data_1N35
# 
_entry.id   1N35 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1N35         
NDB   PR0087       
RCSB  RCSB017459   
WWPDB D_1000017459 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1MUK 'lambda3 native structure'       unspecified 
PDB 1MWH 'lambda3 with a mRNA cap analog' unspecified 
PDB 1N1H 'lambda3 initiation complex'     unspecified 
PDB 1N38 .                                unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1N35 
_pdbx_database_status.recvd_initial_deposition_date   2002-10-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tao, Y.'        1 
'Farsetta, D.L.' 2 
'Nibert, M.L.'   3 
'Harrison, S.C.' 4 
# 
_citation.id                        primary 
_citation.title                     'RNA Synthesis in a Cage--Structural Studies of Reovirus Polymerase [lambda] 3' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            111 
_citation.page_first                733 
_citation.page_last                 745 
_citation.year                      2002 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12464184 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(02)01110-8' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Tao, Y.'        1 
primary 'Farsetta, D.L.' 2 
primary 'Nibert, M.L.'   3 
primary 'Harrison, S.C.' 4 
# 
_cell.entry_id           1N35 
_cell.length_a           70.883 
_cell.length_b           85.013 
_cell.length_c           249.294 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1N35 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-R(P*GP*GP*GP*GP*G)-3'"               1681.072   1   ? ? ? ? 
2 polymer     syn "5'-R(*AP*UP*UP*AP*GP*CP*CP*CP*CP*C)-3'" 3096.901   1   ? ? ? ? 
3 polymer     man 'Minor core protein lambda 3'            142423.797 1   ? ? ? ? 
4 non-polymer syn 'MANGANESE (II) ION'                     54.938     2   ? ? ? ? 
5 non-polymer syn "3'-DEOXY-CYTIDINE-5'-TRIPHOSPHATE"      467.157    3   ? ? ? ? 
6 water       nat water                                    18.015     350 ? ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        lambda3 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no no GGGGG GGGGG B ? 
2 polyribonucleotide no no AUUAGCCCCC AUUAGCCCCC C ? 
3 'polypeptide(L)'   no no 
;MSSMILTQFGPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMLPIPPTIYTKPSHDSYYYIDALNR
VRRKTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIENRAKDGDSQARIATTYGRIAESQARQIKAPLEKFVLALLV
AEAGGSLYDPVLQKYDEIPDLSHNCPLWCFREICRHISGPLPDRAPYLYLSAGVFWLMSPRMTSAIPPLLSDLVNLAILQ
QTAGLDPSLVKLGVQICLHAAASSSYSWFILKTKSIFPQNTLHSMYESLEGGYCPNLEWLEPRSDYKFMYMGVMPLSAKY
ARSAPSNDKKARELGEKYGLSSVVGELRKRTKTYVKHDFASVRYIRDAMACTSGIFLVRTPTETVLQEYTQSPEIKVPIP
QKDWTGPIGEIRILKDTTSSIARYLYRTWYLAAARMAAQPRTWDPLFQAIMRSQYVTARGGSGAALRESLYAINVSLPDF
KGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSAPHTLTADYINYHMNLSPTSG
SAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLSVIMAAIHEGVASSSIGKPFMGVPASIVNDESVVGVRAARP
ISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWGPEHTDDPDVLRLM
KSLTIQRNYVCQGDDGLMIIDGTTAGKVNSETIQNDLELISKYGEEFGWKYDIAYDGTAEYLKLYFIFGCRIPNLSRHPI
VGKERANSSAEEPWPAILDQIMGVFFNGVHDGLQWQRWIRYSWALCCAFSRQRTMIGESVGYLQYPMWSFVYWGLPLVKA
FGSDPWIFSWYMPTGDLGMYSWISLIRPLMTRWMVANGYVTDRCSTVFGNADYRRCFNELKLYQGYYMAQLPRNPKKSGR
AASREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHNPPSLFDVPHKWYQGAQEAAIATREELAEMDETLMR
ARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPMLQSTRKYFAQTLFMAKTVSGLD
VNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLL
PKDGRHLNTDIPPRMGWLRAILRFLGAGMVMTATGVAVDIYLEDIHGGGRSLGQRFMTWMRQEGRSA
;
;MSSMILTQFGPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMLPIPPTIYTKPSHDSYYYIDALNR
VRRKTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIENRAKDGDSQARIATTYGRIAESQARQIKAPLEKFVLALLV
AEAGGSLYDPVLQKYDEIPDLSHNCPLWCFREICRHISGPLPDRAPYLYLSAGVFWLMSPRMTSAIPPLLSDLVNLAILQ
QTAGLDPSLVKLGVQICLHAAASSSYSWFILKTKSIFPQNTLHSMYESLEGGYCPNLEWLEPRSDYKFMYMGVMPLSAKY
ARSAPSNDKKARELGEKYGLSSVVGELRKRTKTYVKHDFASVRYIRDAMACTSGIFLVRTPTETVLQEYTQSPEIKVPIP
QKDWTGPIGEIRILKDTTSSIARYLYRTWYLAAARMAAQPRTWDPLFQAIMRSQYVTARGGSGAALRESLYAINVSLPDF
KGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSAPHTLTADYINYHMNLSPTSG
SAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLSVIMAAIHEGVASSSIGKPFMGVPASIVNDESVVGVRAARP
ISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWGPEHTDDPDVLRLM
KSLTIQRNYVCQGDDGLMIIDGTTAGKVNSETIQNDLELISKYGEEFGWKYDIAYDGTAEYLKLYFIFGCRIPNLSRHPI
VGKERANSSAEEPWPAILDQIMGVFFNGVHDGLQWQRWIRYSWALCCAFSRQRTMIGESVGYLQYPMWSFVYWGLPLVKA
FGSDPWIFSWYMPTGDLGMYSWISLIRPLMTRWMVANGYVTDRCSTVFGNADYRRCFNELKLYQGYYMAQLPRNPKKSGR
AASREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHNPPSLFDVPHKWYQGAQEAAIATREELAEMDETLMR
ARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPMLQSTRKYFAQTLFMAKTVSGLD
VNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLL
PKDGRHLNTDIPPRMGWLRAILRFLGAGMVMTATGVAVDIYLEDIHGGGRSLGQRFMTWMRQEGRSA
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    G   n 
1 2    G   n 
1 3    G   n 
1 4    G   n 
1 5    G   n 
2 1    A   n 
2 2    U   n 
2 3    U   n 
2 4    A   n 
2 5    G   n 
2 6    C   n 
2 7    C   n 
2 8    C   n 
2 9    C   n 
2 10   C   n 
3 1    MET n 
3 2    SER n 
3 3    SER n 
3 4    MET n 
3 5    ILE n 
3 6    LEU n 
3 7    THR n 
3 8    GLN n 
3 9    PHE n 
3 10   GLY n 
3 11   PRO n 
3 12   PHE n 
3 13   ILE n 
3 14   GLU n 
3 15   SER n 
3 16   ILE n 
3 17   SER n 
3 18   GLY n 
3 19   ILE n 
3 20   THR n 
3 21   ASP n 
3 22   GLN n 
3 23   SER n 
3 24   ASN n 
3 25   ASP n 
3 26   VAL n 
3 27   PHE n 
3 28   GLU n 
3 29   ASP n 
3 30   ALA n 
3 31   ALA n 
3 32   LYS n 
3 33   ALA n 
3 34   PHE n 
3 35   SER n 
3 36   MET n 
3 37   PHE n 
3 38   THR n 
3 39   ARG n 
3 40   SER n 
3 41   ASP n 
3 42   VAL n 
3 43   TYR n 
3 44   LYS n 
3 45   ALA n 
3 46   LEU n 
3 47   ASP n 
3 48   GLU n 
3 49   ILE n 
3 50   PRO n 
3 51   PHE n 
3 52   SER n 
3 53   ASP n 
3 54   ASP n 
3 55   ALA n 
3 56   MET n 
3 57   LEU n 
3 58   PRO n 
3 59   ILE n 
3 60   PRO n 
3 61   PRO n 
3 62   THR n 
3 63   ILE n 
3 64   TYR n 
3 65   THR n 
3 66   LYS n 
3 67   PRO n 
3 68   SER n 
3 69   HIS n 
3 70   ASP n 
3 71   SER n 
3 72   TYR n 
3 73   TYR n 
3 74   TYR n 
3 75   ILE n 
3 76   ASP n 
3 77   ALA n 
3 78   LEU n 
3 79   ASN n 
3 80   ARG n 
3 81   VAL n 
3 82   ARG n 
3 83   ARG n 
3 84   LYS n 
3 85   THR n 
3 86   TYR n 
3 87   GLN n 
3 88   GLY n 
3 89   PRO n 
3 90   ASP n 
3 91   ASP n 
3 92   VAL n 
3 93   TYR n 
3 94   VAL n 
3 95   PRO n 
3 96   ASN n 
3 97   CYS n 
3 98   SER n 
3 99   ILE n 
3 100  VAL n 
3 101  GLU n 
3 102  LEU n 
3 103  LEU n 
3 104  GLU n 
3 105  PRO n 
3 106  HIS n 
3 107  GLU n 
3 108  THR n 
3 109  LEU n 
3 110  THR n 
3 111  SER n 
3 112  TYR n 
3 113  GLY n 
3 114  ARG n 
3 115  LEU n 
3 116  SER n 
3 117  GLU n 
3 118  ALA n 
3 119  ILE n 
3 120  GLU n 
3 121  ASN n 
3 122  ARG n 
3 123  ALA n 
3 124  LYS n 
3 125  ASP n 
3 126  GLY n 
3 127  ASP n 
3 128  SER n 
3 129  GLN n 
3 130  ALA n 
3 131  ARG n 
3 132  ILE n 
3 133  ALA n 
3 134  THR n 
3 135  THR n 
3 136  TYR n 
3 137  GLY n 
3 138  ARG n 
3 139  ILE n 
3 140  ALA n 
3 141  GLU n 
3 142  SER n 
3 143  GLN n 
3 144  ALA n 
3 145  ARG n 
3 146  GLN n 
3 147  ILE n 
3 148  LYS n 
3 149  ALA n 
3 150  PRO n 
3 151  LEU n 
3 152  GLU n 
3 153  LYS n 
3 154  PHE n 
3 155  VAL n 
3 156  LEU n 
3 157  ALA n 
3 158  LEU n 
3 159  LEU n 
3 160  VAL n 
3 161  ALA n 
3 162  GLU n 
3 163  ALA n 
3 164  GLY n 
3 165  GLY n 
3 166  SER n 
3 167  LEU n 
3 168  TYR n 
3 169  ASP n 
3 170  PRO n 
3 171  VAL n 
3 172  LEU n 
3 173  GLN n 
3 174  LYS n 
3 175  TYR n 
3 176  ASP n 
3 177  GLU n 
3 178  ILE n 
3 179  PRO n 
3 180  ASP n 
3 181  LEU n 
3 182  SER n 
3 183  HIS n 
3 184  ASN n 
3 185  CYS n 
3 186  PRO n 
3 187  LEU n 
3 188  TRP n 
3 189  CYS n 
3 190  PHE n 
3 191  ARG n 
3 192  GLU n 
3 193  ILE n 
3 194  CYS n 
3 195  ARG n 
3 196  HIS n 
3 197  ILE n 
3 198  SER n 
3 199  GLY n 
3 200  PRO n 
3 201  LEU n 
3 202  PRO n 
3 203  ASP n 
3 204  ARG n 
3 205  ALA n 
3 206  PRO n 
3 207  TYR n 
3 208  LEU n 
3 209  TYR n 
3 210  LEU n 
3 211  SER n 
3 212  ALA n 
3 213  GLY n 
3 214  VAL n 
3 215  PHE n 
3 216  TRP n 
3 217  LEU n 
3 218  MET n 
3 219  SER n 
3 220  PRO n 
3 221  ARG n 
3 222  MET n 
3 223  THR n 
3 224  SER n 
3 225  ALA n 
3 226  ILE n 
3 227  PRO n 
3 228  PRO n 
3 229  LEU n 
3 230  LEU n 
3 231  SER n 
3 232  ASP n 
3 233  LEU n 
3 234  VAL n 
3 235  ASN n 
3 236  LEU n 
3 237  ALA n 
3 238  ILE n 
3 239  LEU n 
3 240  GLN n 
3 241  GLN n 
3 242  THR n 
3 243  ALA n 
3 244  GLY n 
3 245  LEU n 
3 246  ASP n 
3 247  PRO n 
3 248  SER n 
3 249  LEU n 
3 250  VAL n 
3 251  LYS n 
3 252  LEU n 
3 253  GLY n 
3 254  VAL n 
3 255  GLN n 
3 256  ILE n 
3 257  CYS n 
3 258  LEU n 
3 259  HIS n 
3 260  ALA n 
3 261  ALA n 
3 262  ALA n 
3 263  SER n 
3 264  SER n 
3 265  SER n 
3 266  TYR n 
3 267  SER n 
3 268  TRP n 
3 269  PHE n 
3 270  ILE n 
3 271  LEU n 
3 272  LYS n 
3 273  THR n 
3 274  LYS n 
3 275  SER n 
3 276  ILE n 
3 277  PHE n 
3 278  PRO n 
3 279  GLN n 
3 280  ASN n 
3 281  THR n 
3 282  LEU n 
3 283  HIS n 
3 284  SER n 
3 285  MET n 
3 286  TYR n 
3 287  GLU n 
3 288  SER n 
3 289  LEU n 
3 290  GLU n 
3 291  GLY n 
3 292  GLY n 
3 293  TYR n 
3 294  CYS n 
3 295  PRO n 
3 296  ASN n 
3 297  LEU n 
3 298  GLU n 
3 299  TRP n 
3 300  LEU n 
3 301  GLU n 
3 302  PRO n 
3 303  ARG n 
3 304  SER n 
3 305  ASP n 
3 306  TYR n 
3 307  LYS n 
3 308  PHE n 
3 309  MET n 
3 310  TYR n 
3 311  MET n 
3 312  GLY n 
3 313  VAL n 
3 314  MET n 
3 315  PRO n 
3 316  LEU n 
3 317  SER n 
3 318  ALA n 
3 319  LYS n 
3 320  TYR n 
3 321  ALA n 
3 322  ARG n 
3 323  SER n 
3 324  ALA n 
3 325  PRO n 
3 326  SER n 
3 327  ASN n 
3 328  ASP n 
3 329  LYS n 
3 330  LYS n 
3 331  ALA n 
3 332  ARG n 
3 333  GLU n 
3 334  LEU n 
3 335  GLY n 
3 336  GLU n 
3 337  LYS n 
3 338  TYR n 
3 339  GLY n 
3 340  LEU n 
3 341  SER n 
3 342  SER n 
3 343  VAL n 
3 344  VAL n 
3 345  GLY n 
3 346  GLU n 
3 347  LEU n 
3 348  ARG n 
3 349  LYS n 
3 350  ARG n 
3 351  THR n 
3 352  LYS n 
3 353  THR n 
3 354  TYR n 
3 355  VAL n 
3 356  LYS n 
3 357  HIS n 
3 358  ASP n 
3 359  PHE n 
3 360  ALA n 
3 361  SER n 
3 362  VAL n 
3 363  ARG n 
3 364  TYR n 
3 365  ILE n 
3 366  ARG n 
3 367  ASP n 
3 368  ALA n 
3 369  MET n 
3 370  ALA n 
3 371  CYS n 
3 372  THR n 
3 373  SER n 
3 374  GLY n 
3 375  ILE n 
3 376  PHE n 
3 377  LEU n 
3 378  VAL n 
3 379  ARG n 
3 380  THR n 
3 381  PRO n 
3 382  THR n 
3 383  GLU n 
3 384  THR n 
3 385  VAL n 
3 386  LEU n 
3 387  GLN n 
3 388  GLU n 
3 389  TYR n 
3 390  THR n 
3 391  GLN n 
3 392  SER n 
3 393  PRO n 
3 394  GLU n 
3 395  ILE n 
3 396  LYS n 
3 397  VAL n 
3 398  PRO n 
3 399  ILE n 
3 400  PRO n 
3 401  GLN n 
3 402  LYS n 
3 403  ASP n 
3 404  TRP n 
3 405  THR n 
3 406  GLY n 
3 407  PRO n 
3 408  ILE n 
3 409  GLY n 
3 410  GLU n 
3 411  ILE n 
3 412  ARG n 
3 413  ILE n 
3 414  LEU n 
3 415  LYS n 
3 416  ASP n 
3 417  THR n 
3 418  THR n 
3 419  SER n 
3 420  SER n 
3 421  ILE n 
3 422  ALA n 
3 423  ARG n 
3 424  TYR n 
3 425  LEU n 
3 426  TYR n 
3 427  ARG n 
3 428  THR n 
3 429  TRP n 
3 430  TYR n 
3 431  LEU n 
3 432  ALA n 
3 433  ALA n 
3 434  ALA n 
3 435  ARG n 
3 436  MET n 
3 437  ALA n 
3 438  ALA n 
3 439  GLN n 
3 440  PRO n 
3 441  ARG n 
3 442  THR n 
3 443  TRP n 
3 444  ASP n 
3 445  PRO n 
3 446  LEU n 
3 447  PHE n 
3 448  GLN n 
3 449  ALA n 
3 450  ILE n 
3 451  MET n 
3 452  ARG n 
3 453  SER n 
3 454  GLN n 
3 455  TYR n 
3 456  VAL n 
3 457  THR n 
3 458  ALA n 
3 459  ARG n 
3 460  GLY n 
3 461  GLY n 
3 462  SER n 
3 463  GLY n 
3 464  ALA n 
3 465  ALA n 
3 466  LEU n 
3 467  ARG n 
3 468  GLU n 
3 469  SER n 
3 470  LEU n 
3 471  TYR n 
3 472  ALA n 
3 473  ILE n 
3 474  ASN n 
3 475  VAL n 
3 476  SER n 
3 477  LEU n 
3 478  PRO n 
3 479  ASP n 
3 480  PHE n 
3 481  LYS n 
3 482  GLY n 
3 483  LEU n 
3 484  PRO n 
3 485  VAL n 
3 486  LYS n 
3 487  ALA n 
3 488  ALA n 
3 489  THR n 
3 490  LYS n 
3 491  ILE n 
3 492  PHE n 
3 493  GLN n 
3 494  ALA n 
3 495  ALA n 
3 496  GLN n 
3 497  LEU n 
3 498  ALA n 
3 499  ASN n 
3 500  LEU n 
3 501  PRO n 
3 502  PHE n 
3 503  SER n 
3 504  HIS n 
3 505  THR n 
3 506  SER n 
3 507  VAL n 
3 508  ALA n 
3 509  ILE n 
3 510  LEU n 
3 511  ALA n 
3 512  ASP n 
3 513  THR n 
3 514  SER n 
3 515  MET n 
3 516  GLY n 
3 517  LEU n 
3 518  ARG n 
3 519  ASN n 
3 520  GLN n 
3 521  VAL n 
3 522  GLN n 
3 523  ARG n 
3 524  ARG n 
3 525  PRO n 
3 526  ARG n 
3 527  SER n 
3 528  ILE n 
3 529  MET n 
3 530  PRO n 
3 531  LEU n 
3 532  ASN n 
3 533  VAL n 
3 534  PRO n 
3 535  GLN n 
3 536  GLN n 
3 537  GLN n 
3 538  VAL n 
3 539  SER n 
3 540  ALA n 
3 541  PRO n 
3 542  HIS n 
3 543  THR n 
3 544  LEU n 
3 545  THR n 
3 546  ALA n 
3 547  ASP n 
3 548  TYR n 
3 549  ILE n 
3 550  ASN n 
3 551  TYR n 
3 552  HIS n 
3 553  MET n 
3 554  ASN n 
3 555  LEU n 
3 556  SER n 
3 557  PRO n 
3 558  THR n 
3 559  SER n 
3 560  GLY n 
3 561  SER n 
3 562  ALA n 
3 563  VAL n 
3 564  ILE n 
3 565  GLU n 
3 566  LYS n 
3 567  VAL n 
3 568  ILE n 
3 569  PRO n 
3 570  LEU n 
3 571  GLY n 
3 572  VAL n 
3 573  TYR n 
3 574  ALA n 
3 575  SER n 
3 576  SER n 
3 577  PRO n 
3 578  PRO n 
3 579  ASN n 
3 580  GLN n 
3 581  SER n 
3 582  ILE n 
3 583  ASN n 
3 584  ILE n 
3 585  ASP n 
3 586  ILE n 
3 587  SER n 
3 588  ALA n 
3 589  CYS n 
3 590  ASP n 
3 591  ALA n 
3 592  SER n 
3 593  ILE n 
3 594  THR n 
3 595  TRP n 
3 596  ASP n 
3 597  PHE n 
3 598  PHE n 
3 599  LEU n 
3 600  SER n 
3 601  VAL n 
3 602  ILE n 
3 603  MET n 
3 604  ALA n 
3 605  ALA n 
3 606  ILE n 
3 607  HIS n 
3 608  GLU n 
3 609  GLY n 
3 610  VAL n 
3 611  ALA n 
3 612  SER n 
3 613  SER n 
3 614  SER n 
3 615  ILE n 
3 616  GLY n 
3 617  LYS n 
3 618  PRO n 
3 619  PHE n 
3 620  MET n 
3 621  GLY n 
3 622  VAL n 
3 623  PRO n 
3 624  ALA n 
3 625  SER n 
3 626  ILE n 
3 627  VAL n 
3 628  ASN n 
3 629  ASP n 
3 630  GLU n 
3 631  SER n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  VAL n 
3 636  ARG n 
3 637  ALA n 
3 638  ALA n 
3 639  ARG n 
3 640  PRO n 
3 641  ILE n 
3 642  SER n 
3 643  GLY n 
3 644  MET n 
3 645  GLN n 
3 646  ASN n 
3 647  MET n 
3 648  ILE n 
3 649  GLN n 
3 650  HIS n 
3 651  LEU n 
3 652  SER n 
3 653  LYS n 
3 654  LEU n 
3 655  TYR n 
3 656  LYS n 
3 657  ARG n 
3 658  GLY n 
3 659  PHE n 
3 660  SER n 
3 661  TYR n 
3 662  ARG n 
3 663  VAL n 
3 664  ASN n 
3 665  ASP n 
3 666  SER n 
3 667  PHE n 
3 668  SER n 
3 669  PRO n 
3 670  GLY n 
3 671  ASN n 
3 672  ASP n 
3 673  PHE n 
3 674  THR n 
3 675  HIS n 
3 676  MET n 
3 677  THR n 
3 678  THR n 
3 679  THR n 
3 680  PHE n 
3 681  PRO n 
3 682  SER n 
3 683  GLY n 
3 684  SER n 
3 685  THR n 
3 686  ALA n 
3 687  THR n 
3 688  SER n 
3 689  THR n 
3 690  GLU n 
3 691  HIS n 
3 692  THR n 
3 693  ALA n 
3 694  ASN n 
3 695  ASN n 
3 696  SER n 
3 697  THR n 
3 698  MET n 
3 699  MET n 
3 700  GLU n 
3 701  THR n 
3 702  PHE n 
3 703  LEU n 
3 704  THR n 
3 705  VAL n 
3 706  TRP n 
3 707  GLY n 
3 708  PRO n 
3 709  GLU n 
3 710  HIS n 
3 711  THR n 
3 712  ASP n 
3 713  ASP n 
3 714  PRO n 
3 715  ASP n 
3 716  VAL n 
3 717  LEU n 
3 718  ARG n 
3 719  LEU n 
3 720  MET n 
3 721  LYS n 
3 722  SER n 
3 723  LEU n 
3 724  THR n 
3 725  ILE n 
3 726  GLN n 
3 727  ARG n 
3 728  ASN n 
3 729  TYR n 
3 730  VAL n 
3 731  CYS n 
3 732  GLN n 
3 733  GLY n 
3 734  ASP n 
3 735  ASP n 
3 736  GLY n 
3 737  LEU n 
3 738  MET n 
3 739  ILE n 
3 740  ILE n 
3 741  ASP n 
3 742  GLY n 
3 743  THR n 
3 744  THR n 
3 745  ALA n 
3 746  GLY n 
3 747  LYS n 
3 748  VAL n 
3 749  ASN n 
3 750  SER n 
3 751  GLU n 
3 752  THR n 
3 753  ILE n 
3 754  GLN n 
3 755  ASN n 
3 756  ASP n 
3 757  LEU n 
3 758  GLU n 
3 759  LEU n 
3 760  ILE n 
3 761  SER n 
3 762  LYS n 
3 763  TYR n 
3 764  GLY n 
3 765  GLU n 
3 766  GLU n 
3 767  PHE n 
3 768  GLY n 
3 769  TRP n 
3 770  LYS n 
3 771  TYR n 
3 772  ASP n 
3 773  ILE n 
3 774  ALA n 
3 775  TYR n 
3 776  ASP n 
3 777  GLY n 
3 778  THR n 
3 779  ALA n 
3 780  GLU n 
3 781  TYR n 
3 782  LEU n 
3 783  LYS n 
3 784  LEU n 
3 785  TYR n 
3 786  PHE n 
3 787  ILE n 
3 788  PHE n 
3 789  GLY n 
3 790  CYS n 
3 791  ARG n 
3 792  ILE n 
3 793  PRO n 
3 794  ASN n 
3 795  LEU n 
3 796  SER n 
3 797  ARG n 
3 798  HIS n 
3 799  PRO n 
3 800  ILE n 
3 801  VAL n 
3 802  GLY n 
3 803  LYS n 
3 804  GLU n 
3 805  ARG n 
3 806  ALA n 
3 807  ASN n 
3 808  SER n 
3 809  SER n 
3 810  ALA n 
3 811  GLU n 
3 812  GLU n 
3 813  PRO n 
3 814  TRP n 
3 815  PRO n 
3 816  ALA n 
3 817  ILE n 
3 818  LEU n 
3 819  ASP n 
3 820  GLN n 
3 821  ILE n 
3 822  MET n 
3 823  GLY n 
3 824  VAL n 
3 825  PHE n 
3 826  PHE n 
3 827  ASN n 
3 828  GLY n 
3 829  VAL n 
3 830  HIS n 
3 831  ASP n 
3 832  GLY n 
3 833  LEU n 
3 834  GLN n 
3 835  TRP n 
3 836  GLN n 
3 837  ARG n 
3 838  TRP n 
3 839  ILE n 
3 840  ARG n 
3 841  TYR n 
3 842  SER n 
3 843  TRP n 
3 844  ALA n 
3 845  LEU n 
3 846  CYS n 
3 847  CYS n 
3 848  ALA n 
3 849  PHE n 
3 850  SER n 
3 851  ARG n 
3 852  GLN n 
3 853  ARG n 
3 854  THR n 
3 855  MET n 
3 856  ILE n 
3 857  GLY n 
3 858  GLU n 
3 859  SER n 
3 860  VAL n 
3 861  GLY n 
3 862  TYR n 
3 863  LEU n 
3 864  GLN n 
3 865  TYR n 
3 866  PRO n 
3 867  MET n 
3 868  TRP n 
3 869  SER n 
3 870  PHE n 
3 871  VAL n 
3 872  TYR n 
3 873  TRP n 
3 874  GLY n 
3 875  LEU n 
3 876  PRO n 
3 877  LEU n 
3 878  VAL n 
3 879  LYS n 
3 880  ALA n 
3 881  PHE n 
3 882  GLY n 
3 883  SER n 
3 884  ASP n 
3 885  PRO n 
3 886  TRP n 
3 887  ILE n 
3 888  PHE n 
3 889  SER n 
3 890  TRP n 
3 891  TYR n 
3 892  MET n 
3 893  PRO n 
3 894  THR n 
3 895  GLY n 
3 896  ASP n 
3 897  LEU n 
3 898  GLY n 
3 899  MET n 
3 900  TYR n 
3 901  SER n 
3 902  TRP n 
3 903  ILE n 
3 904  SER n 
3 905  LEU n 
3 906  ILE n 
3 907  ARG n 
3 908  PRO n 
3 909  LEU n 
3 910  MET n 
3 911  THR n 
3 912  ARG n 
3 913  TRP n 
3 914  MET n 
3 915  VAL n 
3 916  ALA n 
3 917  ASN n 
3 918  GLY n 
3 919  TYR n 
3 920  VAL n 
3 921  THR n 
3 922  ASP n 
3 923  ARG n 
3 924  CYS n 
3 925  SER n 
3 926  THR n 
3 927  VAL n 
3 928  PHE n 
3 929  GLY n 
3 930  ASN n 
3 931  ALA n 
3 932  ASP n 
3 933  TYR n 
3 934  ARG n 
3 935  ARG n 
3 936  CYS n 
3 937  PHE n 
3 938  ASN n 
3 939  GLU n 
3 940  LEU n 
3 941  LYS n 
3 942  LEU n 
3 943  TYR n 
3 944  GLN n 
3 945  GLY n 
3 946  TYR n 
3 947  TYR n 
3 948  MET n 
3 949  ALA n 
3 950  GLN n 
3 951  LEU n 
3 952  PRO n 
3 953  ARG n 
3 954  ASN n 
3 955  PRO n 
3 956  LYS n 
3 957  LYS n 
3 958  SER n 
3 959  GLY n 
3 960  ARG n 
3 961  ALA n 
3 962  ALA n 
3 963  SER n 
3 964  ARG n 
3 965  GLU n 
3 966  VAL n 
3 967  ARG n 
3 968  GLU n 
3 969  GLN n 
3 970  PHE n 
3 971  THR n 
3 972  GLN n 
3 973  ALA n 
3 974  LEU n 
3 975  SER n 
3 976  ASP n 
3 977  TYR n 
3 978  LEU n 
3 979  MET n 
3 980  GLN n 
3 981  ASN n 
3 982  PRO n 
3 983  GLU n 
3 984  LEU n 
3 985  LYS n 
3 986  SER n 
3 987  ARG n 
3 988  VAL n 
3 989  LEU n 
3 990  ARG n 
3 991  GLY n 
3 992  ARG n 
3 993  SER n 
3 994  GLU n 
3 995  TRP n 
3 996  GLU n 
3 997  LYS n 
3 998  TYR n 
3 999  GLY n 
3 1000 ALA n 
3 1001 GLY n 
3 1002 ILE n 
3 1003 ILE n 
3 1004 HIS n 
3 1005 ASN n 
3 1006 PRO n 
3 1007 PRO n 
3 1008 SER n 
3 1009 LEU n 
3 1010 PHE n 
3 1011 ASP n 
3 1012 VAL n 
3 1013 PRO n 
3 1014 HIS n 
3 1015 LYS n 
3 1016 TRP n 
3 1017 TYR n 
3 1018 GLN n 
3 1019 GLY n 
3 1020 ALA n 
3 1021 GLN n 
3 1022 GLU n 
3 1023 ALA n 
3 1024 ALA n 
3 1025 ILE n 
3 1026 ALA n 
3 1027 THR n 
3 1028 ARG n 
3 1029 GLU n 
3 1030 GLU n 
3 1031 LEU n 
3 1032 ALA n 
3 1033 GLU n 
3 1034 MET n 
3 1035 ASP n 
3 1036 GLU n 
3 1037 THR n 
3 1038 LEU n 
3 1039 MET n 
3 1040 ARG n 
3 1041 ALA n 
3 1042 ARG n 
3 1043 ARG n 
3 1044 HIS n 
3 1045 SER n 
3 1046 TYR n 
3 1047 SER n 
3 1048 SER n 
3 1049 PHE n 
3 1050 SER n 
3 1051 LYS n 
3 1052 LEU n 
3 1053 LEU n 
3 1054 GLU n 
3 1055 ALA n 
3 1056 TYR n 
3 1057 LEU n 
3 1058 LEU n 
3 1059 VAL n 
3 1060 LYS n 
3 1061 TRP n 
3 1062 ARG n 
3 1063 MET n 
3 1064 CYS n 
3 1065 GLU n 
3 1066 ALA n 
3 1067 ARG n 
3 1068 GLU n 
3 1069 PRO n 
3 1070 SER n 
3 1071 VAL n 
3 1072 ASP n 
3 1073 LEU n 
3 1074 ARG n 
3 1075 LEU n 
3 1076 PRO n 
3 1077 LEU n 
3 1078 CYS n 
3 1079 ALA n 
3 1080 GLY n 
3 1081 ILE n 
3 1082 ASP n 
3 1083 PRO n 
3 1084 LEU n 
3 1085 ASN n 
3 1086 SER n 
3 1087 ASP n 
3 1088 PRO n 
3 1089 PHE n 
3 1090 LEU n 
3 1091 LYS n 
3 1092 MET n 
3 1093 VAL n 
3 1094 SER n 
3 1095 VAL n 
3 1096 GLY n 
3 1097 PRO n 
3 1098 MET n 
3 1099 LEU n 
3 1100 GLN n 
3 1101 SER n 
3 1102 THR n 
3 1103 ARG n 
3 1104 LYS n 
3 1105 TYR n 
3 1106 PHE n 
3 1107 ALA n 
3 1108 GLN n 
3 1109 THR n 
3 1110 LEU n 
3 1111 PHE n 
3 1112 MET n 
3 1113 ALA n 
3 1114 LYS n 
3 1115 THR n 
3 1116 VAL n 
3 1117 SER n 
3 1118 GLY n 
3 1119 LEU n 
3 1120 ASP n 
3 1121 VAL n 
3 1122 ASN n 
3 1123 ALA n 
3 1124 ILE n 
3 1125 ASP n 
3 1126 SER n 
3 1127 ALA n 
3 1128 LEU n 
3 1129 LEU n 
3 1130 ARG n 
3 1131 LEU n 
3 1132 ARG n 
3 1133 THR n 
3 1134 LEU n 
3 1135 GLY n 
3 1136 ALA n 
3 1137 ASP n 
3 1138 LYS n 
3 1139 LYS n 
3 1140 ALA n 
3 1141 LEU n 
3 1142 THR n 
3 1143 ALA n 
3 1144 GLN n 
3 1145 LEU n 
3 1146 LEU n 
3 1147 MET n 
3 1148 VAL n 
3 1149 GLY n 
3 1150 LEU n 
3 1151 GLN n 
3 1152 GLU n 
3 1153 SER n 
3 1154 GLU n 
3 1155 ALA n 
3 1156 ASP n 
3 1157 ALA n 
3 1158 LEU n 
3 1159 ALA n 
3 1160 GLY n 
3 1161 LYS n 
3 1162 ILE n 
3 1163 MET n 
3 1164 LEU n 
3 1165 GLN n 
3 1166 ASP n 
3 1167 VAL n 
3 1168 ASN n 
3 1169 THR n 
3 1170 VAL n 
3 1171 GLN n 
3 1172 LEU n 
3 1173 ALA n 
3 1174 ARG n 
3 1175 VAL n 
3 1176 VAL n 
3 1177 ASN n 
3 1178 LEU n 
3 1179 ALA n 
3 1180 VAL n 
3 1181 PRO n 
3 1182 ASP n 
3 1183 THR n 
3 1184 TRP n 
3 1185 MET n 
3 1186 SER n 
3 1187 LEU n 
3 1188 ASP n 
3 1189 PHE n 
3 1190 ASP n 
3 1191 SER n 
3 1192 MET n 
3 1193 PHE n 
3 1194 LYS n 
3 1195 HIS n 
3 1196 HIS n 
3 1197 VAL n 
3 1198 LYS n 
3 1199 LEU n 
3 1200 LEU n 
3 1201 PRO n 
3 1202 LYS n 
3 1203 ASP n 
3 1204 GLY n 
3 1205 ARG n 
3 1206 HIS n 
3 1207 LEU n 
3 1208 ASN n 
3 1209 THR n 
3 1210 ASP n 
3 1211 ILE n 
3 1212 PRO n 
3 1213 PRO n 
3 1214 ARG n 
3 1215 MET n 
3 1216 GLY n 
3 1217 TRP n 
3 1218 LEU n 
3 1219 ARG n 
3 1220 ALA n 
3 1221 ILE n 
3 1222 LEU n 
3 1223 ARG n 
3 1224 PHE n 
3 1225 LEU n 
3 1226 GLY n 
3 1227 ALA n 
3 1228 GLY n 
3 1229 MET n 
3 1230 VAL n 
3 1231 MET n 
3 1232 THR n 
3 1233 ALA n 
3 1234 THR n 
3 1235 GLY n 
3 1236 VAL n 
3 1237 ALA n 
3 1238 VAL n 
3 1239 ASP n 
3 1240 ILE n 
3 1241 TYR n 
3 1242 LEU n 
3 1243 GLU n 
3 1244 ASP n 
3 1245 ILE n 
3 1246 HIS n 
3 1247 GLY n 
3 1248 GLY n 
3 1249 GLY n 
3 1250 ARG n 
3 1251 SER n 
3 1252 LEU n 
3 1253 GLY n 
3 1254 GLN n 
3 1255 ARG n 
3 1256 PHE n 
3 1257 MET n 
3 1258 THR n 
3 1259 TRP n 
3 1260 MET n 
3 1261 ARG n 
3 1262 GLN n 
3 1263 GLU n 
3 1264 GLY n 
3 1265 ARG n 
3 1266 SER n 
3 1267 ALA n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Orthoreovirus 
_entity_src_gen.pdbx_gene_src_gene                 L1 
_entity_src_gen.gene_src_species                   'Mammalian orthoreovirus' 
_entity_src_gen.gene_src_strain                    Dearing 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mammalian orthoreovirus 3' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10886 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               SF21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          'baculovirus AcNPV' 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pFastbac 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       ? 
_pdbx_entity_src_syn.pdbx_end_seq_num       ? 
_pdbx_entity_src_syn.organism_scientific    ? 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       ? 
_pdbx_entity_src_syn.details                'AUUAGC, Ordered from Dharmacon' 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP VL3_REOVD 3 
;MSSMILTQFGPFIESISGITDQSNDVFEDAAKAFSMFTRSDVYKALDEIPFSDDAMLPIPPTIYTKPSHDSYYYIDALNR
VRRKTYQGPDDVYVPNCSIVELLEPHETLTSYGRLSEAIENRAKDGDSQARIATTYGRIAESQARQIKAPLEKFVLALLV
AEAGGSLYDPVLQKYDEIPDLSHNCPLWCFREICRHISGPLPDRAPYLYLSAGVFWLMSPRMTSAIPPLLSDLVNLAILQ
QTAGLDPSLVKLGVQICLHAAASSSYSWFILKTKSIFPQNTLHSMYESLEGGYCPNLEWLEPRSDYKFMYMGVMPLSAKY
ARSAPSNDKKARELGEKYGLSSVVGELRKRTKTYVKHDFASVRYIRDAMACTSGIFLVRTPTETVLQEYTQSPEIKVPIP
QKDWTGPIGEIRILKDTTSSIARYLYRTWYLAAARMAAQPRTWDPLFQAIMRSQYVTARGGSGAALRESLYAINVSLPDF
KGLPVKAATKIFQAAQLANLPFSHTSVAILADTSMGLRNQVQRRPRSIMPLNVPQQQVSAPHTLTADYINYHMNLSPTSG
SAVIEKVIPLGVYASSPPNQSINIDISACDASITWDFFLSVIMAAIHEGVASSSIGKPFMGVPASIVNDESVVGVRAARP
ISGMQNMIQHLSKLYKRGFSYRVNDSFSPGNDFTHMTTTFPSGSTATSTEHTANNSTMMETFLTVWGPEHTDDPDVLRLM
KSLTIQRNYVCQGDDGLMIIDGTTAGKVNSETIQNDLELISKYGEEFGWKYDIAYDGTAEYLKLYFIFGCRIPNLSRHPI
VGKERANSSAEEPWPAILDQIMGVFFNGVHDGLQWQRWIRYSWALCCAFSRQRTMIGESVGYLQYPMWSFVYWGLPLVKA
FGSDPWIFSWYMPTGDLGMYSWISLIRPLMTRWMVANGYVTDRCSTVFGNADYRRCFNELKLYQGYYMAQLPRNPKKSGR
AASREVREQFTQALSDYLMQNPELKSRVLRGRSEWEKYGAGIIHNPPSLFDVPHKWYQGAQEAAIATREELAEMDETLMR
ARRHSYSSFSKLLEAYLLVKWRMCEAREPSVDLRLPLCAGIDPLNSDPFLKMVSVGPMLQSTRKYFAQTLFMAKTVSGLD
VNAIDSALLRLRTLGADKKALTAQLLMVGLQESEADALAGKIMLQDVNTVQLARVVNLAVPDTWMSLDFDSMFKHHVKLL
PKDGRHLNTDIPPRMGWLRAILRFLGAGMVMTATGVAVDIYLEDIHGGGRSLGQRFMTWMRQEGRSA
;
1 P17378 ? 
2 PDB 1N35      1 ? ? 1N35   ? 
3 PDB 1N35      2 ? ? 1N35   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1N35 A 1 ? 1267 ? P17378 1    ? 1267 ? 1    1267 
2 2 1N35 B 1 ? 5    ? 1N35   1272 ? 1276 ? 1272 1276 
3 3 1N35 C 1 ? 10   ? 1N35   1281 ? 1290 ? 1281 1290 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"        ? 'C10 H14 N5 O7 P'  347.221 
ALA 'L-peptide linking' y ALANINE                             ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                            ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                          ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                     ? 'C4 H7 N O4'       133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"         ? 'C9 H14 N3 O8 P'   323.197 
CH1 non-polymer         . "3'-DEOXY-CYTIDINE-5'-TRIPHOSPHATE" ? 'C9 H16 N3 O13 P3' 467.157 
CYS 'L-peptide linking' y CYSTEINE                            ? 'C3 H7 N O2 S'     121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"        ? 'C10 H14 N5 O8 P'  363.221 
GLN 'L-peptide linking' y GLUTAMINE                           ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                     ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                             ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                           ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                               ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                          ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                             ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                              ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                          ? 'C5 H11 N O2 S'    149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                ? 'Mn 2'             54.938  
PHE 'L-peptide linking' y PHENYLALANINE                       ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                             ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                              ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                           ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                          ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                            ? 'C9 H11 N O3'      181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"          ? 'C9 H13 N2 O9 P'   324.181 
VAL 'L-peptide linking' y VALINE                              ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1N35 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.55 
_exptl_crystal.density_percent_sol   51.77 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.8 
_exptl_crystal_grow.pdbx_details    'PEG4000, NaCl, HEPES, glycerol, pH 7.8, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.details 
1 1 1 PEG4000  ? ? ? 
1 2 1 NaCl     ? ? ? 
1 3 1 HEPES    ? ? ? 
1 4 1 glycerol ? ? ? 
1 5 2 PEG4000  ? ? ? 
1 6 2 NaCl     ? ? ? 
1 7 2 HEPES    ? ? ? 
