data_1N0W
# 
_entry.id   1N0W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1N0W         
RCSB  RCSB017380   
WWPDB D_1000017380 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1N0W 
_pdbx_database_status.recvd_initial_deposition_date   2002-10-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pellegrini, L.'     1 
'Yu, D.S.'           2 
'Lo, T.'             3 
'Anand, S.'          4 
'Lee, M.'            5 
'Blundell, T.L.'     6 
'Venkitaraman, A.R.' 7 
# 
_citation.id                        primary 
_citation.title                     'Insights into DNA recombination from the structure of a RAD51-BRCA2 complex' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            420 
_citation.page_first                287 
_citation.page_last                 293 
_citation.year                      2002 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12442171 
_citation.pdbx_database_id_DOI      10.1038/nature01230 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pellegrini, L.'     1 
primary 'Yu, D.S.'           2 
primary 'Lo, T.'             3 
primary 'Anand, S.'          4 
primary 'Lee, M.'            5 
primary 'Blundell, T.L.'     6 
primary 'Venkitaraman, A.R.' 7 
# 
_cell.entry_id           1N0W 
_cell.length_a           57.30 
_cell.length_b           59.14 
_cell.length_c           77.20 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1N0W 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA repair protein RAD51 homolog 1'          26855.346 1   ? ? 'ATPase domain'     ? 
2 polymer     man 'Breast cancer type 2 susceptibility protein' 3966.598  1   ? ? 'BRC repeat type 4' ? 
3 polymer     man 'peptide linker'                              1234.091  1   ? ? ?                   
'this peptide links the BRCA2 to the RAD51'                                              
4 polymer     man 'ARTIFICIAL GLY-SER-MSE-GLY PEPTIDE'          397.287   1   ? ? ?                   
'this peptide comes from the expression vector and is linked to the N-terminus of BRCA2' 
5 non-polymer syn 'MAGNESIUM ION'                               24.305    1   ? ? ?                   ? 
6 non-polymer syn 'CHLORIDE ION'                                35.453    1   ? ? ?                   ? 
7 non-polymer syn 1,2-ETHANEDIOL                                62.068    5   ? ? ?                   ? 
8 water       nat water                                         18.015    247 ? ? ?                   ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RAD51, hRAD51, HsRAD51'     
2 'BRCA2 BRC4 REPEAT SEQUENCE' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;SEIIQITTGSKELDKLLQGGIETGSITE(MSE)FGEFRTGKTQICHTLAVTCQLPIDRGGGEGKA(MSE)YIDTEGTFRP
ERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASA(MSE)(MSE)VESRYALLIVDSATALYRTDYSGRGELSA
RQ(MSE)HLARFLR(MSE)LLRLADEFGVAVVITNQVVAQVDGAA(MSE)FAADPKKPIGGNIIAHASTTRLYLRKGRGE
TRICKIYDSPCLPEAEA(MSE)FAINADGVGDAKD
;
;SEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAE
RYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLA
DEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGD
AKD
;
A ? 
2 'polypeptide(L)' no no  KEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ KEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ B ? 
3 'polypeptide(L)' no yes 'TGSTGSTGSTGS(MSE)G' TGSTGSTGSTGSMG L ? 
4 'polypeptide(L)' no yes 'GS(MSE)G' GSMG C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   GLU n 
1 3   ILE n 
1 4   ILE n 
1 5   GLN n 
1 6   ILE n 
1 7   THR n 
1 8   THR n 
1 9   GLY n 
1 10  SER n 
1 11  LYS n 
1 12  GLU n 
1 13  LEU n 
1 14  ASP n 
1 15  LYS n 
1 16  LEU n 
1 17  LEU n 
1 18  GLN n 
1 19  GLY n 
1 20  GLY n 
1 21  ILE n 
1 22  GLU n 
1 23  THR n 
1 24  GLY n 
1 25  SER n 
1 26  ILE n 
1 27  THR n 
1 28  GLU n 
1 29  MSE n 
1 30  PHE n 
1 31  GLY n 
1 32  GLU n 
1 33  PHE n 
1 34  ARG n 
1 35  THR n 
1 36  GLY n 
1 37  LYS n 
1 38  THR n 
1 39  GLN n 
1 40  ILE n 
1 41  CYS n 
1 42  HIS n 
1 43  THR n 
1 44  LEU n 
1 45  ALA n 
1 46  VAL n 
1 47  THR n 
1 48  CYS n 
1 49  GLN n 
1 50  LEU n 
1 51  PRO n 
1 52  ILE n 
1 53  ASP n 
1 54  ARG n 
1 55  GLY n 
1 56  GLY n 
1 57  GLY n 
1 58  GLU n 
1 59  GLY n 
1 60  LYS n 
1 61  ALA n 
1 62  MSE n 
1 63  TYR n 
1 64  ILE n 
1 65  ASP n 
1 66  THR n 
1 67  GLU n 
1 68  GLY n 
1 69  THR n 
1 70  PHE n 
1 71  ARG n 
1 72  PRO n 
1 73  GLU n 
1 74  ARG n 
1 75  LEU n 
1 76  LEU n 
1 77  ALA n 
1 78  VAL n 
1 79  ALA n 
1 80  GLU n 
1 81  ARG n 
1 82  TYR n 
1 83  GLY n 
1 84  LEU n 
1 85  SER n 
1 86  GLY n 
1 87  SER n 
1 88  ASP n 
1 89  VAL n 
1 90  LEU n 
1 91  ASP n 
1 92  ASN n 
1 93  VAL n 
1 94  ALA n 
1 95  TYR n 
1 96  ALA n 
1 97  ARG n 
1 98  ALA n 
1 99  PHE n 
1 100 ASN n 
1 101 THR n 
1 102 ASP n 
1 103 HIS n 
1 104 GLN n 
1 105 THR n 
1 106 GLN n 
1 107 LEU n 
1 108 LEU n 
1 109 TYR n 
1 110 GLN n 
1 111 ALA n 
1 112 SER n 
1 113 ALA n 
1 114 MSE n 
1 115 MSE n 
1 116 VAL n 
1 117 GLU n 
1 118 SER n 
1 119 ARG n 
1 120 TYR n 
1 121 ALA n 
1 122 LEU n 
1 123 LEU n 
1 124 ILE n 
1 125 VAL n 
1 126 ASP n 
1 127 SER n 
1 128 ALA n 
1 129 THR n 
1 130 ALA n 
1 131 LEU n 
1 132 TYR n 
1 133 ARG n 
1 134 THR n 
1 135 ASP n 
1 136 TYR n 
1 137 SER n 
1 138 GLY n 
1 139 ARG n 
1 140 GLY n 
1 141 GLU n 
1 142 LEU n 
1 143 SER n 
1 144 ALA n 
1 145 ARG n 
1 146 GLN n 
1 147 MSE n 
1 148 HIS n 
1 149 LEU n 
1 150 ALA n 
1 151 ARG n 
1 152 PHE n 
1 153 LEU n 
1 154 ARG n 
1 155 MSE n 
1 156 LEU n 
1 157 LEU n 
1 158 ARG n 
1 159 LEU n 
1 160 ALA n 
1 161 ASP n 
1 162 GLU n 
1 163 PHE n 
1 164 GLY n 
1 165 VAL n 
1 166 ALA n 
1 167 VAL n 
1 168 VAL n 
1 169 ILE n 
1 170 THR n 
1 171 ASN n 
1 172 GLN n 
1 173 VAL n 
1 174 VAL n 
1 175 ALA n 
1 176 GLN n 
1 177 VAL n 
1 178 ASP n 
1 179 GLY n 
1 180 ALA n 
1 181 ALA n 
1 182 MSE n 
1 183 PHE n 
1 184 ALA n 
1 185 ALA n 
1 186 ASP n 
1 187 PRO n 
1 188 LYS n 
1 189 LYS n 
1 190 PRO n 
1 191 ILE n 
1 192 GLY n 
1 193 GLY n 
1 194 ASN n 
1 195 ILE n 
1 196 ILE n 
1 197 ALA n 
1 198 HIS n 
1 199 ALA n 
1 200 SER n 
1 201 THR n 
1 202 THR n 
1 203 ARG n 
1 204 LEU n 
1 205 TYR n 
1 206 LEU n 
1 207 ARG n 
1 208 LYS n 
1 209 GLY n 
1 210 ARG n 
1 211 GLY n 
1 212 GLU n 
1 213 THR n 
1 214 ARG n 
1 215 ILE n 
1 216 CYS n 
1 217 LYS n 
1 218 ILE n 
1 219 TYR n 
1 220 ASP n 
1 221 SER n 
1 222 PRO n 
1 223 CYS n 
1 224 LEU n 
1 225 PRO n 
1 226 GLU n 
1 227 ALA n 
1 228 GLU n 
1 229 ALA n 
1 230 MSE n 
1 231 PHE n 
1 232 ALA n 
1 233 ILE n 
1 234 ASN n 
1 235 ALA n 
1 236 ASP n 
1 237 GLY n 
1 238 VAL n 
1 239 GLY n 
1 240 ASP n 
1 241 ALA n 
1 242 LYS n 
1 243 ASP n 
2 1   LYS n 
2 2   GLU n 
2 3   PRO n 
2 4   THR n 
2 5   LEU n 
2 6   LEU n 
2 7   GLY n 
2 8   PHE n 
2 9   HIS n 
2 10  THR n 
2 11  ALA n 
2 12  SER n 
2 13  GLY n 
2 14  LYS n 
2 15  LYS n 
2 16  VAL n 
2 17  LYS n 
2 18  ILE n 
2 19  ALA n 
2 20  LYS n 
2 21  GLU n 
2 22  SER n 
2 23  LEU n 
2 24  ASP n 
2 25  LYS n 
2 26  VAL n 
2 27  LYS n 
2 28  ASN n 
2 29  LEU n 
2 30  PHE n 
2 31  ASP n 
2 32  GLU n 
2 33  LYS n 
2 34  GLU n 
2 35  GLN n 
3 1   THR n 
3 2   GLY n 
3 3   SER n 
3 4   THR n 
3 5   GLY n 
3 6   SER n 
3 7   THR n 
3 8   GLY n 
3 9   SER n 
3 10  THR n 
3 11  GLY n 
3 12  SER n 
3 13  MSE n 
3 14  GLY n 
4 1   GLY n 
4 2   SER n 
4 3   MSE n 
4 4   GLY n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo RAD51 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia 
? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pGAT3 ? ? 
2 1 sample ? ? ? human Homo BRCA2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia 
? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pGAT3 ? ? 
3 1 sample ? ? ? ?     ?    ?     ? ? ? ? ? ? ?              ?    ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia 
? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pGAT3 ? ? 
4 1 sample ? ? ? ?     ?    ?     ? ? ? ? ? ? ?              ?    ? ? ? ? ? ? ? ? 'Escherichia coli BL21(DE3)' 469008 Escherichia 
? ? 'Escherichia coli' ? ? 'BL21(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? pGAT3 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP RAD51_HUMAN Q06609 1 
;SEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAE
RYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLA
DEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGD
AKD
;
97   ? 
2 UNP BRCA2_HUMAN P51587 2 KEPTLLGFHTASGKKVKIAKESLDKVKNLFDEKEQ 1517 ? 
3 PDB 1N0W        1N0W   3 ? ?    ? 
4 PDB 1N0W        1N0W   4 ? ?    ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1N0W A 1 ? 243 ? Q06609 97   ? 339  ? 97   339  
2 2 1N0W B 1 ? 35  ? P51587 1517 ? 1551 ? 1517 1551 
3 3 1N0W L 1 ? 14  ? 1N0W   1543 ? 1556 ? 1543 1556 
4 4 1N0W C 1 ? 4   ? 1N0W   1    ? 4    ? 1    4    
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1N0W MSE A 29  ? UNP Q06609 MET 125 'MODIFIED RESIDUE' 125 1 
1 1N0W MSE A 62  ? UNP Q06609 MET 158 'MODIFIED RESIDUE' 158 2 
1 1N0W MSE A 114 ? UNP Q06609 MET 210 'MODIFIED RESIDUE' 210 3 
1 1N0W MSE A 115 ? UNP Q06609 MET 211 'MODIFIED RESIDUE' 211 4 
1 1N0W MSE A 147 ? UNP Q06609 MET 243 'MODIFIED RESIDUE' 243 5 
1 1N0W MSE A 155 ? UNP Q06609 MET 251 'MODIFIED RESIDUE' 251 6 
1 1N0W MSE A 182 ? UNP Q06609 MET 278 'MODIFIED RESIDUE' 278 7 
1 1N0W MSE A 230 ? UNP Q06609 MET 326 'MODIFIED RESIDUE' 326 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ?                 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'   ?                 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE         ?                 'C3 H7 N O2 S'   121.158 
EDO non-polymer         . 1,2-ETHANEDIOL   'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE        ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ?                 'C5 H11 N O2 S'  149.211 
MG  non-polymer         . 'MAGNESIUM ION'  ?                 'Mg 2'           24.305  
MSE 'L-peptide linking' n SELENOMETHIONINE ?                 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ?                 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE         ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1N0W 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.01 
_exptl_crystal.density_percent_sol   38.95 
_exptl_crystal.description           'Freidel pairs were used.' 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.2 
_exptl_crystal_grow.pdbx_details    'ETHYLENE GLYCOL, pH 7.2, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-04-07 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'channel - cut Si monochromator + cylindrical grazing incidence mirror' 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9792  1.0 
2 0.90831 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.9792, 0.90831' 
# 
_reflns.entry_id                     1N0W 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            1.70 
_reflns.d_resolution_low             24.85 
_reflns.number_all                   ? 
_reflns.number_obs                   55746 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            0.077 
_reflns.pdbx_Rsym_value              0.077 
_reflns.pdbx_netI_over_sigmaI        23.5 
_reflns.B_iso_Wilson_estimate        16.9 
_reflns.pdbx_redundancy              7.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.73 
_reflns_shell.percent_possible_all   99.9 
_reflns_shell.Rmerge_I_obs           0.321 
_reflns_shell.pdbx_Rsym_value        0.321 
_reflns_shell.meanI_over_sigI_obs    6.5 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1N0W 
_refine.ls_d_res_high                            1.70 
_refine.ls_d_res_low                             24.85 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     55746 
_refine.ls_number_reflns_R_free                  1529 
_refine.ls_percent_reflns_obs                    99.9 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_work                       0.191 
_refine.ls_R_factor_R_free                       0.206 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               0.000 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               21.10 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  
;The structure was refined against the peak Se K edge wavelength dataset. Selenomethionine residues (residue name MSE) were used in the refinement, and are present in the deposited coordinate file.  Freidel pairs were used.
;
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1956 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         22 
_refine_hist.number_atoms_solvent             247 
_refine_hist.number_atoms_total               2225 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        24.85 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d    0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg 1.23  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1N0W 
_struct.title                     'Crystal structure of a RAD51-BRCA2 BRC repeat complex' 
_struct.pdbx_descriptor           
'DNA repair protein RAD51 homolog 1/Breast cancer type 2 susceptibility protein/LINKER PEPTIDE/ARTIFICIAL GLY-SER-MSE-GLY PEPTIDE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1N0W 
_struct_keywords.pdbx_keywords   'GENE REGULATION/ANTITUMOR PROTEIN' 
_struct_keywords.text            
;DNA repair, homologous recombination, breast cancer susceptibility, RecA-like ATPase, protein complex, GENE REGULATION-ANTITUMOR PROTEIN COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
L N N 8 ? 
M N N 8 ? 
N N N 8 ? 
O N N 8 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
'The asymmetric unit contains one biological unit, constituted by one chain A, one chain B and one chain C' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER A 10  ? LEU A 17  ? SER A 106  LEU A 113  1 ? 8  
HELX_P HELX_P2  2  GLY A 36  ? CYS A 48  ? GLY A 132  CYS A 144  1 ? 13 
HELX_P HELX_P3  3  GLN A 49  ? LEU A 50  ? GLN A 145  LEU A 146  5 ? 2  
HELX_P HELX_P4  4  PRO A 51  ? GLY A 55  ? PRO A 147  GLY A 151  5 ? 5  
HELX_P HELX_P5  5  ARG A 71  ? TYR A 82  ? ARG A 167  TYR A 178  1 ? 12 
HELX_P HELX_P6  6  SER A 85  ? ASN A 92  ? SER A 181  ASN A 188  1 ? 8  
HELX_P HELX_P7  7  ASN A 100 ? SER A 118 ? ASN A 196  SER A 214  1 ? 19 
HELX_P HELX_P8  8  THR A 129 ? ARG A 133 ? THR A 225  ARG A 229  5 ? 5  
HELX_P HELX_P9  9  GLU A 141 ? GLY A 164 ? GLU A 237  GLY A 260  1 ? 24 
HELX_P HELX_P10 10 PRO B 3   ? GLY B 7   ? PRO B 1519 GLY B 1523 5 ? 5  
HELX_P HELX_P11 11 ALA B 19  ? VAL B 26  ? ALA B 1535 VAL B 1542 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? B GLN 35  C  ? ? ? 1_555 C THR 10  N   ? ? B GLN 1551 L THR 1   1_555 ? ? ? ? ? ? ? 1.328 ? 
covale2  covale ? ? A GLU 28  C  ? ? ? 1_555 A MSE 29  N   ? ? A GLU 124  A MSE 125 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale3  covale ? ? A MSE 29  C  ? ? ? 1_555 A PHE 30  N   ? ? A MSE 125  A PHE 126 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale4  covale ? ? A ALA 61  C  ? ? ? 1_555 A MSE 62  N   A ? A ALA 157  A MSE 158 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale5  covale ? ? A ALA 61  C  ? ? ? 1_555 A MSE 62  N   B ? A ALA 157  A MSE 158 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale6  covale ? ? A MSE 62  C  A ? ? 1_555 A TYR 63  N   ? ? A MSE 158  A TYR 159 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale7  covale ? ? A MSE 62  C  B ? ? 1_555 A TYR 63  N   ? ? A MSE 158  A TYR 159 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale8  covale ? ? A ALA 113 C  ? ? ? 1_555 A MSE 114 N   ? ? A ALA 209  A MSE 210 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale9  covale ? ? A MSE 114 C  ? ? ? 1_555 A MSE 115 N   ? ? A MSE 210  A MSE 211 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale10 covale ? ? A MSE 115 C  ? ? ? 1_555 A VAL 116 N   ? ? A MSE 211  A VAL 212 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale11 covale ? ? A GLN 146 C  ? ? ? 1_555 A MSE 147 N   ? ? A GLN 242  A MSE 243 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale12 covale ? ? A MSE 147 C  ? ? ? 1_555 A HIS 148 N   ? ? A MSE 243  A HIS 244 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale13 covale ? ? A ARG 154 C  ? ? ? 1_555 A MSE 155 N   ? ? A ARG 250  A MSE 251 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale14 covale ? ? A MSE 155 C  ? ? ? 1_555 A LEU 156 N   ? ? A MSE 251  A LEU 252 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale15 covale ? ? A ALA 229 C  ? ? ? 1_555 A MSE 230 N   B ? A ALA 325  A MSE 326 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale16 covale ? ? A ALA 229 C  ? ? ? 1_555 A MSE 230 N   A ? A ALA 325  A MSE 326 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale17 covale ? ? A MSE 230 C  B ? ? 1_555 A PHE 231 N   ? ? A MSE 326  A PHE 327 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale18 covale ? ? A MSE 230 C  A ? ? 1_555 A PHE 231 N   ? ? A MSE 326  A PHE 327 1_555 ? ? ? ? ? ? ? 1.328 ? 
metalc1  metalc ? ? E MG  .   MG ? ? ? 1_555 A GLN 5   OE1 ? ? A MG  401  A GLN 101 1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc2  metalc ? ? E MG  .   MG ? ? ? 1_555 L HOH .   O   ? ? A MG  401  A HOH 553 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc3  metalc ? ? E MG  .   MG ? ? ? 1_555 A LEU 17  O   ? ? A MG  401  A LEU 113 1_555 ? ? ? ? ? ? ? 2.235 ? 
metalc4  metalc ? ? E MG  .   MG ? ? ? 1_555 A GLY 20  O   ? ? A MG  401  A GLY 116 1_555 ? ? ? ? ? ? ? 1.899 ? 
metalc5  metalc ? ? E MG  .   MG ? ? ? 1_555 L HOH .   O   ? ? A MG  401  A HOH 646 1_555 ? ? ? ? ? ? ? 2.219 ? 
covale19 covale ? ? D SER 2   C  ? ? ? 1_555 D MSE 3   N   ? ? C SER 2    C MSE 3   1_555 ? ? ? ? ? ? ? 1.328 ? 
covale20 covale ? ? D MSE 3   C  ? ? ? 1_555 D GLY 4   N   ? ? C MSE 3    C GLY 4   1_555 ? ? ? ? ? ? ? 1.331 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASP 
_struct_mon_prot_cis.label_seq_id           126 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASP 
_struct_mon_prot_cis.auth_seq_id            222 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    127 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     223 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.13 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2  ? 
B ? 10 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2  ? anti-parallel 
B 1 2  ? anti-parallel 
B 2 3  ? anti-parallel 
B 3 4  ? anti-parallel 
B 4 5  ? parallel      
B 5 6  ? parallel      
B 6 7  ? parallel      
B 7 8  ? parallel      
B 8 9  ? parallel      
B 9 10 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  GLN A 5   ? ILE A 6   ? GLN A 101  ILE A 102  
A 2  ILE A 21  ? GLU A 22  ? ILE A 117  GLU A 118  
B 1  GLY A 237 ? GLY A 239 ? GLY A 333  GLY A 335  
B 2  ALA A 227 ? ASN A 234 ? ALA A 323  ASN A 330  
B 3  THR A 213 ? ILE A 218 ? THR A 309  ILE A 314  
B 4  THR A 202 ? LYS A 208 ? THR A 298  LYS A 304  
B 5  ILE A 26  ? PHE A 30  ? ILE A 122  PHE A 126  
B 6  ALA A 166 ? ASN A 171 ? ALA A 262  ASN A 267  
B 7  TYR A 120 ? ASP A 126 ? TYR A 216  ASP A 222  
B 8  LYS A 60  ? ASP A 65  ? LYS A 156  ASP A 161  
B 9  VAL A 93  ? ARG A 97  ? VAL A 189  ARG A 193  
B 10 HIS B 9   ? THR B 10  ? HIS B 1525 THR B 1526 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2  N ILE A 6   ? N ILE A 102 O ILE A 21  ? O ILE A 117  
B 1 2  O GLY A 239 ? O GLY A 335 N ALA A 232 ? N ALA A 328  
B 2 3  O PHE A 231 ? O PHE A 327 N ARG A 214 ? N ARG A 310  
B 3 4  O LYS A 217 ? O LYS A 313 N TYR A 205 ? N TYR A 301  
B 4 5  O LEU A 204 ? O LEU A 300 N PHE A 30  ? N PHE A 126  
B 5 6  N MSE A 29  ? N MSE A 125 O ILE A 169 ? O ILE A 265  
B 6 7  O VAL A 168 ? O VAL A 264 N LEU A 123 ? N LEU A 219  
B 7 8  O ILE A 124 ? O ILE A 220 N ILE A 64  ? N ILE A 160  
B 8 9  N TYR A 63  ? N TYR A 159 O ALA A 94  ? O ALA A 190  
B 9 10 N TYR A 95  ? N TYR A 191 O HIS B 9   ? O HIS B 1525 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 401'  
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL A 501'  
AC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO A 502' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO A 503' 
AC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO A 504' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO A 505' 
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE EDO A 506' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 GLN A 5   ? GLN A 101 . ? 1_555 ? 
2  AC1 5 LEU A 17  ? LEU A 113 . ? 1_555 ? 
3  AC1 5 GLY A 20  ? GLY A 116 . ? 1_555 ? 
4  AC1 5 HOH L .   ? HOH A 553 . ? 1_555 ? 
5  AC1 5 HOH L .   ? HOH A 646 . ? 1_555 ? 
6  AC2 5 ARG A 34  ? ARG A 130 . ? 1_555 ? 
7  AC2 5 GLY A 36  ? GLY A 132 . ? 1_555 ? 
8  AC2 5 LYS A 37  ? LYS A 133 . ? 1_555 ? 
9  AC2 5 THR A 38  ? THR A 134 . ? 1_555 ? 
10 AC2 5 GLN A 39  ? GLN A 135 . ? 1_555 ? 
11 AC3 5 GLU A 58  ? GLU A 154 . ? 1_555 ? 
12 AC3 5 ALA A 150 ? ALA A 246 . ? 2_665 ? 
13 AC3 5 HOH L .   ? HOH A 516 . ? 1_555 ? 
14 AC3 5 HOH L .   ? HOH A 536 . ? 1_555 ? 
15 AC3 5 HOH L .   ? HOH A 689 . ? 1_555 ? 
16 AC4 5 GLU A 28  ? GLU A 124 . ? 1_555 ? 
17 AC4 5 LEU A 153 ? LEU A 249 . ? 1_555 ? 
18 AC4 5 ALA A 197 ? ALA A 293 . ? 1_555 ? 
19 AC4 5 ARG A 203 ? ARG A 299 . ? 1_555 ? 
20 AC4 5 HOH L .   ? HOH A 528 . ? 1_555 ? 
21 AC5 5 ILE A 215 ? ILE A 311 . ? 1_555 ? 
22 AC5 5 GLU A 228 ? GLU A 324 . ? 1_555 ? 
23 AC5 5 MSE A 230 ? MSE A 326 . ? 1_555 ? 
24 AC5 5 HOH L .   ? HOH A 694 . ? 1_555 ? 
25 AC5 5 HOH L .   ? HOH A 695 . ? 1_555 ? 
26 AC6 4 THR A 66  ? THR A 162 . ? 1_555 ? 
27 AC6 4 GLU A 67  ? GLU A 163 . ? 1_555 ? 
28 AC6 4 ALA A 130 ? ALA A 226 . ? 1_555 ? 
29 AC6 4 LEU A 131 ? LEU A 227 . ? 1_555 ? 
30 AC7 5 GLN A 39  ? GLN A 135 . ? 1_555 ? 
31 AC7 5 THR A 69  ? THR A 165 . ? 1_555 ? 
32 AC7 5 ARG A 74  ? ARG A 170 . ? 1_555 ? 
33 AC7 5 PRO A 222 ? PRO A 318 . ? 4_455 ? 
34 AC7 5 CYS A 223 ? CYS A 319 . ? 4_455 ? 
# 
_database_PDB_matrix.entry_id          1N0W 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1N0W 
_atom_sites.fract_transf_matrix[1][1]   0.017452 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016909 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012953 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 2   ? 53.866 28.288 4.399   1.00 38.15 ? 98   GLU A N   1 
ATOM   2    C  CA  . GLU A 1 2   ? 53.509 26.878 4.717   1.00 37.21 ? 98   GLU A CA  1 
ATOM   3    C  C   . GLU A 1 2   ? 51.999 26.666 4.744   1.00 34.53 ? 98   GLU A C   1 
ATOM   4    O  O   . GLU A 1 2   ? 51.235 27.538 5.157   1.00 34.61 ? 98   GLU A O   1 
ATOM   5    C  CB  . GLU A 1 2   ? 54.122 26.467 6.057   1.00 41.21 ? 98   GLU A CB  1 
ATOM   6    C  CG  . GLU A 1 2   ? 55.636 26.317 6.015   1.00 45.64 ? 98   GLU A CG  1 
ATOM   7    C  CD  . GLU A 1 2   ? 56.085 25.256 5.027   1.00 47.43 ? 98   GLU A CD  1 
ATOM   8    O  OE1 . GLU A 1 2   ? 55.620 24.103 5.147   1.00 49.28 ? 98   GLU A OE1 1 
ATOM   9    O  OE2 . GLU A 1 2   ? 56.901 25.572 4.134   1.00 49.29 ? 98   GLU A OE2 1 
ATOM   10   N  N   . ILE A 1 3   ? 51.587 25.484 4.306   1.00 30.62 ? 99   ILE A N   1 
ATOM   11   C  CA  . ILE A 1 3   ? 50.181 25.125 4.226   1.00 26.62 ? 99   ILE A CA  1 
ATOM   12   C  C   . ILE A 1 3   ? 49.542 24.625 5.516   1.00 22.96 ? 99   ILE A C   1 
ATOM   13   O  O   . ILE A 1 3   ? 50.152 23.893 6.292   1.00 22.20 ? 99   ILE A O   1 
ATOM   14   C  CB  . ILE A 1 3   ? 49.982 24.054 3.143   1.00 28.34 ? 99   ILE A CB  1 
ATOM   15   C  CG1 . ILE A 1 3   ? 50.421 24.613 1.790   1.00 29.12 ? 99   ILE A CG1 1 
ATOM   16   C  CG2 . ILE A 1 3   ? 48.540 23.603 3.115   1.00 29.76 ? 99   ILE A CG2 1 
ATOM   17   C  CD1 . ILE A 1 3   ? 50.399 23.600 0.678   1.00 33.00 ? 99   ILE A CD1 1 
ATOM   18   N  N   . ILE A 1 4   ? 48.299 25.039 5.728   1.00 19.56 ? 100  ILE A N   1 
ATOM   19   C  CA  . ILE A 1 4   ? 47.524 24.619 6.885   1.00 16.84 ? 100  ILE A CA  1 
ATOM   20   C  C   . ILE A 1 4   ? 46.356 23.824 6.315   1.00 15.59 ? 100  ILE A C   1 
ATOM   21   O  O   . ILE A 1 4   ? 45.805 24.185 5.275   1.00 14.24 ? 100  ILE A O   1 
ATOM   22   C  CB  . ILE A 1 4   ? 46.967 25.825 7.679   1.00 16.90 ? 100  ILE A CB  1 
ATOM   23   C  CG1 . ILE A 1 4   ? 48.113 26.580 8.358   1.00 19.95 ? 100  ILE A CG1 1 
ATOM   24   C  CG2 . ILE A 1 4   ? 45.957 25.344 8.714   1.00 18.72 ? 100  ILE A CG2 1 
ATOM   25   C  CD1 . ILE A 1 4   ? 47.669 27.845 9.089   1.00 22.55 ? 100  ILE A CD1 1 
ATOM   26   N  N   . GLN A 1 5   ? 45.999 22.731 6.978   1.00 13.53 ? 101  GLN A N   1 
ATOM   27   C  CA  . GLN A 1 5   ? 44.887 21.907 6.523   1.00 15.11 ? 101  GLN A CA  1 
ATOM   28   C  C   . GLN A 1 5   ? 43.786 21.993 7.564   1.00 13.47 ? 101  GLN A C   1 
ATOM   29   O  O   . GLN A 1 5   ? 43.959 21.568 8.706   1.00 15.75 ? 101  GLN A O   1 
ATOM   30   C  CB  . GLN A 1 5   ? 45.348 20.464 6.330   1.00 19.35 ? 101  GLN A CB  1 
ATOM   31   C  CG  . GLN A 1 5   ? 46.592 20.374 5.458   1.00 26.50 ? 101  GLN A CG  1 
ATOM   32   C  CD  . GLN A 1 5   ? 46.427 19.451 4.273   1.00 31.87 ? 101  GLN A CD  1 
ATOM   33   O  OE1 . GLN A 1 5   ? 45.487 19.588 3.488   1.00 35.05 ? 101  GLN A OE1 1 
ATOM   34   N  NE2 . GLN A 1 5   ? 47.350 18.507 4.129   1.00 33.92 ? 101  GLN A NE2 1 
ATOM   35   N  N   . ILE A 1 6   ? 42.654 22.557 7.161   1.00 10.05 ? 102  ILE A N   1 
ATOM   36   C  CA  . ILE A 1 6   ? 41.520 22.748 8.060   1.00 8.05  ? 102  ILE A CA  1 
ATOM   37   C  C   . ILE A 1 6   ? 40.604 21.531 8.085   1.00 8.43  ? 102  ILE A C   1 
ATOM   38   O  O   . ILE A 1 6   ? 40.166 21.054 7.042   1.00 8.83  ? 102  ILE A O   1 
ATOM   39   C  CB  . ILE A 1 6   ? 40.706 23.983 7.633   1.00 8.89  ? 102  ILE A CB  1 
ATOM   40   C  CG1 . ILE A 1 6   ? 41.620 25.215 7.602   1.00 11.08 ? 102  ILE A CG1 1 
ATOM   41   C  CG2 . ILE A 1 6   ? 39.544 24.206 8.599   1.00 8.83  ? 102  ILE A CG2 1 
ATOM   42   C  CD1 . ILE A 1 6   ? 41.023 26.415 6.880   1.00 9.86  ? 102  ILE A CD1 1 
ATOM   43   N  N   . THR A 1 7   ? 40.309 21.036 9.282   1.00 8.44  ? 103  THR A N   1 
ATOM   44   C  CA  . THR A 1 7   ? 39.446 19.868 9.411   1.00 9.31  ? 103  THR A CA  1 
ATOM   45   C  C   . THR A 1 7   ? 38.020 20.116 8.923   1.00 9.93  ? 103  THR A C   1 
ATOM   46   O  O   . THR A 1 7   ? 37.449 21.186 9.141   1.00 8.54  ? 103  THR A O   1 
ATOM   47   C  CB  . THR A 1 7   ? 39.386 19.368 10.872  1.00 10.02 ? 103  THR A CB  1 
ATOM   48   O  OG1 . THR A 1 7   ? 38.605 18.164 10.929  1.00 11.79 ? 103  THR A OG1 1 
ATOM   49   C  CG2 . THR A 1 7   ? 38.755 20.417 11.776  1.00 11.70 ? 103  THR A CG2 1 
ATOM   50   N  N   . THR A 1 8   ? 37.456 19.110 8.259   1.00 10.38 ? 104  THR A N   1 
ATOM   51   C  CA  . THR A 1 8   ? 36.091 19.174 7.737   1.00 11.01 ? 104  THR A CA  1 
ATOM   52   C  C   . THR A 1 8   ? 35.090 18.688 8.784   1.00 11.39 ? 104  THR A C   1 
ATOM   53   O  O   . THR A 1 8   ? 33.878 18.830 8.604   1.00 12.53 ? 104  THR A O   1 
ATOM   54   C  CB  . THR A 1 8   ? 35.912 18.256 6.510   1.00 11.26 ? 104  THR A CB  1 
ATOM   55   O  OG1 . THR A 1 8   ? 36.128 16.896 6.914   1.00 14.11 ? 104  THR A OG1 1 
ATOM   56   C  CG2 . THR A 1 8   ? 36.892 18.613 5.415   1.00 12.62 ? 104  THR A CG2 1 
ATOM   57   N  N   . GLY A 1 9   ? 35.598 18.109 9.868   1.00 10.65 ? 105  GLY A N   1 
ATOM   58   C  CA  . GLY A 1 9   ? 34.724 17.582 10.901  1.00 11.97 ? 105  GLY A CA  1 
ATOM   59   C  C   . GLY A 1 9   ? 34.619 16.071 10.780  1.00 13.09 ? 105  GLY A C   1 
ATOM   60   O  O   . GLY A 1 9   ? 34.156 15.390 11.699  1.00 13.32 ? 105  GLY A O   1 
ATOM   61   N  N   . SER A 1 10  ? 35.052 15.550 9.634   1.00 12.40 ? 106  SER A N   1 
ATOM   62   C  CA  . SER A 1 10  ? 35.033 14.115 9.363   1.00 14.20 ? 106  SER A CA  1 
ATOM   63   C  C   . SER A 1 10  ? 36.453 13.563 9.217   1.00 14.25 ? 106  SER A C   1 
ATOM   64   O  O   . SER A 1 10  ? 37.230 14.041 8.391   1.00 13.00 ? 106  SER A O   1 
ATOM   65   C  CB  . SER A 1 10  ? 34.242 13.835 8.079   1.00 14.61 ? 106  SER A CB  1 
ATOM   66   O  OG  . SER A 1 10  ? 34.505 12.528 7.589   1.00 14.19 ? 106  SER A OG  1 
ATOM   67   N  N   . LYS A 1 11  ? 36.788 12.553 10.017  1.00 15.63 ? 107  LYS A N   1 
ATOM   68   C  CA  . LYS A 1 11  ? 38.117 11.946 9.951   1.00 17.24 ? 107  LYS A CA  1 
ATOM   69   C  C   . LYS A 1 11  ? 38.359 11.310 8.587   1.00 16.91 ? 107  LYS A C   1 
ATOM   70   O  O   . LYS A 1 11  ? 39.446 11.430 8.020   1.00 16.59 ? 107  LYS A O   1 
ATOM   71   C  CB  . LYS A 1 11  ? 38.279 10.867 11.026  1.00 21.76 ? 107  LYS A CB  1 
ATOM   72   C  CG  . LYS A 1 11  ? 38.184 11.361 12.456  1.00 26.56 ? 107  LYS A CG  1 
ATOM   73   C  CD  . LYS A 1 11  ? 38.430 10.209 13.417  1.00 31.38 ? 107  LYS A CD  1 
ATOM   74   C  CE  . LYS A 1 11  ? 38.312 10.642 14.868  1.00 35.03 ? 107  LYS A CE  1 
ATOM   75   N  NZ  . LYS A 1 11  ? 38.599 9.505  15.791  1.00 37.82 ? 107  LYS A NZ  1 
ATOM   76   N  N   . GLU A 1 12  ? 37.345 10.623 8.068   1.00 16.08 ? 108  GLU A N   1 
ATOM   77   C  CA  . GLU A 1 12  ? 37.464 9.970  6.770   1.00 16.56 ? 108  GLU A CA  1 
ATOM   78   C  C   . GLU A 1 12  ? 37.611 10.973 5.641   1.00 14.32 ? 108  GLU A C   1 
ATOM   79   O  O   . GLU A 1 12  ? 38.403 10.768 4.720   1.00 15.54 ? 108  GLU A O   1 
ATOM   80   C  CB  . GLU A 1 12  ? 36.252 9.072  6.508   1.00 18.83 ? 108  GLU A CB  1 
ATOM   81   C  CG  . GLU A 1 12  ? 36.214 7.829  7.379   1.00 24.11 ? 108  GLU A CG  1 
ATOM   82   C  CD  . GLU A 1 12  ? 37.473 6.991  7.241   1.00 29.12 ? 108  GLU A CD  1 
ATOM   83   O  OE1 . GLU A 1 12  ? 37.798 6.583  6.104   1.00 31.85 ? 108  GLU A OE1 1 
ATOM   84   O  OE2 . GLU A 1 12  ? 38.136 6.742  8.268   1.00 31.72 ? 108  GLU A OE2 1 
ATOM   85   N  N   . LEU A 1 13  ? 36.842 12.057 5.703   1.00 14.02 ? 109  LEU A N   1 
ATOM   86   C  CA  . LEU A 1 13  ? 36.920 13.072 4.667   1.00 13.21 ? 109  LEU A CA  1 
ATOM   87   C  C   . LEU A 1 13  ? 38.280 13.769 4.754   1.00 14.45 ? 109  LEU A C   1 
ATOM   88   O  O   . LEU A 1 13  ? 38.896 14.070 3.731   1.00 15.30 ? 109  LEU A O   1 
ATOM   89   C  CB  . LEU A 1 13  ? 35.772 14.076 4.823   1.00 14.04 ? 109  LEU A CB  1 
ATOM   90   C  CG  . LEU A 1 13  ? 35.622 15.125 3.721   1.00 15.48 ? 109  LEU A CG  1 
ATOM   91   C  CD1 . LEU A 1 13  ? 35.590 14.448 2.353   1.00 17.82 ? 109  LEU A CD1 1 
ATOM   92   C  CD2 . LEU A 1 13  ? 34.345 15.925 3.958   1.00 15.78 ? 109  LEU A CD2 1 
ATOM   93   N  N   . ASP A 1 14  ? 38.751 14.014 5.977   1.00 13.76 ? 110  ASP A N   1 
ATOM   94   C  CA  . ASP A 1 14  ? 40.056 14.644 6.170   1.00 14.88 ? 110  ASP A CA  1 
ATOM   95   C  C   . ASP A 1 14  ? 41.152 13.762 5.566   1.00 15.86 ? 110  ASP A C   1 
