.637   154.625 -16.083 1.00 19.70 ? 101  ASP A CA  1 
ATOM   383  C  C   . ASP A 1 101 ? 9.246   154.838 -17.469 1.00 19.49 ? 101  ASP A C   1 
ATOM   384  O  O   . ASP A 1 101 ? 8.625   154.534 -18.489 1.00 18.97 ? 101  ASP A O   1 
ATOM   385  C  CB  . ASP A 1 101 ? 8.017   155.936 -15.582 1.00 20.17 ? 101  ASP A CB  1 
ATOM   386  C  CG  . ASP A 1 101 ? 6.947   155.717 -14.524 1.00 21.10 ? 101  ASP A CG  1 
ATOM   387  O  OD1 . ASP A 1 101 ? 6.436   156.721 -13.981 1.00 21.08 ? 101  ASP A OD1 1 
ATOM   388  O  OD2 . ASP A 1 101 ? 6.611   154.547 -14.239 1.00 20.75 ? 101  ASP A OD2 1 
ATOM   389  N  N   . TYR A 1 102 ? 10.471  155.358 -17.508 1.00 19.92 ? 102  TYR A N   1 
ATOM   390  C  CA  . TYR A 1 102 ? 11.131  155.576 -18.792 1.00 20.27 ? 102  TYR A CA  1 
ATOM   391  C  C   . TYR A 1 102 ? 11.727  154.286 -19.341 1.00 20.58 ? 102  TYR A C   1 
ATOM   392  O  O   . TYR A 1 102 ? 11.807  154.100 -20.558 1.00 20.45 ? 102  TYR A O   1 
ATOM   393  C  CB  . TYR A 1 102 ? 12.194  156.674 -18.683 1.00 20.35 ? 102  TYR A CB  1 
ATOM   394  C  CG  . TYR A 1 102 ? 11.577  158.056 -18.758 1.00 21.34 ? 102  TYR A CG  1 
ATOM   395  C  CD1 . TYR A 1 102 ? 11.004  158.652 -17.633 1.00 21.06 ? 102  TYR A CD1 1 
ATOM   396  C  CD2 . TYR A 1 102 ? 11.482  158.727 -19.978 1.00 21.27 ? 102  TYR A CD2 1 
ATOM   397  C  CE1 . TYR A 1 102 ? 10.346  159.883 -17.722 1.00 21.15 ? 102  TYR A CE1 1 
ATOM   398  C  CE2 . TYR A 1 102 ? 10.826  159.954 -20.079 1.00 21.41 ? 102  TYR A CE2 1 
ATOM   399  C  CZ  . TYR A 1 102 ? 10.260  160.524 -18.950 1.00 21.26 ? 102  TYR A CZ  1 
ATOM   400  O  OH  . TYR A 1 102 ? 9.591   161.724 -19.058 1.00 21.27 ? 102  TYR A OH  1 
ATOM   401  N  N   . PHE A 1 103 ? 12.136  153.386 -18.451 1.00 20.02 ? 103  PHE A N   1 
ATOM   402  C  CA  . PHE A 1 103 ? 12.675  152.119 -18.916 1.00 20.27 ? 103  PHE A CA  1 
ATOM   403  C  C   . PHE A 1 103 ? 11.541  151.383 -19.625 1.00 19.74 ? 103  PHE A C   1 
ATOM   404  O  O   . PHE A 1 103 ? 11.721  150.846 -20.717 1.00 19.76 ? 103  PHE A O   1 
ATOM   405  C  CB  . PHE A 1 103 ? 13.183  151.262 -17.757 1.00 20.44 ? 103  PHE A CB  1 
ATOM   406  C  CG  . PHE A 1 103 ? 13.573  149.871 -18.176 1.00 20.60 ? 103  PHE A CG  1 
ATOM   407  C  CD1 . PHE A 1 103 ? 14.695  149.661 -18.970 1.00 20.49 ? 103  PHE A CD1 1 
ATOM   408  C  CD2 . PHE A 1 103 ? 12.784  148.778 -17.824 1.00 20.06 ? 103  PHE A CD2 1 
ATOM   409  C  CE1 . PHE A 1 103 ? 15.028  148.377 -19.413 1.00 21.78 ? 103  PHE A CE1 1 
ATOM   410  C  CE2 . PHE A 1 103 ? 13.107  147.490 -18.261 1.00 20.48 ? 103  PHE A CE2 1 
ATOM   411  C  CZ  . PHE A 1 103 ? 14.228  147.288 -19.057 1.00 20.51 ? 103  PHE A CZ  1 
ATOM   412  N  N   . ARG A 1 104 ? 10.367  151.368 -19.001 1.00 19.40 ? 104  ARG A N   1 
ATOM   413  C  CA  . ARG A 1 104 ? 9.216   150.703 -19.592 1.00 19.87 ? 104  ARG A CA  1 
ATOM   414  C  C   . ARG A 1 104 ? 8.901   151.301 -20.960 1.00 20.46 ? 104  ARG A C   1 
ATOM   415  O  O   . ARG A 1 104 ? 8.472   150.595 -21.871 1.00 20.12 ? 104  ARG A O   1 
ATOM   416  C  CB  . ARG A 1 104 ? 7.993   150.816 -18.671 1.00 20.48 ? 104  ARG A CB  1 
ATOM   417  C  CG  . ARG A 1 104 ? 8.018   149.857 -17.476 1.00 20.37 ? 104  ARG A CG  1 
ATOM   418  C  CD  . ARG A 1 104 ? 6.757   149.984 -16.617 1.00 20.91 ? 104  ARG A CD  1 
ATOM   419  N  NE  . ARG A 1 104 ? 6.856   151.051 -15.620 1.00 21.28 ? 104  ARG A NE  1 
ATOM   420  C  CZ  . ARG A 1 104 ? 7.489   150.933 -14.455 1.00 22.11 ? 104  ARG A CZ  1 
ATOM   421  N  NH1 . ARG A 1 104 ? 8.085   149.790 -14.129 1.00 21.58 ? 104  ARG A NH1 1 
ATOM   422  N  NH2 . ARG A 1 104 ? 7.527   151.959 -13.610 1.00 21.43 ? 104  ARG A NH2 1 
ATOM   423  N  N   . ALA A 1 105 ? 9.128   152.602 -21.107 1.00 20.64 ? 105  ALA A N   1 
ATOM   424  C  CA  . ALA A 1 105 ? 8.861   153.271 -22.375 1.00 21.44 ? 105  ALA A CA  1 
ATOM   425  C  C   . ALA A 1 105 ? 9.810   152.799 -23.474 1.00 21.98 ? 105  ALA A C   1 
ATOM   426  O  O   . ALA A 1 105 ? 9.376   152.465 -24.576 1.00 21.58 ? 105  ALA A O   1 
ATOM   427  C  CB  . ALA A 1 105 ? 8.970   154.784 -22.205 1.00 21.38 ? 105  ALA A CB  1 
ATOM   428  N  N   . VAL A 1 106 ? 11.105  152.767 -23.176 1.00 23.13 ? 106  VAL A N   1 
ATOM   429  C  CA  . VAL A 1 106 ? 12.084  152.341 -24.172 1.00 24.96 ? 106  VAL A CA  1 
ATOM   430  C  C   . VAL A 1 106 ? 11.937  150.864 -24.523 1.00 25.77 ? 106  VAL A C   1 
ATOM   431  O  O   . VAL A 1 106 ? 12.109  150.473 -25.678 1.00 25.27 ? 106  VAL A O   1 
ATOM   432  C  CB  . VAL A 1 106 ? 13.532  152.612 -23.700 1.00 25.33 ? 106  VAL A CB  1 
ATOM   433  C  CG1 . VAL A 1 106 ? 13.854  151.792 -22.468 1.00 26.35 ? 106  VAL A CG1 1 
ATOM   434  C  CG2 . VAL A 1 106 ? 14.499  152.279 -24.816 1.00 27.57 ? 106  VAL A CG2 1 
ATOM   435  N  N   . LEU A 1 107 ? 11.610  150.049 -23.525 1.00 26.89 ? 107  LEU A N   1 
ATOM   436  C  CA  . LEU A 1 107 ? 11.437  148.618 -23.735 1.00 28.71 ? 107  LEU A CA  1 
ATOM   437  C  C   . LEU A 1 107 ? 10.238  148.362 -24.639 1.00 29.75 ? 107  LEU A C   1 
ATOM   438  O  O   . LEU A 1 107 ? 10.327  147.622 -25.617 1.00 30.13 ? 107  LEU A O   1 
ATOM   439  C  CB  . LEU A 1 107 ? 11.225  147.908 -22.393 1.00 28.39 ? 107  LEU A CB  1 
ATOM   440  C  CG  . LEU A 1 107 ? 11.129  146.380 -22.445 1.00 28.46 ? 107  LEU A CG  1 
ATOM   441  C  CD1 . LEU A 1 107 ? 12.451  145.808 -22.934 1.00 28.39 ? 107  LEU A CD1 1 
ATOM   442  C  CD2 . LEU A 1 107 ? 10.787  145.834 -21.063 1.00 27.75 ? 107  LEU A CD2 1 
ATOM   443  N  N   . GLN A 1 108 ? 9.117   148.984 -24.300 1.00 31.14 ? 108  GLN A N   1 
ATOM   444  C  CA  . GLN A 1 108 ? 7.885   148.834 -25.062 1.00 32.97 ? 108  GLN A CA  1 
ATOM   445  C  C   . GLN A 1 108 ? 8.069   149.336 -26.489 1.00 33.54 ? 108  GLN A C   1 
ATOM   446  O  O   . GLN A 1 108 ? 7.426   148.855 -27.422 1.00 33.67 ? 108  GLN A O   1 
ATOM   447  C  CB  . GLN A 1 108 ? 6.764   149.608 -24.364 1.00 33.96 ? 108  GLN A CB  1 
ATOM   448  C  CG  . GLN A 1 108 ? 5.449   149.673 -25.117 1.00 36.03 ? 108  GLN A CG  1 
ATOM   449  C  CD  . GLN A 1 108 ? 4.356   150.352 -24.306 1.00 37.01 ? 108  GLN A CD  1 
ATOM   450  O  OE1 . GLN A 1 108 ? 3.880   149.810 -23.306 1.00 37.98 ? 108  GLN A OE1 1 
ATOM   451  N  NE2 . GLN A 1 108 ? 3.963   151.548 -24.726 1.00 37.61 ? 108  GLN A NE2 1 
ATOM   452  N  N   . ARG A 1 109 ? 8.968   150.298 -26.645 1.00 34.15 ? 109  ARG A N   1 
ATOM   453  C  CA  . ARG A 1 109 ? 9.256   150.898 -27.940 1.00 35.22 ? 109  ARG A CA  1 
ATOM   454  C  C   . ARG A 1 109 ? 10.422  150.169 -28.604 1.00 34.44 ? 109  ARG A C   1 
ATOM   455  O  O   . ARG A 1 109 ? 10.702  150.369 -29.786 1.00 34.47 ? 109  ARG A O   1 
ATOM   456  C  CB  . ARG A 1 109 ? 9.610   152.371 -27.727 1.00 37.21 ? 109  ARG A CB  1 
ATOM   457  C  CG  . ARG A 1 109 ? 9.541   153.245 -28.952 1.00 40.65 ? 109  ARG A CG  1 
ATOM   458  C  CD  . ARG A 1 109 ? 9.779   154.698 -28.556 1.00 43.47 ? 109  ARG A CD  1 
ATOM   459  N  NE  . ARG A 1 109 ? 9.645   155.614 -29.686 1.00 46.39 ? 109  ARG A NE  1 
ATOM   460  C  CZ  . ARG A 1 109 ? 9.859   156.924 -29.615 1.00 47.36 ? 109  ARG A CZ  1 
ATOM   461  N  NH1 . ARG A 1 109 ? 10.219  157.478 -28.465 1.00 48.24 ? 109  ARG A NH1 1 
ATOM   462  N  NH2 . ARG A 1 109 ? 9.719   157.681 -30.697 1.00 48.21 ? 109  ARG A NH2 1 
ATOM   463  N  N   . ASP A 1 110 ? 11.090  149.315 -27.831 1.00 33.10 ? 110  ASP A N   1 
ATOM   464  C  CA  . ASP A 1 110 ? 12.246  148.566 -28.308 1.00 31.79 ? 110  ASP A CA  1 
ATOM   465  C  C   . ASP A 1 110 ? 13.234  149.524 -28.970 1.00 31.30 ? 110  ASP A C   1 
ATOM   466  O  O   . ASP A 1 110 ? 13.720  149.281 -30.077 1.00 30.58 ? 110  ASP A O   1 
ATOM   467  C  CB  . ASP A 1 110 ? 11.820  147.469 -29.291 1.00 31.87 ? 110  ASP A CB  1 
ATOM   468  C  CG  . ASP A 1 110 ? 12.970  146.548 -29.666 1.00 32.19 ? 110  ASP A CG  1 
ATOM   469  O  OD1 . ASP A 1 110 ? 13.817  146.272 -28.791 1.00 32.04 ? 110  ASP A OD1 1 
ATOM   470  O  OD2 . ASP A 1 110 ? 13.027  146.091 -30.827 1.00 33.04 ? 110  ASP A OD2 1 
ATOM   471  N  N   . GLU A 1 111 ? 13.523  150.619 -28.273 1.00 30.25 ? 111  GLU A N   1 
ATOM   472  C  CA  . GLU A 1 111 ? 14.447  151.631 -28.765 1.00 29.55 ? 111  GLU A CA  1 
ATOM   473  C  C   . GLU A 1 111 ? 15.893  151.224 -28.494 1.00 29.45 ? 111  GLU A C   1 
ATOM   474  O  O   . GLU A 1 111 ? 16.330  151.189 -27.343 1.00 28.98 ? 111  GLU A O   1 
ATOM   475  C  CB  . GLU A 1 111 ? 14.158  152.971 -28.084 1.00 28.95 ? 111  GLU A CB  1 
ATOM   476  C  CG  . GLU A 1 111 ? 14.987  154.130 -28.605 1.00 28.61 ? 111  GLU A CG  1 
ATOM   477  C  CD  . GLU A 1 111 ? 14.728  155.414 -27.842 1.00 28.14 ? 111  GLU A CD  1 
ATOM   478  O  OE1 . GLU A 1 111 ? 15.585  155.807 -27.023 1.00 28.54 ? 111  GLU A OE1 1 
ATOM   479  O  OE2 . GLU A 1 111 ? 13.662  156.028 -28.053 1.00 28.37 ? 111  GLU A OE2 1 
ATOM   480  N  N   . ARG A 1 112 ? 16.628  150.910 -29.557 1.00 29.40 ? 112  ARG A N   1 
ATOM   481  C  CA  . ARG A 1 112 ? 18.030  150.518 -29.434 1.00 29.92 ? 112  ARG A CA  1 
ATOM   482  C  C   . ARG A 1 112 ? 18.854  151.790 -29.577 1.00 29.63 ? 112  ARG A C   1 
ATOM   483  O  O   . ARG A 1 112 ? 19.424  152.049 -30.637 1.00 30.20 ? 112  ARG A O   1 
ATOM   484  C  CB  . ARG A 1 112 ? 18.425  149.545 -30.550 1.00 30.78 ? 112  ARG A CB  1 
ATOM   485  C  CG  . ARG A 1 112 ? 17.433  148.425 -30.826 1.00 32.43 ? 112  ARG A CG  1 
ATOM   486  C  CD  . ARG A 1 112 ? 17.282  147.487 -29.650 1.00 33.28 ? 112  ARG A CD  1 
ATOM   487  N  NE  . ARG A 1 112 ? 16.382  146.375 -29.957 1.00 34.21 ? 112  ARG A NE  1 
ATOM   488  C  CZ  . ARG A 1 112 ? 16.699  145.335 -30.724 1.00 34.46 ? 112  ARG A CZ  1 
ATOM   489  N  NH1 . ARG A 1 112 ? 17.902  145.249 -31.273 1.00 35.22 ? 112  ARG A NH1 1 
ATOM   490  N  NH2 . ARG A 1 112 ? 15.809  144.377 -30.943 1.00 34.29 ? 112  ARG A NH2 1 
ATOM   491  N  N   . SER A 1 113 ? 18.920  152.581 -28.513 1.00 28.77 ? 113  SER A N   1 
ATOM   492  C  CA  . SER A 1 113 ? 19.655  153.836 -28.563 1.00 27.64 ? 113  SER A CA  1 
ATOM   493  C  C   . SER A 1 113 ? 20.685  153.984 -27.457 1.00 27.05 ? 113  SER A C   1 
ATOM   494  O  O   . SER A 1 113 ? 20.692  153.231 -26.479 1.00 26.55 ? 113  SER A O   1 
ATOM   495  C  CB  . SER A 1 113 ? 18.679  155.006 -28.473 1.00 27.78 ? 113  SER A CB  1 
ATOM   496  O  OG  . SER A 1 113 ? 18.040  155.014 -27.207 1.00 27.60 ? 113  SER A OG  1 
ATOM   497  N  N   . GLU A 1 114 ? 21.545  154.981 -27.620 1.00 25.65 ? 114  GLU A N   1 
ATOM   498  C  CA  . GLU A 1 114 ? 22.580  155.273 -26.647 1.00 25.26 ? 114  GLU A CA  1 
ATOM   499  C  C   . GLU A 1 114 ? 21.938  155.763 -25.351 1.00 24.40 ? 114  GLU A C   1 
ATOM   500  O  O   . GLU A 1 114 ? 22.384  155.407 -24.259 1.00 24.42 ? 114  GLU A O   1 
ATOM   501  C  CB  . GLU A 1 114 ? 23.528  156.337 -27.207 1.00 26.18 ? 114  GLU A CB  1 
ATOM   502  C  CG  . GLU A 1 114 ? 24.631  156.784 -26.260 1.00 27.61 ? 114  GLU A CG  1 
ATOM   503  C  CD  . GLU A 1 114 ? 25.494  155.639 -25.760 1.00 28.55 ? 114  GLU A CD  1 
ATOM   504  O  OE1 . GLU A 1 114 ? 25.793  154.715 -26.550 1.00 28.76 ? 114  GLU A OE1 1 
ATOM   505  O  OE2 . GLU A 1 114 ? 25.887  155.674 -24.575 1.00 29.22 ? 114  GLU A OE2 1 
ATOM   506  N  N   . ARG A 1 115 ? 20.887  156.572 -25.464 1.00 23.21 ? 115  ARG A N   1 
ATOM   507  C  CA  . ARG A 1 115 ? 20.229  157.079 -24.264 1.00 22.70 ? 115  ARG A CA  1 
ATOM   508  C  C   . ARG A 1 115 ? 19.593  155.930 -23.489 1.00 21.89 ? 115  ARG A C   1 
ATOM   509  O  O   . ARG A 1 115 ? 19.619  155.914 -22.261 1.00 21.10 ? 115  ARG A O   1 
ATOM   510  C  CB  . ARG A 1 115 ? 19.179  158.146 -24.611 1.00 22.47 ? 115  ARG A CB  1 
ATOM   511  C  CG  . ARG A 1 115 ? 17.957  157.666 -25.378 1.00 23.67 ? 115  ARG A CG  1 
ATOM   512  C  CD  . ARG A 1 115 ? 16.958  158.813 -25.544 1.00 24.30 ? 115  ARG A CD  1 
ATOM   513  N  NE  . ARG A 1 115 ? 15.728  158.410 -26.224 1.00 25.02 ? 115  ARG A NE  1 
ATOM   514  C  CZ  . ARG A 1 115 ? 14.736  159.243 -26.530 1.00 25.44 ? 115  ARG A CZ  1 
ATOM   515  N  NH1 . ARG A 1 115 ? 14.826  160.530 -26.217 1.00 25.34 ? 115  ARG A NH1 1 
ATOM   516  N  NH2 . ARG A 1 115 ? 13.655  158.795 -27.154 1.00 25.16 ? 115  ARG A NH2 1 
ATOM   517  N  N   . ALA A 1 116 ? 19.030  154.967 -24.210 1.00 21.60 ? 116  ALA A N   1 
ATOM   518  C  CA  . ALA A 1 116 ? 18.418  153.809 -23.570 1.00 22.16 ? 116  ALA A CA  1 
ATOM   519  C  C   . ALA A 1 116 ? 19.510  153.011 -22.850 1.00 22.39 ? 116  ALA A C   1 
ATOM   520  O  O   . ALA A 1 116 ? 19.304  152.507 -21.742 1.00 22.74 ? 116  ALA A O   1 
ATOM   521  C  CB  . ALA A 1 116 ? 17.724  152.939 -24.611 1.00 21.30 ? 116  ALA A CB  1 
ATOM   522  N  N   . PHE A 1 117 ? 20.677  152.914 -23.481 1.00 22.41 ? 117  PHE A N   1 
ATOM   523  C  CA  . PHE A 1 117 ? 21.803  152.188 -22.902 1.00 22.68 ? 117  PHE A CA  1 
ATOM   524  C  C   . PHE A 1 117 ? 22.226  152.809 -21.572 1.00 22.71 ? 117  PHE A C   1 
ATOM   525  O  O   . PHE A 1 117 ? 22.417  152.101 -20.586 1.00 22.67 ? 117  PHE A O   1 
ATOM   526  C  CB  . PHE A 1 117 ? 22.992  152.184 -23.869 1.00 21.48 ? 117  PHE A CB  1 
ATOM   527  C  CG  . PHE A 1 117 ? 24.192  151.434 -23.353 1.00 21.65 ? 117  PHE A CG  1 
ATOM   528  C  CD1 . PHE A 1 117 ? 24.131  150.060 -23.135 1.00 21.73 ? 117  PHE A CD1 1 
ATOM   529  C  CD2 . PHE A 1 117 ? 25.384  152.100 -23.085 1.00 21.61 ? 117  PHE A CD2 1 
ATOM   530  C  CE1 . PHE A 1 117 ? 25.241  149.361 -22.659 1.00 21.41 ? 117  PHE A CE1 1 
ATOM   531  C  CE2 . PHE A 1 117 ? 26.500  151.410 -22.609 1.00 21.29 ? 117  PHE A CE2 1 
ATOM   532  C  CZ  . PHE A 1 117 ? 26.427  150.038 -22.396 1.00 21.80 ? 117  PHE A CZ  1 
ATOM   533  N  N   . LYS A 1 118 ? 22.376  154.131 -21.545 1.00 22.56 ? 118  LYS A N   1 
ATOM   534  C  CA  . LYS A 1 118 ? 22.772  154.812 -20.314 1.00 23.06 ? 118  LYS A CA  1 
ATOM   535  C  C   . LYS A 1 118 ? 21.692  154.650 -19.249 1.00 21.73 ? 118  LYS A C   1 
ATOM   536  O  O   . LYS A 1 118 ? 21.993  154.576 -18.056 1.00 21.55 ? 118  LYS A O   1 
ATOM   537  C  CB  . LYS A 1 118 ? 23.008  156.303 -20.569 1.00 24.35 ? 118  LYS A CB  1 
ATOM   538  C  CG  . LYS A 1 118 ? 24.164  156.618 -21.509 1.00 27.68 ? 118  LYS A CG  1 
ATOM   539  C  CD  . LYS A 1 118 ? 24.284  158.128 -21.716 1.00 30.06 ? 118  LYS A CD  1 
ATOM   540  C  CE  . LYS A 1 118 ? 25.353  158.484 -22.737 1.00 31.43 ? 118  LYS A CE  1 
ATOM   541  N  NZ  . LYS A 1 118 ? 26.713  158.084 -22.278 1.00 33.09 ? 118  LYS A NZ  1 
ATOM   542  N  N   . LEU A 1 119 ? 20.437  154.603 -19.684 1.00 20.67 ? 119  LEU A N   1 
ATOM   543  C  CA  . LEU A 1 119 ? 19.314  154.452 -18.762 1.00 20.73 ? 119  LEU A CA  1 
ATOM   544  C  C   . LEU A 1 119 ? 19.360  153.117 -18.020 1.00 20.41 ? 119  LEU A C   1 
ATOM   545  O  O   . LEU A 1 119 ? 19.091  153.065 -16.818 1.00 19.55 ? 119  LEU A O   1 
ATOM   546  C  CB  . LEU A 1 119 ? 17.984  154.578 -19.513 1.00 20.88 ? 119  LEU A CB  1 
ATOM   547  C  CG  . LEU A 1 119 ? 16.709  154.290 -18.708 1.00 21.70 ? 119  LEU A CG  1 
ATOM   548  C  CD1 . LEU A 1 119 ? 16.611  155.240 -17.530 1.00 22.62 ? 119  LEU A CD1 1 
ATOM   549  C  CD2 . LEU A 1 119 ? 15.491  154.442 -19.607 1.00 22.94 ? 119  LEU A CD2 1 
ATOM   550  N  N   . THR A 1 120 ? 19.699  152.041 -18.729 1.00 20.04 ? 120  THR A N   1 
ATOM   551  C  CA  . THR A 1 120 ? 19.767  150.727 -18.093 1.00 19.92 ? 120  THR A CA  1 
ATOM   552  C  C   . THR A 1 120 ? 20.756  150.746 -16.935 1.00 20.26 ? 120  THR A C   1 
ATOM   553  O  O   . THR A 1 120 ? 20.575  150.036 -15.945 1.00 19.94 ? 120  THR A O   1 
ATOM   554  C  CB  . THR A 1 120 ? 20.180  149.609 -19.089 1.00 19.59 ? 120  THR A CB  1 
ATOM   555  O  OG1 . THR A 1 120 ? 21.501  149.856 -19.587 1.00 18.53 ? 120  THR A OG1 1 
ATOM   556  C  CG2 . THR A 1 120 ? 19.194  149.542 -20.245 1.00 18.86 ? 120  THR A CG2 1 
ATOM   557  N  N   . ARG A 1 121 ? 21.798  151.567 -17.052 1.00 20.70 ? 121  ARG A N   1 
ATOM   558  C  CA  . ARG A 1 121 ? 22.791  151.663 -15.986 1.00 21.61 ? 121  ARG A CA  1 
ATOM   559  C  C   . ARG A 1 121 ? 22.144  152.172 -14.701 1.00 20.97 ? 121  ARG A C   1 
ATOM   560  O  O   . ARG A 1 121 ? 22.454  151.692 -13.609 1.00 20.06 ? 121  ARG A O   1 
ATOM   561  C  CB  . ARG A 1 121 ? 23.932  152.604 -16.383 1.00 23.84 ? 121  ARG A CB  1 
ATOM   562  C  CG  . ARG A 1 121 ? 24.866  152.933 -15.222 1.00 26.98 ? 121  ARG A CG  1 
ATOM   563  C  CD  . ARG A 1 121 ? 25.823  154.063 -15.572 1.00 29.50 ? 121  ARG A CD  1 
ATOM   564  N  NE  . ARG A 1 121 ? 26.989  153.594 -16.312 1.00 32.09 ? 121  ARG A NE  1 
ATOM   565  C  CZ  . ARG A 1 121 ? 28.126  153.197 -15.746 1.00 32.94 ? 121  ARG A CZ  1 
ATOM   566  N  NH1 . ARG A 1 121 ? 28.258  153.217 -14.425 1.00 33.36 ? 121  ARG A NH1 1 
ATOM   567  N  NH2 . ARG A 1 121 ? 29.132  152.775 -16.503 1.00 32.71 ? 121  ARG A NH2 1 
ATOM   568  N  N   . ASP A 1 122 ? 21.249  153.148 -14.830 1.00 20.68 ? 122  ASP A N   1 
ATOM   569  C  CA  . ASP A 1 122 ? 20.568  153.695 -13.660 1.00 20.87 ? 122  ASP A CA  1 
ATOM   570  C  C   . ASP A 1 122 ? 19.535  152.705 -13.128 1.00 19.89 ? 122  ASP A C   1 
ATOM   571  O  O   . ASP A 1 122 ? 19.374  152.559 -11.917 1.00 20.46 ? 122  ASP A O   1 
ATOM   572  C  CB  . ASP A 1 122 ? 19.874  155.027 -13.993 1.00 21.34 ? 122  ASP A CB  1 
ATOM   573  C  CG  . ASP A 1 122 ? 20.858  156.163 -14.218 1.00 22.06 ? 122  ASP A CG  1 
ATOM   574  O  OD1 . ASP A 1 122 ? 21.948  156.139 -13.608 1.00 22.95 ? 122  ASP A OD1 1 
ATOM   575  O  OD2 . ASP A 1 122 ? 20.534  157.088 -14.990 1.00 21.86 ? 122  ASP A OD2 1 
ATOM   576  N  N   . ALA A 1 123 ? 18.829  152.036 -14.034 1.00 19.43 ? 123  ALA A N   1 
ATOM   577  C  CA  . ALA A 1 123 ? 17.821  151.062 -13.631 1.00 19.18 ? 123  ALA A CA  1 
ATOM   578  C  C   . ALA A 1 123 ? 18.502  149.956 -12.832 1.00 19.29 ? 123  ALA A C   1 
ATOM   579  O  O   . ALA A 1 123 ? 17.972  149.486 -11.825 1.00 19.11 ? 123  ALA A O   1 
ATOM   580  C  CB  . ALA A 1 123 ? 17.125  150.480 -14.858 1.00 18.61 ? 123  ALA A CB  1 
ATOM   581  N  N   . ILE A 1 124 ? 19.683  149.551 -13.288 1.00 19.03 ? 124  ILE A N   1 
ATOM   582  C  CA  . ILE A 1 124 ? 20.446  148.510 -12.611 1.00 19.13 ? 124  ILE A CA  1 
ATOM   583  C  C   . ILE A 1 124 ? 20.868  148.949 -11.210 1.00 19.89 ? 124  ILE A C   1 
ATOM   584  O  O   . ILE A 1 124 ? 20.745  148.185 -10.253 1.00 20.02 ? 124  ILE A O   1 
ATOM   585  C  CB  . ILE A 1 124 ? 21.692  148.119 -13.444 1.00 18.40 ? 124  ILE A CB  1 
ATOM   586  C  CG1 . ILE A 1 124 ? 21.248  147.303 -14.659 1.00 17.38 ? 124  ILE A CG1 1 
ATOM   587  C  CG2 . ILE A 1 124 ? 22.682  147.331 -12.594 1.00 18.19 ? 124  ILE A CG2 1 
ATOM   588  C  CD1 . ILE A 1 124 ? 22.349  147.045 -15.668 1.00 16.85 ? 124  ILE A CD1 1 
ATOM   589  N  N   . GLU A 1 125 ? 21.358  150.177 -11.079 1.00 20.56 ? 125  GLU A N   1 
ATOM   590  C  CA  . GLU A 1 125 ? 21.778  150.662 -9.770  1.00 21.30 ? 125  GLU A CA  1 
ATOM   591  C  C   . GLU A 1 125 ? 20.605  150.638 -8.791  1.00 20.35 ? 125  GLU A C   1 
ATOM   592  O  O   . GLU A 1 125 ? 20.779  150.320 -7.615  1.00 20.36 ? 125  GLU A O   1 
ATOM   593  C  CB  . GLU A 1 125 ? 22.348  152.085 -9.874  1.00 23.50 ? 125  GLU A CB  1 
ATOM   594  C  CG  . GLU A 1 125 ? 22.709  152.696 -8.526  1.00 27.49 ? 125  GLU A CG  1 
ATOM   595  C  CD  . GLU A 1 125 ? 23.429  154.034 -8.643  1.00 30.24 ? 125  GLU A CD  1 
ATOM   596  O  OE1 . GLU A 1 125 ? 23.020  154.871 -9.476  1.00 33.55 ? 125  GLU A OE1 1 
ATOM   597  O  OE2 . GLU A 1 125 ? 24.399  154.258 -7.889  1.00 31.66 ? 125  GLU A OE2 1 
ATOM   598  N  N   . LEU A 1 126 ? 19.413  150.967 -9.285  1.00 19.39 ? 126  LEU A N   1 
ATOM   599  C  CA  . LEU A 1 126 ? 18.201  150.981 -8.468  1.00 18.57 ? 126  LEU A CA  1 
ATOM   600  C  C   . LEU A 1 126 ? 17.774  149.571 -8.064  1.00 18.36 ? 126  LEU A C   1 
ATOM   601  O  O   . LEU A 1 126 ? 17.285  149.356 -6.956  1.00 17.41 ? 126  LEU A O   1 
ATOM   602  C  CB  . LEU A 1 126 ? 17.067  151.672 -9.226  1.00 18.56 ? 126  LEU A CB  1 
ATOM   603  C  CG  . LEU A 1 126 ? 17.228  153.193 -9.340  1.00 18.77 ? 126  LEU A CG  1 
ATOM   604  C  CD1 . LEU A 1 126 ? 16.232  153.747 -10.347 1.00 18.87 ? 126  LEU A CD1 1 
ATOM   605  C  CD2 . LEU A 1 126 ? 17.025  153.832 -7.965  1.00 19.03 ? 126  LEU A CD2 1 
ATOM   606  N  N   . ASN A 1 127 ? 17.941  148.615 -8.975  1.00 16.77 ? 127  ASN A N   1 
ATOM   607  C  CA  . ASN A 1 127 ? 17.613  147.224 -8.683  1.00 16.53 ? 127  ASN A CA  1 
ATOM   608  C  C   . ASN A 1 127 ? 18.439  146.313 -9.581  1.00 16.20 ? 127  ASN A C   1 
ATOM   609  O  O   . ASN A 1 127 ? 18.021  145.966 -10.685 1.00 16.40 ? 127  ASN A O   1 
ATOM   610  C  CB  . ASN A 1 127 ? 16.121  146.941 -8.887  1.00 15.39 ? 127  ASN A CB  1 
ATOM   611  C  CG  . ASN A 1 127 ? 15.772  145.486 -8.614  1.00 15.96 ? 127  ASN A CG  1 
ATOM   612  O  OD1 . ASN A 1 127 ? 16.546  144.769 -7.979  1.00 15.38 ? 127  ASN A OD1 1 
ATOM   613  N  ND2 . ASN A 1 127 ? 14.607  145.047 -9.079  1.00 15.38 ? 127  ASN A ND2 1 
ATOM   614  N  N   . ALA A 1 128 ? 19.615  145.931 -9.097  1.00 16.06 ? 128  ALA A N   1 
ATOM   615  C  CA  . ALA A 1 128 ? 20.517  145.078 -9.859  1.00 16.69 ? 128  ALA A CA  1 
ATOM   616  C  C   . ALA A 1 128 ? 19.979  143.665 -10.065 1.00 16.99 ? 128  ALA A C   1 
ATOM   617  O  O   . ALA A 1 128 ? 20.563  142.885 -10.818 1.00 17.05 ? 128  ALA A O   1 
ATOM   618  C  CB  . ALA A 1 128 ? 21.882  145.030 -9.178  1.00 16.81 ? 128  ALA A CB  1 
ATOM   619  N  N   . ALA A 1 129 ? 18.873  143.331 -9.403  1.00 16.35 ? 129  ALA A N   1 
ATOM   620  C  CA  . ALA A 1 129 ? 18.285  142.000 -9.553  1.00 16.50 ? 129  ALA A CA  1 
ATOM   621  C  C   . ALA A 1 129 ? 17.225  141.960 -10.657 1.00 16.49 ? 129  ALA A C   1 
ATOM   622  O  O   . ALA A 1 129 ? 16.620  140.914 -10.904 1.00 15.90 ? 129  ALA A O   1 
ATOM   623  C  CB  . ALA A 1 129 ? 17.673  141.538 -8.229  1.00 15.88 ? 129  ALA A CB  1 
ATOM   624  N  N   . ASN A 1 130 ? 16.990  143.091 -11.318 1.00 15.88 ? 130  ASN A N   1 
ATOM   625  C  CA  . ASN A 1 130 ? 15.996  143.125 -12.386 1.00 15.91 ? 130  ASN A CA  1 
ATOM   626  C  C   . ASN A 1 130 ? 16.598  142.518 -13.648 1.00 16.20 ? 130  ASN A C   1 
ATOM   627  O  O   . ASN A 1 130 ? 17.293  143.198 -14.407 1.00 15.71 ? 130  ASN A O   1 
ATOM   628  C  CB  . ASN A 1 130 ? 15.540  144.557 -12.673 1.00 15.35 ? 130  ASN A CB  1 
ATOM   629  C  CG  . ASN A 1 130 ? 14.349  144.598 -13.598 1.00 15.10 ? 130  ASN A CG  1 
ATOM   630  O  OD1 . ASN A 1 130 ? 14.363  143.983 -14.666 1.00 15.04 ? 130  ASN A OD1 1 
ATOM   631  N  ND2 . ASN A 1 130 ? 13.302  145.311 -13.193 1.00 14.12 ? 130  ASN A ND2 1 
ATOM   632  N  N   . TYR A 1 131 ? 16.313  141.235 -13.863 1.00 15.68 ? 131  TYR A N   1 
ATOM   633  C  CA  . TYR A 1 131 ? 16.833  140.487 -15.004 1.00 14.82 ? 131  TYR A CA  1 
ATOM   634  C  C   . TYR A 1 131 ? 16.366  141.009 -16.359 1.00 14.72 ? 131  TYR A C   1 
ATOM   635  O  O   . TYR A 1 131 ? 17.051  140.828 -17.367 1.00 15.06 ? 131  TYR A O   1 
ATOM   636  C  CB  . TYR A 1 131 ? 16.458  139.007 -14.850 1.00 13.51 ? 131  TYR A CB  1 
ATOM   637  C  CG  . TYR A 1 131 ? 14.966  138.777 -14.741 1.00 13.29 ? 131  TYR A CG  1 
ATOM   638  C  CD1 . TYR A 1 131 ? 14.180  138.636 -15.881 1.00 12.17 ? 131  TYR A CD1 1 
ATOM   639  C  CD2 . TYR A 1 131 ? 14.333  138.755 -13.493 1.00 12.70 ? 131  TYR A CD2 1 
ATOM   640  C  CE1 . TYR A 1 131 ? 12.806  138.482 -15.788 1.00 12.22 ? 131  TYR A CE1 1 
ATOM   641  C  CE2 . TYR A 1 131 ? 12.955  138.605 -13.390 1.00 12.21 ? 131  TYR A CE2 1 
ATOM   642  C  CZ  . TYR A 1 131 ? 12.199  138.470 -14.541 1.00 12.23 ? 131  TYR A CZ  1 
ATOM   643  O  OH  . TYR A 1 131 ? 10.835  138.331 -14.455 1.00 12.63 ? 131  TYR A OH  1 
ATOM   644  N  N   . THR A 1 132 ? 15.202  141.648 -16.388 1.00 14.87 ? 132  THR A N   1 
ATOM   645  C  CA  . THR A 1 132 ? 14.680  142.189 -17.634 1.00 14.97 ? 132  THR A CA  1 
ATOM   646  C  C   . THR A 1 132 ? 15.569  143.336 -18.125 1.00 15.35 ? 132  THR A C   1 
ATOM   647  O  O   . THR A 1 132 ? 15.865  143.432 -19.318 1.00 15.14 ? 132  THR A O   1 
ATOM   648  C  CB  . THR A 1 132 ? 13.232  142.678 -17.455 1.00 14.77 ? 132  THR A CB  1 
ATOM   649  O  OG1 . THR A 1 132 ? 12.391  141.556 -17.152 1.00 15.30 ? 132  THR A OG1 1 
ATOM   650  C  CG2 . THR A 1 132 ? 12.728  143.350 -18.728 1.00 14.65 ? 132  THR A CG2 1 
ATOM   651  N  N   . VAL A 1 133 ? 16.004  144.193 -17.203 1.00 15.26 ? 133  VAL A N   1 
ATOM   652  C  CA  . VAL A 1 133 ? 16.873  145.310 -17.561 1.00 15.83 ? 133  VAL A CA  1 
ATOM   653  C  C   . VAL A 1 133 ? 18.205  144.794 -18.108 1.00 16.17 ? 133  VAL A C   1 
ATOM   654  O  O   . VAL A 1 133 ? 18.681  145.259 -19.144 1.00 15.84 ? 133  VAL A O   1 
ATOM   655  C  CB  . VAL A 1 133 ? 17.157  146.221 -16.343 1.00 15.74 ? 133  VAL A CB  1 
ATOM   656  C  CG1 . VAL A 1 133 ? 18.146  147.323 -16.733 1.00 15.27 ? 133  VAL A CG1 1 
ATOM   657  C  CG2 . VAL A 1 133 ? 15.853  146.833 -15.839 1.00 14.88 ? 133  VAL A CG2 1 
ATOM   658  N  N   . TRP A 1 134 ? 18.805  143.837 -17.404 1.00 17.22 ? 134  TRP A N   1 
ATOM   659  C  CA  . TRP A 1 134 ? 20.073  143.254 -17.833 1.00 17.64 ? 134  TRP A CA  1 
ATOM   660  C  C   . TRP A 1 134 ? 19.962  142.650 -19.230 1.00 18.71 ? 134  TRP A C   1 
ATOM   661  O  O   . TRP A 1 134 ? 20.874  142.780 -20.049 1.00 18.51 ? 134  TRP A O   1 
ATOM   662  C  CB  . TRP A 1 134 ? 20.528  142.171 -16.851 1.00 17.10 ? 134  TRP A CB  1 
ATOM   663  C  CG  . TRP A 1 134 ? 21.135  142.704 -15.597 1.00 16.53 ? 134  TRP A CG  1 
ATOM   664  C  CD1 . TRP A 1 134 ? 20.557  142.766 -14.358 1.00 16.90 ? 134  TRP A CD1 1 
ATOM   665  C  CD2 . TRP A 1 134 ? 22.447  143.253 -15.455 1.00 16.94 ? 134  TRP A CD2 1 
ATOM   666  N  NE1 . TRP A 1 134 ? 21.432  143.317 -13.454 1.00 16.15 ? 134  TRP A NE1 1 
ATOM   667  C  CE2 . TRP A 1 134 ? 22.601  143.625 -14.102 1.00 16.61 ? 134  TRP A CE2 1 
ATOM   668  C  CE3 . TRP A 1 134 ? 23.512  143.467 -16.344 1.00 16.16 ? 134  TRP A CE3 1 
ATOM   669  C  CZ2 . TRP A 1 134 ? 23.778  144.200 -13.613 1.00 15.97 ? 134  TRP A CZ2 1 
ATOM   670  C  CZ3 . TRP A 1 134 ? 24.680  144.037 -15.857 1.00 15.94 ? 134  TRP A CZ3 1 
ATOM   671  C  CH2 . TRP A 1 134 ? 24.803  144.397 -14.502 1.00 16.08 ? 134  TRP A CH2 1 
ATOM   672  N  N   . HIS A 1 135 ? 18.847  141.978 -19.497 1.00 19.49 ? 135  HIS A N   1 
ATOM   673  C  CA  . HIS A 1 135 ? 18.642  141.370 -20.803 1.00 20.74 ? 135  HIS A CA  1 
ATOM   674  C  C   . HIS A 1 135 ? 18.627  142.444 -21.887 1.00 20.61 ? 135  HIS A C   1 
ATOM   675  O  O   . HIS A 1 135 ? 19.263  142.299 -22.931 1.00 19.66 ? 135  HIS A O   1 
ATOM   676  C  CB  . HIS A 1 135 ? 17.318  140.608 -20.849 1.00 22.75 ? 135  HIS A CB  1 
ATOM   677  C  CG  . HIS A 1 135 ? 17.011  140.032 -22.195 1.00 25.71 ? 135  HIS A CG  1 
ATOM   678  N  ND1 . HIS A 1 135 ? 17.617  138.887 -22.668 1.00 27.84 ? 135  HIS A ND1 1 
ATOM   679  C  CD2 . HIS A 1 135 ? 16.216  140.477 -23.196 1.00 26.61 ? 135  HIS A CD2 1 
ATOM   680  C  CE1 . HIS A 1 135 ? 17.207  138.654 -23.904 1.00 27.78 ? 135  HIS A CE1 1 
ATOM   681  N  NE2 . HIS A 1 135 ? 16.357  139.604 -24.247 1.00 27.42 ? 135  HIS A NE2 1 
ATOM   682  N  N   . PHE A 1 136 ? 17.894  143.521 -21.636 1.00 19.98 ? 136  PHE A N   1 
ATOM   683  C  CA  . PHE A 1 136 ? 17.805  144.601 -22.608 1.00 20.37 ? 136  PHE A CA  1 
ATOM   684  C  C   . PHE A 1 136 ? 19.168  145.261 -22.791 1.00 20.13 ? 136  PHE A C   1 
ATOM   685  O  O   . PHE A 1 136 ? 19.533  145.637 -23.903 1.00 20.00 ? 136  PHE A O   1 
ATOM   686  C  CB  . PHE A 1 136 ? 16.770  145.641 -22.167 1.00 21.06 ? 136  PHE A CB  1 
ATOM   687  C  CG  . PHE A 1 136 ? 16.367  146.594 -23.262 1.00 22.20 ? 136  PHE A CG  1 
ATOM   688  C  CD1 . PHE A 1 136 ? 15.762  146.120 -24.422 1.00 22.84 ? 136  PHE A CD1 1 
ATOM   689  C  CD2 . PHE A 1 136 ? 16.605  147.958 -23.140 1.00 22.65 ? 136  PHE A CD2 1 
ATOM   690  C  CE1 . PHE A 1 136 ? 15.400  146.993 -25.452 1.00 23.81 ? 136  PHE A CE1 1 
ATOM   691  C  CE2 . PHE A 1 136 ? 16.248  148.842 -24.162 1.00 23.21 ? 136  PHE A CE2 1 
ATOM   692  C  CZ  . PHE A 1 136 ? 15.645  148.359 -25.318 1.00 22.97 ? 136  PHE A CZ  1 
ATOM   693  N  N   . ARG A 1 137 ? 19.923  145.394 -21.703 1.00 19.82 ? 137  ARG A N   1 
ATOM   694  C  CA  . ARG A 1 137 ? 21.243  146.006 -21.792 1.00 20.20 ? 137  ARG A CA  1 
ATOM   695  C  C   . ARG A 1 137 ? 22.132  145.189 -22.730 1.00 20.37 ? 137  ARG A C   1 
ATOM   696  O  O   . ARG A 1 137 ? 22.904  145.752 -23.505 1.00 20.42 ? 137  ARG A O   1 
ATOM   697  C  CB  . ARG A 1 137 ? 21.898  146.107 -20.411 1.00 19.70 ? 137  ARG A CB  1 
ATOM   698  C  CG  . ARG A 1 137 ? 23.220  146.883 -20.418 1.00 19.71 ? 137  ARG A CG  1 
ATOM   699  C  CD  . ARG A 1 137 ? 23.852  146.951 -19.035 1.00 19.53 ? 137  ARG A CD  1 
ATOM   700  N  NE  . ARG A 1 137 ? 25.142  147.645 -19.036 1.00 19.30 ? 137  ARG A NE  1 
ATOM   701  C  CZ  . ARG A 1 137 ? 25.289  148.967 -19.085 1.00 20.26 ? 137  ARG A CZ  1 
ATOM   702  N  NH1 . ARG A 1 137 ? 24.223  149.761 -19.136 1.00 20.39 ? 137  ARG A NH1 1 
ATOM   703  N  NH2 . ARG A 1 137 ? 26.505  149.498 -19.084 1.00 20.04 ? 137  ARG A NH2 1 
ATOM   704  N  N   . ARG A 1 138 ? 22.021  143.865 -22.664 1.00 20.02 ? 138  ARG A N   1 
ATOM   705  C  CA  . ARG A 1 138 ? 22.820  143.007 -23.533 1.00 20.15 ? 138  ARG A CA  1 
ATOM   706  C  C   . ARG A 1 138 ? 22.375  143.143 -24.988 1.00 20.62 ? 138  ARG A C   1 
ATOM   707  O  O   . ARG A 1 138 ? 23.195  143.064 -25.901 1.00 20.83 ? 138  ARG A O   1 
ATOM   708  C  CB  . ARG A 1 138 ? 22.740  141.543 -23.079 1.00 19.65 ? 138  ARG A CB  1 
ATOM   709  C  CG  . ARG A 1 138 ? 23.575  141.256 -21.833 1.00 18.52 ? 138  ARG A CG  1 
ATOM   710  C  CD  . ARG A 1 138 ? 23.710  139.764 -21.567 1.00 17.62 ? 138  ARG A CD  1 
ATOM   711  N  NE  . ARG A 1 138 ? 22.500  139.173 -21.004 1.00 18.10 ? 138  ARG A NE  1 
ATOM   712  C  CZ  . ARG A 1 138 ? 22.137  139.271 -19.727 1.00 17.16 ? 138  ARG A CZ  1 
ATOM   713  N  NH1 . ARG A 1 138 ? 22.891  139.940 -18.863 1.00 16.57 ? 138  ARG A NH1 1 
ATOM   714  N  NH2 . ARG A 1 138 ? 21.018  138.691 -19.315 1.00 16.79 ? 138  ARG A NH2 1 
ATOM   715  N  N   . VAL A 1 139 ? 21.078  143.350 -25.201 1.00 20.64 ? 139  VAL A N   1 
ATOM   716  C  CA  . VAL A 1 139 ? 20.555  143.535 -26.552 1.00 21.37 ? 139  VAL A CA  1 
ATOM   717  C  C   . VAL A 1 139 ? 21.138  144.832 -27.117 1.00 21.72 ? 139  VAL A C   1 
ATOM   718  O  O   . VAL A 1 139 ? 21.467  144.916 -28.301 1.00 22.31 ? 139  VAL A O   1 
ATOM   719  C  CB  . VAL A 1 139 ? 19.007  143.643 -26.553 1.00 21.46 ? 139  VAL A CB  1 
ATOM   720  C  CG1 . VAL A 1 139 ? 18.512  144.110 -27.919 1.00 21.55 ? 139  VAL A CG1 1 
ATOM   721  C  CG2 . VAL A 1 139 ? 18.390  142.292 -26.210 1.00 21.16 ? 139  VAL A CG2 1 
ATOM   722  N  N   . LEU A 1 140 ? 21.267  145.839 -26.258 1.00 21.79 ? 140  LEU A N   1 
ATOM   723  C  CA  . LEU A 1 140 ? 21.812  147.134 -26.655 1.00 22.38 ? 140  LEU A CA  1 
ATOM   724  C  C   . LEU A 1 140 ? 23.315  147.056 -26.916 1.00 22.79 ? 140  LEU A C   1 
ATOM   725  O  O   . LEU A 1 140 ? 23.816  147.670 -27.857 1.00 22.05 ? 140  LEU A O   1 
ATOM   726  C  CB  . LEU A 1 140 ? 21.525  148.183 -25.574 1.00 22.18 ? 140  LEU A CB  1 
ATOM   727  C  CG  . LEU A 1 140 ? 20.050  148.565 -25.392 1.00 23.17 ? 140  LEU A CG  1 
ATOM   728  C  CD1 . LEU A 1 140 ? 19.880  149.446 -24.155 1.00 24.01 ? 140  LEU A CD1 1 
ATOM   729  C  CD2 . LEU A 1 140 ? 19.554  149.285 -26.636 1.00 22.81 ? 140  LEU A CD2 1 
ATOM   730  N  N   . LEU A 1 141 ? 24.035  146.307 -26.084 1.00 23.04 ? 141  LEU A N   1 
ATOM   731  C  CA  . LEU A 1 141 ? 25.477  146.163 -26.268 1.00 24.23 ? 141  LEU A CA  1 
ATOM   732  C  C   . LEU A 1 141 ? 25.756  145.657 -27.682 1.00 24.97 ? 141  LEU A C   1 
ATOM   733  O  O   . LEU A 1 141 ? 26.687  146.110 -28.346 1.00 24.98 ? 141  LEU A O   1 
ATOM   734  C  CB  . LEU A 1 141 ? 26.059  145.175 -25.249 1.00 23.40 ? 141  LEU A CB  1 
ATOM   735  C  CG  . LEU A 1 141 ? 26.220  145.634 -23.795 1.00 23.68 ? 141  LEU A CG  1 
ATOM   736  C  CD1 . LEU A 1 141 ? 26.500  144.423 -22.903 1.00 22.42 ? 141  LEU A CD1 1 
ATOM   737  C  CD2 . LEU A 1 141 ? 27.354  146.653 -23.696 1.00 21.78 ? 141  LEU A CD2 1 
ATOM   738  N  N   . LYS A 1 142 ? 24.934  144.717 -28.133 1.00 26.31 ? 142  LYS A N   1 
ATOM   739  C  CA  . LYS A 1 142 ? 25.084  144.141 -29.461 1.00 27.88 ? 142  LYS A CA  1 
ATOM   740  C  C   . LYS A 1 142 ? 24.650  145.132 -30.543 1.00 27.93 ? 142  LYS A C   1 
ATOM   741  O  O   . LYS A 1 142 ? 25.424  145.456 -31.443 1.00 27.77 ? 142  LYS A O   1 
ATOM   742  C  CB  . LYS A 1 142 ? 24.259  142.853 -29.565 1.00 28.95 ? 142  LYS A CB  1 
ATOM   743  C  CG  . LYS A 1 142 ? 24.555  142.019 -30.800 1.00 31.68 ? 142  LYS A CG  1 
ATOM   744  C  CD  . LYS A 1 142 ? 23.722  140.741 -30.826 1.00 33.65 ? 142  LYS A CD  1 
ATOM   745  C  CE  . LYS A 1 142 ? 24.182  139.801 -31.937 1.00 34.94 ? 142  LYS A CE  1 
ATOM   746  N  NZ  . LYS A 1 142 ? 24.146  140.453 -33.279 1.00 36.43 ? 142  LYS A NZ  1 
ATOM   747  N  N   . SER A 1 143 ? 23.414  145.612 -30.448 1.00 27.80 ? 143  SER A N   1 
ATOM   748  C  CA  . SER A 1 143 ? 22.881  146.563 -31.423 1.00 28.51 ? 143  SER A CA  1 
ATOM   749  C  C   . SER A 1 143 ? 23.773  147.783 -31.628 1.00 28.21 ? 143  SER A C   1 
ATOM   750  O  O   . SER A 1 143 ? 24.050  148.174 -32.760 1.00 28.65 ? 143  SER A O   1 
ATOM   751  C  CB  . SER A 1 143 ? 21.492  147.039 -30.995 1.00 28.61 ? 143  SER A CB  1 
ATOM   752  O  OG  . SER A 1 143 ? 20.560  145.978 -31.025 1.00 30.77 ? 143  SER A OG  1 
ATOM   753  N  N   . LEU A 1 144 ? 24.215  148.387 -30.531 1.00 27.81 ? 144  LEU A N   1 
ATOM   754  C  CA  . LEU A 1 144 ? 25.055  149.576 -30.597 1.00 27.85 ? 144  LEU A CA  1 
ATOM   755  C  C   . LEU A 1 144 ? 26.529  149.248 -30.785 1.00 28.28 ? 144  LEU A C   1 
ATOM   756  O  O   . LEU A 1 144 ? 27.360  150.152 -30.868 1.00 28.21 ? 144  LEU A O   1 
ATOM   757  C  CB  . LEU A 1 144 ? 24.880  150.411 -29.325 1.00 26.91 ? 144  LEU A CB  1 
ATOM   758  C  CG  . LEU A 1 144 ? 23.453  150.869 -29.002 1.00 26.92 ? 144  LEU A CG  1 
ATOM   759  C  CD1 . LEU A 1 144 ? 23.417  151.505 -27.620 1.00 25.78 ? 144  LEU A CD1 1 
ATOM   760  C  CD2 . LEU A 1 144 ? 22.973  151.850 -30.062 1.00 26.60 ? 144  LEU A CD2 1 
ATOM   761  N  N   . GLN A 1 145 ? 26.852  147.960 -30.854 1.00 28.86 ? 145  GLN A N   1 
ATOM   762  C  CA  . GLN A 1 145 ? 28.237  147.528 -31.018 1.00 29.68 ? 145  GLN A CA  1 
ATOM   763  C  C   . GLN A 1 145 ? 29.141  148.223 -29.998 1.00 29.31 ? 145  GLN A C   1 
ATOM   764  O  O   . GLN A 1 145 ? 30.195  148.764 -30.345 1.00 28.74 ? 145  GLN A O   1 
ATOM   765  C  CB  . GLN A 1 145 ? 28.723  147.827 -32.442 1.00 31.31 ? 145  GLN A CB  1 
ATOM   766  C  CG  . GLN A 1 145 ? 28.017  147.012 -33.518 1.00 34.28 ? 145  GLN A CG  1 
ATOM   767  C  CD  . GLN A 1 145 ? 28.599  147.236 -34.906 1.00 36.78 ? 145  GLN A CD  1 
ATOM   768  O  OE1 . GLN A 1 145 ? 29.803  147.075 -35.121 1.00 38.47 ? 145  GLN A OE1 1 
ATOM   769  N  NE2 . GLN A 1 145 ? 27.744  147.604 -35.855 1.00 37.61 ? 145  GLN A NE2 1 
ATOM   770  N  N   . LYS A 1 146 ? 28.720  148.195 -28.736 1.00 28.29 ? 146  LYS A N   1 
ATOM   771  C  CA  . LYS A 1 146 ? 29.466  148.825 -27.650 1.00 27.78 ? 146  LYS A CA  1 
ATOM   772  C  C   . LYS A 1 146 ? 30.800  148.139 -27.368 1.00 27.70 ? 146  LYS A C   1 
ATOM   773  O  O   . LYS A 1 146 ? 30.956  146.942 -27.606 1.00 27.92 ? 146  LYS A O   1 
ATOM   774  C  CB  . LYS A 1 146 ? 28.624  148.826 -26.368 1.00 27.50 ? 146  LYS A CB  1 
ATOM   775  C  CG  . LYS A 1 146 ? 27.268  149.506 -26.495 1.00 27.20 ? 146  LYS A CG  1 
ATOM   776  C  CD  . LYS A 1 146 ? 27.400  150.975 -26.880 1.00 27.30 ? 146  LYS A CD  1 
ATOM   777  C  CE  . LYS A 1 146 ? 28.225  151.746 -25.864 1.00 27.36 ? 146  LYS A CE  1 
ATOM   778  N  NZ  . LYS A 1 146 ? 28.315  153.190 -26.212 1.00 27.19 ? 146  LYS A NZ  1 
ATOM   779  N  N   . ASP A 1 147 ? 31.759  148.908 -26.859 1.00 27.83 ? 147  ASP A N   1 
ATOM   780  C  CA  . ASP A 1 147 ? 33.080  148.381 -26.520 1.00 28.40 ? 147  ASP A CA  1 
ATOM   781  C  C   . ASP A 1 147 ? 32.898  147.410 -25.354 1.00 27.77 ? 147  ASP A C   1 
ATOM   782  O  O   . ASP A 1 147 ? 32.524  147.822 -24.257 1.00 27.33 ? 147  ASP A O   1 
ATOM   783  C  CB  . ASP A 1 147 ? 34.007  149.523 -26.099 1.00 29.40 ? 147  ASP A CB  1 
ATOM   784  C  CG  . ASP A 1 147 ? 35.439  149.065 -25.873 1.00 31.27 ? 147  ASP A CG  1 
ATOM   785  O  OD1 . ASP A 1 147 ? 35.655  148.098 -25.112 1.00 30.84 ? 147  ASP A OD1 1 
ATOM   786  O  OD2 . ASP A 1 147 ? 36.356  149.684 -26.455 1.00 33.16 ? 147  ASP A OD2 1 
ATOM   787  N  N   . LEU A 1 148 ? 33.167  146.130 -25.590 1.00 27.85 ? 148  LEU A N   1 
ATOM   788  C  CA  . LEU A 1 148 ? 32.999  145.115 -24.554 1.00 27.60 ? 148  LEU A CA  1 
ATOM   789  C  C   . LEU A 1 148 ? 34.026  145.163 -23.430 1.00 27.48 ? 148  LEU A C   1 
ATOM   790  O  O   . LEU A 1 148 ? 33.745  144.723 -22.316 1.00 27.48 ? 148  LEU A O   1 
ATOM   791  C  CB  . LEU A 1 148 ? 32.971  143.722 -25.188 1.00 27.30 ? 148  LEU A CB  1 
ATOM   792  C  CG  . LEU A 1 148 ? 31.797  143.500 -26.147 1.00 27.69 ? 148  LEU A CG  1 
ATOM   793  C  CD1 . LEU A 1 148 ? 31.801  142.068 -26.649 1.00 26.71 ? 148  LEU A CD1 1 
ATOM   794  C  CD2 . LEU A 1 148 ? 30.483  143.812 -25.437 1.00 27.29 ? 148  LEU A CD2 1 
ATOM   795  N  N   . HIS A 1 149 ? 35.214  145.689 -23.708 1.00 27.80 ? 149  HIS A N   1 
ATOM   796  C  CA  . HIS A 1 149 ? 36.236  145.791 -22.673 1.00 27.80 ? 149  HIS A CA  1 
ATOM   797  C  C   . HIS A 1 149 ? 35.806  146.879 -21.702 1.00 28.08 ? 149  HIS A C   1 
ATOM   798  O  O   . HIS A 1 149 ? 36.119  146.833 -20.512 1.00 27.72 ? 149  HIS A O   1 
ATOM   799  C  CB  . HIS A 1 149 ? 37.596  146.129 -23.289 1.00 28.94 ? 149  HIS A CB  1 
ATOM   800  C  CG  . HIS A 1 149 ? 38.200  144.997 -24.060 1.00 30.39 ? 149  HIS A CG  1 
ATOM   801  N  ND1 . HIS A 1 149 ? 38.623  143.830 -23.460 1.00 30.87 ? 149  HIS A ND1 1 
ATOM   802  C  CD2 . HIS A 1 149 ? 38.414  144.835 -25.388 1.00 31.02 ? 149  HIS A CD2 1 
ATOM   803  C  CE1 . HIS A 1 149 ? 39.069  142.998 -24.383 1.00 31.32 ? 149  HIS A CE1 1 
ATOM   804  N  NE2 . HIS A 1 149 ? 38.953  143.583 -25.562 1.00 31.52 ? 149  HIS A NE2 1 
ATOM   805  N  N   . GLU A 1 150 ? 35.070  147.856 -22.218 1.00 28.12 ? 150  GLU A N   1 
ATOM   806  C  CA  . GLU A 1 150 ? 34.577  148.946 -21.389 1.00 28.39 ? 150  GLU A CA  1 
ATOM   807  C  C   . GLU A 1 150 ? 33.478  148.379 -20.485 1.00 26.83 ? 150  GLU A C   1 
ATOM   808  O  O   . GLU A 1 150 ? 33.398  148.714 -19.302 1.00 25.80 ? 150  GLU A O   1 
ATOM   809  C  CB  . GLU A 1 150 ? 34.006  150.063 -22.267 1.00 30.69 ? 150  GLU A CB  1 
ATOM   810  C  CG  . GLU A 1 150 ? 34.099  151.443 -21.644 1.00 35.00 ? 150  GLU A CG  1 
ATOM   811  C  CD  . GLU A 1 150 ? 35.527  151.967 -21.618 1.00 37.35 ? 150  GLU A CD  1 
ATOM   812  O  OE1 . GLU A 1 150 ? 35.759  153.049 -21.034 1.00 39.36 ? 150  GLU A OE1 1 
ATOM   813  O  OE2 . GLU A 1 150 ? 36.418  151.299 -22.188 1.00 38.64 ? 150  GLU A OE2 1 
ATOM   814  N  N   . GLU A 1 151 ? 32.637  147.516 -21.051 1.00 25.19 ? 151  GLU A N   1 
ATOM   815  C  CA  . GLU A 1 151 ? 31.554  146.901 -20.288 1.00 25.01 ? 151  GLU A CA  1 
ATOM   816  C  C   . GLU A 1 151 ? 32.144  145.996 -19.204 1.00 24.66 ? 151  GLU A C   1 
ATOM   817  O  O   . GLU A 1 151 ? 31.578  145.862 -18.120 1.00 24.91 ? 151  GLU A O   1 
ATOM   818  C  CB  . GLU A 1 151 ? 30.638  146.090 -21.217 1.00 23.94 ? 151  GLU A CB  1 
ATOM   819  C  CG  . GLU A 1 151 ? 29.433  145.448 -20.523 1.00 23.24 ? 151  GLU A CG  1 
ATOM   820  C  CD  . GLU A 1 151 ? 28.392  146.454 -20.042 1.00 22.97 ? 151  GLU A CD  1 
ATOM   821  O  OE1 . GLU A 1 151 ? 28.642  147.677 -20.116 1.00 22.35 ? 151  GLU A OE1 1 
ATOM   822  O  OE2 . GLU A 1 151 ? 27.316  146.016 -19.580 1.00 23.20 ? 151  GLU A OE2 1 
ATOM   823  N  N   . MET A 1 152 ? 33.283  145.378 -19.500 1.00 24.48 ? 152  MET A N   1 
ATOM   824  C  CA  . MET A 1 152 ? 33.942  144.505 -18.532 1.00 24.53 ? 152  MET A CA  1 
ATOM   825  C  C   . MET A 1 152 ? 34.389  145.311 -17.318 1.00 24.11 ? 152  MET A C   1 
ATOM   826  O  O   . MET A 1 152 ? 34.284  144.844 -16.181 1.00 23.99 ? 152  MET A O   1 
ATOM   827  C  CB  . MET A 1 152 ? 35.148  143.804 -19.169 1.00 25.01 ? 152  MET A CB  1 
ATOM   828  C  CG  . MET A 1 152 ? 34.806  142.520 -19.924 1.00 26.37 ? 152  MET A CG  1 
ATOM   829  S  SD  . MET A 1 152 ? 34.380  141.143 -18.812 1.00 28.11 ? 152  MET A SD  1 
ATOM   830  C  CE  . MET A 1 152 ? 36.013  140.532 -18.405 1.00 27.30 ? 152  MET A CE  1 
ATOM   831  N  N   . ASN A 1 153 ? 34.894  146.519 -17.561 1.00 23.68 ? 153  ASN A N   1 
ATOM   832  C  CA  . ASN A 1 153 ? 35.335  147.383 -16.471 1.00 23.37 ? 153  ASN A CA  1 
ATOM   833  C  C   . ASN A 1 153 ? 34.107  147.742 -15.643 1.00 22.43 ? 153  ASN A C   1 
ATOM   834  O  O   . ASN A 1 153 ? 34.174  147.860 -14.420 1.00 21.94 ? 153  ASN A O   1 
ATOM   835  C  CB  . ASN A 1 153 ? 35.980  148.667 -17.010 1.00 24.64 ? 153  ASN A CB  1 
ATOM   836  C  CG  . ASN A 1 153 ? 37.197  148.394 -17.873 1.00 26.06 ? 153  ASN A CG  1 
ATOM   837  O  OD1 . ASN A 1 153 ? 37.927  147.430 -17.649 1.00 27.10 ? 153  ASN A OD1 1 
ATOM   838  N  ND2 . ASN A 1 153 ? 37.432  149.258 -18.857 1.00 26.61 ? 153  ASN A ND2 1 
ATOM   839  N  N   . TYR A 1 154 ? 32.981  147.917 -16.326 1.00 21.51 ? 154  TYR A N   1 
ATOM   840  C  CA  . TYR A 1 154 ? 31.730  148.251 -15.665 1.00 20.66 ? 154  TYR A CA  1 
ATOM   841  C  C   . TYR A 1 154 ? 31.235  147.108 -14.774 1.00 20.53 ? 154  TYR A C   1 
ATOM   842  O  O   . TYR A 1 154 ? 30.913  147.322 -13.607 1.00 20.44 ? 154  TYR A O   1 
ATOM   843  C  CB  . TYR A 1 154 ? 30.658  148.576 -16.708 1.00 20.56 ? 154  TYR A CB  1 
ATOM   844  C  CG  . TYR A 1 154 ? 29.254  148.605 -16.141 1.00 20.56 ? 154  TYR A CG  1 
ATOM   845  C  CD1 . TYR A 1 154 ? 28.859  149.608 -15.256 1.00 20.03 ? 154  TYR A CD1 1 
ATOM   846  C  CD2 . TYR A 1 154 ? 28.323  147.623 -16.487 1.00 20.33 ? 154  TYR A CD2 1 
ATOM   847  C  CE1 . TYR A 1 154 ? 27.567  149.639 -14.729 1.00 20.57 ? 154  TYR A CE1 1 
ATOM   848  C  CE2 . TYR A 1 154 ? 27.025  147.642 -15.964 1.00 20.60 ? 154  TYR A CE2 1 
ATOM   849  C  CZ  . TYR A 1 154 ? 26.656  148.655 -15.088 1.00 21.21 ? 154  TYR A CZ  1 
ATOM   850  O  OH  . TYR A 1 154 ? 25.376  148.698 -14.587 1.00 21.66 ? 154  TYR A OH  1 
ATOM   851  N  N   . ILE A 1 155 ? 31.175  145.896 -15.326 1.00 20.32 ? 155  ILE A N   1 
ATOM   852  C  CA  . ILE A 1 155 ? 30.692  144.745 -14.567 1.00 19.75 ? 155  ILE A CA  1 
ATOM   853  C  C   . ILE A 1 155 ? 31.619  144.436 -13.394 1.00 20.39 ? 155  ILE A C   1 
ATOM   854  O  O   . ILE A 1 155 ? 31.178  143.958 -12.346 1.00 19.53 ? 155  ILE A O   1 
ATOM   855  C  CB  . ILE A 1 155 ? 30.539  143.492 -15.473 1.00 19.85 ? 155  ILE A CB  1 
ATOM   856  C  CG1 . ILE A 1 155 ? 29.605  142.478 -14.805 1.00 19.90 ? 155  ILE A CG1 1 
ATOM   857  C  CG2 . ILE A 1 155 ? 31.896  142.847 -15.729 1.00 19.75 ? 155  ILE A CG2 1 
ATOM   858  C  CD1 . ILE A 1 155 ? 28.200  143.005 -14.538 1.00 18.86 ? 155  ILE A CD1 1 
ATOM   859  N  N   . THR A 1 156 ? 32.904  144.724 -13.573 1.00 20.04 ? 156  THR A N   1 
ATOM   860  C  CA  . THR A 1 156 ? 33.891  144.501 -12.526 1.00 19.87 ? 156  THR A CA  1 
ATOM   861  C  C   . THR A 1 156 ? 33.529  145.332 -11.295 1.00 19.91 ? 156  THR A C   1 
ATOM   862  O  O   . THR A 1 156 ? 33.499  144.820 -10.174 1.00 19.48 ? 156  THR A O   1 
ATOM   863  C  CB  . THR A 1 156 ? 35.312  144.899 -13.000 1.00 20.37 ? 156  THR A CB  1 
ATOM   864  O  OG1 . THR A 1 156 ? 35.762  143.976 -14.001 1.00 19.76 ? 156  THR A OG1 1 
ATOM   865  C  CG2 . THR A 1 156 ? 36.287  144.896 -11.832 1.00 18.92 ? 156  THR A CG2 1 
ATOM   866  N  N   . ALA A 1 157 ? 33.250  146.614 -11.511 1.00 19.55 ? 157  ALA A N   1 
ATOM   867  C  CA  . ALA A 1 157 ? 32.892  147.508 -10.416 1.00 19.91 ? 157  ALA A CA  1 
ATOM   868  C  C   . ALA A 1 157 ? 31.572  147.092 -9.775  1.00 19.74 ? 157  ALA A C   1 
ATOM   869  O  O   . ALA A 1 157 ? 31.424  147.127 -8.554  1.00 20.24 ? 157  ALA A O   1 
ATOM   870  C  CB  . ALA A 1 157 ? 32.791  148.947 -10.924 1.00 19.65 ? 157  ALA A CB  1 
ATOM   871  N  N   . ILE A 1 158 ? 30.616  146.695 -10.605 1.00 19.72 ? 158  ILE A N   1 
ATOM   872  C  CA  . ILE A 1 158 ? 29.304  146.289 -10.119 1.00 19.78 ? 158  ILE A CA  1 
ATOM   873  C  C   . ILE A 1 158 ? 29.376  145.054 -9.222  1.00 19.20 ? 158  ILE A C   1 
ATOM   874  O  O   . ILE A 1 158 ? 28.798  145.035 -8.135  1.00 19.12 ? 158  ILE A O   1 
ATOM   875  C  CB  . ILE A 1 158 ? 28.347  146.011 -11.299 1.00 20.49 ? 158  ILE A CB  1 
ATOM   876  C  CG1 . ILE A 1 158 ? 28.130  147.299 -12.097 1.00 21.51 ? 158  ILE A CG1 1 
ATOM   877  C  CG2 . ILE A 1 158 ? 27.017  145.463 -10.788 1.00 21.64 ? 158  ILE A CG2 1 
ATOM   878  C  CD1 . ILE A 1 158 ? 27.588  148.459 -11.269 1.00 22.43 ? 158  ILE A CD1 1 
ATOM   879  N  N   . ILE A 1 159 ? 30.083  144.025 -9.674  1.00 18.32 ? 159  ILE A N   1 
ATOM   880  C  CA  . ILE A 1 159 ? 30.210  142.806 -8.888  1.00 17.87 ? 159  ILE A CA  1 
ATOM   881  C  C   . ILE A 1 159 ? 30.905  143.084 -7.554  1.00 18.42 ? 159  ILE A C   1 
ATOM   882  O  O   . ILE A 1 159 ? 30.522  142.523 -6.527  1.00 17.31 ? 159  ILE A O   1 
ATOM   883  C  CB  . ILE A 1 159 ? 30.977  141.715 -9.673  1.00 17.34 ? 159  ILE A CB  1 
ATOM   884  C  CG1 . ILE A 1 159 ? 30.147  141.278 -10.885 1.00 16.80 ? 159  ILE A CG1 1 
ATOM   885  C  CG2 . ILE A 1 159 ? 31.260  140.519 -8.774  1.00 15.98 ? 159  ILE A CG2 1 
ATOM   886  C  CD1 . ILE A 1 159 ? 30.872  140.312 -11.821 1.00 17.75 ? 159  ILE A CD1 1 
ATOM   887  N  N   . GLU A 1 160 ? 31.918  143.951 -7.564  1.00 18.94 ? 160  GLU A N   1 
ATOM   888  C  CA  . GLU A 1 160 ? 32.627  144.296 -6.332  1.00 20.54 ? 160  GLU A CA  1 
ATOM   889  C  C   . GLU A 1 160 ? 31.637  144.875 -5.313  1.00 21.16 ? 160  GLU A C   1 
ATOM   890  O  O   . GLU A 1 160 ? 31.742  144.616 -4.115  1.00 21.55 ? 160  GLU A O   1 
ATOM   891  C  CB  . GLU A 1 160 ? 33.734  145.325 -6.611  1.00 20.85 ? 160  GLU A CB  1 
ATOM   892  C  CG  . GLU A 1 160 ? 34.957  144.792 -7.356  1.00 20.98 ? 160  GLU A CG  1 
ATOM   893  C  CD  . GLU A 1 160 ? 35.898  143.981 -6.473  1.00 21.79 ? 160  GLU A CD  1 
ATOM   894  O  OE1 . GLU A 1 160 ? 35.735  144.004 -5.232  1.00 22.29 ? 160  GLU A OE1 1 
ATOM   895  O  OE2 . GLU A 1 160 ? 36.815  143.326 -7.020  1.00 22.01 ? 160  GLU A OE2 1 
ATOM   896  N  N   . GLU A 1 161 ? 30.674  145.654 -5.798  1.00 22.22 ? 161  GLU A N   1 
ATOM   897  C  CA  . GLU A 1 161 ? 29.664  146.267 -4.933  1.00 23.38 ? 161  GLU A CA  1 
ATOM   898  C  C   . GLU A 1 161 ? 28.561  145.295 -4.516  1.00 23.13 ? 161  GLU A C   1 
ATOM   899  O  O   . GLU A 1 161 ? 28.064  145.361 -3.395  1.00 22.76 ? 161  GLU A O   1 
ATOM   900  C  CB  . GLU A 1 161 ? 29.018  147.466 -5.635  1.00 25.32 ? 161  GLU A CB  1 
ATOM   901  C  CG  . GLU A 1 161 ? 29.942  148.660 -5.829  1.00 29.40 ? 161  GLU A CG  1 
ATOM   902  C  CD  . GLU A 1 161 ? 29.321  149.747 -6.697  1.00 31.94 ? 161  GLU A CD  1 
ATOM   903  O  OE1 . GLU A 1 161 ? 29.975  150.794 -6.900  1.00 33.35 ? 161  GLU A OE1 1 
ATOM   904  O  OE2 . GLU A 1 161 ? 28.181  149.555 -7.180  1.00 33.22 ? 161  GLU A OE2 1 
ATOM   905  N  N   . GLN A 1 162 ? 28.171  144.405 -5.426  1.00 22.65 ? 162  GLN A N   1 
ATOM   906  C  CA  . GLN A 1 162 ? 27.115  143.436 -5.147  1.00 22.72 ? 162  GLN A CA  1 
ATOM   907  C  C   . GLN A 1 162 ? 27.524  142.048 -5.638  1.00 21.64 ? 162  GLN A C   1 
ATOM   908  O  O   . GLN A 1 162 ? 27.013  141.562 -6.647  1.00 21.53 ? 162  GLN A O   1 
ATOM   909  C  CB  . GLN A 1 162 ? 25.812  143.873 -5.833  1.00 23.46 ? 162  GLN A CB  1 
ATOM   910  C  CG  . GLN A 1 162 ? 25.345  145.273 -5.438  1.00 24.85 ? 162  GLN A CG  1 
ATOM   911  C  CD  . GLN A 1 162 ? 23.943  145.591 -5.927  1.00 25.47 ? 162  GLN A CD  1 
ATOM   912  O  OE1 . GLN A 1 162 ? 22.980  144.929 -5.548  1.00 26.63 ? 162  GLN A OE1 1 
ATOM   913  N  NE2 . GLN A 1 162 ? 23.824  146.608 -6.771  1.00 25.21 ? 162  GLN A NE2 1 
ATOM   914  N  N   . PRO A 1 163 ? 28.451  141.392 -4.919  1.00 20.68 ? 163  PRO A N   1 
ATOM   915  C  CA  . PRO A 1 163 ? 28.952  140.057 -5.261  1.00 20.50 ? 163  PRO A CA  1 
ATOM   916  C  C   . PRO A 1 163 ? 27.971  138.899 -5.077  1.00 20.79 ? 163  PRO A C   1 
ATOM   917  O  O   . PRO A 1 163 ? 28.190  137.816 -5.620  1.00 20.82 ? 163  PRO A O   1 
ATOM   918  C  CB  . PRO A 1 163 ? 30.183  139.920 -4.372  1.00 20.45 ? 163  PRO A CB  1 
ATOM   919  C  CG  . PRO A 1 163 ? 29.778  140.667 -3.145  1.00 20.32 ? 163  PRO A CG  1 
ATOM   920  C  CD  . PRO A 1 163 ? 29.127  141.910 -3.714  1.00 20.83 ? 163  PRO A CD  1 
ATOM   921  N  N   . LYS A 1 164 ? 26.905  139.116 -4.308  1.00 20.75 ? 164  LYS A N   1 
ATOM   922  C  CA  . LYS A 1 164 ? 25.904  138.072 -4.083  1.00 21.66 ? 164  LYS A CA  1 
ATOM   923  C  C   . LYS A 1 164 ? 24.652  138.397 -4.890  1.00 21.58 ? 164  LYS A C   1 
ATOM   924  O  O   . LYS A 1 164 ? 23.589  138.676 -4.339  1.00 23.30 ? 164  LYS A O   1 
ATOM   925  C  CB  . LYS A 1 164 ? 25.564  137.964 -2.591  1.00 22.27 ? 164  LYS A CB  1 
ATOM   926  C  CG  . LYS A 1 164 ? 26.711  137.429 -1.735  1.00 23.48 ? 164  LYS A CG  1 
ATOM   927  C  CD  . LYS A 1 164 ? 26.225  136.991 -0.357  1.00 24.83 ? 164  LYS A CD  1 
ATOM   928  C  CE  . LYS A 1 164 ? 27.306  136.219 0.400   1.00 25.60 ? 164  LYS A CE  1 
ATOM   929  N  NZ  . LYS A 1 164 ? 26.798  135.665 1.695   1.00 26.50 ? 164  LYS A NZ  1 
ATOM   930  N  N   . ASN A 1 165 ? 24.795  138.361 -6.206  1.00 20.73 ? 165  ASN A N   1 
ATOM   931  C  CA  . ASN A 1 165 ? 23.709  138.673 -7.128  1.00 19.54 ? 165  ASN A CA  1 
ATOM   932  C  C   . ASN A 1 165 ? 23.928  137.790 -8.356  1.00 19.27 ? 165  ASN A C   1 
ATOM   933  O  O   . ASN A 1 165 ? 25.041  137.739 -8.871  1.00 18.98 ? 165  ASN A O   1 
ATOM   934  C  CB  . ASN A 1 165 ? 23.799  140.159 -7.493  1.00 19.19 ? 165  ASN A CB  1 
ATOM   935  C  CG  . ASN A 1 165 ? 22.867  140.549 -8.613  1.00 19.80 ? 165  ASN A CG  1 
ATOM   936  O  OD1 . ASN A 1 165 ? 22.999  140.071 -9.737  1.00 19.28 ? 165  ASN A OD1 1 
ATOM   937  N  ND2 . ASN A 1 165 ? 21.918  141.436 -8.315  1.00 17.88 ? 165  ASN A ND2 1 
ATOM   938  N  N   . TYR A 1 166 ? 22.885  137.088 -8.808  1.00 18.20 ? 166  TYR A N   1 
ATOM   939  C  CA  . TYR A 1 166 ? 22.979  136.197 -9.969  1.00 17.63 ? 166  TYR A CA  1 
ATOM   940  C  C   . TYR A 1 166 ? 23.181  136.916 -11.294 1.00 18.12 ? 166  TYR A C   1 
ATOM   941  O  O   . TYR A 1 166 ? 24.010  136.480 -12.106 1.00 16.51 ? 166  TYR A O   1 
ATOM   942  C  CB  . TYR A 1 166 ? 21.726  135.331 -10.106 1.00 16.56 ? 166  TYR A CB  1 
ATOM   943  C  CG  . TYR A 1 166 ? 21.641  134.150 -9.167  1.00 16.15 ? 166  TYR A CG  1 
ATOM   944  C  CD1 . TYR A 1 166 ? 21.189  134.306 -7.856  1.00 15.38 ? 166  TYR A CD1 1 
ATOM   945  C  CD2 . TYR A 1 166 ? 21.959  132.862 -9.607  1.00 16.36 ? 166  TYR A CD2 1 
ATOM   946  C  CE1 . TYR A 1 166 ? 21.047  133.203 -7.004  1.00 17.19 ? 166  TYR A CE1 1 
ATOM   947  C  CE2 . TYR A 1 166 ? 21.820  131.754 -8.760  1.00 16.85 ? 166  TYR A CE2 1 
ATOM   948  C  CZ  . TYR A 1 166 ? 21.364  131.936 -7.466  1.00 17.09 ? 166  TYR A CZ  1 
ATOM   949  O  OH  . TYR A 1 166 ? 21.236  130.850 -6.636  1.00 18.13 ? 166  TYR A OH  1 
ATOM   950  N  N   . GLN A 1 167 ? 22.474  138.016 -11.501 1.00 19.39 ? 167  GLN A N   1 
ATOM   951  C  CA  . GLN A 1 167 ? 22.581  138.729 -12.768 1.00 20.30 ? 167  GLN A CA  1 
ATOM   952  C  C   . GLN A 1 167 ? 23.946  139.287 -13.124 1.00 19.38 ? 167  GLN A C   1 
ATOM   953  O  O   . GLN A 1 167 ? 24.352  139.243 -14.283 1.00 19.77 ? 167  GLN A O   1 
ATOM   954  C  CB  . GLN A 1 167 ? 21.556  139.853 -12.845 1.00 22.94 ? 167  GLN A CB  1 
ATOM   955  C  CG  . GLN A 1 167 ? 20.128  139.383 -13.088 1.00 25.85 ? 167  GLN A CG  1 
ATOM   956  C  CD  . GLN A 1 167 ? 19.599  138.581 -11.937 1.00 28.67 ? 167  GLN A CD  1 
ATOM   957  O  OE1 . GLN A 1 167 ? 19.747  138.975 -10.770 1.00 30.02 ? 167  GLN A OE1 1 
ATOM   958  N  NE2 . GLN A 1 167 ? 18.981  137.446 -12.242 1.00 28.57 ? 167  GLN A NE2 1 
ATOM   959  N  N   . VAL A 1 168 ? 24.672  139.835 -12.142 1.00 17.42 ? 168  VAL A N   1 
ATOM   960  C  CA  . VAL A 1 168 ? 25.968  140.419 -12.426 1.00 16.85 ? 168  VAL A CA  1 
ATOM   961  C  C   . VAL A 1 168 ? 27.002  139.372 -12.860 1.00 16.12 ? 168  VAL A C   1 
ATOM   962  O  O   . VAL A 1 168 ? 27.809  139.618 -13.761 1.00 14.77 ? 168  VAL A O   1 
ATOM   963  C  CB  . VAL A 1 168 ? 26.480  141.250 -11.205 1.00 16.21 ? 168  VAL A CB  1 
ATOM   964  C  CG1 . VAL A 1 168 ? 25.500  142.373 -10.896 1.00 15.69 ? 168  VAL A CG1 1 
ATOM   965  C  CG2 . VAL A 1 168 ? 26.636  140.374 -9.981  1.00 16.06 ? 168  VAL A CG2 1 
ATOM   966  N  N   . TRP A 1 169 ? 26.969  138.202 -12.230 1.00 15.75 ? 169  TRP A N   1 
ATOM   967  C  CA  . TRP A 1 169 ? 27.910  137.164 -12.607 1.00 15.63 ? 169  TRP A CA  1 
ATOM   968  C  C   . TRP A 1 169 ? 27.559  136.582 -13.971 1.00 16.09 ? 169  TRP A C   1 
ATOM   969  O  O   . TRP A 1 169 ? 28.454  136.269 -14.748 1.00 16.00 ? 169  TRP A O   1 
ATOM   970  C  CB  . TRP A 1 169 ? 27.960  136.053 -11.564 1.00 14.63 ? 169  TRP A CB  1 
ATOM   971  C  CG  . TRP A 1 169 ? 28.688  136.460 -10.327 1.00 14.27 ? 169  TRP A CG  1 
ATOM   972  C  CD1 . TRP A 1 169 ? 28.133  136.908 -9.166  1.00 13.73 ? 169  TRP A CD1 1 
ATOM   973  C  CD2 . TRP A 1 169 ? 30.111  136.493 -10.135 1.00 13.64 ? 169  TRP A CD2 1 
ATOM   974  N  NE1 . TRP A 1 169 ? 29.117  137.216 -8.259  1.00 14.41 ? 169  TRP A NE1 1 
ATOM   975  C  CE2 . TRP A 1 169 ? 30.341  136.971 -8.826  1.00 13.40 ? 169  TRP A CE2 1 
ATOM   976  C  CE3 . TRP A 1 169 ? 31.216  136.165 -10.941 1.00 14.04 ? 169  TRP A CE3 1 
ATOM   977  C  CZ2 . TRP A 1 169 ? 31.631  137.132 -8.297  1.00 13.28 ? 169  TRP A CZ2 1 
ATOM   978  C  CZ3 . TRP A 1 169 ? 32.506  136.326 -10.412 1.00 12.73 ? 169  TRP A CZ3 1 
ATOM   979  C  CH2 . TRP A 1 169 ? 32.697  136.806 -9.101  1.00 13.20 ? 169  TRP A CH2 1 
ATOM   980  N  N   . HIS A 1 170 ? 26.269  136.436 -14.272 1.00 15.98 ? 170  HIS A N   1 
ATOM   981  C  CA  . HIS A 1 170 ? 25.880  135.903 -15.575 1.00 16.73 ? 170  HIS A CA  1 
ATOM   982  C  C   . HIS A 1 170 ? 26.293  136.878 -16.681 1.00 16.83 ? 170  HIS A C   1 
ATOM   983  O  O   . HIS A 1 170 ? 26.781  136.471 -17.738 1.00 16.68 ? 170  HIS A O   1 
ATOM   984  C  CB  . HIS A 1 170 ? 24.370  135.675 -15.647 1.00 16.77 ? 170  HIS A CB  1 
ATOM   985  C  CG  . HIS A 1 170 ? 23.909  135.186 -16.984 1.00 17.61 ? 170  HIS A CG  1 
ATOM   986  N  ND1 . HIS A 1 170 ? 23.022  135.890 -17.770 1.00 18.53 ? 170  HIS A ND1 1 
ATOM   987  C  CD2 . HIS A 1 170 ? 24.264  134.095 -17.703 1.00 17.24 ? 170  HIS A CD2 1 
ATOM   988  C  CE1 . HIS A 1 170 ? 22.856  135.256 -18.917 1.00 17.76 ? 170  HIS A CE1 1 
ATOM   989  N  NE2 . HIS A 1 170 ? 23.598  134.164 -18.902 1.00 18.70 ? 170  HIS A NE2 1 
ATOM   990  N  N   . HIS A 1 171 ? 26.081  138.169 -16.429 1.00 16.54 ? 171  HIS A N   1 
ATOM   991  C  CA  . HIS A 1 171 ? 26.443  139.201 -17.394 1.00 16.28 ? 171  HIS A CA  1 
ATOM   992  C  C   . HIS A 1 171 ? 27.937  139.099 -17.700 1.00 16.30 ? 171  HIS A C   1 
ATOM   993  O  O   . HIS A 1 171 ? 28.338  139.114 -18.863 1.00 16.54 ? 171  HIS A O   1 
ATOM   994  C  CB  . HIS A 1 171 ? 26.120  140.598 -16.844 1.00 16.12 ? 171  HIS A CB  1 
ATOM   995  C  CG  . HIS A 1 171 ? 26.188  141.686 -17.875 1.00 16.21 ? 171  HIS A CG  1 
ATOM   996  N  ND1 . HIS A 1 171 ? 25.290  141.785 -18.915 1.00 16.87 ? 171  HIS A ND1 1 
ATOM   997  C  CD2 . HIS A 1 171 ? 27.049  142.722 -18.023 1.00 16.77 ? 171  HIS A CD2 1 
ATOM   998  C  CE1 . HIS A 1 171 ? 25.592  142.834 -19.660 1.00 17.33 ? 171  HIS A CE1 1 
ATOM   999  N  NE2 . HIS A 1 171 ? 26.655  143.421 -19.140 1.00 17.01 ? 171  HIS A NE2 1 
ATOM   1000 N  N   . ARG A 1 172 ? 28.757  138.989 -16.657 1.00 16.37 ? 172  ARG A N   1 
ATOM   1001 C  CA  . ARG A 1 172 ? 30.201  138.878 -16.846 1.00 16.40 ? 172  ARG A CA  1 
ATOM   1002 C  C   . ARG A 1 172 ? 30.548  137.644 -17.671 1.00 17.16 ? 172  ARG A C   1 
ATOM   1003 O  O   . ARG A 1 172 ? 31.404  137.703 -18.552 1.00 17.06 ? 172  ARG A O   1 
ATOM   1004 C  CB  . ARG A 1 172 ? 30.936  138.809 -15.507 1.00 16.35 ? 172  ARG A CB  1 
ATOM   1005 C  CG  . ARG A 1 172 ? 32.451  138.915 -15.668 1.00 15.90 ? 172  ARG A CG  1 
ATOM   1006 C  CD  . ARG A 1 172 ? 33.214  138.761 -14.361 1.00 16.27 ? 172  ARG A CD  1 
ATOM   1007 N  NE  . ARG A 1 172 ? 34.648  138.920 -14.596 1.00 16.92 ? 172  ARG A NE  1 
ATOM   1008 C  CZ  . ARG A 1 172 ? 35.330  140.044 -14.399 1.00 17.31 ? 172  ARG A CZ  1 
ATOM   1009 N  NH1 . ARG A 1 172 ? 34.724  141.133 -13.939 1.00 16.76 ? 172  ARG A NH1 1 
ATOM   1010 N  NH2 . ARG A 1 172 ? 36.622  140.090 -14.704 1.00 17.83 ? 172  ARG A NH2 1 
ATOM   1011 N  N   . ARG A 1 173 ? 29.892  136.523 -17.393 1.00 17.86 ? 173  ARG A N   1 
ATOM   1012 C  CA  . ARG A 1 173 ? 30.169  135.313 -18.156 1.00 18.36 ? 173  ARG A CA  1 
ATOM   1013 C  C   . ARG A 1 173 ? 29.861  135.521 -19.639 1.00 18.68 ? 173  ARG A C   1 
ATOM   1014 O  O   . ARG A 1 173 ? 30.639  135.107 -20.503 1.00 18.45 ? 173  ARG A O   1 
ATOM   1015 C  CB  . ARG A 1 173 ? 29.361  134.132 -17.620 1.00 19.18 ? 173  ARG A CB  1 
ATOM   1016 C  CG  . ARG A 1 173 ? 29.382  132.925 -18.551 1.00 20.42 ? 173  ARG A CG  1 
ATOM   1017 C  CD  . ARG A 1 173 ? 28.802  131.694 -17.885 1.00 21.52 ? 173  ARG A CD  1 
ATOM   1018 N  NE  . ARG A 1 173 ? 28.609  130.607 -18.839 1.00 22.07 ? 173  ARG A NE  1 
ATOM   1019 C  CZ  . ARG A 1 173 ? 28.396  129.341 -18.496 1.00 21.91 ? 173  ARG A CZ  1 
ATOM   1020 N  NH1 . ARG A 1 173 ? 28.353  128.998 -17.215 1.00 21.44 ? 173  ARG A NH1 1 
ATOM   1021 N  NH2 . ARG A 1 173 ? 28.220  128.419 -19.433 1.00 21.84 ? 173  ARG A NH2 1 
ATOM   1022 N  N   . VAL A 1 174 ? 28.737  136.169 -19.934 1.00 18.11 ? 174  VAL A N   1 
ATOM   1023 C  CA  . VAL A 1 174 ? 28.357  136.423 -21.322 1.00 18.89 ? 174  VAL A CA  1 
ATOM   1024 C  C   . VAL A 1 174 ? 29.430  137.248 -22.037 1.00 19.16 ? 174  VAL A C   1 
ATOM   1025 O  O   . VAL A 1 174 ? 29.778  136.962 -23.184 1.00 19.21 ? 174  VAL A O   1 
ATOM   1026 C  CB  . VAL A 1 174 ? 26.996  137.161 -21.409 1.00 19.18 ? 174  VAL A CB  1 
ATOM   1027 C  CG1 . VAL A 1 174 ? 26.736  137.622 -22.842 1.00 19.44 ? 174  VAL A CG1 1 
ATOM   1028 C  CG2 . VAL A 1 174 ? 25.880  136.236 -20.959 1.00 18.32 ? 174  VAL A CG2 1 
ATOM   1029 N  N   . LEU A 1 175 ? 29.949  138.266 -21.354 1.00 18.90 ? 175  LEU A N   1 
ATOM   1030 C  CA  . LEU A 1 175 ? 30.988  139.123 -21.914 1.00 19.32 ? 175  LEU A CA  1 
ATOM   1031 C  C   . LEU A 1 175 ? 32.262  138.325 -22.200 1.00 20.34 ? 175  LEU A C   1 
ATOM   1032 O  O   . LEU A 1 175 ? 32.847  138.442 -23.278 1.00 20.52 ? 175  LEU A O   1 
ATOM   1033 C  CB  . LEU A 1 175 ? 31.301  140.277 -20.953 1.00 18.68 ? 175  LEU A CB  1 
ATOM   1034 C  CG  . LEU A 1 175 ? 30.152  141.258 -20.679 1.00 18.56 ? 175  LEU A CG  1 
ATOM   1035 C  CD1 . LEU A 1 175 ? 30.591  142.313 -19.675 1.00 17.93 ? 175  LEU A CD1 1 
ATOM   1036 C  CD2 . LEU A 1 175 ? 29.718  141.916 -21.983 1.00 18.38 ? 175  LEU A CD2 1 
ATOM   1037 N  N   . VAL A 1 176 ? 32.696  137.518 -21.236 1.00 20.62 ? 176  VAL A N   1 
ATOM   1038 C  CA  . VAL A 1 176 ? 33.896  136.712 -21.428 1.00 21.43 ? 176  VAL A CA  1 
ATOM   1039 C  C   . VAL A 1 176 ? 33.688  135.782 -22.622 1.00 22.11 ? 176  VAL A C   1 
ATOM   1040 O  O   . VAL A 1 176 ? 34.603  135.562 -23.413 1.00 21.74 ? 176  VAL A O   1 
ATOM   1041 C  CB  . VAL A 1 176 ? 34.227  135.887 -20.163 1.00 21.15 ? 176  VAL A CB  1 
ATOM   1042 C  CG1 . VAL A 1 176 ? 35.382  134.939 -20.437 1.00 21.35 ? 176  VAL A CG1 1 
ATOM   1043 C  CG2 . VAL A 1 176 ? 34.593  136.826 -19.025 1.00 21.12 ? 176  VAL A CG2 1 
ATOM   1044 N  N   . GLU A 1 177 ? 32.478  135.248 -22.753 1.00 22.73 ? 177  GLU A N   1 
ATOM   1045 C  CA  . GLU A 1 177 ? 32.148  134.365 -23.867 1.00 24.29 ? 177  GLU A CA  1 
ATOM   1046 C  C   . GLU A 1 177 ? 32.205  135.122 -25.197 1.00 24.80 ? 177  GLU A C   1 
ATOM   1047 O  O   . GLU A 1 177 ? 32.786  134.639 -26.171 1.00 24.14 ? 177  GLU A O   1 
ATOM   1048 C  CB  . GLU A 1 177 ? 30.748  133.766 -23.681 1.00 25.18 ? 177  GLU A CB  1 
ATOM   1049 C  CG  . GLU A 1 177 ? 30.685  132.609 -22.694 1.00 27.48 ? 177  GLU A CG  1 
ATOM   1050 C  CD  . GLU A 1 177 ? 29.262  132.157 -22.395 1.00 29.46 ? 177  GLU A CD  1 
ATOM   1051 O  OE1 . GLU A 1 177 ? 29.096  131.070 -21.800 1.00 30.50 ? 177  GLU A OE1 1 
ATOM   1052 O  OE2 . GLU A 1 177 ? 28.309  132.888 -22.741 1.00 30.15 ? 177  GLU A OE2 1 
ATOM   1053 N  N   . TRP A 1 178 ? 31.603  136.309 -25.235 1.00 24.81 ? 178  TRP A N   1 
ATOM   1054 C  CA  . TRP A 1 178 ? 31.599  137.112 -26.456 1.00 25.73 ? 178  TRP A CA  1 
ATOM   1055 C  C   . TRP A 1 178 ? 33.005  137.501 -26.878 1.00 25.86 ? 178  TRP A C   1 
ATOM   1056 O  O   . TRP A 1 178 ? 33.314  137.539 -28.066 1.00 26.45 ? 178  TRP A O   1 
ATOM   1057 C  CB  . TRP A 1 178 ? 30.777  138.389 -26.272 1.00 25.21 ? 178  TRP A CB  1 
ATOM   1058 C  CG  . TRP A 1 178 ? 29.303  138.185 -26.314 1.00 25.90 ? 178  TRP A CG  1 
ATOM   1059 C  CD1 . TRP A 1 178 ? 28.637  137.059 -26.709 1.00 25.62 ? 178  TRP A CD1 1 
ATOM   1060 C  CD2 . TRP A 1 178 ? 28.297  139.153 -25.986 1.00 26.17 ? 178  TRP A CD2 1 
ATOM   1061 N  NE1 . TRP A 1 178 ? 27.278  137.265 -26.648 1.00 25.86 ? 178  TRP A NE1 1 
ATOM   1062 C  CE2 . TRP A 1 178 ? 27.042  138.542 -26.208 1.00 26.12 ? 178  TRP A CE2 1 
ATOM   1063 C  CE3 . TRP A 1 178 ? 28.336  140.478 -25.528 1.00 26.03 ? 178  TRP A CE3 1 
ATOM   1064 C  CZ2 . TRP A 1 178 ? 25.831  139.212 -25.987 1.00 26.36 ? 178  TRP A CZ2 1 
ATOM   1065 C  CZ3 . TRP A 1 178 ? 27.131  141.146 -25.308 1.00 26.43 ? 178  TRP A CZ3 1 
ATOM   1066 C  CH2 . TRP A 1 178 ? 25.896  140.509 -25.538 1.00 26.41 ? 178  TRP A CH2 1 
ATOM   1067 N  N   . LEU A 1 179 ? 33.848  137.802 -25.898 1.00 25.61 ? 179  LEU A N   1 
ATOM   1068 C  CA  . LEU A 1 179 ? 35.221  138.201 -26.168 1.00 26.28 ? 179  LEU A CA  1 
ATOM   1069 C  C   . LEU A 1 179 ? 36.177  137.024 -26.286 1.00 26.69 ? 179  LEU A C   1 
ATOM   1070 O  O   . LEU A 1 179 ? 37.255  137.156 -26.865 1.00 26.62 ? 179  LEU A O   1 
ATOM   1071 C  CB  . LEU A 1 179 ? 35.731  139.122 -25.060 1.00 26.14 ? 179  LEU A CB  1 
ATOM   1072 C  CG  . LEU A 1 179 ? 35.157  140.531 -24.933 1.00 26.48 ? 179  LEU A CG  1 
ATOM   1073 C  CD1 . LEU A 1 179 ? 35.670  141.159 -23.646 1.00 26.31 ? 179  LEU A CD1 1 
ATOM   1074 C  CD2 . LEU A 1 179 ? 35.559  141.368 -26.144 1.00 26.48 ? 179  LEU A CD2 1 
ATOM   1075 N  N   . ARG A 1 180 ? 35.792  135.877 -25.736 1.00 27.23 ? 180  ARG A N   1 
ATOM   1076 C  CA  . ARG A 1 180 ? 36.671  134.716 -25.764 1.00 28.22 ? 180  ARG A CA  1 
ATOM   1077 C  C   . ARG A 1 180 ? 37.980  135.128 -25.096 1.00 28.08 ? 180  ARG A C   1 
ATOM   1078 O  O   . ARG A 1 180 ? 39.054  134.636 -25.448 1.00 28.63 ? 180  ARG A O   1 
ATOM   1079 C  CB  . ARG A 1 180 ? 36.930  134.283 -27.210 1.00 29.62 ? 180  ARG A CB  1 
ATOM   1080 C  CG  . ARG A 1 180 ? 35.933  133.276 -27.730 1.00 31.25 ? 180  ARG A CG  1 
ATOM   1081 C  CD  . ARG A 1 180 ? 36.222  131.919 -27.118 1.00 33.62 ? 180  ARG A CD  1 
ATOM   1082 N  NE  . ARG A 1 180 ? 35.051  131.341 -26.471 1.00 35.34 ? 180  ARG A NE  1 
ATOM   1083 C  CZ  . ARG A 1 180 ? 35.071  130.209 -25.777 1.00 35.23 ? 180  ARG A CZ  1 
ATOM   1084 N  NH1 . ARG A 1 180 ? 36.204  129.533 -25.640 1.00 35.35 ? 180  ARG A NH1 1 
ATOM   1085 N  NH2 . ARG A 1 180 ? 33.959  129.755 -25.218 1.00 35.35 ? 180  ARG A NH2 1 
ATOM   1086 N  N   . ASP A 1 181 ? 37.872  136.035 -24.127 1.00 27.11 ? 181  ASP A N   1 
ATOM   1087 C  CA  . ASP A 1 181 ? 39.025  136.559 -23.398 1.00 26.63 ? 181  ASP A CA  1 
ATOM   1088 C  C   . ASP A 1 181 ? 38.897  136.366 -21.880 1.00 26.21 ? 181  ASP A C   1 
ATOM   1089 O  O   . ASP A 1 181 ? 38.179  137.105 -21.203 1.00 25.47 ? 181  ASP A O   1 
ATOM   1090 C  CB  . ASP A 1 181 ? 39.195  138.043 -23.734 1.00 27.40 ? 181  ASP A CB  1 
ATOM   1091 C  CG  . ASP A 1 181 ? 40.260  138.715 -22.900 1.00 28.35 ? 181  ASP A CG  1 
ATOM   1092 O  OD1 . ASP A 1 181 ? 41.208  138.027 -22.466 1.00 28.48 ? 181  ASP A OD1 1 
ATOM   1093 O  OD2 . ASP A 1 181 ? 40.156  139.943 -22.691 1.00 29.41 ? 181  ASP A OD2 1 
ATOM   1094 N  N   . PRO A 1 182 ? 39.609  135.369 -21.328 1.00 25.42 ? 182  PRO A N   1 
ATOM   1095 C  CA  . PRO A 1 182 ? 39.588  135.055 -19.897 1.00 24.89 ? 182  PRO A CA  1 
ATOM   1096 C  C   . PRO A 1 182 ? 40.775  135.608 -19.116 1.00 24.16 ? 182  PRO A C   1 
ATOM   1097 O  O   . PRO A 1 182 ? 40.927  135.306 -17.935 1.00 23.46 ? 182  PRO A O   1 
ATOM   1098 C  CB  . PRO A 1 182 ? 39.608  133.543 -19.905 1.00 25.34 ? 182  PRO A CB  1 
ATOM   1099 C  CG  . PRO A 1 182 ? 40.654  133.289 -20.975 1.00 25.54 ? 182  PRO A CG  1 
ATOM   1100 C  CD  . PRO A 1 182 ? 40.267  134.280 -22.078 1.00 25.74 ? 182  PRO A CD  1 
ATOM   1101 N  N   . SER A 1 183 ? 41.607  136.414 -19.771 1.00 23.98 ? 183  SER A N   1 
ATOM   1102 C  CA  . SER A 1 183 ? 42.814  136.957 -19.145 1.00 23.99 ? 183  SER A CA  1 
ATOM   1103 C  C   . SER A 1 183 ? 42.676  137.679 -17.803 1.00 23.60 ? 183  SER A C   1 
ATOM   1104 O  O   . SER A 1 183 ? 43.622  137.697 -17.021 1.00 24.02 ? 183  SER A O   1 
ATOM   1105 C  CB  . SER A 1 183 ? 43.547  137.871 -20.134 1.00 24.23 ? 183  SER A CB  1 
ATOM   1106 O  OG  . SER A 1 183 ? 42.755  138.992 -20.480 1.00 24.97 ? 183  SER A OG  1 
ATOM   1107 N  N   . GLN A 1 184 ? 41.515  138.267 -17.529 1.00 23.33 ? 184  GLN A N   1 
ATOM   1108 C  CA  . GLN A 1 184 ? 41.309  138.991 -16.270 1.00 23.18 ? 184  GLN A CA  1 
ATOM   1109 C  C   . GLN A 1 184 ? 40.547  138.203 -15.204 1.00 22.08 ? 184  GLN A C   1 
ATOM   1110 O  O   . GLN A 1 184 ? 40.486  138.614 -14.045 1.00 21.80 ? 184  GLN A O   1 
ATOM   1111 C  CB  . GLN A 1 184 ? 40.528  140.283 -16.528 1.00 23.85 ? 184  GLN A CB  1 
ATOM   1112 C  CG  . GLN A 1 184 ? 41.266  141.361 -17.290 1.00 26.36 ? 184  GLN A CG  1 
ATOM   1113 C  CD  . GLN A 1 184 ? 40.352  142.526 -17.632 1.00 27.52 ? 184  GLN A CD  1 
ATOM   1114 O  OE1 . GLN A 1 184 ? 39.563  142.975 -16.800 1.00 28.01 ? 184  GLN A OE1 1 
ATOM   1115 N  NE2 . GLN A 1 184 ? 40.457  143.024 -18.859 1.00 29.05 ? 184  GLN A NE2 1 
ATOM   1116 N  N   . GLU A 1 185 ? 39.976  137.073 -15.597 1.00 21.61 ? 185  GLU A N   1 
ATOM   1117 C  CA  . GLU A 1 185 ? 39.155  136.272 -14.695 1.00 20.74 ? 185  GLU A CA  1 
ATOM   1118 C  C   . GLU A 1 185 ? 39.725  135.740 -13.383 1.00 20.51 ? 185  GLU A C   1 
ATOM   1119 O  O   . GLU A 1 185 ? 39.192  136.049 -12.317 1.00 19.54 ? 185  GLU A O   1 
ATOM   1120 C  CB  . GLU A 1 185 ? 38.524  135.130 -15.486 1.00 20.57 ? 185  GLU A CB  1 
ATOM   1121 C  CG  . GLU A 1 185 ? 37.678  135.637 -16.638 1.00 20.49 ? 185  GLU A CG  1 
ATOM   1122 C  CD  . GLU A 1 185 ? 36.790  136.799 -16.219 1.00 21.64 ? 185  GLU A CD  1 
ATOM   1123 O  OE1 . GLU A 1 185 ? 35.854  136.579 -15.419 1.00 20.53 ? 185  GLU A OE1 1 
ATOM   1124 O  OE2 . GLU A 1 185 ? 37.039  137.935 -16.682 1.00 21.11 ? 185  GLU A OE2 1 
ATOM   1125 N  N   . LEU A 1 186 ? 40.788  134.945 -13.443 1.00 20.16 ? 186  LEU A N   1 
ATOM   1126 C  CA  . LEU A 1 186 ? 41.353  134.381 -12.222 1.00 20.81 ? 186  LEU A CA  1 
ATOM   1127 C  C   . LEU A 1 186 ? 41.764  135.424 -11.189 1.00 21.18 ? 186  LEU A C   1 
ATOM   1128 O  O   . LEU A 1 186 ? 41.573  135.221 -9.989  1.00 20.28 ? 186  LEU A O   1 
ATOM   1129 C  CB  . LEU A 1 186 ? 42.544  133.480 -12.553 1.00 21.07 ? 186  LEU A CB  1 
ATOM   1130 C  CG  . LEU A 1 186 ? 42.222  132.268 -13.434 1.00 21.64 ? 186  LEU A CG  1 
ATOM   1131 C  CD1 . LEU A 1 186 ? 43.480  131.425 -13.601 1.00 22.17 ? 186  LEU A CD1 1 
ATOM   1132 C  CD2 . LEU A 1 186 ? 41.105  131.437 -12.805 1.00 21.24 ? 186  LEU A CD2 1 
ATOM   1133 N  N   . GLU A 1 187 ? 42.327  136.537 -11.648 1.00 21.21 ? 187  GLU A N   1 
ATOM   1134 C  CA  . GLU A 1 187 ? 42.750  137.590 -10.733 1.00 21.71 ? 187  GLU A CA  1 
ATOM   1135 C  C   . GLU A 1 187 ? 41.548  138.343 -10.156 1.00 20.53 ? 187  GLU A C   1 
ATOM   1136 O  O   . GLU A 1 187 ? 41.544  138.712 -8.981  1.00 19.95 ? 187  GLU A O   1 
ATOM   1137 C  CB  . GLU A 1 187 ? 43.687  138.572 -11.442 1.00 24.00 ? 187  GLU A CB  1 
ATOM   1138 C  CG  . GLU A 1 187 ? 44.128  139.727 -10.554 1.00 28.48 ? 187  GLU A CG  1 
ATOM   1139 C  CD  . GLU A 1 187 ? 45.127  140.657 -11.229 1.00 31.09 ? 187  GLU A CD  1 
ATOM   1140 O  OE1 . GLU A 1 187 ? 45.394  141.740 -10.665 1.00 33.19 ? 187  GLU A OE1 1 
ATOM   1141 O  OE2 . GLU A 1 187 ? 45.647  140.308 -12.312 1.00 32.48 ? 187  GLU A OE2 1 
ATOM   1142 N  N   . PHE A 1 188 ? 40.536  138.579 -10.985 1.00 19.48 ? 188  PHE A N   1 
ATOM   1143 C  CA  . PHE A 1 188 ? 39.340  139.271 -10.517 1.00 18.96 ? 188  PHE A CA  1 
ATOM   1144 C  C   . PHE A 1 188 ? 38.619  138.401 -9.488  1.00 17.92 ? 188  PHE A C   1 
ATOM   1145 O  O   . PHE A 1 188 ? 38.249  138.868 -8.416  1.00 17.28 ? 188  PHE A O   1 
ATOM   1146 C  CB  . PHE A 1 188 ? 38.385  139.567 -11.673 1.00 18.82 ? 188  PHE A CB  1 
ATOM   1147 C  CG  . PHE A 1 188 ? 37.037  140.044 -11.220 1.00 18.80 ? 188  PHE A CG  1 
ATOM   1148 C  CD1 . PHE A 1 188 ? 36.889  141.300 -10.639 1.00 18.48 ? 188  PHE A CD1 1 
ATOM   1149 C  CD2 . PHE A 1 188 ? 35.923  139.209 -11.308 1.00 18.86 ? 188  PHE A CD2 1 
ATOM   1150 C  CE1 . PHE A 1 188 ? 35.657  141.717 -10.147 1.00 18.32 ? 188  PHE A CE1 1 
ATOM   1151 C  CE2 . PHE A 1 188 ? 34.682  139.618 -10.817 1.00 18.11 ? 188  PHE A CE2 1 
ATOM   1152 C  CZ  . PHE A 1 188 ? 34.549  140.871 -10.236 1.00 18.33 ? 188  PHE A CZ  1 
ATOM   1153 N  N   . ILE A 1 189 ? 38.418  137.131 -9.822  1.00 17.78 ? 189  ILE A N   1 
ATOM   1154 C  CA  . ILE A 1 189 ? 37.749  136.216 -8.906  1.00 17.45 ? 189  ILE A CA  1 
ATOM   1155 C  C   . ILE A 1 189 ? 38.516  136.155 -7.583  1.00 18.02 ? 189  ILE A C   1 
ATOM   1156 O  O   . ILE A 1 189 ? 37.923  136.206 -6.503  1.00 17.02 ? 189  ILE A O   1 
ATOM   1157 C  CB  . ILE A 1 189 ? 37.657  134.801 -9.506  1.00 16.89 ? 189  ILE A CB  1 
ATOM   1158 C  CG1 . ILE A 1 189 ? 36.879  134.849 -10.825 1.00 16.13 ? 189  ILE A CG1 1 
ATOM   1159 C  CG2 . ILE A 1 189 ? 36.976  133.855 -8.513  1.00 16.67 ? 189  ILE A CG2 1 
ATOM   1160 C  CD1 . ILE A 1 189 ? 36.883  133.538 -11.590 1.00 16.41 ? 189  ILE A CD1 1 
ATOM   1161 N  N   . ALA A 1 190 ? 39.839  136.053 -7.674  1.00 18.16 ? 190  ALA A N   1 
ATOM   1162 C  CA  . ALA A 1 190 ? 40.681  135.993 -6.487  1.00 18.81 ? 190  ALA A CA  1 
ATOM   1163 C  C   . ALA A 1 190 ? 40.436  137.193 -5.575  1.00 19.00 ? 190  ALA A C   1 
ATOM   1164 O  O   . ALA A 1 190 ? 40.476  137.066 -4.352  1.00 20.19 ? 190  ALA A O   1 
ATOM   1165 C  CB  . ALA A 1 190 ? 42.161  135.927 -6.889  1.00 18.14 ? 190  ALA A CB  1 
ATOM   1166 N  N   . ASP A 1 191 ? 40.186  138.360 -6.161  1.00 19.41 ? 191  ASP A N   1 
ATOM   1167 C  CA  . ASP A 1 191 ? 39.943  139.552 -5.353  1.00 20.08 ? 191  ASP A CA  1 
ATOM   1168 C  C   . ASP A 1 191 ? 38.608  139.445 -4.621  1.00 19.60 ? 191  ASP A C   1 
ATOM   1169 O  O   . ASP A 1 191 ? 38.501  139.799 -3.445  1.00 18.57 ? 191  ASP A O   1 
ATOM   1170 C  CB  . ASP A 1 191 ? 39.949  140.815 -6.214  1.00 21.54 ? 191  ASP A CB  1 
ATOM   1171 C  CG  . ASP A 1 191 ? 39.780  142.076 -5.383  1.00 23.71 ? 191  ASP A CG  1 
ATOM   1172 O  OD1 . ASP A 1 191 ? 40.681  142.376 -4.571  1.00 25.60 ? 191  ASP A OD1 1 
ATOM   1173 O  OD2 . ASP A 1 191 ? 38.746  142.760 -5.524  1.00 25.02 ? 191  ASP A OD2 1 
ATOM   1174 N  N   . ILE A 1 192 ? 37.589  138.953 -5.320  1.00 19.42 ? 192  ILE A N   1 
ATOM   1175 C  CA  . ILE A 1 192 ? 36.274  138.784 -4.712  1.00 19.25 ? 192  ILE A CA  1 
ATOM   1176 C  C   . ILE A 1 192 ? 36.387  137.792 -3.557  1.00 19.44 ? 192  ILE A C   1 
ATOM   1177 O  O   . ILE A 1 192 ? 35.896  138.046 -2.456  1.00 18.94 ? 192  ILE A O   1 
ATOM   1178 C  CB  . ILE A 1 192 ? 35.246  138.255 -5.743  1.00 19.53 ? 192  ILE A CB  1 
ATOM   1179 C  CG1 . ILE A 1 192 ? 35.025  139.301 -6.839  1.00 18.86 ? 192  ILE A CG1 1 
ATOM   1180 C  CG2 . ILE A 1 192 ? 33.926  137.925 -5.054  1.00 19.71 ? 192  ILE A CG2 1 
ATOM   1181 C  CD1 . ILE A 1 192 ? 34.541  140.649 -6.319  1.00 18.64 ? 192  ILE A CD1 1 
ATOM   1182 N  N   . LEU A 1 193 ? 37.055  136.670 -3.811  1.00 19.85 ? 193  LEU A N   1 
ATOM   1183 C  CA  . LEU A 1 193 ? 37.233  135.633 -2.801  1.00 20.35 ? 193  LEU A CA  1 
ATOM   1184 C  C   . LEU A 1 193 ? 38.091  136.104 -1.635  1.00 21.26 ? 193  LEU A C   1 
ATOM   1185 O  O   . LEU A 1 193 ? 38.033  135.540 -0.544  1.00 20.48 ? 193  LEU A O   1 
ATOM   1186 C  CB  . LEU A 1 193 ? 37.854  134.384 -3.435  1.00 20.00 ? 193  LEU A CB  1 
ATOM   1187 C  CG  . LEU A 1 193 ? 36.938  133.637 -4.410  1.00 19.93 ? 193  LEU A CG  1 
ATOM   1188 C  CD1 . LEU A 1 193 ? 37.716  132.527 -5.117  1.00 18.79 ? 193  LEU A CD1 1 
ATOM   1189 C  CD2 . LEU A 1 193 ? 35.746  133.062 -3.640  1.00 19.03 ? 193  LEU A CD2 1 
ATOM   1190 N  N   . ASN A 1 194 ? 38.892  137.137 -1.866  1.00 22.49 ? 194  ASN A N   1 
ATOM   1191 C  CA  . ASN A 1 194 ? 39.737  137.670 -0.810  1.00 22.94 ? 194  ASN A CA  1 
ATOM   1192 C  C   . ASN A 1 194 ? 38.849  138.408 0.192   1.00 22.83 ? 194  ASN A C   1 
ATOM   1193 O  O   . ASN A 1 194 ? 39.217  138.586 1.352   1.00 22.74 ? 194  ASN A O   1 
ATOM   1194 C  CB  . ASN A 1 194 ? 40.782  138.624 -1.394  1.00 24.51 ? 194  ASN A CB  1 
ATOM   1195 C  CG  . ASN A 1 194 ? 41.777  139.098 -0.356  1.00 26.75 ? 194  ASN A CG  1 
ATOM   1196 O  OD1 . ASN A 1 194 ? 42.504  138.297 0.239   1.00 27.60 ? 194  ASN A OD1 1 
ATOM   1197 N  ND2 . ASN A 1 194 ? 41.816  140.407 -0.129  1.00 27.61 ? 194  ASN A ND2 1 
ATOM   1198 N  N   . GLN A 1 195 ? 37.672  138.829 -0.265  1.00 22.18 ? 195  GLN A N   1 
ATOM   1199 C  CA  . GLN A 1 195 ? 36.724  139.536 0.591   1.00 22.09 ? 195  GLN A CA  1 
ATOM   1200 C  C   . GLN A 1 195 ? 35.724  138.564 1.222   1.00 21.30 ? 195  GLN A C   1 
ATOM   1201 O  O   . GLN A 1 195 ? 35.269  138.774 2.344   1.00 21.07 ? 195  GLN A O   1 
ATOM   1202 C  CB  . GLN A 1 195 ? 35.991  140.605 -0.221  1.00 22.87 ? 195  GLN A CB  1 
ATOM   1203 C  CG  . GLN A 1 195 ? 36.920  141.692 -0.743  1.00 24.66 ? 195  GLN A CG  1 
ATOM   1204 C  CD  . GLN A 1 195 ? 36.265  142.580 -1.779  1.00 25.78 ? 195  GLN A CD  1 
ATOM   1205 O  OE1 . GLN A 1 195 ? 35.296  143.285 -1.491  1.00 26.44 ? 195  GLN A OE1 1 
ATOM   1206 N  NE2 . GLN A 1 195 ? 36.789  142.546 -2.997  1.00 26.49 ? 195  GLN A NE2 1 
ATOM   1207 N  N   . ASP A 1 196 ? 35.387  137.506 0.488   1.00 20.17 ? 196  ASP A N   1 
ATOM   1208 C  CA  . ASP A 1 196 ? 34.467  136.466 0.961   1.00 19.19 ? 196  ASP A CA  1 
ATOM   1209 C  C   . ASP A 1 196 ? 34.948  135.171 0.313   1.00 18.00 ? 196  ASP A C   1 
ATOM   1210 O  O   . ASP A 1 196 ? 34.616  134.873 -0.835  1.00 16.71 ? 196  ASP A O   1 
ATOM   1211 C  CB  . ASP A 1 196 ? 33.030  136.783 0.537   1.00 19.31 ? 196  ASP A CB  1 
ATOM   1212 C  CG  . ASP A 1 196 ? 32.035  135.715 0.974   1.00 20.52 ? 196  ASP A CG  1 
ATOM   1213 O  OD1 . ASP A 1 196 ? 30.825  135.925 0.763   1.00 21.97 ? 196  ASP A OD1 1 
ATOM   1214 O  OD2 . ASP A 1 196 ? 32.449  134.668 1.521   1.00 19.96 ? 196  ASP A OD2 1 
ATOM   1215 N  N   . ALA A 1 197 ? 35.741  134.412 1.060   1.00 17.04 ? 197  ALA A N   1 
ATOM   1216 C  CA  . ALA A 1 197 ? 36.330  133.174 0.562   1.00 16.83 ? 197  ALA A CA  1 
ATOM   1217 C  C   . ALA A 1 197 ? 35.348  132.058 0.219   1.00 16.98 ? 197  ALA A C   1 
ATOM   1218 O  O   . ALA A 1 197 ? 35.757  131.010 -0.287  1.00 16.86 ? 197  ALA A O   1 
ATOM   1219 C  CB  . ALA A 1 197 ? 37.366  132.665 1.568   1.00 16.42 ? 197  ALA A CB  1 
ATOM   1220 N  N   . LYS A 1 198 ? 34.059  132.281 0.471   1.00 16.24 ? 198  LYS A N   1 
ATOM   1221 C  CA  . LYS A 1 198 ? 33.060  131.256 0.195   1.00 15.89 ? 198  LYS A CA  1 
ATOM   1222 C  C   . LYS A 1 198 ? 31.955  131.693 -0.775  1.00 15.85 ? 198  LYS A C   1 
ATOM   1223 O  O   . LYS A 1 198 ? 30.984  130.961 -0.990  1.00 15.79 ? 198  LYS A O   1 
ATOM   1224 C  CB  . LYS A 1 198 ? 32.442  130.779 1.519   1.00 14.56 ? 198  LYS A CB  1 
ATOM   1225 C  CG  . LYS A 1 198 ? 33.484  130.317 2.544   1.00 14.33 ? 198  LYS A CG  1 
ATOM   1226 C  CD  . LYS A 1 198 ? 32.850  129.773 3.825   1.00 13.68 ? 198  LYS A CD  1 
ATOM   1227 C  CE  . LYS A 1 198 ? 33.919  129.284 4.809   1.00 13.15 ? 198  LYS A CE  1 
ATOM   1228 N  NZ  . LYS A 1 198 ? 33.341  128.589 5.999   1.00 12.47 ? 198  LYS A NZ  1 
ATOM   1229 N  N   . ASN A 1 199 ? 32.103  132.872 -1.371  1.00 15.61 ? 199  ASN A N   1 
ATOM   1230 C  CA  . ASN A 1 199 ? 31.092  133.359 -2.308  1.00 15.52 ? 199  ASN A CA  1 
ATOM   1231 C  C   . ASN A 1 199 ? 30.792  132.271 -3.343  1.00 15.52 ? 199  ASN A C   1 
ATOM   1232 O  O   . ASN A 1 199 ? 31.655  131.899 -4.141  1.00 15.26 ? 199  ASN A O   1 
ATOM   1233 C  CB  . ASN A 1 199 ? 31.576  134.632 -3.002  1.00 16.09 ? 199  ASN A CB  1 
ATOM   1234 C  CG  . ASN A 1 199 ? 30.507  135.256 -3.875  1.00 16.08 ? 199  ASN A CG  1 
ATOM   1235 O  OD1 . ASN A 1 199 ? 30.118  134.692 -4.894  1.00 16.92 ? 199  ASN A OD1 1 
ATOM   1236 N  ND2 . ASN A 1 199 ? 30.019  136.424 -3.472  1.00 16.42 ? 199  ASN A ND2 1 
ATOM   1237 N  N   . TYR A 1 200 ? 29.562  131.765 -3.319  1.00 14.70 ? 200  TYR A N   1 
ATOM   1238 C  CA  . TYR A 1 200 ? 29.154  130.692 -4.221  1.00 13.87 ? 200  TYR A CA  1 
ATOM   1239 C  C   . TYR A 1 200 ? 29.283  131.067 -5.701  1.00 13.85 ? 200  TYR A C   1 
ATOM   1240 O  O   . TYR A 1 200 ? 29.836  130.298 -6.487  1.00 12.74 ? 200  TYR A O   1 
ATOM   1241 C  CB  . TYR A 1 200 ? 27.712  130.266 -3.914  1.00 12.55 ? 200  TYR A CB  1 
ATOM   1242 C  CG  . TYR A 1 200 ? 27.400  128.845 -4.330  1.00 12.72 ? 200  TYR A CG  1 
ATOM   1243 C  CD1 . TYR A 1 200 ? 27.580  127.778 -3.444  1.00 12.56 ? 200  TYR A CD1 1 
ATOM   1244 C  CD2 . TYR A 1 200 ? 26.952  128.562 -5.618  1.00 11.43 ? 200  TYR A CD2 1 
ATOM   1245 C  CE1 . TYR A 1 200 ? 27.315  126.458 -3.838  1.00 12.43 ? 200  TYR A CE1 1 
ATOM   1246 C  CE2 . TYR A 1 200 ? 26.690  127.257 -6.024  1.00 11.95 ? 200  TYR A CE2 1 
ATOM   1247 C  CZ  . TYR A 1 200 ? 26.871  126.209 -5.132  1.00 12.38 ? 200  TYR A CZ  1 
ATOM   1248 O  OH  . TYR A 1 200 ? 26.602  124.921 -5.545  1.00 12.27 ? 200  TYR A OH  1 
ATOM   1249 N  N   . HIS A 1 201 ? 28.773  132.239 -6.080  1.00 14.08 ? 201  HIS A N   1 
ATOM   1250 C  CA  . HIS A 1 201 ? 28.849  132.686 -7.476  1.00 14.67 ? 201  HIS A CA  1 
ATOM   1251 C  C   . HIS A 1 201 ? 30.292  132.795 -7.955  1.00 14.54 ? 201  HIS A C   1 
ATOM   1252 O  O   . HIS A 1 201 ? 30.608  132.434 -9.093  1.00 14.05 ? 201  HIS A O   1 
ATOM   1253 C  CB  . HIS A 1 201 ? 28.184  134.054 -7.651  1.00 15.65 ? 201  HIS A CB  1 
ATOM   1254 C  CG  . HIS A 1 201 ? 26.742  134.083 -7.256  1.00 16.30 ? 201  HIS A CG  1 
ATOM   1255 N  ND1 . HIS A 1 201 ? 25.764  133.409 -7.954  1.00 16.29 ? 201  HIS A ND1 1 
ATOM   1256 C  CD2 . HIS A 1 201 ? 26.116  134.692 -6.222  1.00 17.13 ? 201  HIS A CD2 1 
ATOM   1257 C  CE1 . HIS A 1 201 ? 24.596  133.600 -7.365  1.00 17.83 ? 201  HIS A CE1 1 