1 8 2 glycerol ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2000-12-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.948 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.948 
# 
_reflns.entry_id                     1N35 
_reflns.observed_criterion_sigma_I   -2.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   48139 
_reflns.number_all                   48139 
_reflns.percent_possible_obs         89.7 
_reflns.pdbx_Rmerge_I_obs            0.087 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12 
_reflns.B_iso_Wilson_estimate        46.0 
_reflns.pdbx_redundancy              3.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.59 
_reflns_shell.percent_possible_all   75.3 
_reflns_shell.Rmerge_I_obs           0.482 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2 
_reflns_shell.pdbx_redundancy        1.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3986 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1N35 
_refine.ls_number_reflns_obs                     47743 
_refine.ls_number_reflns_all                     47743 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               2358160.53 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.ls_d_res_low                             43.01 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    89.9 
_refine.ls_R_factor_obs                          0.207 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.207 
_refine.ls_R_factor_R_free                       0.259 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.4 
_refine.ls_number_reflns_R_free                  2581 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               36.5 
_refine.aniso_B[1][1]                            -5.70 
_refine.aniso_B[2][2]                            5.04 
_refine.aniso_B[3][3]                            0.66 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 .345166 
_refine.solvent_model_param_bsol                 24.2565 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'lambda3 native structure' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1N35 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.38 
_refine_analyze.Luzzati_sigma_a_free            0.39 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9987 
_refine_hist.pdbx_number_atoms_nucleic_acid   282 
_refine_hist.pdbx_number_atoms_ligand         86 
_refine_hist.number_atoms_solvent             350 
_refine_hist.number_atoms_total               10705 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        43.01 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.6  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.10  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.59 
_refine_ls_shell.number_reflns_R_work             3880 
_refine_ls_shell.R_factor_R_work                  0.29 
_refine_ls_shell.percent_reflns_obs               76.9 
_refine_ls_shell.R_factor_R_free                  0.318 
_refine_ls_shell.R_factor_R_free_error            0.030 
_refine_ls_shell.percent_reflns_R_free            2.8 
_refine_ls_shell.number_reflns_R_free             113 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP      'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP        'X-RAY DIFFRACTION' 
4 MGP_NTP_DEOXY_XP  MGP_NTP_DEOXY_XP 'X-RAY DIFFRACTION' 
5 ION.PARAM         ION.TOP          'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1N35 
_struct.title                     'lambda3 elongation complex with four phosphodiester bond formed' 
_struct.pdbx_descriptor           'Minor core protein lambda 3' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1N35 
_struct_keywords.pdbx_keywords   TRANSFERASE/RNA 
_struct_keywords.text            'RNA polymerase, right hand configuration, bracelet, TRANSFERASE-RNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  SER C 2    ? ILE C 16   ? SER A 2    ILE A 16   1 ? 15 
HELX_P HELX_P2  2  SER C 23   ? PHE C 37   ? SER A 23   PHE A 37   1 ? 15 
HELX_P HELX_P3  3  THR C 38   ? GLU C 48   ? THR A 38   GLU A 48   1 ? 11 
HELX_P HELX_P4  4  SER C 52   ? MET C 56   ? SER A 52   MET A 56   5 ? 5  
HELX_P HELX_P5  5  PRO C 60   ? TYR C 64   ? PRO A 60   TYR A 64   5 ? 5  
HELX_P HELX_P6  6  SER C 68   ? SER C 71   ? SER A 68   SER A 71   5 ? 4  
HELX_P HELX_P7  7  ILE C 99   ? GLU C 101  ? ILE A 99   GLU A 101  5 ? 3  
HELX_P HELX_P8  8  SER C 116  ? GLY C 126  ? SER A 116  GLY A 126  1 ? 11 
HELX_P HELX_P9  9  ASP C 127  ? GLN C 146  ? ASP A 127  GLN A 146  1 ? 20 
HELX_P HELX_P10 10 PRO C 150  ? ALA C 163  ? PRO A 150  ALA A 163  1 ? 14 
HELX_P HELX_P11 11 ASP C 180  ? HIS C 183  ? ASP A 180  HIS A 183  5 ? 4  
HELX_P HELX_P12 12 ASN C 184  ? GLY C 199  ? ASN A 184  GLY A 199  1 ? 16 
HELX_P HELX_P13 13 ALA C 225  ? ALA C 243  ? ALA A 225  ALA A 243  1 ? 19 
HELX_P HELX_P14 14 ASP C 246  ? SER C 263  ? ASP A 246  SER A 263  1 ? 18 
HELX_P HELX_P15 15 SER C 265  ? LYS C 274  ? SER A 265  LYS A 274  1 ? 10 
HELX_P HELX_P16 16 SER C 275  ? ASN C 280  ? SER A 275  ASN A 280  1 ? 6  
HELX_P HELX_P17 17 THR C 281  ? MET C 285  ? THR A 281  MET A 285  5 ? 5  
HELX_P HELX_P18 18 PRO C 302  ? TYR C 306  ? PRO A 302  TYR A 306  5 ? 5  
HELX_P HELX_P19 19 SER C 317  ? ALA C 321  ? SER A 317  ALA A 321  5 ? 5  
HELX_P HELX_P20 20 ASN C 327  ? TYR C 338  ? ASN A 327  TYR A 338  1 ? 12 
HELX_P HELX_P21 21 LEU C 340  ? TYR C 354  ? LEU A 340  TYR A 354  1 ? 15 
HELX_P HELX_P22 22 ASP C 358  ? ALA C 370  ? ASP A 358  ALA A 370  1 ? 13 
HELX_P HELX_P23 23 THR C 380  ? TYR C 389  ? THR A 380  TYR A 389  1 ? 10 
HELX_P HELX_P24 24 PRO C 400  ? LYS C 402  ? PRO A 400  LYS A 402  5 ? 3  
HELX_P HELX_P25 25 ILE C 421  ? GLN C 439  ? ILE A 421  GLN A 439  1 ? 19 
HELX_P HELX_P26 26 PRO C 440  ? TRP C 443  ? PRO A 440  TRP A 443  5 ? 4  
HELX_P HELX_P27 27 ASP C 444  ? TYR C 455  ? ASP A 444  TYR A 455  1 ? 12 
HELX_P HELX_P28 28 SER C 462  ? ALA C 472  ? SER A 462  ALA A 472  1 ? 11 
HELX_P HELX_P29 29 THR C 489  ? ALA C 498  ? THR A 489  ALA A 498  1 ? 10 
HELX_P HELX_P30 30 PRO C 501  ? SER C 506  ? PRO A 501  SER A 506  1 ? 6  
HELX_P HELX_P31 31 VAL C 507  ? ALA C 511  ? VAL A 507  ALA A 511  5 ? 5  
HELX_P HELX_P32 32 ASN C 532  ? SER C 539  ? ASN A 532  SER A 539  1 ? 8  
HELX_P HELX_P33 33 SER C 539  ? MET C 553  ? SER A 539  MET A 553  1 ? 15 
HELX_P HELX_P34 34 VAL C 567  ? SER C 576  ? VAL A 567  SER A 576  1 ? 10 
HELX_P HELX_P35 35 ALA C 588  ? ILE C 593  ? ALA A 588  ILE A 593  1 ? 6  
HELX_P HELX_P36 36 PHE C 598  ? VAL C 610  ? PHE A 598  VAL A 610  1 ? 13 
HELX_P HELX_P37 37 VAL C 610  ? ILE C 615  ? VAL A 610  ILE A 615  1 ? 6  
HELX_P HELX_P38 38 SER C 642  ? GLY C 658  ? SER A 642  GLY A 658  1 ? 17 
HELX_P HELX_P39 39 ALA C 686  ? VAL C 705  ? ALA A 686  VAL A 705  1 ? 20 
HELX_P HELX_P40 40 VAL C 705  ? HIS C 710  ? VAL A 705  HIS A 710  1 ? 6  
HELX_P HELX_P41 41 ASP C 713  ? SER C 722  ? ASP A 713  SER A 722  1 ? 10 
HELX_P HELX_P42 42 ASN C 749  ? GLU C 766  ? ASN A 749  GLU A 766  1 ? 18 
HELX_P HELX_P43 43 ASN C 794  ? HIS C 798  ? ASN A 794  HIS A 798  5 ? 5  
HELX_P HELX_P44 44 PRO C 815  ? ASP C 831  ? PRO A 815  ASP A 831  1 ? 17 
HELX_P HELX_P45 45 GLN C 834  ? ALA C 848  ? GLN A 834  ALA A 848  1 ? 15 
HELX_P HELX_P46 46 PRO C 866  ? GLY C 874  ? PRO A 866  GLY A 874  1 ? 9  
HELX_P HELX_P47 47 THR C 894  ? ILE C 906  ? THR A 894  ILE A 906  1 ? 13 
HELX_P HELX_P48 48 ILE C 906  ? ALA C 916  ? ILE A 906  ALA A 916  1 ? 11 
HELX_P HELX_P49 49 ASP C 932  ? LEU C 940  ? ASP A 932  LEU A 940  1 ? 9  
HELX_P HELX_P50 50 LYS C 941  ? ALA C 949  ? LYS A 941  ALA A 949  1 ? 9  
HELX_P HELX_P51 51 SER C 963  ? MET C 979  ? SER A 963  MET A 979  1 ? 17 
HELX_P HELX_P52 52 ASN C 981  ? GLY C 999  ? ASN A 981  GLY A 999  1 ? 19 
HELX_P HELX_P53 53 SER C 1008 ? PHE C 1010 ? SER A 1008 PHE A 1010 5 ? 3  
HELX_P HELX_P54 54 ASP C 1011 ? GLU C 1022 ? ASP A 1011 GLU A 1022 1 ? 12 
HELX_P HELX_P55 55 THR C 1027 ? HIS C 1044 ? THR A 1027 HIS A 1044 1 ? 18 
HELX_P HELX_P56 56 SER C 1050 ? LEU C 1057 ? SER A 1050 LEU A 1057 1 ? 8  
HELX_P HELX_P57 57 ASN C 1085 ? GLY C 1096 ? ASN A 1085 GLY A 1096 1 ? 12 
HELX_P HELX_P58 58 SER C 1101 ? GLN C 1108 ? SER A 1101 GLN A 1108 1 ? 8  
HELX_P HELX_P59 59 ASP C 1120 ? LEU C 1134 ? ASP A 1120 LEU A 1134 1 ? 15 
HELX_P HELX_P60 60 ASP C 1137 ? VAL C 1148 ? ASP A 1137 VAL A 1148 1 ? 12 
HELX_P HELX_P61 61 GLN C 1151 ? GLN C 1165 ? GLN A 1151 GLN A 1165 1 ? 15 
HELX_P HELX_P62 62 ASN C 1168 ? ALA C 1173 ? ASN A 1168 ALA A 1173 1 ? 6  
HELX_P HELX_P63 63 ARG C 1174 ? ASN C 1177 ? ARG A 1174 ASN A 1177 5 ? 4  
HELX_P HELX_P64 64 PRO C 1181 ? MET C 1185 ? PRO A 1181 MET A 1185 5 ? 5  
HELX_P HELX_P65 65 ASP C 1188 ? HIS C 1196 ? ASP A 1188 HIS A 1196 1 ? 9  
HELX_P HELX_P66 66 TRP C 1217 ? ALA C 1233 ? TRP A 1217 ALA A 1233 1 ? 17 
HELX_P HELX_P67 67 GLY C 1247 ? GLU C 1263 ? GLY A 1247 GLU A 1263 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? D MN . MN ? ? ? 1_555 F CH1 .   O2B ? ? A MN 1301 A CH1 1291 1_555 ? ? ? ? ? ? ?            2.279 ? 
metalc2 metalc ? ? D MN . MN ? ? ? 1_555 C ASP 585 OD1 ? ? A MN 1301 A ASP 585  1_555 ? ? ? ? ? ? ?            2.700 ? 
metalc3 metalc ? ? D MN . MN ? ? ? 1_555 C ILE 586 O   ? ? A MN 1301 A ILE 586  1_555 ? ? ? ? ? ? ?            2.482 ? 
metalc4 metalc ? ? D MN . MN ? ? ? 1_555 C ASP 734 OD2 ? ? A MN 1301 A ASP 734  1_555 ? ? ? ? ? ? ?            2.193 ? 
metalc5 metalc ? ? E MN . MN ? ? ? 1_555 C ASP 585 OD2 ? ? A MN 1302 A ASP 585  1_555 ? ? ? ? ? ? ?            2.714 ? 
metalc6 metalc ? ? E MN . MN ? ? ? 1_555 C ASP 734 OD1 ? ? A MN 1302 A ASP 734  1_555 ? ? ? ? ? ? ?            2.318 ? 
metalc7 metalc ? ? E MN . MN ? ? ? 1_555 F CH1 .   O1A ? ? A MN 1302 A CH1 1291 1_555 ? ? ? ? ? ? ?            2.567 ? 
hydrog1 hydrog ? ? A G  2 N1 ? ? ? 1_555 B C   9   N3  ? ? B G  1273 C C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2 hydrog ? ? A G  2 N2 ? ? ? 1_555 B C   9   O2  ? ? B G  1273 C C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3 hydrog ? ? A G  2 O6 ? ? ? 1_555 B C   9   N4  ? ? B G  1273 C C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4 hydrog ? ? A G  3 N1 ? ? ? 1_555 B C   8   N3  ? ? B G  1274 C C   1288 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5 hydrog ? ? A G  3 N2 ? ? ? 1_555 B C   8   O2  ? ? B G  1274 C C   1288 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6 hydrog ? ? A G  3 O6 ? ? ? 1_555 B C   8   N4  ? ? B G  1274 C C   1288 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7 hydrog ? ? A G  5 N1 ? ? ? 1_555 B C   6   N3  ? ? B G  1276 C C   1286 1_555 ? ? ? ? ? ? 'G-C PAIR'   ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 301 C . ? GLU 301 A PRO 302 C ? PRO 302 A 1 -0.20 
2 PRO 577 C . ? PRO 577 A PRO 578 C ? PRO 578 A 1 0.49  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 4 ? 
C ? 2 ? 
D ? 3 ? 
E ? 2 ? 
F ? 3 ? 
G ? 2 ? 
H ? 4 ? 
I ? 2 ? 
J ? 3 ? 
K ? 2 ? 
L ? 2 ? 
M ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? parallel      
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? anti-parallel 
M 2 3 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR C 73   ? ILE C 75   ? TYR A 73   ILE A 75   
A 2 VAL C 81   ? ARG C 83   ? VAL A 81   ARG A 83   
B 1 LEU C 103  ? PRO C 105  ? LEU A 103  PRO A 105  
B 2 TYR C 112  ? LEU C 115  ? TYR A 112  LEU A 115  
B 3 PHE C 215  ? LEU C 217  ? PHE A 215  LEU A 217  
B 4 TYR C 207  ? LEU C 208  ? TYR A 207  LEU A 208  
C 1 TYR C 168  ? ASP C 169  ? TYR A 168  ASP A 169  
C 2 LYS C 174  ? TYR C 175  ? LYS A 174  TYR A 175  
D 1 PHE C 308  ? PRO C 315  ? PHE A 308  PRO A 315  
D 2 GLY C 291  ? TRP C 299  ? GLY A 291  TRP A 299  
D 3 LYS C 356  ? HIS C 357  ? LYS A 356  HIS A 357  
E 1 TRP C 404  ? ILE C 408  ? TRP A 404  ILE A 408  
E 2 ILE C 411  ? LEU C 414  ? ILE A 411  LEU A 414  
F 1 THR C 513  ? SER C 514  ? THR A 513  SER A 514  
F 2 PHE C 659  ? ASN C 664  ? PHE A 659  ASN A 664  
F 3 ASP C 672  ? THR C 677  ? ASP A 672  THR A 677  
G 1 GLY C 516  ? ARG C 518  ? GLY A 516  ARG A 518  
G 2 ARG C 526  ? ILE C 528  ? ARG A 526  ILE A 528  
H 1 TYR C 729  ? GLN C 732  ? TYR A 729  GLN A 732  
H 2 ASP C 735  ? ILE C 740  ? ASP A 735  ILE A 740  
H 3 GLN C 580  ? SER C 587  ? GLN A 580  SER A 587  
H 4 LYS C 770  ? ASP C 772  ? LYS A 770  ASP A 772  
I 1 SER C 625  ? ASP C 629  ? SER A 625  ASP A 629  
I 2 ALA C 637  ? ILE C 641  ? ALA A 637  ILE A 641  
J 1 THR C 778  ? TYR C 781  ? THR A 778  TYR A 781  
J 2 LEU C 784  ? ILE C 787  ? LEU A 784  ILE A 787  
J 3 CYS C 790  ? ARG C 791  ? CYS A 790  ARG A 791  
K 1 ARG C 851  ? THR C 854  ? ARG A 851  THR A 854  
K 2 GLY C 861  ? GLN C 864  ? GLY A 861  GLN A 864  
L 1 VAL C 920  ? SER C 925  ? VAL A 920  SER A 925  
L 2 GLY C 929  ? ALA C 931  ? GLY A 929  ALA A 931  
M 1 VAL C 1059 ? ALA C 1066 ? VAL A 1059 ALA A 1066 
M 2 VAL C 1238 ? ILE C 1245 ? VAL A 1238 ILE A 1245 
M 3 VAL C 1197 ? LYS C 1198 ? VAL A 1197 LYS A 1198 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR C 74   ? N TYR A 74   O ARG C 82   ? O ARG A 82   
B 1 2 N GLU C 104  ? N GLU A 104  O ARG C 114  ? O ARG A 114  
B 2 3 N GLY C 113  ? N GLY A 113  O TRP C 216  ? O TRP A 216  
B 3 4 O PHE C 215  ? O PHE A 215  N LEU C 208  ? N LEU A 208  
C 1 2 N ASP C 169  ? N ASP A 169  O LYS C 174  ? O LYS A 174  
D 1 2 O MET C 314  ? O MET A 314  N CYS C 294  ? N CYS A 294  
D 2 3 N GLY C 291  ? N GLY A 291  O HIS C 357  ? O HIS A 357  
E 1 2 N ILE C 408  ? N ILE A 408  O ILE C 411  ? O ILE A 411  
F 1 2 N THR C 513  ? N THR A 513  O ARG C 662  ? O ARG A 662  
F 2 3 N TYR C 661  ? N TYR A 661  O HIS C 675  ? O HIS A 675  
G 1 2 N GLY C 516  ? N GLY A 516  O ILE C 528  ? O ILE A 528  
H 1 2 N GLN C 732  ? N GLN A 732  O ASP C 735  ? O ASP A 735  
H 2 3 O GLY C 736  ? O GLY A 736  N ILE C 584  ? N ILE A 584  
H 3 4 N ASP C 585  ? N ASP A 585  O ASP C 772  ? O ASP A 772  
I 1 2 N ASP C 629  ? N ASP A 629  O ALA C 637  ? O ALA A 637  
J 1 2 N ALA C 779  ? N ALA A 779  O PHE C 786  ? O PHE A 786  
J 2 3 N ILE C 787  ? N ILE A 787  O CYS C 790  ? O CYS A 790  
K 1 2 N GLN C 852  ? N GLN A 852  O LEU C 863  ? O LEU A 863  
L 1 2 N SER C 925  ? N SER A 925  O GLY C 929  ? O GLY A 929  
M 1 2 N LYS C 1060 ? N LYS A 1060 O ASP C 1244 ? O ASP A 1244 
M 2 3 O LEU C 1242 ? O LEU A 1242 N LYS C 1198 ? N LYS A 1198 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN A 1301'  
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MN A 1302'  
AC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CH1 A 1291' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CH1 A 1294' 
AC5 Software ? ? ? ? 9  'BINDING SITE FOR RESIDUE CH1 A 1295' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASP C 585  ? ASP A 585  . ? 1_555 ? 
2  AC1 5  ILE C 586  ? ILE A 586  . ? 1_555 ? 
3  AC1 5  ASP C 734  ? ASP A 734  . ? 1_555 ? 
4  AC1 5  CH1 F .    ? CH1 A 1291 . ? 1_555 ? 
5  AC1 5  MN  E .    ? MN  A 1302 . ? 1_555 ? 
6  AC2 5  ASP C 585  ? ASP A 585  . ? 1_555 ? 
7  AC2 5  ASP C 734  ? ASP A 734  . ? 1_555 ? 
8  AC2 5  ASP C 735  ? ASP A 735  . ? 1_555 ? 
9  AC2 5  CH1 F .    ? CH1 A 1291 . ? 1_555 ? 
10 AC2 5  MN  D .    ? MN  A 1301 . ? 1_555 ? 
11 AC3 15 ARG C 523  ? ARG A 523  . ? 1_555 ? 
12 AC3 15 ARG C 524  ? ARG A 524  . ? 1_555 ? 
13 AC3 15 ARG C 526  ? ARG A 526  . ? 1_555 ? 
14 AC3 15 ILE C 586  ? ILE A 586  . ? 1_555 ? 
15 AC3 15 SER C 587  ? SER A 587  . ? 1_555 ? 
16 AC3 15 ALA C 588  ? ALA A 588  . ? 1_555 ? 
17 AC3 15 ASP C 590  ? ASP A 590  . ? 1_555 ? 
18 AC3 15 SER C 682  ? SER A 682  . ? 1_555 ? 
19 AC3 15 ASP C 734  ? ASP A 734  . ? 1_555 ? 
20 AC3 15 MN  D .    ? MN  A 1301 . ? 1_555 ? 
21 AC3 15 MN  E .    ? MN  A 1302 . ? 1_555 ? 
22 AC3 15 HOH K .    ? HOH A 1447 . ? 1_555 ? 
23 AC3 15 HOH K .    ? HOH A 1552 . ? 1_555 ? 
24 AC3 15 G   A 5    ? G   B 1276 . ? 1_555 ? 
25 AC3 15 G   B 5    ? G   C 1285 . ? 1_555 ? 
26 AC4 6  LYS C 32   ? LYS A 32   . ? 1_555 ? 
27 AC4 6  SER C 35   ? SER A 35   . ? 1_555 ? 
28 AC4 6  MET C 36   ? MET A 36   . ? 1_555 ? 
29 AC4 6  ARG C 851  ? ARG A 851  . ? 1_555 ? 
30 AC4 6  TYR C 862  ? TYR A 862  . ? 1_555 ? 
31 AC4 6  HOH K .    ? HOH A 1617 . ? 1_555 ? 
32 AC5 9  GLN C 852  ? GLN A 852  . ? 1_555 ? 
33 AC5 9  ARG C 853  ? ARG A 853  . ? 1_555 ? 
34 AC5 9  THR C 854  ? THR A 854  . ? 1_555 ? 
35 AC5 9  MET C 855  ? MET A 855  . ? 1_555 ? 
36 AC5 9  ASP C 1035 ? ASP A 1035 . ? 1_555 ? 
37 AC5 9  HOH K .    ? HOH A 1316 . ? 1_555 ? 
38 AC5 9  HOH K .    ? HOH A 1334 . ? 1_555 ? 
39 AC5 9  HOH K .    ? HOH A 1431 . ? 1_555 ? 
40 AC5 9  HOH K .    ? HOH A 1617 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1N35 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       .000000 
_database_PDB_matrix.origx[1][3]       .000000 
_database_PDB_matrix.origx[2][1]       .000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       .000000 
_database_PDB_matrix.origx[3][1]       .000000 
_database_PDB_matrix.origx[3][2]       .000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   .00000 
_database_PDB_matrix.origx_vector[2]   .00000 
_database_PDB_matrix.origx_vector[3]   .00000 
# 
_atom_sites.entry_id                    1N35 
_atom_sites.fract_transf_matrix[1][1]   .014108 
_atom_sites.fract_transf_matrix[1][2]   .000000 
_atom_sites.fract_transf_matrix[1][3]   .000000 
_atom_sites.fract_transf_matrix[2][1]   .000000 
_atom_sites.fract_transf_matrix[2][2]   .011763 
_atom_sites.fract_transf_matrix[2][3]   .000000 
_atom_sites.fract_transf_matrix[3][1]   .000000 
_atom_sites.fract_transf_matrix[3][2]   .000000 
_atom_sites.fract_transf_matrix[3][3]   .004011 
_atom_sites.fract_transf_vector[1]      .00000 
_atom_sites.fract_transf_vector[2]      .00000 
_atom_sites.fract_transf_vector[3]      .00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  OP3   . G   A 1 1    ? -15.656 81.948  31.355  1.00 128.46 ? 1272 G   B OP3   1 
ATOM   2     P  P     . G   A 1 1    ? -14.815 81.275  32.430  1.00 129.06 ? 1272 G   B P     1 
ATOM   3     O  OP1   . G   A 1 1    ? -14.549 79.805  32.141  1.00 129.01 ? 1272 G   B OP1   1 
ATOM   4     O  OP2   . G   A 1 1    ? -13.541 82.049  32.745  1.00 128.90 ? 1272 G   B OP2   1 
ATOM   5     O  "O5'" . G   A 1 1    ? -15.709 81.300  33.795  1.00 127.74 ? 1272 G   B "O5'" 1 
ATOM   6     C  "C5'" . G   A 1 1    ? -15.288 80.565  34.962  1.00 126.21 ? 1272 G   B "C5'" 1 
ATOM   7     C  "C4'" . G   A 1 1    ? -15.073 81.502  36.131  1.00 125.07 ? 1272 G   B "C4'" 1 
ATOM   8     O  "O4'" . G   A 1 1    ? -14.024 80.943  36.975  1.00 124.35 ? 1272 G   B "O4'" 1 
ATOM   9     C  "C3'" . G   A 1 1    ? -14.573 82.901  35.784  1.00 124.64 ? 1272 G   B "C3'" 1 
ATOM   10    O  "O3'" . G   A 1 1    ? -15.644 83.792  35.464  1.00 124.22 ? 1272 G   B "O3'" 1 
ATOM   11    C  "C2'" . G   A 1 1    ? -13.843 83.296  37.062  1.00 123.92 ? 1272 G   B "C2'" 1 
ATOM   12    O  "O2'" . G   A 1 1    ? -14.724 83.673  38.106  1.00 122.87 ? 1272 G   B "O2'" 1 
ATOM   13    C  "C1'" . G   A 1 1    ? -13.155 81.977  37.418  1.00 123.56 ? 1272 G   B "C1'" 1 
ATOM   14    N  N9    . G   A 1 1    ? -11.869 81.804  36.741  1.00 122.68 ? 1272 G   B N9    1 
ATOM   15    C  C8    . G   A 1 1    ? -11.665 81.290  35.480  1.00 122.06 ? 1272 G   B C8    1 
ATOM   16    N  N7    . G   A 1 1    ? -10.406 81.258  35.134  1.00 121.63 ? 1272 G   B N7    1 
ATOM   17    C  C5    . G   A 1 1    ? -9.732  81.780  36.231  1.00 121.38 ? 1272 G   B C5    1 
ATOM   18    C  C6    . G   A 1 1    ? -8.342  81.991  36.440  1.00 120.83 ? 1272 G   B C6    1 
ATOM   19    O  O6    . G   A 1 1    ? -7.399  81.746  35.675  1.00 120.23 ? 1272 G   B O6    1 
ATOM   20    N  N1    . G   A 1 1    ? -8.093  82.547  37.692  1.00 120.48 ? 1272 G   B N1    1 
ATOM   21    C  C2    . G   A 1 1    ? -9.052  82.860  38.625  1.00 120.41 ? 1272 G   B C2    1 
ATOM   22    N  N2    . G   A 1 1    ? -8.606  83.397  39.770  1.00 119.52 ? 1272 G   B N2    1 
ATOM   23    N  N3    . G   A 1 1    ? -10.352 82.663  38.446  1.00 120.89 ? 1272 G   B N3    1 
ATOM   24    C  C4    . G   A 1 1    ? -10.619 82.124  37.234  1.00 121.85 ? 1272 G   B C4    1 
ATOM   25    P  P     . G   A 1 2    ? -15.378 85.047  34.485  1.00 123.46 ? 1273 G   B P     1 
ATOM   26    O  OP1   . G   A 1 2    ? -16.680 85.736  34.284  1.00 123.21 ? 1273 G   B OP1   1 
ATOM   27    O  OP2   . G   A 1 2    ? -14.610 84.578  33.302  1.00 123.09 ? 1273 G   B OP2   1 
ATOM   28    O  "O5'" . G   A 1 2    ? -14.432 86.008  35.338  1.00 123.63 ? 1273 G   B "O5'" 1 
ATOM   29    C  "C5'" . G   A 1 2    ? -14.847 86.507  36.610  1.00 123.64 ? 1273 G   B "C5'" 1 
ATOM   30    C  "C4'" . G   A 1 2    ? -13.701 87.212  37.307  1.00 123.53 ? 1273 G   B "C4'" 1 
ATOM   31    O  "O4'" . G   A 1 2    ? -12.636 86.263  37.580  1.00 123.46 ? 1273 G   B "O4'" 1 
ATOM   32    C  "C3'" . G   A 1 2    ? -13.024 88.330  36.528  1.00 123.47 ? 1273 G   B "C3'" 1 
ATOM   33    O  "O3'" . G   A 1 2    ? -13.742 89.553  36.683  1.00 123.77 ? 1273 G   B "O3'" 1 
ATOM   34    C  "C2'" . G   A 1 2    ? -11.650 88.394  37.191  1.00 123.33 ? 1273 G   B "C2'" 1 
ATOM   35    O  "O2'" . G   A 1 2    ? -11.654 89.121  38.404  1.00 122.79 ? 1273 G   B "O2'" 1 
ATOM   36    C  "C1'" . G   A 1 2    ? -11.379 86.915  37.486  1.00 123.44 ? 1273 G   B "C1'" 1 
ATOM   37    N  N9    . G   A 1 2    ? -10.585 86.235  36.464  1.00 123.83 ? 1273 G   B N9    1 
ATOM   38    C  C8    . G   A 1 2    ? -11.044 85.371  35.496  1.00 123.88 ? 1273 G   B C8    1 
ATOM   39    N  N7    . G   A 1 2    ? -10.094 84.909  34.727  1.00 123.83 ? 1273 G   B N7    1 
ATOM   40    C  C5    . G   A 1 2    ? -8.936  85.505  35.212  1.00 123.85 ? 1273 G   B C5    1 
ATOM   41    C  C6    . G   A 1 2    ? -7.583  85.385  34.778  1.00 123.75 ? 1273 G   B C6    1 
ATOM   42    O  O6    . G   A 1 2    ? -7.125  84.699  33.850  1.00 123.29 ? 1273 G   B O6    1 
ATOM   43    N  N1    . G   A 1 2    ? -6.729  86.169  35.550  1.00 123.54 ? 1273 G   B N1    1 
ATOM   44    C  C2    . G   A 1 2    ? -7.118  86.964  36.604  1.00 123.39 ? 1273 G   B C2    1 
ATOM   45    N  N2    . G   A 1 2    ? -6.143  87.650  37.223  1.00 123.09 ? 1273 G   B N2    1 
ATOM   46    N  N3    . G   A 1 2    ? -8.371  87.081  37.020  1.00 123.63 ? 1273 G   B N3    1 
ATOM   47    C  C4    . G   A 1 2    ? -9.221  86.329  36.284  1.00 123.87 ? 1273 G   B C4    1 
ATOM   48    P  P     . G   A 1 3    ? -14.010 90.496  35.405  1.00 124.20 ? 1274 G   B P     1 
ATOM   49    O  OP1   . G   A 1 3    ? -14.957 91.558  35.840  1.00 123.54 ? 1274 G   B OP1   1 
ATOM   50    O  OP2   . G   A 1 3    ? -14.356 89.639  34.239  1.00 123.76 ? 1274 G   B OP2   1 
ATOM   51    O  "O5'" . G   A 1 3    ? -12.596 91.180  35.128  1.00 123.80 ? 1274 G   B "O5'" 1 
ATOM   52    C  "C5'" . G   A 1 3    ? -12.125 92.238  35.957  1.00 123.76 ? 1274 G   B "C5'" 1 
ATOM   53    C  "C4'" . G   A 1 3    ? -10.776 92.723  35.478  1.00 123.80 ? 1274 G   B "C4'" 1 
ATOM   54    O  "O4'" . G   A 1 3    ? -9.792  91.669  35.649  1.00 123.91 ? 1274 G   B "O4'" 1 
ATOM   55    C  "C3'" . G   A 1 3    ? -10.686 93.081  34.003  1.00 123.86 ? 1274 G   B "C3'" 1 
ATOM   56    O  "O3'" . G   A 1 3    ? -11.156 94.405  33.762  1.00 123.96 ? 1274 G   B "O3'" 1 
ATOM   57    C  "C2'" . G   A 1 3    ? -9.191  92.948  33.739  1.00 123.87 ? 1274 G   B "C2'" 1 
ATOM   58    O  "O2'" . G   A 1 3    ? -8.450  94.074  34.170  1.00 123.63 ? 1274 G   B "O2'" 1 
ATOM   59    C  "C1'" . G   A 1 3    ? -8.840  91.729  34.598  1.00 123.69 ? 1274 G   B "C1'" 1 
ATOM   60    N  N9    . G   A 1 3    ? -8.896  90.472  33.855  1.00 123.44 ? 1274 G   B N9    1 
ATOM   61    C  C8    . G   A 1 3    ? -9.965  89.612  33.760  1.00 123.09 ? 1274 G   B C8    1 
ATOM   62    N  N7    . G   A 1 3    ? -9.717  88.565  33.020  1.00 123.11 ? 1274 G   B N7    1 
ATOM   63    C  C5    . G   A 1 3    ? -8.404  88.739  32.602  1.00 123.07 ? 1274 G   B C5    1 
ATOM   64    C  C6    . G   A 1 3    ? -7.580  87.921  31.776  1.00 122.77 ? 1274 G   B C6    1 
ATOM   65    O  O6    . G   A 1 3    ? -7.854  86.841  31.236  1.00 122.86 ? 1274 G   B O6    1 
ATOM   66    N  N1    . G   A 1 3    ? -6.317  88.479  31.604  1.00 122.51 ? 1274 G   B N1    1 
ATOM   67    C  C2    . G   A 1 3    ? -5.894  89.665  32.152  1.00 122.52 ? 1274 G   B C2    1 
ATOM   68    N  N2    . G   A 1 3    ? -4.637  90.033  31.862  1.00 122.01 ? 1274 G   B N2    1 
ATOM   69    N  N3    . G   A 1 3    ? -6.647  90.433  32.926  1.00 122.81 ? 1274 G   B N3    1 
ATOM   70    C  C4    . G   A 1 3    ? -7.881  89.913  33.107  1.00 123.15 ? 1274 G   B C4    1 
ATOM   71    P  P     . G   A 1 4    ? -11.549 94.854  32.266  1.00 124.12 ? 1275 G   B P     1 
ATOM   72    O  OP1   . G   A 1 4    ? -12.587 95.912  32.381  1.00 123.98 ? 1275 G   B OP1   1 
ATOM   73    O  OP2   . G   A 1 4    ? -11.829 93.636  31.462  1.00 123.84 ? 1275 G   B OP2   1 
ATOM   74    O  "O5'" . G   A 1 4    ? -10.217 95.527  31.708  1.00 122.78 ? 1275 G   B "O5'" 1 
ATOM   75    C  "C5'" . G   A 1 4    ? -9.842  95.387  30.342  1.00 120.85 ? 1275 G   B "C5'" 1 
ATOM   76    C  "C4'" . G   A 1 4    ? -8.377  95.043  30.246  1.00 119.74 ? 1275 G   B "C4'" 1 
ATOM   77    O  "O4'" . G   A 1 4    ? -8.134  93.808  30.978  1.00 119.77 ? 1275 G   B "O4'" 1 
ATOM   78    C  "C3'" . G   A 1 4    ? -7.855  94.739  28.852  1.00 118.79 ? 1275 G   B "C3'" 1 
ATOM   79    O  "O3'" . G   A 1 4    ? -7.552  95.924  28.124  1.00 116.37 ? 1275 G   B "O3'" 1 
ATOM   80    C  "C2'" . G   A 1 4    ? -6.613  93.923  29.175  1.00 119.22 ? 1275 G   B "C2'" 1 
ATOM   81    O  "O2'" . G   A 1 4    ? -5.566  94.729  29.675  1.00 119.11 ? 1275 G   B "O2'" 1 
ATOM   82    C  "C1'" . G   A 1 4    ? -7.134  93.047  30.313  1.00 119.45 ? 1275 G   B "C1'" 1 
ATOM   83    N  N9    . G   A 1 4    ? -7.735  91.804  29.830  1.00 119.39 ? 1275 G   B N9    1 
ATOM   84    C  C8    . G   A 1 4    ? -9.056  91.426  29.909  1.00 119.17 ? 1275 G   B C8    1 
ATOM   85    N  N7    . G   A 1 4    ? -9.287  90.251  29.385  1.00 118.83 ? 1275 G   B N7    1 
ATOM   86    C  C5    . G   A 1 4    ? -8.044  89.825  28.931  1.00 118.46 ? 1275 G   B C5    1 
ATOM   87    C  C6    . G   A 1 4    ? -7.663  88.620  28.273  1.00 117.70 ? 1275 G   B C6    1 
ATOM   88    O  O6    . G   A 1 4    ? -8.371  87.653  27.955  1.00 116.33 ? 1275 G   B O6    1 
ATOM   89    N  N1    . G   A 1 4    ? -6.301  88.605  27.988  1.00 117.66 ? 1275 G   B N1    1 
ATOM   90    C  C2    . G   A 1 4    ? -5.416  89.613  28.295  1.00 117.73 ? 1275 G   B C2    1 
ATOM   91    N  N2    . G   A 1 4    ? -4.142  89.415  27.933  1.00 117.54 ? 1275 G   B N2    1 
ATOM   92    N  N3    . G   A 1 4    ? -5.755  90.733  28.912  1.00 118.07 ? 1275 G   B N3    1 
ATOM   93    C  C4    . G   A 1 4    ? -7.075  90.773  29.197  1.00 118.80 ? 1275 G   B C4    1 
ATOM   94    P  P     . G   A 1 5    ? -8.247  96.170  26.696  1.00 114.56 ? 1276 G   B P     1 
ATOM   95    O  OP1   . G   A 1 5    ? -8.696  97.588  26.660  1.00 114.12 ? 1276 G   B OP1   1 
ATOM   96    O  OP2   . G   A 1 5    ? -9.233  95.078  26.479  1.00 114.00 ? 1276 G   B OP2   1 
ATOM   97    O  "O5'" . G   A 1 5    ? -7.078  95.980  25.629  1.00 112.33 ? 1276 G   B "O5'" 1 
ATOM   98    C  "C5'" . G   A 1 5    ? -7.386  95.681  24.269  1.00 109.27 ? 1276 G   B "C5'" 1 
ATOM   99    C  "C4'" . G   A 1 5    ? -6.157  95.197  23.539  1.00 107.49 ? 1276 G   B "C4'" 1 
ATOM   100   O  "O4'" . G   A 1 5    ? -5.435  94.253  24.371  1.00 107.09 ? 1276 G   B "O4'" 1 
ATOM   101   C  "C3'" . G   A 1 5    ? -6.463  94.444  22.255  1.00 106.90 ? 1276 G   B "C3'" 1 
ATOM   102   O  "O3'" . G   A 1 5    ? -6.712  95.314  21.146  1.00 105.97 ? 1276 G   B "O3'" 1 
ATOM   103   C  "C2'" . G   A 1 5    ? -5.264  93.515  22.112  1.00 106.60 ? 1276 G   B "C2'" 1 
ATOM   104   O  "O2'" . G   A 1 5    ? -4.152  94.152  21.520  1.00 105.47 ? 1276 G   B "O2'" 1 
ATOM   105   C  "C1'" . G   A 1 5    ? -4.961  93.179  23.577  1.00 106.83 ? 1276 G   B "C1'" 1 
ATOM   106   N  N9    . G   A 1 5    ? -5.582  91.952  24.075  1.00 107.05 ? 1276 G   B N9    1 
ATOM   107   C  C8    . G   A 1 5    ? -6.235  91.791  25.277  1.00 106.68 ? 1276 G   B C8    1 
ATOM   108   N  N7    . G   A 1 5    ? -6.686  90.579  25.460  1.00 105.96 ? 1276 G   B N7    1 
ATOM   109   C  C5    . G   A 1 5    ? -6.311  89.895  24.311  1.00 106.11 ? 1276 G   B C5    1 
ATOM   110   C  C6    . G   A 1 5    ? -6.526  88.542  23.937  1.00 105.60 ? 1276 G   B C6    1 
ATOM   111   O  O6    . G   A 1 5    ? -7.114  87.654  24.563  1.00 105.65 ? 1276 G   B O6    1 
ATOM   112   N  N1    . G   A 1 5    ? -5.974  88.264  22.692  1.00 105.27 ? 1276 G   B N1    1 
ATOM   113   C  C2    . G   A 1 5    ? -5.303  89.169  21.903  1.00 105.65 ? 1276 G   B C2    1 
ATOM   114   N  N2    . G   A 1 5    ? -4.833  88.702  20.739  1.00 105.31 ? 1276 G   B N2    1 
ATOM   115   N  N3    . G   A 1 5    ? -5.104  90.436  22.234  1.00 106.25 ? 1276 G   B N3    1 