ATOM   96   O  O   . ASP A 1 14  ? 42.067 14.261 4.910   1.00 15.60 ? 110  ASP A O   1 
ATOM   97   C  CB  . ASP A 1 14  ? 40.349 14.864 7.661   1.00 15.02 ? 110  ASP A CB  1 
ATOM   98   C  CG  . ASP A 1 14  ? 39.606 16.057 8.240   1.00 15.43 ? 110  ASP A CG  1 
ATOM   99   O  OD1 . ASP A 1 14  ? 38.930 16.782 7.475   1.00 15.66 ? 110  ASP A OD1 1 
ATOM   100  O  OD2 . ASP A 1 14  ? 39.706 16.272 9.471   1.00 15.62 ? 110  ASP A OD2 1 
ATOM   101  N  N   . LYS A 1 15  ? 41.061 12.451 5.788   1.00 17.06 ? 111  LYS A N   1 
ATOM   102  C  CA  . LYS A 1 15  ? 42.056 11.528 5.242   1.00 19.14 ? 111  LYS A CA  1 
ATOM   103  C  C   . LYS A 1 15  ? 42.070 11.585 3.720   1.00 18.08 ? 111  LYS A C   1 
ATOM   104  O  O   . LYS A 1 15  ? 43.136 11.599 3.098   1.00 19.72 ? 111  LYS A O   1 
ATOM   105  C  CB  . LYS A 1 15  ? 41.773 10.094 5.692   1.00 21.83 ? 111  LYS A CB  1 
ATOM   106  C  CG  . LYS A 1 15  ? 41.970 9.845  7.176   1.00 28.51 ? 111  LYS A CG  1 
ATOM   107  C  CD  . LYS A 1 15  ? 41.702 8.384  7.515   1.00 32.83 ? 111  LYS A CD  1 
ATOM   108  C  CE  . LYS A 1 15  ? 41.819 8.123  9.007   1.00 35.12 ? 111  LYS A CE  1 
ATOM   109  N  NZ  . LYS A 1 15  ? 41.489 6.707  9.342   1.00 37.22 ? 111  LYS A NZ  1 
ATOM   110  N  N   . LEU A 1 16  ? 40.885 11.616 3.119   1.00 18.52 ? 112  LEU A N   1 
ATOM   111  C  CA  . LEU A 1 16  ? 40.771 11.680 1.666   1.00 18.11 ? 112  LEU A CA  1 
ATOM   112  C  C   . LEU A 1 16  ? 41.424 12.958 1.151   1.00 18.62 ? 112  LEU A C   1 
ATOM   113  O  O   . LEU A 1 16  ? 42.010 12.979 0.063   1.00 18.72 ? 112  LEU A O   1 
ATOM   114  C  CB  . LEU A 1 16  ? 39.300 11.662 1.244   1.00 18.15 ? 112  LEU A CB  1 
ATOM   115  C  CG  . LEU A 1 16  ? 39.045 11.712 -0.266  1.00 19.29 ? 112  LEU A CG  1 
ATOM   116  C  CD1 . LEU A 1 16  ? 39.575 10.438 -0.906  1.00 20.79 ? 112  LEU A CD1 1 
ATOM   117  C  CD2 . LEU A 1 16  ? 37.556 11.857 -0.538  1.00 18.97 ? 112  LEU A CD2 1 
ATOM   118  N  N   . LEU A 1 17  ? 41.315 14.021 1.944   1.00 18.70 ? 113  LEU A N   1 
ATOM   119  C  CA  . LEU A 1 17  ? 41.879 15.321 1.592   1.00 18.77 ? 113  LEU A CA  1 
ATOM   120  C  C   . LEU A 1 17  ? 43.313 15.493 2.085   1.00 20.09 ? 113  LEU A C   1 
ATOM   121  O  O   . LEU A 1 17  ? 43.843 16.606 2.098   1.00 20.28 ? 113  LEU A O   1 
ATOM   122  C  CB  . LEU A 1 17  ? 41.003 16.442 2.160   1.00 18.91 ? 113  LEU A CB  1 
ATOM   123  C  CG  . LEU A 1 17  ? 39.611 16.587 1.546   1.00 21.50 ? 113  LEU A CG  1 
ATOM   124  C  CD1 . LEU A 1 17  ? 38.779 17.536 2.391   1.00 21.32 ? 113  LEU A CD1 1 
ATOM   125  C  CD2 . LEU A 1 17  ? 39.735 17.096 0.120   1.00 22.16 ? 113  LEU A CD2 1 
ATOM   126  N  N   . GLN A 1 18  ? 43.935 14.392 2.498   1.00 19.91 ? 114  GLN A N   1 
ATOM   127  C  CA  . GLN A 1 18  ? 45.313 14.420 2.974   1.00 21.17 ? 114  GLN A CA  1 
ATOM   128  C  C   . GLN A 1 18  ? 45.521 15.340 4.171   1.00 20.81 ? 114  GLN A C   1 
ATOM   129  O  O   . GLN A 1 18  ? 46.588 15.938 4.323   1.00 24.10 ? 114  GLN A O   1 
ATOM   130  C  CB  . GLN A 1 18  ? 46.245 14.852 1.841   1.00 22.49 ? 114  GLN A CB  1 
ATOM   131  C  CG  . GLN A 1 18  ? 46.229 13.937 0.635   1.00 23.81 ? 114  GLN A CG  1 
ATOM   132  C  CD  . GLN A 1 18  ? 47.072 14.475 -0.504  1.00 24.77 ? 114  GLN A CD  1 
ATOM   133  O  OE1 . GLN A 1 18  ? 48.272 14.698 -0.351  1.00 27.78 ? 114  GLN A OE1 1 
ATOM   134  N  NE2 . GLN A 1 18  ? 46.444 14.691 -1.653  1.00 26.62 ? 114  GLN A NE2 1 
ATOM   135  N  N   . GLY A 1 19  ? 44.506 15.455 5.019   1.00 18.52 ? 115  GLY A N   1 
ATOM   136  C  CA  . GLY A 1 19  ? 44.628 16.302 6.189   1.00 19.04 ? 115  GLY A CA  1 
ATOM   137  C  C   . GLY A 1 19  ? 43.440 17.215 6.393   1.00 17.02 ? 115  GLY A C   1 
ATOM   138  O  O   . GLY A 1 19  ? 43.026 17.462 7.524   1.00 18.66 ? 115  GLY A O   1 
ATOM   139  N  N   . GLY A 1 20  ? 42.886 17.714 5.292   1.00 15.87 ? 116  GLY A N   1 
ATOM   140  C  CA  . GLY A 1 20  ? 41.740 18.600 5.372   1.00 14.66 ? 116  GLY A CA  1 
ATOM   141  C  C   . GLY A 1 20  ? 41.760 19.626 4.253   1.00 14.23 ? 116  GLY A C   1 
ATOM   142  O  O   . GLY A 1 20  ? 42.488 19.462 3.276   1.00 14.98 ? 116  GLY A O   1 
ATOM   143  N  N   . ILE A 1 21  ? 40.967 20.683 4.393   1.00 12.49 ? 117  ILE A N   1 
ATOM   144  C  CA  . ILE A 1 21  ? 40.907 21.738 3.384   1.00 11.37 ? 117  ILE A CA  1 
ATOM   145  C  C   . ILE A 1 21  ? 42.195 22.559 3.428   1.00 10.95 ? 117  ILE A C   1 
ATOM   146  O  O   . ILE A 1 21  ? 42.578 23.093 4.466   1.00 12.19 ? 117  ILE A O   1 
ATOM   147  C  CB  . ILE A 1 21  ? 39.677 22.639 3.619   1.00 10.73 ? 117  ILE A CB  1 
ATOM   148  C  CG1 . ILE A 1 21  ? 38.396 21.819 3.429   1.00 12.81 ? 117  ILE A CG1 1 
ATOM   149  C  CG2 . ILE A 1 21  ? 39.706 23.836 2.676   1.00 12.58 ? 117  ILE A CG2 1 
ATOM   150  C  CD1 . ILE A 1 21  ? 38.180 21.302 2.016   1.00 14.44 ? 117  ILE A CD1 1 
ATOM   151  N  N   . GLU A 1 22  ? 42.849 22.665 2.277   1.00 10.51 ? 118  GLU A N   1 
ATOM   152  C  CA  . GLU A 1 22  ? 44.132 23.343 2.151   1.00 12.58 ? 118  GLU A CA  1 
ATOM   153  C  C   . GLU A 1 22  ? 44.120 24.861 1.982   1.00 12.88 ? 118  GLU A C   1 
ATOM   154  O  O   . GLU A 1 22  ? 43.449 25.384 1.098   1.00 12.57 ? 118  GLU A O   1 
ATOM   155  C  CB  . GLU A 1 22  ? 44.870 22.714 0.968   1.00 15.64 ? 118  GLU A CB  1 
ATOM   156  C  CG  . GLU A 1 22  ? 46.365 22.783 1.022   1.00 21.41 ? 118  GLU A CG  1 
ATOM   157  C  CD  . GLU A 1 22  ? 46.996 21.963 -0.085  1.00 20.95 ? 118  GLU A CD  1 
ATOM   158  O  OE1 . GLU A 1 22  ? 47.180 22.499 -1.194  1.00 23.24 ? 118  GLU A OE1 1 
ATOM   159  O  OE2 . GLU A 1 22  ? 47.284 20.773 0.156   1.00 26.48 ? 118  GLU A OE2 1 
ATOM   160  N  N   . THR A 1 23  ? 44.872 25.569 2.822   1.00 11.45 ? 119  THR A N   1 
ATOM   161  C  CA  . THR A 1 23  ? 44.962 27.017 2.681   1.00 11.27 ? 119  THR A CA  1 
ATOM   162  C  C   . THR A 1 23  ? 45.891 27.282 1.492   1.00 11.98 ? 119  THR A C   1 
ATOM   163  O  O   . THR A 1 23  ? 46.769 26.467 1.194   1.00 12.27 ? 119  THR A O   1 
ATOM   164  C  CB  . THR A 1 23  ? 45.553 27.700 3.946   1.00 11.65 ? 119  THR A CB  1 
ATOM   165  O  OG1 . THR A 1 23  ? 46.863 27.180 4.220   1.00 12.69 ? 119  THR A OG1 1 
ATOM   166  C  CG2 . THR A 1 23  ? 44.650 27.468 5.149   1.00 11.67 ? 119  THR A CG2 1 
ATOM   167  N  N   . GLY A 1 24  ? 45.679 28.397 0.798   1.00 10.27 ? 120  GLY A N   1 
ATOM   168  C  CA  . GLY A 1 24  ? 46.526 28.740 -0.333  1.00 10.55 ? 120  GLY A CA  1 
ATOM   169  C  C   . GLY A 1 24  ? 46.071 28.245 -1.690  1.00 10.39 ? 120  GLY A C   1 
ATOM   170  O  O   . GLY A 1 24  ? 46.737 28.490 -2.700  1.00 11.43 ? 120  GLY A O   1 
ATOM   171  N  N   . SER A 1 25  ? 44.948 27.534 -1.726  1.00 10.13 ? 121  SER A N   1 
ATOM   172  C  CA  . SER A 1 25  ? 44.423 27.028 -2.984  1.00 9.86  ? 121  SER A CA  1 
ATOM   173  C  C   . SER A 1 25  ? 42.904 26.947 -2.918  1.00 9.08  ? 121  SER A C   1 
ATOM   174  O  O   . SER A 1 25  ? 42.302 27.194 -1.875  1.00 8.68  ? 121  SER A O   1 
ATOM   175  C  CB  . SER A 1 25  ? 45.008 25.645 -3.299  1.00 13.87 ? 121  SER A CB  1 
ATOM   176  O  OG  . SER A 1 25  ? 44.622 24.700 -2.326  1.00 19.34 ? 121  SER A OG  1 
ATOM   177  N  N   . ILE A 1 26  ? 42.298 26.611 -4.048  1.00 9.44  ? 122  ILE A N   1 
ATOM   178  C  CA  . ILE A 1 26  ? 40.854 26.503 -4.154  1.00 10.10 ? 122  ILE A CA  1 
ATOM   179  C  C   . ILE A 1 26  ? 40.381 25.056 -4.072  1.00 11.37 ? 122  ILE A C   1 
ATOM   180  O  O   . ILE A 1 26  ? 40.982 24.162 -4.666  1.00 12.71 ? 122  ILE A O   1 
ATOM   181  C  CB  . ILE A 1 26  ? 40.360 27.090 -5.505  1.00 10.40 ? 122  ILE A CB  1 
ATOM   182  C  CG1 . ILE A 1 26  ? 40.702 28.579 -5.586  1.00 13.97 ? 122  ILE A CG1 1 
ATOM   183  C  CG2 . ILE A 1 26  ? 38.858 26.863 -5.663  1.00 12.37 ? 122  ILE A CG2 1 
ATOM   184  C  CD1 . ILE A 1 26  ? 40.453 29.187 -6.952  1.00 14.82 ? 122  ILE A CD1 1 
ATOM   185  N  N   . THR A 1 27  ? 39.323 24.832 -3.304  1.00 9.56  ? 123  THR A N   1 
ATOM   186  C  CA  . THR A 1 27  ? 38.708 23.513 -3.212  1.00 9.79  ? 123  THR A CA  1 
ATOM   187  C  C   . THR A 1 27  ? 37.339 23.769 -3.827  1.00 8.71  ? 123  THR A C   1 
ATOM   188  O  O   . THR A 1 27  ? 36.581 24.603 -3.329  1.00 10.46 ? 123  THR A O   1 
ATOM   189  C  CB  . THR A 1 27  ? 38.526 23.041 -1.760  1.00 10.66 ? 123  THR A CB  1 
ATOM   190  O  OG1 . THR A 1 27  ? 39.811 22.851 -1.158  1.00 13.42 ? 123  THR A OG1 1 
ATOM   191  C  CG2 . THR A 1 27  ? 37.751 21.719 -1.724  1.00 10.55 ? 123  THR A CG2 1 
ATOM   192  N  N   . GLU A 1 28  ? 37.041 23.084 -4.926  1.00 9.35  ? 124  GLU A N   1 
ATOM   193  C  CA  . GLU A 1 28  ? 35.770 23.256 -5.624  1.00 9.53  ? 124  GLU A CA  1 
ATOM   194  C  C   . GLU A 1 28  ? 34.900 22.025 -5.399  1.00 10.21 ? 124  GLU A C   1 
ATOM   195  O  O   . GLU A 1 28  ? 35.283 20.911 -5.749  1.00 10.78 ? 124  GLU A O   1 
ATOM   196  C  CB  . GLU A 1 28  ? 36.043 23.472 -7.115  1.00 12.39 ? 124  GLU A CB  1 
ATOM   197  C  CG  . GLU A 1 28  ? 34.820 23.549 -8.006  1.00 13.73 ? 124  GLU A CG  1 
ATOM   198  C  CD  . GLU A 1 28  ? 35.199 23.914 -9.429  1.00 17.73 ? 124  GLU A CD  1 
ATOM   199  O  OE1 . GLU A 1 28  ? 36.273 23.462 -9.887  1.00 16.72 ? 124  GLU A OE1 1 
ATOM   200  O  OE2 . GLU A 1 28  ? 34.428 24.647 -10.086 1.00 18.68 ? 124  GLU A OE2 1 
HETATM 201  N  N   . MSE A 1 29  ? 33.729 22.239 -4.807  1.00 10.59 ? 125  MSE A N   1 
HETATM 202  C  CA  . MSE A 1 29  ? 32.825 21.143 -4.495  1.00 11.22 ? 125  MSE A CA  1 
HETATM 203  C  C   . MSE A 1 29  ? 31.595 21.128 -5.387  1.00 12.28 ? 125  MSE A C   1 
HETATM 204  O  O   . MSE A 1 29  ? 30.878 22.123 -5.495  1.00 12.87 ? 125  MSE A O   1 
HETATM 205  C  CB  . MSE A 1 29  ? 32.413 21.237 -3.028  1.00 13.67 ? 125  MSE A CB  1 
HETATM 206  C  CG  . MSE A 1 29  ? 33.605 21.453 -2.110  1.00 14.05 ? 125  MSE A CG  1 
HETATM 207  SE SE  . MSE A 1 29  ? 33.164 21.237 -0.250  1.00 21.89 ? 125  MSE A SE  1 
HETATM 208  C  CE  . MSE A 1 29  ? 31.991 22.745 -0.036  1.00 16.55 ? 125  MSE A CE  1 
ATOM   209  N  N   . PHE A 1 30  ? 31.361 19.986 -6.026  1.00 13.37 ? 126  PHE A N   1 
ATOM   210  C  CA  . PHE A 1 30  ? 30.220 19.829 -6.917  1.00 14.46 ? 126  PHE A CA  1 
ATOM   211  C  C   . PHE A 1 30  ? 29.078 19.083 -6.252  1.00 16.95 ? 126  PHE A C   1 
ATOM   212  O  O   . PHE A 1 30  ? 29.292 18.071 -5.589  1.00 16.20 ? 126  PHE A O   1 
ATOM   213  C  CB  . PHE A 1 30  ? 30.634 19.085 -8.185  1.00 13.72 ? 126  PHE A CB  1 
ATOM   214  C  CG  . PHE A 1 30  ? 31.575 19.857 -9.059  1.00 15.70 ? 126  PHE A CG  1 
ATOM   215  C  CD1 . PHE A 1 30  ? 32.938 19.890 -8.783  1.00 16.05 ? 126  PHE A CD1 1 
ATOM   216  C  CD2 . PHE A 1 30  ? 31.095 20.565 -10.155 1.00 15.36 ? 126  PHE A CD2 1 
ATOM   217  C  CE1 . PHE A 1 30  ? 33.811 20.619 -9.588  1.00 16.76 ? 126  PHE A CE1 1 
ATOM   218  C  CE2 . PHE A 1 30  ? 31.961 21.297 -10.966 1.00 16.46 ? 126  PHE A CE2 1 
ATOM   219  C  CZ  . PHE A 1 30  ? 33.320 21.323 -10.682 1.00 15.73 ? 126  PHE A CZ  1 
ATOM   220  N  N   . GLY A 1 31  ? 27.866 19.597 -6.442  1.00 19.76 ? 127  GLY A N   1 
ATOM   221  C  CA  . GLY A 1 31  ? 26.683 18.983 -5.866  1.00 22.59 ? 127  GLY A CA  1 
ATOM   222  C  C   . GLY A 1 31  ? 25.608 20.006 -5.542  1.00 24.79 ? 127  GLY A C   1 
ATOM   223  O  O   . GLY A 1 31  ? 25.904 21.181 -5.300  1.00 24.48 ? 127  GLY A O   1 
ATOM   224  N  N   . GLU A 1 32  ? 24.354 19.561 -5.535  1.00 27.02 ? 128  GLU A N   1 
ATOM   225  C  CA  . GLU A 1 32  ? 23.230 20.442 -5.228  1.00 28.56 ? 128  GLU A CA  1 
ATOM   226  C  C   . GLU A 1 32  ? 23.089 20.606 -3.721  1.00 27.92 ? 128  GLU A C   1 
ATOM   227  O  O   . GLU A 1 32  ? 23.714 19.878 -2.949  1.00 27.36 ? 128  GLU A O   1 
ATOM   228  C  CB  . GLU A 1 32  ? 21.929 19.863 -5.787  1.00 31.81 ? 128  GLU A CB  1 
ATOM   229  C  CG  . GLU A 1 32  ? 21.852 19.818 -7.305  1.00 36.61 ? 128  GLU A CG  1 
ATOM   230  C  CD  . GLU A 1 32  ? 21.889 21.199 -7.932  1.00 39.77 ? 128  GLU A CD  1 
ATOM   231  O  OE1 . GLU A 1 32  ? 21.116 22.075 -7.487  1.00 42.32 ? 128  GLU A OE1 1 
ATOM   232  O  OE2 . GLU A 1 32  ? 22.685 21.410 -8.874  1.00 41.49 ? 128  GLU A OE2 1 
ATOM   233  N  N   . PHE A 1 33  ? 22.269 21.567 -3.306  1.00 26.59 ? 129  PHE A N   1 
ATOM   234  C  CA  . PHE A 1 33  ? 22.044 21.794 -1.887  1.00 26.34 ? 129  PHE A CA  1 
ATOM   235  C  C   . PHE A 1 33  ? 21.567 20.467 -1.312  1.00 26.38 ? 129  PHE A C   1 
ATOM   236  O  O   . PHE A 1 33  ? 20.789 19.756 -1.949  1.00 26.54 ? 129  PHE A O   1 
ATOM   237  C  CB  . PHE A 1 33  ? 20.979 22.879 -1.682  1.00 26.99 ? 129  PHE A CB  1 
ATOM   238  C  CG  . PHE A 1 33  ? 20.628 23.128 -0.238  1.00 27.71 ? 129  PHE A CG  1 
ATOM   239  C  CD1 . PHE A 1 33  ? 21.607 23.501 0.678   1.00 26.29 ? 129  PHE A CD1 1 
ATOM   240  C  CD2 . PHE A 1 33  ? 19.311 23.006 0.203   1.00 27.59 ? 129  PHE A CD2 1 
ATOM   241  C  CE1 . PHE A 1 33  ? 21.284 23.751 2.013   1.00 27.10 ? 129  PHE A CE1 1 
ATOM   242  C  CE2 . PHE A 1 33  ? 18.976 23.253 1.537   1.00 27.95 ? 129  PHE A CE2 1 
ATOM   243  C  CZ  . PHE A 1 33  ? 19.966 23.627 2.443   1.00 28.18 ? 129  PHE A CZ  1 
ATOM   244  N  N   . ARG A 1 34  ? 22.062 20.138 -0.124  1.00 25.28 ? 130  ARG A N   1 
ATOM   245  C  CA  . ARG A 1 34  ? 21.727 18.909 0.589   1.00 24.10 ? 130  ARG A CA  1 
ATOM   246  C  C   . ARG A 1 34  ? 22.666 17.735 0.327   1.00 21.02 ? 130  ARG A C   1 
ATOM   247  O  O   . ARG A 1 34  ? 22.608 16.737 1.035   1.00 20.30 ? 130  ARG A O   1 
ATOM   248  C  CB  . ARG A 1 34  ? 20.270 18.507 0.331   1.00 27.41 ? 130  ARG A CB  1 
ATOM   249  C  CG  . ARG A 1 34  ? 19.291 19.529 0.893   1.00 32.24 ? 130  ARG A CG  1 
ATOM   250  C  CD  . ARG A 1 34  ? 17.866 19.017 0.958   1.00 38.42 ? 130  ARG A CD  1 
ATOM   251  N  NE  . ARG A 1 34  ? 17.058 19.876 1.820   1.00 44.65 ? 130  ARG A NE  1 
ATOM   252  C  CZ  . ARG A 1 34  ? 15.787 19.650 2.135   1.00 48.26 ? 130  ARG A CZ  1 
ATOM   253  N  NH1 . ARG A 1 34  ? 15.160 18.583 1.657   1.00 50.05 ? 130  ARG A NH1 1 
ATOM   254  N  NH2 . ARG A 1 34  ? 15.144 20.490 2.937   1.00 49.61 ? 130  ARG A NH2 1 
ATOM   255  N  N   . THR A 1 35  ? 23.530 17.846 -0.680  1.00 19.13 ? 131  THR A N   1 
ATOM   256  C  CA  . THR A 1 35  ? 24.490 16.776 -0.955  1.00 17.15 ? 131  THR A CA  1 
ATOM   257  C  C   . THR A 1 35  ? 25.601 16.899 0.082   1.00 16.43 ? 131  THR A C   1 
ATOM   258  O  O   . THR A 1 35  ? 26.455 16.020 0.212   1.00 15.57 ? 131  THR A O   1 
ATOM   259  C  CB  . THR A 1 35  ? 25.129 16.904 -2.351  1.00 19.70 ? 131  THR A CB  1 
ATOM   260  O  OG1 . THR A 1 35  ? 25.761 18.184 -2.469  1.00 21.01 ? 131  THR A OG1 1 
ATOM   261  C  CG2 . THR A 1 35  ? 24.079 16.744 -3.439  1.00 22.19 ? 131  THR A CG2 1 
ATOM   262  N  N   . GLY A 1 36  ? 25.583 18.012 0.810   1.00 15.23 ? 132  GLY A N   1 
ATOM   263  C  CA  . GLY A 1 36  ? 26.581 18.246 1.836   1.00 14.02 ? 132  GLY A CA  1 
ATOM   264  C  C   . GLY A 1 36  ? 27.459 19.463 1.598   1.00 13.72 ? 132  GLY A C   1 
ATOM   265  O  O   . GLY A 1 36  ? 28.118 19.935 2.524   1.00 13.81 ? 132  GLY A O   1 
ATOM   266  N  N   . LYS A 1 37  ? 27.467 19.986 0.374   1.00 12.58 ? 133  LYS A N   1 
ATOM   267  C  CA  . LYS A 1 37  ? 28.306 21.140 0.060   1.00 12.45 ? 133  LYS A CA  1 
ATOM   268  C  C   . LYS A 1 37  ? 28.111 22.343 0.990   1.00 11.78 ? 133  LYS A C   1 
ATOM   269  O  O   . LYS A 1 37  ? 29.084 22.923 1.476   1.00 12.85 ? 133  LYS A O   1 
ATOM   270  C  CB  . LYS A 1 37  ? 28.111 21.557 -1.408  1.00 13.99 ? 133  LYS A CB  1 
ATOM   271  C  CG  . LYS A 1 37  ? 26.687 21.910 -1.804  1.00 16.59 ? 133  LYS A CG  1 
ATOM   272  C  CD  . LYS A 1 37  ? 26.511 23.414 -1.951  1.00 19.12 ? 133  LYS A CD  1 
ATOM   273  C  CE  . LYS A 1 37  ? 25.098 23.756 -2.398  1.00 21.74 ? 133  LYS A CE  1 
ATOM   274  N  NZ  . LYS A 1 37  ? 24.906 25.222 -2.577  1.00 23.48 ? 133  LYS A NZ  1 
ATOM   275  N  N   . THR A 1 38  ? 26.866 22.718 1.250   1.00 12.16 ? 134  THR A N   1 
ATOM   276  C  CA  . THR A 1 38  ? 26.615 23.856 2.123   1.00 12.03 ? 134  THR A CA  1 
ATOM   277  C  C   . THR A 1 38  ? 26.892 23.515 3.585   1.00 11.44 ? 134  THR A C   1 
ATOM   278  O  O   . THR A 1 38  ? 27.315 24.380 4.357   1.00 11.86 ? 134  THR A O   1 
ATOM   279  C  CB  . THR A 1 38  ? 25.169 24.366 1.959   1.00 12.33 ? 134  THR A CB  1 
ATOM   280  O  OG1 . THR A 1 38  ? 24.999 24.861 0.622   1.00 14.07 ? 134  THR A OG1 1 
ATOM   281  C  CG2 . THR A 1 38  ? 24.874 25.485 2.950   1.00 14.49 ? 134  THR A CG2 1 
ATOM   282  N  N   . GLN A 1 39  ? 26.668 22.260 3.964   1.00 11.19 ? 135  GLN A N   1 
ATOM   283  C  CA  . GLN A 1 39  ? 26.920 21.833 5.339   1.00 9.68  ? 135  GLN A CA  1 
ATOM   284  C  C   . GLN A 1 39  ? 28.420 21.868 5.605   1.00 10.76 ? 135  GLN A C   1 
ATOM   285  O  O   . GLN A 1 39  ? 28.859 22.279 6.679   1.00 9.99  ? 135  GLN A O   1 
ATOM   286  C  CB  . GLN A 1 39  ? 26.391 20.419 5.581   1.00 12.98 ? 135  GLN A CB  1 
ATOM   287  C  CG  . GLN A 1 39  ? 24.923 20.247 5.243   1.00 15.40 ? 135  GLN A CG  1 
ATOM   288  C  CD  . GLN A 1 39  ? 24.058 21.355 5.807   1.00 19.13 ? 135  GLN A CD  1 
ATOM   289  O  OE1 . GLN A 1 39  ? 23.318 22.011 5.071   1.00 22.64 ? 135  GLN A OE1 1 
ATOM   290  N  NE2 . GLN A 1 39  ? 24.141 21.570 7.115   1.00 16.98 ? 135  GLN A NE2 1 
ATOM   291  N  N   . ILE A 1 40  ? 29.204 21.432 4.624   1.00 9.71  ? 136  ILE A N   1 
ATOM   292  C  CA  . ILE A 1 40  ? 30.655 21.449 4.761   1.00 10.04 ? 136  ILE A CA  1 
ATOM   293  C  C   . ILE A 1 40  ? 31.112 22.896 4.924   1.00 10.64 ? 136  ILE A C   1 
ATOM   294  O  O   . ILE A 1 40  ? 31.962 23.195 5.764   1.00 9.71  ? 136  ILE A O   1 
ATOM   295  C  CB  . ILE A 1 40  ? 31.345 20.817 3.528   1.00 9.93  ? 136  ILE A CB  1 
ATOM   296  C  CG1 . ILE A 1 40  ? 31.113 19.303 3.528   1.00 12.11 ? 136  ILE A CG1 1 
ATOM   297  C  CG2 . ILE A 1 40  ? 32.840 21.125 3.548   1.00 12.14 ? 136  ILE A CG2 1 
ATOM   298  C  CD1 . ILE A 1 40  ? 31.574 18.602 2.263   1.00 10.81 ? 136  ILE A CD1 1 
ATOM   299  N  N   . CYS A 1 41  ? 30.537 23.796 4.129   1.00 10.36 ? 137  CYS A N   1 
ATOM   300  C  CA  . CYS A 1 41  ? 30.896 25.209 4.210   1.00 10.00 ? 137  CYS A CA  1 
ATOM   301  C  C   . CYS A 1 41  ? 30.620 25.777 5.598   1.00 7.98  ? 137  CYS A C   1 
ATOM   302  O  O   . CYS A 1 41  ? 31.448 26.500 6.151   1.00 10.27 ? 137  CYS A O   1 
ATOM   303  C  CB  . CYS A 1 41  ? 30.135 26.025 3.164   1.00 8.86  ? 137  CYS A CB  1 
ATOM   304  S  SG  . CYS A 1 41  ? 30.711 25.760 1.458   1.00 13.33 ? 137  CYS A SG  1 
ATOM   305  N  N   . HIS A 1 42  ? 29.461 25.456 6.165   1.00 8.44  ? 138  HIS A N   1 
ATOM   306  C  CA  . HIS A 1 42  ? 29.131 25.960 7.493   1.00 7.87  ? 138  HIS A CA  1 
ATOM   307  C  C   . HIS A 1 42  ? 30.070 25.384 8.549   1.00 8.06  ? 138  HIS A C   1 
ATOM   308  O  O   . HIS A 1 42  ? 30.481 26.091 9.465   1.00 9.19  ? 138  HIS A O   1 
ATOM   309  C  CB  . HIS A 1 42  ? 27.675 25.634 7.864   1.00 9.77  ? 138  HIS A CB  1 
ATOM   310  C  CG  . HIS A 1 42  ? 26.672 26.585 7.280   1.00 9.79  ? 138  HIS A CG  1 
ATOM   311  N  ND1 . HIS A 1 42  ? 26.385 26.629 5.933   1.00 10.42 ? 138  HIS A ND1 1 
ATOM   312  C  CD2 . HIS A 1 42  ? 25.904 27.537 7.861   1.00 10.42 ? 138  HIS A CD2 1 
ATOM   313  C  CE1 . HIS A 1 42  ? 25.482 27.570 5.708   1.00 12.62 ? 138  HIS A CE1 1 
ATOM   314  N  NE2 . HIS A 1 42  ? 25.175 28.136 6.860   1.00 10.74 ? 138  HIS A NE2 1 
ATOM   315  N  N   . THR A 1 43  ? 30.412 24.107 8.422   1.00 7.84  ? 139  THR A N   1 
ATOM   316  C  CA  . THR A 1 43  ? 31.306 23.489 9.395   1.00 8.21  ? 139  THR A CA  1 
ATOM   317  C  C   . THR A 1 43  ? 32.684 24.151 9.336   1.00 8.27  ? 139  THR A C   1 
ATOM   318  O  O   . THR A 1 43  ? 33.249 24.504 10.365  1.00 8.65  ? 139  THR A O   1 
ATOM   319  C  CB  . THR A 1 43  ? 31.439 21.970 9.154   1.00 9.18  ? 139  THR A CB  1 
ATOM   320  O  OG1 . THR A 1 43  ? 30.147 21.358 9.273   1.00 11.07 ? 139  THR A OG1 1 
ATOM   321  C  CG2 . THR A 1 43  ? 32.372 21.344 10.186  1.00 9.48  ? 139  THR A CG2 1 
ATOM   322  N  N   . LEU A 1 44  ? 33.208 24.328 8.126   1.00 6.73  ? 140  LEU A N   1 
ATOM   323  C  CA  . LEU A 1 44  ? 34.516 24.952 7.936   1.00 7.10  ? 140  LEU A CA  1 
ATOM   324  C  C   . LEU A 1 44  ? 34.572 26.389 8.447   1.00 8.54  ? 140  LEU A C   1 
ATOM   325  O  O   . LEU A 1 44  ? 35.629 26.856 8.879   1.00 8.74  ? 140  LEU A O   1 
ATOM   326  C  CB  . LEU A 1 44  ? 34.900 24.938 6.454   1.00 6.22  ? 140  LEU A CB  1 
ATOM   327  C  CG  . LEU A 1 44  ? 35.191 23.585 5.806   1.00 7.89  ? 140  LEU A CG  1 
ATOM   328  C  CD1 . LEU A 1 44  ? 35.368 23.765 4.298   1.00 9.36  ? 140  LEU A CD1 1 
ATOM   329  C  CD2 . LEU A 1 44  ? 36.446 22.975 6.425   1.00 10.17 ? 140  LEU A CD2 1 
ATOM   330  N  N   . ALA A 1 45  ? 33.444 27.094 8.380   1.00 8.10  ? 141  ALA A N   1 
ATOM   331  C  CA  . ALA A 1 45  ? 33.397 28.479 8.840   1.00 7.81  ? 141  ALA A CA  1 
ATOM   332  C  C   . ALA A 1 45  ? 33.664 28.551 10.339  1.00 8.11  ? 141  ALA A C   1 
ATOM   333  O  O   . ALA A 1 45  ? 34.018 29.612 10.871  1.00 8.73  ? 141  ALA A O   1 
ATOM   334  C  CB  . ALA A 1 45  ? 32.044 29.098 8.513   1.00 7.95  ? 141  ALA A CB  1 
ATOM   335  N  N   . VAL A 1 46  ? 33.488 27.419 11.018  1.00 7.57  ? 142  VAL A N   1 
ATOM   336  C  CA  . VAL A 1 46  ? 33.746 27.349 12.450  1.00 8.68  ? 142  VAL A CA  1 
ATOM   337  C  C   . VAL A 1 46  ? 35.087 26.674 12.742  1.00 8.97  ? 142  VAL A C   1 
ATOM   338  O  O   . VAL A 1 46  ? 35.889 27.197 13.517  1.00 10.90 ? 142  VAL A O   1 
ATOM   339  C  CB  . VAL A 1 46  ? 32.628 26.579 13.187  1.00 8.53  ? 142  VAL A CB  1 
ATOM   340  C  CG1 . VAL A 1 46  ? 32.926 26.526 14.693  1.00 9.23  ? 142  VAL A CG1 1 
ATOM   341  C  CG2 . VAL A 1 46  ? 31.292 27.270 12.946  1.00 9.18  ? 142  VAL A CG2 1 
ATOM   342  N  N   . THR A 1 47  ? 35.345 25.525 12.121  1.00 9.37  ? 143  THR A N   1 
ATOM   343  C  CA  . THR A 1 47  ? 36.601 24.819 12.378  1.00 9.23  ? 143  THR A CA  1 
ATOM   344  C  C   . THR A 1 47  ? 37.839 25.591 11.945  1.00 9.03  ? 143  THR A C   1 
ATOM   345  O  O   . THR A 1 47  ? 38.929 25.348 12.456  1.00 10.11 ? 143  THR A O   1 
ATOM   346  C  CB  . THR A 1 47  ? 36.637 23.422 11.716  1.00 9.23  ? 143  THR A CB  1 
ATOM   347  O  OG1 . THR A 1 47  ? 36.497 23.550 10.295  1.00 9.23  ? 143  THR A OG1 1 
ATOM   348  C  CG2 . THR A 1 47  ? 35.521 22.546 12.274  1.00 9.22  ? 143  THR A CG2 1 
ATOM   349  N  N   . CYS A 1 48  ? 37.688 26.522 11.010  1.00 8.10  ? 144  CYS A N   1 
ATOM   350  C  CA  . CYS A 1 48  ? 38.848 27.294 10.580  1.00 9.39  ? 144  CYS A CA  1 
ATOM   351  C  C   . CYS A 1 48  ? 39.315 28.200 11.719  1.00 9.07  ? 144  CYS A C   1 
ATOM   352  O  O   . CYS A 1 48  ? 40.447 28.680 11.712  1.00 10.50 ? 144  CYS A O   1 
ATOM   353  C  CB  . CYS A 1 48  ? 38.514 28.139 9.345   1.00 9.38  ? 144  CYS A CB  1 
ATOM   354  S  SG  . CYS A 1 48  ? 37.374 29.498 9.667   1.00 12.00 ? 144  CYS A SG  1 
ATOM   355  N  N   . GLN A 1 49  ? 38.447 28.403 12.709  1.00 8.72  ? 145  GLN A N   1 
ATOM   356  C  CA  . GLN A 1 49  ? 38.755 29.256 13.858  1.00 10.01 ? 145  GLN A CA  1 
ATOM   357  C  C   . GLN A 1 49  ? 39.477 28.521 14.985  1.00 10.04 ? 145  GLN A C   1 
ATOM   358  O  O   . GLN A 1 49  ? 39.982 29.143 15.926  1.00 11.00 ? 145  GLN A O   1 
ATOM   359  C  CB  . GLN A 1 49  ? 37.465 29.865 14.403  1.00 10.49 ? 145  GLN A CB  1 
ATOM   360  C  CG  . GLN A 1 49  ? 36.725 30.720 13.387  1.00 11.33 ? 145  GLN A CG  1 
ATOM   361  C  CD  . GLN A 1 49  ? 35.499 31.375 13.976  1.00 13.67 ? 145  GLN A CD  1 
ATOM   362  O  OE1 . GLN A 1 49  ? 35.543 31.907 15.086  1.00 14.78 ? 145  GLN A OE1 1 
ATOM   363  N  NE2 . GLN A 1 49  ? 34.398 31.355 13.234  1.00 10.01 ? 145  GLN A NE2 1 
ATOM   364  N  N   . LEU A 1 50  ? 39.524 27.198 14.886  1.00 9.00  ? 146  LEU A N   1 
ATOM   365  C  CA  . LEU A 1 50  ? 40.179 26.373 15.898  1.00 10.62 ? 146  LEU A CA  1 
ATOM   366  C  C   . LEU A 1 50  ? 41.692 26.528 15.932  1.00 11.26 ? 146  LEU A C   1 
ATOM   367  O  O   . LEU A 1 50  ? 42.309 26.979 14.968  1.00 11.50 ? 146  LEU A O   1 
ATOM   368  C  CB  . LEU A 1 50  ? 39.875 24.893 15.653  1.00 10.21 ? 146  LEU A CB  1 
ATOM   369  C  CG  . LEU A 1 50  ? 38.469 24.337 15.874  1.00 11.36 ? 146  LEU A CG  1 
ATOM   370  C  CD1 . LEU A 1 50  ? 38.393 22.952 15.256  1.00 11.83 ? 146  LEU A CD1 1 
ATOM   371  C  CD2 . LEU A 1 50  ? 38.151 24.280 17.365  1.00 15.14 ? 146  LEU A CD2 1 
ATOM   372  N  N   . PRO A 1 51  ? 42.309 26.178 17.070  1.00 12.58 ? 147  PRO A N   1 
ATOM   373  C  CA  . PRO A 1 51  ? 43.764 26.265 17.202  1.00 11.87 ? 147  PRO A CA  1 
ATOM   374  C  C   . PRO A 1 51  ? 44.320 25.316 16.139  1.00 11.90 ? 147  PRO A C   1 
ATOM   375  O  O   . PRO A 1 51  ? 43.670 24.321 15.796  1.00 12.36 ? 147  PRO A O   1 
ATOM   376  C  CB  . PRO A 1 51  ? 44.010 25.732 18.608  1.00 13.51 ? 147  PRO A CB  1 
ATOM   377  C  CG  . PRO A 1 51  ? 42.792 26.180 19.349  1.00 13.16 ? 147  PRO A CG  1 
ATOM   378  C  CD  . PRO A 1 51  ? 41.680 25.866 18.367  1.00 12.30 ? 147  PRO A CD  1 
ATOM   379  N  N   . ILE A 1 52  ? 45.505 25.602 15.620  1.00 12.68 ? 148  ILE A N   1 
ATOM   380  C  CA  . ILE A 1 52  ? 46.072 24.736 14.596  1.00 13.79 ? 148  ILE A CA  1 
ATOM   381  C  C   . ILE A 1 52  ? 46.212 23.285 15.060  1.00 12.90 ? 148  ILE A C   1 
ATOM   382  O  O   . ILE A 1 52  ? 45.996 22.361 14.277  1.00 12.36 ? 148  ILE A O   1 
ATOM   383  C  CB  . ILE A 1 52  ? 47.433 25.279 14.105  1.00 15.52 ? 148  ILE A CB  1 
ATOM   384  C  CG1 . ILE A 1 52  ? 47.216 26.625 13.397  1.00 19.02 ? 148  ILE A CG1 1 
ATOM   385  C  CG2 . ILE A 1 52  ? 48.074 24.290 13.141  1.00 16.43 ? 148  ILE A CG2 1 
ATOM   386  C  CD1 . ILE A 1 52  ? 48.492 27.326 12.980  1.00 23.77 ? 148  ILE A CD1 1 
ATOM   387  N  N   . ASP A 1 53  ? 46.538 23.074 16.335  1.00 13.06 ? 149  ASP A N   1 
ATOM   388  C  CA  . ASP A 1 53  ? 46.687 21.708 16.833  1.00 13.17 ? 149  ASP A CA  1 
ATOM   389  C  C   . ASP A 1 53  ? 45.368 20.926 16.894  1.00 14.26 ? 149  ASP A C   1 
ATOM   390  O  O   . ASP A 1 53  ? 45.374 19.700 17.034  1.00 14.29 ? 149  ASP A O   1 
ATOM   391  C  CB  . ASP A 1 53  ? 47.367 21.698 18.213  1.00 14.99 ? 149  ASP A CB  1 
ATOM   392  C  CG  . ASP A 1 53  ? 46.454 22.178 19.326  1.00 15.68 ? 149  ASP A CG  1 
ATOM   393  O  OD1 . ASP A 1 53  ? 46.334 23.404 19.522  1.00 15.33 ? 149  ASP A OD1 1 
ATOM   394  O  OD2 . ASP A 1 53  ? 45.856 21.318 20.005  1.00 18.19 ? 149  ASP A OD2 1 
ATOM   395  N  N   . ARG A 1 54  ? 44.237 21.624 16.789  1.00 11.56 ? 150  ARG A N   1 
ATOM   396  C  CA  . ARG A 1 54  ? 42.940 20.954 16.810  1.00 12.66 ? 150  ARG A CA  1 
ATOM   397  C  C   . ARG A 1 54  ? 42.391 20.819 15.390  1.00 13.09 ? 150  ARG A C   1 
ATOM   398  O  O   . ARG A 1 54  ? 41.246 20.404 15.195  1.00 13.09 ? 150  ARG A O   1 
ATOM   399  C  CB  . ARG A 1 54  ? 41.936 21.724 17.676  1.00 13.00 ? 150  ARG A CB  1 
ATOM   400  C  CG  . ARG A 1 54  ? 42.306 21.817 19.157  1.00 13.36 ? 150  ARG A CG  1 
ATOM   401  C  CD  . ARG A 1 54  ? 41.143 22.378 19.964  1.00 12.59 ? 150  ARG A CD  1 
ATOM   402  N  NE  . ARG A 1 54  ? 40.019 21.444 19.975  1.00 12.66 ? 150  ARG A NE  1 
ATOM   403  C  CZ  . ARG A 1 54  ? 38.785 21.745 20.369  1.00 13.24 ? 150  ARG A CZ  1 
ATOM   404  N  NH1 . ARG A 1 54  ? 38.494 22.967 20.791  1.00 13.27 ? 150  ARG A NH1 1 
ATOM   405  N  NH2 . ARG A 1 54  ? 37.838 20.815 20.338  1.00 13.59 ? 150  ARG A NH2 1 
ATOM   406  N  N   . GLY A 1 55  ? 43.212 21.183 14.407  1.00 12.45 ? 151  GLY A N   1 
ATOM   407  C  CA  . GLY A 1 55  ? 42.797 21.082 13.017  1.00 12.19 ? 151  GLY A CA  1 
ATOM   408  C  C   . GLY A 1 55  ? 42.254 22.366 12.423  1.00 11.65 ? 151  GLY A C   1 
ATOM   409  O  O   . GLY A 1 55  ? 41.647 22.354 11.353  1.00 12.49 ? 151  GLY A O   1 
ATOM   410  N  N   . GLY A 1 56  ? 42.472 23.484 13.106  1.00 11.30 ? 152  GLY A N   1 
ATOM   411  C  CA  . GLY A 1 56  ? 41.969 24.747 12.599  1.00 10.67 ? 152  GLY A CA  1 
ATOM   412  C  C   . GLY A 1 56  ? 43.004 25.589 11.885  1.00 11.78 ? 152  GLY A C   1 
ATOM   413  O  O   . GLY A 1 56  ? 44.135 25.155 11.659  1.00 10.04 ? 152  GLY A O   1 
ATOM   414  N  N   . GLY A 1 57  ? 42.603 26.805 11.522  1.00 11.68 ? 153  GLY A N   1 
ATOM   415  C  CA  . GLY A 1 57  ? 43.504 27.713 10.842  1.00 12.29 ? 153  GLY A CA  1 
ATOM   416  C  C   . GLY A 1 57  ? 43.735 28.967 11.661  1.00 11.95 ? 153  GLY A C   1 
ATOM   417  O  O   . GLY A 1 57  ? 44.413 29.892 11.210  1.00 14.26 ? 153  GLY A O   1 
ATOM   418  N  N   . GLU A 1 58  ? 43.178 28.991 12.870  1.00 13.09 ? 154  GLU A N   1 
ATOM   419  C  CA  . GLU A 1 58  ? 43.310 30.138 13.765  1.00 13.65 ? 154  GLU A CA  1 
ATOM   420  C  C   . GLU A 1 58  ? 43.000 31.447 13.045  1.00 13.66 ? 154  GLU A C   1 
ATOM   421  O  O   . GLU A 1 58  ? 43.714 32.439 13.193  1.00 15.59 ? 154  GLU A O   1 
ATOM   422  C  CB  . GLU A 1 58  ? 44.722 30.185 14.359  1.00 15.09 ? 154  GLU A CB  1 
ATOM   423  C  CG  . GLU A 1 58  ? 44.924 29.184 15.479  1.00 17.51 ? 154  GLU A CG  1 
ATOM   424  C  CD  . GLU A 1 58  ? 46.372 29.050 15.907  1.00 21.30 ? 154  GLU A CD  1 
ATOM   425  O  OE1 . GLU A 1 58  ? 47.095 30.070 15.921  1.00 21.05 ? 154  GLU A OE1 1 
ATOM   426  O  OE2 . GLU A 1 58  ? 46.779 27.920 16.244  1.00 21.68 ? 154  GLU A OE2 1 
ATOM   427  N  N   . GLY A 1 59  ? 41.921 31.444 12.271  1.00 12.01 ? 155  GLY A N   1 
ATOM   428  C  CA  . GLY A 1 59  ? 41.549 32.638 11.540  1.00 11.09 ? 155  GLY A CA  1 
ATOM   429  C  C   . GLY A 1 59  ? 40.055 32.792 11.354  1.00 11.53 ? 155  GLY A C   1 
ATOM   430  O  O   . GLY A 1 59  ? 39.278 31.872 11.616  1.00 10.72 ? 155  GLY A O   1 
ATOM   431  N  N   . LYS A 1 60  ? 39.654 33.976 10.903  1.00 11.50 ? 156  LYS A N   1 
ATOM   432  C  CA  . LYS A 1 60  ? 38.252 34.277 10.655  1.00 11.09 ? 156  LYS A CA  1 
ATOM   433  C  C   . LYS A 1 60  ? 37.789 33.643 9.352   1.00 10.36 ? 156  LYS A C   1 
ATOM   434  O  O   . LYS A 1 60  ? 38.599 33.213 8.529   1.00 9.77  ? 156  LYS A O   1 
ATOM   435  C  CB  . LYS A 1 60  ? 38.048 35.789 10.561  1.00 11.40 ? 156  LYS A CB  1 
ATOM   436  C  CG  . LYS A 1 60  ? 38.265 36.533 11.863  1.00 14.73 ? 156  LYS A CG  1 
ATOM   437  C  CD  . LYS A 1 60  ? 38.168 38.031 11.616  1.00 18.50 ? 156  LYS A CD  1 
ATOM   438  C  CE  . LYS A 1 60  ? 38.158 38.814 12.916  1.00 21.90 ? 156  LYS A CE  1 
ATOM   439  N  NZ  . LYS A 1 60  ? 38.016 40.271 12.640  1.00 26.01 ? 156  LYS A NZ  1 
ATOM   440  N  N   . ALA A 1 61  ? 36.477 33.593 9.168   1.00 9.56  ? 157  ALA A N   1 