ATOM   1258 N  NE2 . HIS A 1 201 ? 24.783  134.374 -6.311  1.00 18.22 ? 201  HIS A NE2 1 
ATOM   1259 N  N   . ALA A 1 202 ? 31.160  133.311 -7.089  1.00 14.42 ? 202  ALA A N   1 
ATOM   1260 C  CA  . ALA A 1 202 ? 32.568  133.472 -7.434  1.00 15.26 ? 202  ALA A CA  1 
ATOM   1261 C  C   . ALA A 1 202 ? 33.200  132.123 -7.764  1.00 15.22 ? 202  ALA A C   1 
ATOM   1262 O  O   . ALA A 1 202 ? 33.898  131.985 -8.767  1.00 15.64 ? 202  ALA A O   1 
ATOM   1263 C  CB  . ALA A 1 202 ? 33.318  134.138 -6.285  1.00 14.93 ? 202  ALA A CB  1 
ATOM   1264 N  N   . TRP A 1 203 ? 32.953  131.125 -6.922  1.00 15.24 ? 203  TRP A N   1 
ATOM   1265 C  CA  . TRP A 1 203 ? 33.512  129.800 -7.161  1.00 15.80 ? 203  TRP A CA  1 
ATOM   1266 C  C   . TRP A 1 203 ? 32.923  129.153 -8.411  1.00 16.19 ? 203  TRP A C   1 
ATOM   1267 O  O   . TRP A 1 203 ? 33.621  128.442 -9.136  1.00 16.05 ? 203  TRP A O   1 
ATOM   1268 C  CB  . TRP A 1 203 ? 33.283  128.890 -5.948  1.00 15.50 ? 203  TRP A CB  1 
ATOM   1269 C  CG  . TRP A 1 203 ? 34.242  129.159 -4.832  1.00 16.67 ? 203  TRP A CG  1 
ATOM   1270 C  CD1 . TRP A 1 203 ? 33.954  129.690 -3.605  1.00 16.04 ? 203  TRP A CD1 1 
ATOM   1271 C  CD2 . TRP A 1 203 ? 35.657  128.931 -4.851  1.00 16.66 ? 203  TRP A CD2 1 
ATOM   1272 N  NE1 . TRP A 1 203 ? 35.105  129.807 -2.859  1.00 16.98 ? 203  TRP A NE1 1 
ATOM   1273 C  CE2 . TRP A 1 203 ? 36.164  129.349 -3.599  1.00 16.49 ? 203  TRP A CE2 1 
ATOM   1274 C  CE3 . TRP A 1 203 ? 36.547  128.415 -5.805  1.00 16.26 ? 203  TRP A CE3 1 
ATOM   1275 C  CZ2 . TRP A 1 203 ? 37.524  129.267 -3.274  1.00 16.58 ? 203  TRP A CZ2 1 
ATOM   1276 C  CZ3 . TRP A 1 203 ? 37.905  128.333 -5.481  1.00 16.84 ? 203  TRP A CZ3 1 
ATOM   1277 C  CH2 . TRP A 1 203 ? 38.376  128.758 -4.224  1.00 16.35 ? 203  TRP A CH2 1 
ATOM   1278 N  N   . GLN A 1 204 ? 31.642  129.398 -8.668  1.00 15.77 ? 204  GLN A N   1 
ATOM   1279 C  CA  . GLN A 1 204 ? 31.001  128.815 -9.843  1.00 16.51 ? 204  GLN A CA  1 
ATOM   1280 C  C   . GLN A 1 204 ? 31.588  129.414 -11.119 1.00 16.83 ? 204  GLN A C   1 
ATOM   1281 O  O   . GLN A 1 204 ? 31.814  128.715 -12.106 1.00 17.30 ? 204  GLN A O   1 
ATOM   1282 C  CB  . GLN A 1 204 ? 29.494  129.061 -9.808  1.00 15.66 ? 204  GLN A CB  1 
ATOM   1283 C  CG  . GLN A 1 204 ? 28.732  128.324 -10.905 1.00 16.37 ? 204  GLN A CG  1 
ATOM   1284 C  CD  . GLN A 1 204 ? 27.241  128.315 -10.655 1.00 16.50 ? 204  GLN A CD  1 
ATOM   1285 O  OE1 . GLN A 1 204 ? 26.800  128.123 -9.523  1.00 17.78 ? 204  GLN A OE1 1 
ATOM   1286 N  NE2 . GLN A 1 204 ? 26.455  128.504 -11.709 1.00 15.09 ? 204  GLN A NE2 1 
ATOM   1287 N  N   . HIS A 1 205 ? 31.836  130.716 -11.090 1.00 16.72 ? 205  HIS A N   1 
ATOM   1288 C  CA  . HIS A 1 205 ? 32.398  131.400 -12.241 1.00 16.95 ? 205  HIS A CA  1 
ATOM   1289 C  C   . HIS A 1 205 ? 33.838  130.935 -12.447 1.00 16.78 ? 205  HIS A C   1 
ATOM   1290 O  O   . HIS A 1 205 ? 34.295  130.782 -13.575 1.00 16.43 ? 205  HIS A O   1 
ATOM   1291 C  CB  . HIS A 1 205 ? 32.369  132.911 -12.015 1.00 17.21 ? 205  HIS A CB  1 
ATOM   1292 C  CG  . HIS A 1 205 ? 32.781  133.708 -13.214 1.00 17.97 ? 205  HIS A CG  1 
ATOM   1293 N  ND1 . HIS A 1 205 ? 32.012  133.790 -14.354 1.00 18.10 ? 205  HIS A ND1 1 
ATOM   1294 C  CD2 . HIS A 1 205 ? 33.890  134.446 -13.453 1.00 18.16 ? 205  HIS A CD2 1 
ATOM   1295 C  CE1 . HIS A 1 205 ? 32.629  134.547 -15.244 1.00 19.33 ? 205  HIS A CE1 1 
ATOM   1296 N  NE2 . HIS A 1 205 ? 33.771  134.957 -14.722 1.00 18.39 ? 205  HIS A NE2 1 
ATOM   1297 N  N   . ARG A 1 206 ? 34.549  130.709 -11.347 1.00 17.26 ? 206  ARG A N   1 
ATOM   1298 C  CA  . ARG A 1 206 ? 35.934  130.270 -11.425 1.00 17.18 ? 206  ARG A CA  1 
ATOM   1299 C  C   . ARG A 1 206 ? 36.016  128.894 -12.090 1.00 17.33 ? 206  ARG A C   1 
ATOM   1300 O  O   . ARG A 1 206 ? 36.872  128.670 -12.953 1.00 16.72 ? 206  ARG A O   1 
ATOM   1301 C  CB  . ARG A 1 206 ? 36.560  130.231 -10.023 1.00 17.10 ? 206  ARG A CB  1 
ATOM   1302 C  CG  . ARG A 1 206 ? 38.083  130.328 -10.026 1.00 17.10 ? 206  ARG A CG  1 
ATOM   1303 C  CD  . ARG A 1 206 ? 38.676  130.286 -8.616  1.00 16.60 ? 206  ARG A CD  1 
ATOM   1304 N  NE  . ARG A 1 206 ? 40.135  130.273 -8.668  1.00 17.15 ? 206  ARG A NE  1 
ATOM   1305 C  CZ  . ARG A 1 206 ? 40.898  131.351 -8.837  1.00 17.81 ? 206  ARG A CZ  1 
ATOM   1306 N  NH1 . ARG A 1 206 ? 40.350  132.554 -8.957  1.00 17.36 ? 206  ARG A NH1 1 
ATOM   1307 N  NH2 . ARG A 1 206 ? 42.214  131.220 -8.923  1.00 18.08 ? 206  ARG A NH2 1 
ATOM   1308 N  N   . GLN A 1 207 ? 35.123  127.980 -11.707 1.00 16.83 ? 207  GLN A N   1 
ATOM   1309 C  CA  . GLN A 1 207 ? 35.132  126.640 -12.296 1.00 17.34 ? 207  GLN A CA  1 
ATOM   1310 C  C   . GLN A 1 207 ? 34.818  126.690 -13.787 1.00 17.71 ? 207  GLN A C   1 
ATOM   1311 O  O   . GLN A 1 207 ? 35.444  125.987 -14.588 1.00 17.71 ? 207  GLN A O   1 
ATOM   1312 C  CB  . GLN A 1 207 ? 34.128  125.714 -11.594 1.00 16.57 ? 207  GLN A CB  1 
ATOM   1313 C  CG  . GLN A 1 207 ? 34.425  125.459 -10.118 1.00 15.73 ? 207  GLN A CG  1 
ATOM   1314 C  CD  . GLN A 1 207 ? 33.695  124.240 -9.568  1.00 15.41 ? 207  GLN A CD  1 
ATOM   1315 O  OE1 . GLN A 1 207 ? 32.658  123.830 -10.096 1.00 15.02 ? 207  GLN A OE1 1 
ATOM   1316 N  NE2 . GLN A 1 207 ? 34.231  123.660 -8.498  1.00 13.04 ? 207  GLN A NE2 1 
ATOM   1317 N  N   . TRP A 1 208 ? 33.847  127.521 -14.161 1.00 18.00 ? 208  TRP A N   1 
ATOM   1318 C  CA  . TRP A 1 208 ? 33.472  127.649 -15.562 1.00 18.29 ? 208  TRP A CA  1 
ATOM   1319 C  C   . TRP A 1 208 ? 34.638  128.151 -16.409 1.00 18.55 ? 208  TRP A C   1 
ATOM   1320 O  O   . TRP A 1 208 ? 34.947  127.576 -17.451 1.00 18.68 ? 208  TRP A O   1 
ATOM   1321 C  CB  . TRP A 1 208 ? 32.294  128.611 -15.731 1.00 17.65 ? 208  TRP A CB  1 
ATOM   1322 C  CG  . TRP A 1 208 ? 32.036  128.922 -17.175 1.00 17.31 ? 208  TRP A CG  1 
ATOM   1323 C  CD1 . TRP A 1 208 ? 31.507  128.081 -18.115 1.00 17.76 ? 208  TRP A CD1 1 
ATOM   1324 C  CD2 . TRP A 1 208 ? 32.397  130.121 -17.868 1.00 17.32 ? 208  TRP A CD2 1 
ATOM   1325 N  NE1 . TRP A 1 208 ? 31.524  128.681 -19.352 1.00 17.88 ? 208  TRP A NE1 1 
ATOM   1326 C  CE2 . TRP A 1 208 ? 32.065  129.935 -19.227 1.00 17.65 ? 208  TRP A CE2 1 
ATOM   1327 C  CE3 . TRP A 1 208 ? 32.975  131.336 -17.472 1.00 18.06 ? 208  TRP A CE3 1 
ATOM   1328 C  CZ2 . TRP A 1 208 ? 32.292  130.919 -20.196 1.00 17.99 ? 208  TRP A CZ2 1 
ATOM   1329 C  CZ3 . TRP A 1 208 ? 33.202  132.316 -18.436 1.00 18.11 ? 208  TRP A CZ3 1 
ATOM   1330 C  CH2 . TRP A 1 208 ? 32.859  132.099 -19.783 1.00 17.98 ? 208  TRP A CH2 1 
ATOM   1331 N  N   . VAL A 1 209 ? 35.272  129.232 -15.964 1.00 19.27 ? 209  VAL A N   1 
ATOM   1332 C  CA  . VAL A 1 209 ? 36.398  129.816 -16.689 1.00 20.26 ? 209  VAL A CA  1 
ATOM   1333 C  C   . VAL A 1 209 ? 37.545  128.820 -16.855 1.00 20.17 ? 209  VAL A C   1 
ATOM   1334 O  O   . VAL A 1 209 ? 38.077  128.645 -17.950 1.00 19.21 ? 209  VAL A O   1 
ATOM   1335 C  CB  . VAL A 1 209 ? 36.942  131.068 -15.964 1.00 21.23 ? 209  VAL A CB  1 
ATOM   1336 C  CG1 . VAL A 1 209 ? 38.162  131.604 -16.696 1.00 23.09 ? 209  VAL A CG1 1 
ATOM   1337 C  CG2 . VAL A 1 209 ? 35.866  132.141 -15.898 1.00 22.51 ? 209  VAL A CG2 1 
ATOM   1338 N  N   . ILE A 1 210 ? 37.923  128.174 -15.758 1.00 20.05 ? 210  ILE A N   1 
ATOM   1339 C  CA  . ILE A 1 210 ? 39.007  127.207 -15.787 1.00 21.08 ? 210  ILE A CA  1 
ATOM   1340 C  C   . ILE A 1 210 ? 38.705  126.065 -16.745 1.00 21.97 ? 210  ILE A C   1 
ATOM   1341 O  O   . ILE A 1 210 ? 39.560  125.661 -17.530 1.00 21.45 ? 210  ILE A O   1 
ATOM   1342 C  CB  . ILE A 1 210 ? 39.268  126.635 -14.382 1.00 20.90 ? 210  ILE A CB  1 
ATOM   1343 C  CG1 . ILE A 1 210 ? 39.835  127.737 -13.485 1.00 20.87 ? 210  ILE A CG1 1 
ATOM   1344 C  CG2 . ILE A 1 210 ? 40.217  125.437 -14.464 1.00 21.05 ? 210  ILE A CG2 1 
ATOM   1345 C  CD1 . ILE A 1 210 ? 40.049  127.316 -12.038 1.00 22.09 ? 210  ILE A CD1 1 
ATOM   1346 N  N   . GLN A 1 211 ? 37.479  125.558 -16.689 1.00 23.25 ? 211  GLN A N   1 
ATOM   1347 C  CA  . GLN A 1 211 ? 37.077  124.453 -17.543 1.00 24.42 ? 211  GLN A CA  1 
ATOM   1348 C  C   . GLN A 1 211 ? 36.910  124.863 -19.006 1.00 24.68 ? 211  GLN A C   1 
ATOM   1349 O  O   . GLN A 1 211 ? 37.370  124.163 -19.909 1.00 24.28 ? 211  GLN A O   1 
ATOM   1350 C  CB  . GLN A 1 211 ? 35.778  123.836 -17.012 1.00 26.48 ? 211  GLN A CB  1 
ATOM   1351 C  CG  . GLN A 1 211 ? 35.349  122.568 -17.728 1.00 29.39 ? 211  GLN A CG  1 
ATOM   1352 C  CD  . GLN A 1 211 ? 34.777  121.531 -16.775 1.00 31.82 ? 211  GLN A CD  1 
ATOM   1353 O  OE1 . GLN A 1 211 ? 33.771  121.773 -16.097 1.00 32.91 ? 211  GLN A OE1 1 
ATOM   1354 N  NE2 . GLN A 1 211 ? 35.420  120.368 -16.715 1.00 31.57 ? 211  GLN A NE2 1 
ATOM   1355 N  N   . GLU A 1 212 ? 36.265  126.000 -19.243 1.00 24.38 ? 212  GLU A N   1 
ATOM   1356 C  CA  . GLU A 1 212 ? 36.047  126.464 -20.608 1.00 24.82 ? 212  GLU A CA  1 
ATOM   1357 C  C   . GLU A 1 212 ? 37.331  126.874 -21.337 1.00 24.79 ? 212  GLU A C   1 
ATOM   1358 O  O   . GLU A 1 212 ? 37.470  126.634 -22.536 1.00 24.30 ? 212  GLU A O   1 
ATOM   1359 C  CB  . GLU A 1 212 ? 35.068  127.639 -20.616 1.00 25.34 ? 212  GLU A CB  1 
ATOM   1360 C  CG  . GLU A 1 212 ? 34.794  128.209 -22.003 1.00 26.81 ? 212  GLU A CG  1 
ATOM   1361 C  CD  . GLU A 1 212 ? 34.013  127.257 -22.896 1.00 27.98 ? 212  GLU A CD  1 
ATOM   1362 O  OE1 . GLU A 1 212 ? 33.923  127.528 -24.109 1.00 29.13 ? 212  GLU A OE1 1 
ATOM   1363 O  OE2 . GLU A 1 212 ? 33.482  126.245 -22.392 1.00 28.39 ? 212  GLU A OE2 1 
ATOM   1364 N  N   . PHE A 1 213 ? 38.262  127.494 -20.620 1.00 24.54 ? 213  PHE A N   1 
ATOM   1365 C  CA  . PHE A 1 213 ? 39.506  127.942 -21.239 1.00 25.07 ? 213  PHE A CA  1 
ATOM   1366 C  C   . PHE A 1 213 ? 40.748  127.146 -20.841 1.00 25.28 ? 213  PHE A C   1 
ATOM   1367 O  O   . PHE A 1 213 ? 41.875  127.565 -21.116 1.00 24.62 ? 213  PHE A O   1 
ATOM   1368 C  CB  . PHE A 1 213 ? 39.724  129.431 -20.952 1.00 25.27 ? 213  PHE A CB  1 
ATOM   1369 C  CG  . PHE A 1 213 ? 38.638  130.315 -21.504 1.00 25.91 ? 213  PHE A CG  1 
ATOM   1370 C  CD1 . PHE A 1 213 ? 37.455  130.512 -20.798 1.00 26.01 ? 213  PHE A CD1 1 
ATOM   1371 C  CD2 . PHE A 1 213 ? 38.778  130.908 -22.757 1.00 26.49 ? 213  PHE A CD2 1 
ATOM   1372 C  CE1 . PHE A 1 213 ? 36.422  131.287 -21.331 1.00 26.54 ? 213  PHE A CE1 1 
ATOM   1373 C  CE2 . PHE A 1 213 ? 37.752  131.685 -23.304 1.00 27.07 ? 213  PHE A CE2 1 
ATOM   1374 C  CZ  . PHE A 1 213 ? 36.571  131.874 -22.589 1.00 27.15 ? 213  PHE A CZ  1 
ATOM   1375 N  N   . LYS A 1 214 ? 40.537  125.998 -20.201 1.00 25.13 ? 214  LYS A N   1 
ATOM   1376 C  CA  . LYS A 1 214 ? 41.635  125.128 -19.782 1.00 25.79 ? 214  LYS A CA  1 
ATOM   1377 C  C   . LYS A 1 214 ? 42.730  125.845 -19.002 1.00 25.22 ? 214  LYS A C   1 
ATOM   1378 O  O   . LYS A 1 214 ? 43.888  125.835 -19.414 1.00 24.73 ? 214  LYS A O   1 
ATOM   1379 C  CB  . LYS A 1 214 ? 42.278  124.452 -20.999 1.00 27.30 ? 214  LYS A CB  1 
ATOM   1380 C  CG  . LYS A 1 214 ? 41.425  123.405 -21.694 1.00 30.30 ? 214  LYS A CG  1 
ATOM   1381 C  CD  . LYS A 1 214 ? 40.263  124.018 -22.454 1.00 32.82 ? 214  LYS A CD  1 
ATOM   1382 C  CE  . LYS A 1 214 ? 39.494  122.948 -23.220 1.00 34.63 ? 214  LYS A CE  1 
ATOM   1383 N  NZ  . LYS A 1 214 ? 40.363  122.240 -24.207 1.00 36.01 ? 214  LYS A NZ  1 
ATOM   1384 N  N   . LEU A 1 215 ? 42.374  126.458 -17.879 1.00 24.35 ? 215  LEU A N   1 
ATOM   1385 C  CA  . LEU A 1 215 ? 43.352  127.163 -17.059 1.00 24.17 ? 215  LEU A CA  1 
ATOM   1386 C  C   . LEU A 1 215 ? 43.574  126.413 -15.748 1.00 23.86 ? 215  LEU A C   1 
ATOM   1387 O  O   . LEU A 1 215 ? 43.371  126.967 -14.671 1.00 23.72 ? 215  LEU A O   1 
ATOM   1388 C  CB  . LEU A 1 215 ? 42.862  128.585 -16.769 1.00 24.42 ? 215  LEU A CB  1 
ATOM   1389 C  CG  . LEU A 1 215 ? 42.555  129.452 -17.995 1.00 25.05 ? 215  LEU A CG  1 
ATOM   1390 C  CD1 . LEU A 1 215 ? 41.947  130.774 -17.555 1.00 24.34 ? 215  LEU A CD1 1 
ATOM   1391 C  CD2 . LEU A 1 215 ? 43.836  129.679 -18.790 1.00 25.15 ? 215  LEU A CD2 1 
ATOM   1392 N  N   . TRP A 1 216 ? 44.006  125.157 -15.850 1.00 23.71 ? 216  TRP A N   1 
ATOM   1393 C  CA  . TRP A 1 216 ? 44.230  124.309 -14.677 1.00 24.08 ? 216  TRP A CA  1 
ATOM   1394 C  C   . TRP A 1 216 ? 45.603  124.419 -14.021 1.00 24.56 ? 216  TRP A C   1 
ATOM   1395 O  O   . TRP A 1 216 ? 45.760  124.113 -12.837 1.00 24.60 ? 216  TRP A O   1 
ATOM   1396 C  CB  . TRP A 1 216 ? 44.025  122.836 -15.042 1.00 23.44 ? 216  TRP A CB  1 
ATOM   1397 C  CG  . TRP A 1 216 ? 42.764  122.544 -15.781 1.00 23.20 ? 216  TRP A CG  1 
ATOM   1398 C  CD1 . TRP A 1 216 ? 42.593  122.520 -17.136 1.00 22.33 ? 216  TRP A CD1 1 
ATOM   1399 C  CD2 . TRP A 1 216 ? 41.488  122.242 -15.209 1.00 22.21 ? 216  TRP A CD2 1 
ATOM   1400 N  NE1 . TRP A 1 216 ? 41.290  122.221 -17.443 1.00 22.27 ? 216  TRP A NE1 1 
ATOM   1401 C  CE2 . TRP A 1 216 ? 40.588  122.046 -16.279 1.00 22.32 ? 216  TRP A CE2 1 
ATOM   1402 C  CE3 . TRP A 1 216 ? 41.016  122.119 -13.894 1.00 22.46 ? 216  TRP A CE3 1 
ATOM   1403 C  CZ2 . TRP A 1 216 ? 39.239  121.734 -16.077 1.00 22.29 ? 216  TRP A CZ2 1 
ATOM   1404 C  CZ3 . TRP A 1 216 ? 39.673  121.808 -13.694 1.00 21.45 ? 216  TRP A CZ3 1 
ATOM   1405 C  CH2 . TRP A 1 216 ? 38.802  121.619 -14.781 1.00 21.91 ? 216  TRP A CH2 1 
ATOM   1406 N  N   . ASP A 1 217 ? 46.591  124.846 -14.796 1.00 24.98 ? 217  ASP A N   1 
ATOM   1407 C  CA  . ASP A 1 217 ? 47.972  124.939 -14.331 1.00 25.51 ? 217  ASP A CA  1 
ATOM   1408 C  C   . ASP A 1 217 ? 48.290  125.413 -12.916 1.00 24.33 ? 217  ASP A C   1 
ATOM   1409 O  O   . ASP A 1 217 ? 49.141  124.823 -12.252 1.00 24.47 ? 217  ASP A O   1 
ATOM   1410 C  CB  . ASP A 1 217 ? 48.787  125.772 -15.321 1.00 27.15 ? 217  ASP A CB  1 
ATOM   1411 C  CG  . ASP A 1 217 ? 48.941  125.090 -16.666 1.00 29.36 ? 217  ASP A CG  1 
ATOM   1412 O  OD1 . ASP A 1 217 ? 49.566  125.689 -17.566 1.00 31.98 ? 217  ASP A OD1 1 
ATOM   1413 O  OD2 . ASP A 1 217 ? 48.444  123.956 -16.829 1.00 30.23 ? 217  ASP A OD2 1 
ATOM   1414 N  N   . ASN A 1 218 ? 47.628  126.460 -12.441 1.00 23.13 ? 218  ASN A N   1 
ATOM   1415 C  CA  . ASN A 1 218 ? 47.942  126.977 -11.114 1.00 22.53 ? 218  ASN A CA  1 
ATOM   1416 C  C   . ASN A 1 218 ? 46.828  126.905 -10.082 1.00 21.94 ? 218  ASN A C   1 
ATOM   1417 O  O   . ASN A 1 218 ? 46.955  127.480 -9.001  1.00 21.48 ? 218  ASN A O   1 
ATOM   1418 C  CB  . ASN A 1 218 ? 48.400  128.435 -11.232 1.00 23.17 ? 218  ASN A CB  1 
ATOM   1419 C  CG  . ASN A 1 218 ? 49.573  128.602 -12.176 1.00 24.19 ? 218  ASN A CG  1 
ATOM   1420 O  OD1 . ASN A 1 218 ? 50.668  128.105 -11.916 1.00 24.19 ? 218  ASN A OD1 1 
ATOM   1421 N  ND2 . ASN A 1 218 ? 49.348  129.300 -13.285 1.00 24.83 ? 218  ASN A ND2 1 
ATOM   1422 N  N   . GLU A 1 219 ? 45.749  126.195 -10.387 1.00 21.85 ? 219  GLU A N   1 
ATOM   1423 C  CA  . GLU A 1 219 ? 44.641  126.138 -9.443  1.00 21.41 ? 219  GLU A CA  1 
ATOM   1424 C  C   . GLU A 1 219 ? 44.897  125.321 -8.175  1.00 21.76 ? 219  GLU A C   1 
ATOM   1425 O  O   . GLU A 1 219 ? 44.433  125.699 -7.100  1.00 21.43 ? 219  GLU A O   1 
ATOM   1426 C  CB  . GLU A 1 219 ? 43.369  125.645 -10.139 1.00 20.64 ? 219  GLU A CB  1 
ATOM   1427 C  CG  . GLU A 1 219 ? 42.104  125.831 -9.302  1.00 19.08 ? 219  GLU A CG  1 
ATOM   1428 C  CD  . GLU A 1 219 ? 41.752  127.297 -9.047  1.00 19.56 ? 219  GLU A CD  1 
ATOM   1429 O  OE1 . GLU A 1 219 ? 42.579  128.187 -9.350  1.00 19.11 ? 219  GLU A OE1 1 
ATOM   1430 O  OE2 . GLU A 1 219 ? 40.641  127.558 -8.530  1.00 17.39 ? 219  GLU A OE2 1 
ATOM   1431 N  N   . LEU A 1 220 ? 45.628  124.213 -8.280  1.00 22.12 ? 220  LEU A N   1 
ATOM   1432 C  CA  . LEU A 1 220 ? 45.902  123.409 -7.090  1.00 22.79 ? 220  LEU A CA  1 
ATOM   1433 C  C   . LEU A 1 220 ? 46.752  124.228 -6.125  1.00 23.14 ? 220  LEU A C   1 
ATOM   1434 O  O   . LEU A 1 220 ? 46.610  124.123 -4.904  1.00 22.99 ? 220  LEU A O   1 
ATOM   1435 C  CB  . LEU A 1 220 ? 46.626  122.108 -7.456  1.00 23.35 ? 220  LEU A CB  1 
ATOM   1436 C  CG  . LEU A 1 220 ? 46.897  121.143 -6.296  1.00 24.03 ? 220  LEU A CG  1 
ATOM   1437 C  CD1 . LEU A 1 220 ? 45.598  120.825 -5.554  1.00 24.29 ? 220  LEU A CD1 1 
ATOM   1438 C  CD2 . LEU A 1 220 ? 47.518  119.865 -6.839  1.00 24.16 ? 220  LEU A CD2 1 
ATOM   1439 N  N   . GLN A 1 221 ? 47.633  125.051 -6.682  1.00 23.24 ? 221  GLN A N   1 
ATOM   1440 C  CA  . GLN A 1 221 ? 48.489  125.911 -5.874  1.00 23.48 ? 221  GLN A CA  1 
ATOM   1441 C  C   . GLN A 1 221 ? 47.606  126.954 -5.179  1.00 22.56 ? 221  GLN A C   1 
ATOM   1442 O  O   . GLN A 1 221 ? 47.849  127.321 -4.031  1.00 21.69 ? 221  GLN A O   1 
ATOM   1443 C  CB  . GLN A 1 221 ? 49.534  126.596 -6.765  1.00 24.82 ? 221  GLN A CB  1 
ATOM   1444 C  CG  . GLN A 1 221 ? 50.411  127.597 -6.039  1.00 28.27 ? 221  GLN A CG  1 
ATOM   1445 C  CD  . GLN A 1 221 ? 51.488  128.206 -6.930  1.00 30.19 ? 221  GLN A CD  1 
ATOM   1446 O  OE1 . GLN A 1 221 ? 52.149  129.169 -6.541  1.00 32.01 ? 221  GLN A OE1 1 
ATOM   1447 N  NE2 . GLN A 1 221 ? 51.674  127.643 -8.122  1.00 30.50 ? 221  GLN A NE2 1 
ATOM   1448 N  N   . TYR A 1 222 ? 46.576  127.420 -5.881  1.00 21.72 ? 222  TYR A N   1 
ATOM   1449 C  CA  . TYR A 1 222 ? 45.650  128.405 -5.323  1.00 21.43 ? 222  TYR A CA  1 
ATOM   1450 C  C   . TYR A 1 222 ? 44.842  127.761 -4.197  1.00 21.05 ? 222  TYR A C   1 
ATOM   1451 O  O   . TYR A 1 222 ? 44.591  128.379 -3.159  1.00 20.73 ? 222  TYR A O   1 
ATOM   1452 C  CB  . TYR A 1 222 ? 44.694  128.916 -6.404  1.00 20.70 ? 222  TYR A CB  1 
ATOM   1453 C  CG  . TYR A 1 222 ? 43.746  129.992 -5.917  1.00 20.79 ? 222  TYR A CG  1 
ATOM   1454 C  CD1 . TYR A 1 222 ? 44.231  131.218 -5.459  1.00 20.92 ? 222  TYR A CD1 1 
ATOM   1455 C  CD2 . TYR A 1 222 ? 42.365  129.786 -5.917  1.00 20.45 ? 222  TYR A CD2 1 
ATOM   1456 C  CE1 . TYR A 1 222 ? 43.362  132.216 -5.014  1.00 21.27 ? 222  TYR A CE1 1 
ATOM   1457 C  CE2 . TYR A 1 222 ? 41.487  130.777 -5.476  1.00 20.27 ? 222  TYR A CE2 1 
ATOM   1458 C  CZ  . TYR A 1 222 ? 41.990  131.987 -5.026  1.00 20.67 ? 222  TYR A CZ  1 
ATOM   1459 O  OH  . TYR A 1 222 ? 41.130  132.968 -4.591  1.00 20.22 ? 222  TYR A OH  1 
ATOM   1460 N  N   . VAL A 1 223 ? 44.435  126.514 -4.419  1.00 20.87 ? 223  VAL A N   1 
ATOM   1461 C  CA  . VAL A 1 223 ? 43.674  125.762 -3.434  1.00 20.70 ? 223  VAL A CA  1 
ATOM   1462 C  C   . VAL A 1 223 ? 44.486  125.604 -2.149  1.00 21.24 ? 223  VAL A C   1 
ATOM   1463 O  O   . VAL A 1 223 ? 43.977  125.852 -1.054  1.00 20.45 ? 223  VAL A O   1 
ATOM   1464 C  CB  . VAL A 1 223 ? 43.290  124.359 -3.984  1.00 20.26 ? 223  VAL A CB  1 
ATOM   1465 C  CG1 . VAL A 1 223 ? 42.779  123.468 -2.862  1.00 18.94 ? 223  VAL A CG1 1 
ATOM   1466 C  CG2 . VAL A 1 223 ? 42.213  124.505 -5.055  1.00 20.00 ? 223  VAL A CG2 1 
ATOM   1467 N  N   . ASP A 1 224 ? 45.750  125.206 -2.284  1.00 21.68 ? 224  ASP A N   1 
ATOM   1468 C  CA  . ASP A 1 224 ? 46.613  125.024 -1.118  1.00 22.34 ? 224  ASP A CA  1 
ATOM   1469 C  C   . ASP A 1 224 ? 46.790  126.310 -0.320  1.00 22.27 ? 224  ASP A C   1 
ATOM   1470 O  O   . ASP A 1 224 ? 46.883  126.276 0.907   1.00 22.14 ? 224  ASP A O   1 
ATOM   1471 C  CB  . ASP A 1 224 ? 47.995  124.505 -1.528  1.00 23.36 ? 224  ASP A CB  1 
ATOM   1472 C  CG  . ASP A 1 224 ? 47.951  123.102 -2.086  1.00 24.28 ? 224  ASP A CG  1 
ATOM   1473 O  OD1 . ASP A 1 224 ? 47.116  122.298 -1.620  1.00 25.35 ? 224  ASP A OD1 1 
ATOM   1474 O  OD2 . ASP A 1 224 ? 48.763  122.795 -2.979  1.00 24.96 ? 224  ASP A OD2 1 
ATOM   1475 N  N   . GLN A 1 225 ? 46.847  127.444 -1.006  1.00 22.47 ? 225  GLN A N   1 
ATOM   1476 C  CA  . GLN A 1 225 ? 47.017  128.704 -0.303  1.00 23.60 ? 225  GLN A CA  1 
ATOM   1477 C  C   . GLN A 1 225 ? 45.782  129.046 0.526   1.00 22.92 ? 225  GLN A C   1 
ATOM   1478 O  O   . GLN A 1 225 ? 45.901  129.484 1.671   1.00 22.93 ? 225  GLN A O   1 
ATOM   1479 C  CB  . GLN A 1 225 ? 47.315  129.840 -1.283  1.00 25.50 ? 225  GLN A CB  1 
ATOM   1480 C  CG  . GLN A 1 225 ? 47.613  131.165 -0.590  1.00 28.42 ? 225  GLN A CG  1 
ATOM   1481 C  CD  . GLN A 1 225 ? 48.640  131.023 0.529   1.00 31.04 ? 225  GLN A CD  1 
ATOM   1482 O  OE1 . GLN A 1 225 ? 49.723  130.463 0.331   1.00 33.04 ? 225  GLN A OE1 1 
ATOM   1483 N  NE2 . GLN A 1 225 ? 48.304  131.536 1.712   1.00 31.29 ? 225  GLN A NE2 1 
ATOM   1484 N  N   . LEU A 1 226 ? 44.600  128.843 -0.049  1.00 22.18 ? 226  LEU A N   1 
ATOM   1485 C  CA  . LEU A 1 226 ? 43.362  129.136 0.666   1.00 21.97 ? 226  LEU A CA  1 
ATOM   1486 C  C   . LEU A 1 226 ? 43.122  128.163 1.823   1.00 21.51 ? 226  LEU A C   1 
ATOM   1487 O  O   . LEU A 1 226 ? 42.517  128.533 2.828   1.00 21.52 ? 226  LEU A O   1 
ATOM   1488 C  CB  . LEU A 1 226 ? 42.167  129.124 -0.294  1.00 22.07 ? 226  LEU A CB  1 
ATOM   1489 C  CG  . LEU A 1 226 ? 42.153  130.205 -1.387  1.00 23.36 ? 226  LEU A CG  1 
ATOM   1490 C  CD1 . LEU A 1 226 ? 40.772  130.263 -2.027  1.00 23.10 ? 226  LEU A CD1 1 
ATOM   1491 C  CD2 . LEU A 1 226 ? 42.491  131.558 -0.794  1.00 23.17 ? 226  LEU A CD2 1 
ATOM   1492 N  N   . LEU A 1 227 ? 43.590  126.924 1.682   1.00 21.40 ? 227  LEU A N   1 
ATOM   1493 C  CA  . LEU A 1 227 ? 43.433  125.935 2.747   1.00 22.03 ? 227  LEU A CA  1 
ATOM   1494 C  C   . LEU A 1 227 ? 44.363  126.277 3.908   1.00 22.63 ? 227  LEU A C   1 
ATOM   1495 O  O   . LEU A 1 227 ? 44.099  125.934 5.061   1.00 22.14 ? 227  LEU A O   1 
ATOM   1496 C  CB  . LEU A 1 227 ? 43.736  124.525 2.231   1.00 21.50 ? 227  LEU A CB  1 
ATOM   1497 C  CG  . LEU A 1 227 ? 42.617  123.860 1.427   1.00 21.46 ? 227  LEU A CG  1 
ATOM   1498 C  CD1 . LEU A 1 227 ? 43.053  122.470 1.001   1.00 21.85 ? 227  LEU A CD1 1 
ATOM   1499 C  CD2 . LEU A 1 227 ? 41.345  123.784 2.275   1.00 21.85 ? 227  LEU A CD2 1 
ATOM   1500 N  N   . LYS A 1 228 ? 45.458  126.959 3.589   1.00 23.50 ? 228  LYS A N   1 
ATOM   1501 C  CA  . LYS A 1 228 ? 46.415  127.379 4.600   1.00 24.05 ? 228  LYS A CA  1 
ATOM   1502 C  C   . LYS A 1 228 ? 45.760  128.498 5.403   1.00 23.46 ? 228  LYS A C   1 
ATOM   1503 O  O   . LYS A 1 228 ? 45.891  128.562 6.622   1.00 23.14 ? 228  LYS A O   1 
ATOM   1504 C  CB  . LYS A 1 228 ? 47.688  127.895 3.929   1.00 26.16 ? 228  LYS A CB  1 
ATOM   1505 C  CG  . LYS A 1 228 ? 48.685  128.545 4.875   1.00 29.59 ? 228  LYS A CG  1 
ATOM   1506 C  CD  . LYS A 1 228 ? 49.254  127.543 5.864   1.00 32.53 ? 228  LYS A CD  1 
ATOM   1507 C  CE  . LYS A 1 228 ? 50.405  128.149 6.658   1.00 34.32 ? 228  LYS A CE  1 
ATOM   1508 N  NZ  . LYS A 1 228 ? 51.016  127.157 7.590   1.00 35.39 ? 228  LYS A NZ  1 
ATOM   1509 N  N   . GLU A 1 229 ? 45.047  129.375 4.704   1.00 22.60 ? 229  GLU A N   1 
ATOM   1510 C  CA  . GLU A 1 229 ? 44.363  130.497 5.336   1.00 22.90 ? 229  GLU A CA  1 
ATOM   1511 C  C   . GLU A 1 229 ? 43.194  130.031 6.206   1.00 21.81 ? 229  GLU A C   1 
ATOM   1512 O  O   . GLU A 1 229 ? 43.008  130.518 7.319   1.00 21.85 ? 229  GLU A O   1 
ATOM   1513 C  CB  . GLU A 1 229 ? 43.885  131.482 4.261   1.00 24.01 ? 229  GLU A CB  1 
ATOM   1514 C  CG  . GLU A 1 229 ? 45.010  132.343 3.689   1.00 25.99 ? 229  GLU A CG  1 
ATOM   1515 C  CD  . GLU A 1 229 ? 44.628  133.060 2.406   1.00 27.47 ? 229  GLU A CD  1 
ATOM   1516 O  OE1 . GLU A 1 229 ? 43.500  133.586 2.317   1.00 28.24 ? 229  GLU A OE1 1 
ATOM   1517 O  OE2 . GLU A 1 229 ? 45.470  133.107 1.485   1.00 29.40 ? 229  GLU A OE2 1 
ATOM   1518 N  N   . ASP A 1 230 ? 42.410  129.086 5.699   1.00 20.46 ? 230  ASP A N   1 
ATOM   1519 C  CA  . ASP A 1 230 ? 41.283  128.545 6.457   1.00 19.12 ? 230  ASP A CA  1 
ATOM   1520 C  C   . ASP A 1 230 ? 41.049  127.117 5.984   1.00 18.75 ? 230  ASP A C   1 
ATOM   1521 O  O   . ASP A 1 230 ? 40.392  126.888 4.967   1.00 18.06 ? 230  ASP A O   1 
ATOM   1522 C  CB  . ASP A 1 230 ? 40.020  129.382 6.235   1.00 18.30 ? 230  ASP A CB  1 
ATOM   1523 C  CG  . ASP A 1 230 ? 38.895  129.007 7.189   1.00 18.11 ? 230  ASP A CG  1 
ATOM   1524 O  OD1 . ASP A 1 230 ? 38.976  127.931 7.820   1.00 17.20 ? 230  ASP A OD1 1 
ATOM   1525 O  OD2 . ASP A 1 230 ? 37.923  129.786 7.300   1.00 17.90 ? 230  ASP A OD2 1 
ATOM   1526 N  N   . VAL A 1 231 ? 41.601  126.164 6.730   1.00 17.92 ? 231  VAL A N   1 
ATOM   1527 C  CA  . VAL A 1 231 ? 41.488  124.754 6.396   1.00 17.70 ? 231  VAL A CA  1 
ATOM   1528 C  C   . VAL A 1 231 ? 40.052  124.250 6.520   1.00 17.39 ? 231  VAL A C   1 
ATOM   1529 O  O   . VAL A 1 231 ? 39.743  123.137 6.099   1.00 17.66 ? 231  VAL A O   1 
ATOM   1530 C  CB  . VAL A 1 231 ? 42.433  123.900 7.291   1.00 18.10 ? 231  VAL A CB  1 
ATOM   1531 C  CG1 . VAL A 1 231 ? 41.916  123.864 8.721   1.00 17.28 ? 231  VAL A CG1 1 
ATOM   1532 C  CG2 . VAL A 1 231 ? 42.575  122.494 6.716   1.00 18.24 ? 231  VAL A CG2 1 
ATOM   1533 N  N   . ARG A 1 232 ? 39.175  125.079 7.082   1.00 16.56 ? 232  ARG A N   1 
ATOM   1534 C  CA  . ARG A 1 232 ? 37.771  124.713 7.245   1.00 16.17 ? 232  ARG A CA  1 
ATOM   1535 C  C   . ARG A 1 232 ? 36.905  125.227 6.094   1.00 16.31 ? 232  ARG A C   1 
ATOM   1536 O  O   . ARG A 1 232 ? 35.685  125.063 6.121   1.00 16.26 ? 232  ARG A O   1 
ATOM   1537 C  CB  . ARG A 1 232 ? 37.207  125.281 8.555   1.00 15.31 ? 232  ARG A CB  1 
ATOM   1538 C  CG  . ARG A 1 232 ? 37.850  124.759 9.837   1.00 15.71 ? 232  ARG A CG  1 
ATOM   1539 C  CD  . ARG A 1 232 ? 37.124  125.332 11.054  1.00 14.85 ? 232  ARG A CD  1 
ATOM   1540 N  NE  . ARG A 1 232 ? 37.628  124.810 12.322  1.00 14.17 ? 232  ARG A NE  1 
ATOM   1541 C  CZ  . ARG A 1 232 ? 38.678  125.302 12.976  1.00 15.81 ? 232  ARG A CZ  1 
ATOM   1542 N  NH1 . ARG A 1 232 ? 39.352  126.340 12.484  1.00 14.60 ? 232  ARG A NH1 1 
ATOM   1543 N  NH2 . ARG A 1 232 ? 39.042  124.766 14.134  1.00 14.70 ? 232  ARG A NH2 1 
ATOM   1544 N  N   . ASN A 1 233 ? 37.523  125.853 5.095   1.00 16.01 ? 233  ASN A N   1 
ATOM   1545 C  CA  . ASN A 1 233 ? 36.766  126.398 3.974   1.00 15.59 ? 233  ASN A CA  1 
ATOM   1546 C  C   . ASN A 1 233 ? 36.307  125.292 3.031   1.00 14.93 ? 233  ASN A C   1 
ATOM   1547 O  O   . ASN A 1 233 ? 37.052  124.864 2.144   1.00 14.37 ? 233  ASN A O   1 
ATOM   1548 C  CB  . ASN A 1 233 ? 37.604  127.418 3.200   1.00 15.25 ? 233  ASN A CB  1 
ATOM   1549 C  CG  . ASN A 1 233 ? 36.783  128.172 2.173   1.00 16.16 ? 233  ASN A CG  1 
ATOM   1550 O  OD1 . ASN A 1 233 ? 35.818  127.635 1.625   1.00 14.98 ? 233  ASN A OD1 1 
ATOM   1551 N  ND2 . ASN A 1 233 ? 37.164  129.418 1.897   1.00 15.75 ? 233  ASN A ND2 1 
ATOM   1552 N  N   . ASN A 1 234 ? 35.066  124.851 3.215   1.00 14.35 ? 234  ASN A N   1 
ATOM   1553 C  CA  . ASN A 1 234 ? 34.506  123.776 2.406   1.00 14.08 ? 234  ASN A CA  1 
ATOM   1554 C  C   . ASN A 1 234 ? 34.493  124.071 0.903   1.00 14.35 ? 234  ASN A C   1 
ATOM   1555 O  O   . ASN A 1 234 ? 34.574  123.152 0.086   1.00 13.64 ? 234  ASN A O   1 
ATOM   1556 C  CB  . ASN A 1 234 ? 33.089  123.452 2.879   1.00 13.22 ? 234  ASN A CB  1 
ATOM   1557 C  CG  . ASN A 1 234 ? 32.634  122.077 2.436   1.00 13.75 ? 234  ASN A CG  1 
ATOM   1558 O  OD1 . ASN A 1 234 ? 33.175  121.061 2.880   1.00 12.32 ? 234  ASN A OD1 1 
ATOM   1559 N  ND2 . ASN A 1 234 ? 31.642  122.035 1.550   1.00 11.83 ? 234  ASN A ND2 1 
ATOM   1560 N  N   . SER A 1 235 ? 34.385  125.344 0.536   1.00 14.02 ? 235  SER A N   1 
ATOM   1561 C  CA  . SER A 1 235 ? 34.375  125.708 -0.879  1.00 14.86 ? 235  SER A CA  1 
ATOM   1562 C  C   . SER A 1 235 ? 35.717  125.376 -1.530  1.00 14.74 ? 235  SER A C   1 
ATOM   1563 O  O   . SER A 1 235 ? 35.781  125.072 -2.722  1.00 14.57 ? 235  SER A O   1 
ATOM   1564 C  CB  . SER A 1 235 ? 34.089  127.205 -1.048  1.00 13.44 ? 235  SER A CB  1 
ATOM   1565 O  OG  . SER A 1 235 ? 32.802  127.536 -0.565  1.00 13.89 ? 235  SER A OG  1 
ATOM   1566 N  N   . VAL A 1 236 ? 36.785  125.448 -0.741  1.00 15.32 ? 236  VAL A N   1 
ATOM   1567 C  CA  . VAL A 1 236 ? 38.127  125.162 -1.237  1.00 16.02 ? 236  VAL A CA  1 
ATOM   1568 C  C   . VAL A 1 236 ? 38.360  123.660 -1.386  1.00 15.62 ? 236  VAL A C   1 
ATOM   1569 O  O   . VAL A 1 236 ? 39.020  123.223 -2.333  1.00 15.64 ? 236  VAL A O   1 
ATOM   1570 C  CB  . VAL A 1 236 ? 39.200  125.780 -0.311  1.00 16.14 ? 236  VAL A CB  1 
ATOM   1571 C  CG1 . VAL A 1 236 ? 40.602  125.454 -0.827  1.00 16.92 ? 236  VAL A CG1 1 
ATOM   1572 C  CG2 . VAL A 1 236 ? 39.009  127.290 -0.255  1.00 16.03 ? 236  VAL A CG2 1 
ATOM   1573 N  N   . TRP A 1 237 ? 37.828  122.868 -0.459  1.00 14.89 ? 237  TRP A N   1 
ATOM   1574 C  CA  . TRP A 1 237 ? 37.977  121.419 -0.566  1.00 15.10 ? 237  TRP A CA  1 
ATOM   1575 C  C   . TRP A 1 237 ? 37.206  120.956 -1.794  1.00 14.43 ? 237  TRP A C   1 
ATOM   1576 O  O   . TRP A 1 237 ? 37.604  120.013 -2.475  1.00 14.09 ? 237  TRP A O   1 
ATOM   1577 C  CB  . TRP A 1 237 ? 37.436  120.705 0.679   1.00 15.39 ? 237  TRP A CB  1 
ATOM   1578 C  CG  . TRP A 1 237 ? 38.328  120.820 1.879   1.00 15.87 ? 237  TRP A CG  1 
ATOM   1579 C  CD1 . TRP A 1 237 ? 38.237  121.734 2.888   1.00 15.87 ? 237  TRP A CD1 1 
ATOM   1580 C  CD2 . TRP A 1 237 ? 39.459  119.993 2.186   1.00 16.46 ? 237  TRP A CD2 1 
ATOM   1581 N  NE1 . TRP A 1 237 ? 39.238  121.525 3.808   1.00 16.70 ? 237  TRP A NE1 1 
ATOM   1582 C  CE2 . TRP A 1 237 ? 40.003  120.464 3.402   1.00 16.15 ? 237  TRP A CE2 1 
ATOM   1583 C  CE3 . TRP A 1 237 ? 40.065  118.898 1.551   1.00 16.31 ? 237  TRP A CE3 1 
ATOM   1584 C  CZ2 . TRP A 1 237 ? 41.127  119.877 3.999   1.00 17.15 ? 237  TRP A CZ2 1 
ATOM   1585 C  CZ3 . TRP A 1 237 ? 41.182  118.313 2.145   1.00 16.81 ? 237  TRP A CZ3 1 
ATOM   1586 C  CH2 . TRP A 1 237 ? 41.700  118.807 3.358   1.00 16.50 ? 237  TRP A CH2 1 
ATOM   1587 N  N   . ASN A 1 238 ? 36.090  121.618 -2.077  1.00 14.99 ? 238  ASN A N   1 
ATOM   1588 C  CA  . ASN A 1 238 ? 35.304  121.256 -3.249  1.00 15.28 ? 238  ASN A CA  1 
ATOM   1589 C  C   . ASN A 1 238 ? 36.115  121.570 -4.504  1.00 15.54 ? 238  ASN A C   1 
ATOM   1590 O  O   . ASN A 1 238 ? 36.098  120.812 -5.470  1.00 15.71 ? 238  ASN A O   1 
ATOM   1591 C  CB  . ASN A 1 238 ? 33.994  122.040 -3.302  1.00 15.69 ? 238  ASN A CB  1 
ATOM   1592 C  CG  . ASN A 1 238 ? 33.178  121.700 -4.530  1.00 15.73 ? 238  ASN A CG  1 
ATOM   1593 O  OD1 . ASN A 1 238 ? 32.637  120.599 -4.638  1.00 15.55 ? 238  ASN A OD1 1 
ATOM   1594 N  ND2 . ASN A 1 238 ? 33.103  122.636 -5.475  1.00 14.72 ? 238  ASN A ND2 1 
ATOM   1595 N  N   . GLN A 1 239 ? 36.815  122.700 -4.487  1.00 15.82 ? 239  GLN A N   1 
ATOM   1596 C  CA  . GLN A 1 239 ? 37.632  123.099 -5.628  1.00 16.00 ? 239  GLN A CA  1 
ATOM   1597 C  C   . GLN A 1 239 ? 38.779  122.107 -5.790  1.00 16.01 ? 239  GLN A C   1 
ATOM   1598 O  O   . GLN A 1 239 ? 39.186  121.799 -6.906  1.00 16.70 ? 239  GLN A O   1 
ATOM   1599 C  CB  . GLN A 1 239 ? 38.199  124.506 -5.418  1.00 16.40 ? 239  GLN A CB  1 
ATOM   1600 C  CG  . GLN A 1 239 ? 38.863  125.120 -6.657  1.00 16.59 ? 239  GLN A CG  1 
ATOM   1601 C  CD  . GLN A 1 239 ? 37.866  125.512 -7.741  1.00 17.85 ? 239  GLN A CD  1 
ATOM   1602 O  OE1 . GLN A 1 239 ? 38.224  126.169 -8.725  1.00 20.06 ? 239  GLN A OE1 1 
ATOM   1603 N  NE2 . GLN A 1 239 ? 36.613  125.111 -7.569  1.00 17.12 ? 239  GLN A NE2 1 
ATOM   1604 N  N   . ARG A 1 240 ? 39.297  121.604 -4.671  1.00 16.40 ? 240  ARG A N   1 
ATOM   1605 C  CA  . ARG A 1 240 ? 40.391  120.645 -4.728  1.00 16.62 ? 240  ARG A CA  1 
ATOM   1606 C  C   . ARG A 1 240 ? 39.949  119.416 -5.520  1.00 16.75 ? 240  ARG A C   1 
ATOM   1607 O  O   . ARG A 1 240 ? 40.652  118.965 -6.428  1.00 16.61 ? 240  ARG A O   1 
ATOM   1608 C  CB  . ARG A 1 240 ? 40.835  120.228 -3.321  1.00 17.03 ? 240  ARG A CB  1 
ATOM   1609 C  CG  . ARG A 1 240 ? 42.182  119.502 -3.315  1.00 17.41 ? 240  ARG A CG  1 
ATOM   1610 C  CD  . ARG A 1 240 ? 42.630  119.060 -1.928  1.00 18.31 ? 240  ARG A CD  1 
ATOM   1611 N  NE  . ARG A 1 240 ? 43.975  118.489 -1.993  1.00 19.64 ? 240  ARG A NE  1 
ATOM   1612 C  CZ  . ARG A 1 240 ? 45.093  119.209 -2.042  1.00 20.04 ? 240  ARG A CZ  1 
ATOM   1613 N  NH1 . ARG A 1 240 ? 45.038  120.535 -2.015  1.00 18.90 ? 240  ARG A NH1 1 
ATOM   1614 N  NH2 . ARG A 1 240 ? 46.266  118.603 -2.157  1.00 19.81 ? 240  ARG A NH2 1 
ATOM   1615 N  N   . TYR A 1 241 ? 38.777  118.881 -5.183  1.00 16.47 ? 241  TYR A N   1 
ATOM   1616 C  CA  . TYR A 1 241 ? 38.251  117.715 -5.881  1.00 16.05 ? 241  TYR A CA  1 
ATOM   1617 C  C   . TYR A 1 241 ? 38.023  118.067 -7.346  1.00 16.28 ? 241  TYR A C   1 
ATOM   1618 O  O   . TYR A 1 241 ? 38.316  117.276 -8.245  1.00 15.55 ? 241  TYR A O   1 
ATOM   1619 C  CB  . TYR A 1 241 ? 36.921  117.257 -5.273  1.00 16.76 ? 241  TYR A CB  1 
ATOM   1620 C  CG  . TYR A 1 241 ? 36.451  115.934 -5.838  1.00 16.60 ? 241  TYR A CG  1 
ATOM   1621 C  CD1 . TYR A 1 241 ? 36.788  114.732 -5.217  1.00 16.43 ? 241  TYR A CD1 1 
ATOM   1622 C  CD2 . TYR A 1 241 ? 35.751  115.880 -7.042  1.00 17.02 ? 241  TYR A CD2 1 
ATOM   1623 C  CE1 . TYR A 1 241 ? 36.446  113.505 -5.785  1.00 17.43 ? 241  TYR A CE1 1 
ATOM   1624 C  CE2 . TYR A 1 241 ? 35.407  114.658 -7.621  1.00 17.96 ? 241  TYR A CE2 1 
ATOM   1625 C  CZ  . TYR A 1 241 ? 35.763  113.477 -6.985  1.00 17.32 ? 241  TYR A CZ  1 
ATOM   1626 O  OH  . TYR A 1 241 ? 35.459  112.271 -7.567  1.00 19.25 ? 241  TYR A OH  1 
ATOM   1627 N  N   . PHE A 1 242 ? 37.484  119.258 -7.574  1.00 16.71 ? 242  PHE A N   1 
ATOM   1628 C  CA  . PHE A 1 242 ? 37.215  119.737 -8.923  1.00 17.79 ? 242  PHE A CA  1 
ATOM   1629 C  C   . PHE A 1 242 ? 38.485  119.704 -9.784  1.00 17.93 ? 242  PHE A C   1 
ATOM   1630 O  O   . PHE A 1 242 ? 38.483  119.181 -10.899 1.00 18.14 ? 242  PHE A O   1 
ATOM   1631 C  CB  . PHE A 1 242 ? 36.667  121.168 -8.858  1.00 18.44 ? 242  PHE A CB  1 
ATOM   1632 C  CG  . PHE A 1 242 ? 36.534  121.831 -10.200 1.00 19.51 ? 242  PHE A CG  1 
ATOM   1633 C  CD1 . PHE A 1 242 ? 35.541  121.437 -11.092 1.00 20.08 ? 242  PHE A CD1 1 
ATOM   1634 C  CD2 . PHE A 1 242 ? 37.410  122.847 -10.574 1.00 19.60 ? 242  PHE A CD2 1 
ATOM   1635 C  CE1 . PHE A 1 242 ? 35.420  122.048 -12.343 1.00 20.88 ? 242  PHE A CE1 1 
ATOM   1636 C  CE2 . PHE A 1 242 ? 37.299  123.465 -11.823 1.00 20.80 ? 242  PHE A CE2 1 
ATOM   1637 C  CZ  . PHE A 1 242 ? 36.303  123.064 -12.707 1.00 20.44 ? 242  PHE A CZ  1 
ATOM   1638 N  N   . VAL A 1 243 ? 39.570  120.256 -9.254  1.00 18.62 ? 243  VAL A N   1 
ATOM   1639 C  CA  . VAL A 1 243 ? 40.838  120.306 -9.980  1.00 19.48 ? 243  VAL A CA  1 
ATOM   1640 C  C   . VAL A 1 243 ? 41.455  118.933 -10.261 1.00 20.12 ? 243  VAL A C   1 
ATOM   1641 O  O   . VAL A 1 243 ? 41.787  118.615 -11.403 1.00 20.10 ? 243  VAL A O   1 
ATOM   1642 C  CB  . VAL A 1 243 ? 41.878  121.156 -9.214  1.00 19.65 ? 243  VAL A CB  1 
ATOM   1643 C  CG1 . VAL A 1 243 ? 43.217  121.138 -9.946  1.00 19.20 ? 243  VAL A CG1 1 
ATOM   1644 C  CG2 . VAL A 1 243 ? 41.371  122.582 -9.067  1.00 19.35 ? 243  VAL A CG2 1 
ATOM   1645 N  N   . ILE A 1 244 ? 41.613  118.124 -9.221  1.00 20.81 ? 244  ILE A N   1 
ATOM   1646 C  CA  . ILE A 1 244 ? 42.215  116.805 -9.380  1.00 21.01 ? 244  ILE A CA  1 
ATOM   1647 C  C   . ILE A 1 244 ? 41.399  115.873 -10.271 1.00 21.71 ? 244  ILE A C   1 
ATOM   1648 O  O   . ILE A 1 244 ? 41.953  115.222 -11.161 1.00 21.42 ? 244  ILE A O   1 
ATOM   1649 C  CB  . ILE A 1 244 ? 42.443  116.139 -8.007  1.00 21.42 ? 244  ILE A CB  1 
ATOM   1650 C  CG1 . ILE A 1 244 ? 43.404  117.000 -7.182  1.00 21.09 ? 244  ILE A CG1 1 
ATOM   1651 C  CG2 . ILE A 1 244 ? 42.996  114.721 -8.194  1.00 20.77 ? 244  ILE A CG2 1 
ATOM   1652 C  CD1 . ILE A 1 244 ? 43.563  116.550 -5.743  1.00 21.66 ? 244  ILE A CD1 1 
ATOM   1653 N  N   . SER A 1 245 ? 40.088  115.814 -10.051 1.00 21.90 ? 245  SER A N   1 
ATOM   1654 C  CA  . SER A 1 245 ? 39.239  114.942 -10.857 1.00 22.76 ? 245  SER A CA  1 
ATOM   1655 C  C   . SER A 1 245 ? 39.280  115.308 -12.338 1.00 23.17 ? 245  SER A C   1 
ATOM   1656 O  O   . SER A 1 245 ? 39.084  114.450 -13.200 1.00 22.71 ? 245  SER A O   1 
ATOM   1657 C  CB  . SER A 1 245 ? 37.785  114.990 -10.367 1.00 23.45 ? 245  SER A CB  1 
ATOM   1658 O  OG  . SER A 1 245 ? 37.175  116.235 -10.672 1.00 24.52 ? 245  SER A OG  1 
ATOM   1659 N  N   . ASN A 1 246 ? 39.534  116.580 -12.635 1.00 23.56 ? 246  ASN A N   1 
ATOM   1660 C  CA  . ASN A 1 246 ? 39.577  117.026 -14.024 1.00 23.98 ? 246  ASN A CA  1 
ATOM   1661 C  C   . ASN A 1 246 ? 40.961  117.078 -14.658 1.00 23.97 ? 246  ASN A C   1 
ATOM   1662 O  O   . ASN A 1 246 ? 41.080  117.309 -15.860 1.00 23.93 ? 246  ASN A O   1 
ATOM   1663 C  CB  . ASN A 1 246 ? 38.909  118.392 -14.167 1.00 24.39 ? 246  ASN A CB  1 
ATOM   1664 C  CG  . ASN A 1 246 ? 37.402  118.310 -14.067 1.00 25.14 ? 246  ASN A CG  1 
ATOM   1665 O  OD1 . ASN A 1 246 ? 36.812  118.639 -13.035 1.00 24.76 ? 246  ASN A OD1 1 
ATOM   1666 N  ND2 . ASN A 1 246 ? 36.767  117.858 -15.141 1.00 25.38 ? 246  ASN A ND2 1 
ATOM   1667 N  N   . THR A 1 247 ? 42.002  116.871 -13.859 1.00 23.88 ? 247  THR A N   1 
ATOM   1668 C  CA  . THR A 1 247 ? 43.361  116.886 -14.381 1.00 24.33 ? 247  THR A CA  1 
ATOM   1669 C  C   . THR A 1 247 ? 43.954  115.475 -14.382 1.00 24.41 ? 247  THR A C   1 
ATOM   1670 O  O   . THR A 1 247 ? 43.875  114.771 -15.388 1.00 24.43 ? 247  THR A O   1 
ATOM   1671 C  CB  . THR A 1 247 ? 44.266  117.840 -13.570 1.00 24.22 ? 247  THR A CB  1 
ATOM   1672 O  OG1 . THR A 1 247 ? 44.166  117.535 -12.175 1.00 24.91 ? 247  THR A OG1 1 
ATOM   1673 C  CG2 . THR A 1 247 ? 43.852  119.288 -13.801 1.00 24.80 ? 247  THR A CG2 1 
ATOM   1674 N  N   . THR A 1 248 ? 44.529  115.059 -13.258 1.00 24.56 ? 248  THR A N   1 
ATOM   1675 C  CA  . THR A 1 248 ? 45.127  113.730 -13.150 1.00 24.63 ? 248  THR A CA  1 
ATOM   1676 C  C   . THR A 1 248 ? 44.088  112.649 -12.878 1.00 24.96 ? 248  THR A C   1 
ATOM   1677 O  O   . THR A 1 248 ? 44.239  111.505 -13.310 1.00 24.63 ? 248  THR A O   1 
ATOM   1678 C  CB  . THR A 1 248 ? 46.159  113.663 -12.001 1.00 25.16 ? 248  THR A CB  1 
ATOM   1679 O  OG1 . THR A 1 248 ? 45.515  113.993 -10.763 1.00 24.92 ? 248  THR A OG1 1 
ATOM   1680 C  CG2 . THR A 1 248 ? 47.310  114.626 -12.247 1.00 24.36 ? 248  THR A CG2 1 
ATOM   1681 N  N   . GLY A 1 249 ? 43.032  113.018 -12.161 1.00 24.55 ? 249  GLY A N   1 
ATOM   1682 C  CA  . GLY A 1 249 ? 42.010  112.052 -11.807 1.00 23.72 ? 249  GLY A CA  1 
ATOM   1683 C  C   . GLY A 1 249 ? 42.487  111.376 -10.534 1.00 23.83 ? 249  GLY A C   1 
ATOM   1684 O  O   . GLY A 1 249 ? 43.623  111.603 -10.111 1.00 23.64 ? 249  GLY A O   1 
ATOM   1685 N  N   . TYR A 1 250 ? 41.643  110.554 -9.920  1.00 23.56 ? 250  TYR A N   1 
ATOM   1686 C  CA  . TYR A 1 250 ? 42.024  109.865 -8.691  1.00 24.32 ? 250  TYR A CA  1 
ATOM   1687 C  C   . TYR A 1 250 ? 42.400  108.402 -8.903  1.00 25.16 ? 250  TYR A C   1 
ATOM   1688 O  O   . TYR A 1 250 ? 42.660  107.684 -7.940  1.00 24.10 ? 250  TYR A O   1 
ATOM   1689 C  CB  . TYR A 1 250 ? 40.897  109.939 -7.656  1.00 22.36 ? 250  TYR A CB  1 
ATOM   1690 C  CG  . TYR A 1 250 ? 40.698  111.309 -7.051  1.00 21.65 ? 250  TYR A CG  1 
ATOM   1691 C  CD1 . TYR A 1 250 ? 39.816  112.226 -7.620  1.00 20.91 ? 250  TYR A CD1 1 
ATOM   1692 C  CD2 . TYR A 1 250 ? 41.401  111.690 -5.909  1.00 20.98 ? 250  TYR A CD2 1 
ATOM   1693 C  CE1 . TYR A 1 250 ? 39.636  113.493 -7.061  1.00 21.01 ? 250  TYR A CE1 1 
ATOM   1694 C  CE2 . TYR A 1 250 ? 41.231  112.952 -5.345  1.00 21.37 ? 250  TYR A CE2 1 
ATOM   1695 C  CZ  . TYR A 1 250 ? 40.346  113.847 -5.925  1.00 20.69 ? 250  TYR A CZ  1 
ATOM   1696 O  OH  . TYR A 1 250 ? 40.176  115.090 -5.365  1.00 20.40 ? 250  TYR A OH  1 
ATOM   1697 N  N   . ASN A 1 251 ? 42.424  107.956 -10.156 1.00 26.63 ? 251  ASN A N   1 
ATOM   1698 C  CA  . ASN A 1 251 ? 42.775  106.569 -10.444 1.00 28.35 ? 251  ASN A CA  1 
ATOM   1699 C  C   . ASN A 1 251 ? 44.268  106.323 -10.304 1.00 28.42 ? 251  ASN A C   1 
ATOM   1700 O  O   . ASN A 1 251 ? 44.694  105.205 -10.023 1.00 28.93 ? 251  ASN A O   1 
ATOM   1701 C  CB  . ASN A 1 251 ? 42.300  106.172 -11.841 1.00 30.57 ? 251  ASN A CB  1 
ATOM   1702 C  CG  . ASN A 1 251 ? 40.796  106.021 -11.914 1.00 32.55 ? 251  ASN A CG  1 
ATOM   1703 O  OD1 . ASN A 1 251 ? 40.193  105.303 -11.113 1.00 33.71 ? 251  ASN A OD1 1 
ATOM   1704 N  ND2 . ASN A 1 251 ? 40.178  106.696 -12.877 1.00 34.34 ? 251  ASN A ND2 1 
ATOM   1705 N  N   . ASP A 1 252 ? 45.062  107.367 -10.506 1.00 28.54 ? 252  ASP A N   1 
ATOM   1706 C  CA  . ASP A 1 252 ? 46.504  107.256 -10.351 1.00 28.37 ? 252  ASP A CA  1 
ATOM   1707 C  C   . ASP A 1 252 ? 46.703  107.015 -8.857  1.00 27.50 ? 252  ASP A C   1 
ATOM   1708 O  O   . ASP A 1 252 ? 46.450  107.902 -8.039  1.00 26.74 ? 252  ASP A O   1 
ATOM   1709 C  CB  . ASP A 1 252 ? 47.175  108.562 -10.792 1.00 30.61 ? 252  ASP A CB  1 
ATOM   1710 C  CG  . ASP A 1 252 ? 48.677  108.564 -10.562 1.00 32.31 ? 252  ASP A CG  1 
ATOM   1711 O  OD1 . ASP A 1 252 ? 49.359  109.425 -11.157 1.00 34.19 ? 252  ASP A OD1 1 
ATOM   1712 O  OD2 . ASP A 1 252 ? 49.179  107.723 -9.787  1.00 33.89 ? 252  ASP A OD2 1 
ATOM   1713 N  N   . ARG A 1 253 ? 47.138  105.810 -8.501  1.00 26.52 ? 253  ARG A N   1 
ATOM   1714 C  CA  . ARG A 1 253 ? 47.326  105.468 -7.096  1.00 25.24 ? 253  ARG A CA  1 
ATOM   1715 C  C   . ARG A 1 253 ? 48.314  106.366 -6.365  1.00 24.18 ? 253  ARG A C   1 
ATOM   1716 O  O   . ARG A 1 253 ? 48.191  106.569 -5.157  1.00 23.87 ? 253  ARG A O   1 
ATOM   1717 C  CB  . ARG A 1 253 ? 47.713  103.990 -6.962  1.00 25.08 ? 253  ARG A CB  1 
ATOM   1718 C  CG  . ARG A 1 253 ? 46.594  103.070 -7.433  1.00 25.28 ? 253  ARG A CG  1 
ATOM   1719 C  CD  . ARG A 1 253 ? 46.876  101.587 -7.217  1.00 25.06 ? 253  ARG A CD  1 
ATOM   1720 N  NE  . ARG A 1 253 ? 45.847  100.767 -7.859  1.00 25.10 ? 253  ARG A NE  1 
ATOM   1721 C  CZ  . ARG A 1 253 ? 44.591  100.649 -7.428  1.00 25.53 ? 253  ARG A CZ  1 
ATOM   1722 N  NH1 . ARG A 1 253 ? 44.191  101.289 -6.338  1.00 25.15 ? 253  ARG A NH1 1 
ATOM   1723 N  NH2 . ARG A 1 253 ? 43.721  99.915  -8.107  1.00 25.92 ? 253  ARG A NH2 1 
ATOM   1724 N  N   . ALA A 1 254 ? 49.283  106.918 -7.087  1.00 23.24 ? 254  ALA A N   1 
ATOM   1725 C  CA  . ALA A 1 254 ? 50.251  107.815 -6.459  1.00 22.71 ? 254  ALA A CA  1 
ATOM   1726 C  C   . ALA A 1 254 ? 49.534  109.111 -6.070  1.00 21.72 ? 254  ALA A C   1 
ATOM   1727 O  O   . ALA A 1 254 ? 49.798  109.692 -5.018  1.00 21.81 ? 254  ALA A O   1 
ATOM   1728 C  CB  . ALA A 1 254 ? 51.394  108.114 -7.421  1.00 22.69 ? 254  ALA A CB  1 
ATOM   1729 N  N   . VAL A 1 255 ? 48.629  109.561 -6.932  1.00 21.11 ? 255  VAL A N   1 
ATOM   1730 C  CA  . VAL A 1 255 ? 47.868  110.775 -6.669  1.00 20.76 ? 255  VAL A CA  1 
ATOM   1731 C  C   . VAL A 1 255 ? 46.915  110.541 -5.502  1.00 19.84 ? 255  VAL A C   1 
ATOM   1732 O  O   . VAL A 1 255 ? 46.778  111.391 -4.626  1.00 19.46 ? 255  VAL A O   1 
ATOM   1733 C  CB  . VAL A 1 255 ? 47.056  111.211 -7.914  1.00 21.26 ? 255  VAL A CB  1 
ATOM   1734 C  CG1 . VAL A 1 255 ? 46.099  112.345 -7.553  1.00 20.99 ? 255  VAL A CG1 1 
ATOM   1735 C  CG2 . VAL A 1 255 ? 48.004  111.664 -9.015  1.00 21.97 ? 255  VAL A CG2 1 
ATOM   1736 N  N   . LEU A 1 256 ? 46.263  109.383 -5.486  1.00 19.46 ? 256  LEU A N   1 
ATOM   1737 C  CA  . LEU A 1 256 ? 45.330  109.069 -4.409  1.00 19.37 ? 256  LEU A CA  1 
ATOM   1738 C  C   . LEU A 1 256 ? 46.058  109.020 -3.068  1.00 19.13 ? 256  LEU A C   1 
ATOM   1739 O  O   . LEU A 1 256 ? 45.591  109.584 -2.076  1.00 18.53 ? 256  LEU A O   1 
ATOM   1740 C  CB  . LEU A 1 256 ? 44.635  107.730 -4.681  1.00 19.15 ? 256  LEU A CB  1 
ATOM   1741 C  CG  . LEU A 1 256 ? 43.538  107.327 -3.690  1.00 19.20 ? 256  LEU A CG  1 
ATOM   1742 C  CD1 . LEU A 1 256 ? 42.404  108.351 -3.730  1.00 18.82 ? 256  LEU A CD1 1 
ATOM   1743 C  CD2 . LEU A 1 256 ? 43.019  105.944 -4.039  1.00 17.73 ? 256  LEU A CD2 1 
ATOM   1744 N  N   . GLU A 1 257 ? 47.208  108.349 -3.041  1.00 19.99 ? 257  GLU A N   1 
ATOM   1745 C  CA  . GLU A 1 257 ? 48.001  108.239 -1.821  1.00 19.93 ? 257  GLU A CA  1 
ATOM   1746 C  C   . GLU A 1 257 ? 48.390  109.633 -1.333  1.00 19.69 ? 257  GLU A C   1 
ATOM   1747 O  O   . GLU A 1 257 ? 48.312  109.928 -0.139  1.00 18.71 ? 257  GLU A O   1 
ATOM   1748 C  CB  . GLU A 1 257 ? 49.254  107.393 -2.086  1.00 21.31 ? 257  GLU A CB  1 
ATOM   1749 C  CG  . GLU A 1 257 ? 50.215  107.265 -0.913  1.00 23.01 ? 257  GLU A CG  1 
ATOM   1750 C  CD  . GLU A 1 257 ? 49.553  106.767 0.361   1.00 25.20 ? 257  GLU A CD  1 
ATOM   1751 O  OE1 . GLU A 1 257 ? 48.526  106.057 0.280   1.00 26.17 ? 257  GLU A OE1 1 
ATOM   1752 O  OE2 . GLU A 1 257 ? 50.071  107.074 1.455   1.00 26.28 ? 257  GLU A OE2 1 
ATOM   1753 N  N   . ARG A 1 258 ? 48.805  110.490 -2.262  1.00 19.65 ? 258  ARG A N   1 
ATOM   1754 C  CA  . ARG A 1 258 ? 49.184  111.855 -1.917  1.00 20.14 ? 258  ARG A CA  1 
ATOM   1755 C  C   . ARG A 1 258 ? 47.998  112.569 -1.265  1.00 19.75 ? 258  ARG A C   1 
ATOM   1756 O  O   . ARG A 1 258 ? 48.150  113.266 -0.261  1.00 19.87 ? 258  ARG A O   1 
ATOM   1757 C  CB  . ARG A 1 258 ? 49.594  112.628 -3.172  1.00 21.03 ? 258  ARG A CB  1 
ATOM   1758 C  CG  . ARG A 1 258 ? 50.022  114.070 -2.905  1.00 22.30 ? 258  ARG A CG  1 
ATOM   1759 C  CD  . ARG A 1 258 ? 49.999  114.892 -4.188  1.00 24.52 ? 258  ARG A CD  1 
ATOM   1760 N  NE  . ARG A 1 258 ? 48.632  115.188 -4.619  1.00 25.32 ? 258  ARG A NE  1 
ATOM   1761 C  CZ  . ARG A 1 258 ? 48.301  115.545 -5.857  1.00 26.81 ? 258  ARG A CZ  1 
ATOM   1762 N  NH1 . ARG A 1 258 ? 49.237  115.644 -6.792  1.00 27.02 ? 258  ARG A NH1 1 
ATOM   1763 N  NH2 . ARG A 1 258 ? 47.038  115.808 -6.163  1.00 26.93 ? 258  ARG A NH2 1 
ATOM   1764 N  N   . GLU A 1 259 ? 46.818  112.392 -1.847  1.00 18.95 ? 259  GLU A N   1 
ATOM   1765 C  CA  . GLU A 1 259 ? 45.619  113.037 -1.327  1.00 18.97 ? 259  GLU A CA  1 
ATOM   1766 C  C   . GLU A 1 259 ? 45.184  112.484 0.023   1.00 18.70 ? 259  GLU A C   1 
ATOM   1767 O  O   . GLU A 1 259 ? 44.805  113.246 0.913   1.00 18.71 ? 259  GLU A O   1 
ATOM   1768 C  CB  . GLU A 1 259 ? 44.483  112.936 -2.348  1.00 18.55 ? 259  GLU A CB  1 
ATOM   1769 C  CG  . GLU A 1 259 ? 44.681  113.863 -3.537  1.00 18.84 ? 259  GLU A CG  1 
ATOM   1770 C  CD  . GLU A 1 259 ? 44.886  115.305 -3.103  1.00 19.68 ? 259  GLU A CD  1 
ATOM   1771 O  OE1 . GLU A 1 259 ? 43.962  115.879 -2.480  1.00 19.37 ? 259  GLU A OE1 1 
ATOM   1772 O  OE2 . GLU A 1 259 ? 45.973  115.863 -3.376  1.00 18.92 ? 259  GLU A OE2 1 
ATOM   1773 N  N   . VAL A 1 260 ? 45.239  111.167 0.186   1.00 18.85 ? 260  VAL A N   1 
ATOM   1774 C  CA  . VAL A 1 260 ? 44.858  110.565 1.461   1.00 18.51 ? 260  VAL A CA  1 
ATOM   1775 C  C   . VAL A 1 260 ? 45.831  111.016 2.557   1.00 19.41 ? 260  VAL A C   1 
ATOM   1776 O  O   . VAL A 1 260 ? 45.418  111.317 3.676   1.00 19.68 ? 260  VAL A O   1 
ATOM   1777 C  CB  . VAL A 1 260 ? 44.836  109.016 1.364   1.00 17.93 ? 260  VAL A CB  1 
ATOM   1778 C  CG1 . VAL A 1 260 ? 44.686  108.396 2.755   1.00 17.05 ? 260  VAL A CG1 1 
ATOM   1779 C  CG2 . VAL A 1 260 ? 43.678  108.578 0.483   1.00 17.49 ? 260  VAL A CG2 1 
ATOM   1780 N  N   . GLN A 1 261 ? 47.120  111.080 2.230   1.00 19.83 ? 261  GLN A N   1 
ATOM   1781 C  CA  . GLN A 1 261 ? 48.132  111.518 3.196   1.00 21.02 ? 261  GLN A CA  1 
ATOM   1782 C  C   . GLN A 1 261 ? 47.892  112.972 3.583   1.00 20.61 ? 261  GLN A C   1 
ATOM   1783 O  O   . GLN A 1 261 ? 47.912  113.330 4.759   1.00 20.99 ? 261  GLN A O   1 
ATOM   1784 C  CB  . GLN A 1 261 ? 49.541  111.402 2.604   1.00 22.62 ? 261  GLN A CB  1 
ATOM   1785 C  CG  . GLN A 1 261 ? 50.170  110.022 2.666   1.00 25.03 ? 261  GLN A CG  1 
ATOM   1786 C  CD  . GLN A 1 261 ? 50.394  109.547 4.089   1.00 27.20 ? 261  GLN A CD  1 
ATOM   1787 O  OE1 . GLN A 1 261 ? 50.705  110.340 4.976   1.00 28.70 ? 261  GLN A OE1 1 
ATOM   1788 N  NE2 . GLN A 1 261 ? 50.252  108.246 4.311   1.00 28.32 ? 261  GLN A NE2 1 
ATOM   1789 N  N   . TYR A 1 262 ? 47.689  113.809 2.573   1.00 20.37 ? 262  TYR A N   1 
ATOM   1790 C  CA  . TYR A 1 262 ? 47.443  115.229 2.780   1.00 20.53 ? 262  TYR A CA  1 
ATOM   1791 C  C   . TYR A 1 262 ? 46.254  115.431 3.715   1.00 19.86 ? 262  TYR A C   1 
ATOM   1792 O  O   . TYR A 1 262 ? 46.332  116.173 4.693   1.00 19.13 ? 262  TYR A O   1 
ATOM   1793 C  CB  . TYR A 1 262 ? 47.152  115.901 1.438   1.00 21.47 ? 262  TYR A CB  1 
ATOM   1794 C  CG  . TYR A 1 262 ? 46.788  117.363 1.543   1.00 23.13 ? 262  TYR A CG  1 
ATOM   1795 C  CD1 . TYR A 1 262 ? 47.776  118.345 1.576   1.00 24.66 ? 262  TYR A CD1 1 
ATOM   1796 C  CD2 . TYR A 1 262 ? 45.454  117.765 1.619   1.00 23.02 ? 262  TYR A CD2 1 
ATOM   1797 C  CE1 . TYR A 1 262 ? 47.448  119.694 1.678   1.00 26.00 ? 262  TYR A CE1 1 
ATOM   1798 C  CE2 . TYR A 1 262 ? 45.113  119.112 1.724   1.00 24.62 ? 262  TYR A CE2 1 
ATOM   1799 C  CZ  . TYR A 1 262 ? 46.115  120.070 1.751   1.00 25.97 ? 262  TYR A CZ  1 
ATOM   1800 O  OH  . TYR A 1 262 ? 45.795  121.406 1.835   1.00 27.68 ? 262  TYR A OH  1 
ATOM   1801 N  N   . THR A 1 263 ? 45.152  114.759 3.404   1.00 19.47 ? 263  THR A N   1 
ATOM   1802 C  CA  . THR A 1 263 ? 43.932  114.871 4.195   1.00 19.25 ? 263  THR A CA  1 
ATOM   1803 C  C   . THR A 1 263 ? 44.102  114.374 5.630   1.00 19.61 ? 263  THR A C   1 
ATOM   1804 O  O   . THR A 1 263 ? 43.628  115.012 6.568   1.00 20.00 ? 263  THR A O   1 
ATOM   1805 C  CB  . THR A 1 263 ? 42.784  114.115 3.504   1.00 18.41 ? 263  THR A CB  1 
ATOM   1806 O  OG1 . THR A 1 263 ? 42.660  114.600 2.163   1.00 17.30 ? 263  THR A OG1 1 
ATOM   1807 C  CG2 . THR A 1 263 ? 41.458  114.332 4.239   1.00 17.52 ? 263  THR A CG2 1 
ATOM   1808 N  N   . LEU A 1 264 ? 44.778  113.242 5.806   1.00 19.88 ? 264  LEU A N   1 
ATOM   1809 C  CA  . LEU A 1 264 ? 44.997  112.709 7.146   1.00 20.57 ? 264  LEU A CA  1 
ATOM   1810 C  C   . LEU A 1 264 ? 45.817  113.681 7.987   1.00 21.11 ? 264  LEU A C   1 
ATOM   1811 O  O   . LEU A 1 264 ? 45.579  113.829 9.184   1.00 21.11 ? 264  LEU A O   1 
ATOM   1812 C  CB  . LEU A 1 264 ? 45.704  111.351 7.080   1.00 20.07 ? 264  LEU A CB  1 
ATOM   1813 C  CG  . LEU A 1 264 ? 44.833  110.170 6.641   1.00 20.75 ? 264  LEU A CG  1 
ATOM   1814 C  CD1 . LEU A 1 264 ? 45.699  108.933 6.452   1.00 20.04 ? 264  LEU A CD1 1 
ATOM   1815 C  CD2 . LEU A 1 264 ? 43.745  109.913 7.686   1.00 20.34 ? 264  LEU A CD2 1 
ATOM   1816 N  N   . GLU A 1 265 ? 46.783  114.348 7.363   1.00 22.12 ? 265  GLU A N   1 
ATOM   1817 C  CA  . GLU A 1 265 ? 47.597  115.310 8.092   1.00 23.31 ? 265  GLU A CA  1 
ATOM   1818 C  C   . GLU A 1 265 ? 46.729  116.486 8.531   1.00 22.82 ? 265  GLU A C   1 
ATOM   1819 O  O   . GLU A 1 265 ? 46.876  116.995 9.644   1.00 22.13 ? 265  GLU A O   1 
ATOM   1820 C  CB  . GLU A 1 265 ? 48.751  115.817 7.222   1.00 25.63 ? 265  GLU A CB  1 
ATOM   1821 C  CG  . GLU A 1 265 ? 49.492  117.023 7.809   1.00 29.87 ? 265  GLU A CG  1 
ATOM   1822 C  CD  . GLU A 1 265 ? 50.113  116.751 9.181   1.00 33.20 ? 265  GLU A CD  1 
ATOM   1823 O  OE1 . GLU A 1 265 ? 49.371  116.442 10.143  1.00 34.21 ? 265  GLU A OE1 1 
ATOM   1824 O  OE2 . GLU A 1 265 ? 51.354  116.857 9.298   1.00 35.85 ? 265  GLU A OE2 1 
ATOM   1825 N  N   . MET A 1 266 ? 45.824  116.922 7.658   1.00 22.17 ? 266  MET A N   1 
ATOM   1826 C  CA  . MET A 1 266 ? 44.951  118.035 8.007   1.00 21.86 ? 266  MET A CA  1 
ATOM   1827 C  C   . MET A 1 266 ? 44.041  117.627 9.158   1.00 21.28 ? 266  MET A C   1 
ATOM   1828 O  O   . MET A 1 266 ? 43.748  118.428 10.041  1.00 20.82 ? 266  MET A O   1 
ATOM   1829 C  CB  . MET A 1 266 ? 44.122  118.477 6.796   1.00 21.89 ? 266  MET A CB  1 
ATOM   1830 C  CG  . MET A 1 266 ? 44.950  119.099 5.671   1.00 22.76 ? 266  MET A CG  1 
ATOM   1831 S  SD  . MET A 1 266 ? 45.902  120.553 6.202   1.00 23.82 ? 266  MET A SD  1 
ATOM   1832 C  CE  . MET A 1 266 ? 47.415  119.789 6.833   1.00 25.87 ? 266  MET A CE  1 
ATOM   1833 N  N   . ILE A 1 267 ? 43.611  116.370 9.153   1.00 21.24 ? 267  ILE A N   1 
ATOM   1834 C  CA  . ILE A 1 267 ? 42.742  115.857 10.206  1.00 21.72 ? 267  ILE A CA  1 
ATOM   1835 C  C   . ILE A 1 267 ? 43.467  115.814 11.554  1.00 22.83 ? 267  ILE A C   1 
ATOM   1836 O  O   . ILE A 1 267 ? 42.880  116.120 12.593  1.00 22.13 ? 267  ILE A O   1 
ATOM   1837 C  CB  . ILE A 1 267 ? 42.222  114.446 9.849   1.00 21.17 ? 267  ILE A CB  1 
ATOM   1838 C  CG1 . ILE A 1 267 ? 41.207  114.553 8.702   1.00 21.15 ? 267  ILE A CG1 1 
ATOM   1839 C  CG2 . ILE A 1 267 ? 41.609  113.778 11.081  1.00 21.34 ? 267  ILE A CG2 1 
ATOM   1840 C  CD1 . ILE A 1 267 ? 40.696  113.220 8.183   1.00 19.31 ? 267  ILE A CD1 1 
ATOM   1841 N  N   . LYS A 1 268 ? 44.741  115.437 11.539  1.00 23.62 ? 268  LYS A N   1 
ATOM   1842 C  CA  . LYS A 1 268 ? 45.508  115.379 12.777  1.00 24.91 ? 268  LYS A CA  1 
ATOM   1843 C  C   . LYS A 1 268 ? 45.706  116.786 13.321  1.00 24.23 ? 268  LYS A C   1 
ATOM   1844 O  O   . LYS A 1 268 ? 45.742  116.990 14.531  1.00 24.38 ? 268  LYS A O   1 
ATOM   1845 C  CB  . LYS A 1 268 ? 46.870  114.721 12.538  1.00 27.01 ? 268  LYS A CB  1 
ATOM   1846 C  CG  . LYS A 1 268 ? 46.792  113.264 12.109  1.00 29.57 ? 268  LYS A CG  1 
ATOM   1847 C  CD  . LYS A 1 268 ? 48.184  112.688 11.886  1.00 31.56 ? 268  LYS A CD  1 
ATOM   1848 C  CE  . LYS A 1 268 ? 48.119  111.292 11.298  1.00 33.00 ? 268  LYS A CE  1 
ATOM   1849 N  NZ  . LYS A 1 268 ? 49.486  110.749 11.046  1.00 34.59 ? 268  LYS A NZ  1 
ATOM   1850 N  N   . LEU A 1 269 ? 45.832  117.751 12.416  1.00 23.84 ? 269  LEU A N   1 
ATOM   1851 C  CA  . LEU A 1 269 ? 46.013  119.152 12.788  1.00 23.80 ? 269  LEU A CA  1 
ATOM   1852 C  C   . LEU A 1 269 ? 44.733  119.749 13.374  1.00 23.38 ? 269  LEU A C   1 
ATOM   1853 O  O   . LEU A 1 269 ? 44.776  120.455 14.382  1.00 22.97 ? 269  LEU A O   1 
ATOM   1854 C  CB  . LEU A 1 269 ? 46.430  119.967 11.560  1.00 24.40 ? 269  LEU A CB  1 
ATOM   1855 C  CG  . LEU A 1 269 ? 47.883  120.430 11.417  1.00 25.91 ? 269  LEU A CG  1 
ATOM   1856 C  CD1 . LEU A 1 269 ? 48.851  119.320 11.782  1.00 26.02 ? 269  LEU A CD1 1 
ATOM   1857 C  CD2 . LEU A 1 269 ? 48.105  120.899 9.986   1.00 25.59 ? 269  LEU A CD2 1 
ATOM   1858 N  N   . VAL A 1 270 ? 43.600  119.472 12.730  1.00 22.38 ? 270  VAL A N   1 
ATOM   1859 C  CA  . VAL A 1 270 ? 42.301  119.982 13.175  1.00 21.48 ? 270  VAL A CA  1 
ATOM   1860 C  C   . VAL A 1 270 ? 41.287  118.830 13.152  1.00 21.48 ? 270  VAL A C   1 
ATOM   1861 O  O   . VAL A 1 270 ? 40.460  118.731 12.245  1.00 21.48 ? 270  VAL A O   1 
ATOM   1862 C  CB  . VAL A 1 270 ? 41.811  121.118 12.247  1.00 21.26 ? 270  VAL A CB  1 
ATOM   1863 C  CG1 . VAL A 1 270 ? 40.566  121.771 12.824  1.00 21.09 ? 270  VAL A CG1 1 
ATOM   1864 C  CG2 . VAL A 1 270 ? 42.912  122.150 12.061  1.00 21.19 ? 270  VAL A CG2 1 
ATOM   1865 N  N   . PRO A 1 271 ? 41.344  117.949 14.166  1.00 20.92 ? 271  PRO A N   1 
ATOM   1866 C  CA  . PRO A 1 271 ? 40.487  116.770 14.346  1.00 20.32 ? 271  PRO A CA  1 
ATOM   1867 C  C   . PRO A 1 271 ? 38.981  116.977 14.185  1.00 19.66 ? 271  PRO A C   1 
ATOM   1868 O  O   . PRO A 1 271 ? 38.276  116.073 13.727  1.00 19.06 ? 271  PRO A O   1 
ATOM   1869 C  CB  . PRO A 1 271 ? 40.844  116.296 15.756  1.00 20.78 ? 271  PRO A CB  1 
ATOM   1870 C  CG  . PRO A 1 271 ? 42.260  116.711 15.898  1.00 21.17 ? 271  PRO A CG  1 
ATOM   1871 C  CD  . PRO A 1 271 ? 42.259  118.097 15.311  1.00 21.05 ? 271  PRO A CD  1 
ATOM   1872 N  N   . HIS A 1 272 ? 38.483  118.149 14.564  1.00 18.87 ? 272  HIS A N   1 
ATOM   1873 C  CA  . HIS A 1 272 ? 37.052  118.401 14.463  1.00 18.68 ? 272  HIS A CA  1 
ATOM   1874 C  C   . HIS A 1 272 ? 36.598  119.195 13.243  1.00 18.64 ? 272  HIS A C   1 
ATOM   1875 O  O   . HIS A 1 272 ? 35.475  119.704 13.216  1.00 18.25 ? 272  HIS A O   1 
ATOM   1876 C  CB  . HIS A 1 272 ? 36.541  119.057 15.753  1.00 18.32 ? 272  HIS A CB  1 
ATOM   1877 C  CG  . HIS A 1 272 ? 36.670  118.178 16.960  1.00 18.69 ? 272  HIS A CG  1 
ATOM   1878 N  ND1 . HIS A 1 272 ? 37.848  118.049 17.665  1.00 18.09 ? 272  HIS A ND1 1 
ATOM   1879 C  CD2 . HIS A 1 272 ? 35.787  117.334 17.547  1.00 18.62 ? 272  HIS A CD2 1 
ATOM   1880 C  CE1 . HIS A 1 272 ? 37.686  117.164 18.633  1.00 18.22 ? 272  HIS A CE1 1 
ATOM   1881 N  NE2 . HIS A 1 272 ? 36.445  116.714 18.583  1.00 18.82 ? 272  HIS A NE2 1 
ATOM   1882 N  N   . ASN A 1 273 ? 37.463  119.304 12.236  1.00 18.02 ? 273  ASN A N   1 
ATOM   1883 C  CA  . ASN A 1 273 ? 37.101  120.004 11.009  1.00 17.66 ? 273  ASN A CA  1 
ATOM   1884 C  C   . ASN A 1 273 ? 36.416  118.982 10.109  1.00 17.21 ? 273  ASN A C   1 
ATOM   1885 O  O   . ASN A 1 273 ? 37.060  118.076 9.583   1.00 16.94 ? 273  ASN A O   1 
ATOM   1886 C  CB  . ASN A 1 273 ? 38.343  120.577 10.315  1.00 18.06 ? 273  ASN A CB  1 
ATOM   1887 C  CG  . ASN A 1 273 ? 38.044  121.088 8.915   1.00 17.84 ? 273  ASN A CG  1 
ATOM   1888 O  OD1 . ASN A 1 273 ? 36.945  121.576 8.639   1.00 16.89 ? 273  ASN A OD1 1 
ATOM   1889 N  ND2 . ASN A 1 273 ? 39.028  120.991 8.026   1.00 17.37 ? 273  ASN A ND2 1 
ATOM   1890 N  N   . GLU A 1 274 ? 35.105  119.125 9.941   1.00 17.24 ? 274  GLU A N   1 
ATOM   1891 C  CA  . GLU A 1 274 ? 34.334  118.185 9.131   1.00 17.51 ? 274  GLU A CA  1 
ATOM   1892 C  C   . GLU A 1 274 ? 34.693  118.122 7.649   1.00 16.41 ? 274  GLU A C   1 
ATOM   1893 O  O   . GLU A 1 274 ? 34.598  117.057 7.043   1.00 16.19 ? 274  GLU A O   1 
ATOM   1894 C  CB  . GLU A 1 274 ? 32.828  118.461 9.263   1.00 18.30 ? 274  GLU A CB  1 
ATOM   1895 C  CG  . GLU A 1 274 ? 31.969  117.503 8.428   1.00 20.27 ? 274  GLU A CG  1 
ATOM   1896 C  CD  . GLU A 1 274 ? 30.474  117.724 8.590   1.00 21.99 ? 274  GLU A CD  1 
ATOM   1897 O  OE1 . GLU A 1 274 ? 29.691  117.097 7.840   1.00 20.21 ? 274  GLU A OE1 1 
ATOM   1898 O  OE2 . GLU A 1 274 ? 30.077  118.519 9.468   1.00 24.31 ? 274  GLU A OE2 1 
ATOM   1899 N  N   . SER A 1 275 ? 35.107  119.243 7.063   1.00 16.12 ? 275  SER A N   1 
ATOM   1900 C  CA  . SER A 1 275 ? 35.435  119.257 5.639   1.00 15.73 ? 275  SER A CA  1 
ATOM   1901 C  C   . SER A 1 275 ? 36.503  118.247 5.239   1.00 15.88 ? 275  SER A C   1 
ATOM   1902 O  O   . SER A 1 275 ? 36.360  117.564 4.221   1.00 16.32 ? 275  SER A O   1 
ATOM   1903 C  CB  . SER A 1 275 ? 35.863  120.658 5.195   1.00 15.43 ? 275  SER A CB  1 
ATOM   1904 O  OG  . SER A 1 275 ? 34.742  121.523 5.089   1.00 15.50 ? 275  SER A OG  1 
ATOM   1905 N  N   . ALA A 1 276 ? 37.571  118.155 6.026   1.00 15.15 ? 276  ALA A N   1 
ATOM   1906 C  CA  . ALA A 1 276 ? 38.645  117.209 5.723   1.00 15.37 ? 276  ALA A CA  1 
ATOM   1907 C  C   . ALA A 1 276 ? 38.124  115.774 5.795   1.00 14.88 ? 276  ALA A C   1 
ATOM   1908 O  O   . ALA A 1 276 ? 38.460  114.943 4.954   1.00 14.47 ? 276  ALA A O   1 
ATOM   1909 C  CB  . ALA A 1 276 ? 39.811  117.402 6.695   1.00 14.94 ? 276  ALA A CB  1 
ATOM   1910 N  N   . TRP A 1 277 ? 37.308  115.481 6.806   1.00 14.58 ? 277  TRP A N   1 
ATOM   1911 C  CA  . TRP A 1 277 ? 36.738  114.142 6.946   1.00 14.60 ? 277  TRP A CA  1 
ATOM   1912 C  C   . TRP A 1 277 ? 35.852  113.808 5.749   1.00 14.52 ? 277  TRP A C   1 
ATOM   1913 O  O   . TRP A 1 277 ? 35.908  112.702 5.208   1.00 14.65 ? 277  TRP A O   1 
ATOM   1914 C  CB  . TRP A 1 277 ? 35.904  114.038 8.225   1.00 14.53 ? 277  TRP A CB  1 
ATOM   1915 C  CG  . TRP A 1 277 ? 36.721  113.879 9.466   1.00 14.88 ? 277  TRP A CG  1 
ATOM   1916 C  CD1 . TRP A 1 277 ? 36.991  114.833 10.404  1.00 14.08 ? 277  TRP A CD1 1 
ATOM   1917 C  CD2 . TRP A 1 277 ? 37.363  112.680 9.911   1.00 14.89 ? 277  TRP A CD2 1 
ATOM   1918 N  NE1 . TRP A 1 277 ? 37.764  114.298 11.412  1.00 14.97 ? 277  TRP A NE1 1 
ATOM   1919 C  CE2 . TRP A 1 277 ? 38.005  112.978 11.134  1.00 14.94 ? 277  TRP A CE2 1 
ATOM   1920 C  CE3 . TRP A 1 277 ? 37.459  111.380 9.395   1.00 15.48 ? 277  TRP A CE3 1 
ATOM   1921 C  CZ2 . TRP A 1 277 ? 38.733  112.022 11.852  1.00 15.94 ? 277  TRP A CZ2 1 
ATOM   1922 C  CZ3 . TRP A 1 277 ? 38.186  110.427 10.109  1.00 16.42 ? 277  TRP A CZ3 1 
ATOM   1923 C  CH2 . TRP A 1 277 ? 38.812  110.757 11.326  1.00 15.41 ? 277  TRP A CH2 1 
ATOM   1924 N  N   . ASN A 1 278 ? 35.029  114.768 5.338   1.00 14.31 ? 278  ASN A N   1 
ATOM   1925 C  CA  . ASN A 1 278 ? 34.139  114.556 4.205   1.00 14.48 ? 278  ASN A CA  1 
ATOM   1926 C  C   . ASN A 1 278 ? 34.928  114.355 2.917   1.00 14.19 ? 278  ASN A C   1 
ATOM   1927 O  O   . ASN A 1 278 ? 34.530  113.573 2.057   1.00 14.29 ? 278  ASN A O   1 
ATOM   1928 C  CB  . ASN A 1 278 ? 33.170  115.735 4.054   1.00 13.61 ? 278  ASN A CB  1 
ATOM   1929 C  CG  . ASN A 1 278 ? 32.227  115.867 5.236   1.00 14.25 ? 278  ASN A CG  1 
ATOM   1930 O  OD1 . ASN A 1 278 ? 32.073  114.935 6.030   1.00 14.61 ? 278  ASN A OD1 1 
ATOM   1931 N  ND2 . ASN A 1 278 ? 31.580  117.019 5.351   1.00 13.45 ? 278  ASN A ND2 1 
ATOM   1932 N  N   . TYR A 1 279 ? 36.047  115.059 2.782   1.00 14.73 ? 279  TYR A N   1 
ATOM   1933 C  CA  . TYR A 1 279 ? 36.876  114.920 1.587   1.00 14.64 ? 279  TYR A CA  1 
ATOM   1934 C  C   . TYR A 1 279 ? 37.527  113.540 1.575   1.00 14.96 ? 279  TYR A C   1 
ATOM   1935 O  O   . TYR A 1 279 ? 37.641  112.911 0.524   1.00 14.32 ? 279  TYR A O   1 
ATOM   1936 C  CB  . TYR A 1 279 ? 37.960  116.002 1.550   1.00 14.99 ? 279  TYR A CB  1 
ATOM   1937 C  CG  . TYR A 1 279 ? 38.868  115.942 0.333   1.00 15.30 ? 279  TYR A CG  1 
ATOM   1938 C  CD1 . TYR A 1 279 ? 38.422  116.370 -0.919  1.00 15.09 ? 279  TYR A CD1 1 
ATOM   1939 C  CD2 . TYR A 1 279 ? 40.181  115.480 0.441   1.00 15.70 ? 279  TYR A CD2 1 
ATOM   1940 C  CE1 . TYR A 1 279 ? 39.264  116.346 -2.036  1.00 15.82 ? 279  TYR A CE1 1 
ATOM   1941 C  CE2 . TYR A 1 279 ? 41.033  115.451 -0.669  1.00 15.49 ? 279  TYR A CE2 1 
ATOM   1942 C  CZ  . TYR A 1 279 ? 40.568  115.886 -1.903  1.00 16.15 ? 279  TYR A CZ  1 
ATOM   1943 O  OH  . TYR A 1 279 ? 41.401  115.867 -3.001  1.00 14.68 ? 279  TYR A OH  1 
ATOM   1944 N  N   . LEU A 1 280 ? 37.966  113.074 2.741   1.00 15.23 ? 280  LEU A N   1 
ATOM   1945 C  CA  . LEU A 1 280 ? 38.595  111.755 2.830   1.00 16.09 ? 280  LEU A CA  1 
ATOM   1946 C  C   . LEU A 1 280 ? 37.614  110.692 2.341   1.00 16.35 ? 280  LEU A C   1 
ATOM   1947 O  O   . LEU A 1 280 ? 37.952  109.848 1.512   1.00 16.49 ? 280  LEU A O   1 
ATOM   1948 C  CB  . LEU A 1 280 ? 39.011  111.451 4.274   1.00 16.56 ? 280  LEU A CB  1 
ATOM   1949 C  CG  . LEU A 1 280 ? 39.700  110.100 4.525   1.00 17.34 ? 280  LEU A CG  1 
ATOM   1950 C  CD1 . LEU A 1 280 ? 40.989  110.012 3.703   1.00 17.40 ? 280  LEU A CD1 1 
ATOM   1951 C  CD2 . LEU A 1 280 ? 40.001  109.948 6.014   1.00 17.69 ? 280  LEU A CD2 1 
ATOM   1952 N  N   . LYS A 1 281 ? 36.388  110.742 2.845   1.00 16.70 ? 281  LYS A N   1 
ATOM   1953 C  CA  . LYS A 1 281 ? 35.375  109.779 2.433   1.00 17.40 ? 281  LYS A CA  1 
ATOM   1954 C  C   . LYS A 1 281 ? 35.019  109.967 0.960   1.00 16.89 ? 281  LYS A C   1 
ATOM   1955 O  O   . LYS A 1 281 ? 34.817  108.997 0.229   1.00 16.12 ? 281  LYS A O   1 
ATOM   1956 C  CB  . LYS A 1 281 ? 34.120  109.937 3.296   1.00 19.12 ? 281  LYS A CB  1 
ATOM   1957 C  CG  . LYS A 1 281 ? 32.974  108.997 2.933   1.00 21.59 ? 281  LYS A CG  1 
ATOM   1958 C  CD  . LYS A 1 281 ? 31.862  109.079 3.980   1.00 24.86 ? 281  LYS A CD  1 
ATOM   1959 C  CE  . LYS A 1 281 ? 31.284  110.489 4.060   1.00 27.23 ? 281  LYS A CE  1 
ATOM   1960 N  NZ  . LYS A 1 281 ? 30.443  110.693 5.270   1.00 29.89 ? 281  LYS A NZ  1 
ATOM   1961 N  N   . GLY A 1 282 ? 34.957  111.224 0.531   1.00 16.57 ? 282  GLY A N   1 
ATOM   1962 C  CA  . GLY A 1 282 ? 34.612  111.532 -0.847  1.00 17.24 ? 282  GLY A CA  1 
ATOM   1963 C  C   . GLY A 1 282 ? 35.516  110.936 -1.912  1.00 17.61 ? 282  GLY A C   1 
ATOM   1964 O  O   . GLY A 1 282 ? 35.037  110.506 -2.961  1.00 17.61 ? 282  GLY A O   1 
ATOM   1965 N  N   . ILE A 1 283 ? 36.821  110.904 -1.655  1.00 17.07 ? 283  ILE A N   1 
ATOM   1966 C  CA  . ILE A 1 283 ? 37.763  110.367 -2.631  1.00 17.43 ? 283  ILE A CA  1 
ATOM   1967 C  C   . ILE A 1 283 ? 37.938  108.856 -2.553  1.00 17.46 ? 283  ILE A C   1 
ATOM   1968 O  O   . ILE A 1 283 ? 38.613  108.265 -3.396  1.00 17.55 ? 283  ILE A O   1 
ATOM   1969 C  CB  . ILE A 1 283 ? 39.158  111.026 -2.494  1.00 16.85 ? 283  ILE A CB  1 
ATOM   1970 C  CG1 . ILE A 1 283 ? 39.776  110.692 -1.133  1.00 17.66 ? 283  ILE A CG1 1 
ATOM   1971 C  CG2 . ILE A 1 283 ? 39.033  112.531 -2.671  1.00 16.54 ? 283  ILE A CG2 1 
ATOM   1972 C  CD1 . ILE A 1 283 ? 41.181  111.276 -0.926  1.00 17.70 ? 283  ILE A CD1 1 
ATOM   1973 N  N   . LEU A 1 284 ? 37.325  108.228 -1.555  1.00 17.70 ? 284  LEU A N   1 
ATOM   1974 C  CA  . LEU A 1 284 ? 37.444  106.781 -1.389  1.00 18.01 ? 284  LEU A CA  1 
ATOM   1975 C  C   . LEU A 1 284 ? 36.126  106.021 -1.535  1.00 18.57 ? 284  LEU A C   1 
ATOM   1976 O  O   . LEU A 1 284 ? 36.127  104.825 -1.822  1.00 18.11 ? 284  LEU A O   1 
ATOM   1977 C  CB  . LEU A 1 284 ? 38.034  106.465 -0.010  1.00 17.44 ? 284  LEU A CB  1 
ATOM   1978 C  CG  . LEU A 1 284 ? 39.395  107.058 0.357   1.00 17.43 ? 284  LEU A CG  1 
ATOM   1979 C  CD1 . LEU A 1 284 ? 39.721  106.705 1.799   1.00 16.76 ? 284  LEU A CD1 1 
ATOM   1980 C  CD2 . LEU A 1 284 ? 40.472  106.529 -0.587  1.00 17.12 ? 284  LEU A CD2 1 
ATOM   1981 N  N   . GLN A 1 285 ? 35.007  106.715 -1.348  1.00 19.44 ? 285  GLN A N   1 
ATOM   1982 C  CA  . GLN A 1 285 ? 33.695  106.075 -1.397  1.00 20.90 ? 285  GLN A CA  1 
ATOM   1983 C  C   . GLN A 1 285 ? 33.299  105.318 -2.666  1.00 21.98 ? 285  GLN A C   1 
ATOM   1984 O  O   . GLN A 1 285 ? 32.665  104.269 -2.581  1.00 22.57 ? 285  GLN A O   1 
ATOM   1985 C  CB  . GLN A 1 285 ? 32.607  107.100 -1.054  1.00 20.35 ? 285  GLN A CB  1 
ATOM   1986 C  CG  . GLN A 1 285 ? 32.347  108.139 -2.129  1.00 20.48 ? 285  GLN A CG  1 
ATOM   1987 C  CD  . GLN A 1 285 ? 31.553  109.326 -1.605  1.00 21.16 ? 285  GLN A CD  1 
ATOM   1988 O  OE1 . GLN A 1 285 ? 30.964  109.268 -0.520  1.00 21.47 ? 285  GLN A OE1 1 
ATOM   1989 N  NE2 . GLN A 1 285 ? 31.529  110.406 -2.374  1.00 19.68 ? 285  GLN A NE2 1 
ATOM   1990 N  N   . ASP A 1 286 ? 33.663  105.823 -3.837  1.00 23.46 ? 286  ASP A N   1 
ATOM   1991 C  CA  . ASP A 1 286 ? 33.277  105.137 -5.066  1.00 25.04 ? 286  ASP A CA  1 
ATOM   1992 C  C   . ASP A 1 286 ? 33.878  103.743 -5.190  1.00 24.93 ? 286  ASP A C   1 
ATOM   1993 O  O   . ASP A 1 286 ? 33.209  102.813 -5.641  1.00 24.56 ? 286  ASP A O   1 
ATOM   1994 C  CB  . ASP A 1 286 ? 33.644  105.972 -6.292  1.00 27.05 ? 286  ASP A CB  1 
ATOM   1995 C  CG  . ASP A 1 286 ? 32.919  107.305 -6.325  1.00 29.25 ? 286  ASP A CG  1 
ATOM   1996 O  OD1 . ASP A 1 286 ? 31.711  107.342 -6.006  1.00 30.43 ? 286  ASP A OD1 1 
ATOM   1997 O  OD2 . ASP A 1 286 ? 33.560  108.313 -6.681  1.00 31.91 ? 286  ASP A OD2 1 
ATOM   1998 N  N   . ARG A 1 287 ? 35.137  103.595 -4.801  1.00 24.58 ? 287  ARG A N   1 
ATOM   1999 C  CA  . ARG A 1 287 ? 35.782  102.290 -4.867  1.00 24.87 ? 287  ARG A CA  1 
ATOM   2000 C  C   . ARG A 1 287 ? 35.301  101.427 -3.710  1.00 23.82 ? 287  ARG A C   1 
ATOM   2001 O  O   . ARG A 1 287 ? 35.271  100.201 -3.807  1.00 23.60 ? 287  ARG A O   1 
ATOM   2002 C  CB  . ARG A 1 287 ? 37.302  102.447 -4.805  1.00 26.11 ? 287  ARG A CB  1 
ATOM   2003 C  CG  . ARG A 1 287 ? 37.893  103.040 -6.068  1.00 29.59 ? 287  ARG A CG  1 
ATOM   2004 C  CD  . ARG A 1 287 ? 37.831  102.037 -7.213  1.00 32.65 ? 287  ARG A CD  1 
ATOM   2005 N  NE  . ARG A 1 287 ? 37.942  102.689 -8.514  1.00 35.92 ? 287  ARG A NE  1 
ATOM   2006 C  CZ  . ARG A 1 287 ? 36.966  103.395 -9.080  1.00 37.70 ? 287  ARG A CZ  1 
ATOM   2007 N  NH1 . ARG A 1 287 ? 35.800  103.540 -8.461  1.00 38.64 ? 287  ARG A NH1 1 
ATOM   2008 N  NH2 . ARG A 1 287 ? 37.155  103.958 -10.267 1.00 38.78 ? 287  ARG A NH2 1 
ATOM   2009 N  N   . GLY A 1 288 ? 34.912  102.079 -2.619  1.00 23.11 ? 288  GLY A N   1 
ATOM   2010 C  CA  . GLY A 1 288 ? 34.445  101.358 -1.449  1.00 22.41 ? 288  GLY A CA  1 
ATOM   2011 C  C   . GLY A 1 288 ? 35.442  101.520 -0.320  1.00 22.37 ? 288  GLY A C   1 
ATOM   2012 O  O   . GLY A 1 288 ? 36.629  101.216 -0.480  1.00 21.63 ? 288  GLY A O   1 
ATOM   2013 N  N   . LEU A 1 289 ? 34.965  102.000 0.824   1.00 21.99 ? 289  LEU A N   1 
ATOM   2014 C  CA  . LEU A 1 289 ? 35.828  102.218 1.976   1.00 22.41 ? 289  LEU A CA  1 
ATOM   2015 C  C   . LEU A 1 289 ? 36.519  100.947 2.459   1.00 22.78 ? 289  LEU A C   1 
ATOM   2016 O  O   . LEU A 1 289 ? 37.614  101.011 3.012   1.00 23.43 ? 289  LEU A O   1 
ATOM   2017 C  CB  . LEU A 1 289 ? 35.031  102.848 3.125   1.00 22.56 ? 289  LEU A CB  1 
ATOM   2018 C  CG  . LEU A 1 289 ? 34.385  104.207 2.832   1.00 22.89 ? 289  LEU A CG  1 
ATOM   2019 C  CD1 . LEU A 1 289 ? 33.735  104.748 4.097   1.00 21.84 ? 289  LEU A CD1 1 
ATOM   2020 C  CD2 . LEU A 1 289 ? 35.436  105.182 2.323   1.00 23.06 ? 289  LEU A CD2 1 
ATOM   2021 N  N   . SER A 1 290 ? 35.894  99.793  2.243   1.00 22.70 ? 290  SER A N   1 
ATOM   2022 C  CA  . SER A 1 290 ? 36.486  98.533  2.681   1.00 23.08 ? 290  SER A CA  1 
ATOM   2023 C  C   . SER A 1 290 ? 37.657  98.091  1.801   1.00 23.03 ? 290  SER A C   1 
ATOM   2024 O  O   . SER A 1 290 ? 38.351  97.131  2.129   1.00 22.74 ? 290  SER A O   1 
ATOM   2025 C  CB  . SER A 1 290 ? 35.427  97.424  2.717   1.00 22.63 ? 290  SER A CB  1 
ATOM   2026 O  OG  . SER A 1 290 ? 34.970  97.101  1.416   1.00 24.04 ? 290  SER A OG  1 
ATOM   2027 N  N   . LYS A 1 291 ? 37.877  98.782  0.686   1.00 23.04 ? 291  LYS A N   1 
ATOM   2028 C  CA  . LYS A 1 291 ? 38.981  98.426  -0.206  1.00 23.46 ? 291  LYS A CA  1 
ATOM   2029 C  C   . LYS A 1 291 ? 40.317  98.986  0.275   1.00 22.68 ? 291  LYS A C   1 
ATOM   2030 O  O   . LYS A 1 291 ? 41.353  98.753  -0.347  1.00 22.63 ? 291  LYS A O   1 
ATOM   2031 C  CB  . LYS A 1 291 ? 38.709  98.922  -1.632  1.00 24.51 ? 291  LYS A CB  1 
ATOM   2032 C  CG  . LYS A 1 291 ? 37.942  97.941  -2.512  1.00 26.65 ? 291  LYS A CG  1 
ATOM   2033 C  CD  . LYS A 1 291 ? 36.545  97.680  -1.992  1.00 28.56 ? 291  LYS A CD  1 
ATOM   2034 C  CE  . LYS A 1 291 ? 35.798  96.699  -2.884  1.00 29.67 ? 291  LYS A CE  1 
ATOM   2035 N  NZ  . LYS A 1 291 ? 36.422  95.353  -2.869  1.00 31.39 ? 291  LYS A NZ  1 
ATOM   2036 N  N   . TYR A 1 292 ? 40.291  99.722  1.381   1.00 21.84 ? 292  TYR A N   1 
ATOM   2037 C  CA  . TYR A 1 292 ? 41.505  100.312 1.933   1.00 21.97 ? 292  TYR A CA  1 
ATOM   2038 C  C   . TYR A 1 292 ? 41.721  99.835  3.368   1.00 22.16 ? 292  TYR A C   1 
ATOM   2039 O  O   . TYR A 1 292 ? 41.548  100.590 4.326   1.00 21.43 ? 292  TYR A O   1 
ATOM   2040 C  CB  . TYR A 1 292 ? 41.412  101.842 1.877   1.00 21.35 ? 292  TYR A CB  1 
ATOM   2041 C  CG  . TYR A 1 292 ? 41.065  102.365 0.496   1.00 21.26 ? 292  TYR A CG  1 
ATOM   2042 C  CD1 . TYR A 1 292 ? 39.735  102.527 0.099   1.00 21.03 ? 292  TYR A CD1 1 
ATOM   2043 C  CD2 . TYR A 1 292 ? 42.067  102.654 -0.433  1.00 20.28 ? 292  TYR A CD2 1 
ATOM   2044 C  CE1 . TYR A 1 292 ? 39.413  102.964 -1.191  1.00 21.13 ? 292  TYR A CE1 1 
ATOM   2045 C  CE2 . TYR A 1 292 ? 41.757  103.084 -1.719  1.00 20.86 ? 292  TYR A CE2 1 
ATOM   2046 C  CZ  . TYR A 1 292 ? 40.432  103.237 -2.093  1.00 21.08 ? 292  TYR A CZ  1 
ATOM   2047 O  OH  . TYR A 1 292 ? 40.134  103.642 -3.374  1.00 21.23 ? 292  TYR A OH  1 
ATOM   2048 N  N   . PRO A 1 293 ? 42.132  98.565  3.528   1.00 23.05 ? 293  PRO A N   1 
ATOM   2049 C  CA  . PRO A 1 293 ? 42.379  97.943  4.834   1.00 23.36 ? 293  PRO A CA  1 
ATOM   2050 C  C   . PRO A 1 293 ? 43.270  98.694  5.823   1.00 23.87 ? 293  PRO A C   1 
ATOM   2051 O  O   . PRO A 1 293 ? 42.990  98.702  7.023   1.00 24.53 ? 293  PRO A O   1 
ATOM   2052 C  CB  . PRO A 1 293 ? 42.936  96.566  4.462   1.00 23.79 ? 293  PRO A CB  1 
ATOM   2053 C  CG  . PRO A 1 293 ? 43.570  96.798  3.123   1.00 23.32 ? 293  PRO A CG  1 
ATOM   2054 C  CD  . PRO A 1 293 ? 42.554  97.669  2.437   1.00 22.51 ? 293  PRO A CD  1 
ATOM   2055 N  N   . ASN A 1 294 ? 44.333  99.330  5.341   1.00 23.73 ? 294  ASN A N   1 
ATOM   2056 C  CA  . ASN A 1 294 ? 45.216  100.051 6.249   1.00 23.58 ? 294  ASN A CA  1 
ATOM   2057 C  C   . ASN A 1 294 ? 44.564  101.282 6.870   1.00 23.49 ? 294  ASN A C   1 
ATOM   2058 O  O   . ASN A 1 294 ? 44.926  101.688 7.977   1.00 23.13 ? 294  ASN A O   1 
ATOM   2059 C  CB  . ASN A 1 294 ? 46.510  100.460 5.538   1.00 23.43 ? 294  ASN A CB  1 
ATOM   2060 C  CG  . ASN A 1 294 ? 47.278  99.270  5.002   1.00 24.59 ? 294  ASN A CG  1 
ATOM   2061 O  OD1 . ASN A 1 294 ? 47.228  98.179  5.570   1.00 23.75 ? 294  ASN A OD1 1 
ATOM   2062 N  ND2 . ASN A 1 294 ? 48.006  99.477  3.910   1.00 24.30 ? 294  ASN A ND2 1 
ATOM   2063 N  N   . LEU A 1 295 ? 43.603  101.875 6.167   1.00 23.38 ? 295  LEU A N   1 
ATOM   2064 C  CA  . LEU A 1 295 ? 42.927  103.061 6.685   1.00 23.57 ? 295  LEU A CA  1 
ATOM   2065 C  C   . LEU A 1 295 ? 42.168  102.754 7.971   1.00 23.04 ? 295  LEU A C   1 
ATOM   2066 O  O   . LEU A 1 295 ? 42.160  103.558 8.900   1.00 23.10 ? 295  LEU A O   1 
ATOM   2067 C  CB  . LEU A 1 295 ? 41.968  103.640 5.638   1.00 23.68 ? 295  LEU A CB  1 
ATOM   2068 C  CG  . LEU A 1 295 ? 41.209  104.901 6.067   1.00 23.89 ? 295  LEU A CG  1 
ATOM   2069 C  CD1 . LEU A 1 295 ? 42.195  105.970 6.522   1.00 24.38 ? 295  LEU A CD1 1 
ATOM   2070 C  CD2 . LEU A 1 295 ? 40.373  105.416 4.909   1.00 23.80 ? 295  LEU A CD2 1 
ATOM   2071 N  N   . LEU A 1 296 ? 41.530  101.592 8.028   1.00 23.77 ? 296  LEU A N   1 
ATOM   2072 C  CA  . LEU A 1 296 ? 40.786  101.207 9.223   1.00 25.07 ? 296  LEU A CA  1 
ATOM   2073 C  C   . LEU A 1 296 ? 41.706  101.170 10.442  1.00 26.14 ? 296  LEU A C   1 
ATOM   2074 O  O   . LEU A 1 296 ? 41.371  101.704 11.497  1.00 25.17 ? 296  LEU A O   1 
ATOM   2075 C  CB  . LEU A 1 296 ? 40.136  99.835  9.034   1.00 24.51 ? 296  LEU A CB  1 
ATOM   2076 C  CG  . LEU A 1 296 ? 39.459  99.240  10.272  1.00 24.78 ? 296  LEU A CG  1 
ATOM   2077 C  CD1 . LEU A 1 296 ? 38.399  100.190 10.805  1.00 23.66 ? 296  LEU A CD1 1 
ATOM   2078 C  CD2 . LEU A 1 296 ? 38.847  97.900  9.911   1.00 25.05 ? 296  LEU A CD2 1 
ATOM   2079 N  N   . ASN A 1 297 ? 42.868  100.543 10.286  1.00 27.94 ? 297  ASN A N   1 
ATOM   2080 C  CA  . ASN A 1 297 ? 43.831  100.439 11.378  1.00 30.14 ? 297  ASN A CA  1 
ATOM   2081 C  C   . ASN A 1 297 ? 44.359  101.788 11.832  1.00 30.50 ? 297  ASN A C   1 
ATOM   2082 O  O   . ASN A 1 297 ? 44.434  102.058 13.028  1.00 30.32 ? 297  ASN A O   1 
ATOM   2083 C  CB  . ASN A 1 297 ? 45.011  99.557  10.971  1.00 32.07 ? 297  ASN A CB  1 
ATOM   2084 C  CG  . ASN A 1 297 ? 44.617  98.115  10.788  1.00 34.22 ? 297  ASN A CG  1 
ATOM   2085 O  OD1 . ASN A 1 297 ? 44.013  97.507  11.675  1.00 36.19 ? 297  ASN A OD1 1 
ATOM   2086 N  ND2 . ASN A 1 297 ? 44.957  97.551  9.635   1.00 35.75 ? 297  ASN A ND2 1 
ATOM   2087 N  N   . GLN A 1 298 ? 44.733  102.636 10.882  1.00 31.59 ? 298  GLN A N   1 
ATOM   2088 C  CA  . GLN A 1 298 ? 45.255  103.947 11.238  1.00 33.54 ? 298  GLN A CA  1 
ATOM   2089 C  C   . GLN A 1 298 ? 44.210  104.760 11.994  1.00 34.02 ? 298  GLN A C   1 
ATOM   2090 O  O   . GLN A 1 298 ? 44.529  105.424 12.981  1.00 34.15 ? 298  GLN A O   1 
ATOM   2091 C  CB  . GLN A 1 298 ? 45.719  104.698 9.987   1.00 34.32 ? 298  GLN A CB  1 
ATOM   2092 C  CG  . GLN A 1 298 ? 46.812  103.964 9.217   1.00 36.62 ? 298  GLN A CG  1 
ATOM   2093 C  CD  . GLN A 1 298 ? 47.539  104.851 8.220   1.00 37.96 ? 298  GLN A CD  1 
ATOM   2094 O  OE1 . GLN A 1 298 ? 48.341  104.371 7.416   1.00 39.12 ? 298  GLN A OE1 1 
ATOM   2095 N  NE2 . GLN A 1 298 ? 47.271  106.152 8.274   1.00 38.79 ? 298  GLN A NE2 1 
ATOM   2096 N  N   . LEU A 1 299 ? 42.961  104.703 11.539  1.00 34.29 ? 299  LEU A N   1 
ATOM   2097 C  CA  . LEU A 1 299 ? 41.888  105.436 12.202  1.00 34.81 ? 299  LEU A CA  1 
ATOM   2098 C  C   . LEU A 1 299 ? 41.628  104.826 13.570  1.00 35.90 ? 299  LEU A C   1 
ATOM   2099 O  O   . LEU A 1 299 ? 41.335  105.532 14.535  1.00 35.68 ? 299  LEU A O   1 
ATOM   2100 C  CB  . LEU A 1 299 ? 40.603  105.386 11.371  1.00 33.64 ? 299  LEU A CB  1 
ATOM   2101 C  CG  . LEU A 1 299 ? 40.619  106.129 10.034  1.00 32.93 ? 299  LEU A CG  1 
ATOM   2102 C  CD1 . LEU A 1 299 ? 39.255  106.031 9.382   1.00 31.18 ? 299  LEU A CD1 1 
ATOM   2103 C  CD2 . LEU A 1 299 ? 40.999  107.585 10.266  1.00 32.48 ? 299  LEU A CD2 1 
ATOM   2104 N  N   . LEU A 1 300 ? 41.738  103.505 13.639  1.00 37.75 ? 300  LEU A N   1 
ATOM   2105 C  CA  . LEU A 1 300 ? 41.523  102.773 14.877  1.00 40.11 ? 300  LEU A CA  1 
ATOM   2106 C  C   . LEU A 1 300 ? 42.584  103.157 15.909  1.00 42.04 ? 300  LEU A C   1 
ATOM   2107 O  O   . LEU A 1 300 ? 42.328  103.123 17.115  1.00 42.71 ? 300  LEU A O   1 
ATOM   2108 C  CB  . LEU A 1 300 ? 41.570  101.270 14.592  1.00 39.95 ? 300  LEU A CB  1 
ATOM   2109 C  CG  . LEU A 1 300 ? 40.375  100.412 15.018  1.00 40.35 ? 300  LEU A CG  1 
ATOM   2110 C  CD1 . LEU A 1 300 ? 39.065  101.113 14.698  1.00 40.31 ? 300  LEU A CD1 1 
ATOM   2111 C  CD2 . LEU A 1 300 ? 40.453  99.068  14.307  1.00 40.29 ? 300  LEU A CD2 1 
ATOM   2112 N  N   . ASP A 1 301 ? 43.770  103.530 15.435  1.00 43.72 ? 301  ASP A N   1 
ATOM   2113 C  CA  . ASP A 1 301 ? 44.852  103.927 16.331  1.00 45.67 ? 301  ASP A CA  1 
ATOM   2114 C  C   . ASP A 1 301 ? 44.616  105.324 16.892  1.00 46.98 ? 301  ASP A C   1 
ATOM   2115 O  O   . ASP A 1 301 ? 44.984  105.611 18.030  1.00 47.48 ? 301  ASP A O   1 
ATOM   2116 C  CB  . ASP A 1 301 ? 46.206  103.890 15.610  1.00 45.85 ? 301  ASP A CB  1 
ATOM   2117 C  CG  . ASP A 1 301 ? 46.665  102.478 15.298  1.00 46.04 ? 301  ASP A CG  1 
ATOM   2118 O  OD1 . ASP A 1 301 ? 46.458  101.587 16.146  1.00 46.49 ? 301  ASP A OD1 1 
ATOM   2119 O  OD2 . ASP A 1 301 ? 47.246  102.258 14.213  1.00 46.70 ? 301  ASP A OD2 1 
ATOM   2120 N  N   . LEU A 1 302 ? 44.006  106.191 16.091  1.00 48.25 ? 302  LEU A N   1 
ATOM   2121 C  CA  . LEU A 1 302 ? 43.718  107.557 16.517  1.00 49.84 ? 302  LEU A CA  1 
ATOM   2122 C  C   . LEU A 1 302 ? 42.497  107.577 17.427  1.00 50.84 ? 302  LEU A C   1 
ATOM   2123 O  O   . LEU A 1 302 ? 42.253  108.553 18.138  1.00 50.99 ? 302  LEU A O   1 
ATOM   2124 C  CB  . LEU A 1 302 ? 43.455  108.443 15.299  1.00 49.85 ? 302  LEU A CB  1 
ATOM   2125 C  CG  . LEU A 1 302 ? 44.592  108.556 14.284  1.00 50.30 ? 302  LEU A CG  1 
ATOM   2126 C  CD1 . LEU A 1 302 ? 44.119  109.349 13.074  1.00 50.23 ? 302  LEU A CD1 1 
ATOM   2127 C  CD2 . LEU A 1 302 ? 45.794  109.224 14.935  1.00 50.19 ? 302  LEU A CD2 1 
ATOM   2128 N  N   . GLN A 1 303 ? 41.739  106.486 17.391  1.00 52.24 ? 303  GLN A N   1 
ATOM   2129 C  CA  . GLN A 1 303 ? 40.523  106.326 18.181  1.00 53.50 ? 303  GLN A CA  1 
ATOM   2130 C  C   . GLN A 1 303 ? 40.642  106.822 19.625  1.00 54.05 ? 303  GLN A C   1 
ATOM   2131 O  O   . GLN A 1 303 ? 39.917  107.729 20.037  1.00 53.98 ? 303  GLN A O   1 
ATOM   2132 C  CB  . GLN A 1 303 ? 40.104  104.849 18.166  1.00 54.42 ? 303  GLN A CB  1 
ATOM   2133 C  CG  . GLN A 1 303 ? 38.883  104.502 19.002  1.00 55.93 ? 303  GLN A CG  1 