ATOM   116   C  C4    . G   A 1 5    ? -5.628  90.728  23.444  1.00 106.74 ? 1276 G   B C4    1 
ATOM   117   P  P     . U   B 2 3    ? -21.083 71.508  18.918  1.00 71.05  ? 1283 U   C P     1 
ATOM   118   O  OP1   . U   B 2 3    ? -22.134 71.144  17.872  1.00 69.24  ? 1283 U   C OP1   1 
ATOM   119   O  OP2   . U   B 2 3    ? -21.520 71.183  20.342  1.00 69.69  ? 1283 U   C OP2   1 
ATOM   120   O  "O5'" . U   B 2 3    ? -20.954 73.129  18.841  1.00 69.58  ? 1283 U   C "O5'" 1 
ATOM   121   C  "C5'" . U   B 2 3    ? -20.687 73.772  17.586  1.00 67.19  ? 1283 U   C "C5'" 1 
ATOM   122   C  "C4'" . U   B 2 3    ? -20.650 75.270  17.758  1.00 65.95  ? 1283 U   C "C4'" 1 
ATOM   123   O  "O4'" . U   B 2 3    ? -21.950 75.766  18.182  1.00 66.20  ? 1283 U   C "O4'" 1 
ATOM   124   C  "C3'" . U   B 2 3    ? -19.709 75.798  18.824  1.00 64.24  ? 1283 U   C "C3'" 1 
ATOM   125   O  "O3'" . U   B 2 3    ? -18.367 75.833  18.358  1.00 59.30  ? 1283 U   C "O3'" 1 
ATOM   126   C  "C2'" . U   B 2 3    ? -20.267 77.197  19.038  1.00 65.86  ? 1283 U   C "C2'" 1 
ATOM   127   O  "O2'" . U   B 2 3    ? -19.892 78.060  17.981  1.00 65.92  ? 1283 U   C "O2'" 1 
ATOM   128   C  "C1'" . U   B 2 3    ? -21.775 76.928  18.984  1.00 67.18  ? 1283 U   C "C1'" 1 
ATOM   129   N  N1    . U   B 2 3    ? -22.354 76.665  20.311  1.00 69.58  ? 1283 U   C N1    1 
ATOM   130   C  C2    . U   B 2 3    ? -22.683 77.752  21.117  1.00 71.38  ? 1283 U   C C2    1 
ATOM   131   O  O2    . U   B 2 3    ? -22.541 78.916  20.764  1.00 71.00  ? 1283 U   C O2    1 
ATOM   132   N  N3    . U   B 2 3    ? -23.187 77.423  22.352  1.00 71.91  ? 1283 U   C N3    1 
ATOM   133   C  C4    . U   B 2 3    ? -23.396 76.152  22.854  1.00 72.21  ? 1283 U   C C4    1 
ATOM   134   O  O4    . U   B 2 3    ? -23.809 76.014  24.010  1.00 74.21  ? 1283 U   C O4    1 
ATOM   135   C  C5    . U   B 2 3    ? -23.049 75.090  21.957  1.00 71.66  ? 1283 U   C C5    1 
ATOM   136   C  C6    . U   B 2 3    ? -22.554 75.375  20.750  1.00 70.75  ? 1283 U   C C6    1 
ATOM   137   P  P     . A   B 2 4    ? -17.160 75.675  19.406  1.00 54.69  ? 1284 A   C P     1 
ATOM   138   O  OP1   . A   B 2 4    ? -15.900 75.649  18.626  1.00 55.43  ? 1284 A   C OP1   1 
ATOM   139   O  OP2   . A   B 2 4    ? -17.480 74.543  20.308  1.00 56.89  ? 1284 A   C OP2   1 
ATOM   140   O  "O5'" . A   B 2 4    ? -17.221 77.020  20.261  1.00 54.23  ? 1284 A   C "O5'" 1 
ATOM   141   C  "C5'" . A   B 2 4    ? -16.803 78.263  19.694  1.00 52.85  ? 1284 A   C "C5'" 1 
ATOM   142   C  "C4'" . A   B 2 4    ? -17.110 79.414  20.629  1.00 51.42  ? 1284 A   C "C4'" 1 
ATOM   143   O  "O4'" . A   B 2 4    ? -18.550 79.540  20.792  1.00 52.57  ? 1284 A   C "O4'" 1 
ATOM   144   C  "C3'" . A   B 2 4    ? -16.568 79.311  22.049  1.00 48.58  ? 1284 A   C "C3'" 1 
ATOM   145   O  "O3'" . A   B 2 4    ? -15.224 79.778  22.130  1.00 42.91  ? 1284 A   C "O3'" 1 
ATOM   146   C  "C2'" . A   B 2 4    ? -17.518 80.229  22.801  1.00 50.19  ? 1284 A   C "C2'" 1 
ATOM   147   O  "O2'" . A   B 2 4    ? -17.223 81.589  22.575  1.00 49.44  ? 1284 A   C "O2'" 1 
ATOM   148   C  "C1'" . A   B 2 4    ? -18.849 79.878  22.137  1.00 54.17  ? 1284 A   C "C1'" 1 
ATOM   149   N  N9    . A   B 2 4    ? -19.451 78.704  22.763  1.00 59.28  ? 1284 A   C N9    1 
ATOM   150   C  C8    . A   B 2 4    ? -19.366 77.395  22.341  1.00 60.69  ? 1284 A   C C8    1 
ATOM   151   N  N7    . A   B 2 4    ? -19.977 76.545  23.129  1.00 62.56  ? 1284 A   C N7    1 
ATOM   152   C  C5    . A   B 2 4    ? -20.507 77.345  24.134  1.00 63.20  ? 1284 A   C C5    1 
ATOM   153   C  C6    . A   B 2 4    ? -21.266 77.045  25.282  1.00 64.09  ? 1284 A   C C6    1 
ATOM   154   N  N6    . A   B 2 4    ? -21.636 75.805  25.624  1.00 63.18  ? 1284 A   C N6    1 
ATOM   155   N  N1    . A   B 2 4    ? -21.638 78.076  26.076  1.00 64.60  ? 1284 A   C N1    1 
ATOM   156   C  C2    . A   B 2 4    ? -21.265 79.318  25.730  1.00 64.28  ? 1284 A   C C2    1 
ATOM   157   N  N3    . A   B 2 4    ? -20.552 79.726  24.679  1.00 62.97  ? 1284 A   C N3    1 
ATOM   158   C  C4    . A   B 2 4    ? -20.200 78.679  23.913  1.00 61.74  ? 1284 A   C C4    1 
ATOM   159   P  P     . G   B 2 5    ? -14.264 79.249  23.310  1.00 37.65  ? 1285 G   C P     1 
ATOM   160   O  OP1   . G   B 2 5    ? -14.749 77.897  23.700  1.00 38.05  ? 1285 G   C OP1   1 
ATOM   161   O  OP2   . G   B 2 5    ? -14.152 80.312  24.341  1.00 35.00  ? 1285 G   C OP2   1 
ATOM   162   O  "O5'" . G   B 2 5    ? -12.847 79.098  22.600  1.00 34.63  ? 1285 G   C "O5'" 1 
ATOM   163   C  "C5'" . G   B 2 5    ? -12.640 78.106  21.599  1.00 34.25  ? 1285 G   C "C5'" 1 
ATOM   164   C  "C4'" . G   B 2 5    ? -11.533 78.524  20.660  1.00 34.12  ? 1285 G   C "C4'" 1 
ATOM   165   O  "O4'" . G   B 2 5    ? -11.970 79.637  19.836  1.00 35.09  ? 1285 G   C "O4'" 1 
ATOM   166   C  "C3'" . G   B 2 5    ? -10.274 79.025  21.341  1.00 33.00  ? 1285 G   C "C3'" 1 
ATOM   167   O  "O3'" . G   B 2 5    ? -9.428  77.950  21.696  1.00 32.05  ? 1285 G   C "O3'" 1 
ATOM   168   C  "C2'" . G   B 2 5    ? -9.672  79.928  20.277  1.00 32.81  ? 1285 G   C "C2'" 1 
ATOM   169   O  "O2'" . G   B 2 5    ? -9.050  79.220  19.230  1.00 32.24  ? 1285 G   C "O2'" 1 
ATOM   170   C  "C1'" . G   B 2 5    ? -10.930 80.595  19.738  1.00 34.23  ? 1285 G   C "C1'" 1 
ATOM   171   N  N9    . G   B 2 5    ? -11.321 81.730  20.558  1.00 34.62  ? 1285 G   C N9    1 
ATOM   172   C  C8    . G   B 2 5    ? -12.353 81.767  21.464  1.00 34.58  ? 1285 G   C C8    1 
ATOM   173   N  N7    . G   B 2 5    ? -12.488 82.927  22.040  1.00 34.59  ? 1285 G   C N7    1 
ATOM   174   C  C5    . G   B 2 5    ? -11.484 83.703  21.483  1.00 35.55  ? 1285 G   C C5    1 
ATOM   175   C  C6    . G   B 2 5    ? -11.151 85.050  21.711  1.00 36.54  ? 1285 G   C C6    1 
ATOM   176   O  O6    . G   B 2 5    ? -11.701 85.855  22.474  1.00 38.54  ? 1285 G   C O6    1 
ATOM   177   N  N1    . G   B 2 5    ? -10.053 85.445  20.946  1.00 39.00  ? 1285 G   C N1    1 
ATOM   178   C  C2    . G   B 2 5    ? -9.362  84.630  20.073  1.00 38.88  ? 1285 G   C C2    1 
ATOM   179   N  N2    . G   B 2 5    ? -8.300  85.187  19.458  1.00 38.75  ? 1285 G   C N2    1 
ATOM   180   N  N3    . G   B 2 5    ? -9.683  83.362  19.835  1.00 34.63  ? 1285 G   C N3    1 
ATOM   181   C  C4    . G   B 2 5    ? -10.745 82.971  20.572  1.00 34.66  ? 1285 G   C C4    1 
ATOM   182   P  P     . C   B 2 6    ? -8.354  78.154  22.859  1.00 27.97  ? 1286 C   C P     1 
ATOM   183   O  OP1   . C   B 2 6    ? -7.656  76.872  23.093  1.00 32.82  ? 1286 C   C OP1   1 
ATOM   184   O  OP2   . C   B 2 6    ? -9.039  78.825  23.984  1.00 33.87  ? 1286 C   C OP2   1 
ATOM   185   O  "O5'" . C   B 2 6    ? -7.326  79.189  22.225  1.00 34.39  ? 1286 C   C "O5'" 1 
ATOM   186   C  "C5'" . C   B 2 6    ? -6.433  78.796  21.190  1.00 35.43  ? 1286 C   C "C5'" 1 
ATOM   187   C  "C4'" . C   B 2 6    ? -5.480  79.923  20.865  1.00 40.06  ? 1286 C   C "C4'" 1 
ATOM   188   O  "O4'" . C   B 2 6    ? -6.229  81.056  20.348  1.00 38.21  ? 1286 C   C "O4'" 1 
ATOM   189   C  "C3'" . C   B 2 6    ? -4.708  80.508  22.036  1.00 42.56  ? 1286 C   C "C3'" 1 
ATOM   190   O  "O3'" . C   B 2 6    ? -3.556  79.734  22.336  1.00 50.54  ? 1286 C   C "O3'" 1 
ATOM   191   C  "C2'" . C   B 2 6    ? -4.331  81.878  21.492  1.00 41.14  ? 1286 C   C "C2'" 1 
ATOM   192   O  "O2'" . C   B 2 6    ? -3.279  81.812  20.549  1.00 40.49  ? 1286 C   C "O2'" 1 
ATOM   193   C  "C1'" . C   B 2 6    ? -5.618  82.267  20.771  1.00 38.95  ? 1286 C   C "C1'" 1 
ATOM   194   N  N1    . C   B 2 6    ? -6.562  82.990  21.643  1.00 39.45  ? 1286 C   C N1    1 
ATOM   195   C  C2    . C   B 2 6    ? -6.439  84.388  21.763  1.00 38.88  ? 1286 C   C C2    1 
ATOM   196   O  O2    . C   B 2 6    ? -5.541  84.967  21.137  1.00 40.15  ? 1286 C   C O2    1 
ATOM   197   N  N3    . C   B 2 6    ? -7.302  85.063  22.559  1.00 38.49  ? 1286 C   C N3    1 
ATOM   198   C  C4    . C   B 2 6    ? -8.257  84.399  23.227  1.00 37.99  ? 1286 C   C C4    1 
ATOM   199   N  N4    . C   B 2 6    ? -9.081  85.105  24.005  1.00 34.32  ? 1286 C   C N4    1 
ATOM   200   C  C5    . C   B 2 6    ? -8.405  82.979  23.125  1.00 36.73  ? 1286 C   C C5    1 
ATOM   201   C  C6    . C   B 2 6    ? -7.544  82.322  22.329  1.00 37.61  ? 1286 C   C C6    1 
ATOM   202   P  P     . C   B 2 7    ? -2.813  79.931  23.749  1.00 56.04  ? 1287 C   C P     1 
ATOM   203   O  OP1   . C   B 2 7    ? -1.605  79.067  23.723  1.00 56.25  ? 1287 C   C OP1   1 
ATOM   204   O  OP2   . C   B 2 7    ? -3.805  79.777  24.839  1.00 55.41  ? 1287 C   C OP2   1 
ATOM   205   O  "O5'" . C   B 2 7    ? -2.338  81.451  23.734  1.00 62.98  ? 1287 C   C "O5'" 1 
ATOM   206   C  "C5'" . C   B 2 7    ? -1.179  81.858  23.010  1.00 73.20  ? 1287 C   C "C5'" 1 
ATOM   207   C  "C4'" . C   B 2 7    ? -0.783  83.257  23.420  1.00 80.63  ? 1287 C   C "C4'" 1 
ATOM   208   O  "O4'" . C   B 2 7    ? -1.852  84.179  23.066  1.00 82.75  ? 1287 C   C "O4'" 1 
ATOM   209   C  "C3'" . C   B 2 7    ? -0.600  83.452  24.916  1.00 85.36  ? 1287 C   C "C3'" 1 
ATOM   210   O  "O3'" . C   B 2 7    ? 0.707   83.060  25.328  1.00 91.77  ? 1287 C   C "O3'" 1 
ATOM   211   C  "C2'" . C   B 2 7    ? -0.864  84.944  25.080  1.00 84.76  ? 1287 C   C "C2'" 1 
ATOM   212   O  "O2'" . C   B 2 7    ? 0.236   85.743  24.692  1.00 85.28  ? 1287 C   C "O2'" 1 
ATOM   213   C  "C1'" . C   B 2 7    ? -2.012  85.149  24.091  1.00 83.71  ? 1287 C   C "C1'" 1 
ATOM   214   N  N1    . C   B 2 7    ? -3.346  84.967  24.696  1.00 82.95  ? 1287 C   C N1    1 
ATOM   215   C  C2    . C   B 2 7    ? -3.991  86.077  25.253  1.00 82.92  ? 1287 C   C C2    1 
ATOM   216   O  O2    . C   B 2 7    ? -3.432  87.181  25.204  1.00 84.03  ? 1287 C   C O2    1 
ATOM   217   N  N3    . C   B 2 7    ? -5.206  85.918  25.827  1.00 82.01  ? 1287 C   C N3    1 
ATOM   218   C  C4    . C   B 2 7    ? -5.778  84.712  25.853  1.00 81.67  ? 1287 C   C C4    1 
ATOM   219   N  N4    . C   B 2 7    ? -6.973  84.602  26.436  1.00 82.03  ? 1287 C   C N4    1 
ATOM   220   C  C5    . C   B 2 7    ? -5.149  83.566  25.284  1.00 81.46  ? 1287 C   C C5    1 
ATOM   221   C  C6    . C   B 2 7    ? -3.945  83.737  24.722  1.00 81.86  ? 1287 C   C C6    1 
ATOM   222   P  P     . C   B 2 8    ? 0.984   82.708  26.873  1.00 96.63  ? 1288 C   C P     1 
ATOM   223   O  OP1   . C   B 2 8    ? 2.092   81.717  26.903  1.00 96.12  ? 1288 C   C OP1   1 
ATOM   224   O  OP2   . C   B 2 8    ? -0.315  82.374  27.516  1.00 96.24  ? 1288 C   C OP2   1 
ATOM   225   O  "O5'" . C   B 2 8    ? 1.513   84.088  27.478  1.00 100.25 ? 1288 C   C "O5'" 1 
ATOM   226   C  "C5'" . C   B 2 8    ? 1.347   84.408  28.859  1.00 105.22 ? 1288 C   C "C5'" 1 
ATOM   227   C  "C4'" . C   B 2 8    ? 1.094   85.893  29.025  1.00 108.97 ? 1288 C   C "C4'" 1 
ATOM   228   O  "O4'" . C   B 2 8    ? -0.058  86.268  28.218  1.00 108.90 ? 1288 C   C "O4'" 1 
ATOM   229   C  "C3'" . C   B 2 8    ? 0.741   86.339  30.439  1.00 111.67 ? 1288 C   C "C3'" 1 
ATOM   230   O  "O3'" . C   B 2 8    ? 1.908   86.604  31.219  1.00 116.46 ? 1288 C   C "O3'" 1 
ATOM   231   C  "C2'" . C   B 2 8    ? -0.086  87.594  30.181  1.00 110.70 ? 1288 C   C "C2'" 1 
ATOM   232   O  "O2'" . C   B 2 8    ? 0.696   88.734  29.883  1.00 110.10 ? 1288 C   C "O2'" 1 
ATOM   233   C  "C1'" . C   B 2 8    ? -0.878  87.172  28.941  1.00 109.58 ? 1288 C   C "C1'" 1 
ATOM   234   N  N1    . C   B 2 8    ? -2.139  86.481  29.272  1.00 108.77 ? 1288 C   C N1    1 
ATOM   235   C  C2    . C   B 2 8    ? -3.171  87.209  29.876  1.00 108.01 ? 1288 C   C C2    1 
ATOM   236   O  O2    . C   B 2 8    ? -2.996  88.416  30.114  1.00 108.38 ? 1288 C   C O2    1 
ATOM   237   N  N3    . C   B 2 8    ? -4.329  86.580  30.187  1.00 107.22 ? 1288 C   C N3    1 
ATOM   238   C  C4    . C   B 2 8    ? -4.477  85.281  29.917  1.00 106.37 ? 1288 C   C C4    1 
ATOM   239   N  N4    . C   B 2 8    ? -5.636  84.705  30.243  1.00 105.83 ? 1288 C   C N4    1 
ATOM   240   C  C5    . C   B 2 8    ? -3.445  84.517  29.301  1.00 106.50 ? 1288 C   C C5    1 
ATOM   241   C  C6    . C   B 2 8    ? -2.304  85.150  28.997  1.00 107.93 ? 1288 C   C C6    1 
ATOM   242   P  P     . C   B 2 9    ? 2.070   85.926  32.673  1.00 119.87 ? 1289 C   C P     1 
ATOM   243   O  OP1   . C   B 2 9    ? 3.528   85.841  32.957  1.00 119.87 ? 1289 C   C OP1   1 
ATOM   244   O  OP2   . C   B 2 9    ? 1.242   84.690  32.705  1.00 119.25 ? 1289 C   C OP2   1 
ATOM   245   O  "O5'" . C   B 2 9    ? 1.430   86.980  33.688  1.00 122.13 ? 1289 C   C "O5'" 1 
ATOM   246   C  "C5'" . C   B 2 9    ? 2.231   87.982  34.325  1.00 125.18 ? 1289 C   C "C5'" 1 
ATOM   247   C  "C4'" . C   B 2 9    ? 1.422   88.719  35.377  1.00 127.56 ? 1289 C   C "C4'" 1 
ATOM   248   O  "O4'" . C   B 2 9    ? 0.285   89.364  34.738  1.00 128.05 ? 1289 C   C "O4'" 1 
ATOM   249   C  "C3'" . C   B 2 9    ? 0.816   87.865  36.488  1.00 129.03 ? 1289 C   C "C3'" 1 
ATOM   250   O  "O3'" . C   B 2 9    ? 1.746   87.682  37.563  1.00 131.12 ? 1289 C   C "O3'" 1 
ATOM   251   C  "C2'" . C   B 2 9    ? -0.387  88.699  36.929  1.00 128.55 ? 1289 C   C "C2'" 1 
ATOM   252   O  "O2'" . C   B 2 9    ? -0.057  89.715  37.855  1.00 127.94 ? 1289 C   C "O2'" 1 
ATOM   253   C  "C1'" . C   B 2 9    ? -0.836  89.331  35.607  1.00 128.37 ? 1289 C   C "C1'" 1 
ATOM   254   N  N1    . C   B 2 9    ? -1.925  88.595  34.938  1.00 128.63 ? 1289 C   C N1    1 
ATOM   255   C  C2    . C   B 2 9    ? -3.210  88.637  35.493  1.00 128.71 ? 1289 C   C C2    1 
ATOM   256   O  O2    . C   B 2 9    ? -3.397  89.303  36.524  1.00 128.62 ? 1289 C   C O2    1 
ATOM   257   N  N3    . C   B 2 9    ? -4.213  87.953  34.893  1.00 128.72 ? 1289 C   C N3    1 
ATOM   258   C  C4    . C   B 2 9    ? -3.970  87.250  33.783  1.00 128.78 ? 1289 C   C C4    1 
ATOM   259   N  N4    . C   B 2 9    ? -4.986  86.584  33.227  1.00 128.73 ? 1289 C   C N4    1 
ATOM   260   C  C5    . C   B 2 9    ? -2.673  87.196  33.193  1.00 128.63 ? 1289 C   C C5    1 
ATOM   261   C  C6    . C   B 2 9    ? -1.690  87.877  33.797  1.00 128.71 ? 1289 C   C C6    1 
ATOM   262   P  P     . C   B 2 10   ? 1.692   86.343  38.468  1.00 132.73 ? 1290 C   C P     1 
ATOM   263   O  OP1   . C   B 2 10   ? 2.842   86.382  39.413  1.00 132.07 ? 1290 C   C OP1   1 
ATOM   264   O  OP2   . C   B 2 10   ? 1.526   85.171  37.567  1.00 132.50 ? 1290 C   C OP2   1 
ATOM   265   O  "O5'" . C   B 2 10   ? 0.356   86.494  39.328  1.00 133.00 ? 1290 C   C "O5'" 1 
ATOM   266   C  "C5'" . C   B 2 10   ? 0.246   87.472  40.364  1.00 133.06 ? 1290 C   C "C5'" 1 
ATOM   267   C  "C4'" . C   B 2 10   ? -1.035  87.263  41.141  1.00 133.12 ? 1290 C   C "C4'" 1 
ATOM   268   O  "O4'" . C   B 2 10   ? -2.153  87.293  40.212  1.00 133.16 ? 1290 C   C "O4'" 1 
ATOM   269   C  "C3'" . C   B 2 10   ? -1.167  85.915  41.834  1.00 133.13 ? 1290 C   C "C3'" 1 
ATOM   270   O  "O3'" . C   B 2 10   ? -0.474  85.844  43.087  1.00 132.51 ? 1290 C   C "O3'" 1 
ATOM   271   C  "C2'" . C   B 2 10   ? -2.677  85.753  41.946  1.00 133.08 ? 1290 C   C "C2'" 1 
ATOM   272   O  "O2'" . C   B 2 10   ? -3.223  86.481  43.029  1.00 132.56 ? 1290 C   C "O2'" 1 
ATOM   273   C  "C1'" . C   B 2 10   ? -3.142  86.356  40.615  1.00 133.11 ? 1290 C   C "C1'" 1 
ATOM   274   N  N1    . C   B 2 10   ? -3.300  85.365  39.534  1.00 133.08 ? 1290 C   C N1    1 
ATOM   275   C  C2    . C   B 2 10   ? -4.563  84.797  39.313  1.00 133.15 ? 1290 C   C C2    1 
ATOM   276   O  O2    . C   B 2 10   ? -5.513  85.140  40.036  1.00 133.00 ? 1290 C   C O2    1 
ATOM   277   N  N3    . C   B 2 10   ? -4.715  83.890  38.316  1.00 133.26 ? 1290 C   C N3    1 
ATOM   278   C  C4    . C   B 2 10   ? -3.667  83.548  37.559  1.00 133.05 ? 1290 C   C C4    1 
ATOM   279   N  N4    . C   B 2 10   ? -3.864  82.657  36.582  1.00 132.75 ? 1290 C   C N4    1 
ATOM   280   C  C5    . C   B 2 10   ? -2.372  84.107  37.767  1.00 132.80 ? 1290 C   C C5    1 
ATOM   281   C  C6    . C   B 2 10   ? -2.235  85.003  38.755  1.00 132.79 ? 1290 C   C C6    1 
ATOM   282   N  N     . SER C 3 2    ? -33.649 110.243 51.811  1.00 69.79  ? 2    SER A N     1 
ATOM   283   C  CA    . SER C 3 2    ? -32.467 109.475 52.305  1.00 69.02  ? 2    SER A CA    1 
ATOM   284   C  C     . SER C 3 2    ? -32.701 108.933 53.725  1.00 67.64  ? 2    SER A C     1 
ATOM   285   O  O     . SER C 3 2    ? -31.822 108.298 54.306  1.00 67.98  ? 2    SER A O     1 
ATOM   286   C  CB    . SER C 3 2    ? -31.215 110.369 52.276  1.00 69.71  ? 2    SER A CB    1 
ATOM   287   O  OG    . SER C 3 2    ? -30.035 109.630 52.547  1.00 68.35  ? 2    SER A OG    1 
ATOM   288   N  N     . SER C 3 3    ? -33.887 109.191 54.277  1.00 65.53  ? 3    SER A N     1 
ATOM   289   C  CA    . SER C 3 3    ? -34.237 108.709 55.609  1.00 62.05  ? 3    SER A CA    1 
ATOM   290   C  C     . SER C 3 3    ? -34.554 107.227 55.491  1.00 59.68  ? 3    SER A C     1 
ATOM   291   O  O     . SER C 3 3    ? -34.333 106.451 56.420  1.00 60.26  ? 3    SER A O     1 
ATOM   292   C  CB    . SER C 3 3    ? -35.454 109.461 56.150  1.00 62.17  ? 3    SER A CB    1 
ATOM   293   O  OG    . SER C 3 3    ? -35.154 110.832 56.331  1.00 62.39  ? 3    SER A OG    1 
ATOM   294   N  N     . MET C 3 4    ? -35.079 106.844 54.334  1.00 56.13  ? 4    MET A N     1 
ATOM   295   C  CA    . MET C 3 4    ? -35.406 105.455 54.061  1.00 52.95  ? 4    MET A CA    1 
ATOM   296   C  C     . MET C 3 4    ? -34.082 104.702 54.161  1.00 50.93  ? 4    MET A C     1 
ATOM   297   O  O     . MET C 3 4    ? -33.959 103.746 54.929  1.00 51.29  ? 4    MET A O     1 
ATOM   298   C  CB    . MET C 3 4    ? -35.984 105.328 52.650  1.00 54.39  ? 4    MET A CB    1 
ATOM   299   C  CG    . MET C 3 4    ? -36.750 104.048 52.369  1.00 55.85  ? 4    MET A CG    1 
ATOM   300   S  SD    . MET C 3 4    ? -37.286 103.959 50.633  1.00 58.41  ? 4    MET A SD    1 
ATOM   301   C  CE    . MET C 3 4    ? -38.152 105.509 50.456  1.00 58.47  ? 4    MET A CE    1 
ATOM   302   N  N     . ILE C 3 5    ? -33.088 105.156 53.395  1.00 47.49  ? 5    ILE A N     1 
ATOM   303   C  CA    . ILE C 3 5    ? -31.760 104.541 53.394  1.00 44.47  ? 5    ILE A CA    1 
ATOM   304   C  C     . ILE C 3 5    ? -31.103 104.620 54.782  1.00 44.94  ? 5    ILE A C     1 
ATOM   305   O  O     . ILE C 3 5    ? -30.597 103.619 55.301  1.00 43.72  ? 5    ILE A O     1 
ATOM   306   C  CB    . ILE C 3 5    ? -30.831 105.220 52.344  1.00 41.60  ? 5    ILE A CB    1 
ATOM   307   C  CG1   . ILE C 3 5    ? -31.288 104.864 50.929  1.00 38.33  ? 5    ILE A CG1   1 
ATOM   308   C  CG2   . ILE C 3 5    ? -29.393 104.788 52.551  1.00 38.91  ? 5    ILE A CG2   1 
ATOM   309   C  CD1   . ILE C 3 5    ? -31.258 103.384 50.622  1.00 36.01  ? 5    ILE A CD1   1 
ATOM   310   N  N     . LEU C 3 6    ? -31.119 105.812 55.376  1.00 45.42  ? 6    LEU A N     1 
ATOM   311   C  CA    . LEU C 3 6    ? -30.542 106.029 56.700  1.00 46.02  ? 6    LEU A CA    1 
ATOM   312   C  C     . LEU C 3 6    ? -31.088 105.053 57.745  1.00 46.43  ? 6    LEU A C     1 
ATOM   313   O  O     . LEU C 3 6    ? -30.324 104.419 58.475  1.00 46.97  ? 6    LEU A O     1 
ATOM   314   C  CB    . LEU C 3 6    ? -30.794 107.470 57.167  1.00 45.54  ? 6    LEU A CB    1 
ATOM   315   C  CG    . LEU C 3 6    ? -29.874 108.577 56.629  1.00 46.37  ? 6    LEU A CG    1 
ATOM   316   C  CD1   . LEU C 3 6    ? -30.384 109.930 57.095  1.00 46.09  ? 6    LEU A CD1   1 
ATOM   317   C  CD2   . LEU C 3 6    ? -28.447 108.363 57.114  1.00 44.30  ? 6    LEU A CD2   1 
ATOM   318   N  N     . THR C 3 7    ? -32.407 104.927 57.817  1.00 46.21  ? 7    THR A N     1 
ATOM   319   C  CA    . THR C 3 7    ? -33.019 104.032 58.790  1.00 46.07  ? 7    THR A CA    1 
ATOM   320   C  C     . THR C 3 7    ? -32.561 102.591 58.586  1.00 45.44  ? 7    THR A C     1 
ATOM   321   O  O     . THR C 3 7    ? -32.075 101.938 59.516  1.00 45.63  ? 7    THR A O     1 
ATOM   322   C  CB    . THR C 3 7    ? -34.564 104.097 58.699  1.00 48.02  ? 7    THR A CB    1 
ATOM   323   O  OG1   . THR C 3 7    ? -35.002 105.428 59.010  1.00 48.85  ? 7    THR A OG1   1 
ATOM   324   C  CG2   . THR C 3 7    ? -35.211 103.108 59.668  1.00 45.91  ? 7    THR A CG2   1 
ATOM   325   N  N     . GLN C 3 8    ? -32.700 102.108 57.359  1.00 43.83  ? 8    GLN A N     1 
ATOM   326   C  CA    . GLN C 3 8    ? -32.331 100.738 57.022  1.00 41.44  ? 8    GLN A CA    1 
ATOM   327   C  C     . GLN C 3 8    ? -30.854 100.352 57.129  1.00 38.16  ? 8    GLN A C     1 
ATOM   328   O  O     . GLN C 3 8    ? -30.544 99.226  57.518  1.00 37.68  ? 8    GLN A O     1 
ATOM   329   C  CB    . GLN C 3 8    ? -32.836 100.414 55.615  1.00 42.39  ? 8    GLN A CB    1 
ATOM   330   C  CG    . GLN C 3 8    ? -34.328 100.148 55.545  1.00 45.71  ? 8    GLN A CG    1 
ATOM   331   C  CD    . GLN C 3 8    ? -34.655 98.683  55.725  1.00 47.35  ? 8    GLN A CD    1 
ATOM   332   O  OE1   . GLN C 3 8    ? -34.323 97.853  54.875  1.00 49.07  ? 8    GLN A OE1   1 
ATOM   333   N  NE2   . GLN C 3 8    ? -35.300 98.351  56.834  1.00 48.75  ? 8    GLN A NE2   1 
ATOM   334   N  N     . PHE C 3 9    ? -29.944 101.262 56.790  1.00 33.51  ? 9    PHE A N     1 
ATOM   335   C  CA    . PHE C 3 9    ? -28.519 100.929 56.830  1.00 30.20  ? 9    PHE A CA    1 
ATOM   336   C  C     . PHE C 3 9    ? -27.683 101.822 57.748  1.00 30.23  ? 9    PHE A C     1 
ATOM   337   O  O     . PHE C 3 9    ? -26.449 101.781 57.709  1.00 28.40  ? 9    PHE A O     1 
ATOM   338   C  CB    . PHE C 3 9    ? -27.943 100.988 55.417  1.00 28.02  ? 9    PHE A CB    1 
ATOM   339   C  CG    . PHE C 3 9    ? -28.662 100.118 54.424  1.00 24.93  ? 9    PHE A CG    1 
ATOM   340   C  CD1   . PHE C 3 9    ? -28.274 98.792  54.225  1.00 23.37  ? 9    PHE A CD1   1 
ATOM   341   C  CD2   . PHE C 3 9    ? -29.720 100.627 53.678  1.00 22.68  ? 9    PHE A CD2   1 
ATOM   342   C  CE1   . PHE C 3 9    ? -28.922 97.990  53.301  1.00 22.13  ? 9    PHE A CE1   1 
ATOM   343   C  CE2   . PHE C 3 9    ? -30.377 99.834  52.750  1.00 20.91  ? 9    PHE A CE2   1 
ATOM   344   C  CZ    . PHE C 3 9    ? -29.978 98.510  52.559  1.00 22.55  ? 9    PHE A CZ    1 
ATOM   345   N  N     . GLY C 3 10   ? -28.366 102.606 58.579  1.00 30.46  ? 10   GLY A N     1 
ATOM   346   C  CA    . GLY C 3 10   ? -27.700 103.520 59.494  1.00 28.05  ? 10   GLY A CA    1 
ATOM   347   C  C     . GLY C 3 10   ? -26.365 103.071 60.046  1.00 26.75  ? 10   GLY A C     1 
ATOM   348   O  O     . GLY C 3 10   ? -25.320 103.575 59.634  1.00 27.61  ? 10   GLY A O     1 
ATOM   349   N  N     . PRO C 3 11   ? -26.369 102.133 61.003  1.00 26.07  ? 11   PRO A N     1 
ATOM   350   C  CA    . PRO C 3 11   ? -25.163 101.596 61.637  1.00 23.95  ? 11   PRO A CA    1 
ATOM   351   C  C     . PRO C 3 11   ? -24.097 101.105 60.655  1.00 24.00  ? 11   PRO A C     1 
ATOM   352   O  O     . PRO C 3 11   ? -22.900 101.266 60.906  1.00 24.19  ? 11   PRO A O     1 
ATOM   353   C  CB    . PRO C 3 11   ? -25.711 100.465 62.504  1.00 21.75  ? 11   PRO A CB    1 
ATOM   354   C  CG    . PRO C 3 11   ? -27.029 100.985 62.905  1.00 22.49  ? 11   PRO A CG    1 
ATOM   355   C  CD    . PRO C 3 11   ? -27.575 101.546 61.612  1.00 25.27  ? 11   PRO A CD    1 
ATOM   356   N  N     . PHE C 3 12   ? -24.528 100.498 59.551  1.00 24.13  ? 12   PHE A N     1 
ATOM   357   C  CA    . PHE C 3 12   ? -23.587 99.993  58.557  1.00 24.82  ? 12   PHE A CA    1 
ATOM   358   C  C     . PHE C 3 12   ? -22.900 101.148 57.863  1.00 25.26  ? 12   PHE A C     1 
ATOM   359   O  O     . PHE C 3 12   ? -21.694 101.124 57.632  1.00 25.23  ? 12   PHE A O     1 
ATOM   360   C  CB    . PHE C 3 12   ? -24.298 99.133  57.515  1.00 25.67  ? 12   PHE A CB    1 
ATOM   361   C  CG    . PHE C 3 12   ? -23.420 98.749  56.359  1.00 26.47  ? 12   PHE A CG    1 
ATOM   362   C  CD1   . PHE C 3 12   ? -22.218 98.085  56.572  1.00 27.45  ? 12   PHE A CD1   1 
ATOM   363   C  CD2   . PHE C 3 12   ? -23.791 99.047  55.057  1.00 27.00  ? 12   PHE A CD2   1 
ATOM   364   C  CE1   . PHE C 3 12   ? -21.399 97.720  55.497  1.00 28.50  ? 12   PHE A CE1   1 
ATOM   365   C  CE2   . PHE C 3 12   ? -22.977 98.686  53.975  1.00 27.73  ? 12   PHE A CE2   1 
ATOM   366   C  CZ    . PHE C 3 12   ? -21.782 98.023  54.197  1.00 25.03  ? 12   PHE A CZ    1 
ATOM   367   N  N     . ILE C 3 13   ? -23.691 102.156 57.516  1.00 26.53  ? 13   ILE A N     1 
ATOM   368   C  CA    . ILE C 3 13   ? -23.177 103.344 56.861  1.00 26.78  ? 13   ILE A CA    1 
ATOM   369   C  C     . ILE C 3 13   ? -22.030 103.916 57.692  1.00 29.17  ? 13   ILE A C     1 
ATOM   370   O  O     . ILE C 3 13   ? -20.960 104.207 57.161  1.00 30.01  ? 13   ILE A O     1 
ATOM   371   C  CB    . ILE C 3 13   ? -24.287 104.404 56.711  1.00 24.10  ? 13   ILE A CB    1 
ATOM   372   C  CG1   . ILE C 3 13   ? -25.345 103.891 55.726  1.00 24.38  ? 13   ILE A CG1   1 
ATOM   373   C  CG2   . ILE C 3 13   ? -23.694 105.727 56.253  1.00 22.43  ? 13   ILE A CG2   1 
ATOM   374   C  CD1   . ILE C 3 13   ? -26.573 104.796 55.577  1.00 21.35  ? 13   ILE A CD1   1 
ATOM   375   N  N     . GLU C 3 14   ? -22.246 104.061 58.996  1.00 30.33  ? 14   GLU A N     1 
ATOM   376   C  CA    . GLU C 3 14   ? -21.208 104.611 59.860  1.00 32.92  ? 14   GLU A CA    1 
ATOM   377   C  C     . GLU C 3 14   ? -20.006 103.684 59.960  1.00 32.11  ? 14   GLU A C     1 
ATOM   378   O  O     . GLU C 3 14   ? -18.877 104.135 60.165  1.00 33.42  ? 14   GLU A O     1 
ATOM   379   C  CB    . GLU C 3 14   ? -21.753 104.894 61.272  1.00 34.73  ? 14   GLU A CB    1 
ATOM   380   C  CG    . GLU C 3 14   ? -22.842 105.963 61.326  1.00 37.54  ? 14   GLU A CG    1 
ATOM   381   C  CD    . GLU C 3 14   ? -23.194 106.384 62.750  1.00 40.65  ? 14   GLU A CD    1 
ATOM   382   O  OE1   . GLU C 3 14   ? -23.527 105.500 63.580  1.00 40.43  ? 14   GLU A OE1   1 
ATOM   383   O  OE2   . GLU C 3 14   ? -23.142 107.606 63.034  1.00 40.25  ? 14   GLU A OE2   1 
ATOM   384   N  N     . SER C 3 15   ? -20.248 102.389 59.814  1.00 31.63  ? 15   SER A N     1 
ATOM   385   C  CA    . SER C 3 15   ? -19.168 101.422 59.910  1.00 31.21  ? 15   SER A CA    1 
ATOM   386   C  C     . SER C 3 15   ? -18.195 101.533 58.738  1.00 30.52  ? 15   SER A C     1 
ATOM   387   O  O     . SER C 3 15   ? -17.012 101.232 58.880  1.00 29.90  ? 15   SER A O     1 
ATOM   388   C  CB    . SER C 3 15   ? -19.739 100.000 59.998  1.00 31.50  ? 15   SER A CB    1 
ATOM   389   O  OG    . SER C 3 15   ? -20.376 99.613  58.792  1.00 32.00  ? 15   SER A OG    1 
ATOM   390   N  N     . ILE C 3 16   ? -18.689 101.976 57.586  1.00 29.73  ? 16   ILE A N     1 
ATOM   391   C  CA    . ILE C 3 16   ? -17.837 102.097 56.410  1.00 28.83  ? 16   ILE A CA    1 
ATOM   392   C  C     . ILE C 3 16   ? -17.473 103.542 56.079  1.00 28.76  ? 16   ILE A C     1 
ATOM   393   O  O     . ILE C 3 16   ? -16.999 103.834 54.975  1.00 28.04  ? 16   ILE A O     1 
ATOM   394   C  CB    . ILE C 3 16   ? -18.490 101.434 55.171  1.00 28.16  ? 16   ILE A CB    1 
ATOM   395   C  CG1   . ILE C 3 16   ? -19.905 101.974 54.975  1.00 29.64  ? 16   ILE A CG1   1 
ATOM   396   C  CG2   . ILE C 3 16   ? -18.531 99.928  55.348  1.00 27.21  ? 16   ILE A CG2   1 
ATOM   397   C  CD1   . ILE C 3 16   ? -20.571 101.518 53.700  1.00 29.79  ? 16   ILE A CD1   1 
ATOM   398   N  N     . SER C 3 17   ? -17.703 104.448 57.027  1.00 28.17  ? 17   SER A N     1 
ATOM   399   C  CA    . SER C 3 17   ? -17.352 105.855 56.821  1.00 28.44  ? 17   SER A CA    1 
ATOM   400   C  C     . SER C 3 17   ? -16.231 106.272 57.772  1.00 29.84  ? 17   SER A C     1 
ATOM   401   O  O     . SER C 3 17   ? -15.773 107.416 57.746  1.00 32.05  ? 17   SER A O     1 
ATOM   402   C  CB    . SER C 3 17   ? -18.564 106.762 57.014  1.00 26.10  ? 17   SER A CB    1 
ATOM   403   O  OG    . SER C 3 17   ? -19.487 106.592 55.955  1.00 25.14  ? 17   SER A OG    1 
ATOM   404   N  N     . GLY C 3 18   ? -15.784 105.329 58.599  1.00 30.00  ? 18   GLY A N     1 
ATOM   405   C  CA    . GLY C 3 18   ? -14.713 105.607 59.539  1.00 30.82  ? 18   GLY A CA    1 
ATOM   406   C  C     . GLY C 3 18   ? -15.202 106.173 60.855  1.00 31.05  ? 18   GLY A C     1 
ATOM   407   O  O     . GLY C 3 18   ? -14.407 106.499 61.725  1.00 31.65  ? 18   GLY A O     1 
ATOM   408   N  N     . ILE C 3 19   ? -16.517 106.282 61.005  1.00 31.81  ? 19   ILE A N     1 
ATOM   409   C  CA    . ILE C 3 19   ? -17.112 106.818 62.222  1.00 31.06  ? 19   ILE A CA    1 
ATOM   410   C  C     . ILE C 3 19   ? -17.248 105.731 63.285  1.00 30.89  ? 19   ILE A C     1 
ATOM   411   O  O     . ILE C 3 19   ? -16.951 105.957 64.453  1.00 29.84  ? 19   ILE A O     1 
ATOM   412   C  CB    . ILE C 3 19   ? -18.502 107.439 61.925  1.00 30.35  ? 19   ILE A CB    1 