ATOM   441  C  CA  . ALA A 1 61  ? 35.919 33.037 7.949   1.00 8.82  ? 157  ALA A CA  1 
ATOM   442  C  C   . ALA A 1 61  ? 35.093 34.085 7.234   1.00 10.33 ? 157  ALA A C   1 
ATOM   443  O  O   . ALA A 1 61  ? 34.468 34.942 7.860   1.00 10.06 ? 157  ALA A O   1 
ATOM   444  C  CB  . ALA A 1 61  ? 35.042 31.831 8.262   1.00 9.17  ? 157  ALA A CB  1 
HETATM 445  N  N   A MSE A 1 62  ? 35.099 34.006 5.912   0.54 9.17  ? 158  MSE A N   1 
HETATM 446  N  N   B MSE A 1 62  ? 35.110 34.014 5.907   0.44 10.21 ? 158  MSE A N   1 
HETATM 447  C  CA  A MSE A 1 62  ? 34.321 34.913 5.097   0.54 10.42 ? 158  MSE A CA  1 
HETATM 448  C  CA  B MSE A 1 62  ? 34.354 34.920 5.054   0.44 11.98 ? 158  MSE A CA  1 
HETATM 449  C  C   A MSE A 1 62  ? 33.391 34.013 4.298   0.54 10.25 ? 158  MSE A C   1 
HETATM 450  C  C   B MSE A 1 62  ? 33.395 34.019 4.277   0.44 11.27 ? 158  MSE A C   1 
HETATM 451  O  O   A MSE A 1 62  ? 33.830 33.034 3.694   0.54 10.22 ? 158  MSE A O   1 
HETATM 452  O  O   B MSE A 1 62  ? 33.821 33.037 3.669   0.44 11.23 ? 158  MSE A O   1 
HETATM 453  C  CB  A MSE A 1 62  ? 35.231 35.701 4.174   0.54 11.72 ? 158  MSE A CB  1 
HETATM 454  C  CB  B MSE A 1 62  ? 35.299 35.639 4.091   0.44 15.25 ? 158  MSE A CB  1 
HETATM 455  C  CG  A MSE A 1 62  ? 34.551 36.879 3.548   0.54 13.13 ? 158  MSE A CG  1 
HETATM 456  C  CG  B MSE A 1 62  ? 34.663 36.759 3.292   0.44 19.01 ? 158  MSE A CG  1 
HETATM 457  SE SE  A MSE A 1 62  ? 35.839 37.882 2.572   0.54 15.92 ? 158  MSE A SE  1 
HETATM 458  SE SE  B MSE A 1 62  ? 35.246 38.493 3.909   0.44 26.38 ? 158  MSE A SE  1 
HETATM 459  C  CE  A MSE A 1 62  ? 37.003 38.379 4.022   0.54 11.46 ? 158  MSE A CE  1 
HETATM 460  C  CE  B MSE A 1 62  ? 37.144 38.257 3.682   0.44 20.56 ? 158  MSE A CE  1 
ATOM   461  N  N   . TYR A 1 63  ? 32.106 34.343 4.304   1.00 10.25 ? 159  TYR A N   1 
ATOM   462  C  CA  . TYR A 1 63  ? 31.111 33.534 3.616   1.00 10.01 ? 159  TYR A CA  1 
ATOM   463  C  C   . TYR A 1 63  ? 30.267 34.333 2.630   1.00 10.25 ? 159  TYR A C   1 
ATOM   464  O  O   . TYR A 1 63  ? 29.432 35.139 3.038   1.00 10.49 ? 159  TYR A O   1 
ATOM   465  C  CB  . TYR A 1 63  ? 30.201 32.892 4.676   1.00 9.57  ? 159  TYR A CB  1 
ATOM   466  C  CG  . TYR A 1 63  ? 29.410 31.677 4.242   1.00 10.37 ? 159  TYR A CG  1 
ATOM   467  C  CD1 . TYR A 1 63  ? 28.533 31.730 3.158   1.00 11.98 ? 159  TYR A CD1 1 
ATOM   468  C  CD2 . TYR A 1 63  ? 29.520 30.474 4.943   1.00 11.85 ? 159  TYR A CD2 1 
ATOM   469  C  CE1 . TYR A 1 63  ? 27.786 30.609 2.783   1.00 13.38 ? 159  TYR A CE1 1 
ATOM   470  C  CE2 . TYR A 1 63  ? 28.777 29.350 4.576   1.00 11.39 ? 159  TYR A CE2 1 
ATOM   471  C  CZ  . TYR A 1 63  ? 27.914 29.425 3.498   1.00 13.64 ? 159  TYR A CZ  1 
ATOM   472  O  OH  . TYR A 1 63  ? 27.187 28.315 3.136   1.00 14.59 ? 159  TYR A OH  1 
ATOM   473  N  N   . ILE A 1 64  ? 30.490 34.115 1.336   1.00 9.28  ? 160  ILE A N   1 
ATOM   474  C  CA  . ILE A 1 64  ? 29.705 34.792 0.314   1.00 9.69  ? 160  ILE A CA  1 
ATOM   475  C  C   . ILE A 1 64  ? 28.645 33.794 -0.135  1.00 10.60 ? 160  ILE A C   1 
ATOM   476  O  O   . ILE A 1 64  ? 28.960 32.751 -0.708  1.00 10.08 ? 160  ILE A O   1 
ATOM   477  C  CB  . ILE A 1 64  ? 30.568 35.214 -0.896  1.00 9.03  ? 160  ILE A CB  1 
ATOM   478  C  CG1 . ILE A 1 64  ? 31.592 36.265 -0.458  1.00 10.09 ? 160  ILE A CG1 1 
ATOM   479  C  CG2 . ILE A 1 64  ? 29.678 35.780 -1.999  1.00 13.08 ? 160  ILE A CG2 1 
ATOM   480  C  CD1 . ILE A 1 64  ? 32.556 36.699 -1.554  1.00 8.81  ? 160  ILE A CD1 1 
ATOM   481  N  N   . ASP A 1 65  ? 27.390 34.117 0.155   1.00 11.32 ? 161  ASP A N   1 
ATOM   482  C  CA  . ASP A 1 65  ? 26.263 33.260 -0.192  1.00 12.57 ? 161  ASP A CA  1 
ATOM   483  C  C   . ASP A 1 65  ? 25.520 33.815 -1.399  1.00 13.45 ? 161  ASP A C   1 
ATOM   484  O  O   . ASP A 1 65  ? 25.437 35.027 -1.577  1.00 15.58 ? 161  ASP A O   1 
ATOM   485  C  CB  . ASP A 1 65  ? 25.293 33.175 0.994   1.00 13.81 ? 161  ASP A CB  1 
ATOM   486  C  CG  . ASP A 1 65  ? 23.963 32.540 0.619   1.00 16.41 ? 161  ASP A CG  1 
ATOM   487  O  OD1 . ASP A 1 65  ? 23.936 31.323 0.345   1.00 17.20 ? 161  ASP A OD1 1 
ATOM   488  O  OD2 . ASP A 1 65  ? 22.945 33.267 0.589   1.00 19.96 ? 161  ASP A OD2 1 
ATOM   489  N  N   . THR A 1 66  ? 24.984 32.925 -2.226  1.00 15.93 ? 162  THR A N   1 
ATOM   490  C  CA  . THR A 1 66  ? 24.221 33.347 -3.396  1.00 16.70 ? 162  THR A CA  1 
ATOM   491  C  C   . THR A 1 66  ? 22.898 32.594 -3.409  1.00 18.68 ? 162  THR A C   1 
ATOM   492  O  O   . THR A 1 66  ? 22.012 32.894 -4.212  1.00 19.52 ? 162  THR A O   1 
ATOM   493  C  CB  . THR A 1 66  ? 24.949 33.011 -4.718  1.00 16.70 ? 162  THR A CB  1 
ATOM   494  O  OG1 . THR A 1 66  ? 24.979 31.588 -4.897  1.00 17.06 ? 162  THR A OG1 1 
ATOM   495  C  CG2 . THR A 1 66  ? 26.371 33.555 -4.708  1.00 16.05 ? 162  THR A CG2 1 
ATOM   496  N  N   . GLU A 1 67  ? 22.771 31.629 -2.501  1.00 18.38 ? 163  GLU A N   1 
ATOM   497  C  CA  . GLU A 1 67  ? 21.589 30.772 -2.425  1.00 20.29 ? 163  GLU A CA  1 
ATOM   498  C  C   . GLU A 1 67  ? 20.573 31.078 -1.332  1.00 20.03 ? 163  GLU A C   1 
ATOM   499  O  O   . GLU A 1 67  ? 19.466 30.539 -1.354  1.00 21.59 ? 163  GLU A O   1 
ATOM   500  C  CB  . GLU A 1 67  ? 22.031 29.318 -2.260  1.00 20.64 ? 163  GLU A CB  1 
ATOM   501  C  CG  . GLU A 1 67  ? 23.048 28.837 -3.278  1.00 25.07 ? 163  GLU A CG  1 
ATOM   502  C  CD  . GLU A 1 67  ? 22.527 28.909 -4.696  1.00 27.45 ? 163  GLU A CD  1 
ATOM   503  O  OE1 . GLU A 1 67  ? 22.624 29.991 -5.315  1.00 26.80 ? 163  GLU A OE1 1 
ATOM   504  O  OE2 . GLU A 1 67  ? 22.009 27.883 -5.184  1.00 28.60 ? 163  GLU A OE2 1 
ATOM   505  N  N   . GLY A 1 68  ? 20.948 31.915 -0.372  1.00 19.41 ? 164  GLY A N   1 
ATOM   506  C  CA  . GLY A 1 68  ? 20.043 32.234 0.718   1.00 19.90 ? 164  GLY A CA  1 
ATOM   507  C  C   . GLY A 1 68  ? 19.981 31.097 1.723   1.00 19.77 ? 164  GLY A C   1 
ATOM   508  O  O   . GLY A 1 68  ? 18.979 30.919 2.419   1.00 19.85 ? 164  GLY A O   1 
ATOM   509  N  N   . THR A 1 69  ? 21.059 30.323 1.807   1.00 15.75 ? 165  THR A N   1 
ATOM   510  C  CA  . THR A 1 69  ? 21.106 29.193 2.729   1.00 16.97 ? 165  THR A CA  1 
ATOM   511  C  C   . THR A 1 69  ? 22.117 29.344 3.864   1.00 16.78 ? 165  THR A C   1 
ATOM   512  O  O   . THR A 1 69  ? 22.512 28.359 4.492   1.00 16.85 ? 165  THR A O   1 
ATOM   513  C  CB  . THR A 1 69  ? 21.388 27.879 1.973   1.00 16.58 ? 165  THR A CB  1 
ATOM   514  O  OG1 . THR A 1 69  ? 22.474 28.074 1.057   1.00 16.41 ? 165  THR A OG1 1 
ATOM   515  C  CG2 . THR A 1 69  ? 20.149 27.435 1.205   1.00 19.06 ? 165  THR A CG2 1 
ATOM   516  N  N   . PHE A 1 70  ? 22.543 30.574 4.125   1.00 15.79 ? 166  PHE A N   1 
ATOM   517  C  CA  . PHE A 1 70  ? 23.477 30.820 5.217   1.00 14.36 ? 166  PHE A CA  1 
ATOM   518  C  C   . PHE A 1 70  ? 22.650 30.805 6.498   1.00 16.02 ? 166  PHE A C   1 
ATOM   519  O  O   . PHE A 1 70  ? 21.637 31.502 6.592   1.00 15.82 ? 166  PHE A O   1 
ATOM   520  C  CB  . PHE A 1 70  ? 24.153 32.181 5.058   1.00 13.90 ? 166  PHE A CB  1 
ATOM   521  C  CG  . PHE A 1 70  ? 25.137 32.498 6.154   1.00 13.95 ? 166  PHE A CG  1 
ATOM   522  C  CD1 . PHE A 1 70  ? 26.357 31.829 6.230   1.00 13.42 ? 166  PHE A CD1 1 
ATOM   523  C  CD2 . PHE A 1 70  ? 24.840 33.462 7.115   1.00 13.77 ? 166  PHE A CD2 1 
ATOM   524  C  CE1 . PHE A 1 70  ? 27.270 32.119 7.248   1.00 13.37 ? 166  PHE A CE1 1 
ATOM   525  C  CE2 . PHE A 1 70  ? 25.744 33.759 8.135   1.00 13.84 ? 166  PHE A CE2 1 
ATOM   526  C  CZ  . PHE A 1 70  ? 26.963 33.086 8.202   1.00 14.21 ? 166  PHE A CZ  1 
ATOM   527  N  N   . ARG A 1 71  ? 23.073 30.018 7.482   1.00 14.61 ? 167  ARG A N   1 
ATOM   528  C  CA  . ARG A 1 71  ? 22.333 29.919 8.738   1.00 15.67 ? 167  ARG A CA  1 
ATOM   529  C  C   . ARG A 1 71  ? 23.206 30.046 9.984   1.00 14.69 ? 167  ARG A C   1 
ATOM   530  O  O   . ARG A 1 71  ? 23.897 29.099 10.375  1.00 13.43 ? 167  ARG A O   1 
ATOM   531  C  CB  . ARG A 1 71  ? 21.574 28.590 8.785   1.00 17.46 ? 167  ARG A CB  1 
ATOM   532  C  CG  . ARG A 1 71  ? 20.523 28.425 7.695   1.00 21.67 ? 167  ARG A CG  1 
ATOM   533  C  CD  . ARG A 1 71  ? 19.307 29.307 7.944   1.00 26.33 ? 167  ARG A CD  1 
ATOM   534  N  NE  . ARG A 1 71  ? 18.267 29.086 6.940   1.00 30.64 ? 167  ARG A NE  1 
ATOM   535  C  CZ  . ARG A 1 71  ? 18.256 29.639 5.731   1.00 32.90 ? 167  ARG A CZ  1 
ATOM   536  N  NH1 . ARG A 1 71  ? 19.229 30.462 5.362   1.00 32.52 ? 167  ARG A NH1 1 
ATOM   537  N  NH2 . ARG A 1 71  ? 17.272 29.362 4.884   1.00 34.53 ? 167  ARG A NH2 1 
ATOM   538  N  N   . PRO A 1 72  ? 23.186 31.223 10.627  1.00 14.89 ? 168  PRO A N   1 
ATOM   539  C  CA  . PRO A 1 72  ? 23.984 31.445 11.836  1.00 15.39 ? 168  PRO A CA  1 
ATOM   540  C  C   . PRO A 1 72  ? 23.738 30.391 12.919  1.00 16.84 ? 168  PRO A C   1 
ATOM   541  O  O   . PRO A 1 72  ? 24.656 30.028 13.654  1.00 16.46 ? 168  PRO A O   1 
ATOM   542  C  CB  . PRO A 1 72  ? 23.561 32.846 12.273  1.00 14.97 ? 168  PRO A CB  1 
ATOM   543  C  CG  . PRO A 1 72  ? 23.315 33.530 10.956  1.00 15.63 ? 168  PRO A CG  1 
ATOM   544  C  CD  . PRO A 1 72  ? 22.557 32.476 10.172  1.00 14.33 ? 168  PRO A CD  1 
ATOM   545  N  N   . GLU A 1 73  ? 22.508 29.887 13.015  1.00 17.31 ? 169  GLU A N   1 
ATOM   546  C  CA  . GLU A 1 73  ? 22.208 28.886 14.036  1.00 18.18 ? 169  GLU A CA  1 
ATOM   547  C  C   . GLU A 1 73  ? 23.029 27.614 13.861  1.00 16.74 ? 169  GLU A C   1 
ATOM   548  O  O   . GLU A 1 73  ? 23.365 26.949 14.844  1.00 15.48 ? 169  GLU A O   1 
ATOM   549  C  CB  . GLU A 1 73  ? 20.714 28.538 14.055  1.00 21.53 ? 169  GLU A CB  1 
ATOM   550  C  CG  . GLU A 1 73  ? 20.140 28.117 12.717  1.00 26.55 ? 169  GLU A CG  1 
ATOM   551  C  CD  . GLU A 1 73  ? 19.394 29.242 12.019  1.00 30.20 ? 169  GLU A CD  1 
ATOM   552  O  OE1 . GLU A 1 73  ? 19.999 30.309 11.762  1.00 27.11 ? 169  GLU A OE1 1 
ATOM   553  O  OE2 . GLU A 1 73  ? 18.194 29.050 11.728  1.00 32.63 ? 169  GLU A OE2 1 
ATOM   554  N  N   . ARG A 1 74  ? 23.349 27.268 12.615  1.00 14.29 ? 170  ARG A N   1 
ATOM   555  C  CA  . ARG A 1 74  ? 24.149 26.077 12.363  1.00 13.93 ? 170  ARG A CA  1 
ATOM   556  C  C   . ARG A 1 74  ? 25.557 26.301 12.899  1.00 13.95 ? 170  ARG A C   1 
ATOM   557  O  O   . ARG A 1 74  ? 26.167 25.387 13.455  1.00 12.96 ? 170  ARG A O   1 
ATOM   558  C  CB  . ARG A 1 74  ? 24.206 25.757 10.867  1.00 15.66 ? 170  ARG A CB  1 
ATOM   559  C  CG  . ARG A 1 74  ? 25.057 24.536 10.535  1.00 20.09 ? 170  ARG A CG  1 
ATOM   560  C  CD  . ARG A 1 74  ? 24.452 23.251 11.095  1.00 23.76 ? 170  ARG A CD  1 
ATOM   561  N  NE  . ARG A 1 74  ? 23.147 22.970 10.502  1.00 28.96 ? 170  ARG A NE  1 
ATOM   562  C  CZ  . ARG A 1 74  ? 22.019 22.859 11.197  1.00 31.03 ? 170  ARG A CZ  1 
ATOM   563  N  NH1 . ARG A 1 74  ? 22.031 23.000 12.514  1.00 33.04 ? 170  ARG A NH1 1 
ATOM   564  N  NH2 . ARG A 1 74  ? 20.875 22.616 10.573  1.00 35.19 ? 170  ARG A NH2 1 
ATOM   565  N  N   . LEU A 1 75  ? 26.070 27.518 12.736  1.00 12.17 ? 171  LEU A N   1 
ATOM   566  C  CA  . LEU A 1 75  ? 27.407 27.839 13.233  1.00 11.76 ? 171  LEU A CA  1 
ATOM   567  C  C   . LEU A 1 75  ? 27.447 27.687 14.755  1.00 11.70 ? 171  LEU A C   1 
ATOM   568  O  O   . LEU A 1 75  ? 28.425 27.190 15.311  1.00 11.76 ? 171  LEU A O   1 
ATOM   569  C  CB  . LEU A 1 75  ? 27.796 29.269 12.854  1.00 12.30 ? 171  LEU A CB  1 
ATOM   570  C  CG  . LEU A 1 75  ? 27.693 29.625 11.371  1.00 11.31 ? 171  LEU A CG  1 
ATOM   571  C  CD1 . LEU A 1 75  ? 28.133 31.070 11.170  1.00 12.66 ? 171  LEU A CD1 1 
ATOM   572  C  CD2 . LEU A 1 75  ? 28.552 28.677 10.546  1.00 12.20 ? 171  LEU A CD2 1 
ATOM   573  N  N   . LEU A 1 76  ? 26.382 28.114 15.427  1.00 11.75 ? 172  LEU A N   1 
ATOM   574  C  CA  . LEU A 1 76  ? 26.321 28.001 16.880  1.00 12.10 ? 172  LEU A CA  1 
ATOM   575  C  C   . LEU A 1 76  ? 26.379 26.546 17.324  1.00 12.23 ? 172  LEU A C   1 
ATOM   576  O  O   . LEU A 1 76  ? 27.018 26.227 18.326  1.00 12.62 ? 172  LEU A O   1 
ATOM   577  C  CB  . LEU A 1 76  ? 25.049 28.656 17.424  1.00 12.80 ? 172  LEU A CB  1 
ATOM   578  C  CG  . LEU A 1 76  ? 24.981 30.178 17.302  1.00 14.86 ? 172  LEU A CG  1 
ATOM   579  C  CD1 . LEU A 1 76  ? 23.659 30.671 17.874  1.00 16.13 ? 172  LEU A CD1 1 
ATOM   580  C  CD2 . LEU A 1 76  ? 26.153 30.811 18.043  1.00 15.33 ? 172  LEU A CD2 1 
ATOM   581  N  N   . ALA A 1 77  ? 25.712 25.665 16.580  1.00 12.72 ? 173  ALA A N   1 
ATOM   582  C  CA  . ALA A 1 77  ? 25.713 24.245 16.919  1.00 13.14 ? 173  ALA A CA  1 
ATOM   583  C  C   . ALA A 1 77  ? 27.112 23.665 16.747  1.00 12.63 ? 173  ALA A C   1 
ATOM   584  O  O   . ALA A 1 77  ? 27.578 22.894 17.581  1.00 11.33 ? 173  ALA A O   1 
ATOM   585  C  CB  . ALA A 1 77  ? 24.720 23.486 16.041  1.00 11.87 ? 173  ALA A CB  1 
ATOM   586  N  N   . VAL A 1 78  ? 27.787 24.034 15.662  1.00 10.42 ? 174  VAL A N   1 
ATOM   587  C  CA  . VAL A 1 78  ? 29.133 23.534 15.428  1.00 9.27  ? 174  VAL A CA  1 
ATOM   588  C  C   . VAL A 1 78  ? 30.075 24.073 16.499  1.00 10.17 ? 174  VAL A C   1 
ATOM   589  O  O   . VAL A 1 78  ? 30.953 23.358 16.977  1.00 10.23 ? 174  VAL A O   1 
ATOM   590  C  CB  . VAL A 1 78  ? 29.662 23.953 14.041  1.00 9.04  ? 174  VAL A CB  1 
ATOM   591  C  CG1 . VAL A 1 78  ? 31.093 23.458 13.861  1.00 8.42  ? 174  VAL A CG1 1 
ATOM   592  C  CG2 . VAL A 1 78  ? 28.763 23.386 12.955  1.00 9.09  ? 174  VAL A CG2 1 
ATOM   593  N  N   . ALA A 1 79  ? 29.886 25.335 16.877  1.00 9.90  ? 175  ALA A N   1 
ATOM   594  C  CA  . ALA A 1 79  ? 30.725 25.951 17.897  1.00 10.67 ? 175  ALA A CA  1 
ATOM   595  C  C   . ALA A 1 79  ? 30.611 25.182 19.208  1.00 11.92 ? 175  ALA A C   1 
ATOM   596  O  O   . ALA A 1 79  ? 31.616 24.883 19.847  1.00 11.33 ? 175  ALA A O   1 
ATOM   597  C  CB  . ALA A 1 79  ? 30.316 27.407 18.108  1.00 11.94 ? 175  ALA A CB  1 
ATOM   598  N  N   . GLU A 1 80  ? 29.383 24.854 19.600  1.00 13.20 ? 176  GLU A N   1 
ATOM   599  C  CA  . GLU A 1 80  ? 29.163 24.119 20.845  1.00 13.21 ? 176  GLU A CA  1 
ATOM   600  C  C   . GLU A 1 80  ? 29.854 22.762 20.793  1.00 12.78 ? 176  GLU A C   1 
ATOM   601  O  O   . GLU A 1 80  ? 30.477 22.325 21.762  1.00 13.68 ? 176  GLU A O   1 
ATOM   602  C  CB  . GLU A 1 80  ? 27.664 23.932 21.099  1.00 15.61 ? 176  GLU A CB  1 
ATOM   603  C  CG  . GLU A 1 80  ? 27.349 23.074 22.326  1.00 19.61 ? 176  GLU A CG  1 
ATOM   604  C  CD  . GLU A 1 80  ? 25.879 23.099 22.705  1.00 23.95 ? 176  GLU A CD  1 
ATOM   605  O  OE1 . GLU A 1 80  ? 25.027 23.172 21.795  1.00 25.62 ? 176  GLU A OE1 1 
ATOM   606  O  OE2 . GLU A 1 80  ? 25.573 23.030 23.916  1.00 27.39 ? 176  GLU A OE2 1 
ATOM   607  N  N   . ARG A 1 81  ? 29.740 22.099 19.650  1.00 11.89 ? 177  ARG A N   1 
ATOM   608  C  CA  . ARG A 1 81  ? 30.360 20.798 19.454  1.00 11.86 ? 177  ARG A CA  1 
ATOM   609  C  C   . ARG A 1 81  ? 31.869 20.852 19.701  1.00 12.81 ? 177  ARG A C   1 
ATOM   610  O  O   . ARG A 1 81  ? 32.447 19.941 20.297  1.00 11.57 ? 177  ARG A O   1 
ATOM   611  C  CB  . ARG A 1 81  ? 30.078 20.329 18.026  1.00 10.78 ? 177  ARG A CB  1 
ATOM   612  C  CG  . ARG A 1 81  ? 30.928 19.176 17.542  1.00 11.79 ? 177  ARG A CG  1 
ATOM   613  C  CD  . ARG A 1 81  ? 30.643 18.947 16.070  1.00 12.75 ? 177  ARG A CD  1 
ATOM   614  N  NE  . ARG A 1 81  ? 31.478 17.900 15.497  1.00 14.37 ? 177  ARG A NE  1 
ATOM   615  C  CZ  . ARG A 1 81  ? 31.587 17.681 14.193  1.00 13.51 ? 177  ARG A CZ  1 
ATOM   616  N  NH1 . ARG A 1 81  ? 30.915 18.440 13.337  1.00 13.86 ? 177  ARG A NH1 1 
ATOM   617  N  NH2 . ARG A 1 81  ? 32.366 16.708 13.746  1.00 13.82 ? 177  ARG A NH2 1 
ATOM   618  N  N   . TYR A 1 82  ? 32.510 21.924 19.243  1.00 12.95 ? 178  TYR A N   1 
ATOM   619  C  CA  . TYR A 1 82  ? 33.952 22.068 19.406  1.00 12.76 ? 178  TYR A CA  1 
ATOM   620  C  C   . TYR A 1 82  ? 34.387 22.826 20.657  1.00 13.57 ? 178  TYR A C   1 
ATOM   621  O  O   . TYR A 1 82  ? 35.571 23.115 20.837  1.00 14.22 ? 178  TYR A O   1 
ATOM   622  C  CB  . TYR A 1 82  ? 34.540 22.714 18.146  1.00 13.24 ? 178  TYR A CB  1 
ATOM   623  C  CG  . TYR A 1 82  ? 34.686 21.722 17.018  1.00 12.79 ? 178  TYR A CG  1 
ATOM   624  C  CD1 . TYR A 1 82  ? 35.763 20.834 16.987  1.00 12.88 ? 178  TYR A CD1 1 
ATOM   625  C  CD2 . TYR A 1 82  ? 33.736 21.642 16.002  1.00 12.10 ? 178  TYR A CD2 1 
ATOM   626  C  CE1 . TYR A 1 82  ? 35.890 19.891 15.971  1.00 14.50 ? 178  TYR A CE1 1 
ATOM   627  C  CE2 . TYR A 1 82  ? 33.853 20.700 14.980  1.00 13.48 ? 178  TYR A CE2 1 
ATOM   628  C  CZ  . TYR A 1 82  ? 34.933 19.831 14.972  1.00 13.02 ? 178  TYR A CZ  1 
ATOM   629  O  OH  . TYR A 1 82  ? 35.066 18.902 13.966  1.00 16.93 ? 178  TYR A OH  1 
ATOM   630  N  N   . GLY A 1 83  ? 33.427 23.140 21.522  1.00 14.01 ? 179  GLY A N   1 
ATOM   631  C  CA  . GLY A 1 83  ? 33.742 23.841 22.755  1.00 14.86 ? 179  GLY A CA  1 
ATOM   632  C  C   . GLY A 1 83  ? 34.238 25.260 22.561  1.00 15.37 ? 179  GLY A C   1 
ATOM   633  O  O   . GLY A 1 83  ? 35.016 25.769 23.368  1.00 16.81 ? 179  GLY A O   1 
ATOM   634  N  N   . LEU A 1 84  ? 33.788 25.903 21.491  1.00 14.92 ? 180  LEU A N   1 
ATOM   635  C  CA  . LEU A 1 84  ? 34.182 27.276 21.208  1.00 15.19 ? 180  LEU A CA  1 
ATOM   636  C  C   . LEU A 1 84  ? 33.066 28.229 21.611  1.00 16.56 ? 180  LEU A C   1 
ATOM   637  O  O   . LEU A 1 84  ? 31.897 27.842 21.669  1.00 17.28 ? 180  LEU A O   1 
ATOM   638  C  CB  . LEU A 1 84  ? 34.468 27.447 19.719  1.00 16.63 ? 180  LEU A CB  1 
ATOM   639  C  CG  . LEU A 1 84  ? 35.636 26.648 19.147  1.00 15.00 ? 180  LEU A CG  1 
ATOM   640  C  CD1 . LEU A 1 84  ? 35.705 26.872 17.641  1.00 17.63 ? 180  LEU A CD1 1 
ATOM   641  C  CD2 . LEU A 1 84  ? 36.931 27.079 19.815  1.00 19.25 ? 180  LEU A CD2 1 
ATOM   642  N  N   . SER A 1 85  ? 33.434 29.475 21.891  1.00 16.35 ? 181  SER A N   1 
ATOM   643  C  CA  . SER A 1 85  ? 32.463 30.497 22.261  1.00 16.39 ? 181  SER A CA  1 
ATOM   644  C  C   . SER A 1 85  ? 31.556 30.764 21.067  1.00 16.14 ? 181  SER A C   1 
ATOM   645  O  O   . SER A 1 85  ? 32.029 31.173 20.009  1.00 15.41 ? 181  SER A O   1 
ATOM   646  C  CB  . SER A 1 85  ? 33.177 31.792 22.647  1.00 17.27 ? 181  SER A CB  1 
ATOM   647  O  OG  . SER A 1 85  ? 32.259 32.871 22.715  1.00 18.74 ? 181  SER A OG  1 
ATOM   648  N  N   . GLY A 1 86  ? 30.258 30.534 21.240  1.00 15.64 ? 182  GLY A N   1 
ATOM   649  C  CA  . GLY A 1 86  ? 29.320 30.759 20.156  1.00 14.80 ? 182  GLY A CA  1 
ATOM   650  C  C   . GLY A 1 86  ? 29.312 32.209 19.708  1.00 14.74 ? 182  GLY A C   1 
ATOM   651  O  O   . GLY A 1 86  ? 29.257 32.502 18.508  1.00 14.19 ? 182  GLY A O   1 
ATOM   652  N  N   . SER A 1 87  ? 29.377 33.124 20.673  1.00 16.05 ? 183  SER A N   1 
ATOM   653  C  CA  . SER A 1 87  ? 29.377 34.549 20.365  1.00 17.71 ? 183  SER A CA  1 
ATOM   654  C  C   . SER A 1 87  ? 30.626 34.942 19.579  1.00 16.35 ? 183  SER A C   1 
ATOM   655  O  O   . SER A 1 87  ? 30.534 35.682 18.595  1.00 16.95 ? 183  SER A O   1 
ATOM   656  C  CB  . SER A 1 87  ? 29.274 35.374 21.654  1.00 17.19 ? 183  SER A CB  1 
ATOM   657  O  OG  . SER A 1 87  ? 30.314 35.052 22.557  1.00 21.78 ? 183  SER A OG  1 
ATOM   658  N  N   . ASP A 1 88  ? 31.789 34.453 20.006  1.00 15.79 ? 184  ASP A N   1 
ATOM   659  C  CA  . ASP A 1 88  ? 33.028 34.754 19.297  1.00 15.34 ? 184  ASP A CA  1 
ATOM   660  C  C   . ASP A 1 88  ? 32.966 34.183 17.884  1.00 14.07 ? 184  ASP A C   1 
ATOM   661  O  O   . ASP A 1 88  ? 33.351 34.847 16.923  1.00 14.53 ? 184  ASP A O   1 
ATOM   662  C  CB  . ASP A 1 88  ? 34.243 34.153 20.009  1.00 17.96 ? 184  ASP A CB  1 
ATOM   663  C  CG  . ASP A 1 88  ? 34.646 34.928 21.244  1.00 21.29 ? 184  ASP A CG  1 
ATOM   664  O  OD1 . ASP A 1 88  ? 34.198 36.082 21.401  1.00 22.54 ? 184  ASP A OD1 1 
ATOM   665  O  OD2 . ASP A 1 88  ? 35.430 34.384 22.050  1.00 24.60 ? 184  ASP A OD2 1 
ATOM   666  N  N   . VAL A 1 89  ? 32.485 32.948 17.762  1.00 12.60 ? 185  VAL A N   1 
ATOM   667  C  CA  . VAL A 1 89  ? 32.393 32.309 16.451  1.00 10.90 ? 185  VAL A CA  1 
ATOM   668  C  C   . VAL A 1 89  ? 31.552 33.139 15.483  1.00 10.62 ? 185  VAL A C   1 
ATOM   669  O  O   . VAL A 1 89  ? 31.947 33.347 14.336  1.00 11.96 ? 185  VAL A O   1 
ATOM   670  C  CB  . VAL A 1 89  ? 31.812 30.875 16.565  1.00 10.19 ? 185  VAL A CB  1 
ATOM   671  C  CG1 . VAL A 1 89  ? 31.437 30.336 15.178  1.00 11.57 ? 185  VAL A CG1 1 
ATOM   672  C  CG2 . VAL A 1 89  ? 32.854 29.957 17.206  1.00 11.80 ? 185  VAL A CG2 1 
ATOM   673  N  N   . LEU A 1 90  ? 30.406 33.633 15.937  1.00 11.61 ? 186  LEU A N   1 
ATOM   674  C  CA  . LEU A 1 90  ? 29.568 34.441 15.056  1.00 12.75 ? 186  LEU A CA  1 
ATOM   675  C  C   . LEU A 1 90  ? 30.246 35.761 14.698  1.00 12.81 ? 186  LEU A C   1 
ATOM   676  O  O   . LEU A 1 90  ? 30.136 36.235 13.565  1.00 13.44 ? 186  LEU A O   1 
ATOM   677  C  CB  . LEU A 1 90  ? 28.206 34.719 15.698  1.00 13.84 ? 186  LEU A CB  1 
ATOM   678  C  CG  . LEU A 1 90  ? 27.315 33.502 15.965  1.00 15.35 ? 186  LEU A CG  1 
ATOM   679  C  CD1 . LEU A 1 90  ? 25.951 33.981 16.429  1.00 17.79 ? 186  LEU A CD1 1 
ATOM   680  C  CD2 . LEU A 1 90  ? 27.170 32.663 14.709  1.00 16.34 ? 186  LEU A CD2 1 
ATOM   681  N  N   . ASP A 1 91  ? 30.938 36.362 15.659  1.00 12.21 ? 187  ASP A N   1 
ATOM   682  C  CA  . ASP A 1 91  ? 31.619 37.627 15.394  1.00 14.99 ? 187  ASP A CA  1 
ATOM   683  C  C   . ASP A 1 91  ? 32.791 37.436 14.440  1.00 15.26 ? 187  ASP A C   1 
ATOM   684  O  O   . ASP A 1 91  ? 33.259 38.400 13.830  1.00 15.23 ? 187  ASP A O   1 
ATOM   685  C  CB  . ASP A 1 91  ? 32.163 38.255 16.678  1.00 16.78 ? 187  ASP A CB  1 
ATOM   686  C  CG  . ASP A 1 91  ? 31.074 38.721 17.619  1.00 20.35 ? 187  ASP A CG  1 
ATOM   687  O  OD1 . ASP A 1 91  ? 29.988 39.116 17.147  1.00 21.97 ? 187  ASP A OD1 1 
ATOM   688  O  OD2 . ASP A 1 91  ? 31.324 38.706 18.843  1.00 25.56 ? 187  ASP A OD2 1 
ATOM   689  N  N   . ASN A 1 92  ? 33.270 36.200 14.322  1.00 13.87 ? 188  ASN A N   1 
ATOM   690  C  CA  . ASN A 1 92  ? 34.403 35.905 13.450  1.00 14.14 ? 188  ASN A CA  1 
ATOM   691  C  C   . ASN A 1 92  ? 34.050 35.359 12.072  1.00 13.53 ? 188  ASN A C   1 
ATOM   692  O  O   . ASN A 1 92  ? 34.929 34.904 11.343  1.00 13.36 ? 188  ASN A O   1 
ATOM   693  C  CB  . ASN A 1 92  ? 35.368 34.942 14.135  1.00 14.82 ? 188  ASN A CB  1 
ATOM   694  C  CG  . ASN A 1 92  ? 36.110 35.587 15.281  1.00 18.85 ? 188  ASN A CG  1 
ATOM   695  O  OD1 . ASN A 1 92  ? 36.520 36.744 15.195  1.00 20.12 ? 188  ASN A OD1 1 
ATOM   696  N  ND2 . ASN A 1 92  ? 36.306 34.836 16.357  1.00 21.10 ? 188  ASN A ND2 1 
ATOM   697  N  N   . VAL A 1 93  ? 32.769 35.367 11.727  1.00 12.06 ? 189  VAL A N   1 
ATOM   698  C  CA  . VAL A 1 93  ? 32.357 34.924 10.402  1.00 10.87 ? 189  VAL A CA  1 
ATOM   699  C  C   . VAL A 1 93  ? 31.726 36.135 9.725   1.00 13.11 ? 189  VAL A C   1 
ATOM   700  O  O   . VAL A 1 93  ? 30.705 36.642 10.187  1.00 14.95 ? 189  VAL A O   1 
ATOM   701  C  CB  . VAL A 1 93  ? 31.309 33.779 10.446  1.00 9.92  ? 189  VAL A CB  1 
ATOM   702  C  CG1 . VAL A 1 93  ? 30.851 33.443 9.026   1.00 9.91  ? 189  VAL A CG1 1 
ATOM   703  C  CG2 . VAL A 1 93  ? 31.913 32.537 11.092  1.00 10.65 ? 189  VAL A CG2 1 
ATOM   704  N  N   . ALA A 1 94  ? 32.352 36.614 8.653   1.00 11.72 ? 190  ALA A N   1 
ATOM   705  C  CA  . ALA A 1 94  ? 31.825 37.753 7.905   1.00 11.20 ? 190  ALA A CA  1 
ATOM   706  C  C   . ALA A 1 94  ? 30.992 37.170 6.773   1.00 11.60 ? 190  ALA A C   1 
ATOM   707  O  O   . ALA A 1 94  ? 31.458 36.303 6.032   1.00 12.58 ? 190  ALA A O   1 
ATOM   708  C  CB  . ALA A 1 94  ? 32.961 38.597 7.353   1.00 10.95 ? 190  ALA A CB  1 
ATOM   709  N  N   . TYR A 1 95  ? 29.765 37.658 6.643   1.00 9.10  ? 191  TYR A N   1 
ATOM   710  C  CA  . TYR A 1 95  ? 28.829 37.157 5.646   1.00 11.15 ? 191  TYR A CA  1 
ATOM   711  C  C   . TYR A 1 95  ? 28.296 38.219 4.701   1.00 9.98  ? 191  TYR A C   1 
ATOM   712  O  O   . TYR A 1 95  ? 28.083 39.363 5.091   1.00 10.36 ? 191  TYR A O   1 
ATOM   713  C  CB  . TYR A 1 95  ? 27.653 36.493 6.377   1.00 14.31 ? 191  TYR A CB  1 
ATOM   714  C  CG  . TYR A 1 95  ? 26.381 36.329 5.573   1.00 16.33 ? 191  TYR A CG  1 
ATOM   715  C  CD1 . TYR A 1 95  ? 26.292 35.384 4.550   1.00 18.03 ? 191  TYR A CD1 1 
ATOM   716  C  CD2 . TYR A 1 95  ? 25.259 37.110 5.846   1.00 19.21 ? 191  TYR A CD2 1 
ATOM   717  C  CE1 . TYR A 1 95  ? 25.116 35.219 3.819   1.00 21.10 ? 191  TYR A CE1 1 
ATOM   718  C  CE2 . TYR A 1 95  ? 24.077 36.955 5.120   1.00 21.77 ? 191  TYR A CE2 1 
ATOM   719  C  CZ  . TYR A 1 95  ? 24.012 36.007 4.110   1.00 22.07 ? 191  TYR A CZ  1 
ATOM   720  O  OH  . TYR A 1 95  ? 22.842 35.844 3.399   1.00 24.46 ? 191  TYR A OH  1 
ATOM   721  N  N   . ALA A 1 96  ? 28.085 37.823 3.452   1.00 9.94  ? 192  ALA A N   1 
ATOM   722  C  CA  . ALA A 1 96  ? 27.527 38.718 2.452   1.00 10.77 ? 192  ALA A CA  1 
ATOM   723  C  C   . ALA A 1 96  ? 26.725 37.881 1.478   1.00 12.63 ? 192  ALA A C   1 
ATOM   724  O  O   . ALA A 1 96  ? 27.075 36.735 1.204   1.00 13.05 ? 192  ALA A O   1 
ATOM   725  C  CB  . ALA A 1 96  ? 28.635 39.455 1.709   1.00 11.74 ? 192  ALA A CB  1 
ATOM   726  N  N   . ARG A 1 97  ? 25.630 38.432 0.974   1.00 14.15 ? 193  ARG A N   1 
ATOM   727  C  CA  . ARG A 1 97  ? 24.857 37.701 -0.013  1.00 16.28 ? 193  ARG A CA  1 
ATOM   728  C  C   . ARG A 1 97  ? 24.997 38.467 -1.314  1.00 15.74 ? 193  ARG A C   1 
ATOM   729  O  O   . ARG A 1 97  ? 24.666 39.650 -1.380  1.00 17.52 ? 193  ARG A O   1 
ATOM   730  C  CB  . ARG A 1 97  ? 23.381 37.591 0.372   1.00 18.72 ? 193  ARG A CB  1 
ATOM   731  C  CG  . ARG A 1 97  ? 22.590 36.823 -0.680  1.00 18.20 ? 193  ARG A CG  1 
ATOM   732  C  CD  . ARG A 1 97  ? 21.215 36.423 -0.216  1.00 21.34 ? 193  ARG A CD  1 
ATOM   733  N  NE  . ARG A 1 97  ? 20.500 35.721 -1.275  1.00 20.08 ? 193  ARG A NE  1 
ATOM   734  C  CZ  . ARG A 1 97  ? 19.286 35.204 -1.138  1.00 21.29 ? 193  ARG A CZ  1 
ATOM   735  N  NH1 . ARG A 1 97  ? 18.647 35.307 0.022   1.00 22.51 ? 193  ARG A NH1 1 
ATOM   736  N  NH2 . ARG A 1 97  ? 18.709 34.591 -2.161  1.00 20.69 ? 193  ARG A NH2 1 
ATOM   737  N  N   . ALA A 1 98  ? 25.518 37.798 -2.339  1.00 13.91 ? 194  ALA A N   1 
ATOM   738  C  CA  . ALA A 1 98  ? 25.706 38.422 -3.641  1.00 15.22 ? 194  ALA A CA  1 
ATOM   739  C  C   . ALA A 1 98  ? 24.353 38.530 -4.333  1.00 15.34 ? 194  ALA A C   1 
ATOM   740  O  O   . ALA A 1 98  ? 23.612 37.550 -4.424  1.00 15.21 ? 194  ALA A O   1 
ATOM   741  C  CB  . ALA A 1 98  ? 26.674 37.593 -4.482  1.00 13.64 ? 194  ALA A CB  1 
ATOM   742  N  N   . PHE A 1 99  ? 24.040 39.730 -4.811  1.00 16.95 ? 195  PHE A N   1 
ATOM   743  C  CA  . PHE A 1 99  ? 22.770 39.999 -5.478  1.00 19.87 ? 195  PHE A CA  1 
ATOM   744  C  C   . PHE A 1 99  ? 22.789 39.670 -6.967  1.00 19.68 ? 195  PHE A C   1 
ATOM   745  O  O   . PHE A 1 99  ? 21.758 39.329 -7.550  1.00 21.50 ? 195  PHE A O   1 
ATOM   746  C  CB  . PHE A 1 99  ? 22.384 41.466 -5.268  1.00 19.91 ? 195  PHE A CB  1 
ATOM   747  C  CG  . PHE A 1 99  ? 21.846 41.761 -3.894  1.00 22.04 ? 195  PHE A CG  1 
ATOM   748  C  CD1 . PHE A 1 99  ? 22.553 41.386 -2.757  1.00 24.87 ? 195  PHE A CD1 1 
ATOM   749  C  CD2 . PHE A 1 99  ? 20.625 42.407 -3.737  1.00 22.22 ? 195  PHE A CD2 1 
ATOM   750  C  CE1 . PHE A 1 99  ? 22.051 41.648 -1.481  1.00 25.60 ? 195  PHE A CE1 1 
ATOM   751  C  CE2 . PHE A 1 99  ? 20.114 42.674 -2.466  1.00 22.41 ? 195  PHE A CE2 1 
ATOM   752  C  CZ  . PHE A 1 99  ? 20.829 42.293 -1.337  1.00 24.45 ? 195  PHE A CZ  1 
ATOM   753  N  N   . ASN A 1 100 ? 23.963 39.779 -7.577  1.00 17.00 ? 196  ASN A N   1 
ATOM   754  C  CA  . ASN A 1 100 ? 24.129 39.485 -8.996  1.00 18.09 ? 196  ASN A CA  1 
ATOM   755  C  C   . ASN A 1 100 ? 25.609 39.218 -9.253  1.00 16.35 ? 196  ASN A C   1 
ATOM   756  O  O   . ASN A 1 100 ? 26.427 39.344 -8.344  1.00 14.96 ? 196  ASN A O   1 
ATOM   757  C  CB  . ASN A 1 100 ? 23.633 40.658 -9.848  1.00 18.40 ? 196  ASN A CB  1 
ATOM   758  C  CG  . ASN A 1 100 ? 24.312 41.964 -9.495  1.00 19.85 ? 196  ASN A CG  1 
ATOM   759  O  OD1 . ASN A 1 100 ? 25.514 42.124 -9.689  1.00 20.52 ? 196  ASN A OD1 1 
ATOM   760  N  ND2 . ASN A 1 100 ? 23.540 42.910 -8.966  1.00 22.23 ? 196  ASN A ND2 1 
ATOM   761  N  N   . THR A 1 101 ? 25.959 38.858 -10.483 1.00 17.26 ? 197  THR A N   1 
ATOM   762  C  CA  . THR A 1 101 ? 27.354 38.557 -10.791 1.00 16.17 ? 197  THR A CA  1 
ATOM   763  C  C   . THR A 1 101 ? 28.322 39.730 -10.654 1.00 16.37 ? 197  THR A C   1 
ATOM   764  O  O   . THR A 1 101 ? 29.496 39.525 -10.338 1.00 13.66 ? 197  THR A O   1 
ATOM   765  C  CB  . THR A 1 101 ? 27.494 37.932 -12.195 1.00 17.31 ? 197  THR A CB  1 
ATOM   766  O  OG1 . THR A 1 101 ? 26.899 38.793 -13.171 1.00 20.03 ? 197  THR A OG1 1 
ATOM   767  C  CG2 . THR A 1 101 ? 26.813 36.571 -12.234 1.00 18.30 ? 197  THR A CG2 1 
ATOM   768  N  N   . ASP A 1 102 ? 27.857 40.956 -10.894 1.00 16.79 ? 198  ASP A N   1 
ATOM   769  C  CA  . ASP A 1 102 ? 28.741 42.107 -10.742 1.00 18.01 ? 198  ASP A CA  1 
ATOM   770  C  C   . ASP A 1 102 ? 29.050 42.284 -9.259  1.00 17.29 ? 198  ASP A C   1 
ATOM   771  O  O   . ASP A 1 102 ? 30.197 42.523 -8.874  1.00 17.00 ? 198  ASP A O   1 
ATOM   772  C  CB  . ASP A 1 102 ? 28.095 43.394 -11.271 1.00 22.18 ? 198  ASP A CB  1 
ATOM   773  C  CG  . ASP A 1 102 ? 28.117 43.486 -12.786 1.00 26.46 ? 198  ASP A CG  1 
ATOM   774  O  OD1 . ASP A 1 102 ? 28.972 42.833 -13.420 1.00 29.30 ? 198  ASP A OD1 1 
ATOM   775  O  OD2 . ASP A 1 102 ? 27.287 44.235 -13.341 1.00 31.93 ? 198  ASP A OD2 1 
ATOM   776  N  N   . HIS A 1 103 ? 28.014 42.165 -8.432  1.00 15.89 ? 199  HIS A N   1 
ATOM   777  C  CA  . HIS A 1 103 ? 28.163 42.310 -6.989  1.00 14.74 ? 199  HIS A CA  1 
ATOM   778  C  C   . HIS A 1 103 ? 29.075 41.211 -6.454  1.00 13.93 ? 199  HIS A C   1 
ATOM   779  O  O   . HIS A 1 103 ? 29.907 41.454 -5.581  1.00 12.91 ? 199  HIS A O   1 
ATOM   780  C  CB  . HIS A 1 103 ? 26.804 42.211 -6.296  1.00 14.97 ? 199  HIS A CB  1 
ATOM   781  C  CG  . HIS A 1 103 ? 26.862 42.446 -4.818  1.00 13.46 ? 199  HIS A CG  1 
ATOM   782  N  ND1 . HIS A 1 103 ? 26.015 41.818 -3.931  1.00 14.71 ? 199  HIS A ND1 1 
ATOM   783  C  CD2 . HIS A 1 103 ? 27.658 43.249 -4.075  1.00 12.84 ? 199  HIS A CD2 1 
ATOM   784  C  CE1 . HIS A 1 103 ? 26.290 42.223 -2.703  1.00 13.89 ? 199  HIS A CE1 1 
ATOM   785  N  NE2 . HIS A 1 103 ? 27.281 43.092 -2.763  1.00 14.41 ? 199  HIS A NE2 1 