ATOM   2134 C  CD  . GLN A 1 303 ? 37.585  104.938 18.358  1.00 56.55 ? 303  GLN A CD  1 
ATOM   2135 O  OE1 . GLN A 1 303 ? 36.500  104.626 18.850  1.00 57.14 ? 303  GLN A OE1 1 
ATOM   2136 N  NE2 . GLN A 1 303 ? 37.687  105.665 17.252  1.00 57.64 ? 303  GLN A NE2 1 
ATOM   2137 N  N   . PRO A 1 304 ? 41.565  106.241 20.410  1.00 54.43 ? 304  PRO A N   1 
ATOM   2138 C  CA  . PRO A 1 304 ? 41.752  106.643 21.810  1.00 54.40 ? 304  PRO A CA  1 
ATOM   2139 C  C   . PRO A 1 304 ? 42.055  108.122 22.049  1.00 54.29 ? 304  PRO A C   1 
ATOM   2140 O  O   . PRO A 1 304 ? 41.668  108.675 23.079  1.00 54.66 ? 304  PRO A O   1 
ATOM   2141 C  CB  . PRO A 1 304 ? 42.897  105.745 22.273  1.00 54.56 ? 304  PRO A CB  1 
ATOM   2142 C  CG  . PRO A 1 304 ? 42.720  104.516 21.430  1.00 54.71 ? 304  PRO A CG  1 
ATOM   2143 C  CD  . PRO A 1 304 ? 42.465  105.123 20.075  1.00 54.45 ? 304  PRO A CD  1 
ATOM   2144 N  N   . SER A 1 305 ? 42.738  108.762 21.104  1.00 53.84 ? 305  SER A N   1 
ATOM   2145 C  CA  . SER A 1 305 ? 43.098  110.170 21.258  1.00 53.44 ? 305  SER A CA  1 
ATOM   2146 C  C   . SER A 1 305 ? 42.296  111.143 20.392  1.00 53.22 ? 305  SER A C   1 
ATOM   2147 O  O   . SER A 1 305 ? 41.358  111.781 20.872  1.00 53.66 ? 305  SER A O   1 
ATOM   2148 C  CB  . SER A 1 305 ? 44.592  110.356 20.979  1.00 53.46 ? 305  SER A CB  1 
ATOM   2149 O  OG  . SER A 1 305 ? 44.931  109.902 19.680  1.00 53.45 ? 305  SER A OG  1 
ATOM   2150 N  N   . HIS A 1 306 ? 42.679  111.261 19.123  1.00 52.51 ? 306  HIS A N   1 
ATOM   2151 C  CA  . HIS A 1 306 ? 42.015  112.165 18.185  1.00 51.44 ? 306  HIS A CA  1 
ATOM   2152 C  C   . HIS A 1 306 ? 40.559  111.812 17.893  1.00 49.88 ? 306  HIS A C   1 
ATOM   2153 O  O   . HIS A 1 306 ? 40.025  112.191 16.848  1.00 49.94 ? 306  HIS A O   1 
ATOM   2154 C  CB  . HIS A 1 306 ? 42.788  112.208 16.864  1.00 52.77 ? 306  HIS A CB  1 
ATOM   2155 C  CG  . HIS A 1 306 ? 44.017  113.060 16.908  1.00 54.23 ? 306  HIS A CG  1 
ATOM   2156 N  ND1 . HIS A 1 306 ? 45.014  112.886 17.844  1.00 55.06 ? 306  HIS A ND1 1 
ATOM   2157 C  CD2 . HIS A 1 306 ? 44.412  114.093 16.125  1.00 54.73 ? 306  HIS A CD2 1 
ATOM   2158 C  CE1 . HIS A 1 306 ? 45.969  113.776 17.636  1.00 55.47 ? 306  HIS A CE1 1 
ATOM   2159 N  NE2 . HIS A 1 306 ? 45.628  114.520 16.599  1.00 55.26 ? 306  HIS A NE2 1 
ATOM   2160 N  N   . SER A 1 307 ? 39.916  111.101 18.814  1.00 47.47 ? 307  SER A N   1 
ATOM   2161 C  CA  . SER A 1 307 ? 38.527  110.703 18.630  1.00 44.89 ? 307  SER A CA  1 
ATOM   2162 C  C   . SER A 1 307 ? 37.599  111.883 18.358  1.00 43.26 ? 307  SER A C   1 
ATOM   2163 O  O   . SER A 1 307 ? 37.980  113.049 18.512  1.00 43.29 ? 307  SER A O   1 
ATOM   2164 C  CB  . SER A 1 307 ? 38.026  109.945 19.857  1.00 45.14 ? 307  SER A CB  1 
ATOM   2165 O  OG  . SER A 1 307 ? 36.702  109.480 19.652  1.00 45.39 ? 307  SER A OG  1 
ATOM   2166 N  N   . SER A 1 308 ? 36.374  111.559 17.955  1.00 40.65 ? 308  SER A N   1 
ATOM   2167 C  CA  . SER A 1 308 ? 35.351  112.550 17.647  1.00 37.50 ? 308  SER A CA  1 
ATOM   2168 C  C   . SER A 1 308 ? 34.209  111.830 16.946  1.00 35.47 ? 308  SER A C   1 
ATOM   2169 O  O   . SER A 1 308 ? 34.356  110.685 16.514  1.00 35.13 ? 308  SER A O   1 
ATOM   2170 C  CB  . SER A 1 308 ? 35.908  113.622 16.714  1.00 37.83 ? 308  SER A CB  1 
ATOM   2171 O  OG  . SER A 1 308 ? 36.216  113.068 15.448  1.00 37.68 ? 308  SER A OG  1 
ATOM   2172 N  N   . PRO A 1 309 ? 33.050  112.489 16.822  1.00 33.15 ? 309  PRO A N   1 
ATOM   2173 C  CA  . PRO A 1 309 ? 31.944  111.814 16.145  1.00 30.97 ? 309  PRO A CA  1 
ATOM   2174 C  C   . PRO A 1 309 ? 32.291  111.517 14.687  1.00 28.84 ? 309  PRO A C   1 
ATOM   2175 O  O   . PRO A 1 309 ? 31.814  110.536 14.120  1.00 27.78 ? 309  PRO A O   1 
ATOM   2176 C  CB  . PRO A 1 309 ? 30.792  112.809 16.292  1.00 31.38 ? 309  PRO A CB  1 
ATOM   2177 C  CG  . PRO A 1 309 ? 31.492  114.135 16.335  1.00 32.32 ? 309  PRO A CG  1 
ATOM   2178 C  CD  . PRO A 1 309 ? 32.665  113.847 17.244  1.00 32.75 ? 309  PRO A CD  1 
ATOM   2179 N  N   . TYR A 1 310 ? 33.135  112.359 14.092  1.00 26.97 ? 310  TYR A N   1 
ATOM   2180 C  CA  . TYR A 1 310 ? 33.537  112.180 12.695  1.00 25.70 ? 310  TYR A CA  1 
ATOM   2181 C  C   . TYR A 1 310 ? 34.325  110.889 12.497  1.00 23.92 ? 310  TYR A C   1 
ATOM   2182 O  O   . TYR A 1 310 ? 34.113  110.170 11.522  1.00 22.60 ? 310  TYR A O   1 
ATOM   2183 C  CB  . TYR A 1 310 ? 34.377  113.372 12.221  1.00 27.06 ? 310  TYR A CB  1 
ATOM   2184 C  CG  . TYR A 1 310 ? 33.790  114.701 12.629  1.00 28.91 ? 310  TYR A CG  1 
ATOM   2185 C  CD1 . TYR A 1 310 ? 34.296  115.397 13.724  1.00 29.90 ? 310  TYR A CD1 1 
ATOM   2186 C  CD2 . TYR A 1 310 ? 32.671  115.217 11.980  1.00 29.78 ? 310  TYR A CD2 1 
ATOM   2187 C  CE1 . TYR A 1 310 ? 33.698  116.568 14.170  1.00 31.11 ? 310  TYR A CE1 1 
ATOM   2188 C  CE2 . TYR A 1 310 ? 32.062  116.388 12.418  1.00 31.17 ? 310  TYR A CE2 1 
ATOM   2189 C  CZ  . TYR A 1 310 ? 32.578  117.055 13.517  1.00 31.75 ? 310  TYR A CZ  1 
ATOM   2190 O  OH  . TYR A 1 310 ? 31.959  118.189 13.988  1.00 32.75 ? 310  TYR A OH  1 
ATOM   2191 N  N   . LEU A 1 311 ? 35.232  110.598 13.423  1.00 22.71 ? 311  LEU A N   1 
ATOM   2192 C  CA  . LEU A 1 311 ? 36.039  109.385 13.340  1.00 22.47 ? 311  LEU A CA  1 
ATOM   2193 C  C   . LEU A 1 311 ? 35.176  108.143 13.559  1.00 21.25 ? 311  LEU A C   1 
ATOM   2194 O  O   . LEU A 1 311 ? 35.281  107.165 12.818  1.00 20.14 ? 311  LEU A O   1 
ATOM   2195 C  CB  . LEU A 1 311 ? 37.165  109.428 14.378  1.00 23.63 ? 311  LEU A CB  1 
ATOM   2196 C  CG  . LEU A 1 311 ? 38.037  108.179 14.549  1.00 25.21 ? 311  LEU A CG  1 
ATOM   2197 C  CD1 . LEU A 1 311 ? 38.551  107.710 13.207  1.00 27.07 ? 311  LEU A CD1 1 
ATOM   2198 C  CD2 . LEU A 1 311 ? 39.204  108.501 15.471  1.00 26.73 ? 311  LEU A CD2 1 
ATOM   2199 N  N   . ILE A 1 312 ? 34.321  108.196 14.576  1.00 20.27 ? 312  ILE A N   1 
ATOM   2200 C  CA  . ILE A 1 312 ? 33.434  107.081 14.909  1.00 19.29 ? 312  ILE A CA  1 
ATOM   2201 C  C   . ILE A 1 312 ? 32.484  106.799 13.750  1.00 17.89 ? 312  ILE A C   1 
ATOM   2202 O  O   . ILE A 1 312 ? 32.242  105.641 13.401  1.00 16.60 ? 312  ILE A O   1 
ATOM   2203 C  CB  . ILE A 1 312 ? 32.599  107.387 16.183  1.00 19.77 ? 312  ILE A CB  1 
ATOM   2204 C  CG1 . ILE A 1 312 ? 33.530  107.639 17.370  1.00 21.08 ? 312  ILE A CG1 1 
ATOM   2205 C  CG2 . ILE A 1 312 ? 31.650  106.224 16.487  1.00 19.46 ? 312  ILE A CG2 1 
ATOM   2206 C  CD1 . ILE A 1 312 ? 34.395  106.450 17.740  1.00 22.97 ? 312  ILE A CD1 1 
ATOM   2207 N  N   . ALA A 1 313 ? 31.950  107.865 13.158  1.00 16.87 ? 313  ALA A N   1 
ATOM   2208 C  CA  . ALA A 1 313 ? 31.033  107.735 12.029  1.00 16.06 ? 313  ALA A CA  1 
ATOM   2209 C  C   . ALA A 1 313 ? 31.768  107.126 10.834  1.00 15.97 ? 313  ALA A C   1 
ATOM   2210 O  O   . ALA A 1 313 ? 31.216  106.302 10.105  1.00 15.41 ? 313  ALA A O   1 
ATOM   2211 C  CB  . ALA A 1 313 ? 30.462  109.107 11.653  1.00 15.98 ? 313  ALA A CB  1 
ATOM   2212 N  N   . PHE A 1 314 ? 33.016  107.539 10.632  1.00 16.01 ? 314  PHE A N   1 
ATOM   2213 C  CA  . PHE A 1 314 ? 33.798  107.017 9.521   1.00 16.26 ? 314  PHE A CA  1 
ATOM   2214 C  C   . PHE A 1 314 ? 33.986  105.510 9.699   1.00 15.96 ? 314  PHE A C   1 
ATOM   2215 O  O   . PHE A 1 314 ? 33.918  104.752 8.734   1.00 16.29 ? 314  PHE A O   1 
ATOM   2216 C  CB  . PHE A 1 314 ? 35.168  107.700 9.446   1.00 16.78 ? 314  PHE A CB  1 
ATOM   2217 C  CG  . PHE A 1 314 ? 35.793  107.640 8.080   1.00 17.79 ? 314  PHE A CG  1 
ATOM   2218 C  CD1 . PHE A 1 314 ? 35.735  108.736 7.227   1.00 17.49 ? 314  PHE A CD1 1 
ATOM   2219 C  CD2 . PHE A 1 314 ? 36.398  106.472 7.627   1.00 18.64 ? 314  PHE A CD2 1 
ATOM   2220 C  CE1 . PHE A 1 314 ? 36.268  108.672 5.941   1.00 19.10 ? 314  PHE A CE1 1 
ATOM   2221 C  CE2 . PHE A 1 314 ? 36.935  106.395 6.337   1.00 18.86 ? 314  PHE A CE2 1 
ATOM   2222 C  CZ  . PHE A 1 314 ? 36.869  107.498 5.494   1.00 18.48 ? 314  PHE A CZ  1 
ATOM   2223 N  N   . LEU A 1 315 ? 34.231  105.084 10.937  1.00 15.63 ? 315  LEU A N   1 
ATOM   2224 C  CA  . LEU A 1 315 ? 34.408  103.664 11.235  1.00 16.12 ? 315  LEU A CA  1 
ATOM   2225 C  C   . LEU A 1 315 ? 33.150  102.883 10.870  1.00 15.82 ? 315  LEU A C   1 
ATOM   2226 O  O   . LEU A 1 315 ? 33.227  101.777 10.340  1.00 15.62 ? 315  LEU A O   1 
ATOM   2227 C  CB  . LEU A 1 315 ? 34.719  103.457 12.724  1.00 15.79 ? 315  LEU A CB  1 
ATOM   2228 C  CG  . LEU A 1 315 ? 36.106  103.894 13.208  1.00 16.76 ? 315  LEU A CG  1 
ATOM   2229 C  CD1 . LEU A 1 315 ? 36.191  103.785 14.722  1.00 16.31 ? 315  LEU A CD1 1 
ATOM   2230 C  CD2 . LEU A 1 315 ? 37.162  103.024 12.554  1.00 16.77 ? 315  LEU A CD2 1 
ATOM   2231 N  N   . VAL A 1 316 ? 31.987  103.454 11.163  1.00 15.54 ? 316  VAL A N   1 
ATOM   2232 C  CA  . VAL A 1 316 ? 30.738  102.782 10.838  1.00 15.57 ? 316  VAL A CA  1 
ATOM   2233 C  C   . VAL A 1 316 ? 30.628  102.644 9.321   1.00 16.28 ? 316  VAL A C   1 
ATOM   2234 O  O   . VAL A 1 316 ? 30.217  101.597 8.821   1.00 15.78 ? 316  VAL A O   1 
ATOM   2235 C  CB  . VAL A 1 316 ? 29.517  103.560 11.378  1.00 15.33 ? 316  VAL A CB  1 
ATOM   2236 C  CG1 . VAL A 1 316 ? 28.224  102.891 10.916  1.00 13.11 ? 316  VAL A CG1 1 
ATOM   2237 C  CG2 . VAL A 1 316 ? 29.570  103.613 12.900  1.00 15.40 ? 316  VAL A CG2 1 
ATOM   2238 N  N   . ASP A 1 317 ? 31.004  103.697 8.594   1.00 17.10 ? 317  ASP A N   1 
ATOM   2239 C  CA  . ASP A 1 317 ? 30.955  103.673 7.133   1.00 18.16 ? 317  ASP A CA  1 
ATOM   2240 C  C   . ASP A 1 317 ? 31.868  102.574 6.585   1.00 18.52 ? 317  ASP A C   1 
ATOM   2241 O  O   . ASP A 1 317 ? 31.521  101.895 5.616   1.00 17.88 ? 317  ASP A O   1 
ATOM   2242 C  CB  . ASP A 1 317 ? 31.389  105.019 6.539   1.00 19.96 ? 317  ASP A CB  1 
ATOM   2243 C  CG  . ASP A 1 317 ? 30.519  106.182 7.000   1.00 23.21 ? 317  ASP A CG  1 
ATOM   2244 O  OD1 . ASP A 1 317 ? 29.286  106.009 7.116   1.00 24.02 ? 317  ASP A OD1 1 
ATOM   2245 O  OD2 . ASP A 1 317 ? 31.074  107.281 7.231   1.00 24.73 ? 317  ASP A OD2 1 
ATOM   2246 N  N   . ILE A 1 318 ? 33.040  102.408 7.194   1.00 18.15 ? 318  ILE A N   1 
ATOM   2247 C  CA  . ILE A 1 318 ? 33.966  101.369 6.752   1.00 18.90 ? 318  ILE A CA  1 
ATOM   2248 C  C   . ILE A 1 318 ? 33.324  100.004 6.997   1.00 19.53 ? 318  ILE A C   1 
ATOM   2249 O  O   . ILE A 1 318 ? 33.277  99.159  6.105   1.00 19.14 ? 318  ILE A O   1 
ATOM   2250 C  CB  . ILE A 1 318 ? 35.319  101.444 7.509   1.00 18.64 ? 318  ILE A CB  1 
ATOM   2251 C  CG1 . ILE A 1 318 ? 36.070  102.717 7.110   1.00 18.77 ? 318  ILE A CG1 1 
ATOM   2252 C  CG2 . ILE A 1 318 ? 36.179  100.217 7.183   1.00 18.52 ? 318  ILE A CG2 1 
ATOM   2253 C  CD1 . ILE A 1 318 ? 37.378  102.938 7.875   1.00 17.86 ? 318  ILE A CD1 1 
ATOM   2254 N  N   . TYR A 1 319 ? 32.813  99.799  8.206   1.00 19.95 ? 319  TYR A N   1 
ATOM   2255 C  CA  . TYR A 1 319 ? 32.170  98.534  8.550   1.00 20.55 ? 319  TYR A CA  1 
ATOM   2256 C  C   . TYR A 1 319 ? 30.997  98.210  7.624   1.00 20.88 ? 319  TYR A C   1 
ATOM   2257 O  O   . TYR A 1 319 ? 30.821  97.056  7.233   1.00 20.60 ? 319  TYR A O   1 
ATOM   2258 C  CB  . TYR A 1 319 ? 31.703  98.566  10.007  1.00 20.42 ? 319  TYR A CB  1 
ATOM   2259 C  CG  . TYR A 1 319 ? 32.839  98.562  11.012  1.00 21.84 ? 319  TYR A CG  1 
ATOM   2260 C  CD1 . TYR A 1 319 ? 32.688  99.167  12.259  1.00 22.22 ? 319  TYR A CD1 1 
ATOM   2261 C  CD2 . TYR A 1 319 ? 34.062  97.949  10.721  1.00 21.83 ? 319  TYR A CD2 1 
ATOM   2262 C  CE1 . TYR A 1 319 ? 33.723  99.168  13.193  1.00 22.59 ? 319  TYR A CE1 1 
ATOM   2263 C  CE2 . TYR A 1 319 ? 35.106  97.943  11.653  1.00 22.64 ? 319  TYR A CE2 1 
ATOM   2264 C  CZ  . TYR A 1 319 ? 34.927  98.555  12.884  1.00 22.98 ? 319  TYR A CZ  1 
ATOM   2265 O  OH  . TYR A 1 319 ? 35.944  98.561  13.810  1.00 24.03 ? 319  TYR A OH  1 
ATOM   2266 N  N   . GLU A 1 320 ? 30.198  99.218  7.275   1.00 21.04 ? 320  GLU A N   1 
ATOM   2267 C  CA  . GLU A 1 320 ? 29.060  99.002  6.379   1.00 22.11 ? 320  GLU A CA  1 
ATOM   2268 C  C   . GLU A 1 320 ? 29.547  98.426  5.052   1.00 21.35 ? 320  GLU A C   1 
ATOM   2269 O  O   . GLU A 1 320 ? 29.001  97.440  4.549   1.00 21.02 ? 320  GLU A O   1 
ATOM   2270 C  CB  . GLU A 1 320 ? 28.324  100.312 6.071   1.00 23.54 ? 320  GLU A CB  1 
ATOM   2271 C  CG  . GLU A 1 320 ? 27.846  101.105 7.269   1.00 28.09 ? 320  GLU A CG  1 
ATOM   2272 C  CD  . GLU A 1 320 ? 27.139  102.393 6.863   1.00 30.39 ? 320  GLU A CD  1 
ATOM   2273 O  OE1 . GLU A 1 320 ? 27.573  103.030 5.878   1.00 32.05 ? 320  GLU A OE1 1 
ATOM   2274 O  OE2 . GLU A 1 320 ? 26.158  102.776 7.535   1.00 32.75 ? 320  GLU A OE2 1 
ATOM   2275 N  N   . ASP A 1 321 ? 30.563  99.061  4.478   1.00 20.57 ? 321  ASP A N   1 
ATOM   2276 C  CA  . ASP A 1 321 ? 31.102  98.605  3.201   1.00 20.61 ? 321  ASP A CA  1 
ATOM   2277 C  C   . ASP A 1 321 ? 31.697  97.206  3.327   1.00 20.19 ? 321  ASP A C   1 
ATOM   2278 O  O   . ASP A 1 321 ? 31.542  96.376  2.428   1.00 19.33 ? 321  ASP A O   1 
ATOM   2279 C  CB  . ASP A 1 321 ? 32.168  99.577  2.684   1.00 20.74 ? 321  ASP A CB  1 
ATOM   2280 C  CG  . ASP A 1 321 ? 32.459  99.380  1.205   1.00 21.53 ? 321  ASP A CG  1 
ATOM   2281 O  OD1 . ASP A 1 321 ? 31.501  99.461  0.408   1.00 21.78 ? 321  ASP A OD1 1 
ATOM   2282 O  OD2 . ASP A 1 321 ? 33.632  99.147  0.839   1.00 21.07 ? 321  ASP A OD2 1 
ATOM   2283 N  N   . MET A 1 322 ? 32.376  96.949  4.442   1.00 20.15 ? 322  MET A N   1 
ATOM   2284 C  CA  . MET A 1 322 ? 32.975  95.638  4.679   1.00 21.56 ? 322  MET A CA  1 
ATOM   2285 C  C   . MET A 1 322 ? 31.909  94.548  4.646   1.00 21.80 ? 322  MET A C   1 
ATOM   2286 O  O   . MET A 1 322 ? 32.079  93.521  3.991   1.00 21.36 ? 322  MET A O   1 
ATOM   2287 C  CB  . MET A 1 322 ? 33.692  95.606  6.033   1.00 21.83 ? 322  MET A CB  1 
ATOM   2288 C  CG  . MET A 1 322 ? 34.987  96.419  6.084   1.00 22.88 ? 322  MET A CG  1 
ATOM   2289 S  SD  . MET A 1 322 ? 35.837  96.286  7.676   1.00 23.80 ? 322  MET A SD  1 
ATOM   2290 C  CE  . MET A 1 322 ? 36.536  94.632  7.555   1.00 24.37 ? 322  MET A CE  1 
ATOM   2291 N  N   . LEU A 1 323 ? 30.813  94.777  5.360   1.00 22.27 ? 323  LEU A N   1 
ATOM   2292 C  CA  . LEU A 1 323 ? 29.721  93.812  5.417   1.00 23.45 ? 323  LEU A CA  1 
ATOM   2293 C  C   . LEU A 1 323 ? 29.065  93.637  4.053   1.00 25.10 ? 323  LEU A C   1 
ATOM   2294 O  O   . LEU A 1 323 ? 28.562  92.565  3.726   1.00 24.92 ? 323  LEU A O   1 
ATOM   2295 C  CB  . LEU A 1 323 ? 28.675  94.265  6.438   1.00 22.30 ? 323  LEU A CB  1 
ATOM   2296 C  CG  . LEU A 1 323 ? 29.137  94.308  7.899   1.00 21.64 ? 323  LEU A CG  1 
ATOM   2297 C  CD1 . LEU A 1 323 ? 28.086  94.990  8.755   1.00 21.46 ? 323  LEU A CD1 1 
ATOM   2298 C  CD2 . LEU A 1 323 ? 29.395  92.894  8.392   1.00 21.43 ? 323  LEU A CD2 1 
ATOM   2299 N  N   . GLU A 1 324 ? 29.075  94.701  3.261   1.00 27.49 ? 324  GLU A N   1 
ATOM   2300 C  CA  . GLU A 1 324 ? 28.476  94.676  1.936   1.00 30.56 ? 324  GLU A CA  1 
ATOM   2301 C  C   . GLU A 1 324 ? 29.390  93.952  0.952   1.00 31.88 ? 324  GLU A C   1 
ATOM   2302 O  O   . GLU A 1 324 ? 28.995  93.661  -0.177  1.00 31.80 ? 324  GLU A O   1 
ATOM   2303 C  CB  . GLU A 1 324 ? 28.229  96.109  1.458   1.00 32.27 ? 324  GLU A CB  1 
ATOM   2304 C  CG  . GLU A 1 324 ? 27.270  96.222  0.295   1.00 35.95 ? 324  GLU A CG  1 
ATOM   2305 C  CD  . GLU A 1 324 ? 25.860  95.818  0.674   1.00 37.84 ? 324  GLU A CD  1 
ATOM   2306 O  OE1 . GLU A 1 324 ? 25.274  96.473  1.561   1.00 39.49 ? 324  GLU A OE1 1 
ATOM   2307 O  OE2 . GLU A 1 324 ? 25.340  94.846  0.089   1.00 39.47 ? 324  GLU A OE2 1 
ATOM   2308 N  N   . ASN A 1 325 ? 30.610  93.654  1.389   1.00 33.10 ? 325  ASN A N   1 
ATOM   2309 C  CA  . ASN A 1 325 ? 31.581  92.974  0.540   1.00 35.37 ? 325  ASN A CA  1 
ATOM   2310 C  C   . ASN A 1 325 ? 32.062  91.637  1.080   1.00 36.93 ? 325  ASN A C   1 
ATOM   2311 O  O   . ASN A 1 325 ? 33.238  91.296  0.946   1.00 37.37 ? 325  ASN A O   1 
ATOM   2312 C  CB  . ASN A 1 325 ? 32.784  93.884  0.292   1.00 34.93 ? 325  ASN A CB  1 
ATOM   2313 C  CG  . ASN A 1 325 ? 32.512  94.921  -0.773  1.00 35.26 ? 325  ASN A CG  1 
ATOM   2314 O  OD1 . ASN A 1 325 ? 32.407  94.596  -1.956  1.00 35.55 ? 325  ASN A OD1 1 
ATOM   2315 N  ND2 . ASN A 1 325 ? 32.386  96.176  -0.361  1.00 34.81 ? 325  ASN A ND2 1 
ATOM   2316 N  N   . GLN A 1 326 ? 31.153  90.886  1.693   1.00 38.53 ? 326  GLN A N   1 
ATOM   2317 C  CA  . GLN A 1 326 ? 31.476  89.570  2.230   1.00 40.19 ? 326  GLN A CA  1 
ATOM   2318 C  C   . GLN A 1 326 ? 32.797  89.536  2.992   1.00 40.19 ? 326  GLN A C   1 
ATOM   2319 O  O   . GLN A 1 326 ? 33.644  88.681  2.739   1.00 40.15 ? 326  GLN A O   1 
ATOM   2320 C  CB  . GLN A 1 326 ? 31.526  88.549  1.089   1.00 41.70 ? 326  GLN A CB  1 
ATOM   2321 C  CG  . GLN A 1 326 ? 30.212  88.378  0.338   1.00 43.92 ? 326  GLN A CG  1 
ATOM   2322 C  CD  . GLN A 1 326 ? 29.112  87.800  1.208   1.00 45.01 ? 326  GLN A CD  1 
ATOM   2323 O  OE1 . GLN A 1 326 ? 28.680  88.422  2.180   1.00 46.49 ? 326  GLN A OE1 1 
ATOM   2324 N  NE2 . GLN A 1 326 ? 28.657  86.599  0.866   1.00 45.73 ? 326  GLN A NE2 1 
ATOM   2325 N  N   . CYS A 1 327 ? 32.973  90.465  3.924   1.00 40.34 ? 327  CYS A N   1 
ATOM   2326 C  CA  . CYS A 1 327 ? 34.198  90.512  4.708   1.00 39.97 ? 327  CYS A CA  1 
ATOM   2327 C  C   . CYS A 1 327 ? 34.284  89.279  5.600   1.00 40.55 ? 327  CYS A C   1 
ATOM   2328 O  O   . CYS A 1 327 ? 33.307  88.544  5.762   1.00 40.20 ? 327  CYS A O   1 
ATOM   2329 C  CB  . CYS A 1 327 ? 34.223  91.767  5.582   1.00 39.83 ? 327  CYS A CB  1 
ATOM   2330 S  SG  . CYS A 1 327 ? 32.985  91.771  6.905   1.00 37.83 ? 327  CYS A SG  1 
ATOM   2331 N  N   . ASP A 1 328 ? 35.459  89.059  6.179   1.00 40.94 ? 328  ASP A N   1 
ATOM   2332 C  CA  . ASP A 1 328 ? 35.663  87.926  7.069   1.00 41.31 ? 328  ASP A CA  1 
ATOM   2333 C  C   . ASP A 1 328 ? 35.212  88.361  8.461   1.00 40.49 ? 328  ASP A C   1 
ATOM   2334 O  O   . ASP A 1 328 ? 35.199  89.555  8.766   1.00 40.19 ? 328  ASP A O   1 
ATOM   2335 C  CB  . ASP A 1 328 ? 37.141  87.539  7.098   1.00 43.62 ? 328  ASP A CB  1 
ATOM   2336 C  CG  . ASP A 1 328 ? 37.352  86.092  7.490   1.00 45.61 ? 328  ASP A CG  1 
ATOM   2337 O  OD1 . ASP A 1 328 ? 36.798  85.668  8.528   1.00 47.02 ? 328  ASP A OD1 1 
ATOM   2338 O  OD2 . ASP A 1 328 ? 38.073  85.379  6.758   1.00 46.95 ? 328  ASP A OD2 1 
ATOM   2339 N  N   . ASN A 1 329 ? 34.840  87.400  9.301   1.00 39.18 ? 329  ASN A N   1 
ATOM   2340 C  CA  . ASN A 1 329 ? 34.384  87.710  10.654  1.00 37.98 ? 329  ASN A CA  1 
ATOM   2341 C  C   . ASN A 1 329 ? 33.200  88.673  10.597  1.00 36.25 ? 329  ASN A C   1 
ATOM   2342 O  O   . ASN A 1 329 ? 33.162  89.675  11.311  1.00 35.38 ? 329  ASN A O   1 
ATOM   2343 C  CB  . ASN A 1 329 ? 35.521  88.337  11.468  1.00 38.82 ? 329  ASN A CB  1 
ATOM   2344 C  CG  . ASN A 1 329 ? 36.734  87.430  11.567  1.00 40.28 ? 329  ASN A CG  1 
ATOM   2345 O  OD1 . ASN A 1 329 ? 36.624  86.267  11.965  1.00 41.14 ? 329  ASN A OD1 1 
ATOM   2346 N  ND2 . ASN A 1 329 ? 37.901  87.959  11.208  1.00 40.17 ? 329  ASN A ND2 1 
ATOM   2347 N  N   . LYS A 1 330 ? 32.235  88.347  9.745   1.00 34.61 ? 330  LYS A N   1 
ATOM   2348 C  CA  . LYS A 1 330 ? 31.042  89.162  9.556   1.00 33.76 ? 330  LYS A CA  1 
ATOM   2349 C  C   . LYS A 1 330 ? 30.314  89.492  10.860  1.00 32.37 ? 330  LYS A C   1 
ATOM   2350 O  O   . LYS A 1 330 ? 30.000  90.652  11.122  1.00 31.69 ? 330  LYS A O   1 
ATOM   2351 C  CB  . LYS A 1 330 ? 30.083  88.447  8.602   1.00 34.54 ? 330  LYS A CB  1 
ATOM   2352 C  CG  . LYS A 1 330 ? 29.045  89.347  7.969   1.00 36.34 ? 330  LYS A CG  1 
ATOM   2353 C  CD  . LYS A 1 330 ? 28.233  88.590  6.926   1.00 37.91 ? 330  LYS A CD  1 
ATOM   2354 C  CE  . LYS A 1 330 ? 27.704  89.533  5.854   1.00 38.73 ? 330  LYS A CE  1 
ATOM   2355 N  NZ  . LYS A 1 330 ? 28.824  90.189  5.119   1.00 38.59 ? 330  LYS A NZ  1 
ATOM   2356 N  N   . GLU A 1 331 ? 30.044  88.473  11.672  1.00 31.13 ? 331  GLU A N   1 
ATOM   2357 C  CA  . GLU A 1 331 ? 29.340  88.674  12.935  1.00 30.52 ? 331  GLU A CA  1 
ATOM   2358 C  C   . GLU A 1 331 ? 30.052  89.672  13.839  1.00 29.20 ? 331  GLU A C   1 
ATOM   2359 O  O   . GLU A 1 331 ? 29.412  90.504  14.485  1.00 28.56 ? 331  GLU A O   1 
ATOM   2360 C  CB  . GLU A 1 331 ? 29.175  87.341  13.673  1.00 32.03 ? 331  GLU A CB  1 
ATOM   2361 C  CG  . GLU A 1 331 ? 28.262  86.351  12.964  1.00 34.31 ? 331  GLU A CG  1 
ATOM   2362 C  CD  . GLU A 1 331 ? 26.825  86.843  12.849  1.00 36.56 ? 331  GLU A CD  1 
ATOM   2363 O  OE1 . GLU A 1 331 ? 26.045  86.210  12.105  1.00 38.27 ? 331  GLU A OE1 1 
ATOM   2364 O  OE2 . GLU A 1 331 ? 26.469  87.853  13.499  1.00 37.14 ? 331  GLU A OE2 1 
ATOM   2365 N  N   . ASP A 1 332 ? 31.376  89.586  13.881  1.00 27.62 ? 332  ASP A N   1 
ATOM   2366 C  CA  . ASP A 1 332 ? 32.176  90.481  14.703  1.00 26.58 ? 332  ASP A CA  1 
ATOM   2367 C  C   . ASP A 1 332 ? 32.082  91.915  14.189  1.00 24.82 ? 332  ASP A C   1 
ATOM   2368 O  O   . ASP A 1 332 ? 31.931  92.860  14.968  1.00 23.42 ? 332  ASP A O   1 
ATOM   2369 C  CB  . ASP A 1 332 ? 33.638  90.033  14.699  1.00 28.35 ? 332  ASP A CB  1 
ATOM   2370 C  CG  . ASP A 1 332 ? 34.513  90.910  15.567  1.00 30.44 ? 332  ASP A CG  1 
ATOM   2371 O  OD1 . ASP A 1 332 ? 34.259  90.966  16.790  1.00 32.57 ? 332  ASP A OD1 1 
ATOM   2372 O  OD2 . ASP A 1 332 ? 35.451  91.545  15.031  1.00 31.38 ? 332  ASP A OD2 1 
ATOM   2373 N  N   . ILE A 1 333 ? 32.179  92.067  12.872  1.00 22.35 ? 333  ILE A N   1 
ATOM   2374 C  CA  . ILE A 1 333 ? 32.106  93.378  12.247  1.00 20.58 ? 333  ILE A CA  1 
ATOM   2375 C  C   . ILE A 1 333 ? 30.734  94.002  12.487  1.00 19.45 ? 333  ILE A C   1 
ATOM   2376 O  O   . ILE A 1 333 ? 30.628  95.186  12.814  1.00 18.66 ? 333  ILE A O   1 
ATOM   2377 C  CB  . ILE A 1 333 ? 32.368  93.276  10.731  1.00 21.10 ? 333  ILE A CB  1 
ATOM   2378 C  CG1 . ILE A 1 333 ? 33.812  92.817  10.492  1.00 21.42 ? 333  ILE A CG1 1 
ATOM   2379 C  CG2 . ILE A 1 333 ? 32.094  94.618  10.052  1.00 20.19 ? 333  ILE A CG2 1 
ATOM   2380 C  CD1 . ILE A 1 333 ? 34.871  93.741  11.086  1.00 21.29 ? 333  ILE A CD1 1 
ATOM   2381 N  N   . LEU A 1 334 ? 29.687  93.199  12.331  1.00 18.29 ? 334  LEU A N   1 
ATOM   2382 C  CA  . LEU A 1 334 ? 28.324  93.675  12.534  1.00 17.72 ? 334  LEU A CA  1 
ATOM   2383 C  C   . LEU A 1 334 ? 28.133  94.150  13.975  1.00 17.84 ? 334  LEU A C   1 
ATOM   2384 O  O   . LEU A 1 334 ? 27.511  95.181  14.225  1.00 16.11 ? 334  LEU A O   1 
ATOM   2385 C  CB  . LEU A 1 334 ? 27.319  92.562  12.220  1.00 17.01 ? 334  LEU A CB  1 
ATOM   2386 C  CG  . LEU A 1 334 ? 25.855  92.905  12.525  1.00 17.30 ? 334  LEU A CG  1 
ATOM   2387 C  CD1 . LEU A 1 334 ? 25.454  94.164  11.755  1.00 17.10 ? 334  LEU A CD1 1 
ATOM   2388 C  CD2 . LEU A 1 334 ? 24.957  91.729  12.159  1.00 16.61 ? 334  LEU A CD2 1 
ATOM   2389 N  N   . ASN A 1 335 ? 28.671  93.388  14.921  1.00 18.53 ? 335  ASN A N   1 
ATOM   2390 C  CA  . ASN A 1 335 ? 28.556  93.743  16.325  1.00 19.78 ? 335  ASN A CA  1 
ATOM   2391 C  C   . ASN A 1 335 ? 29.281  95.057  16.624  1.00 19.13 ? 335  ASN A C   1 
ATOM   2392 O  O   . ASN A 1 335 ? 28.776  95.887  17.377  1.00 18.79 ? 335  ASN A O   1 
ATOM   2393 C  CB  . ASN A 1 335 ? 29.104  92.609  17.200  1.00 22.67 ? 335  ASN A CB  1 
ATOM   2394 C  CG  . ASN A 1 335 ? 29.133  92.971  18.671  1.00 25.51 ? 335  ASN A CG  1 
ATOM   2395 O  OD1 . ASN A 1 335 ? 30.151  93.432  19.191  1.00 28.01 ? 335  ASN A OD1 1 
ATOM   2396 N  ND2 . ASN A 1 335 ? 28.006  92.782  19.349  1.00 28.18 ? 335  ASN A ND2 1 
ATOM   2397 N  N   . LYS A 1 336 ? 30.456  95.248  16.027  1.00 18.97 ? 336  LYS A N   1 
ATOM   2398 C  CA  . LYS A 1 336 ? 31.225  96.478  16.225  1.00 18.58 ? 336  LYS A CA  1 
ATOM   2399 C  C   . LYS A 1 336 ? 30.428  97.658  15.659  1.00 17.61 ? 336  LYS A C   1 
ATOM   2400 O  O   . LYS A 1 336 ? 30.282  98.696  16.303  1.00 16.63 ? 336  LYS A O   1 
ATOM   2401 C  CB  . LYS A 1 336 ? 32.569  96.407  15.489  1.00 20.20 ? 336  LYS A CB  1 
ATOM   2402 C  CG  . LYS A 1 336 ? 33.497  95.266  15.895  1.00 23.07 ? 336  LYS A CG  1 
ATOM   2403 C  CD  . LYS A 1 336 ? 34.108  95.479  17.260  1.00 25.39 ? 336  LYS A CD  1 
ATOM   2404 C  CE  . LYS A 1 336 ? 35.127  94.382  17.578  1.00 27.39 ? 336  LYS A CE  1 
ATOM   2405 N  NZ  . LYS A 1 336 ? 36.225  94.314  16.563  1.00 28.25 ? 336  LYS A NZ  1 
ATOM   2406 N  N   . ALA A 1 337 ? 29.922  97.486  14.442  1.00 16.63 ? 337  ALA A N   1 
ATOM   2407 C  CA  . ALA A 1 337 ? 29.156  98.532  13.778  1.00 16.44 ? 337  ALA A CA  1 
ATOM   2408 C  C   . ALA A 1 337 ? 27.934  98.936  14.596  1.00 16.45 ? 337  ALA A C   1 
ATOM   2409 O  O   . ALA A 1 337 ? 27.671  100.123 14.781  1.00 16.66 ? 337  ALA A O   1 
ATOM   2410 C  CB  . ALA A 1 337 ? 28.731  98.066  12.393  1.00 15.95 ? 337  ALA A CB  1 
ATOM   2411 N  N   . LEU A 1 338 ? 27.198  97.947  15.096  1.00 16.55 ? 338  LEU A N   1 
ATOM   2412 C  CA  . LEU A 1 338 ? 26.002  98.217  15.890  1.00 17.67 ? 338  LEU A CA  1 
ATOM   2413 C  C   . LEU A 1 338 ? 26.324  98.919  17.206  1.00 17.84 ? 338  LEU A C   1 
ATOM   2414 O  O   . LEU A 1 338 ? 25.581  99.797  17.641  1.00 16.98 ? 338  LEU A O   1 
ATOM   2415 C  CB  . LEU A 1 338 ? 25.240  96.915  16.158  1.00 17.76 ? 338  LEU A CB  1 
ATOM   2416 C  CG  . LEU A 1 338 ? 24.681  96.244  14.897  1.00 18.43 ? 338  LEU A CG  1 
ATOM   2417 C  CD1 . LEU A 1 338 ? 24.052  94.903  15.255  1.00 18.50 ? 338  LEU A CD1 1 
ATOM   2418 C  CD2 . LEU A 1 338 ? 23.656  97.162  14.242  1.00 18.45 ? 338  LEU A CD2 1 
ATOM   2419 N  N   . GLU A 1 339 ? 27.429  98.538  17.842  1.00 19.08 ? 339  GLU A N   1 
ATOM   2420 C  CA  . GLU A 1 339 ? 27.817  99.175  19.096  1.00 19.95 ? 339  GLU A CA  1 
ATOM   2421 C  C   . GLU A 1 339 ? 28.117  100.653 18.839  1.00 18.80 ? 339  GLU A C   1 
ATOM   2422 O  O   . GLU A 1 339 ? 27.732  101.517 19.624  1.00 18.56 ? 339  GLU A O   1 
ATOM   2423 C  CB  . GLU A 1 339 ? 29.055  98.493  19.695  1.00 22.76 ? 339  GLU A CB  1 
ATOM   2424 C  CG  . GLU A 1 339 ? 28.838  97.035  20.085  1.00 28.16 ? 339  GLU A CG  1 
ATOM   2425 C  CD  . GLU A 1 339 ? 30.059  96.415  20.755  1.00 30.91 ? 339  GLU A CD  1 
ATOM   2426 O  OE1 . GLU A 1 339 ? 31.175  96.552  20.208  1.00 33.37 ? 339  GLU A OE1 1 
ATOM   2427 O  OE2 . GLU A 1 339 ? 29.900  95.785  21.824  1.00 32.26 ? 339  GLU A OE2 1 
ATOM   2428 N  N   . LEU A 1 340 ? 28.799  100.943 17.734  1.00 18.16 ? 340  LEU A N   1 
ATOM   2429 C  CA  . LEU A 1 340 ? 29.133  102.328 17.401  1.00 17.93 ? 340  LEU A CA  1 
ATOM   2430 C  C   . LEU A 1 340 ? 27.894  103.151 17.045  1.00 17.50 ? 340  LEU A C   1 
ATOM   2431 O  O   . LEU A 1 340 ? 27.812  104.331 17.387  1.00 17.55 ? 340  LEU A O   1 
ATOM   2432 C  CB  . LEU A 1 340 ? 30.144  102.382 16.251  1.00 17.09 ? 340  LEU A CB  1 
ATOM   2433 C  CG  . LEU A 1 340 ? 31.534  101.800 16.532  1.00 17.06 ? 340  LEU A CG  1 
ATOM   2434 C  CD1 . LEU A 1 340 ? 32.464  102.132 15.370  1.00 16.80 ? 340  LEU A CD1 1 
ATOM   2435 C  CD2 . LEU A 1 340 ? 32.092  102.376 17.833  1.00 16.85 ? 340  LEU A CD2 1 
ATOM   2436 N  N   . CYS A 1 341 ? 26.938  102.538 16.353  1.00 17.76 ? 341  CYS A N   1 
ATOM   2437 C  CA  . CYS A 1 341 ? 25.703  103.240 16.000  1.00 18.12 ? 341  CYS A CA  1 
ATOM   2438 C  C   . CYS A 1 341 ? 24.987  103.645 17.289  1.00 19.01 ? 341  CYS A C   1 
ATOM   2439 O  O   . CYS A 1 341 ? 24.437  104.740 17.391  1.00 18.92 ? 341  CYS A O   1 
ATOM   2440 C  CB  . CYS A 1 341 ? 24.778  102.341 15.166  1.00 17.74 ? 341  CYS A CB  1 
ATOM   2441 S  SG  . CYS A 1 341 ? 25.281  102.113 13.440  1.00 17.42 ? 341  CYS A SG  1 
ATOM   2442 N  N   . GLU A 1 342 ? 25.003  102.748 18.271  1.00 20.02 ? 342  GLU A N   1 
ATOM   2443 C  CA  . GLU A 1 342 ? 24.369  102.999 19.559  1.00 21.32 ? 342  GLU A CA  1 
ATOM   2444 C  C   . GLU A 1 342 ? 25.092  104.141 20.267  1.00 20.38 ? 342  GLU A C   1 
ATOM   2445 O  O   . GLU A 1 342 ? 24.464  105.071 20.776  1.00 19.51 ? 342  GLU A O   1 
ATOM   2446 C  CB  . GLU A 1 342 ? 24.427  101.736 20.419  1.00 24.08 ? 342  GLU A CB  1 
ATOM   2447 C  CG  . GLU A 1 342 ? 23.096  101.321 21.022  1.00 28.89 ? 342  GLU A CG  1 
ATOM   2448 C  CD  . GLU A 1 342 ? 22.555  102.329 22.013  1.00 31.09 ? 342  GLU A CD  1 
ATOM   2449 O  OE1 . GLU A 1 342 ? 23.263  102.635 22.997  1.00 33.89 ? 342  GLU A OE1 1 
ATOM   2450 O  OE2 . GLU A 1 342 ? 21.419  102.812 21.815  1.00 32.07 ? 342  GLU A OE2 1 
ATOM   2451 N  N   . ILE A 1 343 ? 26.419  104.066 20.292  1.00 19.62 ? 343  ILE A N   1 
ATOM   2452 C  CA  . ILE A 1 343 ? 27.232  105.100 20.924  1.00 19.63 ? 343  ILE A CA  1 
ATOM   2453 C  C   . ILE A 1 343 ? 26.961  106.463 20.282  1.00 18.62 ? 343  ILE A C   1 
ATOM   2454 O  O   . ILE A 1 343 ? 26.838  107.474 20.969  1.00 17.49 ? 343  ILE A O   1 
ATOM   2455 C  CB  . ILE A 1 343 ? 28.740  104.762 20.802  1.00 20.31 ? 343  ILE A CB  1 
ATOM   2456 C  CG1 . ILE A 1 343 ? 29.090  103.639 21.784  1.00 21.67 ? 343  ILE A CG1 1 
ATOM   2457 C  CG2 . ILE A 1 343 ? 29.590  106.000 21.049  1.00 20.61 ? 343  ILE A CG2 1 
ATOM   2458 C  CD1 . ILE A 1 343 ? 30.541  103.199 21.729  1.00 22.66 ? 343  ILE A CD1 1 
ATOM   2459 N  N   . LEU A 1 344 ? 26.865  106.481 18.959  1.00 17.64 ? 344  LEU A N   1 
ATOM   2460 C  CA  . LEU A 1 344 ? 26.607  107.720 18.243  1.00 17.24 ? 344  LEU A CA  1 
ATOM   2461 C  C   . LEU A 1 344 ? 25.214  108.260 18.550  1.00 17.16 ? 344  LEU A C   1 
ATOM   2462 O  O   . LEU A 1 344 ? 25.048  109.445 18.818  1.00 16.78 ? 344  LEU A O   1 
ATOM   2463 C  CB  . LEU A 1 344 ? 26.757  107.489 16.738  1.00 17.15 ? 344  LEU A CB  1 
ATOM   2464 C  CG  . LEU A 1 344 ? 28.196  107.303 16.246  1.00 16.81 ? 344  LEU A CG  1 
ATOM   2465 C  CD1 . LEU A 1 344 ? 28.203  106.640 14.881  1.00 16.46 ? 344  LEU A CD1 1 
ATOM   2466 C  CD2 . LEU A 1 344 ? 28.895  108.657 16.198  1.00 16.32 ? 344  LEU A CD2 1 
ATOM   2467 N  N   . ALA A 1 345 ? 24.219  107.380 18.532  1.00 17.51 ? 345  ALA A N   1 
ATOM   2468 C  CA  . ALA A 1 345 ? 22.836  107.781 18.777  1.00 18.61 ? 345  ALA A CA  1 
ATOM   2469 C  C   . ALA A 1 345 ? 22.547  108.245 20.199  1.00 19.29 ? 345  ALA A C   1 
ATOM   2470 O  O   . ALA A 1 345 ? 21.751  109.161 20.413  1.00 18.73 ? 345  ALA A O   1 
ATOM   2471 C  CB  . ALA A 1 345 ? 21.898  106.633 18.422  1.00 18.11 ? 345  ALA A CB  1 
ATOM   2472 N  N   . LYS A 1 346 ? 23.204  107.617 21.164  1.00 19.85 ? 346  LYS A N   1 
ATOM   2473 C  CA  . LYS A 1 346 ? 22.980  107.919 22.570  1.00 21.42 ? 346  LYS A CA  1 
ATOM   2474 C  C   . LYS A 1 346 ? 23.924  108.934 23.203  1.00 21.12 ? 346  LYS A C   1 
ATOM   2475 O  O   . LYS A 1 346 ? 23.560  109.599 24.173  1.00 20.36 ? 346  LYS A O   1 
ATOM   2476 C  CB  . LYS A 1 346 ? 23.050  106.613 23.371  1.00 23.45 ? 346  LYS A CB  1 
ATOM   2477 C  CG  . LYS A 1 346 ? 22.834  106.763 24.871  1.00 27.26 ? 346  LYS A CG  1 
ATOM   2478 C  CD  . LYS A 1 346 ? 21.368  107.012 25.208  1.00 30.10 ? 346  LYS A CD  1 
ATOM   2479 C  CE  . LYS A 1 346 ? 20.497  105.837 24.775  1.00 31.90 ? 346  LYS A CE  1 
ATOM   2480 N  NZ  . LYS A 1 346 ? 20.919  104.563 25.428  1.00 33.15 ? 346  LYS A NZ  1 
ATOM   2481 N  N   . GLU A 1 347 ? 25.129  109.071 22.667  1.00 20.95 ? 347  GLU A N   1 
ATOM   2482 C  CA  . GLU A 1 347 ? 26.074  109.985 23.291  1.00 22.06 ? 347  GLU A CA  1 
ATOM   2483 C  C   . GLU A 1 347 ? 26.914  110.920 22.431  1.00 20.49 ? 347  GLU A C   1 
ATOM   2484 O  O   . GLU A 1 347 ? 26.965  112.124 22.692  1.00 20.13 ? 347  GLU A O   1 
ATOM   2485 C  CB  . GLU A 1 347 ? 27.019  109.176 24.187  1.00 24.48 ? 347  GLU A CB  1 
ATOM   2486 C  CG  . GLU A 1 347 ? 28.213  109.962 24.701  1.00 29.70 ? 347  GLU A CG  1 
ATOM   2487 C  CD  . GLU A 1 347 ? 29.227  109.084 25.410  1.00 32.80 ? 347  GLU A CD  1 
ATOM   2488 O  OE1 . GLU A 1 347 ? 30.320  109.593 25.742  1.00 34.45 ? 347  GLU A OE1 1 
ATOM   2489 O  OE2 . GLU A 1 347 ? 28.928  107.889 25.636  1.00 34.54 ? 347  GLU A OE2 1 
ATOM   2490 N  N   . LYS A 1 348 ? 27.574  110.375 21.417  1.00 19.26 ? 348  LYS A N   1 
ATOM   2491 C  CA  . LYS A 1 348 ? 28.472  111.178 20.595  1.00 19.08 ? 348  LYS A CA  1 
ATOM   2492 C  C   . LYS A 1 348 ? 27.909  111.969 19.422  1.00 17.83 ? 348  LYS A C   1 
ATOM   2493 O  O   . LYS A 1 348 ? 28.557  112.897 18.941  1.00 17.37 ? 348  LYS A O   1 
ATOM   2494 C  CB  . LYS A 1 348 ? 29.628  110.298 20.113  1.00 20.93 ? 348  LYS A CB  1 
ATOM   2495 C  CG  . LYS A 1 348 ? 30.533  109.826 21.246  1.00 24.11 ? 348  LYS A CG  1 
ATOM   2496 C  CD  . LYS A 1 348 ? 31.711  109.015 20.721  1.00 26.92 ? 348  LYS A CD  1 
ATOM   2497 C  CE  . LYS A 1 348 ? 32.670  108.627 21.846  1.00 28.42 ? 348  LYS A CE  1 
ATOM   2498 N  NZ  . LYS A 1 348 ? 33.359  109.814 22.436  1.00 30.55 ? 348  LYS A NZ  1 
ATOM   2499 N  N   . ASP A 1 349 ? 26.716  111.624 18.957  1.00 16.47 ? 349  ASP A N   1 
ATOM   2500 C  CA  . ASP A 1 349 ? 26.135  112.351 17.832  1.00 15.41 ? 349  ASP A CA  1 
ATOM   2501 C  C   . ASP A 1 349 ? 24.618  112.265 17.931  1.00 14.36 ? 349  ASP A C   1 
ATOM   2502 O  O   . ASP A 1 349 ? 23.935  111.925 16.965  1.00 13.11 ? 349  ASP A O   1 
ATOM   2503 C  CB  . ASP A 1 349 ? 26.650  111.738 16.522  1.00 15.79 ? 349  ASP A CB  1 
ATOM   2504 C  CG  . ASP A 1 349 ? 26.478  112.662 15.333  1.00 16.63 ? 349  ASP A CG  1 
ATOM   2505 O  OD1 . ASP A 1 349 ? 26.514  113.894 15.528  1.00 16.70 ? 349  ASP A OD1 1 
ATOM   2506 O  OD2 . ASP A 1 349 ? 26.327  112.155 14.200  1.00 15.17 ? 349  ASP A OD2 1 
ATOM   2507 N  N   . THR A 1 350 ? 24.102  112.600 19.113  1.00 14.12 ? 350  THR A N   1 
ATOM   2508 C  CA  . THR A 1 350 ? 22.673  112.531 19.394  1.00 13.21 ? 350  THR A CA  1 
ATOM   2509 C  C   . THR A 1 350 ? 21.776  113.345 18.474  1.00 13.03 ? 350  THR A C   1 
ATOM   2510 O  O   . THR A 1 350 ? 20.614  112.996 18.297  1.00 13.31 ? 350  THR A O   1 
ATOM   2511 C  CB  . THR A 1 350 ? 22.361  112.928 20.866  1.00 13.38 ? 350  THR A CB  1 
ATOM   2512 O  OG1 . THR A 1 350 ? 22.671  114.314 21.076  1.00 13.90 ? 350  THR A OG1 1 
ATOM   2513 C  CG2 . THR A 1 350 ? 23.183  112.075 21.832  1.00 12.82 ? 350  THR A CG2 1 
ATOM   2514 N  N   . ILE A 1 351 ? 22.291  114.418 17.882  1.00 12.43 ? 351  ILE A N   1 
ATOM   2515 C  CA  . ILE A 1 351 ? 21.453  115.211 16.988  1.00 12.54 ? 351  ILE A CA  1 
ATOM   2516 C  C   . ILE A 1 351 ? 21.014  114.334 15.811  1.00 13.00 ? 351  ILE A C   1 
ATOM   2517 O  O   . ILE A 1 351 ? 19.955  114.552 15.217  1.00 13.09 ? 351  ILE A O   1 
ATOM   2518 C  CB  . ILE A 1 351 ? 22.194  116.469 16.450  1.00 12.54 ? 351  ILE A CB  1 
ATOM   2519 C  CG1 . ILE A 1 351 ? 21.185  117.418 15.794  1.00 12.36 ? 351  ILE A CG1 1 
ATOM   2520 C  CG2 . ILE A 1 351 ? 23.273  116.075 15.438  1.00 11.23 ? 351  ILE A CG2 1 
ATOM   2521 C  CD1 . ILE A 1 351 ? 20.262  118.121 16.785  1.00 11.28 ? 351  ILE A CD1 1 
ATOM   2522 N  N   . ARG A 1 352 ? 21.823  113.329 15.490  1.00 13.07 ? 352  ARG A N   1 
ATOM   2523 C  CA  . ARG A 1 352 ? 21.513  112.424 14.389  1.00 13.83 ? 352  ARG A CA  1 
ATOM   2524 C  C   . ARG A 1 352 ? 21.049  111.049 14.877  1.00 14.29 ? 352  ARG A C   1 
ATOM   2525 O  O   . ARG A 1 352 ? 21.243  110.038 14.201  1.00 14.43 ? 352  ARG A O   1 
ATOM   2526 C  CB  . ARG A 1 352 ? 22.737  112.284 13.474  1.00 14.17 ? 352  ARG A CB  1 
ATOM   2527 C  CG  . ARG A 1 352 ? 22.882  113.430 12.466  1.00 15.00 ? 352  ARG A CG  1 
ATOM   2528 C  CD  . ARG A 1 352 ? 24.271  113.485 11.850  1.00 15.97 ? 352  ARG A CD  1 
ATOM   2529 N  NE  . ARG A 1 352 ? 25.225  114.181 12.716  1.00 17.36 ? 352  ARG A NE  1 
ATOM   2530 C  CZ  . ARG A 1 352 ? 25.283  115.505 12.874  1.00 17.22 ? 352  ARG A CZ  1 
ATOM   2531 N  NH1 . ARG A 1 352 ? 24.441  116.306 12.222  1.00 16.64 ? 352  ARG A NH1 1 
ATOM   2532 N  NH2 . ARG A 1 352 ? 26.188  116.033 13.688  1.00 16.00 ? 352  ARG A NH2 1 
ATOM   2533 N  N   . LYS A 1 353 ? 20.416  111.025 16.045  1.00 14.82 ? 353  LYS A N   1 
ATOM   2534 C  CA  . LYS A 1 353 ? 19.926  109.785 16.634  1.00 15.67 ? 353  LYS A CA  1 
ATOM   2535 C  C   . LYS A 1 353 ? 19.050  108.968 15.679  1.00 15.22 ? 353  LYS A C   1 
ATOM   2536 O  O   . LYS A 1 353 ? 19.231  107.756 15.560  1.00 13.37 ? 353  LYS A O   1 
ATOM   2537 C  CB  . LYS A 1 353 ? 19.148  110.083 17.921  1.00 17.61 ? 353  LYS A CB  1 
ATOM   2538 C  CG  . LYS A 1 353 ? 17.798  110.773 17.702  1.00 21.49 ? 353  LYS A CG  1 
ATOM   2539 C  CD  . LYS A 1 353 ? 17.224  111.319 19.012  1.00 24.19 ? 353  LYS A CD  1 
ATOM   2540 C  CE  . LYS A 1 353 ? 15.781  111.787 18.863  1.00 25.13 ? 353  LYS A CE  1 
ATOM   2541 N  NZ  . LYS A 1 353 ? 15.573  112.712 17.703  1.00 26.36 ? 353  LYS A NZ  1 
ATOM   2542 N  N   . GLU A 1 354 ? 18.103  109.618 15.006  1.00 14.59 ? 354  GLU A N   1 
ATOM   2543 C  CA  . GLU A 1 354 ? 17.225  108.899 14.081  1.00 15.45 ? 354  GLU A CA  1 
ATOM   2544 C  C   . GLU A 1 354 ? 18.007  108.284 12.928  1.00 15.46 ? 354  GLU A C   1 
ATOM   2545 O  O   . GLU A 1 354 ? 17.710  107.170 12.492  1.00 15.92 ? 354  GLU A O   1 
ATOM   2546 C  CB  . GLU A 1 354 ? 16.135  109.820 13.526  1.00 16.07 ? 354  GLU A CB  1 
ATOM   2547 C  CG  . GLU A 1 354 ? 14.978  110.073 14.480  1.00 17.83 ? 354  GLU A CG  1 
ATOM   2548 C  CD  . GLU A 1 354 ? 14.332  108.788 14.992  1.00 18.78 ? 354  GLU A CD  1 
ATOM   2549 O  OE1 . GLU A 1 354 ? 14.071  107.867 14.186  1.00 18.02 ? 354  GLU A OE1 1 
ATOM   2550 O  OE2 . GLU A 1 354 ? 14.071  108.704 16.208  1.00 20.02 ? 354  GLU A OE2 1 
ATOM   2551 N  N   . TYR A 1 355 ? 19.003  109.009 12.430  1.00 15.12 ? 355  TYR A N   1 
ATOM   2552 C  CA  . TYR A 1 355 ? 19.826  108.504 11.340  1.00 15.33 ? 355  TYR A CA  1 
ATOM   2553 C  C   . TYR A 1 355 ? 20.595  107.261 11.792  1.00 15.31 ? 355  TYR A C   1 
ATOM   2554 O  O   . TYR A 1 355 ? 20.586  106.237 11.111  1.00 14.98 ? 355  TYR A O   1 
ATOM   2555 C  CB  . TYR A 1 355 ? 20.833  109.564 10.878  1.00 15.44 ? 355  TYR A CB  1 
ATOM   2556 C  CG  . TYR A 1 355 ? 21.835  109.039 9.867   1.00 15.91 ? 355  TYR A CG  1 
ATOM   2557 C  CD1 . TYR A 1 355 ? 21.443  108.732 8.566   1.00 15.81 ? 355  TYR A CD1 1 
ATOM   2558 C  CD2 . TYR A 1 355 ? 23.168  108.828 10.219  1.00 15.80 ? 355  TYR A CD2 1 
ATOM   2559 C  CE1 . TYR A 1 355 ? 22.353  108.228 7.636   1.00 16.35 ? 355  TYR A CE1 1 
ATOM   2560 C  CE2 . TYR A 1 355 ? 24.088  108.322 9.296   1.00 16.56 ? 355  TYR A CE2 1 
ATOM   2561 C  CZ  . TYR A 1 355 ? 23.671  108.025 8.006   1.00 16.26 ? 355  TYR A CZ  1 
ATOM   2562 O  OH  . TYR A 1 355 ? 24.566  107.522 7.084   1.00 16.10 ? 355  TYR A OH  1 
ATOM   2563 N  N   . TRP A 1 356 ? 21.267  107.357 12.937  1.00 15.52 ? 356  TRP A N   1 
ATOM   2564 C  CA  . TRP A 1 356 ? 22.048  106.230 13.439  1.00 16.01 ? 356  TRP A CA  1 
ATOM   2565 C  C   . TRP A 1 356 ? 21.209  105.011 13.788  1.00 16.04 ? 356  TRP A C   1 
ATOM   2566 O  O   . TRP A 1 356 ? 21.657  103.885 13.590  1.00 16.00 ? 356  TRP A O   1 
ATOM   2567 C  CB  . TRP A 1 356 ? 22.915  106.668 14.626  1.00 15.47 ? 356  TRP A CB  1 
ATOM   2568 C  CG  . TRP A 1 356 ? 24.023  107.584 14.183  1.00 15.62 ? 356  TRP A CG  1 
ATOM   2569 C  CD1 . TRP A 1 356 ? 24.228  108.877 14.574  1.00 14.90 ? 356  TRP A CD1 1 
ATOM   2570 C  CD2 . TRP A 1 356 ? 25.014  107.306 13.181  1.00 15.61 ? 356  TRP A CD2 1 
ATOM   2571 N  NE1 . TRP A 1 356 ? 25.278  109.425 13.872  1.00 15.66 ? 356  TRP A NE1 1 
ATOM   2572 C  CE2 . TRP A 1 356 ? 25.778  108.483 13.010  1.00 15.97 ? 356  TRP A CE2 1 
ATOM   2573 C  CE3 . TRP A 1 356 ? 25.329  106.177 12.409  1.00 16.15 ? 356  TRP A CE3 1 
ATOM   2574 C  CZ2 . TRP A 1 356 ? 26.837  108.566 12.097  1.00 16.07 ? 356  TRP A CZ2 1 
ATOM   2575 C  CZ3 . TRP A 1 356 ? 26.385  106.259 11.500  1.00 15.91 ? 356  TRP A CZ3 1 
ATOM   2576 C  CH2 . TRP A 1 356 ? 27.124  107.447 11.354  1.00 15.87 ? 356  TRP A CH2 1 
ATOM   2577 N  N   . ARG A 1 357 ? 19.996  105.227 14.296  1.00 16.50 ? 357  ARG A N   1 
ATOM   2578 C  CA  . ARG A 1 357 ? 19.107  104.114 14.619  1.00 17.26 ? 357  ARG A CA  1 
ATOM   2579 C  C   . ARG A 1 357 ? 18.731  103.437 13.301  1.00 16.58 ? 357  ARG A C   1 
ATOM   2580 O  O   . ARG A 1 357 ? 18.646  102.212 13.221  1.00 16.57 ? 357  ARG A O   1 
ATOM   2581 C  CB  . ARG A 1 357 ? 17.828  104.604 15.312  1.00 18.78 ? 357  ARG A CB  1 
ATOM   2582 C  CG  . ARG A 1 357 ? 18.023  105.162 16.711  1.00 22.03 ? 357  ARG A CG  1 
ATOM   2583 C  CD  . ARG A 1 357 ? 18.607  104.123 17.636  1.00 24.80 ? 357  ARG A CD  1 
ATOM   2584 N  NE  . ARG A 1 357 ? 18.680  104.596 19.015  1.00 27.22 ? 357  ARG A NE  1 
ATOM   2585 C  CZ  . ARG A 1 357 ? 19.446  104.040 19.947  1.00 28.70 ? 357  ARG A CZ  1 
ATOM   2586 N  NH1 . ARG A 1 357 ? 20.206  102.991 19.640  1.00 29.53 ? 357  ARG A NH1 1 
ATOM   2587 N  NH2 . ARG A 1 357 ? 19.450  104.529 21.182  1.00 29.57 ? 357  ARG A NH2 1 
ATOM   2588 N  N   . TYR A 1 358 ? 18.497  104.249 12.273  1.00 15.48 ? 358  TYR A N   1 
ATOM   2589 C  CA  . TYR A 1 358 ? 18.149  103.736 10.950  1.00 14.90 ? 358  TYR A CA  1 
ATOM   2590 C  C   . TYR A 1 358 ? 19.293  102.877 10.411  1.00 14.43 ? 358  TYR A C   1 
ATOM   2591 O  O   . TYR A 1 358 ? 19.065  101.794 9.872   1.00 13.99 ? 358  TYR A O   1 
ATOM   2592 C  CB  . TYR A 1 358 ? 17.876  104.894 9.981   1.00 14.53 ? 358  TYR A CB  1 
ATOM   2593 C  CG  . TYR A 1 358 ? 17.874  104.487 8.520   1.00 14.42 ? 358  TYR A CG  1 
ATOM   2594 C  CD1 . TYR A 1 358 ? 16.834  103.723 7.983   1.00 14.36 ? 358  TYR A CD1 1 
ATOM   2595 C  CD2 . TYR A 1 358 ? 18.924  104.851 7.680   1.00 14.11 ? 358  TYR A CD2 1 
ATOM   2596 C  CE1 . TYR A 1 358 ? 16.844  103.332 6.640   1.00 14.78 ? 358  TYR A CE1 1 
ATOM   2597 C  CE2 . TYR A 1 358 ? 18.947  104.466 6.338   1.00 14.59 ? 358  TYR A CE2 1 
ATOM   2598 C  CZ  . TYR A 1 358 ? 17.906  103.709 5.826   1.00 15.44 ? 358  TYR A CZ  1 
ATOM   2599 O  OH  . TYR A 1 358 ? 17.932  103.336 4.501   1.00 15.86 ? 358  TYR A OH  1 
ATOM   2600 N  N   . ILE A 1 359 ? 20.522  103.367 10.552  1.00 14.11 ? 359  ILE A N   1 
ATOM   2601 C  CA  . ILE A 1 359 ? 21.688  102.627 10.082  1.00 14.35 ? 359  ILE A CA  1 
ATOM   2602 C  C   . ILE A 1 359 ? 21.792  101.293 10.826  1.00 14.73 ? 359  ILE A C   1 
ATOM   2603 O  O   . ILE A 1 359 ? 22.084  100.255 10.225  1.00 15.34 ? 359  ILE A O   1 
ATOM   2604 C  CB  . ILE A 1 359 ? 22.993  103.447 10.281  1.00 14.12 ? 359  ILE A CB  1 
ATOM   2605 C  CG1 . ILE A 1 359 ? 22.953  104.710 9.405   1.00 13.84 ? 359  ILE A CG1 1 
ATOM   2606 C  CG2 . ILE A 1 359 ? 24.207  102.600 9.918   1.00 13.42 ? 359  ILE A CG2 1 
ATOM   2607 C  CD1 . ILE A 1 359 ? 22.848  104.429 7.906   1.00 12.86 ? 359  ILE A CD1 1 
ATOM   2608 N  N   . GLY A 1 360 ? 21.539  101.322 12.132  1.00 15.18 ? 360  GLY A N   1 
ATOM   2609 C  CA  . GLY A 1 360 ? 21.594  100.100 12.918  1.00 14.92 ? 360  GLY A CA  1 
ATOM   2610 C  C   . GLY A 1 360 ? 20.590  99.077  12.407  1.00 15.60 ? 360  GLY A C   1 
ATOM   2611 O  O   . GLY A 1 360 ? 20.907  97.890  12.268  1.00 14.96 ? 360  GLY A O   1 
ATOM   2612 N  N   . ARG A 1 361 ? 19.372  99.533  12.125  1.00 14.92 ? 361  ARG A N   1 
ATOM   2613 C  CA  . ARG A 1 361 ? 18.341  98.643  11.611  1.00 15.47 ? 361  ARG A CA  1 
ATOM   2614 C  C   . ARG A 1 361 ? 18.682  98.171  10.192  1.00 15.69 ? 361  ARG A C   1 
ATOM   2615 O  O   . ARG A 1 361 ? 18.435  97.017  9.847   1.00 15.68 ? 361  ARG A O   1 
ATOM   2616 C  CB  . ARG A 1 361 ? 16.972  99.337  11.619  1.00 15.24 ? 361  ARG A CB  1 
ATOM   2617 C  CG  . ARG A 1 361 ? 16.462  99.707  13.014  1.00 15.19 ? 361  ARG A CG  1 
ATOM   2618 C  CD  . ARG A 1 361 ? 14.979  100.067 12.994  1.00 15.48 ? 361  ARG A CD  1 
ATOM   2619 N  NE  . ARG A 1 361 ? 14.689  101.216 12.135  1.00 14.93 ? 361  ARG A NE  1 
ATOM   2620 C  CZ  . ARG A 1 361 ? 14.813  102.487 12.509  1.00 14.71 ? 361  ARG A CZ  1 
ATOM   2621 N  NH1 . ARG A 1 361 ? 15.219  102.785 13.736  1.00 13.72 ? 361  ARG A NH1 1 
ATOM   2622 N  NH2 . ARG A 1 361 ? 14.527  103.464 11.653  1.00 13.40 ? 361  ARG A NH2 1 
ATOM   2623 N  N   . SER A 1 362 ? 19.252  99.056  9.375   1.00 15.62 ? 362  SER A N   1 
ATOM   2624 C  CA  . SER A 1 362 ? 19.619  98.695  8.004   1.00 16.42 ? 362  SER A CA  1 
ATOM   2625 C  C   . SER A 1 362 ? 20.653  97.580  8.008   1.00 15.58 ? 362  SER A C   1 
ATOM   2626 O  O   . SER A 1 362 ? 20.536  96.612  7.259   1.00 15.01 ? 362  SER A O   1 
ATOM   2627 C  CB  . SER A 1 362 ? 20.202  99.894  7.248   1.00 17.31 ? 362  SER A CB  1 
ATOM   2628 O  OG  . SER A 1 362 ? 19.284  100.967 7.193   1.00 21.31 ? 362  SER A OG  1 
ATOM   2629 N  N   . LEU A 1 363 ? 21.674  97.731  8.847   1.00 15.76 ? 363  LEU A N   1 
ATOM   2630 C  CA  . LEU A 1 363 ? 22.733  96.735  8.951   1.00 16.15 ? 363  LEU A CA  1 
ATOM   2631 C  C   . LEU A 1 363 ? 22.155  95.372  9.316   1.00 15.91 ? 363  LEU A C   1 
ATOM   2632 O  O   . LEU A 1 363 ? 22.566  94.349  8.767   1.00 15.63 ? 363  LEU A O   1 
ATOM   2633 C  CB  . LEU A 1 363 ? 23.762  97.156  10.005  1.00 16.83 ? 363  LEU A CB  1 
ATOM   2634 C  CG  . LEU A 1 363 ? 24.553  98.432  9.712   1.00 18.35 ? 363  LEU A CG  1 
ATOM   2635 C  CD1 . LEU A 1 363 ? 25.394  98.798  10.924  1.00 19.36 ? 363  LEU A CD1 1 
ATOM   2636 C  CD2 . LEU A 1 363 ? 25.434  98.232  8.482   1.00 19.09 ? 363  LEU A CD2 1 
ATOM   2637 N  N   . GLN A 1 364 ? 21.199  95.361  10.241  1.00 16.06 ? 364  GLN A N   1 
ATOM   2638 C  CA  . GLN A 1 364 ? 20.568  94.118  10.670  1.00 17.00 ? 364  GLN A CA  1 
ATOM   2639 C  C   . GLN A 1 364 ? 19.684  93.486  9.597   1.00 17.72 ? 364  GLN A C   1 
ATOM   2640 O  O   . GLN A 1 364 ? 19.547  92.264  9.540   1.00 17.87 ? 364  GLN A O   1 
ATOM   2641 C  CB  . GLN A 1 364 ? 19.736  94.357  11.929  1.00 17.22 ? 364  GLN A CB  1 
ATOM   2642 C  CG  . GLN A 1 364 ? 20.559  94.518  13.199  1.00 18.83 ? 364  GLN A CG  1 
ATOM   2643 C  CD  . GLN A 1 364 ? 19.723  94.993  14.363  1.00 20.17 ? 364  GLN A CD  1 
ATOM   2644 O  OE1 . GLN A 1 364 ? 19.572  96.198  14.585  1.00 21.76 ? 364  GLN A OE1 1 
ATOM   2645 N  NE2 . GLN A 1 364 ? 19.154  94.052  15.104  1.00 19.70 ? 364  GLN A NE2 1 
ATOM   2646 N  N   . SER A 1 365 ? 19.077  94.310  8.751   1.00 18.36 ? 365  SER A N   1 
ATOM   2647 C  CA  . SER A 1 365 ? 18.211  93.782  7.704   1.00 19.74 ? 365  SER A CA  1 
ATOM   2648 C  C   . SER A 1 365 ? 19.047  93.238  6.549   1.00 20.31 ? 365  SER A C   1 
ATOM   2649 O  O   . SER A 1 365 ? 18.595  92.379  5.797   1.00 19.84 ? 365  SER A O   1 
ATOM   2650 C  CB  . SER A 1 365 ? 17.279  94.874  7.183   1.00 19.76 ? 365  SER A CB  1 
ATOM   2651 O  OG  . SER A 1 365 ? 18.012  95.867  6.488   1.00 21.66 ? 365  SER A OG  1 
ATOM   2652 N  N   . LYS A 1 366 ? 20.273  93.734  6.422   1.00 21.19 ? 366  LYS A N   1 
ATOM   2653 C  CA  . LYS A 1 366 ? 21.158  93.302  5.346   1.00 22.50 ? 366  LYS A CA  1 
ATOM   2654 C  C   . LYS A 1 366 ? 22.146  92.198  5.706   1.00 23.22 ? 366  LYS A C   1 
ATOM   2655 O  O   . LYS A 1 366 ? 22.487  91.375  4.855   1.00 23.15 ? 366  LYS A O   1 
ATOM   2656 C  CB  . LYS A 1 366 ? 21.950  94.493  4.808   1.00 23.00 ? 366  LYS A CB  1 
ATOM   2657 C  CG  . LYS A 1 366 ? 21.121  95.556  4.122   1.00 23.49 ? 366  LYS A CG  1 
ATOM   2658 C  CD  . LYS A 1 366 ? 21.991  96.763  3.816   1.00 25.52 ? 366  LYS A CD  1 
ATOM   2659 C  CE  . LYS A 1 366 ? 21.194  97.865  3.150   1.00 26.41 ? 366  LYS A CE  1 
ATOM   2660 N  NZ  . LYS A 1 366 ? 22.039  99.078  2.968   1.00 29.24 ? 366  LYS A NZ  1 
ATOM   2661 N  N   . HIS A 1 367 ? 22.608  92.168  6.952   1.00 24.20 ? 367  HIS A N   1 
ATOM   2662 C  CA  . HIS A 1 367 ? 23.599  91.165  7.332   1.00 25.96 ? 367  HIS A CA  1 
ATOM   2663 C  C   . HIS A 1 367 ? 23.294  90.345  8.586   1.00 27.12 ? 367  HIS A C   1 
ATOM   2664 O  O   . HIS A 1 367 ? 24.248  89.730  9.115   1.00 27.59 ? 367  HIS A O   1 
ATOM   2665 C  CB  . HIS A 1 367 ? 24.962  91.848  7.488   1.00 25.66 ? 367  HIS A CB  1 
ATOM   2666 C  CG  . HIS A 1 367 ? 25.262  92.844  6.408   1.00 26.00 ? 367  HIS A CG  1 
ATOM   2667 N  ND1 . HIS A 1 367 ? 25.048  94.198  6.562   1.00 25.87 ? 367  HIS A ND1 1 
ATOM   2668 C  CD2 . HIS A 1 367 ? 25.716  92.678  5.143   1.00 25.41 ? 367  HIS A CD2 1 
ATOM   2669 C  CE1 . HIS A 1 367 ? 25.355  94.821  5.439   1.00 25.50 ? 367  HIS A CE1 1 
ATOM   2670 N  NE2 . HIS A 1 367 ? 25.763  93.922  4.561   1.00 25.71 ? 367  HIS A NE2 1 
ATOM   2671 N  N   . PRO B 2 17  ? 4.478   117.887 34.924  1.00 19.71 ? 517  PRO B N   1 
ATOM   2672 C  CA  . PRO B 2 17  ? 3.264   118.741 34.858  1.00 18.78 ? 517  PRO B CA  1 
ATOM   2673 C  C   . PRO B 2 17  ? 3.104   119.351 33.467  1.00 18.37 ? 517  PRO B C   1 
ATOM   2674 O  O   . PRO B 2 17  ? 4.094   119.604 32.775  1.00 17.06 ? 517  PRO B O   1 
ATOM   2675 C  CB  . PRO B 2 17  ? 3.413   119.818 35.925  1.00 19.70 ? 517  PRO B CB  1 
ATOM   2676 C  CG  . PRO B 2 17  ? 4.931   119.841 36.141  1.00 20.25 ? 517  PRO B CG  1 
ATOM   2677 C  CD  . PRO B 2 17  ? 5.384   118.385 35.976  1.00 20.31 ? 517  PRO B CD  1 
ATOM   2678 N  N   . VAL B 2 18  ? 1.857   119.581 33.061  1.00 17.62 ? 518  VAL B N   1 
ATOM   2679 C  CA  . VAL B 2 18  ? 1.570   120.125 31.735  1.00 17.35 ? 518  VAL B CA  1 
ATOM   2680 C  C   . VAL B 2 18  ? 2.135   121.517 31.482  1.00 17.92 ? 518  VAL B C   1 
ATOM   2681 O  O   . VAL B 2 18  ? 2.303   121.913 30.329  1.00 18.49 ? 518  VAL B O   1 
ATOM   2682 C  CB  . VAL B 2 18  ? 0.042   120.169 31.457  1.00 17.64 ? 518  VAL B CB  1 
ATOM   2683 C  CG1 . VAL B 2 18  ? -0.544  118.770 31.542  1.00 17.58 ? 518  VAL B CG1 1 
ATOM   2684 C  CG2 . VAL B 2 18  ? -0.650  121.101 32.452  1.00 16.69 ? 518  VAL B CG2 1 
ATOM   2685 N  N   . TRP B 2 19  ? 2.430   122.259 32.548  1.00 17.90 ? 519  TRP B N   1 
ATOM   2686 C  CA  . TRP B 2 19  ? 2.953   123.612 32.399  1.00 17.77 ? 519  TRP B CA  1 
ATOM   2687 C  C   . TRP B 2 19  ? 4.475   123.717 32.300  1.00 18.27 ? 519  TRP B C   1 
ATOM   2688 O  O   . TRP B 2 19  ? 5.030   124.816 32.311  1.00 19.14 ? 519  TRP B O   1 
ATOM   2689 C  CB  . TRP B 2 19  ? 2.440   124.510 33.532  1.00 17.95 ? 519  TRP B CB  1 
ATOM   2690 C  CG  . TRP B 2 19  ? 2.480   123.879 34.898  1.00 17.82 ? 519  TRP B CG  1 
ATOM   2691 C  CD1 . TRP B 2 19  ? 1.433   123.316 35.574  1.00 17.82 ? 519  TRP B CD1 1 
ATOM   2692 C  CD2 . TRP B 2 19  ? 3.628   123.731 35.742  1.00 17.27 ? 519  TRP B CD2 1 
ATOM   2693 N  NE1 . TRP B 2 19  ? 1.859   122.827 36.788  1.00 18.38 ? 519  TRP B NE1 1 
ATOM   2694 C  CE2 . TRP B 2 19  ? 3.202   123.068 36.917  1.00 17.80 ? 519  TRP B CE2 1 
ATOM   2695 C  CE3 . TRP B 2 19  ? 4.976   124.094 35.620  1.00 16.29 ? 519  TRP B CE3 1 
ATOM   2696 C  CZ2 . TRP B 2 19  ? 4.079   122.759 37.965  1.00 17.01 ? 519  TRP B CZ2 1 
ATOM   2697 C  CZ3 . TRP B 2 19  ? 5.850   123.787 36.664  1.00 16.25 ? 519  TRP B CZ3 1 
ATOM   2698 C  CH2 . TRP B 2 19  ? 5.393   123.125 37.821  1.00 16.87 ? 519  TRP B CH2 1 
ATOM   2699 N  N   . SER B 2 20  ? 5.155   122.581 32.214  1.00 18.34 ? 520  SER B N   1 
ATOM   2700 C  CA  . SER B 2 20  ? 6.604   122.592 32.069  1.00 18.73 ? 520  SER B CA  1 
ATOM   2701 C  C   . SER B 2 20  ? 6.965   121.491 31.089  1.00 18.60 ? 520  SER B C   1 
ATOM   2702 O  O   . SER B 2 20  ? 6.456   120.376 31.182  1.00 19.01 ? 520  SER B O   1 
ATOM   2703 C  CB  . SER B 2 20  ? 7.302   122.354 33.411  1.00 19.20 ? 520  SER B CB  1 
ATOM   2704 O  OG  . SER B 2 20  ? 8.698   122.595 33.295  1.00 19.65 ? 520  SER B OG  1 
ATOM   2705 N  N   . GLU B 2 21  ? 7.827   121.807 30.132  1.00 18.24 ? 521  GLU B N   1 
ATOM   2706 C  CA  . GLU B 2 21  ? 8.224   120.821 29.138  1.00 18.32 ? 521  GLU B CA  1 
ATOM   2707 C  C   . GLU B 2 21  ? 9.727   120.891 28.897  1.00 17.90 ? 521  GLU B C   1 
ATOM   2708 O  O   . GLU B 2 21  ? 10.227  121.841 28.301  1.00 17.26 ? 521  GLU B O   1 
ATOM   2709 C  CB  . GLU B 2 21  ? 7.450   121.058 27.837  1.00 18.92 ? 521  GLU B CB  1 
ATOM   2710 C  CG  . GLU B 2 21  ? 7.877   120.185 26.673  1.00 20.25 ? 521  GLU B CG  1 
ATOM   2711 C  CD  . GLU B 2 21  ? 6.904   120.259 25.507  1.00 21.77 ? 521  GLU B CD  1 
ATOM   2712 O  OE1 . GLU B 2 21  ? 6.541   121.380 25.087  1.00 21.02 ? 521  GLU B OE1 1 
ATOM   2713 O  OE2 . GLU B 2 21  ? 6.506   119.190 25.004  1.00 23.08 ? 521  GLU B OE2 1 
ATOM   2714 N  N   . PRO B 2 22  ? 10.468  119.885 29.386  1.00 18.16 ? 522  PRO B N   1 
ATOM   2715 C  CA  . PRO B 2 22  ? 11.925  119.821 29.230  1.00 18.10 ? 522  PRO B CA  1 
ATOM   2716 C  C   . PRO B 2 22  ? 12.338  119.943 27.765  1.00 17.45 ? 522  PRO B C   1 
ATOM   2717 O  O   . PRO B 2 22  ? 11.677  119.400 26.879  1.00 18.02 ? 522  PRO B O   1 
ATOM   2718 C  CB  . PRO B 2 22  ? 12.272  118.457 29.822  1.00 18.51 ? 522  PRO B CB  1 
ATOM   2719 C  CG  . PRO B 2 22  ? 11.225  118.296 30.903  1.00 19.15 ? 522  PRO B CG  1 
ATOM   2720 C  CD  . PRO B 2 22  ? 9.973   118.748 30.184  1.00 18.15 ? 522  PRO B CD  1 
ATOM   2721 N  N   . LEU B 2 23  ? 13.431  120.656 27.515  1.00 16.20 ? 523  LEU B N   1 
ATOM   2722 C  CA  . LEU B 2 23  ? 13.911  120.849 26.153  1.00 15.52 ? 523  LEU B CA  1 
ATOM   2723 C  C   . LEU B 2 23  ? 15.274  120.203 25.918  1.00 15.41 ? 523  LEU B C   1 
ATOM   2724 O  O   . LEU B 2 23  ? 16.132  120.184 26.799  1.00 14.99 ? 523  LEU B O   1 
ATOM   2725 C  CB  . LEU B 2 23  ? 13.987  122.345 25.826  1.00 14.59 ? 523  LEU B CB  1 
ATOM   2726 C  CG  . LEU B 2 23  ? 12.659  123.117 25.878  1.00 15.12 ? 523  LEU B CG  1 
ATOM   2727 C  CD1 . LEU B 2 23  ? 12.893  124.578 25.543  1.00 14.13 ? 523  LEU B CD1 1 
ATOM   2728 C  CD2 . LEU B 2 23  ? 11.664  122.500 24.896  1.00 14.51 ? 523  LEU B CD2 1 
ATOM   2729 N  N   . TYR B 2 24  ? 15.452  119.673 24.714  1.00 15.26 ? 524  TYR B N   1 
ATOM   2730 C  CA  . TYR B 2 24  ? 16.694  119.027 24.309  1.00 16.09 ? 524  TYR B CA  1 
ATOM   2731 C  C   . TYR B 2 24  ? 17.862  120.010 24.427  1.00 16.63 ? 524  TYR B C   1 
ATOM   2732 O  O   . TYR B 2 24  ? 18.918  119.681 24.974  1.00 16.66 ? 524  TYR B O   1 
ATOM   2733 C  CB  . TYR B 2 24  ? 16.549  118.553 22.859  1.00 15.42 ? 524  TYR B CB  1 
ATOM   2734 C  CG  . TYR B 2 24  ? 17.785  117.945 22.236  1.00 15.71 ? 524  TYR B CG  1 
ATOM   2735 C  CD1 . TYR B 2 24  ? 18.186  116.642 22.546  1.00 15.73 ? 524  TYR B CD1 1 
ATOM   2736 C  CD2 . TYR B 2 24  ? 18.529  118.657 21.292  1.00 15.25 ? 524  TYR B CD2 1 
ATOM   2737 C  CE1 . TYR B 2 24  ? 19.298  116.062 21.918  1.00 16.29 ? 524  TYR B CE1 1 
ATOM   2738 C  CE2 . TYR B 2 24  ? 19.638  118.092 20.666  1.00 15.33 ? 524  TYR B CE2 1 
ATOM   2739 C  CZ  . TYR B 2 24  ? 20.014  116.798 20.978  1.00 15.49 ? 524  TYR B CZ  1 
ATOM   2740 O  OH  . TYR B 2 24  ? 21.093  116.237 20.338  1.00 15.34 ? 524  TYR B OH  1 
ATOM   2741 N  N   . SER B 2 25  ? 17.653  121.224 23.926  1.00 16.33 ? 525  SER B N   1 
ATOM   2742 C  CA  . SER B 2 25  ? 18.685  122.256 23.939  1.00 17.28 ? 525  SER B CA  1 
ATOM   2743 C  C   . SER B 2 25  ? 19.071  122.746 25.329  1.00 17.80 ? 525  SER B C   1 
ATOM   2744 O  O   . SER B 2 25  ? 20.117  123.376 25.495  1.00 17.43 ? 525  SER B O   1 
ATOM   2745 C  CB  . SER B 2 25  ? 18.236  123.452 23.093  1.00 16.97 ? 525  SER B CB  1 
ATOM   2746 O  OG  . SER B 2 25  ? 17.907  123.042 21.776  1.00 16.82 ? 525  SER B OG  1 
ATOM   2747 N  N   . LEU B 2 26  ? 18.229  122.462 26.319  1.00 18.39 ? 526  LEU B N   1 
ATOM   2748 C  CA  . LEU B 2 26  ? 18.487  122.895 27.688  1.00 20.16 ? 526  LEU B CA  1 
ATOM   2749 C  C   . LEU B 2 26  ? 19.056  121.808 28.595  1.00 20.69 ? 526  LEU B C   1 
ATOM   2750 O  O   . LEU B 2 26  ? 19.312  122.058 29.771  1.00 20.90 ? 526  LEU B O   1 
ATOM   2751 C  CB  . LEU B 2 26  ? 17.207  123.462 28.311  1.00 20.76 ? 526  LEU B CB  1 
ATOM   2752 C  CG  . LEU B 2 26  ? 16.615  124.692 27.617  1.00 21.57 ? 526  LEU B CG  1 
ATOM   2753 C  CD1 . LEU B 2 26  ? 15.400  125.194 28.385  1.00 22.10 ? 526  LEU B CD1 1 
ATOM   2754 C  CD2 . LEU B 2 26  ? 17.669  125.778 27.538  1.00 22.45 ? 526  LEU B CD2 1 
ATOM   2755 N  N   . ARG B 2 27  ? 19.249  120.605 28.059  1.00 21.22 ? 527  ARG B N   1 
ATOM   2756 C  CA  . ARG B 2 27  ? 19.814  119.515 28.854  1.00 22.69 ? 527  ARG B CA  1 
ATOM   2757 C  C   . ARG B 2 27  ? 21.237  119.905 29.252  1.00 22.75 ? 527  ARG B C   1 
ATOM   2758 O  O   . ARG B 2 27  ? 21.928  120.605 28.513  1.00 21.64 ? 527  ARG B O   1 
ATOM   2759 C  CB  . ARG B 2 27  ? 19.867  118.212 28.046  1.00 24.25 ? 527  ARG B CB  1 
ATOM   2760 C  CG  . ARG B 2 27  ? 18.515  117.658 27.617  1.00 27.38 ? 527  ARG B CG  1 
ATOM   2761 C  CD  . ARG B 2 27  ? 18.677  116.354 26.837  1.00 30.58 ? 527  ARG B CD  1 
ATOM   2762 N  NE  . ARG B 2 27  ? 17.391  115.815 26.394  1.00 34.35 ? 527  ARG B NE  1 
ATOM   2763 C  CZ  . ARG B 2 27  ? 17.251  114.743 25.616  1.00 35.90 ? 527  ARG B CZ  1 
ATOM   2764 N  NH1 . ARG B 2 27  ? 18.321  114.080 25.189  1.00 36.49 ? 527  ARG B NH1 1 
ATOM   2765 N  NH2 . ARG B 2 27  ? 16.037  114.336 25.256  1.00 36.20 ? 527  ARG B NH2 1 
ATOM   2766 N  N   . PRO B 2 28  ? 21.695  119.459 30.430  1.00 23.22 ? 528  PRO B N   1 
ATOM   2767 C  CA  . PRO B 2 28  ? 23.058  119.816 30.833  1.00 23.29 ? 528  PRO B CA  1 
ATOM   2768 C  C   . PRO B 2 28  ? 24.129  119.263 29.892  1.00 22.75 ? 528  PRO B C   1 
ATOM   2769 O  O   . PRO B 2 28  ? 25.163  119.895 29.690  1.00 22.76 ? 528  PRO B O   1 
ATOM   2770 C  CB  . PRO B 2 28  ? 23.160  119.255 32.252  1.00 23.60 ? 528  PRO B CB  1 
ATOM   2771 C  CG  . PRO B 2 28  ? 22.206  118.101 32.233  1.00 24.21 ? 528  PRO B CG  1 
ATOM   2772 C  CD  . PRO B 2 28  ? 21.026  118.669 31.476  1.00 23.48 ? 528  PRO B CD  1 
ATOM   2773 N  N   . GLU B 2 29  ? 23.877  118.098 29.301  1.00 22.79 ? 529  GLU B N   1 
ATOM   2774 C  CA  . GLU B 2 29  ? 24.842  117.494 28.383  1.00 23.53 ? 529  GLU B CA  1 
ATOM   2775 C  C   . GLU B 2 29  ? 24.943  118.278 27.078  1.00 22.30 ? 529  GLU B C   1 
ATOM   2776 O  O   . GLU B 2 29  ? 25.898  118.112 26.320  1.00 22.12 ? 529  GLU B O   1 
ATOM   2777 C  CB  . GLU B 2 29  ? 24.450  116.057 28.014  1.00 25.94 ? 529  GLU B CB  1 
ATOM   2778 C  CG  . GLU B 2 29  ? 23.693  115.277 29.064  1.00 30.51 ? 529  GLU B CG  1 
ATOM   2779 C  CD  . GLU B 2 29  ? 22.216  115.597 29.064  1.00 31.89 ? 529  GLU B CD  1 
ATOM   2780 O  OE1 . GLU B 2 29  ? 21.825  116.590 29.707  1.00 33.71 ? 529  GLU B OE1 1 
ATOM   2781 O  OE2 . GLU B 2 29  ? 21.446  114.859 28.407  1.00 34.03 ? 529  GLU B OE2 1 
ATOM   2782 N  N   . HIS B 2 30  ? 23.954  119.117 26.804  1.00 20.57 ? 530  HIS B N   1 
ATOM   2783 C  CA  . HIS B 2 30  ? 23.959  119.873 25.559  1.00 19.55 ? 530  HIS B CA  1 
ATOM   2784 C  C   . HIS B 2 30  ? 25.153  120.815 25.436  1.00 19.22 ? 530  HIS B C   1 
ATOM   2785 O  O   . HIS B 2 30  ? 25.602  121.115 24.328  1.00 18.06 ? 530  HIS B O   1 
ATOM   2786 C  CB  . HIS B 2 30  ? 22.646  120.649 25.402  1.00 18.60 ? 530  HIS B CB  1 
ATOM   2787 C  CG  . HIS B 2 30  ? 22.406  121.135 24.008  1.00 18.61 ? 530  HIS B CG  1 
ATOM   2788 N  ND1 . HIS B 2 30  ? 22.594  122.448 23.632  1.00 18.96 ? 530  HIS B ND1 1 
ATOM   2789 C  CD2 . HIS B 2 30  ? 22.042  120.471 22.885  1.00 18.20 ? 530  HIS B CD2 1 
ATOM   2790 C  CE1 . HIS B 2 30  ? 22.357  122.571 22.338  1.00 18.22 ? 530  HIS B CE1 1 
ATOM   2791 N  NE2 . HIS B 2 30  ? 22.021  121.386 21.861  1.00 18.22 ? 530  HIS B NE2 1 
ATOM   2792 N  N   . ALA B 2 31  ? 25.678  121.273 26.570  1.00 19.50 ? 531  ALA B N   1 
ATOM   2793 C  CA  . ALA B 2 31  ? 26.832  122.171 26.556  1.00 19.60 ? 531  ALA B CA  1 
ATOM   2794 C  C   . ALA B 2 31  ? 28.038  121.487 25.914  1.00 19.82 ? 531  ALA B C   1 
ATOM   2795 O  O   . ALA B 2 31  ? 28.942  122.150 25.406  1.00 19.59 ? 531  ALA B O   1 
ATOM   2796 C  CB  . ALA B 2 31  ? 27.177  122.620 27.978  1.00 19.95 ? 531  ALA B CB  1 
ATOM   2797 N  N   . ARG B 2 32  ? 28.049  120.158 25.925  1.00 20.65 ? 532  ARG B N   1 
ATOM   2798 C  CA  . ARG B 2 32  ? 29.153  119.414 25.328  1.00 22.05 ? 532  ARG B CA  1 
ATOM   2799 C  C   . ARG B 2 32  ? 29.146  119.489 23.805  1.00 21.45 ? 532  ARG B C   1 
ATOM   2800 O  O   . ARG B 2 32  ? 30.127  119.128 23.157  1.00 20.92 ? 532  ARG B O   1 
ATOM   2801 C  CB  . ARG B 2 32  ? 29.111  117.950 25.766  1.00 24.93 ? 532  ARG B CB  1 
ATOM   2802 C  CG  . ARG B 2 32  ? 30.008  117.651 26.955  1.00 29.78 ? 532  ARG B CG  1 
ATOM   2803 C  CD  . ARG B 2 32  ? 29.234  117.069 28.122  1.00 33.44 ? 532  ARG B CD  1 
ATOM   2804 N  NE  . ARG B 2 32  ? 28.638  115.777 27.805  1.00 36.66 ? 532  ARG B NE  1 
ATOM   2805 C  CZ  . ARG B 2 32  ? 27.974  115.031 28.682  1.00 38.36 ? 532  ARG B CZ  1 
ATOM   2806 N  NH1 . ARG B 2 32  ? 27.823  115.453 29.933  1.00 39.42 ? 532  ARG B NH1 1 
ATOM   2807 N  NH2 . ARG B 2 32  ? 27.457  113.866 28.310  1.00 39.17 ? 532  ARG B NH2 1 
ATOM   2808 N  N   . GLU B 2 33  ? 28.041  119.963 23.240  1.00 20.48 ? 533  GLU B N   1 
ATOM   2809 C  CA  . GLU B 2 33  ? 27.915  120.071 21.792  1.00 20.71 ? 533  GLU B CA  1 
ATOM   2810 C  C   . GLU B 2 33  ? 28.500  121.370 21.240  1.00 20.21 ? 533  GLU B C   1 
ATOM   2811 O  O   . GLU B 2 33  ? 28.421  121.632 20.033  1.00 19.10 ? 533  GLU B O   1 
ATOM   2812 C  CB  . GLU B 2 33  ? 26.442  119.948 21.386  1.00 20.91 ? 533  GLU B CB  1 
ATOM   2813 C  CG  . GLU B 2 33  ? 25.787  118.647 21.834  1.00 22.79 ? 533  GLU B CG  1 
ATOM   2814 C  CD  . GLU B 2 33  ? 26.564  117.424 21.390  1.00 24.47 ? 533  GLU B CD  1 
ATOM   2815 O  OE1 . GLU B 2 33  ? 26.975  117.378 20.214  1.00 25.65 ? 533  GLU B OE1 1 
ATOM   2816 O  OE2 . GLU B 2 33  ? 26.760  116.502 22.211  1.00 25.71 ? 533  GLU B OE2 1 
ATOM   2817 N  N   . ARG B 2 34  ? 29.084  122.183 22.121  1.00 19.29 ? 534  ARG B N   1 
ATOM   2818 C  CA  . ARG B 2 34  ? 29.689  123.441 21.700  1.00 19.20 ? 534  ARG B CA  1 
ATOM   2819 C  C   . ARG B 2 34  ? 30.890  123.137 20.814  1.00 18.63 ? 534  ARG B C   1 
ATOM   2820 O  O   . ARG B 2 34  ? 31.533  122.094 20.951  1.00 17.20 ? 534  ARG B O   1 
ATOM   2821 C  CB  . ARG B 2 34  ? 30.135  124.273 22.914  1.00 20.37 ? 534  ARG B CB  1 
ATOM   2822 C  CG  . ARG B 2 34  ? 28.994  124.937 23.692  1.00 22.30 ? 534  ARG B CG  1 
ATOM   2823 C  CD  . ARG B 2 34  ? 28.274  125.994 22.857  1.00 23.52 ? 534  ARG B CD  1 
ATOM   2824 N  NE  . ARG B 2 34  ? 29.028  127.240 22.712  1.00 24.40 ? 534  ARG B NE  1 
ATOM   2825 C  CZ  . ARG B 2 34  ? 29.031  128.229 23.605  1.00 25.78 ? 534  ARG B CZ  1 
ATOM   2826 N  NH1 . ARG B 2 34  ? 28.319  128.129 24.721  1.00 25.78 ? 534  ARG B NH1 1 
ATOM   2827 N  NH2 . ARG B 2 34  ? 29.739  129.327 23.380  1.00 25.19 ? 534  ARG B NH2 1 
ATOM   2828 N  N   . LEU B 2 35  ? 31.187  124.056 19.906  1.00 18.53 ? 535  LEU B N   1 
ATOM   2829 C  CA  . LEU B 2 35  ? 32.296  123.886 18.976  1.00 19.42 ? 535  LEU B CA  1 
ATOM   2830 C  C   . LEU B 2 35  ? 33.638  123.589 19.646  1.00 19.50 ? 535  LEU B C   1 
ATOM   2831 O  O   . LEU B 2 35  ? 33.989  124.187 20.661  1.00 19.55 ? 535  LEU B O   1 
ATOM   2832 C  CB  . LEU B 2 35  ? 32.445  125.144 18.111  1.00 19.37 ? 535  LEU B CB  1 
ATOM   2833 C  CG  . LEU B 2 35  ? 33.610  125.171 17.115  1.00 20.03 ? 535  LEU B CG  1 
ATOM   2834 C  CD1 . LEU B 2 35  ? 33.401  124.102 16.050  1.00 19.34 ? 535  LEU B CD1 1 
ATOM   2835 C  CD2 . LEU B 2 35  ? 33.706  126.551 16.471  1.00 19.66 ? 535  LEU B CD2 1 
ATOM   2836 N  N   . GLN B 2 36  ? 34.375  122.649 19.067  1.00 19.36 ? 536  GLN B N   1 
ATOM   2837 C  CA  . GLN B 2 36  ? 35.709  122.301 19.546  1.00 19.46 ? 536  GLN B CA  1 
ATOM   2838 C  C   . GLN B 2 36  ? 36.620  122.729 18.405  1.00 19.39 ? 536  GLN B C   1 
ATOM   2839 O  O   . GLN B 2 36  ? 36.694  122.046 17.381  1.00 19.53 ? 536  GLN B O   1 
ATOM   2840 C  CB  . GLN B 2 36  ? 35.826  120.792 19.788  1.00 19.67 ? 536  GLN B CB  1 
ATOM   2841 C  CG  . GLN B 2 36  ? 35.199  120.333 21.100  1.00 20.74 ? 536  GLN B CG  1 
ATOM   2842 C  CD  . GLN B 2 36  ? 35.224  118.827 21.273  1.00 21.74 ? 536  GLN B CD  1 
ATOM   2843 O  OE1 . GLN B 2 36  ? 34.241  118.135 20.994  1.00 22.46 ? 536  GLN B OE1 1 
ATOM   2844 N  NE2 . GLN B 2 36  ? 36.354  118.307 21.728  1.00 21.59 ? 536  GLN B NE2 1 
ATOM   2845 N  N   . ASP B 2 37  ? 37.297  123.863 18.563  1.00 19.00 ? 537  ASP B N   1 
ATOM   2846 C  CA  . ASP B 2 37  ? 38.165  124.356 17.498  1.00 19.44 ? 537  ASP B CA  1 
ATOM   2847 C  C   . ASP B 2 37  ? 39.585  123.796 17.493  1.00 19.37 ? 537  ASP B C   1 
ATOM   2848 O  O   . ASP B 2 37  ? 40.427  124.247 16.718  1.00 19.20 ? 537  ASP B O   1 
ATOM   2849 C  CB  . ASP B 2 37  ? 38.215  125.889 17.510  1.00 19.86 ? 537  ASP B CB  1 
ATOM   2850 C  CG  . ASP B 2 37  ? 38.865  126.454 18.762  1.00 20.51 ? 537  ASP B CG  1 
ATOM   2851 O  OD1 . ASP B 2 37  ? 39.446  125.684 19.555  1.00 20.35 ? 537  ASP B OD1 1 
ATOM   2852 O  OD2 . ASP B 2 37  ? 38.799  127.687 18.943  1.00 21.98 ? 537  ASP B OD2 1 
ATOM   2853 N  N   . ASP B 2 38  ? 39.845  122.813 18.349  1.00 19.78 ? 538  ASP B N   1 
ATOM   2854 C  CA  . ASP B 2 38  ? 41.164  122.186 18.421  1.00 20.27 ? 538  ASP B CA  1 
ATOM   2855 C  C   . ASP B 2 38  ? 42.285  123.210 18.615  1.00 21.37 ? 538  ASP B C   1 
ATOM   2856 O  O   . ASP B 2 38  ? 43.429  122.963 18.234  1.00 20.96 ? 538  ASP B O   1 
ATOM   2857 C  CB  . ASP B 2 38  ? 41.430  121.385 17.140  1.00 19.75 ? 538  ASP B CB  1 
ATOM   2858 C  CG  . ASP B 2 38  ? 40.306  120.421 16.810  1.00 19.67 ? 538  ASP B CG  1 
ATOM   2859 O  OD1 . ASP B 2 38  ? 39.963  119.585 17.672  1.00 17.81 ? 538  ASP B OD1 1 
ATOM   2860 O  OD2 . ASP B 2 38  ? 39.767  120.498 15.683  1.00 20.07 ? 538  ASP B OD2 1 
ATOM   2861 N  N   . SER B 2 39  ? 41.950  124.355 19.201  1.00 21.98 ? 539  SER B N   1 
ATOM   2862 C  CA  . SER B 2 39  ? 42.924  125.415 19.432  1.00 23.27 ? 539  SER B CA  1 
ATOM   2863 C  C   . SER B 2 39  ? 43.528  125.950 18.134  1.00 23.58 ? 539  SER B C   1 
ATOM   2864 O  O   . SER B 2 39  ? 44.637  126.483 18.128  1.00 24.06 ? 539  SER B O   1 
ATOM   2865 C  CB  . SER B 2 39  ? 44.039  124.920 20.357  1.00 23.66 ? 539  SER B CB  1 
ATOM   2866 O  OG  . SER B 2 39  ? 43.528  124.637 21.649  1.00 24.93 ? 539  SER B OG  1 
ATOM   2867 N  N   . VAL B 2 40  ? 42.802  125.795 17.032  1.00 23.64 ? 540  VAL B N   1 
ATOM   2868 C  CA  . VAL B 2 40  ? 43.260  126.296 15.739  1.00 22.91 ? 540  VAL B CA  1 
ATOM   2869 C  C   . VAL B 2 40  ? 42.149  127.192 15.205  1.00 22.78 ? 540  VAL B C   1 
ATOM   2870 O  O   . VAL B 2 40  ? 41.140  126.708 14.690  1.00 22.03 ? 540  VAL B O   1 
ATOM   2871 C  CB  . VAL B 2 40  ? 43.523  125.149 14.737  1.00 22.67 ? 540  VAL B CB  1 
ATOM   2872 C  CG1 . VAL B 2 40  ? 43.967  125.720 13.395  1.00 23.07 ? 540  VAL B CG1 1 
ATOM   2873 C  CG2 . VAL B 2 40  ? 44.592  124.216 15.286  1.00 22.75 ? 540  VAL B CG2 1 
ATOM   2874 N  N   . GLU B 2 41  ? 42.334  128.501 15.341  1.00 22.64 ? 541  GLU B N   1 
ATOM   2875 C  CA  . GLU B 2 41  ? 41.331  129.459 14.897  1.00 23.11 ? 541  GLU B CA  1 
ATOM   2876 C  C   . GLU B 2 41  ? 41.458  129.899 13.447  1.00 22.11 ? 541  GLU B C   1 
ATOM   2877 O  O   . GLU B 2 41  ? 42.553  130.171 12.958  1.00 22.14 ? 541  GLU B O   1 
ATOM   2878 C  CB  . GLU B 2 41  ? 41.362  130.709 15.780  1.00 24.88 ? 541  GLU B CB  1 
ATOM   2879 C  CG  . GLU B 2 41  ? 41.346  130.440 17.269  1.00 28.08 ? 541  GLU B CG  1 
ATOM   2880 C  CD  . GLU B 2 41  ? 41.062  131.696 18.072  1.00 30.03 ? 541  GLU B CD  1 
ATOM   2881 O  OE1 . GLU B 2 41  ? 41.666  132.746 17.769  1.00 31.13 ? 541  GLU B OE1 1 
ATOM   2882 O  OE2 . GLU B 2 41  ? 40.236  131.633 19.007  1.00 31.94 ? 541  GLU B OE2 1 
ATOM   2883 N  N   . THR B 2 42  ? 40.320  129.958 12.763  1.00 20.64 ? 542  THR B N   1 
ATOM   2884 C  CA  . THR B 2 42  ? 40.261  130.419 11.382  1.00 19.46 ? 542  THR B CA  1 
ATOM   2885 C  C   . THR B 2 42  ? 38.966  131.207 11.317  1.00 19.16 ? 542  THR B C   1 
ATOM   2886 O  O   . THR B 2 42  ? 38.146  131.118 12.229  1.00 18.66 ? 542  THR B O   1 
ATOM   2887 C  CB  . THR B 2 42  ? 40.195  129.262 10.358  1.00 18.99 ? 542  THR B CB  1 
ATOM   2888 O  OG1 . THR B 2 42  ? 38.991  128.511 10.555  1.00 18.66 ? 542  THR B OG1 1 
ATOM   2889 C  CG2 . THR B 2 42  ? 41.403  128.347 10.499  1.00 19.15 ? 542  THR B CG2 1 
ATOM   2890 N  N   . VAL B 2 43  ? 38.782  131.979 10.255  1.00 18.98 ? 543  VAL B N   1 
ATOM   2891 C  CA  . VAL B 2 43  ? 37.571  132.776 10.108  1.00 19.41 ? 543  VAL B CA  1 
ATOM   2892 C  C   . VAL B 2 43  ? 36.321  131.927 10.335  1.00 18.46 ? 543  VAL B C   1 
ATOM   2893 O  O   . VAL B 2 43  ? 35.354  132.382 10.947  1.00 18.10 ? 543  VAL B O   1 
ATOM   2894 C  CB  . VAL B 2 43  ? 37.491  133.408 8.702   1.00 20.41 ? 543  VAL B CB  1 
ATOM   2895 C  CG1 . VAL B 2 43  ? 36.179  134.165 8.544   1.00 22.17 ? 543  VAL B CG1 1 
ATOM   2896 C  CG2 . VAL B 2 43  ? 38.668  134.349 8.493   1.00 21.70 ? 543  VAL B CG2 1 
ATOM   2897 N  N   . THR B 2 44  ? 36.353  130.690 9.848   1.00 17.21 ? 544  THR B N   1 
ATOM   2898 C  CA  . THR B 2 44  ? 35.216  129.788 9.991   1.00 16.79 ? 544  THR B CA  1 
ATOM   2899 C  C   . THR B 2 44  ? 34.837  129.480 11.439  1.00 16.84 ? 544  THR B C   1 
ATOM   2900 O  O   . THR B 2 44  ? 33.671  129.629 11.817  1.00 15.89 ? 544  THR B O   1 
ATOM   2901 C  CB  . THR B 2 44  ? 35.471  128.450 9.264   1.00 16.85 ? 544  THR B CB  1 
ATOM   2902 O  OG1 . THR B 2 44  ? 35.555  128.683 7.851   1.00 16.59 ? 544  THR B OG1 1 
ATOM   2903 C  CG2 . THR B 2 44  ? 34.335  127.462 9.544   1.00 16.14 ? 544  THR B CG2 1 
ATOM   2904 N  N   . SER B 2 45  ? 35.810  129.053 12.244  1.00 16.38 ? 545  SER B N   1 
ATOM   2905 C  CA  . SER B 2 45  ? 35.532  128.711 13.636  1.00 16.77 ? 545  SER B CA  1 
ATOM   2906 C  C   . SER B 2 45  ? 35.152  129.931 14.469  1.00 17.56 ? 545  SER B C   1 
ATOM   2907 O  O   . SER B 2 45  ? 34.327  129.835 15.380  1.00 17.26 ? 545  SER B O   1 
ATOM   2908 C  CB  . SER B 2 45  ? 36.731  127.987 14.272  1.00 16.52 ? 545  SER B CB  1 
ATOM   2909 O  OG  . SER B 2 45  ? 37.901  128.785 14.271  1.00 16.01 ? 545  SER B OG  1 
ATOM   2910 N  N   . ILE B 2 46  ? 35.751  131.076 14.155  1.00 17.84 ? 546  ILE B N   1 
ATOM   2911 C  CA  . ILE B 2 46  ? 35.452  132.309 14.874  1.00 18.63 ? 546  ILE B CA  1 
ATOM   2912 C  C   . ILE B 2 46  ? 33.992  132.709 14.669  1.00 18.54 ? 546  ILE B C   1 
ATOM   2913 O  O   . ILE B 2 46  ? 33.298  133.067 15.621  1.00 17.80 ? 546  ILE B O   1 
ATOM   2914 C  CB  . ILE B 2 46  ? 36.359  133.468 14.399  1.00 19.48 ? 546  ILE B CB  1 
ATOM   2915 C  CG1 . ILE B 2 46  ? 37.806  133.196 14.821  1.00 19.59 ? 546  ILE B CG1 1 
ATOM   2916 C  CG2 . ILE B 2 46  ? 35.876  134.792 14.992  1.00 19.42 ? 546  ILE B CG2 1 
ATOM   2917 C  CD1 . ILE B 2 46  ? 38.795  134.196 14.275  1.00 21.72 ? 546  ILE B CD1 1 
ATOM   2918 N  N   . GLU B 2 47  ? 33.526  132.650 13.425  1.00 18.30 ? 547  GLU B N   1 
ATOM   2919 C  CA  . GLU B 2 47  ? 32.145  133.015 13.136  1.00 18.87 ? 547  GLU B CA  1 
ATOM   2920 C  C   . GLU B 2 47  ? 31.180  132.019 13.769  1.00 17.91 ? 547  GLU B C   1 
ATOM   2921 O  O   . GLU B 2 47  ? 30.154  132.409 14.329  1.00 17.26 ? 547  GLU B O   1 
ATOM   2922 C  CB  . GLU B 2 47  ? 31.919  133.094 11.625  1.00 20.28 ? 547  GLU B CB  1 
ATOM   2923 C  CG  . GLU B 2 47  ? 32.678  134.240 10.971  1.00 23.42 ? 547  GLU B CG  1 
ATOM   2924 C  CD  . GLU B 2 47  ? 32.372  135.573 11.635  1.00 26.47 ? 547  GLU B CD  1 
ATOM   2925 O  OE1 . GLU B 2 47  ? 31.209  136.026 11.546  1.00 27.44 ? 547  GLU B OE1 1 
ATOM   2926 O  OE2 . GLU B 2 47  ? 33.289  136.160 12.257  1.00 27.20 ? 547  GLU B OE2 1 
ATOM   2927 N  N   . GLN B 2 48  ? 31.517  130.736 13.684  1.00 17.11 ? 548  GLN B N   1 
ATOM   2928 C  CA  . GLN B 2 48  ? 30.683  129.692 14.264  1.00 17.16 ? 548  GLN B CA  1 
ATOM   2929 C  C   . GLN B 2 48  ? 30.577  129.886 15.779  1.00 17.25 ? 548  GLN B C   1 
ATOM   2930 O  O   . GLN B 2 48  ? 29.496  129.768 16.349  1.00 17.66 ? 548  GLN B O   1 
ATOM   2931 C  CB  . GLN B 2 48  ? 31.271  128.312 13.948  1.00 16.73 ? 548  GLN B CB  1 
ATOM   2932 C  CG  . GLN B 2 48  ? 30.506  127.129 14.543  1.00 15.91 ? 548  GLN B CG  1 
ATOM   2933 C  CD  . GLN B 2 48  ? 29.047  127.094 14.117  1.00 16.05 ? 548  GLN B CD  1 
ATOM   2934 O  OE1 . GLN B 2 48  ? 28.703  127.508 13.011  1.00 15.09 ? 548  GLN B OE1 1 
ATOM   2935 N  NE2 . GLN B 2 48  ? 28.185  126.585 14.992  1.00 14.92 ? 548  GLN B NE2 1 
ATOM   2936 N  N   . ALA B 2 49  ? 31.697  130.194 16.427  1.00 17.57 ? 549  ALA B N   1 
ATOM   2937 C  CA  . ALA B 2 49  ? 31.705  130.395 17.876  1.00 17.83 ? 549  ALA B CA  1 
ATOM   2938 C  C   . ALA B 2 49  ? 30.847  131.597 18.273  1.00 17.94 ? 549  ALA B C   1 
ATOM   2939 O  O   . ALA B 2 49  ? 30.135  131.559 19.280  1.00 18.07 ? 549  ALA B O   1 
ATOM   2940 C  CB  . ALA B 2 49  ? 33.143  130.577 18.378  1.00 18.14 ? 549  ALA B CB  1 
ATOM   2941 N  N   . LYS B 2 50  ? 30.912  132.663 17.484  1.00 18.28 ? 550  LYS B N   1 
ATOM   2942 C  CA  . LYS B 2 50  ? 30.119  133.856 17.769  1.00 19.06 ? 550  LYS B CA  1 
ATOM   2943 C  C   . LYS B 2 50  ? 28.627  133.528 17.758  1.00 18.51 ? 550  LYS B C   1 
ATOM   2944 O  O   . LYS B 2 50  ? 27.886  133.953 18.644  1.00 18.58 ? 550  LYS B O   1 
ATOM   2945 C  CB  . LYS B 2 50  ? 30.403  134.954 16.743  1.00 20.25 ? 550  LYS B CB  1 
ATOM   2946 C  CG  . LYS B 2 50  ? 31.758  135.629 16.886  1.00 23.36 ? 550  LYS B CG  1 
ATOM   2947 C  CD  . LYS B 2 50  ? 31.937  136.686 15.798  1.00 25.94 ? 550  LYS B CD  1 
ATOM   2948 C  CE  . LYS B 2 50  ? 33.306  137.353 15.869  1.00 28.36 ? 550  LYS B CE  1 
ATOM   2949 N  NZ  . LYS B 2 50  ? 33.504  138.315 14.740  1.00 29.41 ? 550  LYS B NZ  1 
ATOM   2950 N  N   . VAL B 2 51  ? 28.184  132.778 16.754  1.00 17.72 ? 551  VAL B N   1 
ATOM   2951 C  CA  . VAL B 2 51  ? 26.775  132.410 16.664  1.00 17.12 ? 551  VAL B CA  1 
ATOM   2952 C  C   . VAL B 2 51  ? 26.383  131.550 17.864  1.00 17.19 ? 551  VAL B C   1 
ATOM   2953 O  O   . VAL B 2 51  ? 25.355  131.786 18.498  1.00 16.76 ? 551  VAL B O   1 
ATOM   2954 C  CB  . VAL B 2 51  ? 26.474  131.629 15.358  1.00 17.45 ? 551  VAL B CB  1 
ATOM   2955 C  CG1 . VAL B 2 51  ? 25.064  131.032 15.414  1.00 17.12 ? 551  VAL B CG1 1 
ATOM   2956 C  CG2 . VAL B 2 51  ? 26.595  132.563 14.153  1.00 17.22 ? 551  VAL B CG2 1 
ATOM   2957 N  N   . GLU B 2 52  ? 27.211  130.562 18.183  1.00 17.07 ? 552  GLU B N   1 
ATOM   2958 C  CA  . GLU B 2 52  ? 26.924  129.676 19.304  1.00 18.22 ? 552  GLU B CA  1 
ATOM   2959 C  C   . GLU B 2 52  ? 26.808  130.410 20.635  1.00 18.92 ? 552  GLU B C   1 
ATOM   2960 O  O   . GLU B 2 52  ? 25.941  130.088 21.448  1.00 18.47 ? 552  GLU B O   1 
ATOM   2961 C  CB  . GLU B 2 52  ? 27.984  128.571 19.396  1.00 18.29 ? 552  GLU B CB  1 
ATOM   2962 C  CG  . GLU B 2 52  ? 27.771  127.449 18.381  1.00 17.96 ? 552  GLU B CG  1 
ATOM   2963 C  CD  . GLU B 2 52  ? 28.819  126.353 18.462  1.00 18.44 ? 552  GLU B CD  1 
ATOM   2964 O  OE1 . GLU B 2 52  ? 29.396  126.138 19.550  1.00 18.89 ? 552  GLU B OE1 1 
ATOM   2965 O  OE2 . GLU B 2 52  ? 29.053  125.690 17.435  1.00 18.54 ? 552  GLU B OE2 1 
ATOM   2966 N  N   . GLU B 2 53  ? 27.674  131.393 20.863  1.00 20.10 ? 553  GLU B N   1 
ATOM   2967 C  CA  . GLU B 2 53  ? 27.625  132.149 22.110  1.00 21.55 ? 553  GLU B CA  1 
ATOM   2968 C  C   . GLU B 2 53  ? 26.277  132.858 22.235  1.00 20.86 ? 553  GLU B C   1 
ATOM   2969 O  O   . GLU B 2 53  ? 25.652  132.846 23.296  1.00 20.32 ? 553  GLU B O   1 
ATOM   2970 C  CB  . GLU B 2 53  ? 28.759  133.177 22.165  1.00 24.25 ? 553  GLU B CB  1 
ATOM   2971 C  CG  . GLU B 2 53  ? 28.718  134.052 23.411  1.00 29.70 ? 553  GLU B CG  1 
ATOM   2972 C  CD  . GLU B 2 53  ? 28.774  133.237 24.693  1.00 32.70 ? 553  GLU B CD  1 
ATOM   2973 O  OE1 . GLU B 2 53  ? 29.823  132.602 24.945  1.00 35.44 ? 553  GLU B OE1 1 
ATOM   2974 O  OE2 . GLU B 2 53  ? 27.768  133.221 25.443  1.00 35.30 ? 553  GLU B OE2 1 
ATOM   2975 N  N   . LYS B 2 54  ? 25.832  133.474 21.146  1.00 19.67 ? 554  LYS B N   1 
ATOM   2976 C  CA  . LYS B 2 54  ? 24.558  134.178 21.135  1.00 19.98 ? 554  LYS B CA  1 
ATOM   2977 C  C   . LYS B 2 54  ? 23.379  133.218 21.336  1.00 18.94 ? 554  LYS B C   1 
ATOM   2978 O  O   . LYS B 2 54  ? 22.473  133.498 22.122  1.00 18.78 ? 554  LYS B O   1 
ATOM   2979 C  CB  . LYS B 2 54  ? 24.398  134.938 19.815  1.00 21.52 ? 554  LYS B CB  1 
ATOM   2980 C  CG  . LYS B 2 54  ? 23.040  135.587 19.613  1.00 23.54 ? 554  LYS B CG  1 
ATOM   2981 C  CD  . LYS B 2 54  ? 22.718  136.585 20.713  1.00 25.63 ? 554  LYS B CD  1 
ATOM   2982 C  CE  . LYS B 2 54  ? 21.384  137.268 20.444  1.00 27.07 ? 554  LYS B CE  1 
ATOM   2983 N  NZ  . LYS B 2 54  ? 21.020  138.215 21.535  1.00 28.92 ? 554  LYS B NZ  1 
ATOM   2984 N  N   . ILE B 2 55  ? 23.399  132.087 20.637  1.00 17.83 ? 555  ILE B N   1 
ATOM   2985 C  CA  . ILE B 2 55  ? 22.328  131.099 20.748  1.00 17.45 ? 555  ILE B CA  1 
ATOM   2986 C  C   . ILE B 2 55  ? 22.205  130.542 22.170  1.00 17.13 ? 555  ILE B C   1 
ATOM   2987 O  O   . ILE B 2 55  ? 21.099  130.283 22.641  1.00 16.88 ? 555  ILE B O   1 
ATOM   2988 C  CB  . ILE B 2 55  ? 22.543  129.918 19.757  1.00 17.54 ? 555  ILE B CB  1 
ATOM   2989 C  CG1 . ILE B 2 55  ? 22.568  130.440 18.315  1.00 18.19 ? 555  ILE B CG1 1 
ATOM   2990 C  CG2 . ILE B 2 55  ? 21.435  128.880 19.918  1.00 16.80 ? 555  ILE B CG2 1 
ATOM   2991 C  CD1 . ILE B 2 55  ? 21.305  131.146 17.883  1.00 18.73 ? 555  ILE B CD1 1 
ATOM   2992 N  N   . GLN B 2 56  ? 23.333  130.355 22.850  1.00 16.88 ? 556  GLN B N   1 
ATOM   2993 C  CA  . GLN B 2 56  ? 23.307  129.836 24.215  1.00 17.41 ? 556  GLN B CA  1 
ATOM   2994 C  C   . GLN B 2 56  ? 22.578  130.820 25.127  1.00 17.85 ? 556  GLN B C   1 
ATOM   2995 O  O   . GLN B 2 56  ? 21.811  130.419 26.001  1.00 17.31 ? 556  GLN B O   1 
ATOM   2996 C  CB  . GLN B 2 56  ? 24.728  129.606 24.735  1.00 17.31 ? 556  GLN B CB  1 
ATOM   2997 C  CG  . GLN B 2 56  ? 24.796  129.052 26.159  1.00 18.09 ? 556  GLN B CG  1 
ATOM   2998 C  CD  . GLN B 2 56  ? 24.027  127.743 26.323  1.00 19.56 ? 556  GLN B CD  1 
ATOM   2999 O  OE1 . GLN B 2 56  ? 22.877  127.729 26.769  1.00 21.31 ? 556  GLN B OE1 1 
ATOM   3000 N  NE2 . GLN B 2 56  ? 24.660  126.638 25.953  1.00 19.37 ? 556  GLN B NE2 1 
ATOM   3001 N  N   . GLU B 2 57  ? 22.825  132.109 24.917  1.00 18.41 ? 557  GLU B N   1 
ATOM   3002 C  CA  . GLU B 2 57  ? 22.173  133.145 25.706  1.00 19.09 ? 557  GLU B CA  1 
ATOM   3003 C  C   . GLU B 2 57  ? 20.667  133.061 25.507  1.00 17.83 ? 557  GLU B C   1 
ATOM   3004 O  O   . GLU B 2 57  ? 19.903  133.142 26.465  1.00 17.01 ? 557  GLU B O   1 
ATOM   3005 C  CB  . GLU B 2 57  ? 22.660  134.529 25.280  1.00 21.18 ? 557  GLU B CB  1 
ATOM   3006 C  CG  . GLU B 2 57  ? 24.067  134.852 25.718  1.00 26.14 ? 557  GLU B CG  1 
ATOM   3007 C  CD  . GLU B 2 57  ? 24.505  136.220 25.241  1.00 29.31 ? 557  GLU B CD  1 
ATOM   3008 O  OE1 . GLU B 2 57  ? 23.698  137.172 25.352  1.00 31.42 ? 557  GLU B OE1 1 
ATOM   3009 O  OE2 . GLU B 2 57  ? 25.655  136.343 24.761  1.00 31.71 ? 557  GLU B OE2 1 