ATOM   413   C  CG1   . ILE C 3 19   ? -18.341 108.617 60.962  1.00 28.94  ? 19   ILE A CG1   1 
ATOM   414   C  CG2   . ILE C 3 19   ? -19.150 107.912 63.206  1.00 26.56  ? 19   ILE A CG2   1 
ATOM   415   C  CD1   . ILE C 3 19   ? -19.635 109.050 60.295  1.00 33.02  ? 19   ILE A CD1   1 
ATOM   416   N  N     . THR C 3 20   ? -17.679 104.545 62.877  1.00 30.92  ? 20   THR A N     1 
ATOM   417   C  CA    . THR C 3 20   ? -17.840 103.455 63.827  1.00 31.65  ? 20   THR A CA    1 
ATOM   418   C  C     . THR C 3 20   ? -17.076 102.210 63.358  1.00 32.08  ? 20   THR A C     1 
ATOM   419   O  O     . THR C 3 20   ? -16.670 102.130 62.198  1.00 33.37  ? 20   THR A O     1 
ATOM   420   C  CB    . THR C 3 20   ? -19.335 103.131 63.996  1.00 31.70  ? 20   THR A CB    1 
ATOM   421   O  OG1   . THR C 3 20   ? -19.538 102.453 65.234  1.00 35.38  ? 20   THR A OG1   1 
ATOM   422   C  CG2   . THR C 3 20   ? -19.824 102.255 62.878  1.00 31.07  ? 20   THR A CG2   1 
ATOM   423   N  N     . ASP C 3 21   ? -16.861 101.250 64.254  1.00 30.92  ? 21   ASP A N     1 
ATOM   424   C  CA    . ASP C 3 21   ? -16.155 100.018 63.892  1.00 29.33  ? 21   ASP A CA    1 
ATOM   425   C  C     . ASP C 3 21   ? -16.989 99.109  62.993  1.00 28.53  ? 21   ASP A C     1 
ATOM   426   O  O     . ASP C 3 21   ? -18.219 99.130  63.030  1.00 29.32  ? 21   ASP A O     1 
ATOM   427   C  CB    . ASP C 3 21   ? -15.789 99.223  65.145  1.00 30.19  ? 21   ASP A CB    1 
ATOM   428   C  CG    . ASP C 3 21   ? -14.475 99.659  65.760  1.00 32.63  ? 21   ASP A CG    1 
ATOM   429   O  OD1   . ASP C 3 21   ? -13.947 100.726 65.379  1.00 33.73  ? 21   ASP A OD1   1 
ATOM   430   O  OD2   . ASP C 3 21   ? -13.970 98.930  66.640  1.00 33.73  ? 21   ASP A OD2   1 
ATOM   431   N  N     . GLN C 3 22   ? -16.320 98.311  62.175  1.00 27.16  ? 22   GLN A N     1 
ATOM   432   C  CA    . GLN C 3 22   ? -17.035 97.369  61.324  1.00 26.93  ? 22   GLN A CA    1 
ATOM   433   C  C     . GLN C 3 22   ? -17.272 96.118  62.169  1.00 26.81  ? 22   GLN A C     1 
ATOM   434   O  O     . GLN C 3 22   ? -16.437 95.738  62.984  1.00 25.35  ? 22   GLN A O     1 
ATOM   435   C  CB    . GLN C 3 22   ? -16.209 96.982  60.090  1.00 26.10  ? 22   GLN A CB    1 
ATOM   436   C  CG    . GLN C 3 22   ? -15.961 98.096  59.112  1.00 27.86  ? 22   GLN A CG    1 
ATOM   437   C  CD    . GLN C 3 22   ? -15.316 97.604  57.832  1.00 29.86  ? 22   GLN A CD    1 
ATOM   438   O  OE1   . GLN C 3 22   ? -15.910 96.824  57.085  1.00 30.81  ? 22   GLN A OE1   1 
ATOM   439   N  NE2   . GLN C 3 22   ? -14.095 98.058  57.570  1.00 29.03  ? 22   GLN A NE2   1 
ATOM   440   N  N     . SER C 3 23   ? -18.418 95.486  61.988  1.00 28.09  ? 23   SER A N     1 
ATOM   441   C  CA    . SER C 3 23   ? -18.723 94.273  62.724  1.00 29.27  ? 23   SER A CA    1 
ATOM   442   C  C     . SER C 3 23   ? -19.542 93.392  61.798  1.00 29.05  ? 23   SER A C     1 
ATOM   443   O  O     . SER C 3 23   ? -20.384 93.877  61.033  1.00 28.61  ? 23   SER A O     1 
ATOM   444   C  CB    . SER C 3 23   ? -19.493 94.588  64.011  1.00 28.70  ? 23   SER A CB    1 
ATOM   445   O  OG    . SER C 3 23   ? -20.708 95.273  63.741  1.00 33.12  ? 23   SER A OG    1 
ATOM   446   N  N     . ASN C 3 24   ? -19.285 92.094  61.852  1.00 28.71  ? 24   ASN A N     1 
ATOM   447   C  CA    . ASN C 3 24   ? -19.999 91.175  60.995  1.00 27.72  ? 24   ASN A CA    1 
ATOM   448   C  C     . ASN C 3 24   ? -21.498 91.207  61.237  1.00 29.15  ? 24   ASN A C     1 
ATOM   449   O  O     . ASN C 3 24   ? -22.288 91.009  60.307  1.00 29.63  ? 24   ASN A O     1 
ATOM   450   C  CB    . ASN C 3 24   ? -19.492 89.767  61.194  1.00 26.60  ? 24   ASN A CB    1 
ATOM   451   C  CG    . ASN C 3 24   ? -19.850 88.894  60.052  1.00 26.99  ? 24   ASN A CG    1 
ATOM   452   O  OD1   . ASN C 3 24   ? -19.443 89.158  58.920  1.00 26.53  ? 24   ASN A OD1   1 
ATOM   453   N  ND2   . ASN C 3 24   ? -20.630 87.853  60.317  1.00 27.01  ? 24   ASN A ND2   1 
ATOM   454   N  N     . ASP C 3 25   ? -21.889 91.448  62.487  1.00 28.43  ? 25   ASP A N     1 
ATOM   455   C  CA    . ASP C 3 25   ? -23.300 91.520  62.831  1.00 29.28  ? 25   ASP A CA    1 
ATOM   456   C  C     . ASP C 3 25   ? -23.993 92.630  62.058  1.00 29.29  ? 25   ASP A C     1 
ATOM   457   O  O     . ASP C 3 25   ? -25.068 92.431  61.505  1.00 29.53  ? 25   ASP A O     1 
ATOM   458   C  CB    . ASP C 3 25   ? -23.483 91.757  64.326  1.00 32.06  ? 25   ASP A CB    1 
ATOM   459   C  CG    . ASP C 3 25   ? -23.289 90.493  65.136  1.00 37.00  ? 25   ASP A CG    1 
ATOM   460   O  OD1   . ASP C 3 25   ? -23.636 89.407  64.606  1.00 36.28  ? 25   ASP A OD1   1 
ATOM   461   O  OD2   . ASP C 3 25   ? -22.808 90.585  66.296  1.00 39.21  ? 25   ASP A OD2   1 
ATOM   462   N  N     . VAL C 3 26   ? -23.381 93.805  62.018  1.00 27.95  ? 26   VAL A N     1 
ATOM   463   C  CA    . VAL C 3 26   ? -23.988 94.901  61.293  1.00 26.73  ? 26   VAL A CA    1 
ATOM   464   C  C     . VAL C 3 26   ? -23.937 94.614  59.797  1.00 26.48  ? 26   VAL A C     1 
ATOM   465   O  O     . VAL C 3 26   ? -24.915 94.838  59.075  1.00 26.76  ? 26   VAL A O     1 
ATOM   466   C  CB    . VAL C 3 26   ? -23.281 96.244  61.620  1.00 27.16  ? 26   VAL A CB    1 
ATOM   467   C  CG1   . VAL C 3 26   ? -23.697 97.333  60.620  1.00 22.56  ? 26   VAL A CG1   1 
ATOM   468   C  CG2   . VAL C 3 26   ? -23.653 96.676  63.041  1.00 24.72  ? 26   VAL A CG2   1 
ATOM   469   N  N     . PHE C 3 27   ? -22.797 94.099  59.348  1.00 25.69  ? 27   PHE A N     1 
ATOM   470   C  CA    . PHE C 3 27   ? -22.593 93.776  57.943  1.00 26.42  ? 27   PHE A CA    1 
ATOM   471   C  C     . PHE C 3 27   ? -23.652 92.822  57.410  1.00 25.93  ? 27   PHE A C     1 
ATOM   472   O  O     . PHE C 3 27   ? -24.270 93.082  56.383  1.00 26.80  ? 27   PHE A O     1 
ATOM   473   C  CB    . PHE C 3 27   ? -21.213 93.141  57.746  1.00 27.28  ? 27   PHE A CB    1 
ATOM   474   C  CG    . PHE C 3 27   ? -20.917 92.752  56.319  1.00 26.19  ? 27   PHE A CG    1 
ATOM   475   C  CD1   . PHE C 3 27   ? -20.497 93.700  55.397  1.00 26.28  ? 27   PHE A CD1   1 
ATOM   476   C  CD2   . PHE C 3 27   ? -21.074 91.437  55.898  1.00 26.68  ? 27   PHE A CD2   1 
ATOM   477   C  CE1   . PHE C 3 27   ? -20.240 93.345  54.083  1.00 26.89  ? 27   PHE A CE1   1 
ATOM   478   C  CE2   . PHE C 3 27   ? -20.819 91.072  54.580  1.00 25.83  ? 27   PHE A CE2   1 
ATOM   479   C  CZ    . PHE C 3 27   ? -20.401 92.028  53.673  1.00 26.60  ? 27   PHE A CZ    1 
ATOM   480   N  N     . GLU C 3 28   ? -23.858 91.715  58.110  1.00 26.84  ? 28   GLU A N     1 
ATOM   481   C  CA    . GLU C 3 28   ? -24.824 90.727  57.658  1.00 29.17  ? 28   GLU A CA    1 
ATOM   482   C  C     . GLU C 3 28   ? -26.241 91.276  57.685  1.00 29.79  ? 28   GLU A C     1 
ATOM   483   O  O     . GLU C 3 28   ? -27.067 90.906  56.851  1.00 30.76  ? 28   GLU A O     1 
ATOM   484   C  CB    . GLU C 3 28   ? -24.703 89.448  58.490  1.00 29.25  ? 28   GLU A CB    1 
ATOM   485   C  CG    . GLU C 3 28   ? -23.261 88.927  58.542  1.00 30.69  ? 28   GLU A CG    1 
ATOM   486   C  CD    . GLU C 3 28   ? -23.159 87.458  58.907  1.00 30.11  ? 28   GLU A CD    1 
ATOM   487   O  OE1   . GLU C 3 28   ? -24.086 86.937  59.566  1.00 32.48  ? 28   GLU A OE1   1 
ATOM   488   O  OE2   . GLU C 3 28   ? -22.144 86.830  58.544  1.00 25.90  ? 28   GLU A OE2   1 
ATOM   489   N  N     . ASP C 3 29   ? -26.526 92.163  58.629  1.00 30.30  ? 29   ASP A N     1 
ATOM   490   C  CA    . ASP C 3 29   ? -27.848 92.761  58.688  1.00 31.70  ? 29   ASP A CA    1 
ATOM   491   C  C     . ASP C 3 29   ? -27.994 93.690  57.492  1.00 30.76  ? 29   ASP A C     1 
ATOM   492   O  O     . ASP C 3 29   ? -29.052 93.753  56.864  1.00 30.83  ? 29   ASP A O     1 
ATOM   493   C  CB    . ASP C 3 29   ? -28.042 93.541  59.989  1.00 36.35  ? 29   ASP A CB    1 
ATOM   494   C  CG    . ASP C 3 29   ? -28.477 92.652  61.128  1.00 41.54  ? 29   ASP A CG    1 
ATOM   495   O  OD1   . ASP C 3 29   ? -29.491 91.939  60.963  1.00 45.09  ? 29   ASP A OD1   1 
ATOM   496   O  OD2   . ASP C 3 29   ? -27.812 92.658  62.186  1.00 45.68  ? 29   ASP A OD2   1 
ATOM   497   N  N     . ALA C 3 30   ? -26.929 94.419  57.186  1.00 28.28  ? 30   ALA A N     1 
ATOM   498   C  CA    . ALA C 3 30   ? -26.941 95.314  56.044  1.00 27.62  ? 30   ALA A CA    1 
ATOM   499   C  C     . ALA C 3 30   ? -27.204 94.452  54.792  1.00 28.05  ? 30   ALA A C     1 
ATOM   500   O  O     . ALA C 3 30   ? -27.985 94.820  53.909  1.00 25.49  ? 30   ALA A O     1 
ATOM   501   C  CB    . ALA C 3 30   ? -25.599 96.025  55.943  1.00 27.39  ? 30   ALA A CB    1 
ATOM   502   N  N     . ALA C 3 31   ? -26.557 93.291  54.741  1.00 27.53  ? 31   ALA A N     1 
ATOM   503   C  CA    . ALA C 3 31   ? -26.730 92.368  53.628  1.00 29.73  ? 31   ALA A CA    1 
ATOM   504   C  C     . ALA C 3 31   ? -28.197 91.942  53.513  1.00 30.65  ? 31   ALA A C     1 
ATOM   505   O  O     . ALA C 3 31   ? -28.789 91.979  52.434  1.00 30.65  ? 31   ALA A O     1 
ATOM   506   C  CB    . ALA C 3 31   ? -25.847 91.149  53.834  1.00 29.73  ? 31   ALA A CB    1 
ATOM   507   N  N     . LYS C 3 32   ? -28.776 91.520  54.629  1.00 32.05  ? 32   LYS A N     1 
ATOM   508   C  CA    . LYS C 3 32   ? -30.171 91.114  54.643  1.00 33.04  ? 32   LYS A CA    1 
ATOM   509   C  C     . LYS C 3 32   ? -31.056 92.285  54.203  1.00 33.27  ? 32   LYS A C     1 
ATOM   510   O  O     . LYS C 3 32   ? -32.015 92.099  53.456  1.00 34.53  ? 32   LYS A O     1 
ATOM   511   C  CB    . LYS C 3 32   ? -30.557 90.647  56.044  1.00 34.67  ? 32   LYS A CB    1 
ATOM   512   C  CG    . LYS C 3 32   ? -32.028 90.298  56.230  1.00 37.55  ? 32   LYS A CG    1 
ATOM   513   C  CD    . LYS C 3 32   ? -32.213 89.461  57.497  1.00 39.42  ? 32   LYS A CD    1 
ATOM   514   C  CE    . LYS C 3 32   ? -33.679 89.284  57.872  1.00 39.60  ? 32   LYS A CE    1 
ATOM   515   N  NZ    . LYS C 3 32   ? -34.273 90.557  58.372  1.00 40.19  ? 32   LYS A NZ    1 
ATOM   516   N  N     . ALA C 3 33   ? -30.722 93.492  54.648  1.00 31.82  ? 33   ALA A N     1 
ATOM   517   C  CA    . ALA C 3 33   ? -31.500 94.666  54.280  1.00 30.71  ? 33   ALA A CA    1 
ATOM   518   C  C     . ALA C 3 33   ? -31.420 94.906  52.777  1.00 31.86  ? 33   ALA A C     1 
ATOM   519   O  O     . ALA C 3 33   ? -32.409 95.291  52.150  1.00 33.78  ? 33   ALA A O     1 
ATOM   520   C  CB    . ALA C 3 33   ? -31.006 95.885  55.037  1.00 27.80  ? 33   ALA A CB    1 
ATOM   521   N  N     . PHE C 3 34   ? -30.246 94.676  52.197  1.00 31.19  ? 34   PHE A N     1 
ATOM   522   C  CA    . PHE C 3 34   ? -30.064 94.868  50.763  1.00 31.02  ? 34   PHE A CA    1 
ATOM   523   C  C     . PHE C 3 34   ? -30.938 93.905  49.978  1.00 31.67  ? 34   PHE A C     1 
ATOM   524   O  O     . PHE C 3 34   ? -31.552 94.277  48.981  1.00 30.47  ? 34   PHE A O     1 
ATOM   525   C  CB    . PHE C 3 34   ? -28.594 94.659  50.360  1.00 29.18  ? 34   PHE A CB    1 
ATOM   526   C  CG    . PHE C 3 34   ? -27.770 95.912  50.397  1.00 28.44  ? 34   PHE A CG    1 
ATOM   527   C  CD1   . PHE C 3 34   ? -28.079 96.986  49.568  1.00 28.78  ? 34   PHE A CD1   1 
ATOM   528   C  CD2   . PHE C 3 34   ? -26.687 96.025  51.260  1.00 28.56  ? 34   PHE A CD2   1 
ATOM   529   C  CE1   . PHE C 3 34   ? -27.322 98.159  49.595  1.00 26.75  ? 34   PHE A CE1   1 
ATOM   530   C  CE2   . PHE C 3 34   ? -25.922 97.192  51.298  1.00 29.05  ? 34   PHE A CE2   1 
ATOM   531   C  CZ    . PHE C 3 34   ? -26.243 98.263  50.460  1.00 26.46  ? 34   PHE A CZ    1 
ATOM   532   N  N     . SER C 3 35   ? -30.992 92.662  50.433  1.00 34.08  ? 35   SER A N     1 
ATOM   533   C  CA    . SER C 3 35   ? -31.784 91.657  49.749  1.00 37.74  ? 35   SER A CA    1 
ATOM   534   C  C     . SER C 3 35   ? -33.284 91.802  49.951  1.00 39.10  ? 35   SER A C     1 
ATOM   535   O  O     . SER C 3 35   ? -34.070 91.281  49.162  1.00 41.26  ? 35   SER A O     1 
ATOM   536   C  CB    . SER C 3 35   ? -31.339 90.263  50.174  1.00 39.81  ? 35   SER A CB    1 
ATOM   537   O  OG    . SER C 3 35   ? -30.198 89.866  49.430  1.00 44.68  ? 35   SER A OG    1 
ATOM   538   N  N     . MET C 3 36   ? -33.686 92.512  50.996  1.00 38.91  ? 36   MET A N     1 
ATOM   539   C  CA    . MET C 3 36   ? -35.104 92.697  51.257  1.00 39.27  ? 36   MET A CA    1 
ATOM   540   C  C     . MET C 3 36   ? -35.644 93.965  50.623  1.00 37.85  ? 36   MET A C     1 
ATOM   541   O  O     . MET C 3 36   ? -36.852 94.197  50.614  1.00 36.59  ? 36   MET A O     1 
ATOM   542   C  CB    . MET C 3 36   ? -35.370 92.700  52.756  1.00 41.11  ? 36   MET A CB    1 
ATOM   543   C  CG    . MET C 3 36   ? -34.956 91.406  53.418  1.00 43.71  ? 36   MET A CG    1 
ATOM   544   S  SD    . MET C 3 36   ? -35.618 91.272  55.069  1.00 48.98  ? 36   MET A SD    1 
ATOM   545   C  CE    . MET C 3 36   ? -37.187 90.491  54.680  1.00 47.14  ? 36   MET A CE    1 
ATOM   546   N  N     . PHE C 3 37   ? -34.738 94.784  50.098  1.00 37.25  ? 37   PHE A N     1 
ATOM   547   C  CA    . PHE C 3 37   ? -35.109 96.022  49.416  1.00 35.75  ? 37   PHE A CA    1 
ATOM   548   C  C     . PHE C 3 37   ? -35.666 95.629  48.041  1.00 35.72  ? 37   PHE A C     1 
ATOM   549   O  O     . PHE C 3 37   ? -35.039 94.866  47.303  1.00 33.62  ? 37   PHE A O     1 
ATOM   550   C  CB    . PHE C 3 37   ? -33.876 96.896  49.203  1.00 34.19  ? 37   PHE A CB    1 
ATOM   551   C  CG    . PHE C 3 37   ? -34.025 98.306  49.699  1.00 33.16  ? 37   PHE A CG    1 
ATOM   552   C  CD1   . PHE C 3 37   ? -33.875 98.601  51.046  1.00 30.99  ? 37   PHE A CD1   1 
ATOM   553   C  CD2   . PHE C 3 37   ? -34.273 99.346  48.808  1.00 32.72  ? 37   PHE A CD2   1 
ATOM   554   C  CE1   . PHE C 3 37   ? -33.962 99.907  51.502  1.00 31.12  ? 37   PHE A CE1   1 
ATOM   555   C  CE2   . PHE C 3 37   ? -34.363 100.659 49.254  1.00 32.25  ? 37   PHE A CE2   1 
ATOM   556   C  CZ    . PHE C 3 37   ? -34.205 100.940 50.606  1.00 33.25  ? 37   PHE A CZ    1 
ATOM   557   N  N     . THR C 3 38   ? -36.835 96.145  47.692  1.00 36.38  ? 38   THR A N     1 
ATOM   558   C  CA    . THR C 3 38   ? -37.424 95.829  46.397  1.00 38.19  ? 38   THR A CA    1 
ATOM   559   C  C     . THR C 3 38   ? -36.949 96.876  45.396  1.00 38.04  ? 38   THR A C     1 
ATOM   560   O  O     . THR C 3 38   ? -36.699 98.020  45.774  1.00 37.25  ? 38   THR A O     1 
ATOM   561   C  CB    . THR C 3 38   ? -38.963 95.866  46.464  1.00 39.87  ? 38   THR A CB    1 
ATOM   562   O  OG1   . THR C 3 38   ? -39.408 97.227  46.455  1.00 43.44  ? 38   THR A OG1   1 
ATOM   563   C  CG2   . THR C 3 38   ? -39.455 95.208  47.741  1.00 37.18  ? 38   THR A CG2   1 
ATOM   564   N  N     . ARG C 3 39   ? -36.822 96.485  44.129  1.00 38.75  ? 39   ARG A N     1 
ATOM   565   C  CA    . ARG C 3 39   ? -36.372 97.409  43.088  1.00 38.51  ? 39   ARG A CA    1 
ATOM   566   C  C     . ARG C 3 39   ? -37.057 98.755  43.177  1.00 38.19  ? 39   ARG A C     1 
ATOM   567   O  O     . ARG C 3 39   ? -36.395 99.788  43.254  1.00 38.49  ? 39   ARG A O     1 
ATOM   568   C  CB    . ARG C 3 39   ? -36.639 96.857  41.692  1.00 38.07  ? 39   ARG A CB    1 
ATOM   569   C  CG    . ARG C 3 39   ? -35.867 95.630  41.345  1.00 40.02  ? 39   ARG A CG    1 
ATOM   570   C  CD    . ARG C 3 39   ? -35.910 95.415  39.859  1.00 41.65  ? 39   ARG A CD    1 
ATOM   571   N  NE    . ARG C 3 39   ? -35.454 94.082  39.467  1.00 46.12  ? 39   ARG A NE    1 
ATOM   572   C  CZ    . ARG C 3 39   ? -34.357 93.481  39.931  1.00 46.53  ? 39   ARG A CZ    1 
ATOM   573   N  NH1   . ARG C 3 39   ? -33.583 94.087  40.826  1.00 46.58  ? 39   ARG A NH1   1 
ATOM   574   N  NH2   . ARG C 3 39   ? -34.023 92.275  39.477  1.00 45.11  ? 39   ARG A NH2   1 
ATOM   575   N  N     . SER C 3 40   ? -38.386 98.740  43.155  1.00 37.28  ? 40   SER A N     1 
ATOM   576   C  CA    . SER C 3 40   ? -39.145 99.978  43.211  1.00 37.30  ? 40   SER A CA    1 
ATOM   577   C  C     . SER C 3 40   ? -38.787 100.802 44.424  1.00 35.78  ? 40   SER A C     1 
ATOM   578   O  O     . SER C 3 40   ? -38.932 102.022 44.414  1.00 36.88  ? 40   SER A O     1 
ATOM   579   C  CB    . SER C 3 40   ? -40.649 99.699  43.188  1.00 37.60  ? 40   SER A CB    1 
ATOM   580   O  OG    . SER C 3 40   ? -41.047 99.263  41.904  1.00 36.51  ? 40   SER A OG    1 
ATOM   581   N  N     . ASP C 3 41   ? -38.309 100.149 45.473  1.00 35.00  ? 41   ASP A N     1 
ATOM   582   C  CA    . ASP C 3 41   ? -37.929 100.900 46.655  1.00 34.57  ? 41   ASP A CA    1 
ATOM   583   C  C     . ASP C 3 41   ? -36.699 101.748 46.368  1.00 32.72  ? 41   ASP A C     1 
ATOM   584   O  O     . ASP C 3 41   ? -36.585 102.863 46.870  1.00 34.38  ? 41   ASP A O     1 
ATOM   585   C  CB    . ASP C 3 41   ? -37.681 99.968  47.845  1.00 37.31  ? 41   ASP A CB    1 
ATOM   586   C  CG    . ASP C 3 41   ? -38.985 99.512  48.515  1.00 42.75  ? 41   ASP A CG    1 
ATOM   587   O  OD1   . ASP C 3 41   ? -39.870 100.372 48.755  1.00 42.86  ? 41   ASP A OD1   1 
ATOM   588   O  OD2   . ASP C 3 41   ? -39.122 98.297  48.808  1.00 44.59  ? 41   ASP A OD2   1 
ATOM   589   N  N     . VAL C 3 42   ? -35.784 101.239 45.549  1.00 29.30  ? 42   VAL A N     1 
ATOM   590   C  CA    . VAL C 3 42   ? -34.586 101.999 45.227  1.00 28.05  ? 42   VAL A CA    1 
ATOM   591   C  C     . VAL C 3 42   ? -34.971 103.314 44.554  1.00 28.36  ? 42   VAL A C     1 
ATOM   592   O  O     . VAL C 3 42   ? -34.350 104.361 44.791  1.00 27.30  ? 42   VAL A O     1 
ATOM   593   C  CB    . VAL C 3 42   ? -33.655 101.203 44.295  1.00 28.78  ? 42   VAL A CB    1 
ATOM   594   C  CG1   . VAL C 3 42   ? -32.391 101.997 44.013  1.00 28.72  ? 42   VAL A CG1   1 
ATOM   595   C  CG2   . VAL C 3 42   ? -33.293 99.875  44.940  1.00 31.09  ? 42   VAL A CG2   1 
ATOM   596   N  N     . TYR C 3 43   ? -35.998 103.256 43.713  1.00 28.27  ? 43   TYR A N     1 
ATOM   597   C  CA    . TYR C 3 43   ? -36.487 104.439 43.013  1.00 30.07  ? 43   TYR A CA    1 
ATOM   598   C  C     . TYR C 3 43   ? -37.183 105.373 44.011  1.00 30.31  ? 43   TYR A C     1 
ATOM   599   O  O     . TYR C 3 43   ? -37.048 106.602 43.932  1.00 29.15  ? 43   TYR A O     1 
ATOM   600   C  CB    . TYR C 3 43   ? -37.439 104.018 41.886  1.00 29.96  ? 43   TYR A CB    1 
ATOM   601   C  CG    . TYR C 3 43   ? -36.737 103.267 40.771  1.00 28.00  ? 43   TYR A CG    1 
ATOM   602   C  CD1   . TYR C 3 43   ? -36.012 103.949 39.801  1.00 28.80  ? 43   TYR A CD1   1 
ATOM   603   C  CD2   . TYR C 3 43   ? -36.744 101.872 40.724  1.00 27.85  ? 43   TYR A CD2   1 
ATOM   604   C  CE1   . TYR C 3 43   ? -35.303 103.263 38.809  1.00 27.04  ? 43   TYR A CE1   1 
ATOM   605   C  CE2   . TYR C 3 43   ? -36.037 101.176 39.739  1.00 25.56  ? 43   TYR A CE2   1 
ATOM   606   C  CZ    . TYR C 3 43   ? -35.317 101.880 38.788  1.00 26.00  ? 43   TYR A CZ    1 
ATOM   607   O  OH    . TYR C 3 43   ? -34.590 101.212 37.823  1.00 24.59  ? 43   TYR A OH    1 
ATOM   608   N  N     . LYS C 3 44   ? -37.910 104.783 44.958  1.00 31.25  ? 44   LYS A N     1 
ATOM   609   C  CA    . LYS C 3 44   ? -38.587 105.565 45.989  1.00 33.61  ? 44   LYS A CA    1 
ATOM   610   C  C     . LYS C 3 44   ? -37.507 106.282 46.785  1.00 33.37  ? 44   LYS A C     1 
ATOM   611   O  O     . LYS C 3 44   ? -37.697 107.407 47.234  1.00 36.10  ? 44   LYS A O     1 
ATOM   612   C  CB    . LYS C 3 44   ? -39.378 104.669 46.953  1.00 35.37  ? 44   LYS A CB    1 
ATOM   613   C  CG    . LYS C 3 44   ? -40.596 103.970 46.375  1.00 38.26  ? 44   LYS A CG    1 
ATOM   614   C  CD    . LYS C 3 44   ? -41.304 103.176 47.469  1.00 41.36  ? 44   LYS A CD    1 
ATOM   615   C  CE    . LYS C 3 44   ? -42.580 102.507 46.971  1.00 43.15  ? 44   LYS A CE    1 
ATOM   616   N  NZ    . LYS C 3 44   ? -43.298 101.814 48.090  1.00 45.01  ? 44   LYS A NZ    1 
ATOM   617   N  N     . ALA C 3 45   ? -36.376 105.614 46.980  1.00 32.33  ? 45   ALA A N     1 
ATOM   618   C  CA    . ALA C 3 45   ? -35.274 106.210 47.717  1.00 30.78  ? 45   ALA A CA    1 
ATOM   619   C  C     . ALA C 3 45   ? -34.708 107.347 46.872  1.00 30.44  ? 45   ALA A C     1 
ATOM   620   O  O     . ALA C 3 45   ? -34.381 108.417 47.382  1.00 29.70  ? 45   ALA A O     1 
ATOM   621   C  CB    . ALA C 3 45   ? -34.204 105.162 47.995  1.00 30.02  ? 45   ALA A CB    1 
ATOM   622   N  N     . LEU C 3 46   ? -34.602 107.112 45.570  1.00 30.21  ? 46   LEU A N     1 
ATOM   623   C  CA    . LEU C 3 46   ? -34.088 108.133 44.677  1.00 32.30  ? 46   LEU A CA    1 
ATOM   624   C  C     . LEU C 3 46   ? -34.965 109.379 44.709  1.00 33.46  ? 46   LEU A C     1 
ATOM   625   O  O     . LEU C 3 46   ? -34.458 110.495 44.594  1.00 33.98  ? 46   LEU A O     1 
ATOM   626   C  CB    . LEU C 3 46   ? -33.991 107.596 43.245  1.00 32.23  ? 46   LEU A CB    1 
ATOM   627   C  CG    . LEU C 3 46   ? -32.796 106.693 42.921  1.00 29.80  ? 46   LEU A CG    1 
ATOM   628   C  CD1   . LEU C 3 46   ? -32.854 106.302 41.454  1.00 27.99  ? 46   LEU A CD1   1 
ATOM   629   C  CD2   . LEU C 3 46   ? -31.481 107.417 43.227  1.00 27.64  ? 46   LEU A CD2   1 
ATOM   630   N  N     . ASP C 3 47   ? -36.276 109.186 44.855  1.00 33.84  ? 47   ASP A N     1 
ATOM   631   C  CA    . ASP C 3 47   ? -37.210 110.308 44.925  1.00 33.27  ? 47   ASP A CA    1 
ATOM   632   C  C     . ASP C 3 47   ? -36.909 111.194 46.131  1.00 33.10  ? 47   ASP A C     1 
ATOM   633   O  O     . ASP C 3 47   ? -37.089 112.409 46.066  1.00 33.61  ? 47   ASP A O     1 
ATOM   634   C  CB    . ASP C 3 47   ? -38.662 109.827 45.043  1.00 35.13  ? 47   ASP A CB    1 
ATOM   635   C  CG    . ASP C 3 47   ? -39.235 109.305 43.729  1.00 36.82  ? 47   ASP A CG    1 
ATOM   636   O  OD1   . ASP C 3 47   ? -38.924 109.859 42.646  1.00 36.35  ? 47   ASP A OD1   1 
ATOM   637   O  OD2   . ASP C 3 47   ? -40.029 108.345 43.790  1.00 37.41  ? 47   ASP A OD2   1 
ATOM   638   N  N     . GLU C 3 48   ? -36.454 110.589 47.227  1.00 32.44  ? 48   GLU A N     1 
ATOM   639   C  CA    . GLU C 3 48   ? -36.147 111.341 48.446  1.00 34.19  ? 48   GLU A CA    1 
ATOM   640   C  C     . GLU C 3 48   ? -34.973 112.313 48.323  1.00 34.78  ? 48   GLU A C     1 
ATOM   641   O  O     . GLU C 3 48   ? -34.699 113.071 49.252  1.00 35.24  ? 48   GLU A O     1 
ATOM   642   C  CB    . GLU C 3 48   ? -35.863 110.390 49.613  1.00 33.73  ? 48   GLU A CB    1 
ATOM   643   C  CG    . GLU C 3 48   ? -36.953 109.380 49.873  1.00 36.96  ? 48   GLU A CG    1 
ATOM   644   C  CD    . GLU C 3 48   ? -36.857 108.760 51.257  1.00 38.89  ? 48   GLU A CD    1 
ATOM   645   O  OE1   . GLU C 3 48   ? -35.726 108.610 51.766  1.00 39.14  ? 48   GLU A OE1   1 
ATOM   646   O  OE2   . GLU C 3 48   ? -37.913 108.412 51.831  1.00 39.23  ? 48   GLU A OE2   1 
ATOM   647   N  N     . ILE C 3 49   ? -34.273 112.298 47.193  1.00 34.49  ? 49   ILE A N     1 
ATOM   648   C  CA    . ILE C 3 49   ? -33.138 113.197 47.024  1.00 33.31  ? 49   ILE A CA    1 
ATOM   649   C  C     . ILE C 3 49   ? -33.485 114.588 46.474  1.00 33.36  ? 49   ILE A C     1 
ATOM   650   O  O     . ILE C 3 49   ? -34.064 114.727 45.396  1.00 33.42  ? 49   ILE A O     1 
ATOM   651   C  CB    . ILE C 3 49   ? -32.061 112.545 46.139  1.00 31.32  ? 49   ILE A CB    1 
ATOM   652   C  CG1   . ILE C 3 49   ? -31.537 111.291 46.836  1.00 29.71  ? 49   ILE A CG1   1 
ATOM   653   C  CG2   . ILE C 3 49   ? -30.931 113.534 45.859  1.00 27.82  ? 49   ILE A CG2   1 
ATOM   654   C  CD1   . ILE C 3 49   ? -30.644 110.424 45.970  1.00 29.35  ? 49   ILE A CD1   1 
ATOM   655   N  N     . PRO C 3 50   ? -33.117 115.637 47.226  1.00 33.97  ? 50   PRO A N     1 
ATOM   656   C  CA    . PRO C 3 50   ? -33.338 117.053 46.906  1.00 34.36  ? 50   PRO A CA    1 
ATOM   657   C  C     . PRO C 3 50   ? -32.329 117.551 45.882  1.00 35.06  ? 50   PRO A C     1 
ATOM   658   O  O     . PRO C 3 50   ? -31.449 118.355 46.201  1.00 35.48  ? 50   PRO A O     1 
ATOM   659   C  CB    . PRO C 3 50   ? -33.147 117.733 48.254  1.00 33.26  ? 50   PRO A CB    1 
ATOM   660   C  CG    . PRO C 3 50   ? -32.018 116.933 48.838  1.00 32.75  ? 50   PRO A CG    1 
ATOM   661   C  CD    . PRO C 3 50   ? -32.458 115.504 48.540  1.00 33.44  ? 50   PRO A CD    1 
ATOM   662   N  N     . PHE C 3 51   ? -32.455 117.064 44.656  1.00 36.11  ? 51   PHE A N     1 
ATOM   663   C  CA    . PHE C 3 51   ? -31.542 117.446 43.588  1.00 37.45  ? 51   PHE A CA    1 
ATOM   664   C  C     . PHE C 3 51   ? -31.395 118.948 43.355  1.00 38.96  ? 51   PHE A C     1 
ATOM   665   O  O     . PHE C 3 51   ? -32.366 119.697 43.396  1.00 39.29  ? 51   PHE A O     1 
ATOM   666   C  CB    . PHE C 3 51   ? -31.965 116.757 42.294  1.00 36.55  ? 51   PHE A CB    1 
ATOM   667   C  CG    . PHE C 3 51   ? -31.626 115.300 42.259  1.00 37.30  ? 51   PHE A CG    1 
ATOM   668   C  CD1   . PHE C 3 51   ? -30.321 114.885 41.998  1.00 35.67  ? 51   PHE A CD1   1 
ATOM   669   C  CD2   . PHE C 3 51   ? -32.599 114.340 42.507  1.00 37.20  ? 51   PHE A CD2   1 
ATOM   670   C  CE1   . PHE C 3 51   ? -29.993 113.537 41.983  1.00 35.30  ? 51   PHE A CE1   1 
ATOM   671   C  CE2   . PHE C 3 51   ? -32.279 112.987 42.494  1.00 36.98  ? 51   PHE A CE2   1 
ATOM   672   C  CZ    . PHE C 3 51   ? -30.970 112.587 42.231  1.00 36.15  ? 51   PHE A CZ    1 
ATOM   673   N  N     . SER C 3 52   ? -30.159 119.373 43.117  1.00 39.74  ? 52   SER A N     1 
ATOM   674   C  CA    . SER C 3 52   ? -29.845 120.770 42.857  1.00 40.90  ? 52   SER A CA    1 
ATOM   675   C  C     . SER C 3 52   ? -30.071 121.053 41.375  1.00 41.13  ? 52   SER A C     1 
ATOM   676   O  O     . SER C 3 52   ? -30.003 120.146 40.550  1.00 42.33  ? 52   SER A O     1 
ATOM   677   C  CB    . SER C 3 52   ? -28.382 121.052 43.232  1.00 42.83  ? 52   SER A CB    1 
ATOM   678   O  OG    . SER C 3 52   ? -27.913 122.261 42.655  1.00 45.04  ? 52   SER A OG    1 
ATOM   679   N  N     . ASP C 3 53   ? -30.337 122.306 41.030  1.00 40.62  ? 53   ASP A N     1 
ATOM   680   C  CA    . ASP C 3 53   ? -30.574 122.644 39.635  1.00 41.09  ? 53   ASP A CA    1 
ATOM   681   C  C     . ASP C 3 53   ? -29.382 122.343 38.720  1.00 39.02  ? 53   ASP A C     1 
ATOM   682   O  O     . ASP C 3 53   ? -29.562 122.059 37.531  1.00 37.98  ? 53   ASP A O     1 
ATOM   683   C  CB    . ASP C 3 53   ? -30.979 124.118 39.509  1.00 44.43  ? 53   ASP A CB    1 
ATOM   684   C  CG    . ASP C 3 53   ? -32.444 124.354 39.859  1.00 48.97  ? 53   ASP A CG    1 
ATOM   685   O  OD1   . ASP C 3 53   ? -33.323 123.792 39.164  1.00 50.34  ? 53   ASP A OD1   1 
ATOM   686   O  OD2   . ASP C 3 53   ? -32.719 125.100 40.828  1.00 51.32  ? 53   ASP A OD2   1 
ATOM   687   N  N     . ASP C 3 54   ? -28.170 122.399 39.269  1.00 37.19  ? 54   ASP A N     1 
ATOM   688   C  CA    . ASP C 3 54   ? -26.973 122.139 38.477  1.00 35.04  ? 54   ASP A CA    1 
ATOM   689   C  C     . ASP C 3 54   ? -26.898 120.685 38.033  1.00 33.52  ? 54   ASP A C     1 
ATOM   690   O  O     . ASP C 3 54   ? -26.166 120.360 37.104  1.00 32.77  ? 54   ASP A O     1 
ATOM   691   C  CB    . ASP C 3 54   ? -25.704 122.520 39.253  1.00 34.79  ? 54   ASP A CB    1 
ATOM   692   C  CG    . ASP C 3 54   ? -25.631 121.878 40.632  1.00 37.49  ? 54   ASP A CG    1 
ATOM   693   O  OD1   . ASP C 3 54   ? -25.649 120.633 40.742  1.00 35.95  ? 54   ASP A OD1   1 
ATOM   694   O  OD2   . ASP C 3 54   ? -25.546 122.634 41.620  1.00 41.82  ? 54   ASP A OD2   1 
ATOM   695   N  N     . ALA C 3 55   ? -27.675 119.825 38.688  1.00 32.27  ? 55   ALA A N     1 
ATOM   696   C  CA    . ALA C 3 55   ? -27.702 118.402 38.364  1.00 33.21  ? 55   ALA A CA    1 
ATOM   697   C  C     . ALA C 3 55   ? -28.728 118.075 37.289  1.00 33.53  ? 55   ALA A C     1 
ATOM   698   O  O     . ALA C 3 55   ? -28.940 116.907 36.959  1.00 33.35  ? 55   ALA A O     1 
ATOM   699   C  CB    . ALA C 3 55   ? -27.999 117.583 39.615  1.00 32.09  ? 55   ALA A CB    1 
ATOM   700   N  N     . MET C 3 56   ? -29.354 119.103 36.731  1.00 34.40  ? 56   MET A N     1 
ATOM   701   C  CA    . MET C 3 56   ? -30.368 118.886 35.714  1.00 35.90  ? 56   MET A CA    1 
ATOM   702   C  C     . MET C 3 56   ? -29.969 119.436 34.367  1.00 35.59  ? 56   MET A C     1 
ATOM   703   O  O     . MET C 3 56   ? -29.171 120.365 34.272  1.00 36.41  ? 56   MET A O     1 
ATOM   704   C  CB    . MET C 3 56   ? -31.681 119.536 36.134  1.00 37.05  ? 56   MET A CB    1 
ATOM   705   C  CG    . MET C 3 56   ? -32.115 119.186 37.537  1.00 40.61  ? 56   MET A CG    1 
ATOM   706   S  SD    . MET C 3 56   ? -33.626 120.043 38.007  1.00 44.38  ? 56   MET A SD    1 
ATOM   707   C  CE    . MET C 3 56   ? -33.855 119.406 39.721  1.00 41.38  ? 56   MET A CE    1 
ATOM   708   N  N     . LEU C 3 57   ? -30.537 118.844 33.326  1.00 35.00  ? 57   LEU A N     1 
ATOM   709   C  CA    . LEU C 3 57   ? -30.293 119.273 31.962  1.00 34.95  ? 57   LEU A CA    1 
ATOM   710   C  C     . LEU C 3 57   ? -31.454 118.784 31.094  1.00 34.72  ? 57   LEU A C     1 