ATOM   786  N  N   . GLN A 1 104 ? 28.902 40.005 -6.985  1.00 13.22 ? 200  GLN A N   1 
ATOM   787  C  CA  . GLN A 1 104 ? 29.702 38.854 -6.573  1.00 12.96 ? 200  GLN A CA  1 
ATOM   788  C  C   . GLN A 1 104 ? 31.191 39.147 -6.717  1.00 13.87 ? 200  GLN A C   1 
ATOM   789  O  O   . GLN A 1 104 ? 31.994 38.816 -5.840  1.00 12.77 ? 200  GLN A O   1 
ATOM   790  C  CB  . GLN A 1 104 ? 29.331 37.642 -7.421  1.00 12.31 ? 200  GLN A CB  1 
ATOM   791  C  CG  . GLN A 1 104 ? 30.026 36.352 -7.013  1.00 13.47 ? 200  GLN A CG  1 
ATOM   792  C  CD  . GLN A 1 104 ? 29.566 35.175 -7.848  1.00 13.16 ? 200  GLN A CD  1 
ATOM   793  O  OE1 . GLN A 1 104 ? 28.375 35.028 -8.125  1.00 15.14 ? 200  GLN A OE1 1 
ATOM   794  N  NE2 . GLN A 1 104 ? 30.504 34.321 -8.245  1.00 13.84 ? 200  GLN A NE2 1 
ATOM   795  N  N   . THR A 1 105 ? 31.556 39.765 -7.834  1.00 11.64 ? 201  THR A N   1 
ATOM   796  C  CA  . THR A 1 105 ? 32.948 40.109 -8.086  1.00 12.73 ? 201  THR A CA  1 
ATOM   797  C  C   . THR A 1 105 ? 33.377 41.313 -7.244  1.00 11.26 ? 201  THR A C   1 
ATOM   798  O  O   . THR A 1 105 ? 34.495 41.350 -6.727  1.00 11.94 ? 201  THR A O   1 
ATOM   799  C  CB  . THR A 1 105 ? 33.178 40.403 -9.593  1.00 11.84 ? 201  THR A CB  1 
ATOM   800  O  OG1 . THR A 1 105 ? 33.216 39.168 -10.321 1.00 13.35 ? 201  THR A OG1 1 
ATOM   801  C  CG2 . THR A 1 105 ? 34.479 41.155 -9.803  1.00 14.26 ? 201  THR A CG2 1 
ATOM   802  N  N   . GLN A 1 106 ? 32.485 42.289 -7.092  1.00 12.98 ? 202  GLN A N   1 
ATOM   803  C  CA  . GLN A 1 106 ? 32.803 43.477 -6.312  1.00 13.80 ? 202  GLN A CA  1 
ATOM   804  C  C   . GLN A 1 106 ? 33.123 43.115 -4.863  1.00 12.44 ? 202  GLN A C   1 
ATOM   805  O  O   . GLN A 1 106 ? 33.972 43.742 -4.235  1.00 13.52 ? 202  GLN A O   1 
ATOM   806  C  CB  . GLN A 1 106 ? 31.639 44.475 -6.360  1.00 17.53 ? 202  GLN A CB  1 
ATOM   807  C  CG  . GLN A 1 106 ? 32.024 45.875 -5.899  1.00 25.23 ? 202  GLN A CG  1 
ATOM   808  C  CD  . GLN A 1 106 ? 32.228 45.970 -4.400  1.00 28.15 ? 202  GLN A CD  1 
ATOM   809  O  OE1 . GLN A 1 106 ? 33.065 46.738 -3.922  1.00 32.69 ? 202  GLN A OE1 1 
ATOM   810  N  NE2 . GLN A 1 106 ? 31.455 45.194 -3.647  1.00 29.89 ? 202  GLN A NE2 1 
ATOM   811  N  N   . LEU A 1 107 ? 32.449 42.094 -4.342  1.00 12.46 ? 203  LEU A N   1 
ATOM   812  C  CA  . LEU A 1 107 ? 32.672 41.655 -2.968  1.00 11.73 ? 203  LEU A CA  1 
ATOM   813  C  C   . LEU A 1 107 ? 34.115 41.215 -2.719  1.00 12.56 ? 203  LEU A C   1 
ATOM   814  O  O   . LEU A 1 107 ? 34.605 41.288 -1.590  1.00 11.56 ? 203  LEU A O   1 
ATOM   815  C  CB  . LEU A 1 107 ? 31.704 40.519 -2.608  1.00 12.52 ? 203  LEU A CB  1 
ATOM   816  C  CG  . LEU A 1 107 ? 30.257 40.950 -2.332  1.00 12.51 ? 203  LEU A CG  1 
ATOM   817  C  CD1 . LEU A 1 107 ? 29.347 39.739 -2.274  1.00 14.88 ? 203  LEU A CD1 1 
ATOM   818  C  CD2 . LEU A 1 107 ? 30.204 41.722 -1.023  1.00 15.21 ? 203  LEU A CD2 1 
ATOM   819  N  N   . LEU A 1 108 ? 34.801 40.768 -3.767  1.00 11.31 ? 204  LEU A N   1 
ATOM   820  C  CA  . LEU A 1 108 ? 36.185 40.339 -3.611  1.00 11.87 ? 204  LEU A CA  1 
ATOM   821  C  C   . LEU A 1 108 ? 37.109 41.513 -3.294  1.00 11.61 ? 204  LEU A C   1 
ATOM   822  O  O   . LEU A 1 108 ? 38.158 41.335 -2.679  1.00 11.18 ? 204  LEU A O   1 
ATOM   823  C  CB  . LEU A 1 108 ? 36.672 39.614 -4.865  1.00 11.53 ? 204  LEU A CB  1 
ATOM   824  C  CG  . LEU A 1 108 ? 35.976 38.285 -5.169  1.00 12.00 ? 204  LEU A CG  1 
ATOM   825  C  CD1 . LEU A 1 108 ? 36.753 37.566 -6.269  1.00 12.14 ? 204  LEU A CD1 1 
ATOM   826  C  CD2 . LEU A 1 108 ? 35.920 37.417 -3.913  1.00 12.53 ? 204  LEU A CD2 1 
ATOM   827  N  N   . TYR A 1 109 ? 36.730 42.712 -3.724  1.00 13.97 ? 205  TYR A N   1 
ATOM   828  C  CA  . TYR A 1 109 ? 37.544 43.883 -3.425  1.00 16.07 ? 205  TYR A CA  1 
ATOM   829  C  C   . TYR A 1 109 ? 37.415 44.192 -1.940  1.00 15.39 ? 205  TYR A C   1 
ATOM   830  O  O   . TYR A 1 109 ? 38.408 44.484 -1.268  1.00 14.26 ? 205  TYR A O   1 
ATOM   831  C  CB  . TYR A 1 109 ? 37.097 45.073 -4.274  1.00 19.68 ? 205  TYR A CB  1 
ATOM   832  C  CG  . TYR A 1 109 ? 37.769 45.087 -5.621  1.00 23.06 ? 205  TYR A CG  1 
ATOM   833  C  CD1 . TYR A 1 109 ? 39.088 45.522 -5.752  1.00 26.38 ? 205  TYR A CD1 1 
ATOM   834  C  CD2 . TYR A 1 109 ? 37.114 44.616 -6.755  1.00 24.97 ? 205  TYR A CD2 1 
ATOM   835  C  CE1 . TYR A 1 109 ? 39.742 45.482 -6.977  1.00 28.42 ? 205  TYR A CE1 1 
ATOM   836  C  CE2 . TYR A 1 109 ? 37.760 44.569 -7.989  1.00 27.75 ? 205  TYR A CE2 1 
ATOM   837  C  CZ  . TYR A 1 109 ? 39.073 45.004 -8.091  1.00 29.20 ? 205  TYR A CZ  1 
ATOM   838  O  OH  . TYR A 1 109 ? 39.722 44.956 -9.304  1.00 32.07 ? 205  TYR A OH  1 
ATOM   839  N  N   . GLN A 1 110 ? 36.191 44.113 -1.426  1.00 14.66 ? 206  GLN A N   1 
ATOM   840  C  CA  . GLN A 1 110 ? 35.957 44.355 -0.007  1.00 14.18 ? 206  GLN A CA  1 
ATOM   841  C  C   . GLN A 1 110 ? 36.682 43.262 0.768   1.00 11.99 ? 206  GLN A C   1 
ATOM   842  O  O   . GLN A 1 110 ? 37.325 43.520 1.784   1.00 13.05 ? 206  GLN A O   1 
ATOM   843  C  CB  . GLN A 1 110 ? 34.459 44.298 0.310   1.00 16.50 ? 206  GLN A CB  1 
ATOM   844  C  CG  . GLN A 1 110 ? 33.621 45.297 -0.469  1.00 21.42 ? 206  GLN A CG  1 
ATOM   845  C  CD  . GLN A 1 110 ? 32.151 45.230 -0.103  1.00 24.13 ? 206  GLN A CD  1 
ATOM   846  O  OE1 . GLN A 1 110 ? 31.282 45.253 -0.975  1.00 26.96 ? 206  GLN A OE1 1 
ATOM   847  N  NE2 . GLN A 1 110 ? 31.863 45.156 1.193   1.00 26.12 ? 206  GLN A NE2 1 
ATOM   848  N  N   . ALA A 1 111 ? 36.577 42.033 0.276   1.00 11.37 ? 207  ALA A N   1 
ATOM   849  C  CA  . ALA A 1 111 ? 37.224 40.901 0.924   1.00 9.55  ? 207  ALA A CA  1 
ATOM   850  C  C   . ALA A 1 111 ? 38.726 41.137 1.086   1.00 9.68  ? 207  ALA A C   1 
ATOM   851  O  O   . ALA A 1 111 ? 39.286 40.901 2.154   1.00 10.32 ? 207  ALA A O   1 
ATOM   852  C  CB  . ALA A 1 111 ? 36.981 39.630 0.112   1.00 11.15 ? 207  ALA A CB  1 
ATOM   853  N  N   A SER A 1 112 ? 39.370 41.607 0.021   0.50 8.91  ? 208  SER A N   1 
ATOM   854  N  N   B SER A 1 112 ? 39.368 41.606 0.024   0.50 5.19  ? 208  SER A N   1 
ATOM   855  C  CA  A SER A 1 112 ? 40.809 41.855 0.055   0.50 8.84  ? 208  SER A CA  1 
ATOM   856  C  CA  B SER A 1 112 ? 40.803 41.859 0.059   0.50 6.96  ? 208  SER A CA  1 
ATOM   857  C  C   A SER A 1 112 ? 41.180 42.910 1.091   0.50 8.91  ? 208  SER A C   1 
ATOM   858  C  C   B SER A 1 112 ? 41.172 42.904 1.102   0.50 5.34  ? 208  SER A C   1 
ATOM   859  O  O   A SER A 1 112 ? 42.186 42.773 1.787   0.50 9.06  ? 208  SER A O   1 
ATOM   860  O  O   B SER A 1 112 ? 42.168 42.759 1.808   0.50 2.94  ? 208  SER A O   1 
ATOM   861  C  CB  A SER A 1 112 ? 41.319 42.271 -1.332  0.50 8.15  ? 208  SER A CB  1 
ATOM   862  C  CB  B SER A 1 112 ? 41.287 42.307 -1.316  0.50 6.77  ? 208  SER A CB  1 
ATOM   863  O  OG  A SER A 1 112 ? 40.748 43.489 -1.778  0.50 5.66  ? 208  SER A OG  1 
ATOM   864  O  OG  B SER A 1 112 ? 41.093 41.278 -2.266  0.50 12.86 ? 208  SER A OG  1 
ATOM   865  N  N   . ALA A 1 113 ? 40.364 43.955 1.198   1.00 9.46  ? 209  ALA A N   1 
ATOM   866  C  CA  . ALA A 1 113 ? 40.613 45.020 2.163   1.00 10.03 ? 209  ALA A CA  1 
ATOM   867  C  C   . ALA A 1 113 ? 40.474 44.466 3.581   1.00 12.23 ? 209  ALA A C   1 
ATOM   868  O  O   . ALA A 1 113 ? 41.252 44.796 4.474   1.00 13.45 ? 209  ALA A O   1 
ATOM   869  C  CB  . ALA A 1 113 ? 39.631 46.163 1.940   1.00 11.01 ? 209  ALA A CB  1 
HETATM 870  N  N   . MSE A 1 114 ? 39.483 43.608 3.782   1.00 11.13 ? 210  MSE A N   1 
HETATM 871  C  CA  . MSE A 1 114 ? 39.263 43.015 5.093   1.00 11.31 ? 210  MSE A CA  1 
HETATM 872  C  C   . MSE A 1 114 ? 40.416 42.100 5.502   1.00 10.40 ? 210  MSE A C   1 
HETATM 873  O  O   . MSE A 1 114 ? 40.816 42.075 6.667   1.00 11.49 ? 210  MSE A O   1 
HETATM 874  C  CB  . MSE A 1 114 ? 37.939 42.245 5.087   1.00 11.10 ? 210  MSE A CB  1 
HETATM 875  C  CG  . MSE A 1 114 ? 36.738 43.163 4.929   1.00 12.90 ? 210  MSE A CG  1 
HETATM 876  SE SE  . MSE A 1 114 ? 35.166 42.285 4.275   1.00 19.56 ? 210  MSE A SE  1 
HETATM 877  C  CE  . MSE A 1 114 ? 34.748 41.258 5.846   1.00 18.08 ? 210  MSE A CE  1 
HETATM 878  N  N   . MSE A 1 115 ? 40.959 41.361 4.538   1.00 9.79  ? 211  MSE A N   1 
HETATM 879  C  CA  . MSE A 1 115 ? 42.054 40.442 4.809   1.00 9.90  ? 211  MSE A CA  1 
HETATM 880  C  C   . MSE A 1 115 ? 43.354 41.161 5.150   1.00 12.40 ? 211  MSE A C   1 
HETATM 881  O  O   . MSE A 1 115 ? 44.254 40.576 5.751   1.00 12.31 ? 211  MSE A O   1 
HETATM 882  C  CB  . MSE A 1 115 ? 42.246 39.502 3.622   1.00 11.35 ? 211  MSE A CB  1 
HETATM 883  C  CG  . MSE A 1 115 ? 41.034 38.605 3.419   1.00 13.28 ? 211  MSE A CG  1 
HETATM 884  SE SE  . MSE A 1 115 ? 41.249 37.350 1.970   1.00 19.97 ? 211  MSE A SE  1 
HETATM 885  C  CE  . MSE A 1 115 ? 39.669 36.267 2.266   1.00 17.37 ? 211  MSE A CE  1 
ATOM   886  N  N   . VAL A 1 116 ? 43.448 42.429 4.771   1.00 13.63 ? 212  VAL A N   1 
ATOM   887  C  CA  . VAL A 1 116 ? 44.633 43.219 5.092   1.00 16.42 ? 212  VAL A CA  1 
ATOM   888  C  C   . VAL A 1 116 ? 44.566 43.633 6.565   1.00 18.07 ? 212  VAL A C   1 
ATOM   889  O  O   . VAL A 1 116 ? 45.587 43.696 7.256   1.00 20.15 ? 212  VAL A O   1 
ATOM   890  C  CB  . VAL A 1 116 ? 44.710 44.499 4.215   1.00 16.91 ? 212  VAL A CB  1 
ATOM   891  C  CG1 . VAL A 1 116 ? 45.666 45.507 4.837   1.00 20.67 ? 212  VAL A CG1 1 
ATOM   892  C  CG2 . VAL A 1 116 ? 45.179 44.141 2.815   1.00 16.11 ? 212  VAL A CG2 1 
ATOM   893  N  N   . GLU A 1 117 ? 43.351 43.890 7.039   1.00 17.71 ? 213  GLU A N   1 
ATOM   894  C  CA  . GLU A 1 117 ? 43.111 44.333 8.412   1.00 19.16 ? 213  GLU A CA  1 
ATOM   895  C  C   . GLU A 1 117 ? 43.076 43.256 9.498   1.00 19.63 ? 213  GLU A C   1 
ATOM   896  O  O   . GLU A 1 117 ? 43.546 43.486 10.614  1.00 18.83 ? 213  GLU A O   1 
ATOM   897  C  CB  . GLU A 1 117 ? 41.801 45.127 8.470   1.00 21.15 ? 213  GLU A CB  1 
ATOM   898  C  CG  . GLU A 1 117 ? 41.862 46.502 7.823   1.00 24.58 ? 213  GLU A CG  1 
ATOM   899  C  CD  . GLU A 1 117 ? 40.552 47.263 7.955   1.00 28.91 ? 213  GLU A CD  1 
ATOM   900  O  OE1 . GLU A 1 117 ? 39.820 47.024 8.940   1.00 29.96 ? 213  GLU A OE1 1 
ATOM   901  O  OE2 . GLU A 1 117 ? 40.257 48.111 7.085   1.00 30.33 ? 213  GLU A OE2 1 
ATOM   902  N  N   . SER A 1 118 ? 42.509 42.093 9.184   1.00 18.76 ? 214  SER A N   1 
ATOM   903  C  CA  . SER A 1 118 ? 42.399 41.004 10.159  1.00 18.30 ? 214  SER A CA  1 
ATOM   904  C  C   . SER A 1 118 ? 42.839 39.686 9.546   1.00 17.21 ? 214  SER A C   1 
ATOM   905  O  O   . SER A 1 118 ? 42.840 39.540 8.324   1.00 15.90 ? 214  SER A O   1 
ATOM   906  C  CB  . SER A 1 118 ? 40.945 40.857 10.626  1.00 20.42 ? 214  SER A CB  1 
ATOM   907  O  OG  . SER A 1 118 ? 40.397 42.099 11.016  1.00 25.34 ? 214  SER A OG  1 
ATOM   908  N  N   . ARG A 1 119 ? 43.190 38.719 10.391  1.00 16.03 ? 215  ARG A N   1 
ATOM   909  C  CA  . ARG A 1 119 ? 43.612 37.419 9.891   1.00 14.50 ? 215  ARG A CA  1 
ATOM   910  C  C   . ARG A 1 119 ? 42.444 36.502 9.568   1.00 13.33 ? 215  ARG A C   1 
ATOM   911  O  O   . ARG A 1 119 ? 41.666 36.124 10.448  1.00 14.15 ? 215  ARG A O   1 
ATOM   912  C  CB  . ARG A 1 119 ? 44.521 36.686 10.885  1.00 17.55 ? 215  ARG A CB  1 
ATOM   913  C  CG  . ARG A 1 119 ? 44.837 35.257 10.414  1.00 20.04 ? 215  ARG A CG  1 
ATOM   914  C  CD  . ARG A 1 119 ? 45.692 34.456 11.384  1.00 25.67 ? 215  ARG A CD  1 
ATOM   915  N  NE  . ARG A 1 119 ? 45.705 33.035 11.032  1.00 28.44 ? 215  ARG A NE  1 
ATOM   916  C  CZ  . ARG A 1 119 ? 46.186 32.539 9.894   1.00 32.44 ? 215  ARG A CZ  1 
ATOM   917  N  NH1 . ARG A 1 119 ? 46.710 33.342 8.977   1.00 33.60 ? 215  ARG A NH1 1 
ATOM   918  N  NH2 . ARG A 1 119 ? 46.132 31.232 9.664   1.00 33.47 ? 215  ARG A NH2 1 
ATOM   919  N  N   . TYR A 1 120 ? 42.337 36.148 8.294   1.00 12.11 ? 216  TYR A N   1 
ATOM   920  C  CA  . TYR A 1 120 ? 41.309 35.235 7.826   1.00 10.66 ? 216  TYR A CA  1 
ATOM   921  C  C   . TYR A 1 120 ? 41.996 33.942 7.435   1.00 10.55 ? 216  TYR A C   1 
ATOM   922  O  O   . TYR A 1 120 ? 43.151 33.952 7.012   1.00 11.94 ? 216  TYR A O   1 
ATOM   923  C  CB  . TYR A 1 120 ? 40.597 35.796 6.600   1.00 11.82 ? 216  TYR A CB  1 
ATOM   924  C  CG  . TYR A 1 120 ? 39.502 36.761 6.941   1.00 11.74 ? 216  TYR A CG  1 
ATOM   925  C  CD1 . TYR A 1 120 ? 39.789 38.074 7.311   1.00 13.91 ? 216  TYR A CD1 1 
ATOM   926  C  CD2 . TYR A 1 120 ? 38.172 36.348 6.939   1.00 13.07 ? 216  TYR A CD2 1 
ATOM   927  C  CE1 . TYR A 1 120 ? 38.773 38.950 7.670   1.00 14.14 ? 216  TYR A CE1 1 
ATOM   928  C  CE2 . TYR A 1 120 ? 37.157 37.209 7.296   1.00 13.62 ? 216  TYR A CE2 1 
ATOM   929  C  CZ  . TYR A 1 120 ? 37.459 38.506 7.661   1.00 15.01 ? 216  TYR A CZ  1 
ATOM   930  O  OH  . TYR A 1 120 ? 36.434 39.349 8.016   1.00 17.98 ? 216  TYR A OH  1 
ATOM   931  N  N   . ALA A 1 121 ? 41.288 32.829 7.572   1.00 8.82  ? 217  ALA A N   1 
ATOM   932  C  CA  . ALA A 1 121 ? 41.849 31.538 7.200   1.00 8.08  ? 217  ALA A CA  1 
ATOM   933  C  C   . ALA A 1 121 ? 41.023 30.927 6.082   1.00 8.74  ? 217  ALA A C   1 
ATOM   934  O  O   . ALA A 1 121 ? 41.492 30.030 5.380   1.00 9.17  ? 217  ALA A O   1 
ATOM   935  C  CB  . ALA A 1 121 ? 41.849 30.599 8.403   1.00 10.40 ? 217  ALA A CB  1 
ATOM   936  N  N   . LEU A 1 122 ? 39.811 31.440 5.889   1.00 8.26  ? 218  LEU A N   1 
ATOM   937  C  CA  . LEU A 1 122 ? 38.913 30.856 4.897   1.00 9.02  ? 218  LEU A CA  1 
ATOM   938  C  C   . LEU A 1 122 ? 37.946 31.799 4.184   1.00 7.66  ? 218  LEU A C   1 
ATOM   939  O  O   . LEU A 1 122 ? 37.368 32.697 4.794   1.00 8.43  ? 218  LEU A O   1 
ATOM   940  C  CB  . LEU A 1 122 ? 38.089 29.765 5.593   1.00 9.51  ? 218  LEU A CB  1 
ATOM   941  C  CG  . LEU A 1 122 ? 36.917 29.094 4.872   1.00 10.64 ? 218  LEU A CG  1 
ATOM   942  C  CD1 . LEU A 1 122 ? 37.450 28.079 3.870   1.00 11.06 ? 218  LEU A CD1 1 
ATOM   943  C  CD2 . LEU A 1 122 ? 36.024 28.398 5.892   1.00 13.12 ? 218  LEU A CD2 1 
ATOM   944  N  N   . LEU A 1 123 ? 37.778 31.571 2.885   1.00 8.37  ? 219  LEU A N   1 
ATOM   945  C  CA  . LEU A 1 123 ? 36.821 32.322 2.078   1.00 7.10  ? 219  LEU A CA  1 
ATOM   946  C  C   . LEU A 1 123 ? 35.929 31.294 1.395   1.00 7.22  ? 219  LEU A C   1 
ATOM   947  O  O   . LEU A 1 123 ? 36.412 30.419 0.668   1.00 7.85  ? 219  LEU A O   1 
ATOM   948  C  CB  . LEU A 1 123 ? 37.507 33.171 1.000   1.00 9.27  ? 219  LEU A CB  1 
ATOM   949  C  CG  . LEU A 1 123 ? 36.542 33.707 -0.075  1.00 10.99 ? 219  LEU A CG  1 
ATOM   950  C  CD1 . LEU A 1 123 ? 35.445 34.564 0.560   1.00 13.35 ? 219  LEU A CD1 1 
ATOM   951  C  CD2 . LEU A 1 123 ? 37.322 34.518 -1.101  1.00 12.85 ? 219  LEU A CD2 1 
ATOM   952  N  N   A ILE A 1 124 ? 34.627 31.412 1.626   0.50 6.12  ? 220  ILE A N   1 
ATOM   953  N  N   B ILE A 1 124 ? 34.627 31.400 1.641   0.50 1.35  ? 220  ILE A N   1 
ATOM   954  C  CA  A ILE A 1 124 ? 33.644 30.508 1.045   0.50 5.48  ? 220  ILE A CA  1 
ATOM   955  C  CA  B ILE A 1 124 ? 33.627 30.506 1.061   0.50 1.35  ? 220  ILE A CA  1 
ATOM   956  C  C   A ILE A 1 124 ? 32.785 31.247 0.029   0.50 5.49  ? 220  ILE A C   1 
ATOM   957  C  C   B ILE A 1 124 ? 32.807 31.257 0.020   0.50 1.35  ? 220  ILE A C   1 
ATOM   958  O  O   A ILE A 1 124 ? 32.343 32.369 0.281   0.50 5.14  ? 220  ILE A O   1 
ATOM   959  O  O   B ILE A 1 124 ? 32.421 32.406 0.246   0.50 1.35  ? 220  ILE A O   1 
ATOM   960  C  CB  A ILE A 1 124 ? 32.706 29.953 2.131   0.50 5.16  ? 220  ILE A CB  1 
ATOM   961  C  CB  B ILE A 1 124 ? 32.618 30.008 2.134   0.50 1.35  ? 220  ILE A CB  1 
ATOM   962  C  CG1 A ILE A 1 124 ? 33.509 29.143 3.150   0.50 4.87  ? 220  ILE A CG1 1 
ATOM   963  C  CG1 B ILE A 1 124 ? 33.312 29.085 3.141   0.50 1.97  ? 220  ILE A CG1 1 
ATOM   964  C  CG2 A ILE A 1 124 ? 31.606 29.110 1.492   0.50 5.91  ? 220  ILE A CG2 1 
ATOM   965  C  CG2 B ILE A 1 124 ? 31.422 29.326 1.458   0.50 1.35  ? 220  ILE A CG2 1 
ATOM   966  C  CD1 A ILE A 1 124 ? 32.776 28.924 4.455   0.50 2.48  ? 220  ILE A CD1 1 
ATOM   967  C  CD1 B ILE A 1 124 ? 33.863 27.818 2.556   0.50 8.09  ? 220  ILE A CD1 1 
ATOM   968  N  N   . VAL A 1 125 ? 32.555 30.616 -1.118  1.00 6.21  ? 221  VAL A N   1 
ATOM   969  C  CA  . VAL A 1 125 ? 31.713 31.202 -2.158  1.00 6.05  ? 221  VAL A CA  1 
ATOM   970  C  C   . VAL A 1 125 ? 30.747 30.083 -2.525  1.00 9.19  ? 221  VAL A C   1 
ATOM   971  O  O   . VAL A 1 125 ? 31.097 29.156 -3.257  1.00 9.66  ? 221  VAL A O   1 
ATOM   972  C  CB  . VAL A 1 125 ? 32.479 31.630 -3.418  1.00 8.43  ? 221  VAL A CB  1 
ATOM   973  C  CG1 . VAL A 1 125 ? 31.489 32.232 -4.424  1.00 11.56 ? 221  VAL A CG1 1 
ATOM   974  C  CG2 . VAL A 1 125 ? 33.545 32.652 -3.065  1.00 9.56  ? 221  VAL A CG2 1 
ATOM   975  N  N   . ASP A 1 126 ? 29.530 30.182 -2.001  1.00 8.99  ? 222  ASP A N   1 
ATOM   976  C  CA  . ASP A 1 126 ? 28.488 29.178 -2.208  1.00 10.19 ? 222  ASP A CA  1 
ATOM   977  C  C   . ASP A 1 126 ? 27.218 29.870 -2.712  1.00 10.73 ? 222  ASP A C   1 
ATOM   978  O  O   . ASP A 1 126 ? 26.485 30.447 -1.914  1.00 11.04 ? 222  ASP A O   1 
ATOM   979  C  CB  . ASP A 1 126 ? 28.237 28.482 -0.859  1.00 12.30 ? 222  ASP A CB  1 
ATOM   980  C  CG  . ASP A 1 126 ? 27.093 27.492 -0.899  1.00 13.65 ? 222  ASP A CG  1 
ATOM   981  O  OD1 . ASP A 1 126 ? 26.893 26.851 -1.945  1.00 14.21 ? 222  ASP A OD1 1 
ATOM   982  O  OD2 . ASP A 1 126 ? 26.407 27.343 0.138   1.00 17.00 ? 222  ASP A OD2 1 
ATOM   983  N  N   . SER A 1 127 ? 26.926 29.815 -4.014  1.00 11.76 ? 223  SER A N   1 
ATOM   984  C  CA  . SER A 1 127 ? 27.693 29.127 -5.053  1.00 11.53 ? 223  SER A CA  1 
ATOM   985  C  C   . SER A 1 127 ? 28.470 30.107 -5.937  1.00 12.18 ? 223  SER A C   1 
ATOM   986  O  O   . SER A 1 127 ? 28.063 31.256 -6.113  1.00 12.29 ? 223  SER A O   1 
ATOM   987  C  CB  . SER A 1 127 ? 26.717 28.320 -5.922  1.00 13.99 ? 223  SER A CB  1 
ATOM   988  O  OG  . SER A 1 127 ? 27.250 28.040 -7.204  1.00 15.91 ? 223  SER A OG  1 
ATOM   989  N  N   . ALA A 1 128 ? 29.578 29.649 -6.509  1.00 11.55 ? 224  ALA A N   1 
ATOM   990  C  CA  . ALA A 1 128 ? 30.389 30.505 -7.365  1.00 12.08 ? 224  ALA A CA  1 
ATOM   991  C  C   . ALA A 1 128 ? 29.812 30.646 -8.771  1.00 12.99 ? 224  ALA A C   1 
ATOM   992  O  O   . ALA A 1 128 ? 30.159 31.578 -9.495  1.00 13.90 ? 224  ALA A O   1 
ATOM   993  C  CB  . ALA A 1 128 ? 31.815 29.960 -7.447  1.00 12.08 ? 224  ALA A CB  1 
ATOM   994  N  N   . THR A 1 129 ? 28.916 29.741 -9.150  1.00 14.01 ? 225  THR A N   1 
ATOM   995  C  CA  . THR A 1 129 ? 28.355 29.777 -10.497 1.00 15.06 ? 225  THR A CA  1 
ATOM   996  C  C   . THR A 1 129 ? 26.844 29.966 -10.621 1.00 16.24 ? 225  THR A C   1 
ATOM   997  O  O   . THR A 1 129 ? 26.353 30.310 -11.696 1.00 16.22 ? 225  THR A O   1 
ATOM   998  C  CB  . THR A 1 129 ? 28.715 28.492 -11.251 1.00 15.67 ? 225  THR A CB  1 
ATOM   999  O  OG1 . THR A 1 129 ? 28.169 27.367 -10.550 1.00 18.32 ? 225  THR A OG1 1 
ATOM   1000 C  CG2 . THR A 1 129 ? 30.227 28.341 -11.350 1.00 17.70 ? 225  THR A CG2 1 
ATOM   1001 N  N   . ALA A 1 130 ? 26.111 29.742 -9.536  1.00 15.40 ? 226  ALA A N   1 
ATOM   1002 C  CA  . ALA A 1 130 ? 24.655 29.863 -9.569  1.00 17.16 ? 226  ALA A CA  1 
ATOM   1003 C  C   . ALA A 1 130 ? 24.121 31.139 -10.218 1.00 18.11 ? 226  ALA A C   1 
ATOM   1004 O  O   . ALA A 1 130 ? 23.215 31.080 -11.050 1.00 19.76 ? 226  ALA A O   1 
ATOM   1005 C  CB  . ALA A 1 130 ? 24.087 29.724 -8.157  1.00 17.20 ? 226  ALA A CB  1 
ATOM   1006 N  N   . LEU A 1 131 ? 24.677 32.289 -9.849  1.00 17.52 ? 227  LEU A N   1 
ATOM   1007 C  CA  . LEU A 1 131 ? 24.207 33.558 -10.396 1.00 17.98 ? 227  LEU A CA  1 
ATOM   1008 C  C   . LEU A 1 131 ? 24.481 33.740 -11.890 1.00 18.80 ? 227  LEU A C   1 
ATOM   1009 O  O   . LEU A 1 131 ? 23.895 34.616 -12.530 1.00 18.94 ? 227  LEU A O   1 
ATOM   1010 C  CB  . LEU A 1 131 ? 24.802 34.726 -9.603  1.00 18.01 ? 227  LEU A CB  1 
ATOM   1011 C  CG  . LEU A 1 131 ? 24.397 34.787 -8.123  1.00 18.20 ? 227  LEU A CG  1 
ATOM   1012 C  CD1 . LEU A 1 131 ? 24.978 36.043 -7.489  1.00 19.48 ? 227  LEU A CD1 1 
ATOM   1013 C  CD2 . LEU A 1 131 ? 22.876 34.783 -7.992  1.00 21.19 ? 227  LEU A CD2 1 
ATOM   1014 N  N   . TYR A 1 132 ? 25.360 32.911 -12.443 1.00 18.50 ? 228  TYR A N   1 
ATOM   1015 C  CA  . TYR A 1 132 ? 25.693 32.986 -13.863 1.00 21.58 ? 228  TYR A CA  1 
ATOM   1016 C  C   . TYR A 1 132 ? 24.699 32.205 -14.717 1.00 25.16 ? 228  TYR A C   1 
ATOM   1017 O  O   . TYR A 1 132 ? 24.694 32.327 -15.942 1.00 27.01 ? 228  TYR A O   1 
ATOM   1018 C  CB  . TYR A 1 132 ? 27.107 32.450 -14.099 1.00 17.41 ? 228  TYR A CB  1 
ATOM   1019 C  CG  . TYR A 1 132 ? 28.196 33.411 -13.689 1.00 14.92 ? 228  TYR A CG  1 
ATOM   1020 C  CD1 . TYR A 1 132 ? 28.626 34.417 -14.554 1.00 12.76 ? 228  TYR A CD1 1 
ATOM   1021 C  CD2 . TYR A 1 132 ? 28.789 33.328 -12.430 1.00 13.04 ? 228  TYR A CD2 1 
ATOM   1022 C  CE1 . TYR A 1 132 ? 29.620 35.314 -14.179 1.00 13.80 ? 228  TYR A CE1 1 
ATOM   1023 C  CE2 . TYR A 1 132 ? 29.785 34.224 -12.044 1.00 12.87 ? 228  TYR A CE2 1 
ATOM   1024 C  CZ  . TYR A 1 132 ? 30.196 35.211 -12.920 1.00 12.36 ? 228  TYR A CZ  1 
ATOM   1025 O  OH  . TYR A 1 132 ? 31.182 36.091 -12.551 1.00 14.32 ? 228  TYR A OH  1 
ATOM   1026 N  N   . ARG A 1 133 ? 23.857 31.409 -14.066 1.00 28.73 ? 229  ARG A N   1 
ATOM   1027 C  CA  . ARG A 1 133 ? 22.861 30.608 -14.770 1.00 34.06 ? 229  ARG A CA  1 
ATOM   1028 C  C   . ARG A 1 133 ? 21.469 31.210 -14.619 1.00 35.05 ? 229  ARG A C   1 
ATOM   1029 O  O   . ARG A 1 133 ? 21.162 32.242 -15.216 1.00 37.10 ? 229  ARG A O   1 
ATOM   1030 C  CB  . ARG A 1 133 ? 22.862 29.173 -14.233 1.00 37.97 ? 229  ARG A CB  1 
ATOM   1031 C  CG  . ARG A 1 133 ? 21.948 28.221 -14.994 1.00 45.76 ? 229  ARG A CG  1 
ATOM   1032 C  CD  . ARG A 1 133 ? 22.082 26.795 -14.476 1.00 50.57 ? 229  ARG A CD  1 
ATOM   1033 N  NE  . ARG A 1 133 ? 21.591 26.658 -13.107 1.00 56.15 ? 229  ARG A NE  1 
ATOM   1034 C  CZ  . ARG A 1 133 ? 20.304 26.628 -12.771 1.00 58.13 ? 229  ARG A CZ  1 
ATOM   1035 N  NH1 . ARG A 1 133 ? 19.366 26.723 -13.705 1.00 59.34 ? 229  ARG A NH1 1 
ATOM   1036 N  NH2 . ARG A 1 133 ? 19.955 26.504 -11.498 1.00 59.67 ? 229  ARG A NH2 1 
ATOM   1037 N  N   . GLU A 1 141 ? 26.455 36.730 -25.203 1.00 45.75 ? 237  GLU A N   1 
ATOM   1038 C  CA  . GLU A 1 141 ? 25.871 36.676 -23.870 1.00 45.26 ? 237  GLU A CA  1 
ATOM   1039 C  C   . GLU A 1 141 ? 26.505 35.558 -23.052 1.00 43.96 ? 237  GLU A C   1 
ATOM   1040 O  O   . GLU A 1 141 ? 27.098 35.803 -22.001 1.00 43.47 ? 237  GLU A O   1 
ATOM   1041 C  CB  . GLU A 1 141 ? 24.361 36.455 -23.965 1.00 47.65 ? 237  GLU A CB  1 
ATOM   1042 C  CG  . GLU A 1 141 ? 23.661 36.374 -22.618 1.00 51.11 ? 237  GLU A CG  1 
ATOM   1043 C  CD  . GLU A 1 141 ? 24.004 37.545 -21.718 1.00 52.82 ? 237  GLU A CD  1 
ATOM   1044 O  OE1 . GLU A 1 141 ? 23.878 38.701 -22.172 1.00 54.95 ? 237  GLU A OE1 1 
ATOM   1045 O  OE2 . GLU A 1 141 ? 24.397 37.309 -20.555 1.00 53.95 ? 237  GLU A OE2 1 
ATOM   1046 N  N   . LEU A 1 142 ? 26.371 34.329 -23.541 1.00 41.51 ? 238  LEU A N   1 
ATOM   1047 C  CA  . LEU A 1 142 ? 26.937 33.170 -22.866 1.00 39.97 ? 238  LEU A CA  1 
ATOM   1048 C  C   . LEU A 1 142 ? 28.447 33.318 -22.725 1.00 38.07 ? 238  LEU A C   1 
ATOM   1049 O  O   . LEU A 1 142 ? 29.005 33.095 -21.651 1.00 36.76 ? 238  LEU A O   1 
ATOM   1050 C  CB  . LEU A 1 142 ? 26.619 31.896 -23.650 1.00 41.06 ? 238  LEU A CB  1 
ATOM   1051 C  CG  . LEU A 1 142 ? 27.342 30.621 -23.203 1.00 42.05 ? 238  LEU A CG  1 
ATOM   1052 C  CD1 . LEU A 1 142 ? 27.008 30.309 -21.751 1.00 42.90 ? 238  LEU A CD1 1 
ATOM   1053 C  CD2 . LEU A 1 142 ? 26.935 29.469 -24.107 1.00 43.61 ? 238  LEU A CD2 1 
ATOM   1054 N  N   . SER A 1 143 ? 29.105 33.693 -23.818 1.00 35.69 ? 239  SER A N   1 
ATOM   1055 C  CA  . SER A 1 143 ? 30.552 33.870 -23.813 1.00 33.46 ? 239  SER A CA  1 
ATOM   1056 C  C   . SER A 1 143 ? 30.947 35.005 -22.875 1.00 31.86 ? 239  SER A C   1 
ATOM   1057 O  O   . SER A 1 143 ? 32.013 34.973 -22.260 1.00 30.28 ? 239  SER A O   1 
ATOM   1058 C  CB  . SER A 1 143 ? 31.055 34.167 -25.227 1.00 34.80 ? 239  SER A CB  1 
ATOM   1059 O  OG  . SER A 1 143 ? 30.508 35.377 -25.721 1.00 37.47 ? 239  SER A OG  1 
ATOM   1060 N  N   . ALA A 1 144 ? 30.082 36.008 -22.769 1.00 29.26 ? 240  ALA A N   1 
ATOM   1061 C  CA  . ALA A 1 144 ? 30.344 37.146 -21.897 1.00 27.57 ? 240  ALA A CA  1 
ATOM   1062 C  C   . ALA A 1 144 ? 30.359 36.676 -20.446 1.00 26.33 ? 240  ALA A C   1 
ATOM   1063 O  O   . ALA A 1 144 ? 31.229 37.065 -19.665 1.00 24.83 ? 240  ALA A O   1 
ATOM   1064 C  CB  . ALA A 1 144 ? 29.276 38.212 -22.091 1.00 28.86 ? 240  ALA A CB  1 
ATOM   1065 N  N   . ARG A 1 145 ? 29.391 35.837 -20.095 1.00 24.47 ? 241  ARG A N   1 
ATOM   1066 C  CA  . ARG A 1 145 ? 29.298 35.308 -18.741 1.00 24.64 ? 241  ARG A CA  1 
ATOM   1067 C  C   . ARG A 1 145 ? 30.467 34.381 -18.436 1.00 23.05 ? 241  ARG A C   1 
ATOM   1068 O  O   . ARG A 1 145 ? 30.986 34.376 -17.321 1.00 21.52 ? 241  ARG A O   1 
ATOM   1069 C  CB  . ARG A 1 145 ? 27.986 34.545 -18.545 1.00 26.26 ? 241  ARG A CB  1 
ATOM   1070 C  CG  . ARG A 1 145 ? 26.748 35.415 -18.618 1.00 30.40 ? 241  ARG A CG  1 
ATOM   1071 C  CD  . ARG A 1 145 ? 25.509 34.636 -18.222 1.00 32.71 ? 241  ARG A CD  1 
ATOM   1072 N  NE  . ARG A 1 145 ? 24.309 35.459 -18.327 1.00 37.68 ? 241  ARG A NE  1 
ATOM   1073 C  CZ  . ARG A 1 145 ? 23.094 35.063 -17.964 1.00 40.61 ? 241  ARG A CZ  1 
ATOM   1074 N  NH1 . ARG A 1 145 ? 22.910 33.848 -17.465 1.00 42.19 ? 241  ARG A NH1 1 
ATOM   1075 N  NH2 . ARG A 1 145 ? 22.061 35.883 -18.104 1.00 41.34 ? 241  ARG A NH2 1 
ATOM   1076 N  N   . GLN A 1 146 ? 30.882 33.597 -19.427 1.00 21.32 ? 242  GLN A N   1 
ATOM   1077 C  CA  . GLN A 1 146 ? 31.991 32.675 -19.227 1.00 22.07 ? 242  GLN A CA  1 
ATOM   1078 C  C   . GLN A 1 146 ? 33.291 33.417 -18.946 1.00 19.58 ? 242  GLN A C   1 
ATOM   1079 O  O   . GLN A 1 146 ? 34.074 32.992 -18.098 1.00 17.88 ? 242  GLN A O   1 
ATOM   1080 C  CB  . GLN A 1 146 ? 32.152 31.754 -20.442 1.00 26.14 ? 242  GLN A CB  1 
ATOM   1081 C  CG  . GLN A 1 146 ? 31.006 30.759 -20.591 1.00 32.63 ? 242  GLN A CG  1 
ATOM   1082 C  CD  . GLN A 1 146 ? 31.207 29.788 -21.737 1.00 37.09 ? 242  GLN A CD  1 
ATOM   1083 O  OE1 . GLN A 1 146 ? 31.310 30.188 -22.897 1.00 39.23 ? 242  GLN A OE1 1 
ATOM   1084 N  NE2 . GLN A 1 146 ? 31.259 28.499 -21.415 1.00 39.89 ? 242  GLN A NE2 1 
HETATM 1085 N  N   . MSE A 1 147 ? 33.519 34.521 -19.652 1.00 18.13 ? 243  MSE A N   1 
HETATM 1086 C  CA  . MSE A 1 147 ? 34.729 35.313 -19.444 1.00 18.31 ? 243  MSE A CA  1 
HETATM 1087 C  C   . MSE A 1 147 ? 34.701 35.976 -18.073 1.00 17.43 ? 243  MSE A C   1 
HETATM 1088 O  O   . MSE A 1 147 ? 35.715 36.041 -17.384 1.00 15.93 ? 243  MSE A O   1 
HETATM 1089 C  CB  . MSE A 1 147 ? 34.868 36.397 -20.519 1.00 20.88 ? 243  MSE A CB  1 
HETATM 1090 C  CG  . MSE A 1 147 ? 35.243 35.872 -21.895 1.00 24.97 ? 243  MSE A CG  1 
HETATM 1091 SE SE  . MSE A 1 147 ? 35.643 37.308 -23.133 1.00 31.39 ? 243  MSE A SE  1 
HETATM 1092 C  CE  . MSE A 1 147 ? 33.856 37.603 -23.805 1.00 31.87 ? 243  MSE A CE  1 
ATOM   1093 N  N   . HIS A 1 148 ? 33.532 36.473 -17.684 1.00 15.35 ? 244  HIS A N   1 
ATOM   1094 C  CA  . HIS A 1 148 ? 33.382 37.135 -16.396 1.00 14.53 ? 244  HIS A CA  1 
ATOM   1095 C  C   . HIS A 1 148 ? 33.645 36.141 -15.264 1.00 13.42 ? 244  HIS A C   1 
ATOM   1096 O  O   . HIS A 1 148 ? 34.323 36.466 -14.290 1.00 11.85 ? 244  HIS A O   1 
ATOM   1097 C  CB  . HIS A 1 148 ? 31.975 37.732 -16.286 1.00 16.88 ? 244  HIS A CB  1 
ATOM   1098 C  CG  . HIS A 1 148 ? 31.813 38.698 -15.155 1.00 18.28 ? 244  HIS A CG  1 
ATOM   1099 N  ND1 . HIS A 1 148 ? 31.585 38.294 -13.857 1.00 17.51 ? 244  HIS A ND1 1 
ATOM   1100 C  CD2 . HIS A 1 148 ? 31.863 40.050 -15.125 1.00 17.28 ? 244  HIS A CD2 1 
ATOM   1101 C  CE1 . HIS A 1 148 ? 31.502 39.355 -13.076 1.00 17.03 ? 244  HIS A CE1 1 
ATOM   1102 N  NE2 . HIS A 1 148 ? 31.667 40.435 -13.820 1.00 18.85 ? 244  HIS A NE2 1 
ATOM   1103 N  N   . LEU A 1 149 ? 33.111 34.931 -15.400 1.00 12.32 ? 245  LEU A N   1 
ATOM   1104 C  CA  . LEU A 1 149 ? 33.313 33.894 -14.393 1.00 11.41 ? 245  LEU A CA  1 
ATOM   1105 C  C   . LEU A 1 149 ? 34.790 33.504 -14.341 1.00 11.45 ? 245  LEU A C   1 
ATOM   1106 O  O   . LEU A 1 149 ? 35.363 33.358 -13.263 1.00 11.37 ? 245  LEU A O   1 
ATOM   1107 C  CB  . LEU A 1 149 ? 32.459 32.664 -14.716 1.00 11.93 ? 245  LEU A CB  1 
ATOM   1108 C  CG  . LEU A 1 149 ? 32.704 31.410 -13.869 1.00 12.45 ? 245  LEU A CG  1 
ATOM   1109 C  CD1 . LEU A 1 149 ? 32.472 31.715 -12.389 1.00 12.44 ? 245  LEU A CD1 1 
ATOM   1110 C  CD2 . LEU A 1 149 ? 31.778 30.300 -14.339 1.00 13.60 ? 245  LEU A CD2 1 
ATOM   1111 N  N   . ALA A 1 150 ? 35.411 33.344 -15.506 1.00 11.75 ? 246  ALA A N   1 
ATOM   1112 C  CA  . ALA A 1 150 ? 36.822 32.976 -15.558 1.00 11.29 ? 246  ALA A CA  1 
ATOM   1113 C  C   . ALA A 1 150 ? 37.655 33.998 -14.791 1.00 11.07 ? 246  ALA A C   1 
ATOM   1114 O  O   . ALA A 1 150 ? 38.552 33.638 -14.032 1.00 10.62 ? 246  ALA A O   1 
ATOM   1115 C  CB  . ALA A 1 150 ? 37.298 32.895 -17.007 1.00 11.67 ? 246  ALA A CB  1 
ATOM   1116 N  N   . ARG A 1 151 ? 37.344 35.274 -14.985 1.00 11.10 ? 247  ARG A N   1 
ATOM   1117 C  CA  . ARG A 1 151 ? 38.064 36.337 -14.300 1.00 12.88 ? 247  ARG A CA  1 
ATOM   1118 C  C   . ARG A 1 151 ? 37.841 36.204 -12.795 1.00 11.48 ? 247  ARG A C   1 
ATOM   1119 O  O   . ARG A 1 151 ? 38.779 36.316 -12.005 1.00 11.35 ? 247  ARG A O   1 
ATOM   1120 C  CB  . ARG A 1 151 ? 37.572 37.702 -14.774 1.00 17.27 ? 247  ARG A CB  1 
ATOM   1121 C  CG  . ARG A 1 151 ? 38.347 38.868 -14.189 1.00 25.65 ? 247  ARG A CG  1 
ATOM   1122 C  CD  . ARG A 1 151 ? 39.732 38.971 -14.804 1.00 32.96 ? 247  ARG A CD  1 
ATOM   1123 N  NE  . ARG A 1 151 ? 40.475 40.118 -14.287 1.00 39.20 ? 247  ARG A NE  1 
ATOM   1124 C  CZ  . ARG A 1 151 ? 41.244 40.089 -13.204 1.00 41.96 ? 247  ARG A CZ  1 
ATOM   1125 N  NH1 . ARG A 1 151 ? 41.387 38.965 -12.512 1.00 42.95 ? 247  ARG A NH1 1 
ATOM   1126 N  NH2 . ARG A 1 151 ? 41.862 41.192 -12.807 1.00 43.69 ? 247  ARG A NH2 1 
ATOM   1127 N  N   . PHE A 1 152 ? 36.591 35.971 -12.406 1.00 9.96  ? 248  PHE A N   1 
ATOM   1128 C  CA  . PHE A 1 152 ? 36.257 35.809 -10.993 1.00 8.76  ? 248  PHE A CA  1 
ATOM   1129 C  C   . PHE A 1 152 ? 37.098 34.698 -10.367 1.00 8.86  ? 248  PHE A C   1 
ATOM   1130 O  O   . PHE A 1 152 ? 37.636 34.861 -9.274  1.00 9.14  ? 248  PHE A O   1 