ATOM   3010 N  N   . VAL B 2 58  ? 20.243  132.909 24.256  1.00 16.80 ? 558  VAL B N   1 
ATOM   3011 C  CA  . VAL B 2 58  ? 18.820  132.798 23.957  1.00 16.90 ? 558  VAL B CA  1 
ATOM   3012 C  C   . VAL B 2 58  ? 18.248  131.558 24.644  1.00 16.36 ? 558  VAL B C   1 
ATOM   3013 O  O   . VAL B 2 58  ? 17.248  131.648 25.359  1.00 16.66 ? 558  VAL B O   1 
ATOM   3014 C  CB  . VAL B 2 58  ? 18.567  132.694 22.433  1.00 17.11 ? 558  VAL B CB  1 
ATOM   3015 C  CG1 . VAL B 2 58  ? 17.074  132.534 22.161  1.00 17.18 ? 558  VAL B CG1 1 
ATOM   3016 C  CG2 . VAL B 2 58  ? 19.102  133.936 21.731  1.00 17.46 ? 558  VAL B CG2 1 
ATOM   3017 N  N   . PHE B 2 59  ? 18.881  130.407 24.427  1.00 16.39 ? 559  PHE B N   1 
ATOM   3018 C  CA  . PHE B 2 59  ? 18.432  129.152 25.039  1.00 16.69 ? 559  PHE B CA  1 
ATOM   3019 C  C   . PHE B 2 59  ? 18.230  129.333 26.543  1.00 17.14 ? 559  PHE B C   1 
ATOM   3020 O  O   . PHE B 2 59  ? 17.195  128.954 27.100  1.00 17.68 ? 559  PHE B O   1 
ATOM   3021 C  CB  . PHE B 2 59  ? 19.469  128.039 24.821  1.00 16.51 ? 559  PHE B CB  1 
ATOM   3022 C  CG  . PHE B 2 59  ? 19.452  127.428 23.439  1.00 17.22 ? 559  PHE B CG  1 
ATOM   3023 C  CD1 . PHE B 2 59  ? 20.509  126.627 23.016  1.00 16.28 ? 559  PHE B CD1 1 
ATOM   3024 C  CD2 . PHE B 2 59  ? 18.377  127.625 22.576  1.00 15.95 ? 559  PHE B CD2 1 
ATOM   3025 C  CE1 . PHE B 2 59  ? 20.496  126.029 21.756  1.00 16.47 ? 559  PHE B CE1 1 
ATOM   3026 C  CE2 . PHE B 2 59  ? 18.356  127.031 21.314  1.00 16.30 ? 559  PHE B CE2 1 
ATOM   3027 C  CZ  . PHE B 2 59  ? 19.414  126.233 20.903  1.00 15.35 ? 559  PHE B CZ  1 
ATOM   3028 N  N   . SER B 2 60  ? 19.235  129.905 27.198  1.00 17.07 ? 560  SER B N   1 
ATOM   3029 C  CA  . SER B 2 60  ? 19.177  130.126 28.637  1.00 17.24 ? 560  SER B CA  1 
ATOM   3030 C  C   . SER B 2 60  ? 18.012  131.009 29.083  1.00 17.15 ? 560  SER B C   1 
ATOM   3031 O  O   . SER B 2 60  ? 17.494  130.839 30.190  1.00 17.18 ? 560  SER B O   1 
ATOM   3032 C  CB  . SER B 2 60  ? 20.497  130.726 29.129  1.00 17.79 ? 560  SER B CB  1 
ATOM   3033 O  OG  . SER B 2 60  ? 21.534  129.760 29.082  1.00 18.67 ? 560  SER B OG  1 
ATOM   3034 N  N   . SER B 2 61  ? 17.584  131.937 28.230  1.00 16.71 ? 561  SER B N   1 
ATOM   3035 C  CA  . SER B 2 61  ? 16.482  132.824 28.603  1.00 17.07 ? 561  SER B CA  1 
ATOM   3036 C  C   . SER B 2 61  ? 15.132  132.112 28.668  1.00 17.46 ? 561  SER B C   1 
ATOM   3037 O  O   . SER B 2 61  ? 14.148  132.694 29.130  1.00 17.72 ? 561  SER B O   1 
ATOM   3038 C  CB  . SER B 2 61  ? 16.389  134.017 27.642  1.00 17.23 ? 561  SER B CB  1 
ATOM   3039 O  OG  . SER B 2 61  ? 15.935  133.625 26.361  1.00 16.75 ? 561  SER B OG  1 
ATOM   3040 N  N   . TYR B 2 62  ? 15.080  130.862 28.206  1.00 16.73 ? 562  TYR B N   1 
ATOM   3041 C  CA  . TYR B 2 62  ? 13.836  130.091 28.243  1.00 17.25 ? 562  TYR B CA  1 
ATOM   3042 C  C   . TYR B 2 62  ? 13.822  129.073 29.379  1.00 17.20 ? 562  TYR B C   1 
ATOM   3043 O  O   . TYR B 2 62  ? 12.857  128.324 29.541  1.00 17.55 ? 562  TYR B O   1 
ATOM   3044 C  CB  . TYR B 2 62  ? 13.599  129.363 26.911  1.00 17.79 ? 562  TYR B CB  1 
ATOM   3045 C  CG  . TYR B 2 62  ? 13.215  130.289 25.785  1.00 16.83 ? 562  TYR B CG  1 
ATOM   3046 C  CD1 . TYR B 2 62  ? 14.187  130.934 25.021  1.00 17.26 ? 562  TYR B CD1 1 
ATOM   3047 C  CD2 . TYR B 2 62  ? 11.875  130.573 25.528  1.00 16.93 ? 562  TYR B CD2 1 
ATOM   3048 C  CE1 . TYR B 2 62  ? 13.831  131.850 24.026  1.00 17.06 ? 562  TYR B CE1 1 
ATOM   3049 C  CE2 . TYR B 2 62  ? 11.510  131.481 24.543  1.00 17.92 ? 562  TYR B CE2 1 
ATOM   3050 C  CZ  . TYR B 2 62  ? 12.493  132.116 23.796  1.00 17.34 ? 562  TYR B CZ  1 
ATOM   3051 O  OH  . TYR B 2 62  ? 12.128  133.019 22.827  1.00 19.02 ? 562  TYR B OH  1 
ATOM   3052 N  N   . LYS B 2 63  ? 14.891  129.060 30.170  1.00 17.11 ? 563  LYS B N   1 
ATOM   3053 C  CA  . LYS B 2 63  ? 15.022  128.129 31.289  1.00 17.86 ? 563  LYS B CA  1 
ATOM   3054 C  C   . LYS B 2 63  ? 15.041  128.869 32.626  1.00 17.34 ? 563  LYS B C   1 
ATOM   3055 O  O   . LYS B 2 63  ? 15.746  129.861 32.779  1.00 16.98 ? 563  LYS B O   1 
ATOM   3056 C  CB  . LYS B 2 63  ? 16.315  127.320 31.134  1.00 18.37 ? 563  LYS B CB  1 
ATOM   3057 C  CG  . LYS B 2 63  ? 16.590  126.316 32.245  1.00 19.65 ? 563  LYS B CG  1 
ATOM   3058 C  CD  . LYS B 2 63  ? 17.900  125.574 31.989  1.00 20.59 ? 563  LYS B CD  1 
ATOM   3059 C  CE  . LYS B 2 63  ? 18.323  124.740 33.194  1.00 21.50 ? 563  LYS B CE  1 
ATOM   3060 N  NZ  . LYS B 2 63  ? 17.290  123.733 33.578  1.00 22.30 ? 563  LYS B NZ  1 
ATOM   3061 N  N   . PHE B 2 64  ? 14.254  128.388 33.582  1.00 16.95 ? 564  PHE B N   1 
ATOM   3062 C  CA  . PHE B 2 64  ? 14.202  128.990 34.914  1.00 17.16 ? 564  PHE B CA  1 
ATOM   3063 C  C   . PHE B 2 64  ? 14.430  127.841 35.884  1.00 17.00 ? 564  PHE B C   1 
ATOM   3064 O  O   . PHE B 2 64  ? 13.521  127.395 36.592  1.00 16.72 ? 564  PHE B O   1 
ATOM   3065 C  CB  . PHE B 2 64  ? 12.845  129.659 35.135  1.00 18.03 ? 564  PHE B CB  1 
ATOM   3066 C  CG  . PHE B 2 64  ? 12.503  130.677 34.077  1.00 19.04 ? 564  PHE B CG  1 
ATOM   3067 C  CD1 . PHE B 2 64  ? 11.802  130.306 32.933  1.00 19.20 ? 564  PHE B CD1 1 
ATOM   3068 C  CD2 . PHE B 2 64  ? 12.937  131.995 34.198  1.00 19.39 ? 564  PHE B CD2 1 
ATOM   3069 C  CE1 . PHE B 2 64  ? 11.539  131.235 31.919  1.00 20.03 ? 564  PHE B CE1 1 
ATOM   3070 C  CE2 . PHE B 2 64  ? 12.681  132.933 33.193  1.00 19.83 ? 564  PHE B CE2 1 
ATOM   3071 C  CZ  . PHE B 2 64  ? 11.981  132.553 32.050  1.00 20.06 ? 564  PHE B CZ  1 
ATOM   3072 N  N   . ASN B 2 65  ? 15.671  127.369 35.896  1.00 16.54 ? 565  ASN B N   1 
ATOM   3073 C  CA  . ASN B 2 65  ? 16.061  126.229 36.704  1.00 17.09 ? 565  ASN B CA  1 
ATOM   3074 C  C   . ASN B 2 65  ? 15.203  125.045 36.267  1.00 17.06 ? 565  ASN B C   1 
ATOM   3075 O  O   . ASN B 2 65  ? 15.220  124.689 35.090  1.00 17.26 ? 565  ASN B O   1 
ATOM   3076 C  CB  . ASN B 2 65  ? 15.924  126.542 38.199  1.00 16.53 ? 565  ASN B CB  1 
ATOM   3077 C  CG  . ASN B 2 65  ? 17.037  127.454 38.689  1.00 17.59 ? 565  ASN B CG  1 
ATOM   3078 O  OD1 . ASN B 2 65  ? 18.205  127.222 38.382  1.00 17.45 ? 565  ASN B OD1 1 
ATOM   3079 N  ND2 . ASN B 2 65  ? 16.687  128.492 39.443  1.00 16.83 ? 565  ASN B ND2 1 
ATOM   3080 N  N   . HIS B 2 66  ? 14.434  124.446 37.170  1.00 16.93 ? 566  HIS B N   1 
ATOM   3081 C  CA  . HIS B 2 66  ? 13.629  123.295 36.771  1.00 17.31 ? 566  HIS B CA  1 
ATOM   3082 C  C   . HIS B 2 66  ? 12.313  123.682 36.092  1.00 16.86 ? 566  HIS B C   1 
ATOM   3083 O  O   . HIS B 2 66  ? 11.577  122.820 35.608  1.00 17.04 ? 566  HIS B O   1 
ATOM   3084 C  CB  . HIS B 2 66  ? 13.359  122.393 37.979  1.00 18.31 ? 566  HIS B CB  1 
ATOM   3085 C  CG  . HIS B 2 66  ? 12.898  121.018 37.610  1.00 20.04 ? 566  HIS B CG  1 
ATOM   3086 N  ND1 . HIS B 2 66  ? 13.594  120.212 36.736  1.00 21.05 ? 566  HIS B ND1 1 
ATOM   3087 C  CD2 . HIS B 2 66  ? 11.811  120.306 37.993  1.00 21.09 ? 566  HIS B CD2 1 
ATOM   3088 C  CE1 . HIS B 2 66  ? 12.955  119.064 36.593  1.00 21.71 ? 566  HIS B CE1 1 
ATOM   3089 N  NE2 . HIS B 2 66  ? 11.870  119.095 37.345  1.00 22.23 ? 566  HIS B NE2 1 
ATOM   3090 N  N   . LEU B 2 67  ? 12.014  124.976 36.057  1.00 16.08 ? 567  LEU B N   1 
ATOM   3091 C  CA  . LEU B 2 67  ? 10.795  125.442 35.406  1.00 16.09 ? 567  LEU B CA  1 
ATOM   3092 C  C   . LEU B 2 67  ? 11.118  125.781 33.952  1.00 15.89 ? 567  LEU B C   1 
ATOM   3093 O  O   . LEU B 2 67  ? 11.949  126.650 33.687  1.00 16.09 ? 567  LEU B O   1 
ATOM   3094 C  CB  . LEU B 2 67  ? 10.246  126.685 36.118  1.00 15.83 ? 567  LEU B CB  1 
ATOM   3095 C  CG  . LEU B 2 67  ? 9.066   127.388 35.434  1.00 15.67 ? 567  LEU B CG  1 
ATOM   3096 C  CD1 . LEU B 2 67  ? 7.890   126.423 35.300  1.00 15.43 ? 567  LEU B CD1 1 
ATOM   3097 C  CD2 . LEU B 2 67  ? 8.660   128.611 36.238  1.00 15.72 ? 567  LEU B CD2 1 
ATOM   3098 N  N   . VAL B 2 68  ? 10.478  125.084 33.015  1.00 15.73 ? 568  VAL B N   1 
ATOM   3099 C  CA  . VAL B 2 68  ? 10.702  125.337 31.591  1.00 15.50 ? 568  VAL B CA  1 
ATOM   3100 C  C   . VAL B 2 68  ? 9.351   125.495 30.891  1.00 15.48 ? 568  VAL B C   1 
ATOM   3101 O  O   . VAL B 2 68  ? 8.779   124.528 30.390  1.00 15.90 ? 568  VAL B O   1 
ATOM   3102 C  CB  . VAL B 2 68  ? 11.497  124.185 30.930  1.00 15.39 ? 568  VAL B CB  1 
ATOM   3103 C  CG1 . VAL B 2 68  ? 11.950  124.597 29.528  1.00 15.26 ? 568  VAL B CG1 1 
ATOM   3104 C  CG2 . VAL B 2 68  ? 12.709  123.819 31.794  1.00 15.55 ? 568  VAL B CG2 1 
ATOM   3105 N  N   . PRO B 2 69  ? 8.820   126.726 30.857  1.00 15.41 ? 569  PRO B N   1 
ATOM   3106 C  CA  . PRO B 2 69  ? 7.527   127.021 30.223  1.00 15.95 ? 569  PRO B CA  1 
ATOM   3107 C  C   . PRO B 2 69  ? 7.435   126.553 28.771  1.00 16.02 ? 569  PRO B C   1 
ATOM   3108 O  O   . PRO B 2 69  ? 8.419   126.594 28.028  1.00 15.36 ? 569  PRO B O   1 
ATOM   3109 C  CB  . PRO B 2 69  ? 7.423   128.540 30.341  1.00 15.25 ? 569  PRO B CB  1 
ATOM   3110 C  CG  . PRO B 2 69  ? 8.204   128.836 31.600  1.00 16.14 ? 569  PRO B CG  1 
ATOM   3111 C  CD  . PRO B 2 69  ? 9.414   127.947 31.430  1.00 15.54 ? 569  PRO B CD  1 
ATOM   3112 N  N   . ARG B 2 70  ? 6.251   126.107 28.366  1.00 16.18 ? 570  ARG B N   1 
ATOM   3113 C  CA  . ARG B 2 70  ? 6.065   125.646 26.995  1.00 16.70 ? 570  ARG B CA  1 
ATOM   3114 C  C   . ARG B 2 70  ? 6.355   126.766 26.002  1.00 16.38 ? 570  ARG B C   1 
ATOM   3115 O  O   . ARG B 2 70  ? 6.048   127.930 26.259  1.00 16.59 ? 570  ARG B O   1 
ATOM   3116 C  CB  . ARG B 2 70  ? 4.641   125.117 26.799  1.00 17.38 ? 570  ARG B CB  1 
ATOM   3117 C  CG  . ARG B 2 70  ? 4.438   123.717 27.361  1.00 18.38 ? 570  ARG B CG  1 
ATOM   3118 C  CD  . ARG B 2 70  ? 3.014   123.213 27.157  1.00 19.49 ? 570  ARG B CD  1 
ATOM   3119 N  NE  . ARG B 2 70  ? 2.843   121.875 27.713  1.00 20.05 ? 570  ARG B NE  1 
ATOM   3120 C  CZ  . ARG B 2 70  ? 2.834   120.750 27.003  1.00 20.83 ? 570  ARG B CZ  1 
ATOM   3121 N  NH1 . ARG B 2 70  ? 2.979   120.784 25.685  1.00 21.15 ? 570  ARG B NH1 1 
ATOM   3122 N  NH2 . ARG B 2 70  ? 2.695   119.581 27.619  1.00 21.36 ? 570  ARG B NH2 1 
ATOM   3123 N  N   . LEU B 2 71  ? 6.966   126.409 24.876  1.00 15.77 ? 571  LEU B N   1 
ATOM   3124 C  CA  . LEU B 2 71  ? 7.300   127.378 23.840  1.00 15.83 ? 571  LEU B CA  1 
ATOM   3125 C  C   . LEU B 2 71  ? 6.045   127.814 23.098  1.00 15.92 ? 571  LEU B C   1 
ATOM   3126 O  O   . LEU B 2 71  ? 5.106   127.030 22.927  1.00 15.71 ? 571  LEU B O   1 
ATOM   3127 C  CB  . LEU B 2 71  ? 8.303   126.775 22.856  1.00 15.60 ? 571  LEU B CB  1 
ATOM   3128 C  CG  . LEU B 2 71  ? 9.624   126.360 23.503  1.00 15.67 ? 571  LEU B CG  1 
ATOM   3129 C  CD1 . LEU B 2 71  ? 10.526  125.713 22.466  1.00 15.66 ? 571  LEU B CD1 1 
ATOM   3130 C  CD2 . LEU B 2 71  ? 10.293  127.586 24.123  1.00 15.06 ? 571  LEU B CD2 1 
ATOM   3131 N  N   . VAL B 2 72  ? 6.040   129.065 22.654  1.00 15.29 ? 572  VAL B N   1 
ATOM   3132 C  CA  . VAL B 2 72  ? 4.889   129.613 21.956  1.00 15.88 ? 572  VAL B CA  1 
ATOM   3133 C  C   . VAL B 2 72  ? 5.201   130.240 20.600  1.00 16.21 ? 572  VAL B C   1 
ATOM   3134 O  O   . VAL B 2 72  ? 6.099   131.078 20.476  1.00 16.31 ? 572  VAL B O   1 
ATOM   3135 C  CB  . VAL B 2 72  ? 4.183   130.689 22.821  1.00 15.96 ? 572  VAL B CB  1 
ATOM   3136 C  CG1 . VAL B 2 72  ? 2.966   131.244 22.080  1.00 16.31 ? 572  VAL B CG1 1 
ATOM   3137 C  CG2 . VAL B 2 72  ? 3.776   130.094 24.168  1.00 16.23 ? 572  VAL B CG2 1 
ATOM   3138 N  N   . LEU B 2 73  ? 4.459   129.810 19.586  1.00 16.47 ? 573  LEU B N   1 
ATOM   3139 C  CA  . LEU B 2 73  ? 4.590   130.362 18.243  1.00 16.08 ? 573  LEU B CA  1 
ATOM   3140 C  C   . LEU B 2 73  ? 3.667   131.578 18.313  1.00 16.58 ? 573  LEU B C   1 
ATOM   3141 O  O   . LEU B 2 73  ? 2.485   131.439 18.635  1.00 15.88 ? 573  LEU B O   1 
ATOM   3142 C  CB  . LEU B 2 73  ? 4.071   129.370 17.195  1.00 15.22 ? 573  LEU B CB  1 
ATOM   3143 C  CG  . LEU B 2 73  ? 4.006   129.888 15.752  1.00 15.08 ? 573  LEU B CG  1 
ATOM   3144 C  CD1 . LEU B 2 73  ? 5.409   130.076 15.214  1.00 13.89 ? 573  LEU B CD1 1 
ATOM   3145 C  CD2 . LEU B 2 73  ? 3.231   128.914 14.881  1.00 14.70 ? 573  LEU B CD2 1 
ATOM   3146 N  N   . GLN B 2 74  ? 4.203   132.762 18.031  1.00 16.76 ? 574  GLN B N   1 
ATOM   3147 C  CA  . GLN B 2 74  ? 3.416   133.988 18.103  1.00 18.24 ? 574  GLN B CA  1 
ATOM   3148 C  C   . GLN B 2 74  ? 2.521   134.201 16.882  1.00 18.23 ? 574  GLN B C   1 
ATOM   3149 O  O   . GLN B 2 74  ? 2.687   135.159 16.122  1.00 16.92 ? 574  GLN B O   1 
ATOM   3150 C  CB  . GLN B 2 74  ? 4.349   135.186 18.302  1.00 19.13 ? 574  GLN B CB  1 
ATOM   3151 C  CG  . GLN B 2 74  ? 5.200   135.106 19.573  1.00 21.48 ? 574  GLN B CG  1 
ATOM   3152 C  CD  . GLN B 2 74  ? 4.365   135.047 20.847  1.00 23.50 ? 574  GLN B CD  1 
ATOM   3153 O  OE1 . GLN B 2 74  ? 3.316   135.681 20.947  1.00 25.33 ? 574  GLN B OE1 1 
ATOM   3154 N  NE2 . GLN B 2 74  ? 4.841   134.298 21.832  1.00 24.64 ? 574  GLN B NE2 1 
ATOM   3155 N  N   . ARG B 2 75  ? 1.561   133.294 16.725  1.00 18.77 ? 575  ARG B N   1 
ATOM   3156 C  CA  . ARG B 2 75  ? 0.603   133.304 15.621  1.00 19.64 ? 575  ARG B CA  1 
ATOM   3157 C  C   . ARG B 2 75  ? 0.023   134.656 15.242  1.00 19.87 ? 575  ARG B C   1 
ATOM   3158 O  O   . ARG B 2 75  ? 0.142   135.089 14.096  1.00 18.44 ? 575  ARG B O   1 
ATOM   3159 C  CB  . ARG B 2 75  ? -0.560  132.371 15.940  1.00 20.33 ? 575  ARG B CB  1 
ATOM   3160 C  CG  . ARG B 2 75  ? -0.182  130.926 16.008  1.00 21.76 ? 575  ARG B CG  1 
ATOM   3161 C  CD  . ARG B 2 75  ? -1.348  130.090 16.500  1.00 22.62 ? 575  ARG B CD  1 
ATOM   3162 N  NE  . ARG B 2 75  ? -1.222  128.733 15.999  1.00 23.67 ? 575  ARG B NE  1 
ATOM   3163 C  CZ  . ARG B 2 75  ? -1.476  128.384 14.745  1.00 23.52 ? 575  ARG B CZ  1 
ATOM   3164 N  NH1 . ARG B 2 75  ? -1.882  129.297 13.873  1.00 23.78 ? 575  ARG B NH1 1 
ATOM   3165 N  NH2 . ARG B 2 75  ? -1.296  127.131 14.361  1.00 23.71 ? 575  ARG B NH2 1 
ATOM   3166 N  N   . GLU B 2 76  ? -0.632  135.307 16.198  1.00 20.30 ? 576  GLU B N   1 
ATOM   3167 C  CA  . GLU B 2 76  ? -1.253  136.597 15.930  1.00 21.72 ? 576  GLU B CA  1 
ATOM   3168 C  C   . GLU B 2 76  ? -0.300  137.674 15.444  1.00 20.87 ? 576  GLU B C   1 
ATOM   3169 O  O   . GLU B 2 76  ? -0.661  138.471 14.577  1.00 20.75 ? 576  GLU B O   1 
ATOM   3170 C  CB  . GLU B 2 76  ? -2.010  137.096 17.159  1.00 23.61 ? 576  GLU B CB  1 
ATOM   3171 C  CG  . GLU B 2 76  ? -3.388  136.482 17.307  1.00 29.39 ? 576  GLU B CG  1 
ATOM   3172 C  CD  . GLU B 2 76  ? -4.206  136.560 16.021  1.00 32.72 ? 576  GLU B CD  1 
ATOM   3173 O  OE1 . GLU B 2 76  ? -3.994  135.712 15.121  1.00 34.94 ? 576  GLU B OE1 1 
ATOM   3174 O  OE2 . GLU B 2 76  ? -5.053  137.477 15.904  1.00 35.13 ? 576  GLU B OE2 1 
ATOM   3175 N  N   . LYS B 2 77  ? 0.907   137.715 15.998  1.00 20.06 ? 577  LYS B N   1 
ATOM   3176 C  CA  . LYS B 2 77  ? 1.878   138.714 15.568  1.00 20.10 ? 577  LYS B CA  1 
ATOM   3177 C  C   . LYS B 2 77  ? 2.289   138.422 14.127  1.00 19.11 ? 577  LYS B C   1 
ATOM   3178 O  O   . LYS B 2 77  ? 2.374   139.328 13.295  1.00 18.39 ? 577  LYS B O   1 
ATOM   3179 C  CB  . LYS B 2 77  ? 3.116   138.686 16.461  1.00 21.77 ? 577  LYS B CB  1 
ATOM   3180 C  CG  . LYS B 2 77  ? 2.862   138.987 17.928  1.00 24.53 ? 577  LYS B CG  1 
ATOM   3181 C  CD  . LYS B 2 77  ? 4.165   138.830 18.698  1.00 28.04 ? 577  LYS B CD  1 
ATOM   3182 C  CE  . LYS B 2 77  ? 3.983   138.965 20.201  1.00 30.26 ? 577  LYS B CE  1 
ATOM   3183 N  NZ  . LYS B 2 77  ? 5.300   138.788 20.889  1.00 31.39 ? 577  LYS B NZ  1 
ATOM   3184 N  N   . HIS B 2 78  ? 2.543   137.151 13.832  1.00 17.91 ? 578  HIS B N   1 
ATOM   3185 C  CA  . HIS B 2 78  ? 2.940   136.771 12.482  1.00 17.65 ? 578  HIS B CA  1 
ATOM   3186 C  C   . HIS B 2 78  ? 1.812   137.085 11.507  1.00 18.11 ? 578  HIS B C   1 
ATOM   3187 O  O   . HIS B 2 78  ? 2.053   137.598 10.415  1.00 17.36 ? 578  HIS B O   1 
ATOM   3188 C  CB  . HIS B 2 78  ? 3.285   135.281 12.424  1.00 16.42 ? 578  HIS B CB  1 
ATOM   3189 C  CG  . HIS B 2 78  ? 4.389   134.883 13.356  1.00 14.83 ? 578  HIS B CG  1 
ATOM   3190 N  ND1 . HIS B 2 78  ? 5.521   135.649 13.536  1.00 14.56 ? 578  HIS B ND1 1 
ATOM   3191 C  CD2 . HIS B 2 78  ? 4.534   133.801 14.158  1.00 14.71 ? 578  HIS B CD2 1 
ATOM   3192 C  CE1 . HIS B 2 78  ? 6.316   135.056 14.410  1.00 14.98 ? 578  HIS B CE1 1 
ATOM   3193 N  NE2 . HIS B 2 78  ? 5.740   133.933 14.801  1.00 14.63 ? 578  HIS B NE2 1 
ATOM   3194 N  N   . PHE B 2 79  ? 0.580   136.785 11.916  1.00 18.27 ? 579  PHE B N   1 
ATOM   3195 C  CA  . PHE B 2 79  ? -0.591  137.030 11.079  1.00 18.91 ? 579  PHE B CA  1 
ATOM   3196 C  C   . PHE B 2 79  ? -0.733  138.499 10.682  1.00 19.18 ? 579  PHE B C   1 
ATOM   3197 O  O   . PHE B 2 79  ? -0.958  138.812 9.513   1.00 18.93 ? 579  PHE B O   1 
ATOM   3198 C  CB  . PHE B 2 79  ? -1.858  136.561 11.804  1.00 19.24 ? 579  PHE B CB  1 
ATOM   3199 C  CG  . PHE B 2 79  ? -3.138  137.014 11.153  1.00 19.63 ? 579  PHE B CG  1 
ATOM   3200 C  CD1 . PHE B 2 79  ? -3.419  136.689 9.829   1.00 19.97 ? 579  PHE B CD1 1 
ATOM   3201 C  CD2 . PHE B 2 79  ? -4.066  137.766 11.868  1.00 20.49 ? 579  PHE B CD2 1 
ATOM   3202 C  CE1 . PHE B 2 79  ? -4.605  137.104 9.224   1.00 20.17 ? 579  PHE B CE1 1 
ATOM   3203 C  CE2 . PHE B 2 79  ? -5.259  138.187 11.272  1.00 21.14 ? 579  PHE B CE2 1 
ATOM   3204 C  CZ  . PHE B 2 79  ? -5.528  137.854 9.947   1.00 21.20 ? 579  PHE B CZ  1 
ATOM   3205 N  N   . HIS B 2 80  ? -0.609  139.400 11.651  1.00 19.55 ? 580  HIS B N   1 
ATOM   3206 C  CA  . HIS B 2 80  ? -0.731  140.824 11.360  1.00 20.25 ? 580  HIS B CA  1 
ATOM   3207 C  C   . HIS B 2 80  ? 0.383   141.327 10.447  1.00 19.26 ? 580  HIS B C   1 
ATOM   3208 O  O   . HIS B 2 80  ? 0.144   142.157 9.572   1.00 18.34 ? 580  HIS B O   1 
ATOM   3209 C  CB  . HIS B 2 80  ? -0.779  141.623 12.663  1.00 22.89 ? 580  HIS B CB  1 
ATOM   3210 C  CG  . HIS B 2 80  ? -2.051  141.423 13.425  1.00 25.68 ? 580  HIS B CG  1 
ATOM   3211 N  ND1 . HIS B 2 80  ? -3.291  141.652 12.867  1.00 26.95 ? 580  HIS B ND1 1 
ATOM   3212 C  CD2 . HIS B 2 80  ? -2.282  140.962 14.678  1.00 27.16 ? 580  HIS B CD2 1 
ATOM   3213 C  CE1 . HIS B 2 80  ? -4.231  141.337 13.741  1.00 27.54 ? 580  HIS B CE1 1 
ATOM   3214 N  NE2 . HIS B 2 80  ? -3.645  140.915 14.848  1.00 27.58 ? 580  HIS B NE2 1 
ATOM   3215 N  N   . TYR B 2 81  ? 1.592   140.809 10.646  1.00 18.11 ? 581  TYR B N   1 
ATOM   3216 C  CA  . TYR B 2 81  ? 2.745   141.171 9.822   1.00 16.92 ? 581  TYR B CA  1 
ATOM   3217 C  C   . TYR B 2 81  ? 2.477   140.758 8.367   1.00 16.76 ? 581  TYR B C   1 
ATOM   3218 O  O   . TYR B 2 81  ? 2.673   141.542 7.431   1.00 16.11 ? 581  TYR B O   1 
ATOM   3219 C  CB  . TYR B 2 81  ? 3.991   140.455 10.363  1.00 16.41 ? 581  TYR B CB  1 
ATOM   3220 C  CG  . TYR B 2 81  ? 5.216   140.493 9.472   1.00 16.69 ? 581  TYR B CG  1 
ATOM   3221 C  CD1 . TYR B 2 81  ? 5.800   141.704 9.091   1.00 16.50 ? 581  TYR B CD1 1 
ATOM   3222 C  CD2 . TYR B 2 81  ? 5.821   139.308 9.052   1.00 16.63 ? 581  TYR B CD2 1 
ATOM   3223 C  CE1 . TYR B 2 81  ? 6.966   141.729 8.315   1.00 16.78 ? 581  TYR B CE1 1 
ATOM   3224 C  CE2 . TYR B 2 81  ? 6.981   139.320 8.281   1.00 16.70 ? 581  TYR B CE2 1 
ATOM   3225 C  CZ  . TYR B 2 81  ? 7.550   140.528 7.917   1.00 17.10 ? 581  TYR B CZ  1 
ATOM   3226 O  OH  . TYR B 2 81  ? 8.710   140.523 7.173   1.00 16.88 ? 581  TYR B OH  1 
ATOM   3227 N  N   . LEU B 2 82  ? 2.008   139.527 8.194   1.00 16.66 ? 582  LEU B N   1 
ATOM   3228 C  CA  . LEU B 2 82  ? 1.701   138.983 6.877   1.00 17.66 ? 582  LEU B CA  1 
ATOM   3229 C  C   . LEU B 2 82  ? 0.554   139.721 6.176   1.00 19.03 ? 582  LEU B C   1 
ATOM   3230 O  O   . LEU B 2 82  ? 0.669   140.099 5.004   1.00 18.77 ? 582  LEU B O   1 
ATOM   3231 C  CB  . LEU B 2 82  ? 1.350   137.495 7.009   1.00 17.32 ? 582  LEU B CB  1 
ATOM   3232 C  CG  . LEU B 2 82  ? 2.500   136.564 7.413   1.00 17.03 ? 582  LEU B CG  1 
ATOM   3233 C  CD1 . LEU B 2 82  ? 1.950   135.239 7.926   1.00 16.64 ? 582  LEU B CD1 1 
ATOM   3234 C  CD2 . LEU B 2 82  ? 3.419   136.351 6.208   1.00 16.44 ? 582  LEU B CD2 1 
ATOM   3235 N  N   . LYS B 2 83  ? -0.547  139.919 6.895   1.00 19.94 ? 583  LYS B N   1 
ATOM   3236 C  CA  . LYS B 2 83  ? -1.720  140.596 6.348   1.00 22.18 ? 583  LYS B CA  1 
ATOM   3237 C  C   . LYS B 2 83  ? -1.361  141.968 5.776   1.00 22.36 ? 583  LYS B C   1 
ATOM   3238 O  O   . LYS B 2 83  ? -1.822  142.346 4.702   1.00 22.02 ? 583  LYS B O   1 
ATOM   3239 C  CB  . LYS B 2 83  ? -2.793  140.744 7.436   1.00 22.93 ? 583  LYS B CB  1 
ATOM   3240 C  CG  . LYS B 2 83  ? -4.053  141.468 6.978   1.00 25.67 ? 583  LYS B CG  1 
ATOM   3241 C  CD  . LYS B 2 83  ? -5.076  141.589 8.103   1.00 26.47 ? 583  LYS B CD  1 
ATOM   3242 C  CE  . LYS B 2 83  ? -6.242  142.479 7.685   1.00 27.50 ? 583  LYS B CE  1 
ATOM   3243 N  NZ  . LYS B 2 83  ? -7.221  142.682 8.795   1.00 28.97 ? 583  LYS B NZ  1 
ATOM   3244 N  N   . ARG B 2 84  ? -0.527  142.701 6.501   1.00 23.89 ? 584  ARG B N   1 
ATOM   3245 C  CA  . ARG B 2 84  ? -0.097  144.024 6.075   1.00 25.59 ? 584  ARG B CA  1 
ATOM   3246 C  C   . ARG B 2 84  ? 0.750   143.963 4.799   1.00 25.22 ? 584  ARG B C   1 
ATOM   3247 O  O   . ARG B 2 84  ? 0.528   144.728 3.859   1.00 25.11 ? 584  ARG B O   1 
ATOM   3248 C  CB  . ARG B 2 84  ? 0.702   144.691 7.198   1.00 27.68 ? 584  ARG B CB  1 
ATOM   3249 C  CG  . ARG B 2 84  ? 1.309   146.038 6.828   1.00 32.02 ? 584  ARG B CG  1 
ATOM   3250 C  CD  . ARG B 2 84  ? 0.245   147.101 6.585   1.00 35.13 ? 584  ARG B CD  1 
ATOM   3251 N  NE  . ARG B 2 84  ? 0.820   148.340 6.061   1.00 38.37 ? 584  ARG B NE  1 
ATOM   3252 C  CZ  . ARG B 2 84  ? 0.138   149.472 5.894   1.00 40.25 ? 584  ARG B CZ  1 
ATOM   3253 N  NH1 . ARG B 2 84  ? -1.150  149.530 6.213   1.00 41.04 ? 584  ARG B NH1 1 
ATOM   3254 N  NH2 . ARG B 2 84  ? 0.743   150.549 5.403   1.00 40.88 ? 584  ARG B NH2 1 
ATOM   3255 N  N   . GLY B 2 85  ? 1.707   143.040 4.764   1.00 23.98 ? 585  GLY B N   1 
ATOM   3256 C  CA  . GLY B 2 85  ? 2.573   142.926 3.604   1.00 23.38 ? 585  GLY B CA  1 
ATOM   3257 C  C   . GLY B 2 85  ? 1.884   142.525 2.312   1.00 23.34 ? 585  GLY B C   1 
ATOM   3258 O  O   . GLY B 2 85  ? 2.395   142.782 1.224   1.00 22.01 ? 585  GLY B O   1 
ATOM   3259 N  N   . LEU B 2 86  ? 0.717   141.904 2.424   1.00 23.97 ? 586  LEU B N   1 
ATOM   3260 C  CA  . LEU B 2 86  ? -0.007  141.453 1.246   1.00 24.84 ? 586  LEU B CA  1 
ATOM   3261 C  C   . LEU B 2 86  ? -0.600  142.609 0.434   1.00 25.59 ? 586  LEU B C   1 
ATOM   3262 O  O   . LEU B 2 86  ? -0.924  142.444 -0.742  1.00 24.57 ? 586  LEU B O   1 
ATOM   3263 C  CB  . LEU B 2 86  ? -1.099  140.460 1.663   1.00 24.55 ? 586  LEU B CB  1 
ATOM   3264 C  CG  . LEU B 2 86  ? -1.770  139.633 0.561   1.00 25.28 ? 586  LEU B CG  1 
ATOM   3265 C  CD1 . LEU B 2 86  ? -0.725  138.926 -0.294  1.00 24.61 ? 586  LEU B CD1 1 
ATOM   3266 C  CD2 . LEU B 2 86  ? -2.709  138.628 1.198   1.00 24.73 ? 586  LEU B CD2 1 
ATOM   3267 N  N   . ARG B 2 87  ? -0.726  143.782 1.049   1.00 26.56 ? 587  ARG B N   1 
ATOM   3268 C  CA  . ARG B 2 87  ? -1.278  144.933 0.341   1.00 29.11 ? 587  ARG B CA  1 
ATOM   3269 C  C   . ARG B 2 87  ? -0.197  145.941 -0.037  1.00 30.16 ? 587  ARG B C   1 
ATOM   3270 O  O   . ARG B 2 87  ? -0.022  146.251 -1.213  1.00 30.03 ? 587  ARG B O   1 
ATOM   3271 C  CB  . ARG B 2 87  ? -2.359  145.620 1.190   1.00 30.24 ? 587  ARG B CB  1 
ATOM   3272 C  CG  . ARG B 2 87  ? -3.442  144.667 1.684   1.00 32.00 ? 587  ARG B CG  1 
ATOM   3273 C  CD  . ARG B 2 87  ? -4.767  144.775 0.921   1.00 33.70 ? 587  ARG B CD  1 
ATOM   3274 N  NE  . ARG B 2 87  ? -4.633  144.702 -0.531  1.00 33.95 ? 587  ARG B NE  1 
ATOM   3275 C  CZ  . ARG B 2 87  ? -5.619  144.345 -1.355  1.00 34.53 ? 587  ARG B CZ  1 
ATOM   3276 N  NH1 . ARG B 2 87  ? -6.809  144.015 -0.870  1.00 34.18 ? 587  ARG B NH1 1 
ATOM   3277 N  NH2 . ARG B 2 87  ? -5.426  144.342 -2.667  1.00 33.84 ? 587  ARG B NH2 1 
ATOM   3278 N  N   . GLN B 2 88  ? 0.535   146.445 0.950   1.00 31.67 ? 588  GLN B N   1 
ATOM   3279 C  CA  . GLN B 2 88  ? 1.578   147.425 0.668   1.00 33.12 ? 588  GLN B CA  1 
ATOM   3280 C  C   . GLN B 2 88  ? 2.935   147.133 1.287   1.00 32.90 ? 588  GLN B C   1 
ATOM   3281 O  O   . GLN B 2 88  ? 3.053   146.348 2.230   1.00 33.28 ? 588  GLN B O   1 
ATOM   3282 C  CB  . GLN B 2 88  ? 1.132   148.820 1.098   1.00 34.19 ? 588  GLN B CB  1 
ATOM   3283 C  CG  . GLN B 2 88  ? -0.027  149.360 0.294   1.00 37.63 ? 588  GLN B CG  1 
ATOM   3284 C  CD  . GLN B 2 88  ? 0.041   150.863 0.138   1.00 38.93 ? 588  GLN B CD  1 
ATOM   3285 O  OE1 . GLN B 2 88  ? 0.196   151.594 1.116   1.00 40.31 ? 588  GLN B OE1 1 
ATOM   3286 N  NE2 . GLN B 2 88  ? -0.076  151.335 -1.099  1.00 40.49 ? 588  GLN B NE2 1 
ATOM   3287 N  N   . LEU B 2 89  ? 3.955   147.790 0.743   1.00 31.85 ? 589  LEU B N   1 
ATOM   3288 C  CA  . LEU B 2 89  ? 5.327   147.628 1.201   1.00 30.90 ? 589  LEU B CA  1 
ATOM   3289 C  C   . LEU B 2 89  ? 6.081   148.943 1.022   1.00 30.74 ? 589  LEU B C   1 
ATOM   3290 O  O   . LEU B 2 89  ? 5.786   149.712 0.108   1.00 30.39 ? 589  LEU B O   1 
ATOM   3291 C  CB  . LEU B 2 89  ? 6.007   146.526 0.389   1.00 29.95 ? 589  LEU B CB  1 
ATOM   3292 C  CG  . LEU B 2 89  ? 5.320   145.160 0.421   1.00 29.89 ? 589  LEU B CG  1 
ATOM   3293 C  CD1 . LEU B 2 89  ? 5.895   144.259 -0.664  1.00 28.93 ? 589  LEU B CD1 1 
ATOM   3294 C  CD2 . LEU B 2 89  ? 5.497   144.541 1.802   1.00 29.41 ? 589  LEU B CD2 1 
ATOM   3295 N  N   . THR B 2 90  ? 7.047   149.203 1.899   1.00 31.22 ? 590  THR B N   1 
ATOM   3296 C  CA  . THR B 2 90  ? 7.838   150.428 1.812   1.00 31.78 ? 590  THR B CA  1 
ATOM   3297 C  C   . THR B 2 90  ? 8.868   150.268 0.700   1.00 31.85 ? 590  THR B C   1 
ATOM   3298 O  O   . THR B 2 90  ? 9.051   149.166 0.178   1.00 31.46 ? 590  THR B O   1 
ATOM   3299 C  CB  . THR B 2 90  ? 8.583   150.709 3.126   1.00 32.08 ? 590  THR B CB  1 
ATOM   3300 O  OG1 . THR B 2 90  ? 9.414   149.588 3.450   1.00 33.32 ? 590  THR B OG1 1 
ATOM   3301 C  CG2 . THR B 2 90  ? 7.594   150.950 4.259   1.00 32.63 ? 590  THR B CG2 1 
ATOM   3302 N  N   . ASP B 2 91  ? 9.543   151.360 0.341   1.00 31.44 ? 591  ASP B N   1 
ATOM   3303 C  CA  . ASP B 2 91  ? 10.547  151.301 -0.713  1.00 31.25 ? 591  ASP B CA  1 
ATOM   3304 C  C   . ASP B 2 91  ? 11.719  150.411 -0.326  1.00 30.66 ? 591  ASP B C   1 
ATOM   3305 O  O   . ASP B 2 91  ? 12.663  150.240 -1.097  1.00 30.79 ? 591  ASP B O   1 
ATOM   3306 C  CB  . ASP B 2 91  ? 11.052  152.702 -1.082  1.00 31.87 ? 591  ASP B CB  1 
ATOM   3307 C  CG  . ASP B 2 91  ? 11.549  153.492 0.118   1.00 32.37 ? 591  ASP B CG  1 
ATOM   3308 O  OD1 . ASP B 2 91  ? 12.219  152.913 0.998   1.00 31.56 ? 591  ASP B OD1 1 
ATOM   3309 O  OD2 . ASP B 2 91  ? 11.280  154.710 0.163   1.00 33.83 ? 591  ASP B OD2 1 
ATOM   3310 N  N   . ALA B 2 92  ? 11.658  149.850 0.875   1.00 29.99 ? 592  ALA B N   1 
ATOM   3311 C  CA  . ALA B 2 92  ? 12.705  148.955 1.340   1.00 29.16 ? 592  ALA B CA  1 
ATOM   3312 C  C   . ALA B 2 92  ? 12.601  147.673 0.523   1.00 28.92 ? 592  ALA B C   1 
ATOM   3313 O  O   . ALA B 2 92  ? 13.528  146.864 0.498   1.00 29.15 ? 592  ALA B O   1 
ATOM   3314 C  CB  . ALA B 2 92  ? 12.521  148.652 2.820   1.00 29.27 ? 592  ALA B CB  1 
ATOM   3315 N  N   . TYR B 2 93  ? 11.461  147.492 -0.141  1.00 28.12 ? 593  TYR B N   1 
ATOM   3316 C  CA  . TYR B 2 93  ? 11.249  146.311 -0.965  1.00 26.73 ? 593  TYR B CA  1 
ATOM   3317 C  C   . TYR B 2 93  ? 11.480  146.570 -2.452  1.00 25.33 ? 593  TYR B C   1 
ATOM   3318 O  O   . TYR B 2 93  ? 11.059  145.786 -3.302  1.00 24.27 ? 593  TYR B O   1 
ATOM   3319 C  CB  . TYR B 2 93  ? 9.844   145.735 -0.736  1.00 28.52 ? 593  TYR B CB  1 
ATOM   3320 C  CG  . TYR B 2 93  ? 9.791   144.783 0.441   1.00 30.26 ? 593  TYR B CG  1 
ATOM   3321 C  CD1 . TYR B 2 93  ? 9.642   145.253 1.750   1.00 31.31 ? 593  TYR B CD1 1 
ATOM   3322 C  CD2 . TYR B 2 93  ? 9.978   143.415 0.252   1.00 31.16 ? 593  TYR B CD2 1 
ATOM   3323 C  CE1 . TYR B 2 93  ? 9.690   144.375 2.844   1.00 31.79 ? 593  TYR B CE1 1 
ATOM   3324 C  CE2 . TYR B 2 93  ? 10.030  142.534 1.332   1.00 32.23 ? 593  TYR B CE2 1 
ATOM   3325 C  CZ  . TYR B 2 93  ? 9.889   143.018 2.624   1.00 32.58 ? 593  TYR B CZ  1 
ATOM   3326 O  OH  . TYR B 2 93  ? 9.977   142.135 3.684   1.00 33.53 ? 593  TYR B OH  1 
ATOM   3327 N  N   . GLU B 2 94  ? 12.154  147.672 -2.765  1.00 23.34 ? 594  GLU B N   1 
ATOM   3328 C  CA  . GLU B 2 94  ? 12.453  147.982 -4.153  1.00 22.49 ? 594  GLU B CA  1 
ATOM   3329 C  C   . GLU B 2 94  ? 13.380  146.902 -4.708  1.00 21.04 ? 594  GLU B C   1 
ATOM   3330 O  O   . GLU B 2 94  ? 13.340  146.589 -5.898  1.00 20.67 ? 594  GLU B O   1 
ATOM   3331 C  CB  . GLU B 2 94  ? 13.117  149.361 -4.268  1.00 22.74 ? 594  GLU B CB  1 
ATOM   3332 C  CG  . GLU B 2 94  ? 12.128  150.528 -4.241  1.00 23.51 ? 594  GLU B CG  1 
ATOM   3333 C  CD  . GLU B 2 94  ? 12.809  151.891 -4.234  1.00 23.58 ? 594  GLU B CD  1 
ATOM   3334 O  OE1 . GLU B 2 94  ? 12.113  152.905 -4.452  1.00 23.89 ? 594  GLU B OE1 1 
ATOM   3335 O  OE2 . GLU B 2 94  ? 14.036  151.952 -4.003  1.00 23.29 ? 594  GLU B OE2 1 
ATOM   3336 N  N   . CYS B 2 95  ? 14.202  146.323 -3.835  1.00 20.01 ? 595  CYS B N   1 
ATOM   3337 C  CA  . CYS B 2 95  ? 15.142  145.277 -4.241  1.00 19.93 ? 595  CYS B CA  1 
ATOM   3338 C  C   . CYS B 2 95  ? 14.445  143.996 -4.699  1.00 18.59 ? 595  CYS B C   1 
ATOM   3339 O  O   . CYS B 2 95  ? 15.074  143.123 -5.302  1.00 18.42 ? 595  CYS B O   1 
ATOM   3340 C  CB  . CYS B 2 95  ? 16.107  144.954 -3.092  1.00 20.30 ? 595  CYS B CB  1 
ATOM   3341 S  SG  . CYS B 2 95  ? 15.304  144.357 -1.579  1.00 22.55 ? 595  CYS B SG  1 
ATOM   3342 N  N   . LEU B 2 96  ? 13.147  143.893 -4.420  1.00 17.77 ? 596  LEU B N   1 
ATOM   3343 C  CA  . LEU B 2 96  ? 12.362  142.726 -4.805  1.00 17.29 ? 596  LEU B CA  1 
ATOM   3344 C  C   . LEU B 2 96  ? 11.299  143.069 -5.844  1.00 17.06 ? 596  LEU B C   1 
ATOM   3345 O  O   . LEU B 2 96  ? 10.338  142.320 -6.032  1.00 16.57 ? 596  LEU B O   1 
ATOM   3346 C  CB  . LEU B 2 96  ? 11.696  142.111 -3.567  1.00 18.96 ? 596  LEU B CB  1 
ATOM   3347 C  CG  . LEU B 2 96  ? 12.667  141.472 -2.569  1.00 19.52 ? 596  LEU B CG  1 
ATOM   3348 C  CD1 . LEU B 2 96  ? 11.918  140.979 -1.335  1.00 21.53 ? 596  LEU B CD1 1 
ATOM   3349 C  CD2 . LEU B 2 96  ? 13.384  140.321 -3.245  1.00 20.37 ? 596  LEU B CD2 1 
ATOM   3350 N  N   . ASP B 2 97  ? 11.481  144.198 -6.522  1.00 16.25 ? 597  ASP B N   1 
ATOM   3351 C  CA  . ASP B 2 97  ? 10.534  144.647 -7.544  1.00 16.52 ? 597  ASP B CA  1 
ATOM   3352 C  C   . ASP B 2 97  ? 10.439  143.660 -8.715  1.00 15.92 ? 597  ASP B C   1 
ATOM   3353 O  O   . ASP B 2 97  ? 9.482   143.696 -9.494  1.00 15.86 ? 597  ASP B O   1 
ATOM   3354 C  CB  . ASP B 2 97  ? 10.940  146.040 -8.045  1.00 15.84 ? 597  ASP B CB  1 
ATOM   3355 C  CG  . ASP B 2 97  ? 9.924   146.641 -8.993  1.00 16.14 ? 597  ASP B CG  1 
ATOM   3356 O  OD1 . ASP B 2 97  ? 8.716   146.607 -8.677  1.00 15.98 ? 597  ASP B OD1 1 
ATOM   3357 O  OD2 . ASP B 2 97  ? 10.336  147.158 -10.053 1.00 16.22 ? 597  ASP B OD2 1 
ATOM   3358 N  N   . ALA B 2 98  ? 11.425  142.773 -8.829  1.00 15.10 ? 598  ALA B N   1 
ATOM   3359 C  CA  . ALA B 2 98  ? 11.432  141.771 -9.893  1.00 14.66 ? 598  ALA B CA  1 
ATOM   3360 C  C   . ALA B 2 98  ? 11.056  140.395 -9.331  1.00 14.83 ? 598  ALA B C   1 
ATOM   3361 O  O   . ALA B 2 98  ? 11.297  139.365 -9.969  1.00 14.26 ? 598  ALA B O   1 
ATOM   3362 C  CB  . ALA B 2 98  ? 12.812  141.714 -10.552 1.00 14.64 ? 598  ALA B CB  1 
ATOM   3363 N  N   . SER B 2 99  ? 10.459  140.385 -8.141  1.00 14.07 ? 599  SER B N   1 
ATOM   3364 C  CA  . SER B 2 99  ? 10.055  139.136 -7.486  1.00 14.39 ? 599  SER B CA  1 
ATOM   3365 C  C   . SER B 2 99  ? 8.729   139.278 -6.742  1.00 14.39 ? 599  SER B C   1 
ATOM   3366 O  O   . SER B 2 99  ? 8.523   138.635 -5.713  1.00 14.16 ? 599  SER B O   1 
ATOM   3367 C  CB  . SER B 2 99  ? 11.125  138.694 -6.476  1.00 13.40 ? 599  SER B CB  1 
ATOM   3368 O  OG  . SER B 2 99  ? 12.380  138.483 -7.100  1.00 13.68 ? 599  SER B OG  1 
ATOM   3369 N  N   . ARG B 2 100 ? 7.825   140.106 -7.253  1.00 14.30 ? 600  ARG B N   1 
ATOM   3370 C  CA  . ARG B 2 100 ? 6.562   140.300 -6.561  1.00 14.67 ? 600  ARG B CA  1 
ATOM   3371 C  C   . ARG B 2 100 ? 5.708   139.041 -6.451  1.00 14.39 ? 600  ARG B C   1 
ATOM   3372 O  O   . ARG B 2 100 ? 5.004   138.863 -5.458  1.00 14.95 ? 600  ARG B O   1 
ATOM   3373 C  CB  . ARG B 2 100 ? 5.810   141.485 -7.172  1.00 14.35 ? 600  ARG B CB  1 
ATOM   3374 C  CG  . ARG B 2 100 ? 6.533   142.799 -6.843  1.00 15.36 ? 600  ARG B CG  1 
ATOM   3375 C  CD  . ARG B 2 100 ? 5.949   143.995 -7.545  1.00 15.82 ? 600  ARG B CD  1 
ATOM   3376 N  NE  . ARG B 2 100 ? 4.607   144.309 -7.072  1.00 16.32 ? 600  ARG B NE  1 
ATOM   3377 C  CZ  . ARG B 2 100 ? 3.757   145.075 -7.744  1.00 16.60 ? 600  ARG B CZ  1 
ATOM   3378 N  NH1 . ARG B 2 100 ? 4.125   145.590 -8.911  1.00 16.04 ? 600  ARG B NH1 1 
ATOM   3379 N  NH2 . ARG B 2 100 ? 2.549   145.326 -7.255  1.00 15.94 ? 600  ARG B NH2 1 
ATOM   3380 N  N   . PRO B 2 101 ? 5.749   138.151 -7.458  1.00 14.70 ? 601  PRO B N   1 
ATOM   3381 C  CA  . PRO B 2 101 ? 4.927   136.947 -7.295  1.00 14.20 ? 601  PRO B CA  1 
ATOM   3382 C  C   . PRO B 2 101 ? 5.461   136.143 -6.097  1.00 14.46 ? 601  PRO B C   1 
ATOM   3383 O  O   . PRO B 2 101 ? 4.722   135.392 -5.462  1.00 14.00 ? 601  PRO B O   1 
ATOM   3384 C  CB  . PRO B 2 101 ? 5.121   136.215 -8.621  1.00 14.30 ? 601  PRO B CB  1 
ATOM   3385 C  CG  . PRO B 2 101 ? 5.255   137.355 -9.601  1.00 14.06 ? 601  PRO B CG  1 
ATOM   3386 C  CD  . PRO B 2 101 ? 6.203   138.288 -8.857  1.00 14.48 ? 601  PRO B CD  1 
ATOM   3387 N  N   . TRP B 2 102 ? 6.751   136.301 -5.796  1.00 14.87 ? 602  TRP B N   1 
ATOM   3388 C  CA  . TRP B 2 102 ? 7.348   135.603 -4.654  1.00 14.75 ? 602  TRP B CA  1 
ATOM   3389 C  C   . TRP B 2 102 ? 6.751   136.127 -3.351  1.00 15.06 ? 602  TRP B C   1 
ATOM   3390 O  O   . TRP B 2 102 ? 6.465   135.359 -2.426  1.00 15.56 ? 602  TRP B O   1 
ATOM   3391 C  CB  . TRP B 2 102 ? 8.872   135.787 -4.626  1.00 14.06 ? 602  TRP B CB  1 
ATOM   3392 C  CG  . TRP B 2 102 ? 9.595   134.842 -5.533  1.00 14.17 ? 602  TRP B CG  1 
ATOM   3393 C  CD1 . TRP B 2 102 ? 10.138  135.123 -6.756  1.00 14.03 ? 602  TRP B CD1 1 
ATOM   3394 C  CD2 . TRP B 2 102 ? 9.806   133.442 -5.313  1.00 13.71 ? 602  TRP B CD2 1 
ATOM   3395 N  NE1 . TRP B 2 102 ? 10.673  133.983 -7.310  1.00 13.38 ? 602  TRP B NE1 1 
ATOM   3396 C  CE2 . TRP B 2 102 ? 10.482  132.937 -6.445  1.00 14.02 ? 602  TRP B CE2 1 
ATOM   3397 C  CE3 . TRP B 2 102 ? 9.485   132.566 -4.266  1.00 13.76 ? 602  TRP B CE3 1 
ATOM   3398 C  CZ2 . TRP B 2 102 ? 10.845  131.590 -6.562  1.00 13.04 ? 602  TRP B CZ2 1 
ATOM   3399 C  CZ3 . TRP B 2 102 ? 9.845   131.224 -4.383  1.00 14.00 ? 602  TRP B CZ3 1 
ATOM   3400 C  CH2 . TRP B 2 102 ? 10.519  130.753 -5.524  1.00 13.92 ? 602  TRP B CH2 1 
ATOM   3401 N  N   . LEU B 2 103 ? 6.571   137.440 -3.274  1.00 14.88 ? 603  LEU B N   1 
ATOM   3402 C  CA  . LEU B 2 103 ? 5.993   138.037 -2.081  1.00 14.71 ? 603  LEU B CA  1 
ATOM   3403 C  C   . LEU B 2 103 ? 4.581   137.478 -1.891  1.00 14.70 ? 603  LEU B C   1 
ATOM   3404 O  O   . LEU B 2 103 ? 4.186   137.134 -0.775  1.00 14.62 ? 603  LEU B O   1 
ATOM   3405 C  CB  . LEU B 2 103 ? 5.977   139.560 -2.219  1.00 14.97 ? 603  LEU B CB  1 
ATOM   3406 C  CG  . LEU B 2 103 ? 7.368   140.202 -2.106  1.00 15.20 ? 603  LEU B CG  1 
ATOM   3407 C  CD1 . LEU B 2 103 ? 7.362   141.612 -2.703  1.00 15.42 ? 603  LEU B CD1 1 
ATOM   3408 C  CD2 . LEU B 2 103 ? 7.785   140.232 -0.636  1.00 14.90 ? 603  LEU B CD2 1 
ATOM   3409 N  N   . CYS B 2 104 ? 3.830   137.364 -2.983  1.00 14.44 ? 604  CYS B N   1 
ATOM   3410 C  CA  . CYS B 2 104 ? 2.475   136.813 -2.912  1.00 15.03 ? 604  CYS B CA  1 
ATOM   3411 C  C   . CYS B 2 104 ? 2.521   135.382 -2.372  1.00 14.95 ? 604  CYS B C   1 
ATOM   3412 O  O   . CYS B 2 104 ? 1.766   135.022 -1.458  1.00 14.15 ? 604  CYS B O   1 
ATOM   3413 C  CB  . CYS B 2 104 ? 1.821   136.789 -4.298  1.00 15.58 ? 604  CYS B CB  1 
ATOM   3414 S  SG  . CYS B 2 104 ? 1.360   138.408 -4.977  1.00 16.87 ? 604  CYS B SG  1 
ATOM   3415 N  N   . TYR B 2 105 ? 3.410   134.574 -2.946  1.00 14.02 ? 605  TYR B N   1 
ATOM   3416 C  CA  . TYR B 2 105 ? 3.555   133.179 -2.540  1.00 14.59 ? 605  TYR B CA  1 
ATOM   3417 C  C   . TYR B 2 105 ? 3.997   133.009 -1.088  1.00 13.96 ? 605  TYR B C   1 
ATOM   3418 O  O   . TYR B 2 105 ? 3.370   132.264 -0.335  1.00 15.23 ? 605  TYR B O   1 
ATOM   3419 C  CB  . TYR B 2 105 ? 4.541   132.442 -3.462  1.00 13.89 ? 605  TYR B CB  1 
ATOM   3420 C  CG  . TYR B 2 105 ? 5.011   131.123 -2.878  1.00 14.23 ? 605  TYR B CG  1 
ATOM   3421 C  CD1 . TYR B 2 105 ? 4.114   130.078 -2.661  1.00 13.34 ? 605  TYR B CD1 1 
ATOM   3422 C  CD2 . TYR B 2 105 ? 6.334   130.954 -2.466  1.00 13.77 ? 605  TYR B CD2 1 
ATOM   3423 C  CE1 . TYR B 2 105 ? 4.517   128.898 -2.038  1.00 13.25 ? 605  TYR B CE1 1 
ATOM   3424 C  CE2 . TYR B 2 105 ? 6.752   129.777 -1.845  1.00 14.38 ? 605  TYR B CE2 1 
ATOM   3425 C  CZ  . TYR B 2 105 ? 5.837   128.755 -1.630  1.00 14.63 ? 605  TYR B CZ  1 
ATOM   3426 O  OH  . TYR B 2 105 ? 6.236   127.607 -0.989  1.00 14.64 ? 605  TYR B OH  1 
ATOM   3427 N  N   . TRP B 2 106 ? 5.074   133.683 -0.696  1.00 13.83 ? 606  TRP B N   1 
ATOM   3428 C  CA  . TRP B 2 106 ? 5.572   133.570 0.678   1.00 13.78 ? 606  TRP B CA  1 
ATOM   3429 C  C   . TRP B 2 106 ? 4.497   133.920 1.704   1.00 13.68 ? 606  TRP B C   1 
ATOM   3430 O  O   . TRP B 2 106 ? 4.327   133.226 2.708   1.00 13.31 ? 606  TRP B O   1 
ATOM   3431 C  CB  . TRP B 2 106 ? 6.765   134.503 0.924   1.00 13.73 ? 606  TRP B CB  1 
ATOM   3432 C  CG  . TRP B 2 106 ? 8.000   134.195 0.143   1.00 13.97 ? 606  TRP B CG  1 
ATOM   3433 C  CD1 . TRP B 2 106 ? 8.474   132.961 -0.207  1.00 13.43 ? 606  TRP B CD1 1 
ATOM   3434 C  CD2 . TRP B 2 106 ? 8.949   135.146 -0.351  1.00 13.88 ? 606  TRP B CD2 1 
ATOM   3435 N  NE1 . TRP B 2 106 ? 9.663   133.088 -0.889  1.00 13.65 ? 606  TRP B NE1 1 
ATOM   3436 C  CE2 . TRP B 2 106 ? 9.976   134.419 -0.992  1.00 13.83 ? 606  TRP B CE2 1 
ATOM   3437 C  CE3 . TRP B 2 106 ? 9.031   136.545 -0.313  1.00 13.94 ? 606  TRP B CE3 1 
ATOM   3438 C  CZ2 . TRP B 2 106 ? 11.073  135.044 -1.593  1.00 14.03 ? 606  TRP B CZ2 1 
ATOM   3439 C  CZ3 . TRP B 2 106 ? 10.122  137.166 -0.910  1.00 14.79 ? 606  TRP B CZ3 1 
ATOM   3440 C  CH2 . TRP B 2 106 ? 11.127  136.415 -1.542  1.00 13.92 ? 606  TRP B CH2 1 
ATOM   3441 N  N   . ILE B 2 107 ? 3.787   135.015 1.451   1.00 13.56 ? 607  ILE B N   1 
ATOM   3442 C  CA  . ILE B 2 107 ? 2.749   135.475 2.361   1.00 13.77 ? 607  ILE B CA  1 
ATOM   3443 C  C   . ILE B 2 107 ? 1.533   134.548 2.378   1.00 14.12 ? 607  ILE B C   1 
ATOM   3444 O  O   . ILE B 2 107 ? 1.049   134.175 3.450   1.00 14.11 ? 607  ILE B O   1 
ATOM   3445 C  CB  . ILE B 2 107 ? 2.319   136.921 2.006   1.00 13.94 ? 607  ILE B CB  1 
ATOM   3446 C  CG1 . ILE B 2 107 ? 3.511   137.864 2.213   1.00 13.92 ? 607  ILE B CG1 1 
ATOM   3447 C  CG2 . ILE B 2 107 ? 1.136   137.355 2.868   1.00 12.57 ? 607  ILE B CG2 1 
ATOM   3448 C  CD1 . ILE B 2 107 ? 3.256   139.304 1.775   1.00 15.58 ? 607  ILE B CD1 1 
ATOM   3449 N  N   . LEU B 2 108 ? 1.044   134.168 1.201   1.00 13.82 ? 608  LEU B N   1 
ATOM   3450 C  CA  . LEU B 2 108 ? -0.111  133.281 1.127   1.00 14.15 ? 608  LEU B CA  1 
ATOM   3451 C  C   . LEU B 2 108 ? 0.179   131.913 1.740   1.00 14.05 ? 608  LEU B C   1 
ATOM   3452 O  O   . LEU B 2 108 ? -0.675  131.326 2.404   1.00 13.85 ? 608  LEU B O   1 
ATOM   3453 C  CB  . LEU B 2 108 ? -0.567  133.109 -0.325  1.00 15.24 ? 608  LEU B CB  1 
ATOM   3454 C  CG  . LEU B 2 108 ? -1.203  134.337 -0.988  1.00 16.58 ? 608  LEU B CG  1 
ATOM   3455 C  CD1 . LEU B 2 108 ? -1.605  134.003 -2.420  1.00 17.53 ? 608  LEU B CD1 1 
ATOM   3456 C  CD2 . LEU B 2 108 ? -2.417  134.776 -0.194  1.00 18.43 ? 608  LEU B CD2 1 
ATOM   3457 N  N   . HIS B 2 109 ? 1.385   131.401 1.522   1.00 14.01 ? 609  HIS B N   1 
ATOM   3458 C  CA  . HIS B 2 109 ? 1.737   130.100 2.074   1.00 13.52 ? 609  HIS B CA  1 
ATOM   3459 C  C   . HIS B 2 109 ? 1.873   130.176 3.592   1.00 13.75 ? 609  HIS B C   1 
ATOM   3460 O  O   . HIS B 2 109 ? 1.498   129.238 4.300   1.00 13.36 ? 609  HIS B O   1 
ATOM   3461 C  CB  . HIS B 2 109 ? 3.036   129.582 1.451   1.00 13.66 ? 609  HIS B CB  1 
ATOM   3462 C  CG  . HIS B 2 109 ? 3.432   128.223 1.936   1.00 13.65 ? 609  HIS B CG  1 
ATOM   3463 N  ND1 . HIS B 2 109 ? 2.533   127.182 2.044   1.00 13.28 ? 609  HIS B ND1 1 
ATOM   3464 C  CD2 . HIS B 2 109 ? 4.629   127.728 2.329   1.00 13.15 ? 609  HIS B CD2 1 
ATOM   3465 C  CE1 . HIS B 2 109 ? 3.161   126.105 2.481   1.00 13.13 ? 609  HIS B CE1 1 
ATOM   3466 N  NE2 . HIS B 2 109 ? 4.433   126.409 2.662   1.00 13.40 ? 609  HIS B NE2 1 
ATOM   3467 N  N   . SER B 2 110 ? 2.403   131.290 4.094   1.00 13.16 ? 610  SER B N   1 
ATOM   3468 C  CA  . SER B 2 110 ? 2.553   131.465 5.539   1.00 13.67 ? 610  SER B CA  1 
ATOM   3469 C  C   . SER B 2 110 ? 1.173   131.503 6.193   1.00 13.99 ? 610  SER B C   1 
ATOM   3470 O  O   . SER B 2 110 ? 0.946   130.872 7.228   1.00 13.86 ? 610  SER B O   1 
ATOM   3471 C  CB  . SER B 2 110 ? 3.314   132.761 5.857   1.00 13.34 ? 610  SER B CB  1 
ATOM   3472 O  OG  . SER B 2 110 ? 4.648   132.707 5.376   1.00 13.78 ? 610  SER B OG  1 
ATOM   3473 N  N   . LEU B 2 111 ? 0.250   132.247 5.587   1.00 13.98 ? 611  LEU B N   1 
ATOM   3474 C  CA  . LEU B 2 111 ? -1.106  132.344 6.120   1.00 14.28 ? 611  LEU B CA  1 
ATOM   3475 C  C   . LEU B 2 111 ? -1.756  130.967 6.079   1.00 14.55 ? 611  LEU B C   1 
ATOM   3476 O  O   . LEU B 2 111 ? -2.472  130.569 6.999   1.00 14.32 ? 611  LEU B O   1 
ATOM   3477 C  CB  . LEU B 2 111 ? -1.930  133.335 5.296   1.00 14.50 ? 611  LEU B CB  1 
ATOM   3478 C  CG  . LEU B 2 111 ? -1.495  134.801 5.420   1.00 15.35 ? 611  LEU B CG  1 
ATOM   3479 C  CD1 . LEU B 2 111 ? -2.190  135.640 4.344   1.00 16.11 ? 611  LEU B CD1 1 
ATOM   3480 C  CD2 . LEU B 2 111 ? -1.828  135.313 6.813   1.00 15.74 ? 611  LEU B CD2 1 
ATOM   3481 N  N   . GLU B 2 112 ? -1.505  130.246 4.993   1.00 14.35 ? 612  GLU B N   1 
ATOM   3482 C  CA  . GLU B 2 112 ? -2.043  128.905 4.829   1.00 14.92 ? 612  GLU B CA  1 
ATOM   3483 C  C   . GLU B 2 112 ? -1.520  127.993 5.945   1.00 14.54 ? 612  GLU B C   1 
ATOM   3484 O  O   . GLU B 2 112 ? -2.284  127.242 6.557   1.00 13.80 ? 612  GLU B O   1 
ATOM   3485 C  CB  . GLU B 2 112 ? -1.641  128.368 3.455   1.00 16.04 ? 612  GLU B CB  1 
ATOM   3486 C  CG  . GLU B 2 112 ? -1.688  126.875 3.327   1.00 17.54 ? 612  GLU B CG  1 
ATOM   3487 C  CD  . GLU B 2 112 ? -1.179  126.402 1.984   1.00 16.99 ? 612  GLU B CD  1 
ATOM   3488 O  OE1 . GLU B 2 112 ? -0.081  126.828 1.563   1.00 15.96 ? 612  GLU B OE1 1 
ATOM   3489 O  OE2 . GLU B 2 112 ? -1.877  125.591 1.354   1.00 18.44 ? 612  GLU B OE2 1 
ATOM   3490 N  N   . LEU B 2 113 ? -0.219  128.061 6.216   1.00 13.72 ? 613  LEU B N   1 
ATOM   3491 C  CA  . LEU B 2 113 ? 0.364   127.233 7.270   1.00 14.03 ? 613  LEU B CA  1 
ATOM   3492 C  C   . LEU B 2 113 ? -0.254  127.573 8.629   1.00 14.58 ? 613  LEU B C   1 
ATOM   3493 O  O   . LEU B 2 113 ? -0.481  126.691 9.459   1.00 13.51 ? 613  LEU B O   1 
ATOM   3494 C  CB  . LEU B 2 113 ? 1.881   127.432 7.321   1.00 14.22 ? 613  LEU B CB  1 
ATOM   3495 C  CG  . LEU B 2 113 ? 2.675   126.836 6.150   1.00 14.76 ? 613  LEU B CG  1 
ATOM   3496 C  CD1 . LEU B 2 113 ? 4.114   127.326 6.186   1.00 13.57 ? 613  LEU B CD1 1 
ATOM   3497 C  CD2 . LEU B 2 113 ? 2.621   125.315 6.225   1.00 14.59 ? 613  LEU B CD2 1 
ATOM   3498 N  N   . LEU B 2 114 ? -0.527  128.859 8.837   1.00 14.90 ? 614  LEU B N   1 
ATOM   3499 C  CA  . LEU B 2 114 ? -1.117  129.354 10.076  1.00 16.46 ? 614  LEU B CA  1 
ATOM   3500 C  C   . LEU B 2 114 ? -2.630  129.152 10.121  1.00 18.12 ? 614  LEU B C   1 
ATOM   3501 O  O   . LEU B 2 114 ? -3.288  129.558 11.076  1.00 18.52 ? 614  LEU B O   1 
ATOM   3502 C  CB  . LEU B 2 114 ? -0.797  130.843 10.240  1.00 15.88 ? 614  LEU B CB  1 
ATOM   3503 C  CG  . LEU B 2 114 ? 0.682   131.189 10.423  1.00 16.19 ? 614  LEU B CG  1 
ATOM   3504 C  CD1 . LEU B 2 114 ? 0.881   132.702 10.334  1.00 16.69 ? 614  LEU B CD1 1 
ATOM   3505 C  CD2 . LEU B 2 114 ? 1.159   130.659 11.768  1.00 16.88 ? 614  LEU B CD2 1 
ATOM   3506 N  N   . ASP B 2 115 ? -3.176  128.526 9.085   1.00 19.70 ? 615  ASP B N   1 
ATOM   3507 C  CA  . ASP B 2 115 ? -4.610  128.274 9.009   1.00 22.50 ? 615  ASP B CA  1 
ATOM   3508 C  C   . ASP B 2 115 ? -5.413  129.573 9.150   1.00 24.02 ? 615  ASP B C   1 
ATOM   3509 O  O   . ASP B 2 115 ? -6.438  129.614 9.833   1.00 24.10 ? 615  ASP B O   1 
ATOM   3510 C  CB  . ASP B 2 115 ? -5.024  127.271 10.095  1.00 23.42 ? 615  ASP B CB  1 
ATOM   3511 C  CG  . ASP B 2 115 ? -6.370  126.635 9.815   1.00 24.81 ? 615  ASP B CG  1 
ATOM   3512 O  OD1 . ASP B 2 115 ? -6.654  126.346 8.635   1.00 25.46 ? 615  ASP B OD1 1 
ATOM   3513 O  OD2 . ASP B 2 115 ? -7.140  126.411 10.772  1.00 25.84 ? 615  ASP B OD2 1 
ATOM   3514 N  N   . GLU B 2 116 ? -4.927  130.634 8.510   1.00 25.05 ? 616  GLU B N   1 
ATOM   3515 C  CA  . GLU B 2 116 ? -5.597  131.932 8.534   1.00 26.60 ? 616  GLU B CA  1 
ATOM   3516 C  C   . GLU B 2 116 ? -6.296  132.074 7.187   1.00 27.84 ? 616  GLU B C   1 
ATOM   3517 O  O   . GLU B 2 116 ? -5.653  132.048 6.140   1.00 28.37 ? 616  GLU B O   1 
ATOM   3518 C  CB  . GLU B 2 116 ? -4.581  133.066 8.707   1.00 26.43 ? 616  GLU B CB  1 
ATOM   3519 C  CG  . GLU B 2 116 ? -3.789  133.021 10.007  1.00 26.18 ? 616  GLU B CG  1 
ATOM   3520 C  CD  . GLU B 2 116 ? -4.541  133.615 11.186  1.00 27.29 ? 616  GLU B CD  1 
ATOM   3521 O  OE1 . GLU B 2 116 ? -5.750  133.905 11.047  1.00 26.55 ? 616  GLU B OE1 1 
ATOM   3522 O  OE2 . GLU B 2 116 ? -3.917  133.786 12.257  1.00 27.77 ? 616  GLU B OE2 1 
ATOM   3523 N  N   . PRO B 2 117 ? -7.624  132.223 7.192   1.00 29.23 ? 617  PRO B N   1 
ATOM   3524 C  CA  . PRO B 2 117 ? -8.338  132.357 5.920   1.00 30.31 ? 617  PRO B CA  1 
ATOM   3525 C  C   . PRO B 2 117 ? -7.967  133.596 5.110   1.00 30.54 ? 617  PRO B C   1 
ATOM   3526 O  O   . PRO B 2 117 ? -7.656  134.651 5.664   1.00 31.09 ? 617  PRO B O   1 
ATOM   3527 C  CB  . PRO B 2 117 ? -9.805  132.356 6.347   1.00 30.54 ? 617  PRO B CB  1 
ATOM   3528 C  CG  . PRO B 2 117 ? -9.757  132.993 7.705   1.00 30.40 ? 617  PRO B CG  1 
ATOM   3529 C  CD  . PRO B 2 117 ? -8.554  132.316 8.332   1.00 30.05 ? 617  PRO B CD  1 
ATOM   3530 N  N   . ILE B 2 118 ? -7.986  133.448 3.791   1.00 30.96 ? 618  ILE B N   1 
ATOM   3531 C  CA  . ILE B 2 118 ? -7.683  134.552 2.897   1.00 31.93 ? 618  ILE B CA  1 
ATOM   3532 C  C   . ILE B 2 118 ? -9.015  135.083 2.374   1.00 31.04 ? 618  ILE B C   1 
ATOM   3533 O  O   . ILE B 2 118 ? -9.757  134.372 1.700   1.00 31.43 ? 618  ILE B O   1 
ATOM   3534 C  CB  . ILE B 2 118 ? -6.792  134.095 1.709   1.00 33.15 ? 618  ILE B CB  1 
ATOM   3535 C  CG1 . ILE B 2 118 ? -7.489  132.988 0.918   1.00 34.50 ? 618  ILE B CG1 1 
ATOM   3536 C  CG2 . ILE B 2 118 ? -5.450  133.579 2.232   1.00 33.83 ? 618  ILE B CG2 1 
ATOM   3537 C  CD1 . ILE B 2 118 ? -6.698  132.502 -0.287  1.00 35.37 ? 618  ILE B CD1 1 
ATOM   3538 N  N   . PRO B 2 119 ? -9.349  136.336 2.705   1.00 30.40 ? 619  PRO B N   1 
ATOM   3539 C  CA  . PRO B 2 119 ? -10.606 136.941 2.254   1.00 30.16 ? 619  PRO B CA  1 
ATOM   3540 C  C   . PRO B 2 119 ? -10.795 136.777 0.746   1.00 29.79 ? 619  PRO B C   1 
ATOM   3541 O  O   . PRO B 2 119 ? -9.830  136.816 -0.013  1.00 28.77 ? 619  PRO B O   1 
ATOM   3542 C  CB  . PRO B 2 119 ? -10.448 138.400 2.668   1.00 30.63 ? 619  PRO B CB  1 
ATOM   3543 C  CG  . PRO B 2 119 ? -9.622  138.298 3.916   1.00 30.60 ? 619  PRO B CG  1 
ATOM   3544 C  CD  . PRO B 2 119 ? -8.573  137.282 3.526   1.00 30.56 ? 619  PRO B CD  1 
ATOM   3545 N  N   . GLN B 2 120 ? -12.041 136.592 0.321   1.00 30.13 ? 620  GLN B N   1 
ATOM   3546 C  CA  . GLN B 2 120 ? -12.354 136.412 -1.094  1.00 30.95 ? 620  GLN B CA  1 
ATOM   3547 C  C   . GLN B 2 120 ? -11.876 137.605 -1.928  1.00 30.06 ? 620  GLN B C   1 
ATOM   3548 O  O   . GLN B 2 120 ? -11.378 137.438 -3.040  1.00 29.32 ? 620  GLN B O   1 
ATOM   3549 C  CB  . GLN B 2 120 ? -13.862 136.230 -1.274  1.00 33.18 ? 620  GLN B CB  1 
ATOM   3550 C  CG  . GLN B 2 120 ? -14.275 135.401 -2.490  1.00 36.95 ? 620  GLN B CG  1 
ATOM   3551 C  CD  . GLN B 2 120 ? -13.634 135.868 -3.789  1.00 39.26 ? 620  GLN B CD  1 
ATOM   3552 O  OE1 . GLN B 2 120 ? -12.517 135.462 -4.133  1.00 40.62 ? 620  GLN B OE1 1 
ATOM   3553 N  NE2 . GLN B 2 120 ? -14.337 136.733 -4.517  1.00 40.50 ? 620  GLN B NE2 1 
ATOM   3554 N  N   . ILE B 2 121 ? -12.031 138.809 -1.386  1.00 29.39 ? 621  ILE B N   1 
ATOM   3555 C  CA  . ILE B 2 121 ? -11.611 140.016 -2.087  1.00 29.03 ? 621  ILE B CA  1 
ATOM   3556 C  C   . ILE B 2 121 ? -10.100 140.036 -2.290  1.00 28.11 ? 621  ILE B C   1 
ATOM   3557 O  O   . ILE B 2 121 ? -9.614  140.406 -3.360  1.00 27.65 ? 621  ILE B O   1 
ATOM   3558 C  CB  . ILE B 2 121 ? -12.054 141.284 -1.321  1.00 29.39 ? 621  ILE B CB  1 
ATOM   3559 C  CG1 . ILE B 2 121 ? -13.567 141.468 -1.482  1.00 30.60 ? 621  ILE B CG1 1 
ATOM   3560 C  CG2 . ILE B 2 121 ? -11.314 142.508 -1.844  1.00 29.75 ? 621  ILE B CG2 1 
ATOM   3561 C  CD1 . ILE B 2 121 ? -14.127 142.700 -0.793  1.00 31.31 ? 621  ILE B CD1 1 
ATOM   3562 N  N   . VAL B 2 122 ? -9.364  139.632 -1.261  1.00 26.84 ? 622  VAL B N   1 
ATOM   3563 C  CA  . VAL B 2 122 ? -7.911  139.586 -1.338  1.00 26.08 ? 622  VAL B CA  1 
ATOM   3564 C  C   . VAL B 2 122 ? -7.492  138.544 -2.377  1.00 24.90 ? 622  VAL B C   1 
ATOM   3565 O  O   . VAL B 2 122 ? -6.593  138.783 -3.185  1.00 24.24 ? 622  VAL B O   1 
ATOM   3566 C  CB  . VAL B 2 122 ? -7.292  139.218 0.035   1.00 26.68 ? 622  VAL B CB  1 
ATOM   3567 C  CG1 . VAL B 2 122 ? -5.786  139.072 -0.090  1.00 27.29 ? 622  VAL B CG1 1 
ATOM   3568 C  CG2 . VAL B 2 122 ? -7.625  140.291 1.058   1.00 28.27 ? 622  VAL B CG2 1 
ATOM   3569 N  N   . ALA B 2 123 ? -8.156  137.393 -2.355  1.00 23.81 ? 623  ALA B N   1 
ATOM   3570 C  CA  . ALA B 2 123 ? -7.856  136.312 -3.287  1.00 23.61 ? 623  ALA B CA  1 
ATOM   3571 C  C   . ALA B 2 123 ? -8.020  136.756 -4.740  1.00 23.66 ? 623  ALA B C   1 
ATOM   3572 O  O   . ALA B 2 123 ? -7.168  136.479 -5.589  1.00 22.64 ? 623  ALA B O   1 
ATOM   3573 C  CB  . ALA B 2 123 ? -8.756  135.125 -3.004  1.00 23.92 ? 623  ALA B CB  1 
ATOM   3574 N  N   . THR B 2 124 ? -9.123  137.441 -5.022  1.00 23.18 ? 624  THR B N   1 
ATOM   3575 C  CA  . THR B 2 124 ? -9.387  137.916 -6.372  1.00 23.51 ? 624  THR B CA  1 
ATOM   3576 C  C   . THR B 2 124 ? -8.372  138.976 -6.784  1.00 21.54 ? 624  THR B C   1 
ATOM   3577 O  O   . THR B 2 124 ? -7.931  139.008 -7.932  1.00 21.52 ? 624  THR B O   1 
ATOM   3578 C  CB  . THR B 2 124 ? -10.815 138.490 -6.487  1.00 24.62 ? 624  THR B CB  1 
ATOM   3579 O  OG1 . THR B 2 124 ? -11.023 139.464 -5.458  1.00 28.12 ? 624  THR B OG1 1 
ATOM   3580 C  CG2 . THR B 2 124 ? -11.844 137.381 -6.331  1.00 24.75 ? 624  THR B CG2 1 
ATOM   3581 N  N   . ASP B 2 125 ? -7.990  139.835 -5.847  1.00 20.80 ? 625  ASP B N   1 
ATOM   3582 C  CA  . ASP B 2 125 ? -7.012  140.871 -6.150  1.00 19.94 ? 625  ASP B CA  1 
ATOM   3583 C  C   . ASP B 2 125 ? -5.653  140.255 -6.478  1.00 19.50 ? 625  ASP B C   1 
ATOM   3584 O  O   . ASP B 2 125 ? -4.946  140.738 -7.363  1.00 18.26 ? 625  ASP B O   1 
ATOM   3585 C  CB  . ASP B 2 125 ? -6.894  141.847 -4.980  1.00 20.56 ? 625  ASP B CB  1 
ATOM   3586 C  CG  . ASP B 2 125 ? -8.102  142.773 -4.870  1.00 21.64 ? 625  ASP B CG  1 
ATOM   3587 O  OD1 . ASP B 2 125 ? -8.185  143.543 -3.894  1.00 22.40 ? 625  ASP B OD1 1 
ATOM   3588 O  OD2 . ASP B 2 125 ? -8.968  142.733 -5.767  1.00 21.23 ? 625  ASP B OD2 1 
ATOM   3589 N  N   . VAL B 2 126 ? -5.289  139.187 -5.772  1.00 18.27 ? 626  VAL B N   1 
ATOM   3590 C  CA  . VAL B 2 126 ? -4.017  138.522 -6.033  1.00 17.96 ? 626  VAL B CA  1 
ATOM   3591 C  C   . VAL B 2 126 ? -4.086  137.889 -7.415  1.00 18.13 ? 626  VAL B C   1 
ATOM   3592 O  O   . VAL B 2 126 ? -3.145  137.990 -8.202  1.00 17.77 ? 626  VAL B O   1 
ATOM   3593 C  CB  . VAL B 2 126 ? -3.710  137.422 -4.981  1.00 17.67 ? 626  VAL B CB  1 
ATOM   3594 C  CG1 . VAL B 2 126 ? -2.496  136.594 -5.419  1.00 16.76 ? 626  VAL B CG1 1 
ATOM   3595 C  CG2 . VAL B 2 126 ? -3.432  138.063 -3.635  1.00 16.90 ? 626  VAL B CG2 1 
ATOM   3596 N  N   . CYS B 2 127 ? -5.207  137.235 -7.708  1.00 18.43 ? 627  CYS B N   1 
ATOM   3597 C  CA  . CYS B 2 127 ? -5.391  136.603 -9.007  1.00 19.44 ? 627  CYS B CA  1 
ATOM   3598 C  C   . CYS B 2 127 ? -5.207  137.624 -10.132 1.00 20.02 ? 627  CYS B C   1 
ATOM   3599 O  O   . CYS B 2 127 ? -4.486  137.371 -11.100 1.00 20.03 ? 627  CYS B O   1 
ATOM   3600 C  CB  . CYS B 2 127 ? -6.788  135.980 -9.110  1.00 19.99 ? 627  CYS B CB  1 
ATOM   3601 S  SG  . CYS B 2 127 ? -6.992  134.411 -8.242  1.00 19.71 ? 627  CYS B SG  1 
ATOM   3602 N  N   . GLN B 2 128 ? -5.859  138.776 -9.997  1.00 20.14 ? 628  GLN B N   1 
ATOM   3603 C  CA  . GLN B 2 128 ? -5.769  139.822 -11.011 1.00 20.90 ? 628  GLN B CA  1 
ATOM   3604 C  C   . GLN B 2 128 ? -4.344  140.321 -11.179 1.00 19.85 ? 628  GLN B C   1 
ATOM   3605 O  O   . GLN B 2 128 ? -3.892  140.560 -12.301 1.00 19.53 ? 628  GLN B O   1 
ATOM   3606 C  CB  . GLN B 2 128 ? -6.685  140.997 -10.656 1.00 22.61 ? 628  GLN B CB  1 
ATOM   3607 C  CG  . GLN B 2 128 ? -8.161  140.642 -10.670 1.00 26.68 ? 628  GLN B CG  1 
ATOM   3608 C  CD  . GLN B 2 128 ? -9.060  141.822 -10.328 1.00 29.08 ? 628  GLN B CD  1 
ATOM   3609 O  OE1 . GLN B 2 128 ? -10.268 141.661 -10.169 1.00 31.18 ? 628  GLN B OE1 1 
ATOM   3610 N  NE2 . GLN B 2 128 ? -8.473  143.015 -10.217 1.00 30.24 ? 628  GLN B NE2 1 
ATOM   3611 N  N   . PHE B 2 129 ? -3.641  140.487 -10.063 1.00 18.70 ? 629  PHE B N   1 
ATOM   3612 C  CA  . PHE B 2 129 ? -2.264  140.952 -10.116 1.00 18.10 ? 629  PHE B CA  1 
ATOM   3613 C  C   . PHE B 2 129 ? -1.357  139.955 -10.827 1.00 17.88 ? 629  PHE B C   1 
ATOM   3614 O  O   . PHE B 2 129 ? -0.528  140.343 -11.646 1.00 17.39 ? 629  PHE B O   1 
ATOM   3615 C  CB  . PHE B 2 129 ? -1.706  141.200 -8.716  1.00 17.66 ? 629  PHE B CB  1 
ATOM   3616 C  CG  . PHE B 2 129 ? -0.241  141.519 -8.717  1.00 18.07 ? 629  PHE B CG  1 
ATOM   3617 C  CD1 . PHE B 2 129 ? 0.232   142.657 -9.366  1.00 17.38 ? 629  PHE B CD1 1 
ATOM   3618 C  CD2 . PHE B 2 129 ? 0.674   140.659 -8.118  1.00 17.31 ? 629  PHE B CD2 1 
ATOM   3619 C  CE1 . PHE B 2 129 ? 1.591   142.931 -9.422  1.00 17.13 ? 629  PHE B CE1 1 
ATOM   3620 C  CE2 . PHE B 2 129 ? 2.040   140.926 -8.168  1.00 17.95 ? 629  PHE B CE2 1 
ATOM   3621 C  CZ  . PHE B 2 129 ? 2.499   142.062 -8.820  1.00 16.71 ? 629  PHE B CZ  1 
ATOM   3622 N  N   . LEU B 2 130 ? -1.505  138.672 -10.508 1.00 17.82 ? 630  LEU B N   1 
ATOM   3623 C  CA  . LEU B 2 130 ? -0.672  137.655 -11.139 1.00 17.64 ? 630  LEU B CA  1 
ATOM   3624 C  C   . LEU B 2 130 ? -0.986  137.559 -12.629 1.00 18.04 ? 630  LEU B C   1 
ATOM   3625 O  O   . LEU B 2 130 ? -0.123  137.209 -13.436 1.00 17.74 ? 630  LEU B O   1 
ATOM   3626 C  CB  . LEU B 2 130 ? -0.861  136.302 -10.440 1.00 17.14 ? 630  LEU B CB  1 
ATOM   3627 C  CG  . LEU B 2 130 ? -0.396  136.305 -8.975  1.00 17.50 ? 630  LEU B CG  1 
ATOM   3628 C  CD1 . LEU B 2 130 ? -0.621  134.945 -8.339  1.00 16.86 ? 630  LEU B CD1 1 
ATOM   3629 C  CD2 . LEU B 2 130 ? 1.080   136.683 -8.908  1.00 16.62 ? 630  LEU B CD2 1 
ATOM   3630 N  N   . GLU B 2 131 ? -2.221  137.880 -13.002 1.00 18.35 ? 631  GLU B N   1 
ATOM   3631 C  CA  . GLU B 2 131 ? -2.591  137.847 -14.410 1.00 19.65 ? 631  GLU B CA  1 
ATOM   3632 C  C   . GLU B 2 131 ? -1.796  138.941 -15.126 1.00 18.86 ? 631  GLU B C   1 
ATOM   3633 O  O   . GLU B 2 131 ? -1.345  138.758 -16.256 1.00 17.89 ? 631  GLU B O   1 
ATOM   3634 C  CB  . GLU B 2 131 ? -4.097  138.078 -14.574 1.00 21.94 ? 631  GLU B CB  1 
ATOM   3635 C  CG  . GLU B 2 131 ? -4.585  138.027 -16.015 1.00 26.94 ? 631  GLU B CG  1 
ATOM   3636 C  CD  . GLU B 2 131 ? -6.088  137.788 -16.120 1.00 29.89 ? 631  GLU B CD  1 
ATOM   3637 O  OE1 . GLU B 2 131 ? -6.862  138.534 -15.480 1.00 31.86 ? 631  GLU B OE1 1 
ATOM   3638 O  OE2 . GLU B 2 131 ? -6.495  136.852 -16.846 1.00 32.09 ? 631  GLU B OE2 1 
ATOM   3639 N  N   . LEU B 2 132 ? -1.609  140.072 -14.449 1.00 18.44 ? 632  LEU B N   1 
ATOM   3640 C  CA  . LEU B 2 132 ? -0.856  141.186 -15.020 1.00 18.44 ? 632  LEU B CA  1 
ATOM   3641 C  C   . LEU B 2 132 ? 0.632   140.854 -15.143 1.00 18.20 ? 632  LEU B C   1 
ATOM   3642 O  O   . LEU B 2 132 ? 1.339   141.439 -15.965 1.00 16.97 ? 632  LEU B O   1 
ATOM   3643 C  CB  . LEU B 2 132 ? -1.033  142.443 -14.165 1.00 18.32 ? 632  LEU B CB  1 
ATOM   3644 C  CG  . LEU B 2 132 ? -2.439  143.053 -14.113 1.00 20.01 ? 632  LEU B CG  1 
ATOM   3645 C  CD1 . LEU B 2 132 ? -2.451  144.238 -13.145 1.00 20.16 ? 632  LEU B CD1 1 
ATOM   3646 C  CD2 . LEU B 2 132 ? -2.859  143.492 -15.510 1.00 19.22 ? 632  LEU B CD2 1 
ATOM   3647 N  N   . CYS B 2 133 ? 1.103   139.919 -14.320 1.00 18.02 ? 633  CYS B N   1 
ATOM   3648 C  CA  . CYS B 2 133 ? 2.506   139.507 -14.348 1.00 17.79 ? 633  CYS B CA  1 
ATOM   3649 C  C   . CYS B 2 133 ? 2.767   138.434 -15.398 1.00 17.88 ? 633  CYS B C   1 
ATOM   3650 O  O   . CYS B 2 133 ? 3.917   138.147 -15.724 1.00 18.04 ? 633  CYS B O   1 
ATOM   3651 C  CB  . CYS B 2 133 ? 2.935   138.955 -12.985 1.00 17.30 ? 633  CYS B CB  1 
ATOM   3652 S  SG  . CYS B 2 133 ? 3.004   140.147 -11.643 1.00 16.32 ? 633  CYS B SG  1 
ATOM   3653 N  N   . GLN B 2 134 ? 1.703   137.830 -15.917 1.00 17.91 ? 634  GLN B N   1 
ATOM   3654 C  CA  . GLN B 2 134 ? 1.855   136.773 -16.906 1.00 18.39 ? 634  GLN B CA  1 
ATOM   3655 C  C   . GLN B 2 134 ? 2.230   137.327 -18.270 1.00 19.20 ? 634  GLN B C   1 
ATOM   3656 O  O   . GLN B 2 134 ? 1.613   138.269 -18.761 1.00 19.29 ? 634  GLN B O   1 
ATOM   3657 C  CB  . GLN B 2 134 ? 0.567   135.949 -17.004 1.00 17.88 ? 634  GLN B CB  1 
ATOM   3658 C  CG  . GLN B 2 134 ? 0.674   134.734 -17.920 1.00 16.00 ? 634  GLN B CG  1 
ATOM   3659 C  CD  . GLN B 2 134 ? -0.479  133.771 -17.730 1.00 16.80 ? 634  GLN B CD  1 
ATOM   3660 O  OE1 . GLN B 2 134 ? -1.644  134.179 -17.662 1.00 17.34 ? 634  GLN B OE1 1 
ATOM   3661 N  NE2 . GLN B 2 134 ? -0.165  132.486 -17.646 1.00 14.43 ? 634  GLN B NE2 1 
ATOM   3662 N  N   . SER B 2 135 ? 3.252   136.733 -18.876 1.00 19.79 ? 635  SER B N   1 
ATOM   3663 C  CA  . SER B 2 135 ? 3.730   137.169 -20.181 1.00 21.25 ? 635  SER B CA  1 
ATOM   3664 C  C   . SER B 2 135 ? 2.956   136.542 -21.331 1.00 22.01 ? 635  SER B C   1 
ATOM   3665 O  O   . SER B 2 135 ? 2.512   135.397 -21.244 1.00 21.93 ? 635  SER B O   1 
ATOM   3666 C  CB  . SER B 2 135 ? 5.213   136.823 -20.333 1.00 21.36 ? 635  SER B CB  1 
ATOM   3667 O  OG  . SER B 2 135 ? 5.666   137.099 -21.648 1.00 22.08 ? 635  SER B OG  1 
ATOM   3668 N  N   . PRO B 2 136 ? 2.777   137.292 -22.429 1.00 23.04 ? 636  PRO B N   1 
ATOM   3669 C  CA  . PRO B 2 136 ? 2.047   136.736 -23.570 1.00 23.47 ? 636  PRO B CA  1 
ATOM   3670 C  C   . PRO B 2 136 ? 2.805   135.558 -24.190 1.00 23.18 ? 636  PRO B C   1 
ATOM   3671 O  O   . PRO B 2 136 ? 2.226   134.759 -24.915 1.00 23.38 ? 636  PRO B O   1 
ATOM   3672 C  CB  . PRO B 2 136 ? 1.917   137.932 -24.518 1.00 23.77 ? 636  PRO B CB  1 
ATOM   3673 C  CG  . PRO B 2 136 ? 3.111   138.766 -24.186 1.00 24.53 ? 636  PRO B CG  1 
ATOM   3674 C  CD  . PRO B 2 136 ? 3.151   138.696 -22.677 1.00 23.17 ? 636  PRO B CD  1 
ATOM   3675 N  N   . GLU B 2 137 ? 4.098   135.447 -23.892 1.00 24.25 ? 637  GLU B N   1 
ATOM   3676 C  CA  . GLU B 2 137 ? 4.894   134.342 -24.427 1.00 24.27 ? 637  GLU B CA  1 
ATOM   3677 C  C   . GLU B 2 137 ? 4.816   133.127 -23.501 1.00 22.73 ? 637  GLU B C   1 
ATOM   3678 O  O   . GLU B 2 137 ? 5.382   132.073 -23.793 1.00 21.78 ? 637  GLU B O   1 
ATOM   3679 C  CB  . GLU B 2 137 ? 6.360   134.759 -24.605 1.00 26.53 ? 637  GLU B CB  1 
ATOM   3680 C  CG  . GLU B 2 137 ? 7.126   134.991 -23.306 1.00 29.38 ? 637  GLU B CG  1 
ATOM   3681 C  CD  . GLU B 2 137 ? 8.611   135.269 -23.534 1.00 31.55 ? 637  GLU B CD  1 
ATOM   3682 O  OE1 . GLU B 2 137 ? 9.329   134.358 -24.005 1.00 31.52 ? 637  GLU B OE1 1 
ATOM   3683 O  OE2 . GLU B 2 137 ? 9.065   136.400 -23.243 1.00 32.89 ? 637  GLU B OE2 1 
ATOM   3684 N  N   . GLY B 2 138 ? 4.102   133.278 -22.389 1.00 21.31 ? 638  GLY B N   1 
ATOM   3685 C  CA  . GLY B 2 138 ? 3.980   132.189 -21.437 1.00 19.04 ? 638  GLY B CA  1 
ATOM   3686 C  C   . GLY B 2 138 ? 4.840   132.438 -20.212 1.00 18.06 ? 638  GLY B C   1 
ATOM   3687 O  O   . GLY B 2 138 ? 5.867   133.106 -20.296 1.00 17.62 ? 638  GLY B O   1 
ATOM   3688 N  N   . GLY B 2 139 ? 4.423   131.893 -19.073 1.00 17.20 ? 639  GLY B N   1 
ATOM   3689 C  CA  . GLY B 2 139 ? 5.167   132.081 -17.840 1.00 16.32 ? 639  GLY B CA  1 
ATOM   3690 C  C   . GLY B 2 139 ? 4.848   133.419 -17.202 1.00 15.68 ? 639  GLY B C   1 
ATOM   3691 O  O   . GLY B 2 139 ? 4.090   134.217 -17.764 1.00 15.34 ? 639  GLY B O   1 
ATOM   3692 N  N   . PHE B 2 140 ? 5.420   133.666 -16.029 1.00 14.83 ? 640  PHE B N   1 
ATOM   3693 C  CA  . PHE B 2 140 ? 5.197   134.919 -15.313 1.00 14.68 ? 640  PHE B CA  1 
ATOM   3694 C  C   . PHE B 2 140 ? 6.507   135.657 -15.061 1.00 14.73 ? 640  PHE B C   1 
ATOM   3695 O  O   . PHE B 2 140 ? 7.564   135.037 -14.907 1.00 14.04 ? 640  PHE B O   1 
ATOM   3696 C  CB  . PHE B 2 140 ? 4.519   134.669 -13.959 1.00 14.52 ? 640  PHE B CB  1 
ATOM   3697 C  CG  . PHE B 2 140 ? 3.174   134.007 -14.056 1.00 14.11 ? 640  PHE B CG  1 
ATOM   3698 C  CD1 . PHE B 2 140 ? 3.068   132.653 -14.365 1.00 13.99 ? 640  PHE B CD1 1 
ATOM   3699 C  CD2 . PHE B 2 140 ? 2.006   134.740 -13.833 1.00 13.66 ? 640  PHE B CD2 1 
ATOM   3700 C  CE1 . PHE B 2 140 ? 1.817   132.032 -14.450 1.00 14.00 ? 640  PHE B CE1 1 
ATOM   3701 C  CE2 . PHE B 2 140 ? 0.750   134.129 -13.916 1.00 13.45 ? 640  PHE B CE2 1 
ATOM   3702 C  CZ  . PHE B 2 140 ? 0.657   132.771 -14.225 1.00 14.09 ? 640  PHE B CZ  1 
ATOM   3703 N  N   . GLY B 2 141 ? 6.422   136.986 -15.024 1.00 14.13 ? 641  GLY B N   1 
ATOM   3704 C  CA  . GLY B 2 141 ? 7.582   137.812 -14.756 1.00 13.81 ? 641  GLY B CA  1 
ATOM   3705 C  C   . GLY B 2 141 ? 7.506   138.311 -13.323 1.00 14.29 ? 641  GLY B C   1 
ATOM   3706 O  O   . GLY B 2 141 ? 6.521   138.047 -12.625 1.00 14.39 ? 641  GLY B O   1 
ATOM   3707 N  N   . GLY B 2 142 ? 8.524   139.044 -12.886 1.00 14.49 ? 642  GLY B N   1 
ATOM   3708 C  CA  . GLY B 2 142 ? 8.552   139.544 -11.518 1.00 15.13 ? 642  GLY B CA  1 
ATOM   3709 C  C   . GLY B 2 142 ? 7.625   140.707 -11.225 1.00 15.20 ? 642  GLY B C   1 
ATOM   3710 O  O   . GLY B 2 142 ? 7.505   141.142 -10.080 1.00 14.77 ? 642  GLY B O   1 
ATOM   3711 N  N   . GLY B 2 143 ? 6.968   141.209 -12.264 1.00 15.93 ? 643  GLY B N   1 
ATOM   3712 C  CA  . GLY B 2 143 ? 6.052   142.324 -12.113 1.00 15.43 ? 643  GLY B CA  1 
ATOM   3713 C  C   . GLY B 2 143 ? 5.393   142.587 -13.455 1.00 16.12 ? 643  GLY B C   1 
ATOM   3714 O  O   . GLY B 2 143 ? 5.810   142.008 -14.457 1.00 15.28 ? 643  GLY B O   1 
ATOM   3715 N  N   . PRO B 2 144 ? 4.368   143.452 -13.514 1.00 16.43 ? 644  PRO B N   1 
ATOM   3716 C  CA  . PRO B 2 144 ? 3.683   143.751 -14.776 1.00 16.78 ? 644  PRO B CA  1 
ATOM   3717 C  C   . PRO B 2 144 ? 4.638   144.219 -15.871 1.00 17.11 ? 644  PRO B C   1 
ATOM   3718 O  O   . PRO B 2 144 ? 5.416   145.150 -15.667 1.00 16.54 ? 644  PRO B O   1 
ATOM   3719 C  CB  . PRO B 2 144 ? 2.690   144.844 -14.379 1.00 16.75 ? 644  PRO B CB  1 
ATOM   3720 C  CG  . PRO B 2 144 ? 2.384   144.512 -12.948 1.00 17.23 ? 644  PRO B CG  1 
ATOM   3721 C  CD  . PRO B 2 144 ? 3.757   144.195 -12.399 1.00 16.31 ? 644  PRO B CD  1 
ATOM   3722 N  N   . GLY B 2 145 ? 4.584   143.564 -17.026 1.00 17.60 ? 645  GLY B N   1 
ATOM   3723 C  CA  . GLY B 2 145 ? 5.438   143.956 -18.134 1.00 17.68 ? 645  GLY B CA  1 
ATOM   3724 C  C   . GLY B 2 145 ? 6.856   143.417 -18.121 1.00 17.86 ? 645  GLY B C   1 
ATOM   3725 O  O   . GLY B 2 145 ? 7.616   143.644 -19.067 1.00 17.11 ? 645  GLY B O   1 
ATOM   3726 N  N   . GLN B 2 146 ? 7.230   142.714 -17.057 1.00 16.98 ? 646  GLN B N   1 
ATOM   3727 C  CA  . GLN B 2 146 ? 8.570   142.147 -16.982 1.00 16.36 ? 646  GLN B CA  1 
ATOM   3728 C  C   . GLN B 2 146 ? 8.627   140.847 -17.788 1.00 16.73 ? 646  GLN B C   1 
ATOM   3729 O  O   . GLN B 2 146 ? 7.609   140.187 -17.985 1.00 16.57 ? 646  GLN B O   1 
ATOM   3730 C  CB  . GLN B 2 146 ? 8.955   141.879 -15.518 1.00 15.97 ? 646  GLN B CB  1 
ATOM   3731 C  CG  . GLN B 2 146 ? 9.235   143.146 -14.705 1.00 16.01 ? 646  GLN B CG  1 
ATOM   3732 C  CD  . GLN B 2 146 ? 9.533   142.858 -13.240 1.00 16.82 ? 646  GLN B CD  1 
ATOM   3733 O  OE1 . GLN B 2 146 ? 10.300  141.949 -12.917 1.00 15.74 ? 646  GLN B OE1 1 
ATOM   3734 N  NE2 . GLN B 2 146 ? 8.935   143.644 -12.346 1.00 15.60 ? 646  GLN B NE2 1 
ATOM   3735 N  N   . TYR B 2 147 ? 9.813   140.492 -18.268 1.00 16.99 ? 647  TYR B N   1 
ATOM   3736 C  CA  . TYR B 2 147 ? 9.978   139.255 -19.027 1.00 17.91 ? 647  TYR B CA  1 
ATOM   3737 C  C   . TYR B 2 147 ? 9.682   138.068 -18.114 1.00 17.08 ? 647  TYR B C   1 
ATOM   3738 O  O   . TYR B 2 147 ? 9.867   138.149 -16.898 1.00 16.62 ? 647  TYR B O   1 
ATOM   3739 C  CB  . TYR B 2 147 ? 11.413  139.135 -19.551 1.00 19.15 ? 647  TYR B CB  1 
ATOM   3740 C  CG  . TYR B 2 147 ? 11.765  140.116 -20.643 1.00 22.07 ? 647  TYR B CG  1 
ATOM   3741 C  CD1 . TYR B 2 147 ? 13.097  140.370 -20.967 1.00 23.55 ? 647  TYR B CD1 1 
ATOM   3742 C  CD2 . TYR B 2 147 ? 10.771  140.782 -21.363 1.00 23.27 ? 647  TYR B CD2 1 
ATOM   3743 C  CE1 . TYR B 2 147 ? 13.432  141.263 -21.981 1.00 25.18 ? 647  TYR B CE1 1 
ATOM   3744 C  CE2 . TYR B 2 147 ? 11.096  141.676 -22.381 1.00 25.23 ? 647  TYR B CE2 1 
ATOM   3745 C  CZ  . TYR B 2 147 ? 12.429  141.910 -22.682 1.00 25.82 ? 647  TYR B CZ  1 
ATOM   3746 O  OH  . TYR B 2 147 ? 12.763  142.788 -23.687 1.00 28.94 ? 647  TYR B OH  1 
ATOM   3747 N  N   . PRO B 2 148 ? 9.203   136.953 -18.686 1.00 16.36 ? 648  PRO B N   1 
ATOM   3748 C  CA  . PRO B 2 148 ? 8.914   135.789 -17.847 1.00 15.84 ? 648  PRO B CA  1 
ATOM   3749 C  C   . PRO B 2 148 ? 10.222  135.198 -17.314 1.00 15.57 ? 648  PRO B C   1 
ATOM   3750 O  O   . PRO B 2 148 ? 11.281  135.357 -17.924 1.00 15.80 ? 648  PRO B O   1 
ATOM   3751 C  CB  . PRO B 2 148 ? 8.175   134.853 -18.801 1.00 16.03 ? 648  PRO B CB  1 
ATOM   3752 C  CG  . PRO B 2 148 ? 8.775   135.190 -20.137 1.00 16.02 ? 648  PRO B CG  1 
ATOM   3753 C  CD  . PRO B 2 148 ? 8.858   136.697 -20.096 1.00 15.74 ? 648  PRO B CD  1 
ATOM   3754 N  N   . HIS B 2 149 ? 10.145  134.518 -16.177 1.00 14.97 ? 649  HIS B N   1 
ATOM   3755 C  CA  . HIS B 2 149 ? 11.327  133.937 -15.549 1.00 14.20 ? 649  HIS B CA  1 
ATOM   3756 C  C   . HIS B 2 149 ? 10.812  132.752 -14.736 1.00 14.00 ? 649  HIS B C   1 
ATOM   3757 O  O   . HIS B 2 149 ? 9.747   132.840 -14.118 1.00 13.18 ? 649  HIS B O   1 
ATOM   3758 C  CB  . HIS B 2 149 ? 11.970  135.009 -14.656 1.00 14.31 ? 649  HIS B CB  1 
ATOM   3759 C  CG  . HIS B 2 149 ? 13.285  134.617 -14.057 1.00 13.90 ? 649  HIS B CG  1 
ATOM   3760 N  ND1 . HIS B 2 149 ? 13.405  133.639 -13.094 1.00 13.74 ? 649  HIS B ND1 1 
ATOM   3761 C  CD2 . HIS B 2 149 ? 14.529  135.122 -14.237 1.00 13.91 ? 649  HIS B CD2 1 
ATOM   3762 C  CE1 . HIS B 2 149 ? 14.664  133.563 -12.701 1.00 13.05 ? 649  HIS B CE1 1 
ATOM   3763 N  NE2 . HIS B 2 149 ? 15.367  134.452 -13.379 1.00 12.78 ? 649  HIS B NE2 1 
ATOM   3764 N  N   . LEU B 2 150 ? 11.547  131.641 -14.744 1.00 13.25 ? 650  LEU B N   1 
ATOM   3765 C  CA  . LEU B 2 150 ? 11.097  130.452 -14.021 1.00 12.82 ? 650  LEU B CA  1 
ATOM   3766 C  C   . LEU B 2 150 ? 10.889  130.624 -12.523 1.00 12.77 ? 650  LEU B C   1 
ATOM   3767 O  O   . LEU B 2 150 ? 10.013  129.981 -11.954 1.00 12.35 ? 650  LEU B O   1 
ATOM   3768 C  CB  . LEU B 2 150 ? 12.042  129.271 -14.275 1.00 12.39 ? 650  LEU B CB  1 
ATOM   3769 C  CG  . LEU B 2 150 ? 11.753  128.490 -15.564 1.00 13.19 ? 650  LEU B CG  1 
ATOM   3770 C  CD1 . LEU B 2 150 ? 12.834  127.437 -15.792 1.00 12.45 ? 650  LEU B CD1 1 
ATOM   3771 C  CD2 . LEU B 2 150 ? 10.372  127.835 -15.466 1.00 13.81 ? 650  LEU B CD2 1 
ATOM   3772 N  N   . ALA B 2 151 ? 11.677  131.484 -11.880 1.00 13.01 ? 651  ALA B N   1 
ATOM   3773 C  CA  . ALA B 2 151 ? 11.522  131.685 -10.441 1.00 12.35 ? 651  ALA B CA  1 
ATOM   3774 C  C   . ALA B 2 151 ? 10.143  132.265 -10.127 1.00 12.87 ? 651  ALA B C   1 
ATOM   3775 O  O   . ALA B 2 151 ? 9.367   131.655 -9.391  1.00 13.34 ? 651  ALA B O   1 
ATOM   3776 C  CB  . ALA B 2 151 ? 12.633  132.588 -9.903  1.00 12.74 ? 651  ALA B CB  1 
ATOM   3777 N  N   . PRO B 2 152 ? 9.814   133.455 -10.673 1.00 12.69 ? 652  PRO B N   1 
ATOM   3778 C  CA  . PRO B 2 152 ? 8.485   134.011 -10.381 1.00 12.70 ? 652  PRO B CA  1 
ATOM   3779 C  C   . PRO B 2 152 ? 7.342   133.173 -10.979 1.00 12.69 ? 652  PRO B C   1 
ATOM   3780 O  O   . PRO B 2 152 ? 6.211   133.220 -10.497 1.00 12.81 ? 652  PRO B O   1 
ATOM   3781 C  CB  . PRO B 2 152 ? 8.558   135.426 -10.967 1.00 12.86 ? 652  PRO B CB  1 
ATOM   3782 C  CG  . PRO B 2 152 ? 9.585   135.298 -12.070 1.00 13.04 ? 652  PRO B CG  1 
ATOM   3783 C  CD  . PRO B 2 152 ? 10.636  134.422 -11.424 1.00 12.23 ? 652  PRO B CD  1 
ATOM   3784 N  N   . THR B 2 153 ? 7.635   132.412 -12.032 1.00 12.82 ? 653  THR B N   1 
ATOM   3785 C  CA  . THR B 2 153 ? 6.624   131.556 -12.651 1.00 11.87 ? 653  THR B CA  1 
ATOM   3786 C  C   . THR B 2 153 ? 6.233   130.477 -11.640 1.00 11.94 ? 653  THR B C   1 
ATOM   3787 O  O   . THR B 2 153 ? 5.054   130.176 -11.458 1.00 11.55 ? 653  THR B O   1 
ATOM   3788 C  CB  . THR B 2 153 ? 7.159   130.882 -13.933 1.00 12.11 ? 653  THR B CB  1 
ATOM   3789 O  OG1 . THR B 2 153 ? 7.388   131.880 -14.937 1.00 11.94 ? 653  THR B OG1 1 
ATOM   3790 C  CG2 . THR B 2 153 ? 6.157   129.858 -14.460 1.00 11.44 ? 653  THR B CG2 1 
ATOM   3791 N  N   . TYR B 2 154 ? 7.241   129.901 -10.989 1.00 11.45 ? 654  TYR B N   1 
ATOM   3792 C  CA  . TYR B 2 154 ? 7.036   128.878 -9.970  1.00 11.42 ? 654  TYR B CA  1 
ATOM   3793 C  C   . TYR B 2 154 ? 6.207   129.457 -8.821  1.00 11.39 ? 654  TYR B C   1 
ATOM   3794 O  O   . TYR B 2 154 ? 5.237   128.843 -8.363  1.00 11.51 ? 654  TYR B O   1 
ATOM   3795 C  CB  . TYR B 2 154 ? 8.393   128.408 -9.434  1.00 11.54 ? 654  TYR B CB  1 
ATOM   3796 C  CG  . TYR B 2 154 ? 8.332   127.708 -8.088  1.00 11.86 ? 654  TYR B CG  1 
ATOM   3797 C  CD1 . TYR B 2 154 ? 8.021   126.351 -7.992  1.00 12.49 ? 654  TYR B CD1 1 
ATOM   3798 C  CD2 . TYR B 2 154 ? 8.607   128.404 -6.911  1.00 12.22 ? 654  TYR B CD2 1 
ATOM   3799 C  CE1 . TYR B 2 154 ? 7.991   125.702 -6.751  1.00 12.06 ? 654  TYR B CE1 1 
ATOM   3800 C  CE2 . TYR B 2 154 ? 8.582   127.768 -5.670  1.00 12.65 ? 654  TYR B CE2 1 
ATOM   3801 C  CZ  . TYR B 2 154 ? 8.278   126.418 -5.596  1.00 13.43 ? 654  TYR B CZ  1 
ATOM   3802 O  OH  . TYR B 2 154 ? 8.299   125.785 -4.369  1.00 11.94 ? 654  TYR B OH  1 
ATOM   3803 N  N   . ALA B 2 155 ? 6.599   130.643 -8.361  1.00 10.83 ? 655  ALA B N   1 
ATOM   3804 C  CA  . ALA B 2 155 ? 5.913   131.312 -7.260  1.00 11.60 ? 655  ALA B CA  1 
ATOM   3805 C  C   . ALA B 2 155 ? 4.469   131.659 -7.596  1.00 12.05 ? 655  ALA B C   1 
ATOM   3806 O  O   . ALA B 2 155 ? 3.578   131.466 -6.773  1.00 12.47 ? 655  ALA B O   1 
ATOM   3807 C  CB  . ALA B 2 155 ? 6.676   132.581 -6.855  1.00 10.78 ? 655  ALA B CB  1 
ATOM   3808 N  N   . ALA B 2 156 ? 4.241   132.177 -8.800  1.00 11.93 ? 656  ALA B N   1 
ATOM   3809 C  CA  . ALA B 2 156 ? 2.895   132.549 -9.225  1.00 12.33 ? 656  ALA B CA  1 
ATOM   3810 C  C   . ALA B 2 156 ? 1.978   131.332 -9.280  1.00 12.45 ? 656  ALA B C   1 
ATOM   3811 O  O   . ALA B 2 156 ? 0.845   131.372 -8.794  1.00 13.12 ? 656  ALA B O   1 
ATOM   3812 C  CB  . ALA B 2 156 ? 2.945   133.229 -10.593 1.00 12.67 ? 656  ALA B CB  1 
ATOM   3813 N  N   . VAL B 2 157 ? 2.465   130.249 -9.875  1.00 12.31 ? 657  VAL B N   1 
ATOM   3814 C  CA  . VAL B 2 157 ? 1.670   129.035 -9.981  1.00 12.39 ? 657  VAL B CA  1 
ATOM   3815 C  C   . VAL B 2 157 ? 1.334   128.500 -8.584  1.00 12.59 ? 657  VAL B C   1 
ATOM   3816 O  O   . VAL B 2 157 ? 0.200   128.101 -8.320  1.00 12.45 ? 657  VAL B O   1 
ATOM   3817 C  CB  . VAL B 2 157 ? 2.414   127.964 -10.817 1.00 12.79 ? 657  VAL B CB  1 
ATOM   3818 C  CG1 . VAL B 2 157 ? 1.668   126.631 -10.760 1.00 11.51 ? 657  VAL B CG1 1 
ATOM   3819 C  CG2 . VAL B 2 157 ? 2.533   128.441 -12.265 1.00 11.96 ? 657  VAL B CG2 1 
ATOM   3820 N  N   . ASN B 2 158 ? 2.313   128.499 -7.687  1.00 12.92 ? 658  ASN B N   1 
ATOM   3821 C  CA  . ASN B 2 158 ? 2.071   128.036 -6.324  1.00 13.27 ? 658  ASN B CA  1 
ATOM   3822 C  C   . ASN B 2 158 ? 1.035   128.924 -5.628  1.00 12.79 ? 658  ASN B C   1 
ATOM   3823 O  O   . ASN B 2 158 ? 0.127   128.424 -4.965  1.00 12.20 ? 658  ASN B O   1 
ATOM   3824 C  CB  . ASN B 2 158 ? 3.377   128.031 -5.518  1.00 13.02 ? 658  ASN B CB  1 
ATOM   3825 C  CG  . ASN B 2 158 ? 4.037   126.656 -5.474  1.00 14.09 ? 658  ASN B CG  1 
ATOM   3826 O  OD1 . ASN B 2 158 ? 3.631   125.731 -6.183  1.00 12.65 ? 658  ASN B OD1 1 
ATOM   3827 N  ND2 . ASN B 2 158 ? 5.064   126.521 -4.639  1.00 12.58 ? 658  ASN B ND2 1 
ATOM   3828 N  N   . ALA B 2 159 ? 1.170   130.240 -5.779  1.00 12.82 ? 659  ALA B N   1 
ATOM   3829 C  CA  . ALA B 2 159 ? 0.234   131.175 -5.150  1.00 13.10 ? 659  ALA B CA  1 
ATOM   3830 C  C   . ALA B 2 159 ? -1.187  130.926 -5.649  1.00 14.21 ? 659  ALA B C   1 
ATOM   3831 O  O   . ALA B 2 159 ? -2.141  130.906 -4.863  1.00 14.30 ? 659  ALA B O   1 
ATOM   3832 C  CB  . ALA B 2 159 ? 0.645   132.621 -5.447  1.00 12.76 ? 659  ALA B CB  1 
ATOM   3833 N  N   . LEU B 2 160 ? -1.322  130.740 -6.960  1.00 14.09 ? 660  LEU B N   1 
ATOM   3834 C  CA  . LEU B 2 160 ? -2.627  130.493 -7.558  1.00 14.99 ? 660  LEU B CA  1 
ATOM   3835 C  C   . LEU B 2 160 ? -3.227  129.194 -7.032  1.00 14.99 ? 660  LEU B C   1 
ATOM   3836 O  O   . LEU B 2 160 ? -4.432  129.117 -6.786  1.00 15.11 ? 660  LEU B O   1 
ATOM   3837 C  CB  . LEU B 2 160 ? -2.511  130.454 -9.090  1.00 14.73 ? 660  LEU B CB  1 
ATOM   3838 C  CG  . LEU B 2 160 ? -2.202  131.813 -9.733  1.00 15.34 ? 660  LEU B CG  1 
ATOM   3839 C  CD1 . LEU B 2 160 ? -1.889  131.632 -11.214 1.00 15.28 ? 660  LEU B CD1 1 
ATOM   3840 C  CD2 . LEU B 2 160 ? -3.390  132.748 -9.551  1.00 14.72 ? 660  LEU B CD2 1 
ATOM   3841 N  N   . CYS B 2 161 ? -2.390  128.174 -6.851  1.00 14.47 ? 661  CYS B N   1 
ATOM   3842 C  CA  . CYS B 2 161 ? -2.878  126.898 -6.337  1.00 14.93 ? 661  CYS B CA  1 
ATOM   3843 C  C   . CYS B 2 161 ? -3.285  126.990 -4.862  1.00 14.81 ? 661  CYS B C   1 
ATOM   3844 O  O   . CYS B 2 161 ? -4.195  126.287 -4.423  1.00 15.04 ? 661  CYS B O   1 
ATOM   3845 C  CB  . CYS B 2 161 ? -1.828  125.801 -6.548  1.00 14.84 ? 661  CYS B CB  1 
ATOM   3846 S  SG  . CYS B 2 161 ? -1.631  125.352 -8.299  1.00 16.31 ? 661  CYS B SG  1 
ATOM   3847 N  N   . ILE B 2 162 ? -2.622  127.857 -4.102  1.00 13.99 ? 662  ILE B N   1 
ATOM   3848 C  CA  . ILE B 2 162 ? -2.967  128.037 -2.693  1.00 14.46 ? 662  ILE B CA  1 
ATOM   3849 C  C   . ILE B 2 162 ? -4.367  128.665 -2.597  1.00 15.09 ? 662  ILE B C   1 
ATOM   3850 O  O   . ILE B 2 162 ? -5.153  128.316 -1.718  1.00 14.83 ? 662  ILE B O   1 
ATOM   3851 C  CB  . ILE B 2 162 ? -1.926  128.933 -1.972  1.00 14.40 ? 662  ILE B CB  1 
ATOM   3852 C  CG1 . ILE B 2 162 ? -0.603  128.164 -1.831  1.00 14.15 ? 662  ILE B CG1 1 
ATOM   3853 C  CG2 . ILE B 2 162 ? -2.444  129.354 -0.589  1.00 14.59 ? 662  ILE B CG2 1 
ATOM   3854 C  CD1 . ILE B 2 162 ? 0.579   129.019 -1.378  1.00 12.87 ? 662  ILE B CD1 1 
ATOM   3855 N  N   . ILE B 2 163 ? -4.675  129.593 -3.498  1.00 15.52 ? 663  ILE B N   1 
ATOM   3856 C  CA  . ILE B 2 163 ? -5.996  130.218 -3.513  1.00 16.99 ? 663  ILE B CA  1 
ATOM   3857 C  C   . ILE B 2 163 ? -6.956  129.091 -3.898  1.00 17.66 ? 663  ILE B C   1 
ATOM   3858 O  O   . ILE B 2 163 ? -8.017  128.926 -3.299  1.00 17.48 ? 663  ILE B O   1 
ATOM   3859 C  CB  . ILE B 2 163 ? -6.038  131.379 -4.531  1.00 16.95 ? 663  ILE B CB  1 
ATOM   3860 C  CG1 . ILE B 2 163 ? -5.166  132.528 -4.009  1.00 16.28 ? 663  ILE B CG1 1 
ATOM   3861 C  CG2 . ILE B 2 163 ? -7.480  131.835 -4.767  1.00 17.55 ? 663  ILE B CG2 1 
ATOM   3862 C  CD1 . ILE B 2 163 ? -5.093  133.727 -4.921  1.00 17.83 ? 663  ILE B CD1 1 
ATOM   3863 N  N   . GLY B 2 164 ? -6.552  128.311 -4.897  1.00 18.58 ? 664  GLY B N   1 
ATOM   3864 C  CA  . GLY B 2 164 ? -7.317  127.152 -5.324  1.00 19.94 ? 664  GLY B CA  1 
ATOM   3865 C  C   . GLY B 2 164 ? -8.717  127.272 -5.890  1.00 20.70 ? 664  GLY B C   1 
ATOM   3866 O  O   . GLY B 2 164 ? -9.483  126.309 -5.831  1.00 21.34 ? 664  GLY B O   1 
ATOM   3867 N  N   . THR B 2 165 ? -9.068  128.428 -6.436  1.00 21.17 ? 665  THR B N   1 
ATOM   3868 C  CA  . THR B 2 165 ? -10.392 128.595 -7.020  1.00 21.64 ? 665  THR B CA  1 
ATOM   3869 C  C   . THR B 2 165 ? -10.261 128.432 -8.532  1.00 22.15 ? 665  THR B C   1 
ATOM   3870 O  O   . THR B 2 165 ? -9.169  128.589 -9.077  1.00 21.71 ? 665  THR B O   1 
ATOM   3871 C  CB  . THR B 2 165 ? -10.965 129.983 -6.713  1.00 21.30 ? 665  THR B CB  1 
ATOM   3872 O  OG1 . THR B 2 165 ? -10.138 130.985 -7.318  1.00 21.51 ? 665  THR B OG1 1 
ATOM   3873 C  CG2 . THR B 2 165 ? -11.015 130.215 -5.202  1.00 21.22 ? 665  THR B CG2 1 
ATOM   3874 N  N   . GLU B 2 166 ? -11.360 128.111 -9.208  1.00 22.84 ? 666  GLU B N   1 
ATOM   3875 C  CA  . GLU B 2 166 ? -11.310 127.948 -10.656 1.00 24.17 ? 666  GLU B CA  1 
ATOM   3876 C  C   . GLU B 2 166 ? -10.823 129.249 -11.278 1.00 23.90 ? 666  GLU B C   1 
ATOM   3877 O  O   . GLU B 2 166 ? -10.142 129.241 -12.302 1.00 23.51 ? 666  GLU B O   1 
ATOM   3878 C  CB  . GLU B 2 166 ? -12.688 127.585 -11.214 1.00 25.58 ? 666  GLU B CB  1 
ATOM   3879 C  CG  . GLU B 2 166 ? -13.332 126.396 -10.516 1.00 29.34 ? 666  GLU B CG  1 
ATOM   3880 C  CD  . GLU B 2 166 ? -14.293 125.634 -11.412 1.00 31.45 ? 666  GLU B CD  1 
ATOM   3881 O  OE1 . GLU B 2 166 ? -15.068 126.280 -12.154 1.00 32.52 ? 666  GLU B OE1 1 
ATOM   3882 O  OE2 . GLU B 2 166 ? -14.276 124.384 -11.366 1.00 32.39 ? 666  GLU B OE2 1 
ATOM   3883 N  N   . GLU B 2 167 ? -11.180 130.367 -10.653 1.00 23.82 ? 667  GLU B N   1 
ATOM   3884 C  CA  . GLU B 2 167 ? -10.755 131.673 -11.134 1.00 23.80 ? 667  GLU B CA  1 
ATOM   3885 C  C   . GLU B 2 167 ? -9.226  131.699 -11.152 1.00 22.83 ? 667  GLU B C   1 