ATOM   711   O  O     . LEU C 3 57   ? -32.049 117.740 31.353  1.00 35.59  ? 57   LEU A O     1 
ATOM   712   C  CB    . LEU C 3 57   ? -28.938 118.747 31.460  1.00 33.33  ? 57   LEU A CB    1 
ATOM   713   C  CG    . LEU C 3 57   ? -28.715 117.311 30.986  1.00 32.64  ? 57   LEU A CG    1 
ATOM   714   C  CD1   . LEU C 3 57   ? -27.229 117.130 30.743  1.00 28.05  ? 57   LEU A CD1   1 
ATOM   715   C  CD2   . LEU C 3 57   ? -29.210 116.302 32.012  1.00 33.10  ? 57   LEU A CD2   1 
ATOM   716   N  N     . PRO C 3 58   ? -31.807 119.550 30.061  1.00 35.05  ? 58   PRO A N     1 
ATOM   717   C  CA    . PRO C 3 58   ? -32.907 119.204 29.154  1.00 35.42  ? 58   PRO A CA    1 
ATOM   718   C  C     . PRO C 3 58   ? -32.862 117.783 28.617  1.00 35.24  ? 58   PRO A C     1 
ATOM   719   O  O     . PRO C 3 58   ? -31.902 117.390 27.963  1.00 37.16  ? 58   PRO A O     1 
ATOM   720   C  CB    . PRO C 3 58   ? -32.763 120.229 28.037  1.00 34.47  ? 58   PRO A CB    1 
ATOM   721   C  CG    . PRO C 3 58   ? -32.172 121.409 28.750  1.00 35.23  ? 58   PRO A CG    1 
ATOM   722   C  CD    . PRO C 3 58   ? -31.131 120.779 29.619  1.00 34.02  ? 58   PRO A CD    1 
ATOM   723   N  N     . ILE C 3 59   ? -33.901 117.012 28.892  1.00 34.40  ? 59   ILE A N     1 
ATOM   724   C  CA    . ILE C 3 59   ? -33.961 115.653 28.390  1.00 34.07  ? 59   ILE A CA    1 
ATOM   725   C  C     . ILE C 3 59   ? -34.821 115.612 27.123  1.00 35.30  ? 59   ILE A C     1 
ATOM   726   O  O     . ILE C 3 59   ? -35.998 115.981 27.145  1.00 35.34  ? 59   ILE A O     1 
ATOM   727   C  CB    . ILE C 3 59   ? -34.504 114.693 29.466  1.00 31.33  ? 59   ILE A CB    1 
ATOM   728   C  CG1   . ILE C 3 59   ? -33.451 114.571 30.568  1.00 32.87  ? 59   ILE A CG1   1 
ATOM   729   C  CG2   . ILE C 3 59   ? -34.827 113.328 28.859  1.00 28.89  ? 59   ILE A CG2   1 
ATOM   730   C  CD1   . ILE C 3 59   ? -33.762 113.555 31.648  1.00 38.01  ? 59   ILE A CD1   1 
ATOM   731   N  N     . PRO C 3 60   ? -34.227 115.159 26.000  1.00 35.66  ? 60   PRO A N     1 
ATOM   732   C  CA    . PRO C 3 60   ? -34.854 115.042 24.678  1.00 35.83  ? 60   PRO A CA    1 
ATOM   733   C  C     . PRO C 3 60   ? -36.143 114.232 24.679  1.00 37.71  ? 60   PRO A C     1 
ATOM   734   O  O     . PRO C 3 60   ? -36.155 113.059 25.053  1.00 37.17  ? 60   PRO A O     1 
ATOM   735   C  CB    . PRO C 3 60   ? -33.773 114.369 23.831  1.00 34.93  ? 60   PRO A CB    1 
ATOM   736   C  CG    . PRO C 3 60   ? -32.504 114.756 24.504  1.00 34.37  ? 60   PRO A CG    1 
ATOM   737   C  CD    . PRO C 3 60   ? -32.858 114.614 25.966  1.00 35.10  ? 60   PRO A CD    1 
ATOM   738   N  N     . PRO C 3 61   ? -37.252 114.852 24.252  1.00 39.06  ? 61   PRO A N     1 
ATOM   739   C  CA    . PRO C 3 61   ? -38.521 114.119 24.229  1.00 37.88  ? 61   PRO A CA    1 
ATOM   740   C  C     . PRO C 3 61   ? -38.483 112.920 23.278  1.00 36.15  ? 61   PRO A C     1 
ATOM   741   O  O     . PRO C 3 61   ? -39.119 111.905 23.536  1.00 35.90  ? 61   PRO A O     1 
ATOM   742   C  CB    . PRO C 3 61   ? -39.526 115.186 23.789  1.00 37.52  ? 61   PRO A CB    1 
ATOM   743   C  CG    . PRO C 3 61   ? -38.926 116.452 24.334  1.00 37.74  ? 61   PRO A CG    1 
ATOM   744   C  CD    . PRO C 3 61   ? -37.466 116.287 23.988  1.00 37.44  ? 61   PRO A CD    1 
ATOM   745   N  N     . THR C 3 62   ? -37.726 113.035 22.191  1.00 36.12  ? 62   THR A N     1 
ATOM   746   C  CA    . THR C 3 62   ? -37.639 111.951 21.211  1.00 37.47  ? 62   THR A CA    1 
ATOM   747   C  C     . THR C 3 62   ? -36.987 110.676 21.734  1.00 36.74  ? 62   THR A C     1 
ATOM   748   O  O     . THR C 3 62   ? -36.918 109.672 21.036  1.00 38.14  ? 62   THR A O     1 
ATOM   749   C  CB    . THR C 3 62   ? -36.901 112.400 19.926  1.00 39.11  ? 62   THR A CB    1 
ATOM   750   O  OG1   . THR C 3 62   ? -35.716 113.127 20.274  1.00 40.48  ? 62   THR A OG1   1 
ATOM   751   C  CG2   . THR C 3 62   ? -37.808 113.283 19.071  1.00 40.58  ? 62   THR A CG2   1 
ATOM   752   N  N     . ILE C 3 63   ? -36.514 110.713 22.967  1.00 35.58  ? 63   ILE A N     1 
ATOM   753   C  CA    . ILE C 3 63   ? -35.901 109.543 23.558  1.00 34.86  ? 63   ILE A CA    1 
ATOM   754   C  C     . ILE C 3 63   ? -36.983 108.530 23.895  1.00 35.76  ? 63   ILE A C     1 
ATOM   755   O  O     . ILE C 3 63   ? -36.709 107.337 24.026  1.00 37.10  ? 63   ILE A O     1 
ATOM   756   C  CB    . ILE C 3 63   ? -35.118 109.931 24.843  1.00 34.85  ? 63   ILE A CB    1 
ATOM   757   C  CG1   . ILE C 3 63   ? -33.688 110.327 24.465  1.00 33.52  ? 63   ILE A CG1   1 
ATOM   758   C  CG2   . ILE C 3 63   ? -35.141 108.798 25.858  1.00 34.15  ? 63   ILE A CG2   1 
ATOM   759   C  CD1   . ILE C 3 63   ? -32.886 110.875 25.608  1.00 32.89  ? 63   ILE A CD1   1 
ATOM   760   N  N     . TYR C 3 64   ? -38.220 109.006 24.001  1.00 35.85  ? 64   TYR A N     1 
ATOM   761   C  CA    . TYR C 3 64   ? -39.345 108.151 24.373  1.00 35.76  ? 64   TYR A CA    1 
ATOM   762   C  C     . TYR C 3 64   ? -40.239 107.704 23.222  1.00 36.35  ? 64   TYR A C     1 
ATOM   763   O  O     . TYR C 3 64   ? -40.793 106.607 23.233  1.00 37.81  ? 64   TYR A O     1 
ATOM   764   C  CB    . TYR C 3 64   ? -40.199 108.872 25.412  1.00 33.23  ? 64   TYR A CB    1 
ATOM   765   C  CG    . TYR C 3 64   ? -39.424 109.337 26.622  1.00 30.86  ? 64   TYR A CG    1 
ATOM   766   C  CD1   . TYR C 3 64   ? -38.865 108.414 27.511  1.00 29.06  ? 64   TYR A CD1   1 
ATOM   767   C  CD2   . TYR C 3 64   ? -39.259 110.701 26.892  1.00 28.34  ? 64   TYR A CD2   1 
ATOM   768   C  CE1   . TYR C 3 64   ? -38.164 108.837 28.644  1.00 27.42  ? 64   TYR A CE1   1 
ATOM   769   C  CE2   . TYR C 3 64   ? -38.553 111.135 28.024  1.00 27.27  ? 64   TYR A CE2   1 
ATOM   770   C  CZ    . TYR C 3 64   ? -38.011 110.195 28.892  1.00 26.89  ? 64   TYR A CZ    1 
ATOM   771   O  OH    . TYR C 3 64   ? -37.298 110.599 29.993  1.00 24.72  ? 64   TYR A OH    1 
ATOM   772   N  N     . THR C 3 65   ? -40.390 108.559 22.228  1.00 37.72  ? 65   THR A N     1 
ATOM   773   C  CA    . THR C 3 65   ? -41.242 108.238 21.093  1.00 38.32  ? 65   THR A CA    1 
ATOM   774   C  C     . THR C 3 65   ? -40.403 107.724 19.926  1.00 37.69  ? 65   THR A C     1 
ATOM   775   O  O     . THR C 3 65   ? -39.769 108.504 19.207  1.00 36.21  ? 65   THR A O     1 
ATOM   776   C  CB    . THR C 3 65   ? -42.026 109.487 20.673  1.00 39.23  ? 65   THR A CB    1 
ATOM   777   O  OG1   . THR C 3 65   ? -41.115 110.467 20.147  1.00 39.50  ? 65   THR A OG1   1 
ATOM   778   C  CG2   . THR C 3 65   ? -42.734 110.087 21.898  1.00 38.92  ? 65   THR A CG2   1 
ATOM   779   N  N     . LYS C 3 66   ? -40.387 106.405 19.753  1.00 36.54  ? 66   LYS A N     1 
ATOM   780   C  CA    . LYS C 3 66   ? -39.618 105.803 18.671  1.00 37.19  ? 66   LYS A CA    1 
ATOM   781   C  C     . LYS C 3 66   ? -40.481 105.030 17.689  1.00 37.78  ? 66   LYS A C     1 
ATOM   782   O  O     . LYS C 3 66   ? -41.536 104.507 18.049  1.00 38.95  ? 66   LYS A O     1 
ATOM   783   C  CB    . LYS C 3 66   ? -38.518 104.892 19.232  1.00 37.12  ? 66   LYS A CB    1 
ATOM   784   C  CG    . LYS C 3 66   ? -37.343 105.659 19.808  1.00 34.80  ? 66   LYS A CG    1 
ATOM   785   C  CD    . LYS C 3 66   ? -36.797 106.632 18.771  1.00 32.60  ? 66   LYS A CD    1 
ATOM   786   C  CE    . LYS C 3 66   ? -35.710 107.511 19.356  1.00 33.82  ? 66   LYS A CE    1 
ATOM   787   N  NZ    . LYS C 3 66   ? -35.169 108.465 18.365  1.00 31.19  ? 66   LYS A NZ    1 
ATOM   788   N  N     . PRO C 3 67   ? -40.039 104.953 16.423  1.00 37.71  ? 67   PRO A N     1 
ATOM   789   C  CA    . PRO C 3 67   ? -40.759 104.247 15.361  1.00 37.39  ? 67   PRO A CA    1 
ATOM   790   C  C     . PRO C 3 67   ? -40.811 102.749 15.621  1.00 37.44  ? 67   PRO A C     1 
ATOM   791   O  O     . PRO C 3 67   ? -40.276 102.256 16.611  1.00 37.41  ? 67   PRO A O     1 
ATOM   792   C  CB    . PRO C 3 67   ? -39.930 104.549 14.109  1.00 36.78  ? 67   PRO A CB    1 
ATOM   793   C  CG    . PRO C 3 67   ? -39.117 105.752 14.477  1.00 37.99  ? 67   PRO A CG    1 
ATOM   794   C  CD    . PRO C 3 67   ? -38.782 105.520 15.909  1.00 36.60  ? 67   PRO A CD    1 
ATOM   795   N  N     . SER C 3 68   ? -41.462 102.034 14.713  1.00 37.35  ? 68   SER A N     1 
ATOM   796   C  CA    . SER C 3 68   ? -41.544 100.587 14.799  1.00 36.88  ? 68   SER A CA    1 
ATOM   797   C  C     . SER C 3 68   ? -40.201 100.084 14.290  1.00 36.53  ? 68   SER A C     1 
ATOM   798   O  O     . SER C 3 68   ? -39.533 100.759 13.502  1.00 37.10  ? 68   SER A O     1 
ATOM   799   C  CB    . SER C 3 68   ? -42.660 100.058 13.895  1.00 37.07  ? 68   SER A CB    1 
ATOM   800   O  OG    . SER C 3 68   ? -42.559 98.652  13.731  1.00 35.64  ? 68   SER A OG    1 
ATOM   801   N  N     . HIS C 3 69   ? -39.809 98.901  14.736  1.00 35.75  ? 69   HIS A N     1 
ATOM   802   C  CA    . HIS C 3 69   ? -38.544 98.312  14.322  1.00 35.22  ? 69   HIS A CA    1 
ATOM   803   C  C     . HIS C 3 69   ? -38.595 97.824  12.874  1.00 35.67  ? 69   HIS A C     1 
ATOM   804   O  O     . HIS C 3 69   ? -37.568 97.760  12.193  1.00 35.77  ? 69   HIS A O     1 
ATOM   805   C  CB    . HIS C 3 69   ? -38.241 97.101  15.185  1.00 33.70  ? 69   HIS A CB    1 
ATOM   806   C  CG    . HIS C 3 69   ? -39.104 95.926  14.856  1.00 33.00  ? 69   HIS A CG    1 
ATOM   807   N  ND1   . HIS C 3 69   ? -40.438 95.870  15.192  1.00 31.11  ? 69   HIS A ND1   1 
ATOM   808   C  CD2   . HIS C 3 69   ? -38.849 94.806  14.137  1.00 33.41  ? 69   HIS A CD2   1 
ATOM   809   C  CE1   . HIS C 3 69   ? -40.968 94.768  14.691  1.00 32.48  ? 69   HIS A CE1   1 
ATOM   810   N  NE2   . HIS C 3 69   ? -40.025 94.104  14.046  1.00 31.85  ? 69   HIS A NE2   1 
ATOM   811   N  N     . ASP C 3 70   ? -39.796 97.472  12.419  1.00 35.90  ? 70   ASP A N     1 
ATOM   812   C  CA    . ASP C 3 70   ? -39.989 96.914  11.088  1.00 35.24  ? 70   ASP A CA    1 
ATOM   813   C  C     . ASP C 3 70   ? -39.327 97.571  9.865   1.00 35.60  ? 70   ASP A C     1 
ATOM   814   O  O     . ASP C 3 70   ? -38.919 96.866  8.943   1.00 35.80  ? 70   ASP A O     1 
ATOM   815   C  CB    . ASP C 3 70   ? -41.491 96.677  10.841  1.00 35.97  ? 70   ASP A CB    1 
ATOM   816   C  CG    . ASP C 3 70   ? -42.284 97.960  10.616  1.00 38.22  ? 70   ASP A CG    1 
ATOM   817   O  OD1   . ASP C 3 70   ? -41.734 99.069  10.816  1.00 38.94  ? 70   ASP A OD1   1 
ATOM   818   O  OD2   . ASP C 3 70   ? -43.479 97.838  10.239  1.00 34.63  ? 70   ASP A OD2   1 
ATOM   819   N  N     . SER C 3 71   ? -39.185 98.892  9.846   1.00 35.12  ? 71   SER A N     1 
ATOM   820   C  CA    . SER C 3 71   ? -38.564 99.546  8.696   1.00 33.29  ? 71   SER A CA    1 
ATOM   821   C  C     . SER C 3 71   ? -37.042 99.505  8.754   1.00 32.42  ? 71   SER A C     1 
ATOM   822   O  O     . SER C 3 71   ? -36.364 99.897  7.797   1.00 31.47  ? 71   SER A O     1 
ATOM   823   C  CB    . SER C 3 71   ? -39.028 100.999 8.605   1.00 33.39  ? 71   SER A CB    1 
ATOM   824   O  OG    . SER C 3 71   ? -38.778 101.692 9.813   1.00 36.36  ? 71   SER A OG    1 
ATOM   825   N  N     . TYR C 3 72   ? -36.513 99.024  9.877   1.00 31.06  ? 72   TYR A N     1 
ATOM   826   C  CA    . TYR C 3 72   ? -35.068 98.930  10.096  1.00 29.73  ? 72   TYR A CA    1 
ATOM   827   C  C     . TYR C 3 72   ? -34.478 97.585  9.698   1.00 30.18  ? 72   TYR A C     1 
ATOM   828   O  O     . TYR C 3 72   ? -33.286 97.343  9.875   1.00 31.36  ? 72   TYR A O     1 
ATOM   829   C  CB    . TYR C 3 72   ? -34.761 99.220  11.563  1.00 26.50  ? 72   TYR A CB    1 
ATOM   830   C  CG    . TYR C 3 72   ? -34.927 100.677 11.905  1.00 26.28  ? 72   TYR A CG    1 
ATOM   831   C  CD1   . TYR C 3 72   ? -33.917 101.590 11.639  1.00 27.82  ? 72   TYR A CD1   1 
ATOM   832   C  CD2   . TYR C 3 72   ? -36.120 101.160 12.432  1.00 26.60  ? 72   TYR A CD2   1 
ATOM   833   C  CE1   . TYR C 3 72   ? -34.091 102.951 11.887  1.00 26.94  ? 72   TYR A CE1   1 
ATOM   834   C  CE2   . TYR C 3 72   ? -36.302 102.513 12.679  1.00 23.45  ? 72   TYR A CE2   1 
ATOM   835   C  CZ    . TYR C 3 72   ? -35.287 103.401 12.406  1.00 25.65  ? 72   TYR A CZ    1 
ATOM   836   O  OH    . TYR C 3 72   ? -35.457 104.747 12.648  1.00 28.14  ? 72   TYR A OH    1 
ATOM   837   N  N     . TYR C 3 73   ? -35.319 96.713  9.157   1.00 31.72  ? 73   TYR A N     1 
ATOM   838   C  CA    . TYR C 3 73   ? -34.896 95.389  8.737   1.00 32.47  ? 73   TYR A CA    1 
ATOM   839   C  C     . TYR C 3 73   ? -35.470 95.000  7.382   1.00 33.96  ? 73   TYR A C     1 
ATOM   840   O  O     . TYR C 3 73   ? -36.357 95.672  6.835   1.00 32.63  ? 73   TYR A O     1 
ATOM   841   C  CB    . TYR C 3 73   ? -35.332 94.359  9.766   1.00 33.42  ? 73   TYR A CB    1 
ATOM   842   C  CG    . TYR C 3 73   ? -34.619 94.477  11.081  1.00 35.19  ? 73   TYR A CG    1 
ATOM   843   C  CD1   . TYR C 3 73   ? -33.375 93.874  11.278  1.00 33.76  ? 73   TYR A CD1   1 
ATOM   844   C  CD2   . TYR C 3 73   ? -35.180 95.201  12.133  1.00 34.93  ? 73   TYR A CD2   1 
ATOM   845   C  CE1   . TYR C 3 73   ? -32.714 93.988  12.488  1.00 34.68  ? 73   TYR A CE1   1 
ATOM   846   C  CE2   . TYR C 3 73   ? -34.521 95.326  13.344  1.00 34.72  ? 73   TYR A CE2   1 
ATOM   847   C  CZ    . TYR C 3 73   ? -33.291 94.717  13.515  1.00 35.10  ? 73   TYR A CZ    1 
ATOM   848   O  OH    . TYR C 3 73   ? -32.632 94.853  14.709  1.00 37.45  ? 73   TYR A OH    1 
ATOM   849   N  N     . TYR C 3 74   ? -34.956 93.896  6.852   1.00 34.70  ? 74   TYR A N     1 
ATOM   850   C  CA    . TYR C 3 74   ? -35.395 93.383  5.565   1.00 35.00  ? 74   TYR A CA    1 
ATOM   851   C  C     . TYR C 3 74   ? -34.811 91.988  5.375   1.00 35.10  ? 74   TYR A C     1 
ATOM   852   O  O     . TYR C 3 74   ? -33.897 91.584  6.090   1.00 34.39  ? 74   TYR A O     1 
ATOM   853   C  CB    . TYR C 3 74   ? -34.914 94.312  4.447   1.00 35.53  ? 74   TYR A CB    1 
ATOM   854   C  CG    . TYR C 3 74   ? -33.467 94.109  4.051   1.00 36.82  ? 74   TYR A CG    1 
ATOM   855   C  CD1   . TYR C 3 74   ? -33.129 93.316  2.954   1.00 36.32  ? 74   TYR A CD1   1 
ATOM   856   C  CD2   . TYR C 3 74   ? -32.434 94.714  4.766   1.00 38.41  ? 74   TYR A CD2   1 
ATOM   857   C  CE1   . TYR C 3 74   ? -31.803 93.135  2.574   1.00 36.30  ? 74   TYR A CE1   1 
ATOM   858   C  CE2   . TYR C 3 74   ? -31.094 94.537  4.394   1.00 38.19  ? 74   TYR A CE2   1 
ATOM   859   C  CZ    . TYR C 3 74   ? -30.794 93.749  3.296   1.00 37.70  ? 74   TYR A CZ    1 
ATOM   860   O  OH    . TYR C 3 74   ? -29.489 93.587  2.910   1.00 37.20  ? 74   TYR A OH    1 
ATOM   861   N  N     . ILE C 3 75   ? -35.355 91.247  4.421   1.00 35.99  ? 75   ILE A N     1 
ATOM   862   C  CA    . ILE C 3 75   ? -34.858 89.912  4.123   1.00 35.96  ? 75   ILE A CA    1 
ATOM   863   C  C     . ILE C 3 75   ? -33.973 90.030  2.875   1.00 36.65  ? 75   ILE A C     1 
ATOM   864   O  O     . ILE C 3 75   ? -34.413 90.586  1.862   1.00 37.17  ? 75   ILE A O     1 
ATOM   865   C  CB    . ILE C 3 75   ? -36.016 88.959  3.815   1.00 35.36  ? 75   ILE A CB    1 
ATOM   866   C  CG1   . ILE C 3 75   ? -37.019 88.963  4.974   1.00 35.51  ? 75   ILE A CG1   1 
ATOM   867   C  CG2   . ILE C 3 75   ? -35.471 87.563  3.548   1.00 35.93  ? 75   ILE A CG2   1 
ATOM   868   C  CD1   . ILE C 3 75   ? -36.486 88.372  6.262   1.00 34.91  ? 75   ILE A CD1   1 
ATOM   869   N  N     . ASP C 3 76   ? -32.737 89.530  2.935   1.00 35.33  ? 76   ASP A N     1 
ATOM   870   C  CA    . ASP C 3 76   ? -31.853 89.621  1.774   1.00 34.54  ? 76   ASP A CA    1 
ATOM   871   C  C     . ASP C 3 76   ? -32.017 88.461  0.779   1.00 34.62  ? 76   ASP A C     1 
ATOM   872   O  O     . ASP C 3 76   ? -32.848 87.566  0.962   1.00 33.80  ? 76   ASP A O     1 
ATOM   873   C  CB    . ASP C 3 76   ? -30.382 89.738  2.203   1.00 33.68  ? 76   ASP A CB    1 
ATOM   874   C  CG    . ASP C 3 76   ? -29.865 88.492  2.908   1.00 32.62  ? 76   ASP A CG    1 
ATOM   875   O  OD1   . ASP C 3 76   ? -30.300 87.376  2.569   1.00 33.01  ? 76   ASP A OD1   1 
ATOM   876   O  OD2   . ASP C 3 76   ? -28.999 88.628  3.795   1.00 32.02  ? 76   ASP A OD2   1 
ATOM   877   N  N     . ALA C 3 77   ? -31.209 88.486  -0.274  1.00 34.76  ? 77   ALA A N     1 
ATOM   878   C  CA    . ALA C 3 77   ? -31.275 87.471  -1.319  1.00 35.94  ? 77   ALA A CA    1 
ATOM   879   C  C     . ALA C 3 77   ? -31.068 86.038  -0.841  1.00 35.09  ? 77   ALA A C     1 
ATOM   880   O  O     . ALA C 3 77   ? -31.591 85.103  -1.439  1.00 35.67  ? 77   ALA A O     1 
ATOM   881   C  CB    . ALA C 3 77   ? -30.274 87.801  -2.423  1.00 34.80  ? 77   ALA A CB    1 
ATOM   882   N  N     . LEU C 3 78   ? -30.306 85.863  0.230   1.00 35.33  ? 78   LEU A N     1 
ATOM   883   C  CA    . LEU C 3 78   ? -30.052 84.528  0.756   1.00 33.61  ? 78   LEU A CA    1 
ATOM   884   C  C     . LEU C 3 78   ? -31.028 84.182  1.880   1.00 32.50  ? 78   LEU A C     1 
ATOM   885   O  O     . LEU C 3 78   ? -30.831 83.220  2.617   1.00 32.25  ? 78   LEU A O     1 
ATOM   886   C  CB    . LEU C 3 78   ? -28.604 84.426  1.244   1.00 33.34  ? 78   LEU A CB    1 
ATOM   887   C  CG    . LEU C 3 78   ? -27.547 84.670  0.163   1.00 33.77  ? 78   LEU A CG    1 
ATOM   888   C  CD1   . LEU C 3 78   ? -26.151 84.587  0.756   1.00 33.02  ? 78   LEU A CD1   1 
ATOM   889   C  CD2   . LEU C 3 78   ? -27.712 83.643  -0.937  1.00 32.83  ? 78   LEU A CD2   1 
ATOM   890   N  N     . ASN C 3 79   ? -32.079 84.984  2.002   1.00 31.80  ? 79   ASN A N     1 
ATOM   891   C  CA    . ASN C 3 79   ? -33.120 84.769  3.001   1.00 32.44  ? 79   ASN A CA    1 
ATOM   892   C  C     . ASN C 3 79   ? -32.721 85.027  4.455   1.00 32.03  ? 79   ASN A C     1 
ATOM   893   O  O     . ASN C 3 79   ? -33.438 84.634  5.376   1.00 30.35  ? 79   ASN A O     1 
ATOM   894   C  CB    . ASN C 3 79   ? -33.683 83.349  2.857   1.00 33.40  ? 79   ASN A CB    1 
ATOM   895   C  CG    . ASN C 3 79   ? -35.102 83.228  3.386   1.00 36.03  ? 79   ASN A CG    1 
ATOM   896   O  OD1   . ASN C 3 79   ? -35.898 84.158  3.267   1.00 38.13  ? 79   ASN A OD1   1 
ATOM   897   N  ND2   . ASN C 3 79   ? -35.431 82.074  3.956   1.00 37.88  ? 79   ASN A ND2   1 
ATOM   898   N  N     . ARG C 3 80   ? -31.589 85.694  4.665   1.00 32.21  ? 80   ARG A N     1 
ATOM   899   C  CA    . ARG C 3 80   ? -31.152 85.998  6.023   1.00 33.09  ? 80   ARG A CA    1 
ATOM   900   C  C     . ARG C 3 80   ? -31.867 87.271  6.491   1.00 34.07  ? 80   ARG A C     1 
ATOM   901   O  O     . ARG C 3 80   ? -32.145 88.161  5.688   1.00 34.42  ? 80   ARG A O     1 
ATOM   902   C  CB    . ARG C 3 80   ? -29.635 86.255  6.096   1.00 32.30  ? 80   ARG A CB    1 
ATOM   903   C  CG    . ARG C 3 80   ? -28.739 85.592  5.045   1.00 32.92  ? 80   ARG A CG    1 
ATOM   904   C  CD    . ARG C 3 80   ? -27.282 85.733  5.476   1.00 33.00  ? 80   ARG A CD    1 
ATOM   905   N  NE    . ARG C 3 80   ? -26.290 85.695  4.397   1.00 34.84  ? 80   ARG A NE    1 
ATOM   906   C  CZ    . ARG C 3 80   ? -26.113 86.669  3.508   1.00 37.17  ? 80   ARG A CZ    1 
ATOM   907   N  NH1   . ARG C 3 80   ? -26.863 87.760  3.551   1.00 40.03  ? 80   ARG A NH1   1 
ATOM   908   N  NH2   . ARG C 3 80   ? -25.161 86.581  2.595   1.00 36.85  ? 80   ARG A NH2   1 
ATOM   909   N  N     . VAL C 3 81   ? -32.191 87.356  7.777   1.00 34.79  ? 81   VAL A N     1 
ATOM   910   C  CA    . VAL C 3 81   ? -32.805 88.582  8.271   1.00 35.12  ? 81   VAL A CA    1 
ATOM   911   C  C     . VAL C 3 81   ? -31.647 89.568  8.387   1.00 35.30  ? 81   VAL A C     1 
ATOM   912   O  O     . VAL C 3 81   ? -30.606 89.260  8.987   1.00 34.14  ? 81   VAL A O     1 
ATOM   913   C  CB    . VAL C 3 81   ? -33.445 88.424  9.654   1.00 33.60  ? 81   VAL A CB    1 
ATOM   914   C  CG1   . VAL C 3 81   ? -33.744 89.799  10.228  1.00 31.79  ? 81   VAL A CG1   1 
ATOM   915   C  CG2   . VAL C 3 81   ? -34.727 87.621  9.543   1.00 34.76  ? 81   VAL A CG2   1 
ATOM   916   N  N     . ARG C 3 82   ? -31.825 90.745  7.802   1.00 33.74  ? 82   ARG A N     1 
ATOM   917   C  CA    . ARG C 3 82   ? -30.775 91.741  7.824   1.00 34.15  ? 82   ARG A CA    1 
ATOM   918   C  C     . ARG C 3 82   ? -31.235 93.087  8.311   1.00 33.48  ? 82   ARG A C     1 
ATOM   919   O  O     . ARG C 3 82   ? -32.416 93.429  8.279   1.00 35.10  ? 82   ARG A O     1 
ATOM   920   C  CB    . ARG C 3 82   ? -30.160 91.903  6.426   1.00 33.99  ? 82   ARG A CB    1 
ATOM   921   C  CG    . ARG C 3 82   ? -29.359 90.704  5.965   1.00 35.32  ? 82   ARG A CG    1 
ATOM   922   C  CD    . ARG C 3 82   ? -28.067 90.560  6.761   1.00 36.04  ? 82   ARG A CD    1 
ATOM   923   N  NE    . ARG C 3 82   ? -27.125 91.632  6.446   1.00 38.34  ? 82   ARG A NE    1 
ATOM   924   C  CZ    . ARG C 3 82   ? -26.575 91.816  5.247   1.00 37.86  ? 82   ARG A CZ    1 
ATOM   925   N  NH1   . ARG C 3 82   ? -26.870 90.994  4.242   1.00 36.03  ? 82   ARG A NH1   1 
ATOM   926   N  NH2   . ARG C 3 82   ? -25.732 92.822  5.053   1.00 36.33  ? 82   ARG A NH2   1 
ATOM   927   N  N     . ARG C 3 83   ? -30.262 93.854  8.758   1.00 32.53  ? 83   ARG A N     1 
ATOM   928   C  CA    . ARG C 3 83   ? -30.498 95.183  9.243   1.00 32.53  ? 83   ARG A CA    1 
ATOM   929   C  C     . ARG C 3 83   ? -30.442 96.095  8.018   1.00 32.27  ? 83   ARG A C     1 
ATOM   930   O  O     . ARG C 3 83   ? -29.504 96.028  7.219   1.00 31.88  ? 83   ARG A O     1 
ATOM   931   C  CB    . ARG C 3 83   ? -29.407 95.524  10.248  1.00 33.60  ? 83   ARG A CB    1 
ATOM   932   C  CG    . ARG C 3 83   ? -29.481 96.898  10.803  1.00 36.00  ? 83   ARG A CG    1 
ATOM   933   C  CD    . ARG C 3 83   ? -30.709 97.133  11.638  1.00 33.23  ? 83   ARG A CD    1 
ATOM   934   N  NE    . ARG C 3 83   ? -30.536 98.412  12.311  1.00 36.34  ? 83   ARG A NE    1 
ATOM   935   C  CZ    . ARG C 3 83   ? -30.461 99.582  11.689  1.00 34.72  ? 83   ARG A CZ    1 
ATOM   936   N  NH1   . ARG C 3 83   ? -30.555 99.649  10.375  1.00 36.73  ? 83   ARG A NH1   1 
ATOM   937   N  NH2   . ARG C 3 83   ? -30.260 100.687 12.383  1.00 39.36  ? 83   ARG A NH2   1 
ATOM   938   N  N     . LYS C 3 84   ? -31.459 96.929  7.862   1.00 32.15  ? 84   LYS A N     1 
ATOM   939   C  CA    . LYS C 3 84   ? -31.529 97.841  6.729   1.00 31.72  ? 84   LYS A CA    1 
ATOM   940   C  C     . LYS C 3 84   ? -30.858 99.168  7.080   1.00 30.56  ? 84   LYS A C     1 
ATOM   941   O  O     . LYS C 3 84   ? -31.264 99.867  8.006   1.00 29.04  ? 84   LYS A O     1 
ATOM   942   C  CB    . LYS C 3 84   ? -32.992 98.040  6.350   1.00 33.63  ? 84   LYS A CB    1 
ATOM   943   C  CG    . LYS C 3 84   ? -33.248 98.632  4.988   1.00 37.50  ? 84   LYS A CG    1 
ATOM   944   C  CD    . LYS C 3 84   ? -33.184 100.141 5.000   1.00 40.83  ? 84   LYS A CD    1 
ATOM   945   C  CE    . LYS C 3 84   ? -33.933 100.733 3.797   1.00 43.77  ? 84   LYS A CE    1 
ATOM   946   N  NZ    . LYS C 3 84   ? -35.417 100.542 3.908   1.00 44.81  ? 84   LYS A NZ    1 
ATOM   947   N  N     . THR C 3 85   ? -29.818 99.492  6.323   1.00 31.23  ? 85   THR A N     1 
ATOM   948   C  CA    . THR C 3 85   ? -29.023 100.705 6.509   1.00 32.75  ? 85   THR A CA    1 
ATOM   949   C  C     . THR C 3 85   ? -29.693 102.034 6.163   1.00 32.93  ? 85   THR A C     1 
ATOM   950   O  O     . THR C 3 85   ? -30.461 102.123 5.206   1.00 34.26  ? 85   THR A O     1 
ATOM   951   C  CB    . THR C 3 85   ? -27.720 100.592 5.695   1.00 32.93  ? 85   THR A CB    1 
ATOM   952   O  OG1   . THR C 3 85   ? -26.773 99.826  6.449   1.00 35.32  ? 85   THR A OG1   1 
ATOM   953   C  CG2   . THR C 3 85   ? -27.154 101.980 5.346   1.00 31.67  ? 85   THR A CG2   1 
ATOM   954   N  N     . TYR C 3 86   ? -29.370 103.069 6.938   1.00 32.66  ? 86   TYR A N     1 
ATOM   955   C  CA    . TYR C 3 86   ? -29.918 104.407 6.722   1.00 32.72  ? 86   TYR A CA    1 
ATOM   956   C  C     . TYR C 3 86   ? -28.870 105.506 6.913   1.00 32.70  ? 86   TYR A C     1 
ATOM   957   O  O     . TYR C 3 86   ? -28.838 106.482 6.162   1.00 33.06  ? 86   TYR A O     1 
ATOM   958   C  CB    . TYR C 3 86   ? -31.095 104.666 7.676   1.00 32.63  ? 86   TYR A CB    1 
ATOM   959   C  CG    . TYR C 3 86   ? -32.372 103.958 7.293   1.00 31.86  ? 86   TYR A CG    1 
ATOM   960   C  CD1   . TYR C 3 86   ? -33.096 104.352 6.168   1.00 32.13  ? 86   TYR A CD1   1 
ATOM   961   C  CD2   . TYR C 3 86   ? -32.845 102.879 8.041   1.00 31.35  ? 86   TYR A CD2   1 
ATOM   962   C  CE1   . TYR C 3 86   ? -34.267 103.687 5.791   1.00 33.86  ? 86   TYR A CE1   1 
ATOM   963   C  CE2   . TYR C 3 86   ? -34.006 102.206 7.679   1.00 33.36  ? 86   TYR A CE2   1 
ATOM   964   C  CZ    . TYR C 3 86   ? -34.718 102.614 6.547   1.00 35.04  ? 86   TYR A CZ    1 
ATOM   965   O  OH    . TYR C 3 86   ? -35.857 101.936 6.159   1.00 33.31  ? 86   TYR A OH    1 
ATOM   966   N  N     . GLN C 3 87   ? -28.014 105.346 7.916   1.00 32.88  ? 87   GLN A N     1 
ATOM   967   C  CA    . GLN C 3 87   ? -26.994 106.341 8.200   1.00 32.97  ? 87   GLN A CA    1 
ATOM   968   C  C     . GLN C 3 87   ? -25.610 105.920 7.731   1.00 33.92  ? 87   GLN A C     1 
ATOM   969   O  O     . GLN C 3 87   ? -24.625 106.555 8.089   1.00 36.99  ? 87   GLN A O     1 
ATOM   970   C  CB    . GLN C 3 87   ? -26.943 106.630 9.699   1.00 33.02  ? 87   GLN A CB    1 
ATOM   971   C  CG    . GLN C 3 87   ? -28.252 107.118 10.303  1.00 36.54  ? 87   GLN A CG    1 
ATOM   972   C  CD    . GLN C 3 87   ? -28.727 108.424 9.693   1.00 38.74  ? 87   GLN A CD    1 
ATOM   973   O  OE1   . GLN C 3 87   ? -28.020 109.438 9.726   1.00 38.45  ? 87   GLN A OE1   1 
ATOM   974   N  NE2   . GLN C 3 87   ? -29.932 108.407 9.130   1.00 38.95  ? 87   GLN A NE2   1 
ATOM   975   N  N     . GLY C 3 88   ? -25.527 104.862 6.931   1.00 33.29  ? 88   GLY A N     1 
ATOM   976   C  CA    . GLY C 3 88   ? -24.230 104.407 6.460   1.00 33.40  ? 88   GLY A CA    1 
ATOM   977   C  C     . GLY C 3 88   ? -24.045 102.908 6.615   1.00 34.09  ? 88   GLY A C     1 
ATOM   978   O  O     . GLY C 3 88   ? -24.849 102.261 7.278   1.00 33.88  ? 88   GLY A O     1 
ATOM   979   N  N     . PRO C 3 89   ? -22.987 102.326 6.026   1.00 35.94  ? 89   PRO A N     1 
ATOM   980   C  CA    . PRO C 3 89   ? -22.720 100.881 6.108   1.00 37.03  ? 89   PRO A CA    1 
ATOM   981   C  C     . PRO C 3 89   ? -22.543 100.396 7.540   1.00 38.04  ? 89   PRO A C     1 
ATOM   982   O  O     . PRO C 3 89   ? -22.604 99.195  7.809   1.00 39.47  ? 89   PRO A O     1 
ATOM   983   C  CB    . PRO C 3 89   ? -21.440 100.711 5.290   1.00 37.71  ? 89   PRO A CB    1 
ATOM   984   C  CG    . PRO C 3 89   ? -21.471 101.891 4.340   1.00 37.90  ? 89   PRO A CG    1 
ATOM   985   C  CD    . PRO C 3 89   ? -21.950 103.005 5.230   1.00 36.00  ? 89   PRO A CD    1 
ATOM   986   N  N     . ASP C 3 90   ? -22.317 101.336 8.451   1.00 37.89  ? 90   ASP A N     1 
ATOM   987   C  CA    . ASP C 3 90   ? -22.139 101.017 9.861   1.00 38.58  ? 90   ASP A CA    1 
ATOM   988   C  C     . ASP C 3 90   ? -23.458 100.801 10.598  1.00 36.74  ? 90   ASP A C     1 
ATOM   989   O  O     . ASP C 3 90   ? -23.503 100.049 11.563  1.00 37.07  ? 90   ASP A O     1 
ATOM   990   C  CB    . ASP C 3 90   ? -21.390 102.143 10.574  1.00 42.05  ? 90   ASP A CB    1 
ATOM   991   C  CG    . ASP C 3 90   ? -19.895 102.017 10.453  1.00 44.31  ? 90   ASP A CG    1 
ATOM   992   O  OD1   . ASP C 3 90   ? -19.388 100.876 10.474  1.00 46.71  ? 90   ASP A OD1   1 
ATOM   993   O  OD2   . ASP C 3 90   ? -19.224 103.064 10.360  1.00 46.71  ? 90   ASP A OD2   1 
ATOM   994   N  N     . ASP C 3 91   ? -24.510 101.479 10.139  1.00 33.43  ? 91   ASP A N     1 
ATOM   995   C  CA    . ASP C 3 91   ? -25.837 101.429 10.749  1.00 30.16  ? 91   ASP A CA    1 
ATOM   996   C  C     . ASP C 3 91   ? -26.451 100.037 10.689  1.00 28.76  ? 91   ASP A C     1 
ATOM   997   O  O     . ASP C 3 91   ? -27.482 99.805  10.051  1.00 27.73  ? 91   ASP A O     1 
ATOM   998   C  CB    . ASP C 3 91   ? -26.730 102.456 10.060  1.00 31.11  ? 91   ASP A CB    1 
ATOM   999   C  CG    . ASP C 3 91   ? -28.056 102.621 10.744  1.00 30.48  ? 91   ASP A CG    1 
ATOM   1000  O  OD1   . ASP C 3 91   ? -28.112 102.404 11.972  1.00 31.79  ? 91   ASP A OD1   1 
ATOM   1001  O  OD2   . ASP C 3 91   ? -29.036 102.984 10.055  1.00 32.18  ? 91   ASP A OD2   1 
ATOM   1002  N  N     . VAL C 3 92   ? -25.822 99.132  11.426  1.00 26.68  ? 92   VAL A N     1 
ATOM   1003  C  CA    . VAL C 3 92   ? -26.187 97.735  11.459  1.00 24.93  ? 92   VAL A CA    1 
ATOM   1004  C  C     . VAL C 3 92   ? -26.539 97.203  12.851  1.00 25.11  ? 92   VAL A C     1 
ATOM   1005  O  O     . VAL C 3 92   ? -26.966 96.056  13.005  1.00 25.09  ? 92   VAL A O     1 
ATOM   1006  C  CB    . VAL C 3 92   ? -25.015 96.950  10.834  1.00 25.63  ? 92   VAL A CB    1 
ATOM   1007  C  CG1   . VAL C 3 92   ? -24.928 95.560  11.398  1.00 27.48  ? 92   VAL A CG1   1 