ATOM   1131 C  CB  . PHE A 1 152 ? 34.775 35.465 -10.831 1.00 8.82  ? 248  PHE A CB  1 
ATOM   1132 C  CG  . PHE A 1 152 ? 34.360 35.228 -9.402  1.00 8.05  ? 248  PHE A CG  1 
ATOM   1133 C  CD1 . PHE A 1 152 ? 34.228 36.293 -8.515  1.00 9.83  ? 248  PHE A CD1 1 
ATOM   1134 C  CD2 . PHE A 1 152 ? 34.111 33.937 -8.942  1.00 9.86  ? 248  PHE A CD2 1 
ATOM   1135 C  CE1 . PHE A 1 152 ? 33.853 36.076 -7.186  1.00 8.69  ? 248  PHE A CE1 1 
ATOM   1136 C  CE2 . PHE A 1 152 ? 33.735 33.708 -7.617  1.00 9.42  ? 248  PHE A CE2 1 
ATOM   1137 C  CZ  . PHE A 1 152 ? 33.607 34.781 -6.738  1.00 8.27  ? 248  PHE A CZ  1 
ATOM   1138 N  N   . LEU A 1 153 ? 37.205 33.567 -11.059 1.00 9.66  ? 249  LEU A N   1 
ATOM   1139 C  CA  . LEU A 1 153 ? 37.971 32.435 -10.542 1.00 9.31  ? 249  LEU A CA  1 
ATOM   1140 C  C   . LEU A 1 153 ? 39.462 32.744 -10.429 1.00 10.28 ? 249  LEU A C   1 
ATOM   1141 O  O   . LEU A 1 153 ? 40.126 32.268 -9.505  1.00 9.43  ? 249  LEU A O   1 
ATOM   1142 C  CB  . LEU A 1 153 ? 37.736 31.195 -11.415 1.00 8.82  ? 249  LEU A CB  1 
ATOM   1143 C  CG  . LEU A 1 153 ? 36.283 30.708 -11.405 1.00 13.09 ? 249  LEU A CG  1 
ATOM   1144 C  CD1 . LEU A 1 153 ? 36.127 29.567 -12.393 1.00 13.38 ? 249  LEU A CD1 1 
ATOM   1145 C  CD2 . LEU A 1 153 ? 35.888 30.265 -9.996  1.00 12.31 ? 249  LEU A CD2 1 
ATOM   1146 N  N   . ARG A 1 154 ? 39.999 33.536 -11.355 1.00 9.79  ? 250  ARG A N   1 
ATOM   1147 C  CA  . ARG A 1 154 ? 41.410 33.897 -11.270 1.00 9.23  ? 250  ARG A CA  1 
ATOM   1148 C  C   . ARG A 1 154 ? 41.617 34.851 -10.087 1.00 9.42  ? 250  ARG A C   1 
ATOM   1149 O  O   . ARG A 1 154 ? 42.674 34.852 -9.461  1.00 10.80 ? 250  ARG A O   1 
ATOM   1150 C  CB  . ARG A 1 154 ? 41.899 34.549 -12.573 1.00 10.09 ? 250  ARG A CB  1 
ATOM   1151 C  CG  . ARG A 1 154 ? 41.905 33.591 -13.770 1.00 10.89 ? 250  ARG A CG  1 
ATOM   1152 C  CD  . ARG A 1 154 ? 42.923 34.015 -14.832 1.00 12.35 ? 250  ARG A CD  1 
ATOM   1153 N  NE  . ARG A 1 154 ? 42.692 35.372 -15.318 1.00 14.15 ? 250  ARG A NE  1 
ATOM   1154 C  CZ  . ARG A 1 154 ? 41.768 35.713 -16.213 1.00 12.84 ? 250  ARG A CZ  1 
ATOM   1155 N  NH1 . ARG A 1 154 ? 40.968 34.793 -16.744 1.00 12.74 ? 250  ARG A NH1 1 
ATOM   1156 N  NH2 . ARG A 1 154 ? 41.642 36.985 -16.573 1.00 13.32 ? 250  ARG A NH2 1 
HETATM 1157 N  N   . MSE A 1 155 ? 40.603 35.660 -9.786  1.00 8.99  ? 251  MSE A N   1 
HETATM 1158 C  CA  . MSE A 1 155 ? 40.693 36.585 -8.664  1.00 7.90  ? 251  MSE A CA  1 
HETATM 1159 C  C   . MSE A 1 155 ? 40.728 35.785 -7.368  1.00 8.49  ? 251  MSE A C   1 
HETATM 1160 O  O   . MSE A 1 155 ? 41.453 36.134 -6.441  1.00 8.06  ? 251  MSE A O   1 
HETATM 1161 C  CB  . MSE A 1 155 ? 39.503 37.546 -8.655  1.00 10.28 ? 251  MSE A CB  1 
HETATM 1162 C  CG  . MSE A 1 155 ? 39.546 38.555 -9.787  1.00 10.58 ? 251  MSE A CG  1 
HETATM 1163 SE SE  . MSE A 1 155 ? 37.927 39.597 -9.882  1.00 19.52 ? 251  MSE A SE  1 
HETATM 1164 C  CE  . MSE A 1 155 ? 38.253 40.781 -8.392  1.00 16.71 ? 251  MSE A CE  1 
ATOM   1165 N  N   . LEU A 1 156 ? 39.946 34.708 -7.306  1.00 8.09  ? 252  LEU A N   1 
ATOM   1166 C  CA  . LEU A 1 156 ? 39.936 33.873 -6.109  1.00 8.04  ? 252  LEU A CA  1 
ATOM   1167 C  C   . LEU A 1 156 ? 41.314 33.262 -5.899  1.00 9.42  ? 252  LEU A C   1 
ATOM   1168 O  O   . LEU A 1 156 ? 41.800 33.177 -4.771  1.00 9.61  ? 252  LEU A O   1 
ATOM   1169 C  CB  . LEU A 1 156 ? 38.891 32.757 -6.222  1.00 8.32  ? 252  LEU A CB  1 
ATOM   1170 C  CG  . LEU A 1 156 ? 37.411 33.159 -6.168  1.00 8.66  ? 252  LEU A CG  1 
ATOM   1171 C  CD1 . LEU A 1 156 ? 36.544 31.914 -6.288  1.00 9.22  ? 252  LEU A CD1 1 
ATOM   1172 C  CD2 . LEU A 1 156 ? 37.104 33.889 -4.867  1.00 9.32  ? 252  LEU A CD2 1 
ATOM   1173 N  N   . LEU A 1 157 ? 41.944 32.834 -6.990  1.00 9.24  ? 253  LEU A N   1 
ATOM   1174 C  CA  . LEU A 1 157 ? 43.271 32.239 -6.910  1.00 11.62 ? 253  LEU A CA  1 
ATOM   1175 C  C   . LEU A 1 157 ? 44.276 33.279 -6.413  1.00 11.13 ? 253  LEU A C   1 
ATOM   1176 O  O   . LEU A 1 157 ? 45.169 32.960 -5.627  1.00 11.41 ? 253  LEU A O   1 
ATOM   1177 C  CB  . LEU A 1 157 ? 43.696 31.706 -8.282  1.00 13.39 ? 253  LEU A CB  1 
ATOM   1178 C  CG  . LEU A 1 157 ? 45.049 30.990 -8.331  1.00 17.43 ? 253  LEU A CG  1 
ATOM   1179 C  CD1 . LEU A 1 157 ? 45.023 29.793 -7.394  1.00 20.44 ? 253  LEU A CD1 1 
ATOM   1180 C  CD2 . LEU A 1 157 ? 45.351 30.550 -9.761  1.00 20.02 ? 253  LEU A CD2 1 
ATOM   1181 N  N   . ARG A 1 158 ? 44.129 34.520 -6.871  1.00 11.69 ? 254  ARG A N   1 
ATOM   1182 C  CA  . ARG A 1 158 ? 45.022 35.600 -6.450  1.00 13.18 ? 254  ARG A CA  1 
ATOM   1183 C  C   . ARG A 1 158 ? 44.860 35.835 -4.943  1.00 12.40 ? 254  ARG A C   1 
ATOM   1184 O  O   . ARG A 1 158 ? 45.843 36.054 -4.233  1.00 13.42 ? 254  ARG A O   1 
ATOM   1185 C  CB  . ARG A 1 158 ? 44.700 36.888 -7.219  1.00 15.17 ? 254  ARG A CB  1 
ATOM   1186 C  CG  . ARG A 1 158 ? 45.686 38.045 -7.004  1.00 21.07 ? 254  ARG A CG  1 
ATOM   1187 C  CD  . ARG A 1 158 ? 47.047 37.763 -7.645  1.00 26.19 ? 254  ARG A CD  1 
ATOM   1188 N  NE  . ARG A 1 158 ? 47.962 37.064 -6.746  1.00 35.54 ? 254  ARG A NE  1 
ATOM   1189 C  CZ  . ARG A 1 158 ? 48.623 37.648 -5.751  1.00 38.24 ? 254  ARG A CZ  1 
ATOM   1190 N  NH1 . ARG A 1 158 ? 48.474 38.948 -5.527  1.00 41.13 ? 254  ARG A NH1 1 
ATOM   1191 N  NH2 . ARG A 1 158 ? 49.434 36.934 -4.979  1.00 39.76 ? 254  ARG A NH2 1 
ATOM   1192 N  N   . LEU A 1 159 ? 43.623 35.788 -4.452  1.00 11.26 ? 255  LEU A N   1 
ATOM   1193 C  CA  . LEU A 1 159 ? 43.383 35.977 -3.023  1.00 11.62 ? 255  LEU A CA  1 
ATOM   1194 C  C   . LEU A 1 159 ? 44.043 34.852 -2.226  1.00 12.01 ? 255  LEU A C   1 
ATOM   1195 O  O   . LEU A 1 159 ? 44.672 35.103 -1.197  1.00 10.55 ? 255  LEU A O   1 
ATOM   1196 C  CB  . LEU A 1 159 ? 41.879 36.014 -2.717  1.00 12.84 ? 255  LEU A CB  1 
ATOM   1197 C  CG  . LEU A 1 159 ? 41.140 37.298 -3.105  1.00 17.32 ? 255  LEU A CG  1 
ATOM   1198 C  CD1 . LEU A 1 159 ? 39.664 37.180 -2.748  1.00 15.50 ? 255  LEU A CD1 1 
ATOM   1199 C  CD2 . LEU A 1 159 ? 41.770 38.479 -2.372  1.00 16.31 ? 255  LEU A CD2 1 
ATOM   1200 N  N   . ALA A 1 160 ? 43.901 33.616 -2.701  1.00 12.67 ? 256  ALA A N   1 
ATOM   1201 C  CA  . ALA A 1 160 ? 44.507 32.474 -2.017  1.00 14.15 ? 256  ALA A CA  1 
ATOM   1202 C  C   . ALA A 1 160 ? 46.029 32.614 -1.996  1.00 15.50 ? 256  ALA A C   1 
ATOM   1203 O  O   . ALA A 1 160 ? 46.671 32.310 -0.988  1.00 17.69 ? 256  ALA A O   1 
ATOM   1204 C  CB  . ALA A 1 160 ? 44.103 31.165 -2.701  1.00 12.71 ? 256  ALA A CB  1 
ATOM   1205 N  N   . ASP A 1 161 ? 46.601 33.077 -3.106  1.00 16.20 ? 257  ASP A N   1 
ATOM   1206 C  CA  . ASP A 1 161 ? 48.050 33.266 -3.209  1.00 18.87 ? 257  ASP A CA  1 
ATOM   1207 C  C   . ASP A 1 161 ? 48.536 34.380 -2.296  1.00 18.97 ? 257  ASP A C   1 
ATOM   1208 O  O   . ASP A 1 161 ? 49.505 34.227 -1.552  1.00 19.55 ? 257  ASP A O   1 
ATOM   1209 C  CB  . ASP A 1 161 ? 48.465 33.654 -4.633  1.00 20.67 ? 257  ASP A CB  1 
ATOM   1210 C  CG  . ASP A 1 161 ? 48.336 32.520 -5.621  1.00 25.45 ? 257  ASP A CG  1 
ATOM   1211 O  OD1 . ASP A 1 161 ? 48.382 31.348 -5.202  1.00 26.70 ? 257  ASP A OD1 1 
ATOM   1212 O  OD2 . ASP A 1 161 ? 48.210 32.812 -6.830  1.00 27.63 ? 257  ASP A OD2 1 
ATOM   1213 N  N   . GLU A 1 162 ? 47.852 35.512 -2.374  1.00 15.45 ? 258  GLU A N   1 
ATOM   1214 C  CA  . GLU A 1 162 ? 48.214 36.695 -1.613  1.00 15.96 ? 258  GLU A CA  1 
ATOM   1215 C  C   . GLU A 1 162 ? 48.098 36.580 -0.100  1.00 15.06 ? 258  GLU A C   1 
ATOM   1216 O  O   . GLU A 1 162 ? 49.035 36.918 0.627   1.00 14.21 ? 258  GLU A O   1 
ATOM   1217 C  CB  . GLU A 1 162 ? 47.364 37.874 -2.090  1.00 15.35 ? 258  GLU A CB  1 
ATOM   1218 C  CG  . GLU A 1 162 ? 47.812 39.233 -1.579  1.00 19.78 ? 258  GLU A CG  1 
ATOM   1219 C  CD  . GLU A 1 162 ? 49.205 39.596 -2.052  1.00 21.75 ? 258  GLU A CD  1 
ATOM   1220 O  OE1 . GLU A 1 162 ? 49.551 39.254 -3.204  1.00 24.81 ? 258  GLU A OE1 1 
ATOM   1221 O  OE2 . GLU A 1 162 ? 49.949 40.232 -1.277  1.00 24.19 ? 258  GLU A OE2 1 
ATOM   1222 N  N   . PHE A 1 163 ? 46.953 36.092 0.365   1.00 12.81 ? 259  PHE A N   1 
ATOM   1223 C  CA  . PHE A 1 163 ? 46.678 36.003 1.794   1.00 12.40 ? 259  PHE A CA  1 
ATOM   1224 C  C   . PHE A 1 163 ? 46.828 34.642 2.461   1.00 13.00 ? 259  PHE A C   1 
ATOM   1225 O  O   . PHE A 1 163 ? 46.724 34.539 3.684   1.00 14.38 ? 259  PHE A O   1 
ATOM   1226 C  CB  . PHE A 1 163 ? 45.275 36.549 2.048   1.00 14.06 ? 259  PHE A CB  1 
ATOM   1227 C  CG  . PHE A 1 163 ? 45.103 37.973 1.612   1.00 13.57 ? 259  PHE A CG  1 
ATOM   1228 C  CD1 . PHE A 1 163 ? 45.752 39.002 2.290   1.00 15.40 ? 259  PHE A CD1 1 
ATOM   1229 C  CD2 . PHE A 1 163 ? 44.322 38.288 0.505   1.00 13.21 ? 259  PHE A CD2 1 
ATOM   1230 C  CE1 . PHE A 1 163 ? 45.625 40.326 1.872   1.00 14.07 ? 259  PHE A CE1 1 
ATOM   1231 C  CE2 . PHE A 1 163 ? 44.188 39.610 0.078   1.00 13.61 ? 259  PHE A CE2 1 
ATOM   1232 C  CZ  . PHE A 1 163 ? 44.842 40.631 0.763   1.00 15.29 ? 259  PHE A CZ  1 
ATOM   1233 N  N   . GLY A 1 164 ? 47.068 33.604 1.668   1.00 12.99 ? 260  GLY A N   1 
ATOM   1234 C  CA  . GLY A 1 164 ? 47.242 32.276 2.227   1.00 13.13 ? 260  GLY A CA  1 
ATOM   1235 C  C   . GLY A 1 164 ? 45.980 31.705 2.844   1.00 14.85 ? 260  GLY A C   1 
ATOM   1236 O  O   . GLY A 1 164 ? 46.039 30.916 3.785   1.00 17.57 ? 260  GLY A O   1 
ATOM   1237 N  N   . VAL A 1 165 ? 44.832 32.120 2.330   1.00 12.38 ? 261  VAL A N   1 
ATOM   1238 C  CA  . VAL A 1 165 ? 43.568 31.615 2.843   1.00 11.17 ? 261  VAL A CA  1 
ATOM   1239 C  C   . VAL A 1 165 ? 43.118 30.429 2.021   1.00 10.55 ? 261  VAL A C   1 
ATOM   1240 O  O   . VAL A 1 165 ? 43.524 30.265 0.871   1.00 11.12 ? 261  VAL A O   1 
ATOM   1241 C  CB  . VAL A 1 165 ? 42.446 32.672 2.766   1.00 12.70 ? 261  VAL A CB  1 
ATOM   1242 C  CG1 . VAL A 1 165 ? 42.764 33.841 3.681   1.00 13.51 ? 261  VAL A CG1 1 
ATOM   1243 C  CG2 . VAL A 1 165 ? 42.274 33.140 1.334   1.00 13.33 ? 261  VAL A CG2 1 
ATOM   1244 N  N   . ALA A 1 166 ? 42.285 29.594 2.623   1.00 8.95  ? 262  ALA A N   1 
ATOM   1245 C  CA  . ALA A 1 166 ? 41.727 28.464 1.911   1.00 7.48  ? 262  ALA A CA  1 
ATOM   1246 C  C   . ALA A 1 166 ? 40.508 29.059 1.224   1.00 8.31  ? 262  ALA A C   1 
ATOM   1247 O  O   . ALA A 1 166 ? 39.759 29.815 1.842   1.00 11.69 ? 262  ALA A O   1 
ATOM   1248 C  CB  . ALA A 1 166 ? 41.299 27.378 2.886   1.00 8.32  ? 262  ALA A CB  1 
ATOM   1249 N  N   . VAL A 1 167 ? 40.322 28.746 -0.053  1.00 6.91  ? 263  VAL A N   1 
ATOM   1250 C  CA  . VAL A 1 167 ? 39.160 29.236 -0.781  1.00 8.79  ? 263  VAL A CA  1 
ATOM   1251 C  C   . VAL A 1 167 ? 38.330 28.020 -1.150  1.00 7.77  ? 263  VAL A C   1 
ATOM   1252 O  O   . VAL A 1 167 ? 38.807 27.124 -1.842  1.00 10.31 ? 263  VAL A O   1 
ATOM   1253 C  CB  . VAL A 1 167 ? 39.563 29.988 -2.064  1.00 6.94  ? 263  VAL A CB  1 
ATOM   1254 C  CG1 . VAL A 1 167 ? 38.314 30.359 -2.868  1.00 9.46  ? 263  VAL A CG1 1 
ATOM   1255 C  CG2 . VAL A 1 167 ? 40.349 31.238 -1.698  1.00 9.49  ? 263  VAL A CG2 1 
ATOM   1256 N  N   . VAL A 1 168 ? 37.094 27.984 -0.664  1.00 8.77  ? 264  VAL A N   1 
ATOM   1257 C  CA  . VAL A 1 168 ? 36.196 26.870 -0.933  1.00 8.22  ? 264  VAL A CA  1 
ATOM   1258 C  C   . VAL A 1 168 ? 34.984 27.389 -1.686  1.00 9.72  ? 264  VAL A C   1 
ATOM   1259 O  O   . VAL A 1 168 ? 34.284 28.280 -1.205  1.00 11.71 ? 264  VAL A O   1 
ATOM   1260 C  CB  . VAL A 1 168 ? 35.721 26.217 0.381   1.00 8.51  ? 264  VAL A CB  1 
ATOM   1261 C  CG1 . VAL A 1 168 ? 34.704 25.114 0.082   1.00 10.31 ? 264  VAL A CG1 1 
ATOM   1262 C  CG2 . VAL A 1 168 ? 36.912 25.668 1.148   1.00 9.45  ? 264  VAL A CG2 1 
ATOM   1263 N  N   . ILE A 1 169 ? 34.738 26.837 -2.868  1.00 10.40 ? 265  ILE A N   1 
ATOM   1264 C  CA  . ILE A 1 169 ? 33.600 27.263 -3.660  1.00 10.29 ? 265  ILE A CA  1 
ATOM   1265 C  C   . ILE A 1 169 ? 32.748 26.063 -4.034  1.00 10.17 ? 265  ILE A C   1 
ATOM   1266 O  O   . ILE A 1 169 ? 33.236 24.935 -4.084  1.00 9.91  ? 265  ILE A O   1 
ATOM   1267 C  CB  . ILE A 1 169 ? 34.047 27.971 -4.957  1.00 10.14 ? 265  ILE A CB  1 
ATOM   1268 C  CG1 . ILE A 1 169 ? 34.708 26.966 -5.907  1.00 12.27 ? 265  ILE A CG1 1 
ATOM   1269 C  CG2 . ILE A 1 169 ? 35.016 29.101 -4.621  1.00 11.21 ? 265  ILE A CG2 1 
ATOM   1270 C  CD1 . ILE A 1 169 ? 35.143 27.565 -7.238  1.00 13.03 ? 265  ILE A CD1 1 
ATOM   1271 N  N   . THR A 1 170 ? 31.470 26.305 -4.282  1.00 8.88  ? 266  THR A N   1 
ATOM   1272 C  CA  . THR A 1 170 ? 30.584 25.225 -4.676  1.00 9.58  ? 266  THR A CA  1 
ATOM   1273 C  C   . THR A 1 170 ? 30.161 25.483 -6.112  1.00 11.50 ? 266  THR A C   1 
ATOM   1274 O  O   . THR A 1 170 ? 30.132 26.628 -6.565  1.00 12.79 ? 266  THR A O   1 
ATOM   1275 C  CB  . THR A 1 170 ? 29.349 25.134 -3.760  1.00 10.99 ? 266  THR A CB  1 
ATOM   1276 O  OG1 . THR A 1 170 ? 28.518 26.287 -3.941  1.00 12.11 ? 266  THR A OG1 1 
ATOM   1277 C  CG2 . THR A 1 170 ? 29.785 25.052 -2.301  1.00 12.65 ? 266  THR A CG2 1 
ATOM   1278 N  N   . ASN A 1 171 ? 29.850 24.410 -6.828  1.00 12.20 ? 267  ASN A N   1 
ATOM   1279 C  CA  . ASN A 1 171 ? 29.465 24.504 -8.227  1.00 13.60 ? 267  ASN A CA  1 
ATOM   1280 C  C   . ASN A 1 171 ? 28.391 23.458 -8.494  1.00 15.70 ? 267  ASN A C   1 
ATOM   1281 O  O   . ASN A 1 171 ? 28.267 22.495 -7.738  1.00 15.21 ? 267  ASN A O   1 
ATOM   1282 C  CB  . ASN A 1 171 ? 30.686 24.223 -9.103  1.00 14.59 ? 267  ASN A CB  1 
ATOM   1283 C  CG  . ASN A 1 171 ? 30.539 24.763 -10.510 1.00 17.75 ? 267  ASN A CG  1 
ATOM   1284 O  OD1 . ASN A 1 171 ? 29.429 24.953 -11.008 1.00 19.43 ? 267  ASN A OD1 1 
ATOM   1285 N  ND2 . ASN A 1 171 ? 31.667 25.002 -11.166 1.00 17.66 ? 267  ASN A ND2 1 
ATOM   1286 N  N   . ALA A 1 197 ? 40.359 24.063 -14.750 1.00 25.75 ? 293  ALA A N   1 
ATOM   1287 C  CA  . ALA A 1 197 ? 40.748 24.289 -13.361 1.00 26.09 ? 293  ALA A CA  1 
ATOM   1288 C  C   . ALA A 1 197 ? 42.263 24.395 -13.226 1.00 26.19 ? 293  ALA A C   1 
ATOM   1289 O  O   . ALA A 1 197 ? 43.008 23.745 -13.960 1.00 26.65 ? 293  ALA A O   1 
ATOM   1290 C  CB  . ALA A 1 197 ? 40.228 23.156 -12.482 1.00 26.24 ? 293  ALA A CB  1 
ATOM   1291 N  N   . HIS A 1 198 ? 42.712 25.216 -12.283 1.00 24.21 ? 294  HIS A N   1 
ATOM   1292 C  CA  . HIS A 1 198 ? 44.140 25.393 -12.051 1.00 23.37 ? 294  HIS A CA  1 
ATOM   1293 C  C   . HIS A 1 198 ? 44.713 24.110 -11.463 1.00 21.69 ? 294  HIS A C   1 
ATOM   1294 O  O   . HIS A 1 198 ? 43.996 23.323 -10.841 1.00 20.98 ? 294  HIS A O   1 
ATOM   1295 C  CB  . HIS A 1 198 ? 44.377 26.568 -11.098 1.00 23.08 ? 294  HIS A CB  1 
ATOM   1296 C  CG  . HIS A 1 198 ? 45.820 26.933 -10.933 1.00 25.13 ? 294  HIS A CG  1 
ATOM   1297 N  ND1 . HIS A 1 198 ? 46.605 26.429 -9.919  1.00 24.49 ? 294  HIS A ND1 1 
ATOM   1298 C  CD2 . HIS A 1 198 ? 46.623 27.742 -11.665 1.00 25.75 ? 294  HIS A CD2 1 
ATOM   1299 C  CE1 . HIS A 1 198 ? 47.831 26.914 -10.032 1.00 26.77 ? 294  HIS A CE1 1 
ATOM   1300 N  NE2 . HIS A 1 198 ? 47.867 27.712 -11.084 1.00 26.73 ? 294  HIS A NE2 1 
ATOM   1301 N  N   . ALA A 1 199 ? 46.006 23.897 -11.672 1.00 20.58 ? 295  ALA A N   1 
ATOM   1302 C  CA  . ALA A 1 199 ? 46.677 22.704 -11.173 1.00 20.25 ? 295  ALA A CA  1 
ATOM   1303 C  C   . ALA A 1 199 ? 46.534 22.525 -9.662  1.00 19.38 ? 295  ALA A C   1 
ATOM   1304 O  O   . ALA A 1 199 ? 46.484 21.397 -9.170  1.00 20.16 ? 295  ALA A O   1 
ATOM   1305 C  CB  . ALA A 1 199 ? 48.154 22.749 -11.553 1.00 20.07 ? 295  ALA A CB  1 
ATOM   1306 N  N   . SER A 1 200 ? 46.451 23.632 -8.930  1.00 18.12 ? 296  SER A N   1 
ATOM   1307 C  CA  . SER A 1 200 ? 46.341 23.574 -7.472  1.00 17.16 ? 296  SER A CA  1 
ATOM   1308 C  C   . SER A 1 200 ? 44.929 23.347 -6.943  1.00 18.00 ? 296  SER A C   1 
ATOM   1309 O  O   . SER A 1 200 ? 44.744 23.083 -5.755  1.00 17.02 ? 296  SER A O   1 
ATOM   1310 C  CB  . SER A 1 200 ? 46.902 24.858 -6.853  1.00 17.73 ? 296  SER A CB  1 
ATOM   1311 O  OG  . SER A 1 200 ? 46.143 25.993 -7.244  1.00 17.47 ? 296  SER A OG  1 
ATOM   1312 N  N   . THR A 1 201 ? 43.934 23.438 -7.816  1.00 15.86 ? 297  THR A N   1 
ATOM   1313 C  CA  . THR A 1 201 ? 42.552 23.259 -7.393  1.00 16.19 ? 297  THR A CA  1 
ATOM   1314 C  C   . THR A 1 201 ? 42.186 21.804 -7.121  1.00 16.88 ? 297  THR A C   1 
ATOM   1315 O  O   . THR A 1 201 ? 42.511 20.910 -7.899  1.00 19.37 ? 297  THR A O   1 
ATOM   1316 C  CB  . THR A 1 201 ? 41.580 23.837 -8.446  1.00 16.61 ? 297  THR A CB  1 
ATOM   1317 O  OG1 . THR A 1 201 ? 41.795 25.249 -8.558  1.00 19.45 ? 297  THR A OG1 1 
ATOM   1318 C  CG2 . THR A 1 201 ? 40.130 23.589 -8.042  1.00 18.10 ? 297  THR A CG2 1 
ATOM   1319 N  N   . THR A 1 202 ? 41.522 21.579 -5.993  1.00 14.80 ? 298  THR A N   1 
ATOM   1320 C  CA  . THR A 1 202 ? 41.072 20.248 -5.609  1.00 14.89 ? 298  THR A CA  1 
ATOM   1321 C  C   . THR A 1 202 ? 39.581 20.203 -5.890  1.00 13.32 ? 298  THR A C   1 
ATOM   1322 O  O   . THR A 1 202 ? 38.838 21.043 -5.398  1.00 12.51 ? 298  THR A O   1 
ATOM   1323 C  CB  . THR A 1 202 ? 41.282 19.988 -4.103  1.00 16.40 ? 298  THR A CB  1 
ATOM   1324 O  OG1 . THR A 1 202 ? 42.680 19.966 -3.812  1.00 18.58 ? 298  THR A OG1 1 
ATOM   1325 C  CG2 . THR A 1 202 ? 40.672 18.650 -3.697  1.00 18.79 ? 298  THR A CG2 1 
ATOM   1326 N  N   . ARG A 1 203 ? 39.149 19.232 -6.688  1.00 13.14 ? 299  ARG A N   1 
ATOM   1327 C  CA  . ARG A 1 203 ? 37.735 19.094 -7.007  1.00 13.42 ? 299  ARG A CA  1 
ATOM   1328 C  C   . ARG A 1 203 ? 37.101 17.919 -6.276  1.00 13.27 ? 299  ARG A C   1 
ATOM   1329 O  O   . ARG A 1 203 ? 37.580 16.785 -6.365  1.00 16.01 ? 299  ARG A O   1 
ATOM   1330 C  CB  . ARG A 1 203 ? 37.543 18.923 -8.513  1.00 14.70 ? 299  ARG A CB  1 
ATOM   1331 C  CG  . ARG A 1 203 ? 37.595 20.223 -9.282  1.00 15.90 ? 299  ARG A CG  1 
ATOM   1332 C  CD  . ARG A 1 203 ? 37.341 19.992 -10.756 1.00 18.69 ? 299  ARG A CD  1 
ATOM   1333 N  NE  . ARG A 1 203 ? 37.088 21.244 -11.455 1.00 22.79 ? 299  ARG A NE  1 
ATOM   1334 C  CZ  . ARG A 1 203 ? 36.981 21.349 -12.773 1.00 23.75 ? 299  ARG A CZ  1 
ATOM   1335 N  NH1 . ARG A 1 203 ? 37.111 20.271 -13.535 1.00 25.24 ? 299  ARG A NH1 1 
ATOM   1336 N  NH2 . ARG A 1 203 ? 36.738 22.528 -13.327 1.00 24.88 ? 299  ARG A NH2 1 
ATOM   1337 N  N   . LEU A 1 204 ? 36.024 18.201 -5.550  1.00 11.42 ? 300  LEU A N   1 
ATOM   1338 C  CA  . LEU A 1 204 ? 35.302 17.181 -4.799  1.00 12.66 ? 300  LEU A CA  1 
ATOM   1339 C  C   . LEU A 1 204 ? 33.913 17.004 -5.391  1.00 13.73 ? 300  LEU A C   1 
ATOM   1340 O  O   . LEU A 1 204 ? 33.200 17.981 -5.615  1.00 14.00 ? 300  LEU A O   1 
ATOM   1341 C  CB  . LEU A 1 204 ? 35.158 17.594 -3.333  1.00 14.16 ? 300  LEU A CB  1 
ATOM   1342 C  CG  . LEU A 1 204 ? 36.415 18.043 -2.589  1.00 15.24 ? 300  LEU A CG  1 
ATOM   1343 C  CD1 . LEU A 1 204 ? 36.058 18.364 -1.142  1.00 15.73 ? 300  LEU A CD1 1 
ATOM   1344 C  CD2 . LEU A 1 204 ? 37.469 16.963 -2.654  1.00 17.90 ? 300  LEU A CD2 1 
ATOM   1345 N  N   . TYR A 1 205 ? 33.531 15.756 -5.649  1.00 13.54 ? 301  TYR A N   1 
ATOM   1346 C  CA  . TYR A 1 205 ? 32.213 15.463 -6.197  1.00 13.49 ? 301  TYR A CA  1 
ATOM   1347 C  C   . TYR A 1 205 ? 31.390 14.768 -5.122  1.00 13.26 ? 301  TYR A C   1 
ATOM   1348 O  O   . TYR A 1 205 ? 31.678 13.634 -4.741  1.00 14.37 ? 301  TYR A O   1 
ATOM   1349 C  CB  . TYR A 1 205 ? 32.336 14.587 -7.446  1.00 15.65 ? 301  TYR A CB  1 
ATOM   1350 C  CG  . TYR A 1 205 ? 33.051 15.291 -8.577  1.00 17.58 ? 301  TYR A CG  1 
ATOM   1351 C  CD1 . TYR A 1 205 ? 34.443 15.368 -8.606  1.00 18.47 ? 301  TYR A CD1 1 
ATOM   1352 C  CD2 . TYR A 1 205 ? 32.332 15.945 -9.581  1.00 18.30 ? 301  TYR A CD2 1 
ATOM   1353 C  CE1 . TYR A 1 205 ? 35.105 16.079 -9.602  1.00 19.95 ? 301  TYR A CE1 1 
ATOM   1354 C  CE2 . TYR A 1 205 ? 32.985 16.661 -10.583 1.00 20.78 ? 301  TYR A CE2 1 
ATOM   1355 C  CZ  . TYR A 1 205 ? 34.371 16.725 -10.584 1.00 21.42 ? 301  TYR A CZ  1 
ATOM   1356 O  OH  . TYR A 1 205 ? 35.025 17.440 -11.563 1.00 24.94 ? 301  TYR A OH  1 
ATOM   1357 N  N   . LEU A 1 206 ? 30.369 15.465 -4.633  1.00 11.70 ? 302  LEU A N   1 
ATOM   1358 C  CA  . LEU A 1 206 ? 29.518 14.945 -3.570  1.00 12.66 ? 302  LEU A CA  1 
ATOM   1359 C  C   . LEU A 1 206 ? 28.221 14.332 -4.081  1.00 14.19 ? 302  LEU A C   1 
ATOM   1360 O  O   . LEU A 1 206 ? 27.629 14.816 -5.046  1.00 15.47 ? 302  LEU A O   1 
ATOM   1361 C  CB  . LEU A 1 206 ? 29.176 16.067 -2.584  1.00 13.35 ? 302  LEU A CB  1 
ATOM   1362 C  CG  . LEU A 1 206 ? 30.341 16.918 -2.075  1.00 14.08 ? 302  LEU A CG  1 
ATOM   1363 C  CD1 . LEU A 1 206 ? 29.806 18.031 -1.184  1.00 16.90 ? 302  LEU A CD1 1 
ATOM   1364 C  CD2 . LEU A 1 206 ? 31.327 16.046 -1.317  1.00 14.36 ? 302  LEU A CD2 1 
ATOM   1365 N  N   . ARG A 1 207 ? 27.783 13.264 -3.427  1.00 14.19 ? 303  ARG A N   1 
ATOM   1366 C  CA  . ARG A 1 207 ? 26.531 12.624 -3.796  1.00 16.12 ? 303  ARG A CA  1 
ATOM   1367 C  C   . ARG A 1 207 ? 25.846 12.099 -2.543  1.00 17.08 ? 303  ARG A C   1 
ATOM   1368 O  O   . ARG A 1 207 ? 26.469 11.966 -1.485  1.00 15.73 ? 303  ARG A O   1 
ATOM   1369 C  CB  . ARG A 1 207 ? 26.757 11.496 -4.807  1.00 16.82 ? 303  ARG A CB  1 
ATOM   1370 C  CG  . ARG A 1 207 ? 27.559 10.303 -4.318  1.00 18.49 ? 303  ARG A CG  1 
ATOM   1371 C  CD  . ARG A 1 207 ? 27.532 9.215  -5.390  1.00 20.58 ? 303  ARG A CD  1 
ATOM   1372 N  NE  . ARG A 1 207 ? 28.155 7.963  -4.968  1.00 22.33 ? 303  ARG A NE  1 
ATOM   1373 C  CZ  . ARG A 1 207 ? 29.466 7.745  -4.928  1.00 24.00 ? 303  ARG A CZ  1 
ATOM   1374 N  NH1 . ARG A 1 207 ? 30.318 8.698  -5.286  1.00 24.08 ? 303  ARG A NH1 1 
ATOM   1375 N  NH2 . ARG A 1 207 ? 29.926 6.561  -4.541  1.00 24.43 ? 303  ARG A NH2 1 
ATOM   1376 N  N   . LYS A 1 208 ? 24.556 11.810 -2.659  1.00 16.79 ? 304  LYS A N   1 
ATOM   1377 C  CA  . LYS A 1 208 ? 23.812 11.334 -1.511  1.00 17.94 ? 304  LYS A CA  1 
ATOM   1378 C  C   . LYS A 1 208 ? 24.025 9.868  -1.172  1.00 16.85 ? 304  LYS A C   1 
ATOM   1379 O  O   . LYS A 1 208 ? 24.151 9.015  -2.055  1.00 18.41 ? 304  LYS A O   1 
ATOM   1380 C  CB  . LYS A 1 208 ? 22.314 11.601 -1.690  1.00 18.58 ? 304  LYS A CB  1 
ATOM   1381 C  CG  . LYS A 1 208 ? 21.506 11.138 -0.488  1.00 22.70 ? 304  LYS A CG  1 
ATOM   1382 C  CD  . LYS A 1 208 ? 20.282 11.987 -0.235  1.00 24.03 ? 304  LYS A CD  1 
ATOM   1383 C  CE  . LYS A 1 208 ? 19.806 11.807 1.199   1.00 21.77 ? 304  LYS A CE  1 
ATOM   1384 N  NZ  . LYS A 1 208 ? 19.638 10.368 1.563   1.00 19.38 ? 304  LYS A NZ  1 
ATOM   1385 N  N   . GLY A 1 209 ? 24.089 9.604  0.128   1.00 16.74 ? 305  GLY A N   1 
ATOM   1386 C  CA  . GLY A 1 209 ? 24.237 8.254  0.637   1.00 16.44 ? 305  GLY A CA  1 
ATOM   1387 C  C   . GLY A 1 209 ? 22.957 7.994  1.404   1.00 16.49 ? 305  GLY A C   1 
ATOM   1388 O  O   . GLY A 1 209 ? 22.066 8.843  1.414   1.00 16.52 ? 305  GLY A O   1 
ATOM   1389 N  N   . ARG A 1 210 ? 22.838 6.844  2.057   1.00 17.03 ? 306  ARG A N   1 
ATOM   1390 C  CA  . ARG A 1 210 ? 21.614 6.569  2.798   1.00 18.22 ? 306  ARG A CA  1 
ATOM   1391 C  C   . ARG A 1 210 ? 21.448 7.493  4.002   1.00 16.95 ? 306  ARG A C   1 
ATOM   1392 O  O   . ARG A 1 210 ? 22.409 7.795  4.710   1.00 16.27 ? 306  ARG A O   1 
ATOM   1393 C  CB  . ARG A 1 210 ? 21.575 5.110  3.261   1.00 21.45 ? 306  ARG A CB  1 
ATOM   1394 C  CG  . ARG A 1 210 ? 20.253 4.741  3.913   1.00 27.33 ? 306  ARG A CG  1 
ATOM   1395 C  CD  . ARG A 1 210 ? 20.090 3.243  4.113   1.00 32.41 ? 306  ARG A CD  1 
ATOM   1396 N  NE  . ARG A 1 210 ? 21.051 2.699  5.067   1.00 36.11 ? 306  ARG A NE  1 
ATOM   1397 C  CZ  . ARG A 1 210 ? 20.914 1.520  5.662   1.00 37.74 ? 306  ARG A CZ  1 
ATOM   1398 N  NH1 . ARG A 1 210 ? 19.853 0.768  5.399   1.00 39.22 ? 306  ARG A NH1 1 
ATOM   1399 N  NH2 . ARG A 1 210 ? 21.831 1.092  6.520   1.00 39.30 ? 306  ARG A NH2 1 
ATOM   1400 N  N   . GLY A 1 211 ? 20.220 7.954  4.221   1.00 16.74 ? 307  GLY A N   1 
ATOM   1401 C  CA  . GLY A 1 211 ? 19.946 8.824  5.350   1.00 14.78 ? 307  GLY A CA  1 
ATOM   1402 C  C   . GLY A 1 211 ? 20.798 10.080 5.393   1.00 16.48 ? 307  GLY A C   1 
ATOM   1403 O  O   . GLY A 1 211 ? 20.848 10.843 4.426   1.00 15.11 ? 307  GLY A O   1 
ATOM   1404 N  N   . GLU A 1 212 ? 21.476 10.289 6.519   1.00 16.48 ? 308  GLU A N   1 
ATOM   1405 C  CA  . GLU A 1 212 ? 22.318 11.467 6.694   1.00 17.56 ? 308  GLU A CA  1 
ATOM   1406 C  C   . GLU A 1 212 ? 23.726 11.301 6.132   1.00 16.66 ? 308  GLU A C   1 
ATOM   1407 O  O   . GLU A 1 212 ? 24.532 12.235 6.185   1.00 15.98 ? 308  GLU A O   1 
ATOM   1408 C  CB  . GLU A 1 212 ? 22.399 11.838 8.182   1.00 19.01 ? 308  GLU A CB  1 
ATOM   1409 C  CG  . GLU A 1 212 ? 23.297 10.947 9.053   1.00 21.25 ? 308  GLU A CG  1 
ATOM   1410 C  CD  . GLU A 1 212 ? 22.828 9.501  9.145   1.00 24.06 ? 308  GLU A CD  1 
ATOM   1411 O  OE1 . GLU A 1 212 ? 21.610 9.266  9.285   1.00 23.79 ? 308  GLU A OE1 1 
ATOM   1412 O  OE2 . GLU A 1 212 ? 23.686 8.595  9.095   1.00 26.02 ? 308  GLU A OE2 1 
ATOM   1413 N  N   . THR A 1 213 ? 24.032 10.127 5.586   1.00 14.19 ? 309  THR A N   1 
ATOM   1414 C  CA  . THR A 1 213 ? 25.367 9.899  5.044   1.00 15.36 ? 309  THR A CA  1 
ATOM   1415 C  C   . THR A 1 213 ? 25.507 10.461 3.637   1.00 14.74 ? 309  THR A C   1 
ATOM   1416 O  O   . THR A 1 213 ? 24.535 10.565 2.886   1.00 14.98 ? 309  THR A O   1 
ATOM   1417 C  CB  . THR A 1 213 ? 25.741 8.396  5.038   1.00 16.75 ? 309  THR A CB  1 
ATOM   1418 O  OG1 . THR A 1 213 ? 24.944 7.694  4.077   1.00 17.63 ? 309  THR A OG1 1 
ATOM   1419 C  CG2 . THR A 1 213 ? 25.515 7.794  6.416   1.00 17.50 ? 309  THR A CG2 1 
ATOM   1420 N  N   . ARG A 1 214 ? 26.730 10.843 3.296   1.00 14.85 ? 310  ARG A N   1 
ATOM   1421 C  CA  . ARG A 1 214 ? 27.027 11.410 1.989   1.00 14.16 ? 310  ARG A CA  1 
ATOM   1422 C  C   . ARG A 1 214 ? 28.362 10.846 1.532   1.00 13.62 ? 310  ARG A C   1 
ATOM   1423 O  O   . ARG A 1 214 ? 29.150 10.355 2.343   1.00 14.37 ? 310  ARG A O   1 
ATOM   1424 C  CB  . ARG A 1 214 ? 27.110 12.938 2.092   1.00 13.55 ? 310  ARG A CB  1 
ATOM   1425 C  CG  . ARG A 1 214 ? 25.824 13.620 2.565   1.00 14.48 ? 310  ARG A CG  1 
ATOM   1426 C  CD  . ARG A 1 214 ? 24.745 13.562 1.493   1.00 14.76 ? 310  ARG A CD  1 
ATOM   1427 N  NE  . ARG A 1 214 ? 23.552 14.340 1.830   1.00 15.70 ? 310  ARG A NE  1 
ATOM   1428 C  CZ  . ARG A 1 214 ? 22.574 13.926 2.632   1.00 16.49 ? 310  ARG A CZ  1 
ATOM   1429 N  NH1 . ARG A 1 214 ? 22.634 12.730 3.199   1.00 14.99 ? 310  ARG A NH1 1 
ATOM   1430 N  NH2 . ARG A 1 214 ? 21.523 14.708 2.854   1.00 15.34 ? 310  ARG A NH2 1 
ATOM   1431 N  N   . ILE A 1 215 ? 28.619 10.911 0.234   1.00 13.83 ? 311  ILE A N   1 
ATOM   1432 C  CA  . ILE A 1 215 ? 29.871 10.404 -0.297  1.00 15.05 ? 311  ILE A CA  1 
ATOM   1433 C  C   . ILE A 1 215 ? 30.599 11.477 -1.095  1.00 14.37 ? 311  ILE A C   1 
ATOM   1434 O  O   . ILE A 1 215 ? 29.989 12.222 -1.866  1.00 14.03 ? 311  ILE A O   1 
ATOM   1435 C  CB  . ILE A 1 215 ? 29.633 9.181  -1.206  1.00 17.49 ? 311  ILE A CB  1 
ATOM   1436 C  CG1 . ILE A 1 215 ? 28.929 8.079  -0.412  1.00 21.16 ? 311  ILE A CG1 1 
ATOM   1437 C  CG2 . ILE A 1 215 ? 30.958 8.671  -1.751  1.00 19.53 ? 311  ILE A CG2 1 
ATOM   1438 C  CD1 . ILE A 1 215 ? 28.447 6.931  -1.269  1.00 24.48 ? 311  ILE A CD1 1 
ATOM   1439 N  N   . CYS A 1 216 ? 31.907 11.560 -0.884  1.00 13.85 ? 312  CYS A N   1 
ATOM   1440 C  CA  . CYS A 1 216 ? 32.741 12.519 -1.588  1.00 13.35 ? 312  CYS A CA  1 
ATOM   1441 C  C   . CYS A 1 216 ? 33.718 11.728 -2.440  1.00 14.32 ? 312  CYS A C   1 
ATOM   1442 O  O   . CYS A 1 216 ? 34.361 10.793 -1.956  1.00 14.42 ? 312  CYS A O   1 
ATOM   1443 C  CB  . CYS A 1 216 ? 33.516 13.393 -0.597  1.00 13.04 ? 312  CYS A CB  1 
ATOM   1444 S  SG  . CYS A 1 216 ? 34.710 14.505 -1.391  1.00 16.96 ? 312  CYS A SG  1 
ATOM   1445 N  N   . LYS A 1 217 ? 33.825 12.097 -3.710  1.00 14.16 ? 313  LYS A N   1 
ATOM   1446 C  CA  . LYS A 1 217 ? 34.733 11.408 -4.610  1.00 15.69 ? 313  LYS A CA  1 
ATOM   1447 C  C   . LYS A 1 217 ? 35.692 12.396 -5.258  1.00 16.66 ? 313  LYS A C   1 
ATOM   1448 O  O   . LYS A 1 217 ? 35.300 13.510 -5.610  1.00 15.05 ? 313  LYS A O   1 
ATOM   1449 C  CB  . LYS A 1 217 ? 33.940 10.672 -5.693  1.00 18.29 ? 313  LYS A CB  1 
ATOM   1450 C  CG  . LYS A 1 217 ? 34.806 9.870  -6.650  1.00 21.66 ? 313  LYS A CG  1 
ATOM   1451 C  CD  . LYS A 1 217 ? 33.953 9.085  -7.636  1.00 27.84 ? 313  LYS A CD  1 
ATOM   1452 C  CE  . LYS A 1 217 ? 34.818 8.203  -8.525  1.00 31.20 ? 313  LYS A CE  1 
ATOM   1453 N  NZ  . LYS A 1 217 ? 34.006 7.412  -9.494  1.00 36.03 ? 313  LYS A NZ  1 
ATOM   1454 N  N   . ILE A 1 218 ? 36.950 11.985 -5.391  1.00 17.72 ? 314  ILE A N   1 
ATOM   1455 C  CA  . ILE A 1 218 ? 37.977 12.812 -6.016  1.00 22.21 ? 314  ILE A CA  1 
ATOM   1456 C  C   . ILE A 1 218 ? 38.580 12.015 -7.169  1.00 26.09 ? 314  ILE A C   1 
ATOM   1457 O  O   . ILE A 1 218 ? 38.628 10.785 -7.119  1.00 24.64 ? 314  ILE A O   1 
ATOM   1458 C  CB  . ILE A 1 218 ? 39.083 13.192 -5.016  1.00 22.48 ? 314  ILE A CB  1 
ATOM   1459 C  CG1 . ILE A 1 218 ? 38.472 13.959 -3.843  1.00 21.65 ? 314  ILE A CG1 1 
ATOM   1460 C  CG2 . ILE A 1 218 ? 40.135 14.053 -5.708  1.00 26.30 ? 314  ILE A CG2 1 
ATOM   1461 C  CD1 . ILE A 1 218 ? 39.476 14.366 -2.786  1.00 26.01 ? 314  ILE A CD1 1 
ATOM   1462 N  N   . TYR A 1 219 ? 39.047 12.718 -8.197  1.00 31.43 ? 315  TYR A N   1 
ATOM   1463 C  CA  . TYR A 1 219 ? 39.607 12.073 -9.383  1.00 37.29 ? 315  TYR A CA  1 
ATOM   1464 C  C   . TYR A 1 219 ? 41.089 12.288 -9.656  1.00 41.54 ? 315  TYR A C   1 
ATOM   1465 O  O   . TYR A 1 219 ? 41.827 12.818 -8.823  1.00 42.77 ? 315  TYR A O   1 
ATOM   1466 C  CB  . TYR A 1 219 ? 38.827 12.518 -10.616 1.00 37.68 ? 315  TYR A CB  1 
ATOM   1467 C  CG  . TYR A 1 219 ? 37.426 11.976 -10.689 1.00 38.88 ? 315  TYR A CG  1 
ATOM   1468 C  CD1 . TYR A 1 219 ? 37.179 10.702 -11.197 1.00 39.92 ? 315  TYR A CD1 1 
ATOM   1469 C  CD2 . TYR A 1 219 ? 36.342 12.736 -10.255 1.00 39.19 ? 315  TYR A CD2 1 
ATOM   1470 C  CE1 . TYR A 1 219 ? 35.887 10.198 -11.275 1.00 39.85 ? 315  TYR A CE1 1 
ATOM   1471 C  CE2 . TYR A 1 219 ? 35.046 12.242 -10.325 1.00 39.96 ? 315  TYR A CE2 1 
ATOM   1472 C  CZ  . TYR A 1 219 ? 34.825 10.971 -10.839 1.00 40.03 ? 315  TYR A CZ  1 
ATOM   1473 O  OH  . TYR A 1 219 ? 33.547 10.474 -10.922 1.00 41.58 ? 315  TYR A OH  1 
ATOM   1474 N  N   . ASP A 1 220 ? 41.488 11.867 -10.857 1.00 45.11 ? 316  ASP A N   1 
ATOM   1475 C  CA  . ASP A 1 220 ? 42.856 11.955 -11.364 1.00 48.76 ? 316  ASP A CA  1 