ATOM   3886 O  O   . GLU B 2 167 ? -8.612  132.076 -12.148 1.00 22.35 ? 667  GLU B O   1 
ATOM   3887 C  CB  . GLU B 2 167 ? -11.274 132.775 -10.208 1.00 25.45 ? 667  GLU B CB  1 
ATOM   3888 C  CG  . GLU B 2 167 ? -10.793 134.171 -10.577 1.00 28.84 ? 667  GLU B CG  1 
ATOM   3889 C  CD  . GLU B 2 167 ? -11.296 135.238 -9.621  1.00 30.73 ? 667  GLU B CD  1 
ATOM   3890 O  OE1 . GLU B 2 167 ? -10.989 135.160 -8.414  1.00 32.38 ? 667  GLU B OE1 1 
ATOM   3891 O  OE2 . GLU B 2 167 ? -12.004 136.161 -10.078 1.00 33.41 ? 667  GLU B OE2 1 
ATOM   3892 N  N   . ALA B 2 168 ? -8.621  131.284 -10.043 1.00 21.50 ? 668  ALA B N   1 
ATOM   3893 C  CA  . ALA B 2 168 ? -7.166  131.257 -9.932  1.00 20.77 ? 668  ALA B CA  1 
ATOM   3894 C  C   . ALA B 2 168 ? -6.557  130.285 -10.948 1.00 20.10 ? 668  ALA B C   1 
ATOM   3895 O  O   . ALA B 2 168 ? -5.656  130.651 -11.703 1.00 19.92 ? 668  ALA B O   1 
ATOM   3896 C  CB  . ALA B 2 168 ? -6.759  130.865 -8.511  1.00 19.76 ? 668  ALA B CB  1 
ATOM   3897 N  N   . TYR B 2 169 ? -7.059  129.054 -10.967 1.00 19.60 ? 669  TYR B N   1 
ATOM   3898 C  CA  . TYR B 2 169 ? -6.570  128.029 -11.891 1.00 19.64 ? 669  TYR B CA  1 
ATOM   3899 C  C   . TYR B 2 169 ? -6.575  128.494 -13.346 1.00 20.18 ? 669  TYR B C   1 
ATOM   3900 O  O   . TYR B 2 169 ? -5.596  128.309 -14.069 1.00 20.13 ? 669  TYR B O   1 
ATOM   3901 C  CB  . TYR B 2 169 ? -7.436  126.767 -11.809 1.00 18.44 ? 669  TYR B CB  1 
ATOM   3902 C  CG  . TYR B 2 169 ? -7.400  126.011 -10.496 1.00 17.85 ? 669  TYR B CG  1 
ATOM   3903 C  CD1 . TYR B 2 169 ? -8.514  125.293 -10.067 1.00 16.99 ? 669  TYR B CD1 1 
ATOM   3904 C  CD2 . TYR B 2 169 ? -6.256  125.992 -9.697  1.00 17.36 ? 669  TYR B CD2 1 
ATOM   3905 C  CE1 . TYR B 2 169 ? -8.497  124.572 -8.876  1.00 17.97 ? 669  TYR B CE1 1 
ATOM   3906 C  CE2 . TYR B 2 169 ? -6.226  125.269 -8.496  1.00 16.98 ? 669  TYR B CE2 1 
ATOM   3907 C  CZ  . TYR B 2 169 ? -7.352  124.562 -8.095  1.00 17.36 ? 669  TYR B CZ  1 
ATOM   3908 O  OH  . TYR B 2 169 ? -7.343  123.841 -6.921  1.00 17.11 ? 669  TYR B OH  1 
ATOM   3909 N  N   . ASP B 2 170 ? -7.685  129.091 -13.771 1.00 19.89 ? 670  ASP B N   1 
ATOM   3910 C  CA  . ASP B 2 170 ? -7.831  129.527 -15.157 1.00 21.08 ? 670  ASP B CA  1 
ATOM   3911 C  C   . ASP B 2 170 ? -6.989  130.713 -15.612 1.00 20.49 ? 670  ASP B C   1 
ATOM   3912 O  O   . ASP B 2 170 ? -6.920  131.003 -16.804 1.00 20.31 ? 670  ASP B O   1 
ATOM   3913 C  CB  . ASP B 2 170 ? -9.305  129.791 -15.468 1.00 22.32 ? 670  ASP B CB  1 
ATOM   3914 C  CG  . ASP B 2 170 ? -10.163 128.554 -15.285 1.00 24.53 ? 670  ASP B CG  1 
ATOM   3915 O  OD1 . ASP B 2 170 ? -9.658  127.435 -15.526 1.00 24.41 ? 670  ASP B OD1 1 
ATOM   3916 O  OD2 . ASP B 2 170 ? -11.345 128.700 -14.907 1.00 27.24 ? 670  ASP B OD2 1 
ATOM   3917 N  N   . ILE B 2 171 ? -6.353  131.403 -14.676 1.00 19.87 ? 671  ILE B N   1 
ATOM   3918 C  CA  . ILE B 2 171 ? -5.506  132.525 -15.047 1.00 19.67 ? 671  ILE B CA  1 
ATOM   3919 C  C   . ILE B 2 171 ? -4.315  132.020 -15.864 1.00 18.52 ? 671  ILE B C   1 
ATOM   3920 O  O   . ILE B 2 171 ? -3.881  132.658 -16.821 1.00 17.51 ? 671  ILE B O   1 
ATOM   3921 C  CB  . ILE B 2 171 ? -4.995  133.254 -13.793 1.00 20.85 ? 671  ILE B CB  1 
ATOM   3922 C  CG1 . ILE B 2 171 ? -6.136  134.070 -13.184 1.00 22.78 ? 671  ILE B CG1 1 
ATOM   3923 C  CG2 . ILE B 2 171 ? -3.809  134.143 -14.138 1.00 21.17 ? 671  ILE B CG2 1 
ATOM   3924 C  CD1 . ILE B 2 171 ? -5.787  134.699 -11.872 1.00 23.66 ? 671  ILE B CD1 1 
ATOM   3925 N  N   . ILE B 2 172 ? -3.803  130.854 -15.488 1.00 17.65 ? 672  ILE B N   1 
ATOM   3926 C  CA  . ILE B 2 172 ? -2.650  130.270 -16.159 1.00 16.66 ? 672  ILE B CA  1 
ATOM   3927 C  C   . ILE B 2 172 ? -2.888  129.925 -17.625 1.00 16.91 ? 672  ILE B C   1 
ATOM   3928 O  O   . ILE B 2 172 ? -3.798  129.166 -17.955 1.00 17.07 ? 672  ILE B O   1 
ATOM   3929 C  CB  . ILE B 2 172 ? -2.196  128.991 -15.434 1.00 17.21 ? 672  ILE B CB  1 
ATOM   3930 C  CG1 . ILE B 2 172 ? -1.920  129.306 -13.959 1.00 16.97 ? 672  ILE B CG1 1 
ATOM   3931 C  CG2 . ILE B 2 172 ? -0.960  128.407 -16.127 1.00 16.30 ? 672  ILE B CG2 1 
ATOM   3932 C  CD1 . ILE B 2 172 ? -1.740  128.069 -13.089 1.00 15.75 ? 672  ILE B CD1 1 
ATOM   3933 N  N   . ASN B 2 173 ? -2.069  130.490 -18.504 1.00 16.52 ? 673  ASN B N   1 
ATOM   3934 C  CA  . ASN B 2 173 ? -2.174  130.192 -19.924 1.00 16.95 ? 673  ASN B CA  1 
ATOM   3935 C  C   . ASN B 2 173 ? -1.300  128.953 -20.102 1.00 16.49 ? 673  ASN B C   1 
ATOM   3936 O  O   . ASN B 2 173 ? -0.088  129.056 -20.283 1.00 16.22 ? 673  ASN B O   1 
ATOM   3937 C  CB  . ASN B 2 173 ? -1.621  131.344 -20.764 1.00 16.95 ? 673  ASN B CB  1 
ATOM   3938 C  CG  . ASN B 2 173 ? -1.800  131.112 -22.252 1.00 18.28 ? 673  ASN B CG  1 
ATOM   3939 O  OD1 . ASN B 2 173 ? -1.763  129.973 -22.723 1.00 17.90 ? 673  ASN B OD1 1 
ATOM   3940 N  ND2 . ASN B 2 173 ? -1.979  132.193 -23.004 1.00 18.24 ? 673  ASN B ND2 1 
ATOM   3941 N  N   . ARG B 2 174 ? -1.925  127.784 -20.032 1.00 16.42 ? 674  ARG B N   1 
ATOM   3942 C  CA  . ARG B 2 174 ? -1.212  126.521 -20.143 1.00 16.54 ? 674  ARG B CA  1 
ATOM   3943 C  C   . ARG B 2 174 ? -0.530  126.282 -21.484 1.00 16.53 ? 674  ARG B C   1 
ATOM   3944 O  O   . ARG B 2 174 ? 0.567   125.726 -21.527 1.00 16.21 ? 674  ARG B O   1 
ATOM   3945 C  CB  . ARG B 2 174 ? -2.168  125.368 -19.812 1.00 16.50 ? 674  ARG B CB  1 
ATOM   3946 C  CG  . ARG B 2 174 ? -2.682  125.430 -18.374 1.00 16.36 ? 674  ARG B CG  1 
ATOM   3947 C  CD  . ARG B 2 174 ? -3.782  124.416 -18.079 1.00 15.89 ? 674  ARG B CD  1 
ATOM   3948 N  NE  . ARG B 2 174 ? -3.325  123.031 -18.158 1.00 14.30 ? 674  ARG B NE  1 
ATOM   3949 C  CZ  . ARG B 2 174 ? -3.527  122.231 -19.198 1.00 14.81 ? 674  ARG B CZ  1 
ATOM   3950 N  NH1 . ARG B 2 174 ? -4.185  122.675 -20.265 1.00 13.63 ? 674  ARG B NH1 1 
ATOM   3951 N  NH2 . ARG B 2 174 ? -3.076  120.984 -19.169 1.00 13.13 ? 674  ARG B NH2 1 
ATOM   3952 N  N   . GLU B 2 175 ? -1.166  126.698 -22.575 1.00 17.34 ? 675  GLU B N   1 
ATOM   3953 C  CA  . GLU B 2 175 ? -0.576  126.508 -23.897 1.00 18.10 ? 675  GLU B CA  1 
ATOM   3954 C  C   . GLU B 2 175 ? 0.751   127.257 -24.007 1.00 17.88 ? 675  GLU B C   1 
ATOM   3955 O  O   . GLU B 2 175 ? 1.757   126.692 -24.426 1.00 17.75 ? 675  GLU B O   1 
ATOM   3956 C  CB  . GLU B 2 175 ? -1.530  127.001 -24.994 1.00 20.34 ? 675  GLU B CB  1 
ATOM   3957 C  CG  . GLU B 2 175 ? -2.822  126.197 -25.158 1.00 21.90 ? 675  GLU B CG  1 
ATOM   3958 C  CD  . GLU B 2 175 ? -3.795  126.363 -24.000 1.00 24.01 ? 675  GLU B CD  1 
ATOM   3959 O  OE1 . GLU B 2 175 ? -3.736  127.401 -23.301 1.00 24.19 ? 675  GLU B OE1 1 
ATOM   3960 O  OE2 . GLU B 2 175 ? -4.640  125.460 -23.801 1.00 25.03 ? 675  GLU B OE2 1 
ATOM   3961 N  N   . LYS B 2 176 ? 0.750   128.530 -23.623 1.00 17.35 ? 676  LYS B N   1 
ATOM   3962 C  CA  . LYS B 2 176 ? 1.957   129.342 -23.694 1.00 17.47 ? 676  LYS B CA  1 
ATOM   3963 C  C   . LYS B 2 176 ? 2.984   128.939 -22.641 1.00 16.74 ? 676  LYS B C   1 
ATOM   3964 O  O   . LYS B 2 176 ? 4.188   129.052 -22.867 1.00 16.28 ? 676  LYS B O   1 
ATOM   3965 C  CB  . LYS B 2 176 ? 1.606   130.825 -23.542 1.00 18.84 ? 676  LYS B CB  1 
ATOM   3966 C  CG  . LYS B 2 176 ? 0.677   131.349 -24.631 1.00 21.07 ? 676  LYS B CG  1 
ATOM   3967 C  CD  . LYS B 2 176 ? 1.226   131.090 -26.035 1.00 23.32 ? 676  LYS B CD  1 
ATOM   3968 C  CE  . LYS B 2 176 ? 2.537   131.825 -26.277 1.00 25.31 ? 676  LYS B CE  1 
ATOM   3969 N  NZ  . LYS B 2 176 ? 2.953   131.782 -27.716 1.00 27.12 ? 676  LYS B NZ  1 
ATOM   3970 N  N   . LEU B 2 177 ? 2.512   128.466 -21.492 1.00 15.59 ? 677  LEU B N   1 
ATOM   3971 C  CA  . LEU B 2 177 ? 3.427   128.045 -20.437 1.00 15.61 ? 677  LEU B CA  1 
ATOM   3972 C  C   . LEU B 2 177 ? 4.297   126.888 -20.934 1.00 15.23 ? 677  LEU B C   1 
ATOM   3973 O  O   . LEU B 2 177 ? 5.507   126.885 -20.724 1.00 15.59 ? 677  LEU B O   1 
ATOM   3974 C  CB  . LEU B 2 177 ? 2.653   127.620 -19.178 1.00 14.22 ? 677  LEU B CB  1 
ATOM   3975 C  CG  . LEU B 2 177 ? 3.488   127.117 -17.988 1.00 14.95 ? 677  LEU B CG  1 
ATOM   3976 C  CD1 . LEU B 2 177 ? 4.556   128.143 -17.629 1.00 13.83 ? 677  LEU B CD1 1 
ATOM   3977 C  CD2 . LEU B 2 177 ? 2.583   126.840 -16.788 1.00 13.85 ? 677  LEU B CD2 1 
ATOM   3978 N  N   . LEU B 2 178 ? 3.683   125.912 -21.600 1.00 15.65 ? 678  LEU B N   1 
ATOM   3979 C  CA  . LEU B 2 178 ? 4.435   124.768 -22.110 1.00 15.08 ? 678  LEU B CA  1 
ATOM   3980 C  C   . LEU B 2 178 ? 5.432   125.207 -23.179 1.00 15.25 ? 678  LEU B C   1 
ATOM   3981 O  O   . LEU B 2 178 ? 6.569   124.738 -23.208 1.00 14.73 ? 678  LEU B O   1 
ATOM   3982 C  CB  . LEU B 2 178 ? 3.484   123.704 -22.677 1.00 14.93 ? 678  LEU B CB  1 
ATOM   3983 C  CG  . LEU B 2 178 ? 4.154   122.427 -23.197 1.00 15.13 ? 678  LEU B CG  1 
ATOM   3984 C  CD1 . LEU B 2 178 ? 5.160   121.911 -22.173 1.00 14.84 ? 678  LEU B CD1 1 
ATOM   3985 C  CD2 . LEU B 2 178 ? 3.093   121.373 -23.491 1.00 15.42 ? 678  LEU B CD2 1 
ATOM   3986 N  N   . GLN B 2 179 ? 5.003   126.104 -24.062 1.00 15.10 ? 679  GLN B N   1 
ATOM   3987 C  CA  . GLN B 2 179 ? 5.880   126.613 -25.110 1.00 15.65 ? 679  GLN B CA  1 
ATOM   3988 C  C   . GLN B 2 179 ? 7.069   127.342 -24.485 1.00 15.51 ? 679  GLN B C   1 
ATOM   3989 O  O   . GLN B 2 179 ? 8.209   127.214 -24.944 1.00 14.95 ? 679  GLN B O   1 
ATOM   3990 C  CB  . GLN B 2 179 ? 5.108   127.569 -26.021 1.00 17.22 ? 679  GLN B CB  1 
ATOM   3991 C  CG  . GLN B 2 179 ? 4.174   126.868 -26.998 1.00 19.44 ? 679  GLN B CG  1 
ATOM   3992 C  CD  . GLN B 2 179 ? 3.379   127.850 -27.832 1.00 21.58 ? 679  GLN B CD  1 
ATOM   3993 O  OE1 . GLN B 2 179 ? 3.907   128.864 -28.289 1.00 22.71 ? 679  GLN B OE1 1 
ATOM   3994 N  NE2 . GLN B 2 179 ? 2.104   127.551 -28.040 1.00 22.22 ? 679  GLN B NE2 1 
ATOM   3995 N  N   . TYR B 2 180 ? 6.792   128.112 -23.438 1.00 15.08 ? 680  TYR B N   1 
ATOM   3996 C  CA  . TYR B 2 180 ? 7.832   128.849 -22.733 1.00 14.77 ? 680  TYR B CA  1 
ATOM   3997 C  C   . TYR B 2 180 ? 8.866   127.871 -22.156 1.00 14.55 ? 680  TYR B C   1 
ATOM   3998 O  O   . TYR B 2 180 ? 10.070  128.069 -22.308 1.00 14.34 ? 680  TYR B O   1 
ATOM   3999 C  CB  . TYR B 2 180 ? 7.211   129.685 -21.608 1.00 15.30 ? 680  TYR B CB  1 
ATOM   4000 C  CG  . TYR B 2 180 ? 8.232   130.441 -20.794 1.00 15.93 ? 680  TYR B CG  1 
ATOM   4001 C  CD1 . TYR B 2 180 ? 9.086   131.359 -21.402 1.00 16.01 ? 680  TYR B CD1 1 
ATOM   4002 C  CD2 . TYR B 2 180 ? 8.370   130.214 -19.427 1.00 15.78 ? 680  TYR B CD2 1 
ATOM   4003 C  CE1 . TYR B 2 180 ? 10.057  132.028 -20.675 1.00 16.52 ? 680  TYR B CE1 1 
ATOM   4004 C  CE2 . TYR B 2 180 ? 9.344   130.885 -18.683 1.00 16.78 ? 680  TYR B CE2 1 
ATOM   4005 C  CZ  . TYR B 2 180 ? 10.184  131.788 -19.318 1.00 16.85 ? 680  TYR B CZ  1 
ATOM   4006 O  OH  . TYR B 2 180 ? 11.160  132.448 -18.606 1.00 18.04 ? 680  TYR B OH  1 
ATOM   4007 N  N   . LEU B 2 181 ? 8.399   126.815 -21.495 1.00 14.06 ? 681  LEU B N   1 
ATOM   4008 C  CA  . LEU B 2 181 ? 9.321   125.835 -20.932 1.00 14.26 ? 681  LEU B CA  1 
ATOM   4009 C  C   . LEU B 2 181 ? 10.195  125.259 -22.046 1.00 14.77 ? 681  LEU B C   1 
ATOM   4010 O  O   . LEU B 2 181 ? 11.405  125.091 -21.876 1.00 14.18 ? 681  LEU B O   1 
ATOM   4011 C  CB  . LEU B 2 181 ? 8.556   124.710 -20.229 1.00 13.94 ? 681  LEU B CB  1 
ATOM   4012 C  CG  . LEU B 2 181 ? 7.768   125.120 -18.978 1.00 14.77 ? 681  LEU B CG  1 
ATOM   4013 C  CD1 . LEU B 2 181 ? 7.153   123.883 -18.331 1.00 14.38 ? 681  LEU B CD1 1 
ATOM   4014 C  CD2 . LEU B 2 181 ? 8.698   125.831 -17.992 1.00 14.54 ? 681  LEU B CD2 1 
ATOM   4015 N  N   . TYR B 2 182 ? 9.577   124.960 -23.187 1.00 14.39 ? 682  TYR B N   1 
ATOM   4016 C  CA  . TYR B 2 182 ? 10.313  124.427 -24.328 1.00 14.91 ? 682  TYR B CA  1 
ATOM   4017 C  C   . TYR B 2 182 ? 11.377  125.426 -24.754 1.00 14.22 ? 682  TYR B C   1 
ATOM   4018 O  O   . TYR B 2 182 ? 12.490  125.037 -25.105 1.00 15.10 ? 682  TYR B O   1 
ATOM   4019 C  CB  . TYR B 2 182 ? 9.369   124.158 -25.510 1.00 15.78 ? 682  TYR B CB  1 
ATOM   4020 C  CG  . TYR B 2 182 ? 8.828   122.745 -25.581 1.00 17.40 ? 682  TYR B CG  1 
ATOM   4021 C  CD1 . TYR B 2 182 ? 8.179   122.163 -24.490 1.00 17.20 ? 682  TYR B CD1 1 
ATOM   4022 C  CD2 . TYR B 2 182 ? 8.950   121.993 -26.751 1.00 17.89 ? 682  TYR B CD2 1 
ATOM   4023 C  CE1 . TYR B 2 182 ? 7.669   120.865 -24.567 1.00 18.40 ? 682  TYR B CE1 1 
ATOM   4024 C  CE2 . TYR B 2 182 ? 8.442   120.699 -26.838 1.00 17.31 ? 682  TYR B CE2 1 
ATOM   4025 C  CZ  . TYR B 2 182 ? 7.806   120.140 -25.744 1.00 17.77 ? 682  TYR B CZ  1 
ATOM   4026 O  OH  . TYR B 2 182 ? 7.327   118.851 -25.825 1.00 17.48 ? 682  TYR B OH  1 
ATOM   4027 N  N   . SER B 2 183 ? 11.032  126.713 -24.712 1.00 13.67 ? 683  SER B N   1 
ATOM   4028 C  CA  . SER B 2 183 ? 11.958  127.770 -25.113 1.00 13.79 ? 683  SER B CA  1 
ATOM   4029 C  C   . SER B 2 183 ? 13.162  127.902 -24.182 1.00 13.33 ? 683  SER B C   1 
ATOM   4030 O  O   . SER B 2 183 ? 14.107  128.629 -24.488 1.00 13.43 ? 683  SER B O   1 
ATOM   4031 C  CB  . SER B 2 183 ? 11.231  129.122 -25.191 1.00 13.56 ? 683  SER B CB  1 
ATOM   4032 O  OG  . SER B 2 183 ? 11.078  129.708 -23.904 1.00 12.57 ? 683  SER B OG  1 
ATOM   4033 N  N   . LEU B 2 184 ? 13.132  127.204 -23.052 1.00 14.05 ? 684  LEU B N   1 
ATOM   4034 C  CA  . LEU B 2 184 ? 14.237  127.268 -22.094 1.00 14.81 ? 684  LEU B CA  1 
ATOM   4035 C  C   . LEU B 2 184 ? 15.008  125.948 -21.980 1.00 15.05 ? 684  LEU B C   1 
ATOM   4036 O  O   . LEU B 2 184 ? 16.069  125.898 -21.363 1.00 15.16 ? 684  LEU B O   1 
ATOM   4037 C  CB  . LEU B 2 184 ? 13.711  127.654 -20.707 1.00 14.59 ? 684  LEU B CB  1 
ATOM   4038 C  CG  . LEU B 2 184 ? 12.937  128.966 -20.538 1.00 15.51 ? 684  LEU B CG  1 
ATOM   4039 C  CD1 . LEU B 2 184 ? 12.455  129.073 -19.090 1.00 14.75 ? 684  LEU B CD1 1 
ATOM   4040 C  CD2 . LEU B 2 184 ? 13.822  130.161 -20.901 1.00 14.42 ? 684  LEU B CD2 1 
ATOM   4041 N  N   . LYS B 2 185 ? 14.475  124.887 -22.578 1.00 15.79 ? 685  LYS B N   1 
ATOM   4042 C  CA  . LYS B 2 185 ? 15.095  123.561 -22.516 1.00 16.39 ? 685  LYS B CA  1 
ATOM   4043 C  C   . LYS B 2 185 ? 16.380  123.446 -23.335 1.00 17.16 ? 685  LYS B C   1 
ATOM   4044 O  O   . LYS B 2 185 ? 16.399  123.770 -24.523 1.00 16.54 ? 685  LYS B O   1 
ATOM   4045 C  CB  . LYS B 2 185 ? 14.092  122.498 -22.984 1.00 16.83 ? 685  LYS B CB  1 
ATOM   4046 C  CG  . LYS B 2 185 ? 14.638  121.065 -23.023 1.00 17.55 ? 685  LYS B CG  1 
ATOM   4047 C  CD  . LYS B 2 185 ? 14.955  120.542 -21.633 1.00 18.22 ? 685  LYS B CD  1 
ATOM   4048 C  CE  . LYS B 2 185 ? 15.580  119.145 -21.676 1.00 18.63 ? 685  LYS B CE  1 
ATOM   4049 N  NZ  . LYS B 2 185 ? 14.688  118.113 -22.276 1.00 18.54 ? 685  LYS B NZ  1 
ATOM   4050 N  N   . GLN B 2 186 ? 17.443  122.974 -22.683 1.00 16.75 ? 686  GLN B N   1 
ATOM   4051 C  CA  . GLN B 2 186 ? 18.749  122.794 -23.314 1.00 18.24 ? 686  GLN B CA  1 
ATOM   4052 C  C   . GLN B 2 186 ? 18.919  121.336 -23.742 1.00 18.48 ? 686  GLN B C   1 
ATOM   4053 O  O   . GLN B 2 186 ? 18.306  120.439 -23.166 1.00 18.48 ? 686  GLN B O   1 
ATOM   4054 C  CB  . GLN B 2 186 ? 19.863  123.171 -22.331 1.00 18.53 ? 686  GLN B CB  1 
ATOM   4055 C  CG  . GLN B 2 186 ? 19.765  124.599 -21.828 1.00 20.48 ? 686  GLN B CG  1 
ATOM   4056 C  CD  . GLN B 2 186 ? 19.916  125.607 -22.949 1.00 21.80 ? 686  GLN B CD  1 
ATOM   4057 O  OE1 . GLN B 2 186 ? 21.026  125.875 -23.410 1.00 22.42 ? 686  GLN B OE1 1 
ATOM   4058 N  NE2 . GLN B 2 186 ? 18.794  126.160 -23.406 1.00 21.31 ? 686  GLN B NE2 1 
ATOM   4059 N  N   . PRO B 2 187 ? 19.768  121.081 -24.749 1.00 19.64 ? 687  PRO B N   1 
ATOM   4060 C  CA  . PRO B 2 187 ? 19.981  119.709 -25.218 1.00 20.01 ? 687  PRO B CA  1 
ATOM   4061 C  C   . PRO B 2 187 ? 20.593  118.729 -24.206 1.00 19.98 ? 687  PRO B C   1 
ATOM   4062 O  O   . PRO B 2 187 ? 20.432  117.521 -24.351 1.00 20.28 ? 687  PRO B O   1 
ATOM   4063 C  CB  . PRO B 2 187 ? 20.850  119.902 -26.465 1.00 21.06 ? 687  PRO B CB  1 
ATOM   4064 C  CG  . PRO B 2 187 ? 21.622  121.141 -26.158 1.00 21.82 ? 687  PRO B CG  1 
ATOM   4065 C  CD  . PRO B 2 187 ? 20.580  122.039 -25.523 1.00 20.55 ? 687  PRO B CD  1 
ATOM   4066 N  N   . ASP B 2 188 ? 21.277  119.232 -23.182 1.00 19.48 ? 688  ASP B N   1 
ATOM   4067 C  CA  . ASP B 2 188 ? 21.880  118.341 -22.190 1.00 18.99 ? 688  ASP B CA  1 
ATOM   4068 C  C   . ASP B 2 188 ? 20.931  118.020 -21.037 1.00 18.46 ? 688  ASP B C   1 
ATOM   4069 O  O   . ASP B 2 188 ? 21.338  117.421 -20.042 1.00 18.42 ? 688  ASP B O   1 
ATOM   4070 C  CB  . ASP B 2 188 ? 23.180  118.942 -21.636 1.00 19.02 ? 688  ASP B CB  1 
ATOM   4071 C  CG  . ASP B 2 188 ? 22.952  120.211 -20.837 1.00 19.44 ? 688  ASP B CG  1 
ATOM   4072 O  OD1 . ASP B 2 188 ? 23.950  120.781 -20.342 1.00 19.21 ? 688  ASP B OD1 1 
ATOM   4073 O  OD2 . ASP B 2 188 ? 21.786  120.643 -20.697 1.00 19.12 ? 688  ASP B OD2 1 
ATOM   4074 N  N   . GLY B 2 189 ? 19.671  118.425 -21.177 1.00 17.51 ? 689  GLY B N   1 
ATOM   4075 C  CA  . GLY B 2 189 ? 18.682  118.163 -20.145 1.00 17.12 ? 689  GLY B CA  1 
ATOM   4076 C  C   . GLY B 2 189 ? 18.420  119.307 -19.177 1.00 16.42 ? 689  GLY B C   1 
ATOM   4077 O  O   . GLY B 2 189 ? 17.417  119.298 -18.459 1.00 16.27 ? 689  GLY B O   1 
ATOM   4078 N  N   . SER B 2 190 ? 19.305  120.296 -19.150 1.00 15.68 ? 690  SER B N   1 
ATOM   4079 C  CA  . SER B 2 190 ? 19.134  121.428 -18.244 1.00 15.08 ? 690  SER B CA  1 
ATOM   4080 C  C   . SER B 2 190 ? 18.176  122.473 -18.814 1.00 14.77 ? 690  SER B C   1 
ATOM   4081 O  O   . SER B 2 190 ? 17.794  122.408 -19.982 1.00 14.67 ? 690  SER B O   1 
ATOM   4082 C  CB  . SER B 2 190 ? 20.491  122.082 -17.952 1.00 15.55 ? 690  SER B CB  1 
ATOM   4083 O  OG  . SER B 2 190 ? 21.013  122.728 -19.104 1.00 16.24 ? 690  SER B OG  1 
ATOM   4084 N  N   . PHE B 2 191 ? 17.790  123.431 -17.975 1.00 14.08 ? 691  PHE B N   1 
ATOM   4085 C  CA  . PHE B 2 191 ? 16.895  124.512 -18.378 1.00 14.48 ? 691  PHE B CA  1 
ATOM   4086 C  C   . PHE B 2 191 ? 17.517  125.860 -18.018 1.00 14.81 ? 691  PHE B C   1 
ATOM   4087 O  O   . PHE B 2 191 ? 18.232  125.977 -17.021 1.00 14.61 ? 691  PHE B O   1 
ATOM   4088 C  CB  . PHE B 2 191 ? 15.542  124.434 -17.649 1.00 13.89 ? 691  PHE B CB  1 
ATOM   4089 C  CG  . PHE B 2 191 ? 14.629  123.338 -18.127 1.00 15.17 ? 691  PHE B CG  1 
ATOM   4090 C  CD1 . PHE B 2 191 ? 14.799  122.026 -17.695 1.00 15.30 ? 691  PHE B CD1 1 
ATOM   4091 C  CD2 . PHE B 2 191 ? 13.556  123.632 -18.967 1.00 14.38 ? 691  PHE B CD2 1 
ATOM   4092 C  CE1 . PHE B 2 191 ? 13.909  121.022 -18.088 1.00 16.25 ? 691  PHE B CE1 1 
ATOM   4093 C  CE2 . PHE B 2 191 ? 12.660  122.637 -19.367 1.00 15.51 ? 691  PHE B CE2 1 
ATOM   4094 C  CZ  . PHE B 2 191 ? 12.835  121.329 -18.925 1.00 15.57 ? 691  PHE B CZ  1 
ATOM   4095 N  N   . LEU B 2 192 ? 17.243  126.873 -18.834 1.00 14.83 ? 692  LEU B N   1 
ATOM   4096 C  CA  . LEU B 2 192 ? 17.719  128.225 -18.555 1.00 14.93 ? 692  LEU B CA  1 
ATOM   4097 C  C   . LEU B 2 192 ? 16.703  128.782 -17.553 1.00 14.64 ? 692  LEU B C   1 
ATOM   4098 O  O   . LEU B 2 192 ? 15.550  128.349 -17.548 1.00 13.37 ? 692  LEU B O   1 
ATOM   4099 C  CB  . LEU B 2 192 ? 17.690  129.081 -19.828 1.00 15.18 ? 692  LEU B CB  1 
ATOM   4100 C  CG  . LEU B 2 192 ? 18.620  128.686 -20.980 1.00 15.74 ? 692  LEU B CG  1 
ATOM   4101 C  CD1 . LEU B 2 192 ? 18.361  129.588 -22.184 1.00 16.40 ? 692  LEU B CD1 1 
ATOM   4102 C  CD2 . LEU B 2 192 ? 20.063  128.797 -20.529 1.00 16.14 ? 692  LEU B CD2 1 
ATOM   4103 N  N   . MET B 2 193 ? 17.116  129.719 -16.703 1.00 14.91 ? 693  MET B N   1 
ATOM   4104 C  CA  . MET B 2 193 ? 16.182  130.308 -15.743 1.00 15.41 ? 693  MET B CA  1 
ATOM   4105 C  C   . MET B 2 193 ? 15.227  131.238 -16.493 1.00 15.88 ? 693  MET B C   1 
ATOM   4106 O  O   . MET B 2 193 ? 14.094  131.471 -16.062 1.00 15.59 ? 693  MET B O   1 
ATOM   4107 C  CB  . MET B 2 193 ? 16.930  131.091 -14.657 1.00 16.17 ? 693  MET B CB  1 
ATOM   4108 C  CG  . MET B 2 193 ? 17.606  130.226 -13.591 1.00 16.58 ? 693  MET B CG  1 
ATOM   4109 S  SD  . MET B 2 193 ? 16.462  129.174 -12.659 1.00 18.61 ? 693  MET B SD  1 
ATOM   4110 C  CE  . MET B 2 193 ? 15.610  130.386 -11.661 1.00 18.01 ? 693  MET B CE  1 
ATOM   4111 N  N   . HIS B 2 194 ? 15.707  131.769 -17.616 1.00 15.74 ? 694  HIS B N   1 
ATOM   4112 C  CA  . HIS B 2 194 ? 14.930  132.659 -18.476 1.00 16.00 ? 694  HIS B CA  1 
ATOM   4113 C  C   . HIS B 2 194 ? 15.687  132.829 -19.787 1.00 16.40 ? 694  HIS B C   1 
ATOM   4114 O  O   . HIS B 2 194 ? 16.858  132.464 -19.884 1.00 15.94 ? 694  HIS B O   1 
ATOM   4115 C  CB  . HIS B 2 194 ? 14.707  134.021 -17.799 1.00 16.27 ? 694  HIS B CB  1 
ATOM   4116 C  CG  . HIS B 2 194 ? 15.963  134.805 -17.572 1.00 16.68 ? 694  HIS B CG  1 
ATOM   4117 N  ND1 . HIS B 2 194 ? 16.307  135.897 -18.338 1.00 16.76 ? 694  HIS B ND1 1 
ATOM   4118 C  CD2 . HIS B 2 194 ? 16.952  134.660 -16.657 1.00 16.24 ? 694  HIS B CD2 1 
ATOM   4119 C  CE1 . HIS B 2 194 ? 17.452  136.395 -17.903 1.00 16.49 ? 694  HIS B CE1 1 
ATOM   4120 N  NE2 . HIS B 2 194 ? 17.865  135.662 -16.884 1.00 16.39 ? 694  HIS B NE2 1 
ATOM   4121 N  N   . VAL B 2 195 ? 15.018  133.368 -20.802 1.00 17.32 ? 695  VAL B N   1 
ATOM   4122 C  CA  . VAL B 2 195 ? 15.652  133.558 -22.104 1.00 18.32 ? 695  VAL B CA  1 
ATOM   4123 C  C   . VAL B 2 195 ? 16.953  134.336 -21.956 1.00 18.90 ? 695  VAL B C   1 
ATOM   4124 O  O   . VAL B 2 195 ? 16.981  135.401 -21.342 1.00 19.28 ? 695  VAL B O   1 
ATOM   4125 C  CB  . VAL B 2 195 ? 14.708  134.305 -23.080 1.00 18.46 ? 695  VAL B CB  1 
ATOM   4126 C  CG1 . VAL B 2 195 ? 15.373  134.467 -24.441 1.00 18.37 ? 695  VAL B CG1 1 
ATOM   4127 C  CG2 . VAL B 2 195 ? 13.407  133.527 -23.229 1.00 18.55 ? 695  VAL B CG2 1 
ATOM   4128 N  N   . GLY B 2 196 ? 18.028  133.793 -22.518 1.00 19.70 ? 696  GLY B N   1 
ATOM   4129 C  CA  . GLY B 2 196 ? 19.322  134.443 -22.422 1.00 20.55 ? 696  GLY B CA  1 
ATOM   4130 C  C   . GLY B 2 196 ? 19.840  134.490 -20.995 1.00 21.73 ? 696  GLY B C   1 
ATOM   4131 O  O   . GLY B 2 196 ? 20.725  135.286 -20.680 1.00 22.29 ? 696  GLY B O   1 
ATOM   4132 N  N   . GLY B 2 197 ? 19.294  133.636 -20.130 1.00 21.32 ? 697  GLY B N   1 
ATOM   4133 C  CA  . GLY B 2 197 ? 19.713  133.612 -18.739 1.00 20.76 ? 697  GLY B CA  1 
ATOM   4134 C  C   . GLY B 2 197 ? 20.703  132.508 -18.404 1.00 20.97 ? 697  GLY B C   1 
ATOM   4135 O  O   . GLY B 2 197 ? 21.285  131.887 -19.292 1.00 20.71 ? 697  GLY B O   1 
ATOM   4136 N  N   . GLU B 2 198 ? 20.891  132.257 -17.113 1.00 20.79 ? 698  GLU B N   1 
ATOM   4137 C  CA  . GLU B 2 198 ? 21.828  131.236 -16.662 1.00 21.31 ? 698  GLU B CA  1 
ATOM   4138 C  C   . GLU B 2 198 ? 21.150  129.915 -16.339 1.00 20.63 ? 698  GLU B C   1 
ATOM   4139 O  O   . GLU B 2 198 ? 19.933  129.844 -16.156 1.00 20.48 ? 698  GLU B O   1 
ATOM   4140 C  CB  . GLU B 2 198 ? 22.585  131.714 -15.421 1.00 22.72 ? 698  GLU B CB  1 
ATOM   4141 C  CG  . GLU B 2 198 ? 21.709  131.938 -14.186 1.00 24.94 ? 698  GLU B CG  1 
ATOM   4142 C  CD  . GLU B 2 198 ? 20.847  133.190 -14.292 1.00 27.13 ? 698  GLU B CD  1 
ATOM   4143 O  OE1 . GLU B 2 198 ? 19.767  133.143 -14.920 1.00 26.72 ? 698  GLU B OE1 1 
ATOM   4144 O  OE2 . GLU B 2 198 ? 21.265  134.234 -13.751 1.00 29.47 ? 698  GLU B OE2 1 
ATOM   4145 N  N   . VAL B 2 199 ? 21.955  128.868 -16.266 1.00 20.14 ? 699  VAL B N   1 
ATOM   4146 C  CA  . VAL B 2 199 ? 21.450  127.543 -15.953 1.00 19.75 ? 699  VAL B CA  1 
ATOM   4147 C  C   . VAL B 2 199 ? 22.019  127.005 -14.639 1.00 18.74 ? 699  VAL B C   1 
ATOM   4148 O  O   . VAL B 2 199 ? 23.203  127.149 -14.357 1.00 18.27 ? 699  VAL B O   1 
ATOM   4149 C  CB  . VAL B 2 199 ? 21.787  126.545 -17.086 1.00 20.73 ? 699  VAL B CB  1 
ATOM   4150 C  CG1 . VAL B 2 199 ? 23.170  126.829 -17.624 1.00 23.43 ? 699  VAL B CG1 1 
ATOM   4151 C  CG2 . VAL B 2 199 ? 21.738  125.121 -16.566 1.00 20.43 ? 699  VAL B CG2 1 
ATOM   4152 N  N   . ASP B 2 200 ? 21.142  126.410 -13.836 1.00 17.65 ? 700  ASP B N   1 
ATOM   4153 C  CA  . ASP B 2 200 ? 21.500  125.768 -12.578 1.00 16.55 ? 700  ASP B CA  1 
ATOM   4154 C  C   . ASP B 2 200 ? 20.298  124.912 -12.181 1.00 16.21 ? 700  ASP B C   1 
ATOM   4155 O  O   . ASP B 2 200 ? 19.239  125.010 -12.800 1.00 16.21 ? 700  ASP B O   1 
ATOM   4156 C  CB  . ASP B 2 200 ? 21.898  126.782 -11.485 1.00 16.41 ? 700  ASP B CB  1 
ATOM   4157 C  CG  . ASP B 2 200 ? 20.795  127.752 -11.130 1.00 16.51 ? 700  ASP B CG  1 
ATOM   4158 O  OD1 . ASP B 2 200 ? 19.730  127.310 -10.655 1.00 17.11 ? 700  ASP B OD1 1 
ATOM   4159 O  OD2 . ASP B 2 200 ? 21.006  128.971 -11.313 1.00 16.94 ? 700  ASP B OD2 1 
ATOM   4160 N  N   . VAL B 2 201 ? 20.462  124.067 -11.171 1.00 15.81 ? 701  VAL B N   1 
ATOM   4161 C  CA  . VAL B 2 201 ? 19.400  123.150 -10.759 1.00 15.32 ? 701  VAL B CA  1 
ATOM   4162 C  C   . VAL B 2 201 ? 18.050  123.767 -10.400 1.00 14.40 ? 701  VAL B C   1 
ATOM   4163 O  O   . VAL B 2 201 ? 17.028  123.092 -10.478 1.00 13.40 ? 701  VAL B O   1 
ATOM   4164 C  CB  . VAL B 2 201 ? 19.858  122.272 -9.574  1.00 16.37 ? 701  VAL B CB  1 
ATOM   4165 C  CG1 . VAL B 2 201 ? 18.993  121.017 -9.492  1.00 17.36 ? 701  VAL B CG1 1 
ATOM   4166 C  CG2 . VAL B 2 201 ? 21.314  121.892 -9.744  1.00 19.63 ? 701  VAL B CG2 1 
ATOM   4167 N  N   . ARG B 2 202 ? 18.029  125.036 -9.999  1.00 13.91 ? 702  ARG B N   1 
ATOM   4168 C  CA  . ARG B 2 202 ? 16.758  125.665 -9.644  1.00 13.20 ? 702  ARG B CA  1 
ATOM   4169 C  C   . ARG B 2 202 ? 15.773  125.644 -10.812 1.00 13.22 ? 702  ARG B C   1 
ATOM   4170 O  O   . ARG B 2 202 ? 14.568  125.469 -10.610 1.00 13.32 ? 702  ARG B O   1 
ATOM   4171 C  CB  . ARG B 2 202 ? 16.967  127.117 -9.209  1.00 12.98 ? 702  ARG B CB  1 
ATOM   4172 C  CG  . ARG B 2 202 ? 17.816  127.311 -7.956  1.00 11.96 ? 702  ARG B CG  1 
ATOM   4173 C  CD  . ARG B 2 202 ? 18.117  128.796 -7.777  1.00 13.64 ? 702  ARG B CD  1 
ATOM   4174 N  NE  . ARG B 2 202 ? 18.719  129.347 -8.993  1.00 13.47 ? 702  ARG B NE  1 
ATOM   4175 C  CZ  . ARG B 2 202 ? 18.649  130.624 -9.360  1.00 14.38 ? 702  ARG B CZ  1 
ATOM   4176 N  NH1 . ARG B 2 202 ? 18.003  131.510 -8.604  1.00 13.09 ? 702  ARG B NH1 1 
ATOM   4177 N  NH2 . ARG B 2 202 ? 19.207  131.013 -10.500 1.00 13.89 ? 702  ARG B NH2 1 
ATOM   4178 N  N   . SER B 2 203 ? 16.281  125.817 -12.032 1.00 12.56 ? 703  SER B N   1 
ATOM   4179 C  CA  . SER B 2 203 ? 15.413  125.847 -13.208 1.00 12.07 ? 703  SER B CA  1 
ATOM   4180 C  C   . SER B 2 203 ? 14.669  124.533 -13.420 1.00 11.84 ? 703  SER B C   1 
ATOM   4181 O  O   . SER B 2 203 ? 13.473  124.536 -13.731 1.00 11.41 ? 703  SER B O   1 
ATOM   4182 C  CB  . SER B 2 203 ? 16.216  126.205 -14.467 1.00 12.06 ? 703  SER B CB  1 
ATOM   4183 O  OG  . SER B 2 203 ? 17.109  125.170 -14.829 1.00 12.24 ? 703  SER B OG  1 
ATOM   4184 N  N   . ALA B 2 204 ? 15.368  123.414 -13.242 1.00 11.38 ? 704  ALA B N   1 
ATOM   4185 C  CA  . ALA B 2 204 ? 14.750  122.106 -13.412 1.00 11.30 ? 704  ALA B CA  1 
ATOM   4186 C  C   . ALA B 2 204 ? 13.594  121.933 -12.430 1.00 11.02 ? 704  ALA B C   1 
ATOM   4187 O  O   . ALA B 2 204 ? 12.547  121.387 -12.782 1.00 10.54 ? 704  ALA B O   1 
ATOM   4188 C  CB  . ALA B 2 204 ? 15.782  121.000 -13.204 1.00 11.50 ? 704  ALA B CB  1 
ATOM   4189 N  N   . TYR B 2 205 ? 13.791  122.392 -11.197 1.00 10.49 ? 705  TYR B N   1 
ATOM   4190 C  CA  . TYR B 2 205 ? 12.757  122.278 -10.172 1.00 10.89 ? 705  TYR B CA  1 
ATOM   4191 C  C   . TYR B 2 205 ? 11.554  123.166 -10.486 1.00 10.80 ? 705  TYR B C   1 
ATOM   4192 O  O   . TYR B 2 205 ? 10.407  122.723 -10.409 1.00 10.70 ? 705  TYR B O   1 
ATOM   4193 C  CB  . TYR B 2 205 ? 13.316  122.658 -8.790  1.00 10.56 ? 705  TYR B CB  1 
ATOM   4194 C  CG  . TYR B 2 205 ? 12.237  122.762 -7.730  1.00 10.91 ? 705  TYR B CG  1 
ATOM   4195 C  CD1 . TYR B 2 205 ? 11.473  121.645 -7.371  1.00 10.67 ? 705  TYR B CD1 1 
ATOM   4196 C  CD2 . TYR B 2 205 ? 11.946  123.985 -7.122  1.00 10.40 ? 705  TYR B CD2 1 
ATOM   4197 C  CE1 . TYR B 2 205 ? 10.439  121.748 -6.432  1.00 10.92 ? 705  TYR B CE1 1 
ATOM   4198 C  CE2 . TYR B 2 205 ? 10.919  124.097 -6.183  1.00 10.19 ? 705  TYR B CE2 1 
ATOM   4199 C  CZ  . TYR B 2 205 ? 10.172  122.978 -5.844  1.00 10.76 ? 705  TYR B CZ  1 
ATOM   4200 O  OH  . TYR B 2 205 ? 9.164   123.094 -4.914  1.00 11.08 ? 705  TYR B OH  1 
ATOM   4201 N  N   . CYS B 2 206 ? 11.820  124.423 -10.827 1.00 10.66 ? 706  CYS B N   1 
ATOM   4202 C  CA  . CYS B 2 206 ? 10.748  125.356 -11.149 1.00 11.87 ? 706  CYS B CA  1 
ATOM   4203 C  C   . CYS B 2 206 ? 9.909   124.824 -12.308 1.00 11.89 ? 706  CYS B C   1 
ATOM   4204 O  O   . CYS B 2 206 ? 8.678   124.856 -12.255 1.00 12.37 ? 706  CYS B O   1 
ATOM   4205 C  CB  . CYS B 2 206 ? 11.322  126.737 -11.503 1.00 11.71 ? 706  CYS B CB  1 
ATOM   4206 S  SG  . CYS B 2 206 ? 12.016  127.642 -10.085 1.00 14.02 ? 706  CYS B SG  1 
ATOM   4207 N  N   . ALA B 2 207 ? 10.580  124.321 -13.341 1.00 12.11 ? 707  ALA B N   1 
ATOM   4208 C  CA  . ALA B 2 207 ? 9.899   123.779 -14.515 1.00 12.26 ? 707  ALA B CA  1 
ATOM   4209 C  C   . ALA B 2 207 ? 9.080   122.532 -14.183 1.00 12.39 ? 707  ALA B C   1 
ATOM   4210 O  O   . ALA B 2 207 ? 7.909   122.439 -14.556 1.00 12.46 ? 707  ALA B O   1 
ATOM   4211 C  CB  . ALA B 2 207 ? 10.916  123.457 -15.617 1.00 11.09 ? 707  ALA B CB  1 
ATOM   4212 N  N   . ALA B 2 208 ? 9.693   121.576 -13.486 1.00 13.04 ? 708  ALA B N   1 
ATOM   4213 C  CA  . ALA B 2 208 ? 8.999   120.337 -13.119 1.00 12.39 ? 708  ALA B CA  1 
ATOM   4214 C  C   . ALA B 2 208 ? 7.807   120.620 -12.212 1.00 12.65 ? 708  ALA B C   1 
ATOM   4215 O  O   . ALA B 2 208 ? 6.745   120.006 -12.347 1.00 12.79 ? 708  ALA B O   1 
ATOM   4216 C  CB  . ALA B 2 208 ? 9.966   119.371 -12.428 1.00 12.45 ? 708  ALA B CB  1 
ATOM   4217 N  N   . SER B 2 209 ? 7.984   121.548 -11.281 1.00 12.32 ? 709  SER B N   1 
ATOM   4218 C  CA  . SER B 2 209 ? 6.911   121.896 -10.365 1.00 12.80 ? 709  SER B CA  1 
ATOM   4219 C  C   . SER B 2 209 ? 5.689   122.456 -11.095 1.00 12.86 ? 709  SER B C   1 
ATOM   4220 O  O   . SER B 2 209 ? 4.582   121.935 -10.946 1.00 12.51 ? 709  SER B O   1 
ATOM   4221 C  CB  . SER B 2 209 ? 7.400   122.914 -9.333  1.00 13.28 ? 709  SER B CB  1 
ATOM   4222 O  OG  . SER B 2 209 ? 6.346   123.303 -8.465  1.00 12.45 ? 709  SER B OG  1 
ATOM   4223 N  N   . VAL B 2 210 ? 5.876   123.508 -11.886 1.00 12.59 ? 710  VAL B N   1 
ATOM   4224 C  CA  . VAL B 2 210 ? 4.735   124.090 -12.581 1.00 12.79 ? 710  VAL B CA  1 
ATOM   4225 C  C   . VAL B 2 210 ? 4.150   123.171 -13.657 1.00 13.16 ? 710  VAL B C   1 
ATOM   4226 O  O   . VAL B 2 210 ? 2.939   123.177 -13.876 1.00 12.97 ? 710  VAL B O   1 
ATOM   4227 C  CB  . VAL B 2 210 ? 5.077   125.471 -13.225 1.00 13.11 ? 710  VAL B CB  1 
ATOM   4228 C  CG1 . VAL B 2 210 ? 5.622   126.420 -12.165 1.00 12.08 ? 710  VAL B CG1 1 
ATOM   4229 C  CG2 . VAL B 2 210 ? 6.061   125.300 -14.372 1.00 12.48 ? 710  VAL B CG2 1 
ATOM   4230 N  N   . ALA B 2 211 ? 4.995   122.377 -14.314 1.00 13.21 ? 711  ALA B N   1 
ATOM   4231 C  CA  . ALA B 2 211 ? 4.513   121.482 -15.368 1.00 13.96 ? 711  ALA B CA  1 
ATOM   4232 C  C   . ALA B 2 211 ? 3.680   120.325 -14.823 1.00 13.92 ? 711  ALA B C   1 
ATOM   4233 O  O   . ALA B 2 211 ? 2.680   119.932 -15.433 1.00 13.73 ? 711  ALA B O   1 
ATOM   4234 C  CB  . ALA B 2 211 ? 5.690   120.944 -16.196 1.00 13.15 ? 711  ALA B CB  1 
ATOM   4235 N  N   . SER B 2 212 ? 4.083   119.780 -13.679 1.00 14.34 ? 712  SER B N   1 
ATOM   4236 C  CA  . SER B 2 212 ? 3.345   118.675 -13.081 1.00 14.34 ? 712  SER B CA  1 
ATOM   4237 C  C   . SER B 2 212 ? 2.034   119.176 -12.484 1.00 14.46 ? 712  SER B C   1 
ATOM   4238 O  O   . SER B 2 212 ? 0.998   118.537 -12.637 1.00 14.45 ? 712  SER B O   1 
ATOM   4239 C  CB  . SER B 2 212 ? 4.187   117.969 -12.010 1.00 15.11 ? 712  SER B CB  1 
ATOM   4240 O  OG  . SER B 2 212 ? 4.551   118.842 -10.956 1.00 17.05 ? 712  SER B OG  1 
ATOM   4241 N  N   . LEU B 2 213 ? 2.065   120.321 -11.810 1.00 14.27 ? 713  LEU B N   1 
ATOM   4242 C  CA  . LEU B 2 213 ? 0.837   120.859 -11.235 1.00 15.08 ? 713  LEU B CA  1 
ATOM   4243 C  C   . LEU B 2 213 ? -0.215  121.182 -12.301 1.00 15.26 ? 713  LEU B C   1 
ATOM   4244 O  O   . LEU B 2 213 ? -1.396  120.876 -12.131 1.00 15.61 ? 713  LEU B O   1 
ATOM   4245 C  CB  . LEU B 2 213 ? 1.129   122.125 -10.418 1.00 14.42 ? 713  LEU B CB  1 
ATOM   4246 C  CG  . LEU B 2 213 ? 1.831   121.945 -9.067  1.00 14.40 ? 713  LEU B CG  1 
ATOM   4247 C  CD1 . LEU B 2 213 ? 2.178   123.313 -8.478  1.00 14.02 ? 713  LEU B CD1 1 
ATOM   4248 C  CD2 . LEU B 2 213 ? 0.923   121.165 -8.112  1.00 14.37 ? 713  LEU B CD2 1 
ATOM   4249 N  N   . THR B 2 214 ? 0.213   121.783 -13.407 1.00 15.04 ? 714  THR B N   1 
ATOM   4250 C  CA  . THR B 2 214 ? -0.724  122.172 -14.457 1.00 14.66 ? 714  THR B CA  1 
ATOM   4251 C  C   . THR B 2 214 ? -0.960  121.132 -15.550 1.00 15.25 ? 714  THR B C   1 
ATOM   4252 O  O   . THR B 2 214 ? -1.625  121.415 -16.552 1.00 15.70 ? 714  THR B O   1 
ATOM   4253 C  CB  . THR B 2 214 ? -0.278  123.497 -15.107 1.00 14.58 ? 714  THR B CB  1 
ATOM   4254 O  OG1 . THR B 2 214 ? 0.975   123.312 -15.777 1.00 14.36 ? 714  THR B OG1 1 
ATOM   4255 C  CG2 . THR B 2 214 ? -0.108  124.569 -14.036 1.00 13.58 ? 714  THR B CG2 1 
ATOM   4256 N  N   . ASN B 2 215 ? -0.422  119.933 -15.352 1.00 15.15 ? 715  ASN B N   1 
ATOM   4257 C  CA  . ASN B 2 215 ? -0.574  118.835 -16.304 1.00 15.52 ? 715  ASN B CA  1 
ATOM   4258 C  C   . ASN B 2 215 ? -0.181  119.185 -17.745 1.00 15.73 ? 715  ASN B C   1 
ATOM   4259 O  O   . ASN B 2 215 ? -0.984  119.038 -18.670 1.00 15.59 ? 715  ASN B O   1 
ATOM   4260 C  CB  . ASN B 2 215 ? -2.019  118.314 -16.260 1.00 15.41 ? 715  ASN B CB  1 
ATOM   4261 C  CG  . ASN B 2 215 ? -2.241  117.113 -17.166 1.00 16.63 ? 715  ASN B CG  1 
ATOM   4262 O  OD1 . ASN B 2 215 ? -1.374  116.248 -17.302 1.00 17.21 ? 715  ASN B OD1 1 
ATOM   4263 N  ND2 . ASN B 2 215 ? -3.417  117.047 -17.780 1.00 17.31 ? 715  ASN B ND2 1 
ATOM   4264 N  N   . ILE B 2 216 ? 1.056   119.642 -17.933 1.00 15.65 ? 716  ILE B N   1 
ATOM   4265 C  CA  . ILE B 2 216 ? 1.543   119.987 -19.269 1.00 15.84 ? 716  ILE B CA  1 
ATOM   4266 C  C   . ILE B 2 216 ? 2.845   119.257 -19.594 1.00 16.65 ? 716  ILE B C   1 
ATOM   4267 O  O   . ILE B 2 216 ? 3.577   119.645 -20.501 1.00 16.16 ? 716  ILE B O   1 
ATOM   4268 C  CB  . ILE B 2 216 ? 1.791   121.508 -19.420 1.00 15.09 ? 716  ILE B CB  1 
ATOM   4269 C  CG1 . ILE B 2 216 ? 2.858   121.968 -18.423 1.00 14.72 ? 716  ILE B CG1 1 
ATOM   4270 C  CG2 . ILE B 2 216 ? 0.480   122.273 -19.221 1.00 15.31 ? 716  ILE B CG2 1 
ATOM   4271 C  CD1 . ILE B 2 216 ? 3.214   123.448 -18.537 1.00 11.39 ? 716  ILE B CD1 1 
ATOM   4272 N  N   . ILE B 2 217 ? 3.135   118.198 -18.849 1.00 17.41 ? 717  ILE B N   1 
ATOM   4273 C  CA  . ILE B 2 217 ? 4.353   117.437 -19.086 1.00 18.54 ? 717  ILE B CA  1 
ATOM   4274 C  C   . ILE B 2 217 ? 4.238   116.543 -20.312 1.00 19.57 ? 717  ILE B C   1 
ATOM   4275 O  O   . ILE B 2 217 ? 3.266   115.806 -20.464 1.00 19.72 ? 717  ILE B O   1 
ATOM   4276 C  CB  . ILE B 2 217 ? 4.708   116.538 -17.881 1.00 18.32 ? 717  ILE B CB  1 
ATOM   4277 C  CG1 . ILE B 2 217 ? 5.060   117.402 -16.668 1.00 18.18 ? 717  ILE B CG1 1 
ATOM   4278 C  CG2 . ILE B 2 217 ? 5.882   115.615 -18.246 1.00 18.41 ? 717  ILE B CG2 1 
ATOM   4279 C  CD1 . ILE B 2 217 ? 5.367   116.598 -15.419 1.00 18.54 ? 717  ILE B CD1 1 
ATOM   4280 N  N   . THR B 2 218 ? 5.235   116.618 -21.186 1.00 20.61 ? 718  THR B N   1 
ATOM   4281 C  CA  . THR B 2 218 ? 5.272   115.781 -22.374 1.00 21.75 ? 718  THR B CA  1 
ATOM   4282 C  C   . THR B 2 218 ? 6.450   114.835 -22.172 1.00 23.15 ? 718  THR B C   1 
ATOM   4283 O  O   . THR B 2 218 ? 7.313   115.081 -21.326 1.00 22.67 ? 718  THR B O   1 
ATOM   4284 C  CB  . THR B 2 218 ? 5.504   116.601 -23.665 1.00 21.97 ? 718  THR B CB  1 
ATOM   4285 O  OG1 . THR B 2 218 ? 6.735   117.325 -23.563 1.00 20.76 ? 718  THR B OG1 1 
ATOM   4286 C  CG2 . THR B 2 218 ? 4.352   117.574 -23.900 1.00 21.77 ? 718  THR B CG2 1 
ATOM   4287 N  N   . PRO B 2 219 ? 6.501   113.737 -22.938 1.00 24.58 ? 719  PRO B N   1 
ATOM   4288 C  CA  . PRO B 2 219 ? 7.600   112.778 -22.802 1.00 24.70 ? 719  PRO B CA  1 
ATOM   4289 C  C   . PRO B 2 219 ? 8.995   113.359 -23.047 1.00 24.33 ? 719  PRO B C   1 
ATOM   4290 O  O   . PRO B 2 219 ? 9.954   112.962 -22.394 1.00 24.89 ? 719  PRO B O   1 
ATOM   4291 C  CB  . PRO B 2 219 ? 7.229   111.686 -23.809 1.00 25.68 ? 719  PRO B CB  1 
ATOM   4292 C  CG  . PRO B 2 219 ? 6.435   112.440 -24.852 1.00 26.01 ? 719  PRO B CG  1 
ATOM   4293 C  CD  . PRO B 2 219 ? 5.561   113.315 -23.993 1.00 25.06 ? 719  PRO B CD  1 
ATOM   4294 N  N   . ASP B 2 220 ? 9.117   114.310 -23.967 1.00 24.01 ? 720  ASP B N   1 
ATOM   4295 C  CA  . ASP B 2 220 ? 10.431  114.876 -24.249 1.00 23.82 ? 720  ASP B CA  1 
ATOM   4296 C  C   . ASP B 2 220 ? 10.787  116.142 -23.466 1.00 22.41 ? 720  ASP B C   1 
ATOM   4297 O  O   . ASP B 2 220 ? 11.942  116.556 -23.470 1.00 21.50 ? 720  ASP B O   1 
ATOM   4298 C  CB  . ASP B 2 220 ? 10.575  115.158 -25.745 1.00 26.77 ? 720  ASP B CB  1 
ATOM   4299 C  CG  . ASP B 2 220 ? 9.673   116.272 -26.213 1.00 29.39 ? 720  ASP B CG  1 
ATOM   4300 O  OD1 . ASP B 2 220 ? 8.436   116.137 -26.081 1.00 31.43 ? 720  ASP B OD1 1 
ATOM   4301 O  OD2 . ASP B 2 220 ? 10.200  117.286 -26.714 1.00 31.66 ? 720  ASP B OD2 1 
ATOM   4302 N  N   . LEU B 2 221 ? 9.809   116.749 -22.794 1.00 20.64 ? 721  LEU B N   1 
ATOM   4303 C  CA  . LEU B 2 221 ? 10.065  117.971 -22.030 1.00 19.41 ? 721  LEU B CA  1 
ATOM   4304 C  C   . LEU B 2 221 ? 11.233  117.812 -21.058 1.00 18.59 ? 721  LEU B C   1 
ATOM   4305 O  O   . LEU B 2 221 ? 12.134  118.653 -21.008 1.00 17.33 ? 721  LEU B O   1 
ATOM   4306 C  CB  . LEU B 2 221 ? 8.809   118.391 -21.254 1.00 18.91 ? 721  LEU B CB  1 
ATOM   4307 C  CG  . LEU B 2 221 ? 8.947   119.583 -20.297 1.00 19.42 ? 721  LEU B CG  1 
ATOM   4308 C  CD1 . LEU B 2 221 ? 9.429   120.810 -21.058 1.00 18.33 ? 721  LEU B CD1 1 
ATOM   4309 C  CD2 . LEU B 2 221 ? 7.602   119.862 -19.622 1.00 18.93 ? 721  LEU B CD2 1 
ATOM   4310 N  N   . PHE B 2 222 ? 11.222  116.729 -20.290 1.00 18.15 ? 722  PHE B N   1 
ATOM   4311 C  CA  . PHE B 2 222 ? 12.283  116.492 -19.322 1.00 18.42 ? 722  PHE B CA  1 
ATOM   4312 C  C   . PHE B 2 222 ? 13.262  115.402 -19.731 1.00 18.97 ? 722  PHE B C   1 
ATOM   4313 O  O   . PHE B 2 222 ? 13.937  114.800 -18.897 1.00 17.47 ? 722  PHE B O   1 
ATOM   4314 C  CB  . PHE B 2 222 ? 11.669  116.190 -17.956 1.00 17.98 ? 722  PHE B CB  1 
ATOM   4315 C  CG  . PHE B 2 222 ? 10.930  117.356 -17.376 1.00 17.50 ? 722  PHE B CG  1 
ATOM   4316 C  CD1 . PHE B 2 222 ? 9.543   117.363 -17.318 1.00 17.94 ? 722  PHE B CD1 1 
ATOM   4317 C  CD2 . PHE B 2 222 ? 11.627  118.477 -16.932 1.00 16.94 ? 722  PHE B CD2 1 
ATOM   4318 C  CE1 . PHE B 2 222 ? 8.856   118.474 -16.829 1.00 16.94 ? 722  PHE B CE1 1 
ATOM   4319 C  CE2 . PHE B 2 222 ? 10.951  119.591 -16.443 1.00 16.67 ? 722  PHE B CE2 1 
ATOM   4320 C  CZ  . PHE B 2 222 ? 9.564   119.590 -16.392 1.00 17.03 ? 722  PHE B CZ  1 
ATOM   4321 N  N   . GLU B 2 223 ? 13.338  115.161 -21.033 1.00 20.21 ? 723  GLU B N   1 
ATOM   4322 C  CA  . GLU B 2 223 ? 14.248  114.168 -21.574 1.00 21.41 ? 723  GLU B CA  1 
ATOM   4323 C  C   . GLU B 2 223 ? 15.674  114.617 -21.236 1.00 20.25 ? 723  GLU B C   1 
ATOM   4324 O  O   . GLU B 2 223 ? 16.073  115.734 -21.567 1.00 20.31 ? 723  GLU B O   1 
ATOM   4325 C  CB  . GLU B 2 223 ? 14.027  114.066 -23.094 1.00 24.53 ? 723  GLU B CB  1 
ATOM   4326 C  CG  . GLU B 2 223 ? 15.263  114.223 -23.955 1.00 29.46 ? 723  GLU B CG  1 
ATOM   4327 C  CD  . GLU B 2 223 ? 16.223  113.069 -23.800 1.00 32.20 ? 723  GLU B CD  1 
ATOM   4328 O  OE1 . GLU B 2 223 ? 17.346  113.148 -24.349 1.00 35.19 ? 723  GLU B OE1 1 
ATOM   4329 O  OE2 . GLU B 2 223 ? 15.850  112.081 -23.129 1.00 34.50 ? 723  GLU B OE2 1 
ATOM   4330 N  N   . GLY B 2 224 ? 16.422  113.758 -20.546 1.00 19.04 ? 724  GLY B N   1 
ATOM   4331 C  CA  . GLY B 2 224 ? 17.792  114.082 -20.176 1.00 17.37 ? 724  GLY B CA  1 
ATOM   4332 C  C   . GLY B 2 224 ? 17.960  114.856 -18.874 1.00 16.64 ? 724  GLY B C   1 
ATOM   4333 O  O   . GLY B 2 224 ? 19.052  114.901 -18.310 1.00 16.27 ? 724  GLY B O   1 
ATOM   4334 N  N   . THR B 2 225 ? 16.878  115.457 -18.389 1.00 16.28 ? 725  THR B N   1 
ATOM   4335 C  CA  . THR B 2 225 ? 16.914  116.248 -17.159 1.00 15.17 ? 725  THR B CA  1 
ATOM   4336 C  C   . THR B 2 225 ? 17.381  115.470 -15.924 1.00 15.46 ? 725  THR B C   1 
ATOM   4337 O  O   . THR B 2 225 ? 18.246  115.946 -15.179 1.00 14.74 ? 725  THR B O   1 
ATOM   4338 C  CB  . THR B 2 225 ? 15.528  116.870 -16.880 1.00 15.31 ? 725  THR B CB  1 
ATOM   4339 O  OG1 . THR B 2 225 ? 15.127  117.651 -18.014 1.00 15.00 ? 725  THR B OG1 1 
ATOM   4340 C  CG2 . THR B 2 225 ? 15.574  117.771 -15.651 1.00 13.50 ? 725  THR B CG2 1 
ATOM   4341 N  N   . ALA B 2 226 ? 16.819  114.281 -15.703 1.00 14.70 ? 726  ALA B N   1 
ATOM   4342 C  CA  . ALA B 2 226 ? 17.207  113.468 -14.554 1.00 14.53 ? 726  ALA B CA  1 
ATOM   4343 C  C   . ALA B 2 226 ? 18.717  113.205 -14.534 1.00 15.51 ? 726  ALA B C   1 
ATOM   4344 O  O   . ALA B 2 226 ? 19.356  113.288 -13.482 1.00 15.34 ? 726  ALA B O   1 
ATOM   4345 C  CB  . ALA B 2 226 ? 16.438  112.144 -14.558 1.00 14.43 ? 726  ALA B CB  1 
ATOM   4346 N  N   . GLU B 2 227 ? 19.284  112.888 -15.697 1.00 15.96 ? 727  GLU B N   1 
ATOM   4347 C  CA  . GLU B 2 227 ? 20.716  112.622 -15.806 1.00 16.37 ? 727  GLU B CA  1 
ATOM   4348 C  C   . GLU B 2 227 ? 21.540  113.874 -15.492 1.00 16.70 ? 727  GLU B C   1 
ATOM   4349 O  O   . GLU B 2 227 ? 22.581  113.797 -14.839 1.00 17.30 ? 727  GLU B O   1 
ATOM   4350 C  CB  . GLU B 2 227 ? 21.066  112.133 -17.216 1.00 17.63 ? 727  GLU B CB  1 
ATOM   4351 C  CG  . GLU B 2 227 ? 20.505  110.759 -17.596 1.00 19.79 ? 727  GLU B CG  1 
ATOM   4352 C  CD  . GLU B 2 227 ? 18.987  110.727 -17.713 1.00 21.54 ? 727  GLU B CD  1 
ATOM   4353 O  OE1 . GLU B 2 227 ? 18.371  111.775 -18.005 1.00 21.80 ? 727  GLU B OE1 1 
ATOM   4354 O  OE2 . GLU B 2 227 ? 18.405  109.638 -17.530 1.00 23.86 ? 727  GLU B OE2 1 
ATOM   4355 N  N   . TRP B 2 228 ? 21.079  115.026 -15.968 1.00 16.30 ? 728  TRP B N   1 
ATOM   4356 C  CA  . TRP B 2 228 ? 21.791  116.275 -15.722 1.00 16.10 ? 728  TRP B CA  1 
ATOM   4357 C  C   . TRP B 2 228 ? 21.798  116.590 -14.226 1.00 15.89 ? 728  TRP B C   1 
ATOM   4358 O  O   . TRP B 2 228 ? 22.817  117.008 -13.672 1.00 15.39 ? 728  TRP B O   1 
ATOM   4359 C  CB  . TRP B 2 228 ? 21.135  117.437 -16.477 1.00 15.70 ? 728  TRP B CB  1 
ATOM   4360 C  CG  . TRP B 2 228 ? 21.918  118.709 -16.343 1.00 15.52 ? 728  TRP B CG  1 
ATOM   4361 C  CD1 . TRP B 2 228 ? 23.007  119.083 -17.077 1.00 15.67 ? 728  TRP B CD1 1 
ATOM   4362 C  CD2 . TRP B 2 228 ? 21.731  119.728 -15.354 1.00 15.34 ? 728  TRP B CD2 1 
ATOM   4363 N  NE1 . TRP B 2 228 ? 23.516  120.270 -16.600 1.00 16.29 ? 728  TRP B NE1 1 
ATOM   4364 C  CE2 . TRP B 2 228 ? 22.750  120.686 -15.542 1.00 15.95 ? 728  TRP B CE2 1 
ATOM   4365 C  CE3 . TRP B 2 228 ? 20.800  119.921 -14.322 1.00 15.55 ? 728  TRP B CE3 1 
ATOM   4366 C  CZ2 . TRP B 2 228 ? 22.869  121.823 -14.735 1.00 16.20 ? 728  TRP B CZ2 1 
ATOM   4367 C  CZ3 . TRP B 2 228 ? 20.918  121.050 -13.520 1.00 15.29 ? 728  TRP B CZ3 1 
ATOM   4368 C  CH2 . TRP B 2 228 ? 21.946  121.986 -13.732 1.00 16.01 ? 728  TRP B CH2 1 
ATOM   4369 N  N   . ILE B 2 229 ? 20.656  116.389 -13.575 1.00 15.60 ? 729  ILE B N   1 
ATOM   4370 C  CA  . ILE B 2 229 ? 20.556  116.663 -12.148 1.00 15.25 ? 729  ILE B CA  1 
ATOM   4371 C  C   . ILE B 2 229 ? 21.519  115.777 -11.367 1.00 15.51 ? 729  ILE B C   1 
ATOM   4372 O  O   . ILE B 2 229 ? 22.191  116.245 -10.449 1.00 15.59 ? 729  ILE B O   1 
ATOM   4373 C  CB  . ILE B 2 229 ? 19.112  116.438 -11.636 1.00 15.59 ? 729  ILE B CB  1 
ATOM   4374 C  CG1 . ILE B 2 229 ? 18.181  117.488 -12.250 1.00 14.50 ? 729  ILE B CG1 1 
ATOM   4375 C  CG2 . ILE B 2 229 ? 19.072  116.524 -10.108 1.00 15.06 ? 729  ILE B CG2 1 
ATOM   4376 C  CD1 . ILE B 2 229 ? 16.709  117.256 -11.957 1.00 14.80 ? 729  ILE B CD1 1 
ATOM   4377 N  N   . ALA B 2 230 ? 21.594  114.501 -11.736 1.00 15.67 ? 730  ALA B N   1 
ATOM   4378 C  CA  . ALA B 2 230 ? 22.485  113.570 -11.056 1.00 15.45 ? 730  ALA B CA  1 
ATOM   4379 C  C   . ALA B 2 230 ? 23.942  114.027 -11.167 1.00 15.94 ? 730  ALA B C   1 
ATOM   4380 O  O   . ALA B 2 230 ? 24.727  113.837 -10.235 1.00 15.86 ? 730  ALA B O   1 
ATOM   4381 C  CB  . ALA B 2 230 ? 22.321  112.158 -11.633 1.00 15.97 ? 730  ALA B CB  1 
ATOM   4382 N  N   . ARG B 2 231 ? 24.308  114.629 -12.297 1.00 15.45 ? 731  ARG B N   1 
ATOM   4383 C  CA  . ARG B 2 231 ? 25.677  115.111 -12.466 1.00 15.57 ? 731  ARG B CA  1 
ATOM   4384 C  C   . ARG B 2 231 ? 25.989  116.244 -11.486 1.00 14.84 ? 731  ARG B C   1 
ATOM   4385 O  O   . ARG B 2 231 ? 27.158  116.551 -11.247 1.00 13.43 ? 731  ARG B O   1 
ATOM   4386 C  CB  . ARG B 2 231 ? 25.926  115.609 -13.895 1.00 17.74 ? 731  ARG B CB  1 
ATOM   4387 C  CG  . ARG B 2 231 ? 26.076  114.507 -14.942 1.00 21.64 ? 731  ARG B CG  1 
ATOM   4388 C  CD  . ARG B 2 231 ? 26.964  114.966 -16.104 1.00 24.39 ? 731  ARG B CD  1 
ATOM   4389 N  NE  . ARG B 2 231 ? 26.368  116.037 -16.898 1.00 27.91 ? 731  ARG B NE  1 
ATOM   4390 C  CZ  . ARG B 2 231 ? 27.022  117.125 -17.308 1.00 29.22 ? 731  ARG B CZ  1 
ATOM   4391 N  NH1 . ARG B 2 231 ? 28.300  117.299 -16.997 1.00 28.56 ? 731  ARG B NH1 1 
ATOM   4392 N  NH2 . ARG B 2 231 ? 26.399  118.039 -18.041 1.00 29.77 ? 731  ARG B NH2 1 
ATOM   4393 N  N   . CYS B 2 232 ? 24.946  116.868 -10.936 1.00 13.48 ? 732  CYS B N   1 
ATOM   4394 C  CA  . CYS B 2 232 ? 25.117  117.962 -9.975  1.00 13.36 ? 732  CYS B CA  1 
ATOM   4395 C  C   . CYS B 2 232 ? 25.371  117.452 -8.554  1.00 13.29 ? 732  CYS B C   1 
ATOM   4396 O  O   . CYS B 2 232 ? 25.785  118.221 -7.679  1.00 13.56 ? 732  CYS B O   1 
ATOM   4397 C  CB  . CYS B 2 232 ? 23.893  118.889 -9.977  1.00 13.37 ? 732  CYS B CB  1 
ATOM   4398 S  SG  . CYS B 2 232 ? 23.649  119.839 -11.519 1.00 14.01 ? 732  CYS B SG  1 
ATOM   4399 N  N   . GLN B 2 233 ? 25.099  116.172 -8.306  1.00 12.89 ? 733  GLN B N   1 
ATOM   4400 C  CA  . GLN B 2 233 ? 25.379  115.605 -6.987  1.00 13.14 ? 733  GLN B CA  1 
ATOM   4401 C  C   . GLN B 2 233 ? 26.903  115.494 -6.978  1.00 13.66 ? 733  GLN B C   1 
ATOM   4402 O  O   . GLN B 2 233 ? 27.496  115.077 -7.970  1.00 13.91 ? 733  GLN B O   1 
ATOM   4403 C  CB  . GLN B 2 233 ? 24.734  114.217 -6.827  1.00 13.80 ? 733  GLN B CB  1 
ATOM   4404 C  CG  . GLN B 2 233 ? 25.135  113.491 -5.530  1.00 12.58 ? 733  GLN B CG  1 
ATOM   4405 C  CD  . GLN B 2 233 ? 24.325  112.222 -5.270  1.00 13.52 ? 733  GLN B CD  1 
ATOM   4406 O  OE1 . GLN B 2 233 ? 24.084  111.425 -6.175  1.00 12.51 ? 733  GLN B OE1 1 
ATOM   4407 N  NE2 . GLN B 2 233 ? 23.917  112.028 -4.018  1.00 12.86 ? 733  GLN B NE2 1 
ATOM   4408 N  N   . ASN B 2 234 ? 27.549  115.886 -5.887  1.00 13.50 ? 734  ASN B N   1 
ATOM   4409 C  CA  . ASN B 2 234 ? 29.007  115.829 -5.861  1.00 13.62 ? 734  ASN B CA  1 
ATOM   4410 C  C   . ASN B 2 234 ? 29.571  114.867 -4.826  1.00 13.53 ? 734  ASN B C   1 
ATOM   4411 O  O   . ASN B 2 234 ? 28.828  114.099 -4.212  1.00 13.29 ? 734  ASN B O   1 
ATOM   4412 C  CB  . ASN B 2 234 ? 29.585  117.241 -5.659  1.00 12.52 ? 734  ASN B CB  1 
ATOM   4413 C  CG  . ASN B 2 234 ? 29.502  117.722 -4.220  1.00 13.76 ? 734  ASN B CG  1 
ATOM   4414 O  OD1 . ASN B 2 234 ? 28.801  117.138 -3.385  1.00 13.92 ? 734  ASN B OD1 1 
ATOM   4415 N  ND2 . ASN B 2 234 ? 30.217  118.808 -3.923  1.00 11.21 ? 734  ASN B ND2 1 
ATOM   4416 N  N   . TRP B 2 235 ? 30.889  114.917 -4.648  1.00 13.66 ? 735  TRP B N   1 
ATOM   4417 C  CA  . TRP B 2 235 ? 31.598  114.055 -3.709  1.00 14.51 ? 735  TRP B CA  1 
ATOM   4418 C  C   . TRP B 2 235 ? 31.065  114.122 -2.284  1.00 14.85 ? 735  TRP B C   1 
ATOM   4419 O  O   . TRP B 2 235 ? 31.257  113.189 -1.508  1.00 14.94 ? 735  TRP B O   1 
ATOM   4420 C  CB  . TRP B 2 235 ? 33.091  114.406 -3.689  1.00 14.69 ? 735  TRP B CB  1 
ATOM   4421 C  CG  . TRP B 2 235 ? 33.359  115.837 -3.315  1.00 15.23 ? 735  TRP B CG  1 
ATOM   4422 C  CD1 . TRP B 2 235 ? 33.342  116.917 -4.148  1.00 14.80 ? 735  TRP B CD1 1 
ATOM   4423 C  CD2 . TRP B 2 235 ? 33.645  116.348 -2.003  1.00 14.90 ? 735  TRP B CD2 1 
ATOM   4424 N  NE1 . TRP B 2 235 ? 33.600  118.070 -3.441  1.00 15.71 ? 735  TRP B NE1 1 
ATOM   4425 C  CE2 . TRP B 2 235 ? 33.790  117.751 -2.123  1.00 14.83 ? 735  TRP B CE2 1 
ATOM   4426 C  CE3 . TRP B 2 235 ? 33.791  115.758 -0.741  1.00 14.14 ? 735  TRP B CE3 1 
ATOM   4427 C  CZ2 . TRP B 2 235 ? 34.075  118.576 -1.024  1.00 15.44 ? 735  TRP B CZ2 1 
ATOM   4428 C  CZ3 . TRP B 2 235 ? 34.074  116.579 0.355   1.00 15.16 ? 735  TRP B CZ3 1 
ATOM   4429 C  CH2 . TRP B 2 235 ? 34.213  117.974 0.203   1.00 15.05 ? 735  TRP B CH2 1 
ATOM   4430 N  N   . GLU B 2 236 ? 30.407  115.225 -1.939  1.00 14.87 ? 736  GLU B N   1 
ATOM   4431 C  CA  . GLU B 2 236 ? 29.864  115.406 -0.591  1.00 14.23 ? 736  GLU B CA  1 
ATOM   4432 C  C   . GLU B 2 236 ? 28.573  114.627 -0.351  1.00 13.77 ? 736  GLU B C   1 
ATOM   4433 O  O   . GLU B 2 236 ? 28.237  114.306 0.795   1.00 13.54 ? 736  GLU B O   1 
ATOM   4434 C  CB  . GLU B 2 236 ? 29.572  116.882 -0.329  1.00 14.25 ? 736  GLU B CB  1 
ATOM   4435 C  CG  . GLU B 2 236 ? 30.770  117.796 -0.355  1.00 14.41 ? 736  GLU B CG  1 
ATOM   4436 C  CD  . GLU B 2 236 ? 30.354  119.242 -0.191  1.00 14.38 ? 736  GLU B CD  1 
ATOM   4437 O  OE1 . GLU B 2 236 ? 30.265  119.952 -1.215  1.00 14.54 ? 736  GLU B OE1 1 
ATOM   4438 O  OE2 . GLU B 2 236 ? 30.095  119.658 0.964   1.00 14.48 ? 736  GLU B OE2 1 
ATOM   4439 N  N   . GLY B 2 237 ? 27.844  114.352 -1.427  1.00 12.72 ? 737  GLY B N   1 
ATOM   4440 C  CA  . GLY B 2 237 ? 26.589  113.630 -1.310  1.00 12.94 ? 737  GLY B CA  1 
ATOM   4441 C  C   . GLY B 2 237 ? 25.410  114.540 -1.607  1.00 13.03 ? 737  GLY B C   1 
ATOM   4442 O  O   . GLY B 2 237 ? 24.336  114.081 -2.012  1.00 12.57 ? 737  GLY B O   1 
ATOM   4443 N  N   . GLY B 2 238 ? 25.618  115.837 -1.391  1.00 12.90 ? 738  GLY B N   1 
ATOM   4444 C  CA  . GLY B 2 238 ? 24.587  116.823 -1.660  1.00 12.56 ? 738  GLY B CA  1 
ATOM   4445 C  C   . GLY B 2 238 ? 24.645  117.214 -3.126  1.00 12.51 ? 738  GLY B C   1 
ATOM   4446 O  O   . GLY B 2 238 ? 25.402  116.619 -3.892  1.00 12.47 ? 738  GLY B O   1 
ATOM   4447 N  N   . ILE B 2 239 ? 23.872  118.226 -3.512  1.00 12.06 ? 739  ILE B N   1 
ATOM   4448 C  CA  . ILE B 2 239 ? 23.810  118.677 -4.904  1.00 11.34 ? 739  ILE B CA  1 
ATOM   4449 C  C   . ILE B 2 239 ? 24.215  120.149 -5.051  1.00 11.47 ? 739  ILE B C   1 
ATOM   4450 O  O   . ILE B 2 239 ? 23.816  120.997 -4.247  1.00 10.78 ? 739  ILE B O   1 
ATOM   4451 C  CB  . ILE B 2 239 ? 22.369  118.474 -5.454  1.00 11.60 ? 739  ILE B CB  1 
ATOM   4452 C  CG1 . ILE B 2 239 ? 22.009  116.981 -5.403  1.00 12.48 ? 739  ILE B CG1 1 
ATOM   4453 C  CG2 . ILE B 2 239 ? 22.251  119.015 -6.879  1.00 11.37 ? 739  ILE B CG2 1 
ATOM   4454 C  CD1 . ILE B 2 239 ? 20.549  116.666 -5.738  1.00 11.97 ? 739  ILE B CD1 1 
ATOM   4455 N  N   . GLY B 2 240 ? 25.019  120.447 -6.071  1.00 11.59 ? 740  GLY B N   1 
ATOM   4456 C  CA  . GLY B 2 240 ? 25.448  121.817 -6.302  1.00 12.21 ? 740  GLY B CA  1 
ATOM   4457 C  C   . GLY B 2 240 ? 24.628  122.472 -7.400  1.00 12.94 ? 740  GLY B C   1 
ATOM   4458 O  O   . GLY B 2 240 ? 23.870  121.792 -8.091  1.00 13.39 ? 740  GLY B O   1 
ATOM   4459 N  N   . GLY B 2 241 ? 24.773  123.785 -7.567  1.00 13.60 ? 741  GLY B N   1 
ATOM   4460 C  CA  . GLY B 2 241 ? 24.024  124.497 -8.594  1.00 13.33 ? 741  GLY B CA  1 
ATOM   4461 C  C   . GLY B 2 241 ? 24.221  123.942 -9.995  1.00 13.69 ? 741  GLY B C   1 
ATOM   4462 O  O   . GLY B 2 241 ? 23.280  123.900 -10.788 1.00 13.95 ? 741  GLY B O   1 
ATOM   4463 N  N   . VAL B 2 242 ? 25.450  123.537 -10.302 1.00 13.57 ? 742  VAL B N   1 
ATOM   4464 C  CA  . VAL B 2 242 ? 25.798  122.953 -11.598 1.00 13.67 ? 742  VAL B CA  1 
ATOM   4465 C  C   . VAL B 2 242 ? 26.865  121.889 -11.334 1.00 13.39 ? 742  VAL B C   1 
ATOM   4466 O  O   . VAL B 2 242 ? 27.475  121.874 -10.264 1.00 12.69 ? 742  VAL B O   1 
ATOM   4467 C  CB  . VAL B 2 242 ? 26.377  124.018 -12.583 1.00 14.51 ? 742  VAL B CB  1 
ATOM   4468 C  CG1 . VAL B 2 242 ? 25.299  125.036 -12.960 1.00 13.81 ? 742  VAL B CG1 1 
ATOM   4469 C  CG2 . VAL B 2 242 ? 27.573  124.721 -11.952 1.00 14.30 ? 742  VAL B CG2 1 
ATOM   4470 N  N   . PRO B 2 243 ? 27.097  120.977 -12.295 1.00 13.95 ? 743  PRO B N   1 
ATOM   4471 C  CA  . PRO B 2 243 ? 28.110  119.935 -12.097 1.00 14.03 ? 743  PRO B CA  1 
ATOM   4472 C  C   . PRO B 2 243 ? 29.452  120.516 -11.658 1.00 14.64 ? 743  PRO B C   1 
ATOM   4473 O  O   . PRO B 2 243 ? 29.929  121.494 -12.238 1.00 14.45 ? 743  PRO B O   1 
ATOM   4474 C  CB  . PRO B 2 243 ? 28.191  119.267 -13.470 1.00 14.08 ? 743  PRO B CB  1 
ATOM   4475 C  CG  . PRO B 2 243 ? 26.774  119.391 -13.966 1.00 13.99 ? 743  PRO B CG  1 
ATOM   4476 C  CD  . PRO B 2 243 ? 26.437  120.825 -13.605 1.00 13.86 ? 743  PRO B CD  1 
ATOM   4477 N  N   . GLY B 2 244 ? 30.036  119.915 -10.623 1.00 14.51 ? 744  GLY B N   1 
ATOM   4478 C  CA  . GLY B 2 244 ? 31.319  120.362 -10.105 1.00 15.00 ? 744  GLY B CA  1 
ATOM   4479 C  C   . GLY B 2 244 ? 31.255  121.267 -8.883  1.00 14.83 ? 744  GLY B C   1 
ATOM   4480 O  O   . GLY B 2 244 ? 32.193  121.309 -8.084  1.00 14.70 ? 744  GLY B O   1 
ATOM   4481 N  N   . MET B 2 245 ? 30.148  121.984 -8.723  1.00 14.60 ? 745  MET B N   1 
ATOM   4482 C  CA  . MET B 2 245 ? 30.003  122.911 -7.605  1.00 14.25 ? 745  MET B CA  1 
ATOM   4483 C  C   . MET B 2 245 ? 29.646  122.310 -6.249  1.00 13.67 ? 745  MET B C   1 
ATOM   4484 O  O   . MET B 2 245 ? 29.089  121.216 -6.155  1.00 13.32 ? 745  MET B O   1 
ATOM   4485 C  CB  . MET B 2 245 ? 28.996  124.006 -7.966  1.00 15.43 ? 745  MET B CB  1 
ATOM   4486 C  CG  . MET B 2 245 ? 29.626  125.166 -8.731  1.00 17.23 ? 745  MET B CG  1 
ATOM   4487 S  SD  . MET B 2 245 ? 31.004  125.879 -7.811  1.00 21.28 ? 745  MET B SD  1 
ATOM   4488 C  CE  . MET B 2 245 ? 30.132  126.804 -6.552  1.00 20.41 ? 745  MET B CE  1 
ATOM   4489 N  N   . GLU B 2 246 ? 29.987  123.059 -5.205  1.00 13.17 ? 746  GLU B N   1 
ATOM   4490 C  CA  . GLU B 2 246 ? 29.761  122.682 -3.810  1.00 12.93 ? 746  GLU B CA  1 
ATOM   4491 C  C   . GLU B 2 246 ? 28.295  122.377 -3.503  1.00 12.69 ? 746  GLU B C   1 
ATOM   4492 O  O   . GLU B 2 246 ? 27.390  123.055 -3.993  1.00 12.60 ? 746  GLU B O   1 
ATOM   4493 C  CB  . GLU B 2 246 ? 30.271  123.812 -2.904  1.00 12.31 ? 746  GLU B CB  1 
ATOM   4494 C  CG  . GLU B 2 246 ? 30.021  123.643 -1.407  1.00 12.44 ? 746  GLU B CG  1 
ATOM   4495 C  CD  . GLU B 2 246 ? 30.570  124.816 -0.599  1.00 12.86 ? 746  GLU B CD  1 
ATOM   4496 O  OE1 . GLU B 2 246 ? 30.667  125.931 -1.161  1.00 12.98 ? 746  GLU B OE1 1 
ATOM   4497 O  OE2 . GLU B 2 246 ? 30.891  124.635 0.595   1.00 12.98 ? 746  GLU B OE2 1 
ATOM   4498 N  N   . ALA B 2 247 ? 28.078  121.351 -2.685  1.00 12.15 ? 747  ALA B N   1 
ATOM   4499 C  CA  . ALA B 2 247 ? 26.740  120.937 -2.294  1.00 12.39 ? 747  ALA B CA  1 
ATOM   4500 C  C   . ALA B 2 247 ? 26.086  121.995 -1.410  1.00 12.70 ? 747  ALA B C   1 
ATOM   4501 O  O   . ALA B 2 247 ? 26.681  122.459 -0.435  1.00 12.86 ? 747  ALA B O   1 
ATOM   4502 C  CB  . ALA B 2 247 ? 26.808  119.604 -1.547  1.00 11.85 ? 747  ALA B CB  1 
ATOM   4503 N  N   . HIS B 2 248 ? 24.856  122.365 -1.748  1.00 12.97 ? 748  HIS B N   1 
ATOM   4504 C  CA  . HIS B 2 248 ? 24.124  123.364 -0.982  1.00 12.65 ? 748  HIS B CA  1 
ATOM   4505 C  C   . HIS B 2 248 ? 22.665  122.948 -0.801  1.00 12.45 ? 748  HIS B C   1 
ATOM   4506 O  O   . HIS B 2 248 ? 22.050  122.398 -1.717  1.00 12.38 ? 748  HIS B O   1 
ATOM   4507 C  CB  . HIS B 2 248 ? 24.198  124.723 -1.685  1.00 12.63 ? 748  HIS B CB  1 
ATOM   4508 C  CG  . HIS B 2 248 ? 23.849  125.877 -0.798  1.00 13.46 ? 748  HIS B CG  1 
ATOM   4509 N  ND1 . HIS B 2 248 ? 22.560  126.137 -0.383  1.00 13.35 ? 748  HIS B ND1 1 
ATOM   4510 C  CD2 . HIS B 2 248 ? 24.632  126.807 -0.198  1.00 12.92 ? 748  HIS B CD2 1 
ATOM   4511 C  CE1 . HIS B 2 248 ? 22.565  127.174 0.436   1.00 13.34 ? 748  HIS B CE1 1 
ATOM   4512 N  NE2 . HIS B 2 248 ? 23.810  127.598 0.566   1.00 13.19 ? 748  HIS B NE2 1 
ATOM   4513 N  N   . GLY B 2 249 ? 22.119  123.219 0.383   1.00 12.28 ? 749  GLY B N   1 
ATOM   4514 C  CA  . GLY B 2 249 ? 20.740  122.864 0.676   1.00 11.86 ? 749  GLY B CA  1 
ATOM   4515 C  C   . GLY B 2 249 ? 19.734  123.385 -0.332  1.00 12.54 ? 749  GLY B C   1 
ATOM   4516 O  O   . GLY B 2 249 ? 18.798  122.677 -0.713  1.00 12.78 ? 749  GLY B O   1 
ATOM   4517 N  N   . GLY B 2 250 ? 19.918  124.629 -0.764  1.00 12.54 ? 750  GLY B N   1 
ATOM   4518 C  CA  . GLY B 2 250 ? 19.008  125.208 -1.733  1.00 11.57 ? 750  GLY B CA  1 
ATOM   4519 C  C   . GLY B 2 250 ? 18.938  124.411 -3.023  1.00 12.03 ? 750  GLY B C   1 
ATOM   4520 O  O   . GLY B 2 250 ? 17.853  124.063 -3.485  1.00 11.83 ? 750  GLY B O   1 
ATOM   4521 N  N   . TYR B 2 251 ? 20.100  124.117 -3.598  1.00 11.60 ? 751  TYR B N   1 
ATOM   4522 C  CA  . TYR B 2 251 ? 20.179  123.363 -4.840  1.00 11.55 ? 751  TYR B CA  1 
ATOM   4523 C  C   . TYR B 2 251 ? 19.848  121.888 -4.641  1.00 11.68 ? 751  TYR B C   1 
ATOM   4524 O  O   . TYR B 2 251 ? 19.301  121.249 -5.538  1.00 12.10 ? 751  TYR B O   1 
ATOM   4525 C  CB  . TYR B 2 251 ? 21.580  123.511 -5.448  1.00 12.42 ? 751  TYR B CB  1 
ATOM   4526 C  CG  . TYR B 2 251 ? 21.898  124.926 -5.884  1.00 11.84 ? 751  TYR B CG  1 
ATOM   4527 C  CD1 . TYR B 2 251 ? 23.055  125.570 -5.447  1.00 12.94 ? 751  TYR B CD1 1 
ATOM   4528 C  CD2 . TYR B 2 251 ? 21.050  125.612 -6.752  1.00 14.04 ? 751  TYR B CD2 1 
ATOM   4529 C  CE1 . TYR B 2 251 ? 23.362  126.868 -5.870  1.00 12.81 ? 751  TYR B CE1 1 
ATOM   4530 C  CE2 . TYR B 2 251 ? 21.345  126.907 -7.181  1.00 13.65 ? 751  TYR B CE2 1 
ATOM   4531 C  CZ  . TYR B 2 251 ? 22.501  127.526 -6.739  1.00 14.39 ? 751  TYR B CZ  1 
ATOM   4532 O  OH  . TYR B 2 251 ? 22.799  128.798 -7.181  1.00 15.08 ? 751  TYR B OH  1 
ATOM   4533 N  N   . THR B 2 252 ? 20.174  121.345 -3.470  1.00 10.83 ? 752  THR B N   1 
ATOM   4534 C  CA  . THR B 2 252 ? 19.883  119.940 -3.192  1.00 10.49 ? 752  THR B CA  1 
ATOM   4535 C  C   . THR B 2 252 ? 18.372  119.727 -3.082  1.00 10.76 ? 752  THR B C   1 
ATOM   4536 O  O   . THR B 2 252 ? 17.845  118.724 -3.577  1.00 10.56 ? 752  THR B O   1 
ATOM   4537 C  CB  . THR B 2 252 ? 20.586  119.464 -1.904  1.00 9.95  ? 752  THR B CB  1 
ATOM   4538 O  OG1 . THR B 2 252 ? 21.999  119.685 -2.034  1.00 9.27  ? 752  THR B OG1 1 
ATOM   4539 C  CG2 . THR B 2 252 ? 20.338  117.972 -1.674  1.00 8.99  ? 752  THR B CG2 1 
ATOM   4540 N  N   . PHE B 2 253 ? 17.668  120.657 -2.437  1.00 10.73 ? 753  PHE B N   1 
ATOM   4541 C  CA  . PHE B 2 253 ? 16.217  120.527 -2.353  1.00 10.97 ? 753  PHE B CA  1 
ATOM   4542 C  C   . PHE B 2 253 ? 15.656  120.548 -3.775  1.00 10.82 ? 753  PHE B C   1 
ATOM   4543 O  O   . PHE B 2 253 ? 14.864  119.684 -4.151  1.00 10.75 ? 753  PHE B O   1 
ATOM   4544 C  CB  . PHE B 2 253 ? 15.560  121.671 -1.575  1.00 10.08 ? 753  PHE B CB  1 
ATOM   4545 C  CG  . PHE B 2 253 ? 14.053  121.624 -1.627  1.00 10.84 ? 753  PHE B CG  1 
ATOM   4546 C  CD1 . PHE B 2 253 ? 13.341  120.760 -0.794  1.00 10.76 ? 753  PHE B CD1 1 
ATOM   4547 C  CD2 . PHE B 2 253 ? 13.355  122.341 -2.600  1.00 10.52 ? 753  PHE B CD2 1 
ATOM   4548 C  CE1 . PHE B 2 253 ? 11.961  120.599 -0.936  1.00 10.35 ? 753  PHE B CE1 1 
ATOM   4549 C  CE2 . PHE B 2 253 ? 11.973  122.188 -2.754  1.00 11.02 ? 753  PHE B CE2 1 
ATOM   4550 C  CZ  . PHE B 2 253 ? 11.273  121.314 -1.923  1.00 11.23 ? 753  PHE B CZ  1 
ATOM   4551 N  N   . CYS B 2 254 ? 16.059  121.543 -4.563  1.00 11.26 ? 754  CYS B N   1 
ATOM   4552 C  CA  . CYS B 2 254 ? 15.568  121.651 -5.939  1.00 11.51 ? 754  CYS B CA  1 
ATOM   4553 C  C   . CYS B 2 254 ? 15.822  120.379 -6.741  1.00 12.11 ? 754  CYS B C   1 
ATOM   4554 O  O   . CYS B 2 254 ? 14.937  119.901 -7.464  1.00 12.33 ? 754  CYS B O   1 
ATOM   4555 C  CB  . CYS B 2 254 ? 16.223  122.835 -6.666  1.00 11.81 ? 754  CYS B CB  1 
ATOM   4556 S  SG  . CYS B 2 254 ? 15.688  124.476 -6.101  1.00 12.75 ? 754  CYS B SG  1 
ATOM   4557 N  N   . GLY B 2 255 ? 17.030  119.836 -6.611  1.00 11.53 ? 755  GLY B N   1 
ATOM   4558 C  CA  . GLY B 2 255 ? 17.391  118.637 -7.345  1.00 11.30 ? 755  GLY B CA  1 
ATOM   4559 C  C   . GLY B 2 255 ? 16.589  117.401 -6.987  1.00 11.39 ? 755  GLY B C   1 
ATOM   4560 O  O   . GLY B 2 255 ? 16.049  116.735 -7.868  1.00 11.76 ? 755  GLY B O   1 
ATOM   4561 N  N   . LEU B 2 256 ? 16.488  117.086 -5.700  1.00 11.02 ? 756  LEU B N   1 
ATOM   4562 C  CA  . LEU B 2 256 ? 15.748  115.893 -5.307  1.00 10.81 ? 756  LEU B CA  1 
ATOM   4563 C  C   . LEU B 2 256 ? 14.252  116.044 -5.555  1.00 10.59 ? 756  LEU B C   1 
ATOM   4564 O  O   . LEU B 2 256 ? 13.596  115.105 -6.008  1.00 11.18 ? 756  LEU B O   1 
ATOM   4565 C  CB  . LEU B 2 256 ? 16.006  115.544 -3.834  1.00 10.04 ? 756  LEU B CB  1 
ATOM   4566 C  CG  . LEU B 2 256 ? 15.298  114.274 -3.332  1.00 10.58 ? 756  LEU B CG  1 
ATOM   4567 C  CD1 . LEU B 2 256 ? 15.676  113.080 -4.214  1.00 11.19 ? 756  LEU B CD1 1 
ATOM   4568 C  CD2 . LEU B 2 256 ? 15.687  113.997 -1.885  1.00 10.29 ? 756  LEU B CD2 1 
ATOM   4569 N  N   . ALA B 2 257 ? 13.716  117.223 -5.268  1.00 10.36 ? 757  ALA B N   1 
ATOM   4570 C  CA  . ALA B 2 257 ? 12.294  117.476 -5.468  1.00 11.55 ? 757  ALA B CA  1 
ATOM   4571 C  C   . ALA B 2 257 ? 11.933  117.320 -6.949  1.00 11.55 ? 757  ALA B C   1 
ATOM   4572 O  O   . ALA B 2 257 ? 10.889  116.768 -7.288  1.00 11.16 ? 757  ALA B O   1 
ATOM   4573 C  CB  . ALA B 2 257 ? 11.931  118.886 -4.970  1.00 10.51 ? 757  ALA B CB  1 
ATOM   4574 N  N   . ALA B 2 258 ? 12.805  117.802 -7.828  1.00 12.60 ? 758  ALA B N   1 
ATOM   4575 C  CA  . ALA B 2 258 ? 12.562  117.691 -9.261  1.00 12.69 ? 758  ALA B CA  1 
ATOM   4576 C  C   . ALA B 2 258 ? 12.558  116.214 -9.671  1.00 13.50 ? 758  ALA B C   1 
ATOM   4577 O  O   . ALA B 2 258 ? 11.697  115.773 -10.437 1.00 13.24 ? 758  ALA B O   1 
ATOM   4578 C  CB  . ALA B 2 258 ? 13.636  118.461 -10.037 1.00 12.26 ? 758  ALA B CB  1 
ATOM   4579 N  N   . LEU B 2 259 ? 13.516  115.450 -9.152  1.00 14.02 ? 759  LEU B N   1 
ATOM   4580 C  CA  . LEU B 2 259 ? 13.604  114.027 -9.472  1.00 14.94 ? 759  LEU B CA  1 
ATOM   4581 C  C   . LEU B 2 259 ? 12.405  113.251 -8.932  1.00 15.14 ? 759  LEU B C   1 
ATOM   4582 O  O   . LEU B 2 259 ? 11.963  112.279 -9.548  1.00 14.87 ? 759  LEU B O   1 
ATOM   4583 C  CB  . LEU B 2 259 ? 14.912  113.427 -8.929  1.00 14.92 ? 759  LEU B CB  1 
ATOM   4584 C  CG  . LEU B 2 259 ? 16.185  113.847 -9.673  1.00 16.02 ? 759  LEU B CG  1 
ATOM   4585 C  CD1 . LEU B 2 259 ? 17.412  113.268 -8.971  1.00 17.48 ? 759  LEU B CD1 1 
ATOM   4586 C  CD2 . LEU B 2 259 ? 16.123  113.364 -11.121 1.00 15.25 ? 759  LEU B CD2 1 
ATOM   4587 N  N   . VAL B 2 260 ? 11.877  113.669 -7.784  1.00 15.12 ? 760  VAL B N   1 
ATOM   4588 C  CA  . VAL B 2 260 ? 10.712  112.991 -7.222  1.00 14.87 ? 760  VAL B CA  1 
ATOM   4589 C  C   . VAL B 2 260 ? 9.536   113.186 -8.175  1.00 15.13 ? 760  VAL B C   1 
ATOM   4590 O  O   . VAL B 2 260 ? 8.773   112.255 -8.431  1.00 15.22 ? 760  VAL B O   1 
ATOM   4591 C  CB  . VAL B 2 260 ? 10.344  113.540 -5.827  1.00 15.42 ? 760  VAL B CB  1 
ATOM   4592 C  CG1 . VAL B 2 260 ? 8.967   113.001 -5.387  1.00 14.95 ? 760  VAL B CG1 1 
ATOM   4593 C  CG2 . VAL B 2 260 ? 11.409  113.126 -4.816  1.00 14.90 ? 760  VAL B CG2 1 
ATOM   4594 N  N   . ILE B 2 261 ? 9.406   114.397 -8.714  1.00 15.10 ? 761  ILE B N   1 
ATOM   4595 C  CA  . ILE B 2 261 ? 8.328   114.702 -9.648  1.00 15.41 ? 761  ILE B CA  1 
ATOM   4596 C  C   . ILE B 2 261 ? 8.466   113.844 -10.907 1.00 16.47 ? 761  ILE B C   1 
ATOM   4597 O  O   . ILE B 2 261 ? 7.473   113.342 -11.434 1.00 16.20 ? 761  ILE B O   1 
ATOM   4598 C  CB  . ILE B 2 261 ? 8.343   116.195 -10.045 1.00 14.80 ? 761  ILE B CB  1 
ATOM   4599 C  CG1 . ILE B 2 261 ? 7.970   117.051 -8.832  1.00 14.10 ? 761  ILE B CG1 1 
ATOM   4600 C  CG2 . ILE B 2 261 ? 7.372   116.448 -11.195 1.00 14.51 ? 761  ILE B CG2 1 
ATOM   4601 C  CD1 . ILE B 2 261 ? 8.158   118.532 -9.046  1.00 13.68 ? 761  ILE B CD1 1 
ATOM   4602 N  N   . LEU B 2 262 ? 9.700   113.676 -11.377 1.00 16.80 ? 762  LEU B N   1 
ATOM   4603 C  CA  . LEU B 2 262 ? 9.980   112.876 -12.571 1.00 18.14 ? 762  LEU B CA  1 
ATOM   4604 C  C   . LEU B 2 262 ? 10.065  111.376 -12.267 1.00 18.63 ? 762  LEU B C   1 
ATOM   4605 O  O   . LEU B 2 262 ? 10.247  110.563 -13.175 1.00 18.68 ? 762  LEU B O   1 
ATOM   4606 C  CB  . LEU B 2 262 ? 11.301  113.323 -13.199 1.00 18.08 ? 762  LEU B CB  1 
ATOM   4607 C  CG  . LEU B 2 262 ? 11.438  114.796 -13.586 1.00 18.88 ? 762  LEU B CG  1 
ATOM   4608 C  CD1 . LEU B 2 262 ? 12.815  115.031 -14.195 1.00 19.55 ? 762  LEU B CD1 1 
ATOM   4609 C  CD2 . LEU B 2 262 ? 10.348  115.178 -14.571 1.00 19.26 ? 762  LEU B CD2 1 
ATOM   4610 N  N   . LYS B 2 263 ? 9.936   111.021 -10.993 1.00 18.86 ? 763  LYS B N   1 
ATOM   4611 C  CA  . LYS B 2 263 ? 10.023  109.631 -10.553 1.00 20.20 ? 763  LYS B CA  1 
ATOM   4612 C  C   . LYS B 2 263 ? 11.366  109.026 -10.956 1.00 20.29 ? 763  LYS B C   1 
ATOM   4613 O  O   . LYS B 2 263 ? 11.434  107.884 -11.418 1.00 19.62 ? 763  LYS B O   1 
ATOM   4614 C  CB  . LYS B 2 263 ? 8.877   108.797 -11.140 1.00 22.05 ? 763  LYS B CB  1 
ATOM   4615 C  CG  . LYS B 2 263 ? 7.489   109.369 -10.857 1.00 24.41 ? 763  LYS B CG  1 
ATOM   4616 C  CD  . LYS B 2 263 ? 6.380   108.336 -11.052 1.00 27.20 ? 763  LYS B CD  1 
ATOM   4617 C  CE  . LYS B 2 263 ? 6.378   107.739 -12.451 1.00 29.39 ? 763  LYS B CE  1 
ATOM   4618 N  NZ  . LYS B 2 263 ? 6.184   108.769 -13.516 1.00 31.91 ? 763  LYS B NZ  1 
ATOM   4619 N  N   . ARG B 2 264 ? 12.434  109.800 -10.781 1.00 19.18 ? 764  ARG B N   1 
ATOM   4620 C  CA  . ARG B 2 264 ? 13.773  109.336 -11.121 1.00 19.79 ? 764  ARG B CA  1 
ATOM   4621 C  C   . ARG B 2 264 ? 14.746  109.515 -9.947  1.00 19.33 ? 764  ARG B C   1 
ATOM   4622 O  O   . ARG B 2 264 ? 15.936  109.716 -10.160 1.00 18.43 ? 764  ARG B O   1 
ATOM   4623 C  CB  . ARG B 2 264 ? 14.306  110.098 -12.347 1.00 20.57 ? 764  ARG B CB  1 
ATOM   4624 C  CG  . ARG B 2 264 ? 13.554  109.848 -13.660 1.00 22.32 ? 764  ARG B CG  1 
ATOM   4625 C  CD  . ARG B 2 264 ? 13.751  108.419 -14.154 1.00 24.32 ? 764  ARG B CD  1 
ATOM   4626 N  NE  . ARG B 2 264 ? 15.164  108.091 -14.344 1.00 26.47 ? 764  ARG B NE  1 
ATOM   4627 C  CZ  . ARG B 2 264 ? 15.880  108.398 -15.424 1.00 27.42 ? 764  ARG B CZ  1 
ATOM   4628 N  NH1 . ARG B 2 264 ? 15.327  109.046 -16.442 1.00 27.73 ? 764  ARG B NH1 1 
ATOM   4629 N  NH2 . ARG B 2 264 ? 17.162  108.061 -15.482 1.00 28.81 ? 764  ARG B NH2 1 
ATOM   4630 N  N   . GLU B 2 265 ? 14.243  109.429 -8.716  1.00 19.75 ? 765  GLU B N   1 
ATOM   4631 C  CA  . GLU B 2 265 ? 15.088  109.597 -7.529  1.00 21.09 ? 765  GLU B CA  1 
ATOM   4632 C  C   . GLU B 2 265 ? 16.290  108.664 -7.532  1.00 21.27 ? 765  GLU B C   1 
ATOM   4633 O  O   . GLU B 2 265 ? 17.375  109.041 -7.081  1.00 20.54 ? 765  GLU B O   1 
ATOM   4634 C  CB  . GLU B 2 265 ? 14.304  109.342 -6.235  1.00 22.06 ? 765  GLU B CB  1 
ATOM   4635 C  CG  . GLU B 2 265 ? 13.031  110.133 -6.081  1.00 24.84 ? 765  GLU B CG  1 
ATOM   4636 C  CD  . GLU B 2 265 ? 11.827  109.400 -6.633  1.00 26.12 ? 765  GLU B CD  1 
ATOM   4637 O  OE1 . GLU B 2 265 ? 11.835  109.057 -7.830  1.00 26.77 ? 765  GLU B OE1 1 
ATOM   4638 O  OE2 . GLU B 2 265 ? 10.871  109.167 -5.863  1.00 28.35 ? 765  GLU B OE2 1 
ATOM   4639 N  N   . ARG B 2 266 ? 16.090  107.446 -8.026  1.00 21.11 ? 766  ARG B N   1 
ATOM   4640 C  CA  . ARG B 2 266 ? 17.159  106.456 -8.071  1.00 22.59 ? 766  ARG B CA  1 
ATOM   4641 C  C   . ARG B 2 266 ? 18.364  106.848 -8.914  1.00 21.37 ? 766  ARG B C   1 
ATOM   4642 O  O   . ARG B 2 266 ? 19.377  106.149 -8.906  1.00 21.53 ? 766  ARG B O   1 
ATOM   4643 C  CB  . ARG B 2 266 ? 16.628  105.109 -8.564  1.00 25.21 ? 766  ARG B CB  1 
ATOM   4644 C  CG  . ARG B 2 266 ? 15.947  104.274 -7.498  1.00 29.33 ? 766  ARG B CG  1 
ATOM   4645 C  CD  . ARG B 2 266 ? 15.989  102.804 -7.901  1.00 33.16 ? 766  ARG B CD  1 
ATOM   4646 N  NE  . ARG B 2 266 ? 15.420  101.921 -6.889  1.00 36.57 ? 766  ARG B NE  1 
ATOM   4647 C  CZ  . ARG B 2 266 ? 15.545  100.597 -6.901  1.00 38.31 ? 766  ARG B CZ  1 
ATOM   4648 N  NH1 . ARG B 2 266 ? 16.225  100.003 -7.876  1.00 39.25 ? 766  ARG B NH1 1 
ATOM   4649 N  NH2 . ARG B 2 266 ? 14.987  99.866  -5.944  1.00 39.12 ? 766  ARG B NH2 1 
ATOM   4650 N  N   . SER B 2 267 ? 18.262  107.946 -9.653  1.00 20.03 ? 767  SER B N   1 
ATOM   4651 C  CA  . SER B 2 267 ? 19.387  108.394 -10.467 1.00 19.83 ? 767  SER B CA  1 
ATOM   4652 C  C   . SER B 2 267 ? 20.497  108.916 -9.563  1.00 18.64 ? 767  SER B C   1 
ATOM   4653 O  O   . SER B 2 267 ? 21.638  109.077 -9.994  1.00 18.93 ? 767  SER B O   1 
ATOM   4654 C  CB  . SER B 2 267 ? 18.955  109.506 -11.426 1.00 19.58 ? 767  SER B CB  1 
ATOM   4655 O  OG  . SER B 2 267 ? 18.028  109.016 -12.373 1.00 21.79 ? 767  SER B OG  1 
ATOM   4656 N  N   . LEU B 2 268 ? 20.154  109.183 -8.309  1.00 17.67 ? 768  LEU B N   1 
ATOM   4657 C  CA  . LEU B 2 268 ? 21.120  109.695 -7.342  1.00 17.35 ? 768  LEU B CA  1 
ATOM   4658 C  C   . LEU B 2 268 ? 21.610  108.599 -6.405  1.00 17.28 ? 768  LEU B C   1 
ATOM   4659 O  O   . LEU B 2 268 ? 21.028  107.513 -6.335  1.00 17.13 ? 768  LEU B O   1 
ATOM   4660 C  CB  . LEU B 2 268 ? 20.483  110.790 -6.475  1.00 17.25 ? 768  LEU B CB  1 
ATOM   4661 C  CG  . LEU B 2 268 ? 19.942  112.080 -7.098  1.00 17.21 ? 768  LEU B CG  1 
ATOM   4662 C  CD1 . LEU B 2 268 ? 19.241  112.902 -6.025  1.00 16.81 ? 768  LEU B CD1 1 
ATOM   4663 C  CD2 . LEU B 2 268 ? 21.078  112.878 -7.703  1.00 17.29 ? 768  LEU B CD2 1 
ATOM   4664 N  N   . ASN B 2 269 ? 22.691  108.896 -5.693  1.00 15.80 ? 769  ASN B N   1 
ATOM   4665 C  CA  . ASN B 2 269 ? 23.217  107.988 -4.689  1.00 15.67 ? 769  ASN B CA  1 
ATOM   4666 C  C   . ASN B 2 269 ? 22.444  108.489 -3.466  1.00 15.92 ? 769  ASN B C   1 
ATOM   4667 O  O   . ASN B 2 269 ? 22.842  109.469 -2.834  1.00 14.97 ? 769  ASN B O   1 
ATOM   4668 C  CB  . ASN B 2 269 ? 24.716  108.217 -4.489  1.00 15.96 ? 769  ASN B CB  1 
ATOM   4669 C  CG  . ASN B 2 269 ? 25.297  107.358 -3.377  1.00 17.37 ? 769  ASN B CG  1 
ATOM   4670 O  OD1 . ASN B 2 269 ? 24.607  107.021 -2.415  1.00 16.48 ? 769  ASN B OD1 1 
ATOM   4671 N  ND2 . ASN B 2 269 ? 26.581  107.017 -3.495  1.00 17.35 ? 769  ASN B ND2 1 
ATOM   4672 N  N   . LEU B 2 270 ? 21.325  107.844 -3.155  1.00 15.61 ? 770  LEU B N   1 
ATOM   4673 C  CA  . LEU B 2 270 ? 20.509  108.275 -2.024  1.00 16.92 ? 770  LEU B CA  1 
ATOM   4674 C  C   . LEU B 2 270 ? 21.200  108.108 -0.676  1.00 16.85 ? 770  LEU B C   1 
ATOM   4675 O  O   . LEU B 2 270 ? 20.878  108.810 0.279   1.00 17.19 ? 770  LEU B O   1 
ATOM   4676 C  CB  . LEU B 2 270 ? 19.166  107.538 -2.026  1.00 16.59 ? 770  LEU B CB  1 
ATOM   4677 C  CG  . LEU B 2 270 ? 18.293  107.782 -3.266  1.00 17.21 ? 770  LEU B CG  1 
ATOM   4678 C  CD1 . LEU B 2 270 ? 17.011  106.967 -3.150  1.00 18.32 ? 770  LEU B CD1 1 
ATOM   4679 C  CD2 . LEU B 2 270 ? 17.978  109.267 -3.407  1.00 16.36 ? 770  LEU B CD2 1 
ATOM   4680 N  N   . LYS B 2 271 ? 22.152  107.185 -0.599  1.00 17.25 ? 771  LYS B N   1 
ATOM   4681 C  CA  . LYS B 2 271 ? 22.882  106.959 0.640   1.00 17.84 ? 771  LYS B CA  1 
ATOM   4682 C  C   . LYS B 2 271 ? 23.780  108.148 0.970   1.00 16.53 ? 771  LYS B C   1 
ATOM   4683 O  O   . LYS B 2 271 ? 23.746  108.667 2.087   1.00 16.17 ? 771  LYS B O   1 
ATOM   4684 C  CB  . LYS B 2 271 ? 23.745  105.700 0.539   1.00 20.27 ? 771  LYS B CB  1 
ATOM   4685 C  CG  . LYS B 2 271 ? 24.562  105.417 1.797   1.00 23.58 ? 771  LYS B CG  1 
ATOM   4686 C  CD  . LYS B 2 271 ? 25.575  104.306 1.564   1.00 26.40 ? 771  LYS B CD  1 
ATOM   4687 C  CE  . LYS B 2 271 ? 26.596  104.719 0.511   1.00 28.57 ? 771  LYS B CE  1 
ATOM   4688 N  NZ  . LYS B 2 271 ? 27.557  103.630 0.156   1.00 29.74 ? 771  LYS B NZ  1 
ATOM   4689 N  N   . SER B 2 272 ? 24.587  108.579 0.006   1.00 15.32 ? 772  SER B N   1 
ATOM   4690 C  CA  . SER B 2 272 ? 25.482  109.702 0.254   1.00 15.09 ? 772  SER B CA  1 
ATOM   4691 C  C   . SER B 2 272 ? 24.699  110.988 0.491   1.00 14.63 ? 772  SER B C   1 
ATOM   4692 O  O   . SER B 2 272 ? 25.136  111.851 1.255   1.00 14.51 ? 772  SER B O   1 
ATOM   4693 C  CB  . SER B 2 272 ? 26.464  109.886 -0.909  1.00 14.54 ? 772  SER B CB  1 
ATOM   4694 O  OG  . SER B 2 272 ? 25.787  110.155 -2.123  1.00 16.76 ? 772  SER B OG  1 
ATOM   4695 N  N   . LEU B 2 273 ? 23.537  111.109 -0.150  1.00 14.01 ? 773  LEU B N   1 
ATOM   4696 C  CA  . LEU B 2 273 ? 22.707  112.303 0.010   1.00 14.16 ? 773  LEU B CA  1 
ATOM   4697 C  C   . LEU B 2 273 ? 22.112  112.324 1.415   1.00 13.72 ? 773  LEU B C   1 
ATOM   4698 O  O   . LEU B 2 273 ? 22.086  113.363 2.073   1.00 13.85 ? 773  LEU B O   1 
ATOM   4699 C  CB  . LEU B 2 273 ? 21.576  112.311 -1.024  1.00 14.63 ? 773  LEU B CB  1 
ATOM   4700 C  CG  . LEU B 2 273 ? 20.925  113.661 -1.362  1.00 16.94 ? 773  LEU B CG  1 
ATOM   4701 C  CD1 . LEU B 2 273 ? 19.886  113.440 -2.457  1.00 18.31 ? 773  LEU B CD1 1 
ATOM   4702 C  CD2 . LEU B 2 273 ? 20.278  114.283 -0.149  1.00 18.04 ? 773  LEU B CD2 1 
ATOM   4703 N  N   . LEU B 2 274 ? 21.627  111.173 1.870   1.00 13.14 ? 774  LEU B N   1 
ATOM   4704 C  CA  . LEU B 2 274 ? 21.038  111.075 3.202   1.00 13.39 ? 774  LEU B CA  1 
ATOM   4705 C  C   . LEU B 2 274 ? 22.066  111.428 4.274   1.00 13.78 ? 774  LEU B C   1 
ATOM   4706 O  O   . LEU B 2 274 ? 21.780  112.204 5.193   1.00 14.09 ? 774  LEU B O   1 
ATOM   4707 C  CB  . LEU B 2 274 ? 20.503  109.659 3.451   1.00 11.80 ? 774  LEU B CB  1 
ATOM   4708 C  CG  . LEU B 2 274 ? 19.938  109.374 4.852   1.00 12.88 ? 774  LEU B CG  1 
ATOM   4709 C  CD1 . LEU B 2 274 ? 18.718  110.260 5.126   1.00 10.99 ? 774  LEU B CD1 1 
ATOM   4710 C  CD2 . LEU B 2 274 ? 19.568  107.899 4.959   1.00 11.49 ? 774  LEU B CD2 1 
ATOM   4711 N  N   . GLN B 2 275 ? 23.264  110.865 4.159   1.00 14.21 ? 775  GLN B N   1 
ATOM   4712 C  CA  . GLN B 2 275 ? 24.297  111.139 5.145   1.00 14.76 ? 775  GLN B CA  1 
ATOM   4713 C  C   . GLN B 2 275 ? 24.688  112.614 5.111   1.00 14.17 ? 775  GLN B C   1 
ATOM   4714 O  O   . GLN B 2 275 ? 24.920  113.220 6.151   1.00 13.66 ? 775  GLN B O   1 
ATOM   4715 C  CB  . GLN B 2 275 ? 25.522  110.247 4.912   1.00 16.19 ? 775  GLN B CB  1 
ATOM   4716 C  CG  . GLN B 2 275 ? 26.560  110.323 6.042   1.00 18.21 ? 775  GLN B CG  1 
ATOM   4717 C  CD  . GLN B 2 275 ? 27.386  109.051 6.184   1.00 20.17 ? 775  GLN B CD  1 
ATOM   4718 O  OE1 . GLN B 2 275 ? 27.676  108.370 5.198   1.00 21.82 ? 775  GLN B OE1 1 
ATOM   4719 N  NE2 . GLN B 2 275 ? 27.780  108.732 7.418   1.00 21.28 ? 775  GLN B NE2 1 
ATOM   4720 N  N   . TRP B 2 276 ? 24.735  113.193 3.914   1.00 13.99 ? 776  TRP B N   1 
ATOM   4721 C  CA  . TRP B 2 276 ? 25.087  114.601 3.780   1.00 13.30 ? 776  TRP B CA  1 
ATOM   4722 C  C   . TRP B 2 276 ? 24.067  115.528 4.440   1.00 13.20 ? 776  TRP B C   1 
ATOM   4723 O  O   . TRP B 2 276 ? 24.437  116.364 5.264   1.00 12.55 ? 776  TRP B O   1 
ATOM   4724 C  CB  . TRP B 2 276 ? 25.224  114.994 2.307   1.00 13.07 ? 776  TRP B CB  1 
ATOM   4725 C  CG  . TRP B 2 276 ? 25.523  116.460 2.117   1.00 12.83 ? 776  TRP B CG  1 
ATOM   4726 C  CD1 . TRP B 2 276 ? 26.741  117.074 2.220   1.00 13.17 ? 776  TRP B CD1 1 
ATOM   4727 C  CD2 . TRP B 2 276 ? 24.575  117.494 1.817   1.00 12.80 ? 776  TRP B CD2 1 
ATOM   4728 N  NE1 . TRP B 2 276 ? 26.610  118.429 2.000   1.00 12.89 ? 776  TRP B NE1 1 
ATOM   4729 C  CE2 . TRP B 2 276 ? 25.292  118.713 1.751   1.00 12.60 ? 776  TRP B CE2 1 
ATOM   4730 C  CE3 . TRP B 2 276 ? 23.189  117.511 1.597   1.00 12.11 ? 776  TRP B CE3 1 
ATOM   4731 C  CZ2 . TRP B 2 276 ? 24.668  119.938 1.473   1.00 12.37 ? 776  TRP B CZ2 1 
ATOM   4732 C  CZ3 . TRP B 2 276 ? 22.568  118.731 1.319   1.00 13.11 ? 776  TRP B CZ3 1 
ATOM   4733 C  CH2 . TRP B 2 276 ? 23.312  119.928 1.261   1.00 11.90 ? 776  TRP B CH2 1 
ATOM   4734 N  N   . VAL B 2 277 ? 22.787  115.391 4.088   1.00 12.90 ? 777  VAL B N   1 
ATOM   4735 C  CA  . VAL B 2 277 ? 21.780  116.279 4.668   1.00 12.58 ? 777  VAL B CA  1 
ATOM   4736 C  C   . VAL B 2 277 ? 21.643  116.150 6.187   1.00 12.64 ? 777  VAL B C   1 
ATOM   4737 O  O   . VAL B 2 277 ? 21.541  117.161 6.891   1.00 11.53 ? 777  VAL B O   1 
ATOM   4738 C  CB  . VAL B 2 277 ? 20.383  116.102 4.001   1.00 13.09 ? 777  VAL B CB  1 
ATOM   4739 C  CG1 . VAL B 2 277 ? 19.827  114.712 4.273   1.00 12.98 ? 777  VAL B CG1 1 
ATOM   4740 C  CG2 . VAL B 2 277 ? 19.429  117.182 4.519   1.00 12.83 ? 777  VAL B CG2 1 
ATOM   4741 N  N   . THR B 2 278 ? 21.650  114.925 6.704   1.00 11.86 ? 778  THR B N   1 
ATOM   4742 C  CA  . THR B 2 278 ? 21.535  114.756 8.149   1.00 12.31 ? 778  THR B CA  1 
ATOM   4743 C  C   . THR B 2 278 ? 22.728  115.416 8.854   1.00 12.39 ? 778  THR B C   1 
ATOM   4744 O  O   . THR B 2 278 ? 22.607  115.893 9.983   1.00 11.61 ? 778  THR B O   1 
ATOM   4745 C  CB  . THR B 2 278 ? 21.446  113.266 8.541   1.00 12.85 ? 778  THR B CB  1 
ATOM   4746 O  OG1 . THR B 2 278 ? 22.571  112.555 8.008   1.00 12.68 ? 778  THR B OG1 1 
ATOM   4747 C  CG2 . THR B 2 278 ? 20.150  112.654 7.997   1.00 11.95 ? 778  THR B CG2 1 
ATOM   4748 N  N   . SER B 2 279 ? 23.873  115.462 8.178   1.00 12.57 ? 779  SER B N   1 
ATOM   4749 C  CA  . SER B 2 279 ? 25.066  116.081 8.746   1.00 12.86 ? 779  SER B CA  1 
ATOM   4750 C  C   . SER B 2 279 ? 24.955  117.605 8.787   1.00 13.15 ? 779  SER B C   1 
ATOM   4751 O  O   . SER B 2 279 ? 25.713  118.269 9.500   1.00 13.46 ? 779  SER B O   1 
ATOM   4752 C  CB  . SER B 2 279 ? 26.311  115.687 7.942   1.00 13.90 ? 779  SER B CB  1 
ATOM   4753 O  OG  . SER B 2 279 ? 26.624  114.315 8.119   1.00 16.36 ? 779  SER B OG  1 
ATOM   4754 N  N   . ARG B 2 280 ? 24.008  118.155 8.031   1.00 11.97 ? 780  ARG B N   1 
ATOM   4755 C  CA  . ARG B 2 280 ? 23.821  119.600 7.982   1.00 12.23 ? 780  ARG B CA  1 
ATOM   4756 C  C   . ARG B 2 280 ? 23.050  120.167 9.177   1.00 13.11 ? 780  ARG B C   1 
ATOM   4757 O  O   . ARG B 2 280 ? 22.943  121.386 9.328   1.00 12.11 ? 780  ARG B O   1 
ATOM   4758 C  CB  . ARG B 2 280 ? 23.136  119.991 6.667   1.00 12.00 ? 780  ARG B CB  1 
ATOM   4759 C  CG  . ARG B 2 280 ? 23.892  119.536 5.406   1.00 11.66 ? 780  ARG B CG  1 
ATOM   4760 C  CD  . ARG B 2 280 ? 25.129  120.392 5.104   1.00 12.67 ? 780  ARG B CD  1 
ATOM   4761 N  NE  . ARG B 2 280 ? 26.200  120.241 6.086   1.00 12.06 ? 780  ARG B NE  1 