ATOM   1008  C  CG2   . VAL C 3 92   ? -25.181 96.914  9.332   1.00 20.03  ? 92   VAL A CG2   1 
ATOM   1009  N  N     . TYR C 3 93   ? -26.374 98.050  13.858  1.00 24.44  ? 93   TYR A N     1 
ATOM   1010  C  CA    . TYR C 3 93   ? -26.656 97.693  15.248  1.00 22.46  ? 93   TYR A CA    1 
ATOM   1011  C  C     . TYR C 3 93   ? -28.148 97.674  15.600  1.00 22.70  ? 93   TYR A C     1 
ATOM   1012  O  O     . TYR C 3 93   ? -29.015 97.652  14.720  1.00 23.13  ? 93   TYR A O     1 
ATOM   1013  C  CB    . TYR C 3 93   ? -25.900 98.669  16.162  1.00 22.63  ? 93   TYR A CB    1 
ATOM   1014  C  CG    . TYR C 3 93   ? -24.407 98.569  15.947  1.00 22.41  ? 93   TYR A CG    1 
ATOM   1015  C  CD1   . TYR C 3 93   ? -23.642 97.647  16.663  1.00 22.35  ? 93   TYR A CD1   1 
ATOM   1016  C  CD2   . TYR C 3 93   ? -23.776 99.306  14.945  1.00 20.10  ? 93   TYR A CD2   1 
ATOM   1017  C  CE1   . TYR C 3 93   ? -22.293 97.454  16.383  1.00 22.41  ? 93   TYR A CE1   1 
ATOM   1018  C  CE2   . TYR C 3 93   ? -22.430 99.114  14.659  1.00 21.15  ? 93   TYR A CE2   1 
ATOM   1019  C  CZ    . TYR C 3 93   ? -21.698 98.185  15.380  1.00 20.71  ? 93   TYR A CZ    1 
ATOM   1020  O  OH    . TYR C 3 93   ? -20.378 97.968  15.087  1.00 23.06  ? 93   TYR A OH    1 
ATOM   1021  N  N     . VAL C 3 94   ? -28.442 97.655  16.894  1.00 22.69  ? 94   VAL A N     1 
ATOM   1022  C  CA    . VAL C 3 94   ? -29.821 97.659  17.350  1.00 22.12  ? 94   VAL A CA    1 
ATOM   1023  C  C     . VAL C 3 94   ? -30.348 99.069  17.172  1.00 23.30  ? 94   VAL A C     1 
ATOM   1024  O  O     . VAL C 3 94   ? -29.751 100.030 17.647  1.00 21.52  ? 94   VAL A O     1 
ATOM   1025  C  CB    . VAL C 3 94   ? -29.948 97.270  18.845  1.00 21.55  ? 94   VAL A CB    1 
ATOM   1026  C  CG1   . VAL C 3 94   ? -31.408 97.319  19.268  1.00 22.33  ? 94   VAL A CG1   1 
ATOM   1027  C  CG2   . VAL C 3 94   ? -29.398 95.875  19.074  1.00 21.40  ? 94   VAL A CG2   1 
ATOM   1028  N  N     . PRO C 3 95   ? -31.471 99.212  16.457  1.00 24.75  ? 95   PRO A N     1 
ATOM   1029  C  CA    . PRO C 3 95   ? -32.066 100.531 16.226  1.00 25.21  ? 95   PRO A CA    1 
ATOM   1030  C  C     . PRO C 3 95   ? -32.903 100.968 17.432  1.00 25.18  ? 95   PRO A C     1 
ATOM   1031  O  O     . PRO C 3 95   ? -33.370 100.116 18.186  1.00 25.79  ? 95   PRO A O     1 
ATOM   1032  C  CB    . PRO C 3 95   ? -32.902 100.304 14.967  1.00 25.67  ? 95   PRO A CB    1 
ATOM   1033  C  CG    . PRO C 3 95   ? -33.358 98.883  15.130  1.00 23.92  ? 95   PRO A CG    1 
ATOM   1034  C  CD    . PRO C 3 95   ? -32.135 98.172  15.649  1.00 23.37  ? 95   PRO A CD    1 
ATOM   1035  N  N     . ASN C 3 96   ? -33.069 102.282 17.615  1.00 25.32  ? 96   ASN A N     1 
ATOM   1036  C  CA    . ASN C 3 96   ? -33.851 102.853 18.720  1.00 24.83  ? 96   ASN A CA    1 
ATOM   1037  C  C     . ASN C 3 96   ? -35.330 102.860 18.322  1.00 27.20  ? 96   ASN A C     1 
ATOM   1038  O  O     . ASN C 3 96   ? -35.797 103.738 17.583  1.00 26.12  ? 96   ASN A O     1 
ATOM   1039  C  CB    . ASN C 3 96   ? -33.397 104.285 19.016  1.00 25.25  ? 96   ASN A CB    1 
ATOM   1040  C  CG    . ASN C 3 96   ? -31.942 104.365 19.471  1.00 27.02  ? 96   ASN A CG    1 
ATOM   1041  O  OD1   . ASN C 3 96   ? -31.269 103.344 19.641  1.00 26.58  ? 96   ASN A OD1   1 
ATOM   1042  N  ND2   . ASN C 3 96   ? -31.454 105.588 19.676  1.00 25.27  ? 96   ASN A ND2   1 
ATOM   1043  N  N     . CYS C 3 97   ? -36.073 101.883 18.823  1.00 26.88  ? 97   CYS A N     1 
ATOM   1044  C  CA    . CYS C 3 97   ? -37.463 101.769 18.457  1.00 27.60  ? 97   CYS A CA    1 
ATOM   1045  C  C     . CYS C 3 97   ? -38.349 101.391 19.624  1.00 28.95  ? 97   CYS A C     1 
ATOM   1046  O  O     . CYS C 3 97   ? -37.875 101.117 20.732  1.00 29.09  ? 97   CYS A O     1 
ATOM   1047  C  CB    . CYS C 3 97   ? -37.609 100.709 17.355  1.00 28.32  ? 97   CYS A CB    1 
ATOM   1048  S  SG    . CYS C 3 97   ? -36.460 100.897 15.960  1.00 27.14  ? 97   CYS A SG    1 
ATOM   1049  N  N     . SER C 3 98   ? -39.650 101.386 19.357  1.00 28.93  ? 98   SER A N     1 
ATOM   1050  C  CA    . SER C 3 98   ? -40.626 101.004 20.355  1.00 30.37  ? 98   SER A CA    1 
ATOM   1051  C  C     . SER C 3 98   ? -40.415 99.506  20.529  1.00 30.28  ? 98   SER A C     1 
ATOM   1052  O  O     . SER C 3 98   ? -39.672 98.884  19.759  1.00 31.32  ? 98   SER A O     1 
ATOM   1053  C  CB    . SER C 3 98   ? -42.048 101.291 19.854  1.00 30.79  ? 98   SER A CB    1 
ATOM   1054  O  OG    . SER C 3 98   ? -42.311 100.631 18.624  1.00 34.47  ? 98   SER A OG    1 
ATOM   1055  N  N     . ILE C 3 99   ? -41.051 98.913  21.527  1.00 29.06  ? 99   ILE A N     1 
ATOM   1056  C  CA    . ILE C 3 99   ? -40.870 97.488  21.718  1.00 26.75  ? 99   ILE A CA    1 
ATOM   1057  C  C     . ILE C 3 99   ? -42.025 96.849  22.474  1.00 26.13  ? 99   ILE A C     1 
ATOM   1058  O  O     . ILE C 3 99   ? -42.221 95.633  22.401  1.00 26.29  ? 99   ILE A O     1 
ATOM   1059  C  CB    . ILE C 3 99   ? -39.533 97.196  22.454  1.00 26.57  ? 99   ILE A CB    1 
ATOM   1060  C  CG1   . ILE C 3 99   ? -39.241 95.689  22.409  1.00 25.68  ? 99   ILE A CG1   1 
ATOM   1061  C  CG2   . ILE C 3 99   ? -39.597 97.723  23.887  1.00 22.63  ? 99   ILE A CG2   1 
ATOM   1062  C  CD1   . ILE C 3 99   ? -37.918 95.297  22.993  1.00 24.92  ? 99   ILE A CD1   1 
ATOM   1063  N  N     . VAL C 3 100  ? -42.803 97.657  23.184  1.00 24.90  ? 100  VAL A N     1 
ATOM   1064  C  CA    . VAL C 3 100  ? -43.917 97.099  23.925  1.00 26.42  ? 100  VAL A CA    1 
ATOM   1065  C  C     . VAL C 3 100  ? -44.893 96.340  23.016  1.00 26.23  ? 100  VAL A C     1 
ATOM   1066  O  O     . VAL C 3 100  ? -45.404 95.291  23.397  1.00 28.33  ? 100  VAL A O     1 
ATOM   1067  C  CB    . VAL C 3 100  ? -44.697 98.186  24.703  1.00 27.59  ? 100  VAL A CB    1 
ATOM   1068  C  CG1   . VAL C 3 100  ? -45.451 99.108  23.747  1.00 28.99  ? 100  VAL A CG1   1 
ATOM   1069  C  CG2   . VAL C 3 100  ? -45.664 97.524  25.652  1.00 27.99  ? 100  VAL A CG2   1 
ATOM   1070  N  N     . GLU C 3 101  ? -45.141 96.848  21.816  1.00 25.75  ? 101  GLU A N     1 
ATOM   1071  C  CA    . GLU C 3 101  ? -46.076 96.186  20.915  1.00 28.53  ? 101  GLU A CA    1 
ATOM   1072  C  C     . GLU C 3 101  ? -45.721 94.721  20.608  1.00 29.57  ? 101  GLU A C     1 
ATOM   1073  O  O     . GLU C 3 101  ? -46.542 93.979  20.087  1.00 30.01  ? 101  GLU A O     1 
ATOM   1074  C  CB    . GLU C 3 101  ? -46.187 96.961  19.595  1.00 29.40  ? 101  GLU A CB    1 
ATOM   1075  C  CG    . GLU C 3 101  ? -44.972 96.797  18.664  1.00 33.08  ? 101  GLU A CG    1 
ATOM   1076  C  CD    . GLU C 3 101  ? -44.032 98.001  18.660  1.00 33.72  ? 101  GLU A CD    1 
ATOM   1077  O  OE1   . GLU C 3 101  ? -43.815 98.602  19.740  1.00 32.40  ? 101  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU C 3 101  ? -43.502 98.330  17.570  1.00 34.68  ? 101  GLU A OE2   1 
ATOM   1079  N  N     . LEU C 3 102  ? -44.509 94.292  20.934  1.00 31.61  ? 102  LEU A N     1 
ATOM   1080  C  CA    . LEU C 3 102  ? -44.114 92.921  20.634  1.00 32.17  ? 102  LEU A CA    1 
ATOM   1081  C  C     . LEU C 3 102  ? -44.048 92.040  21.870  1.00 34.38  ? 102  LEU A C     1 
ATOM   1082  O  O     . LEU C 3 102  ? -43.530 90.923  21.809  1.00 35.64  ? 102  LEU A O     1 
ATOM   1083  C  CB    . LEU C 3 102  ? -42.749 92.921  19.952  1.00 31.97  ? 102  LEU A CB    1 
ATOM   1084  C  CG    . LEU C 3 102  ? -42.592 93.818  18.717  1.00 33.21  ? 102  LEU A CG    1 
ATOM   1085  C  CD1   . LEU C 3 102  ? -41.116 94.082  18.461  1.00 33.12  ? 102  LEU A CD1   1 
ATOM   1086  C  CD2   . LEU C 3 102  ? -43.247 93.166  17.509  1.00 31.61  ? 102  LEU A CD2   1 
ATOM   1087  N  N     . LEU C 3 103  ? -44.593 92.517  22.984  1.00 34.78  ? 103  LEU A N     1 
ATOM   1088  C  CA    . LEU C 3 103  ? -44.526 91.748  24.221  1.00 36.71  ? 103  LEU A CA    1 
ATOM   1089  C  C     . LEU C 3 103  ? -45.836 91.166  24.767  1.00 37.83  ? 103  LEU A C     1 
ATOM   1090  O  O     . LEU C 3 103  ? -46.924 91.679  24.505  1.00 38.45  ? 103  LEU A O     1 
ATOM   1091  C  CB    . LEU C 3 103  ? -43.862 92.614  25.296  1.00 36.31  ? 103  LEU A CB    1 
ATOM   1092  C  CG    . LEU C 3 103  ? -42.639 93.372  24.772  1.00 34.69  ? 103  LEU A CG    1 
ATOM   1093  C  CD1   . LEU C 3 103  ? -42.054 94.237  25.874  1.00 33.59  ? 103  LEU A CD1   1 
ATOM   1094  C  CD2   . LEU C 3 103  ? -41.619 92.374  24.243  1.00 33.03  ? 103  LEU A CD2   1 
ATOM   1095  N  N     . GLU C 3 104  ? -45.710 90.072  25.516  1.00 38.77  ? 104  GLU A N     1 
ATOM   1096  C  CA    . GLU C 3 104  ? -46.849 89.418  26.154  1.00 40.46  ? 104  GLU A CA    1 
ATOM   1097  C  C     . GLU C 3 104  ? -46.628 89.654  27.630  1.00 40.95  ? 104  GLU A C     1 
ATOM   1098  O  O     . GLU C 3 104  ? -45.529 89.427  28.136  1.00 41.53  ? 104  GLU A O     1 
ATOM   1099  C  CB    . GLU C 3 104  ? -46.847 87.905  25.935  1.00 42.30  ? 104  GLU A CB    1 
ATOM   1100  C  CG    . GLU C 3 104  ? -47.125 87.421  24.523  1.00 48.27  ? 104  GLU A CG    1 
ATOM   1101  C  CD    . GLU C 3 104  ? -47.008 85.900  24.407  1.00 51.56  ? 104  GLU A CD    1 
ATOM   1102  O  OE1   . GLU C 3 104  ? -46.053 85.333  24.988  1.00 51.64  ? 104  GLU A OE1   1 
ATOM   1103  O  OE2   . GLU C 3 104  ? -47.860 85.273  23.731  1.00 53.38  ? 104  GLU A OE2   1 
ATOM   1104  N  N     . PRO C 3 105  ? -47.657 90.122  28.345  1.00 40.70  ? 105  PRO A N     1 
ATOM   1105  C  CA    . PRO C 3 105  ? -47.477 90.352  29.776  1.00 41.19  ? 105  PRO A CA    1 
ATOM   1106  C  C     . PRO C 3 105  ? -46.956 89.080  30.442  1.00 41.90  ? 105  PRO A C     1 
ATOM   1107  O  O     . PRO C 3 105  ? -47.267 87.967  30.010  1.00 40.76  ? 105  PRO A O     1 
ATOM   1108  C  CB    . PRO C 3 105  ? -48.884 90.715  30.238  1.00 40.89  ? 105  PRO A CB    1 
ATOM   1109  C  CG    . PRO C 3 105  ? -49.424 91.449  29.067  1.00 41.16  ? 105  PRO A CG    1 
ATOM   1110  C  CD    . PRO C 3 105  ? -48.983 90.580  27.903  1.00 41.22  ? 105  PRO A CD    1 
ATOM   1111  N  N     . HIS C 3 106  ? -46.150 89.246  31.482  1.00 42.92  ? 106  HIS A N     1 
ATOM   1112  C  CA    . HIS C 3 106  ? -45.604 88.108  32.202  1.00 45.72  ? 106  HIS A CA    1 
ATOM   1113  C  C     . HIS C 3 106  ? -46.600 87.649  33.264  1.00 47.18  ? 106  HIS A C     1 
ATOM   1114  O  O     . HIS C 3 106  ? -47.221 88.472  33.936  1.00 47.13  ? 106  HIS A O     1 
ATOM   1115  C  CB    . HIS C 3 106  ? -44.266 88.505  32.844  1.00 47.59  ? 106  HIS A CB    1 
ATOM   1116  C  CG    . HIS C 3 106  ? -43.767 87.540  33.877  1.00 49.92  ? 106  HIS A CG    1 
ATOM   1117  N  ND1   . HIS C 3 106  ? -44.217 87.543  35.180  1.00 52.35  ? 106  HIS A ND1   1 
ATOM   1118  C  CD2   . HIS C 3 106  ? -42.845 86.549  33.801  1.00 51.68  ? 106  HIS A CD2   1 
ATOM   1119  C  CE1   . HIS C 3 106  ? -43.593 86.599  35.863  1.00 52.70  ? 106  HIS A CE1   1 
ATOM   1120  N  NE2   . HIS C 3 106  ? -42.755 85.981  35.050  1.00 51.97  ? 106  HIS A NE2   1 
ATOM   1121  N  N     . GLU C 3 107  ? -46.773 86.339  33.395  1.00 48.38  ? 107  GLU A N     1 
ATOM   1122  C  CA    . GLU C 3 107  ? -47.681 85.809  34.399  1.00 50.72  ? 107  GLU A CA    1 
ATOM   1123  C  C     . GLU C 3 107  ? -47.077 86.028  35.786  1.00 51.64  ? 107  GLU A C     1 
ATOM   1124  O  O     . GLU C 3 107  ? -46.184 85.285  36.194  1.00 54.01  ? 107  GLU A O     1 
ATOM   1125  C  CB    . GLU C 3 107  ? -47.926 84.310  34.176  1.00 53.41  ? 107  GLU A CB    1 
ATOM   1126  C  CG    . GLU C 3 107  ? -46.787 83.564  33.484  1.00 57.73  ? 107  GLU A CG    1 
ATOM   1127  C  CD    . GLU C 3 107  ? -46.971 83.504  31.973  1.00 59.83  ? 107  GLU A CD    1 
ATOM   1128  O  OE1   . GLU C 3 107  ? -47.093 84.578  31.342  1.00 61.22  ? 107  GLU A OE1   1 
ATOM   1129  O  OE2   . GLU C 3 107  ? -47.000 82.381  31.417  1.00 60.48  ? 107  GLU A OE2   1 
ATOM   1130  N  N     . THR C 3 108  ? -47.577 87.046  36.492  1.00 50.11  ? 108  THR A N     1 
ATOM   1131  C  CA    . THR C 3 108  ? -47.142 87.437  37.842  1.00 46.75  ? 108  THR A CA    1 
ATOM   1132  C  C     . THR C 3 108  ? -46.695 88.898  37.842  1.00 45.61  ? 108  THR A C     1 
ATOM   1133  O  O     . THR C 3 108  ? -47.184 89.700  38.637  1.00 44.75  ? 108  THR A O     1 
ATOM   1134  C  CB    . THR C 3 108  ? -45.978 86.567  38.393  1.00 46.31  ? 108  THR A CB    1 
ATOM   1135  O  OG1   . THR C 3 108  ? -46.457 85.251  38.694  1.00 43.69  ? 108  THR A OG1   1 
ATOM   1136  C  CG2   . THR C 3 108  ? -45.412 87.180  39.664  1.00 46.72  ? 108  THR A CG2   1 
ATOM   1137  N  N     . LEU C 3 109  ? -45.758 89.232  36.958  1.00 44.02  ? 109  LEU A N     1 
ATOM   1138  C  CA    . LEU C 3 109  ? -45.263 90.600  36.833  1.00 42.66  ? 109  LEU A CA    1 
ATOM   1139  C  C     . LEU C 3 109  ? -46.032 91.250  35.685  1.00 41.92  ? 109  LEU A C     1 
ATOM   1140  O  O     . LEU C 3 109  ? -45.446 91.729  34.717  1.00 42.21  ? 109  LEU A O     1 
ATOM   1141  C  CB    . LEU C 3 109  ? -43.768 90.595  36.522  1.00 42.75  ? 109  LEU A CB    1 
ATOM   1142  C  CG    . LEU C 3 109  ? -42.885 89.904  37.566  1.00 45.94  ? 109  LEU A CG    1 
ATOM   1143  C  CD1   . LEU C 3 109  ? -41.453 89.798  37.049  1.00 45.67  ? 109  LEU A CD1   1 
ATOM   1144  C  CD2   . LEU C 3 109  ? -42.928 90.675  38.883  1.00 44.68  ? 109  LEU A CD2   1 
ATOM   1145  N  N     . THR C 3 110  ? -47.354 91.252  35.815  1.00 41.30  ? 110  THR A N     1 
ATOM   1146  C  CA    . THR C 3 110  ? -48.260 91.793  34.810  1.00 41.97  ? 110  THR A CA    1 
ATOM   1147  C  C     . THR C 3 110  ? -47.830 93.081  34.123  1.00 40.71  ? 110  THR A C     1 
ATOM   1148  O  O     . THR C 3 110  ? -48.236 93.333  32.986  1.00 41.26  ? 110  THR A O     1 
ATOM   1149  C  CB    . THR C 3 110  ? -49.676 91.998  35.396  1.00 43.81  ? 110  THR A CB    1 
ATOM   1150  O  OG1   . THR C 3 110  ? -49.603 92.794  36.589  1.00 44.71  ? 110  THR A OG1   1 
ATOM   1151  C  CG2   . THR C 3 110  ? -50.302 90.651  35.722  1.00 45.15  ? 110  THR A CG2   1 
ATOM   1152  N  N     . SER C 3 111  ? -47.019 93.895  34.792  1.00 38.40  ? 111  SER A N     1 
ATOM   1153  C  CA    . SER C 3 111  ? -46.557 95.142  34.186  1.00 37.76  ? 111  SER A CA    1 
ATOM   1154  C  C     . SER C 3 111  ? -45.318 94.964  33.294  1.00 35.65  ? 111  SER A C     1 
ATOM   1155  O  O     . SER C 3 111  ? -44.929 95.878  32.564  1.00 33.36  ? 111  SER A O     1 
ATOM   1156  C  CB    . SER C 3 111  ? -46.268 96.185  35.269  1.00 39.63  ? 111  SER A CB    1 
ATOM   1157  O  OG    . SER C 3 111  ? -47.429 96.933  35.595  1.00 42.67  ? 111  SER A OG    1 
ATOM   1158  N  N     . TYR C 3 112  ? -44.704 93.786  33.354  1.00 34.38  ? 112  TYR A N     1 
ATOM   1159  C  CA    . TYR C 3 112  ? -43.519 93.504  32.546  1.00 34.65  ? 112  TYR A CA    1 
ATOM   1160  C  C     . TYR C 3 112  ? -43.821 92.441  31.500  1.00 34.59  ? 112  TYR A C     1 
ATOM   1161  O  O     . TYR C 3 112  ? -44.707 91.607  31.691  1.00 35.62  ? 112  TYR A O     1 
ATOM   1162  C  CB    . TYR C 3 112  ? -42.363 93.056  33.449  1.00 32.27  ? 112  TYR A CB    1 
ATOM   1163  C  CG    . TYR C 3 112  ? -41.842 94.171  34.320  1.00 29.64  ? 112  TYR A CG    1 
ATOM   1164  C  CD1   . TYR C 3 112  ? -40.906 95.083  33.831  1.00 30.13  ? 112  TYR A CD1   1 
ATOM   1165  C  CD2   . TYR C 3 112  ? -42.332 94.362  35.610  1.00 27.84  ? 112  TYR A CD2   1 
ATOM   1166  C  CE1   . TYR C 3 112  ? -40.472 96.168  34.605  1.00 29.11  ? 112  TYR A CE1   1 
ATOM   1167  C  CE2   . TYR C 3 112  ? -41.909 95.441  36.391  1.00 28.12  ? 112  TYR A CE2   1 
ATOM   1168  C  CZ    . TYR C 3 112  ? -40.983 96.342  35.884  1.00 29.18  ? 112  TYR A CZ    1 
ATOM   1169  O  OH    . TYR C 3 112  ? -40.592 97.430  36.638  1.00 28.85  ? 112  TYR A OH    1 
ATOM   1170  N  N     . GLY C 3 113  ? -43.090 92.479  30.391  1.00 34.97  ? 113  GLY A N     1 
ATOM   1171  C  CA    . GLY C 3 113  ? -43.321 91.512  29.334  1.00 36.07  ? 113  GLY A CA    1 
ATOM   1172  C  C     . GLY C 3 113  ? -42.120 91.050  28.523  1.00 37.06  ? 113  GLY A C     1 
ATOM   1173  O  O     . GLY C 3 113  ? -41.093 91.729  28.429  1.00 34.49  ? 113  GLY A O     1 
ATOM   1174  N  N     . ARG C 3 114  ? -42.284 89.870  27.929  1.00 39.60  ? 114  ARG A N     1 
ATOM   1175  C  CA    . ARG C 3 114  ? -41.274 89.228  27.099  1.00 41.23  ? 114  ARG A CA    1 
ATOM   1176  C  C     . ARG C 3 114  ? -41.799 89.184  25.670  1.00 41.32  ? 114  ARG A C     1 
ATOM   1177  O  O     . ARG C 3 114  ? -42.969 89.482  25.427  1.00 41.99  ? 114  ARG A O     1 
ATOM   1178  C  CB    . ARG C 3 114  ? -41.026 87.804  27.603  1.00 43.14  ? 114  ARG A CB    1 
ATOM   1179  C  CG    . ARG C 3 114  ? -39.813 87.122  27.001  1.00 47.57  ? 114  ARG A CG    1 
ATOM   1180  C  CD    . ARG C 3 114  ? -39.275 86.031  27.925  1.00 50.42  ? 114  ARG A CD    1 
ATOM   1181  N  NE    . ARG C 3 114  ? -37.984 85.511  27.471  1.00 52.64  ? 114  ARG A NE    1 
ATOM   1182  C  CZ    . ARG C 3 114  ? -36.875 86.240  27.337  1.00 54.20  ? 114  ARG A CZ    1 
ATOM   1183  N  NH1   . ARG C 3 114  ? -36.882 87.539  27.622  1.00 53.55  ? 114  ARG A NH1   1 
ATOM   1184  N  NH2   . ARG C 3 114  ? -35.753 85.669  26.910  1.00 54.25  ? 114  ARG A NH2   1 
ATOM   1185  N  N     . LEU C 3 115  ? -40.937 88.818  24.725  1.00 41.31  ? 115  LEU A N     1 
ATOM   1186  C  CA    . LEU C 3 115  ? -41.340 88.728  23.326  1.00 40.28  ? 115  LEU A CA    1 
ATOM   1187  C  C     . LEU C 3 115  ? -42.468 87.710  23.178  1.00 40.46  ? 115  LEU A C     1 
ATOM   1188  O  O     . LEU C 3 115  ? -42.366 86.584  23.664  1.00 39.70  ? 115  LEU A O     1 
ATOM   1189  C  CB    . LEU C 3 115  ? -40.153 88.306  22.465  1.00 39.16  ? 115  LEU A CB    1 
ATOM   1190  C  CG    . LEU C 3 115  ? -40.432 88.158  20.968  1.00 40.05  ? 115  LEU A CG    1 
ATOM   1191  C  CD1   . LEU C 3 115  ? -40.949 89.480  20.403  1.00 38.69  ? 115  LEU A CD1   1 
ATOM   1192  C  CD2   . LEU C 3 115  ? -39.157 87.725  20.255  1.00 38.83  ? 115  LEU A CD2   1 
ATOM   1193  N  N     . SER C 3 116  ? -43.543 88.118  22.510  1.00 41.75  ? 116  SER A N     1 
ATOM   1194  C  CA    . SER C 3 116  ? -44.702 87.257  22.290  1.00 43.12  ? 116  SER A CA    1 
ATOM   1195  C  C     . SER C 3 116  ? -44.301 85.886  21.779  1.00 45.30  ? 116  SER A C     1 
ATOM   1196  O  O     . SER C 3 116  ? -43.603 85.770  20.772  1.00 46.12  ? 116  SER A O     1 
ATOM   1197  C  CB    . SER C 3 116  ? -45.658 87.904  21.284  1.00 43.20  ? 116  SER A CB    1 
ATOM   1198  O  OG    . SER C 3 116  ? -46.575 86.953  20.761  1.00 42.68  ? 116  SER A OG    1 
ATOM   1199  N  N     . GLU C 3 117  ? -44.748 84.844  22.471  1.00 47.07  ? 117  GLU A N     1 
ATOM   1200  C  CA    . GLU C 3 117  ? -44.420 83.485  22.063  1.00 49.32  ? 117  GLU A CA    1 
ATOM   1201  C  C     . GLU C 3 117  ? -45.031 83.241  20.685  1.00 48.27  ? 117  GLU A C     1 
ATOM   1202  O  O     . GLU C 3 117  ? -44.504 82.470  19.882  1.00 48.15  ? 117  GLU A O     1 
ATOM   1203  C  CB    . GLU C 3 117  ? -44.975 82.477  23.072  1.00 52.06  ? 117  GLU A CB    1 
ATOM   1204  C  CG    . GLU C 3 117  ? -44.303 81.110  23.016  1.00 56.35  ? 117  GLU A CG    1 
ATOM   1205  C  CD    . GLU C 3 117  ? -45.053 80.059  23.821  1.00 58.91  ? 117  GLU A CD    1 
ATOM   1206  O  OE1   . GLU C 3 117  ? -45.446 80.351  24.976  1.00 59.34  ? 117  GLU A OE1   1 
ATOM   1207  O  OE2   . GLU C 3 117  ? -45.241 78.937  23.297  1.00 60.29  ? 117  GLU A OE2   1 
ATOM   1208  N  N     . ALA C 3 118  ? -46.149 83.908  20.417  1.00 47.49  ? 118  ALA A N     1 
ATOM   1209  C  CA    . ALA C 3 118  ? -46.822 83.781  19.130  1.00 46.53  ? 118  ALA A CA    1 
ATOM   1210  C  C     . ALA C 3 118  ? -45.888 84.249  18.013  1.00 45.43  ? 118  ALA A C     1 
ATOM   1211  O  O     . ALA C 3 118  ? -45.735 83.577  16.990  1.00 45.40  ? 118  ALA A O     1 
ATOM   1212  C  CB    . ALA C 3 118  ? -48.099 84.615  19.121  1.00 45.89  ? 118  ALA A CB    1 
ATOM   1213  N  N     . ILE C 3 119  ? -45.254 85.400  18.221  1.00 43.67  ? 119  ILE A N     1 
ATOM   1214  C  CA    . ILE C 3 119  ? -44.355 85.947  17.222  1.00 41.33  ? 119  ILE A CA    1 
ATOM   1215  C  C     . ILE C 3 119  ? -43.178 85.023  16.922  1.00 40.78  ? 119  ILE A C     1 
ATOM   1216  O  O     . ILE C 3 119  ? -42.811 84.853  15.758  1.00 39.87  ? 119  ILE A O     1 
ATOM   1217  C  CB    . ILE C 3 119  ? -43.872 87.358  17.639  1.00 40.48  ? 119  ILE A CB    1 
ATOM   1218  C  CG1   . ILE C 3 119  ? -45.076 88.313  17.635  1.00 39.51  ? 119  ILE A CG1   1 
ATOM   1219  C  CG2   . ILE C 3 119  ? -42.793 87.864  16.681  1.00 39.17  ? 119  ILE A CG2   1 
ATOM   1220  C  CD1   . ILE C 3 119  ? -44.752 89.764  17.948  1.00 36.74  ? 119  ILE A CD1   1 
ATOM   1221  N  N     . GLU C 3 120  ? -42.599 84.412  17.955  1.00 40.72  ? 120  GLU A N     1 
ATOM   1222  C  CA    . GLU C 3 120  ? -41.471 83.491  17.760  1.00 40.80  ? 120  GLU A CA    1 
ATOM   1223  C  C     . GLU C 3 120  ? -41.908 82.236  16.997  1.00 40.35  ? 120  GLU A C     1 
ATOM   1224  O  O     . GLU C 3 120  ? -41.167 81.708  16.166  1.00 39.62  ? 120  GLU A O     1 
ATOM   1225  C  CB    . GLU C 3 120  ? -40.866 83.048  19.099  1.00 40.93  ? 120  GLU A CB    1 
ATOM   1226  C  CG    . GLU C 3 120  ? -40.104 84.108  19.867  1.00 44.04  ? 120  GLU A CG    1 
ATOM   1227  C  CD    . GLU C 3 120  ? -38.856 83.548  20.547  1.00 45.80  ? 120  GLU A CD    1 
ATOM   1228  O  OE1   . GLU C 3 120  ? -38.884 82.370  20.970  1.00 45.37  ? 120  GLU A OE1   1 
ATOM   1229  O  OE2   . GLU C 3 120  ? -37.850 84.288  20.670  1.00 46.56  ? 120  GLU A OE2   1 
ATOM   1230  N  N     . ASN C 3 121  ? -43.114 81.762  17.291  1.00 39.94  ? 121  ASN A N     1 
ATOM   1231  C  CA    . ASN C 3 121  ? -43.648 80.572  16.646  1.00 39.94  ? 121  ASN A CA    1 
ATOM   1232  C  C     . ASN C 3 121  ? -43.876 80.811  15.166  1.00 38.79  ? 121  ASN A C     1 
ATOM   1233  O  O     . ASN C 3 121  ? -43.672 79.914  14.351  1.00 37.72  ? 121  ASN A O     1 
ATOM   1234  C  CB    . ASN C 3 121  ? -44.945 80.155  17.333  1.00 40.96  ? 121  ASN A CB    1 
ATOM   1235  C  CG    . ASN C 3 121  ? -44.710 79.640  18.735  1.00 41.63  ? 121  ASN A CG    1 
ATOM   1236  O  OD1   . ASN C 3 121  ? -45.625 79.629  19.560  1.00 42.32  ? 121  ASN A OD1   1 
ATOM   1237  N  ND2   . ASN C 3 121  ? -43.478 79.197  19.014  1.00 40.96  ? 121  ASN A ND2   1 
ATOM   1238  N  N     . ARG C 3 122  ? -44.306 82.019  14.824  1.00 38.77  ? 122  ARG A N     1 
ATOM   1239  C  CA    . ARG C 3 122  ? -44.512 82.373  13.429  1.00 40.46  ? 122  ARG A CA    1 
ATOM   1240  C  C     . ARG C 3 122  ? -43.123 82.478  12.796  1.00 40.29  ? 122  ARG A C     1 
ATOM   1241  O  O     . ARG C 3 122  ? -42.879 81.978  11.697  1.00 40.81  ? 122  ARG A O     1 
ATOM   1242  C  CB    . ARG C 3 122  ? -45.257 83.714  13.312  1.00 41.23  ? 122  ARG A CB    1 
ATOM   1243  C  CG    . ARG C 3 122  ? -46.757 83.587  13.049  1.00 43.36  ? 122  ARG A CG    1 
ATOM   1244  C  CD    . ARG C 3 122  ? -47.482 84.930  13.149  1.00 47.45  ? 122  ARG A CD    1 
ATOM   1245  N  NE    . ARG C 3 122  ? -47.504 85.438  14.524  1.00 51.15  ? 122  ARG A NE    1 
ATOM   1246  C  CZ    . ARG C 3 122  ? -48.300 86.413  14.959  1.00 53.07  ? 122  ARG A CZ    1 
ATOM   1247  N  NH1   . ARG C 3 122  ? -49.152 87.000  14.129  1.00 54.98  ? 122  ARG A NH1   1 
ATOM   1248  N  NH2   . ARG C 3 122  ? -48.248 86.805  16.228  1.00 54.02  ? 122  ARG A NH2   1 
ATOM   1249  N  N     . ALA C 3 123  ? -42.209 83.117  13.512  1.00 40.00  ? 123  ALA A N     1 
ATOM   1250  C  CA    . ALA C 3 123  ? -40.848 83.288  13.025  1.00 40.15  ? 123  ALA A CA    1 
ATOM   1251  C  C     . ALA C 3 123  ? -40.227 81.921  12.760  1.00 39.66  ? 123  ALA A C     1 
ATOM   1252  O  O     . ALA C 3 123  ? -39.514 81.725  11.769  1.00 38.15  ? 123  ALA A O     1 
ATOM   1253  C  CB    . ALA C 3 123  ? -40.013 84.069  14.055  1.00 38.30  ? 123  ALA A CB    1 
ATOM   1254  N  N     . LYS C 3 124  ? -40.510 80.973  13.647  1.00 39.61  ? 124  LYS A N     1 
ATOM   1255  C  CA    . LYS C 3 124  ? -39.967 79.637  13.503  1.00 40.25  ? 124  LYS A CA    1 
ATOM   1256  C  C     . LYS C 3 124  ? -40.642 78.923  12.348  1.00 41.00  ? 124  LYS A C     1 
ATOM   1257  O  O     . LYS C 3 124  ? -40.033 78.071  11.704  1.00 41.40  ? 124  LYS A O     1 
ATOM   1258  C  CB    . LYS C 3 124  ? -40.112 78.869  14.817  1.00 41.00  ? 124  LYS A CB    1 
ATOM   1259  C  CG    . LYS C 3 124  ? -39.298 79.525  15.931  1.00 43.34  ? 124  LYS A CG    1 
ATOM   1260  C  CD    . LYS C 3 124  ? -39.266 78.744  17.238  1.00 43.90  ? 124  LYS A CD    1 
ATOM   1261  C  CE    . LYS C 3 124  ? -38.353 79.455  18.242  1.00 44.84  ? 124  LYS A CE    1 
ATOM   1262  N  NZ    . LYS C 3 124  ? -38.276 78.781  19.570  1.00 45.06  ? 124  LYS A NZ    1 
ATOM   1263  N  N     . ASP C 3 125  ? -41.895 79.279  12.074  1.00 41.48  ? 125  ASP A N     1 
ATOM   1264  C  CA    . ASP C 3 125  ? -42.613 78.681  10.950  1.00 42.18  ? 125  ASP A CA    1 
ATOM   1265  C  C     . ASP C 3 125  ? -41.974 79.229  9.674   1.00 41.56  ? 125  ASP A C     1 
ATOM   1266  O  O     . ASP C 3 125  ? -41.965 78.571  8.634   1.00 42.18  ? 125  ASP A O     1 
ATOM   1267  C  CB    . ASP C 3 125  ? -44.096 79.054  10.989  1.00 44.18  ? 125  ASP A CB    1 
ATOM   1268  C  CG    . ASP C 3 125  ? -44.899 78.210  11.977  1.00 46.18  ? 125  ASP A CG    1 
ATOM   1269  O  OD1   . ASP C 3 125  ? -44.314 77.673  12.952  1.00 45.65  ? 125  ASP A OD1   1 
ATOM   1270  O  OD2   . ASP C 3 125  ? -46.131 78.105  11.777  1.00 46.08  ? 125  ASP A OD2   1 
ATOM   1271  N  N     . GLY C 3 126  ? -41.440 80.444  9.762   1.00 40.29  ? 126  GLY A N     1 
ATOM   1272  C  CA    . GLY C 3 126  ? -40.785 81.038  8.613   1.00 38.45  ? 126  GLY A CA    1 
ATOM   1273  C  C     . GLY C 3 126  ? -41.353 82.351  8.123   1.00 38.13  ? 126  GLY A C     1 
ATOM   1274  O  O     . GLY C 3 126  ? -40.967 82.833  7.057   1.00 38.14  ? 126  GLY A O     1 
ATOM   1275  N  N     . ASP C 3 127  ? -42.265 82.943  8.882   1.00 37.30  ? 127  ASP A N     1 
ATOM   1276  C  CA    . ASP C 3 127  ? -42.857 84.206  8.464   1.00 38.07  ? 127  ASP A CA    1 
ATOM   1277  C  C     . ASP C 3 127  ? -41.832 85.342  8.478   1.00 38.49  ? 127  ASP A C     1 
ATOM   1278  O  O     . ASP C 3 127  ? -41.210 85.596  9.501   1.00 39.97  ? 127  ASP A O     1 
ATOM   1279  C  CB    . ASP C 3 127  ? -44.033 84.563  9.373   1.00 37.34  ? 127  ASP A CB    1 
ATOM   1280  C  CG    . ASP C 3 127  ? -44.719 85.850  8.952   1.00 37.84  ? 127  ASP A CG    1 
ATOM   1281  O  OD1   . ASP C 3 127  ? -45.265 85.892  7.823   1.00 36.28  ? 127  ASP A OD1   1 
ATOM   1282  O  OD2   . ASP C 3 127  ? -44.703 86.820  9.745   1.00 38.53  ? 127  ASP A OD2   1 
ATOM   1283  N  N     . SER C 3 128  ? -41.659 86.027  7.349   1.00 38.62  ? 128  SER A N     1 
ATOM   1284  C  CA    . SER C 3 128  ? -40.701 87.128  7.276   1.00 39.01  ? 128  SER A CA    1 
ATOM   1285  C  C     . SER C 3 128  ? -40.924 88.203  8.347   1.00 39.90  ? 128  SER A C     1 
ATOM   1286  O  O     . SER C 3 128  ? -39.988 88.570  9.060   1.00 40.12  ? 128  SER A O     1 
ATOM   1287  C  CB    . SER C 3 128  ? -40.726 87.777  5.886   1.00 38.38  ? 128  SER A CB    1 
ATOM   1288  O  OG    . SER C 3 128  ? -40.120 86.938  4.916   1.00 38.33  ? 128  SER A OG    1 
ATOM   1289  N  N     . GLN C 3 129  ? -42.151 88.709  8.465   1.00 38.97  ? 129  GLN A N     1 
ATOM   1290  C  CA    . GLN C 3 129  ? -42.439 89.746  9.457   1.00 38.59  ? 129  GLN A CA    1 
ATOM   1291  C  C     . GLN C 3 129  ? -42.156 89.271  10.887  1.00 37.74  ? 129  GLN A C     1 
ATOM   1292  O  O     . GLN C 3 129  ? -41.688 90.041  11.738  1.00 36.00  ? 129  GLN A O     1 
ATOM   1293  C  CB    . GLN C 3 129  ? -43.898 90.202  9.347   1.00 38.65  ? 129  GLN A CB    1 
ATOM   1294  C  CG    . GLN C 3 129  ? -44.285 91.274  10.359  1.00 41.69  ? 129  GLN A CG    1 
ATOM   1295  C  CD    . GLN C 3 129  ? -45.747 91.691  10.262  1.00 44.41  ? 129  GLN A CD    1 
ATOM   1296  O  OE1   . GLN C 3 129  ? -46.163 92.324  9.287   1.00 47.40  ? 129  GLN A OE1   1 
ATOM   1297  N  NE2   . GLN C 3 129  ? -46.535 91.336  11.274  1.00 43.09  ? 129  GLN A NE2   1 
ATOM   1298  N  N     . ALA C 3 130  ? -42.449 87.997  11.137  1.00 35.72  ? 130  ALA A N     1 
ATOM   1299  C  CA    . ALA C 3 130  ? -42.244 87.392  12.446  1.00 34.46  ? 130  ALA A CA    1 
ATOM   1300  C  C     . ALA C 3 130  ? -40.755 87.236  12.761  1.00 33.78  ? 130  ALA A C     1 
ATOM   1301  O  O     . ALA C 3 130  ? -40.327 87.426  13.900  1.00 33.36  ? 130  ALA A O     1 
ATOM   1302  C  CB    . ALA C 3 130  ? -42.935 86.038  12.496  1.00 34.24  ? 130  ALA A CB    1 
ATOM   1303  N  N     . ARG C 3 131  ? -39.972 86.885  11.746  1.00 32.04  ? 131  ARG A N     1 
ATOM   1304  C  CA    . ARG C 3 131  ? -38.543 86.724  11.927  1.00 29.94  ? 131  ARG A CA    1 