ATOM   1476 C  C   . ASP A 1 220 ? 43.901 12.364 -10.339 1.00 50.29 ? 316  ASP A C   1 
ATOM   1477 O  O   . ASP A 1 220 ? 44.235 13.541 -10.202 1.00 50.40 ? 316  ASP A O   1 
ATOM   1478 C  CB  . ASP A 1 220 ? 42.913 12.906 -12.562 1.00 51.10 ? 316  ASP A CB  1 
ATOM   1479 C  CG  . ASP A 1 220 ? 41.986 12.483 -13.685 1.00 53.20 ? 316  ASP A CG  1 
ATOM   1480 O  OD1 . ASP A 1 220 ? 41.864 11.263 -13.929 1.00 54.29 ? 316  ASP A OD1 1 
ATOM   1481 O  OD2 . ASP A 1 220 ? 41.387 13.369 -14.331 1.00 55.12 ? 316  ASP A OD2 1 
ATOM   1482 N  N   . SER A 1 221 ? 44.419 11.370 -9.628  1.00 51.63 ? 317  SER A N   1 
ATOM   1483 C  CA  . SER A 1 221 ? 45.433 11.596 -8.611  1.00 53.06 ? 317  SER A CA  1 
ATOM   1484 C  C   . SER A 1 221 ? 46.563 10.596 -8.817  1.00 53.83 ? 317  SER A C   1 
ATOM   1485 O  O   . SER A 1 221 ? 46.346 9.385  -8.752  1.00 54.39 ? 317  SER A O   1 
ATOM   1486 C  CB  . SER A 1 221 ? 44.829 11.406 -7.217  1.00 53.24 ? 317  SER A CB  1 
ATOM   1487 O  OG  . SER A 1 221 ? 43.646 12.170 -7.060  1.00 53.77 ? 317  SER A OG  1 
ATOM   1488 N  N   . PRO A 1 222 ? 47.786 11.088 -9.079  1.00 54.06 ? 318  PRO A N   1 
ATOM   1489 C  CA  . PRO A 1 222 ? 48.940 10.210 -9.291  1.00 53.91 ? 318  PRO A CA  1 
ATOM   1490 C  C   . PRO A 1 222 ? 49.057 9.138  -8.213  1.00 53.87 ? 318  PRO A C   1 
ATOM   1491 O  O   . PRO A 1 222 ? 49.799 8.167  -8.365  1.00 54.39 ? 318  PRO A O   1 
ATOM   1492 C  CB  . PRO A 1 222 ? 50.110 11.185 -9.282  1.00 54.17 ? 318  PRO A CB  1 
ATOM   1493 C  CG  . PRO A 1 222 ? 49.520 12.377 -9.956  1.00 54.74 ? 318  PRO A CG  1 
ATOM   1494 C  CD  . PRO A 1 222 ? 48.160 12.498 -9.289  1.00 54.37 ? 318  PRO A CD  1 
ATOM   1495 N  N   . CYS A 1 223 ? 48.320 9.321  -7.123  1.00 53.04 ? 319  CYS A N   1 
ATOM   1496 C  CA  . CYS A 1 223 ? 48.323 8.365  -6.025  1.00 52.44 ? 319  CYS A CA  1 
ATOM   1497 C  C   . CYS A 1 223 ? 47.226 7.326  -6.247  1.00 52.16 ? 319  CYS A C   1 
ATOM   1498 O  O   . CYS A 1 223 ? 47.417 6.143  -5.975  1.00 52.41 ? 319  CYS A O   1 
ATOM   1499 C  CB  . CYS A 1 223 ? 48.105 9.089  -4.694  1.00 52.58 ? 319  CYS A CB  1 
ATOM   1500 S  SG  . CYS A 1 223 ? 49.423 10.257 -4.264  1.00 52.30 ? 319  CYS A SG  1 
ATOM   1501 N  N   . LEU A 1 224 ? 46.079 7.776  -6.749  1.00 51.37 ? 320  LEU A N   1 
ATOM   1502 C  CA  . LEU A 1 224 ? 44.950 6.890  -7.020  1.00 50.25 ? 320  LEU A CA  1 
ATOM   1503 C  C   . LEU A 1 224 ? 44.024 7.519  -8.057  1.00 48.37 ? 320  LEU A C   1 
ATOM   1504 O  O   . LEU A 1 224 ? 43.617 8.673  -7.917  1.00 48.51 ? 320  LEU A O   1 
ATOM   1505 C  CB  . LEU A 1 224 ? 44.162 6.617  -5.735  1.00 51.58 ? 320  LEU A CB  1 
ATOM   1506 C  CG  . LEU A 1 224 ? 44.850 5.852  -4.600  1.00 52.61 ? 320  LEU A CG  1 
ATOM   1507 C  CD1 . LEU A 1 224 ? 43.919 5.791  -3.401  1.00 53.53 ? 320  LEU A CD1 1 
ATOM   1508 C  CD2 . LEU A 1 224 ? 45.219 4.449  -5.062  1.00 53.34 ? 320  LEU A CD2 1 
ATOM   1509 N  N   . PRO A 1 225 ? 43.681 6.769  -9.117  1.00 46.71 ? 321  PRO A N   1 
ATOM   1510 C  CA  . PRO A 1 225 ? 42.795 7.290  -10.162 1.00 44.43 ? 321  PRO A CA  1 
ATOM   1511 C  C   . PRO A 1 225 ? 41.545 7.927  -9.562  1.00 41.95 ? 321  PRO A C   1 
ATOM   1512 O  O   . PRO A 1 225 ? 41.167 9.042  -9.924  1.00 40.86 ? 321  PRO A O   1 
ATOM   1513 C  CB  . PRO A 1 225 ? 42.474 6.047  -10.984 1.00 45.46 ? 321  PRO A CB  1 
ATOM   1514 C  CG  . PRO A 1 225 ? 43.749 5.270  -10.895 1.00 46.59 ? 321  PRO A CG  1 
ATOM   1515 C  CD  . PRO A 1 225 ? 44.099 5.390  -9.425  1.00 46.46 ? 321  PRO A CD  1 
ATOM   1516 N  N   . GLU A 1 226 ? 40.911 7.205  -8.644  1.00 39.09 ? 322  GLU A N   1 
ATOM   1517 C  CA  . GLU A 1 226 ? 39.708 7.686  -7.978  1.00 36.24 ? 322  GLU A CA  1 
ATOM   1518 C  C   . GLU A 1 226 ? 39.744 7.232  -6.526  1.00 32.58 ? 322  GLU A C   1 
ATOM   1519 O  O   . GLU A 1 226 ? 40.264 6.161  -6.213  1.00 31.65 ? 322  GLU A O   1 
ATOM   1520 C  CB  . GLU A 1 226 ? 38.455 7.113  -8.646  1.00 39.05 ? 322  GLU A CB  1 
ATOM   1521 C  CG  . GLU A 1 226 ? 38.497 7.091  -10.165 1.00 43.79 ? 322  GLU A CG  1 
ATOM   1522 C  CD  . GLU A 1 226 ? 37.226 6.524  -10.770 1.00 46.15 ? 322  GLU A CD  1 
ATOM   1523 O  OE1 . GLU A 1 226 ? 36.680 5.555  -10.200 1.00 47.26 ? 322  GLU A OE1 1 
ATOM   1524 O  OE2 . GLU A 1 226 ? 36.779 7.036  -11.818 1.00 48.33 ? 322  GLU A OE2 1 
ATOM   1525 N  N   . ALA A 1 227 ? 39.197 8.054  -5.641  1.00 26.73 ? 323  ALA A N   1 
ATOM   1526 C  CA  . ALA A 1 227 ? 39.151 7.722  -4.227  1.00 23.49 ? 323  ALA A CA  1 
ATOM   1527 C  C   . ALA A 1 227 ? 37.874 8.311  -3.655  1.00 21.23 ? 323  ALA A C   1 
ATOM   1528 O  O   . ALA A 1 227 ? 37.432 9.382  -4.074  1.00 18.44 ? 323  ALA A O   1 
ATOM   1529 C  CB  . ALA A 1 227 ? 40.367 8.285  -3.509  1.00 24.09 ? 323  ALA A CB  1 
ATOM   1530 N  N   . GLU A 1 228 ? 37.274 7.606  -2.706  1.00 20.46 ? 324  GLU A N   1 
ATOM   1531 C  CA  . GLU A 1 228 ? 36.043 8.077  -2.100  1.00 21.25 ? 324  GLU A CA  1 
ATOM   1532 C  C   . GLU A 1 228 ? 36.074 7.951  -0.589  1.00 20.52 ? 324  GLU A C   1 
ATOM   1533 O  O   . GLU A 1 228 ? 36.831 7.158  -0.029  1.00 21.51 ? 324  GLU A O   1 
ATOM   1534 C  CB  . GLU A 1 228 ? 34.849 7.280  -2.624  1.00 23.33 ? 324  GLU A CB  1 
ATOM   1535 C  CG  . GLU A 1 228 ? 34.651 7.327  -4.124  1.00 27.34 ? 324  GLU A CG  1 
ATOM   1536 C  CD  . GLU A 1 228 ? 33.426 6.543  -4.550  1.00 29.02 ? 324  GLU A CD  1 
ATOM   1537 O  OE1 . GLU A 1 228 ? 33.318 5.362  -4.158  1.00 31.71 ? 324  GLU A OE1 1 
ATOM   1538 O  OE2 . GLU A 1 228 ? 32.576 7.101  -5.272  1.00 30.39 ? 324  GLU A OE2 1 
ATOM   1539 N  N   . ALA A 1 229 ? 35.237 8.746  0.061   1.00 18.38 ? 325  ALA A N   1 
ATOM   1540 C  CA  . ALA A 1 229 ? 35.120 8.719  1.505   1.00 18.27 ? 325  ALA A CA  1 
ATOM   1541 C  C   . ALA A 1 229 ? 33.684 9.064  1.855   1.00 17.32 ? 325  ALA A C   1 
ATOM   1542 O  O   . ALA A 1 229 ? 33.044 9.869  1.178   1.00 16.37 ? 325  ALA A O   1 
ATOM   1543 C  CB  . ALA A 1 229 ? 36.072 9.727  2.140   1.00 18.87 ? 325  ALA A CB  1 
HETATM 1544 N  N   A MSE A 1 230 ? 33.175 8.440  2.910   0.51 16.14 ? 326  MSE A N   1 
HETATM 1545 N  N   B MSE A 1 230 ? 33.175 8.443  2.911   0.39 17.50 ? 326  MSE A N   1 
HETATM 1546 C  CA  A MSE A 1 230 ? 31.814 8.690  3.353   0.51 15.49 ? 326  MSE A CA  1 
HETATM 1547 C  CA  B MSE A 1 230 ? 31.818 8.709  3.360   0.39 17.68 ? 326  MSE A CA  1 
HETATM 1548 C  C   A MSE A 1 230 ? 31.863 9.603  4.571   0.51 15.12 ? 326  MSE A C   1 
HETATM 1549 C  C   B MSE A 1 230 ? 31.873 9.621  4.568   0.39 16.52 ? 326  MSE A C   1 
HETATM 1550 O  O   A MSE A 1 230 ? 32.823 9.569  5.341   0.51 16.04 ? 326  MSE A O   1 
HETATM 1551 O  O   B MSE A 1 230 ? 32.839 9.602  5.331   0.39 17.10 ? 326  MSE A O   1 
HETATM 1552 C  CB  A MSE A 1 230 ? 31.127 7.370  3.722   0.51 16.90 ? 326  MSE A CB  1 
HETATM 1553 C  CB  B MSE A 1 230 ? 31.105 7.414  3.748   0.39 21.36 ? 326  MSE A CB  1 
HETATM 1554 C  CG  A MSE A 1 230 ? 29.621 7.477  3.913   0.51 17.28 ? 326  MSE A CG  1 
HETATM 1555 C  CG  B MSE A 1 230 ? 30.708 6.543  2.581   0.39 24.62 ? 326  MSE A CG  1 
HETATM 1556 SE SE  A MSE A 1 230 ? 28.788 5.774  4.333   0.51 21.71 ? 326  MSE A SE  1 
HETATM 1557 SE SE  B MSE A 1 230 ? 29.821 4.948  3.175   0.39 34.10 ? 326  MSE A SE  1 
HETATM 1558 C  CE  A MSE A 1 230 ? 29.498 4.732  2.874   0.51 24.72 ? 326  MSE A CE  1 
HETATM 1559 C  CE  B MSE A 1 230 ? 27.998 5.567  3.081   0.39 30.04 ? 326  MSE A CE  1 
ATOM   1560 N  N   . PHE A 1 231 ? 30.837 10.432 4.728   1.00 14.66 ? 327  PHE A N   1 
ATOM   1561 C  CA  . PHE A 1 231 ? 30.746 11.333 5.859   1.00 13.34 ? 327  PHE A CA  1 
ATOM   1562 C  C   . PHE A 1 231 ? 29.267 11.509 6.158   1.00 13.91 ? 327  PHE A C   1 
ATOM   1563 O  O   . PHE A 1 231 ? 28.416 10.945 5.466   1.00 13.73 ? 327  PHE A O   1 
ATOM   1564 C  CB  . PHE A 1 231 ? 31.439 12.686 5.582   1.00 14.23 ? 327  PHE A CB  1 
ATOM   1565 C  CG  . PHE A 1 231 ? 30.856 13.476 4.437   1.00 12.58 ? 327  PHE A CG  1 
ATOM   1566 C  CD1 . PHE A 1 231 ? 31.180 13.169 3.119   1.00 13.45 ? 327  PHE A CD1 1 
ATOM   1567 C  CD2 . PHE A 1 231 ? 30.024 14.568 4.685   1.00 14.05 ? 327  PHE A CD2 1 
ATOM   1568 C  CE1 . PHE A 1 231 ? 30.689 13.942 2.060   1.00 13.50 ? 327  PHE A CE1 1 
ATOM   1569 C  CE2 . PHE A 1 231 ? 29.527 15.347 3.638   1.00 13.64 ? 327  PHE A CE2 1 
ATOM   1570 C  CZ  . PHE A 1 231 ? 29.863 15.033 2.321   1.00 13.36 ? 327  PHE A CZ  1 
ATOM   1571 N  N   . ALA A 1 232 ? 28.952 12.254 7.205   1.00 13.81 ? 328  ALA A N   1 
ATOM   1572 C  CA  . ALA A 1 232 ? 27.560 12.464 7.558   1.00 13.68 ? 328  ALA A CA  1 
ATOM   1573 C  C   . ALA A 1 232 ? 27.306 13.919 7.893   1.00 14.38 ? 328  ALA A C   1 
ATOM   1574 O  O   . ALA A 1 232 ? 28.210 14.631 8.326   1.00 14.71 ? 328  ALA A O   1 
ATOM   1575 C  CB  . ALA A 1 232 ? 27.187 11.586 8.744   1.00 15.04 ? 328  ALA A CB  1 
ATOM   1576 N  N   . ILE A 1 233 ? 26.077 14.365 7.668   1.00 14.86 ? 329  ILE A N   1 
ATOM   1577 C  CA  . ILE A 1 233 ? 25.715 15.732 7.995   1.00 16.92 ? 329  ILE A CA  1 
ATOM   1578 C  C   . ILE A 1 233 ? 24.784 15.663 9.201   1.00 17.32 ? 329  ILE A C   1 
ATOM   1579 O  O   . ILE A 1 233 ? 23.758 14.979 9.179   1.00 18.02 ? 329  ILE A O   1 
ATOM   1580 C  CB  . ILE A 1 233 ? 25.036 16.451 6.798   1.00 18.22 ? 329  ILE A CB  1 
ATOM   1581 C  CG1 . ILE A 1 233 ? 23.752 15.733 6.383   1.00 21.82 ? 329  ILE A CG1 1 
ATOM   1582 C  CG2 . ILE A 1 233 ? 25.997 16.493 5.619   1.00 17.39 ? 329  ILE A CG2 1 
ATOM   1583 C  CD1 . ILE A 1 233 ? 23.055 16.386 5.193   1.00 25.55 ? 329  ILE A CD1 1 
ATOM   1584 N  N   . ASN A 1 234 ? 25.170 16.349 10.268  1.00 17.70 ? 330  ASN A N   1 
ATOM   1585 C  CA  . ASN A 1 234 ? 24.391 16.352 11.497  1.00 18.00 ? 330  ASN A CA  1 
ATOM   1586 C  C   . ASN A 1 234 ? 23.979 17.767 11.883  1.00 18.09 ? 330  ASN A C   1 
ATOM   1587 O  O   . ASN A 1 234 ? 24.365 18.743 11.235  1.00 16.82 ? 330  ASN A O   1 
ATOM   1588 C  CB  . ASN A 1 234 ? 25.208 15.731 12.637  1.00 20.36 ? 330  ASN A CB  1 
ATOM   1589 C  CG  . ASN A 1 234 ? 25.759 14.353 12.289  1.00 21.76 ? 330  ASN A CG  1 
ATOM   1590 O  OD1 . ASN A 1 234 ? 25.006 13.418 12.006  1.00 22.43 ? 330  ASN A OD1 1 
ATOM   1591 N  ND2 . ASN A 1 234 ? 27.081 14.223 12.314  1.00 23.90 ? 330  ASN A ND2 1 
ATOM   1592 N  N   . ALA A 1 235 ? 23.195 17.868 12.951  1.00 18.79 ? 331  ALA A N   1 
ATOM   1593 C  CA  . ALA A 1 235 ? 22.727 19.156 13.441  1.00 19.16 ? 331  ALA A CA  1 
ATOM   1594 C  C   . ALA A 1 235 ? 23.901 20.037 13.837  1.00 18.41 ? 331  ALA A C   1 
ATOM   1595 O  O   . ALA A 1 235 ? 23.822 21.261 13.740  1.00 19.60 ? 331  ALA A O   1 
ATOM   1596 C  CB  . ALA A 1 235 ? 21.802 18.955 14.634  1.00 20.84 ? 331  ALA A CB  1 
ATOM   1597 N  N   . ASP A 1 236 ? 24.989 19.416 14.288  1.00 18.22 ? 332  ASP A N   1 
ATOM   1598 C  CA  . ASP A 1 236 ? 26.168 20.170 14.688  1.00 17.37 ? 332  ASP A CA  1 
ATOM   1599 C  C   . ASP A 1 236 ? 27.311 20.053 13.689  1.00 16.67 ? 332  ASP A C   1 
ATOM   1600 O  O   . ASP A 1 236 ? 28.483 20.038 14.065  1.00 15.11 ? 332  ASP A O   1 
ATOM   1601 C  CB  . ASP A 1 236 ? 26.640 19.752 16.090  1.00 19.49 ? 332  ASP A CB  1 
ATOM   1602 C  CG  . ASP A 1 236 ? 26.835 18.254 16.228  1.00 22.57 ? 332  ASP A CG  1 
ATOM   1603 O  OD1 . ASP A 1 236 ? 26.695 17.528 15.222  1.00 23.71 ? 332  ASP A OD1 1 
ATOM   1604 O  OD2 . ASP A 1 236 ? 27.136 17.803 17.355  1.00 25.43 ? 332  ASP A OD2 1 
ATOM   1605 N  N   . GLY A 1 237 ? 26.959 19.960 12.410  1.00 15.38 ? 333  GLY A N   1 
ATOM   1606 C  CA  . GLY A 1 237 ? 27.974 19.897 11.375  1.00 15.75 ? 333  GLY A CA  1 
ATOM   1607 C  C   . GLY A 1 237 ? 28.344 18.547 10.796  1.00 13.57 ? 333  GLY A C   1 
ATOM   1608 O  O   . GLY A 1 237 ? 27.752 17.513 11.111  1.00 14.77 ? 333  GLY A O   1 
ATOM   1609 N  N   . VAL A 1 238 ? 29.346 18.580 9.924   1.00 11.52 ? 334  VAL A N   1 
ATOM   1610 C  CA  . VAL A 1 238 ? 29.844 17.391 9.254   1.00 10.99 ? 334  VAL A CA  1 
ATOM   1611 C  C   . VAL A 1 238 ? 30.614 16.499 10.218  1.00 11.60 ? 334  VAL A C   1 
ATOM   1612 O  O   . VAL A 1 238 ? 31.450 16.965 10.989  1.00 12.63 ? 334  VAL A O   1 
ATOM   1613 C  CB  . VAL A 1 238 ? 30.746 17.791 8.063   1.00 9.62  ? 334  VAL A CB  1 
ATOM   1614 C  CG1 . VAL A 1 238 ? 31.534 16.585 7.549   1.00 11.92 ? 334  VAL A CG1 1 
ATOM   1615 C  CG2 . VAL A 1 238 ? 29.879 18.366 6.952   1.00 12.03 ? 334  VAL A CG2 1 
ATOM   1616 N  N   . GLY A 1 239 ? 30.301 15.209 10.181  1.00 12.25 ? 335  GLY A N   1 
ATOM   1617 C  CA  . GLY A 1 239 ? 30.975 14.252 11.036  1.00 12.89 ? 335  GLY A CA  1 
ATOM   1618 C  C   . GLY A 1 239 ? 31.193 12.971 10.259  1.00 13.23 ? 335  GLY A C   1 
ATOM   1619 O  O   . GLY A 1 239 ? 30.982 12.931 9.048   1.00 13.01 ? 335  GLY A O   1 
ATOM   1620 N  N   . ASP A 1 240 ? 31.618 11.916 10.938  1.00 15.14 ? 336  ASP A N   1 
ATOM   1621 C  CA  . ASP A 1 240 ? 31.834 10.660 10.244  1.00 16.51 ? 336  ASP A CA  1 
ATOM   1622 C  C   . ASP A 1 240 ? 30.561 9.835  10.172  1.00 16.78 ? 336  ASP A C   1 
ATOM   1623 O  O   . ASP A 1 240 ? 29.688 9.936  11.034  1.00 16.77 ? 336  ASP A O   1 
ATOM   1624 C  CB  . ASP A 1 240 ? 32.956 9.870  10.911  1.00 17.22 ? 336  ASP A CB  1 
ATOM   1625 C  CG  . ASP A 1 240 ? 34.318 10.457 10.610  1.00 19.47 ? 336  ASP A CG  1 
ATOM   1626 O  OD1 . ASP A 1 240 ? 34.936 11.045 11.523  1.00 20.13 ? 336  ASP A OD1 1 
ATOM   1627 O  OD2 . ASP A 1 240 ? 34.753 10.345 9.443   1.00 19.26 ? 336  ASP A OD2 1 
ATOM   1628 N  N   . ALA A 1 241 ? 30.451 9.039  9.116   1.00 16.17 ? 337  ALA A N   1 
ATOM   1629 C  CA  . ALA A 1 241 ? 29.285 8.195  8.920   1.00 17.98 ? 337  ALA A CA  1 
ATOM   1630 C  C   . ALA A 1 241 ? 29.322 7.053  9.926   1.00 19.32 ? 337  ALA A C   1 
ATOM   1631 O  O   . ALA A 1 241 ? 30.376 6.472  10.181  1.00 18.99 ? 337  ALA A O   1 
ATOM   1632 C  CB  . ALA A 1 241 ? 29.267 7.651  7.497   1.00 17.82 ? 337  ALA A CB  1 
ATOM   1633 N  N   . LYS A 1 242 ? 28.163 6.738  10.490  1.00 20.19 ? 338  LYS A N   1 
ATOM   1634 C  CA  . LYS A 1 242 ? 28.053 5.676  11.479  1.00 22.21 ? 338  LYS A CA  1 
ATOM   1635 C  C   . LYS A 1 242 ? 26.946 4.702  11.099  1.00 23.93 ? 338  LYS A C   1 
ATOM   1636 O  O   . LYS A 1 242 ? 25.977 5.080  10.437  1.00 22.40 ? 338  LYS A O   1 
ATOM   1637 C  CB  . LYS A 1 242 ? 27.738 6.279  12.850  1.00 23.47 ? 338  LYS A CB  1 
ATOM   1638 C  CG  . LYS A 1 242 ? 28.784 7.255  13.360  1.00 26.58 ? 338  LYS A CG  1 
ATOM   1639 C  CD  . LYS A 1 242 ? 30.111 6.561  13.623  1.00 29.32 ? 338  LYS A CD  1 
ATOM   1640 C  CE  . LYS A 1 242 ? 31.150 7.544  14.142  1.00 32.11 ? 338  LYS A CE  1 
ATOM   1641 N  NZ  . LYS A 1 242 ? 32.439 6.871  14.460  1.00 34.51 ? 338  LYS A NZ  1 
ATOM   1642 N  N   . ASP A 1 243 ? 27.093 3.447  11.508  1.00 25.44 ? 339  ASP A N   1 
ATOM   1643 C  CA  . ASP A 1 243 ? 26.068 2.452  11.228  1.00 27.67 ? 339  ASP A CA  1 
ATOM   1644 C  C   . ASP A 1 243 ? 25.169 2.347  12.456  1.00 28.80 ? 339  ASP A C   1 
ATOM   1645 O  O   . ASP A 1 243 ? 24.424 1.352  12.570  1.00 28.88 ? 339  ASP A O   1 
ATOM   1646 C  CB  . ASP A 1 243 ? 26.693 1.085  10.924  1.00 29.98 ? 339  ASP A CB  1 
ATOM   1647 C  CG  . ASP A 1 243 ? 27.592 0.584  12.043  1.00 32.94 ? 339  ASP A CG  1 
ATOM   1648 O  OD1 . ASP A 1 243 ? 27.427 1.025  13.201  1.00 33.12 ? 339  ASP A OD1 1 
ATOM   1649 O  OD2 . ASP A 1 243 ? 28.462 -0.267 11.761  1.00 36.58 ? 339  ASP A OD2 1 
ATOM   1650 O  OXT . ASP A 1 243 ? 25.220 3.279  13.289  1.00 28.59 ? 339  ASP A OXT 1 
ATOM   1651 N  N   A PRO B 2 3   ? 24.293 51.611 1.883   0.50 34.39 ? 1519 PRO B N   1 
ATOM   1652 N  N   B PRO B 2 3   ? 25.010 52.092 1.661   0.50 38.05 ? 1519 PRO B N   1 
ATOM   1653 C  CA  A PRO B 2 3   ? 23.845 50.392 1.173   0.50 35.12 ? 1519 PRO B CA  1 
ATOM   1654 C  CA  B PRO B 2 3   ? 24.029 50.997 1.887   0.50 37.02 ? 1519 PRO B CA  1 
ATOM   1655 C  C   A PRO B 2 3   ? 24.307 49.154 1.952   0.50 35.98 ? 1519 PRO B C   1 
ATOM   1656 C  C   B PRO B 2 3   ? 24.595 49.927 2.807   0.50 36.73 ? 1519 PRO B C   1 
ATOM   1657 O  O   A PRO B 2 3   ? 25.171 48.407 1.497   0.50 37.38 ? 1519 PRO B O   1 
ATOM   1658 O  O   B PRO B 2 3   ? 25.750 49.985 3.197   0.50 37.75 ? 1519 PRO B O   1 
ATOM   1659 C  CB  A PRO B 2 3   ? 24.486 50.430 -0.203  0.50 37.27 ? 1519 PRO B CB  1 
ATOM   1660 C  CB  B PRO B 2 3   ? 23.711 50.412 0.520   0.50 37.35 ? 1519 PRO B CB  1 
ATOM   1661 C  CG  A PRO B 2 3   ? 24.699 51.944 -0.398  0.50 37.06 ? 1519 PRO B CG  1 
ATOM   1662 C  CG  B PRO B 2 3   ? 24.961 50.755 -0.261  0.50 38.95 ? 1519 PRO B CG  1 
ATOM   1663 C  CD  A PRO B 2 3   ? 25.117 52.443 0.989   0.50 33.96 ? 1519 PRO B CD  1 
ATOM   1664 C  CD  B PRO B 2 3   ? 25.361 52.159 0.229   0.50 38.46 ? 1519 PRO B CD  1 
ATOM   1665 N  N   . THR B 2 4   ? 23.744 48.961 3.142   1.00 35.07 ? 1520 THR B N   1 
ATOM   1666 C  CA  . THR B 2 4   ? 24.098 47.838 4.013   1.00 33.12 ? 1520 THR B CA  1 
ATOM   1667 C  C   . THR B 2 4   ? 23.952 46.477 3.357   1.00 31.94 ? 1520 THR B C   1 
ATOM   1668 O  O   . THR B 2 4   ? 24.698 45.547 3.676   1.00 31.26 ? 1520 THR B O   1 
ATOM   1669 C  CB  . THR B 2 4   ? 23.242 47.855 5.296   1.00 33.72 ? 1520 THR B CB  1 
ATOM   1670 O  OG1 . THR B 2 4   ? 21.871 47.557 4.982   1.00 33.68 ? 1520 THR B OG1 1 
ATOM   1671 C  CG2 . THR B 2 4   ? 23.307 49.243 5.942   1.00 34.95 ? 1520 THR B CG2 1 
ATOM   1672 N  N   . LEU B 2 5   ? 23.026 46.379 2.411   1.00 28.07 ? 1521 LEU B N   1 
ATOM   1673 C  CA  . LEU B 2 5   ? 22.780 45.125 1.720   1.00 27.74 ? 1521 LEU B CA  1 
ATOM   1674 C  C   . LEU B 2 5   ? 23.899 44.613 0.817   1.00 26.48 ? 1521 LEU B C   1 
ATOM   1675 O  O   . LEU B 2 5   ? 23.957 43.416 0.532   1.00 26.28 ? 1521 LEU B O   1 
ATOM   1676 C  CB  . LEU B 2 5   ? 21.495 45.232 0.896   1.00 27.44 ? 1521 LEU B CB  1 
ATOM   1677 C  CG  . LEU B 2 5   ? 20.189 45.382 1.680   1.00 27.21 ? 1521 LEU B CG  1 
ATOM   1678 C  CD1 . LEU B 2 5   ? 19.046 45.662 0.717   1.00 28.85 ? 1521 LEU B CD1 1 
ATOM   1679 C  CD2 . LEU B 2 5   ? 19.916 44.121 2.486   1.00 27.53 ? 1521 LEU B CD2 1 
ATOM   1680 N  N   . LEU B 2 6   ? 24.783 45.500 0.373   1.00 25.12 ? 1522 LEU B N   1 
ATOM   1681 C  CA  . LEU B 2 6   ? 25.854 45.093 -0.529  1.00 24.52 ? 1522 LEU B CA  1 
ATOM   1682 C  C   . LEU B 2 6   ? 27.221 44.871 0.115   1.00 23.01 ? 1522 LEU B C   1 
ATOM   1683 O  O   . LEU B 2 6   ? 28.192 44.588 -0.584  1.00 23.87 ? 1522 LEU B O   1 
ATOM   1684 C  CB  . LEU B 2 6   ? 25.976 46.115 -1.662  1.00 26.00 ? 1522 LEU B CB  1 
ATOM   1685 C  CG  . LEU B 2 6   ? 24.681 46.354 -2.447  1.00 27.30 ? 1522 LEU B CG  1 
ATOM   1686 C  CD1 . LEU B 2 6   ? 24.911 47.429 -3.496  1.00 28.30 ? 1522 LEU B CD1 1 
ATOM   1687 C  CD2 . LEU B 2 6   ? 24.221 45.056 -3.097  1.00 26.47 ? 1522 LEU B CD2 1 
ATOM   1688 N  N   . GLY B 2 7   ? 27.303 44.997 1.436   1.00 21.25 ? 1523 GLY B N   1 
ATOM   1689 C  CA  . GLY B 2 7   ? 28.572 44.787 2.114   1.00 19.07 ? 1523 GLY B CA  1 
ATOM   1690 C  C   . GLY B 2 7   ? 28.527 43.565 3.013   1.00 16.93 ? 1523 GLY B C   1 
ATOM   1691 O  O   . GLY B 2 7   ? 27.592 42.769 2.933   1.00 18.20 ? 1523 GLY B O   1 
ATOM   1692 N  N   . PHE B 2 8   ? 29.531 43.414 3.872   1.00 15.85 ? 1524 PHE B N   1 
ATOM   1693 C  CA  . PHE B 2 8   ? 29.590 42.278 4.791   1.00 13.68 ? 1524 PHE B CA  1 
ATOM   1694 C  C   . PHE B 2 8   ? 29.088 42.622 6.188   1.00 12.65 ? 1524 PHE B C   1 
ATOM   1695 O  O   . PHE B 2 8   ? 29.194 43.762 6.635   1.00 13.98 ? 1524 PHE B O   1 
ATOM   1696 C  CB  . PHE B 2 8   ? 31.027 41.762 4.942   1.00 13.38 ? 1524 PHE B CB  1 
ATOM   1697 C  CG  . PHE B 2 8   ? 31.521 40.956 3.776   1.00 12.94 ? 1524 PHE B CG  1 
ATOM   1698 C  CD1 . PHE B 2 8   ? 32.085 41.577 2.667   1.00 14.58 ? 1524 PHE B CD1 1 
ATOM   1699 C  CD2 . PHE B 2 8   ? 31.440 39.568 3.799   1.00 13.15 ? 1524 PHE B CD2 1 
ATOM   1700 C  CE1 . PHE B 2 8   ? 32.567 40.825 1.594   1.00 12.21 ? 1524 PHE B CE1 1 
ATOM   1701 C  CE2 . PHE B 2 8   ? 31.914 38.805 2.734   1.00 13.77 ? 1524 PHE B CE2 1 
ATOM   1702 C  CZ  . PHE B 2 8   ? 32.482 39.437 1.628   1.00 14.06 ? 1524 PHE B CZ  1 
ATOM   1703 N  N   . HIS B 2 9   ? 28.547 41.613 6.865   1.00 11.84 ? 1525 HIS B N   1 
ATOM   1704 C  CA  . HIS B 2 9   ? 28.078 41.733 8.241   1.00 13.15 ? 1525 HIS B CA  1 
ATOM   1705 C  C   . HIS B 2 9   ? 28.608 40.506 8.977   1.00 12.75 ? 1525 HIS B C   1 
ATOM   1706 O  O   . HIS B 2 9   ? 28.847 39.468 8.358   1.00 12.86 ? 1525 HIS B O   1 
ATOM   1707 C  CB  . HIS B 2 9   ? 26.553 41.694 8.327   1.00 15.13 ? 1525 HIS B CB  1 
ATOM   1708 C  CG  . HIS B 2 9   ? 25.881 42.936 7.844   1.00 18.82 ? 1525 HIS B CG  1 
ATOM   1709 N  ND1 . HIS B 2 9   ? 25.675 43.198 6.507   1.00 23.42 ? 1525 HIS B ND1 1 
ATOM   1710 C  CD2 . HIS B 2 9   ? 25.345 43.978 8.521   1.00 20.71 ? 1525 HIS B CD2 1 
ATOM   1711 C  CE1 . HIS B 2 9   ? 25.036 44.349 6.382   1.00 21.27 ? 1525 HIS B CE1 1 
ATOM   1712 N  NE2 . HIS B 2 9   ? 24.824 44.842 7.589   1.00 22.01 ? 1525 HIS B NE2 1 
ATOM   1713 N  N   . THR B 2 10  ? 28.812 40.612 10.283  1.00 11.64 ? 1526 THR B N   1 
ATOM   1714 C  CA  . THR B 2 10  ? 29.261 39.439 11.023  1.00 11.86 ? 1526 THR B CA  1 
ATOM   1715 C  C   . THR B 2 10  ? 28.037 38.533 11.065  1.00 12.89 ? 1526 THR B C   1 
ATOM   1716 O  O   . THR B 2 10  ? 26.927 38.979 10.777  1.00 13.46 ? 1526 THR B O   1 
ATOM   1717 C  CB  . THR B 2 10  ? 29.661 39.773 12.471  1.00 12.84 ? 1526 THR B CB  1 
ATOM   1718 O  OG1 . THR B 2 10  ? 28.529 40.315 13.165  1.00 14.05 ? 1526 THR B OG1 1 
ATOM   1719 C  CG2 . THR B 2 10  ? 30.808 40.768 12.495  1.00 12.72 ? 1526 THR B CG2 1 
ATOM   1720 N  N   . ALA B 2 11  ? 28.222 37.267 11.419  1.00 11.46 ? 1527 ALA B N   1 
ATOM   1721 C  CA  . ALA B 2 11  ? 27.090 36.355 11.486  1.00 14.41 ? 1527 ALA B CA  1 
ATOM   1722 C  C   . ALA B 2 11  ? 26.144 36.771 12.614  1.00 15.41 ? 1527 ALA B C   1 
ATOM   1723 O  O   . ALA B 2 11  ? 25.014 36.286 12.695  1.00 17.98 ? 1527 ALA B O   1 
ATOM   1724 C  CB  . ALA B 2 11  ? 27.577 34.923 11.695  1.00 12.82 ? 1527 ALA B CB  1 
ATOM   1725 N  N   . SER B 2 12  ? 26.615 37.667 13.480  1.00 16.56 ? 1528 SER B N   1 
ATOM   1726 C  CA  . SER B 2 12  ? 25.813 38.174 14.593  1.00 19.61 ? 1528 SER B CA  1 
ATOM   1727 C  C   . SER B 2 12  ? 25.045 39.438 14.197  1.00 20.84 ? 1528 SER B C   1 
ATOM   1728 O  O   . SER B 2 12  ? 24.355 40.041 15.025  1.00 22.21 ? 1528 SER B O   1 
ATOM   1729 C  CB  . SER B 2 12  ? 26.701 38.453 15.816  1.00 19.90 ? 1528 SER B CB  1 
ATOM   1730 O  OG  . SER B 2 12  ? 27.833 39.242 15.479  1.00 23.75 ? 1528 SER B OG  1 
ATOM   1731 N  N   . GLY B 2 13  ? 25.177 39.840 12.934  1.00 20.05 ? 1529 GLY B N   1 
ATOM   1732 C  CA  . GLY B 2 13  ? 24.463 41.009 12.440  1.00 20.14 ? 1529 GLY B CA  1 
ATOM   1733 C  C   . GLY B 2 13  ? 25.170 42.352 12.501  1.00 19.33 ? 1529 GLY B C   1 
ATOM   1734 O  O   . GLY B 2 13  ? 24.563 43.386 12.206  1.00 20.61 ? 1529 GLY B O   1 
ATOM   1735 N  N   . LYS B 2 14  ? 26.444 42.355 12.873  1.00 17.30 ? 1530 LYS B N   1 
ATOM   1736 C  CA  . LYS B 2 14  ? 27.201 43.601 12.970  1.00 17.58 ? 1530 LYS B CA  1 
ATOM   1737 C  C   . LYS B 2 14  ? 27.853 43.992 11.647  1.00 18.75 ? 1530 LYS B C   1 
ATOM   1738 O  O   . LYS B 2 14  ? 28.533 43.182 11.018  1.00 17.86 ? 1530 LYS B O   1 
ATOM   1739 C  CB  . LYS B 2 14  ? 28.286 43.475 14.038  1.00 17.52 ? 1530 LYS B CB  1 
ATOM   1740 C  CG  . LYS B 2 14  ? 27.772 43.081 15.411  1.00 21.01 ? 1530 LYS B CG  1 
ATOM   1741 C  CD  . LYS B 2 14  ? 28.925 42.887 16.381  1.00 23.76 ? 1530 LYS B CD  1 
ATOM   1742 C  CE  . LYS B 2 14  ? 28.419 42.487 17.756  1.00 26.60 ? 1530 LYS B CE  1 
ATOM   1743 N  NZ  . LYS B 2 14  ? 27.538 41.296 17.669  1.00 30.15 ? 1530 LYS B NZ  1 
ATOM   1744 N  N   . LYS B 2 15  ? 27.649 45.237 11.228  1.00 17.05 ? 1531 LYS B N   1 
ATOM   1745 C  CA  . LYS B 2 15  ? 28.251 45.718 9.991   1.00 19.95 ? 1531 LYS B CA  1 
ATOM   1746 C  C   . LYS B 2 15  ? 29.767 45.629 10.134  1.00 19.45 ? 1531 LYS B C   1 
ATOM   1747 O  O   . LYS B 2 15  ? 30.314 45.892 11.206  1.00 20.19 ? 1531 LYS B O   1 
ATOM   1748 C  CB  . LYS B 2 15  ? 27.836 47.172 9.727   1.00 22.55 ? 1531 LYS B CB  1 
ATOM   1749 C  CG  . LYS B 2 15  ? 28.565 47.851 8.567   1.00 28.55 ? 1531 LYS B CG  1 
ATOM   1750 C  CD  . LYS B 2 15  ? 28.007 47.435 7.215   1.00 34.63 ? 1531 LYS B CD  1 
ATOM   1751 C  CE  . LYS B 2 15  ? 28.704 48.189 6.086   1.00 36.55 ? 1531 LYS B CE  1 
ATOM   1752 N  NZ  . LYS B 2 15  ? 28.094 47.921 4.752   1.00 39.45 ? 1531 LYS B NZ  1 
ATOM   1753 N  N   . VAL B 2 16  ? 30.446 45.235 9.062   1.00 19.36 ? 1532 VAL B N   1 
ATOM   1754 C  CA  . VAL B 2 16  ? 31.899 45.140 9.091   1.00 19.78 ? 1532 VAL B CA  1 
ATOM   1755 C  C   . VAL B 2 16  ? 32.469 46.419 8.496   1.00 20.72 ? 1532 VAL B C   1 
ATOM   1756 O  O   . VAL B 2 16  ? 32.213 46.738 7.337   1.00 22.21 ? 1532 VAL B O   1 
ATOM   1757 C  CB  . VAL B 2 16  ? 32.411 43.938 8.268   1.00 19.96 ? 1532 VAL B CB  1 
ATOM   1758 C  CG1 . VAL B 2 16  ? 33.930 43.987 8.162   1.00 19.38 ? 1532 VAL B CG1 1 
ATOM   1759 C  CG2 . VAL B 2 16  ? 31.970 42.638 8.919   1.00 19.54 ? 1532 VAL B CG2 1 
ATOM   1760 N  N   . LYS B 2 17  ? 33.234 47.156 9.295   1.00 22.24 ? 1533 LYS B N   1 
ATOM   1761 C  CA  . LYS B 2 17  ? 33.826 48.405 8.829   1.00 25.01 ? 1533 LYS B CA  1 
ATOM   1762 C  C   . LYS B 2 17  ? 35.166 48.173 8.140   1.00 24.17 ? 1533 LYS B C   1 
ATOM   1763 O  O   . LYS B 2 17  ? 35.982 47.369 8.592   1.00 24.48 ? 1533 LYS B O   1 
ATOM   1764 C  CB  . LYS B 2 17  ? 34.009 49.375 10.000  1.00 29.14 ? 1533 LYS B CB  1 
ATOM   1765 C  CG  . LYS B 2 17  ? 32.705 49.823 10.635  1.00 33.73 ? 1533 LYS B CG  1 
ATOM   1766 C  CD  . LYS B 2 17  ? 32.941 50.800 11.776  1.00 38.58 ? 1533 LYS B CD  1 
ATOM   1767 C  CE  . LYS B 2 17  ? 33.556 52.098 11.279  1.00 40.70 ? 1533 LYS B CE  1 
ATOM   1768 N  NZ  . LYS B 2 17  ? 33.790 53.054 12.396  1.00 43.43 ? 1533 LYS B NZ  1 
ATOM   1769 N  N   . ILE B 2 18  ? 35.374 48.882 7.037   1.00 23.24 ? 1534 ILE B N   1 
ATOM   1770 C  CA  . ILE B 2 18  ? 36.605 48.775 6.264   1.00 24.18 ? 1534 ILE B CA  1 
ATOM   1771 C  C   . ILE B 2 18  ? 37.204 50.169 6.111   1.00 23.73 ? 1534 ILE B C   1 
ATOM   1772 O  O   . ILE B 2 18  ? 36.559 51.064 5.569   1.00 23.27 ? 1534 ILE B O   1 
ATOM   1773 C  CB  . ILE B 2 18  ? 36.326 48.206 4.856   1.00 25.08 ? 1534 ILE B CB  1 
ATOM   1774 C  CG1 . ILE B 2 18  ? 35.604 46.860 4.967   1.00 25.24 ? 1534 ILE B CG1 1 
ATOM   1775 C  CG2 . ILE B 2 18  ? 37.633 48.049 4.090   1.00 25.82 ? 1534 ILE B CG2 1 
ATOM   1776 C  CD1 . ILE B 2 18  ? 35.219 46.258 3.627   1.00 25.28 ? 1534 ILE B CD1 1 
ATOM   1777 N  N   . ALA B 2 19  ? 38.430 50.351 6.591   1.00 24.35 ? 1535 ALA B N   1 
ATOM   1778 C  CA  . ALA B 2 19  ? 39.100 51.645 6.489   1.00 24.68 ? 1535 ALA B CA  1 
ATOM   1779 C  C   . ALA B 2 19  ? 39.356 51.984 5.025   1.00 26.08 ? 1535 ALA B C   1 
ATOM   1780 O  O   . ALA B 2 19  ? 39.755 51.121 4.244   1.00 25.25 ? 1535 ALA B O   1 
ATOM   1781 C  CB  . ALA B 2 19  ? 40.416 51.615 7.254   1.00 24.73 ? 1535 ALA B CB  1 
ATOM   1782 N  N   . LYS B 2 20  ? 39.125 53.242 4.655   1.00 26.80 ? 1536 LYS B N   1 
ATOM   1783 C  CA  . LYS B 2 20  ? 39.335 53.681 3.279   1.00 27.59 ? 1536 LYS B CA  1 
ATOM   1784 C  C   . LYS B 2 20  ? 40.762 53.393 2.819   1.00 25.80 ? 1536 LYS B C   1 
ATOM   1785 O  O   . LYS B 2 20  ? 40.993 53.094 1.646   1.00 26.01 ? 1536 LYS B O   1 
ATOM   1786 C  CB  . LYS B 2 20  ? 39.040 55.178 3.145   1.00 30.55 ? 1536 LYS B CB  1 
ATOM   1787 C  CG  . LYS B 2 20  ? 39.898 56.068 4.032   1.00 34.62 ? 1536 LYS B CG  1 
ATOM   1788 C  CD  . LYS B 2 20  ? 39.565 57.545 3.836   1.00 38.95 ? 1536 LYS B CD  1 
ATOM   1789 C  CE  . LYS B 2 20  ? 39.832 57.994 2.403   1.00 41.45 ? 1536 LYS B CE  1 
ATOM   1790 N  NZ  . LYS B 2 20  ? 39.531 59.441 2.196   1.00 43.50 ? 1536 LYS B NZ  1 
ATOM   1791 N  N   . GLU B 2 21  ? 41.716 53.485 3.741   1.00 24.83 ? 1537 GLU B N   1 
ATOM   1792 C  CA  . GLU B 2 21  ? 43.110 53.219 3.409   1.00 24.45 ? 1537 GLU B CA  1 
ATOM   1793 C  C   . GLU B 2 21  ? 43.281 51.756 3.007   1.00 22.80 ? 1537 GLU B C   1 
ATOM   1794 O  O   . GLU B 2 21  ? 44.055 51.440 2.106   1.00 22.40 ? 1537 GLU B O   1 
ATOM   1795 C  CB  . GLU B 2 21  ? 44.029 53.519 4.600   1.00 27.10 ? 1537 GLU B CB  1 
ATOM   1796 C  CG  . GLU B 2 21  ? 44.110 54.984 5.023   1.00 31.85 ? 1537 GLU B CG  1 
ATOM   1797 C  CD  . GLU B 2 21  ? 42.846 55.479 5.698   1.00 35.28 ? 1537 GLU B CD  1 
ATOM   1798 O  OE1 . GLU B 2 21  ? 42.257 54.715 6.492   1.00 35.95 ? 1537 GLU B OE1 1 
ATOM   1799 O  OE2 . GLU B 2 21  ? 42.451 56.639 5.449   1.00 37.98 ? 1537 GLU B OE2 1 
ATOM   1800 N  N   . SER B 2 22  ? 42.556 50.866 3.680   1.00 21.37 ? 1538 SER B N   1 
ATOM   1801 C  CA  . SER B 2 22  ? 42.641 49.440 3.382   1.00 20.86 ? 1538 SER B CA  1 
ATOM   1802 C  C   . SER B 2 22  ? 42.211 49.134 1.949   1.00 20.08 ? 1538 SER B C   1 
ATOM   1803 O  O   . SER B 2 22  ? 42.845 48.333 1.259   1.00 18.25 ? 1538 SER B O   1 
ATOM   1804 C  CB  . SER B 2 22  ? 41.781 48.644 4.366   1.00 21.09 ? 1538 SER B CB  1 
ATOM   1805 O  OG  . SER B 2 22  ? 42.283 48.776 5.684   1.00 23.23 ? 1538 SER B OG  1 
ATOM   1806 N  N   . LEU B 2 23  ? 41.130 49.769 1.508   1.00 19.51 ? 1539 LEU B N   1 
ATOM   1807 C  CA  . LEU B 2 23  ? 40.635 49.577 0.153   1.00 20.82 ? 1539 LEU B CA  1 
ATOM   1808 C  C   . LEU B 2 23  ? 41.638 50.159 -0.839  1.00 20.41 ? 1539 LEU B C   1 
ATOM   1809 O  O   . LEU B 2 23  ? 41.880 49.588 -1.903  1.00 20.85 ? 1539 LEU B O   1 
ATOM   1810 C  CB  . LEU B 2 23  ? 39.276 50.260 -0.013  1.00 22.90 ? 1539 LEU B CB  1 
ATOM   1811 C  CG  . LEU B 2 23  ? 38.104 49.588 0.708   1.00 24.42 ? 1539 LEU B CG  1 
ATOM   1812 C  CD1 . LEU B 2 23  ? 36.933 50.553 0.816   1.00 26.46 ? 1539 LEU B CD1 1 
ATOM   1813 C  CD2 . LEU B 2 23  ? 37.705 48.326 -0.043  1.00 25.08 ? 1539 LEU B CD2 1 
ATOM   1814 N  N   . ASP B 2 24  ? 42.230 51.293 -0.481  1.00 20.18 ? 1540 ASP B N   1 
ATOM   1815 C  CA  . ASP B 2 24  ? 43.207 51.936 -1.348  1.00 20.28 ? 1540 ASP B CA  1 
ATOM   1816 C  C   . ASP B 2 24  ? 44.453 51.060 -1.490  1.00 20.02 ? 1540 ASP B C   1 
ATOM   1817 O  O   . ASP B 2 24  ? 45.038 50.967 -2.569  1.00 20.33 ? 1540 ASP B O   1 
ATOM   1818 C  CB  . ASP B 2 24  ? 43.594 53.305 -0.776  1.00 23.88 ? 1540 ASP B CB  1 
ATOM   1819 C  CG  . ASP B 2 24  ? 44.384 54.147 -1.761  1.00 26.54 ? 1540 ASP B CG  1 
ATOM   1820 O  OD1 . ASP B 2 24  ? 43.862 54.414 -2.865  1.00 29.37 ? 1540 ASP B OD1 1 