ATOM   4762 C  CZ  . ARG B 2 280 ? 26.996  119.177 6.178   1.00 13.31 ? 780  ARG B CZ  1 
ATOM   4763 N  NH1 . ARG B 2 280 ? 26.849  118.156 5.341   1.00 13.19 ? 780  ARG B NH1 1 
ATOM   4764 N  NH2 . ARG B 2 280 ? 27.941  119.132 7.109   1.00 12.51 ? 780  ARG B NH2 1 
ATOM   4765 N  N   . GLN B 2 281 ? 22.504  119.299 10.026  1.00 12.89 ? 781  GLN B N   1 
ATOM   4766 C  CA  . GLN B 2 281 ? 21.803  119.792 11.210  1.00 12.91 ? 781  GLN B CA  1 
ATOM   4767 C  C   . GLN B 2 281 ? 22.890  120.084 12.245  1.00 13.26 ? 781  GLN B C   1 
ATOM   4768 O  O   . GLN B 2 281 ? 23.747  119.244 12.504  1.00 13.40 ? 781  GLN B O   1 
ATOM   4769 C  CB  . GLN B 2 281 ? 20.805  118.758 11.752  1.00 11.77 ? 781  GLN B CB  1 
ATOM   4770 C  CG  . GLN B 2 281 ? 19.998  119.281 12.946  1.00 12.21 ? 781  GLN B CG  1 
ATOM   4771 C  CD  . GLN B 2 281 ? 18.722  118.500 13.217  1.00 13.53 ? 781  GLN B CD  1 
ATOM   4772 O  OE1 . GLN B 2 281 ? 18.636  117.299 12.946  1.00 13.84 ? 781  GLN B OE1 1 
ATOM   4773 N  NE2 . GLN B 2 281 ? 17.726  119.180 13.781  1.00 14.03 ? 781  GLN B NE2 1 
ATOM   4774 N  N   . MET B 2 282 ? 22.852  121.279 12.826  1.00 13.86 ? 782  MET B N   1 
ATOM   4775 C  CA  . MET B 2 282 ? 23.857  121.702 13.798  1.00 14.22 ? 782  MET B CA  1 
ATOM   4776 C  C   . MET B 2 282 ? 23.640  121.094 15.177  1.00 14.55 ? 782  MET B C   1 
ATOM   4777 O  O   . MET B 2 282 ? 22.610  121.323 15.812  1.00 14.20 ? 782  MET B O   1 
ATOM   4778 C  CB  . MET B 2 282 ? 23.854  123.229 13.896  1.00 14.70 ? 782  MET B CB  1 
ATOM   4779 C  CG  . MET B 2 282 ? 23.858  123.930 12.535  1.00 15.47 ? 782  MET B CG  1 
ATOM   4780 S  SD  . MET B 2 282 ? 25.321  123.563 11.529  1.00 16.53 ? 782  MET B SD  1 
ATOM   4781 C  CE  . MET B 2 282 ? 26.505  124.736 12.230  1.00 17.13 ? 782  MET B CE  1 
ATOM   4782 N  N   . ARG B 2 283 ? 24.626  120.335 15.644  1.00 14.63 ? 783  ARG B N   1 
ATOM   4783 C  CA  . ARG B 2 283 ? 24.535  119.678 16.943  1.00 15.54 ? 783  ARG B CA  1 
ATOM   4784 C  C   . ARG B 2 283 ? 24.200  120.629 18.088  1.00 15.45 ? 783  ARG B C   1 
ATOM   4785 O  O   . ARG B 2 283 ? 23.505  120.245 19.029  1.00 15.63 ? 783  ARG B O   1 
ATOM   4786 C  CB  . ARG B 2 283 ? 25.835  118.924 17.254  1.00 16.11 ? 783  ARG B CB  1 
ATOM   4787 C  CG  . ARG B 2 283 ? 27.075  119.807 17.340  1.00 18.59 ? 783  ARG B CG  1 
ATOM   4788 C  CD  . ARG B 2 283 ? 28.331  119.001 17.689  1.00 21.10 ? 783  ARG B CD  1 
ATOM   4789 N  NE  . ARG B 2 283 ? 28.694  118.049 16.642  1.00 23.88 ? 783  ARG B NE  1 
ATOM   4790 C  CZ  . ARG B 2 283 ? 28.432  116.744 16.678  1.00 26.80 ? 783  ARG B CZ  1 
ATOM   4791 N  NH1 . ARG B 2 283 ? 27.799  116.206 17.717  1.00 27.64 ? 783  ARG B NH1 1 
ATOM   4792 N  NH2 . ARG B 2 283 ? 28.810  115.970 15.669  1.00 28.51 ? 783  ARG B NH2 1 
ATOM   4793 N  N   . PHE B 2 284 ? 24.678  121.869 18.022  1.00 15.48 ? 784  PHE B N   1 
ATOM   4794 C  CA  . PHE B 2 284 ? 24.381  122.807 19.102  1.00 15.66 ? 784  PHE B CA  1 
ATOM   4795 C  C   . PHE B 2 284 ? 23.129  123.654 18.887  1.00 15.55 ? 784  PHE B C   1 
ATOM   4796 O  O   . PHE B 2 284 ? 22.233  123.661 19.731  1.00 15.27 ? 784  PHE B O   1 
ATOM   4797 C  CB  . PHE B 2 284 ? 25.555  123.755 19.369  1.00 16.41 ? 784  PHE B CB  1 
ATOM   4798 C  CG  . PHE B 2 284 ? 25.325  124.660 20.553  1.00 16.91 ? 784  PHE B CG  1 
ATOM   4799 C  CD1 . PHE B 2 284 ? 25.403  124.159 21.850  1.00 17.44 ? 784  PHE B CD1 1 
ATOM   4800 C  CD2 . PHE B 2 284 ? 24.948  125.988 20.370  1.00 16.99 ? 784  PHE B CD2 1 
ATOM   4801 C  CE1 . PHE B 2 284 ? 25.102  124.967 22.955  1.00 17.69 ? 784  PHE B CE1 1 
ATOM   4802 C  CE2 . PHE B 2 284 ? 24.647  126.802 21.464  1.00 18.01 ? 784  PHE B CE2 1 
ATOM   4803 C  CZ  . PHE B 2 284 ? 24.723  126.287 22.759  1.00 17.12 ? 784  PHE B CZ  1 
ATOM   4804 N  N   . GLU B 2 285 ? 23.070  124.370 17.765  1.00 14.93 ? 785  GLU B N   1 
ATOM   4805 C  CA  . GLU B 2 285 ? 21.929  125.236 17.477  1.00 14.79 ? 785  GLU B CA  1 
ATOM   4806 C  C   . GLU B 2 285 ? 20.618  124.490 17.239  1.00 14.27 ? 785  GLU B C   1 
ATOM   4807 O  O   . GLU B 2 285 ? 19.551  124.992 17.583  1.00 13.84 ? 785  GLU B O   1 
ATOM   4808 C  CB  . GLU B 2 285 ? 22.220  126.133 16.267  1.00 15.42 ? 785  GLU B CB  1 
ATOM   4809 C  CG  . GLU B 2 285 ? 23.486  126.976 16.385  1.00 15.71 ? 785  GLU B CG  1 
ATOM   4810 C  CD  . GLU B 2 285 ? 24.702  126.289 15.789  1.00 16.74 ? 785  GLU B CD  1 
ATOM   4811 O  OE1 . GLU B 2 285 ? 25.121  125.234 16.312  1.00 16.83 ? 785  GLU B OE1 1 
ATOM   4812 O  OE2 . GLU B 2 285 ? 25.236  126.806 14.787  1.00 16.56 ? 785  GLU B OE2 1 
ATOM   4813 N  N   . GLY B 2 286 ? 20.695  123.303 16.643  1.00 13.72 ? 786  GLY B N   1 
ATOM   4814 C  CA  . GLY B 2 286 ? 19.488  122.541 16.377  1.00 12.25 ? 786  GLY B CA  1 
ATOM   4815 C  C   . GLY B 2 286 ? 18.910  122.800 14.994  1.00 11.95 ? 786  GLY B C   1 
ATOM   4816 O  O   . GLY B 2 286 ? 18.158  121.985 14.470  1.00 11.31 ? 786  GLY B O   1 
ATOM   4817 N  N   . GLY B 2 287 ? 19.248  123.946 14.410  1.00 12.20 ? 787  GLY B N   1 
ATOM   4818 C  CA  . GLY B 2 287 ? 18.766  124.273 13.080  1.00 11.70 ? 787  GLY B CA  1 
ATOM   4819 C  C   . GLY B 2 287 ? 19.706  123.684 12.042  1.00 12.25 ? 787  GLY B C   1 
ATOM   4820 O  O   . GLY B 2 287 ? 20.611  122.920 12.387  1.00 12.02 ? 787  GLY B O   1 
ATOM   4821 N  N   . PHE B 2 288 ? 19.503  124.040 10.775  1.00 12.08 ? 788  PHE B N   1 
ATOM   4822 C  CA  . PHE B 2 288 ? 20.345  123.538 9.692   1.00 12.69 ? 788  PHE B CA  1 
ATOM   4823 C  C   . PHE B 2 288 ? 21.217  124.622 9.043   1.00 12.40 ? 788  PHE B C   1 
ATOM   4824 O  O   . PHE B 2 288 ? 20.842  125.793 8.998   1.00 13.04 ? 788  PHE B O   1 
ATOM   4825 C  CB  . PHE B 2 288 ? 19.483  122.900 8.585   1.00 11.43 ? 788  PHE B CB  1 
ATOM   4826 C  CG  . PHE B 2 288 ? 18.934  121.538 8.930   1.00 12.50 ? 788  PHE B CG  1 
ATOM   4827 C  CD1 . PHE B 2 288 ? 17.859  121.399 9.807   1.00 12.52 ? 788  PHE B CD1 1 
ATOM   4828 C  CD2 . PHE B 2 288 ? 19.483  120.393 8.361   1.00 12.43 ? 788  PHE B CD2 1 
ATOM   4829 C  CE1 . PHE B 2 288 ? 17.337  120.136 10.111  1.00 12.10 ? 788  PHE B CE1 1 
ATOM   4830 C  CE2 . PHE B 2 288 ? 18.970  119.125 8.656   1.00 12.70 ? 788  PHE B CE2 1 
ATOM   4831 C  CZ  . PHE B 2 288 ? 17.893  118.997 9.534   1.00 12.19 ? 788  PHE B CZ  1 
ATOM   4832 N  N   . GLN B 2 289 ? 22.378  124.213 8.536   1.00 12.96 ? 789  GLN B N   1 
ATOM   4833 C  CA  . GLN B 2 289 ? 23.292  125.114 7.827   1.00 12.93 ? 789  GLN B CA  1 
ATOM   4834 C  C   . GLN B 2 289 ? 23.047  124.834 6.334   1.00 12.63 ? 789  GLN B C   1 
ATOM   4835 O  O   . GLN B 2 289 ? 22.457  123.809 5.989   1.00 13.25 ? 789  GLN B O   1 
ATOM   4836 C  CB  . GLN B 2 289 ? 24.756  124.809 8.198   1.00 12.28 ? 789  GLN B CB  1 
ATOM   4837 C  CG  . GLN B 2 289 ? 25.218  123.398 7.815   1.00 12.61 ? 789  GLN B CG  1 
ATOM   4838 C  CD  . GLN B 2 289 ? 26.618  123.068 8.319   1.00 12.13 ? 789  GLN B CD  1 
ATOM   4839 O  OE1 . GLN B 2 289 ? 27.294  123.908 8.915   1.00 14.18 ? 789  GLN B OE1 1 
ATOM   4840 N  NE2 . GLN B 2 289 ? 27.057  121.841 8.081   1.00 11.81 ? 789  GLN B NE2 1 
ATOM   4841 N  N   . GLY B 2 290 ? 23.490  125.731 5.455   1.00 12.92 ? 790  GLY B N   1 
ATOM   4842 C  CA  . GLY B 2 290 ? 23.271  125.539 4.027   1.00 12.09 ? 790  GLY B CA  1 
ATOM   4843 C  C   . GLY B 2 290 ? 24.305  124.663 3.350   1.00 12.31 ? 790  GLY B C   1 
ATOM   4844 O  O   . GLY B 2 290 ? 24.033  124.011 2.338   1.00 11.56 ? 790  GLY B O   1 
ATOM   4845 N  N   . ARG B 2 291 ? 25.509  124.662 3.904   1.00 12.22 ? 791  ARG B N   1 
ATOM   4846 C  CA  . ARG B 2 291 ? 26.597  123.853 3.378   1.00 12.35 ? 791  ARG B CA  1 
ATOM   4847 C  C   . ARG B 2 291 ? 27.588  123.631 4.507   1.00 12.44 ? 791  ARG B C   1 
ATOM   4848 O  O   . ARG B 2 291 ? 27.604  124.383 5.483   1.00 11.90 ? 791  ARG B O   1 
ATOM   4849 C  CB  . ARG B 2 291 ? 27.274  124.545 2.185   1.00 12.30 ? 791  ARG B CB  1 
ATOM   4850 C  CG  . ARG B 2 291 ? 27.299  126.062 2.254   1.00 13.53 ? 791  ARG B CG  1 
ATOM   4851 C  CD  . ARG B 2 291 ? 28.116  126.659 1.112   1.00 12.88 ? 791  ARG B CD  1 
ATOM   4852 N  NE  . ARG B 2 291 ? 27.876  128.096 0.985   1.00 15.24 ? 791  ARG B NE  1 
ATOM   4853 C  CZ  . ARG B 2 291 ? 28.641  128.930 0.286   1.00 15.06 ? 791  ARG B CZ  1 
ATOM   4854 N  NH1 . ARG B 2 291 ? 29.711  128.477 -0.360  1.00 14.51 ? 791  ARG B NH1 1 
ATOM   4855 N  NH2 . ARG B 2 291 ? 28.337  130.222 0.239   1.00 15.28 ? 791  ARG B NH2 1 
ATOM   4856 N  N   . CYS B 2 292 ? 28.398  122.589 4.383   1.00 12.16 ? 792  CYS B N   1 
ATOM   4857 C  CA  . CYS B 2 292 ? 29.367  122.268 5.415   1.00 12.26 ? 792  CYS B CA  1 
ATOM   4858 C  C   . CYS B 2 292 ? 30.242  123.457 5.791   1.00 12.67 ? 792  CYS B C   1 
ATOM   4859 O  O   . CYS B 2 292 ? 30.730  124.197 4.931   1.00 11.43 ? 792  CYS B O   1 
ATOM   4860 C  CB  . CYS B 2 292 ? 30.251  121.100 4.970   1.00 13.16 ? 792  CYS B CB  1 
ATOM   4861 S  SG  . CYS B 2 292 ? 31.419  120.565 6.252   1.00 14.50 ? 792  CYS B SG  1 
ATOM   4862 N  N   . ASN B 2 293 ? 30.421  123.624 7.096   1.00 12.66 ? 793  ASN B N   1 
ATOM   4863 C  CA  . ASN B 2 293 ? 31.225  124.686 7.674   1.00 12.73 ? 793  ASN B CA  1 
ATOM   4864 C  C   . ASN B 2 293 ? 30.748  126.122 7.485   1.00 12.74 ? 793  ASN B C   1 
ATOM   4865 O  O   . ASN B 2 293 ? 31.546  127.055 7.529   1.00 11.72 ? 793  ASN B O   1 
ATOM   4866 C  CB  . ASN B 2 293 ? 32.688  124.547 7.244   1.00 13.60 ? 793  ASN B CB  1 
ATOM   4867 C  CG  . ASN B 2 293 ? 33.500  123.731 8.236   1.00 14.36 ? 793  ASN B CG  1 
ATOM   4868 O  OD1 . ASN B 2 293 ? 33.347  123.891 9.450   1.00 15.98 ? 793  ASN B OD1 1 
ATOM   4869 N  ND2 . ASN B 2 293 ? 34.372  122.860 7.732   1.00 15.55 ? 793  ASN B ND2 1 
ATOM   4870 N  N   . LYS B 2 294 ? 29.452  126.300 7.256   1.00 12.61 ? 794  LYS B N   1 
ATOM   4871 C  CA  . LYS B 2 294 ? 28.902  127.645 7.176   1.00 12.53 ? 794  LYS B CA  1 
ATOM   4872 C  C   . LYS B 2 294 ? 27.887  127.740 8.319   1.00 12.47 ? 794  LYS B C   1 
ATOM   4873 O  O   . LYS B 2 294 ? 27.783  126.807 9.118   1.00 11.58 ? 794  LYS B O   1 
ATOM   4874 C  CB  . LYS B 2 294 ? 28.307  127.949 5.796   1.00 13.30 ? 794  LYS B CB  1 
ATOM   4875 C  CG  . LYS B 2 294 ? 29.416  128.148 4.737   1.00 13.96 ? 794  LYS B CG  1 
ATOM   4876 C  CD  . LYS B 2 294 ? 29.091  129.242 3.713   1.00 13.06 ? 794  LYS B CD  1 
ATOM   4877 C  CE  . LYS B 2 294 ? 29.248  130.650 4.308   1.00 13.23 ? 794  LYS B CE  1 
ATOM   4878 N  NZ  . LYS B 2 294 ? 28.729  131.715 3.388   1.00 12.76 ? 794  LYS B NZ  1 
ATOM   4879 N  N   . LEU B 2 295 ? 27.142  128.836 8.403   1.00 12.35 ? 795  LEU B N   1 
ATOM   4880 C  CA  . LEU B 2 295 ? 26.240  129.046 9.532   1.00 12.33 ? 795  LEU B CA  1 
ATOM   4881 C  C   . LEU B 2 295 ? 24.797  128.548 9.491   1.00 12.41 ? 795  LEU B C   1 
ATOM   4882 O  O   . LEU B 2 295 ? 24.205  128.369 8.429   1.00 12.36 ? 795  LEU B O   1 
ATOM   4883 C  CB  . LEU B 2 295 ? 26.233  130.538 9.877   1.00 12.80 ? 795  LEU B CB  1 
ATOM   4884 C  CG  . LEU B 2 295 ? 27.618  131.196 9.974   1.00 13.28 ? 795  LEU B CG  1 
ATOM   4885 C  CD1 . LEU B 2 295 ? 27.460  132.705 10.173  1.00 13.56 ? 795  LEU B CD1 1 
ATOM   4886 C  CD2 . LEU B 2 295 ? 28.405  130.578 11.122  1.00 12.65 ? 795  LEU B CD2 1 
ATOM   4887 N  N   . VAL B 2 296 ? 24.248  128.336 10.684  1.00 12.39 ? 796  VAL B N   1 
ATOM   4888 C  CA  . VAL B 2 296 ? 22.869  127.895 10.858  1.00 12.40 ? 796  VAL B CA  1 
ATOM   4889 C  C   . VAL B 2 296 ? 21.988  129.012 10.300  1.00 13.07 ? 796  VAL B C   1 
ATOM   4890 O  O   . VAL B 2 296 ? 22.369  130.181 10.341  1.00 13.05 ? 796  VAL B O   1 
ATOM   4891 C  CB  . VAL B 2 296 ? 22.537  127.683 12.370  1.00 12.84 ? 796  VAL B CB  1 
ATOM   4892 C  CG1 . VAL B 2 296 ? 22.460  129.028 13.091  1.00 12.42 ? 796  VAL B CG1 1 
ATOM   4893 C  CG2 . VAL B 2 296 ? 21.232  126.919 12.524  1.00 11.22 ? 796  VAL B CG2 1 
ATOM   4894 N  N   . ASP B 2 297 ? 20.821  128.653 9.774   1.00 12.92 ? 797  ASP B N   1 
ATOM   4895 C  CA  . ASP B 2 297 ? 19.904  129.639 9.208   1.00 13.73 ? 797  ASP B CA  1 
ATOM   4896 C  C   . ASP B 2 297 ? 18.489  129.066 9.186   1.00 13.87 ? 797  ASP B C   1 
ATOM   4897 O  O   . ASP B 2 297 ? 18.254  127.972 8.670   1.00 14.58 ? 797  ASP B O   1 
ATOM   4898 C  CB  . ASP B 2 297 ? 20.343  130.006 7.782   1.00 14.01 ? 797  ASP B CB  1 
ATOM   4899 C  CG  . ASP B 2 297 ? 19.432  131.041 7.126   1.00 14.43 ? 797  ASP B CG  1 
ATOM   4900 O  OD1 . ASP B 2 297 ? 18.295  131.249 7.605   1.00 13.33 ? 797  ASP B OD1 1 
ATOM   4901 O  OD2 . ASP B 2 297 ? 19.854  131.635 6.108   1.00 14.06 ? 797  ASP B OD2 1 
ATOM   4902 N  N   . GLY B 2 298 ? 17.552  129.814 9.754   1.00 13.32 ? 798  GLY B N   1 
ATOM   4903 C  CA  . GLY B 2 298 ? 16.173  129.369 9.808   1.00 13.41 ? 798  GLY B CA  1 
ATOM   4904 C  C   . GLY B 2 298 ? 15.522  128.900 8.514   1.00 13.43 ? 798  GLY B C   1 
ATOM   4905 O  O   . GLY B 2 298 ? 14.715  127.968 8.540   1.00 13.79 ? 798  GLY B O   1 
ATOM   4906 N  N   . CYS B 2 299 ? 15.844  129.513 7.379   1.00 12.42 ? 799  CYS B N   1 
ATOM   4907 C  CA  . CYS B 2 299 ? 15.201  129.085 6.136   1.00 12.40 ? 799  CYS B CA  1 
ATOM   4908 C  C   . CYS B 2 299 ? 15.592  127.662 5.733   1.00 12.15 ? 799  CYS B C   1 
ATOM   4909 O  O   . CYS B 2 299 ? 14.829  126.980 5.049   1.00 12.18 ? 799  CYS B O   1 
ATOM   4910 C  CB  . CYS B 2 299 ? 15.496  130.066 4.990   1.00 11.70 ? 799  CYS B CB  1 
ATOM   4911 S  SG  . CYS B 2 299 ? 17.205  130.108 4.422   1.00 12.21 ? 799  CYS B SG  1 
ATOM   4912 N  N   . TYR B 2 300 ? 16.770  127.203 6.154   1.00 11.78 ? 800  TYR B N   1 
ATOM   4913 C  CA  . TYR B 2 300 ? 17.180  125.846 5.811   1.00 12.18 ? 800  TYR B CA  1 
ATOM   4914 C  C   . TYR B 2 300 ? 16.317  124.837 6.568   1.00 12.05 ? 800  TYR B C   1 
ATOM   4915 O  O   . TYR B 2 300 ? 16.425  123.633 6.356   1.00 12.04 ? 800  TYR B O   1 
ATOM   4916 C  CB  . TYR B 2 300 ? 18.677  125.641 6.093   1.00 11.66 ? 800  TYR B CB  1 
ATOM   4917 C  CG  . TYR B 2 300 ? 19.543  126.508 5.202   1.00 12.06 ? 800  TYR B CG  1 
ATOM   4918 C  CD1 . TYR B 2 300 ? 20.609  127.244 5.723   1.00 11.92 ? 800  TYR B CD1 1 
ATOM   4919 C  CD2 . TYR B 2 300 ? 19.242  126.656 3.848   1.00 11.58 ? 800  TYR B CD2 1 
ATOM   4920 C  CE1 . TYR B 2 300 ? 21.343  128.115 4.914   1.00 12.72 ? 800  TYR B CE1 1 
ATOM   4921 C  CE2 . TYR B 2 300 ? 19.967  127.517 3.036   1.00 11.97 ? 800  TYR B CE2 1 
ATOM   4922 C  CZ  . TYR B 2 300 ? 21.012  128.247 3.572   1.00 12.20 ? 800  TYR B CZ  1 
ATOM   4923 O  OH  . TYR B 2 300 ? 21.699  129.126 2.762   1.00 11.16 ? 800  TYR B OH  1 
ATOM   4924 N  N   . SER B 2 301 ? 15.453  125.340 7.448   1.00 12.29 ? 801  SER B N   1 
ATOM   4925 C  CA  . SER B 2 301 ? 14.535  124.476 8.182   1.00 12.65 ? 801  SER B CA  1 
ATOM   4926 C  C   . SER B 2 301 ? 13.676  123.790 7.122   1.00 12.90 ? 801  SER B C   1 
ATOM   4927 O  O   . SER B 2 301 ? 13.160  122.690 7.331   1.00 13.31 ? 801  SER B O   1 
ATOM   4928 C  CB  . SER B 2 301 ? 13.647  125.299 9.115   1.00 12.37 ? 801  SER B CB  1 
ATOM   4929 O  OG  . SER B 2 301 ? 14.414  125.912 10.134  1.00 13.15 ? 801  SER B OG  1 
ATOM   4930 N  N   . PHE B 2 302 ? 13.515  124.453 5.979   1.00 12.18 ? 802  PHE B N   1 
ATOM   4931 C  CA  . PHE B 2 302 ? 12.752  123.861 4.895   1.00 11.98 ? 802  PHE B CA  1 
ATOM   4932 C  C   . PHE B 2 302 ? 13.650  123.236 3.826   1.00 12.04 ? 802  PHE B C   1 
ATOM   4933 O  O   . PHE B 2 302 ? 13.518  122.055 3.519   1.00 12.40 ? 802  PHE B O   1 
ATOM   4934 C  CB  . PHE B 2 302 ? 11.837  124.873 4.199   1.00 11.90 ? 802  PHE B CB  1 
ATOM   4935 C  CG  . PHE B 2 302 ? 11.132  124.286 3.010   1.00 12.27 ? 802  PHE B CG  1 
ATOM   4936 C  CD1 . PHE B 2 302 ? 10.094  123.374 3.187   1.00 12.72 ? 802  PHE B CD1 1 
ATOM   4937 C  CD2 . PHE B 2 302 ? 11.602  124.519 1.722   1.00 11.89 ? 802  PHE B CD2 1 
ATOM   4938 C  CE1 . PHE B 2 302 ? 9.544   122.693 2.098   1.00 12.66 ? 802  PHE B CE1 1 
ATOM   4939 C  CE2 . PHE B 2 302 ? 11.060  123.843 0.624   1.00 11.99 ? 802  PHE B CE2 1 
ATOM   4940 C  CZ  . PHE B 2 302 ? 10.031  122.927 0.818   1.00 12.56 ? 802  PHE B CZ  1 
ATOM   4941 N  N   . TRP B 2 303 ? 14.559  124.026 3.263   1.00 11.34 ? 803  TRP B N   1 
ATOM   4942 C  CA  . TRP B 2 303 ? 15.433  123.532 2.197   1.00 11.53 ? 803  TRP B CA  1 
ATOM   4943 C  C   . TRP B 2 303 ? 16.173  122.240 2.546   1.00 11.71 ? 803  TRP B C   1 
ATOM   4944 O  O   . TRP B 2 303 ? 16.270  121.338 1.708   1.00 10.97 ? 803  TRP B O   1 
ATOM   4945 C  CB  . TRP B 2 303 ? 16.446  124.608 1.785   1.00 11.79 ? 803  TRP B CB  1 
ATOM   4946 C  CG  . TRP B 2 303 ? 15.835  125.917 1.334   1.00 10.35 ? 803  TRP B CG  1 
ATOM   4947 C  CD1 . TRP B 2 303 ? 16.045  127.151 1.888   1.00 10.42 ? 803  TRP B CD1 1 
ATOM   4948 C  CD2 . TRP B 2 303 ? 14.925  126.119 0.243   1.00 11.15 ? 803  TRP B CD2 1 
ATOM   4949 N  NE1 . TRP B 2 303 ? 15.326  128.107 1.211   1.00 10.30 ? 803  TRP B NE1 1 
ATOM   4950 C  CE2 . TRP B 2 303 ? 14.629  127.504 0.197   1.00 10.54 ? 803  TRP B CE2 1 
ATOM   4951 C  CE3 . TRP B 2 303 ? 14.330  125.268 -0.701  1.00 11.01 ? 803  TRP B CE3 1 
ATOM   4952 C  CZ2 . TRP B 2 303 ? 13.762  128.058 -0.755  1.00 10.92 ? 803  TRP B CZ2 1 
ATOM   4953 C  CZ3 . TRP B 2 303 ? 13.464  125.820 -1.653  1.00 12.17 ? 803  TRP B CZ3 1 
ATOM   4954 C  CH2 . TRP B 2 303 ? 13.191  127.204 -1.669  1.00 11.77 ? 803  TRP B CH2 1 
ATOM   4955 N  N   . GLN B 2 304 ? 16.692  122.145 3.772   1.00 11.19 ? 804  GLN B N   1 
ATOM   4956 C  CA  . GLN B 2 304 ? 17.423  120.946 4.197   1.00 10.97 ? 804  GLN B CA  1 
ATOM   4957 C  C   . GLN B 2 304 ? 16.515  119.893 4.826   1.00 11.34 ? 804  GLN B C   1 
ATOM   4958 O  O   . GLN B 2 304 ? 16.447  118.756 4.349   1.00 11.40 ? 804  GLN B O   1 
ATOM   4959 C  CB  . GLN B 2 304 ? 18.530  121.311 5.204   1.00 10.29 ? 804  GLN B CB  1 
ATOM   4960 C  CG  . GLN B 2 304 ? 19.627  122.230 4.651   1.00 9.81  ? 804  GLN B CG  1 
ATOM   4961 C  CD  . GLN B 2 304 ? 20.635  121.503 3.772   1.00 10.96 ? 804  GLN B CD  1 
ATOM   4962 O  OE1 . GLN B 2 304 ? 20.301  120.527 3.092   1.00 10.40 ? 804  GLN B OE1 1 
ATOM   4963 N  NE2 . GLN B 2 304 ? 21.878  121.990 3.767   1.00 9.16  ? 804  GLN B NE2 1 
ATOM   4964 N  N   . ALA B 2 305 ? 15.822  120.266 5.900   1.00 10.87 ? 805  ALA B N   1 
ATOM   4965 C  CA  . ALA B 2 305 ? 14.944  119.324 6.590   1.00 11.44 ? 805  ALA B CA  1 
ATOM   4966 C  C   . ALA B 2 305 ? 13.876  118.770 5.653   1.00 11.58 ? 805  ALA B C   1 
ATOM   4967 O  O   . ALA B 2 305 ? 13.416  117.638 5.825   1.00 11.71 ? 805  ALA B O   1 
ATOM   4968 C  CB  . ALA B 2 305 ? 14.297  119.991 7.796   1.00 10.68 ? 805  ALA B CB  1 
ATOM   4969 N  N   . GLY B 2 306 ? 13.494  119.568 4.659   1.00 11.56 ? 806  GLY B N   1 
ATOM   4970 C  CA  . GLY B 2 306 ? 12.497  119.132 3.694   1.00 12.04 ? 806  GLY B CA  1 
ATOM   4971 C  C   . GLY B 2 306 ? 12.977  117.959 2.851   1.00 12.34 ? 806  GLY B C   1 
ATOM   4972 O  O   . GLY B 2 306 ? 12.174  117.260 2.236   1.00 12.64 ? 806  GLY B O   1 
ATOM   4973 N  N   . LEU B 2 307 ? 14.288  117.740 2.814   1.00 12.57 ? 807  LEU B N   1 
ATOM   4974 C  CA  . LEU B 2 307 ? 14.853  116.623 2.051   1.00 12.27 ? 807  LEU B CA  1 
ATOM   4975 C  C   . LEU B 2 307 ? 14.564  115.273 2.711   1.00 12.69 ? 807  LEU B C   1 
ATOM   4976 O  O   . LEU B 2 307 ? 14.544  114.238 2.044   1.00 11.97 ? 807  LEU B O   1 
ATOM   4977 C  CB  . LEU B 2 307 ? 16.370  116.792 1.909   1.00 12.66 ? 807  LEU B CB  1 
ATOM   4978 C  CG  . LEU B 2 307 ? 16.859  117.898 0.968   1.00 12.92 ? 807  LEU B CG  1 
ATOM   4979 C  CD1 . LEU B 2 307 ? 18.343  118.194 1.219   1.00 12.33 ? 807  LEU B CD1 1 
ATOM   4980 C  CD2 . LEU B 2 307 ? 16.623  117.461 -0.477  1.00 12.34 ? 807  LEU B CD2 1 
ATOM   4981 N  N   . LEU B 2 308 ? 14.340  115.272 4.021   1.00 12.36 ? 808  LEU B N   1 
ATOM   4982 C  CA  . LEU B 2 308 ? 14.086  114.012 4.705   1.00 12.75 ? 808  LEU B CA  1 
ATOM   4983 C  C   . LEU B 2 308 ? 12.746  113.368 4.359   1.00 12.54 ? 808  LEU B C   1 
ATOM   4984 O  O   . LEU B 2 308 ? 12.667  112.150 4.213   1.00 12.56 ? 808  LEU B O   1 
ATOM   4985 C  CB  . LEU B 2 308 ? 14.292  114.198 6.205   1.00 13.53 ? 808  LEU B CB  1 
ATOM   4986 C  CG  . LEU B 2 308 ? 15.822  114.360 6.256   1.00 15.87 ? 808  LEU B CG  1 
ATOM   4987 C  CD1 . LEU B 2 308 ? 16.235  115.428 7.212   1.00 15.51 ? 808  LEU B CD1 1 
ATOM   4988 C  CD2 . LEU B 2 308 ? 16.469  113.021 6.545   1.00 15.36 ? 808  LEU B CD2 1 
ATOM   4989 N  N   . PRO B 2 309 ? 11.673  114.165 4.234   1.00 12.22 ? 809  PRO B N   1 
ATOM   4990 C  CA  . PRO B 2 309 ? 10.413  113.507 3.878   1.00 12.46 ? 809  PRO B CA  1 
ATOM   4991 C  C   . PRO B 2 309 ? 10.552  112.961 2.448   1.00 12.46 ? 809  PRO B C   1 
ATOM   4992 O  O   . PRO B 2 309 ? 10.011  111.902 2.114   1.00 11.89 ? 809  PRO B O   1 
ATOM   4993 C  CB  . PRO B 2 309 ? 9.393   114.638 3.958   1.00 12.53 ? 809  PRO B CB  1 
ATOM   4994 C  CG  . PRO B 2 309 ? 9.953   115.520 5.025   1.00 13.40 ? 809  PRO B CG  1 
ATOM   4995 C  CD  . PRO B 2 309 ? 11.435  115.537 4.715   1.00 12.21 ? 809  PRO B CD  1 
ATOM   4996 N  N   . LEU B 2 310 ? 11.285  113.689 1.607   1.00 11.93 ? 810  LEU B N   1 
ATOM   4997 C  CA  . LEU B 2 310 ? 11.494  113.261 0.223   1.00 12.71 ? 810  LEU B CA  1 
ATOM   4998 C  C   . LEU B 2 310 ? 12.308  111.969 0.174   1.00 13.02 ? 810  LEU B C   1 
ATOM   4999 O  O   . LEU B 2 310 ? 11.991  111.058 -0.588  1.00 13.18 ? 810  LEU B O   1 
ATOM   5000 C  CB  . LEU B 2 310 ? 12.205  114.352 -0.586  1.00 12.85 ? 810  LEU B CB  1 
ATOM   5001 C  CG  . LEU B 2 310 ? 11.464  115.685 -0.767  1.00 13.83 ? 810  LEU B CG  1 
ATOM   5002 C  CD1 . LEU B 2 310 ? 12.288  116.613 -1.643  1.00 13.43 ? 810  LEU B CD1 1 
ATOM   5003 C  CD2 . LEU B 2 310 ? 10.101  115.442 -1.402  1.00 13.72 ? 810  LEU B CD2 1 
ATOM   5004 N  N   . LEU B 2 311 ? 13.365  111.898 0.979   1.00 12.41 ? 811  LEU B N   1 
ATOM   5005 C  CA  . LEU B 2 311 ? 14.197  110.701 1.036   1.00 13.60 ? 811  LEU B CA  1 
ATOM   5006 C  C   . LEU B 2 311 ? 13.392  109.538 1.612   1.00 14.27 ? 811  LEU B C   1 
ATOM   5007 O  O   . LEU B 2 311 ? 13.531  108.398 1.170   1.00 14.41 ? 811  LEU B O   1 
ATOM   5008 C  CB  . LEU B 2 311 ? 15.439  110.954 1.895   1.00 12.16 ? 811  LEU B CB  1 
ATOM   5009 C  CG  . LEU B 2 311 ? 16.500  111.831 1.220   1.00 13.09 ? 811  LEU B CG  1 
ATOM   5010 C  CD1 . LEU B 2 311 ? 17.542  112.280 2.238   1.00 10.92 ? 811  LEU B CD1 1 
ATOM   5011 C  CD2 . LEU B 2 311 ? 17.148  111.040 0.079   1.00 12.89 ? 811  LEU B CD2 1 
ATOM   5012 N  N   . HIS B 2 312 ? 12.550  109.831 2.597   1.00 14.84 ? 812  HIS B N   1 
ATOM   5013 C  CA  . HIS B 2 312 ? 11.724  108.802 3.216   1.00 16.87 ? 812  HIS B CA  1 
ATOM   5014 C  C   . HIS B 2 312 ? 10.824  108.139 2.172   1.00 17.70 ? 812  HIS B C   1 
ATOM   5015 O  O   . HIS B 2 312 ? 10.730  106.914 2.101   1.00 16.77 ? 812  HIS B O   1 
ATOM   5016 C  CB  . HIS B 2 312 ? 10.842  109.402 4.310   1.00 17.70 ? 812  HIS B CB  1 
ATOM   5017 C  CG  . HIS B 2 312 ? 10.180  108.371 5.168   1.00 19.84 ? 812  HIS B CG  1 
ATOM   5018 N  ND1 . HIS B 2 312 ? 10.772  107.857 6.300   1.00 19.74 ? 812  HIS B ND1 1 
ATOM   5019 C  CD2 . HIS B 2 312 ? 9.008   107.709 5.020   1.00 20.91 ? 812  HIS B CD2 1 
ATOM   5020 C  CE1 . HIS B 2 312 ? 9.995   106.923 6.815   1.00 20.81 ? 812  HIS B CE1 1 
ATOM   5021 N  NE2 . HIS B 2 312 ? 8.918   106.811 6.057   1.00 21.68 ? 812  HIS B NE2 1 
ATOM   5022 N  N   . ARG B 2 313 ? 10.155  108.960 1.372   1.00 18.67 ? 813  ARG B N   1 
ATOM   5023 C  CA  . ARG B 2 313 ? 9.266   108.458 0.334   1.00 20.67 ? 813  ARG B CA  1 
ATOM   5024 C  C   . ARG B 2 313 ? 10.045  107.678 -0.721  1.00 19.93 ? 813  ARG B C   1 
ATOM   5025 O  O   . ARG B 2 313 ? 9.600   106.625 -1.172  1.00 19.80 ? 813  ARG B O   1 
ATOM   5026 C  CB  . ARG B 2 313 ? 8.512   109.620 -0.323  1.00 23.11 ? 813  ARG B CB  1 
ATOM   5027 C  CG  . ARG B 2 313 ? 7.585   109.196 -1.456  1.00 28.30 ? 813  ARG B CG  1 
ATOM   5028 C  CD  . ARG B 2 313 ? 6.743   110.366 -1.950  1.00 32.25 ? 813  ARG B CD  1 
ATOM   5029 N  NE  . ARG B 2 313 ? 5.707   110.731 -0.985  1.00 36.71 ? 813  ARG B NE  1 
ATOM   5030 C  CZ  . ARG B 2 313 ? 4.592   110.032 -0.781  1.00 38.54 ? 813  ARG B CZ  1 
ATOM   5031 N  NH1 . ARG B 2 313 ? 4.358   108.927 -1.479  1.00 39.20 ? 813  ARG B NH1 1 
ATOM   5032 N  NH2 . ARG B 2 313 ? 3.711   110.436 0.127   1.00 39.19 ? 813  ARG B NH2 1 
ATOM   5033 N  N   . ALA B 2 314 ? 11.208  108.194 -1.107  1.00 19.58 ? 814  ALA B N   1 
ATOM   5034 C  CA  . ALA B 2 314 ? 12.039  107.537 -2.109  1.00 19.72 ? 814  ALA B CA  1 
ATOM   5035 C  C   . ALA B 2 314 ? 12.496  106.155 -1.642  1.00 20.21 ? 814  ALA B C   1 
ATOM   5036 O  O   . ALA B 2 314 ? 12.451  105.181 -2.404  1.00 19.53 ? 814  ALA B O   1 
ATOM   5037 C  CB  . ALA B 2 314 ? 13.249  108.403 -2.431  1.00 19.68 ? 814  ALA B CB  1 
ATOM   5038 N  N   . LEU B 2 315 ? 12.945  106.070 -0.393  1.00 19.83 ? 815  LEU B N   1 
ATOM   5039 C  CA  . LEU B 2 315 ? 13.401  104.798 0.151   1.00 20.67 ? 815  LEU B CA  1 
ATOM   5040 C  C   . LEU B 2 315 ? 12.217  103.857 0.362   1.00 21.49 ? 815  LEU B C   1 
ATOM   5041 O  O   . LEU B 2 315 ? 12.320  102.656 0.122   1.00 21.59 ? 815  LEU B O   1 
ATOM   5042 C  CB  . LEU B 2 315 ? 14.153  105.021 1.468   1.00 19.67 ? 815  LEU B CB  1 
ATOM   5043 C  CG  . LEU B 2 315 ? 15.438  105.848 1.339   1.00 20.15 ? 815  LEU B CG  1 
ATOM   5044 C  CD1 . LEU B 2 315 ? 16.071  106.033 2.710   1.00 19.71 ? 815  LEU B CD1 1 
ATOM   5045 C  CD2 . LEU B 2 315 ? 16.412  105.155 0.391   1.00 19.28 ? 815  LEU B CD2 1 
ATOM   5046 N  N   . HIS B 2 316 ? 11.090  104.411 0.797   1.00 22.94 ? 816  HIS B N   1 
ATOM   5047 C  CA  . HIS B 2 316 ? 9.886   103.621 1.030   1.00 25.06 ? 816  HIS B CA  1 
ATOM   5048 C  C   . HIS B 2 316 ? 9.416   102.971 -0.272  1.00 26.02 ? 816  HIS B C   1 
ATOM   5049 O  O   . HIS B 2 316 ? 8.954   101.827 -0.275  1.00 25.96 ? 816  HIS B O   1 
ATOM   5050 C  CB  . HIS B 2 316 ? 8.771   104.503 1.594   1.00 26.30 ? 816  HIS B CB  1 
ATOM   5051 C  CG  . HIS B 2 316 ? 7.504   103.762 1.885   1.00 28.53 ? 816  HIS B CG  1 
ATOM   5052 N  ND1 . HIS B 2 316 ? 7.413   102.797 2.865   1.00 29.22 ? 816  HIS B ND1 1 
ATOM   5053 C  CD2 . HIS B 2 316 ? 6.277   103.835 1.314   1.00 29.11 ? 816  HIS B CD2 1 
ATOM   5054 C  CE1 . HIS B 2 316 ? 6.186   102.308 2.886   1.00 29.31 ? 816  HIS B CE1 1 
ATOM   5055 N  NE2 . HIS B 2 316 ? 5.476   102.921 1.956   1.00 29.66 ? 816  HIS B NE2 1 
ATOM   5056 N  N   . ALA B 2 317 ? 9.537   103.704 -1.376  1.00 26.36 ? 817  ALA B N   1 
ATOM   5057 C  CA  . ALA B 2 317 ? 9.130   103.190 -2.679  1.00 27.13 ? 817  ALA B CA  1 
ATOM   5058 C  C   . ALA B 2 317 ? 9.997   101.993 -3.057  1.00 27.80 ? 817  ALA B C   1 
ATOM   5059 O  O   . ALA B 2 317 ? 9.564   101.115 -3.802  1.00 28.49 ? 817  ALA B O   1 
ATOM   5060 C  CB  . ALA B 2 317 ? 9.252   104.281 -3.738  1.00 26.57 ? 817  ALA B CB  1 
ATOM   5061 N  N   . GLN B 2 318 ? 11.220  101.970 -2.536  1.00 28.62 ? 818  GLN B N   1 
ATOM   5062 C  CA  . GLN B 2 318 ? 12.169  100.891 -2.798  1.00 29.27 ? 818  GLN B CA  1 
ATOM   5063 C  C   . GLN B 2 318 ? 11.988  99.699  -1.864  1.00 28.80 ? 818  GLN B C   1 
ATOM   5064 O  O   . GLN B 2 318 ? 12.656  98.681  -2.024  1.00 29.43 ? 818  GLN B O   1 
ATOM   5065 C  CB  . GLN B 2 318 ? 13.600  101.403 -2.660  1.00 30.16 ? 818  GLN B CB  1 
ATOM   5066 C  CG  . GLN B 2 318 ? 14.119  102.152 -3.858  1.00 32.27 ? 818  GLN B CG  1 
ATOM   5067 C  CD  . GLN B 2 318 ? 15.423  102.861 -3.565  1.00 32.67 ? 818  GLN B CD  1 
ATOM   5068 O  OE1 . GLN B 2 318 ? 16.278  102.340 -2.851  1.00 34.10 ? 818  GLN B OE1 1 
ATOM   5069 N  NE2 . GLN B 2 318 ? 15.587  104.053 -4.126  1.00 33.71 ? 818  GLN B NE2 1 
ATOM   5070 N  N   . GLY B 2 319 ? 11.104  99.833  -0.881  1.00 28.40 ? 819  GLY B N   1 
ATOM   5071 C  CA  . GLY B 2 319 ? 10.864  98.746  0.052   1.00 27.83 ? 819  GLY B CA  1 
ATOM   5072 C  C   . GLY B 2 319 ? 11.855  98.639  1.203   1.00 27.53 ? 819  GLY B C   1 
ATOM   5073 O  O   . GLY B 2 319 ? 12.051  97.553  1.757   1.00 28.01 ? 819  GLY B O   1 
ATOM   5074 N  N   . ASP B 2 320 ? 12.477  99.757  1.569   1.00 25.81 ? 820  ASP B N   1 
ATOM   5075 C  CA  . ASP B 2 320 ? 13.447  99.787  2.663   1.00 23.78 ? 820  ASP B CA  1 
ATOM   5076 C  C   . ASP B 2 320 ? 12.790  99.309  3.964   1.00 23.18 ? 820  ASP B C   1 
ATOM   5077 O  O   . ASP B 2 320 ? 11.974  100.016 4.553   1.00 22.90 ? 820  ASP B O   1 
ATOM   5078 C  CB  . ASP B 2 320 ? 13.966  101.212 2.850   1.00 23.09 ? 820  ASP B CB  1 
ATOM   5079 C  CG  . ASP B 2 320 ? 15.194  101.276 3.733   1.00 21.82 ? 820  ASP B CG  1 
ATOM   5080 O  OD1 . ASP B 2 320 ? 15.251  100.533 4.734   1.00 20.48 ? 820  ASP B OD1 1 
ATOM   5081 O  OD2 . ASP B 2 320 ? 16.097  102.082 3.427   1.00 20.82 ? 820  ASP B OD2 1 
ATOM   5082 N  N   . PRO B 2 321 ? 13.160  98.110  4.443   1.00 22.58 ? 821  PRO B N   1 
ATOM   5083 C  CA  . PRO B 2 321 ? 12.579  97.571  5.677   1.00 21.96 ? 821  PRO B CA  1 
ATOM   5084 C  C   . PRO B 2 321 ? 13.034  98.240  6.979   1.00 20.59 ? 821  PRO B C   1 
ATOM   5085 O  O   . PRO B 2 321 ? 12.459  97.995  8.036   1.00 20.77 ? 821  PRO B O   1 
ATOM   5086 C  CB  . PRO B 2 321 ? 12.978  96.101  5.618   1.00 22.11 ? 821  PRO B CB  1 
ATOM   5087 C  CG  . PRO B 2 321 ? 14.339  96.171  5.018   1.00 22.69 ? 821  PRO B CG  1 
ATOM   5088 C  CD  . PRO B 2 321 ? 14.166  97.184  3.890   1.00 23.15 ? 821  PRO B CD  1 
ATOM   5089 N  N   . ALA B 2 322 ? 14.054  99.089  6.907   1.00 19.46 ? 822  ALA B N   1 
ATOM   5090 C  CA  . ALA B 2 322 ? 14.565  99.744  8.110   1.00 18.75 ? 822  ALA B CA  1 
ATOM   5091 C  C   . ALA B 2 322 ? 14.022  101.148 8.382   1.00 18.39 ? 822  ALA B C   1 
ATOM   5092 O  O   . ALA B 2 322 ? 14.311  101.732 9.427   1.00 17.64 ? 822  ALA B O   1 
ATOM   5093 C  CB  . ALA B 2 322 ? 16.091  99.780  8.063   1.00 18.36 ? 822  ALA B CB  1 
ATOM   5094 N  N   . LEU B 2 323 ? 13.239  101.690 7.454   1.00 17.86 ? 823  LEU B N   1 
ATOM   5095 C  CA  . LEU B 2 323 ? 12.677  103.032 7.622   1.00 17.97 ? 823  LEU B CA  1 
ATOM   5096 C  C   . LEU B 2 323 ? 11.774  103.143 8.846   1.00 18.02 ? 823  LEU B C   1 
ATOM   5097 O  O   . LEU B 2 323 ? 11.056  102.205 9.187   1.00 18.46 ? 823  LEU B O   1 
ATOM   5098 C  CB  . LEU B 2 323 ? 11.866  103.444 6.384   1.00 18.13 ? 823  LEU B CB  1 
ATOM   5099 C  CG  . LEU B 2 323 ? 12.590  103.900 5.117   1.00 18.93 ? 823  LEU B CG  1 
ATOM   5100 C  CD1 . LEU B 2 323 ? 11.558  104.246 4.036   1.00 18.53 ? 823  LEU B CD1 1 
ATOM   5101 C  CD2 . LEU B 2 323 ? 13.454  105.117 5.431   1.00 17.96 ? 823  LEU B CD2 1 
ATOM   5102 N  N   . SER B 2 324 ? 11.810  104.298 9.500   1.00 17.79 ? 824  SER B N   1 
ATOM   5103 C  CA  . SER B 2 324 ? 10.970  104.540 10.665  1.00 18.37 ? 824  SER B CA  1 
ATOM   5104 C  C   . SER B 2 324 ? 9.521   104.716 10.221  1.00 19.43 ? 824  SER B C   1 
ATOM   5105 O  O   . SER B 2 324 ? 9.257   105.139 9.094   1.00 19.23 ? 824  SER B O   1 
ATOM   5106 C  CB  . SER B 2 324 ? 11.420  105.808 11.390  1.00 17.63 ? 824  SER B CB  1 
ATOM   5107 O  OG  . SER B 2 324 ? 10.448  106.218 12.340  1.00 16.06 ? 824  SER B OG  1 
ATOM   5108 N  N   . MET B 2 325 ? 8.586   104.392 11.105  1.00 20.17 ? 825  MET B N   1 
ATOM   5109 C  CA  . MET B 2 325 ? 7.172   104.554 10.792  1.00 21.79 ? 825  MET B CA  1 
ATOM   5110 C  C   . MET B 2 325 ? 6.580   105.650 11.669  1.00 19.99 ? 825  MET B C   1 
ATOM   5111 O  O   . MET B 2 325 ? 5.362   105.781 11.771  1.00 19.31 ? 825  MET B O   1 
ATOM   5112 C  CB  . MET B 2 325 ? 6.410   103.249 11.032  1.00 25.48 ? 825  MET B CB  1 
ATOM   5113 C  CG  . MET B 2 325 ? 6.784   102.122 10.089  1.00 31.21 ? 825  MET B CG  1 
ATOM   5114 S  SD  . MET B 2 325 ? 5.821   100.634 10.440  1.00 38.82 ? 825  MET B SD  1 
ATOM   5115 C  CE  . MET B 2 325 ? 6.733   99.976  11.868  1.00 37.03 ? 825  MET B CE  1 
ATOM   5116 N  N   . SER B 2 326 ? 7.443   106.443 12.294  1.00 18.13 ? 826  SER B N   1 
ATOM   5117 C  CA  . SER B 2 326 ? 6.970   107.503 13.172  1.00 17.46 ? 826  SER B CA  1 
ATOM   5118 C  C   . SER B 2 326 ? 7.771   108.810 13.129  1.00 16.47 ? 826  SER B C   1 
ATOM   5119 O  O   . SER B 2 326 ? 7.266   109.849 13.554  1.00 16.50 ? 826  SER B O   1 
ATOM   5120 C  CB  . SER B 2 326 ? 6.937   106.986 14.610  1.00 17.39 ? 826  SER B CB  1 
ATOM   5121 O  OG  . SER B 2 326 ? 8.240   106.608 15.018  1.00 18.19 ? 826  SER B OG  1 
ATOM   5122 N  N   . HIS B 2 327 ? 9.007   108.767 12.632  1.00 15.62 ? 827  HIS B N   1 
ATOM   5123 C  CA  . HIS B 2 327 ? 9.840   109.971 12.577  1.00 15.01 ? 827  HIS B CA  1 
ATOM   5124 C  C   . HIS B 2 327 ? 10.657  110.157 11.299  1.00 14.19 ? 827  HIS B C   1 
ATOM   5125 O  O   . HIS B 2 327 ? 11.003  109.189 10.622  1.00 13.15 ? 827  HIS B O   1 
ATOM   5126 C  CB  . HIS B 2 327 ? 10.832  109.998 13.746  1.00 16.56 ? 827  HIS B CB  1 
ATOM   5127 C  CG  . HIS B 2 327 ? 10.194  110.078 15.098  1.00 18.91 ? 827  HIS B CG  1 
ATOM   5128 N  ND1 . HIS B 2 327 ? 9.778   108.962 15.793  1.00 20.06 ? 827  HIS B ND1 1 
ATOM   5129 C  CD2 . HIS B 2 327 ? 9.919   111.140 15.892  1.00 19.42 ? 827  HIS B CD2 1 
ATOM   5130 C  CE1 . HIS B 2 327 ? 9.277   109.333 16.958  1.00 19.93 ? 827  HIS B CE1 1 
ATOM   5131 N  NE2 . HIS B 2 327 ? 9.350   110.649 17.043  1.00 21.05 ? 827  HIS B NE2 1 
ATOM   5132 N  N   . TRP B 2 328 ? 10.966  111.417 10.991  1.00 13.44 ? 828  TRP B N   1 
ATOM   5133 C  CA  . TRP B 2 328 ? 11.801  111.765 9.844   1.00 13.27 ? 828  TRP B CA  1 
ATOM   5134 C  C   . TRP B 2 328 ? 13.210  111.526 10.372  1.00 13.68 ? 828  TRP B C   1 
ATOM   5135 O  O   . TRP B 2 328 ? 13.426  111.541 11.588  1.00 13.17 ? 828  TRP B O   1 
ATOM   5136 C  CB  . TRP B 2 328 ? 11.663  113.247 9.479   1.00 12.69 ? 828  TRP B CB  1 
ATOM   5137 C  CG  . TRP B 2 328 ? 10.289  113.676 9.053   1.00 12.43 ? 828  TRP B CG  1 
ATOM   5138 C  CD1 . TRP B 2 328 ? 9.579   114.743 9.535   1.00 12.51 ? 828  TRP B CD1 1 
ATOM   5139 C  CD2 . TRP B 2 328 ? 9.474   113.077 8.036   1.00 12.24 ? 828  TRP B CD2 1 
ATOM   5140 N  NE1 . TRP B 2 328 ? 8.373   114.846 8.878   1.00 11.99 ? 828  TRP B NE1 1 
ATOM   5141 C  CE2 . TRP B 2 328 ? 8.281   113.836 7.955   1.00 12.36 ? 828  TRP B CE2 1 
ATOM   5142 C  CE3 . TRP B 2 328 ? 9.632   111.972 7.183   1.00 13.15 ? 828  TRP B CE3 1 
ATOM   5143 C  CZ2 . TRP B 2 328 ? 7.250   113.525 7.057   1.00 12.91 ? 828  TRP B CZ2 1 
ATOM   5144 C  CZ3 . TRP B 2 328 ? 8.604   111.661 6.288   1.00 13.50 ? 828  TRP B CZ3 1 
ATOM   5145 C  CH2 . TRP B 2 328 ? 7.428   112.437 6.235   1.00 12.92 ? 828  TRP B CH2 1 
ATOM   5146 N  N   . MET B 2 329 ? 14.172  111.334 9.479   1.00 13.76 ? 829  MET B N   1 
ATOM   5147 C  CA  . MET B 2 329 ? 15.530  111.079 9.922   1.00 14.68 ? 829  MET B CA  1 
ATOM   5148 C  C   . MET B 2 329 ? 16.370  112.308 10.266  1.00 14.26 ? 829  MET B C   1 
ATOM   5149 O  O   . MET B 2 329 ? 17.467  112.498 9.738   1.00 14.58 ? 829  MET B O   1 
ATOM   5150 C  CB  . MET B 2 329 ? 16.260  110.192 8.905   1.00 15.17 ? 829  MET B CB  1 
ATOM   5151 C  CG  . MET B 2 329 ? 15.729  108.754 8.900   1.00 16.99 ? 829  MET B CG  1 
ATOM   5152 S  SD  . MET B 2 329 ? 16.620  107.597 7.825   1.00 17.82 ? 829  MET B SD  1 
ATOM   5153 C  CE  . MET B 2 329 ? 15.898  108.018 6.234   1.00 16.07 ? 829  MET B CE  1 
ATOM   5154 N  N   . PHE B 2 330 ? 15.831  113.146 11.146  1.00 13.46 ? 830  PHE B N   1 
ATOM   5155 C  CA  . PHE B 2 330 ? 16.546  114.317 11.644  1.00 12.99 ? 830  PHE B CA  1 
ATOM   5156 C  C   . PHE B 2 330 ? 15.937  114.599 13.011  1.00 12.87 ? 830  PHE B C   1 
ATOM   5157 O  O   . PHE B 2 330 ? 14.901  114.020 13.359  1.00 13.02 ? 830  PHE B O   1 
ATOM   5158 C  CB  . PHE B 2 330 ? 16.449  115.525 10.671  1.00 12.50 ? 830  PHE B CB  1 
ATOM   5159 C  CG  . PHE B 2 330 ? 15.104  116.213 10.634  1.00 13.78 ? 830  PHE B CG  1 
ATOM   5160 C  CD1 . PHE B 2 330 ? 14.793  117.220 11.547  1.00 13.50 ? 830  PHE B CD1 1 
ATOM   5161 C  CD2 . PHE B 2 330 ? 14.164  115.889 9.650   1.00 13.34 ? 830  PHE B CD2 1 
ATOM   5162 C  CE1 . PHE B 2 330 ? 13.569  117.899 11.483  1.00 13.57 ? 830  PHE B CE1 1 
ATOM   5163 C  CE2 . PHE B 2 330 ? 12.935  116.562 9.577   1.00 12.50 ? 830  PHE B CE2 1 
ATOM   5164 C  CZ  . PHE B 2 330 ? 12.639  117.568 10.495  1.00 12.70 ? 830  PHE B CZ  1 
ATOM   5165 N  N   . HIS B 2 331 ? 16.578  115.447 13.805  1.00 11.98 ? 831  HIS B N   1 
ATOM   5166 C  CA  . HIS B 2 331 ? 16.063  115.735 15.139  1.00 12.19 ? 831  HIS B CA  1 
ATOM   5167 C  C   . HIS B 2 331 ? 14.921  116.739 15.055  1.00 12.64 ? 831  HIS B C   1 
ATOM   5168 O  O   . HIS B 2 331 ? 15.134  117.954 15.047  1.00 12.31 ? 831  HIS B O   1 
ATOM   5169 C  CB  . HIS B 2 331 ? 17.186  116.266 16.037  1.00 11.33 ? 831  HIS B CB  1 
ATOM   5170 C  CG  . HIS B 2 331 ? 16.972  115.987 17.493  1.00 12.18 ? 831  HIS B CG  1 
ATOM   5171 N  ND1 . HIS B 2 331 ? 15.940  116.545 18.215  1.00 12.17 ? 831  HIS B ND1 1 
ATOM   5172 C  CD2 . HIS B 2 331 ? 17.654  115.199 18.359  1.00 12.83 ? 831  HIS B CD2 1 
ATOM   5173 C  CE1 . HIS B 2 331 ? 15.995  116.115 19.463  1.00 12.82 ? 831  HIS B CE1 1 
ATOM   5174 N  NE2 . HIS B 2 331 ? 17.025  115.297 19.578  1.00 11.67 ? 831  HIS B NE2 1 
ATOM   5175 N  N   . GLN B 2 332 ? 13.704  116.215 14.990  1.00 13.31 ? 832  GLN B N   1 
ATOM   5176 C  CA  . GLN B 2 332 ? 12.513  117.044 14.881  1.00 13.66 ? 832  GLN B CA  1 
ATOM   5177 C  C   . GLN B 2 332 ? 12.328  118.027 16.036  1.00 13.68 ? 832  GLN B C   1 
ATOM   5178 O  O   . GLN B 2 332 ? 11.943  119.178 15.818  1.00 12.88 ? 832  GLN B O   1 
ATOM   5179 C  CB  . GLN B 2 332 ? 11.277  116.150 14.739  1.00 13.51 ? 832  GLN B CB  1 
ATOM   5180 C  CG  . GLN B 2 332 ? 11.085  115.594 13.329  1.00 11.73 ? 832  GLN B CG  1 
ATOM   5181 C  CD  . GLN B 2 332 ? 10.068  114.469 13.284  1.00 12.97 ? 832  GLN B CD  1 
ATOM   5182 O  OE1 . GLN B 2 332 ? 10.432  113.293 13.237  1.00 12.07 ? 832  GLN B OE1 1 
ATOM   5183 N  NE2 . GLN B 2 332 ? 8.785   114.825 13.312  1.00 11.08 ? 832  GLN B NE2 1 
ATOM   5184 N  N   . GLN B 2 333 ? 12.608  117.585 17.258  1.00 13.57 ? 833  GLN B N   1 
ATOM   5185 C  CA  . GLN B 2 333 ? 12.452  118.461 18.414  1.00 14.32 ? 833  GLN B CA  1 
ATOM   5186 C  C   . GLN B 2 333 ? 13.471  119.596 18.409  1.00 13.95 ? 833  GLN B C   1 
ATOM   5187 O  O   . GLN B 2 333 ? 13.126  120.756 18.643  1.00 13.83 ? 833  GLN B O   1 
ATOM   5188 C  CB  . GLN B 2 333 ? 12.576  117.670 19.725  1.00 15.71 ? 833  GLN B CB  1 
ATOM   5189 C  CG  . GLN B 2 333 ? 12.137  118.485 20.944  1.00 20.53 ? 833  GLN B CG  1 
ATOM   5190 C  CD  . GLN B 2 333 ? 12.241  117.721 22.253  1.00 23.11 ? 833  GLN B CD  1 
ATOM   5191 O  OE1 . GLN B 2 333 ? 11.984  116.515 22.304  1.00 25.77 ? 833  GLN B OE1 1 
ATOM   5192 N  NE2 . GLN B 2 333 ? 12.598  118.424 23.324  1.00 21.24 ? 833  GLN B NE2 1 
ATOM   5193 N  N   . ALA B 2 334 ? 14.728  119.263 18.149  1.00 13.10 ? 834  ALA B N   1 
ATOM   5194 C  CA  . ALA B 2 334 ? 15.775  120.275 18.127  1.00 13.54 ? 834  ALA B CA  1 
ATOM   5195 C  C   . ALA B 2 334 ? 15.484  121.360 17.086  1.00 13.26 ? 834  ALA B C   1 
ATOM   5196 O  O   . ALA B 2 334 ? 15.724  122.542 17.333  1.00 12.85 ? 834  ALA B O   1 
ATOM   5197 C  CB  . ALA B 2 334 ? 17.136  119.620 17.852  1.00 13.13 ? 834  ALA B CB  1 
ATOM   5198 N  N   . LEU B 2 335 ? 14.967  120.968 15.923  1.00 12.39 ? 835  LEU B N   1 
ATOM   5199 C  CA  . LEU B 2 335 ? 14.665  121.958 14.897  1.00 12.37 ? 835  LEU B CA  1 
ATOM   5200 C  C   . LEU B 2 335 ? 13.544  122.877 15.376  1.00 12.44 ? 835  LEU B C   1 
ATOM   5201 O  O   . LEU B 2 335 ? 13.603  124.092 15.188  1.00 12.34 ? 835  LEU B O   1 
ATOM   5202 C  CB  . LEU B 2 335 ? 14.256  121.284 13.581  1.00 12.54 ? 835  LEU B CB  1 
ATOM   5203 C  CG  . LEU B 2 335 ? 13.970  122.279 12.448  1.00 12.44 ? 835  LEU B CG  1 
ATOM   5204 C  CD1 . LEU B 2 335 ? 15.205  123.153 12.206  1.00 12.17 ? 835  LEU B CD1 1 
ATOM   5205 C  CD2 . LEU B 2 335 ? 13.580  121.528 11.181  1.00 12.46 ? 835  LEU B CD2 1 
ATOM   5206 N  N   . GLN B 2 336 ? 12.522  122.301 16.000  1.00 12.20 ? 836  GLN B N   1 
ATOM   5207 C  CA  . GLN B 2 336 ? 11.417  123.109 16.502  1.00 12.65 ? 836  GLN B CA  1 
ATOM   5208 C  C   . GLN B 2 336 ? 11.922  124.063 17.588  1.00 12.50 ? 836  GLN B C   1 
ATOM   5209 O  O   . GLN B 2 336 ? 11.476  125.206 17.682  1.00 12.03 ? 836  GLN B O   1 
ATOM   5210 C  CB  . GLN B 2 336 ? 10.298  122.207 17.041  1.00 12.95 ? 836  GLN B CB  1 
ATOM   5211 C  CG  . GLN B 2 336 ? 9.618   121.371 15.952  1.00 13.36 ? 836  GLN B CG  1 
ATOM   5212 C  CD  . GLN B 2 336 ? 8.464   120.535 16.481  1.00 13.94 ? 836  GLN B CD  1 
ATOM   5213 O  OE1 . GLN B 2 336 ? 7.539   121.055 17.106  1.00 14.57 ? 836  GLN B OE1 1 
ATOM   5214 N  NE2 . GLN B 2 336 ? 8.511   119.233 16.225  1.00 15.20 ? 836  GLN B NE2 1 
ATOM   5215 N  N   . GLU B 2 337 ? 12.874  123.595 18.391  1.00 12.26 ? 837  GLU B N   1 
ATOM   5216 C  CA  . GLU B 2 337 ? 13.436  124.421 19.451  1.00 12.72 ? 837  GLU B CA  1 
ATOM   5217 C  C   . GLU B 2 337 ? 14.204  125.596 18.858  1.00 12.86 ? 837  GLU B C   1 
ATOM   5218 O  O   . GLU B 2 337 ? 14.089  126.721 19.344  1.00 12.01 ? 837  GLU B O   1 
ATOM   5219 C  CB  . GLU B 2 337 ? 14.337  123.574 20.363  1.00 12.81 ? 837  GLU B CB  1 
ATOM   5220 C  CG  . GLU B 2 337 ? 13.541  122.742 21.376  1.00 13.65 ? 837  GLU B CG  1 
ATOM   5221 C  CD  . GLU B 2 337 ? 14.397  121.775 22.190  1.00 14.74 ? 837  GLU B CD  1 
ATOM   5222 O  OE1 . GLU B 2 337 ? 15.591  122.062 22.409  1.00 13.71 ? 837  GLU B OE1 1 
ATOM   5223 O  OE2 . GLU B 2 337 ? 13.862  120.732 22.628  1.00 14.25 ? 837  GLU B OE2 1 
ATOM   5224 N  N   . TYR B 2 338 ? 14.974  125.345 17.801  1.00 12.67 ? 838  TYR B N   1 
ATOM   5225 C  CA  . TYR B 2 338 ? 15.731  126.424 17.168  1.00 13.22 ? 838  TYR B CA  1 
ATOM   5226 C  C   . TYR B 2 338 ? 14.791  127.473 16.583  1.00 13.21 ? 838  TYR B C   1 
ATOM   5227 O  O   . TYR B 2 338 ? 14.965  128.673 16.808  1.00 13.55 ? 838  TYR B O   1 
ATOM   5228 C  CB  . TYR B 2 338 ? 16.635  125.901 16.042  1.00 12.65 ? 838  TYR B CB  1 
ATOM   5229 C  CG  . TYR B 2 338 ? 17.371  127.022 15.336  1.00 12.18 ? 838  TYR B CG  1 
ATOM   5230 C  CD1 . TYR B 2 338 ? 18.326  127.786 16.014  1.00 11.88 ? 838  TYR B CD1 1 
ATOM   5231 C  CD2 . TYR B 2 338 ? 17.063  127.371 14.022  1.00 12.63 ? 838  TYR B CD2 1 
ATOM   5232 C  CE1 . TYR B 2 338 ? 18.948  128.872 15.410  1.00 12.39 ? 838  TYR B CE1 1 
ATOM   5233 C  CE2 . TYR B 2 338 ? 17.683  128.465 13.400  1.00 11.86 ? 838  TYR B CE2 1 
ATOM   5234 C  CZ  . TYR B 2 338 ? 18.619  129.209 14.104  1.00 12.82 ? 838  TYR B CZ  1 
ATOM   5235 O  OH  . TYR B 2 338 ? 19.216  130.300 13.519  1.00 12.28 ? 838  TYR B OH  1 
ATOM   5236 N  N   . ILE B 2 339 ? 13.801  127.020 15.822  1.00 12.87 ? 839  ILE B N   1 
ATOM   5237 C  CA  . ILE B 2 339 ? 12.849  127.931 15.197  1.00 12.85 ? 839  ILE B CA  1 
ATOM   5238 C  C   . ILE B 2 339 ? 12.053  128.746 16.219  1.00 13.44 ? 839  ILE B C   1 
ATOM   5239 O  O   . ILE B 2 339 ? 12.011  129.974 16.144  1.00 13.30 ? 839  ILE B O   1 
ATOM   5240 C  CB  . ILE B 2 339 ? 11.855  127.164 14.284  1.00 12.76 ? 839  ILE B CB  1 
ATOM   5241 C  CG1 . ILE B 2 339 ? 12.615  126.486 13.137  1.00 13.47 ? 839  ILE B CG1 1 
ATOM   5242 C  CG2 . ILE B 2 339 ? 10.801  128.127 13.721  1.00 12.25 ? 839  ILE B CG2 1 
ATOM   5243 C  CD1 . ILE B 2 339 ? 11.741  125.591 12.261  1.00 12.72 ? 839  ILE B CD1 1 
ATOM   5244 N  N   . LEU B 2 340 ? 11.430  128.065 17.175  1.00 13.41 ? 840  LEU B N   1 
ATOM   5245 C  CA  . LEU B 2 340 ? 10.614  128.745 18.180  1.00 13.47 ? 840  LEU B CA  1 
ATOM   5246 C  C   . LEU B 2 340 ? 11.376  129.684 19.116  1.00 13.76 ? 840  LEU B C   1 
ATOM   5247 O  O   . LEU B 2 340 ? 10.894  130.776 19.422  1.00 13.86 ? 840  LEU B O   1 
ATOM   5248 C  CB  . LEU B 2 340 ? 9.829   127.715 19.006  1.00 12.66 ? 840  LEU B CB  1 
ATOM   5249 C  CG  . LEU B 2 340 ? 8.783   126.904 18.232  1.00 13.27 ? 840  LEU B CG  1 
ATOM   5250 C  CD1 . LEU B 2 340 ? 8.211   125.811 19.124  1.00 13.28 ? 840  LEU B CD1 1 
ATOM   5251 C  CD2 . LEU B 2 340 ? 7.670   127.833 17.733  1.00 13.60 ? 840  LEU B CD2 1 
ATOM   5252 N  N   . MET B 2 341 ? 12.555  129.271 19.572  1.00 13.49 ? 841  MET B N   1 
ATOM   5253 C  CA  . MET B 2 341 ? 13.337  130.111 20.477  1.00 14.00 ? 841  MET B CA  1 
ATOM   5254 C  C   . MET B 2 341 ? 14.251  131.139 19.810  1.00 14.08 ? 841  MET B C   1 
ATOM   5255 O  O   . MET B 2 341 ? 14.467  132.217 20.357  1.00 13.68 ? 841  MET B O   1 
ATOM   5256 C  CB  . MET B 2 341 ? 14.191  129.249 21.415  1.00 13.82 ? 841  MET B CB  1 
ATOM   5257 C  CG  . MET B 2 341 ? 13.409  128.500 22.489  1.00 14.27 ? 841  MET B CG  1 
ATOM   5258 S  SD  . MET B 2 341 ? 14.505  127.710 23.702  1.00 16.31 ? 841  MET B SD  1 
ATOM   5259 C  CE  . MET B 2 341 ? 14.909  126.173 22.831  1.00 14.99 ? 841  MET B CE  1 
ATOM   5260 N  N   . CYS B 2 342 ? 14.774  130.828 18.628  1.00 14.07 ? 842  CYS B N   1 
ATOM   5261 C  CA  . CYS B 2 342 ? 15.714  131.742 17.978  1.00 14.14 ? 842  CYS B CA  1 
ATOM   5262 C  C   . CYS B 2 342 ? 15.289  132.457 16.698  1.00 14.33 ? 842  CYS B C   1 
ATOM   5263 O  O   . CYS B 2 342 ? 15.943  133.418 16.296  1.00 13.87 ? 842  CYS B O   1 
ATOM   5264 C  CB  . CYS B 2 342 ? 17.021  130.994 17.679  1.00 14.92 ? 842  CYS B CB  1 
ATOM   5265 S  SG  . CYS B 2 342 ? 17.709  130.035 19.066  1.00 16.88 ? 842  CYS B SG  1 
ATOM   5266 N  N   . CYS B 2 343 ? 14.211  132.014 16.057  1.00 14.30 ? 843  CYS B N   1 
ATOM   5267 C  CA  . CYS B 2 343 ? 13.817  132.617 14.787  1.00 14.83 ? 843  CYS B CA  1 
ATOM   5268 C  C   . CYS B 2 343 ? 12.537  133.447 14.744  1.00 15.52 ? 843  CYS B C   1 
ATOM   5269 O  O   . CYS B 2 343 ? 12.051  133.771 13.662  1.00 14.99 ? 843  CYS B O   1 
ATOM   5270 C  CB  . CYS B 2 343 ? 13.739  131.521 13.717  1.00 14.84 ? 843  CYS B CB  1 
ATOM   5271 S  SG  . CYS B 2 343 ? 15.291  130.605 13.492  1.00 15.19 ? 843  CYS B SG  1 
ATOM   5272 N  N   . GLN B 2 344 ? 11.992  133.792 15.903  1.00 15.65 ? 844  GLN B N   1 
ATOM   5273 C  CA  . GLN B 2 344 ? 10.774  134.589 15.935  1.00 16.68 ? 844  GLN B CA  1 
ATOM   5274 C  C   . GLN B 2 344 ? 11.045  136.046 16.283  1.00 17.83 ? 844  GLN B C   1 
ATOM   5275 O  O   . GLN B 2 344 ? 11.680  136.339 17.292  1.00 16.71 ? 844  GLN B O   1 
ATOM   5276 C  CB  . GLN B 2 344 ? 9.787   134.026 16.959  1.00 16.57 ? 844  GLN B CB  1 
ATOM   5277 C  CG  . GLN B 2 344 ? 9.182   132.688 16.589  1.00 16.12 ? 844  GLN B CG  1 
ATOM   5278 C  CD  . GLN B 2 344 ? 8.072   132.300 17.531  1.00 16.50 ? 844  GLN B CD  1 
ATOM   5279 O  OE1 . GLN B 2 344 ? 8.309   131.705 18.587  1.00 17.49 ? 844  GLN B OE1 1 
ATOM   5280 N  NE2 . GLN B 2 344 ? 6.847   132.657 17.169  1.00 15.15 ? 844  GLN B NE2 1 
ATOM   5281 N  N   . CYS B 2 345 ? 10.561  136.956 15.446  1.00 18.71 ? 845  CYS B N   1 
ATOM   5282 C  CA  . CYS B 2 345 ? 10.720  138.376 15.723  1.00 20.45 ? 845  CYS B CA  1 
ATOM   5283 C  C   . CYS B 2 345 ? 9.585   138.755 16.667  1.00 21.48 ? 845  CYS B C   1 
ATOM   5284 O  O   . CYS B 2 345 ? 8.421   138.462 16.392  1.00 21.24 ? 845  CYS B O   1 
ATOM   5285 C  CB  . CYS B 2 345 ? 10.608  139.202 14.441  1.00 20.58 ? 845  CYS B CB  1 
ATOM   5286 S  SG  . CYS B 2 345 ? 10.590  140.991 14.746  1.00 23.53 ? 845  CYS B SG  1 
ATOM   5287 N  N   . PRO B 2 346 ? 9.907   139.404 17.796  1.00 22.77 ? 846  PRO B N   1 
ATOM   5288 C  CA  . PRO B 2 346 ? 8.886   139.810 18.766  1.00 23.66 ? 846  PRO B CA  1 
ATOM   5289 C  C   . PRO B 2 346 ? 7.728   140.575 18.128  1.00 23.81 ? 846  PRO B C   1 
ATOM   5290 O  O   . PRO B 2 346 ? 6.578   140.426 18.536  1.00 24.95 ? 846  PRO B O   1 
ATOM   5291 C  CB  . PRO B 2 346 ? 9.673   140.675 19.748  1.00 24.24 ? 846  PRO B CB  1 
ATOM   5292 C  CG  . PRO B 2 346 ? 11.015  140.023 19.745  1.00 24.36 ? 846  PRO B CG  1 
ATOM   5293 C  CD  . PRO B 2 346 ? 11.254  139.769 18.271  1.00 23.39 ? 846  PRO B CD  1 
ATOM   5294 N  N   . ALA B 2 347 ? 8.039   141.389 17.125  1.00 23.43 ? 847  ALA B N   1 
ATOM   5295 C  CA  . ALA B 2 347 ? 7.026   142.190 16.442  1.00 23.20 ? 847  ALA B CA  1 
ATOM   5296 C  C   . ALA B 2 347 ? 6.261   141.438 15.354  1.00 22.59 ? 847  ALA B C   1 
ATOM   5297 O  O   . ALA B 2 347 ? 5.406   142.018 14.682  1.00 23.48 ? 847  ALA B O   1 
ATOM   5298 C  CB  . ALA B 2 347 ? 7.675   143.432 15.846  1.00 23.18 ? 847  ALA B CB  1 
ATOM   5299 N  N   . GLY B 2 348 ? 6.558   140.154 15.181  1.00 21.61 ? 848  GLY B N   1 
ATOM   5300 C  CA  . GLY B 2 348 ? 5.880   139.381 14.154  1.00 19.46 ? 848  GLY B CA  1 
ATOM   5301 C  C   . GLY B 2 348 ? 6.832   139.065 13.015  1.00 19.09 ? 848  GLY B C   1 
ATOM   5302 O  O   . GLY B 2 348 ? 7.694   139.879 12.680  1.00 18.66 ? 848  GLY B O   1 
ATOM   5303 N  N   . GLY B 2 349 ? 6.674   137.888 12.414  1.00 18.06 ? 849  GLY B N   1 
ATOM   5304 C  CA  . GLY B 2 349 ? 7.554   137.486 11.333  1.00 17.38 ? 849  GLY B CA  1 
ATOM   5305 C  C   . GLY B 2 349 ? 8.691   136.644 11.883  1.00 17.00 ? 849  GLY B C   1 
ATOM   5306 O  O   . GLY B 2 349 ? 8.962   136.671 13.086  1.00 16.61 ? 849  GLY B O   1 
ATOM   5307 N  N   . LEU B 2 350 ? 9.350   135.880 11.018  1.00 16.16 ? 850  LEU B N   1 
ATOM   5308 C  CA  . LEU B 2 350 ? 10.459  135.050 11.457  1.00 16.13 ? 850  LEU B CA  1 
ATOM   5309 C  C   . LEU B 2 350 ? 11.729  135.390 10.696  1.00 16.86 ? 850  LEU B C   1 
ATOM   5310 O  O   . LEU B 2 350 ? 11.701  136.166 9.734   1.00 16.98 ? 850  LEU B O   1 
ATOM   5311 C  CB  . LEU B 2 350 ? 10.116  133.564 11.315  1.00 14.67 ? 850  LEU B CB  1 
ATOM   5312 C  CG  . LEU B 2 350 ? 9.006   133.094 12.269  1.00 14.52 ? 850  LEU B CG  1 
ATOM   5313 C  CD1 . LEU B 2 350 ? 7.650   133.282 11.599  1.00 14.38 ? 850  LEU B CD1 1 
ATOM   5314 C  CD2 . LEU B 2 350 ? 9.211   131.637 12.639  1.00 13.95 ? 850  LEU B CD2 1 
ATOM   5315 N  N   . LEU B 2 351 ? 12.845  134.806 11.115  1.00 17.13 ? 851  LEU B N   1 
ATOM   5316 C  CA  . LEU B 2 351 ? 14.106  135.127 10.479  1.00 17.87 ? 851  LEU B CA  1 
ATOM   5317 C  C   . LEU B 2 351 ? 15.195  134.057 10.458  1.00 16.89 ? 851  LEU B C   1 
ATOM   5318 O  O   . LEU B 2 351 ? 14.999  132.925 10.901  1.00 16.22 ? 851  LEU B O   1 
ATOM   5319 C  CB  . LEU B 2 351 ? 14.641  136.406 11.117  1.00 20.85 ? 851  LEU B CB  1 
ATOM   5320 C  CG  . LEU B 2 351 ? 14.369  136.475 12.620  1.00 21.80 ? 851  LEU B CG  1 
ATOM   5321 C  CD1 . LEU B 2 351 ? 15.433  135.688 13.359  1.00 23.95 ? 851  LEU B CD1 1 
ATOM   5322 C  CD2 . LEU B 2 351 ? 14.359  137.926 13.074  1.00 23.06 ? 851  LEU B CD2 1 
ATOM   5323 N  N   . ASP B 2 352 ? 16.338  134.454 9.908   1.00 15.72 ? 852  ASP B N   1 
ATOM   5324 C  CA  . ASP B 2 352 ? 17.532  133.624 9.750   1.00 15.50 ? 852  ASP B CA  1 
ATOM   5325 C  C   . ASP B 2 352 ? 18.123  133.179 11.094  1.00 15.49 ? 852  ASP B C   1 
ATOM   5326 O  O   . ASP B 2 352 ? 18.209  131.980 11.388  1.00 14.23 ? 852  ASP B O   1 
ATOM   5327 C  CB  . ASP B 2 352 ? 18.545  134.435 8.918   1.00 15.21 ? 852  ASP B CB  1 
ATOM   5328 C  CG  . ASP B 2 352 ? 19.965  133.896 8.985   1.00 15.60 ? 852  ASP B CG  1 
ATOM   5329 O  OD1 . ASP B 2 352 ? 20.246  132.928 9.715   1.00 15.66 ? 852  ASP B OD1 1 
ATOM   5330 O  OD2 . ASP B 2 352 ? 20.821  134.476 8.291   1.00 16.61 ? 852  ASP B OD2 1 
ATOM   5331 N  N   . LYS B 2 353 ? 18.543  134.143 11.902  1.00 15.47 ? 853  LYS B N   1 
ATOM   5332 C  CA  . LYS B 2 353 ? 19.108  133.838 13.213  1.00 16.44 ? 853  LYS B CA  1 
ATOM   5333 C  C   . LYS B 2 353 ? 18.993  135.080 14.088  1.00 17.05 ? 853  LYS B C   1 
ATOM   5334 O  O   . LYS B 2 353 ? 18.729  136.177 13.585  1.00 17.13 ? 853  LYS B O   1 
ATOM   5335 C  CB  . LYS B 2 353 ? 20.577  133.405 13.085  1.00 16.74 ? 853  LYS B CB  1 
ATOM   5336 C  CG  . LYS B 2 353 ? 21.512  134.460 12.505  1.00 17.68 ? 853  LYS B CG  1 
ATOM   5337 C  CD  . LYS B 2 353 ? 22.979  134.021 12.589  1.00 18.15 ? 853  LYS B CD  1 
ATOM   5338 C  CE  . LYS B 2 353 ? 23.267  132.776 11.742  1.00 17.20 ? 853  LYS B CE  1 
ATOM   5339 N  NZ  . LYS B 2 353 ? 23.077  133.009 10.275  1.00 16.19 ? 853  LYS B NZ  1 
ATOM   5340 N  N   . PRO B 2 354 ? 19.172  134.928 15.409  1.00 17.47 ? 854  PRO B N   1 
ATOM   5341 C  CA  . PRO B 2 354 ? 19.072  136.089 16.300  1.00 18.83 ? 854  PRO B CA  1 
ATOM   5342 C  C   . PRO B 2 354 ? 19.973  137.217 15.816  1.00 19.62 ? 854  PRO B C   1 
ATOM   5343 O  O   . PRO B 2 354 ? 21.120  136.981 15.431  1.00 19.90 ? 854  PRO B O   1 
ATOM   5344 C  CB  . PRO B 2 354 ? 19.521  135.527 17.647  1.00 18.92 ? 854  PRO B CB  1 
ATOM   5345 C  CG  . PRO B 2 354 ? 19.079  134.086 17.573  1.00 18.41 ? 854  PRO B CG  1 
ATOM   5346 C  CD  . PRO B 2 354 ? 19.483  133.703 16.171  1.00 17.87 ? 854  PRO B CD  1 
ATOM   5347 N  N   . GLY B 2 355 ? 19.452  138.438 15.822  1.00 20.88 ? 855  GLY B N   1 
ATOM   5348 C  CA  . GLY B 2 355 ? 20.250  139.569 15.380  1.00 21.75 ? 855  GLY B CA  1 
ATOM   5349 C  C   . GLY B 2 355 ? 19.937  140.013 13.964  1.00 22.37 ? 855  GLY B C   1 
ATOM   5350 O  O   . GLY B 2 355 ? 20.283  141.129 13.568  1.00 21.98 ? 855  GLY B O   1 
ATOM   5351 N  N   . LYS B 2 356 ? 19.292  139.139 13.196  1.00 22.09 ? 856  LYS B N   1 
ATOM   5352 C  CA  . LYS B 2 356 ? 18.922  139.456 11.821  1.00 22.57 ? 856  LYS B CA  1 
ATOM   5353 C  C   . LYS B 2 356 ? 17.530  140.070 11.814  1.00 22.82 ? 856  LYS B C   1 
ATOM   5354 O  O   . LYS B 2 356 ? 16.767  139.908 12.764  1.00 22.37 ? 856  LYS B O   1 
ATOM   5355 C  CB  . LYS B 2 356 ? 18.906  138.189 10.960  1.00 23.36 ? 856  LYS B CB  1 
ATOM   5356 C  CG  . LYS B 2 356 ? 20.231  137.450 10.898  1.00 25.03 ? 856  LYS B CG  1 
ATOM   5357 C  CD  . LYS B 2 356 ? 21.304  138.282 10.223  1.00 26.62 ? 856  LYS B CD  1 
ATOM   5358 C  CE  . LYS B 2 356 ? 22.568  137.465 10.030  1.00 28.10 ? 856  LYS B CE  1 
ATOM   5359 N  NZ  . LYS B 2 356 ? 23.621  138.240 9.326   1.00 30.58 ? 856  LYS B NZ  1 
ATOM   5360 N  N   . SER B 2 357 ? 17.193  140.770 10.740  1.00 22.51 ? 857  SER B N   1 
ATOM   5361 C  CA  . SER B 2 357 ? 15.878  141.377 10.649  1.00 22.57 ? 857  SER B CA  1 
ATOM   5362 C  C   . SER B 2 357 ? 14.907  140.425 9.961   1.00 21.44 ? 857  SER B C   1 
ATOM   5363 O  O   . SER B 2 357 ? 15.303  139.571 9.165   1.00 20.78 ? 857  SER B O   1 
ATOM   5364 C  CB  . SER B 2 357 ? 15.955  142.698 9.883   1.00 23.84 ? 857  SER B CB  1 
ATOM   5365 O  OG  . SER B 2 357 ? 16.462  142.496 8.578   1.00 26.65 ? 857  SER B OG  1 
ATOM   5366 N  N   . ARG B 2 358 ? 13.630  140.573 10.283  1.00 20.48 ? 858  ARG B N   1 
ATOM   5367 C  CA  . ARG B 2 358 ? 12.592  139.736 9.703   1.00 20.09 ? 858  ARG B CA  1 
ATOM   5368 C  C   . ARG B 2 358 ? 12.385  140.065 8.225   1.00 19.26 ? 858  ARG B C   1 
ATOM   5369 O  O   . ARG B 2 358 ? 12.727  141.152 7.760   1.00 19.03 ? 858  ARG B O   1 
ATOM   5370 C  CB  . ARG B 2 358 ? 11.273  139.971 10.440  1.00 20.68 ? 858  ARG B CB  1 
ATOM   5371 C  CG  . ARG B 2 358 ? 10.723  141.384 10.231  1.00 20.99 ? 858  ARG B CG  1 
ATOM   5372 C  CD  . ARG B 2 358 ? 9.456   141.628 11.026  1.00 21.54 ? 858  ARG B CD  1 
ATOM   5373 N  NE  . ARG B 2 358 ? 8.940   142.979 10.820  1.00 22.26 ? 858  ARG B NE  1 
ATOM   5374 C  CZ  . ARG B 2 358 ? 7.870   143.473 11.437  1.00 23.20 ? 858  ARG B CZ  1 
ATOM   5375 N  NH1 . ARG B 2 358 ? 7.199   142.726 12.307  1.00 22.37 ? 858  ARG B NH1 1 
ATOM   5376 N  NH2 . ARG B 2 358 ? 7.465   144.712 11.179  1.00 23.06 ? 858  ARG B NH2 1 
ATOM   5377 N  N   . ASP B 2 359 ? 11.835  139.107 7.491   1.00 18.09 ? 859  ASP B N   1 
ATOM   5378 C  CA  . ASP B 2 359 ? 11.510  139.295 6.082   1.00 17.07 ? 859  ASP B CA  1 
ATOM   5379 C  C   . ASP B 2 359 ? 10.524  138.189 5.728   1.00 16.26 ? 859  ASP B C   1 
ATOM   5380 O  O   . ASP B 2 359 ? 10.442  137.177 6.431   1.00 15.72 ? 859  ASP B O   1 
ATOM   5381 C  CB  . ASP B 2 359 ? 12.764  139.270 5.185   1.00 17.04 ? 859  ASP B CB  1 
ATOM   5382 C  CG  . ASP B 2 359 ? 13.488  137.935 5.200   1.00 18.12 ? 859  ASP B CG  1 
ATOM   5383 O  OD1 . ASP B 2 359 ? 12.873  136.916 4.832   1.00 17.10 ? 859  ASP B OD1 1 
ATOM   5384 O  OD2 . ASP B 2 359 ? 14.684  137.915 5.567   1.00 18.48 ? 859  ASP B OD2 1 
ATOM   5385 N  N   . PHE B 2 360 ? 9.757   138.383 4.663   1.00 15.09 ? 860  PHE B N   1 
ATOM   5386 C  CA  . PHE B 2 360 ? 8.759   137.394 4.286   1.00 15.02 ? 860  PHE B CA  1 
ATOM   5387 C  C   . PHE B 2 360 ? 9.331   136.064 3.813   1.00 14.01 ? 860  PHE B C   1 
ATOM   5388 O  O   . PHE B 2 360 ? 8.693   135.027 3.959   1.00 14.20 ? 860  PHE B O   1 
ATOM   5389 C  CB  . PHE B 2 360 ? 7.814   137.991 3.240   1.00 15.31 ? 860  PHE B CB  1 
ATOM   5390 C  CG  . PHE B 2 360 ? 7.032   139.163 3.754   1.00 16.09 ? 860  PHE B CG  1 
ATOM   5391 C  CD1 . PHE B 2 360 ? 7.325   140.457 3.332   1.00 16.97 ? 860  PHE B CD1 1 
ATOM   5392 C  CD2 . PHE B 2 360 ? 6.034   138.980 4.707   1.00 16.38 ? 860  PHE B CD2 1 
ATOM   5393 C  CE1 . PHE B 2 360 ? 6.634   141.553 3.856   1.00 17.26 ? 860  PHE B CE1 1 
ATOM   5394 C  CE2 . PHE B 2 360 ? 5.338   140.070 5.237   1.00 16.33 ? 860  PHE B CE2 1 
ATOM   5395 C  CZ  . PHE B 2 360 ? 5.640   141.356 4.810   1.00 16.79 ? 860  PHE B CZ  1 
ATOM   5396 N  N   . TYR B 2 361 ? 10.533  136.096 3.251   1.00 13.34 ? 861  TYR B N   1 
ATOM   5397 C  CA  . TYR B 2 361 ? 11.178  134.877 2.782   1.00 13.08 ? 861  TYR B CA  1 
ATOM   5398 C  C   . TYR B 2 361 ? 11.440  133.955 3.979   1.00 12.97 ? 861  TYR B C   1 
ATOM   5399 O  O   . TYR B 2 361 ? 11.062  132.781 3.962   1.00 12.12 ? 861  TYR B O   1 
ATOM   5400 C  CB  . TYR B 2 361 ? 12.492  135.226 2.080   1.00 12.60 ? 861  TYR B CB  1 
ATOM   5401 C  CG  . TYR B 2 361 ? 13.445  134.062 1.908   1.00 12.99 ? 861  TYR B CG  1 
ATOM   5402 C  CD1 . TYR B 2 361 ? 13.404  133.254 0.770   1.00 12.37 ? 861  TYR B CD1 1 
ATOM   5403 C  CD2 . TYR B 2 361 ? 14.408  133.782 2.882   1.00 12.74 ? 861  TYR B CD2 1 
ATOM   5404 C  CE1 . TYR B 2 361 ? 14.304  132.199 0.603   1.00 12.62 ? 861  TYR B CE1 1 
ATOM   5405 C  CE2 . TYR B 2 361 ? 15.309  132.726 2.727   1.00 11.28 ? 861  TYR B CE2 1 
ATOM   5406 C  CZ  . TYR B 2 361 ? 15.254  131.944 1.589   1.00 12.49 ? 861  TYR B CZ  1 
ATOM   5407 O  OH  . TYR B 2 361 ? 16.158  130.917 1.434   1.00 12.44 ? 861  TYR B OH  1 
ATOM   5408 N  N   . HIS B 2 362 ? 12.082  134.484 5.020   1.00 12.19 ? 862  HIS B N   1 
ATOM   5409 C  CA  . HIS B 2 362 ? 12.361  133.668 6.194   1.00 12.86 ? 862  HIS B CA  1 
ATOM   5410 C  C   . HIS B 2 362 ? 11.096  133.306 6.956   1.00 12.54 ? 862  HIS B C   1 
ATOM   5411 O  O   . HIS B 2 362 ? 11.032  132.259 7.598   1.00 12.95 ? 862  HIS B O   1 
ATOM   5412 C  CB  . HIS B 2 362 ? 13.377  134.355 7.116   1.00 12.80 ? 862  HIS B CB  1 
ATOM   5413 C  CG  . HIS B 2 362 ? 14.785  134.272 6.609   1.00 13.32 ? 862  HIS B CG  1 
ATOM   5414 N  ND1 . HIS B 2 362 ? 15.382  135.286 5.893   1.00 13.18 ? 862  HIS B ND1 1 
ATOM   5415 C  CD2 . HIS B 2 362 ? 15.681  133.256 6.640   1.00 13.12 ? 862  HIS B CD2 1 
ATOM   5416 C  CE1 . HIS B 2 362 ? 16.582  134.899 5.501   1.00 12.73 ? 862  HIS B CE1 1 
ATOM   5417 N  NE2 . HIS B 2 362 ? 16.788  133.670 5.939   1.00 12.91 ? 862  HIS B NE2 1 
ATOM   5418 N  N   . THR B 2 363 ? 10.078  134.153 6.879   1.00 12.58 ? 863  THR B N   1 
ATOM   5419 C  CA  . THR B 2 363 ? 8.829   133.840 7.562   1.00 13.26 ? 863  THR B CA  1 
ATOM   5420 C  C   . THR B 2 363 ? 8.228   132.599 6.905   1.00 13.09 ? 863  THR B C   1 
ATOM   5421 O  O   . THR B 2 363 ? 7.800   131.666 7.583   1.00 13.51 ? 863  THR B O   1 
ATOM   5422 C  CB  . THR B 2 363 ? 7.840   135.019 7.474   1.00 14.08 ? 863  THR B CB  1 
ATOM   5423 O  OG1 . THR B 2 363 ? 8.345   136.104 8.259   1.00 14.07 ? 863  THR B OG1 1 
ATOM   5424 C  CG2 . THR B 2 363 ? 6.452   134.616 7.997   1.00 13.63 ? 863  THR B CG2 1 
ATOM   5425 N  N   . CYS B 2 364 ? 8.221   132.586 5.575   1.00 12.51 ? 864  CYS B N   1 
ATOM   5426 C  CA  . CYS B 2 364 ? 7.686   131.457 4.826   1.00 11.95 ? 864  CYS B CA  1 
ATOM   5427 C  C   . CYS B 2 364 ? 8.442   130.155 5.082   1.00 11.70 ? 864  CYS B C   1 
ATOM   5428 O  O   . CYS B 2 364 ? 7.847   129.142 5.438   1.00 11.76 ? 864  CYS B O   1 
ATOM   5429 C  CB  . CYS B 2 364 ? 7.713   131.760 3.320   1.00 12.57 ? 864  CYS B CB  1 
ATOM   5430 S  SG  . CYS B 2 364 ? 7.389   130.327 2.250   1.00 13.32 ? 864  CYS B SG  1 
ATOM   5431 N  N   . TYR B 2 365 ? 9.758   130.177 4.920   1.00 10.78 ? 865  TYR B N   1 
ATOM   5432 C  CA  . TYR B 2 365 ? 10.521  128.949 5.098   1.00 11.03 ? 865  TYR B CA  1 
ATOM   5433 C  C   . TYR B 2 365 ? 10.718  128.460 6.528   1.00 11.11 ? 865  TYR B C   1 
ATOM   5434 O  O   . TYR B 2 365 ? 10.842  127.254 6.743   1.00 10.87 ? 865  TYR B O   1 
ATOM   5435 C  CB  . TYR B 2 365 ? 11.840  129.053 4.329   1.00 10.11 ? 865  TYR B CB  1 
ATOM   5436 C  CG  . TYR B 2 365 ? 11.561  129.114 2.845   1.00 11.50 ? 865  TYR B CG  1 
ATOM   5437 C  CD1 . TYR B 2 365 ? 11.665  130.314 2.137   1.00 11.03 ? 865  TYR B CD1 1 
ATOM   5438 C  CD2 . TYR B 2 365 ? 11.079  127.994 2.170   1.00 10.87 ? 865  TYR B CD2 1 
ATOM   5439 C  CE1 . TYR B 2 365 ? 11.287  130.394 0.796   1.00 11.23 ? 865  TYR B CE1 1 
ATOM   5440 C  CE2 . TYR B 2 365 ? 10.699  128.063 0.833   1.00 11.52 ? 865  TYR B CE2 1 
ATOM   5441 C  CZ  . TYR B 2 365 ? 10.801  129.263 0.153   1.00 11.34 ? 865  TYR B CZ  1 
ATOM   5442 O  OH  . TYR B 2 365 ? 10.402  129.333 -1.163  1.00 11.25 ? 865  TYR B OH  1 
ATOM   5443 N  N   . CYS B 2 366 ? 10.735  129.370 7.502   1.00 10.74 ? 866  CYS B N   1 
ATOM   5444 C  CA  . CYS B 2 366 ? 10.857  128.948 8.895   1.00 11.74 ? 866  CYS B CA  1 
ATOM   5445 C  C   . CYS B 2 366 ? 9.571   128.214 9.268   1.00 11.57 ? 866  CYS B C   1 
ATOM   5446 O  O   . CYS B 2 366 ? 9.608   127.163 9.905   1.00 11.20 ? 866  CYS B O   1 
ATOM   5447 C  CB  . CYS B 2 366 ? 11.050  130.145 9.838   1.00 12.51 ? 866  CYS B CB  1 
ATOM   5448 S  SG  . CYS B 2 366 ? 12.753  130.745 9.968   1.00 13.37 ? 866  CYS B SG  1 
ATOM   5449 N  N   . LEU B 2 367 ? 8.429   128.768 8.864   1.00 12.25 ? 867  LEU B N   1 
ATOM   5450 C  CA  . LEU B 2 367 ? 7.143   128.139 9.165   1.00 12.12 ? 867  LEU B CA  1 
ATOM   5451 C  C   . LEU B 2 367 ? 6.994   126.825 8.400   1.00 12.30 ? 867  LEU B C   1 
ATOM   5452 O  O   . LEU B 2 367 ? 6.496   125.834 8.941   1.00 11.62 ? 867  LEU B O   1 
ATOM   5453 C  CB  . LEU B 2 367 ? 5.988   129.087 8.818   1.00 12.29 ? 867  LEU B CB  1 
ATOM   5454 C  CG  . LEU B 2 367 ? 5.897   130.369 9.659   1.00 12.50 ? 867  LEU B CG  1 
ATOM   5455 C  CD1 . LEU B 2 367 ? 4.829   131.296 9.084   1.00 13.16 ? 867  LEU B CD1 1 
ATOM   5456 C  CD2 . LEU B 2 367 ? 5.579   130.015 11.108  1.00 12.85 ? 867  LEU B CD2 1 
ATOM   5457 N  N   . SER B 2 368 ? 7.422   126.816 7.140   1.00 12.22 ? 868  SER B N   1 
ATOM   5458 C  CA  . SER B 2 368 ? 7.333   125.602 6.337   1.00 12.81 ? 868  SER B CA  1 
ATOM   5459 C  C   . SER B 2 368 ? 8.145   124.504 7.017   1.00 12.98 ? 868  SER B C   1 
ATOM   5460 O  O   . SER B 2 368 ? 7.702   123.357 7.103   1.00 12.89 ? 868  SER B O   1 
ATOM   5461 C  CB  . SER B 2 368 ? 7.867   125.846 4.920   1.00 12.49 ? 868  SER B CB  1 
ATOM   5462 O  OG  . SER B 2 368 ? 7.081   126.815 4.243   1.00 13.81 ? 868  SER B OG  1 
ATOM   5463 N  N   . GLY B 2 369 ? 9.329   124.866 7.507   1.00 12.88 ? 869  GLY B N   1 
ATOM   5464 C  CA  . GLY B 2 369 ? 10.180  123.900 8.181   1.00 12.82 ? 869  GLY B CA  1 
ATOM   5465 C  C   . GLY B 2 369 ? 9.589   123.422 9.498   1.00 12.61 ? 869  GLY B C   1 
ATOM   5466 O  O   . GLY B 2 369 ? 9.677   122.240 9.841   1.00 12.78 ? 869  GLY B O   1 
ATOM   5467 N  N   . LEU B 2 370 ? 8.991   124.341 10.248  1.00 12.26 ? 870  LEU B N   1 
ATOM   5468 C  CA  . LEU B 2 370 ? 8.375   123.990 11.522  1.00 11.84 ? 870  LEU B CA  1 
ATOM   5469 C  C   . LEU B 2 370 ? 7.275   122.950 11.292  1.00 12.49 ? 870  LEU B C   1 
ATOM   5470 O  O   . LEU B 2 370 ? 7.155   121.984 12.045  1.00 12.54 ? 870  LEU B O   1 
ATOM   5471 C  CB  . LEU B 2 370 ? 7.788   125.239 12.187  1.00 12.57 ? 870  LEU B CB  1 
ATOM   5472 C  CG  . LEU B 2 370 ? 7.096   125.041 13.542  1.00 12.63 ? 870  LEU B CG  1 
ATOM   5473 C  CD1 . LEU B 2 370 ? 8.078   124.435 14.530  1.00 13.26 ? 870  LEU B CD1 1 
ATOM   5474 C  CD2 . LEU B 2 370 ? 6.582   126.375 14.066  1.00 12.68 ? 870  LEU B CD2 1 
ATOM   5475 N  N   . SER B 2 371 ? 6.480   123.147 10.242  1.00 12.28 ? 871  SER B N   1 
ATOM   5476 C  CA  . SER B 2 371 ? 5.400   122.218 9.912   1.00 12.26 ? 871  SER B CA  1 
ATOM   5477 C  C   . SER B 2 371 ? 5.943   120.821 9.587   1.00 12.56 ? 871  SER B C   1 
ATOM   5478 O  O   . SER B 2 371 ? 5.401   119.813 10.035  1.00 12.73 ? 871  SER B O   1 
ATOM   5479 C  CB  . SER B 2 371 ? 4.597   122.755 8.724   1.00 12.70 ? 871  SER B CB  1 
ATOM   5480 O  OG  . SER B 2 371 ? 3.573   121.853 8.347   1.00 13.87 ? 871  SER B OG  1 
ATOM   5481 N  N   . ILE B 2 372 ? 7.011   120.760 8.797   1.00 12.57 ? 872  ILE B N   1 
ATOM   5482 C  CA  . ILE B 2 372 ? 7.609   119.476 8.445   1.00 13.15 ? 872  ILE B CA  1 
ATOM   5483 C  C   . ILE B 2 372 ? 8.121   118.766 9.701   1.00 13.05 ? 872  ILE B C   1 
ATOM   5484 O  O   . ILE B 2 372 ? 7.971   117.551 9.848   1.00 13.11 ? 872  ILE B O   1 
ATOM   5485 C  CB  . ILE B 2 372 ? 8.768   119.671 7.441   1.00 13.75 ? 872  ILE B CB  1 
ATOM   5486 C  CG1 . ILE B 2 372 ? 8.185   120.018 6.067   1.00 14.39 ? 872  ILE B CG1 1 
ATOM   5487 C  CG2 . ILE B 2 372 ? 9.640   118.413 7.373   1.00 14.11 ? 872  ILE B CG2 1 
ATOM   5488 C  CD1 . ILE B 2 372 ? 9.210   120.357 5.025   1.00 16.63 ? 872  ILE B CD1 1 
ATOM   5489 N  N   . ALA B 2 373 ? 8.709   119.535 10.611  1.00 12.91 ? 873  ALA B N   1 
ATOM   5490 C  CA  . ALA B 2 373 ? 9.242   118.988 11.853  1.00 13.13 ? 873  ALA B CA  1 
ATOM   5491 C  C   . ALA B 2 373 ? 8.147   118.473 12.789  1.00 13.20 ? 873  ALA B C   1 
ATOM   5492 O  O   . ALA B 2 373 ? 8.392   117.571 13.592  1.00 12.88 ? 873  ALA B O   1 
ATOM   5493 C  CB  . ALA B 2 373 ? 10.078  120.041 12.566  1.00 12.41 ? 873  ALA B CB  1 
ATOM   5494 N  N   . GLN B 2 374 ? 6.947   119.043 12.689  1.00 12.93 ? 874  GLN B N   1 
ATOM   5495 C  CA  . GLN B 2 374 ? 5.836   118.627 13.548  1.00 14.21 ? 874  GLN B CA  1 
ATOM   5496 C  C   . GLN B 2 374 ? 5.070   117.420 13.013  1.00 14.52 ? 874  GLN B C   1 
ATOM   5497 O  O   . GLN B 2 374 ? 4.499   116.647 13.787  1.00 14.91 ? 874  GLN B O   1 
ATOM   5498 C  CB  . GLN B 2 374 ? 4.812   119.763 13.725  1.00 13.63 ? 874  GLN B CB  1 
ATOM   5499 C  CG  . GLN B 2 374 ? 5.339   121.095 14.246  1.00 13.92 ? 874  GLN B CG  1 
ATOM   5500 C  CD  . GLN B 2 374 ? 4.261   122.174 14.224  1.00 14.67 ? 874  GLN B CD  1 
ATOM   5501 O  OE1 . GLN B 2 374 ? 3.389   122.174 13.352  1.00 14.93 ? 874  GLN B OE1 1 
ATOM   5502 N  NE2 . GLN B 2 374 ? 4.324   123.103 15.172  1.00 14.09 ? 874  GLN B NE2 1 
ATOM   5503 N  N   . HIS B 2 375 ? 5.050   117.257 11.694  1.00 14.96 ? 875  HIS B N   1 
ATOM   5504 C  CA  . HIS B 2 375 ? 4.266   116.183 11.097  1.00 16.26 ? 875  HIS B CA  1 
ATOM   5505 C  C   . HIS B 2 375 ? 4.966   115.114 10.277  1.00 16.74 ? 875  HIS B C   1 
ATOM   5506 O  O   . HIS B 2 375 ? 5.612   115.402 9.268   1.00 15.88 ? 875  HIS B O   1 
ATOM   5507 C  CB  . HIS B 2 375 ? 3.159   116.780 10.223  1.00 16.73 ? 875  HIS B CB  1 
ATOM   5508 C  CG  . HIS B 2 375 ? 2.352   117.840 10.902  1.00 18.48 ? 875  HIS B CG  1 
ATOM   5509 N  ND1 . HIS B 2 375 ? 2.492   119.181 10.610  1.00 19.52 ? 875  HIS B ND1 1 
ATOM   5510 C  CD2 . HIS B 2 375 ? 1.378   117.759 11.839  1.00 18.18 ? 875  HIS B CD2 1 
ATOM   5511 C  CE1 . HIS B 2 375 ? 1.637   119.879 11.335  1.00 19.08 ? 875  HIS B CE1 1 
ATOM   5512 N  NE2 . HIS B 2 375 ? 0.949   119.040 12.088  1.00 19.57 ? 875  HIS B NE2 1 
ATOM   5513 N  N   . PHE B 2 376 ? 4.798   113.869 10.708  1.00 17.20 ? 876  PHE B N   1 
ATOM   5514 C  CA  . PHE B 2 376 ? 5.354   112.736 9.992   1.00 18.46 ? 876  PHE B CA  1 
ATOM   5515 C  C   . PHE B 2 376 ? 4.180   111.997 9.377   1.00 19.61 ? 876  PHE B C   1 
ATOM   5516 O  O   . PHE B 2 376 ? 3.148   111.811 10.023  1.00 18.63 ? 876  PHE B O   1 
ATOM   5517 C  CB  . PHE B 2 376 ? 6.086   111.773 10.924  1.00 18.03 ? 876  PHE B CB  1 
ATOM   5518 C  CG  . PHE B 2 376 ? 6.467   110.475 10.259  1.00 18.64 ? 876  PHE B CG  1 
ATOM   5519 C  CD1 . PHE B 2 376 ? 7.629   110.380 9.497   1.00 18.26 ? 876  PHE B CD1 1 
ATOM   5520 C  CD2 . PHE B 2 376 ? 5.634   109.362 10.353  1.00 18.47 ? 876  PHE B CD2 1 
ATOM   5521 C  CE1 . PHE B 2 376 ? 7.956   109.191 8.834   1.00 19.22 ? 876  PHE B CE1 1 
ATOM   5522 C  CE2 . PHE B 2 376 ? 5.949   108.169 9.693   1.00 19.17 ? 876  PHE B CE2 1 
ATOM   5523 C  CZ  . PHE B 2 376 ? 7.111   108.083 8.933   1.00 18.67 ? 876  PHE B CZ  1 
ATOM   5524 N  N   . GLY B 2 377 ? 4.346   111.569 8.133   1.00 21.31 ? 877  GLY B N   1 
ATOM   5525 C  CA  . GLY B 2 377 ? 3.291   110.837 7.463   1.00 24.16 ? 877  GLY B CA  1 
ATOM   5526 C  C   . GLY B 2 377 ? 3.882   109.889 6.441   1.00 26.14 ? 877  GLY B C   1 
ATOM   5527 O  O   . GLY B 2 377 ? 4.710   110.289 5.626   1.00 26.89 ? 877  GLY B O   1 
ATOM   5528 N  N   . SER B 2 378 ? 3.467   108.628 6.491   1.00 27.36 ? 878  SER B N   1 
ATOM   5529 C  CA  . SER B 2 378 ? 3.953   107.619 5.557   1.00 29.16 ? 878  SER B CA  1 
ATOM   5530 C  C   . SER B 2 378 ? 2.932   106.490 5.498   1.00 29.86 ? 878  SER B C   1 
ATOM   5531 O  O   . SER B 2 378 ? 2.680   105.814 6.498   1.00 29.83 ? 878  SER B O   1 
ATOM   5532 C  CB  . SER B 2 378 ? 5.309   107.072 6.012   1.00 29.70 ? 878  SER B CB  1 
ATOM   5533 O  OG  . SER B 2 378 ? 5.814   106.124 5.082   1.00 30.95 ? 878  SER B OG  1 
ATOM   5534 N  N   . GLY B 2 379 ? 2.345   106.290 4.322   1.00 30.52 ? 879  GLY B N   1 
ATOM   5535 C  CA  . GLY B 2 379 ? 1.342   105.255 4.176   1.00 31.32 ? 879  GLY B CA  1 
ATOM   5536 C  C   . GLY B 2 379 ? 0.128   105.658 4.988   1.00 32.00 ? 879  GLY B C   1 
ATOM   5537 O  O   . GLY B 2 379 ? -0.378  106.773 4.845   1.00 32.51 ? 879  GLY B O   1 
ATOM   5538 N  N   . ALA B 2 380 ? -0.337  104.764 5.851   1.00 32.10 ? 880  ALA B N   1 
ATOM   5539 C  CA  . ALA B 2 380 ? -1.493  105.061 6.688   1.00 32.53 ? 880  ALA B CA  1 
ATOM   5540 C  C   . ALA B 2 380 ? -1.020  105.534 8.058   1.00 32.43 ? 880  ALA B C   1 
ATOM   5541 O  O   . ALA B 2 380 ? -1.827  105.790 8.952   1.00 33.12 ? 880  ALA B O   1 
ATOM   5542 C  CB  . ALA B 2 380 ? -2.368  103.818 6.837   1.00 32.66 ? 880  ALA B CB  1 
ATOM   5543 N  N   . MET B 2 381 ? 0.295   105.656 8.212   1.00 31.76 ? 881  MET B N   1 
ATOM   5544 C  CA  . MET B 2 381 ? 0.880   106.082 9.476   1.00 31.28 ? 881  MET B CA  1 
ATOM   5545 C  C   . MET B 2 381 ? 1.057   107.594 9.599   1.00 30.20 ? 881  MET B C   1 
ATOM   5546 O  O   . MET B 2 381 ? 1.647   108.235 8.730   1.00 29.79 ? 881  MET B O   1 
ATOM   5547 C  CB  . MET B 2 381 ? 2.239   105.409 9.672   1.00 32.81 ? 881  MET B CB  1 
ATOM   5548 C  CG  . MET B 2 381 ? 2.196   103.892 9.622   1.00 34.71 ? 881  MET B CG  1 
ATOM   5549 S  SD  . MET B 2 381 ? 1.034   103.222 10.823  1.00 37.46 ? 881  MET B SD  1 
ATOM   5550 C  CE  . MET B 2 381 ? 1.963   103.460 12.362  1.00 36.75 ? 881  MET B CE  1 
ATOM   5551 N  N   . LEU B 2 382 ? 0.537   108.150 10.688  1.00 28.32 ? 882  LEU B N   1 
ATOM   5552 C  CA  . LEU B 2 382 ? 0.654   109.574 10.974  1.00 26.73 ? 882  LEU B CA  1 
ATOM   5553 C  C   . LEU B 2 382 ? 1.139   109.719 12.415  1.00 25.41 ? 882  LEU B C   1 
ATOM   5554 O  O   . LEU B 2 382 ? 0.582   109.108 13.328  1.00 23.69 ? 882  LEU B O   1 
ATOM   5555 C  CB  . LEU B 2 382 ? -0.699  110.281 10.825  1.00 27.60 ? 882  LEU B CB  1 
ATOM   5556 C  CG  . LEU B 2 382 ? -1.304  110.463 9.428   1.00 29.24 ? 882  LEU B CG  1 
ATOM   5557 C  CD1 . LEU B 2 382 ? -1.618  109.110 8.809   1.00 30.36 ? 882  LEU B CD1 1 
ATOM   5558 C  CD2 . LEU B 2 382 ? -2.573  111.294 9.536   1.00 29.39 ? 882  LEU B CD2 1 
ATOM   5559 N  N   . HIS B 2 383 ? 2.183   110.514 12.620  1.00 23.80 ? 883  HIS B N   1 
ATOM   5560 C  CA  . HIS B 2 383 ? 2.709   110.728 13.963  1.00 22.66 ? 883  HIS B CA  1 
ATOM   5561 C  C   . HIS B 2 383 ? 3.158   112.177 14.120  1.00 22.39 ? 883  HIS B C   1 
ATOM   5562 O  O   . HIS B 2 383 ? 4.106   112.624 13.467  1.00 21.37 ? 883  HIS B O   1 
ATOM   5563 C  CB  . HIS B 2 383 ? 3.880   109.782 14.246  1.00 22.56 ? 883  HIS B CB  1 
ATOM   5564 C  CG  . HIS B 2 383 ? 4.405   109.881 15.646  1.00 23.81 ? 883  HIS B CG  1 
ATOM   5565 N  ND1 . HIS B 2 383 ? 3.703   109.420 16.740  1.00 24.39 ? 883  HIS B ND1 1 
ATOM   5566 C  CD2 . HIS B 2 383 ? 5.544   110.429 16.134  1.00 23.48 ? 883  HIS B CD2 1 
ATOM   5567 C  CE1 . HIS B 2 383 ? 4.386   109.681 17.841  1.00 24.49 ? 883  HIS B CE1 1 
ATOM   5568 N  NE2 . HIS B 2 383 ? 5.506   110.293 17.501  1.00 24.05 ? 883  HIS B NE2 1 
ATOM   5569 N  N   . ASP B 2 384 ? 2.466   112.905 14.989  1.00 21.30 ? 884  ASP B N   1 
ATOM   5570 C  CA  . ASP B 2 384 ? 2.773   114.308 15.228  1.00 21.62 ? 884  ASP B CA  1 
ATOM   5571 C  C   . ASP B 2 384 ? 3.604   114.552 16.477  1.00 21.57 ? 884  ASP B C   1 
ATOM   5572 O  O   . ASP B 2 384 ? 3.480   113.844 17.478  1.00 20.84 ? 884  ASP B O   1 
ATOM   5573 C  CB  . ASP B 2 384 ? 1.481   115.114 15.332  1.00 22.05 ? 884  ASP B CB  1 
ATOM   5574 C  CG  . ASP B 2 384 ? 0.802   115.307 13.994  1.00 23.39 ? 884  ASP B CG  1 
ATOM   5575 O  OD1 . ASP B 2 384 ? -0.375  115.717 13.995  1.00 25.66 ? 884  ASP B OD1 1 
ATOM   5576 O  OD2 . ASP B 2 384 ? 1.440   115.063 12.945  1.00 22.69 ? 884  ASP B OD2 1 
ATOM   5577 N  N   . VAL B 2 385 ? 4.453   115.570 16.400  1.00 21.24 ? 885  VAL B N   1 
ATOM   5578 C  CA  . VAL B 2 385 ? 5.307   115.966 17.510  1.00 20.90 ? 885  VAL B CA  1 
ATOM   5579 C  C   . VAL B 2 385 ? 5.248   117.486 17.572  1.00 20.30 ? 885  VAL B C   1 
ATOM   5580 O  O   . VAL B 2 385 ? 6.102   118.167 17.009  1.00 21.70 ? 885  VAL B O   1 
ATOM   5581 C  CB  . VAL B 2 385 ? 6.776   115.537 17.286  1.00 22.01 ? 885  VAL B CB  1 
ATOM   5582 C  CG1 . VAL B 2 385 ? 7.644   116.052 18.429  1.00 22.40 ? 885  VAL B CG1 1 
ATOM   5583 C  CG2 . VAL B 2 385 ? 6.874   114.017 17.196  1.00 22.70 ? 885  VAL B CG2 1 
ATOM   5584 N  N   . VAL B 2 386 ? 4.228   118.016 18.235  1.00 18.73 ? 886  VAL B N   1 
ATOM   5585 C  CA  . VAL B 2 386 ? 4.073   119.460 18.351  1.00 16.94 ? 886  VAL B CA  1 
ATOM   5586 C  C   . VAL B 2 386 ? 4.657   119.952 19.669  1.00 16.64 ? 886  VAL B C   1 
ATOM   5587 O  O   . VAL B 2 386 ? 4.047   119.809 20.727  1.00 16.26 ? 886  VAL B O   1 
ATOM   5588 C  CB  . VAL B 2 386 ? 2.587   119.873 18.273  1.00 16.66 ? 886  VAL B CB  1 
ATOM   5589 C  CG1 . VAL B 2 386 ? 2.462   121.396 18.328  1.00 15.64 ? 886  VAL B CG1 1 
ATOM   5590 C  CG2 . VAL B 2 386 ? 1.971   119.335 17.001  1.00 16.44 ? 886  VAL B CG2 1 
ATOM   5591 N  N   . LEU B 2 387 ? 5.852   120.524 19.598  1.00 16.14 ? 887  LEU B N   1 
ATOM   5592 C  CA  . LEU B 2 387 ? 6.526   121.039 20.782  1.00 16.13 ? 887  LEU B CA  1 
ATOM   5593 C  C   . LEU B 2 387 ? 5.838   122.311 21.269  1.00 15.23 ? 887  LEU B C   1 
ATOM   5594 O  O   . LEU B 2 387 ? 5.419   123.135 20.464  1.00 15.35 ? 887  LEU B O   1 
ATOM   5595 C  CB  . LEU B 2 387 ? 7.988   121.340 20.445  1.00 16.94 ? 887  LEU B CB  1 
ATOM   5596 C  CG  . LEU B 2 387 ? 8.886   121.826 21.581  1.00 18.85 ? 887  LEU B CG  1 
ATOM   5597 C  CD1 . LEU B 2 387 ? 8.946   120.772 22.680  1.00 18.35 ? 887  LEU B CD1 1 
ATOM   5598 C  CD2 . LEU B 2 387 ? 10.282  122.113 21.033  1.00 18.61 ? 887  LEU B CD2 1 
ATOM   5599 N  N   . GLY B 2 388 ? 5.721   122.460 22.586  1.00 14.96 ? 888  GLY B N   1 
ATOM   5600 C  CA  . GLY B 2 388 ? 5.102   123.647 23.156  1.00 14.46 ? 888  GLY B CA  1 
ATOM   5601 C  C   . GLY B 2 388 ? 3.597   123.569 23.329  1.00 15.03 ? 888  GLY B C   1 
ATOM   5602 O  O   . GLY B 2 388 ? 3.025   122.479 23.419  1.00 14.33 ? 888  GLY B O   1 
ATOM   5603 N  N   . VAL B 2 389 ? 2.946   124.727 23.384  1.00 14.91 ? 889  VAL B N   1 
ATOM   5604 C  CA  . VAL B 2 389 ? 1.501   124.747 23.533  1.00 16.15 ? 889  VAL B CA  1 
ATOM   5605 C  C   . VAL B 2 389 ? 0.910   124.106 22.279  1.00 16.94 ? 889  VAL B C   1 
ATOM   5606 O  O   . VAL B 2 389 ? 1.433   124.279 21.176  1.00 16.40 ? 889  VAL B O   1 
ATOM   5607 C  CB  . VAL B 2 389 ? 0.959   126.195 23.717  1.00 15.48 ? 889  VAL B CB  1 
ATOM   5608 C  CG1 . VAL B 2 389 ? 1.485   126.780 25.023  1.00 16.24 ? 889  VAL B CG1 1 
ATOM   5609 C  CG2 . VAL B 2 389 ? 1.370   127.074 22.544  1.00 15.98 ? 889  VAL B CG2 1 
ATOM   5610 N  N   . PRO B 2 390 ? -0.179  123.338 22.435  1.00 17.79 ? 890  PRO B N   1 
ATOM   5611 C  CA  . PRO B 2 390 ? -0.826  122.668 21.300  1.00 18.33 ? 890  PRO B CA  1 
ATOM   5612 C  C   . PRO B 2 390 ? -1.207  123.573 20.132  1.00 17.90 ? 890  PRO B C   1 
ATOM   5613 O  O   . PRO B 2 390 ? -1.243  123.124 18.985  1.00 17.76 ? 890  PRO B O   1 
ATOM   5614 C  CB  . PRO B 2 390 ? -2.035  121.974 21.940  1.00 18.47 ? 890  PRO B CB  1 
ATOM   5615 C  CG  . PRO B 2 390 ? -2.302  122.788 23.171  1.00 19.56 ? 890  PRO B CG  1 
ATOM   5616 C  CD  . PRO B 2 390 ? -0.914  123.084 23.686  1.00 18.11 ? 890  PRO B CD  1 
ATOM   5617 N  N   . GLU B 2 391 ? -1.478  124.843 20.418  1.00 18.13 ? 891  GLU B N   1 
ATOM   5618 C  CA  . GLU B 2 391 ? -1.839  125.796 19.372  1.00 18.45 ? 891  GLU B CA  1 
ATOM   5619 C  C   . GLU B 2 391 ? -0.686  126.053 18.395  1.00 17.83 ? 891  GLU B C   1 
ATOM   5620 O  O   . GLU B 2 391 ? -0.869  126.722 17.375  1.00 17.52 ? 891  GLU B O   1 
ATOM   5621 C  CB  . GLU B 2 391 ? -2.290  127.130 19.981  1.00 20.49 ? 891  GLU B CB  1 
ATOM   5622 C  CG  . GLU B 2 391 ? -3.611  127.060 20.738  1.00 23.41 ? 891  GLU B CG  1 
ATOM   5623 C  CD  . GLU B 2 391 ? -3.439  126.757 22.223  1.00 26.11 ? 891  GLU B CD  1 
ATOM   5624 O  OE1 . GLU B 2 391 ? -2.481  126.037 22.591  1.00 24.92 ? 891  GLU B OE1 1 
ATOM   5625 O  OE2 . GLU B 2 391 ? -4.279  127.235 23.024  1.00 27.92 ? 891  GLU B OE2 1 
ATOM   5626 N  N   . ASN B 2 392 ? 0.499   125.536 18.707  1.00 15.98 ? 892  ASN B N   1 
ATOM   5627 C  CA  . ASN B 2 392 ? 1.653   125.717 17.827  1.00 15.50 ? 892  ASN B CA  1 
ATOM   5628 C  C   . ASN B 2 392 ? 1.521   124.891 16.545  1.00 14.74 ? 892  ASN B C   1 
ATOM   5629 O  O   . ASN B 2 392 ? 2.176   125.181 15.543  1.00 14.38 ? 892  ASN B O   1 
ATOM   5630 C  CB  . ASN B 2 392 ? 2.950   125.311 18.541  1.00 14.24 ? 892  ASN B CB  1 
ATOM   5631 C  CG  . ASN B 2 392 ? 3.385   126.318 19.595  1.00 14.47 ? 892  ASN B CG  1 
ATOM   5632 O  OD1 . ASN B 2 392 ? 2.815   127.407 19.712  1.00 13.98 ? 892  ASN B OD1 1 
ATOM   5633 N  ND2 . ASN B 2 392 ? 4.415   125.962 20.358  1.00 12.73 ? 892  ASN B ND2 1 
ATOM   5634 N  N   . ALA B 2 393 ? 0.677   123.864 16.581  1.00 14.25 ? 893  ALA B N   1 
ATOM   5635 C  CA  . ALA B 2 393 ? 0.484   122.990 15.424  1.00 14.18 ? 893  ALA B CA  1 
ATOM   5636 C  C   . ALA B 2 393 ? 0.117   123.767 14.167  1.00 14.22 ? 893  ALA B C   1 
ATOM   5637 O  O   . ALA B 2 393 ? -0.851  124.526 14.154  1.00 14.23 ? 893  ALA B O   1 