ATOM   1305  C  C     . ARG C 3 131  ? -37.962 88.094  12.239  1.00 28.60  ? 131  ARG A C     1 
ATOM   1306  O  O     . ARG C 3 131  ? -37.227 88.246  13.206  1.00 29.09  ? 131  ARG A O     1 
ATOM   1307  C  CB    . ARG C 3 131  ? -37.902 86.145  10.659  1.00 28.84  ? 131  ARG A CB    1 
ATOM   1308  C  CG    . ARG C 3 131  ? -38.402 84.753  10.308  1.00 29.85  ? 131  ARG A CG    1 
ATOM   1309  C  CD    . ARG C 3 131  ? -37.865 84.289  8.973   1.00 28.85  ? 131  ARG A CD    1 
ATOM   1310  N  NE    . ARG C 3 131  ? -36.423 84.107  9.020   1.00 30.95  ? 131  ARG A NE    1 
ATOM   1311  C  CZ    . ARG C 3 131  ? -35.615 84.274  7.982   1.00 30.25  ? 131  ARG A CZ    1 
ATOM   1312  N  NH1   . ARG C 3 131  ? -36.111 84.634  6.805   1.00 31.99  ? 131  ARG A NH1   1 
ATOM   1313  N  NH2   . ARG C 3 131  ? -34.310 84.087  8.122   1.00 30.71  ? 131  ARG A NH2   1 
ATOM   1314  N  N     . ILE C 3 132  ? -38.306 89.092  11.429  1.00 27.92  ? 132  ILE A N     1 
ATOM   1315  C  CA    . ILE C 3 132  ? -37.797 90.443  11.638  1.00 27.84  ? 132  ILE A CA    1 
ATOM   1316  C  C     . ILE C 3 132  ? -38.009 90.874  13.074  1.00 27.73  ? 132  ILE A C     1 
ATOM   1317  O  O     . ILE C 3 132  ? -37.092 91.382  13.711  1.00 27.69  ? 132  ILE A O     1 
ATOM   1318  C  CB    . ILE C 3 132  ? -38.493 91.472  10.738  1.00 28.06  ? 132  ILE A CB    1 
ATOM   1319  C  CG1   . ILE C 3 132  ? -38.189 91.184  9.271   1.00 30.35  ? 132  ILE A CG1   1 
ATOM   1320  C  CG2   . ILE C 3 132  ? -38.011 92.872  11.085  1.00 28.04  ? 132  ILE A CG2   1 
ATOM   1321  C  CD1   . ILE C 3 132  ? -36.732 91.341  8.930   1.00 34.65  ? 132  ILE A CD1   1 
ATOM   1322  N  N     . ALA C 3 133  ? -39.228 90.662  13.568  1.00 29.34  ? 133  ALA A N     1 
ATOM   1323  C  CA    . ALA C 3 133  ? -39.617 91.026  14.931  1.00 27.36  ? 133  ALA A CA    1 
ATOM   1324  C  C     . ALA C 3 133  ? -38.873 90.210  15.990  1.00 27.41  ? 133  ALA A C     1 
ATOM   1325  O  O     . ALA C 3 133  ? -38.489 90.745  17.031  1.00 27.97  ? 133  ALA A O     1 
ATOM   1326  C  CB    . ALA C 3 133  ? -41.133 90.864  15.103  1.00 25.90  ? 133  ALA A CB    1 
ATOM   1327  N  N     . THR C 3 134  ? -38.674 88.920  15.739  1.00 26.45  ? 134  THR A N     1 
ATOM   1328  C  CA    . THR C 3 134  ? -37.959 88.099  16.700  1.00 25.57  ? 134  THR A CA    1 
ATOM   1329  C  C     . THR C 3 134  ? -36.510 88.568  16.778  1.00 26.05  ? 134  THR A C     1 
ATOM   1330  O  O     . THR C 3 134  ? -35.966 88.755  17.876  1.00 25.64  ? 134  THR A O     1 
ATOM   1331  C  CB    . THR C 3 134  ? -38.001 86.605  16.324  1.00 25.56  ? 134  THR A CB    1 
ATOM   1332  O  OG1   . THR C 3 134  ? -39.346 86.132  16.429  1.00 27.75  ? 134  THR A OG1   1 
ATOM   1333  C  CG2   . THR C 3 134  ? -37.128 85.783  17.274  1.00 25.75  ? 134  THR A CG2   1 
ATOM   1334  N  N     . THR C 3 135  ? -35.892 88.778  15.616  1.00 24.65  ? 135  THR A N     1 
ATOM   1335  C  CA    . THR C 3 135  ? -34.507 89.230  15.572  1.00 23.32  ? 135  THR A CA    1 
ATOM   1336  C  C     . THR C 3 135  ? -34.363 90.511  16.380  1.00 23.83  ? 135  THR A C     1 
ATOM   1337  O  O     . THR C 3 135  ? -33.527 90.586  17.284  1.00 25.70  ? 135  THR A O     1 
ATOM   1338  C  CB    . THR C 3 135  ? -34.034 89.466  14.124  1.00 22.84  ? 135  THR A CB    1 
ATOM   1339  O  OG1   . THR C 3 135  ? -34.154 88.243  13.389  1.00 23.18  ? 135  THR A OG1   1 
ATOM   1340  C  CG2   . THR C 3 135  ? -32.579 89.912  14.090  1.00 19.05  ? 135  THR A CG2   1 
ATOM   1341  N  N     . TYR C 3 136  ? -35.180 91.510  16.068  1.00 22.97  ? 136  TYR A N     1 
ATOM   1342  C  CA    . TYR C 3 136  ? -35.143 92.770  16.801  1.00 23.45  ? 136  TYR A CA    1 
ATOM   1343  C  C     . TYR C 3 136  ? -35.302 92.529  18.305  1.00 24.44  ? 136  TYR A C     1 
ATOM   1344  O  O     . TYR C 3 136  ? -34.527 93.040  19.115  1.00 25.51  ? 136  TYR A O     1 
ATOM   1345  C  CB    . TYR C 3 136  ? -36.263 93.707  16.333  1.00 22.63  ? 136  TYR A CB    1 
ATOM   1346  C  CG    . TYR C 3 136  ? -36.420 94.936  17.207  1.00 22.41  ? 136  TYR A CG    1 
ATOM   1347  C  CD1   . TYR C 3 136  ? -35.382 95.857  17.339  1.00 22.58  ? 136  TYR A CD1   1 
ATOM   1348  C  CD2   . TYR C 3 136  ? -37.595 95.162  17.923  1.00 22.63  ? 136  TYR A CD2   1 
ATOM   1349  C  CE1   . TYR C 3 136  ? -35.507 96.971  18.160  1.00 21.93  ? 136  TYR A CE1   1 
ATOM   1350  C  CE2   . TYR C 3 136  ? -37.734 96.275  18.750  1.00 22.09  ? 136  TYR A CE2   1 
ATOM   1351  C  CZ    . TYR C 3 136  ? -36.683 97.176  18.864  1.00 22.38  ? 136  TYR A CZ    1 
ATOM   1352  O  OH    . TYR C 3 136  ? -36.799 98.270  19.691  1.00 21.97  ? 136  TYR A OH    1 
ATOM   1353  N  N     . GLY C 3 137  ? -36.311 91.752  18.677  1.00 24.22  ? 137  GLY A N     1 
ATOM   1354  C  CA    . GLY C 3 137  ? -36.536 91.474  20.084  1.00 25.16  ? 137  GLY A CA    1 
ATOM   1355  C  C     . GLY C 3 137  ? -35.386 90.783  20.805  1.00 24.36  ? 137  GLY A C     1 
ATOM   1356  O  O     . GLY C 3 137  ? -35.046 91.135  21.931  1.00 23.03  ? 137  GLY A O     1 
ATOM   1357  N  N     . ARG C 3 138  ? -34.783 89.796  20.155  1.00 25.34  ? 138  ARG A N     1 
ATOM   1358  C  CA    . ARG C 3 138  ? -33.682 89.050  20.752  1.00 24.88  ? 138  ARG A CA    1 
ATOM   1359  C  C     . ARG C 3 138  ? -32.391 89.853  20.845  1.00 25.14  ? 138  ARG A C     1 
ATOM   1360  O  O     . ARG C 3 138  ? -31.582 89.637  21.757  1.00 24.56  ? 138  ARG A O     1 
ATOM   1361  C  CB    . ARG C 3 138  ? -33.410 87.777  19.949  1.00 24.51  ? 138  ARG A CB    1 
ATOM   1362  C  CG    . ARG C 3 138  ? -34.463 86.697  20.090  1.00 26.61  ? 138  ARG A CG    1 
ATOM   1363  C  CD    . ARG C 3 138  ? -34.106 85.510  19.212  1.00 29.04  ? 138  ARG A CD    1 
ATOM   1364  N  NE    . ARG C 3 138  ? -35.013 84.381  19.392  1.00 32.00  ? 138  ARG A NE    1 
ATOM   1365  C  CZ    . ARG C 3 138  ? -34.991 83.283  18.639  1.00 34.15  ? 138  ARG A CZ    1 
ATOM   1366  N  NH1   . ARG C 3 138  ? -34.108 83.171  17.654  1.00 33.02  ? 138  ARG A NH1   1 
ATOM   1367  N  NH2   . ARG C 3 138  ? -35.846 82.294  18.870  1.00 34.92  ? 138  ARG A NH2   1 
ATOM   1368  N  N     . ILE C 3 139  ? -32.191 90.771  19.903  1.00 23.67  ? 139  ILE A N     1 
ATOM   1369  C  CA    . ILE C 3 139  ? -30.975 91.550  19.911  1.00 23.12  ? 139  ILE A CA    1 
ATOM   1370  C  C     . ILE C 3 139  ? -31.118 92.736  20.845  1.00 22.72  ? 139  ILE A C     1 
ATOM   1371  O  O     . ILE C 3 139  ? -30.143 93.187  21.449  1.00 23.84  ? 139  ILE A O     1 
ATOM   1372  C  CB    . ILE C 3 139  ? -30.573 91.997  18.472  1.00 23.62  ? 139  ILE A CB    1 
ATOM   1373  C  CG1   . ILE C 3 139  ? -29.067 92.277  18.431  1.00 24.20  ? 139  ILE A CG1   1 
ATOM   1374  C  CG2   . ILE C 3 139  ? -31.325 93.239  18.057  1.00 23.53  ? 139  ILE A CG2   1 
ATOM   1375  C  CD1   . ILE C 3 139  ? -28.228 91.096  18.874  1.00 19.90  ? 139  ILE A CD1   1 
ATOM   1376  N  N     . ALA C 3 140  ? -32.336 93.238  20.979  1.00 23.42  ? 140  ALA A N     1 
ATOM   1377  C  CA    . ALA C 3 140  ? -32.573 94.355  21.887  1.00 23.55  ? 140  ALA A CA    1 
ATOM   1378  C  C     . ALA C 3 140  ? -32.412 93.792  23.294  1.00 24.02  ? 140  ALA A C     1 
ATOM   1379  O  O     . ALA C 3 140  ? -31.905 94.462  24.191  1.00 25.54  ? 140  ALA A O     1 
ATOM   1380  C  CB    . ALA C 3 140  ? -33.964 94.906  21.695  1.00 23.33  ? 140  ALA A CB    1 
ATOM   1381  N  N     . GLU C 3 141  ? -32.842 92.547  23.474  1.00 24.49  ? 141  GLU A N     1 
ATOM   1382  C  CA    . GLU C 3 141  ? -32.721 91.895  24.764  1.00 27.13  ? 141  GLU A CA    1 
ATOM   1383  C  C     . GLU C 3 141  ? -31.250 91.702  25.066  1.00 26.91  ? 141  GLU A C     1 
ATOM   1384  O  O     . GLU C 3 141  ? -30.787 91.963  26.176  1.00 27.79  ? 141  GLU A O     1 
ATOM   1385  C  CB    . GLU C 3 141  ? -33.407 90.529  24.770  1.00 28.87  ? 141  GLU A CB    1 
ATOM   1386  C  CG    . GLU C 3 141  ? -33.048 89.716  26.012  1.00 33.53  ? 141  GLU A CG    1 
ATOM   1387  C  CD    . GLU C 3 141  ? -33.776 88.397  26.094  1.00 35.68  ? 141  GLU A CD    1 
ATOM   1388  O  OE1   . GLU C 3 141  ? -33.713 87.622  25.114  1.00 37.12  ? 141  GLU A OE1   1 
ATOM   1389  O  OE2   . GLU C 3 141  ? -34.403 88.134  27.145  1.00 38.59  ? 141  GLU A OE2   1 
ATOM   1390  N  N     . SER C 3 142  ? -30.520 91.226  24.065  1.00 25.59  ? 142  SER A N     1 
ATOM   1391  C  CA    . SER C 3 142  ? -29.098 91.003  24.212  1.00 24.08  ? 142  SER A CA    1 
ATOM   1392  C  C     . SER C 3 142  ? -28.405 92.300  24.607  1.00 23.99  ? 142  SER A C     1 
ATOM   1393  O  O     . SER C 3 142  ? -27.535 92.311  25.472  1.00 23.96  ? 142  SER A O     1 
ATOM   1394  C  CB    . SER C 3 142  ? -28.513 90.480  22.905  1.00 23.11  ? 142  SER A CB    1 
ATOM   1395  O  OG    . SER C 3 142  ? -27.151 90.155  23.069  1.00 24.95  ? 142  SER A OG    1 
ATOM   1396  N  N     . GLN C 3 143  ? -28.795 93.403  23.981  1.00 24.10  ? 143  GLN A N     1 
ATOM   1397  C  CA    . GLN C 3 143  ? -28.170 94.678  24.306  1.00 23.12  ? 143  GLN A CA    1 
ATOM   1398  C  C     . GLN C 3 143  ? -28.332 95.010  25.786  1.00 22.49  ? 143  GLN A C     1 
ATOM   1399  O  O     . GLN C 3 143  ? -27.428 95.560  26.408  1.00 21.98  ? 143  GLN A O     1 
ATOM   1400  C  CB    . GLN C 3 143  ? -28.770 95.803  23.458  1.00 22.45  ? 143  GLN A CB    1 
ATOM   1401  C  CG    . GLN C 3 143  ? -27.958 97.087  23.526  1.00 22.26  ? 143  GLN A CG    1 
ATOM   1402  C  CD    . GLN C 3 143  ? -28.407 98.144  22.538  1.00 22.12  ? 143  GLN A CD    1 
ATOM   1403  O  OE1   . GLN C 3 143  ? -27.605 98.958  22.092  1.00 23.13  ? 143  GLN A OE1   1 
ATOM   1404  N  NE2   . GLN C 3 143  ? -29.690 98.143  22.196  1.00 22.38  ? 143  GLN A NE2   1 
ATOM   1405  N  N     . ALA C 3 144  ? -29.487 94.662  26.342  1.00 23.04  ? 144  ALA A N     1 
ATOM   1406  C  CA    . ALA C 3 144  ? -29.789 94.934  27.744  1.00 24.42  ? 144  ALA A CA    1 
ATOM   1407  C  C     . ALA C 3 144  ? -29.136 93.951  28.731  1.00 25.76  ? 144  ALA A C     1 
ATOM   1408  O  O     . ALA C 3 144  ? -29.199 94.161  29.942  1.00 27.75  ? 144  ALA A O     1 
ATOM   1409  C  CB    . ALA C 3 144  ? -31.313 94.947  27.950  1.00 22.80  ? 144  ALA A CB    1 
ATOM   1410  N  N     . ARG C 3 145  ? -28.526 92.884  28.225  1.00 26.01  ? 145  ARG A N     1 
ATOM   1411  C  CA    . ARG C 3 145  ? -27.872 91.909  29.095  1.00 28.33  ? 145  ARG A CA    1 
ATOM   1412  C  C     . ARG C 3 145  ? -26.387 92.184  29.323  1.00 27.44  ? 145  ARG A C     1 
ATOM   1413  O  O     . ARG C 3 145  ? -25.772 91.513  30.146  1.00 28.81  ? 145  ARG A O     1 
ATOM   1414  C  CB    . ARG C 3 145  ? -27.998 90.483  28.537  1.00 29.24  ? 145  ARG A CB    1 
ATOM   1415  C  CG    . ARG C 3 145  ? -29.369 89.889  28.580  1.00 32.60  ? 145  ARG A CG    1 
ATOM   1416  C  CD    . ARG C 3 145  ? -29.305 88.433  28.167  1.00 36.85  ? 145  ARG A CD    1 
ATOM   1417  N  NE    . ARG C 3 145  ? -28.943 87.577  29.291  1.00 39.71  ? 145  ARG A NE    1 
ATOM   1418  C  CZ    . ARG C 3 145  ? -27.981 86.661  29.265  1.00 41.12  ? 145  ARG A CZ    1 
ATOM   1419  N  NH1   . ARG C 3 145  ? -27.257 86.469  28.166  1.00 39.20  ? 145  ARG A NH1   1 
ATOM   1420  N  NH2   . ARG C 3 145  ? -27.753 85.925  30.345  1.00 43.68  ? 145  ARG A NH2   1 
ATOM   1421  N  N     . GLN C 3 146  ? -25.805 93.145  28.603  1.00 26.13  ? 146  GLN A N     1 
ATOM   1422  C  CA    . GLN C 3 146  ? -24.370 93.445  28.762  1.00 25.15  ? 146  GLN A CA    1 
ATOM   1423  C  C     . GLN C 3 146  ? -23.981 94.106  30.107  1.00 24.44  ? 146  GLN A C     1 
ATOM   1424  O  O     . GLN C 3 146  ? -23.156 95.024  30.161  1.00 22.82  ? 146  GLN A O     1 
ATOM   1425  C  CB    . GLN C 3 146  ? -23.871 94.308  27.591  1.00 22.82  ? 146  GLN A CB    1 
ATOM   1426  C  CG    . GLN C 3 146  ? -24.157 93.733  26.193  1.00 19.99  ? 146  GLN A CG    1 
ATOM   1427  C  CD    . GLN C 3 146  ? -23.669 92.292  25.987  1.00 16.72  ? 146  GLN A CD    1 
ATOM   1428  O  OE1   . GLN C 3 146  ? -24.448 91.416  25.618  1.00 17.65  ? 146  GLN A OE1   1 
ATOM   1429  N  NE2   . GLN C 3 146  ? -22.387 92.055  26.203  1.00 12.85  ? 146  GLN A NE2   1 
ATOM   1430  N  N     . ILE C 3 147  ? -24.588 93.621  31.188  1.00 24.76  ? 147  ILE A N     1 
ATOM   1431  C  CA    . ILE C 3 147  ? -24.310 94.124  32.519  1.00 23.38  ? 147  ILE A CA    1 
ATOM   1432  C  C     . ILE C 3 147  ? -24.106 92.941  33.452  1.00 24.89  ? 147  ILE A C     1 
ATOM   1433  O  O     . ILE C 3 147  ? -24.499 91.814  33.139  1.00 24.57  ? 147  ILE A O     1 
ATOM   1434  C  CB    . ILE C 3 147  ? -25.447 95.039  33.039  1.00 23.86  ? 147  ILE A CB    1 
ATOM   1435  C  CG1   . ILE C 3 147  ? -26.786 94.298  33.006  1.00 22.40  ? 147  ILE A CG1   1 
ATOM   1436  C  CG2   . ILE C 3 147  ? -25.504 96.333  32.195  1.00 19.42  ? 147  ILE A CG2   1 
ATOM   1437  C  CD1   . ILE C 3 147  ? -27.901 95.033  33.753  1.00 22.15  ? 147  ILE A CD1   1 
ATOM   1438  N  N     . LYS C 3 148  ? -23.467 93.206  34.589  1.00 26.23  ? 148  LYS A N     1 
ATOM   1439  C  CA    . LYS C 3 148  ? -23.151 92.190  35.584  1.00 24.43  ? 148  LYS A CA    1 
ATOM   1440  C  C     . LYS C 3 148  ? -24.335 91.748  36.423  1.00 25.17  ? 148  LYS A C     1 
ATOM   1441  O  O     . LYS C 3 148  ? -24.427 90.584  36.821  1.00 26.98  ? 148  LYS A O     1 
ATOM   1442  C  CB    . LYS C 3 148  ? -22.055 92.706  36.519  1.00 22.47  ? 148  LYS A CB    1 
ATOM   1443  C  CG    . LYS C 3 148  ? -20.750 93.073  35.832  1.00 23.24  ? 148  LYS A CG    1 
ATOM   1444  C  CD    . LYS C 3 148  ? -19.694 93.487  36.860  1.00 23.55  ? 148  LYS A CD    1 
ATOM   1445  C  CE    . LYS C 3 148  ? -18.316 93.743  36.247  1.00 20.34  ? 148  LYS A CE    1 
ATOM   1446  N  NZ    . LYS C 3 148  ? -18.264 94.999  35.465  1.00 17.23  ? 148  LYS A NZ    1 
ATOM   1447  N  N     . ALA C 3 149  ? -25.231 92.685  36.705  1.00 25.82  ? 149  ALA A N     1 
ATOM   1448  C  CA    . ALA C 3 149  ? -26.405 92.419  37.537  1.00 24.90  ? 149  ALA A CA    1 
ATOM   1449  C  C     . ALA C 3 149  ? -27.344 93.601  37.381  1.00 24.10  ? 149  ALA A C     1 
ATOM   1450  O  O     . ALA C 3 149  ? -27.005 94.580  36.716  1.00 22.69  ? 149  ALA A O     1 
ATOM   1451  C  CB    . ALA C 3 149  ? -25.984 92.275  39.009  1.00 23.33  ? 149  ALA A CB    1 
ATOM   1452  N  N     . PRO C 3 150  ? -28.530 93.535  38.001  1.00 24.28  ? 150  PRO A N     1 
ATOM   1453  C  CA    . PRO C 3 150  ? -29.493 94.634  37.901  1.00 23.33  ? 150  PRO A CA    1 
ATOM   1454  C  C     . PRO C 3 150  ? -28.851 95.943  38.281  1.00 23.04  ? 150  PRO A C     1 
ATOM   1455  O  O     . PRO C 3 150  ? -28.090 96.008  39.242  1.00 24.37  ? 150  PRO A O     1 
ATOM   1456  C  CB    . PRO C 3 150  ? -30.581 94.233  38.893  1.00 22.51  ? 150  PRO A CB    1 
ATOM   1457  C  CG    . PRO C 3 150  ? -30.568 92.745  38.809  1.00 23.08  ? 150  PRO A CG    1 
ATOM   1458  C  CD    . PRO C 3 150  ? -29.078 92.439  38.820  1.00 25.05  ? 150  PRO A CD    1 
ATOM   1459  N  N     . LEU C 3 151  ? -29.153 96.988  37.525  1.00 23.47  ? 151  LEU A N     1 
ATOM   1460  C  CA    . LEU C 3 151  ? -28.611 98.297  37.818  1.00 23.45  ? 151  LEU A CA    1 
ATOM   1461  C  C     . LEU C 3 151  ? -28.974 98.735  39.237  1.00 24.95  ? 151  LEU A C     1 
ATOM   1462  O  O     . LEU C 3 151  ? -28.141 99.317  39.935  1.00 26.94  ? 151  LEU A O     1 
ATOM   1463  C  CB    . LEU C 3 151  ? -29.139 99.326  36.820  1.00 21.75  ? 151  LEU A CB    1 
ATOM   1464  C  CG    . LEU C 3 151  ? -28.654 99.112  35.388  1.00 21.87  ? 151  LEU A CG    1 
ATOM   1465  C  CD1   . LEU C 3 151  ? -29.200 100.227 34.500  1.00 19.08  ? 151  LEU A CD1   1 
ATOM   1466  C  CD2   . LEU C 3 151  ? -27.117 99.070  35.353  1.00 18.58  ? 151  LEU A CD2   1 
ATOM   1467  N  N     . GLU C 3 152  ? -30.203 98.440  39.668  1.00 24.68  ? 152  GLU A N     1 
ATOM   1468  C  CA    . GLU C 3 152  ? -30.678 98.841  40.997  1.00 23.73  ? 152  GLU A CA    1 
ATOM   1469  C  C     . GLU C 3 152  ? -29.762 98.462  42.155  1.00 25.13  ? 152  GLU A C     1 
ATOM   1470  O  O     . GLU C 3 152  ? -29.720 99.158  43.171  1.00 23.72  ? 152  GLU A O     1 
ATOM   1471  C  CB    . GLU C 3 152  ? -32.076 98.279  41.264  1.00 24.50  ? 152  GLU A CB    1 
ATOM   1472  C  CG    . GLU C 3 152  ? -33.178 98.900  40.415  1.00 25.42  ? 152  GLU A CG    1 
ATOM   1473  C  CD    . GLU C 3 152  ? -33.318 98.234  39.060  1.00 25.81  ? 152  GLU A CD    1 
ATOM   1474  O  OE1   . GLU C 3 152  ? -32.551 97.286  38.781  1.00 24.79  ? 152  GLU A OE1   1 
ATOM   1475  O  OE2   . GLU C 3 152  ? -34.203 98.659  38.280  1.00 26.60  ? 152  GLU A OE2   1 
ATOM   1476  N  N     . LYS C 3 153  ? -29.039 97.357  42.018  1.00 25.42  ? 153  LYS A N     1 
ATOM   1477  C  CA    . LYS C 3 153  ? -28.134 96.946  43.078  1.00 27.35  ? 153  LYS A CA    1 
ATOM   1478  C  C     . LYS C 3 153  ? -26.975 97.943  43.197  1.00 27.31  ? 153  LYS A C     1 
ATOM   1479  O  O     . LYS C 3 153  ? -26.619 98.351  44.299  1.00 27.51  ? 153  LYS A O     1 
ATOM   1480  C  CB    . LYS C 3 153  ? -27.600 95.530  42.811  1.00 28.79  ? 153  LYS A CB    1 
ATOM   1481  C  CG    . LYS C 3 153  ? -28.646 94.438  42.989  1.00 27.32  ? 153  LYS A CG    1 
ATOM   1482  C  CD    . LYS C 3 153  ? -28.201 93.460  44.051  1.00 29.62  ? 153  LYS A CD    1 
ATOM   1483  C  CE    . LYS C 3 153  ? -29.386 92.720  44.657  1.00 31.84  ? 153  LYS A CE    1 
ATOM   1484  N  NZ    . LYS C 3 153  ? -28.993 91.993  45.893  1.00 34.16  ? 153  LYS A NZ    1 
ATOM   1485  N  N     . PHE C 3 154  ? -26.405 98.343  42.061  1.00 26.64  ? 154  PHE A N     1 
ATOM   1486  C  CA    . PHE C 3 154  ? -25.292 99.289  42.039  1.00 25.02  ? 154  PHE A CA    1 
ATOM   1487  C  C     . PHE C 3 154  ? -25.733 100.648 42.560  1.00 24.79  ? 154  PHE A C     1 
ATOM   1488  O  O     . PHE C 3 154  ? -24.977 101.338 43.248  1.00 24.84  ? 154  PHE A O     1 
ATOM   1489  C  CB    . PHE C 3 154  ? -24.745 99.437  40.614  1.00 24.97  ? 154  PHE A CB    1 
ATOM   1490  C  CG    . PHE C 3 154  ? -24.037 98.211  40.104  1.00 24.57  ? 154  PHE A CG    1 
ATOM   1491  C  CD1   . PHE C 3 154  ? -22.698 97.987  40.411  1.00 24.86  ? 154  PHE A CD1   1 
ATOM   1492  C  CD2   . PHE C 3 154  ? -24.713 97.274  39.325  1.00 23.59  ? 154  PHE A CD2   1 
ATOM   1493  C  CE1   . PHE C 3 154  ? -22.034 96.851  39.949  1.00 22.29  ? 154  PHE A CE1   1 
ATOM   1494  C  CE2   . PHE C 3 154  ? -24.061 96.136  38.858  1.00 23.66  ? 154  PHE A CE2   1 
ATOM   1495  C  CZ    . PHE C 3 154  ? -22.716 95.925  39.170  1.00 23.64  ? 154  PHE A CZ    1 
ATOM   1496  N  N     . VAL C 3 155  ? -26.963 101.022 42.230  1.00 24.42  ? 155  VAL A N     1 
ATOM   1497  C  CA    . VAL C 3 155  ? -27.527 102.297 42.660  1.00 24.63  ? 155  VAL A CA    1 
ATOM   1498  C  C     . VAL C 3 155  ? -27.740 102.282 44.169  1.00 25.28  ? 155  VAL A C     1 
ATOM   1499  O  O     . VAL C 3 155  ? -27.350 103.213 44.871  1.00 27.02  ? 155  VAL A O     1 
ATOM   1500  C  CB    . VAL C 3 155  ? -28.887 102.573 41.962  1.00 24.32  ? 155  VAL A CB    1 
ATOM   1501  C  CG1   . VAL C 3 155  ? -29.485 103.892 42.456  1.00 25.03  ? 155  VAL A CG1   1 
ATOM   1502  C  CG2   . VAL C 3 155  ? -28.700 102.609 40.458  1.00 20.76  ? 155  VAL A CG2   1 
ATOM   1503  N  N     . LEU C 3 156  ? -28.354 101.212 44.665  1.00 26.38  ? 156  LEU A N     1 
ATOM   1504  C  CA    . LEU C 3 156  ? -28.625 101.087 46.089  1.00 25.29  ? 156  LEU A CA    1 
ATOM   1505  C  C     . LEU C 3 156  ? -27.296 101.192 46.820  1.00 24.42  ? 156  LEU A C     1 
ATOM   1506  O  O     . LEU C 3 156  ? -27.151 101.939 47.794  1.00 22.58  ? 156  LEU A O     1 
ATOM   1507  C  CB    . LEU C 3 156  ? -29.311 99.743  46.383  1.00 25.72  ? 156  LEU A CB    1 
ATOM   1508  C  CG    . LEU C 3 156  ? -29.927 99.584  47.786  1.00 28.36  ? 156  LEU A CG    1 
ATOM   1509  C  CD1   . LEU C 3 156  ? -30.848 100.767 48.078  1.00 28.39  ? 156  LEU A CD1   1 
ATOM   1510  C  CD2   . LEU C 3 156  ? -30.697 98.266  47.885  1.00 26.55  ? 156  LEU A CD2   1 
ATOM   1511  N  N     . ALA C 3 157  ? -26.320 100.441 46.331  1.00 23.72  ? 157  ALA A N     1 
ATOM   1512  C  CA    . ALA C 3 157  ? -24.994 100.457 46.921  1.00 23.65  ? 157  ALA A CA    1 
ATOM   1513  C  C     . ALA C 3 157  ? -24.520 101.907 47.001  1.00 23.69  ? 157  ALA A C     1 
ATOM   1514  O  O     . ALA C 3 157  ? -24.068 102.364 48.055  1.00 22.19  ? 157  ALA A O     1 
ATOM   1515  C  CB    . ALA C 3 157  ? -24.035 99.633  46.066  1.00 24.36  ? 157  ALA A CB    1 
ATOM   1516  N  N     . LEU C 3 158  ? -24.646 102.636 45.892  1.00 22.21  ? 158  LEU A N     1 
ATOM   1517  C  CA    . LEU C 3 158  ? -24.213 104.022 45.871  1.00 22.50  ? 158  LEU A CA    1 
ATOM   1518  C  C     . LEU C 3 158  ? -24.936 104.867 46.921  1.00 22.66  ? 158  LEU A C     1 
ATOM   1519  O  O     . LEU C 3 158  ? -24.310 105.674 47.606  1.00 22.87  ? 158  LEU A O     1 
ATOM   1520  C  CB    . LEU C 3 158  ? -24.405 104.629 44.480  1.00 23.98  ? 158  LEU A CB    1 
ATOM   1521  C  CG    . LEU C 3 158  ? -23.872 106.063 44.374  1.00 23.49  ? 158  LEU A CG    1 
ATOM   1522  C  CD1   . LEU C 3 158  ? -22.378 106.053 44.641  1.00 22.22  ? 158  LEU A CD1   1 
ATOM   1523  C  CD2   . LEU C 3 158  ? -24.170 106.643 43.008  1.00 23.94  ? 158  LEU A CD2   1 
ATOM   1524  N  N     . LEU C 3 159  ? -26.246 104.681 47.047  1.00 22.56  ? 159  LEU A N     1 
ATOM   1525  C  CA    . LEU C 3 159  ? -27.034 105.421 48.038  1.00 24.75  ? 159  LEU A CA    1 
ATOM   1526  C  C     . LEU C 3 159  ? -26.541 105.163 49.463  1.00 25.93  ? 159  LEU A C     1 
ATOM   1527  O  O     . LEU C 3 159  ? -26.350 106.094 50.247  1.00 26.49  ? 159  LEU A O     1 
ATOM   1528  C  CB    . LEU C 3 159  ? -28.509 105.021 47.961  1.00 22.35  ? 159  LEU A CB    1 
ATOM   1529  C  CG    . LEU C 3 159  ? -29.264 105.476 46.716  1.00 23.33  ? 159  LEU A CG    1 
ATOM   1530  C  CD1   . LEU C 3 159  ? -30.703 104.933 46.746  1.00 18.90  ? 159  LEU A CD1   1 
ATOM   1531  C  CD2   . LEU C 3 159  ? -29.243 107.010 46.658  1.00 21.98  ? 159  LEU A CD2   1 
ATOM   1532  N  N     . VAL C 3 160  ? -26.360 103.888 49.789  1.00 25.89  ? 160  VAL A N     1 
ATOM   1533  C  CA    . VAL C 3 160  ? -25.900 103.483 51.100  1.00 26.12  ? 160  VAL A CA    1 
ATOM   1534  C  C     . VAL C 3 160  ? -24.529 104.083 51.413  1.00 28.15  ? 160  VAL A C     1 
ATOM   1535  O  O     . VAL C 3 160  ? -24.306 104.636 52.497  1.00 27.35  ? 160  VAL A O     1 
ATOM   1536  C  CB    . VAL C 3 160  ? -25.827 101.935 51.180  1.00 25.06  ? 160  VAL A CB    1 
ATOM   1537  C  CG1   . VAL C 3 160  ? -25.067 101.488 52.431  1.00 24.88  ? 160  VAL A CG1   1 
ATOM   1538  C  CG2   . VAL C 3 160  ? -27.228 101.369 51.186  1.00 24.96  ? 160  VAL A CG2   1 
ATOM   1539  N  N     . ALA C 3 161  ? -23.620 103.987 50.447  1.00 28.81  ? 161  ALA A N     1 
ATOM   1540  C  CA    . ALA C 3 161  ? -22.264 104.485 50.625  1.00 28.05  ? 161  ALA A CA    1 
ATOM   1541  C  C     . ALA C 3 161  ? -22.216 105.994 50.799  1.00 28.43  ? 161  ALA A C     1 
ATOM   1542  O  O     . ALA C 3 161  ? -21.555 106.502 51.714  1.00 29.67  ? 161  ALA A O     1 
ATOM   1543  C  CB    . ALA C 3 161  ? -21.402 104.065 49.451  1.00 25.74  ? 161  ALA A CB    1 
ATOM   1544  N  N     . GLU C 3 162  ? -22.925 106.704 49.926  1.00 27.97  ? 162  GLU A N     1 
ATOM   1545  C  CA    . GLU C 3 162  ? -22.954 108.158 49.959  1.00 26.93  ? 162  GLU A CA    1 
ATOM   1546  C  C     . GLU C 3 162  ? -23.733 108.733 51.129  1.00 25.74  ? 162  GLU A C     1 
ATOM   1547  O  O     . GLU C 3 162  ? -23.611 109.920 51.439  1.00 24.73  ? 162  GLU A O     1 
ATOM   1548  C  CB    . GLU C 3 162  ? -23.502 108.695 48.634  1.00 29.36  ? 162  GLU A CB    1 
ATOM   1549  C  CG    . GLU C 3 162  ? -22.575 108.402 47.461  1.00 31.41  ? 162  GLU A CG    1 
ATOM   1550  C  CD    . GLU C 3 162  ? -21.217 109.064 47.625  1.00 34.97  ? 162  GLU A CD    1 
ATOM   1551  O  OE1   . GLU C 3 162  ? -21.134 110.293 47.412  1.00 36.72  ? 162  GLU A OE1   1 
ATOM   1552  O  OE2   . GLU C 3 162  ? -20.236 108.366 47.977  1.00 34.06  ? 162  GLU A OE2   1 
ATOM   1553  N  N     . ALA C 3 163  ? -24.523 107.896 51.792  1.00 24.93  ? 163  ALA A N     1 
ATOM   1554  C  CA    . ALA C 3 163  ? -25.292 108.363 52.938  1.00 25.70  ? 163  ALA A CA    1 
ATOM   1555  C  C     . ALA C 3 163  ? -24.335 108.754 54.075  1.00 26.57  ? 163  ALA A C     1 
ATOM   1556  O  O     . ALA C 3 163  ? -24.725 109.462 55.012  1.00 25.34  ? 163  ALA A O     1 
ATOM   1557  C  CB    . ALA C 3 163  ? -26.248 107.276 53.407  1.00 23.45  ? 163  ALA A CB    1 
ATOM   1558  N  N     . GLY C 3 164  ? -23.083 108.298 53.973  1.00 25.95  ? 164  GLY A N     1 
ATOM   1559  C  CA    . GLY C 3 164  ? -22.087 108.591 54.990  1.00 26.18  ? 164  GLY A CA    1 
ATOM   1560  C  C     . GLY C 3 164  ? -21.479 109.987 54.963  1.00 27.23  ? 164  GLY A C     1 
ATOM   1561  O  O     . GLY C 3 164  ? -20.775 110.377 55.901  1.00 27.48  ? 164  GLY A O     1 
ATOM   1562  N  N     . GLY C 3 165  ? -21.732 110.740 53.896  1.00 26.28  ? 165  GLY A N     1 
ATOM   1563  C  CA    . GLY C 3 165  ? -21.195 112.084 53.800  1.00 24.96  ? 165  GLY A CA    1 
ATOM   1564  C  C     . GLY C 3 165  ? -19.735 112.124 53.385  1.00 27.00  ? 165  GLY A C     1 
ATOM   1565  O  O     . GLY C 3 165  ? -19.167 111.120 52.975  1.00 25.86  ? 165  GLY A O     1 
ATOM   1566  N  N     . SER C 3 166  ? -19.128 113.301 53.482  1.00 28.82  ? 166  SER A N     1 
ATOM   1567  C  CA    . SER C 3 166  ? -17.732 113.477 53.111  1.00 29.71  ? 166  SER A CA    1 
ATOM   1568  C  C     . SER C 3 166  ? -16.845 112.642 54.013  1.00 29.21  ? 166  SER A C     1 
ATOM   1569  O  O     . SER C 3 166  ? -17.165 112.425 55.186  1.00 27.82  ? 166  SER A O     1 
ATOM   1570  C  CB    . SER C 3 166  ? -17.338 114.943 53.247  1.00 32.53  ? 166  SER A CB    1 
ATOM   1571  O  OG    . SER C 3 166  ? -18.304 115.776 52.630  1.00 38.39  ? 166  SER A OG    1 
ATOM   1572  N  N     . LEU C 3 167  ? -15.727 112.178 53.469  1.00 28.32  ? 167  LEU A N     1 
ATOM   1573  C  CA    . LEU C 3 167  ? -14.808 111.379 54.258  1.00 28.08  ? 167  LEU A CA    1 
ATOM   1574  C  C     . LEU C 3 167  ? -13.585 112.164 54.689  1.00 27.16  ? 167  LEU A C     1 
ATOM   1575  O  O     . LEU C 3 167  ? -13.027 112.947 53.918  1.00 24.86  ? 167  LEU A O     1 
ATOM   1576  C  CB    . LEU C 3 167  ? -14.363 110.140 53.493  1.00 29.26  ? 167  LEU A CB    1 
ATOM   1577  C  CG    . LEU C 3 167  ? -15.443 109.090 53.251  1.00 31.88  ? 167  LEU A CG    1 
ATOM   1578  C  CD1   . LEU C 3 167  ? -16.247 108.895 54.532  1.00 28.11  ? 167  LEU A CD1   1 
ATOM   1579  C  CD2   . LEU C 3 167  ? -16.343 109.541 52.101  1.00 33.45  ? 167  LEU A CD2   1 
ATOM   1580  N  N     . TYR C 3 168  ? -13.178 111.936 55.934  1.00 26.92  ? 168  TYR A N     1 
ATOM   1581  C  CA    . TYR C 3 168  ? -12.014 112.598 56.502  1.00 26.32  ? 168  TYR A CA    1 
ATOM   1582  C  C     . TYR C 3 168  ? -10.753 111.855 56.104  1.00 25.20  ? 168  TYR A C     1 
ATOM   1583  O  O     . TYR C 3 168  ? -10.589 110.689 56.437  1.00 24.13  ? 168  TYR A O     1 
ATOM   1584  C  CB    . TYR C 3 168  ? -12.126 112.625 58.029  1.00 26.75  ? 168  TYR A CB    1 
ATOM   1585  C  CG    . TYR C 3 168  ? -11.044 113.430 58.719  1.00 26.69  ? 168  TYR A CG    1 
ATOM   1586  C  CD1   . TYR C 3 168  ? -10.960 114.815 58.555  1.00 25.37  ? 168  TYR A CD1   1 
ATOM   1587  C  CD2   . TYR C 3 168  ? -10.118 112.809 59.557  1.00 25.61  ? 168  TYR A CD2   1 
ATOM   1588  C  CE1   . TYR C 3 168  ? -9.984  115.557 59.219  1.00 24.81  ? 168  TYR A CE1   1 
ATOM   1589  C  CE2   . TYR C 3 168  ? -9.142  113.539 60.215  1.00 24.42  ? 168  TYR A CE2   1 
ATOM   1590  C  CZ    . TYR C 3 168  ? -9.083  114.910 60.048  1.00 25.17  ? 168  TYR A CZ    1 
ATOM   1591  O  OH    . TYR C 3 168  ? -8.137  115.626 60.735  1.00 26.30  ? 168  TYR A OH    1 
ATOM   1592  N  N     . ASP C 3 169  ? -9.863  112.540 55.393  1.00 26.73  ? 169  ASP A N     1 
ATOM   1593  C  CA    . ASP C 3 169  ? -8.595  111.960 54.957  1.00 26.51  ? 169  ASP A CA    1 
ATOM   1594  C  C     . ASP C 3 169  ? -7.642  111.894 56.157  1.00 26.61  ? 169  ASP A C     1 
ATOM   1595  O  O     . ASP C 3 169  ? -7.312  112.915 56.744  1.00 26.69  ? 169  ASP A O     1 
ATOM   1596  C  CB    . ASP C 3 169  ? -7.993  112.837 53.856  1.00 28.14  ? 169  ASP A CB    1 
ATOM   1597  C  CG    . ASP C 3 169  ? -6.771  112.214 53.199  1.00 30.29  ? 169  ASP A CG    1 
ATOM   1598  O  OD1   . ASP C 3 169  ? -5.753  111.958 53.887  1.00 32.23  ? 169  ASP A OD1   1 
ATOM   1599  O  OD2   . ASP C 3 169  ? -6.829  111.987 51.976  1.00 33.09  ? 169  ASP A OD2   1 
ATOM   1600  N  N     . PRO C 3 170  ? -7.168  110.692 56.518  1.00 27.45  ? 170  PRO A N     1 
ATOM   1601  C  CA    . PRO C 3 170  ? -6.257  110.551 57.661  1.00 28.60  ? 170  PRO A CA    1 