ATOM   1821 O  OD2 . ASP B 2 24  ? 45.522 54.547 -1.435  1.00 30.42 ? 1540 ASP B OD2 1 
ATOM   1822 N  N   . LYS B 2 25  ? 44.851 50.413 -0.399  1.00 19.20 ? 1541 LYS B N   1 
ATOM   1823 C  CA  . LYS B 2 25  ? 46.035 49.556 -0.405  1.00 19.77 ? 1541 LYS B CA  1 
ATOM   1824 C  C   . LYS B 2 25  ? 45.918 48.342 -1.328  1.00 19.38 ? 1541 LYS B C   1 
ATOM   1825 O  O   . LYS B 2 25  ? 46.923 47.879 -1.873  1.00 19.13 ? 1541 LYS B O   1 
ATOM   1826 C  CB  . LYS B 2 25  ? 46.356 49.089 1.019   1.00 21.48 ? 1541 LYS B CB  1 
ATOM   1827 C  CG  . LYS B 2 25  ? 46.809 50.212 1.946   1.00 24.88 ? 1541 LYS B CG  1 
ATOM   1828 C  CD  . LYS B 2 25  ? 46.941 49.733 3.383   1.00 26.41 ? 1541 LYS B CD  1 
ATOM   1829 C  CE  . LYS B 2 25  ? 47.320 50.878 4.309   1.00 28.15 ? 1541 LYS B CE  1 
ATOM   1830 N  NZ  . LYS B 2 25  ? 47.277 50.469 5.743   1.00 31.20 ? 1541 LYS B NZ  1 
ATOM   1831 N  N   . VAL B 2 26  ? 44.701 47.836 -1.514  1.00 18.52 ? 1542 VAL B N   1 
ATOM   1832 C  CA  . VAL B 2 26  ? 44.485 46.669 -2.369  1.00 18.69 ? 1542 VAL B CA  1 
ATOM   1833 C  C   . VAL B 2 26  ? 43.906 47.015 -3.740  1.00 18.77 ? 1542 VAL B C   1 
ATOM   1834 O  O   . VAL B 2 26  ? 43.557 46.123 -4.513  1.00 19.16 ? 1542 VAL B O   1 
ATOM   1835 C  CB  . VAL B 2 26  ? 43.539 45.650 -1.685  1.00 18.33 ? 1542 VAL B CB  1 
ATOM   1836 C  CG1 . VAL B 2 26  ? 44.121 45.214 -0.359  1.00 20.04 ? 1542 VAL B CG1 1 
ATOM   1837 C  CG2 . VAL B 2 26  ? 42.162 46.264 -1.483  1.00 19.59 ? 1542 VAL B CG2 1 
ATOM   1838 N  N   . LYS B 2 27  ? 43.822 48.309 -4.042  1.00 20.01 ? 1543 LYS B N   1 
ATOM   1839 C  CA  . LYS B 2 27  ? 43.268 48.784 -5.312  1.00 21.69 ? 1543 LYS B CA  1 
ATOM   1840 C  C   . LYS B 2 27  ? 43.808 48.090 -6.564  1.00 20.66 ? 1543 LYS B C   1 
ATOM   1841 O  O   . LYS B 2 27  ? 43.067 47.879 -7.525  1.00 21.57 ? 1543 LYS B O   1 
ATOM   1842 C  CB  . LYS B 2 27  ? 43.488 50.299 -5.444  1.00 23.55 ? 1543 LYS B CB  1 
ATOM   1843 C  CG  . LYS B 2 27  ? 44.954 50.700 -5.482  1.00 28.56 ? 1543 LYS B CG  1 
ATOM   1844 C  CD  . LYS B 2 27  ? 45.158 52.205 -5.344  1.00 32.47 ? 1543 LYS B CD  1 
ATOM   1845 C  CE  . LYS B 2 27  ? 44.767 52.961 -6.600  1.00 35.65 ? 1543 LYS B CE  1 
ATOM   1846 N  NZ  . LYS B 2 27  ? 45.188 54.390 -6.512  1.00 38.75 ? 1543 LYS B NZ  1 
ATOM   1847 N  N   . ASN B 2 28  ? 45.088 47.732 -6.556  1.00 20.57 ? 1544 ASN B N   1 
ATOM   1848 C  CA  . ASN B 2 28  ? 45.698 47.090 -7.720  1.00 19.97 ? 1544 ASN B CA  1 
ATOM   1849 C  C   . ASN B 2 28  ? 45.974 45.598 -7.566  1.00 18.50 ? 1544 ASN B C   1 
ATOM   1850 O  O   . ASN B 2 28  ? 46.583 44.989 -8.440  1.00 17.10 ? 1544 ASN B O   1 
ATOM   1851 C  CB  . ASN B 2 28  ? 47.010 47.795 -8.077  1.00 22.42 ? 1544 ASN B CB  1 
ATOM   1852 C  CG  . ASN B 2 28  ? 46.817 49.263 -8.392  1.00 24.61 ? 1544 ASN B CG  1 
ATOM   1853 O  OD1 . ASN B 2 28  ? 46.018 49.624 -9.257  1.00 26.96 ? 1544 ASN B OD1 1 
ATOM   1854 N  ND2 . ASN B 2 28  ? 47.553 50.121 -7.692  1.00 26.00 ? 1544 ASN B ND2 1 
ATOM   1855 N  N   . LEU B 2 29  ? 45.518 45.007 -6.469  1.00 17.20 ? 1545 LEU B N   1 
ATOM   1856 C  CA  . LEU B 2 29  ? 45.762 43.591 -6.217  1.00 16.66 ? 1545 LEU B CA  1 
ATOM   1857 C  C   . LEU B 2 29  ? 45.362 42.637 -7.336  1.00 16.69 ? 1545 LEU B C   1 
ATOM   1858 O  O   . LEU B 2 29  ? 46.047 41.641 -7.579  1.00 16.64 ? 1545 LEU B O   1 
ATOM   1859 C  CB  . LEU B 2 29  ? 45.054 43.156 -4.929  1.00 16.31 ? 1545 LEU B CB  1 
ATOM   1860 C  CG  . LEU B 2 29  ? 45.166 41.665 -4.598  1.00 16.59 ? 1545 LEU B CG  1 
ATOM   1861 C  CD1 . LEU B 2 29  ? 46.622 41.300 -4.352  1.00 16.66 ? 1545 LEU B CD1 1 
ATOM   1862 C  CD2 . LEU B 2 29  ? 44.319 41.347 -3.379  1.00 17.51 ? 1545 LEU B CD2 1 
ATOM   1863 N  N   . PHE B 2 30  ? 44.258 42.932 -8.014  1.00 16.22 ? 1546 PHE B N   1 
ATOM   1864 C  CA  . PHE B 2 30  ? 43.775 42.047 -9.063  1.00 17.49 ? 1546 PHE B CA  1 
ATOM   1865 C  C   . PHE B 2 30  ? 44.225 42.384 -10.474 1.00 18.64 ? 1546 PHE B C   1 
ATOM   1866 O  O   . PHE B 2 30  ? 43.774 41.763 -11.432 1.00 19.17 ? 1546 PHE B O   1 
ATOM   1867 C  CB  . PHE B 2 30  ? 42.247 41.967 -8.998  1.00 15.66 ? 1546 PHE B CB  1 
ATOM   1868 C  CG  . PHE B 2 30  ? 41.737 41.417 -7.699  1.00 11.70 ? 1546 PHE B CG  1 
ATOM   1869 C  CD1 . PHE B 2 30  ? 41.945 40.081 -7.366  1.00 13.72 ? 1546 PHE B CD1 1 
ATOM   1870 C  CD2 . PHE B 2 30  ? 41.099 42.243 -6.780  1.00 13.72 ? 1546 PHE B CD2 1 
ATOM   1871 C  CE1 . PHE B 2 30  ? 41.530 39.577 -6.137  1.00 14.70 ? 1546 PHE B CE1 1 
ATOM   1872 C  CE2 . PHE B 2 30  ? 40.680 41.748 -5.544  1.00 14.99 ? 1546 PHE B CE2 1 
ATOM   1873 C  CZ  . PHE B 2 30  ? 40.897 40.413 -5.223  1.00 14.37 ? 1546 PHE B CZ  1 
ATOM   1874 N  N   . ASP B 2 31  ? 45.116 43.358 -10.609 1.00 19.30 ? 1547 ASP B N   1 
ATOM   1875 C  CA  . ASP B 2 31  ? 45.602 43.709 -11.934 1.00 22.97 ? 1547 ASP B CA  1 
ATOM   1876 C  C   . ASP B 2 31  ? 46.437 42.557 -12.464 1.00 22.48 ? 1547 ASP B C   1 
ATOM   1877 O  O   . ASP B 2 31  ? 47.139 41.882 -11.712 1.00 24.30 ? 1547 ASP B O   1 
ATOM   1878 C  CB  . ASP B 2 31  ? 46.481 44.962 -11.901 1.00 25.04 ? 1547 ASP B CB  1 
ATOM   1879 C  CG  . ASP B 2 31  ? 45.736 46.193 -11.447 1.00 28.33 ? 1547 ASP B CG  1 
ATOM   1880 O  OD1 . ASP B 2 31  ? 44.491 46.212 -11.535 1.00 30.07 ? 1547 ASP B OD1 1 
ATOM   1881 O  OD2 . ASP B 2 31  ? 46.408 47.155 -11.016 1.00 32.49 ? 1547 ASP B OD2 1 
ATOM   1882 N  N   . GLU B 2 32  ? 46.346 42.329 -13.765 1.00 22.96 ? 1548 GLU B N   1 
ATOM   1883 C  CA  . GLU B 2 32  ? 47.118 41.288 -14.413 1.00 22.18 ? 1548 GLU B CA  1 
ATOM   1884 C  C   . GLU B 2 32  ? 47.981 42.024 -15.422 1.00 23.17 ? 1548 GLU B C   1 
ATOM   1885 O  O   . GLU B 2 32  ? 47.867 41.829 -16.633 1.00 24.15 ? 1548 GLU B O   1 
ATOM   1886 C  CB  . GLU B 2 32  ? 46.195 40.276 -15.095 1.00 22.32 ? 1548 GLU B CB  1 
ATOM   1887 C  CG  . GLU B 2 32  ? 45.388 39.459 -14.099 1.00 21.84 ? 1548 GLU B CG  1 
ATOM   1888 C  CD  . GLU B 2 32  ? 44.480 38.444 -14.759 1.00 21.72 ? 1548 GLU B CD  1 
ATOM   1889 O  OE1 . GLU B 2 32  ? 43.684 38.844 -15.632 1.00 20.97 ? 1548 GLU B OE1 1 
ATOM   1890 O  OE2 . GLU B 2 32  ? 44.558 37.251 -14.396 1.00 23.36 ? 1548 GLU B OE2 1 
ATOM   1891 N  N   . LYS B 2 33  ? 48.825 42.901 -14.886 1.00 22.17 ? 1549 LYS B N   1 
ATOM   1892 C  CA  . LYS B 2 33  ? 49.742 43.713 -15.671 1.00 22.56 ? 1549 LYS B CA  1 
ATOM   1893 C  C   . LYS B 2 33  ? 50.822 42.838 -16.275 1.00 20.74 ? 1549 LYS B C   1 
ATOM   1894 O  O   . LYS B 2 33  ? 51.222 41.832 -15.687 1.00 20.95 ? 1549 LYS B O   1 
ATOM   1895 C  CB  . LYS B 2 33  ? 50.412 44.764 -14.781 1.00 24.49 ? 1549 LYS B CB  1 
ATOM   1896 C  CG  . LYS B 2 33  ? 49.486 45.834 -14.236 1.00 29.70 ? 1549 LYS B CG  1 
ATOM   1897 C  CD  . LYS B 2 33  ? 49.077 46.801 -15.325 1.00 33.15 ? 1549 LYS B CD  1 
ATOM   1898 C  CE  . LYS B 2 33  ? 48.328 47.985 -14.745 1.00 36.67 ? 1549 LYS B CE  1 
ATOM   1899 N  NZ  . LYS B 2 33  ? 49.149 48.714 -13.739 1.00 40.31 ? 1549 LYS B NZ  1 
ATOM   1900 N  N   . GLU B 2 34  ? 51.295 43.223 -17.452 1.00 19.67 ? 1550 GLU B N   1 
ATOM   1901 C  CA  . GLU B 2 34  ? 52.353 42.472 -18.099 1.00 20.42 ? 1550 GLU B CA  1 
ATOM   1902 C  C   . GLU B 2 34  ? 53.610 42.632 -17.258 1.00 20.42 ? 1550 GLU B C   1 
ATOM   1903 O  O   . GLU B 2 34  ? 53.912 43.722 -16.769 1.00 21.55 ? 1550 GLU B O   1 
ATOM   1904 C  CB  . GLU B 2 34  ? 52.577 42.987 -19.518 1.00 21.71 ? 1550 GLU B CB  1 
ATOM   1905 C  CG  . GLU B 2 34  ? 51.559 42.447 -20.510 1.00 25.16 ? 1550 GLU B CG  1 
ATOM   1906 C  CD  . GLU B 2 34  ? 51.666 43.101 -21.867 1.00 27.14 ? 1550 GLU B CD  1 
ATOM   1907 O  OE1 . GLU B 2 34  ? 52.801 43.271 -22.360 1.00 28.85 ? 1550 GLU B OE1 1 
ATOM   1908 O  OE2 . GLU B 2 34  ? 50.611 43.440 -22.443 1.00 30.89 ? 1550 GLU B OE2 1 
ATOM   1909 N  N   . GLN B 2 35  ? 54.329 41.532 -17.082 1.00 19.31 ? 1551 GLN B N   1 
ATOM   1910 C  CA  . GLN B 2 35  ? 55.542 41.516 -16.286 1.00 20.35 ? 1551 GLN B CA  1 
ATOM   1911 C  C   . GLN B 2 35  ? 56.782 41.541 -17.170 1.00 21.10 ? 1551 GLN B C   1 
ATOM   1912 O  O   . GLN B 2 35  ? 56.683 41.486 -18.395 1.00 21.97 ? 1551 GLN B O   1 
ATOM   1913 C  CB  . GLN B 2 35  ? 55.559 40.255 -15.422 1.00 19.40 ? 1551 GLN B CB  1 
ATOM   1914 C  CG  . GLN B 2 35  ? 54.349 40.114 -14.521 1.00 19.34 ? 1551 GLN B CG  1 
ATOM   1915 C  CD  . GLN B 2 35  ? 54.267 41.231 -13.504 1.00 22.39 ? 1551 GLN B CD  1 
ATOM   1916 O  OE1 . GLN B 2 35  ? 55.221 41.481 -12.770 1.00 21.26 ? 1551 GLN B OE1 1 
ATOM   1917 N  NE2 . GLN B 2 35  ? 53.127 41.908 -13.455 1.00 22.77 ? 1551 GLN B NE2 1 
ATOM   1918 N  N   . THR C 3 10  ? 57.949 41.639 -16.544 1.00 22.64 ? 1    THR L N   1 
ATOM   1919 C  CA  . THR C 3 10  ? 59.201 41.634 -17.288 1.00 25.11 ? 1    THR L CA  1 
ATOM   1920 C  C   . THR C 3 10  ? 59.567 40.172 -17.505 1.00 25.06 ? 1    THR L C   1 
ATOM   1921 O  O   . THR C 3 10  ? 59.769 39.432 -16.545 1.00 25.65 ? 1    THR L O   1 
ATOM   1922 C  CB  . THR C 3 10  ? 60.332 42.316 -16.497 1.00 27.42 ? 1    THR L CB  1 
ATOM   1923 O  OG1 . THR C 3 10  ? 59.999 43.692 -16.281 1.00 29.24 ? 1    THR L OG1 1 
ATOM   1924 C  CG2 . THR C 3 10  ? 61.645 42.228 -17.265 1.00 27.94 ? 1    THR L CG2 1 
ATOM   1925 N  N   . GLY C 3 11  ? 59.637 39.756 -18.764 1.00 25.65 ? 2    GLY L N   1 
ATOM   1926 C  CA  . GLY C 3 11  ? 59.967 38.373 -19.057 1.00 25.06 ? 2    GLY L CA  1 
ATOM   1927 C  C   . GLY C 3 11  ? 61.378 38.190 -19.573 1.00 26.56 ? 2    GLY L C   1 
ATOM   1928 O  O   . GLY C 3 11  ? 61.927 39.065 -20.242 1.00 26.49 ? 2    GLY L O   1 
ATOM   1929 N  N   . SER C 3 12  ? 61.972 37.046 -19.255 1.00 28.84 ? 3    SER L N   1 
ATOM   1930 C  CA  . SER C 3 12  ? 63.325 36.743 -19.702 1.00 30.62 ? 3    SER L CA  1 
ATOM   1931 C  C   . SER C 3 12  ? 63.510 35.238 -19.872 1.00 30.37 ? 3    SER L C   1 
ATOM   1932 O  O   . SER C 3 12  ? 62.646 34.475 -19.388 1.00 31.99 ? 3    SER L O   1 
ATOM   1933 C  CB  . SER C 3 12  ? 64.346 37.283 -18.696 1.00 32.10 ? 3    SER L CB  1 
ATOM   1934 O  OG  . SER C 3 12  ? 64.127 36.745 -17.401 1.00 33.78 ? 3    SER L OG  1 
ATOM   1935 N  N   . GLY D 4 1   ? 23.653 64.653 13.149  1.00 26.62 ? 1    GLY C N   1 
ATOM   1936 C  CA  . GLY D 4 1   ? 23.720 65.313 11.814  1.00 25.97 ? 1    GLY C CA  1 
ATOM   1937 C  C   . GLY D 4 1   ? 23.040 64.501 10.728  1.00 25.62 ? 1    GLY C C   1 
ATOM   1938 O  O   . GLY D 4 1   ? 22.550 63.402 10.981  1.00 24.58 ? 1    GLY C O   1 
ATOM   1939 N  N   . SER D 4 2   ? 23.029 65.034 9.509   1.00 24.78 ? 2    SER C N   1 
ATOM   1940 C  CA  . SER D 4 2   ? 22.384 64.364 8.385   1.00 25.77 ? 2    SER C CA  1 
ATOM   1941 C  C   . SER D 4 2   ? 23.325 63.569 7.486   1.00 26.68 ? 2    SER C C   1 
ATOM   1942 O  O   . SER D 4 2   ? 22.896 63.028 6.467   1.00 25.80 ? 2    SER C O   1 
ATOM   1943 C  CB  . SER D 4 2   ? 21.632 65.390 7.535   1.00 24.41 ? 2    SER C CB  1 
ATOM   1944 O  OG  . SER D 4 2   ? 20.677 66.091 8.309   1.00 23.97 ? 2    SER C OG  1 
HETATM 1945 N  N   . MSE D 4 3   ? 24.601 63.496 7.847   1.00 28.16 ? 3    MSE C N   1 
HETATM 1946 C  CA  . MSE D 4 3   ? 25.553 62.751 7.031   1.00 31.64 ? 3    MSE C CA  1 
HETATM 1947 C  C   . MSE D 4 3   ? 25.087 61.305 6.881   1.00 32.89 ? 3    MSE C C   1 
HETATM 1948 O  O   . MSE D 4 3   ? 24.652 60.685 7.851   1.00 32.94 ? 3    MSE C O   1 
HETATM 1949 C  CB  . MSE D 4 3   ? 26.938 62.778 7.670   1.00 33.78 ? 3    MSE C CB  1 
HETATM 1950 C  CG  . MSE D 4 3   ? 28.000 62.090 6.840   1.00 38.54 ? 3    MSE C CG  1 
HETATM 1951 SE SE  . MSE D 4 3   ? 29.693 62.045 7.747   1.00 49.47 ? 3    MSE C SE  1 
HETATM 1952 C  CE  . MSE D 4 3   ? 30.391 63.745 7.182   1.00 43.04 ? 3    MSE C CE  1 
ATOM   1953 N  N   . GLY D 4 4   ? 25.182 60.771 5.665   1.00 34.65 ? 4    GLY C N   1 
ATOM   1954 C  CA  . GLY D 4 4   ? 24.754 59.401 5.437   1.00 36.89 ? 4    GLY C CA  1 
ATOM   1955 C  C   . GLY D 4 4   ? 25.681 58.384 6.070   1.00 38.07 ? 4    GLY C C   1 
ATOM   1956 O  O   . GLY D 4 4   ? 26.885 58.684 6.213   1.00 38.86 ? 4    GLY C O   1 
HETATM 1957 MG MG  . MG  E 5 .   ? 43.852 18.841 2.109   1.00 27.78 ? 401  MG  A MG  1 
HETATM 1958 CL CL  . CL  F 6 .   ? 24.304 20.875 1.803   1.00 17.97 ? 501  CL  A CL  1 
HETATM 1959 C  C1  . EDO G 7 .   ? 49.678 27.876 17.913  1.00 32.33 ? 502  EDO A C1  1 
HETATM 1960 O  O1  . EDO G 7 .   ? 48.324 27.636 18.334  1.00 32.24 ? 502  EDO A O1  1 
HETATM 1961 C  C2  . EDO G 7 .   ? 49.859 29.331 17.617  1.00 33.08 ? 502  EDO A C2  1 
HETATM 1962 O  O2  . EDO G 7 .   ? 49.776 29.707 16.203  1.00 33.95 ? 502  EDO A O2  1 
HETATM 1963 C  C1  . EDO H 7 .   ? 35.821 26.057 -12.559 1.00 27.36 ? 503  EDO A C1  1 
HETATM 1964 O  O1  . EDO H 7 .   ? 35.083 24.825 -12.633 1.00 26.99 ? 503  EDO A O1  1 
HETATM 1965 C  C2  . EDO H 7 .   ? 37.288 25.766 -12.507 1.00 27.04 ? 503  EDO A C2  1 
HETATM 1966 O  O2  . EDO H 7 .   ? 37.823 25.421 -11.188 1.00 26.81 ? 503  EDO A O2  1 
HETATM 1967 C  C1  . EDO I 7 .   ? 32.109 4.707  -1.196  1.00 32.05 ? 504  EDO A C1  1 
HETATM 1968 O  O1  . EDO I 7 .   ? 30.999 3.924  -0.720  1.00 34.90 ? 504  EDO A O1  1 
HETATM 1969 C  C2  . EDO I 7 .   ? 32.483 5.724  -0.166  1.00 30.33 ? 504  EDO A C2  1 
HETATM 1970 O  O2  . EDO I 7 .   ? 33.342 5.246  0.915   1.00 32.01 ? 504  EDO A O2  1 
HETATM 1971 C  C1  . EDO J 7 .   ? 20.413 30.402 -8.539  1.00 38.13 ? 505  EDO A C1  1 
HETATM 1972 O  O1  . EDO J 7 .   ? 20.666 29.723 -7.292  1.00 38.27 ? 505  EDO A O1  1 
HETATM 1973 C  C2  . EDO J 7 .   ? 20.600 31.879 -8.368  1.00 38.37 ? 505  EDO A C2  1 
HETATM 1974 O  O2  . EDO J 7 .   ? 20.800 32.350 -6.995  1.00 38.66 ? 505  EDO A O2  1 
HETATM 1975 C  C1  . EDO K 7 .   ? 21.662 24.418 7.348   1.00 35.45 ? 506  EDO A C1  1 
HETATM 1976 O  O1  . EDO K 7 .   ? 23.030 24.437 7.797   1.00 36.25 ? 506  EDO A O1  1 
HETATM 1977 C  C2  . EDO K 7 .   ? 21.624 24.463 5.852   1.00 35.50 ? 506  EDO A C2  1 
HETATM 1978 O  O2  . EDO K 7 .   ? 21.767 25.789 5.249   1.00 36.44 ? 506  EDO A O2  1 
HETATM 1979 O  O   . HOH L 8 .   ? 27.203 32.665 -8.545  1.00 12.07 ? 507  HOH A O   1 
HETATM 1980 O  O   . HOH L 8 .   ? 31.152 37.373 -10.128 1.00 14.68 ? 508  HOH A O   1 
HETATM 1981 O  O   . HOH L 8 .   ? 24.813 29.097 1.505   1.00 19.02 ? 509  HOH A O   1 
HETATM 1982 O  O   . HOH L 8 .   ? 41.055 25.105 -0.319  1.00 11.16 ? 510  HOH A O   1 
HETATM 1983 O  O   . HOH L 8 .   ? 43.681 37.645 6.233   1.00 14.81 ? 511  HOH A O   1 
HETATM 1984 O  O   . HOH L 8 .   ? 45.327 22.607 11.105  1.00 13.75 ? 512  HOH A O   1 
HETATM 1985 O  O   . HOH L 8 .   ? 39.600 31.034 -14.585 1.00 13.20 ? 513  HOH A O   1 
HETATM 1986 O  O   . HOH L 8 .   ? 43.640 26.446 -6.581  1.00 14.05 ? 514  HOH A O   1 
HETATM 1987 O  O   . HOH L 8 .   ? 25.339 14.708 -6.366  1.00 21.76 ? 515  HOH A O   1 
HETATM 1988 O  O   . HOH L 8 .   ? 47.852 25.013 18.123  1.00 15.00 ? 516  HOH A O   1 
HETATM 1989 O  O   . HOH L 8 .   ? 41.038 31.746 -16.720 1.00 15.00 ? 517  HOH A O   1 
HETATM 1990 O  O   . HOH L 8 .   ? 34.703 38.853 -12.674 1.00 14.66 ? 518  HOH A O   1 
HETATM 1991 O  O   . HOH L 8 .   ? 41.935 21.373 -0.230  1.00 15.53 ? 519  HOH A O   1 
HETATM 1992 O  O   . HOH L 8 .   ? 33.052 8.732  7.686   1.00 17.18 ? 520  HOH A O   1 
HETATM 1993 O  O   . HOH L 8 .   ? 29.065 32.805 23.625  1.00 22.84 ? 521  HOH A O   1 
HETATM 1994 O  O   . HOH L 8 .   ? 39.100 42.813 8.664   1.00 24.97 ? 522  HOH A O   1 
HETATM 1995 O  O   . HOH L 8 .   ? 45.225 34.430 -10.500 1.00 14.90 ? 523  HOH A O   1 
HETATM 1996 O  O   . HOH L 8 .   ? 34.758 6.368  4.080   1.00 20.01 ? 524  HOH A O   1 
HETATM 1997 O  O   . HOH L 8 .   ? 27.240 27.751 20.443  1.00 18.69 ? 525  HOH A O   1 
HETATM 1998 O  O   . HOH L 8 .   ? 40.136 25.218 21.558  1.00 19.04 ? 526  HOH A O   1 
HETATM 1999 O  O   . HOH L 8 .   ? 26.144 8.662  10.277  1.00 18.32 ? 527  HOH A O   1 
HETATM 2000 O  O   . HOH L 8 .   ? 40.507 26.175 -10.534 1.00 24.50 ? 528  HOH A O   1 
HETATM 2001 O  O   . HOH L 8 .   ? 28.530 16.165 13.719  1.00 33.54 ? 529  HOH A O   1 
HETATM 2002 O  O   . HOH L 8 .   ? 49.779 14.277 1.640   1.00 26.13 ? 530  HOH A O   1 
HETATM 2003 O  O   . HOH L 8 .   ? 37.754 17.604 13.513  1.00 21.28 ? 531  HOH A O   1 
HETATM 2004 O  O   . HOH L 8 .   ? 42.905 22.704 -2.761  1.00 21.06 ? 532  HOH A O   1 
HETATM 2005 O  O   . HOH L 8 .   ? 25.649 19.886 8.886   1.00 28.23 ? 533  HOH A O   1 
HETATM 2006 O  O   . HOH L 8 .   ? 26.045 10.696 12.207  1.00 26.17 ? 534  HOH A O   1 
HETATM 2007 O  O   . HOH L 8 .   ? 32.469 36.471 23.268  1.00 30.94 ? 535  HOH A O   1 
HETATM 2008 O  O   . HOH L 8 .   ? 45.943 28.640 19.548  1.00 23.84 ? 536  HOH A O   1 
HETATM 2009 O  O   . HOH L 8 .   ? 43.494 30.640 -16.264 1.00 19.57 ? 537  HOH A O   1 
HETATM 2010 O  O   . HOH L 8 .   ? 40.052 27.988 21.059  1.00 19.96 ? 538  HOH A O   1 
HETATM 2011 O  O   . HOH L 8 .   ? 30.163 11.427 -5.817  1.00 23.16 ? 539  HOH A O   1 
HETATM 2012 O  O   . HOH L 8 .   ? 22.655 26.060 -1.019  1.00 25.88 ? 540  HOH A O   1 
HETATM 2013 O  O   . HOH L 8 .   ? 47.443 25.123 -1.056  1.00 26.06 ? 541  HOH A O   1 
HETATM 2014 O  O   . HOH L 8 .   ? 43.351 38.717 -10.710 1.00 31.36 ? 542  HOH A O   1 
HETATM 2015 O  O   . HOH L 8 .   ? 47.439 22.148 9.534   1.00 23.85 ? 543  HOH A O   1 
HETATM 2016 O  O   . HOH L 8 .   ? 39.265 8.211  3.837   1.00 24.72 ? 544  HOH A O   1 
HETATM 2017 O  O   . HOH L 8 .   ? 36.013 33.810 24.513  1.00 26.17 ? 545  HOH A O   1 
HETATM 2018 O  O   . HOH L 8 .   ? 41.724 36.316 13.254  1.00 25.30 ? 546  HOH A O   1 
HETATM 2019 O  O   . HOH L 8 .   ? 38.645 15.363 -8.356  1.00 24.55 ? 547  HOH A O   1 
HETATM 2020 O  O   . HOH L 8 .   ? 31.955 12.217 13.710  1.00 26.51 ? 548  HOH A O   1 
HETATM 2021 O  O   . HOH L 8 .   ? 43.052 19.153 9.777   1.00 23.61 ? 549  HOH A O   1 
HETATM 2022 O  O   . HOH L 8 .   ? 45.777 32.997 -12.641 1.00 28.74 ? 550  HOH A O   1 
HETATM 2023 O  O   . HOH L 8 .   ? 28.793 15.549 -7.585  1.00 26.71 ? 551  HOH A O   1 
HETATM 2024 O  O   . HOH L 8 .   ? 21.473 35.733 -4.098  1.00 21.73 ? 552  HOH A O   1 
HETATM 2025 O  O   . HOH L 8 .   ? 42.925 18.920 -0.016  1.00 30.56 ? 553  HOH A O   1 
HETATM 2026 O  O   . HOH L 8 .   ? 28.680 -0.098 15.206  1.00 24.41 ? 554  HOH A O   1 
HETATM 2027 O  O   . HOH L 8 .   ? 30.575 22.738 24.395  1.00 28.00 ? 555  HOH A O   1 
HETATM 2028 O  O   . HOH L 8 .   ? 17.766 10.990 3.488   1.00 31.85 ? 556  HOH A O   1 
HETATM 2029 O  O   . HOH L 8 .   ? 41.787 11.851 9.383   1.00 31.75 ? 557  HOH A O   1 
HETATM 2030 O  O   . HOH L 8 .   ? 19.342 13.836 4.361   1.00 26.81 ? 558  HOH A O   1 
HETATM 2031 O  O   . HOH L 8 .   ? 28.428 11.606 12.742  1.00 32.86 ? 559  HOH A O   1 
HETATM 2032 O  O   . HOH L 8 .   ? 29.916 3.091  12.731  1.00 35.96 ? 560  HOH A O   1 
HETATM 2033 O  O   . HOH L 8 .   ? 32.525 39.422 -19.919 1.00 28.79 ? 561  HOH A O   1 
HETATM 2034 O  O   . HOH L 8 .   ? 23.391 12.991 -5.165  1.00 27.70 ? 562  HOH A O   1 
HETATM 2035 O  O   . HOH L 8 .   ? 37.988 45.231 8.061   1.00 31.23 ? 563  HOH A O   1 
HETATM 2036 O  O   . HOH L 8 .   ? 44.253 30.674 -13.637 1.00 26.48 ? 564  HOH A O   1 
HETATM 2037 O  O   . HOH L 8 .   ? 50.881 30.964 -3.729  1.00 34.82 ? 565  HOH A O   1 
HETATM 2038 O  O   . HOH L 8 .   ? 40.933 28.825 -10.989 1.00 42.43 ? 566  HOH A O   1 
HETATM 2039 O  O   . HOH L 8 .   ? 27.184 22.223 9.119   1.00 27.88 ? 567  HOH A O   1 
HETATM 2040 O  O   . HOH L 8 .   ? 34.540 39.110 11.358  1.00 40.78 ? 568  HOH A O   1 
HETATM 2041 O  O   . HOH L 8 .   ? 46.502 22.169 -3.457  1.00 30.26 ? 569  HOH A O   1 
HETATM 2042 O  O   . HOH L 8 .   ? 26.474 24.441 -5.560  1.00 27.23 ? 570  HOH A O   1 
HETATM 2043 O  O   . HOH L 8 .   ? 21.166 23.641 -4.948  1.00 35.36 ? 571  HOH A O   1 
HETATM 2044 O  O   . HOH L 8 .   ? 46.816 32.597 16.414  1.00 35.59 ? 572  HOH A O   1 
HETATM 2045 O  O   . HOH L 8 .   ? 29.879 14.101 14.638  1.00 31.68 ? 573  HOH A O   1 
HETATM 2046 O  O   . HOH L 8 .   ? 21.692 33.500 2.984   1.00 30.16 ? 574  HOH A O   1 
HETATM 2047 O  O   . HOH L 8 .   ? 29.295 27.121 22.187  1.00 25.57 ? 575  HOH A O   1 
HETATM 2048 O  O   . HOH L 8 .   ? 28.731 12.779 -8.089  1.00 38.33 ? 576  HOH A O   1 
HETATM 2049 O  O   . HOH L 8 .   ? 27.280 16.834 -9.400  1.00 46.09 ? 577  HOH A O   1 
HETATM 2050 O  O   . HOH L 8 .   ? 26.071 25.682 -7.687  1.00 35.23 ? 578  HOH A O   1 
HETATM 2051 O  O   . HOH L 8 .   ? 42.737 27.677 -16.494 1.00 43.50 ? 579  HOH A O   1 
HETATM 2052 O  O   . HOH L 8 .   ? 35.195 13.995 13.837  1.00 34.72 ? 580  HOH A O   1 
HETATM 2053 O  O   . HOH L 8 .   ? 49.674 15.137 4.173   1.00 42.43 ? 581  HOH A O   1 
HETATM 2054 O  O   . HOH L 8 .   ? 24.992 40.863 2.394   1.00 29.44 ? 582  HOH A O   1 
HETATM 2055 O  O   . HOH L 8 .   ? 35.938 29.931 22.590  1.00 33.47 ? 583  HOH A O   1 
HETATM 2056 O  O   . HOH L 8 .   ? 36.358 31.790 18.073  1.00 38.64 ? 584  HOH A O   1 
HETATM 2057 O  O   . HOH L 8 .   ? 47.298 25.185 -13.959 1.00 27.59 ? 585  HOH A O   1 
HETATM 2058 O  O   . HOH L 8 .   ? 49.410 31.445 -0.598  1.00 37.89 ? 586  HOH A O   1 
HETATM 2059 O  O   . HOH L 8 .   ? 32.034 44.105 -10.298 1.00 32.29 ? 587  HOH A O   1 
HETATM 2060 O  O   . HOH L 8 .   ? 46.589 20.057 12.718  1.00 35.82 ? 588  HOH A O   1 
HETATM 2061 O  O   . HOH L 8 .   ? 40.404 18.582 19.335  1.00 37.38 ? 589  HOH A O   1 
HETATM 2062 O  O   . HOH L 8 .   ? 36.397 37.290 23.171  1.00 38.30 ? 590  HOH A O   1 
HETATM 2063 O  O   . HOH L 8 .   ? 45.419 35.806 6.232   1.00 39.97 ? 591  HOH A O   1 
HETATM 2064 O  O   . HOH L 8 .   ? 39.400 18.431 15.599  1.00 28.80 ? 592  HOH A O   1 
HETATM 2065 O  O   . HOH L 8 .   ? 32.747 22.249 25.771  1.00 35.21 ? 593  HOH A O   1 
HETATM 2066 O  O   . HOH L 8 .   ? 31.993 43.225 -12.811 1.00 31.67 ? 594  HOH A O   1 
HETATM 2067 O  O   . HOH L 8 .   ? 36.965 41.556 8.934   1.00 34.98 ? 595  HOH A O   1 
HETATM 2068 O  O   . HOH L 8 .   ? 28.311 37.534 18.638  1.00 41.87 ? 596  HOH A O   1 
HETATM 2069 O  O   . HOH L 8 .   ? 36.900 23.769 24.433  1.00 36.25 ? 597  HOH A O   1 
HETATM 2070 O  O   . HOH L 8 .   ? 22.163 15.646 14.398  1.00 36.85 ? 598  HOH A O   1 
HETATM 2071 O  O   . HOH L 8 .   ? 35.492 21.090 24.155  1.00 42.67 ? 599  HOH A O   1 
HETATM 2072 O  O   . HOH L 8 .   ? 48.632 28.953 2.985   1.00 31.18 ? 600  HOH A O   1 
HETATM 2073 O  O   . HOH L 8 .   ? 39.959 28.401 -13.559 1.00 38.45 ? 601  HOH A O   1 
HETATM 2074 O  O   . HOH L 8 .   ? 43.928 36.491 15.046  1.00 44.76 ? 602  HOH A O   1 
HETATM 2075 O  O   . HOH L 8 .   ? 41.009 17.495 -8.021  1.00 28.89 ? 603  HOH A O   1 
HETATM 2076 O  O   . HOH L 8 .   ? 19.063 32.664 8.432   1.00 51.10 ? 604  HOH A O   1 
HETATM 2077 O  O   . HOH L 8 .   ? 35.431 41.465 11.175  1.00 35.75 ? 605  HOH A O   1 
HETATM 2078 O  O   . HOH L 8 .   ? 43.399 15.096 -1.902  1.00 35.28 ? 606  HOH A O   1 
HETATM 2079 O  O   . HOH L 8 .   ? 43.037 30.072 18.750  1.00 45.64 ? 607  HOH A O   1 
HETATM 2080 O  O   . HOH L 8 .   ? 44.652 33.989 15.169  1.00 36.16 ? 608  HOH A O   1 
HETATM 2081 O  O   . HOH L 8 .   ? 38.229 48.920 9.835   1.00 47.09 ? 609  HOH A O   1 
HETATM 2082 O  O   . HOH L 8 .   ? 44.947 18.550 19.997  1.00 36.95 ? 610  HOH A O   1 
HETATM 2083 O  O   . HOH L 8 .   ? 19.249 33.307 -4.291  1.00 35.52 ? 611  HOH A O   1 
HETATM 2084 O  O   . HOH L 8 .   ? 32.240 5.674  -7.678  1.00 42.41 ? 612  HOH A O   1 
HETATM 2085 O  O   . HOH L 8 .   ? 25.079 5.184  2.319   1.00 43.83 ? 613  HOH A O   1 
HETATM 2086 O  O   . HOH L 8 .   ? 47.452 34.447 -8.833  1.00 33.02 ? 614  HOH A O   1 
HETATM 2087 O  O   . HOH L 8 .   ? 31.823 25.421 -14.083 1.00 43.26 ? 615  HOH A O   1 
HETATM 2088 O  O   . HOH L 8 .   ? 21.662 1.721  13.249  1.00 37.77 ? 616  HOH A O   1 
HETATM 2089 O  O   . HOH L 8 .   ? 43.284 20.715 -10.461 1.00 32.13 ? 617  HOH A O   1 
HETATM 2090 O  O   . HOH L 8 .   ? 23.845 9.069  -4.875  1.00 37.96 ? 618  HOH A O   1 
HETATM 2091 O  O   . HOH L 8 .   ? 42.205 23.336 -17.516 1.00 39.25 ? 619  HOH A O   1 
HETATM 2092 O  O   . HOH L 8 .   ? 40.071 29.109 18.652  1.00 36.37 ? 620  HOH A O   1 
HETATM 2093 O  O   . HOH L 8 .   ? 50.037 23.125 9.649   1.00 45.98 ? 621  HOH A O   1 
HETATM 2094 O  O   . HOH L 8 .   ? 19.583 34.873 10.411  1.00 47.78 ? 622  HOH A O   1 
HETATM 2095 O  O   . HOH L 8 .   ? 43.464 17.607 18.095  1.00 47.57 ? 623  HOH A O   1 
HETATM 2096 O  O   . HOH L 8 .   ? 25.361 15.356 16.333  1.00 41.25 ? 624  HOH A O   1 
HETATM 2097 O  O   . HOH L 8 .   ? 28.757 38.927 -17.342 1.00 34.49 ? 625  HOH A O   1 
HETATM 2098 O  O   . HOH L 8 .   ? 23.938 -1.305 12.858  1.00 51.98 ? 626  HOH A O   1 
HETATM 2099 O  O   . HOH L 8 .   ? 33.517 18.774 -13.399 1.00 46.54 ? 627  HOH A O   1 
HETATM 2100 O  O   . HOH L 8 .   ? 49.091 33.188 18.209  1.00 46.77 ? 628  HOH A O   1 
HETATM 2101 O  O   . HOH L 8 .   ? 50.357 27.234 -0.902  1.00 40.05 ? 629  HOH A O   1 
HETATM 2102 O  O   . HOH L 8 .   ? 25.608 6.521  -2.912  1.00 43.02 ? 630  HOH A O   1 
HETATM 2103 O  O   . HOH L 8 .   ? 38.264 4.869  -2.160  1.00 38.27 ? 631  HOH A O   1 
HETATM 2104 O  O   . HOH L 8 .   ? 47.852 13.446 6.230   1.00 45.10 ? 632  HOH A O   1 
HETATM 2105 O  O   . HOH L 8 .   ? 30.371 42.873 -21.841 1.00 49.83 ? 633  HOH A O   1 
HETATM 2106 O  O   . HOH L 8 .   ? 25.807 26.178 -10.206 1.00 41.92 ? 634  HOH A O   1 
HETATM 2107 O  O   . HOH L 8 .   ? 20.377 17.443 -2.962  1.00 37.23 ? 635  HOH A O   1 
HETATM 2108 O  O   . HOH L 8 .   ? 26.310 19.158 -9.197  1.00 40.75 ? 636  HOH A O   1 
HETATM 2109 O  O   . HOH L 8 .   ? 38.089 28.511 23.290  1.00 52.16 ? 637  HOH A O   1 
HETATM 2110 O  O   . HOH L 8 .   ? 39.671 34.256 14.970  1.00 52.34 ? 638  HOH A O   1 
HETATM 2111 O  O   . HOH L 8 .   ? 20.912 34.446 6.722   1.00 51.80 ? 639  HOH A O   1 
HETATM 2112 O  O   . HOH L 8 .   ? 47.355 17.692 16.464  1.00 44.35 ? 640  HOH A O   1 
HETATM 2113 O  O   . HOH L 8 .   ? 40.877 24.164 -19.590 1.00 50.62 ? 641  HOH A O   1 
HETATM 2114 O  O   . HOH L 8 .   ? 19.295 40.596 -6.896  1.00 40.71 ? 642  HOH A O   1 
HETATM 2115 O  O   . HOH L 8 .   ? 44.688 45.877 11.462  1.00 49.75 ? 643  HOH A O   1 
HETATM 2116 O  O   . HOH L 8 .   ? 20.892 37.818 3.324   1.00 36.26 ? 644  HOH A O   1 
HETATM 2117 O  O   . HOH L 8 .   ? 37.603 28.849 -15.685 1.00 40.98 ? 645  HOH A O   1 
HETATM 2118 O  O   . HOH L 8 .   ? 45.555 18.839 0.687   1.00 36.06 ? 646  HOH A O   1 
HETATM 2119 O  O   . HOH L 8 .   ? 35.456 41.167 -13.948 1.00 25.05 ? 647  HOH A O   1 
HETATM 2120 O  O   . HOH L 8 .   ? 31.200 38.910 -25.308 1.00 37.28 ? 648  HOH A O   1 
HETATM 2121 O  O   . HOH L 8 .   ? 21.554 13.921 10.766  1.00 36.99 ? 649  HOH A O   1 
HETATM 2122 O  O   . HOH L 8 .   ? 46.026 26.992 -15.385 1.00 39.58 ? 650  HOH A O   1 
HETATM 2123 O  O   . HOH L 8 .   ? 37.903 17.801 18.592  1.00 48.95 ? 651  HOH A O   1 
HETATM 2124 O  O   . HOH L 8 .   ? 43.747 13.395 8.035   1.00 39.48 ? 652  HOH A O   1 
HETATM 2125 O  O   . HOH L 8 .   ? 34.071 38.400 19.794  1.00 35.56 ? 653  HOH A O   1 
HETATM 2126 O  O   . HOH L 8 .   ? 43.250 39.476 13.165  1.00 37.82 ? 654  HOH A O   1 
HETATM 2127 O  O   . HOH L 8 .   ? 41.483 7.783  2.019   1.00 45.02 ? 655  HOH A O   1 
HETATM 2128 O  O   . HOH L 8 .   ? 33.931 41.093 14.772  1.00 41.75 ? 656  HOH A O   1 
HETATM 2129 O  O   . HOH L 8 .   ? 20.394 26.531 -2.994  1.00 45.01 ? 657  HOH A O   1 
HETATM 2130 O  O   . HOH L 8 .   ? 46.284 41.009 9.919   1.00 41.10 ? 658  HOH A O   1 
HETATM 2131 O  O   . HOH L 8 .   ? 49.956 29.227 0.659   1.00 41.68 ? 659  HOH A O   1 
HETATM 2132 O  O   . HOH L 8 .   ? 25.126 33.755 20.531  1.00 45.06 ? 660  HOH A O   1 
HETATM 2133 O  O   . HOH L 8 .   ? 45.660 12.088 6.545   1.00 47.03 ? 661  HOH A O   1 
HETATM 2134 O  O   . HOH L 8 .   ? 53.064 31.023 -2.009  1.00 44.55 ? 662  HOH A O   1 
HETATM 2135 O  O   . HOH L 8 .   ? 47.488 40.412 5.641   1.00 38.47 ? 663  HOH A O   1 
HETATM 2136 O  O   . HOH L 8 .   ? 23.372 38.108 -12.261 1.00 36.78 ? 664  HOH A O   1 
HETATM 2137 O  O   . HOH L 8 .   ? 32.823 6.238  8.957   1.00 31.69 ? 665  HOH A O   1 
HETATM 2138 O  O   . HOH L 8 .   ? 21.776 33.149 15.893  1.00 43.71 ? 666  HOH A O   1 
HETATM 2139 O  O   . HOH L 8 .   ? 25.948 2.717  3.211   1.00 41.21 ? 667  HOH A O   1 
HETATM 2140 O  O   . HOH L 8 .   ? 37.457 24.842 -16.507 1.00 48.71 ? 668  HOH A O   1 
HETATM 2141 O  O   . HOH L 8 .   ? 25.655 4.669  -0.498  1.00 41.01 ? 669  HOH A O   1 
HETATM 2142 O  O   . HOH L 8 .   ? 34.993 41.490 -16.488 1.00 42.97 ? 670  HOH A O   1 
HETATM 2143 O  O   . HOH L 8 .   ? 51.572 32.788 -1.315  1.00 41.87 ? 671  HOH A O   1 
HETATM 2144 O  O   . HOH L 8 .   ? 34.147 30.225 -17.326 1.00 37.43 ? 672  HOH A O   1 
HETATM 2145 O  O   . HOH L 8 .   ? 25.757 45.671 -7.830  1.00 44.53 ? 673  HOH A O   1 
HETATM 2146 O  O   . HOH L 8 .   ? 37.549 6.250  2.375   1.00 38.07 ? 674  HOH A O   1 
HETATM 2147 O  O   . HOH L 8 .   ? 16.646 31.917 2.952   1.00 42.39 ? 675  HOH A O   1 
HETATM 2148 O  O   . HOH L 8 .   ? 49.733 40.229 1.785   1.00 43.85 ? 676  HOH A O   1 
HETATM 2149 O  O   . HOH L 8 .   ? 46.253 39.703 7.766   1.00 42.68 ? 677  HOH A O   1 
HETATM 2150 O  O   . HOH L 8 .   ? 37.677 35.948 18.903  1.00 45.70 ? 678  HOH A O   1 
HETATM 2151 O  O   . HOH L 8 .   ? 54.776 29.648 2.106   1.00 45.43 ? 679  HOH A O   1 
HETATM 2152 O  O   . HOH L 8 .   ? 27.204 25.113 -13.388 1.00 42.37 ? 680  HOH A O   1 
HETATM 2153 O  O   . HOH L 8 .   ? 16.997 29.300 -0.454  1.00 42.78 ? 681  HOH A O   1 
HETATM 2154 O  O   . HOH L 8 .   ? 44.578 21.178 -4.267  1.00 45.11 ? 682  HOH A O   1 
HETATM 2155 O  O   . HOH L 8 .   ? 34.450 39.857 -18.339 1.00 40.15 ? 683  HOH A O   1 
HETATM 2156 O  O   . HOH L 8 .   ? 48.993 29.855 -2.640  1.00 48.30 ? 684  HOH A O   1 
HETATM 2157 O  O   . HOH L 8 .   ? 47.166 30.914 6.435   1.00 40.03 ? 685  HOH A O   1 
HETATM 2158 O  O   . HOH L 8 .   ? 40.570 31.936 15.567  1.00 39.55 ? 686  HOH A O   1 
HETATM 2159 O  O   . HOH L 8 .   ? 47.679 19.437 9.176   1.00 46.30 ? 687  HOH A O   1 
HETATM 2160 O  O   . HOH L 8 .   ? 49.467 32.411 20.725  1.00 49.57 ? 688  HOH A O   1 
HETATM 2161 O  O   . HOH L 8 .   ? 51.817 27.969 14.989  1.00 45.36 ? 689  HOH A O   1 
HETATM 2162 O  O   . HOH L 8 .   ? 45.303 19.657 10.595  1.00 50.38 ? 690  HOH A O   1 
HETATM 2163 O  O   . HOH L 8 .   ? 37.514 51.784 9.970   1.00 45.01 ? 691  HOH A O   1 
HETATM 2164 O  O   . HOH L 8 .   ? 23.691 17.281 -6.725  1.00 34.27 ? 692  HOH A O   1 
HETATM 2165 O  O   . HOH L 8 .   ? 39.832 6.213  -0.004  1.00 43.18 ? 693  HOH A O   1 