ATOM   5638 C  CB  . ALA B 2 393 ? -0.595  121.941 15.722  1.00 13.96 ? 893  ALA B CB  1 
ATOM   5639 N  N   . LEU B 2 394 ? 0.898   123.570 13.112  1.00 13.65 ? 894  LEU B N   1 
ATOM   5640 C  CA  . LEU B 2 394 ? 0.646   124.244 11.847  1.00 14.12 ? 894  LEU B CA  1 
ATOM   5641 C  C   . LEU B 2 394 ? -0.014  123.273 10.874  1.00 14.64 ? 894  LEU B C   1 
ATOM   5642 O  O   . LEU B 2 394 ? -0.020  122.061 11.095  1.00 14.75 ? 894  LEU B O   1 
ATOM   5643 C  CB  . LEU B 2 394 ? 1.962   124.734 11.234  1.00 13.69 ? 894  LEU B CB  1 
ATOM   5644 C  CG  . LEU B 2 394 ? 2.773   125.810 11.963  1.00 14.12 ? 894  LEU B CG  1 
ATOM   5645 C  CD1 . LEU B 2 394 ? 4.096   126.032 11.233  1.00 13.79 ? 894  LEU B CD1 1 
ATOM   5646 C  CD2 . LEU B 2 394 ? 1.974   127.103 12.016  1.00 13.57 ? 894  LEU B CD2 1 
ATOM   5647 N  N   . GLN B 2 395 ? -0.576  123.810 9.799   1.00 15.07 ? 895  GLN B N   1 
ATOM   5648 C  CA  . GLN B 2 395 ? -1.180  122.967 8.782   1.00 16.01 ? 895  GLN B CA  1 
ATOM   5649 C  C   . GLN B 2 395 ? -0.020  122.280 8.059   1.00 15.79 ? 895  GLN B C   1 
ATOM   5650 O  O   . GLN B 2 395 ? 1.077   122.834 7.956   1.00 14.58 ? 895  GLN B O   1 
ATOM   5651 C  CB  . GLN B 2 395 ? -1.988  123.819 7.800   1.00 17.06 ? 895  GLN B CB  1 
ATOM   5652 C  CG  . GLN B 2 395 ? -3.230  124.425 8.429   1.00 19.04 ? 895  GLN B CG  1 
ATOM   5653 C  CD  . GLN B 2 395 ? -4.189  123.358 8.925   1.00 20.76 ? 895  GLN B CD  1 
ATOM   5654 O  OE1 . GLN B 2 395 ? -4.756  122.613 8.136   1.00 22.93 ? 895  GLN B OE1 1 
ATOM   5655 N  NE2 . GLN B 2 395 ? -4.361  123.274 10.237  1.00 21.81 ? 895  GLN B NE2 1 
ATOM   5656 N  N   . PRO B 2 396 ? -0.237  121.055 7.569   1.00 15.88 ? 896  PRO B N   1 
ATOM   5657 C  CA  . PRO B 2 396 ? 0.845   120.359 6.866   1.00 15.62 ? 896  PRO B CA  1 
ATOM   5658 C  C   . PRO B 2 396 ? 1.224   121.019 5.538   1.00 15.08 ? 896  PRO B C   1 
ATOM   5659 O  O   . PRO B 2 396 ? 0.464   121.812 4.983   1.00 14.49 ? 896  PRO B O   1 
ATOM   5660 C  CB  . PRO B 2 396 ? 0.279   118.952 6.675   1.00 16.59 ? 896  PRO B CB  1 
ATOM   5661 C  CG  . PRO B 2 396 ? -1.208  119.200 6.573   1.00 17.66 ? 896  PRO B CG  1 
ATOM   5662 C  CD  . PRO B 2 396 ? -1.437  120.205 7.677   1.00 16.35 ? 896  PRO B CD  1 
ATOM   5663 N  N   . THR B 2 397 ? 2.412   120.703 5.041   1.00 14.38 ? 897  THR B N   1 
ATOM   5664 C  CA  . THR B 2 397 ? 2.853   121.252 3.771   1.00 14.93 ? 897  THR B CA  1 
ATOM   5665 C  C   . THR B 2 397 ? 3.399   120.100 2.929   1.00 15.13 ? 897  THR B C   1 
ATOM   5666 O  O   . THR B 2 397 ? 3.940   119.131 3.467   1.00 15.68 ? 897  THR B O   1 
ATOM   5667 C  CB  . THR B 2 397 ? 3.934   122.349 3.978   1.00 14.67 ? 897  THR B CB  1 
ATOM   5668 O  OG1 . THR B 2 397 ? 4.144   123.049 2.748   1.00 14.24 ? 897  THR B OG1 1 
ATOM   5669 C  CG2 . THR B 2 397 ? 5.255   121.738 4.445   1.00 14.31 ? 897  THR B CG2 1 
ATOM   5670 N  N   . HIS B 2 398 ? 3.223   120.187 1.613   1.00 14.98 ? 898  HIS B N   1 
ATOM   5671 C  CA  . HIS B 2 398 ? 3.705   119.147 0.711   1.00 14.03 ? 898  HIS B CA  1 
ATOM   5672 C  C   . HIS B 2 398 ? 5.209   119.363 0.550   1.00 13.91 ? 898  HIS B C   1 
ATOM   5673 O  O   . HIS B 2 398 ? 5.648   120.453 0.188   1.00 13.50 ? 898  HIS B O   1 
ATOM   5674 C  CB  . HIS B 2 398 ? 2.986   119.257 -0.639  1.00 14.77 ? 898  HIS B CB  1 
ATOM   5675 C  CG  . HIS B 2 398 ? 3.119   118.036 -1.495  1.00 15.22 ? 898  HIS B CG  1 
ATOM   5676 N  ND1 . HIS B 2 398 ? 4.304   117.671 -2.096  1.00 14.71 ? 898  HIS B ND1 1 
ATOM   5677 C  CD2 . HIS B 2 398 ? 2.218   117.081 -1.827  1.00 15.88 ? 898  HIS B CD2 1 
ATOM   5678 C  CE1 . HIS B 2 398 ? 4.128   116.542 -2.760  1.00 15.49 ? 898  HIS B CE1 1 
ATOM   5679 N  NE2 . HIS B 2 398 ? 2.871   116.163 -2.613  1.00 15.86 ? 898  HIS B NE2 1 
ATOM   5680 N  N   . PRO B 2 399 ? 6.019   118.321 0.815   1.00 14.32 ? 899  PRO B N   1 
ATOM   5681 C  CA  . PRO B 2 399 ? 7.481   118.406 0.712   1.00 14.47 ? 899  PRO B CA  1 
ATOM   5682 C  C   . PRO B 2 399 ? 8.052   118.709 -0.668  1.00 14.07 ? 899  PRO B C   1 
ATOM   5683 O  O   . PRO B 2 399 ? 9.167   119.207 -0.779  1.00 14.32 ? 899  PRO B O   1 
ATOM   5684 C  CB  . PRO B 2 399 ? 7.942   117.053 1.259   1.00 14.29 ? 899  PRO B CB  1 
ATOM   5685 C  CG  . PRO B 2 399 ? 6.841   116.138 0.836   1.00 14.69 ? 899  PRO B CG  1 
ATOM   5686 C  CD  . PRO B 2 399 ? 5.600   116.948 1.159   1.00 14.42 ? 899  PRO B CD  1 
ATOM   5687 N  N   . VAL B 2 400 ? 7.298   118.404 -1.719  1.00 13.93 ? 900  VAL B N   1 
ATOM   5688 C  CA  . VAL B 2 400 ? 7.767   118.675 -3.070  1.00 13.31 ? 900  VAL B CA  1 
ATOM   5689 C  C   . VAL B 2 400 ? 7.459   120.111 -3.508  1.00 13.57 ? 900  VAL B C   1 
ATOM   5690 O  O   . VAL B 2 400 ? 8.360   120.849 -3.903  1.00 13.53 ? 900  VAL B O   1 
ATOM   5691 C  CB  . VAL B 2 400 ? 7.120   117.711 -4.106  1.00 13.26 ? 900  VAL B CB  1 
ATOM   5692 C  CG1 . VAL B 2 400 ? 7.495   118.145 -5.517  1.00 12.08 ? 900  VAL B CG1 1 
ATOM   5693 C  CG2 . VAL B 2 400 ? 7.578   116.275 -3.857  1.00 12.39 ? 900  VAL B CG2 1 
ATOM   5694 N  N   . TYR B 2 401 ? 6.190   120.505 -3.416  1.00 13.38 ? 901  TYR B N   1 
ATOM   5695 C  CA  . TYR B 2 401 ? 5.753   121.832 -3.860  1.00 12.91 ? 901  TYR B CA  1 
ATOM   5696 C  C   . TYR B 2 401 ? 5.754   122.946 -2.816  1.00 12.91 ? 901  TYR B C   1 
ATOM   5697 O  O   . TYR B 2 401 ? 5.793   124.132 -3.155  1.00 12.09 ? 901  TYR B O   1 
ATOM   5698 C  CB  . TYR B 2 401 ? 4.343   121.727 -4.458  1.00 13.33 ? 901  TYR B CB  1 
ATOM   5699 C  CG  . TYR B 2 401 ? 4.208   120.658 -5.521  1.00 13.92 ? 901  TYR B CG  1 
ATOM   5700 C  CD1 . TYR B 2 401 ? 3.760   119.376 -5.198  1.00 13.21 ? 901  TYR B CD1 1 
ATOM   5701 C  CD2 . TYR B 2 401 ? 4.564   120.919 -6.843  1.00 13.94 ? 901  TYR B CD2 1 
ATOM   5702 C  CE1 . TYR B 2 401 ? 3.673   118.378 -6.166  1.00 13.89 ? 901  TYR B CE1 1 
ATOM   5703 C  CE2 . TYR B 2 401 ? 4.483   119.931 -7.818  1.00 14.72 ? 901  TYR B CE2 1 
ATOM   5704 C  CZ  . TYR B 2 401 ? 4.039   118.662 -7.474  1.00 14.92 ? 901  TYR B CZ  1 
ATOM   5705 O  OH  . TYR B 2 401 ? 3.991   117.675 -8.434  1.00 15.12 ? 901  TYR B OH  1 
ATOM   5706 N  N   . ASN B 2 402 ? 5.713   122.552 -1.552  1.00 12.10 ? 902  ASN B N   1 
ATOM   5707 C  CA  . ASN B 2 402 ? 5.663   123.469 -0.426  1.00 12.56 ? 902  ASN B CA  1 
ATOM   5708 C  C   . ASN B 2 402 ? 4.429   124.375 -0.420  1.00 12.81 ? 902  ASN B C   1 
ATOM   5709 O  O   . ASN B 2 402 ? 4.520   125.601 -0.290  1.00 12.51 ? 902  ASN B O   1 
ATOM   5710 C  CB  . ASN B 2 402 ? 6.944   124.308 -0.298  1.00 11.89 ? 902  ASN B CB  1 
ATOM   5711 C  CG  . ASN B 2 402 ? 7.084   124.931 1.088   1.00 13.02 ? 902  ASN B CG  1 
ATOM   5712 O  OD1 . ASN B 2 402 ? 6.485   124.450 2.055   1.00 12.28 ? 902  ASN B OD1 1 
ATOM   5713 N  ND2 . ASN B 2 402 ? 7.880   125.995 1.196   1.00 12.42 ? 902  ASN B ND2 1 
ATOM   5714 N  N   . ILE B 2 403 ? 3.278   123.738 -0.611  1.00 13.18 ? 903  ILE B N   1 
ATOM   5715 C  CA  . ILE B 2 403 ? 1.973   124.377 -0.515  1.00 13.41 ? 903  ILE B CA  1 
ATOM   5716 C  C   . ILE B 2 403 ? 1.193   123.244 0.159   1.00 13.85 ? 903  ILE B C   1 
ATOM   5717 O  O   . ILE B 2 403 ? 1.660   122.103 0.161   1.00 13.03 ? 903  ILE B O   1 
ATOM   5718 C  CB  . ILE B 2 403 ? 1.328   124.743 -1.892  1.00 13.08 ? 903  ILE B CB  1 
ATOM   5719 C  CG1 . ILE B 2 403 ? 1.086   123.488 -2.726  1.00 13.18 ? 903  ILE B CG1 1 
ATOM   5720 C  CG2 . ILE B 2 403 ? 2.199   125.767 -2.626  1.00 12.71 ? 903  ILE B CG2 1 
ATOM   5721 C  CD1 . ILE B 2 403 ? 0.323   123.764 -4.019  1.00 15.02 ? 903  ILE B CD1 1 
ATOM   5722 N  N   . GLY B 2 404 ? 0.035   123.541 0.739   1.00 14.45 ? 904  GLY B N   1 
ATOM   5723 C  CA  . GLY B 2 404 ? -0.734  122.497 1.405   1.00 15.45 ? 904  GLY B CA  1 
ATOM   5724 C  C   . GLY B 2 404 ? -1.002  121.266 0.549   1.00 16.26 ? 904  GLY B C   1 
ATOM   5725 O  O   . GLY B 2 404 ? -1.267  121.395 -0.646  1.00 16.46 ? 904  GLY B O   1 
ATOM   5726 N  N   . PRO B 2 405 ? -0.937  120.053 1.131   1.00 16.91 ? 905  PRO B N   1 
ATOM   5727 C  CA  . PRO B 2 405 ? -1.180  118.805 0.398   1.00 17.53 ? 905  PRO B CA  1 
ATOM   5728 C  C   . PRO B 2 405 ? -2.565  118.828 -0.240  1.00 18.05 ? 905  PRO B C   1 
ATOM   5729 O  O   . PRO B 2 405 ? -2.765  118.314 -1.340  1.00 17.47 ? 905  PRO B O   1 
ATOM   5730 C  CB  . PRO B 2 405 ? -1.071  117.737 1.484   1.00 17.55 ? 905  PRO B CB  1 
ATOM   5731 C  CG  . PRO B 2 405 ? -0.115  118.336 2.453   1.00 18.08 ? 905  PRO B CG  1 
ATOM   5732 C  CD  . PRO B 2 405 ? -0.573  119.770 2.531   1.00 17.16 ? 905  PRO B CD  1 
ATOM   5733 N  N   . ASP B 2 406 ? -3.517  119.425 0.468   1.00 18.11 ? 906  ASP B N   1 
ATOM   5734 C  CA  . ASP B 2 406 ? -4.883  119.540 -0.028  1.00 19.25 ? 906  ASP B CA  1 
ATOM   5735 C  C   . ASP B 2 406 ? -4.883  120.376 -1.307  1.00 18.66 ? 906  ASP B C   1 
ATOM   5736 O  O   . ASP B 2 406 ? -5.599  120.070 -2.261  1.00 18.30 ? 906  ASP B O   1 
ATOM   5737 C  CB  . ASP B 2 406 ? -5.778  120.195 1.037   1.00 21.15 ? 906  ASP B CB  1 
ATOM   5738 C  CG  . ASP B 2 406 ? -5.306  121.594 1.427   1.00 24.24 ? 906  ASP B CG  1 
ATOM   5739 O  OD1 . ASP B 2 406 ? -4.088  121.782 1.635   1.00 26.23 ? 906  ASP B OD1 1 
ATOM   5740 O  OD2 . ASP B 2 406 ? -6.154  122.507 1.538   1.00 26.81 ? 906  ASP B OD2 1 
ATOM   5741 N  N   . LYS B 2 407 ? -4.071  121.430 -1.320  1.00 17.78 ? 907  LYS B N   1 
ATOM   5742 C  CA  . LYS B 2 407 ? -3.978  122.309 -2.481  1.00 17.97 ? 907  LYS B CA  1 
ATOM   5743 C  C   . LYS B 2 407 ? -3.367  121.576 -3.675  1.00 17.21 ? 907  LYS B C   1 
ATOM   5744 O  O   . LYS B 2 407 ? -3.784  121.781 -4.814  1.00 17.55 ? 907  LYS B O   1 
ATOM   5745 C  CB  . LYS B 2 407 ? -3.141  123.547 -2.144  1.00 17.95 ? 907  LYS B CB  1 
ATOM   5746 C  CG  . LYS B 2 407 ? -3.659  124.351 -0.954  1.00 19.95 ? 907  LYS B CG  1 
ATOM   5747 C  CD  . LYS B 2 407 ? -5.043  124.914 -1.216  1.00 21.70 ? 907  LYS B CD  1 
ATOM   5748 C  CE  . LYS B 2 407 ? -5.533  125.739 -0.036  1.00 24.00 ? 907  LYS B CE  1 
ATOM   5749 N  NZ  . LYS B 2 407 ? -6.868  126.336 -0.329  1.00 26.21 ? 907  LYS B NZ  1 
ATOM   5750 N  N   . VAL B 2 408 ? -2.381  120.723 -3.412  1.00 17.19 ? 908  VAL B N   1 
ATOM   5751 C  CA  . VAL B 2 408 ? -1.737  119.951 -4.471  1.00 17.39 ? 908  VAL B CA  1 
ATOM   5752 C  C   . VAL B 2 408 ? -2.745  119.019 -5.147  1.00 18.04 ? 908  VAL B C   1 
ATOM   5753 O  O   . VAL B 2 408 ? -2.880  119.014 -6.369  1.00 18.39 ? 908  VAL B O   1 
ATOM   5754 C  CB  . VAL B 2 408 ? -0.578  119.087 -3.918  1.00 17.19 ? 908  VAL B CB  1 
ATOM   5755 C  CG1 . VAL B 2 408 ? -0.033  118.186 -5.018  1.00 15.47 ? 908  VAL B CG1 1 
ATOM   5756 C  CG2 . VAL B 2 408 ? 0.526   119.984 -3.370  1.00 17.28 ? 908  VAL B CG2 1 
ATOM   5757 N  N   . ILE B 2 409 ? -3.449  118.232 -4.341  1.00 18.36 ? 909  ILE B N   1 
ATOM   5758 C  CA  . ILE B 2 409 ? -4.438  117.294 -4.858  1.00 19.25 ? 909  ILE B CA  1 
ATOM   5759 C  C   . ILE B 2 409 ? -5.531  118.003 -5.649  1.00 19.04 ? 909  ILE B C   1 
ATOM   5760 O  O   . ILE B 2 409 ? -5.922  117.557 -6.728  1.00 18.16 ? 909  ILE B O   1 
ATOM   5761 C  CB  . ILE B 2 409 ? -5.094  116.494 -3.710  1.00 20.16 ? 909  ILE B CB  1 
ATOM   5762 C  CG1 . ILE B 2 409 ? -4.034  115.647 -3.002  1.00 20.84 ? 909  ILE B CG1 1 
ATOM   5763 C  CG2 . ILE B 2 409 ? -6.207  115.598 -4.263  1.00 21.25 ? 909  ILE B CG2 1 
ATOM   5764 C  CD1 . ILE B 2 409 ? -4.537  114.947 -1.753  1.00 22.56 ? 909  ILE B CD1 1 
ATOM   5765 N  N   . GLN B 2 410 ? -6.019  119.111 -5.108  1.00 19.01 ? 910  GLN B N   1 
ATOM   5766 C  CA  . GLN B 2 410 ? -7.071  119.867 -5.762  1.00 19.73 ? 910  GLN B CA  1 
ATOM   5767 C  C   . GLN B 2 410 ? -6.627  120.435 -7.111  1.00 19.25 ? 910  GLN B C   1 
ATOM   5768 O  O   . GLN B 2 410 ? -7.368  120.369 -8.091  1.00 17.97 ? 910  GLN B O   1 
ATOM   5769 C  CB  . GLN B 2 410 ? -7.539  120.997 -4.851  1.00 21.70 ? 910  GLN B CB  1 
ATOM   5770 C  CG  . GLN B 2 410 ? -8.794  121.689 -5.334  1.00 25.76 ? 910  GLN B CG  1 
ATOM   5771 C  CD  . GLN B 2 410 ? -9.362  122.624 -4.292  1.00 28.60 ? 910  GLN B CD  1 
ATOM   5772 O  OE1 . GLN B 2 410 ? -9.602  122.222 -3.150  1.00 30.80 ? 910  GLN B OE1 1 
ATOM   5773 N  NE2 . GLN B 2 410 ? -9.585  123.877 -4.676  1.00 29.17 ? 910  GLN B NE2 1 
ATOM   5774 N  N   . ALA B 2 411 ? -5.421  120.991 -7.165  1.00 18.39 ? 911  ALA B N   1 
ATOM   5775 C  CA  . ALA B 2 411 ? -4.921  121.550 -8.415  1.00 18.68 ? 911  ALA B CA  1 
ATOM   5776 C  C   . ALA B 2 411 ? -4.657  120.453 -9.450  1.00 19.18 ? 911  ALA B C   1 
ATOM   5777 O  O   . ALA B 2 411 ? -5.112  120.542 -10.592 1.00 18.25 ? 911  ALA B O   1 
ATOM   5778 C  CB  . ALA B 2 411 ? -3.647  122.355 -8.163  1.00 18.01 ? 911  ALA B CB  1 
ATOM   5779 N  N   . THR B 2 412 ? -3.930  119.413 -9.055  1.00 20.05 ? 912  THR B N   1 
ATOM   5780 C  CA  . THR B 2 412 ? -3.627  118.331 -9.984  1.00 21.59 ? 912  THR B CA  1 
ATOM   5781 C  C   . THR B 2 412 ? -4.899  117.685 -10.518 1.00 22.08 ? 912  THR B C   1 
ATOM   5782 O  O   . THR B 2 412 ? -4.980  117.349 -11.697 1.00 22.37 ? 912  THR B O   1 
ATOM   5783 C  CB  . THR B 2 412 ? -2.750  117.248 -9.332  1.00 22.31 ? 912  THR B CB  1 
ATOM   5784 O  OG1 . THR B 2 412 ? -3.439  116.689 -8.211  1.00 25.19 ? 912  THR B OG1 1 
ATOM   5785 C  CG2 . THR B 2 412 ? -1.428  117.845 -8.865  1.00 22.56 ? 912  THR B CG2 1 
ATOM   5786 N  N   . THR B 2 413 ? -5.894  117.514 -9.655  1.00 22.12 ? 913  THR B N   1 
ATOM   5787 C  CA  . THR B 2 413 ? -7.155  116.914 -10.082 1.00 22.50 ? 913  THR B CA  1 
ATOM   5788 C  C   . THR B 2 413 ? -7.819  117.810 -11.127 1.00 22.08 ? 913  THR B C   1 
ATOM   5789 O  O   . THR B 2 413 ? -8.289  117.337 -12.163 1.00 22.32 ? 913  THR B O   1 
ATOM   5790 C  CB  . THR B 2 413 ? -8.116  116.720 -8.886  1.00 22.69 ? 913  THR B CB  1 
ATOM   5791 O  OG1 . THR B 2 413 ? -7.562  115.755 -7.984  1.00 23.68 ? 913  THR B OG1 1 
ATOM   5792 C  CG2 . THR B 2 413 ? -9.478  116.229 -9.362  1.00 23.62 ? 913  THR B CG2 1 
ATOM   5793 N  N   . TYR B 2 414 ? -7.845  119.108 -10.854 1.00 21.16 ? 914  TYR B N   1 
ATOM   5794 C  CA  . TYR B 2 414 ? -8.443  120.064 -11.773 1.00 21.35 ? 914  TYR B CA  1 
ATOM   5795 C  C   . TYR B 2 414 ? -7.760  120.060 -13.145 1.00 20.82 ? 914  TYR B C   1 
ATOM   5796 O  O   . TYR B 2 414 ? -8.409  119.887 -14.179 1.00 20.49 ? 914  TYR B O   1 
ATOM   5797 C  CB  . TYR B 2 414 ? -8.358  121.471 -11.189 1.00 22.19 ? 914  TYR B CB  1 
ATOM   5798 C  CG  . TYR B 2 414 ? -9.055  122.511 -12.031 1.00 23.00 ? 914  TYR B CG  1 
ATOM   5799 C  CD1 . TYR B 2 414 ? -10.444 122.608 -12.033 1.00 23.44 ? 914  TYR B CD1 1 
ATOM   5800 C  CD2 . TYR B 2 414 ? -8.327  123.394 -12.833 1.00 23.07 ? 914  TYR B CD2 1 
ATOM   5801 C  CE1 . TYR B 2 414 ? -11.098 123.559 -12.808 1.00 24.45 ? 914  TYR B CE1 1 
ATOM   5802 C  CE2 . TYR B 2 414 ? -8.970  124.349 -13.614 1.00 24.03 ? 914  TYR B CE2 1 
ATOM   5803 C  CZ  . TYR B 2 414 ? -10.357 124.426 -13.594 1.00 24.61 ? 914  TYR B CZ  1 
ATOM   5804 O  OH  . TYR B 2 414 ? -11.011 125.373 -14.346 1.00 25.80 ? 914  TYR B OH  1 
ATOM   5805 N  N   . PHE B 2 415 ? -6.447  120.250 -13.150 1.00 19.84 ? 915  PHE B N   1 
ATOM   5806 C  CA  . PHE B 2 415 ? -5.705  120.297 -14.400 1.00 19.77 ? 915  PHE B CA  1 
ATOM   5807 C  C   . PHE B 2 415 ? -5.624  118.970 -15.142 1.00 19.90 ? 915  PHE B C   1 
ATOM   5808 O  O   . PHE B 2 415 ? -5.454  118.956 -16.360 1.00 20.02 ? 915  PHE B O   1 
ATOM   5809 C  CB  . PHE B 2 415 ? -4.305  120.867 -14.156 1.00 18.33 ? 915  PHE B CB  1 
ATOM   5810 C  CG  . PHE B 2 415 ? -4.307  122.330 -13.819 1.00 18.22 ? 915  PHE B CG  1 
ATOM   5811 C  CD1 . PHE B 2 415 ? -3.879  122.773 -12.575 1.00 17.69 ? 915  PHE B CD1 1 
ATOM   5812 C  CD2 . PHE B 2 415 ? -4.766  123.267 -14.742 1.00 18.00 ? 915  PHE B CD2 1 
ATOM   5813 C  CE1 . PHE B 2 415 ? -3.907  124.131 -12.251 1.00 18.51 ? 915  PHE B CE1 1 
ATOM   5814 C  CE2 . PHE B 2 415 ? -4.800  124.627 -14.429 1.00 17.34 ? 915  PHE B CE2 1 
ATOM   5815 C  CZ  . PHE B 2 415 ? -4.370  125.060 -13.183 1.00 17.31 ? 915  PHE B CZ  1 
ATOM   5816 N  N   . LEU B 2 416 ? -5.744  117.859 -14.420 1.00 20.88 ? 916  LEU B N   1 
ATOM   5817 C  CA  . LEU B 2 416 ? -5.704  116.546 -15.057 1.00 21.81 ? 916  LEU B CA  1 
ATOM   5818 C  C   . LEU B 2 416 ? -6.919  116.355 -15.954 1.00 22.76 ? 916  LEU B C   1 
ATOM   5819 O  O   . LEU B 2 416 ? -6.935  115.469 -16.808 1.00 22.83 ? 916  LEU B O   1 
ATOM   5820 C  CB  . LEU B 2 416 ? -5.673  115.431 -14.012 1.00 22.46 ? 916  LEU B CB  1 
ATOM   5821 C  CG  . LEU B 2 416 ? -4.303  115.064 -13.435 1.00 22.83 ? 916  LEU B CG  1 
ATOM   5822 C  CD1 . LEU B 2 416 ? -4.472  113.979 -12.376 1.00 22.93 ? 916  LEU B CD1 1 
ATOM   5823 C  CD2 . LEU B 2 416 ? -3.391  114.584 -14.552 1.00 22.44 ? 916  LEU B CD2 1 
ATOM   5824 N  N   . GLN B 2 417 ? -7.936  117.188 -15.757 1.00 23.47 ? 917  GLN B N   1 
ATOM   5825 C  CA  . GLN B 2 417 ? -9.149  117.106 -16.562 1.00 25.34 ? 917  GLN B CA  1 
ATOM   5826 C  C   . GLN B 2 417 ? -8.995  117.855 -17.881 1.00 25.08 ? 917  GLN B C   1 
ATOM   5827 O  O   . GLN B 2 417 ? -9.887  117.833 -18.728 1.00 25.61 ? 917  GLN B O   1 
ATOM   5828 C  CB  . GLN B 2 417 ? -10.338 117.664 -15.786 1.00 27.06 ? 917  GLN B CB  1 
ATOM   5829 C  CG  . GLN B 2 417 ? -10.740 116.803 -14.605 1.00 30.60 ? 917  GLN B CG  1 
ATOM   5830 C  CD  . GLN B 2 417 ? -11.961 117.340 -13.897 1.00 33.73 ? 917  GLN B CD  1 
ATOM   5831 O  OE1 . GLN B 2 417 ? -11.929 118.428 -13.317 1.00 35.46 ? 917  GLN B OE1 1 
ATOM   5832 N  NE2 . GLN B 2 417 ? -13.054 116.582 -13.944 1.00 35.21 ? 917  GLN B NE2 1 
ATOM   5833 N  N   . LYS B 2 418 ? -7.863  118.528 -18.041 1.00 24.75 ? 918  LYS B N   1 
ATOM   5834 C  CA  . LYS B 2 418 ? -7.580  119.262 -19.264 1.00 24.11 ? 918  LYS B CA  1 
ATOM   5835 C  C   . LYS B 2 418 ? -6.499  118.494 -20.011 1.00 23.18 ? 918  LYS B C   1 
ATOM   5836 O  O   . LYS B 2 418 ? -5.710  117.768 -19.408 1.00 22.53 ? 918  LYS B O   1 
ATOM   5837 C  CB  . LYS B 2 418 ? -7.091  120.675 -18.942 1.00 25.32 ? 918  LYS B CB  1 
ATOM   5838 C  CG  . LYS B 2 418 ? -8.086  121.507 -18.153 1.00 26.12 ? 918  LYS B CG  1 
ATOM   5839 C  CD  . LYS B 2 418 ? -7.597  122.932 -17.993 1.00 27.79 ? 918  LYS B CD  1 
ATOM   5840 C  CE  . LYS B 2 418 ? -8.525  123.733 -17.093 1.00 28.56 ? 918  LYS B CE  1 
ATOM   5841 N  NZ  . LYS B 2 418 ? -9.928  123.706 -17.580 1.00 30.09 ? 918  LYS B NZ  1 
ATOM   5842 N  N   . PRO B 2 419 ? -6.458  118.625 -21.341 1.00 22.87 ? 919  PRO B N   1 
ATOM   5843 C  CA  . PRO B 2 419 ? -5.429  117.897 -22.084 1.00 21.65 ? 919  PRO B CA  1 
ATOM   5844 C  C   . PRO B 2 419 ? -4.097  118.636 -22.045 1.00 20.70 ? 919  PRO B C   1 
ATOM   5845 O  O   . PRO B 2 419 ? -4.042  119.818 -21.708 1.00 19.30 ? 919  PRO B O   1 
ATOM   5846 C  CB  . PRO B 2 419 ? -6.008  117.850 -23.492 1.00 22.14 ? 919  PRO B CB  1 
ATOM   5847 C  CG  . PRO B 2 419 ? -6.654  119.202 -23.600 1.00 22.74 ? 919  PRO B CG  1 
ATOM   5848 C  CD  . PRO B 2 419 ? -7.371  119.332 -22.258 1.00 22.62 ? 919  PRO B CD  1 
ATOM   5849 N  N   . VAL B 2 420 ? -3.024  117.927 -22.372 1.00 20.50 ? 920  VAL B N   1 
ATOM   5850 C  CA  . VAL B 2 420 ? -1.711  118.547 -22.430 1.00 20.66 ? 920  VAL B CA  1 
ATOM   5851 C  C   . VAL B 2 420 ? -1.792  119.372 -23.714 1.00 20.92 ? 920  VAL B C   1 
ATOM   5852 O  O   . VAL B 2 420 ? -2.164  118.849 -24.763 1.00 20.04 ? 920  VAL B O   1 
ATOM   5853 C  CB  . VAL B 2 420 ? -0.600  117.490 -22.554 1.00 20.02 ? 920  VAL B CB  1 
ATOM   5854 C  CG1 . VAL B 2 420 ? 0.757   118.168 -22.687 1.00 19.91 ? 920  VAL B CG1 1 
ATOM   5855 C  CG2 . VAL B 2 420 ? -0.625  116.573 -21.330 1.00 20.70 ? 920  VAL B CG2 1 
ATOM   5856 N  N   . PRO B 2 421 ? -1.456  120.670 -23.644 1.00 21.51 ? 921  PRO B N   1 
ATOM   5857 C  CA  . PRO B 2 421 ? -1.495  121.586 -24.794 1.00 22.04 ? 921  PRO B CA  1 
ATOM   5858 C  C   . PRO B 2 421 ? -0.894  121.053 -26.096 1.00 22.99 ? 921  PRO B C   1 
ATOM   5859 O  O   . PRO B 2 421 ? 0.305   120.780 -26.173 1.00 22.06 ? 921  PRO B O   1 
ATOM   5860 C  CB  . PRO B 2 421 ? -0.749  122.813 -24.280 1.00 22.08 ? 921  PRO B CB  1 
ATOM   5861 C  CG  . PRO B 2 421 ? -1.065  122.802 -22.810 1.00 21.78 ? 921  PRO B CG  1 
ATOM   5862 C  CD  . PRO B 2 421 ? -0.883  121.342 -22.463 1.00 21.40 ? 921  PRO B CD  1 
ATOM   5863 N  N   . GLY B 2 422 ? -1.735  120.920 -27.118 1.00 24.19 ? 922  GLY B N   1 
ATOM   5864 C  CA  . GLY B 2 422 ? -1.269  120.435 -28.407 1.00 26.83 ? 922  GLY B CA  1 
ATOM   5865 C  C   . GLY B 2 422 ? -0.812  118.995 -28.331 1.00 29.12 ? 922  GLY B C   1 
ATOM   5866 O  O   . GLY B 2 422 ? -0.149  118.494 -29.241 1.00 27.96 ? 922  GLY B O   1 
ATOM   5867 N  N   . PHE B 2 423 ? -1.183  118.346 -27.229 1.00 32.01 ? 923  PHE B N   1 
ATOM   5868 C  CA  . PHE B 2 423 ? -0.849  116.954 -26.941 1.00 35.75 ? 923  PHE B CA  1 
ATOM   5869 C  C   . PHE B 2 423 ? 0.658   116.755 -26.814 1.00 36.81 ? 923  PHE B C   1 
ATOM   5870 O  O   . PHE B 2 423 ? 1.104   116.293 -25.744 1.00 37.32 ? 923  PHE B O   1 
ATOM   5871 C  CB  . PHE B 2 423 ? -1.405  116.037 -28.029 1.00 37.94 ? 923  PHE B CB  1 
ATOM   5872 C  CG  . PHE B 2 423 ? -1.667  114.631 -27.564 1.00 39.91 ? 923  PHE B CG  1 
ATOM   5873 C  CD1 . PHE B 2 423 ? -0.635  113.837 -27.070 1.00 40.89 ? 923  PHE B CD1 1 
ATOM   5874 C  CD2 . PHE B 2 423 ? -2.954  114.100 -27.620 1.00 41.45 ? 923  PHE B CD2 1 
ATOM   5875 C  CE1 . PHE B 2 423 ? -0.879  112.533 -26.637 1.00 40.76 ? 923  PHE B CE1 1 
ATOM   5876 C  CE2 . PHE B 2 423 ? -3.209  112.800 -27.190 1.00 41.58 ? 923  PHE B CE2 1 
ATOM   5877 C  CZ  . PHE B 2 423 ? -2.167  112.015 -26.698 1.00 41.74 ? 923  PHE B CZ  1 
HETATM 5878 C  C1  . GLC C 3 .   ? 29.383  112.528 -7.850  1.00 28.16 ? 1    GLC C C1  1 
HETATM 5879 C  C2  . GLC C 3 .   ? 29.878  113.494 -8.963  1.00 28.37 ? 1    GLC C C2  1 
HETATM 5880 C  C3  . GLC C 3 .   ? 31.102  112.705 -9.751  1.00 28.75 ? 1    GLC C C3  1 
HETATM 5881 C  C4  . GLC C 3 .   ? 32.248  112.398 -8.736  1.00 28.54 ? 1    GLC C C4  1 
HETATM 5882 C  C5  . GLC C 3 .   ? 31.689  111.581 -7.502  1.00 28.70 ? 1    GLC C C5  1 
HETATM 5883 C  C6  . GLC C 3 .   ? 32.682  111.431 -6.340  1.00 29.20 ? 1    GLC C C6  1 
HETATM 5884 O  O2  . GLC C 3 .   ? 28.834  113.765 -9.898  1.00 28.85 ? 1    GLC C O2  1 
HETATM 5885 O  O3  . GLC C 3 .   ? 31.565  113.608 -10.754 1.00 28.36 ? 1    GLC C O3  1 
HETATM 5886 O  O4  . GLC C 3 .   ? 33.267  111.680 -9.443  1.00 28.86 ? 1    GLC C O4  1 
HETATM 5887 O  O5  . GLC C 3 .   ? 30.496  112.250 -6.937  1.00 27.89 ? 1    GLC C O5  1 
HETATM 5888 O  O6  . GLC C 3 .   ? 32.159  110.531 -5.360  1.00 30.15 ? 1    GLC C O6  1 
HETATM 5889 C  C1  . FRU C 3 .   ? 26.439  111.191 -8.765  1.00 25.77 ? 2    FRU C C1  1 
HETATM 5890 C  C2  . FRU C 3 .   ? 27.646  110.655 -7.927  1.00 26.25 ? 2    FRU C C2  1 
HETATM 5891 C  C3  . FRU C 3 .   ? 27.741  109.116 -7.789  1.00 26.17 ? 2    FRU C C3  1 
HETATM 5892 C  C4  . FRU C 3 .   ? 28.443  108.961 -6.437  1.00 25.76 ? 2    FRU C C4  1 
HETATM 5893 C  C5  . FRU C 3 .   ? 27.810  110.096 -5.601  1.00 25.10 ? 2    FRU C C5  1 
HETATM 5894 C  C6  . FRU C 3 .   ? 28.708  110.727 -4.513  1.00 24.76 ? 2    FRU C C6  1 
HETATM 5895 O  O1  . FRU C 3 .   ? 25.171  110.686 -8.348  1.00 25.69 ? 2    FRU C O1  1 
HETATM 5896 O  O2  . FRU C 3 .   ? 28.885  111.272 -8.408  1.00 26.82 ? 2    FRU C O2  1 
HETATM 5897 O  O3  . FRU C 3 .   ? 28.477  108.472 -8.836  1.00 26.30 ? 2    FRU C O3  1 
HETATM 5898 O  O4  . FRU C 3 .   ? 28.253  107.658 -5.898  1.00 25.53 ? 2    FRU C O4  1 
HETATM 5899 O  O5  . FRU C 3 .   ? 27.442  111.122 -6.565  1.00 25.46 ? 2    FRU C O5  1 
HETATM 5900 O  O6  . FRU C 3 .   ? 27.904  111.419 -3.564  1.00 23.59 ? 2    FRU C O6  1 
HETATM 5901 ZN ZN  . ZN  D 4 .   ? 18.068  132.167 5.232   1.00 16.32 ? 1001 ZN  B ZN  1 
HETATM 5902 C  C1  . FPP E 5 .   ? 24.538  130.963 -1.099  1.00 17.32 ? 1002 FPP B C1  1 
HETATM 5903 O  O1  . FPP E 5 .   ? 24.193  132.147 -0.392  1.00 17.07 ? 1002 FPP B O1  1 
HETATM 5904 C  C2  . FPP E 5 .   ? 23.291  130.287 -1.629  1.00 17.35 ? 1002 FPP B C2  1 
HETATM 5905 C  C3  . FPP E 5 .   ? 22.923  130.235 -2.948  1.00 17.74 ? 1002 FPP B C3  1 
HETATM 5906 C  C4  . FPP E 5 .   ? 23.739  130.850 -4.062  1.00 18.94 ? 1002 FPP B C4  1 
HETATM 5907 C  C5  . FPP E 5 .   ? 21.661  129.548 -3.447  1.00 17.20 ? 1002 FPP B C5  1 
HETATM 5908 C  C6  . FPP E 5 .   ? 20.647  129.167 -2.353  1.00 17.06 ? 1002 FPP B C6  1 
HETATM 5909 C  C7  . FPP E 5 .   ? 19.345  128.628 -2.905  1.00 16.16 ? 1002 FPP B C7  1 
HETATM 5910 C  C8  . FPP E 5 .   ? 18.209  128.468 -2.166  1.00 16.58 ? 1002 FPP B C8  1 
HETATM 5911 C  C10 . FPP E 5 .   ? 18.120  128.802 -0.694  1.00 16.51 ? 1002 FPP B C10 1 
HETATM 5912 C  C9  . FPP E 5 .   ? 16.909  127.929 -2.726  1.00 16.73 ? 1002 FPP B C9  1 
HETATM 5913 C  C11 . FPP E 5 .   ? 16.615  128.269 -4.195  1.00 15.53 ? 1002 FPP B C11 1 
HETATM 5914 C  C12 . FPP E 5 .   ? 15.323  127.641 -4.658  1.00 14.90 ? 1002 FPP B C12 1 
HETATM 5915 C  C13 . FPP E 5 .   ? 14.454  128.189 -5.537  1.00 14.82 ? 1002 FPP B C13 1 
HETATM 5916 C  C14 . FPP E 5 .   ? 14.649  129.532 -6.200  1.00 14.64 ? 1002 FPP B C14 1 
HETATM 5917 C  C15 . FPP E 5 .   ? 13.187  127.492 -5.941  1.00 14.78 ? 1002 FPP B C15 1 
HETATM 5918 P  PA  . FPP E 5 .   ? 24.935  132.426 0.984   1.00 16.88 ? 1002 FPP B PA  1 
HETATM 5919 O  O1A . FPP E 5 .   ? 26.426  132.315 0.888   1.00 16.28 ? 1002 FPP B O1A 1 
HETATM 5920 O  O2A . FPP E 5 .   ? 24.474  133.837 1.408   1.00 17.40 ? 1002 FPP B O2A 1 
HETATM 5921 O  O3A . FPP E 5 .   ? 24.329  131.431 2.079   1.00 15.28 ? 1002 FPP B O3A 1 
HETATM 5922 P  PB  . FPP E 5 .   ? 25.042  130.357 3.016   1.00 15.34 ? 1002 FPP B PB  1 
HETATM 5923 O  O1B . FPP E 5 .   ? 26.160  130.941 3.826   1.00 14.76 ? 1002 FPP B O1B 1 
HETATM 5924 O  O2B . FPP E 5 .   ? 25.516  129.255 2.046   1.00 14.77 ? 1002 FPP B O2B 1 
HETATM 5925 O  O3B . FPP E 5 .   ? 23.897  129.808 3.900   1.00 15.53 ? 1002 FPP B O3B 1 
HETATM 5926 C  C1  . BNE F 6 .   ? 14.597  135.511 -4.694  1.00 15.35 ? 1003 BNE B C1  1 
HETATM 5927 C  C2  . BNE F 6 .   ? 14.429  134.033 -4.084  1.00 15.24 ? 1003 BNE B C2  1 
HETATM 5928 C  C3  . BNE F 6 .   ? 16.133  135.944 -4.955  1.00 15.89 ? 1003 BNE B C3  1 
HETATM 5929 C  C4  . BNE F 6 .   ? 13.697  135.574 -6.021  1.00 15.65 ? 1003 BNE B C4  1 
HETATM 5930 C  C5  . BNE F 6 .   ? 14.015  136.601 -3.696  1.00 15.85 ? 1003 BNE B C5  1 
HETATM 5931 C  C6  . BNE F 6 .   ? 15.556  133.353 -3.559  1.00 14.35 ? 1003 BNE B C6  1 
HETATM 5932 C  C7  . BNE F 6 .   ? 13.174  133.326 -4.008  1.00 14.73 ? 1003 BNE B C7  1 
HETATM 5933 N  N8  . BNE F 6 .   ? 16.925  135.299 -5.954  1.00 15.88 ? 1003 BNE B N8  1 
HETATM 5934 O  O9  . BNE F 6 .   ? 16.639  136.858 -4.270  1.00 16.15 ? 1003 BNE B O9  1 
HETATM 5935 C  C10 . BNE F 6 .   ? 13.980  134.578 -7.170  1.00 15.72 ? 1003 BNE B C10 1 
HETATM 5936 C  C11 . BNE F 6 .   ? 14.407  136.469 -2.208  1.00 15.67 ? 1003 BNE B C11 1 
HETATM 5937 C  C12 . BNE F 6 .   ? 15.498  132.044 -2.981  1.00 15.73 ? 1003 BNE B C12 1 
HETATM 5938 C  C13 . BNE F 6 .   ? 13.095  132.015 -3.437  1.00 16.01 ? 1003 BNE B C13 1 
HETATM 5939 C  C14 . BNE F 6 .   ? 16.498  134.245 -6.883  1.00 15.37 ? 1003 BNE B C14 1 
HETATM 5940 C  C15 . BNE F 6 .   ? 18.316  135.722 -6.137  1.00 16.37 ? 1003 BNE B C15 1 
HETATM 5941 C  C16 . BNE F 6 .   ? 15.369  134.703 -7.799  1.00 15.24 ? 1003 BNE B C16 1 
HETATM 5942 O  O17 . BNE F 6 .   ? 16.682  131.431 -2.475  1.00 15.40 ? 1003 BNE B O17 1 
HETATM 5943 C  C18 . BNE F 6 .   ? 14.255  131.373 -2.924  1.00 15.46 ? 1003 BNE B C18 1 
HETATM 5944 C  C19 . BNE F 6 .   ? 17.832  132.248 -2.391  1.00 15.95 ? 1003 BNE B C19 1 
HETATM 5945 C  C20 . BNE F 6 .   ? 18.801  132.361 -3.446  1.00 15.68 ? 1003 BNE B C20 1 
HETATM 5946 C  C21 . BNE F 6 .   ? 18.007  132.998 -1.194  1.00 15.56 ? 1003 BNE B C21 1 
HETATM 5947 C  C22 . BNE F 6 .   ? 19.921  133.212 -3.275  1.00 16.21 ? 1003 BNE B C22 1 
HETATM 5948 C  C23 . BNE F 6 .   ? 18.625  131.708 -4.709  1.00 15.63 ? 1003 BNE B C23 1 
HETATM 5949 C  C24 . BNE F 6 .   ? 19.127  133.870 -1.009  1.00 16.03 ? 1003 BNE B C24 1 
HETATM 5950 C  C25 . BNE F 6 .   ? 20.083  133.957 -2.078  1.00 15.97 ? 1003 BNE B C25 1 
HETATM 5951 N  N26 . BNE F 6 .   ? 18.422  131.206 -5.728  1.00 16.62 ? 1003 BNE B N26 1 
HETATM 5952 C  C27 . BNE F 6 .   ? 19.322  134.693 0.293   1.00 15.87 ? 1003 BNE B C27 1 
HETATM 5953 C  C28 . BNE F 6 .   ? 19.308  133.839 1.561   1.00 15.79 ? 1003 BNE B C28 1 
HETATM 5954 C  C29 . BNE F 6 .   ? 18.219  135.794 0.425   1.00 16.39 ? 1003 BNE B C29 1 
HETATM 5955 N  N30 . BNE F 6 .   ? 20.633  135.348 0.253   1.00 15.75 ? 1003 BNE B N30 1 
HETATM 5956 N  N31 . BNE F 6 .   ? 20.094  132.724 1.793   1.00 15.28 ? 1003 BNE B N31 1 
HETATM 5957 C  C32 . BNE F 6 .   ? 18.549  133.946 2.728   1.00 14.44 ? 1003 BNE B C32 1 
HETATM 5958 C  C33 . BNE F 6 .   ? 19.752  132.271 3.023   1.00 15.05 ? 1003 BNE B C33 1 
HETATM 5959 C  C34 . BNE F 6 .   ? 21.108  132.052 0.994   1.00 16.62 ? 1003 BNE B C34 1 
HETATM 5960 N  NZ  . BNE F 6 .   ? 18.825  132.969 3.643   1.00 15.56 ? 1003 BNE B NZ  1 
HETATM 5961 O  O   . HOH G 7 .   ? 12.508  141.793 -14.493 1.00 16.00 ? 1004 HOH A O   1 
HETATM 5962 O  O   . HOH G 7 .   ? 34.369  125.242 -5.207  1.00 21.51 ? 1007 HOH A O   1 
HETATM 5963 O  O   . HOH G 7 .   ? 38.806  138.371 -18.767 1.00 21.08 ? 1008 HOH A O   1 
HETATM 5964 O  O   . HOH G 7 .   ? 15.086  159.110 -11.547 1.00 19.70 ? 1011 HOH A O   1 
HETATM 5965 O  O   . HOH G 7 .   ? 44.703  129.090 -11.029 1.00 19.63 ? 1016 HOH A O   1 
HETATM 5966 O  O   . HOH G 7 .   ? 16.595  169.933 -16.780 1.00 44.21 ? 1020 HOH A O   1 
HETATM 5967 O  O   . HOH G 7 .   ? 30.866  149.973 -23.647 1.00 26.27 ? 1021 HOH A O   1 
HETATM 5968 O  O   . HOH G 7 .   ? 46.595  115.857 -9.026  1.00 27.45 ? 1025 HOH A O   1 
HETATM 5969 O  O   . HOH G 7 .   ? 21.913  159.440 -15.118 1.00 18.73 ? 1027 HOH A O   1 
HETATM 5970 O  O   . HOH G 7 .   ? 22.371  139.036 -16.089 1.00 11.60 ? 1028 HOH A O   1 
HETATM 5971 O  O   . HOH G 7 .   ? 7.092   145.834 -13.691 1.00 16.85 ? 1029 HOH A O   1 
HETATM 5972 O  O   . HOH G 7 .   ? 29.578  144.592 -29.025 1.00 35.58 ? 1031 HOH A O   1 
HETATM 5973 O  O   . HOH G 7 .   ? 31.381  123.898 -12.356 1.00 19.76 ? 1033 HOH A O   1 
HETATM 5974 O  O   . HOH G 7 .   ? 31.795  130.418 7.489   1.00 16.89 ? 1034 HOH A O   1 
HETATM 5975 O  O   . HOH G 7 .   ? 8.319   151.601 -10.817 1.00 21.40 ? 1035 HOH A O   1 
HETATM 5976 O  O   . HOH G 7 .   ? 4.569   147.945 -6.720  1.00 21.87 ? 1036 HOH A O   1 
HETATM 5977 O  O   . HOH G 7 .   ? -0.835  145.064 -7.649  1.00 26.08 ? 1037 HOH A O   1 
HETATM 5978 O  O   . HOH G 7 .   ? 20.451  158.133 -28.056 1.00 24.45 ? 1039 HOH A O   1 
HETATM 5979 O  O   . HOH G 7 .   ? 40.856  132.638 2.618   1.00 20.88 ? 1040 HOH A O   1 
HETATM 5980 O  O   . HOH G 7 .   ? 46.822  122.974 -10.698 1.00 22.49 ? 1041 HOH A O   1 
HETATM 5981 O  O   . HOH G 7 .   ? 17.825  112.559 15.131  1.00 27.57 ? 1044 HOH A O   1 
HETATM 5982 O  O   . HOH G 7 .   ? 30.519  126.540 -13.265 1.00 19.11 ? 1046 HOH A O   1 
HETATM 5983 O  O   . HOH G 7 .   ? 23.534  106.943 4.605   1.00 19.48 ? 1047 HOH A O   1 
HETATM 5984 O  O   . HOH G 7 .   ? 19.942  161.434 -20.346 1.00 21.22 ? 1048 HOH A O   1 
HETATM 5985 O  O   . HOH G 7 .   ? 8.443   158.948 -9.984  1.00 34.50 ? 1054 HOH A O   1 
HETATM 5986 O  O   . HOH G 7 .   ? 32.720  98.870  18.067  1.00 31.93 ? 1057 HOH A O   1 
HETATM 5987 O  O   . HOH G 7 .   ? 43.939  127.107 8.230   1.00 17.05 ? 1063 HOH A O   1 
HETATM 5988 O  O   . HOH G 7 .   ? 45.293  128.076 -13.380 1.00 20.93 ? 1065 HOH A O   1 
HETATM 5989 O  O   . HOH G 7 .   ? 21.355  158.466 -18.726 1.00 32.49 ? 1066 HOH A O   1 
HETATM 5990 O  O   . HOH G 7 .   ? 44.253  133.212 -8.793  1.00 21.47 ? 1069 HOH A O   1 
HETATM 5991 O  O   . HOH G 7 .   ? 42.039  135.211 -3.240  1.00 21.92 ? 1070 HOH A O   1 
HETATM 5992 O  O   . HOH G 7 .   ? 35.212  114.825 20.111  1.00 29.78 ? 1077 HOH A O   1 
HETATM 5993 O  O   . HOH G 7 .   ? 32.248  102.944 0.781   1.00 19.30 ? 1084 HOH A O   1 
HETATM 5994 O  O   . HOH G 7 .   ? 42.427  135.492 -0.444  1.00 29.74 ? 1085 HOH A O   1 
HETATM 5995 O  O   . HOH G 7 .   ? 41.696  95.970  -0.899  1.00 20.96 ? 1087 HOH A O   1 
HETATM 5996 O  O   . HOH G 7 .   ? 24.841  115.787 18.598  1.00 17.50 ? 1090 HOH A O   1 
HETATM 5997 O  O   . HOH G 7 .   ? 44.620  100.561 2.784   1.00 21.61 ? 1096 HOH A O   1 
HETATM 5998 O  O   . HOH G 7 .   ? 19.231  138.819 -17.223 1.00 21.35 ? 1099 HOH A O   1 
HETATM 5999 O  O   . HOH G 7 .   ? 11.993  164.377 -20.285 1.00 22.90 ? 1101 HOH A O   1 
HETATM 6000 O  O   . HOH G 7 .   ? 39.932  129.836 2.616   1.00 15.65 ? 1105 HOH A O   1 
HETATM 6001 O  O   . HOH G 7 .   ? 5.108   152.086 -10.248 1.00 41.75 ? 1106 HOH A O   1 
HETATM 6002 O  O   . HOH G 7 .   ? 25.591  152.312 -19.520 1.00 27.99 ? 1107 HOH A O   1 
HETATM 6003 O  O   . HOH G 7 .   ? 8.977   160.733 -13.485 1.00 22.38 ? 1110 HOH A O   1 
HETATM 6004 O  O   . HOH G 7 .   ? 47.999  129.979 -7.907  1.00 34.03 ? 1112 HOH A O   1 
HETATM 6005 O  O   . HOH G 7 .   ? 41.104  132.101 8.496   1.00 22.19 ? 1113 HOH A O   1 
HETATM 6006 O  O   . HOH G 7 .   ? 45.981  118.127 -10.210 1.00 31.11 ? 1117 HOH A O   1 
HETATM 6007 O  O   . HOH G 7 .   ? 31.770  113.009 2.518   1.00 16.58 ? 1123 HOH A O   1 
HETATM 6008 O  O   . HOH G 7 .   ? 29.944  114.438 7.605   1.00 29.01 ? 1124 HOH A O   1 
HETATM 6009 O  O   . HOH G 7 .   ? 41.296  119.385 8.910   1.00 20.21 ? 1131 HOH A O   1 
HETATM 6010 O  O   . HOH G 7 .   ? 28.707  132.347 -11.170 1.00 23.83 ? 1138 HOH A O   1 
HETATM 6011 O  O   . HOH G 7 .   ? 40.490  142.387 -1.930  1.00 32.98 ? 1142 HOH A O   1 
HETATM 6012 O  O   . HOH G 7 .   ? 30.726  124.189 -23.035 1.00 51.90 ? 1143 HOH A O   1 
HETATM 6013 O  O   . HOH G 7 .   ? 32.586  117.878 16.904  1.00 30.05 ? 1149 HOH A O   1 
HETATM 6014 O  O   . HOH G 7 .   ? 32.935  142.417 -2.914  1.00 30.30 ? 1150 HOH A O   1 
HETATM 6015 O  O   . HOH G 7 .   ? 17.865  98.117  16.408  1.00 31.83 ? 1153 HOH A O   1 
HETATM 6016 O  O   . HOH G 7 .   ? 40.413  105.942 -7.045  1.00 31.02 ? 1160 HOH A O   1 
HETATM 6017 O  O   . HOH G 7 .   ? 15.882  138.587 -9.814  1.00 11.31 ? 1167 HOH A O   1 
HETATM 6018 O  O   . HOH G 7 .   ? 29.322  132.553 -13.830 1.00 21.43 ? 1171 HOH A O   1 
HETATM 6019 O  O   . HOH G 7 .   ? 25.642  141.375 -2.906  1.00 20.12 ? 1174 HOH A O   1 
HETATM 6020 O  O   . HOH G 7 .   ? 18.235  144.569 -5.902  1.00 26.00 ? 1177 HOH A O   1 
HETATM 6021 O  O   . HOH G 7 .   ? 48.847  124.428 -9.247  1.00 24.54 ? 1180 HOH A O   1 
HETATM 6022 O  O   . HOH G 7 .   ? 18.118  135.085 -13.406 1.00 21.87 ? 1181 HOH A O   1 
HETATM 6023 O  O   . HOH G 7 .   ? 30.353  137.727 -1.147  1.00 25.00 ? 1182 HOH A O   1 
HETATM 6024 O  O   . HOH G 7 .   ? 35.641  122.966 12.954  1.00 19.94 ? 1188 HOH A O   1 
HETATM 6025 O  O   . HOH G 7 .   ? 38.694  135.558 4.604   1.00 29.35 ? 1193 HOH A O   1 
HETATM 6026 O  O   . HOH G 7 .   ? 40.283  134.664 0.959   1.00 27.26 ? 1194 HOH A O   1 
HETATM 6027 O  O   . HOH G 7 .   ? 38.612  113.670 15.010  1.00 30.97 ? 1196 HOH A O   1 
HETATM 6028 O  O   . HOH G 7 .   ? 26.134  132.032 -10.066 1.00 28.28 ? 1202 HOH A O   1 
HETATM 6029 O  O   . HOH G 7 .   ? 15.353  106.091 12.735  1.00 24.01 ? 1204 HOH A O   1 
HETATM 6030 O  O   . HOH G 7 .   ? 39.657  117.395 10.048  1.00 19.04 ? 1205 HOH A O   1 
HETATM 6031 O  O   . HOH G 7 .   ? 37.741  144.963 -16.463 1.00 30.71 ? 1208 HOH A O   1 
HETATM 6032 O  O   . HOH G 7 .   ? 32.778  151.793 -14.950 1.00 41.26 ? 1211 HOH A O   1 
HETATM 6033 O  O   . HOH G 7 .   ? 28.259  112.427 4.856   1.00 31.72 ? 1213 HOH A O   1 
HETATM 6034 O  O   . HOH G 7 .   ? 16.058  101.302 16.069  1.00 14.85 ? 1228 HOH A O   1 
HETATM 6035 O  O   . HOH G 7 .   ? 20.598  141.575 -5.166  1.00 40.43 ? 1233 HOH A O   1 
HETATM 6036 O  O   . HOH G 7 .   ? 38.751  149.880 -22.042 1.00 57.49 ? 1238 HOH A O   1 
HETATM 6037 O  O   . HOH G 7 .   ? 42.589  134.833 -15.881 1.00 18.15 ? 1242 HOH A O   1 
HETATM 6038 O  O   . HOH G 7 .   ? 25.843  132.132 -16.428 1.00 29.36 ? 1243 HOH A O   1 
HETATM 6039 O  O   . HOH G 7 .   ? 24.718  150.552 -12.676 1.00 22.71 ? 1244 HOH A O   1 
HETATM 6040 O  O   . HOH G 7 .   ? 8.391   81.004  8.567   1.00 24.89 ? 1248 HOH A O   1 
HETATM 6041 O  O   . HOH G 7 .   ? 37.417  131.380 5.096   1.00 19.86 ? 1250 HOH A O   1 
HETATM 6042 O  O   . HOH G 7 .   ? 36.062  135.117 3.927   1.00 20.75 ? 1251 HOH A O   1 
HETATM 6043 O  O   . HOH G 7 .   ? 46.655  104.828 -3.824  1.00 22.97 ? 1254 HOH A O   1 
HETATM 6044 O  O   . HOH G 7 .   ? 8.793   147.270 -15.341 1.00 26.05 ? 1258 HOH A O   1 
HETATM 6045 O  O   . HOH G 7 .   ? 45.138  135.288 -10.291 1.00 33.05 ? 1265 HOH A O   1 
HETATM 6046 O  O   . HOH G 7 .   ? 38.726  146.274 -14.090 1.00 36.66 ? 1267 HOH A O   1 
HETATM 6047 O  O   . HOH G 7 .   ? 41.720  102.717 -5.519  1.00 37.73 ? 1272 HOH A O   1 
HETATM 6048 O  O   . HOH G 7 .   ? 47.387  120.220 -10.834 1.00 31.41 ? 1276 HOH A O   1 
HETATM 6049 O  O   . HOH G 7 .   ? 46.573  132.837 -2.646  1.00 41.83 ? 1286 HOH A O   1 
HETATM 6050 O  O   . HOH G 7 .   ? 44.738  135.661 -4.071  1.00 29.56 ? 1292 HOH A O   1 
HETATM 6051 O  O   . HOH G 7 .   ? 23.808  155.566 -11.867 1.00 41.52 ? 1293 HOH A O   1 
HETATM 6052 O  O   . HOH G 7 .   ? 42.558  145.417 -14.988 1.00 49.59 ? 1296 HOH A O   1 
HETATM 6053 O  O   . HOH G 7 .   ? 6.918   161.055 -15.345 1.00 34.88 ? 1303 HOH A O   1 
HETATM 6054 O  O   . HOH G 7 .   ? 20.291  138.205 -8.368  1.00 20.08 ? 1310 HOH A O   1 
HETATM 6055 O  O   . HOH G 7 .   ? 19.671  139.093 -5.991  1.00 13.74 ? 1313 HOH A O   1 
HETATM 6056 O  O   . HOH G 7 .   ? 18.859  100.808 15.594  1.00 20.42 ? 1318 HOH A O   1 
HETATM 6057 O  O   . HOH G 7 .   ? 21.681  87.410  9.457   1.00 40.26 ? 1324 HOH A O   1 
HETATM 6058 O  O   . HOH G 7 .   ? 25.914  97.497  4.644   1.00 29.37 ? 1325 HOH A O   1 
HETATM 6059 O  O   . HOH G 7 .   ? 29.645  107.547 0.819   1.00 21.09 ? 1329 HOH A O   1 
HETATM 6060 O  O   . HOH G 7 .   ? 17.977  97.643  4.069   1.00 37.17 ? 1330 HOH A O   1 
HETATM 6061 O  O   . HOH G 7 .   ? 26.905  89.928  15.071  1.00 29.55 ? 1331 HOH A O   1 
HETATM 6062 O  O   . HOH G 7 .   ? 44.854  139.232 -14.574 1.00 34.40 ? 1333 HOH A O   1 
HETATM 6063 O  O   . HOH G 7 .   ? 35.034  132.812 4.895   1.00 16.83 ? 1335 HOH A O   1 
HETATM 6064 O  O   . HOH G 7 .   ? 29.903  100.901 -4.970  1.00 51.76 ? 1336 HOH A O   1 
HETATM 6065 O  O   . HOH G 7 .   ? 33.250  111.878 6.581   1.00 32.13 ? 1338 HOH A O   1 
HETATM 6066 O  O   . HOH G 7 .   ? 27.281  100.787 22.163  1.00 36.80 ? 1341 HOH A O   1 
HETATM 6067 O  O   . HOH G 7 .   ? 25.815  82.675  15.423  1.00 49.09 ? 1342 HOH A O   1 
HETATM 6068 O  O   . HOH G 7 .   ? 25.847  132.220 -21.145 1.00 37.75 ? 1347 HOH A O   1 
HETATM 6069 O  O   . HOH G 7 .   ? 13.480  159.830 -4.874  1.00 25.67 ? 1352 HOH A O   1 
HETATM 6070 O  O   . HOH G 7 .   ? 39.468  132.952 4.897   1.00 20.99 ? 1354 HOH A O   1 
HETATM 6071 O  O   . HOH G 7 .   ? 38.064  142.516 -14.399 1.00 21.84 ? 1357 HOH A O   1 
HETATM 6072 O  O   . HOH G 7 .   ? 11.328  146.006 -15.238 1.00 20.53 ? 1359 HOH A O   1 
HETATM 6073 O  O   . HOH G 7 .   ? 23.075  135.109 -3.931  1.00 34.67 ? 1360 HOH A O   1 
HETATM 6074 O  O   . HOH G 7 .   ? 19.755  110.502 22.004  1.00 31.79 ? 1365 HOH A O   1 
HETATM 6075 O  O   . HOH G 7 .   ? 31.899  121.185 12.561  1.00 18.39 ? 1367 HOH A O   1 
HETATM 6076 O  O   . HOH G 7 .   ? 20.683  147.383 -6.984  1.00 20.98 ? 1369 HOH A O   1 
HETATM 6077 O  O   . HOH G 7 .   ? 30.007  102.756 3.697   1.00 24.89 ? 1370 HOH A O   1 
HETATM 6078 O  O   . HOH G 7 .   ? 4.544   153.742 -12.538 1.00 24.20 ? 1371 HOH A O   1 
HETATM 6079 O  O   . HOH G 7 .   ? 23.616  133.885 -22.369 1.00 45.47 ? 1379 HOH A O   1 
HETATM 6080 O  O   . HOH G 7 .   ? 7.042   162.614 -17.987 1.00 33.36 ? 1381 HOH A O   1 
HETATM 6081 O  O   . HOH G 7 .   ? 50.320  119.615 -0.908  1.00 51.52 ? 1382 HOH A O   1 
HETATM 6082 O  O   . HOH G 7 .   ? 46.065  131.335 -9.696  1.00 30.48 ? 1383 HOH A O   1 
HETATM 6083 O  O   . HOH G 7 .   ? 39.294  105.975 -4.383  1.00 28.49 ? 1386 HOH A O   1 
HETATM 6084 O  O   . HOH G 7 .   ? 3.423   147.846 -16.558 1.00 39.34 ? 1389 HOH A O   1 
HETATM 6085 O  O   . HOH G 7 .   ? 29.103  130.152 -14.768 1.00 32.85 ? 1393 HOH A O   1 
HETATM 6086 O  O   . HOH G 7 .   ? 48.753  120.122 -2.851  1.00 32.29 ? 1398 HOH A O   1 
HETATM 6087 O  O   . HOH G 7 .   ? 38.990  100.370 5.321   1.00 21.55 ? 1404 HOH A O   1 
HETATM 6088 O  O   . HOH G 7 .   ? 43.569  136.867 -14.238 1.00 23.87 ? 1405 HOH A O   1 
HETATM 6089 O  O   . HOH G 7 .   ? 32.937  110.956 9.308   1.00 17.38 ? 1412 HOH A O   1 
HETATM 6090 O  O   . HOH G 7 .   ? 35.112  108.268 -4.698  1.00 22.72 ? 1414 HOH A O   1 
HETATM 6091 O  O   . HOH G 7 .   ? 29.960  149.854 -21.144 1.00 26.87 ? 1417 HOH A O   1 
HETATM 6092 O  O   . HOH G 7 .   ? 18.138  137.026 -9.675  1.00 17.14 ? 1421 HOH A O   1 
HETATM 6093 O  O   . HOH G 7 .   ? 24.650  91.424  15.749  1.00 25.20 ? 1423 HOH A O   1 
HETATM 6094 O  O   . HOH G 7 .   ? 6.027   156.072 -24.674 1.00 34.24 ? 1428 HOH A O   1 
HETATM 6095 O  O   . HOH G 7 .   ? 33.407  120.310 14.604  1.00 25.89 ? 1439 HOH A O   1 
HETATM 6096 O  O   . HOH G 7 .   ? 19.631  89.935  7.620   1.00 32.85 ? 1443 HOH A O   1 
HETATM 6097 O  O   . HOH G 7 .   ? 9.536   162.744 -21.564 1.00 27.01 ? 1445 HOH A O   1 
HETATM 6098 O  O   . HOH G 7 .   ? 8.355   82.578  11.209  1.00 30.38 ? 1447 HOH A O   1 
HETATM 6099 O  O   . HOH G 7 .   ? 20.222  158.370 -21.219 1.00 36.11 ? 1450 HOH A O   1 
HETATM 6100 O  O   . HOH G 7 .   ? 35.277  99.517  16.377  1.00 31.83 ? 1453 HOH A O   1 
HETATM 6101 O  O   . HOH G 7 .   ? 23.657  99.964  5.795   1.00 46.14 ? 1454 HOH A O   1 
HETATM 6102 O  O   . HOH G 7 .   ? 12.415  163.766 -6.561  1.00 27.70 ? 1455 HOH A O   1 
HETATM 6103 O  O   . HOH G 7 .   ? 23.419  91.302  2.319   1.00 44.10 ? 1459 HOH A O   1 
HETATM 6104 O  O   . HOH G 7 .   ? 45.580  134.465 -6.528  1.00 31.09 ? 1461 HOH A O   1 
HETATM 6105 O  O   . HOH G 7 .   ? 27.520  112.202 11.700  1.00 44.55 ? 1462 HOH A O   1 
HETATM 6106 O  O   . HOH G 7 .   ? 34.693  91.025  19.544  1.00 49.04 ? 1471 HOH A O   1 
HETATM 6107 O  O   . HOH G 7 .   ? 43.441  108.967 -12.693 1.00 31.92 ? 1474 HOH A O   1 
HETATM 6108 O  O   . HOH G 7 .   ? 22.458  104.589 4.319   1.00 30.97 ? 1476 HOH A O   1 
HETATM 6109 O  O   . HOH G 7 .   ? 20.869  142.947 -30.349 1.00 32.71 ? 1481 HOH A O   1 
HETATM 6110 O  O   . HOH G 7 .   ? 32.077  133.641 4.042   1.00 35.80 ? 1482 HOH A O   1 
HETATM 6111 O  O   . HOH G 7 .   ? 43.535  139.298 -7.159  1.00 30.92 ? 1484 HOH A O   1 
HETATM 6112 O  O   . HOH G 7 .   ? 37.870  96.344  13.936  1.00 43.72 ? 1485 HOH A O   1 
HETATM 6113 O  O   . HOH G 7 .   ? 33.644  132.478 7.173   1.00 34.32 ? 1493 HOH A O   1 
HETATM 6114 O  O   . HOH G 7 .   ? 7.408   147.988 -20.805 1.00 37.18 ? 1497 HOH A O   1 
HETATM 6115 O  O   . HOH G 7 .   ? 46.971  121.471 15.535  1.00 33.42 ? 1500 HOH A O   1 
HETATM 6116 O  O   . HOH G 7 .   ? 4.073   156.911 -12.863 1.00 35.18 ? 1507 HOH A O   1 
HETATM 6117 O  O   . HOH G 7 .   ? 33.737  118.267 -12.500 1.00 34.65 ? 1510 HOH A O   1 
HETATM 6118 O  O   . HOH G 7 .   ? 29.615  105.260 -3.458  1.00 33.19 ? 1517 HOH A O   1 
HETATM 6119 O  O   . HOH G 7 .   ? 17.429  98.619  1.606   1.00 35.94 ? 1519 HOH A O   1 
HETATM 6120 O  O   . HOH G 7 .   ? 38.874  145.638 -19.662 1.00 31.11 ? 1527 HOH A O   1 
HETATM 6121 O  O   . HOH G 7 .   ? 23.128  84.438  8.799   1.00 42.38 ? 1529 HOH A O   1 
HETATM 6122 O  O   . HOH G 7 .   ? -7.501  147.723 -1.136  1.00 47.95 ? 1538 HOH A O   1 
HETATM 6123 O  O   . HOH G 7 .   ? 44.907  133.274 -16.482 1.00 34.90 ? 1545 HOH A O   1 
HETATM 6124 O  O   . HOH G 7 .   ? 25.716  98.352  22.196  1.00 47.51 ? 1550 HOH A O   1 
HETATM 6125 O  O   . HOH G 7 .   ? 40.658  99.639  -8.678  1.00 36.92 ? 1553 HOH A O   1 
HETATM 6126 O  O   . HOH G 7 .   ? 41.913  141.193 -13.183 1.00 43.39 ? 1559 HOH A O   1 
HETATM 6127 O  O   . HOH G 7 .   ? 42.352  96.272  8.150   1.00 43.16 ? 1560 HOH A O   1 
HETATM 6128 O  O   . HOH G 7 .   ? 21.066  90.864  11.626  1.00 27.82 ? 1565 HOH A O   1 
HETATM 6129 O  O   . HOH G 7 .   ? 24.294  82.766  7.254   1.00 44.27 ? 1571 HOH A O   1 
HETATM 6130 O  O   . HOH G 7 .   ? 39.191  110.098 -10.982 1.00 34.67 ? 1572 HOH A O   1 
HETATM 6131 O  O   . HOH G 7 .   ? 38.041  111.966 -13.199 1.00 35.90 ? 1577 HOH A O   1 
HETATM 6132 O  O   . HOH G 7 .   ? 22.739  99.719  17.344  1.00 31.10 ? 1578 HOH A O   1 
HETATM 6133 O  O   . HOH G 7 .   ? -1.176  162.148 -18.696 1.00 56.09 ? 1585 HOH A O   1 
HETATM 6134 O  O   . HOH G 7 .   ? 38.674  97.691  6.012   1.00 25.53 ? 1588 HOH A O   1 
HETATM 6135 O  O   . HOH G 7 .   ? 14.763  99.140  16.363  1.00 24.54 ? 1590 HOH A O   1 
HETATM 6136 O  O   . HOH G 7 .   ? 24.990  97.193  19.877  1.00 32.40 ? 1593 HOH A O   1 
HETATM 6137 O  O   . HOH G 7 .   ? 26.406  105.480 7.593   1.00 23.77 ? 1594 HOH A O   1 
HETATM 6138 O  O   . HOH G 7 .   ? 7.543   158.545 -12.417 1.00 24.92 ? 1598 HOH A O   1 
HETATM 6139 O  O   . HOH G 7 .   ? 30.941  109.625 8.110   1.00 26.24 ? 1599 HOH A O   1 
HETATM 6140 O  O   . HOH G 7 .   ? 36.606  106.010 -4.854  1.00 30.57 ? 1601 HOH A O   1 
HETATM 6141 O  O   . HOH G 7 .   ? 39.176  140.893 -20.260 1.00 34.96 ? 1603 HOH A O   1 
HETATM 6142 O  O   . HOH G 7 .   ? 25.974  154.307 -29.004 1.00 36.31 ? 1607 HOH A O   1 
HETATM 6143 O  O   . HOH G 7 .   ? 5.165   147.832 -19.260 1.00 30.11 ? 1613 HOH A O   1 
HETATM 6144 O  O   . HOH G 7 .   ? 50.458  127.954 -0.011  1.00 45.40 ? 1618 HOH A O   1 
HETATM 6145 O  O   . HOH G 7 .   ? 45.859  135.215 -13.091 1.00 41.19 ? 1620 HOH A O   1 
HETATM 6146 O  O   . HOH G 7 .   ? 20.028  104.562 2.543   1.00 41.89 ? 1621 HOH A O   1 
HETATM 6147 O  O   . HOH G 7 .   ? 8.832   167.525 -12.938 1.00 40.51 ? 1624 HOH A O   1 
HETATM 6148 O  O   . HOH G 7 .   ? 23.397  86.543  7.775   1.00 27.59 ? 1638 HOH A O   1 
HETATM 6149 O  O   . HOH G 7 .   ? 47.986  103.740 -10.907 1.00 45.55 ? 1640 HOH A O   1 
HETATM 6150 O  O   . HOH G 7 .   ? 35.994  109.651 -7.069  1.00 47.41 ? 1646 HOH A O   1 
HETATM 6151 O  O   . HOH G 7 .   ? 26.050  113.317 25.076  1.00 34.98 ? 1648 HOH A O   1 
HETATM 6152 O  O   . HOH G 7 .   ? 32.759  86.883  13.073  1.00 37.83 ? 1650 HOH A O   1 
HETATM 6153 O  O   . HOH G 7 .   ? 18.198  136.306 -26.075 1.00 48.77 ? 1657 HOH A O   1 
HETATM 6154 O  O   . HOH G 7 .   ? 4.793   80.227  10.109  1.00 38.17 ? 1662 HOH A O   1 
HETATM 6155 O  O   . HOH G 7 .   ? 24.392  88.355  4.589   1.00 46.48 ? 1665 HOH A O   1 
HETATM 6156 O  O   . HOH G 7 .   ? 46.645  127.117 -16.866 1.00 40.66 ? 1670 HOH A O   1 
HETATM 6157 O  O   . HOH G 7 .   ? 23.872  133.943 -12.593 1.00 25.65 ? 1685 HOH A O   1 
HETATM 6158 O  O   . HOH G 7 .   ? 18.819  137.366 -20.730 1.00 34.77 ? 1689 HOH A O   1 
HETATM 6159 O  O   . HOH G 7 .   ? 38.276  143.329 -20.781 1.00 28.42 ? 1692 HOH A O   1 
HETATM 6160 O  O   . HOH G 7 .   ? 26.698  133.013 -14.267 1.00 35.60 ? 1693 HOH A O   1 
HETATM 6161 O  O   . HOH G 7 .   ? 23.150  115.455 23.528  1.00 39.17 ? 1698 HOH A O   1 
HETATM 6162 O  O   . HOH G 7 .   ? 8.086   164.986 -18.463 1.00 43.80 ? 1700 HOH A O   1 
HETATM 6163 O  O   . HOH G 7 .   ? 33.009  123.738 -14.850 1.00 35.17 ? 1705 HOH A O   1 
HETATM 6164 O  O   . HOH G 7 .   ? 38.273  109.246 -6.007  1.00 34.38 ? 1707 HOH A O   1 
HETATM 6165 O  O   . HOH G 7 .   ? -4.763  143.387 -7.892  1.00 29.36 ? 1708 HOH A O   1 
HETATM 6166 O  O   . HOH G 7 .   ? 21.066  136.911 -4.533  1.00 33.76 ? 1716 HOH A O   1 
HETATM 6167 O  O   . HOH G 7 .   ? 39.915  142.772 -12.248 1.00 40.09 ? 1717 HOH A O   1 
HETATM 6168 O  O   . HOH G 7 .   ? 10.964  159.810 -3.113  1.00 29.63 ? 1718 HOH A O   1 
HETATM 6169 O  O   . HOH G 7 .   ? 29.293  135.281 3.335   1.00 42.79 ? 1719 HOH A O   1 
HETATM 6170 O  O   . HOH G 7 .   ? 17.189  147.754 -4.731  1.00 37.99 ? 1721 HOH A O   1 
HETATM 6171 O  O   . HOH G 7 .   ? 41.324  113.151 -16.190 1.00 49.10 ? 1729 HOH A O   1 
HETATM 6172 O  O   . HOH G 7 .   ? 15.250  158.406 -3.666  1.00 38.82 ? 1733 HOH A O   1 
HETATM 6173 O  O   . HOH G 7 .   ? 46.617  129.784 -14.726 1.00 43.87 ? 1739 HOH A O   1 
HETATM 6174 O  O   . HOH G 7 .   ? 36.102  151.835 -18.586 1.00 42.22 ? 1741 HOH A O   1 
HETATM 6175 O  O   . HOH G 7 .   ? 32.947  148.835 -7.203  1.00 31.72 ? 1746 HOH A O   1 
HETATM 6176 O  O   . HOH G 7 .   ? 2.575   150.792 -9.848  1.00 46.59 ? 1747 HOH A O   1 
HETATM 6177 O  O   . HOH G 7 .   ? 26.597  95.042  19.114  1.00 33.61 ? 1748 HOH A O   1 
HETATM 6178 O  O   . HOH G 7 .   ? 46.992  132.257 -12.029 1.00 41.67 ? 1759 HOH A O   1 
HETATM 6179 O  O   . HOH G 7 .   ? 50.863  125.952 -9.932  1.00 40.58 ? 1761 HOH A O   1 
HETATM 6180 O  O   . HOH G 7 .   ? 43.233  103.122 -9.382  1.00 35.90 ? 1762 HOH A O   1 
HETATM 6181 O  O   . HOH G 7 .   ? 40.738  132.404 -25.821 1.00 36.84 ? 1763 HOH A O   1 
HETATM 6182 O  O   . HOH G 7 .   ? 30.647  161.304 -14.442 1.00 54.68 ? 1777 HOH A O   1 
HETATM 6183 O  O   . HOH G 7 .   ? 28.839  120.400 10.431  1.00 43.43 ? 1793 HOH A O   1 
HETATM 6184 O  O   . HOH G 7 .   ? 13.584  108.146 11.398  1.00 29.32 ? 1799 HOH A O   1 
HETATM 6185 O  O   . HOH G 7 .   ? 26.567  129.965 -13.946 1.00 51.03 ? 1801 HOH A O   1 
HETATM 6186 O  O   . HOH G 7 .   ? 26.018  88.148  10.229  1.00 49.24 ? 1802 HOH A O   1 
HETATM 6187 O  O   . HOH G 7 .   ? 40.366  136.478 2.846   1.00 33.57 ? 1805 HOH A O   1 
HETATM 6188 O  O   . HOH G 7 .   ? 13.247  111.384 17.102  1.00 40.06 ? 1808 HOH A O   1 
HETATM 6189 O  O   . HOH G 7 .   ? 10.768  167.698 -11.117 1.00 44.10 ? 1809 HOH A O   1 
HETATM 6190 O  O   . HOH G 7 .   ? 23.957  156.321 -17.278 1.00 31.12 ? 1810 HOH A O   1 
HETATM 6191 O  O   . HOH G 7 .   ? 52.417  112.034 -0.026  1.00 44.34 ? 1816 HOH A O   1 
HETATM 6192 O  O   . HOH G 7 .   ? 5.853   80.854  7.714   1.00 30.66 ? 1818 HOH A O   1 
HETATM 6193 O  O   . HOH G 7 .   ? 37.994  106.861 -7.818  1.00 52.74 ? 1830 HOH A O   1 
HETATM 6194 O  O   . HOH G 7 .   ? 28.186  90.702  1.087   1.00 51.51 ? 1839 HOH A O   1 
HETATM 6195 O  O   . HOH G 7 .   ? 12.010  166.296 -7.128  1.00 37.23 ? 1840 HOH A O   1 
HETATM 6196 O  O   . HOH G 7 .   ? 21.529  101.878 4.640   1.00 51.44 ? 1850 HOH A O   1 
HETATM 6197 O  O   . HOH G 7 .   ? 44.902  131.020 9.098   1.00 39.77 ? 1857 HOH A O   1 
HETATM 6198 O  O   . HOH G 7 .   ? 49.180  119.635 16.007  1.00 42.32 ? 1861 HOH A O   1 
HETATM 6199 O  O   . HOH G 7 .   ? 38.431  139.394 -27.770 1.00 35.95 ? 1862 HOH A O   1 
HETATM 6200 O  O   . HOH G 7 .   ? 32.595  124.229 -20.239 1.00 47.28 ? 1886 HOH A O   1 
HETATM 6201 O  O   . HOH G 7 .   ? 30.635  118.836 11.839  1.00 48.72 ? 1897 HOH A O   1 
HETATM 6202 O  O   . HOH G 7 .   ? 3.433   151.629 -6.145  1.00 26.39 ? 1899 HOH A O   1 
HETATM 6203 O  O   . HOH G 7 .   ? 52.230  109.383 -3.583  1.00 31.59 ? 1903 HOH A O   1 
HETATM 6204 O  O   . HOH G 7 .   ? 8.124   80.514  13.255  1.00 42.35 ? 1905 HOH A O   1 
HETATM 6205 O  O   . HOH G 7 .   ? 36.246  98.844  -6.129  1.00 29.27 ? 1909 HOH A O   1 
HETATM 6206 O  O   . HOH G 7 .   ? 21.074  101.934 16.969  1.00 38.84 ? 1911 HOH A O   1 
HETATM 6207 O  O   . HOH G 7 .   ? 30.522  123.432 12.961  1.00 44.53 ? 1912 HOH A O   1 
HETATM 6208 O  O   . HOH G 7 .   ? 25.108  131.659 -12.416 1.00 35.67 ? 1913 HOH A O   1 
HETATM 6209 O  O   . HOH G 7 .   ? 45.417  102.725 -4.507  1.00 44.02 ? 1919 HOH A O   1 
HETATM 6210 O  O   . HOH G 7 .   ? 6.976   162.766 -25.592 1.00 46.95 ? 1920 HOH A O   1 
HETATM 6211 O  O   . HOH G 7 .   ? 50.147  127.475 -2.836  1.00 34.10 ? 1921 HOH A O   1 
HETATM 6212 O  O   . HOH G 7 .   ? 29.392  139.935 0.191   1.00 32.43 ? 1922 HOH A O   1 
HETATM 6213 O  O   . HOH G 7 .   ? 29.175  111.946 7.994   1.00 45.49 ? 1924 HOH A O   1 
HETATM 6214 O  O   . HOH G 7 .   ? 50.512  114.271 0.547   1.00 31.02 ? 1926 HOH A O   1 
HETATM 6215 O  O   . HOH G 7 .   ? 30.923  124.891 -16.185 1.00 51.82 ? 1928 HOH A O   1 
HETATM 6216 O  O   . HOH G 7 .   ? 34.771  111.016 20.301  1.00 43.41 ? 1929 HOH A O   1 
HETATM 6217 O  O   . HOH G 7 .   ? 11.767  106.584 14.813  1.00 34.45 ? 1930 HOH A O   1 
HETATM 6218 O  O   . HOH G 7 .   ? 21.482  156.602 -30.088 1.00 38.14 ? 1931 HOH A O   1 
HETATM 6219 O  O   . HOH G 7 .   ? 42.740  129.787 -22.894 1.00 36.02 ? 1933 HOH A O   1 
HETATM 6220 O  O   . HOH G 7 .   ? 20.389  149.263 -0.938  1.00 51.59 ? 1936 HOH A O   1 
HETATM 6221 O  O   . HOH G 7 .   ? 2.847   161.855 -27.507 1.00 42.07 ? 1938 HOH A O   1 
HETATM 6222 O  O   . HOH G 7 .   ? 15.726  151.258 -32.230 1.00 38.08 ? 1939 HOH A O   1 
HETATM 6223 O  O   . HOH G 7 .   ? 11.973  106.870 18.152  1.00 51.32 ? 1940 HOH A O   1 
HETATM 6224 O  O   . HOH G 7 .   ? 44.042  136.045 9.523   1.00 51.97 ? 1942 HOH A O   1 
HETATM 6225 O  O   . HOH G 7 .   ? 24.317  156.941 -14.752 1.00 37.52 ? 1943 HOH A O   1 
HETATM 6226 O  O   . HOH G 7 .   ? 21.685  143.084 -33.131 1.00 46.59 ? 1948 HOH A O   1 
HETATM 6227 O  O   . HOH G 7 .   ? 30.973  151.965 -12.873 1.00 44.49 ? 1949 HOH A O   1 
HETATM 6228 O  O   . HOH G 7 .   ? 14.190  105.282 15.356  1.00 38.53 ? 1950 HOH A O   1 
HETATM 6229 O  O   . HOH G 7 .   ? 45.197  134.854 -0.305  1.00 43.81 ? 1951 HOH A O   1 
HETATM 6230 O  O   . HOH G 7 .   ? 31.580  130.976 -25.714 1.00 49.21 ? 1952 HOH A O   1 
HETATM 6231 O  O   . HOH G 7 .   ? 14.582  162.230 -5.272  1.00 37.79 ? 1953 HOH A O   1 
HETATM 6232 O  O   . HOH G 7 .   ? 40.246  95.638  6.881   1.00 46.41 ? 1960 HOH A O   1 
HETATM 6233 O  O   . HOH G 7 .   ? 42.968  104.742 -7.273  1.00 45.59 ? 1961 HOH A O   1 
HETATM 6234 O  O   . HOH G 7 .   ? 19.574  146.725 -4.739  1.00 49.54 ? 1962 HOH A O   1 
HETATM 6235 O  O   . HOH G 7 .   ? 43.132  144.570 -9.525  1.00 57.87 ? 1963 HOH A O   1 
HETATM 6236 O  O   . HOH G 7 .   ? 44.673  107.326 -14.496 1.00 45.58 ? 1965 HOH A O   1 
HETATM 6237 O  O   . HOH G 7 .   ? 45.915  136.285 -17.125 1.00 47.45 ? 1966 HOH A O   1 
HETATM 6238 O  O   . HOH G 7 .   ? 31.080  85.335  11.565  1.00 52.84 ? 1967 HOH A O   1 
HETATM 6239 O  O   . HOH G 7 .   ? 37.369  104.363 22.408  1.00 56.85 ? 1968 HOH A O   1 
HETATM 6240 O  O   . HOH G 7 .   ? 34.578  145.343 -27.913 1.00 37.63 ? 1971 HOH A O   1 
HETATM 6241 O  O   . HOH G 7 .   ? 42.709  137.783 -36.431 1.00 57.94 ? 1974 HOH A O   1 
HETATM 6242 O  O   . HOH G 7 .   ? -1.832  150.926 -10.739 1.00 47.76 ? 1975 HOH A O   1 
HETATM 6243 O  O   . HOH G 7 .   ? 8.143   154.445 0.372   1.00 45.52 ? 1976 HOH A O   1 
HETATM 6244 O  O   . HOH G 7 .   ? 36.898  91.506  9.635   1.00 49.74 ? 1978 HOH A O   1 
HETATM 6245 O  O   . HOH G 7 .   ? 25.964  98.831  2.242   1.00 44.66 ? 1980 HOH A O   1 
HETATM 6246 O  O   . HOH G 7 .   ? 21.963  139.539 -1.962  1.00 49.62 ? 1982 HOH A O   1 
HETATM 6247 O  O   . HOH G 7 .   ? 45.149  127.602 -21.864 1.00 51.33 ? 1985 HOH A O   1 
HETATM 6248 O  O   . HOH G 7 .   ? 38.786  145.517 -4.639  1.00 42.49 ? 1988 HOH A O   1 
HETATM 6249 O  O   . HOH G 7 .   ? 20.838  110.716 24.808  1.00 42.40 ? 1991 HOH A O   1 
HETATM 6250 O  O   . HOH G 7 .   ? 19.656  140.538 -29.351 1.00 46.41 ? 1993 HOH A O   1 
HETATM 6251 O  O   . HOH G 7 .   ? 27.709  88.575  17.477  1.00 46.41 ? 1996 HOH A O   1 
HETATM 6252 O  O   . HOH G 7 .   ? 42.914  115.664 -18.149 1.00 47.05 ? 1998 HOH A O   1 
HETATM 6253 O  O   . HOH G 7 .   ? 51.484  113.243 -6.857  1.00 51.49 ? 2000 HOH A O   1 
HETATM 6254 O  O   . HOH G 7 .   ? 3.318   163.950 -24.620 1.00 34.21 ? 2003 HOH A O   1 
HETATM 6255 O  O   . HOH G 7 .   ? 3.444   155.868 -24.320 1.00 44.15 ? 2006 HOH A O   1 
HETATM 6256 O  O   . HOH G 7 .   ? 46.921  110.929 -14.485 1.00 43.58 ? 2007 HOH A O   1 
HETATM 6257 O  O   . HOH G 7 .   ? 16.742  166.677 -28.145 1.00 49.18 ? 2010 HOH A O   1 
HETATM 6258 O  O   . HOH G 7 .   ? 31.507  151.810 -26.962 1.00 42.44 ? 2011 HOH A O   1 
HETATM 6259 O  O   . HOH G 7 .   ? 28.086  152.099 -18.861 1.00 53.71 ? 2016 HOH A O   1 
HETATM 6260 O  O   . HOH G 7 .   ? 26.671  156.156 -17.676 1.00 56.34 ? 2019 HOH A O   1 
HETATM 6261 O  O   . HOH G 7 .   ? 21.331  160.494 -22.826 1.00 44.77 ? 2022 HOH A O   1 
HETATM 6262 O  O   . HOH G 7 .   ? 39.371  118.089 -17.928 1.00 46.17 ? 2027 HOH A O   1 
HETATM 6263 O  O   . HOH G 7 .   ? 45.953  138.564 -2.284  1.00 52.67 ? 2031 HOH A O   1 
HETATM 6264 O  O   . HOH G 7 .   ? 30.879  112.803 9.765   1.00 40.53 ? 2032 HOH A O   1 
HETATM 6265 O  O   . HOH G 7 .   ? 23.237  85.405  11.922  1.00 48.44 ? 2034 HOH A O   1 
HETATM 6266 O  O   . HOH G 7 .   ? 6.195   158.311 -26.251 1.00 46.67 ? 2036 HOH A O   1 
HETATM 6267 O  O   . HOH G 7 .   ? 35.352  148.188 -8.292  1.00 46.80 ? 2037 HOH A O   1 
HETATM 6268 O  O   . HOH G 7 .   ? -8.453  148.596 -3.714  1.00 50.80 ? 2038 HOH A O   1 
HETATM 6269 O  O   . HOH G 7 .   ? 34.518  149.864 -0.495  1.00 55.82 ? 2042 HOH A O   1 
HETATM 6270 O  O   . HOH G 7 .   ? 29.182  153.404 -29.151 1.00 48.95 ? 2044 HOH A O   1 
HETATM 6271 O  O   . HOH G 7 .   ? 38.663  142.948 -28.317 1.00 51.59 ? 2045 HOH A O   1 
HETATM 6272 O  O   . HOH G 7 .   ? 34.614  115.615 -12.125 1.00 49.19 ? 2046 HOH A O   1 
HETATM 6273 O  O   . HOH G 7 .   ? 34.772  146.216 -2.395  1.00 50.42 ? 2051 HOH A O   1 
HETATM 6274 O  O   . HOH G 7 .   ? 2.683   156.369 -21.804 1.00 44.12 ? 2052 HOH A O   1 
HETATM 6275 O  O   . HOH G 7 .   ? 23.190  88.572  13.282  1.00 41.87 ? 2053 HOH A O   1 
HETATM 6276 O  O   . HOH G 7 .   ? 45.532  123.920 -18.285 1.00 44.24 ? 2054 HOH A O   1 
HETATM 6277 O  O   . HOH G 7 .   ? 26.469  152.478 -12.164 1.00 50.44 ? 2058 HOH A O   1 
HETATM 6278 O  O   . HOH G 7 .   ? 43.030  90.459  23.385  1.00 56.23 ? 2062 HOH A O   1 
HETATM 6279 O  O   . HOH G 7 .   ? 30.775  128.786 -22.389 1.00 44.35 ? 2064 HOH A O   1 
HETATM 6280 O  O   . HOH H 7 .   ? 25.957  128.646 12.958  1.00 16.53 ? 1004 HOH B O   1 
HETATM 6281 O  O   . HOH H 7 .   ? 12.830  147.008 -10.745 1.00 19.39 ? 1005 HOH B O   1 
HETATM 6282 O  O   . HOH H 7 .   ? 17.361  125.791 10.252  1.00 11.09 ? 1006 HOH B O   1 
HETATM 6283 O  O   . HOH H 7 .   ? 5.861   123.184 17.622  1.00 13.24 ? 1007 HOH B O   1 
HETATM 6284 O  O   . HOH H 7 .   ? -5.235  124.064 -5.432  1.00 14.94 ? 1008 HOH B O   1 
HETATM 6285 O  O   . HOH H 7 .   ? 29.040  122.940 17.731  1.00 19.71 ? 1009 HOH B O   1 
HETATM 6286 O  O   . HOH H 7 .   ? 8.725   148.906 -11.425 1.00 17.66 ? 1010 HOH B O   1 
HETATM 6287 O  O   . HOH H 7 .   ? 9.622   142.925 6.373   1.00 31.61 ? 1011 HOH B O   1 
HETATM 6288 O  O   . HOH H 7 .   ? 37.836  122.157 14.814  1.00 14.72 ? 1012 HOH B O   1 
HETATM 6289 O  O   . HOH H 7 .   ? 12.457  135.070 -20.368 1.00 20.82 ? 1013 HOH B O   1 
HETATM 6290 O  O   . HOH H 7 .   ? 20.080  115.414 11.353  1.00 18.01 ? 1014 HOH B O   1 
HETATM 6291 O  O   . HOH H 7 .   ? 4.826   125.751 -8.651  1.00 13.04 ? 1015 HOH B O   1 
HETATM 6292 O  O   . HOH H 7 .   ? 4.079   119.408 6.921   1.00 12.24 ? 1016 HOH B O   1 
HETATM 6293 O  O   . HOH H 7 .   ? 28.368  115.626 5.238   1.00 14.62 ? 1017 HOH B O   1 
HETATM 6294 O  O   . HOH H 7 .   ? 1.712   131.128 -19.015 1.00 15.18 ? 1018 HOH B O   1 
HETATM 6295 O  O   . HOH H 7 .   ? 12.804  112.996 14.774  1.00 14.63 ? 1019 HOH B O   1 
HETATM 6296 O  O   . HOH H 7 .   ? 23.957  111.535 -14.773 1.00 20.56 ? 1020 HOH B O   1 
HETATM 6297 O  O   . HOH H 7 .   ? 23.889  123.920 25.988  1.00 30.29 ? 1021 HOH B O   1 
HETATM 6298 O  O   . HOH H 7 .   ? -5.360  127.292 -16.668 1.00 21.31 ? 1022 HOH B O   1 
HETATM 6299 O  O   . HOH H 7 .   ? 26.496  119.216 13.714  1.00 20.50 ? 1023 HOH B O   1 
HETATM 6300 O  O   . HOH H 7 .   ? 14.608  113.055 -17.151 1.00 18.06 ? 1024 HOH B O   1 
HETATM 6301 O  O   . HOH H 7 .   ? 0.714   129.128 19.320  1.00 13.63 ? 1025 HOH B O   1 
HETATM 6302 O  O   . HOH H 7 .   ? 29.158  134.899 13.201  1.00 23.60 ? 1026 HOH B O   1 
HETATM 6303 O  O   . HOH H 7 .   ? 13.168  105.428 -4.984  1.00 32.38 ? 1027 HOH B O   1 
HETATM 6304 O  O   . HOH H 7 .   ? 18.561  122.894 -15.130 1.00 16.77 ? 1028 HOH B O   1 
HETATM 6305 O  O   . HOH H 7 .   ? 26.806  123.153 16.071  1.00 13.03 ? 1029 HOH B O   1 
HETATM 6306 O  O   . HOH H 7 .   ? 28.224  119.326 -8.081  1.00 15.80 ? 1030 HOH B O   1 
HETATM 6307 O  O   . HOH H 7 .   ? 19.684  112.720 11.504  1.00 15.64 ? 1031 HOH B O   1 
HETATM 6308 O  O   . HOH H 7 .   ? 17.739  99.913  4.869   1.00 28.96 ? 1032 HOH B O   1 
HETATM 6309 O  O   . HOH H 7 .   ? 6.791   145.386 -10.156 1.00 15.51 ? 1033 HOH B O   1 
HETATM 6310 O  O   . HOH H 7 .   ? 5.110   139.713 -17.949 1.00 22.42 ? 1034 HOH B O   1 
HETATM 6311 O  O   . HOH H 7 .   ? 14.079  106.070 9.264   1.00 18.82 ? 1035 HOH B O   1 
HETATM 6312 O  O   . HOH H 7 .   ? 31.743  118.718 2.934   1.00 16.47 ? 1036 HOH B O   1 
HETATM 6313 O  O   . HOH H 7 .   ? 32.599  126.291 4.427   1.00 11.68 ? 1037 HOH B O   1 
HETATM 6314 O  O   . HOH H 7 .   ? 31.837  126.833 1.955   1.00 11.99 ? 1038 HOH B O   1 
HETATM 6315 O  O   . HOH H 7 .   ? 8.915   127.045 -1.845  1.00 13.94 ? 1039 HOH B O   1 
HETATM 6316 O  O   . HOH H 7 .   ? 34.012  121.604 11.107  1.00 13.86 ? 1040 HOH B O   1 
HETATM 6317 O  O   . HOH H 7 .   ? 32.312  115.558 -7.043  1.00 19.17 ? 1041 HOH B O   1 
HETATM 6318 O  O   . HOH H 7 .   ? -8.263  141.608 4.765   1.00 48.80 ? 1042 HOH B O   1 
HETATM 6319 O  O   . HOH H 7 .   ? 17.753  131.741 -24.572 1.00 26.13 ? 1043 HOH B O   1 
HETATM 6320 O  O   . HOH H 7 .   ? 30.022  127.010 10.728  1.00 16.33 ? 1044 HOH B O   1 
HETATM 6321 O  O   . HOH H 7 .   ? 7.013   112.469 14.013  1.00 12.66 ? 1045 HOH B O   1 
HETATM 6322 O  O   . HOH H 7 .   ? 1.379   116.238 -17.456 1.00 22.54 ? 1046 HOH B O   1 
HETATM 6323 O  O   . HOH H 7 .   ? 31.438  129.550 10.043  1.00 12.84 ? 1047 HOH B O   1 
HETATM 6324 O  O   . HOH H 7 .   ? 36.836  125.091 21.056  1.00 28.24 ? 1048 HOH B O   1 
HETATM 6325 O  O   . HOH H 7 .   ? 18.837  122.573 19.592  1.00 25.92 ? 1049 HOH B O   1 
HETATM 6326 O  O   . HOH H 7 .   ? 24.880  129.380 -8.460  1.00 30.25 ? 1050 HOH B O   1 
HETATM 6327 O  O   . HOH H 7 .   ? 20.504  121.025 19.267  1.00 23.68 ? 1051 HOH B O   1 
HETATM 6328 O  O   . HOH H 7 .   ? 29.871  122.660 9.697   1.00 18.48 ? 1052 HOH B O   1 
HETATM 6329 O  O   . HOH H 7 .   ? 14.815  137.284 -20.219 1.00 26.57 ? 1053 HOH B O   1 
HETATM 6330 O  O   . HOH H 7 .   ? 31.898  125.204 11.424  1.00 21.45 ? 1054 HOH B O   1 
HETATM 6331 O  O   . HOH H 7 .   ? 29.715  114.846 2.963   1.00 15.19 ? 1055 HOH B O   1 
HETATM 6332 O  O   . HOH H 7 .   ? 21.438  114.449 -19.786 1.00 21.70 ? 1056 HOH B O   1 
HETATM 6333 O  O   . HOH H 7 .   ? 12.386  133.507 18.725  1.00 27.11 ? 1057 HOH B O   1 
HETATM 6334 O  O   . HOH H 7 .   ? 26.458  120.514 11.076  1.00 24.28 ? 1058 HOH B O   1 
HETATM 6335 O  O   . HOH H 7 .   ? 32.939  120.551 17.306  1.00 19.19 ? 1059 HOH B O   1 
HETATM 6336 O  O   . HOH H 7 .   ? 24.732  111.611 9.194   1.00 23.23 ? 1060 HOH B O   1 
HETATM 6337 O  O   . HOH H 7 .   ? 15.505  154.373 -4.225  1.00 47.72 ? 1061 HOH B O   1 
HETATM 6338 O  O   . HOH H 7 .   ? 6.595   139.733 -21.040 1.00 33.75 ? 1062 HOH B O   1 
HETATM 6339 O  O   . HOH H 7 .   ? 39.964  126.152 22.209  1.00 35.00 ? 1063 HOH B O   1 
HETATM 6340 O  O   . HOH H 7 .   ? 39.081  121.932 20.874  1.00 25.50 ? 1064 HOH B O   1 
HETATM 6341 O  O   . HOH H 7 .   ? -6.662  144.829 -9.074  1.00 32.83 ? 1065 HOH B O   1 
HETATM 6342 O  O   . HOH H 7 .   ? 27.714  132.943 -1.468  1.00 15.47 ? 1066 HOH B O   1 
HETATM 6343 O  O   . HOH H 7 .   ? 17.766  134.117 -10.461 1.00 4.78  ? 1067 HOH B O   1 
HETATM 6344 O  O   . HOH H 7 .   ? 24.798  127.994 5.847   1.00 11.97 ? 1068 HOH B O   1 
HETATM 6345 O  O   . HOH H 7 .   ? 11.456  138.800 1.850   1.00 26.61 ? 1069 HOH B O   1 
HETATM 6346 O  O   . HOH H 7 .   ? 26.400  131.109 6.542   1.00 11.04 ? 1070 HOH B O   1 
HETATM 6347 O  O   . HOH H 7 .   ? 14.057  142.281 -7.628  1.00 18.86 ? 1071 HOH B O   1 
HETATM 6348 O  O   . HOH H 7 .   ? 23.842  131.626 7.592   1.00 26.12 ? 1072 HOH B O   1 
HETATM 6349 O  O   . HOH H 7 .   ? 8.405   131.906 33.989  1.00 47.89 ? 1073 HOH B O   1 
HETATM 6350 O  O   . HOH H 7 .   ? 5.424   116.907 7.081   1.00 16.55 ? 1074 HOH B O   1 
HETATM 6351 O  O   . HOH H 7 .   ? 27.746  111.627 2.156   1.00 14.02 ? 1075 HOH B O   1 
HETATM 6352 O  O   . HOH H 7 .   ? 13.060  114.599 17.826  1.00 22.57 ? 1076 HOH B O   1 
HETATM 6353 O  O   . HOH H 7 .   ? 26.144  133.783 4.373   1.00 32.80 ? 1077 HOH B O   1 
HETATM 6354 O  O   . HOH H 7 .   ? 23.688  129.500 -11.629 1.00 26.51 ? 1078 HOH B O   1 
HETATM 6355 O  O   . HOH H 7 .   ? 22.527  131.723 5.220   1.00 11.93 ? 1079 HOH B O   1 
HETATM 6356 O  O   . HOH H 7 .   ? 21.233  117.849 24.337  1.00 21.91 ? 1080 HOH B O   1 
HETATM 6357 O  O   . HOH H 7 .   ? 23.213  122.774 28.521  1.00 25.21 ? 1081 HOH B O   1 
HETATM 6358 O  O   . HOH H 7 .   ? -4.787  127.561 -20.608 1.00 24.39 ? 1082 HOH B O   1 
HETATM 6359 O  O   . HOH H 7 .   ? 22.396  109.418 -14.389 1.00 35.08 ? 1083 HOH B O   1 
HETATM 6360 O  O   . HOH H 7 .   ? -10.123 120.198 -8.293  1.00 30.62 ? 1084 HOH B O   1 
HETATM 6361 O  O   . HOH H 7 .   ? 20.396  136.316 -15.650 1.00 19.14 ? 1085 HOH B O   1 
HETATM 6362 O  O   . HOH H 7 .   ? 30.187  111.766 0.670   1.00 19.07 ? 1086 HOH B O   1 
HETATM 6363 O  O   . HOH H 7 .   ? 13.161  142.565 12.408  1.00 33.56 ? 1087 HOH B O   1 
HETATM 6364 O  O   . HOH H 7 .   ? 27.263  111.036 9.471   1.00 31.77 ? 1088 HOH B O   1 
HETATM 6365 O  O   . HOH H 7 .   ? 14.795  139.604 -7.487  1.00 12.54 ? 1089 HOH B O   1 
HETATM 6366 O  O   . HOH H 7 .   ? 29.681  133.248 1.124   1.00 19.89 ? 1090 HOH B O   1 
HETATM 6367 O  O   . HOH H 7 .   ? 16.323  137.131 8.684   1.00 16.14 ? 1091 HOH B O   1 
HETATM 6368 O  O   . HOH H 7 .   ? 26.148  114.117 20.920  1.00 17.38 ? 1092 HOH B O   1 
HETATM 6369 O  O   . HOH H 7 .   ? 25.406  127.548 -15.448 1.00 20.66 ? 1093 HOH B O   1 
HETATM 6370 O  O   . HOH H 7 .   ? 27.881  117.156 10.953  1.00 15.72 ? 1094 HOH B O   1 
HETATM 6371 O  O   . HOH H 7 .   ? 9.236   114.419 -19.567 1.00 23.04 ? 1095 HOH B O   1 
HETATM 6372 O  O   . HOH H 7 .   ? 37.762  129.556 16.945  1.00 25.40 ? 1096 HOH B O   1 
HETATM 6373 O  O   . HOH H 7 .   ? 6.331   107.350 2.677   1.00 30.82 ? 1097 HOH B O   1 
HETATM 6374 O  O   . HOH H 7 .   ? 32.707  133.903 20.153  1.00 28.90 ? 1098 HOH B O   1 
HETATM 6375 O  O   . HOH H 7 .   ? 9.772   117.265 26.596  1.00 39.00 ? 1099 HOH B O   1 
HETATM 6376 O  O   . HOH H 7 .   ? 33.924  119.316 -7.134  1.00 22.33 ? 1100 HOH B O   1 
HETATM 6377 O  O   . HOH H 7 .   ? 28.083  114.567 10.622  1.00 27.59 ? 1101 HOH B O   1 
HETATM 6378 O  O   . HOH H 7 .   ? 7.934   130.797 23.472  1.00 23.88 ? 1102 HOH B O   1 
HETATM 6379 O  O   . HOH H 7 .   ? 16.806  139.257 -5.681  1.00 15.78 ? 1103 HOH B O   1 
HETATM 6380 O  O   . HOH H 7 .   ? 7.866   123.684 24.830  1.00 12.27 ? 1104 HOH B O   1 
HETATM 6381 O  O   . HOH H 7 .   ? 24.583  129.452 -17.211 1.00 31.73 ? 1105 HOH B O   1 
HETATM 6382 O  O   . HOH H 7 .   ? 16.949  121.722 31.724  1.00 41.71 ? 1106 HOH B O   1 
HETATM 6383 O  O   . HOH H 7 .   ? 23.058  117.906 19.866  1.00 15.77 ? 1107 HOH B O   1 
HETATM 6384 O  O   . HOH H 7 .   ? -2.328  117.895 -12.901 1.00 25.02 ? 1108 HOH B O   1 
HETATM 6385 O  O   . HOH H 7 .   ? 10.365  128.461 28.154  1.00 18.52 ? 1109 HOH B O   1 
HETATM 6386 O  O   . HOH H 7 .   ? 7.401   110.887 19.387  1.00 32.25 ? 1110 HOH B O   1 
HETATM 6387 O  O   . HOH H 7 .   ? 1.304   113.984 10.630  1.00 25.60 ? 1111 HOH B O   1 
HETATM 6388 O  O   . HOH H 7 .   ? 25.501  116.116 24.466  1.00 34.80 ? 1112 HOH B O   1 
HETATM 6389 O  O   . HOH H 7 .   ? 14.084  115.850 38.141  1.00 35.45 ? 1113 HOH B O   1 
HETATM 6390 O  O   . HOH H 7 .   ? 11.527  133.229 27.897  1.00 40.75 ? 1114 HOH B O   1 
HETATM 6391 O  O   . HOH H 7 .   ? 25.583  122.376 -16.823 1.00 39.71 ? 1115 HOH B O   1 
HETATM 6392 O  O   . HOH H 7 .   ? 18.840  129.550 32.374  1.00 22.95 ? 1116 HOH B O   1 
HETATM 6393 O  O   . HOH H 7 .   ? 1.782   120.440 21.953  1.00 19.30 ? 1117 HOH B O   1 
HETATM 6394 O  O   . HOH H 7 .   ? -2.339  121.860 4.775   1.00 21.92 ? 1118 HOH B O   1 
HETATM 6395 O  O   . HOH H 7 .   ? 4.141   144.065 6.998   1.00 25.67 ? 1119 HOH B O   1 
HETATM 6396 O  O   . HOH H 7 .   ? 4.108   126.442 30.196  1.00 19.25 ? 1120 HOH B O   1 
HETATM 6397 O  O   . HOH H 7 .   ? 0.536   143.663 -17.586 1.00 20.85 ? 1121 HOH B O   1 
HETATM 6398 O  O   . HOH H 7 .   ? -3.835  129.714 -24.849 1.00 30.26 ? 1122 HOH B O   1 
HETATM 6399 O  O   . HOH H 7 .   ? -1.007  134.208 19.090  1.00 32.52 ? 1123 HOH B O   1 
HETATM 6400 O  O   . HOH H 7 .   ? 23.708  123.181 -19.375 1.00 32.49 ? 1124 HOH B O   1 
HETATM 6401 O  O   . HOH H 7 .   ? 31.162  117.064 18.870  1.00 23.18 ? 1125 HOH B O   1 
HETATM 6402 O  O   . HOH H 7 .   ? 15.974  111.405 -18.865 1.00 33.02 ? 1126 HOH B O   1 
HETATM 6403 O  O   . HOH H 7 .   ? -13.639 130.716 -9.049  1.00 34.14 ? 1127 HOH B O   1 
HETATM 6404 O  O   . HOH H 7 .   ? 6.134   117.076 4.700   1.00 26.07 ? 1128 HOH B O   1 
HETATM 6405 O  O   . HOH H 7 .   ? 12.653  132.647 -26.790 1.00 31.12 ? 1129 HOH B O   1 
HETATM 6406 O  O   . HOH H 7 .   ? 2.729   141.912 13.867  1.00 22.25 ? 1130 HOH B O   1 
HETATM 6407 O  O   . HOH H 7 .   ? 30.500  121.352 16.241  1.00 20.40 ? 1131 HOH B O   1 
HETATM 6408 O  O   . HOH H 7 .   ? -5.708  141.336 -14.243 1.00 24.45 ? 1132 HOH B O   1 
HETATM 6409 O  O   . HOH H 7 .   ? 4.647   118.703 30.017  1.00 25.54 ? 1133 HOH B O   1 
HETATM 6410 O  O   . HOH H 7 .   ? -1.728  106.577 12.570  1.00 32.37 ? 1134 HOH B O   1 
HETATM 6411 O  O   . HOH H 7 .   ? 9.098   147.629 8.989   1.00 49.69 ? 1135 HOH B O   1 
HETATM 6412 O  O   . HOH H 7 .   ? 2.223   116.400 19.602  1.00 31.74 ? 1136 HOH B O   1 
HETATM 6413 O  O   . HOH H 7 .   ? 27.824  133.386 6.587   1.00 29.78 ? 1137 HOH B O   1 
HETATM 6414 O  O   . HOH H 7 .   ? 29.519  115.475 -11.992 1.00 25.73 ? 1138 HOH B O   1 
HETATM 6415 O  O   . HOH H 7 .   ? 10.691  120.831 33.898  1.00 22.34 ? 1139 HOH B O   1 
HETATM 6416 O  O   . HOH H 7 .   ? 2.460   116.956 4.343   1.00 33.30 ? 1140 HOH B O   1 
HETATM 6417 O  O   . HOH H 7 .   ? 8.647   109.799 -7.182  1.00 22.84 ? 1141 HOH B O   1 
HETATM 6418 O  O   . HOH H 7 .   ? -13.854 127.853 -7.652  1.00 38.91 ? 1142 HOH B O   1 
HETATM 6419 O  O   . HOH H 7 .   ? 9.450   124.160 27.030  1.00 13.10 ? 1143 HOH B O   1 
HETATM 6420 O  O   . HOH H 7 .   ? -2.050  126.588 11.925  1.00 15.47 ? 1144 HOH B O   1 
HETATM 6421 O  O   . HOH H 7 .   ? 27.959  108.646 2.633   1.00 21.82 ? 1145 HOH B O   1 
HETATM 6422 O  O   . HOH H 7 .   ? 33.943  118.017 -9.636  1.00 29.67 ? 1146 HOH B O   1 
HETATM 6423 O  O   . HOH H 7 .   ? 18.055  128.669 34.853  1.00 24.46 ? 1147 HOH B O   1 
HETATM 6424 O  O   . HOH H 7 .   ? 29.220  122.726 -14.890 1.00 24.44 ? 1148 HOH B O   1 
HETATM 6425 O  O   . HOH H 7 .   ? -3.257  124.158 3.243   1.00 35.40 ? 1149 HOH B O   1 
HETATM 6426 O  O   . HOH H 7 .   ? 29.312  117.470 -9.416  1.00 26.53 ? 1150 HOH B O   1 
HETATM 6427 O  O   . HOH H 7 .   ? 13.543  106.438 -9.274  1.00 31.13 ? 1151 HOH B O   1 
HETATM 6428 O  O   . HOH H 7 .   ? 31.132  127.844 20.852  1.00 27.25 ? 1152 HOH B O   1 
HETATM 6429 O  O   . HOH H 7 .   ? 34.272  125.636 12.877  1.00 26.60 ? 1153 HOH B O   1 
HETATM 6430 O  O   . HOH H 7 .   ? 4.627   118.878 23.297  1.00 22.97 ? 1154 HOH B O   1 
HETATM 6431 O  O   . HOH H 7 .   ? -6.074  139.704 4.738   1.00 28.15 ? 1155 HOH B O   1 
HETATM 6432 O  O   . HOH H 7 .   ? 1.077   136.229 18.979  1.00 25.64 ? 1156 HOH B O   1 
HETATM 6433 O  O   . HOH H 7 .   ? 31.606  119.405 20.665  1.00 26.35 ? 1157 HOH B O   1 
HETATM 6434 O  O   . HOH H 7 .   ? 29.715  114.969 -14.859 1.00 46.81 ? 1158 HOH B O   1 
HETATM 6435 O  O   . HOH H 7 .   ? 18.318  137.760 6.848   1.00 28.85 ? 1159 HOH B O   1 
HETATM 6436 O  O   . HOH H 7 .   ? 7.067   112.248 2.474   1.00 28.66 ? 1160 HOH B O   1 
HETATM 6437 O  O   . HOH H 7 .   ? 24.820  135.291 9.891   1.00 25.50 ? 1161 HOH B O   1 
HETATM 6438 O  O   . HOH H 7 .   ? 28.336  122.258 14.010  1.00 26.50 ? 1162 HOH B O   1 
HETATM 6439 O  O   . HOH H 7 .   ? 23.048  134.758 16.063  1.00 29.51 ? 1163 HOH B O   1 
HETATM 6440 O  O   . HOH H 7 .   ? 17.420  122.987 -26.804 1.00 35.66 ? 1164 HOH B O   1 
HETATM 6441 O  O   . HOH H 7 .   ? 23.120  121.729 -23.482 1.00 30.05 ? 1165 HOH B O   1 
HETATM 6442 O  O   . HOH H 7 .   ? -5.880  124.932 -20.631 1.00 26.85 ? 1166 HOH B O   1 
HETATM 6443 O  O   . HOH H 7 .   ? -0.976  116.023 -1.739  1.00 27.63 ? 1167 HOH B O   1 
HETATM 6444 O  O   . HOH H 7 .   ? 15.277  135.734 17.531  1.00 41.75 ? 1168 HOH B O   1 
HETATM 6445 O  O   . HOH H 7 .   ? 23.408  134.907 -1.395  1.00 57.24 ? 1169 HOH B O   1 
HETATM 6446 O  O   . HOH H 7 .   ? 4.451   129.385 28.081  1.00 33.33 ? 1170 HOH B O   1 
HETATM 6447 O  O   . HOH H 7 .   ? 15.322  148.101 -1.596  1.00 28.58 ? 1171 HOH B O   1 
HETATM 6448 O  O   . HOH H 7 .   ? -10.788 121.088 -15.254 1.00 29.57 ? 1172 HOH B O   1 
HETATM 6449 O  O   . HOH H 7 .   ? 14.828  134.503 31.041  1.00 33.57 ? 1173 HOH B O   1 
HETATM 6450 O  O   . HOH H 7 .   ? -0.388  116.037 -13.081 1.00 34.49 ? 1174 HOH B O   1 
HETATM 6451 O  O   . HOH H 7 .   ? 21.419  125.229 27.215  1.00 34.32 ? 1175 HOH B O   1 
HETATM 6452 O  O   . HOH H 7 .   ? 21.023  114.365 25.009  1.00 42.66 ? 1176 HOH B O   1 
HETATM 6453 O  O   . HOH H 7 .   ? 14.142  139.069 1.402   1.00 45.24 ? 1177 HOH B O   1 
HETATM 6454 O  O   . HOH H 7 .   ? 24.007  116.376 -18.985 1.00 37.33 ? 1178 HOH B O   1 
HETATM 6455 O  O   . HOH H 7 .   ? 5.070   113.225 -0.592  1.00 38.65 ? 1179 HOH B O   1 
HETATM 6456 O  O   . HOH H 7 .   ? 23.278  134.342 7.130   1.00 41.19 ? 1180 HOH B O   1 
HETATM 6457 O  O   . HOH H 7 .   ? 16.220  132.569 32.561  1.00 29.77 ? 1181 HOH B O   1 
HETATM 6458 O  O   . HOH H 7 .   ? 12.497  98.920  10.685  1.00 32.95 ? 1182 HOH B O   1 
HETATM 6459 O  O   . HOH H 7 .   ? 14.173  117.814 -24.912 1.00 35.62 ? 1183 HOH B O   1 
HETATM 6460 O  O   . HOH H 7 .   ? 1.285   108.049 16.664  1.00 25.85 ? 1184 HOH B O   1 
HETATM 6461 O  O   . HOH H 7 .   ? 34.461  133.643 18.023  1.00 32.38 ? 1185 HOH B O   1 
HETATM 6462 O  O   . HOH H 7 .   ? 12.088  136.945 -22.547 1.00 41.63 ? 1186 HOH B O   1 
HETATM 6463 O  O   . HOH H 7 .   ? 7.434   146.456 -17.684 1.00 40.33 ? 1187 HOH B O   1 
HETATM 6464 O  O   . HOH H 7 .   ? 25.037  125.773 -19.980 1.00 44.26 ? 1188 HOH B O   1 
HETATM 6465 O  O   . HOH H 7 .   ? -4.557  126.048 5.807   1.00 41.35 ? 1189 HOH B O   1 
HETATM 6466 O  O   . HOH H 7 .   ? 0.498   111.183 16.517  1.00 32.25 ? 1190 HOH B O   1 
HETATM 6467 O  O   . HOH H 7 .   ? 7.994   130.186 26.580  1.00 39.38 ? 1191 HOH B O   1 
HETATM 6468 O  O   . HOH H 7 .   ? 44.953  129.270 16.176  1.00 44.23 ? 1192 HOH B O   1 
HETATM 6469 O  O   . HOH H 7 .   ? 20.703  127.770 31.446  1.00 42.75 ? 1193 HOH B O   1 
HETATM 6470 O  O   . HOH H 7 .   ? -0.765  130.329 21.121  1.00 27.73 ? 1194 HOH B O   1 
HETATM 6471 O  O   . HOH H 7 .   ? 25.168  111.463 -17.206 1.00 37.96 ? 1195 HOH B O   1 
HETATM 6472 O  O   . HOH H 7 .   ? -1.419  119.906 18.580  1.00 34.37 ? 1196 HOH B O   1 
HETATM 6473 O  O   . HOH H 7 .   ? 3.810   145.254 9.538   1.00 35.37 ? 1197 HOH B O   1 
HETATM 6474 O  O   . HOH H 7 .   ? 13.850  143.899 5.080   1.00 50.55 ? 1198 HOH B O   1 
HETATM 6475 O  O   . HOH H 7 .   ? 5.461   129.343 -31.054 1.00 45.89 ? 1199 HOH B O   1 
HETATM 6476 O  O   . HOH H 7 .   ? 18.781  140.844 8.584   1.00 50.23 ? 1200 HOH B O   1 
HETATM 6477 O  O   . HOH H 7 .   ? 5.238   144.971 13.277  1.00 46.63 ? 1201 HOH B O   1 
HETATM 6478 O  O   . HOH H 7 .   ? 26.163  136.243 12.300  1.00 42.75 ? 1202 HOH B O   1 
HETATM 6479 O  O   . HOH H 7 .   ? 26.906  105.761 4.160   1.00 46.47 ? 1203 HOH B O   1 
HETATM 6480 O  O   . HOH H 7 .   ? 35.919  128.174 19.555  1.00 46.76 ? 1204 HOH B O   1 
HETATM 6481 O  O   . HOH H 7 .   ? 7.186   130.887 -25.514 1.00 22.53 ? 1205 HOH B O   1 
HETATM 6482 O  O   . HOH H 7 .   ? 28.504  136.240 19.923  1.00 24.49 ? 1206 HOH B O   1 
HETATM 6483 O  O   . HOH H 7 .   ? 26.800  108.972 -15.089 1.00 53.07 ? 1207 HOH B O   1 
HETATM 6484 O  O   . HOH H 7 .   ? 16.097  140.023 6.565   1.00 23.77 ? 1208 HOH B O   1 
HETATM 6485 O  O   . HOH H 7 .   ? 7.447   104.102 7.026   1.00 36.38 ? 1209 HOH B O   1 
HETATM 6486 O  O   . HOH H 7 .   ? -3.377  115.529 -23.702 1.00 31.35 ? 1210 HOH B O   1 
HETATM 6487 O  O   . HOH H 7 .   ? 33.283  126.515 21.677  1.00 30.93 ? 1211 HOH B O   1 
HETATM 6488 O  O   . HOH H 7 .   ? 25.903  134.302 -2.975  1.00 43.24 ? 1212 HOH B O   1 
HETATM 6489 O  O   . HOH H 7 .   ? 11.265  93.610  3.571   1.00 28.37 ? 1213 HOH B O   1 
HETATM 6490 O  O   . HOH H 7 .   ? 2.974   116.838 30.821  1.00 38.96 ? 1214 HOH B O   1 
HETATM 6491 O  O   . HOH H 7 .   ? 28.150  130.689 26.749  1.00 39.56 ? 1215 HOH B O   1 
HETATM 6492 O  O   . HOH H 7 .   ? 2.077   112.750 -2.049  1.00 57.73 ? 1216 HOH B O   1 
HETATM 6493 O  O   . HOH H 7 .   ? 46.776  124.301 7.133   1.00 42.25 ? 1217 HOH B O   1 
HETATM 6494 O  O   . HOH H 7 .   ? 9.689   131.006 28.641  1.00 35.25 ? 1218 HOH B O   1 
HETATM 6495 O  O   . HOH H 7 .   ? 20.255  121.545 34.350  1.00 46.72 ? 1219 HOH B O   1 
HETATM 6496 O  O   . HOH H 7 .   ? 28.143  121.194 1.666   1.00 10.44 ? 1220 HOH B O   1 
HETATM 6497 O  O   . HOH H 7 .   ? 13.391  110.883 6.741   1.00 10.61 ? 1221 HOH B O   1 
HETATM 6498 O  O   . HOH H 7 .   ? 9.697   131.841 39.709  1.00 25.62 ? 1222 HOH B O   1 
HETATM 6499 O  O   . HOH H 7 .   ? -13.522 139.373 1.064   1.00 38.05 ? 1223 HOH B O   1 
HETATM 6500 O  O   . HOH H 7 .   ? 13.975  134.879 22.072  1.00 35.38 ? 1224 HOH B O   1 
HETATM 6501 O  O   . HOH H 7 .   ? -5.067  111.423 -29.367 1.00 44.19 ? 1225 HOH B O   1 
HETATM 6502 O  O   . HOH H 7 .   ? 7.786   111.481 -19.644 1.00 57.16 ? 1226 HOH B O   1 
HETATM 6503 O  O   . HOH H 7 .   ? -4.228  109.004 13.352  1.00 37.21 ? 1227 HOH B O   1 
HETATM 6504 O  O   . HOH H 7 .   ? 31.673  116.502 23.341  1.00 40.21 ? 1228 HOH B O   1 
HETATM 6505 O  O   . HOH H 7 .   ? 12.244  111.469 -16.790 1.00 41.75 ? 1229 HOH B O   1 
HETATM 6506 O  O   . HOH H 7 .   ? -3.552  113.435 -31.751 1.00 34.68 ? 1230 HOH B O   1 
HETATM 6507 O  O   . HOH H 7 .   ? 12.231  108.479 8.089   1.00 19.68 ? 1231 HOH B O   1 
HETATM 6508 O  O   . HOH H 7 .   ? 20.174  137.733 -1.887  1.00 31.93 ? 1232 HOH B O   1 
HETATM 6509 O  O   . HOH H 7 .   ? 11.917  136.830 -9.167  1.00 13.42 ? 1233 HOH B O   1 
HETATM 6510 O  O   . HOH H 7 .   ? 14.282  136.406 -10.554 1.00 15.37 ? 1234 HOH B O   1 
HETATM 6511 O  O   . HOH H 7 .   ? -10.186 133.605 -6.653  1.00 23.54 ? 1235 HOH B O   1 
HETATM 6512 O  O   . HOH H 7 .   ? 29.517  119.620 14.613  1.00 33.36 ? 1236 HOH B O   1 
HETATM 6513 O  O   . HOH H 7 .   ? -3.333  124.513 12.277  1.00 37.96 ? 1237 HOH B O   1 