HETATM 2166 O  O   . HOH L 8 .   ? 28.440 3.081  -0.375  1.00 40.66 ? 694  HOH A O   1 
HETATM 2167 O  O   . HOH L 8 .   ? 32.185 1.604  -0.032  1.00 39.88 ? 695  HOH A O   1 
HETATM 2168 O  O   . HOH L 8 .   ? 31.504 47.620 2.802   1.00 38.71 ? 696  HOH A O   1 
HETATM 2169 O  O   . HOH L 8 .   ? 21.172 36.234 8.566   1.00 42.66 ? 697  HOH A O   1 
HETATM 2170 O  O   . HOH L 8 .   ? 19.309 10.393 10.198  1.00 38.58 ? 698  HOH A O   1 
HETATM 2171 O  O   . HOH L 8 .   ? 35.310 7.159  11.114  1.00 38.88 ? 699  HOH A O   1 
HETATM 2172 O  O   . HOH L 8 .   ? 48.544 43.963 6.735   1.00 41.80 ? 700  HOH A O   1 
HETATM 2173 O  O   . HOH L 8 .   ? 32.689 38.646 24.608  1.00 39.11 ? 701  HOH A O   1 
HETATM 2174 O  O   . HOH L 8 .   ? 36.473 38.193 18.321  1.00 41.71 ? 702  HOH A O   1 
HETATM 2175 O  O   . HOH L 8 .   ? 25.507 41.267 -12.919 1.00 35.13 ? 703  HOH A O   1 
HETATM 2176 O  O   . HOH L 8 .   ? 23.143 35.618 -15.172 1.00 39.82 ? 704  HOH A O   1 
HETATM 2177 O  O   . HOH L 8 .   ? 49.140 33.897 5.783   1.00 40.42 ? 705  HOH A O   1 
HETATM 2178 O  O   . HOH L 8 .   ? 29.532 27.579 -16.268 1.00 39.77 ? 706  HOH A O   1 
HETATM 2179 O  O   . HOH M 8 .   ? 50.907 39.282 -16.750 1.00 20.51 ? 20   HOH B O   1 
HETATM 2180 O  O   . HOH M 8 .   ? 47.270 47.282 -4.465  1.00 21.63 ? 21   HOH B O   1 
HETATM 2181 O  O   . HOH M 8 .   ? 42.725 45.381 -8.655  1.00 27.15 ? 24   HOH B O   1 
HETATM 2182 O  O   . HOH M 8 .   ? 25.719 40.907 4.909   1.00 26.13 ? 29   HOH B O   1 
HETATM 2183 O  O   . HOH M 8 .   ? 46.444 34.888 -14.485 1.00 30.70 ? 30   HOH B O   1 
HETATM 2184 O  O   . HOH M 8 .   ? 45.201 36.882 -11.552 1.00 28.24 ? 32   HOH B O   1 
HETATM 2185 O  O   . HOH M 8 .   ? 29.442 47.107 13.465  1.00 28.59 ? 45   HOH B O   1 
HETATM 2186 O  O   . HOH M 8 .   ? 49.276 48.894 -1.723  1.00 23.41 ? 46   HOH B O   1 
HETATM 2187 O  O   . HOH M 8 .   ? 45.068 55.619 1.338   1.00 27.50 ? 51   HOH B O   1 
HETATM 2188 O  O   . HOH M 8 .   ? 49.821 42.639 -12.216 1.00 30.32 ? 55   HOH B O   1 
HETATM 2189 O  O   . HOH M 8 .   ? 49.649 49.378 -5.610  1.00 38.05 ? 61   HOH B O   1 
HETATM 2190 O  O   . HOH M 8 .   ? 47.518 52.219 -2.812  1.00 26.66 ? 62   HOH B O   1 
HETATM 2191 O  O   . HOH M 8 .   ? 26.186 41.935 0.560   1.00 29.32 ? 66   HOH B O   1 
HETATM 2192 O  O   . HOH M 8 .   ? 53.219 46.329 -17.171 1.00 28.75 ? 78   HOH B O   1 
HETATM 2193 O  O   . HOH M 8 .   ? 31.705 45.557 4.386   1.00 36.53 ? 88   HOH B O   1 
HETATM 2194 O  O   . HOH M 8 .   ? 49.946 45.582 -18.866 1.00 29.05 ? 91   HOH B O   1 
HETATM 2195 O  O   . HOH M 8 .   ? 47.419 54.724 -3.794  1.00 29.22 ? 96   HOH B O   1 
HETATM 2196 O  O   . HOH M 8 .   ? 43.152 40.996 -17.014 1.00 34.31 ? 109  HOH B O   1 
HETATM 2197 O  O   . HOH M 8 .   ? 32.211 44.343 12.977  1.00 35.11 ? 115  HOH B O   1 
HETATM 2198 O  O   . HOH M 8 .   ? 57.018 43.358 -20.359 1.00 34.09 ? 116  HOH B O   1 
HETATM 2199 O  O   . HOH M 8 .   ? 47.866 53.440 6.326   1.00 43.86 ? 119  HOH B O   1 
HETATM 2200 O  O   . HOH M 8 .   ? 41.401 44.934 -4.130  1.00 32.52 ? 122  HOH B O   1 
HETATM 2201 O  O   . HOH M 8 .   ? 50.234 39.780 -12.613 1.00 40.18 ? 124  HOH B O   1 
HETATM 2202 O  O   . HOH M 8 .   ? 20.932 42.677 5.492   1.00 38.75 ? 130  HOH B O   1 
HETATM 2203 O  O   . HOH M 8 .   ? 23.782 47.257 8.875   1.00 36.18 ? 139  HOH B O   1 
HETATM 2204 O  O   . HOH M 8 .   ? 44.764 43.862 -15.074 1.00 46.84 ? 158  HOH B O   1 
HETATM 2205 O  O   . HOH M 8 .   ? 22.739 41.807 2.902   1.00 45.77 ? 164  HOH B O   1 
HETATM 2206 O  O   . HOH M 8 .   ? 23.791 54.770 -0.960  1.00 47.88 ? 169  HOH B O   1 
HETATM 2207 O  O   . HOH M 8 .   ? 47.034 40.049 -9.804  1.00 36.98 ? 185  HOH B O   1 
HETATM 2208 O  O   . HOH M 8 .   ? 21.902 54.378 -2.782  1.00 45.52 ? 190  HOH B O   1 
HETATM 2209 O  O   . HOH M 8 .   ? 55.135 44.572 -21.602 1.00 41.06 ? 201  HOH B O   1 
HETATM 2210 O  O   . HOH M 8 .   ? 23.633 36.693 17.352  1.00 40.00 ? 208  HOH B O   1 
HETATM 2211 O  O   . HOH M 8 .   ? 24.477 38.679 9.302   1.00 44.85 ? 216  HOH B O   1 
HETATM 2212 O  O   . HOH M 8 .   ? 40.564 48.980 -8.727  1.00 38.53 ? 220  HOH B O   1 
HETATM 2213 O  O   . HOH M 8 .   ? 43.085 56.718 -6.539  1.00 40.54 ? 226  HOH B O   1 
HETATM 2214 O  O   . HOH M 8 .   ? 43.339 48.665 -10.895 1.00 40.50 ? 230  HOH B O   1 
HETATM 2215 O  O   . HOH M 8 .   ? 48.992 42.900 -8.868  1.00 40.18 ? 231  HOH B O   1 
HETATM 2216 O  O   . HOH M 8 .   ? 50.311 46.431 -10.063 1.00 38.69 ? 232  HOH B O   1 
HETATM 2217 O  O   . HOH M 8 .   ? 45.885 49.961 -12.873 1.00 42.42 ? 233  HOH B O   1 
HETATM 2218 O  O   . HOH M 8 .   ? 37.971 55.166 6.733   1.00 39.07 ? 238  HOH B O   1 
HETATM 2219 O  O   . HOH M 8 .   ? 26.507 50.321 5.926   1.00 35.74 ? 245  HOH B O   1 
HETATM 2220 O  O   . HOH M 8 .   ? 24.886 49.944 8.651   1.00 37.76 ? 246  HOH B O   1 
HETATM 2221 O  O   . HOH M 8 .   ? 33.171 50.567 6.460   1.00 35.10 ? 247  HOH B O   1 
HETATM 2222 O  O   . HOH N 8 .   ? 62.716 38.725 -15.633 1.00 47.64 ? 152  HOH L O   1 
HETATM 2223 O  O   . HOH N 8 .   ? 65.941 38.623 -21.101 1.00 41.18 ? 167  HOH L O   1 
HETATM 2224 O  O   . HOH N 8 .   ? 65.389 34.398 -23.115 1.00 42.44 ? 181  HOH L O   1 
HETATM 2225 O  O   . HOH O 8 .   ? 22.462 61.075 9.569   1.00 27.13 ? 71   HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   97   ?    ?   ?   A . n 
A 1 2   GLU 2   98   98   GLU GLU A . n 
A 1 3   ILE 3   99   99   ILE ILE A . n 
A 1 4   ILE 4   100  100  ILE ILE A . n 
A 1 5   GLN 5   101  101  GLN GLN A . n 
A 1 6   ILE 6   102  102  ILE ILE A . n 
A 1 7   THR 7   103  103  THR THR A . n 
A 1 8   THR 8   104  104  THR THR A . n 
A 1 9   GLY 9   105  105  GLY GLY A . n 
A 1 10  SER 10  106  106  SER SER A . n 
A 1 11  LYS 11  107  107  LYS LYS A . n 
A 1 12  GLU 12  108  108  GLU GLU A . n 
A 1 13  LEU 13  109  109  LEU LEU A . n 
A 1 14  ASP 14  110  110  ASP ASP A . n 
A 1 15  LYS 15  111  111  LYS LYS A . n 
A 1 16  LEU 16  112  112  LEU LEU A . n 
A 1 17  LEU 17  113  113  LEU LEU A . n 
A 1 18  GLN 18  114  114  GLN GLN A . n 
A 1 19  GLY 19  115  115  GLY GLY A . n 
A 1 20  GLY 20  116  116  GLY GLY A . n 
A 1 21  ILE 21  117  117  ILE ILE A . n 
A 1 22  GLU 22  118  118  GLU GLU A . n 
A 1 23  THR 23  119  119  THR THR A . n 
A 1 24  GLY 24  120  120  GLY GLY A . n 
A 1 25  SER 25  121  121  SER SER A . n 
A 1 26  ILE 26  122  122  ILE ILE A . n 
A 1 27  THR 27  123  123  THR THR A . n 
A 1 28  GLU 28  124  124  GLU GLU A . n 
A 1 29  MSE 29  125  125  MSE MSE A . n 
A 1 30  PHE 30  126  126  PHE PHE A . n 
A 1 31  GLY 31  127  127  GLY GLY A . n 
A 1 32  GLU 32  128  128  GLU GLU A . n 
A 1 33  PHE 33  129  129  PHE PHE A . n 
A 1 34  ARG 34  130  130  ARG ARG A . n 
A 1 35  THR 35  131  131  THR THR A . n 
A 1 36  GLY 36  132  132  GLY GLY A . n 
A 1 37  LYS 37  133  133  LYS LYS A . n 
A 1 38  THR 38  134  134  THR THR A . n 
A 1 39  GLN 39  135  135  GLN GLN A . n 
A 1 40  ILE 40  136  136  ILE ILE A . n 
A 1 41  CYS 41  137  137  CYS CYS A . n 
A 1 42  HIS 42  138  138  HIS HIS A . n 
A 1 43  THR 43  139  139  THR THR A . n 
A 1 44  LEU 44  140  140  LEU LEU A . n 
A 1 45  ALA 45  141  141  ALA ALA A . n 
A 1 46  VAL 46  142  142  VAL VAL A . n 
A 1 47  THR 47  143  143  THR THR A . n 
A 1 48  CYS 48  144  144  CYS CYS A . n 
A 1 49  GLN 49  145  145  GLN GLN A . n 
A 1 50  LEU 50  146  146  LEU LEU A . n 
A 1 51  PRO 51  147  147  PRO PRO A . n 
A 1 52  ILE 52  148  148  ILE ILE A . n 
A 1 53  ASP 53  149  149  ASP ASP A . n 
A 1 54  ARG 54  150  150  ARG ARG A . n 
A 1 55  GLY 55  151  151  GLY GLY A . n 
A 1 56  GLY 56  152  152  GLY GLY A . n 
A 1 57  GLY 57  153  153  GLY GLY A . n 
A 1 58  GLU 58  154  154  GLU GLU A . n 
A 1 59  GLY 59  155  155  GLY GLY A . n 
A 1 60  LYS 60  156  156  LYS LYS A . n 
A 1 61  ALA 61  157  157  ALA ALA A . n 
A 1 62  MSE 62  158  158  MSE MSE A . n 
A 1 63  TYR 63  159  159  TYR TYR A . n 
A 1 64  ILE 64  160  160  ILE ILE A . n 
A 1 65  ASP 65  161  161  ASP ASP A . n 
A 1 66  THR 66  162  162  THR THR A . n 
A 1 67  GLU 67  163  163  GLU GLU A . n 
A 1 68  GLY 68  164  164  GLY GLY A . n 
A 1 69  THR 69  165  165  THR THR A . n 
A 1 70  PHE 70  166  166  PHE PHE A . n 
A 1 71  ARG 71  167  167  ARG ARG A . n 
A 1 72  PRO 72  168  168  PRO PRO A . n 
A 1 73  GLU 73  169  169  GLU GLU A . n 
A 1 74  ARG 74  170  170  ARG ARG A . n 
A 1 75  LEU 75  171  171  LEU LEU A . n 
A 1 76  LEU 76  172  172  LEU LEU A . n 
A 1 77  ALA 77  173  173  ALA ALA A . n 
A 1 78  VAL 78  174  174  VAL VAL A . n 
A 1 79  ALA 79  175  175  ALA ALA A . n 
A 1 80  GLU 80  176  176  GLU GLU A . n 
A 1 81  ARG 81  177  177  ARG ARG A . n 
A 1 82  TYR 82  178  178  TYR TYR A . n 
A 1 83  GLY 83  179  179  GLY GLY A . n 
A 1 84  LEU 84  180  180  LEU LEU A . n 
A 1 85  SER 85  181  181  SER SER A . n 
A 1 86  GLY 86  182  182  GLY GLY A . n 
A 1 87  SER 87  183  183  SER SER A . n 
A 1 88  ASP 88  184  184  ASP ASP A . n 
A 1 89  VAL 89  185  185  VAL VAL A . n 
A 1 90  LEU 90  186  186  LEU LEU A . n 
A 1 91  ASP 91  187  187  ASP ASP A . n 
A 1 92  ASN 92  188  188  ASN ASN A . n 
A 1 93  VAL 93  189  189  VAL VAL A . n 
A 1 94  ALA 94  190  190  ALA ALA A . n 
A 1 95  TYR 95  191  191  TYR TYR A . n 
A 1 96  ALA 96  192  192  ALA ALA A . n 
A 1 97  ARG 97  193  193  ARG ARG A . n 
A 1 98  ALA 98  194  194  ALA ALA A . n 
A 1 99  PHE 99  195  195  PHE PHE A . n 
A 1 100 ASN 100 196  196  ASN ASN A . n 
A 1 101 THR 101 197  197  THR THR A . n 
A 1 102 ASP 102 198  198  ASP ASP A . n 
A 1 103 HIS 103 199  199  HIS HIS A . n 
A 1 104 GLN 104 200  200  GLN GLN A . n 
A 1 105 THR 105 201  201  THR THR A . n 
A 1 106 GLN 106 202  202  GLN GLN A . n 
A 1 107 LEU 107 203  203  LEU LEU A . n 
A 1 108 LEU 108 204  204  LEU LEU A . n 
A 1 109 TYR 109 205  205  TYR TYR A . n 
A 1 110 GLN 110 206  206  GLN GLN A . n 
A 1 111 ALA 111 207  207  ALA ALA A . n 
A 1 112 SER 112 208  208  SER SER A . n 
A 1 113 ALA 113 209  209  ALA ALA A . n 
A 1 114 MSE 114 210  210  MSE MSE A . n 
A 1 115 MSE 115 211  211  MSE MSE A . n 
A 1 116 VAL 116 212  212  VAL VAL A . n 
A 1 117 GLU 117 213  213  GLU GLU A . n 
A 1 118 SER 118 214  214  SER SER A . n 
A 1 119 ARG 119 215  215  ARG ARG A . n 
A 1 120 TYR 120 216  216  TYR TYR A . n 
A 1 121 ALA 121 217  217  ALA ALA A . n 
A 1 122 LEU 122 218  218  LEU LEU A . n 
A 1 123 LEU 123 219  219  LEU LEU A . n 
A 1 124 ILE 124 220  220  ILE ILE A . n 
A 1 125 VAL 125 221  221  VAL VAL A . n 
A 1 126 ASP 126 222  222  ASP ASP A . n 
A 1 127 SER 127 223  223  SER SER A . n 
A 1 128 ALA 128 224  224  ALA ALA A . n 
A 1 129 THR 129 225  225  THR THR A . n 
A 1 130 ALA 130 226  226  ALA ALA A . n 
A 1 131 LEU 131 227  227  LEU LEU A . n 
A 1 132 TYR 132 228  228  TYR TYR A . n 
A 1 133 ARG 133 229  229  ARG ARG A . n 
A 1 134 THR 134 230  ?    ?   ?   A . n 
A 1 135 ASP 135 231  ?    ?   ?   A . n 
A 1 136 TYR 136 232  ?    ?   ?   A . n 
A 1 137 SER 137 233  ?    ?   ?   A . n 
A 1 138 GLY 138 234  ?    ?   ?   A . n 
A 1 139 ARG 139 235  ?    ?   ?   A . n 
A 1 140 GLY 140 236  ?    ?   ?   A . n 
A 1 141 GLU 141 237  237  GLU GLU A . n 
A 1 142 LEU 142 238  238  LEU LEU A . n 
A 1 143 SER 143 239  239  SER SER A . n 
A 1 144 ALA 144 240  240  ALA ALA A . n 
A 1 145 ARG 145 241  241  ARG ARG A . n 
A 1 146 GLN 146 242  242  GLN GLN A . n 
A 1 147 MSE 147 243  243  MSE MSE A . n 
A 1 148 HIS 148 244  244  HIS HIS A . n 
A 1 149 LEU 149 245  245  LEU LEU A . n 
A 1 150 ALA 150 246  246  ALA ALA A . n 
A 1 151 ARG 151 247  247  ARG ARG A . n 
A 1 152 PHE 152 248  248  PHE PHE A . n 
A 1 153 LEU 153 249  249  LEU LEU A . n 
A 1 154 ARG 154 250  250  ARG ARG A . n 
A 1 155 MSE 155 251  251  MSE MSE A . n 
A 1 156 LEU 156 252  252  LEU LEU A . n 
A 1 157 LEU 157 253  253  LEU LEU A . n 
A 1 158 ARG 158 254  254  ARG ARG A . n 
A 1 159 LEU 159 255  255  LEU LEU A . n 
A 1 160 ALA 160 256  256  ALA ALA A . n 
A 1 161 ASP 161 257  257  ASP ASP A . n 
A 1 162 GLU 162 258  258  GLU GLU A . n 
A 1 163 PHE 163 259  259  PHE PHE A . n 
A 1 164 GLY 164 260  260  GLY GLY A . n 
A 1 165 VAL 165 261  261  VAL VAL A . n 
A 1 166 ALA 166 262  262  ALA ALA A . n 
A 1 167 VAL 167 263  263  VAL VAL A . n 
A 1 168 VAL 168 264  264  VAL VAL A . n 
A 1 169 ILE 169 265  265  ILE ILE A . n 
A 1 170 THR 170 266  266  THR THR A . n 
A 1 171 ASN 171 267  267  ASN ASN A . n 
A 1 172 GLN 172 268  ?    ?   ?   A . n 
A 1 173 VAL 173 269  ?    ?   ?   A . n 
A 1 174 VAL 174 270  ?    ?   ?   A . n 
A 1 175 ALA 175 271  ?    ?   ?   A . n 
A 1 176 GLN 176 272  ?    ?   ?   A . n 
A 1 177 VAL 177 273  ?    ?   ?   A . n 
A 1 178 ASP 178 274  ?    ?   ?   A . n 
A 1 179 GLY 179 275  ?    ?   ?   A . n 
A 1 180 ALA 180 276  ?    ?   ?   A . n 
A 1 181 ALA 181 277  ?    ?   ?   A . n 
A 1 182 MSE 182 278  ?    ?   ?   A . n 
A 1 183 PHE 183 279  ?    ?   ?   A . n 
A 1 184 ALA 184 280  ?    ?   ?   A . n 
A 1 185 ALA 185 281  ?    ?   ?   A . n 
A 1 186 ASP 186 282  ?    ?   ?   A . n 
A 1 187 PRO 187 283  ?    ?   ?   A . n 
A 1 188 LYS 188 284  ?    ?   ?   A . n 
A 1 189 LYS 189 285  ?    ?   ?   A . n 
A 1 190 PRO 190 286  ?    ?   ?   A . n 
A 1 191 ILE 191 287  ?    ?   ?   A . n 
A 1 192 GLY 192 288  ?    ?   ?   A . n 
A 1 193 GLY 193 289  ?    ?   ?   A . n 
A 1 194 ASN 194 290  ?    ?   ?   A . n 
A 1 195 ILE 195 291  ?    ?   ?   A . n 
A 1 196 ILE 196 292  ?    ?   ?   A . n 
A 1 197 ALA 197 293  293  ALA ALA A . n 
A 1 198 HIS 198 294  294  HIS HIS A . n 
A 1 199 ALA 199 295  295  ALA ALA A . n 
A 1 200 SER 200 296  296  SER SER A . n 
A 1 201 THR 201 297  297  THR THR A . n 
A 1 202 THR 202 298  298  THR THR A . n 
A 1 203 ARG 203 299  299  ARG ARG A . n 
A 1 204 LEU 204 300  300  LEU LEU A . n 
A 1 205 TYR 205 301  301  TYR TYR A . n 
A 1 206 LEU 206 302  302  LEU LEU A . n 
A 1 207 ARG 207 303  303  ARG ARG A . n 
A 1 208 LYS 208 304  304  LYS LYS A . n 
A 1 209 GLY 209 305  305  GLY GLY A . n 
A 1 210 ARG 210 306  306  ARG ARG A . n 
A 1 211 GLY 211 307  307  GLY GLY A . n 
A 1 212 GLU 212 308  308  GLU GLU A . n 
A 1 213 THR 213 309  309  THR THR A . n 
A 1 214 ARG 214 310  310  ARG ARG A . n 
A 1 215 ILE 215 311  311  ILE ILE A . n 
A 1 216 CYS 216 312  312  CYS CYS A . n 
A 1 217 LYS 217 313  313  LYS LYS A . n 
A 1 218 ILE 218 314  314  ILE ILE A . n 
A 1 219 TYR 219 315  315  TYR TYR A . n 
A 1 220 ASP 220 316  316  ASP ASP A . n 
A 1 221 SER 221 317  317  SER SER A . n 
A 1 222 PRO 222 318  318  PRO PRO A . n 
A 1 223 CYS 223 319  319  CYS CYS A . n 
A 1 224 LEU 224 320  320  LEU LEU A . n 
A 1 225 PRO 225 321  321  PRO PRO A . n 
A 1 226 GLU 226 322  322  GLU GLU A . n 
A 1 227 ALA 227 323  323  ALA ALA A . n 
A 1 228 GLU 228 324  324  GLU GLU A . n 
A 1 229 ALA 229 325  325  ALA ALA A . n 
A 1 230 MSE 230 326  326  MSE MSE A . n 
A 1 231 PHE 231 327  327  PHE PHE A . n 
A 1 232 ALA 232 328  328  ALA ALA A . n 
A 1 233 ILE 233 329  329  ILE ILE A . n 
A 1 234 ASN 234 330  330  ASN ASN A . n 
A 1 235 ALA 235 331  331  ALA ALA A . n 
A 1 236 ASP 236 332  332  ASP ASP A . n 
A 1 237 GLY 237 333  333  GLY GLY A . n 
A 1 238 VAL 238 334  334  VAL VAL A . n 
A 1 239 GLY 239 335  335  GLY GLY A . n 
A 1 240 ASP 240 336  336  ASP ASP A . n 
A 1 241 ALA 241 337  337  ALA ALA A . n 
A 1 242 LYS 242 338  338  LYS LYS A . n 
A 1 243 ASP 243 339  339  ASP ASP A . n 
B 2 1   LYS 1   1517 ?    ?   ?   B . n 
B 2 2   GLU 2   1518 ?    ?   ?   B . n 
B 2 3   PRO 3   1519 1519 PRO PRO B . n 
B 2 4   THR 4   1520 1520 THR THR B . n 
B 2 5   LEU 5   1521 1521 LEU LEU B . n 
B 2 6   LEU 6   1522 1522 LEU LEU B . n 
B 2 7   GLY 7   1523 1523 GLY GLY B . n 
B 2 8   PHE 8   1524 1524 PHE PHE B . n 
B 2 9   HIS 9   1525 1525 HIS HIS B . n 
B 2 10  THR 10  1526 1526 THR THR B . n 
B 2 11  ALA 11  1527 1527 ALA ALA B . n 
B 2 12  SER 12  1528 1528 SER SER B . n 
B 2 13  GLY 13  1529 1529 GLY GLY B . n 
B 2 14  LYS 14  1530 1530 LYS LYS B . n 
B 2 15  LYS 15  1531 1531 LYS LYS B . n 
B 2 16  VAL 16  1532 1532 VAL VAL B . n 
B 2 17  LYS 17  1533 1533 LYS LYS B . n 
B 2 18  ILE 18  1534 1534 ILE ILE B . n 
B 2 19  ALA 19  1535 1535 ALA ALA B . n 
B 2 20  LYS 20  1536 1536 LYS LYS B . n 
B 2 21  GLU 21  1537 1537 GLU GLU B . n 
B 2 22  SER 22  1538 1538 SER SER B . n 
B 2 23  LEU 23  1539 1539 LEU LEU B . n 
B 2 24  ASP 24  1540 1540 ASP ASP B . n 
B 2 25  LYS 25  1541 1541 LYS LYS B . n 
B 2 26  VAL 26  1542 1542 VAL VAL B . n 
B 2 27  LYS 27  1543 1543 LYS LYS B . n 
B 2 28  ASN 28  1544 1544 ASN ASN B . n 
B 2 29  LEU 29  1545 1545 LEU LEU B . n 
B 2 30  PHE 30  1546 1546 PHE PHE B . n 
B 2 31  ASP 31  1547 1547 ASP ASP B . n 
B 2 32  GLU 32  1548 1548 GLU GLU B . n 
B 2 33  LYS 33  1549 1549 LYS LYS B . n 
B 2 34  GLU 34  1550 1550 GLU GLU B . n 
B 2 35  GLN 35  1551 1551 GLN GLN B . n 
C 3 1   THR 1   1543 ?    ?   ?   L . n 
C 3 2   GLY 2   1544 ?    ?   ?   L . n 
C 3 3   SER 3   1545 ?    ?   ?   L . n 
C 3 4   THR 4   1546 ?    ?   ?   L . n 
C 3 5   GLY 5   1547 ?    ?   ?   L . n 
C 3 6   SER 6   1548 ?    ?   ?   L . n 
C 3 7   THR 7   1549 ?    ?   ?   L . n 
C 3 8   GLY 8   1550 ?    ?   ?   L . n 
C 3 9   SER 9   1551 ?    ?   ?   L . n 
C 3 10  THR 10  1    1552 THR THR L . n 
C 3 11  GLY 11  2    1553 GLY GLY L . n 
C 3 12  SER 12  3    1554 SER SER L . n 
C 3 13  MSE 13  1555 ?    ?   ?   L . n 
C 3 14  GLY 14  1556 ?    ?   ?   L . n 
D 4 1   GLY 1   1    1    GLY GLY C . n 
D 4 2   SER 2   2    2    SER SER C . n 
D 4 3   MSE 3   3    3    MSE MSE C . n 
D 4 4   GLY 4   4    4    GLY GLY C . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 29  A MSE 125 ? MET SELENOMETHIONINE 
2 A MSE 62  A MSE 158 ? MET SELENOMETHIONINE 
3 A MSE 114 A MSE 210 ? MET SELENOMETHIONINE 
4 A MSE 115 A MSE 211 ? MET SELENOMETHIONINE 
5 A MSE 147 A MSE 243 ? MET SELENOMETHIONINE 
6 A MSE 155 A MSE 251 ? MET SELENOMETHIONINE 
7 A MSE 230 A MSE 326 ? MET SELENOMETHIONINE 
8 D MSE 3   C MSE 3   ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLN 5  ? A GLN 101 ? 1_555 MG ? E MG . ? A MG 401 ? 1_555 O ? L HOH .  ? A HOH 553 ? 1_555 146.6 ? 
2  OE1 ? A GLN 5  ? A GLN 101 ? 1_555 MG ? E MG . ? A MG 401 ? 1_555 O ? A LEU 17 ? A LEU 113 ? 1_555 109.6 ? 
3  O   ? L HOH .  ? A HOH 553 ? 1_555 MG ? E MG . ? A MG 401 ? 1_555 O ? A LEU 17 ? A LEU 113 ? 1_555 91.6  ? 
4  OE1 ? A GLN 5  ? A GLN 101 ? 1_555 MG ? E MG . ? A MG 401 ? 1_555 O ? A GLY 20 ? A GLY 116 ? 1_555 92.1  ? 
5  O   ? L HOH .  ? A HOH 553 ? 1_555 MG ? E MG . ? A MG 401 ? 1_555 O ? A GLY 20 ? A GLY 116 ? 1_555 105.3 ? 
6  O   ? A LEU 17 ? A LEU 113 ? 1_555 MG ? E MG . ? A MG 401 ? 1_555 O ? A GLY 20 ? A GLY 116 ? 1_555 109.1 ? 
7  OE1 ? A GLN 5  ? A GLN 101 ? 1_555 MG ? E MG . ? A MG 401 ? 1_555 O ? L HOH .  ? A HOH 646 ? 1_555 80.6  ? 
8  O   ? L HOH .  ? A HOH 553 ? 1_555 MG ? E MG . ? A MG 401 ? 1_555 O ? L HOH .  ? A HOH 646 ? 1_555 73.7  ? 
9  O   ? A LEU 17 ? A LEU 113 ? 1_555 MG ? E MG . ? A MG 401 ? 1_555 O ? L HOH .  ? A HOH 646 ? 1_555 89.9  ? 
10 O   ? A GLY 20 ? A GLY 116 ? 1_555 MG ? E MG . ? A MG 401 ? 1_555 O ? L HOH .  ? A HOH 646 ? 1_555 161.0 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-11-27 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2016-05-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM 'data reduction' .         ? 1 
SCALA  'data scaling'   .         ? 2 
SHARP  phasing          .         ? 3 
CNS    refinement       1.0       ? 4 
CCP4   'data scaling'   '(SCALA)' ? 5 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
All chains
in the entry are part of an engineered, 
chimeric protein construct. In the construct, 
the amino-to-carboxyl order of the chains is: C-B-L-A. 
Chain C is a GSMG sequence that comes from 
the expression vector, B is the BRCA2 BRC repeat, 
L is the TGSTGSTGSTGSMG sequence linking chains 
B and A, and chain A is the RAD51 ATpase domain. 
Chain C appears as a separate entity because the 
two initial residues of chain B, 1517-8, are not 
visible in the density map. Likewise, the linker 
is not visible in the density map, with the 
exception of the first three residues:TGS.
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 130  ? ? 92.27   -11.93  
2 1 TYR A 315  ? ? -114.56 -169.36 
3 1 ASP A 316  ? ? 9.71    86.64   
4 1 PRO A 318  ? ? -48.20  -14.17  
5 1 GLU B 1548 ? ? -118.93 61.56   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 97   ? A SER 1   
2  1 Y 1 A THR 230  ? A THR 134 
3  1 Y 1 A ASP 231  ? A ASP 135 
4  1 Y 1 A TYR 232  ? A TYR 136 
5  1 Y 1 A SER 233  ? A SER 137 
6  1 Y 1 A GLY 234  ? A GLY 138 
7  1 Y 1 A ARG 235  ? A ARG 139 
8  1 Y 1 A GLY 236  ? A GLY 140 
9  1 Y 1 A GLN 268  ? A GLN 172 
10 1 Y 1 A VAL 269  ? A VAL 173 
11 1 Y 1 A VAL 270  ? A VAL 174 
12 1 Y 1 A ALA 271  ? A ALA 175 
13 1 Y 1 A GLN 272  ? A GLN 176 
14 1 Y 1 A VAL 273  ? A VAL 177 
15 1 Y 1 A ASP 274  ? A ASP 178 
16 1 Y 1 A GLY 275  ? A GLY 179 
17 1 Y 1 A ALA 276  ? A ALA 180 
18 1 Y 1 A ALA 277  ? A ALA 181 
19 1 Y 1 A MSE 278  ? A MSE 182 
20 1 Y 1 A PHE 279  ? A PHE 183 
21 1 Y 1 A ALA 280  ? A ALA 184 
22 1 Y 1 A ALA 281  ? A ALA 185 
23 1 Y 1 A ASP 282  ? A ASP 186 
24 1 Y 1 A PRO 283  ? A PRO 187 
25 1 Y 1 A LYS 284  ? A LYS 188 
26 1 Y 1 A LYS 285  ? A LYS 189 
27 1 Y 1 A PRO 286  ? A PRO 190 
28 1 Y 1 A ILE 287  ? A ILE 191 
29 1 Y 1 A GLY 288  ? A GLY 192 
30 1 Y 1 A GLY 289  ? A GLY 193 
31 1 Y 1 A ASN 290  ? A ASN 194 
32 1 Y 1 A ILE 291  ? A ILE 195 
33 1 Y 1 A ILE 292  ? A ILE 196 
34 1 Y 1 B LYS 1517 ? B LYS 1   
35 1 Y 1 B GLU 1518 ? B GLU 2   
36 1 Y 1 L THR 1543 ? C THR 1   
37 1 Y 1 L GLY 1544 ? C GLY 2   
38 1 Y 1 L SER 1545 ? C SER 3   
39 1 Y 1 L THR 1546 ? C THR 4   
40 1 Y 1 L GLY 1547 ? C GLY 5   
41 1 Y 1 L SER 1548 ? C SER 6   
42 1 Y 1 L THR 1549 ? C THR 7   
43 1 Y 1 L GLY 1550 ? C GLY 8   
44 1 Y 1 L SER 1551 ? C SER 9   
45 1 Y 1 L MSE 1555 ? C MSE 13  
46 1 Y 1 L GLY 1556 ? C GLY 14  
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'MAGNESIUM ION' MG  
6 'CHLORIDE ION'  CL  
7 1,2-ETHANEDIOL  EDO 
8 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 MG  1   401 1   MG  MG2 A . 
F 6 CL  1   501 1   CL  CL1 A . 
G 7 EDO 1   502 1   EDO EDO A . 
H 7 EDO 1   503 2   EDO EDO A . 
I 7 EDO 1   504 3   EDO EDO A . 
J 7 EDO 1   505 4   EDO EDO A . 
K 7 EDO 1   506 5   EDO EDO A . 
L 8 HOH 1   507 1   HOH HOH A . 
L 8 HOH 2   508 2   HOH HOH A . 
L 8 HOH 3   509 3   HOH HOH A . 
L 8 HOH 4   510 4   HOH HOH A . 
L 8 HOH 5   511 5   HOH HOH A . 
L 8 HOH 6   512 6   HOH HOH A . 
L 8 HOH 7   513 7   HOH HOH A . 
L 8 HOH 8   514 8   HOH HOH A . 
L 8 HOH 9   515 9   HOH HOH A . 
L 8 HOH 10  516 10  HOH HOH A . 
L 8 HOH 11  517 11  HOH HOH A . 
L 8 HOH 12  518 12  HOH HOH A . 
L 8 HOH 13  519 13  HOH HOH A . 
L 8 HOH 14  520 14  HOH HOH A . 
L 8 HOH 15  521 15  HOH HOH A . 
L 8 HOH 16  522 16  HOH HOH A . 
L 8 HOH 17  523 17  HOH HOH A . 
L 8 HOH 18  524 18  HOH HOH A . 
L 8 HOH 19  525 19  HOH HOH A . 
L 8 HOH 20  526 22  HOH HOH A . 
L 8 HOH 21  527 23  HOH HOH A . 
L 8 HOH 22  528 25  HOH HOH A . 
L 8 HOH 23  529 26  HOH HOH A . 
L 8 HOH 24  530 27  HOH HOH A . 
L 8 HOH 25  531 28  HOH HOH A . 
L 8 HOH 26  532 31  HOH HOH A . 
L 8 HOH 27  533 33  HOH HOH A . 
L 8 HOH 28  534 34  HOH HOH A . 
L 8 HOH 29  535 35  HOH HOH A . 
L 8 HOH 30  536 36  HOH HOH A . 
L 8 HOH 31  537 37  HOH HOH A . 
L 8 HOH 32  538 38  HOH HOH A . 
L 8 HOH 33  539 39  HOH HOH A . 
L 8 HOH 34  540 40  HOH HOH A . 
L 8 HOH 35  541 41  HOH HOH A . 
L 8 HOH 36  542 42  HOH HOH A . 
L 8 HOH 37  543 43  HOH HOH A . 
L 8 HOH 38  544 44  HOH HOH A . 
L 8 HOH 39  545 47  HOH HOH A . 
L 8 HOH 40  546 48  HOH HOH A . 
L 8 HOH 41  547 49  HOH HOH A . 
L 8 HOH 42  548 50  HOH HOH A . 
L 8 HOH 43  549 52  HOH HOH A . 
L 8 HOH 44  550 53  HOH HOH A . 
L 8 HOH 45  551 54  HOH HOH A . 
L 8 HOH 46  552 56  HOH HOH A . 
L 8 HOH 47  553 57  HOH HOH A . 
L 8 HOH 48  554 58  HOH HOH A . 
L 8 HOH 49  555 59  HOH HOH A . 
L 8 HOH 50  556 60  HOH HOH A . 
L 8 HOH 51  557 63  HOH HOH A . 
L 8 HOH 52  558 64  HOH HOH A . 
L 8 HOH 53  559 65  HOH HOH A . 
L 8 HOH 54  560 67  HOH HOH A . 
L 8 HOH 55  561 68  HOH HOH A . 
L 8 HOH 56  562 69  HOH HOH A . 
L 8 HOH 57  563 70  HOH HOH A . 
L 8 HOH 58  564 72  HOH HOH A . 
L 8 HOH 59  565 73  HOH HOH A . 
L 8 HOH 60  566 74  HOH HOH A . 
L 8 HOH 61  567 75  HOH HOH A . 
L 8 HOH 62  568 76  HOH HOH A . 
L 8 HOH 63  569 77  HOH HOH A . 
L 8 HOH 64  570 79  HOH HOH A . 
L 8 HOH 65  571 80  HOH HOH A . 
L 8 HOH 66  572 81  HOH HOH A . 
L 8 HOH 67  573 82  HOH HOH A . 
L 8 HOH 68  574 83  HOH HOH A . 
L 8 HOH 69  575 84  HOH HOH A . 
L 8 HOH 70  576 85  HOH HOH A . 
L 8 HOH 71  577 86  HOH HOH A . 
L 8 HOH 72  578 87  HOH HOH A . 
L 8 HOH 73  579 89  HOH HOH A . 
L 8 HOH 74  580 90  HOH HOH A . 
L 8 HOH 75  581 92  HOH HOH A . 
L 8 HOH 76  582 93  HOH HOH A . 
L 8 HOH 77  583 94  HOH HOH A . 
L 8 HOH 78  584 95  HOH HOH A . 
L 8 HOH 79  585 97  HOH HOH A . 
L 8 HOH 80  586 98  HOH HOH A . 
L 8 HOH 81  587 99  HOH HOH A . 
L 8 HOH 82  588 100 HOH HOH A . 
L 8 HOH 83  589 101 HOH HOH A . 
L 8 HOH 84  590 102 HOH HOH A . 
L 8 HOH 85  591 103 HOH HOH A . 
L 8 HOH 86  592 104 HOH HOH A . 
L 8 HOH 87  593 105 HOH HOH A . 
L 8 HOH 88  594 106 HOH HOH A . 
L 8 HOH 89  595 107 HOH HOH A . 
L 8 HOH 90  596 108 HOH HOH A . 
L 8 HOH 91  597 110 HOH HOH A . 
L 8 HOH 92  598 111 HOH HOH A . 
L 8 HOH 93  599 112 HOH HOH A . 
L 8 HOH 94  600 113 HOH HOH A . 
L 8 HOH 95  601 114 HOH HOH A . 
L 8 HOH 96  602 117 HOH HOH A . 
L 8 HOH 97  603 118 HOH HOH A . 
L 8 HOH 98  604 120 HOH HOH A . 
L 8 HOH 99  605 121 HOH HOH A . 
L 8 HOH 100 606 123 HOH HOH A . 
L 8 HOH 101 607 125 HOH HOH A . 
L 8 HOH 102 608 126 HOH HOH A . 
L 8 HOH 103 609 127 HOH HOH A . 
L 8 HOH 104 610 128 HOH HOH A . 
L 8 HOH 105 611 129 HOH HOH A . 
L 8 HOH 106 612 131 HOH HOH A . 
L 8 HOH 107 613 132 HOH HOH A . 
L 8 HOH 108 614 133 HOH HOH A . 
L 8 HOH 109 615 134 HOH HOH A . 
L 8 HOH 110 616 135 HOH HOH A . 
L 8 HOH 111 617 136 HOH HOH A . 
L 8 HOH 112 618 137 HOH HOH A . 
L 8 HOH 113 619 138 HOH HOH A . 
L 8 HOH 114 620 140 HOH HOH A . 
L 8 HOH 115 621 141 HOH HOH A . 
L 8 HOH 116 622 142 HOH HOH A . 
L 8 HOH 117 623 143 HOH HOH A . 
L 8 HOH 118 624 144 HOH HOH A . 
L 8 HOH 119 625 145 HOH HOH A . 
L 8 HOH 120 626 146 HOH HOH A . 
L 8 HOH 121 627 147 HOH HOH A . 
L 8 HOH 122 628 148 HOH HOH A . 
L 8 HOH 123 629 149 HOH HOH A . 
L 8 HOH 124 630 150 HOH HOH A . 
L 8 HOH 125 631 151 HOH HOH A . 
L 8 HOH 126 632 153 HOH HOH A . 
L 8 HOH 127 633 154 HOH HOH A . 
L 8 HOH 128 634 155 HOH HOH A . 
L 8 HOH 129 635 156 HOH HOH A . 
L 8 HOH 130 636 157 HOH HOH A . 
L 8 HOH 131 637 159 HOH HOH A . 
L 8 HOH 132 638 160 HOH HOH A . 
L 8 HOH 133 639 161 HOH HOH A . 
L 8 HOH 134 640 162 HOH HOH A . 
L 8 HOH 135 641 163 HOH HOH A . 
L 8 HOH 136 642 165 HOH HOH A . 
L 8 HOH 137 643 166 HOH HOH A . 
L 8 HOH 138 644 168 HOH HOH A . 
L 8 HOH 139 645 170 HOH HOH A . 
L 8 HOH 140 646 171 HOH HOH A . 
L 8 HOH 141 647 172 HOH HOH A . 
L 8 HOH 142 648 173 HOH HOH A . 
L 8 HOH 143 649 174 HOH HOH A . 
L 8 HOH 144 650 175 HOH HOH A . 
L 8 HOH 145 651 176 HOH HOH A . 
L 8 HOH 146 652 177 HOH HOH A . 
L 8 HOH 147 653 178 HOH HOH A . 
L 8 HOH 148 654 179 HOH HOH A . 
L 8 HOH 149 655 180 HOH HOH A . 
L 8 HOH 150 656 182 HOH HOH A . 
L 8 HOH 151 657 183 HOH HOH A . 
L 8 HOH 152 658 184 HOH HOH A . 
L 8 HOH 153 659 186 HOH HOH A . 
L 8 HOH 154 660 187 HOH HOH A . 
L 8 HOH 155 661 188 HOH HOH A . 
L 8 HOH 156 662 189 HOH HOH A . 
L 8 HOH 157 663 191 HOH HOH A . 
L 8 HOH 158 664 192 HOH HOH A . 
L 8 HOH 159 665 193 HOH HOH A . 
L 8 HOH 160 666 194 HOH HOH A . 
L 8 HOH 161 667 195 HOH HOH A . 
L 8 HOH 162 668 196 HOH HOH A . 
L 8 HOH 163 669 197 HOH HOH A . 
L 8 HOH 164 670 198 HOH HOH A . 
L 8 HOH 165 671 199 HOH HOH A . 
L 8 HOH 166 672 200 HOH HOH A . 
L 8 HOH 167 673 202 HOH HOH A . 
L 8 HOH 168 674 203 HOH HOH A . 
L 8 HOH 169 675 204 HOH HOH A . 
L 8 HOH 170 676 205 HOH HOH A . 
L 8 HOH 171 677 206 HOH HOH A . 
L 8 HOH 172 678 207 HOH HOH A . 
L 8 HOH 173 679 209 HOH HOH A . 
L 8 HOH 174 680 210 HOH HOH A . 
L 8 HOH 175 681 211 HOH HOH A . 
L 8 HOH 176 682 212 HOH HOH A . 
L 8 HOH 177 683 213 HOH HOH A . 
L 8 HOH 178 684 214 HOH HOH A . 
L 8 HOH 179 685 215 HOH HOH A . 
L 8 HOH 180 686 217 HOH HOH A . 
L 8 HOH 181 687 218 HOH HOH A . 
L 8 HOH 182 688 219 HOH HOH A . 
L 8 HOH 183 689 221 HOH HOH A . 
L 8 HOH 184 690 222 HOH HOH A . 
L 8 HOH 185 691 223 HOH HOH A . 
L 8 HOH 186 692 224 HOH HOH A . 
L 8 HOH 187 693 225 HOH HOH A . 
L 8 HOH 188 694 227 HOH HOH A . 
L 8 HOH 189 695 228 HOH HOH A . 
L 8 HOH 190 696 229 HOH HOH A . 
L 8 HOH 191 697 234 HOH HOH A . 
L 8 HOH 192 698 235 HOH HOH A . 
L 8 HOH 193 699 236 HOH HOH A . 
L 8 HOH 194 700 237 HOH HOH A . 
L 8 HOH 195 701 239 HOH HOH A . 
L 8 HOH 196 702 240 HOH HOH A . 
L 8 HOH 197 703 241 HOH HOH A . 
L 8 HOH 198 704 242 HOH HOH A . 
L 8 HOH 199 705 243 HOH HOH A . 
L 8 HOH 200 706 244 HOH HOH A . 
M 8 HOH 1   20  20  HOH HOH B . 
M 8 HOH 2   21  21  HOH HOH B . 
M 8 HOH 3   24  24  HOH HOH B . 
M 8 HOH 4   29  29  HOH HOH B . 
M 8 HOH 5   30  30  HOH HOH B . 
M 8 HOH 6   32  32  HOH HOH B . 
M 8 HOH 7   45  45  HOH HOH B . 
M 8 HOH 8   46  46  HOH HOH B . 
M 8 HOH 9   51  51  HOH HOH B . 
M 8 HOH 10  55  55  HOH HOH B . 
M 8 HOH 11  61  61  HOH HOH B . 
M 8 HOH 12  62  62  HOH HOH B . 
M 8 HOH 13  66  66  HOH HOH B . 
M 8 HOH 14  78  78  HOH HOH B . 
M 8 HOH 15  88  88  HOH HOH B . 
M 8 HOH 16  91  91  HOH HOH B . 
M 8 HOH 17  96  96  HOH HOH B . 
M 8 HOH 18  109 109 HOH HOH B . 
M 8 HOH 19  115 115 HOH HOH B . 
M 8 HOH 20  116 116 HOH HOH B . 
M 8 HOH 21  119 119 HOH HOH B . 
M 8 HOH 22  122 122 HOH HOH B . 
M 8 HOH 23  124 124 HOH HOH B . 
M 8 HOH 24  130 130 HOH HOH B . 
M 8 HOH 25  139 139 HOH HOH B . 
M 8 HOH 26  158 158 HOH HOH B . 
M 8 HOH 27  164 164 HOH HOH B . 
M 8 HOH 28  169 169 HOH HOH B . 
M 8 HOH 29  185 185 HOH HOH B . 
M 8 HOH 30  190 190 HOH HOH B . 
M 8 HOH 31  201 201 HOH HOH B . 
M 8 HOH 32  208 208 HOH HOH B . 
M 8 HOH 33  216 216 HOH HOH B . 
M 8 HOH 34  220 220 HOH HOH B . 
M 8 HOH 35  226 226 HOH HOH B . 
M 8 HOH 36  230 230 HOH HOH B . 
M 8 HOH 37  231 231 HOH HOH B . 
M 8 HOH 38  232 232 HOH HOH B . 
M 8 HOH 39  233 233 HOH HOH B . 
M 8 HOH 40  238 238 HOH HOH B . 
M 8 HOH 41  245 245 HOH HOH B . 
M 8 HOH 42  246 246 HOH HOH B . 
M 8 HOH 43  247 247 HOH HOH B . 
N 8 HOH 1   152 152 HOH HOH L . 
N 8 HOH 2   167 167 HOH HOH L . 
N 8 HOH 3   181 181 HOH HOH L . 
O 8 HOH 1   71  71  HOH HOH C . 
#