HETATM 6514 O  O   . HOH H 7 .   ? 2.119   114.058 -25.209 1.00 33.76 ? 1238 HOH B O   1 
HETATM 6515 O  O   . HOH H 7 .   ? -0.948  109.145 16.926  1.00 38.55 ? 1239 HOH B O   1 
HETATM 6516 O  O   . HOH H 7 .   ? 20.811  105.301 -4.032  1.00 27.41 ? 1240 HOH B O   1 
HETATM 6517 O  O   . HOH H 7 .   ? 16.946  141.555 -4.184  1.00 29.96 ? 1241 HOH B O   1 
HETATM 6518 O  O   . HOH H 7 .   ? 5.457   114.672 3.866   1.00 35.00 ? 1242 HOH B O   1 
HETATM 6519 O  O   . HOH H 7 .   ? 1.364   111.458 19.344  1.00 53.46 ? 1243 HOH B O   1 
HETATM 6520 O  O   . HOH H 7 .   ? 3.233   141.332 -17.989 1.00 23.73 ? 1244 HOH B O   1 
HETATM 6521 O  O   . HOH H 7 .   ? -3.623  103.638 18.308  1.00 46.61 ? 1245 HOH B O   1 
HETATM 6522 O  O   . HOH H 7 .   ? -9.631  133.195 -14.436 1.00 28.37 ? 1246 HOH B O   1 
HETATM 6523 O  O   . HOH H 7 .   ? 31.764  116.498 -9.380  1.00 34.80 ? 1247 HOH B O   1 
HETATM 6524 O  O   . HOH H 7 .   ? -0.070  113.396 18.601  1.00 37.13 ? 1248 HOH B O   1 
HETATM 6525 O  O   . HOH H 7 .   ? 30.766  123.899 26.839  1.00 46.77 ? 1249 HOH B O   1 
HETATM 6526 O  O   . HOH H 7 .   ? 9.912   132.069 21.535  1.00 30.53 ? 1250 HOH B O   1 
HETATM 6527 O  O   . HOH H 7 .   ? 2.037   113.934 -18.693 1.00 40.60 ? 1251 HOH B O   1 
HETATM 6528 O  O   . HOH H 7 .   ? -8.821  143.953 1.514   1.00 36.84 ? 1252 HOH B O   1 
HETATM 6529 O  O   . HOH H 7 .   ? 22.368  101.111 -2.953  1.00 56.88 ? 1253 HOH B O   1 
HETATM 6530 O  O   . HOH H 7 .   ? 15.359  151.137 -1.171  1.00 40.51 ? 1254 HOH B O   1 
HETATM 6531 O  O   . HOH H 7 .   ? 18.828  114.029 29.262  1.00 48.23 ? 1255 HOH B O   1 
HETATM 6532 O  O   . HOH H 7 .   ? 11.458  136.022 19.986  1.00 39.97 ? 1256 HOH B O   1 
HETATM 6533 O  O   . HOH H 7 .   ? -24.146 125.152 -12.432 1.00 59.54 ? 1257 HOH B O   1 
HETATM 6534 O  O   . HOH H 7 .   ? 11.611  111.223 19.597  1.00 46.45 ? 1258 HOH B O   1 
HETATM 6535 O  O   . HOH H 7 .   ? -4.178  132.844 16.640  1.00 45.92 ? 1259 HOH B O   1 
HETATM 6536 O  O   . HOH H 7 .   ? 33.182  132.062 21.898  1.00 47.50 ? 1260 HOH B O   1 
HETATM 6537 O  O   . HOH H 7 .   ? 46.779  124.710 9.669   1.00 48.89 ? 1261 HOH B O   1 
HETATM 6538 O  O   . HOH H 7 .   ? 6.041   115.626 34.059  1.00 47.66 ? 1262 HOH B O   1 
HETATM 6539 O  O   . HOH H 7 .   ? 28.932  117.259 13.500  1.00 35.44 ? 1263 HOH B O   1 
HETATM 6540 O  O   . HOH H 7 .   ? -2.944  108.175 15.870  1.00 39.86 ? 1264 HOH B O   1 
HETATM 6541 O  O   . HOH H 7 .   ? -0.760  104.692 15.235  1.00 37.56 ? 1265 HOH B O   1 
HETATM 6542 O  O   . HOH H 7 .   ? 3.609   113.239 5.326   1.00 40.32 ? 1266 HOH B O   1 
HETATM 6543 O  O   . HOH H 7 .   ? 7.418   117.520 33.056  1.00 36.64 ? 1267 HOH B O   1 
HETATM 6544 O  O   . HOH H 7 .   ? 0.914   106.715 14.367  1.00 32.26 ? 1268 HOH B O   1 
HETATM 6545 O  O   . HOH H 7 .   ? -3.155  124.759 15.589  1.00 36.23 ? 1269 HOH B O   1 
HETATM 6546 O  O   . HOH H 7 .   ? 18.695  112.955 20.759  1.00 32.79 ? 1270 HOH B O   1 
HETATM 6547 O  O   . HOH H 7 .   ? 2.807   109.213 2.400   1.00 46.02 ? 1271 HOH B O   1 
HETATM 6548 O  O   . HOH H 7 .   ? 8.659   112.933 -17.313 1.00 45.70 ? 1272 HOH B O   1 
HETATM 6549 O  O   . HOH H 7 .   ? -0.456  115.809 -30.789 1.00 41.82 ? 1273 HOH B O   1 
HETATM 6550 O  O   . HOH H 7 .   ? 18.996  133.800 31.119  1.00 44.29 ? 1274 HOH B O   1 
HETATM 6551 O  O   . HOH H 7 .   ? 29.168  115.233 22.487  1.00 39.72 ? 1275 HOH B O   1 
HETATM 6552 O  O   . HOH H 7 .   ? -5.259  133.619 -19.127 1.00 47.23 ? 1276 HOH B O   1 
HETATM 6553 O  O   . HOH H 7 .   ? -4.428  141.308 3.485   1.00 32.61 ? 1277 HOH B O   1 
HETATM 6554 O  O   . HOH H 7 .   ? -3.794  144.475 4.819   1.00 38.09 ? 1278 HOH B O   1 
HETATM 6555 O  O   . HOH H 7 .   ? 0.394   149.391 8.671   1.00 54.92 ? 1279 HOH B O   1 
HETATM 6556 O  O   . HOH H 7 .   ? 11.927  102.006 -7.375  1.00 41.30 ? 1280 HOH B O   1 
HETATM 6557 O  O   . HOH H 7 .   ? 41.852  122.522 22.032  1.00 39.07 ? 1281 HOH B O   1 
HETATM 6558 O  O   . HOH H 7 .   ? 30.878  135.699 21.025  1.00 49.40 ? 1282 HOH B O   1 
HETATM 6559 O  O   . HOH H 7 .   ? 4.500   145.691 4.984   1.00 31.96 ? 1283 HOH B O   1 
HETATM 6560 O  O   . HOH H 7 .   ? 18.511  104.782 -12.523 1.00 49.58 ? 1284 HOH B O   1 
HETATM 6561 O  O   . HOH H 7 .   ? 9.762   106.643 -7.624  1.00 43.96 ? 1285 HOH B O   1 
HETATM 6562 O  O   . HOH H 7 .   ? 28.500  101.819 1.928   1.00 42.77 ? 1286 HOH B O   1 
HETATM 6563 O  O   . HOH H 7 .   ? 30.735  106.444 -19.564 1.00 56.28 ? 1287 HOH B O   1 
HETATM 6564 O  O   . HOH H 7 .   ? 16.645  137.406 3.289   1.00 38.92 ? 1288 HOH B O   1 
HETATM 6565 O  O   . HOH H 7 .   ? 14.354  115.554 22.387  1.00 48.62 ? 1289 HOH B O   1 
HETATM 6566 O  O   . HOH H 7 .   ? 25.619  136.116 15.191  1.00 51.58 ? 1290 HOH B O   1 
HETATM 6567 O  O   . HOH H 7 .   ? -2.142  116.546 12.386  1.00 38.48 ? 1291 HOH B O   1 
HETATM 6568 O  O   . HOH H 7 .   ? 9.043   114.518 27.422  1.00 50.93 ? 1292 HOH B O   1 
HETATM 6569 O  O   . HOH H 7 .   ? 8.401   115.277 30.686  1.00 36.09 ? 1293 HOH B O   1 
HETATM 6570 O  O   . HOH H 7 .   ? -12.825 123.327 -4.804  1.00 56.10 ? 1294 HOH B O   1 
HETATM 6571 O  O   . HOH H 7 .   ? -8.675  133.440 -17.142 1.00 49.88 ? 1295 HOH B O   1 
HETATM 6572 O  O   . HOH H 7 .   ? 2.572   114.760 -27.647 1.00 36.77 ? 1296 HOH B O   1 
HETATM 6573 O  O   . HOH H 7 .   ? 27.049  126.234 26.054  1.00 28.82 ? 1297 HOH B O   1 
HETATM 6574 O  O   . HOH H 7 .   ? 14.301  130.673 -26.374 1.00 26.19 ? 1298 HOH B O   1 
HETATM 6575 O  O   . HOH H 7 .   ? 28.363  105.896 -1.236  1.00 36.63 ? 1299 HOH B O   1 
HETATM 6576 O  O   . HOH H 7 .   ? 22.900  134.089 3.594   1.00 31.80 ? 1300 HOH B O   1 
HETATM 6577 O  O   . HOH H 7 .   ? 17.831  138.422 -2.171  1.00 31.26 ? 1301 HOH B O   1 
HETATM 6578 O  O   . HOH H 7 .   ? 0.124   134.358 -21.533 1.00 31.37 ? 1302 HOH B O   1 
HETATM 6579 O  O   . HOH H 7 .   ? 20.252  134.244 28.806  1.00 30.72 ? 1303 HOH B O   1 
HETATM 6580 O  O   . HOH H 7 .   ? 5.394   112.348 -30.747 1.00 45.67 ? 1304 HOH B O   1 
HETATM 6581 O  O   . HOH H 7 .   ? 2.544   115.337 6.450   1.00 42.60 ? 1305 HOH B O   1 
HETATM 6582 O  O   . HOH H 7 .   ? 11.242  112.812 -19.900 1.00 37.56 ? 1306 HOH B O   1 
HETATM 6583 O  O   . HOH H 7 .   ? 31.167  130.398 21.495  1.00 31.77 ? 1307 HOH B O   1 
HETATM 6584 O  O   . HOH H 7 .   ? 36.588  131.615 18.426  1.00 31.42 ? 1308 HOH B O   1 
HETATM 6585 O  O   . HOH H 7 .   ? 9.451   95.511  2.554   1.00 44.26 ? 1309 HOH B O   1 
HETATM 6586 O  O   . HOH H 7 .   ? 5.218   102.151 27.591  1.00 47.20 ? 1310 HOH B O   1 
HETATM 6587 O  O   . HOH H 7 .   ? 9.430   118.618 34.619  1.00 32.64 ? 1311 HOH B O   1 
HETATM 6588 O  O   . HOH H 7 .   ? 25.482  107.834 -11.929 1.00 55.21 ? 1312 HOH B O   1 
HETATM 6589 O  O   . HOH H 7 .   ? 3.698   106.347 14.082  1.00 35.04 ? 1313 HOH B O   1 
HETATM 6590 O  O   . HOH H 7 .   ? 2.268   115.298 1.785   1.00 40.74 ? 1314 HOH B O   1 
HETATM 6591 O  O   . HOH H 7 .   ? 35.683  135.662 11.179  1.00 40.69 ? 1315 HOH B O   1 
HETATM 6592 O  O   . HOH H 7 .   ? -2.206  148.307 -1.820  1.00 42.60 ? 1316 HOH B O   1 
HETATM 6593 O  O   . HOH H 7 .   ? 7.967   132.174 30.329  1.00 44.80 ? 1317 HOH B O   1 
HETATM 6594 O  O   . HOH H 7 .   ? -1.158  118.278 14.350  1.00 38.86 ? 1318 HOH B O   1 
HETATM 6595 O  O   . HOH H 7 .   ? 3.451   113.550 21.231  1.00 47.20 ? 1319 HOH B O   1 
HETATM 6596 O  O   . HOH H 7 .   ? 1.462   111.149 4.562   1.00 46.33 ? 1320 HOH B O   1 
HETATM 6597 O  O   . HOH H 7 .   ? 30.412  138.843 12.426  1.00 50.17 ? 1321 HOH B O   1 
HETATM 6598 O  O   . HOH H 7 .   ? 19.519  130.065 -25.454 1.00 48.29 ? 1322 HOH B O   1 
HETATM 6599 O  O   . HOH H 7 .   ? 24.244  108.457 -9.362  1.00 37.46 ? 1323 HOH B O   1 
HETATM 6600 O  O   . HOH H 7 .   ? -2.528  143.562 9.965   1.00 37.06 ? 1324 HOH B O   1 
HETATM 6601 O  O   . HOH H 7 .   ? -8.681  135.765 8.443   1.00 58.96 ? 1325 HOH B O   1 
HETATM 6602 O  O   . HOH H 7 .   ? -12.908 120.917 -13.649 1.00 54.65 ? 1326 HOH B O   1 
HETATM 6603 O  O   . HOH H 7 .   ? 24.435  131.741 28.640  1.00 43.10 ? 1327 HOH B O   1 
HETATM 6604 O  O   . HOH H 7 .   ? 7.365   133.548 21.992  1.00 40.06 ? 1328 HOH B O   1 
HETATM 6605 O  O   . HOH H 7 .   ? 4.600   114.434 -5.204  1.00 40.27 ? 1329 HOH B O   1 
HETATM 6606 O  O   . HOH H 7 .   ? 15.514  134.983 20.032  1.00 38.34 ? 1330 HOH B O   1 
HETATM 6607 O  O   . HOH H 7 .   ? 7.266   144.875 5.899   1.00 40.80 ? 1331 HOH B O   1 
HETATM 6608 O  O   . HOH H 7 .   ? 38.711  119.483 21.740  1.00 30.55 ? 1332 HOH B O   1 
HETATM 6609 O  O   . HOH H 7 .   ? 8.193   102.096 5.403   1.00 42.21 ? 1333 HOH B O   1 
HETATM 6610 O  O   . HOH H 7 .   ? 8.828   135.619 20.212  1.00 39.71 ? 1334 HOH B O   1 
HETATM 6611 O  O   . HOH H 7 .   ? 0.536   115.176 8.414   1.00 39.62 ? 1335 HOH B O   1 
HETATM 6612 O  O   . HOH H 7 .   ? 26.693  117.609 31.946  1.00 47.75 ? 1336 HOH B O   1 
HETATM 6613 O  O   . HOH H 7 .   ? -5.644  130.161 12.902  1.00 40.44 ? 1337 HOH B O   1 
HETATM 6614 O  O   . HOH H 7 .   ? 40.326  129.085 20.547  1.00 41.41 ? 1338 HOH B O   1 
HETATM 6615 O  O   . HOH H 7 .   ? 1.605   115.529 -14.730 1.00 44.75 ? 1339 HOH B O   1 
HETATM 6616 O  O   . HOH H 7 .   ? -12.367 141.385 3.338   1.00 47.50 ? 1340 HOH B O   1 
HETATM 6617 O  O   . HOH H 7 .   ? 15.133  141.906 1.088   1.00 47.63 ? 1341 HOH B O   1 
HETATM 6618 O  O   . HOH H 7 .   ? 30.690  117.510 -15.602 1.00 50.58 ? 1342 HOH B O   1 
HETATM 6619 O  O   . HOH H 7 .   ? 21.886  131.941 -22.047 1.00 40.76 ? 1343 HOH B O   1 
HETATM 6620 O  O   . HOH H 7 .   ? 7.692   135.231 25.014  1.00 54.34 ? 1344 HOH B O   1 
HETATM 6621 O  O   . HOH H 7 .   ? 17.470  101.317 1.047   1.00 31.25 ? 1345 HOH B O   1 
HETATM 6622 O  O   . HOH H 7 .   ? 45.038  129.005 12.616  1.00 51.65 ? 1346 HOH B O   1 
HETATM 6623 O  O   . HOH H 7 .   ? 9.055   134.320 32.671  1.00 51.66 ? 1347 HOH B O   1 
HETATM 6624 O  O   . HOH H 7 .   ? -0.789  86.095  12.655  1.00 55.11 ? 1348 HOH B O   1 
HETATM 6625 O  O   . HOH H 7 .   ? 2.020   136.853 26.252  1.00 49.27 ? 1349 HOH B O   1 
HETATM 6626 O  O   . HOH H 7 .   ? -9.294  114.966 -12.737 1.00 46.42 ? 1350 HOH B O   1 
HETATM 6627 O  O   . HOH H 7 .   ? 20.651  126.941 34.704  1.00 50.14 ? 1351 HOH B O   1 
HETATM 6628 O  O   . HOH H 7 .   ? 13.870  147.384 14.296  1.00 53.47 ? 1352 HOH B O   1 
HETATM 6629 O  O   . HOH H 7 .   ? 21.113  99.305  -7.650  1.00 55.09 ? 1353 HOH B O   1 
HETATM 6630 O  O   . HOH H 7 .   ? 9.555   140.399 -28.841 1.00 56.33 ? 1354 HOH B O   1 
HETATM 6631 O  O   . HOH H 7 .   ? -1.405  111.963 -1.948  1.00 44.75 ? 1355 HOH B O   1 
HETATM 6632 O  O   . HOH H 7 .   ? 23.136  107.749 -16.567 1.00 52.78 ? 1356 HOH B O   1 
HETATM 6633 O  O   . HOH H 7 .   ? 45.567  127.698 10.419  1.00 43.17 ? 1357 HOH B O   1 
HETATM 6634 O  O   . HOH H 7 .   ? -17.242 125.847 -14.070 1.00 49.82 ? 1358 HOH B O   1 
HETATM 6635 O  O   . HOH H 7 .   ? 7.255   136.726 17.897  1.00 35.29 ? 1359 HOH B O   1 
HETATM 6636 O  O   . HOH H 7 .   ? 19.435  139.920 19.461  1.00 43.55 ? 1360 HOH B O   1 
HETATM 6637 O  O   . HOH H 7 .   ? 1.495   114.410 -4.639  1.00 48.32 ? 1361 HOH B O   1 
HETATM 6638 O  O   . HOH H 7 .   ? -2.420  104.178 13.501  1.00 42.94 ? 1362 HOH B O   1 
HETATM 6639 O  O   . HOH H 7 .   ? -6.322  129.361 0.424   1.00 45.27 ? 1363 HOH B O   1 
HETATM 6640 O  O   . HOH H 7 .   ? -8.871  130.623 -1.180  1.00 43.73 ? 1364 HOH B O   1 
HETATM 6641 O  O   . HOH H 7 .   ? -14.272 136.899 2.296   1.00 46.16 ? 1365 HOH B O   1 
HETATM 6642 O  O   . HOH H 7 .   ? 6.784   117.289 28.953  1.00 39.95 ? 1366 HOH B O   1 
HETATM 6643 O  O   . HOH H 7 .   ? -4.609  108.676 8.025   1.00 51.50 ? 1367 HOH B O   1 
HETATM 6644 O  O   . HOH H 7 .   ? 31.202  127.381 -3.306  1.00 37.00 ? 1368 HOH B O   1 
HETATM 6645 O  O   . HOH H 7 .   ? 6.010   132.294 -32.180 1.00 49.12 ? 1369 HOH B O   1 
HETATM 6646 O  O   . HOH H 7 .   ? 25.880  122.125 31.476  1.00 44.11 ? 1370 HOH B O   1 
HETATM 6647 O  O   . HOH H 7 .   ? 19.320  104.290 -6.087  1.00 53.05 ? 1371 HOH B O   1 
HETATM 6648 O  O   . HOH H 7 .   ? 8.550   138.938 -23.759 1.00 48.90 ? 1372 HOH B O   1 
HETATM 6649 O  O   . HOH H 7 .   ? 30.091  135.211 9.314   1.00 42.29 ? 1373 HOH B O   1 
HETATM 6650 O  O   . HOH H 7 .   ? 4.640   115.057 -7.931  1.00 42.94 ? 1374 HOH B O   1 
HETATM 6651 O  O   . HOH H 7 .   ? 46.775  131.581 13.207  1.00 50.09 ? 1375 HOH B O   1 
HETATM 6652 O  O   . HOH H 7 .   ? 16.924  139.001 16.098  1.00 48.04 ? 1376 HOH B O   1 
HETATM 6653 O  O   . HOH H 7 .   ? -12.001 122.642 -8.043  1.00 48.96 ? 1377 HOH B O   1 
HETATM 6654 O  O   . HOH H 7 .   ? 14.817  154.664 -1.402  1.00 51.30 ? 1378 HOH B O   1 
HETATM 6655 O  O   . HOH H 7 .   ? 33.097  117.702 -16.834 1.00 49.71 ? 1379 HOH B O   1 
HETATM 6656 O  O   . HOH H 7 .   ? -8.840  126.967 2.286   1.00 51.42 ? 1380 HOH B O   1 
HETATM 6657 O  O   . HOH H 7 .   ? -12.634 131.075 -14.493 1.00 49.22 ? 1381 HOH B O   1 
HETATM 6658 O  O   . HOH H 7 .   ? -12.435 116.462 -18.934 1.00 50.20 ? 1382 HOH B O   1 
HETATM 6659 O  O   . HOH H 7 .   ? -11.424 119.191 -10.237 1.00 43.13 ? 1383 HOH B O   1 
HETATM 6660 O  O   . HOH H 7 .   ? 18.273  148.131 14.824  1.00 53.51 ? 1384 HOH B O   1 
HETATM 6661 O  O   . HOH H 7 .   ? 7.490   137.473 21.749  1.00 46.65 ? 1385 HOH B O   1 
HETATM 6662 O  O   . HOH H 7 .   ? -6.345  127.904 14.246  1.00 54.86 ? 1386 HOH B O   1 
HETATM 6663 O  O   . HOH H 7 .   ? 26.693  139.793 7.091   1.00 56.34 ? 1387 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   THR 4   4   ?   ?   ?   A . n 
A 1 5   GLU 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   ?   ?   ?   A . n 
A 1 7   VAL 7   7   ?   ?   ?   A . n 
A 1 8   GLY 8   8   ?   ?   ?   A . n 
A 1 9   GLU 9   9   ?   ?   ?   A . n 
A 1 10  ALA 10  10  ?   ?   ?   A . n 
A 1 11  ALA 11  11  ?   ?   ?   A . n 
A 1 12  GLN 12  12  ?   ?   ?   A . n 
A 1 13  GLY 13  13  ?   ?   ?   A . n 
A 1 14  GLY 14  14  ?   ?   ?   A . n 
A 1 15  GLU 15  15  ?   ?   ?   A . n 
A 1 16  PRO 16  16  ?   ?   ?   A . n 
A 1 17  GLY 17  17  ?   ?   ?   A . n 
A 1 18  GLN 18  18  ?   ?   ?   A . n 
A 1 19  PRO 19  19  ?   ?   ?   A . n 
A 1 20  ALA 20  20  ?   ?   ?   A . n 
A 1 21  GLN 21  21  ?   ?   ?   A . n 
A 1 22  PRO 22  22  ?   ?   ?   A . n 
A 1 23  PRO 23  23  ?   ?   ?   A . n 
A 1 24  PRO 24  24  ?   ?   ?   A . n 
A 1 25  GLN 25  25  ?   ?   ?   A . n 
A 1 26  PRO 26  26  ?   ?   ?   A . n 
A 1 27  HIS 27  27  ?   ?   ?   A . n 
A 1 28  PRO 28  28  ?   ?   ?   A . n 
A 1 29  PRO 29  29  ?   ?   ?   A . n 
A 1 30  PRO 30  30  ?   ?   ?   A . n 
A 1 31  PRO 31  31  ?   ?   ?   A . n 
A 1 32  GLN 32  32  ?   ?   ?   A . n 
A 1 33  GLN 33  33  ?   ?   ?   A . n 
A 1 34  GLN 34  34  ?   ?   ?   A . n 
A 1 35  HIS 35  35  ?   ?   ?   A . n 
A 1 36  LYS 36  36  ?   ?   ?   A . n 
A 1 37  GLU 37  37  ?   ?   ?   A . n 
A 1 38  GLU 38  38  ?   ?   ?   A . n 
A 1 39  MET 39  39  ?   ?   ?   A . n 
A 1 40  ALA 40  40  ?   ?   ?   A . n 
A 1 41  ALA 41  41  ?   ?   ?   A . n 
A 1 42  GLU 42  42  ?   ?   ?   A . n 
A 1 43  ALA 43  43  ?   ?   ?   A . n 
A 1 44  GLY 44  44  ?   ?   ?   A . n 
A 1 45  GLU 45  45  ?   ?   ?   A . n 
A 1 46  ALA 46  46  ?   ?   ?   A . n 
A 1 47  VAL 47  47  ?   ?   ?   A . n 
A 1 48  ALA 48  48  ?   ?   ?   A . n 
A 1 49  SER 49  49  ?   ?   ?   A . n 
A 1 50  PRO 50  50  ?   ?   ?   A . n 
A 1 51  MET 51  51  ?   ?   ?   A . n 
A 1 52  ASP 52  52  ?   ?   ?   A . n 
A 1 53  ASP 53  53  ?   ?   ?   A . n 
A 1 54  GLY 54  54  ?   ?   ?   A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  SER 57  57  57  SER SER A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  ASP 59  59  59  ASP ASP A . n 
A 1 60  SER 60  60  60  SER SER A . n 
A 1 61  PRO 61  61  61  PRO PRO A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  VAL 64  64  64  VAL VAL A . n 
A 1 65  LEU 65  65  65  LEU LEU A . n 
A 1 66  TYR 66  66  66  TYR TYR A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  ASP 68  68  68  ASP ASP A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  GLU 71  71  71  GLU GLU A . n 
A 1 72  TRP 72  72  72  TRP TRP A . n 
A 1 73  ALA 73  73  73  ALA ALA A . n 
A 1 74  ASP 74  74  74  ASP ASP A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  PRO 77  77  77  PRO PRO A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  PRO 79  79  79  PRO PRO A . n 
A 1 80  GLN 80  80  80  GLN GLN A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  ASP 82  82  82  ASP ASP A . n 
A 1 83  GLY 83  83  83  GLY GLY A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  VAL 88  88  88  VAL VAL A . n 
A 1 89  GLN 89  89  89  GLN GLN A . n 
A 1 90  ILE 90  90  90  ILE ILE A . n 
A 1 91  ILE 91  91  91  ILE ILE A . n 
A 1 92  TYR 92  92  92  TYR TYR A . n 
A 1 93  SER 93  93  93  SER SER A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  LYS 95  95  95  LYS LYS A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ASP 98  98  98  ASP ASP A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 TYR 102 102 102 TYR TYR A . n 
A 1 103 PHE 103 103 103 PHE PHE A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 GLN 108 108 108 GLN GLN A . n 
A 1 109 ARG 109 109 109 ARG ARG A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 GLU 111 111 111 GLU GLU A . n 
A 1 112 ARG 112 112 112 ARG ARG A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 GLU 114 114 114 GLU GLU A . n 
A 1 115 ARG 115 115 115 ARG ARG A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 PHE 117 117 117 PHE PHE A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 THR 120 120 120 THR THR A . n 
A 1 121 ARG 121 121 121 ARG ARG A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 ILE 124 124 124 ILE ILE A . n 
A 1 125 GLU 125 125 125 GLU GLU A . n 
A 1 126 LEU 126 126 126 LEU LEU A . n 
A 1 127 ASN 127 127 127 ASN ASN A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 TYR 131 131 131 TYR TYR A . n 
A 1 132 THR 132 132 132 THR THR A . n 
A 1 133 VAL 133 133 133 VAL VAL A . n 
A 1 134 TRP 134 134 134 TRP TRP A . n 
A 1 135 HIS 135 135 135 HIS HIS A . n 
A 1 136 PHE 136 136 136 PHE PHE A . n 
A 1 137 ARG 137 137 137 ARG ARG A . n 
A 1 138 ARG 138 138 138 ARG ARG A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 SER 143 143 143 SER SER A . n 
A 1 144 LEU 144 144 144 LEU LEU A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 LYS 146 146 146 LYS LYS A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 HIS 149 149 149 HIS HIS A . n 
A 1 150 GLU 150 150 150 GLU GLU A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 MET 152 152 152 MET MET A . n 
A 1 153 ASN 153 153 153 ASN ASN A . n 
A 1 154 TYR 154 154 154 TYR TYR A . n 
A 1 155 ILE 155 155 155 ILE ILE A . n 
A 1 156 THR 156 156 156 THR THR A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 ILE 159 159 159 ILE ILE A . n 
A 1 160 GLU 160 160 160 GLU GLU A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 PRO 163 163 163 PRO PRO A . n 
A 1 164 LYS 164 164 164 LYS LYS A . n 
A 1 165 ASN 165 165 165 ASN ASN A . n 
A 1 166 TYR 166 166 166 TYR TYR A . n 
A 1 167 GLN 167 167 167 GLN GLN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 TRP 169 169 169 TRP TRP A . n 
A 1 170 HIS 170 170 170 HIS HIS A . n 
A 1 171 HIS 171 171 171 HIS HIS A . n 
A 1 172 ARG 172 172 172 ARG ARG A . n 
A 1 173 ARG 173 173 173 ARG ARG A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 LEU 175 175 175 LEU LEU A . n 
A 1 176 VAL 176 176 176 VAL VAL A . n 
A 1 177 GLU 177 177 177 GLU GLU A . n 
A 1 178 TRP 178 178 178 TRP TRP A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 PRO 182 182 182 PRO PRO A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLN 184 184 184 GLN GLN A . n 
A 1 185 GLU 185 185 185 GLU GLU A . n 
A 1 186 LEU 186 186 186 LEU LEU A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 PHE 188 188 188 PHE PHE A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 ASP 191 191 191 ASP ASP A . n 
A 1 192 ILE 192 192 192 ILE ILE A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 ASN 194 194 194 ASN ASN A . n 
A 1 195 GLN 195 195 195 GLN GLN A . n 
A 1 196 ASP 196 196 196 ASP ASP A . n 
A 1 197 ALA 197 197 197 ALA ALA A . n 
A 1 198 LYS 198 198 198 LYS LYS A . n 
A 1 199 ASN 199 199 199 ASN ASN A . n 
A 1 200 TYR 200 200 200 TYR TYR A . n 
A 1 201 HIS 201 201 201 HIS HIS A . n 
A 1 202 ALA 202 202 202 ALA ALA A . n 
A 1 203 TRP 203 203 203 TRP TRP A . n 
A 1 204 GLN 204 204 204 GLN GLN A . n 
A 1 205 HIS 205 205 205 HIS HIS A . n 
A 1 206 ARG 206 206 206 ARG ARG A . n 
A 1 207 GLN 207 207 207 GLN GLN A . n 
A 1 208 TRP 208 208 208 TRP TRP A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 GLU 212 212 212 GLU GLU A . n 
A 1 213 PHE 213 213 213 PHE PHE A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 LEU 215 215 215 LEU LEU A . n 
A 1 216 TRP 216 216 216 TRP TRP A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 ASN 218 218 218 ASN ASN A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 TYR 222 222 222 TYR TYR A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 ASP 224 224 224 ASP ASP A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 LEU 227 227 227 LEU LEU A . n 
A 1 228 LYS 228 228 228 LYS LYS A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 ASP 230 230 230 ASP ASP A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 ASN 233 233 233 ASN ASN A . n 
A 1 234 ASN 234 234 234 ASN ASN A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 TRP 237 237 237 TRP TRP A . n 
A 1 238 ASN 238 238 238 ASN ASN A . n 
A 1 239 GLN 239 239 239 GLN GLN A . n 
A 1 240 ARG 240 240 240 ARG ARG A . n 
A 1 241 TYR 241 241 241 TYR TYR A . n 
A 1 242 PHE 242 242 242 PHE PHE A . n 
A 1 243 VAL 243 243 243 VAL VAL A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 SER 245 245 245 SER SER A . n 
A 1 246 ASN 246 246 246 ASN ASN A . n 
A 1 247 THR 247 247 247 THR THR A . n 
A 1 248 THR 248 248 248 THR THR A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 TYR 250 250 250 TYR TYR A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 ASP 252 252 252 ASP ASP A . n 
A 1 253 ARG 253 253 253 ARG ARG A . n 
A 1 254 ALA 254 254 254 ALA ALA A . n 
A 1 255 VAL 255 255 255 VAL VAL A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 GLU 257 257 257 GLU GLU A . n 
A 1 258 ARG 258 258 258 ARG ARG A . n 
A 1 259 GLU 259 259 259 GLU GLU A . n 
A 1 260 VAL 260 260 260 VAL VAL A . n 
A 1 261 GLN 261 261 261 GLN GLN A . n 
A 1 262 TYR 262 262 262 TYR TYR A . n 
A 1 263 THR 263 263 263 THR THR A . n 
A 1 264 LEU 264 264 264 LEU LEU A . n 
A 1 265 GLU 265 265 265 GLU GLU A . n 
A 1 266 MET 266 266 266 MET MET A . n 
A 1 267 ILE 267 267 267 ILE ILE A . n 
A 1 268 LYS 268 268 268 LYS LYS A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 VAL 270 270 270 VAL VAL A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 HIS 272 272 272 HIS HIS A . n 
A 1 273 ASN 273 273 273 ASN ASN A . n 
A 1 274 GLU 274 274 274 GLU GLU A . n 
A 1 275 SER 275 275 275 SER SER A . n 
A 1 276 ALA 276 276 276 ALA ALA A . n 
A 1 277 TRP 277 277 277 TRP TRP A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 TYR 279 279 279 TYR TYR A . n 
A 1 280 LEU 280 280 280 LEU LEU A . n 
A 1 281 LYS 281 281 281 LYS LYS A . n 
A 1 282 GLY 282 282 282 GLY GLY A . n 
A 1 283 ILE 283 283 283 ILE ILE A . n 
A 1 284 LEU 284 284 284 LEU LEU A . n 
A 1 285 GLN 285 285 285 GLN GLN A . n 
A 1 286 ASP 286 286 286 ASP ASP A . n 
A 1 287 ARG 287 287 287 ARG ARG A . n 
A 1 288 GLY 288 288 288 GLY GLY A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 SER 290 290 290 SER SER A . n 
A 1 291 LYS 291 291 291 LYS LYS A . n 
A 1 292 TYR 292 292 292 TYR TYR A . n 
A 1 293 PRO 293 293 293 PRO PRO A . n 
A 1 294 ASN 294 294 294 ASN ASN A . n 
A 1 295 LEU 295 295 295 LEU LEU A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 ASN 297 297 297 ASN ASN A . n 
A 1 298 GLN 298 298 298 GLN GLN A . n 
A 1 299 LEU 299 299 299 LEU LEU A . n 
A 1 300 LEU 300 300 300 LEU LEU A . n 
A 1 301 ASP 301 301 301 ASP ASP A . n 
A 1 302 LEU 302 302 302 LEU LEU A . n 
A 1 303 GLN 303 303 303 GLN GLN A . n 
A 1 304 PRO 304 304 304 PRO PRO A . n 
A 1 305 SER 305 305 305 SER SER A . n 
A 1 306 HIS 306 306 306 HIS HIS A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 SER 308 308 308 SER SER A . n 
A 1 309 PRO 309 309 309 PRO PRO A . n 
A 1 310 TYR 310 310 310 TYR TYR A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 ILE 312 312 312 ILE ILE A . n 
A 1 313 ALA 313 313 313 ALA ALA A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 VAL 316 316 316 VAL VAL A . n 
A 1 317 ASP 317 317 317 ASP ASP A . n 
A 1 318 ILE 318 318 318 ILE ILE A . n 
A 1 319 TYR 319 319 319 TYR TYR A . n 
A 1 320 GLU 320 320 320 GLU GLU A . n 
A 1 321 ASP 321 321 321 ASP ASP A . n 
A 1 322 MET 322 322 322 MET MET A . n 
A 1 323 LEU 323 323 323 LEU LEU A . n 
A 1 324 GLU 324 324 324 GLU GLU A . n 
A 1 325 ASN 325 325 325 ASN ASN A . n 
A 1 326 GLN 326 326 326 GLN GLN A . n 
A 1 327 CYS 327 327 327 CYS CYS A . n 
A 1 328 ASP 328 328 328 ASP ASP A . n 
A 1 329 ASN 329 329 329 ASN ASN A . n 
A 1 330 LYS 330 330 330 LYS LYS A . n 
A 1 331 GLU 331 331 331 GLU GLU A . n 
A 1 332 ASP 332 332 332 ASP ASP A . n 
A 1 333 ILE 333 333 333 ILE ILE A . n 
A 1 334 LEU 334 334 334 LEU LEU A . n 
A 1 335 ASN 335 335 335 ASN ASN A . n 
A 1 336 LYS 336 336 336 LYS LYS A . n 
A 1 337 ALA 337 337 337 ALA ALA A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 GLU 339 339 339 GLU GLU A . n 
A 1 340 LEU 340 340 340 LEU LEU A . n 
A 1 341 CYS 341 341 341 CYS CYS A . n 
A 1 342 GLU 342 342 342 GLU GLU A . n 
A 1 343 ILE 343 343 343 ILE ILE A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 ALA 345 345 345 ALA ALA A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 GLU 347 347 347 GLU GLU A . n 
A 1 348 LYS 348 348 348 LYS LYS A . n 
A 1 349 ASP 349 349 349 ASP ASP A . n 
A 1 350 THR 350 350 350 THR THR A . n 
A 1 351 ILE 351 351 351 ILE ILE A . n 
A 1 352 ARG 352 352 352 ARG ARG A . n 
A 1 353 LYS 353 353 353 LYS LYS A . n 
A 1 354 GLU 354 354 354 GLU GLU A . n 
A 1 355 TYR 355 355 355 TYR TYR A . n 
A 1 356 TRP 356 356 356 TRP TRP A . n 
A 1 357 ARG 357 357 357 ARG ARG A . n 
A 1 358 TYR 358 358 358 TYR TYR A . n 
A 1 359 ILE 359 359 359 ILE ILE A . n 
A 1 360 GLY 360 360 360 GLY GLY A . n 
A 1 361 ARG 361 361 361 ARG ARG A . n 
A 1 362 SER 362 362 362 SER SER A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 GLN 364 364 364 GLN GLN A . n 
A 1 365 SER 365 365 365 SER SER A . n 
A 1 366 LYS 366 366 366 LYS LYS A . n 
A 1 367 HIS 367 367 367 HIS HIS A . n 
A 1 368 SER 368 368 ?   ?   ?   A . n 
A 1 369 THR 369 369 ?   ?   ?   A . n 
A 1 370 GLU 370 370 ?   ?   ?   A . n 
A 1 371 ASN 371 371 ?   ?   ?   A . n 
A 1 372 ASP 372 372 ?   ?   ?   A . n 
A 1 373 SER 373 373 ?   ?   ?   A . n 
A 1 374 PRO 374 374 ?   ?   ?   A . n 
A 1 375 THR 375 375 ?   ?   ?   A . n 
A 1 376 ASN 376 376 ?   ?   ?   A . n 
A 1 377 VAL 377 377 ?   ?   ?   A . n 
A 1 378 GLN 378 378 ?   ?   ?   A . n 
A 1 379 GLN 379 379 ?   ?   ?   A . n 
A 1 380 GLU 380 380 ?   ?   ?   A . n 
A 1 381 GLU 381 381 ?   ?   ?   A . n 
A 1 382 PHE 382 382 ?   ?   ?   A . n 
B 2 1   MET 1   501 ?   ?   ?   B . n 
B 2 2   ALA 2   502 ?   ?   ?   B . n 
B 2 3   SER 3   503 ?   ?   ?   B . n 
B 2 4   PRO 4   504 ?   ?   ?   B . n 
B 2 5   SER 5   505 ?   ?   ?   B . n 
B 2 6   SER 6   506 ?   ?   ?   B . n 
B 2 7   PHE 7   507 ?   ?   ?   B . n 
B 2 8   THR 8   508 ?   ?   ?   B . n 
B 2 9   TYR 9   509 ?   ?   ?   B . n 
B 2 10  TYR 10  510 ?   ?   ?   B . n 
B 2 11  CYS 11  511 ?   ?   ?   B . n 
B 2 12  PRO 12  512 ?   ?   ?   B . n 
B 2 13  PRO 13  513 ?   ?   ?   B . n 
B 2 14  SER 14  514 ?   ?   ?   B . n 
B 2 15  SER 15  515 ?   ?   ?   B . n 
B 2 16  SER 16  516 ?   ?   ?   B . n 
B 2 17  PRO 17  517 517 PRO PRO B . n 
B 2 18  VAL 18  518 518 VAL VAL B . n 
B 2 19  TRP 19  519 519 TRP TRP B . n 
B 2 20  SER 20  520 520 SER SER B . n 
B 2 21  GLU 21  521 521 GLU GLU B . n 
B 2 22  PRO 22  522 522 PRO PRO B . n 
B 2 23  LEU 23  523 523 LEU LEU B . n 
B 2 24  TYR 24  524 524 TYR TYR B . n 
B 2 25  SER 25  525 525 SER SER B . n 
B 2 26  LEU 26  526 526 LEU LEU B . n 
B 2 27  ARG 27  527 527 ARG ARG B . n 
B 2 28  PRO 28  528 528 PRO PRO B . n 
B 2 29  GLU 29  529 529 GLU GLU B . n 
B 2 30  HIS 30  530 530 HIS HIS B . n 
B 2 31  ALA 31  531 531 ALA ALA B . n 
B 2 32  ARG 32  532 532 ARG ARG B . n 
B 2 33  GLU 33  533 533 GLU GLU B . n 
B 2 34  ARG 34  534 534 ARG ARG B . n 
B 2 35  LEU 35  535 535 LEU LEU B . n 
B 2 36  GLN 36  536 536 GLN GLN B . n 
B 2 37  ASP 37  537 537 ASP ASP B . n 
B 2 38  ASP 38  538 538 ASP ASP B . n 
B 2 39  SER 39  539 539 SER SER B . n 
B 2 40  VAL 40  540 540 VAL VAL B . n 
B 2 41  GLU 41  541 541 GLU GLU B . n 
B 2 42  THR 42  542 542 THR THR B . n 
B 2 43  VAL 43  543 543 VAL VAL B . n 
B 2 44  THR 44  544 544 THR THR B . n 
B 2 45  SER 45  545 545 SER SER B . n 
B 2 46  ILE 46  546 546 ILE ILE B . n 
B 2 47  GLU 47  547 547 GLU GLU B . n 
B 2 48  GLN 48  548 548 GLN GLN B . n 
B 2 49  ALA 49  549 549 ALA ALA B . n 
B 2 50  LYS 50  550 550 LYS LYS B . n 
B 2 51  VAL 51  551 551 VAL VAL B . n 
B 2 52  GLU 52  552 552 GLU GLU B . n 
B 2 53  GLU 53  553 553 GLU GLU B . n 
B 2 54  LYS 54  554 554 LYS LYS B . n 
B 2 55  ILE 55  555 555 ILE ILE B . n 
B 2 56  GLN 56  556 556 GLN GLN B . n 
B 2 57  GLU 57  557 557 GLU GLU B . n 
B 2 58  VAL 58  558 558 VAL VAL B . n 
B 2 59  PHE 59  559 559 PHE PHE B . n 
B 2 60  SER 60  560 560 SER SER B . n 
B 2 61  SER 61  561 561 SER SER B . n 
B 2 62  TYR 62  562 562 TYR TYR B . n 
B 2 63  LYS 63  563 563 LYS LYS B . n 
B 2 64  PHE 64  564 564 PHE PHE B . n 
B 2 65  ASN 65  565 565 ASN ASN B . n 
B 2 66  HIS 66  566 566 HIS HIS B . n 
B 2 67  LEU 67  567 567 LEU LEU B . n 
B 2 68  VAL 68  568 568 VAL VAL B . n 
B 2 69  PRO 69  569 569 PRO PRO B . n 
B 2 70  ARG 70  570 570 ARG ARG B . n 
B 2 71  LEU 71  571 571 LEU LEU B . n 
B 2 72  VAL 72  572 572 VAL VAL B . n 
B 2 73  LEU 73  573 573 LEU LEU B . n 
B 2 74  GLN 74  574 574 GLN GLN B . n 
B 2 75  ARG 75  575 575 ARG ARG B . n 
B 2 76  GLU 76  576 576 GLU GLU B . n 
B 2 77  LYS 77  577 577 LYS LYS B . n 
B 2 78  HIS 78  578 578 HIS HIS B . n 
B 2 79  PHE 79  579 579 PHE PHE B . n 
B 2 80  HIS 80  580 580 HIS HIS B . n 
B 2 81  TYR 81  581 581 TYR TYR B . n 
B 2 82  LEU 82  582 582 LEU LEU B . n 
B 2 83  LYS 83  583 583 LYS LYS B . n 
B 2 84  ARG 84  584 584 ARG ARG B . n 
B 2 85  GLY 85  585 585 GLY GLY B . n 
B 2 86  LEU 86  586 586 LEU LEU B . n 
B 2 87  ARG 87  587 587 ARG ARG B . n 
B 2 88  GLN 88  588 588 GLN GLN B . n 
B 2 89  LEU 89  589 589 LEU LEU B . n 
B 2 90  THR 90  590 590 THR THR B . n 
B 2 91  ASP 91  591 591 ASP ASP B . n 
B 2 92  ALA 92  592 592 ALA ALA B . n 
B 2 93  TYR 93  593 593 TYR TYR B . n 
B 2 94  GLU 94  594 594 GLU GLU B . n 
B 2 95  CYS 95  595 595 CYS CYS B . n 
B 2 96  LEU 96  596 596 LEU LEU B . n 
B 2 97  ASP 97  597 597 ASP ASP B . n 
B 2 98  ALA 98  598 598 ALA ALA B . n 
B 2 99  SER 99  599 599 SER SER B . n 
B 2 100 ARG 100 600 600 ARG ARG B . n 
B 2 101 PRO 101 601 601 PRO PRO B . n 
B 2 102 TRP 102 602 602 TRP TRP B . n 
B 2 103 LEU 103 603 603 LEU LEU B . n 
B 2 104 CYS 104 604 604 CYS CYS B . n 
B 2 105 TYR 105 605 605 TYR TYR B . n 
B 2 106 TRP 106 606 606 TRP TRP B . n 
B 2 107 ILE 107 607 607 ILE ILE B . n 
B 2 108 LEU 108 608 608 LEU LEU B . n 
B 2 109 HIS 109 609 609 HIS HIS B . n 
B 2 110 SER 110 610 610 SER SER B . n 
B 2 111 LEU 111 611 611 LEU LEU B . n 
B 2 112 GLU 112 612 612 GLU GLU B . n 
B 2 113 LEU 113 613 613 LEU LEU B . n 
B 2 114 LEU 114 614 614 LEU LEU B . n 
B 2 115 ASP 115 615 615 ASP ASP B . n 
B 2 116 GLU 116 616 616 GLU GLU B . n 
B 2 117 PRO 117 617 617 PRO PRO B . n 
B 2 118 ILE 118 618 618 ILE ILE B . n 
B 2 119 PRO 119 619 619 PRO PRO B . n 
B 2 120 GLN 120 620 620 GLN GLN B . n 
B 2 121 ILE 121 621 621 ILE ILE B . n 
B 2 122 VAL 122 622 622 VAL VAL B . n 
B 2 123 ALA 123 623 623 ALA ALA B . n 
B 2 124 THR 124 624 624 THR THR B . n 
B 2 125 ASP 125 625 625 ASP ASP B . n 
B 2 126 VAL 126 626 626 VAL VAL B . n 
B 2 127 CYS 127 627 627 CYS CYS B . n 
B 2 128 GLN 128 628 628 GLN GLN B . n 
B 2 129 PHE 129 629 629 PHE PHE B . n 
B 2 130 LEU 130 630 630 LEU LEU B . n 
B 2 131 GLU 131 631 631 GLU GLU B . n 
B 2 132 LEU 132 632 632 LEU LEU B . n 
B 2 133 CYS 133 633 633 CYS CYS B . n 
B 2 134 GLN 134 634 634 GLN GLN B . n 
B 2 135 SER 135 635 635 SER SER B . n 
B 2 136 PRO 136 636 636 PRO PRO B . n 
B 2 137 GLU 137 637 637 GLU GLU B . n 
B 2 138 GLY 138 638 638 GLY GLY B . n 
B 2 139 GLY 139 639 639 GLY GLY B . n 
B 2 140 PHE 140 640 640 PHE PHE B . n 
B 2 141 GLY 141 641 641 GLY GLY B . n 
B 2 142 GLY 142 642 642 GLY GLY B . n 
B 2 143 GLY 143 643 643 GLY GLY B . n 
B 2 144 PRO 144 644 644 PRO PRO B . n 
B 2 145 GLY 145 645 645 GLY GLY B . n 
B 2 146 GLN 146 646 646 GLN GLN B . n 
B 2 147 TYR 147 647 647 TYR TYR B . n 
B 2 148 PRO 148 648 648 PRO PRO B . n 
B 2 149 HIS 149 649 649 HIS HIS B . n 
B 2 150 LEU 150 650 650 LEU LEU B . n 
B 2 151 ALA 151 651 651 ALA ALA B . n 
B 2 152 PRO 152 652 652 PRO PRO B . n 
B 2 153 THR 153 653 653 THR THR B . n 
B 2 154 TYR 154 654 654 TYR TYR B . n 
B 2 155 ALA 155 655 655 ALA ALA B . n 
B 2 156 ALA 156 656 656 ALA ALA B . n 
B 2 157 VAL 157 657 657 VAL VAL B . n 
B 2 158 ASN 158 658 658 ASN ASN B . n 
B 2 159 ALA 159 659 659 ALA ALA B . n 
B 2 160 LEU 160 660 660 LEU LEU B . n 
B 2 161 CYS 161 661 661 CYS CYS B . n 
B 2 162 ILE 162 662 662 ILE ILE B . n 
B 2 163 ILE 163 663 663 ILE ILE B . n 
B 2 164 GLY 164 664 664 GLY GLY B . n 
B 2 165 THR 165 665 665 THR THR B . n 
B 2 166 GLU 166 666 666 GLU GLU B . n 
B 2 167 GLU 167 667 667 GLU GLU B . n 
B 2 168 ALA 168 668 668 ALA ALA B . n 
B 2 169 TYR 169 669 669 TYR TYR B . n 
B 2 170 ASP 170 670 670 ASP ASP B . n 
B 2 171 ILE 171 671 671 ILE ILE B . n 
B 2 172 ILE 172 672 672 ILE ILE B . n 
B 2 173 ASN 173 673 673 ASN ASN B . n 
B 2 174 ARG 174 674 674 ARG ARG B . n 
B 2 175 GLU 175 675 675 GLU GLU B . n 
B 2 176 LYS 176 676 676 LYS LYS B . n 
B 2 177 LEU 177 677 677 LEU LEU B . n 
B 2 178 LEU 178 678 678 LEU LEU B . n 
B 2 179 GLN 179 679 679 GLN GLN B . n 
B 2 180 TYR 180 680 680 TYR TYR B . n 
B 2 181 LEU 181 681 681 LEU LEU B . n 
B 2 182 TYR 182 682 682 TYR TYR B . n 
B 2 183 SER 183 683 683 SER SER B . n 
B 2 184 LEU 184 684 684 LEU LEU B . n 
B 2 185 LYS 185 685 685 LYS LYS B . n 
B 2 186 GLN 186 686 686 GLN GLN B . n 
B 2 187 PRO 187 687 687 PRO PRO B . n 
B 2 188 ASP 188 688 688 ASP ASP B . n 
B 2 189 GLY 189 689 689 GLY GLY B . n 
B 2 190 SER 190 690 690 SER SER B . n 
B 2 191 PHE 191 691 691 PHE PHE B . n 
B 2 192 LEU 192 692 692 LEU LEU B . n 
B 2 193 MET 193 693 693 MET MET B . n 
B 2 194 HIS 194 694 694 HIS HIS B . n 
B 2 195 VAL 195 695 695 VAL VAL B . n 
B 2 196 GLY 196 696 696 GLY GLY B . n 
B 2 197 GLY 197 697 697 GLY GLY B . n 
B 2 198 GLU 198 698 698 GLU GLU B . n 
B 2 199 VAL 199 699 699 VAL VAL B . n 
B 2 200 ASP 200 700 700 ASP ASP B . n 
B 2 201 VAL 201 701 701 VAL VAL B . n 
B 2 202 ARG 202 702 702 ARG ARG B . n 
B 2 203 SER 203 703 703 SER SER B . n 
B 2 204 ALA 204 704 704 ALA ALA B . n 
B 2 205 TYR 205 705 705 TYR TYR B . n 
B 2 206 CYS 206 706 706 CYS CYS B . n 
B 2 207 ALA 207 707 707 ALA ALA B . n 
B 2 208 ALA 208 708 708 ALA ALA B . n 
B 2 209 SER 209 709 709 SER SER B . n 
B 2 210 VAL 210 710 710 VAL VAL B . n 
B 2 211 ALA 211 711 711 ALA ALA B . n 
B 2 212 SER 212 712 712 SER SER B . n 
B 2 213 LEU 213 713 713 LEU LEU B . n 
B 2 214 THR 214 714 714 THR THR B . n 
B 2 215 ASN 215 715 715 ASN ASN B . n 
B 2 216 ILE 216 716 716 ILE ILE B . n 
B 2 217 ILE 217 717 717 ILE ILE B . n 
B 2 218 THR 218 718 718 THR THR B . n 
B 2 219 PRO 219 719 719 PRO PRO B . n 
B 2 220 ASP 220 720 720 ASP ASP B . n 
B 2 221 LEU 221 721 721 LEU LEU B . n 
B 2 222 PHE 222 722 722 PHE PHE B . n 
B 2 223 GLU 223 723 723 GLU GLU B . n 
B 2 224 GLY 224 724 724 GLY GLY B . n 
B 2 225 THR 225 725 725 THR THR B . n 
B 2 226 ALA 226 726 726 ALA ALA B . n 
B 2 227 GLU 227 727 727 GLU GLU B . n 
B 2 228 TRP 228 728 728 TRP TRP B . n 
B 2 229 ILE 229 729 729 ILE ILE B . n 
B 2 230 ALA 230 730 730 ALA ALA B . n 
B 2 231 ARG 231 731 731 ARG ARG B . n 
B 2 232 CYS 232 732 732 CYS CYS B . n 
B 2 233 GLN 233 733 733 GLN GLN B . n 
B 2 234 ASN 234 734 734 ASN ASN B . n 
B 2 235 TRP 235 735 735 TRP TRP B . n 
B 2 236 GLU 236 736 736 GLU GLU B . n 
B 2 237 GLY 237 737 737 GLY GLY B . n 
B 2 238 GLY 238 738 738 GLY GLY B . n 
B 2 239 ILE 239 739 739 ILE ILE B . n 
B 2 240 GLY 240 740 740 GLY GLY B . n 
B 2 241 GLY 241 741 741 GLY GLY B . n 
B 2 242 VAL 242 742 742 VAL VAL B . n 
B 2 243 PRO 243 743 743 PRO PRO B . n 
B 2 244 GLY 244 744 744 GLY GLY B . n 
B 2 245 MET 245 745 745 MET MET B . n 
B 2 246 GLU 246 746 746 GLU GLU B . n 
B 2 247 ALA 247 747 747 ALA ALA B . n 
B 2 248 HIS 248 748 748 HIS HIS B . n 
B 2 249 GLY 249 749 749 GLY GLY B . n 
B 2 250 GLY 250 750 750 GLY GLY B . n 
B 2 251 TYR 251 751 751 TYR TYR B . n 
B 2 252 THR 252 752 752 THR THR B . n 
B 2 253 PHE 253 753 753 PHE PHE B . n 
B 2 254 CYS 254 754 754 CYS CYS B . n 
B 2 255 GLY 255 755 755 GLY GLY B . n 
B 2 256 LEU 256 756 756 LEU LEU B . n 
B 2 257 ALA 257 757 757 ALA ALA B . n 
B 2 258 ALA 258 758 758 ALA ALA B . n 
B 2 259 LEU 259 759 759 LEU LEU B . n 
B 2 260 VAL 260 760 760 VAL VAL B . n 
B 2 261 ILE 261 761 761 ILE ILE B . n 
B 2 262 LEU 262 762 762 LEU LEU B . n 
B 2 263 LYS 263 763 763 LYS LYS B . n 
B 2 264 ARG 264 764 764 ARG ARG B . n 
B 2 265 GLU 265 765 765 GLU GLU B . n 
B 2 266 ARG 266 766 766 ARG ARG B . n 
B 2 267 SER 267 767 767 SER SER B . n 
B 2 268 LEU 268 768 768 LEU LEU B . n 
B 2 269 ASN 269 769 769 ASN ASN B . n 
B 2 270 LEU 270 770 770 LEU LEU B . n 
B 2 271 LYS 271 771 771 LYS LYS B . n 
B 2 272 SER 272 772 772 SER SER B . n 
B 2 273 LEU 273 773 773 LEU LEU B . n 
B 2 274 LEU 274 774 774 LEU LEU B . n 
B 2 275 GLN 275 775 775 GLN GLN B . n 
B 2 276 TRP 276 776 776 TRP TRP B . n 
B 2 277 VAL 277 777 777 VAL VAL B . n 
B 2 278 THR 278 778 778 THR THR B . n 
B 2 279 SER 279 779 779 SER SER B . n 
B 2 280 ARG 280 780 780 ARG ARG B . n 
B 2 281 GLN 281 781 781 GLN GLN B . n 
B 2 282 MET 282 782 782 MET MET B . n 
B 2 283 ARG 283 783 783 ARG ARG B . n 
B 2 284 PHE 284 784 784 PHE PHE B . n 
B 2 285 GLU 285 785 785 GLU GLU B . n 
B 2 286 GLY 286 786 786 GLY GLY B . n 
B 2 287 GLY 287 787 787 GLY GLY B . n 
B 2 288 PHE 288 788 788 PHE PHE B . n 
B 2 289 GLN 289 789 789 GLN GLN B . n 
B 2 290 GLY 290 790 790 GLY GLY B . n 
B 2 291 ARG 291 791 791 ARG ARG B . n 
B 2 292 CYS 292 792 792 CYS CYS B . n 
B 2 293 ASN 293 793 793 ASN ASN B . n 
B 2 294 LYS 294 794 794 LYS LYS B . n 
B 2 295 LEU 295 795 795 LEU LEU B . n 
B 2 296 VAL 296 796 796 VAL VAL B . n 
B 2 297 ASP 297 797 797 ASP ASP B . n 
B 2 298 GLY 298 798 798 GLY GLY B . n 
B 2 299 CYS 299 799 799 CYS CYS B . n 
B 2 300 TYR 300 800 800 TYR TYR B . n 
B 2 301 SER 301 801 801 SER SER B . n 
B 2 302 PHE 302 802 802 PHE PHE B . n 
B 2 303 TRP 303 803 803 TRP TRP B . n 
B 2 304 GLN 304 804 804 GLN GLN B . n 
B 2 305 ALA 305 805 805 ALA ALA B . n 
B 2 306 GLY 306 806 806 GLY GLY B . n 
B 2 307 LEU 307 807 807 LEU LEU B . n 
B 2 308 LEU 308 808 808 LEU LEU B . n 
B 2 309 PRO 309 809 809 PRO PRO B . n 
B 2 310 LEU 310 810 810 LEU LEU B . n 
B 2 311 LEU 311 811 811 LEU LEU B . n 
B 2 312 HIS 312 812 812 HIS HIS B . n 
B 2 313 ARG 313 813 813 ARG ARG B . n 
B 2 314 ALA 314 814 814 ALA ALA B . n 
B 2 315 LEU 315 815 815 LEU LEU B . n 
B 2 316 HIS 316 816 816 HIS HIS B . n 
B 2 317 ALA 317 817 817 ALA ALA B . n 
B 2 318 GLN 318 818 818 GLN GLN B . n 
B 2 319 GLY 319 819 819 GLY GLY B . n 
B 2 320 ASP 320 820 820 ASP ASP B . n 
B 2 321 PRO 321 821 821 PRO PRO B . n 
B 2 322 ALA 322 822 822 ALA ALA B . n 
B 2 323 LEU 323 823 823 LEU LEU B . n 
B 2 324 SER 324 824 824 SER SER B . n 
B 2 325 MET 325 825 825 MET MET B . n 
B 2 326 SER 326 826 826 SER SER B . n 
B 2 327 HIS 327 827 827 HIS HIS B . n 
B 2 328 TRP 328 828 828 TRP TRP B . n 
B 2 329 MET 329 829 829 MET MET B . n 
B 2 330 PHE 330 830 830 PHE PHE B . n 
B 2 331 HIS 331 831 831 HIS HIS B . n 
B 2 332 GLN 332 832 832 GLN GLN B . n 
B 2 333 GLN 333 833 833 GLN GLN B . n 
B 2 334 ALA 334 834 834 ALA ALA B . n 
B 2 335 LEU 335 835 835 LEU LEU B . n 
B 2 336 GLN 336 836 836 GLN GLN B . n 
B 2 337 GLU 337 837 837 GLU GLU B . n 
B 2 338 TYR 338 838 838 TYR TYR B . n 
B 2 339 ILE 339 839 839 ILE ILE B . n 
B 2 340 LEU 340 840 840 LEU LEU B . n 
B 2 341 MET 341 841 841 MET MET B . n 
B 2 342 CYS 342 842 842 CYS CYS B . n 
B 2 343 CYS 343 843 843 CYS CYS B . n 
B 2 344 GLN 344 844 844 GLN GLN B . n 
B 2 345 CYS 345 845 845 CYS CYS B . n 
B 2 346 PRO 346 846 846 PRO PRO B . n 
B 2 347 ALA 347 847 847 ALA ALA B . n 
B 2 348 GLY 348 848 848 GLY GLY B . n 
B 2 349 GLY 349 849 849 GLY GLY B . n 
B 2 350 LEU 350 850 850 LEU LEU B . n 
B 2 351 LEU 351 851 851 LEU LEU B . n 
B 2 352 ASP 352 852 852 ASP ASP B . n 
B 2 353 LYS 353 853 853 LYS LYS B . n 
B 2 354 PRO 354 854 854 PRO PRO B . n 
B 2 355 GLY 355 855 855 GLY GLY B . n 
B 2 356 LYS 356 856 856 LYS LYS B . n 
B 2 357 SER 357 857 857 SER SER B . n 
B 2 358 ARG 358 858 858 ARG ARG B . n 
B 2 359 ASP 359 859 859 ASP ASP B . n 
B 2 360 PHE 360 860 860 PHE PHE B . n 
B 2 361 TYR 361 861 861 TYR TYR B . n 
B 2 362 HIS 362 862 862 HIS HIS B . n 
B 2 363 THR 363 863 863 THR THR B . n 
B 2 364 CYS 364 864 864 CYS CYS B . n 
B 2 365 TYR 365 865 865 TYR TYR B . n 
B 2 366 CYS 366 866 866 CYS CYS B . n 
B 2 367 LEU 367 867 867 LEU LEU B . n 
B 2 368 SER 368 868 868 SER SER B . n 
B 2 369 GLY 369 869 869 GLY GLY B . n 
B 2 370 LEU 370 870 870 LEU LEU B . n 
B 2 371 SER 371 871 871 SER SER B . n 
B 2 372 ILE 372 872 872 ILE ILE B . n 
B 2 373 ALA 373 873 873 ALA ALA B . n 
B 2 374 GLN 374 874 874 GLN GLN B . n 
B 2 375 HIS 375 875 875 HIS HIS B . n 
B 2 376 PHE 376 876 876 PHE PHE B . n 
B 2 377 GLY 377 877 877 GLY GLY B . n 
B 2 378 SER 378 878 878 SER SER B . n 
B 2 379 GLY 379 879 879 GLY GLY B . n 
B 2 380 ALA 380 880 880 ALA ALA B . n 
B 2 381 MET 381 881 881 MET MET B . n 
B 2 382 LEU 382 882 882 LEU LEU B . n 
B 2 383 HIS 383 883 883 HIS HIS B . n 
B 2 384 ASP 384 884 884 ASP ASP B . n 
B 2 385 VAL 385 885 885 VAL VAL B . n 
B 2 386 VAL 386 886 886 VAL VAL B . n 
B 2 387 LEU 387 887 887 LEU LEU B . n 
B 2 388 GLY 388 888 888 GLY GLY B . n 
B 2 389 VAL 389 889 889 VAL VAL B . n 
B 2 390 PRO 390 890 890 PRO PRO B . n 
B 2 391 GLU 391 891 891 GLU GLU B . n 
B 2 392 ASN 392 892 892 ASN ASN B . n 
B 2 393 ALA 393 893 893 ALA ALA B . n 
B 2 394 LEU 394 894 894 LEU LEU B . n 
B 2 395 GLN 395 895 895 GLN GLN B . n 
B 2 396 PRO 396 896 896 PRO PRO B . n 
B 2 397 THR 397 897 897 THR THR B . n 
B 2 398 HIS 398 898 898 HIS HIS B . n 
B 2 399 PRO 399 899 899 PRO PRO B . n 
B 2 400 VAL 400 900 900 VAL VAL B . n 
B 2 401 TYR 401 901 901 TYR TYR B . n 
B 2 402 ASN 402 902 902 ASN ASN B . n 
B 2 403 ILE 403 903 903 ILE ILE B . n 
B 2 404 GLY 404 904 904 GLY GLY B . n 
B 2 405 PRO 405 905 905 PRO PRO B . n 
B 2 406 ASP 406 906 906 ASP ASP B . n 
B 2 407 LYS 407 907 907 LYS LYS B . n 
B 2 408 VAL 408 908 908 VAL VAL B . n 
B 2 409 ILE 409 909 909 ILE ILE B . n 
B 2 410 GLN 410 910 910 GLN GLN B . n 
B 2 411 ALA 411 911 911 ALA ALA B . n 
B 2 412 THR 412 912 912 THR THR B . n 
B 2 413 THR 413 913 913 THR THR B . n 
B 2 414 TYR 414 914 914 TYR TYR B . n 
B 2 415 PHE 415 915 915 PHE PHE B . n 
B 2 416 LEU 416 916 916 LEU LEU B . n 
B 2 417 GLN 417 917 917 GLN GLN B . n 
B 2 418 LYS 418 918 918 LYS LYS B . n 
B 2 419 PRO 419 919 919 PRO PRO B . n 
B 2 420 VAL 420 920 920 VAL VAL B . n 
B 2 421 PRO 421 921 921 PRO PRO B . n 
B 2 422 GLY 422 922 922 GLY GLY B . n 
B 2 423 PHE 423 923 923 PHE PHE B . n 
B 2 424 GLU 424 924 ?   ?   ?   B . n 
B 2 425 GLU 425 925 ?   ?   ?   B . n 
B 2 426 LEU 426 926 ?   ?   ?   B . n 
B 2 427 LYS 427 927 ?   ?   ?   B . n 
B 2 428 ASP 428 928 ?   ?   ?   B . n 
B 2 429 GLU 429 929 ?   ?   ?   B . n 
B 2 430 THR 430 930 ?   ?   ?   B . n 
B 2 431 SER 431 931 ?   ?   ?   B . n 
B 2 432 ALA 432 932 ?   ?   ?   B . n 
B 2 433 GLU 433 933 ?   ?   ?   B . n 
B 2 434 PRO 434 934 ?   ?   ?   B . n 
B 2 435 ALA 435 935 ?   ?   ?   B . n 
B 2 436 THR 436 936 ?   ?   ?   B . n 
B 2 437 ASP 437 937 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   1001 1001 ZN  ZN2 B . 
E 5 FPP 1   1002 1    FPP FPP B . 
F 6 BNE 1   1003 1    BNE UNK B . 
G 7 HOH 1   1004 1004 HOH WAT A . 
G 7 HOH 2   1007 1007 HOH WAT A . 
G 7 HOH 3   1008 1008 HOH WAT A . 
G 7 HOH 4   1011 1011 HOH WAT A . 
G 7 HOH 5   1016 1016 HOH WAT A . 
G 7 HOH 6   1020 1020 HOH WAT A . 
G 7 HOH 7   1021 1021 HOH WAT A . 
G 7 HOH 8   1025 1025 HOH WAT A . 
G 7 HOH 9   1027 1027 HOH WAT A . 
G 7 HOH 10  1028 1028 HOH WAT A . 
G 7 HOH 11  1029 1029 HOH WAT A . 
G 7 HOH 12  1031 1031 HOH WAT A . 
G 7 HOH 13  1033 1033 HOH WAT A . 
G 7 HOH 14  1034 1034 HOH WAT A . 
G 7 HOH 15  1035 1035 HOH WAT A . 
G 7 HOH 16  1036 1036 HOH WAT A . 
G 7 HOH 17  1037 1037 HOH WAT A . 
G 7 HOH 18  1039 1039 HOH WAT A . 
G 7 HOH 19  1040 1040 HOH WAT A . 
G 7 HOH 20  1041 1041 HOH WAT A . 
G 7 HOH 21  1044 1044 HOH WAT A . 
G 7 HOH 22  1046 1046 HOH WAT A . 
G 7 HOH 23  1047 1047 HOH WAT A . 
G 7 HOH 24  1048 1048 HOH WAT A . 
G 7 HOH 25  1054 1054 HOH WAT A . 
G 7 HOH 26  1057 1057 HOH WAT A . 
G 7 HOH 27  1063 1063 HOH WAT A . 
G 7 HOH 28  1065 1065 HOH WAT A . 
G 7 HOH 29  1066 1066 HOH WAT A . 
G 7 HOH 30  1069 1069 HOH WAT A . 
G 7 HOH 31  1070 1070 HOH WAT A . 
G 7 HOH 32  1077 1077 HOH WAT A . 
G 7 HOH 33  1084 1084 HOH WAT A . 
G 7 HOH 34  1085 1085 HOH WAT A . 
G 7 HOH 35  1087 1087 HOH WAT A . 
G 7 HOH 36  1090 1090 HOH WAT A . 
G 7 HOH 37  1096 1096 HOH WAT A . 
G 7 HOH 38  1099 1099 HOH WAT A . 
G 7 HOH 39  1101 1101 HOH WAT A . 
G 7 HOH 40  1105 1105 HOH WAT A . 
G 7 HOH 41  1106 1106 HOH WAT A . 
G 7 HOH 42  1107 1107 HOH WAT A . 
G 7 HOH 43  1110 1110 HOH WAT A . 
G 7 HOH 44  1112 1112 HOH WAT A . 
G 7 HOH 45  1113 1113 HOH WAT A . 
G 7 HOH 46  1117 1117 HOH WAT A . 
G 7 HOH 47  1123 1123 HOH WAT A . 
G 7 HOH 48  1124 1124 HOH WAT A . 
G 7 HOH 49  1131 1131 HOH WAT A . 
G 7 HOH 50  1138 1138 HOH WAT A . 
G 7 HOH 51  1142 1142 HOH WAT A . 
G 7 HOH 52  1143 1143 HOH WAT A . 
G 7 HOH 53  1149 1149 HOH WAT A . 
G 7 HOH 54  1150 1150 HOH WAT A . 
G 7 HOH 55  1153 1153 HOH WAT A . 
G 7 HOH 56  1160 1160 HOH WAT A . 
G 7 HOH 57  1167 1167 HOH WAT A . 
G 7 HOH 58  1171 1171 HOH WAT A . 
G 7 HOH 59  1174 1174 HOH WAT A . 
G 7 HOH 60  1177 1177 HOH WAT A . 
G 7 HOH 61  1180 1180 HOH WAT A . 
G 7 HOH 62  1181 1181 HOH WAT A . 
G 7 HOH 63  1182 1182 HOH WAT A . 
G 7 HOH 64  1188 1188 HOH WAT A . 
G 7 HOH 65  1193 1193 HOH WAT A . 
G 7 HOH 66  1194 1194 HOH WAT A . 
G 7 HOH 67  1196 1196 HOH WAT A . 
G 7 HOH 68  1202 1202 HOH WAT A . 
G 7 HOH 69  1204 1204 HOH WAT A . 
G 7 HOH 70  1205 1205 HOH WAT A . 
G 7 HOH 71  1208 1208 HOH WAT A . 
G 7 HOH 72  1211 1211 HOH WAT A . 
G 7 HOH 73  1213 1213 HOH WAT A . 
G 7 HOH 74  1228 1228 HOH WAT A . 
G 7 HOH 75  1233 1233 HOH WAT A . 
G 7 HOH 76  1238 1238 HOH WAT A . 
G 7 HOH 77  1242 1242 HOH WAT A . 
G 7 HOH 78  1243 1243 HOH WAT A . 
G 7 HOH 79  1244 1244 HOH WAT A . 
G 7 HOH 80  1248 1248 HOH WAT A . 
G 7 HOH 81  1250 1250 HOH WAT A . 
G 7 HOH 82  1251 1251 HOH WAT A . 
G 7 HOH 83  1254 1254 HOH WAT A . 
G 7 HOH 84  1258 1258 HOH WAT A . 
G 7 HOH 85  1265 1265 HOH WAT A . 
G 7 HOH 86  1267 1267 HOH WAT A . 
G 7 HOH 87  1272 1272 HOH WAT A . 
G 7 HOH 88  1276 1276 HOH WAT A . 
G 7 HOH 89  1286 1286 HOH WAT A . 
G 7 HOH 90  1292 1292 HOH WAT A . 
G 7 HOH 91  1293 1293 HOH WAT A . 
G 7 HOH 92  1296 1296 HOH WAT A . 
G 7 HOH 93  1303 1303 HOH WAT A . 
G 7 HOH 94  1310 1310 HOH WAT A . 
G 7 HOH 95  1313 1313 HOH WAT A . 
G 7 HOH 96  1318 1318 HOH WAT A . 
G 7 HOH 97  1324 1324 HOH WAT A . 
G 7 HOH 98  1325 1325 HOH WAT A . 
G 7 HOH 99  1329 1329 HOH WAT A . 
G 7 HOH 100 1330 1330 HOH WAT A . 
G 7 HOH 101 1331 1331 HOH WAT A . 
G 7 HOH 102 1333 1333 HOH WAT A . 
G 7 HOH 103 1335 1335 HOH WAT A . 
G 7 HOH 104 1336 1336 HOH WAT A . 
G 7 HOH 105 1338 1338 HOH WAT A . 
G 7 HOH 106 1341 1341 HOH WAT A . 
G 7 HOH 107 1342 1342 HOH WAT A . 
G 7 HOH 108 1347 1347 HOH WAT A . 
G 7 HOH 109 1352 1352 HOH WAT A . 
G 7 HOH 110 1354 1354 HOH WAT A . 
G 7 HOH 111 1357 1357 HOH WAT A . 
G 7 HOH 112 1359 1359 HOH WAT A . 
G 7 HOH 113 1360 1360 HOH WAT A . 
G 7 HOH 114 1365 1365 HOH WAT A . 
G 7 HOH 115 1367 1367 HOH WAT A . 
G 7 HOH 116 1369 1369 HOH WAT A . 
G 7 HOH 117 1370 1370 HOH WAT A . 
G 7 HOH 118 1371 1371 HOH WAT A . 
G 7 HOH 119 1379 1379 HOH WAT A . 
G 7 HOH 120 1381 1381 HOH WAT A . 
G 7 HOH 121 1382 1382 HOH WAT A . 
G 7 HOH 122 1383 1383 HOH WAT A . 
G 7 HOH 123 1386 1386 HOH WAT A . 
G 7 HOH 124 1389 1389 HOH WAT A . 
G 7 HOH 125 1393 1393 HOH WAT A . 
G 7 HOH 126 1398 1398 HOH WAT A . 
G 7 HOH 127 1404 1404 HOH WAT A . 
G 7 HOH 128 1405 1405 HOH WAT A . 
G 7 HOH 129 1412 1412 HOH WAT A . 
G 7 HOH 130 1414 1414 HOH WAT A . 
G 7 HOH 131 1417 1417 HOH WAT A . 
G 7 HOH 132 1421 1421 HOH WAT A . 
G 7 HOH 133 1423 1423 HOH WAT A . 
G 7 HOH 134 1428 1428 HOH WAT A . 
G 7 HOH 135 1439 1439 HOH WAT A . 
G 7 HOH 136 1443 1443 HOH WAT A . 
G 7 HOH 137 1445 1445 HOH WAT A . 
G 7 HOH 138 1447 1447 HOH WAT A . 
G 7 HOH 139 1450 1450 HOH WAT A . 
G 7 HOH 140 1453 1453 HOH WAT A . 
G 7 HOH 141 1454 1454 HOH WAT A . 
G 7 HOH 142 1455 1455 HOH WAT A . 
G 7 HOH 143 1459 1459 HOH WAT A . 
G 7 HOH 144 1461 1461 HOH WAT A . 
G 7 HOH 145 1462 1462 HOH WAT A . 
G 7 HOH 146 1471 1471 HOH WAT A . 
G 7 HOH 147 1474 1474 HOH WAT A . 
G 7 HOH 148 1476 1476 HOH WAT A . 
G 7 HOH 149 1481 1481 HOH WAT A . 
G 7 HOH 150 1482 1482 HOH WAT A . 
G 7 HOH 151 1484 1484 HOH WAT A . 
G 7 HOH 152 1485 1485 HOH WAT A . 
G 7 HOH 153 1493 1493 HOH WAT A . 
G 7 HOH 154 1497 1497 HOH WAT A . 
G 7 HOH 155 1500 1500 HOH WAT A . 
G 7 HOH 156 1507 1507 HOH WAT A . 
G 7 HOH 157 1510 1510 HOH WAT A . 
G 7 HOH 158 1517 1517 HOH WAT A . 
G 7 HOH 159 1519 1519 HOH WAT A . 
G 7 HOH 160 1527 1527 HOH WAT A . 
G 7 HOH 161 1529 1529 HOH WAT A . 
G 7 HOH 162 1538 1538 HOH WAT A . 
G 7 HOH 163 1545 1545 HOH WAT A . 
G 7 HOH 164 1550 1550 HOH WAT A . 
G 7 HOH 165 1553 1553 HOH WAT A . 
G 7 HOH 166 1559 1559 HOH WAT A . 
G 7 HOH 167 1560 1560 HOH WAT A . 
G 7 HOH 168 1565 1565 HOH WAT A . 
G 7 HOH 169 1571 1571 HOH WAT A . 
G 7 HOH 170 1572 1572 HOH WAT A . 
G 7 HOH 171 1577 1577 HOH WAT A . 
G 7 HOH 172 1578 1578 HOH WAT A . 
G 7 HOH 173 1585 1585 HOH WAT A . 
G 7 HOH 174 1588 1588 HOH WAT A . 
G 7 HOH 175 1590 1590 HOH WAT A . 
G 7 HOH 176 1593 1593 HOH WAT A . 
G 7 HOH 177 1594 1594 HOH WAT A . 
G 7 HOH 178 1598 1598 HOH WAT A . 
G 7 HOH 179 1599 1599 HOH WAT A . 
G 7 HOH 180 1601 1601 HOH WAT A . 
G 7 HOH 181 1603 1603 HOH WAT A . 
G 7 HOH 182 1607 1607 HOH WAT A . 
G 7 HOH 183 1613 1613 HOH WAT A . 
G 7 HOH 184 1618 1618 HOH WAT A . 
G 7 HOH 185 1620 1620 HOH WAT A . 
G 7 HOH 186 1621 1621 HOH WAT A . 
G 7 HOH 187 1624 1624 HOH WAT A . 
G 7 HOH 188 1638 1638 HOH WAT A . 
G 7 HOH 189 1640 1640 HOH WAT A . 
G 7 HOH 190 1646 1646 HOH WAT A . 
G 7 HOH 191 1648 1648 HOH WAT A . 
G 7 HOH 192 1650 1650 HOH WAT A . 
G 7 HOH 193 1657 1657 HOH WAT A . 
G 7 HOH 194 1662 1662 HOH WAT A . 
G 7 HOH 195 1665 1665 HOH WAT A . 
G 7 HOH 196 1670 1670 HOH WAT A . 
G 7 HOH 197 1685 1685 HOH WAT A . 
G 7 HOH 198 1689 1689 HOH WAT A . 
G 7 HOH 199 1692 1692 HOH WAT A . 
G 7 HOH 200 1693 1693 HOH WAT A . 
G 7 HOH 201 1698 1698 HOH WAT A . 
G 7 HOH 202 1700 1700 HOH WAT A . 
G 7 HOH 203 1705 1705 HOH WAT A . 
G 7 HOH 204 1707 1707 HOH WAT A . 
G 7 HOH 205 1708 1708 HOH WAT A . 
G 7 HOH 206 1716 1716 HOH WAT A . 
G 7 HOH 207 1717 1717 HOH WAT A . 
G 7 HOH 208 1718 1718 HOH WAT A . 
G 7 HOH 209 1719 1719 HOH WAT A . 
G 7 HOH 210 1721 1721 HOH WAT A . 
G 7 HOH 211 1729 1729 HOH WAT A . 
G 7 HOH 212 1733 1733 HOH WAT A . 
G 7 HOH 213 1739 1739 HOH WAT A . 
G 7 HOH 214 1741 1741 HOH WAT A . 
G 7 HOH 215 1746 1746 HOH WAT A . 
G 7 HOH 216 1747 1747 HOH WAT A . 
G 7 HOH 217 1748 1748 HOH WAT A . 
G 7 HOH 218 1759 1759 HOH WAT A . 
G 7 HOH 219 1761 1761 HOH WAT A . 
G 7 HOH 220 1762 1762 HOH WAT A . 
G 7 HOH 221 1763 1763 HOH WAT A . 
G 7 HOH 222 1777 1777 HOH WAT A . 
G 7 HOH 223 1793 1793 HOH WAT A . 
G 7 HOH 224 1799 1799 HOH WAT A . 
G 7 HOH 225 1801 1801 HOH WAT A . 
G 7 HOH 226 1802 1802 HOH WAT A . 
G 7 HOH 227 1805 1805 HOH WAT A . 
G 7 HOH 228 1808 1808 HOH WAT A . 
G 7 HOH 229 1809 1809 HOH WAT A . 
G 7 HOH 230 1810 1810 HOH WAT A . 
G 7 HOH 231 1816 1816 HOH WAT A . 
G 7 HOH 232 1818 1818 HOH WAT A . 
G 7 HOH 233 1830 1830 HOH WAT A . 
G 7 HOH 234 1839 1839 HOH WAT A . 
G 7 HOH 235 1840 1840 HOH WAT A . 
G 7 HOH 236 1850 1850 HOH WAT A . 
G 7 HOH 237 1857 1857 HOH WAT A . 
G 7 HOH 238 1861 1861 HOH WAT A . 
G 7 HOH 239 1862 1862 HOH WAT A . 
G 7 HOH 240 1886 1886 HOH WAT A . 
G 7 HOH 241 1897 1897 HOH WAT A . 
G 7 HOH 242 1899 1899 HOH WAT A . 
G 7 HOH 243 1903 1903 HOH WAT A . 
G 7 HOH 244 1905 1905 HOH WAT A . 
G 7 HOH 245 1909 1909 HOH WAT A . 
G 7 HOH 246 1911 1911 HOH WAT A . 
G 7 HOH 247 1912 1912 HOH WAT A . 
G 7 HOH 248 1913 1913 HOH WAT A . 
G 7 HOH 249 1919 1919 HOH WAT A . 
G 7 HOH 250 1920 1920 HOH WAT A . 
G 7 HOH 251 1921 1921 HOH WAT A . 
G 7 HOH 252 1922 1922 HOH WAT A . 
G 7 HOH 253 1924 1924 HOH WAT A . 
G 7 HOH 254 1926 1926 HOH WAT A . 
G 7 HOH 255 1928 1928 HOH WAT A . 
G 7 HOH 256 1929 1929 HOH WAT A . 
G 7 HOH 257 1930 1930 HOH WAT A . 
G 7 HOH 258 1931 1931 HOH WAT A . 
G 7 HOH 259 1933 1933 HOH WAT A . 
G 7 HOH 260 1936 1936 HOH WAT A . 
G 7 HOH 261 1938 1938 HOH WAT A . 
G 7 HOH 262 1939 1939 HOH WAT A . 
G 7 HOH 263 1940 1940 HOH WAT A . 
G 7 HOH 264 1942 1942 HOH WAT A . 
G 7 HOH 265 1943 1943 HOH WAT A . 
G 7 HOH 266 1948 1948 HOH WAT A . 
G 7 HOH 267 1949 1949 HOH WAT A . 
G 7 HOH 268 1950 1950 HOH WAT A . 
G 7 HOH 269 1951 1951 HOH WAT A . 
G 7 HOH 270 1952 1952 HOH WAT A . 
G 7 HOH 271 1953 1953 HOH WAT A . 
G 7 HOH 272 1960 1960 HOH WAT A . 
G 7 HOH 273 1961 1961 HOH WAT A . 
G 7 HOH 274 1962 1962 HOH WAT A . 
G 7 HOH 275 1963 1963 HOH WAT A . 
G 7 HOH 276 1965 1965 HOH WAT A . 
G 7 HOH 277 1966 1966 HOH WAT A . 
G 7 HOH 278 1967 1967 HOH WAT A . 
G 7 HOH 279 1968 1968 HOH WAT A . 
G 7 HOH 280 1971 1971 HOH WAT A . 
G 7 HOH 281 1974 1974 HOH WAT A . 
G 7 HOH 282 1975 1975 HOH WAT A . 
G 7 HOH 283 1976 1976 HOH WAT A . 
G 7 HOH 284 1978 1978 HOH WAT A . 
G 7 HOH 285 1980 1980 HOH WAT A . 
G 7 HOH 286 1982 1982 HOH WAT A . 
G 7 HOH 287 1985 1985 HOH WAT A . 
G 7 HOH 288 1988 1988 HOH WAT A . 
G 7 HOH 289 1991 1991 HOH WAT A . 
G 7 HOH 290 1993 1993 HOH WAT A . 
G 7 HOH 291 1996 1996 HOH WAT A . 
G 7 HOH 292 1998 1998 HOH WAT A . 
G 7 HOH 293 2000 2000 HOH WAT A . 
G 7 HOH 294 2003 2003 HOH WAT A . 
G 7 HOH 295 2006 2006 HOH WAT A . 
G 7 HOH 296 2007 2007 HOH WAT A . 
G 7 HOH 297 2010 2010 HOH WAT A . 
G 7 HOH 298 2011 2011 HOH WAT A . 
G 7 HOH 299 2016 2016 HOH WAT A . 
G 7 HOH 300 2019 2019 HOH WAT A . 
G 7 HOH 301 2022 2022 HOH WAT A . 
G 7 HOH 302 2027 2027 HOH WAT A . 
G 7 HOH 303 2031 2031 HOH WAT A . 
G 7 HOH 304 2032 2032 HOH WAT A . 
G 7 HOH 305 2034 2034 HOH WAT A . 
G 7 HOH 306 2036 2036 HOH WAT A . 
G 7 HOH 307 2037 2037 HOH WAT A . 
G 7 HOH 308 2038 2038 HOH WAT A . 
G 7 HOH 309 2042 2042 HOH WAT A . 
G 7 HOH 310 2044 2044 HOH WAT A . 
G 7 HOH 311 2045 2045 HOH WAT A . 
G 7 HOH 312 2046 2046 HOH WAT A . 
G 7 HOH 313 2051 2051 HOH WAT A . 
G 7 HOH 314 2052 2052 HOH WAT A . 
G 7 HOH 315 2053 2053 HOH WAT A . 
G 7 HOH 316 2054 2054 HOH WAT A . 
G 7 HOH 317 2058 2058 HOH WAT A . 
G 7 HOH 318 2062 2062 HOH WAT A . 
G 7 HOH 319 2064 2064 HOH WAT A . 
H 7 HOH 1   1004 1003 HOH WAT B . 
H 7 HOH 2   1005 1005 HOH WAT B . 
H 7 HOH 3   1006 1006 HOH WAT B . 
H 7 HOH 4   1007 1009 HOH WAT B . 
H 7 HOH 5   1008 1012 HOH WAT B . 
H 7 HOH 6   1009 1014 HOH WAT B . 
H 7 HOH 7   1010 1015 HOH WAT B . 
H 7 HOH 8   1011 1017 HOH WAT B . 
H 7 HOH 9   1012 1018 HOH WAT B . 
H 7 HOH 10  1013 1019 HOH WAT B . 
H 7 HOH 11  1014 1023 HOH WAT B . 
H 7 HOH 12  1015 1024 HOH WAT B . 
H 7 HOH 13  1016 1026 HOH WAT B . 
H 7 HOH 14  1017 1030 HOH WAT B . 
H 7 HOH 15  1018 1042 HOH WAT B . 
H 7 HOH 16  1019 1043 HOH WAT B . 
H 7 HOH 17  1020 1049 HOH WAT B . 
H 7 HOH 18  1021 1053 HOH WAT B . 
H 7 HOH 19  1022 1055 HOH WAT B . 
H 7 HOH 20  1023 1056 HOH WAT B . 
H 7 HOH 21  1024 1059 HOH WAT B . 
H 7 HOH 22  1025 1061 HOH WAT B . 
H 7 HOH 23  1026 1064 HOH WAT B . 
H 7 HOH 24  1027 1068 HOH WAT B . 
H 7 HOH 25  1028 1071 HOH WAT B . 
H 7 HOH 26  1029 1072 HOH WAT B . 
H 7 HOH 27  1030 1076 HOH WAT B . 
H 7 HOH 28  1031 1080 HOH WAT B . 
H 7 HOH 29  1032 1082 HOH WAT B . 
H 7 HOH 30  1033 1083 HOH WAT B . 
H 7 HOH 31  1034 1086 HOH WAT B . 
H 7 HOH 32  1035 1088 HOH WAT B . 
H 7 HOH 33  1036 1092 HOH WAT B . 
H 7 HOH 34  1037 1093 HOH WAT B . 
H 7 HOH 35  1038 1094 HOH WAT B . 
H 7 HOH 36  1039 1095 HOH WAT B . 
H 7 HOH 37  1040 1097 HOH WAT B . 
H 7 HOH 38  1041 1098 HOH WAT B . 
H 7 HOH 39  1042 1100 HOH WAT B . 
H 7 HOH 40  1043 1102 HOH WAT B . 
H 7 HOH 41  1044 1104 HOH WAT B . 
H 7 HOH 42  1045 1108 HOH WAT B . 
H 7 HOH 43  1046 1109 HOH WAT B . 
H 7 HOH 44  1047 1114 HOH WAT B . 
H 7 HOH 45  1048 1116 HOH WAT B . 
H 7 HOH 46  1049 1118 HOH WAT B . 
H 7 HOH 47  1050 1119 HOH WAT B . 
H 7 HOH 48  1051 1121 HOH WAT B . 
H 7 HOH 49  1052 1122 HOH WAT B . 
H 7 HOH 50  1053 1128 HOH WAT B . 
H 7 HOH 51  1054 1129 HOH WAT B . 
H 7 HOH 52  1055 1130 HOH WAT B . 
H 7 HOH 53  1056 1132 HOH WAT B . 
H 7 HOH 54  1057 1133 HOH WAT B . 
H 7 HOH 55  1058 1135 HOH WAT B . 
H 7 HOH 56  1059 1136 HOH WAT B . 
H 7 HOH 57  1060 1140 HOH WAT B . 
H 7 HOH 58  1061 1144 HOH WAT B . 
H 7 HOH 59  1062 1151 HOH WAT B . 
H 7 HOH 60  1063 1152 HOH WAT B . 
H 7 HOH 61  1064 1155 HOH WAT B . 
H 7 HOH 62  1065 1161 HOH WAT B . 
H 7 HOH 63  1066 1162 HOH WAT B . 
H 7 HOH 64  1067 1163 HOH WAT B . 
H 7 HOH 65  1068 1165 HOH WAT B . 
H 7 HOH 66  1069 1166 HOH WAT B . 
H 7 HOH 67  1070 1168 HOH WAT B . 
H 7 HOH 68  1071 1170 HOH WAT B . 
H 7 HOH 69  1072 1176 HOH WAT B . 
H 7 HOH 70  1073 1178 HOH WAT B . 
H 7 HOH 71  1074 1185 HOH WAT B . 
H 7 HOH 72  1075 1186 HOH WAT B . 
H 7 HOH 73  1076 1192 HOH WAT B . 
H 7 HOH 74  1077 1198 HOH WAT B . 
H 7 HOH 75  1078 1200 HOH WAT B . 
H 7 HOH 76  1079 1207 HOH WAT B . 
H 7 HOH 77  1080 1209 HOH WAT B . 
H 7 HOH 78  1081 1212 HOH WAT B . 
H 7 HOH 79  1082 1214 HOH WAT B . 
H 7 HOH 80  1083 1216 HOH WAT B . 
H 7 HOH 81  1084 1219 HOH WAT B . 
H 7 HOH 82  1085 1222 HOH WAT B . 
H 7 HOH 83  1086 1224 HOH WAT B . 
H 7 HOH 84  1087 1235 HOH WAT B . 
H 7 HOH 85  1088 1240 HOH WAT B . 
H 7 HOH 86  1089 1241 HOH WAT B . 
H 7 HOH 87  1090 1245 HOH WAT B . 
H 7 HOH 88  1091 1252 HOH WAT B . 
H 7 HOH 89  1092 1257 HOH WAT B . 
H 7 HOH 90  1093 1259 HOH WAT B . 
H 7 HOH 91  1094 1260 HOH WAT B . 
H 7 HOH 92  1095 1268 HOH WAT B . 
H 7 HOH 93  1096 1269 HOH WAT B . 
H 7 HOH 94  1097 1273 HOH WAT B . 
H 7 HOH 95  1098 1282 HOH WAT B . 
H 7 HOH 96  1099 1287 HOH WAT B . 
H 7 HOH 97  1100 1291 HOH WAT B . 
H 7 HOH 98  1101 1305 HOH WAT B . 
H 7 HOH 99  1102 1309 HOH WAT B . 
H 7 HOH 100 1103 1312 HOH WAT B . 
H 7 HOH 101 1104 1314 HOH WAT B . 
H 7 HOH 102 1105 1315 HOH WAT B . 
H 7 HOH 103 1106 1317 HOH WAT B . 
H 7 HOH 104 1107 1320 HOH WAT B . 
H 7 HOH 105 1108 1322 HOH WAT B . 
H 7 HOH 106 1109 1323 HOH WAT B . 
H 7 HOH 107 1110 1326 HOH WAT B . 
H 7 HOH 108 1111 1328 HOH WAT B . 
H 7 HOH 109 1112 1339 HOH WAT B . 
H 7 HOH 110 1113 1343 HOH WAT B . 
H 7 HOH 111 1114 1346 HOH WAT B . 
H 7 HOH 112 1115 1348 HOH WAT B . 
H 7 HOH 113 1116 1350 HOH WAT B . 
H 7 HOH 114 1117 1351 HOH WAT B . 
H 7 HOH 115 1118 1353 HOH WAT B . 
H 7 HOH 116 1119 1355 HOH WAT B . 
H 7 HOH 117 1120 1356 HOH WAT B . 
H 7 HOH 118 1121 1361 HOH WAT B . 
H 7 HOH 119 1122 1362 HOH WAT B . 
H 7 HOH 120 1123 1366 HOH WAT B . 
H 7 HOH 121 1124 1368 HOH WAT B . 
H 7 HOH 122 1125 1372 HOH WAT B . 
H 7 HOH 123 1126 1373 HOH WAT B . 
H 7 HOH 124 1127 1375 HOH WAT B . 
H 7 HOH 125 1128 1376 HOH WAT B . 
H 7 HOH 126 1129 1378 HOH WAT B . 
H 7 HOH 127 1130 1380 HOH WAT B . 
H 7 HOH 128 1131 1384 HOH WAT B . 
H 7 HOH 129 1132 1385 HOH WAT B . 
H 7 HOH 130 1133 1387 HOH WAT B . 
H 7 HOH 131 1134 1388 HOH WAT B . 
H 7 HOH 132 1135 1390 HOH WAT B . 
H 7 HOH 133 1136 1391 HOH WAT B . 
H 7 HOH 134 1137 1392 HOH WAT B . 
H 7 HOH 135 1138 1395 HOH WAT B . 
H 7 HOH 136 1139 1396 HOH WAT B . 
H 7 HOH 137 1140 1397 HOH WAT B . 
H 7 HOH 138 1141 1399 HOH WAT B . 
H 7 HOH 139 1142 1400 HOH WAT B . 
H 7 HOH 140 1143 1401 HOH WAT B . 
H 7 HOH 141 1144 1402 HOH WAT B . 
H 7 HOH 142 1145 1403 HOH WAT B . 
H 7 HOH 143 1146 1406 HOH WAT B . 
H 7 HOH 144 1147 1407 HOH WAT B . 
H 7 HOH 145 1148 1408 HOH WAT B . 
H 7 HOH 146 1149 1409 HOH WAT B . 
H 7 HOH 147 1150 1411 HOH WAT B . 
H 7 HOH 148 1151 1413 HOH WAT B . 
H 7 HOH 149 1152 1415 HOH WAT B . 
H 7 HOH 150 1153 1416 HOH WAT B . 
H 7 HOH 151 1154 1418 HOH WAT B . 
H 7 HOH 152 1155 1419 HOH WAT B . 
H 7 HOH 153 1156 1420 HOH WAT B . 
H 7 HOH 154 1157 1422 HOH WAT B . 
H 7 HOH 155 1158 1424 HOH WAT B . 
H 7 HOH 156 1159 1425 HOH WAT B . 
H 7 HOH 157 1160 1426 HOH WAT B . 
H 7 HOH 158 1161 1427 HOH WAT B . 
H 7 HOH 159 1162 1430 HOH WAT B . 
H 7 HOH 160 1163 1431 HOH WAT B . 
H 7 HOH 161 1164 1432 HOH WAT B . 
H 7 HOH 162 1165 1434 HOH WAT B . 
H 7 HOH 163 1166 1435 HOH WAT B . 
H 7 HOH 164 1167 1436 HOH WAT B . 
H 7 HOH 165 1168 1437 HOH WAT B . 
H 7 HOH 166 1169 1438 HOH WAT B . 
H 7 HOH 167 1170 1441 HOH WAT B . 
H 7 HOH 168 1171 1442 HOH WAT B . 
H 7 HOH 169 1172 1446 HOH WAT B . 
H 7 HOH 170 1173 1448 HOH WAT B . 
H 7 HOH 171 1174 1452 HOH WAT B . 
H 7 HOH 172 1175 1457 HOH WAT B . 
H 7 HOH 173 1176 1458 HOH WAT B . 
H 7 HOH 174 1177 1464 HOH WAT B . 
H 7 HOH 175 1178 1467 HOH WAT B . 
H 7 HOH 176 1179 1468 HOH WAT B . 
H 7 HOH 177 1180 1469 HOH WAT B . 
H 7 HOH 178 1181 1473 HOH WAT B . 
H 7 HOH 179 1182 1483 HOH WAT B . 
H 7 HOH 180 1183 1488 HOH WAT B . 
H 7 HOH 181 1184 1492 HOH WAT B . 
H 7 HOH 182 1185 1499 HOH WAT B . 
H 7 HOH 183 1186 1502 HOH WAT B . 
H 7 HOH 184 1187 1503 HOH WAT B . 
H 7 HOH 185 1188 1504 HOH WAT B . 
H 7 HOH 186 1189 1508 HOH WAT B . 
H 7 HOH 187 1190 1509 HOH WAT B . 
H 7 HOH 188 1191 1512 HOH WAT B . 
H 7 HOH 189 1192 1513 HOH WAT B . 
H 7 HOH 190 1193 1514 HOH WAT B . 
H 7 HOH 191 1194 1515 HOH WAT B . 
H 7 HOH 192 1195 1518 HOH WAT B . 
H 7 HOH 193 1196 1526 HOH WAT B . 
H 7 HOH 194 1197 1543 HOH WAT B . 
H 7 HOH 195 1198 1551 HOH WAT B . 
H 7 HOH 196 1199 1554 HOH WAT B . 
H 7 HOH 197 1200 1555 HOH WAT B . 
H 7 HOH 198 1201 1558 HOH WAT B . 
H 7 HOH 199 1202 1566 HOH WAT B . 
H 7 HOH 200 1203 1574 HOH WAT B . 
H 7 HOH 201 1204 1584 HOH WAT B . 
H 7 HOH 202 1205 1587 HOH WAT B . 
H 7 HOH 203 1206 1589 HOH WAT B . 
H 7 HOH 204 1207 1591 HOH WAT B . 
H 7 HOH 205 1208 1592 HOH WAT B . 
H 7 HOH 206 1209 1596 HOH WAT B . 
H 7 HOH 207 1210 1600 HOH WAT B . 
H 7 HOH 208 1211 1604 HOH WAT B . 
H 7 HOH 209 1212 1605 HOH WAT B . 
H 7 HOH 210 1213 1608 HOH WAT B . 
H 7 HOH 211 1214 1612 HOH WAT B . 
H 7 HOH 212 1215 1614 HOH WAT B . 
H 7 HOH 213 1216 1616 HOH WAT B . 
H 7 HOH 214 1217 1617 HOH WAT B . 
H 7 HOH 215 1218 1622 HOH WAT B . 
H 7 HOH 216 1219 1627 HOH WAT B . 
H 7 HOH 217 1220 1635 HOH WAT B . 
H 7 HOH 218 1221 1636 HOH WAT B . 
H 7 HOH 219 1222 1637 HOH WAT B . 
H 7 HOH 220 1223 1642 HOH WAT B . 
H 7 HOH 221 1224 1643 HOH WAT B . 
H 7 HOH 222 1225 1645 HOH WAT B . 
H 7 HOH 223 1226 1647 HOH WAT B . 
H 7 HOH 224 1227 1651 HOH WAT B . 
H 7 HOH 225 1228 1663 HOH WAT B . 
H 7 HOH 226 1229 1666 HOH WAT B . 
H 7 HOH 227 1230 1667 HOH WAT B . 
H 7 HOH 228 1231 1669 HOH WAT B . 
H 7 HOH 229 1232 1673 HOH WAT B . 
H 7 HOH 230 1233 1674 HOH WAT B . 
H 7 HOH 231 1234 1675 HOH WAT B . 
H 7 HOH 232 1235 1677 HOH WAT B . 
H 7 HOH 233 1236 1680 HOH WAT B . 
H 7 HOH 234 1237 1681 HOH WAT B . 
H 7 HOH 235 1238 1682 HOH WAT B . 
H 7 HOH 236 1239 1683 HOH WAT B . 
H 7 HOH 237 1240 1686 HOH WAT B . 
H 7 HOH 238 1241 1687 HOH WAT B . 
H 7 HOH 239 1242 1688 HOH WAT B . 
H 7 HOH 240 1243 1690 HOH WAT B . 
H 7 HOH 241 1244 1694 HOH WAT B . 
H 7 HOH 242 1245 1697 HOH WAT B . 
H 7 HOH 243 1246 1699 HOH WAT B . 
H 7 HOH 244 1247 1706 HOH WAT B . 
H 7 HOH 245 1248 1711 HOH WAT B . 
H 7 HOH 246 1249 1713 HOH WAT B . 
H 7 HOH 247 1250 1727 HOH WAT B . 
H 7 HOH 248 1251 1730 HOH WAT B . 
H 7 HOH 249 1252 1738 HOH WAT B . 
H 7 HOH 250 1253 1740 HOH WAT B . 
H 7 HOH 251 1254 1743 HOH WAT B . 
H 7 HOH 252 1255 1751 HOH WAT B . 
H 7 HOH 253 1256 1753 HOH WAT B . 
H 7 HOH 254 1257 1754 HOH WAT B . 
H 7 HOH 255 1258 1769 HOH WAT B . 
H 7 HOH 256 1259 1770 HOH WAT B . 
H 7 HOH 257 1260 1776 HOH WAT B . 
H 7 HOH 258 1261 1791 HOH WAT B . 
H 7 HOH 259 1262 1792 HOH WAT B . 
H 7 HOH 260 1263 1795 HOH WAT B . 
H 7 HOH 261 1264 1796 HOH WAT B . 
H 7 HOH 262 1265 1797 HOH WAT B . 
H 7 HOH 263 1266 1804 HOH WAT B . 
H 7 HOH 264 1267 1806 HOH WAT B . 
H 7 HOH 265 1268 1807 HOH WAT B . 
H 7 HOH 266 1269 1813 HOH WAT B . 
H 7 HOH 267 1270 1814 HOH WAT B . 
H 7 HOH 268 1271 1820 HOH WAT B . 
H 7 HOH 269 1272 1828 HOH WAT B . 
H 7 HOH 270 1273 1829 HOH WAT B . 
H 7 HOH 271 1274 1831 HOH WAT B . 
H 7 HOH 272 1275 1834 HOH WAT B . 
H 7 HOH 273 1276 1842 HOH WAT B . 
H 7 HOH 274 1277 1845 HOH WAT B . 
H 7 HOH 275 1278 1846 HOH WAT B . 
H 7 HOH 276 1279 1847 HOH WAT B . 
H 7 HOH 277 1280 1848 HOH WAT B . 
H 7 HOH 278 1281 1851 HOH WAT B . 
H 7 HOH 279 1282 1853 HOH WAT B . 
H 7 HOH 280 1283 1854 HOH WAT B . 
H 7 HOH 281 1284 1856 HOH WAT B . 
H 7 HOH 282 1285 1858 HOH WAT B . 
H 7 HOH 283 1286 1860 HOH WAT B . 
H 7 HOH 284 1287 1863 HOH WAT B . 
H 7 HOH 285 1288 1864 HOH WAT B . 
H 7 HOH 286 1289 1866 HOH WAT B . 
H 7 HOH 287 1290 1874 HOH WAT B . 
H 7 HOH 288 1291 1877 HOH WAT B . 
H 7 HOH 289 1292 1879 HOH WAT B . 
H 7 HOH 290 1293 1887 HOH WAT B . 
H 7 HOH 291 1294 1892 HOH WAT B . 
H 7 HOH 292 1295 1893 HOH WAT B . 
H 7 HOH 293 1296 1894 HOH WAT B . 
H 7 HOH 294 1297 1895 HOH WAT B . 
H 7 HOH 295 1298 1896 HOH WAT B . 
H 7 HOH 296 1299 1898 HOH WAT B . 
H 7 HOH 297 1300 1900 HOH WAT B . 
H 7 HOH 298 1301 1901 HOH WAT B . 
H 7 HOH 299 1302 1902 HOH WAT B . 
H 7 HOH 300 1303 1904 HOH WAT B . 
H 7 HOH 301 1304 1906 HOH WAT B . 
H 7 HOH 302 1305 1907 HOH WAT B . 
H 7 HOH 303 1306 1908 HOH WAT B . 
H 7 HOH 304 1307 1910 HOH WAT B . 
H 7 HOH 305 1308 1914 HOH WAT B . 
H 7 HOH 306 1309 1915 HOH WAT B . 
H 7 HOH 307 1310 1916 HOH WAT B . 
H 7 HOH 308 1311 1917 HOH WAT B . 
H 7 HOH 309 1312 1918 HOH WAT B . 
H 7 HOH 310 1313 1923 HOH WAT B . 
H 7 HOH 311 1314 1925 HOH WAT B . 
H 7 HOH 312 1315 1927 HOH WAT B . 
H 7 HOH 313 1316 1932 HOH WAT B . 
H 7 HOH 314 1317 1934 HOH WAT B . 
H 7 HOH 315 1318 1935 HOH WAT B . 
H 7 HOH 316 1319 1937 HOH WAT B . 
H 7 HOH 317 1320 1941 HOH WAT B . 
H 7 HOH 318 1321 1944 HOH WAT B . 
H 7 HOH 319 1322 1945 HOH WAT B . 
H 7 HOH 320 1323 1946 HOH WAT B . 
H 7 HOH 321 1324 1947 HOH WAT B . 
H 7 HOH 322 1325 1954 HOH WAT B . 
H 7 HOH 323 1326 1955 HOH WAT B . 
H 7 HOH 324 1327 1956 HOH WAT B . 
H 7 HOH 325 1328 1957 HOH WAT B . 
H 7 HOH 326 1329 1958 HOH WAT B . 
H 7 HOH 327 1330 1959 HOH WAT B . 
H 7 HOH 328 1331 1964 HOH WAT B . 
H 7 HOH 329 1332 1969 HOH WAT B . 
H 7 HOH 330 1333 1970 HOH WAT B . 
H 7 HOH 331 1334 1972 HOH WAT B . 
H 7 HOH 332 1335 1973 HOH WAT B . 
H 7 HOH 333 1336 1977 HOH WAT B . 
H 7 HOH 334 1337 1979 HOH WAT B . 
H 7 HOH 335 1338 1981 HOH WAT B . 
H 7 HOH 336 1339 1983 HOH WAT B . 
H 7 HOH 337 1340 1984 HOH WAT B . 
H 7 HOH 338 1341 1986 HOH WAT B . 
H 7 HOH 339 1342 1987 HOH WAT B . 
H 7 HOH 340 1343 1989 HOH WAT B . 
H 7 HOH 341 1344 1990 HOH WAT B . 
H 7 HOH 342 1345 1992 HOH WAT B . 
H 7 HOH 343 1346 1994 HOH WAT B . 
H 7 HOH 344 1347 1995 HOH WAT B . 
H 7 HOH 345 1348 1997 HOH WAT B . 
H 7 HOH 346 1349 1999 HOH WAT B . 
H 7 HOH 347 1350 2001 HOH WAT B . 
H 7 HOH 348 1351 2002 HOH WAT B . 
H 7 HOH 349 1352 2004 HOH WAT B . 
H 7 HOH 350 1353 2005 HOH WAT B . 
H 7 HOH 351 1354 2008 HOH WAT B . 
H 7 HOH 352 1355 2009 HOH WAT B . 
H 7 HOH 353 1356 2012 HOH WAT B . 
H 7 HOH 354 1357 2013 HOH WAT B . 
H 7 HOH 355 1358 2014 HOH WAT B . 
H 7 HOH 356 1359 2015 HOH WAT B . 
H 7 HOH 357 1360 2017 HOH WAT B . 
H 7 HOH 358 1361 2018 HOH WAT B . 
H 7 HOH 359 1362 2020 HOH WAT B . 
H 7 HOH 360 1363 2021 HOH WAT B . 
H 7 HOH 361 1364 2023 HOH WAT B . 
H 7 HOH 362 1365 2024 HOH WAT B . 
H 7 HOH 363 1366 2025 HOH WAT B . 
H 7 HOH 364 1367 2026 HOH WAT B . 
H 7 HOH 365 1368 2028 HOH WAT B . 
H 7 HOH 366 1369 2029 HOH WAT B . 
H 7 HOH 367 1370 2030 HOH WAT B . 
H 7 HOH 368 1371 2033 HOH WAT B . 
H 7 HOH 369 1372 2035 HOH WAT B . 
H 7 HOH 370 1373 2039 HOH WAT B . 
H 7 HOH 371 1374 2040 HOH WAT B . 
H 7 HOH 372 1375 2041 HOH WAT B . 
H 7 HOH 373 1376 2043 HOH WAT B . 
H 7 HOH 374 1377 2047 HOH WAT B . 
H 7 HOH 375 1378 2048 HOH WAT B . 
H 7 HOH 376 1379 2049 HOH WAT B . 
H 7 HOH 377 1380 2050 HOH WAT B . 
H 7 HOH 378 1381 2055 HOH WAT B . 
H 7 HOH 379 1382 2056 HOH WAT B . 
H 7 HOH 380 1383 2057 HOH WAT B . 
H 7 HOH 381 1384 2059 HOH WAT B . 
H 7 HOH 382 1385 2060 HOH WAT B . 
H 7 HOH 383 1386 2061 HOH WAT B . 
H 7 HOH 384 1387 2063 HOH WAT B . 
# 
_pdbx_molecule_features.prd_id    PRD_900003 
_pdbx_molecule_features.name      sucrose 
_pdbx_molecule_features.type      Oligosaccharide 
_pdbx_molecule_features.class     Nutrient 
_pdbx_molecule_features.details   'oligosaccharide with reducing-end-to-reducing-end glycosidic bond' 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_900003 
_pdbx_molecule.asym_id       C 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 9320  ? 
1 MORE         -59   ? 
1 'SSA (A^2)'  28190 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 OD2 ? B ASP 297 ? B ASP 797  ? 1_555 55.6  ? 
2  OD1 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 SG  ? B CYS 299 ? B CYS 799  ? 1_555 92.2  ? 
3  OD2 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 SG  ? B CYS 299 ? B CYS 799  ? 1_555 103.7 ? 
4  OD1 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NE2 ? B HIS 362 ? B HIS 862  ? 1_555 89.9  ? 
5  OD2 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NE2 ? B HIS 362 ? B HIS 862  ? 1_555 124.8 ? 
6  SG  ? B CYS 299 ? B CYS 799 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NE2 ? B HIS 362 ? B HIS 862  ? 1_555 121.0 ? 
7  OD1 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NZ  ? F BNE .   ? B BNE 1003 ? 1_555 151.3 ? 
8  OD2 ? B ASP 297 ? B ASP 797 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NZ  ? F BNE .   ? B BNE 1003 ? 1_555 96.7  ? 
9  SG  ? B CYS 299 ? B CYS 799 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NZ  ? F BNE .   ? B BNE 1003 ? 1_555 102.8 ? 
10 NE2 ? B HIS 362 ? B HIS 862 ? 1_555 ZN ? D ZN . ? B ZN 1001 ? 1_555 NZ  ? F BNE .   ? B BNE 1003 ? 1_555 102.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-07-08 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Database references'       
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' 'Non-polymer description'   
8 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' entity_name_com               
5  4 'Structure model' pdbx_branch_scheme            
6  4 'Structure model' pdbx_chem_comp_identifier     
7  4 'Structure model' pdbx_entity_branch            
8  4 'Structure model' pdbx_entity_branch_descriptor 
9  4 'Structure model' pdbx_entity_branch_link       
10 4 'Structure model' pdbx_entity_branch_list       
11 4 'Structure model' pdbx_entity_nonpoly           
12 4 'Structure model' pdbx_molecule_features        
13 4 'Structure model' pdbx_nonpoly_scheme           
14 4 'Structure model' struct_conn                   
15 4 'Structure model' struct_conn_type              
16 4 'Structure model' struct_ref_seq_dif            
17 4 'Structure model' struct_site                   
18 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'   
2  4 'Structure model' '_atom_site.Cartn_x'          
3  4 'Structure model' '_atom_site.Cartn_y'          
4  4 'Structure model' '_atom_site.Cartn_z'          
5  4 'Structure model' '_atom_site.auth_asym_id'     
6  4 'Structure model' '_atom_site.auth_atom_id'     
7  4 'Structure model' '_atom_site.auth_comp_id'     
8  4 'Structure model' '_atom_site.auth_seq_id'      
9  4 'Structure model' '_atom_site.label_atom_id'    
10 4 'Structure model' '_atom_site.label_comp_id'    
11 4 'Structure model' '_atom_site.type_symbol'      
12 4 'Structure model' '_chem_comp.formula'          
13 4 'Structure model' '_chem_comp.formula_weight'   
14 4 'Structure model' '_chem_comp.id'               
15 4 'Structure model' '_chem_comp.mon_nstd_flag'    
16 4 'Structure model' '_chem_comp.name'             
17 4 'Structure model' '_chem_comp.type'             
18 4 'Structure model' '_entity.formula_weight'      
19 4 'Structure model' '_entity.pdbx_description'    
20 4 'Structure model' '_entity.type'                
21 4 'Structure model' '_struct_ref_seq_dif.details' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
CNS       refinement       . ? 3 
CNS       phasing          . ? 4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              808 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              808 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              808 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                100.35 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            -14.95 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 88  ? ? 37.92   44.07   
2  1 LYS A 164 ? ? -105.50 65.83   
3  1 LEU A 215 ? ? -110.60 58.96   
4  1 THR A 247 ? ? -109.33 -85.65  
5  1 SER A 305 ? ? -106.51 -80.56  
6  1 HIS A 306 ? ? -64.27  23.93   
7  1 SER A 308 ? ? 168.04  166.43  
8  1 GLU A 347 ? ? -136.66 -50.52  
9  1 ASP A 349 ? ? -152.59 50.83   
10 1 ASN B 565 ? ? 59.21   -121.20 
11 1 SER B 599 ? ? -142.62 32.95   
12 1 ASP B 820 ? ? -58.75  109.07  
13 1 SER B 826 ? ? -142.37 -19.09  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A ALA 3   ? A ALA 3   
4  1 Y 1 A THR 4   ? A THR 4   
5  1 Y 1 A GLU 5   ? A GLU 5   
6  1 Y 1 A GLY 6   ? A GLY 6   
7  1 Y 1 A VAL 7   ? A VAL 7   
8  1 Y 1 A GLY 8   ? A GLY 8   
9  1 Y 1 A GLU 9   ? A GLU 9   
10 1 Y 1 A ALA 10  ? A ALA 10  
11 1 Y 1 A ALA 11  ? A ALA 11  
12 1 Y 1 A GLN 12  ? A GLN 12  
13 1 Y 1 A GLY 13  ? A GLY 13  
14 1 Y 1 A GLY 14  ? A GLY 14  
15 1 Y 1 A GLU 15  ? A GLU 15  
16 1 Y 1 A PRO 16  ? A PRO 16  
17 1 Y 1 A GLY 17  ? A GLY 17  
18 1 Y 1 A GLN 18  ? A GLN 18  
19 1 Y 1 A PRO 19  ? A PRO 19  
20 1 Y 1 A ALA 20  ? A ALA 20  
21 1 Y 1 A GLN 21  ? A GLN 21  
22 1 Y 1 A PRO 22  ? A PRO 22  
23 1 Y 1 A PRO 23  ? A PRO 23  
24 1 Y 1 A PRO 24  ? A PRO 24  
25 1 Y 1 A GLN 25  ? A GLN 25  
26 1 Y 1 A PRO 26  ? A PRO 26  
27 1 Y 1 A HIS 27  ? A HIS 27  
28 1 Y 1 A PRO 28  ? A PRO 28  
29 1 Y 1 A PRO 29  ? A PRO 29  
30 1 Y 1 A PRO 30  ? A PRO 30  
31 1 Y 1 A PRO 31  ? A PRO 31  
32 1 Y 1 A GLN 32  ? A GLN 32  
33 1 Y 1 A GLN 33  ? A GLN 33  
34 1 Y 1 A GLN 34  ? A GLN 34  
35 1 Y 1 A HIS 35  ? A HIS 35  
36 1 Y 1 A LYS 36  ? A LYS 36  
37 1 Y 1 A GLU 37  ? A GLU 37  
38 1 Y 1 A GLU 38  ? A GLU 38  
39 1 Y 1 A MET 39  ? A MET 39  
40 1 Y 1 A ALA 40  ? A ALA 40  
41 1 Y 1 A ALA 41  ? A ALA 41  
42 1 Y 1 A GLU 42  ? A GLU 42  
43 1 Y 1 A ALA 43  ? A ALA 43  
44 1 Y 1 A GLY 44  ? A GLY 44  
45 1 Y 1 A GLU 45  ? A GLU 45  
46 1 Y 1 A ALA 46  ? A ALA 46  
47 1 Y 1 A VAL 47  ? A VAL 47  
48 1 Y 1 A ALA 48  ? A ALA 48  
49 1 Y 1 A SER 49  ? A SER 49  
50 1 Y 1 A PRO 50  ? A PRO 50  
51 1 Y 1 A MET 51  ? A MET 51  
52 1 Y 1 A ASP 52  ? A ASP 52  
53 1 Y 1 A ASP 53  ? A ASP 53  
54 1 Y 1 A GLY 54  ? A GLY 54  
55 1 Y 1 A SER 368 ? A SER 368 
56 1 Y 1 A THR 369 ? A THR 369 
57 1 Y 1 A GLU 370 ? A GLU 370 
58 1 Y 1 A ASN 371 ? A ASN 371 
59 1 Y 1 A ASP 372 ? A ASP 372 
60 1 Y 1 A SER 373 ? A SER 373 
61 1 Y 1 A PRO 374 ? A PRO 374 
62 1 Y 1 A THR 375 ? A THR 375 
63 1 Y 1 A ASN 376 ? A ASN 376 
64 1 Y 1 A VAL 377 ? A VAL 377 
65 1 Y 1 A GLN 378 ? A GLN 378 
66 1 Y 1 A GLN 379 ? A GLN 379 
67 1 Y 1 A GLU 380 ? A GLU 380 
68 1 Y 1 A GLU 381 ? A GLU 381 
69 1 Y 1 A PHE 382 ? A PHE 382 
70 1 Y 1 B MET 501 ? B MET 1   
71 1 Y 1 B ALA 502 ? B ALA 2   
72 1 Y 1 B SER 503 ? B SER 3   
73 1 Y 1 B PRO 504 ? B PRO 4   
74 1 Y 1 B SER 505 ? B SER 5   
75 1 Y 1 B SER 506 ? B SER 6   
76 1 Y 1 B PHE 507 ? B PHE 7   
77 1 Y 1 B THR 508 ? B THR 8   
78 1 Y 1 B TYR 509 ? B TYR 9   
79 1 Y 1 B TYR 510 ? B TYR 10  
80 1 Y 1 B CYS 511 ? B CYS 11  
81 1 Y 1 B PRO 512 ? B PRO 12  
82 1 Y 1 B PRO 513 ? B PRO 13  
83 1 Y 1 B SER 514 ? B SER 14  
84 1 Y 1 B SER 515 ? B SER 15  
85 1 Y 1 B SER 516 ? B SER 16  
86 1 Y 1 B GLU 924 ? B GLU 424 
87 1 Y 1 B GLU 925 ? B GLU 425 
88 1 Y 1 B LEU 926 ? B LEU 426 
89 1 Y 1 B LYS 927 ? B LYS 427 
90 1 Y 1 B ASP 928 ? B ASP 428 
91 1 Y 1 B GLU 929 ? B GLU 429 
92 1 Y 1 B THR 930 ? B THR 430 
93 1 Y 1 B SER 931 ? B SER 431 
94 1 Y 1 B ALA 932 ? B ALA 432 
95 1 Y 1 B GLU 933 ? B GLU 433 
96 1 Y 1 B PRO 934 ? B PRO 434 
97 1 Y 1 B ALA 935 ? B ALA 435 
98 1 Y 1 B THR 936 ? B THR 436 
99 1 Y 1 B ASP 937 ? B ASP 437 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 3 GLC 1 C GLC 1 ? SUC 901 n 
C 3 FRU 2 C FRU 2 ? SUC 901 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FRU 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DFrufb             
FRU 'COMMON NAME'                         GMML     1.0 b-D-fructofuranose 
FRU 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Fruf           
FRU 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fru                
GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpa             
GLC 'COMMON NAME'                         GMML     1.0 a-D-glucopyranose  
GLC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Glcp           
GLC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc                
# 
_pdbx_entity_branch.entity_id   3 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 3 DFrufb2-1DGlcpa                                            'Glycam Condensed Sequence' GMML       1.0   
2 3 'WURCS=2.0/2,2,1/[ha122h-2b_2-5][a2122h-1a_1-5]/1-2/a2-b1' WURCS                       PDB2Glycan 1.1.0 
3 3 '[][b-D-Fruf]{[(2+1)][a-D-Glcp]{}}'                        LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  3 
_pdbx_entity_branch_link.entity_branch_list_num_1   1 
_pdbx_entity_branch_link.comp_id_1                  GLC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   2 
_pdbx_entity_branch_link.comp_id_2                  FRU 
_pdbx_entity_branch_link.atom_id_2                  O2 
_pdbx_entity_branch_link.leaving_atom_id_2          HO2 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
3 GLC 1 n 
3 FRU 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION'                                                                                                        ZN  
5 'FARNESYL DIPHOSPHATE'                                                                                            FPP 
6 '2-[3-(3-ETHYL-1-METHYL-2-OXO-AZEPAN-3-YL)-PHENOXY]-4-[1-AMINO-1-(1-METHYL-1H-IMIDIZOL-5-YL)-ETHYL]-BENZONITRILE' BNE 
7 water                                                                                                             HOH 
#