ATOM   1602  C  C     . PRO C 3 170  ? -4.923  111.266 57.449  1.00 29.55  ? 170  PRO A C     1 
ATOM   1603  O  O     . PRO C 3 170  ? -4.318  111.772 58.390  1.00 31.76  ? 170  PRO A O     1 
ATOM   1604  C  CB    . PRO C 3 170  ? -6.056  109.033 57.782  1.00 26.50  ? 170  PRO A CB    1 
ATOM   1605  C  CG    . PRO C 3 170  ? -7.069  108.429 56.834  1.00 26.76  ? 170  PRO A CG    1 
ATOM   1606  C  CD    . PRO C 3 170  ? -7.238  109.437 55.756  1.00 26.33  ? 170  PRO A CD    1 
ATOM   1607  N  N     . VAL C 3 171  ? -4.458  111.295 56.210  1.00 30.17  ? 171  VAL A N     1 
ATOM   1608  C  CA    . VAL C 3 171  ? -3.193  111.946 55.912  1.00 31.00  ? 171  VAL A CA    1 
ATOM   1609  C  C     . VAL C 3 171  ? -3.310  113.464 55.781  1.00 30.23  ? 171  VAL A C     1 
ATOM   1610  O  O     . VAL C 3 171  ? -2.578  114.201 56.438  1.00 29.25  ? 171  VAL A O     1 
ATOM   1611  C  CB    . VAL C 3 171  ? -2.580  111.382 54.617  1.00 32.48  ? 171  VAL A CB    1 
ATOM   1612  C  CG1   . VAL C 3 171  ? -1.315  112.159 54.252  1.00 33.86  ? 171  VAL A CG1   1 
ATOM   1613  C  CG2   . VAL C 3 171  ? -2.258  109.903 54.801  1.00 32.70  ? 171  VAL A CG2   1 
ATOM   1614  N  N     . LEU C 3 172  ? -4.226  113.923 54.932  1.00 29.29  ? 172  LEU A N     1 
ATOM   1615  C  CA    . LEU C 3 172  ? -4.429  115.353 54.699  1.00 29.85  ? 172  LEU A CA    1 
ATOM   1616  C  C     . LEU C 3 172  ? -5.079  116.074 55.879  1.00 30.81  ? 172  LEU A C     1 
ATOM   1617  O  O     . LEU C 3 172  ? -4.982  117.294 56.005  1.00 31.76  ? 172  LEU A O     1 
ATOM   1618  C  CB    . LEU C 3 172  ? -5.290  115.563 53.445  1.00 27.47  ? 172  LEU A CB    1 
ATOM   1619  C  CG    . LEU C 3 172  ? -4.761  114.956 52.141  1.00 27.86  ? 172  LEU A CG    1 
ATOM   1620  C  CD1   . LEU C 3 172  ? -5.746  115.220 51.017  1.00 27.32  ? 172  LEU A CD1   1 
ATOM   1621  C  CD2   . LEU C 3 172  ? -3.392  115.549 51.812  1.00 25.56  ? 172  LEU A CD2   1 
ATOM   1622  N  N     . GLN C 3 173  ? -5.749  115.313 56.734  1.00 31.78  ? 173  GLN A N     1 
ATOM   1623  C  CA    . GLN C 3 173  ? -6.432  115.864 57.897  1.00 32.87  ? 173  GLN A CA    1 
ATOM   1624  C  C     . GLN C 3 173  ? -7.537  116.876 57.583  1.00 32.09  ? 173  GLN A C     1 
ATOM   1625  O  O     . GLN C 3 173  ? -7.650  117.913 58.226  1.00 33.07  ? 173  GLN A O     1 
ATOM   1626  C  CB    . GLN C 3 173  ? -5.418  116.466 58.862  1.00 33.09  ? 173  GLN A CB    1 
ATOM   1627  C  CG    . GLN C 3 173  ? -4.595  115.404 59.555  1.00 35.72  ? 173  GLN A CG    1 
ATOM   1628  C  CD    . GLN C 3 173  ? -3.743  115.968 60.660  1.00 36.77  ? 173  GLN A CD    1 
ATOM   1629  O  OE1   . GLN C 3 173  ? -2.792  116.708 60.405  1.00 37.66  ? 173  GLN A OE1   1 
ATOM   1630  N  NE2   . GLN C 3 173  ? -4.083  115.630 61.903  1.00 36.22  ? 173  GLN A NE2   1 
ATOM   1631  N  N     . LYS C 3 174  ? -8.344  116.557 56.580  1.00 30.96  ? 174  LYS A N     1 
ATOM   1632  C  CA    . LYS C 3 174  ? -9.480  117.380 56.189  1.00 29.79  ? 174  LYS A CA    1 
ATOM   1633  C  C     . LYS C 3 174  ? -10.473 116.519 55.413  1.00 28.51  ? 174  LYS A C     1 
ATOM   1634  O  O     . LYS C 3 174  ? -10.125 115.459 54.900  1.00 27.88  ? 174  LYS A O     1 
ATOM   1635  C  CB    . LYS C 3 174  ? -9.049  118.587 55.344  1.00 30.03  ? 174  LYS A CB    1 
ATOM   1636  C  CG    . LYS C 3 174  ? -8.235  118.277 54.113  1.00 31.23  ? 174  LYS A CG    1 
ATOM   1637  C  CD    . LYS C 3 174  ? -8.116  119.518 53.231  1.00 33.08  ? 174  LYS A CD    1 
ATOM   1638  C  CE    . LYS C 3 174  ? -9.487  119.913 52.672  1.00 36.60  ? 174  LYS A CE    1 
ATOM   1639  N  NZ    . LYS C 3 174  ? -9.453  121.163 51.865  1.00 37.56  ? 174  LYS A NZ    1 
ATOM   1640  N  N     . TYR C 3 175  ? -11.721 116.961 55.364  1.00 27.53  ? 175  TYR A N     1 
ATOM   1641  C  CA    . TYR C 3 175  ? -12.751 116.227 54.649  1.00 27.14  ? 175  TYR A CA    1 
ATOM   1642  C  C     . TYR C 3 175  ? -12.623 116.530 53.172  1.00 26.45  ? 175  TYR A C     1 
ATOM   1643  O  O     . TYR C 3 175  ? -12.244 117.638 52.814  1.00 26.59  ? 175  TYR A O     1 
ATOM   1644  C  CB    . TYR C 3 175  ? -14.131 116.657 55.144  1.00 26.31  ? 175  TYR A CB    1 
ATOM   1645  C  CG    . TYR C 3 175  ? -14.516 116.062 56.472  1.00 27.06  ? 175  TYR A CG    1 
ATOM   1646  C  CD1   . TYR C 3 175  ? -15.080 114.789 56.544  1.00 26.83  ? 175  TYR A CD1   1 
ATOM   1647  C  CD2   . TYR C 3 175  ? -14.314 116.766 57.660  1.00 25.80  ? 175  TYR A CD2   1 
ATOM   1648  C  CE1   . TYR C 3 175  ? -15.441 114.232 57.761  1.00 28.59  ? 175  TYR A CE1   1 
ATOM   1649  C  CE2   . TYR C 3 175  ? -14.665 116.218 58.887  1.00 27.37  ? 175  TYR A CE2   1 
ATOM   1650  C  CZ    . TYR C 3 175  ? -15.231 114.951 58.936  1.00 30.13  ? 175  TYR A CZ    1 
ATOM   1651  O  OH    . TYR C 3 175  ? -15.599 114.398 60.148  1.00 29.86  ? 175  TYR A OH    1 
ATOM   1652  N  N     . ASP C 3 176  ? -12.924 115.553 52.314  1.00 28.19  ? 176  ASP A N     1 
ATOM   1653  C  CA    . ASP C 3 176  ? -12.844 115.786 50.874  1.00 29.15  ? 176  ASP A CA    1 
ATOM   1654  C  C     . ASP C 3 176  ? -13.971 116.715 50.477  1.00 29.39  ? 176  ASP A C     1 
ATOM   1655  O  O     . ASP C 3 176  ? -14.932 116.882 51.220  1.00 27.92  ? 176  ASP A O     1 
ATOM   1656  C  CB    . ASP C 3 176  ? -12.932 114.477 50.078  1.00 28.94  ? 176  ASP A CB    1 
ATOM   1657  C  CG    . ASP C 3 176  ? -14.267 113.776 50.218  1.00 31.19  ? 176  ASP A CG    1 
ATOM   1658  O  OD1   . ASP C 3 176  ? -15.310 114.337 49.804  1.00 32.25  ? 176  ASP A OD1   1 
ATOM   1659  O  OD2   . ASP C 3 176  ? -14.267 112.639 50.731  1.00 32.85  ? 176  ASP A OD2   1 
ATOM   1660  N  N     . GLU C 3 177  ? -13.850 117.333 49.312  1.00 32.07  ? 177  GLU A N     1 
ATOM   1661  C  CA    . GLU C 3 177  ? -14.886 118.250 48.862  1.00 35.45  ? 177  GLU A CA    1 
ATOM   1662  C  C     . GLU C 3 177  ? -15.621 117.774 47.618  1.00 34.30  ? 177  GLU A C     1 
ATOM   1663  O  O     . GLU C 3 177  ? -15.866 118.535 46.686  1.00 34.13  ? 177  GLU A O     1 
ATOM   1664  C  CB    . GLU C 3 177  ? -14.286 119.643 48.653  1.00 39.13  ? 177  GLU A CB    1 
ATOM   1665  C  CG    . GLU C 3 177  ? -14.069 120.382 49.963  1.00 45.16  ? 177  GLU A CG    1 
ATOM   1666  C  CD    . GLU C 3 177  ? -12.885 121.319 49.918  1.00 49.92  ? 177  GLU A CD    1 
ATOM   1667  O  OE1   . GLU C 3 177  ? -12.799 122.119 48.958  1.00 53.59  ? 177  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU C 3 177  ? -12.044 121.260 50.846  1.00 52.13  ? 177  GLU A OE2   1 
ATOM   1669  N  N     . ILE C 3 178  ? -15.976 116.496 47.623  1.00 33.30  ? 178  ILE A N     1 
ATOM   1670  C  CA    . ILE C 3 178  ? -16.713 115.904 46.526  1.00 31.43  ? 178  ILE A CA    1 
ATOM   1671  C  C     . ILE C 3 178  ? -18.190 116.231 46.734  1.00 30.82  ? 178  ILE A C     1 
ATOM   1672  O  O     . ILE C 3 178  ? -18.772 115.922 47.774  1.00 29.13  ? 178  ILE A O     1 
ATOM   1673  C  CB    . ILE C 3 178  ? -16.464 114.387 46.485  1.00 31.51  ? 178  ILE A CB    1 
ATOM   1674  C  CG1   . ILE C 3 178  ? -15.039 114.144 45.967  1.00 30.67  ? 178  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE C 3 178  ? -17.512 113.693 45.629  1.00 29.70  ? 178  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE C 3 178  ? -14.531 112.746 46.170  1.00 31.73  ? 178  ILE A CD1   1 
ATOM   1677  N  N     . PRO C 3 179  ? -18.813 116.876 45.737  1.00 30.03  ? 179  PRO A N     1 
ATOM   1678  C  CA    . PRO C 3 179  ? -20.224 117.254 45.821  1.00 29.77  ? 179  PRO A CA    1 
ATOM   1679  C  C     . PRO C 3 179  ? -21.120 116.069 46.131  1.00 30.07  ? 179  PRO A C     1 
ATOM   1680  O  O     . PRO C 3 179  ? -20.927 114.983 45.585  1.00 32.32  ? 179  PRO A O     1 
ATOM   1681  C  CB    . PRO C 3 179  ? -20.503 117.855 44.445  1.00 29.90  ? 179  PRO A CB    1 
ATOM   1682  C  CG    . PRO C 3 179  ? -19.140 118.359 44.007  1.00 30.43  ? 179  PRO A CG    1 
ATOM   1683  C  CD    . PRO C 3 179  ? -18.259 117.215 44.417  1.00 29.31  ? 179  PRO A CD    1 
ATOM   1684  N  N     . ASP C 3 180  ? -22.100 116.270 47.005  1.00 29.44  ? 180  ASP A N     1 
ATOM   1685  C  CA    . ASP C 3 180  ? -22.992 115.178 47.345  1.00 30.05  ? 180  ASP A CA    1 
ATOM   1686  C  C     . ASP C 3 180  ? -23.972 114.872 46.201  1.00 28.90  ? 180  ASP A C     1 
ATOM   1687  O  O     . ASP C 3 180  ? -24.036 115.600 45.205  1.00 27.95  ? 180  ASP A O     1 
ATOM   1688  C  CB    . ASP C 3 180  ? -23.708 115.452 48.685  1.00 31.80  ? 180  ASP A CB    1 
ATOM   1689  C  CG    . ASP C 3 180  ? -24.679 116.622 48.627  1.00 34.73  ? 180  ASP A CG    1 
ATOM   1690  O  OD1   . ASP C 3 180  ? -25.015 117.143 49.715  1.00 32.97  ? 180  ASP A OD1   1 
ATOM   1691  O  OD2   . ASP C 3 180  ? -25.122 117.006 47.519  1.00 36.03  ? 180  ASP A OD2   1 
ATOM   1692  N  N     . LEU C 3 181  ? -24.714 113.781 46.349  1.00 27.80  ? 181  LEU A N     1 
ATOM   1693  C  CA    . LEU C 3 181  ? -25.630 113.317 45.317  1.00 26.68  ? 181  LEU A CA    1 
ATOM   1694  C  C     . LEU C 3 181  ? -26.636 114.306 44.767  1.00 27.58  ? 181  LEU A C     1 
ATOM   1695  O  O     . LEU C 3 181  ? -27.119 114.134 43.639  1.00 27.19  ? 181  LEU A O     1 
ATOM   1696  C  CB    . LEU C 3 181  ? -26.358 112.056 45.792  1.00 24.43  ? 181  LEU A CB    1 
ATOM   1697  C  CG    . LEU C 3 181  ? -25.462 110.820 45.969  1.00 23.52  ? 181  LEU A CG    1 
ATOM   1698  C  CD1   . LEU C 3 181  ? -26.355 109.616 46.167  1.00 20.28  ? 181  LEU A CD1   1 
ATOM   1699  C  CD2   . LEU C 3 181  ? -24.544 110.607 44.746  1.00 17.55  ? 181  LEU A CD2   1 
ATOM   1700  N  N     . SER C 3 182  ? -26.946 115.346 45.534  1.00 27.04  ? 182  SER A N     1 
ATOM   1701  C  CA    . SER C 3 182  ? -27.912 116.324 45.068  1.00 27.05  ? 182  SER A CA    1 
ATOM   1702  C  C     . SER C 3 182  ? -27.325 117.078 43.880  1.00 26.93  ? 182  SER A C     1 
ATOM   1703  O  O     . SER C 3 182  ? -28.001 117.880 43.245  1.00 28.04  ? 182  SER A O     1 
ATOM   1704  C  CB    . SER C 3 182  ? -28.294 117.297 46.196  1.00 26.95  ? 182  SER A CB    1 
ATOM   1705  O  OG    . SER C 3 182  ? -27.371 118.366 46.301  1.00 27.99  ? 182  SER A OG    1 
ATOM   1706  N  N     . HIS C 3 183  ? -26.065 116.801 43.568  1.00 27.08  ? 183  HIS A N     1 
ATOM   1707  C  CA    . HIS C 3 183  ? -25.394 117.457 42.450  1.00 28.22  ? 183  HIS A CA    1 
ATOM   1708  C  C     . HIS C 3 183  ? -24.986 116.465 41.355  1.00 27.91  ? 183  HIS A C     1 
ATOM   1709  O  O     . HIS C 3 183  ? -24.340 116.838 40.370  1.00 25.52  ? 183  HIS A O     1 
ATOM   1710  C  CB    . HIS C 3 183  ? -24.160 118.189 42.969  1.00 31.01  ? 183  HIS A CB    1 
ATOM   1711  C  CG    . HIS C 3 183  ? -24.472 119.226 43.999  1.00 33.27  ? 183  HIS A CG    1 
ATOM   1712  N  ND1   . HIS C 3 183  ? -25.066 120.431 43.686  1.00 35.06  ? 183  HIS A ND1   1 
ATOM   1713  C  CD2   . HIS C 3 183  ? -24.323 119.218 45.344  1.00 32.75  ? 183  HIS A CD2   1 
ATOM   1714  C  CE1   . HIS C 3 183  ? -25.272 121.119 44.793  1.00 34.35  ? 183  HIS A CE1   1 
ATOM   1715  N  NE2   . HIS C 3 183  ? -24.830 120.405 45.814  1.00 35.83  ? 183  HIS A NE2   1 
ATOM   1716  N  N     . ASN C 3 184  ? -25.371 115.204 41.536  1.00 27.79  ? 184  ASN A N     1 
ATOM   1717  C  CA    . ASN C 3 184  ? -25.039 114.146 40.590  1.00 27.90  ? 184  ASN A CA    1 
ATOM   1718  C  C     . ASN C 3 184  ? -26.039 114.135 39.426  1.00 28.69  ? 184  ASN A C     1 
ATOM   1719  O  O     . ASN C 3 184  ? -27.163 113.643 39.555  1.00 30.31  ? 184  ASN A O     1 
ATOM   1720  C  CB    . ASN C 3 184  ? -25.028 112.800 41.329  1.00 26.75  ? 184  ASN A CB    1 
ATOM   1721  C  CG    . ASN C 3 184  ? -24.334 111.704 40.545  1.00 26.61  ? 184  ASN A CG    1 
ATOM   1722  O  OD1   . ASN C 3 184  ? -24.829 111.266 39.510  1.00 27.05  ? 184  ASN A OD1   1 
ATOM   1723  N  ND2   . ASN C 3 184  ? -23.174 111.258 41.034  1.00 25.94  ? 184  ASN A ND2   1 
ATOM   1724  N  N     . CYS C 3 185  ? -25.622 114.693 38.295  1.00 28.85  ? 185  CYS A N     1 
ATOM   1725  C  CA    . CYS C 3 185  ? -26.470 114.771 37.115  1.00 29.56  ? 185  CYS A CA    1 
ATOM   1726  C  C     . CYS C 3 185  ? -26.847 113.398 36.554  1.00 29.30  ? 185  CYS A C     1 
ATOM   1727  O  O     . CYS C 3 185  ? -27.986 113.183 36.130  1.00 28.33  ? 185  CYS A O     1 
ATOM   1728  C  CB    . CYS C 3 185  ? -25.786 115.617 36.039  1.00 31.91  ? 185  CYS A CB    1 
ATOM   1729  S  SG    . CYS C 3 185  ? -26.754 115.782 34.521  1.00 35.45  ? 185  CYS A SG    1 
ATOM   1730  N  N     . PRO C 3 186  ? -25.892 112.454 36.511  1.00 28.39  ? 186  PRO A N     1 
ATOM   1731  C  CA    . PRO C 3 186  ? -26.278 111.145 35.981  1.00 28.51  ? 186  PRO A CA    1 
ATOM   1732  C  C     . PRO C 3 186  ? -27.449 110.532 36.758  1.00 28.46  ? 186  PRO A C     1 
ATOM   1733  O  O     . PRO C 3 186  ? -28.407 110.060 36.151  1.00 29.74  ? 186  PRO A O     1 
ATOM   1734  C  CB    . PRO C 3 186  ? -24.996 110.338 36.113  1.00 26.14  ? 186  PRO A CB    1 
ATOM   1735  C  CG    . PRO C 3 186  ? -23.971 111.353 35.795  1.00 26.46  ? 186  PRO A CG    1 
ATOM   1736  C  CD    . PRO C 3 186  ? -24.426 112.568 36.582  1.00 26.03  ? 186  PRO A CD    1 
ATOM   1737  N  N     . LEU C 3 187  ? -27.379 110.548 38.091  1.00 28.33  ? 187  LEU A N     1 
ATOM   1738  C  CA    . LEU C 3 187  ? -28.459 109.983 38.921  1.00 28.75  ? 187  LEU A CA    1 
ATOM   1739  C  C     . LEU C 3 187  ? -29.799 110.665 38.670  1.00 27.67  ? 187  LEU A C     1 
ATOM   1740  O  O     . LEU C 3 187  ? -30.837 110.010 38.562  1.00 25.16  ? 187  LEU A O     1 
ATOM   1741  C  CB    . LEU C 3 187  ? -28.140 110.104 40.418  1.00 27.44  ? 187  LEU A CB    1 
ATOM   1742  C  CG    . LEU C 3 187  ? -27.902 108.808 41.197  1.00 27.90  ? 187  LEU A CG    1 
ATOM   1743  C  CD1   . LEU C 3 187  ? -27.985 109.099 42.700  1.00 27.37  ? 187  LEU A CD1   1 
ATOM   1744  C  CD2   . LEU C 3 187  ? -28.929 107.759 40.796  1.00 25.51  ? 187  LEU A CD2   1 
ATOM   1745  N  N     . TRP C 3 188  ? -29.766 111.992 38.606  1.00 28.40  ? 188  TRP A N     1 
ATOM   1746  C  CA    . TRP C 3 188  ? -30.973 112.762 38.374  1.00 29.20  ? 188  TRP A CA    1 
ATOM   1747  C  C     . TRP C 3 188  ? -31.640 112.268 37.084  1.00 29.87  ? 188  TRP A C     1 
ATOM   1748  O  O     . TRP C 3 188  ? -32.839 111.965 37.072  1.00 29.77  ? 188  TRP A O     1 
ATOM   1749  C  CB    . TRP C 3 188  ? -30.641 114.253 38.260  1.00 27.78  ? 188  TRP A CB    1 
ATOM   1750  C  CG    . TRP C 3 188  ? -31.856 115.065 37.992  1.00 29.14  ? 188  TRP A CG    1 
ATOM   1751  C  CD1   . TRP C 3 188  ? -32.781 115.478 38.902  1.00 28.46  ? 188  TRP A CD1   1 
ATOM   1752  C  CD2   . TRP C 3 188  ? -32.335 115.485 36.710  1.00 30.15  ? 188  TRP A CD2   1 
ATOM   1753  N  NE1   . TRP C 3 188  ? -33.809 116.130 38.268  1.00 30.04  ? 188  TRP A NE1   1 
ATOM   1754  C  CE2   . TRP C 3 188  ? -33.562 116.146 36.921  1.00 30.37  ? 188  TRP A CE2   1 
ATOM   1755  C  CE3   . TRP C 3 188  ? -31.847 115.360 35.399  1.00 30.53  ? 188  TRP A CE3   1 
ATOM   1756  C  CZ2   . TRP C 3 188  ? -34.315 116.684 35.871  1.00 31.83  ? 188  TRP A CZ2   1 
ATOM   1757  C  CZ3   . TRP C 3 188  ? -32.595 115.893 34.353  1.00 32.72  ? 188  TRP A CZ3   1 
ATOM   1758  C  CH2   . TRP C 3 188  ? -33.817 116.547 34.596  1.00 32.45  ? 188  TRP A CH2   1 
ATOM   1759  N  N     . CYS C 3 189  ? -30.855 112.191 36.007  1.00 29.92  ? 189  CYS A N     1 
ATOM   1760  C  CA    . CYS C 3 189  ? -31.346 111.719 34.718  1.00 31.45  ? 189  CYS A CA    1 
ATOM   1761  C  C     . CYS C 3 189  ? -31.924 110.321 34.846  1.00 30.33  ? 189  CYS A C     1 
ATOM   1762  O  O     . CYS C 3 189  ? -33.005 110.036 34.329  1.00 31.16  ? 189  CYS A O     1 
ATOM   1763  C  CB    . CYS C 3 189  ? -30.222 111.702 33.679  1.00 32.39  ? 189  CYS A CB    1 
ATOM   1764  S  SG    . CYS C 3 189  ? -29.674 113.338 33.166  1.00 38.32  ? 189  CYS A SG    1 
ATOM   1765  N  N     . PHE C 3 190  ? -31.195 109.450 35.533  1.00 29.55  ? 190  PHE A N     1 
ATOM   1766  C  CA    . PHE C 3 190  ? -31.644 108.078 35.735  1.00 29.22  ? 190  PHE A CA    1 
ATOM   1767  C  C     . PHE C 3 190  ? -33.035 108.080 36.388  1.00 29.70  ? 190  PHE A C     1 
ATOM   1768  O  O     . PHE C 3 190  ? -33.948 107.399 35.920  1.00 30.04  ? 190  PHE A O     1 
ATOM   1769  C  CB    . PHE C 3 190  ? -30.637 107.333 36.619  1.00 28.67  ? 190  PHE A CB    1 
ATOM   1770  C  CG    . PHE C 3 190  ? -31.013 105.906 36.901  1.00 27.26  ? 190  PHE A CG    1 
ATOM   1771  C  CD1   . PHE C 3 190  ? -30.687 104.898 36.006  1.00 24.75  ? 190  PHE A CD1   1 
ATOM   1772  C  CD2   . PHE C 3 190  ? -31.721 105.576 38.057  1.00 26.27  ? 190  PHE A CD2   1 
ATOM   1773  C  CE1   . PHE C 3 190  ? -31.057 103.586 36.251  1.00 23.89  ? 190  PHE A CE1   1 
ATOM   1774  C  CE2   . PHE C 3 190  ? -32.094 104.266 38.310  1.00 26.43  ? 190  PHE A CE2   1 
ATOM   1775  C  CZ    . PHE C 3 190  ? -31.760 103.267 37.402  1.00 24.99  ? 190  PHE A CZ    1 
ATOM   1776  N  N     . ARG C 3 191  ? -33.207 108.857 37.456  1.00 29.21  ? 191  ARG A N     1 
ATOM   1777  C  CA    . ARG C 3 191  ? -34.501 108.908 38.131  1.00 28.81  ? 191  ARG A CA    1 
ATOM   1778  C  C     . ARG C 3 191  ? -35.598 109.477 37.235  1.00 29.41  ? 191  ARG A C     1 
ATOM   1779  O  O     . ARG C 3 191  ? -36.688 108.908 37.158  1.00 30.54  ? 191  ARG A O     1 
ATOM   1780  C  CB    . ARG C 3 191  ? -34.419 109.737 39.416  1.00 28.89  ? 191  ARG A CB    1 
ATOM   1781  C  CG    . ARG C 3 191  ? -35.659 109.616 40.301  1.00 24.71  ? 191  ARG A CG    1 
ATOM   1782  C  CD    . ARG C 3 191  ? -35.586 110.576 41.464  1.00 27.33  ? 191  ARG A CD    1 
ATOM   1783  N  NE    . ARG C 3 191  ? -35.721 111.968 41.038  1.00 28.24  ? 191  ARG A NE    1 
ATOM   1784  C  CZ    . ARG C 3 191  ? -35.642 113.019 41.857  1.00 28.49  ? 191  ARG A CZ    1 
ATOM   1785  N  NH1   . ARG C 3 191  ? -35.421 112.840 43.152  1.00 25.46  ? 191  ARG A NH1   1 
ATOM   1786  N  NH2   . ARG C 3 191  ? -35.807 114.252 41.380  1.00 26.18  ? 191  ARG A NH2   1 
ATOM   1787  N  N     . GLU C 3 192  ? -35.310 110.592 36.562  1.00 29.64  ? 192  GLU A N     1 
ATOM   1788  C  CA    . GLU C 3 192  ? -36.282 111.235 35.669  1.00 30.95  ? 192  GLU A CA    1 
ATOM   1789  C  C     . GLU C 3 192  ? -36.692 110.374 34.480  1.00 30.12  ? 192  GLU A C     1 
ATOM   1790  O  O     . GLU C 3 192  ? -37.882 110.209 34.213  1.00 30.57  ? 192  GLU A O     1 
ATOM   1791  C  CB    . GLU C 3 192  ? -35.739 112.564 35.139  1.00 32.60  ? 192  GLU A CB    1 
ATOM   1792  C  CG    . GLU C 3 192  ? -35.748 113.691 36.162  1.00 39.02  ? 192  GLU A CG    1 
ATOM   1793  C  CD    . GLU C 3 192  ? -37.152 114.184 36.482  1.00 42.16  ? 192  GLU A CD    1 
ATOM   1794  O  OE1   . GLU C 3 192  ? -37.842 114.667 35.547  1.00 43.05  ? 192  GLU A OE1   1 
ATOM   1795  O  OE2   . GLU C 3 192  ? -37.559 114.091 37.665  1.00 41.69  ? 192  GLU A OE2   1 
ATOM   1796  N  N     . ILE C 3 193  ? -35.708 109.840 33.764  1.00 28.11  ? 193  ILE A N     1 
ATOM   1797  C  CA    . ILE C 3 193  ? -35.976 109.012 32.597  1.00 26.90  ? 193  ILE A CA    1 
ATOM   1798  C  C     . ILE C 3 193  ? -36.844 107.818 32.974  1.00 27.39  ? 193  ILE A C     1 
ATOM   1799  O  O     . ILE C 3 193  ? -37.838 107.520 32.300  1.00 27.94  ? 193  ILE A O     1 
ATOM   1800  C  CB    . ILE C 3 193  ? -34.644 108.539 31.947  1.00 27.52  ? 193  ILE A CB    1 
ATOM   1801  C  CG1   . ILE C 3 193  ? -33.929 109.740 31.331  1.00 24.40  ? 193  ILE A CG1   1 
ATOM   1802  C  CG2   . ILE C 3 193  ? -34.899 107.462 30.884  1.00 25.52  ? 193  ILE A CG2   1 
ATOM   1803  C  CD1   . ILE C 3 193  ? -32.510 109.456 30.951  1.00 24.88  ? 193  ILE A CD1   1 
ATOM   1804  N  N     . CYS C 3 194  ? -36.479 107.141 34.058  1.00 27.86  ? 194  CYS A N     1 
ATOM   1805  C  CA    . CYS C 3 194  ? -37.237 105.988 34.524  1.00 27.24  ? 194  CYS A CA    1 
ATOM   1806  C  C     . CYS C 3 194  ? -38.610 106.406 35.040  1.00 26.91  ? 194  CYS A C     1 
ATOM   1807  O  O     . CYS C 3 194  ? -39.605 105.760 34.754  1.00 27.65  ? 194  CYS A O     1 
ATOM   1808  C  CB    . CYS C 3 194  ? -36.464 105.252 35.623  1.00 27.54  ? 194  CYS A CB    1 
ATOM   1809  S  SG    . CYS C 3 194  ? -34.927 104.489 35.049  1.00 29.59  ? 194  CYS A SG    1 
ATOM   1810  N  N     . ARG C 3 195  ? -38.671 107.495 35.791  1.00 27.38  ? 195  ARG A N     1 
ATOM   1811  C  CA    . ARG C 3 195  ? -39.952 107.937 36.314  1.00 29.72  ? 195  ARG A CA    1 
ATOM   1812  C  C     . ARG C 3 195  ? -40.900 108.250 35.147  1.00 30.28  ? 195  ARG A C     1 
ATOM   1813  O  O     . ARG C 3 195  ? -42.083 107.885 35.168  1.00 30.44  ? 195  ARG A O     1 
ATOM   1814  C  CB    . ARG C 3 195  ? -39.763 109.175 37.203  1.00 31.07  ? 195  ARG A CB    1 
ATOM   1815  C  CG    . ARG C 3 195  ? -41.020 109.602 37.951  1.00 35.41  ? 195  ARG A CG    1 
ATOM   1816  C  CD    . ARG C 3 195  ? -40.879 110.998 38.572  1.00 40.71  ? 195  ARG A CD    1 
ATOM   1817  N  NE    . ARG C 3 195  ? -40.076 111.028 39.798  1.00 45.24  ? 195  ARG A NE    1 
ATOM   1818  C  CZ    . ARG C 3 195  ? -39.731 112.144 40.445  1.00 47.54  ? 195  ARG A CZ    1 
ATOM   1819  N  NH1   . ARG C 3 195  ? -40.115 113.332 39.986  1.00 46.82  ? 195  ARG A NH1   1 
ATOM   1820  N  NH2   . ARG C 3 195  ? -39.004 112.079 41.556  1.00 46.58  ? 195  ARG A NH2   1 
ATOM   1821  N  N     . HIS C 3 196  ? -40.366 108.922 34.132  1.00 28.87  ? 196  HIS A N     1 
ATOM   1822  C  CA    . HIS C 3 196  ? -41.138 109.303 32.962  1.00 28.61  ? 196  HIS A CA    1 
ATOM   1823  C  C     . HIS C 3 196  ? -41.624 108.068 32.217  1.00 28.55  ? 196  HIS A C     1 
ATOM   1824  O  O     . HIS C 3 196  ? -42.703 108.070 31.621  1.00 26.43  ? 196  HIS A O     1 
ATOM   1825  C  CB    . HIS C 3 196  ? -40.285 110.154 32.020  1.00 30.54  ? 196  HIS A CB    1 
ATOM   1826  C  CG    . HIS C 3 196  ? -41.032 110.669 30.829  1.00 33.12  ? 196  HIS A CG    1 
ATOM   1827  N  ND1   . HIS C 3 196  ? -41.770 111.832 30.859  1.00 34.40  ? 196  HIS A ND1   1 
ATOM   1828  C  CD2   . HIS C 3 196  ? -41.181 110.162 29.583  1.00 34.48  ? 196  HIS A CD2   1 
ATOM   1829  C  CE1   . HIS C 3 196  ? -42.339 112.021 29.682  1.00 33.16  ? 196  HIS A CE1   1 
ATOM   1830  N  NE2   . HIS C 3 196  ? -41.998 111.022 28.889  1.00 33.70  ? 196  HIS A NE2   1 
ATOM   1831  N  N     . ILE C 3 197  ? -40.826 107.008 32.243  1.00 27.64  ? 197  ILE A N     1 
ATOM   1832  C  CA    . ILE C 3 197  ? -41.224 105.798 31.547  1.00 25.50  ? 197  ILE A CA    1 
ATOM   1833  C  C     . ILE C 3 197  ? -42.312 105.090 32.330  1.00 25.88  ? 197  ILE A C     1 
ATOM   1834  O  O     . ILE C 3 197  ? -43.366 104.774 31.786  1.00 26.63  ? 197  ILE A O     1 
ATOM   1835  C  CB    . ILE C 3 197  ? -40.012 104.848 31.320  1.00 23.20  ? 197  ILE A CB    1 
ATOM   1836  C  CG1   . ILE C 3 197  ? -39.005 105.529 30.391  1.00 19.19  ? 197  ILE A CG1   1 
ATOM   1837  C  CG2   . ILE C 3 197  ? -40.480 103.520 30.714  1.00 19.52  ? 197  ILE A CG2   1 
ATOM   1838  C  CD1   . ILE C 3 197  ? -37.822 104.696 30.027  1.00 18.08  ? 197  ILE A CD1   1 
ATOM   1839  N  N     . SER C 3 198  ? -42.073 104.865 33.615  1.00 26.61  ? 198  SER A N     1 
ATOM   1840  C  CA    . SER C 3 198  ? -43.055 104.169 34.439  1.00 29.63  ? 198  SER A CA    1 
ATOM   1841  C  C     . SER C 3 198  ? -44.376 104.934 34.560  1.00 31.06  ? 198  SER A C     1 
ATOM   1842  O  O     . SER C 3 198  ? -45.449 104.322 34.689  1.00 29.94  ? 198  SER A O     1 
ATOM   1843  C  CB    . SER C 3 198  ? -42.482 103.893 35.836  1.00 28.79  ? 198  SER A CB    1 
ATOM   1844  O  OG    . SER C 3 198  ? -42.126 105.097 36.492  1.00 33.51  ? 198  SER A OG    1 
ATOM   1845  N  N     . GLY C 3 199  ? -44.288 106.267 34.510  1.00 31.86  ? 199  GLY A N     1 
ATOM   1846  C  CA    . GLY C 3 199  ? -45.466 107.112 34.626  1.00 30.23  ? 199  GLY A CA    1 
ATOM   1847  C  C     . GLY C 3 199  ? -46.311 106.757 35.840  1.00 31.32  ? 199  GLY A C     1 
ATOM   1848  O  O     . GLY C 3 199  ? -45.837 106.792 36.982  1.00 30.22  ? 199  GLY A O     1 
ATOM   1849  N  N     . PRO C 3 200  ? -47.578 106.396 35.622  1.00 31.55  ? 200  PRO A N     1 
ATOM   1850  C  CA    . PRO C 3 200  ? -48.461 106.038 36.729  1.00 31.44  ? 200  PRO A CA    1 
ATOM   1851  C  C     . PRO C 3 200  ? -48.241 104.619 37.263  1.00 32.24  ? 200  PRO A C     1 
ATOM   1852  O  O     . PRO C 3 200  ? -48.791 104.255 38.298  1.00 32.95  ? 200  PRO A O     1 
ATOM   1853  C  CB    . PRO C 3 200  ? -49.844 106.214 36.120  1.00 31.91  ? 200  PRO A CB    1 
ATOM   1854  C  CG    . PRO C 3 200  ? -49.621 105.733 34.707  1.00 32.80  ? 200  PRO A CG    1 
ATOM   1855  C  CD    . PRO C 3 200  ? -48.313 106.413 34.342  1.00 32.02  ? 200  PRO A CD    1 
ATOM   1856  N  N     . LEU C 3 201  ? -47.442 103.818 36.567  1.00 32.68  ? 201  LEU A N     1 
ATOM   1857  C  CA    . LEU C 3 201  ? -47.207 102.449 37.015  1.00 33.54  ? 201  LEU A CA    1 
ATOM   1858  C  C     . LEU C 3 201  ? -46.491 102.362 38.368  1.00 34.60  ? 201  LEU A C     1 
ATOM   1859  O  O     . LEU C 3 201  ? -45.552 103.108 38.647  1.00 34.00  ? 201  LEU A O     1 
ATOM   1860  C  CB    . LEU C 3 201  ? -46.428 101.661 35.951  1.00 32.93  ? 201  LEU A CB    1 
ATOM   1861  C  CG    . LEU C 3 201  ? -47.146 101.435 34.615  1.00 33.54  ? 201  LEU A CG    1 
ATOM   1862  C  CD1   . LEU C 3 201  ? -46.224 100.724 33.648  1.00 33.49  ? 201  LEU A CD1   1 
ATOM   1863  C  CD2   . LEU C 3 201  ? -48.413 100.623 34.833  1.00 32.62  ? 201  LEU A CD2   1 
ATOM   1864  N  N     . PRO C 3 202  ? -46.949 101.441 39.233  1.00 36.25  ? 202  PRO A N     1 
ATOM   1865  C  CA    . PRO C 3 202  ? -46.416 101.184 40.579  1.00 36.27  ? 202  PRO A CA    1 
ATOM   1866  C  C     . PRO C 3 202  ? -44.982 100.670 40.521  1.00 36.27  ? 202  PRO A C     1 
ATOM   1867  O  O     . PRO C 3 202  ? -44.214 100.835 41.470  1.00 37.78  ? 202  PRO A O     1 
ATOM   1868  C  CB    . PRO C 3 202  ? -47.360 100.123 41.129  1.00 34.57  ? 202  PRO A CB    1 
ATOM   1869  C  CG    . PRO C 3 202  ? -48.628 100.401 40.397  1.00 37.37  ? 202  PRO A CG    1 
ATOM   1870  C  CD    . PRO C 3 202  ? -48.152 100.631 38.998  1.00 34.45  ? 202  PRO A CD    1 
ATOM   1871  N  N     . ASP C 3 203  ? -44.650 100.029 39.403  1.00 34.64  ? 203  ASP A N     1 
ATOM   1872  C  CA    . ASP C 3 203  ? -43.322 99.479  39.170  1.00 34.63  ? 203  ASP A CA    1 
ATOM   1873  C  C     . ASP C 3 203  ? -42.445 100.586 38.601  1.00 34.33  ? 203  ASP A C     1 
ATOM   1874  O  O     . ASP C 3 203  ? -42.750 101.145 37.542  1.00 36.56  ? 203  ASP A O     1 
ATOM   1875  C  CB    . ASP C 3 203  ? -43.428 98.322  38.187  1.00 35.08  ? 203  ASP A CB    1 
ATOM   1876  C  CG    . ASP C 3 203  ? -44.386 97.261  38.665  1.00 36.69  ? 203  ASP A CG    1 
ATOM   1877  O  OD1   . ASP C 3 203  ? -44.028 96.555  39.632  1.00 37.52  ? 203  ASP A OD1   1 
ATOM   1878  O  OD2   . ASP C 3 203  ? -45.497 97.147  38.094  1.00 37.50  ? 203  ASP A OD2   1 
ATOM   1879  N  N     . ARG C 3 204  ? -41.360 100.900 39.303  1.00 31.45  ? 204  ARG A N     1 
ATOM   1880  C  CA    . ARG C 3 204  ? -40.462 101.968 38.886  1.00 29.65  ? 204  ARG A CA    1 
ATOM   1881  C  C     . ARG C 3 204  ? -39.309 101.558 37.958  1.00 29.03  ? 204  ARG A C     1 
ATOM   1882  O  O     . ARG C 3 204  ? -38.669 102.412 37.364  1.00 27.73  ? 204  ARG A O     1 
ATOM   1883  C  CB    . ARG C 3 204  ? -39.912 102.663 40.129  1.00 28.22  ? 204  ARG A CB    1 
ATOM   1884  C  CG    . ARG C 3 204  ? -40.987 103.154 41.094  1.00 26.55  ? 204  ARG A CG    1 
ATOM   1885  C  CD    . ARG C 3 204  ? -41.685 104.371 40.547  1.00 25.06  ? 204  ARG A CD    1 
ATOM   1886  N  NE    . ARG C 3 204  ? -40.710 105.417 40.253  1.00 28.34  ? 204  ARG A NE    1 
ATOM   1887  C  CZ    . ARG C 3 204  ? -40.252 106.302 41.134  1.00 27.36  ? 204  ARG A CZ    1 
ATOM   1888  N  NH1   . ARG C 3 204  ? -40.689 106.289 42.384  1.00 28.12  ? 204  ARG A NH1   1 
ATOM   1889  N  NH2   . ARG C 3 204  ? -39.330 107.182 40.768  1.00 28.11  ? 204  ARG A NH2   1 
ATOM   1890  N  N     . ALA C 3 205  ? -39.049 100.260 37.829  1.00 30.30  ? 205  ALA A N     1 
ATOM   1891  C  CA    . ALA C 3 205  ? -37.966 99.788  36.965  1.00 30.57  ? 205  ALA A CA    1 
ATOM   1892  C  C     . ALA C 3 205  ? -38.409 99.678  35.513  1.00 31.22  ? 205  ALA A C     1 
ATOM   1893  O  O     . ALA C 3 205  ? -39.422 99.050  35.210  1.00 31.42  ? 205  ALA A O     1 
ATOM   1894  C  CB    . ALA C 3 205  ? -37.463 98.442  37.449  1.00 29.54  ? 205  ALA A CB    1 
ATOM   1895  N  N     . PRO C 3 206  ? -37.653 100.292 34.594  1.00 31.91  ? 206  PRO A N     1 
ATOM   1896  C  CA    . PRO C 3 206  ? -37.930 100.289 33.147  1.00 32.37  ? 206  PRO A CA    1 
ATOM   1897  C  C     . PRO C 3 206  ? -37.800 98.905  32.513  1.00 32.10  ? 206  PRO A C     1 
ATOM   1898  O  O     . PRO C 3 206  ? -38.358 98.640  31.451  1.00 32.92  ? 206  PRO A O     1 
ATOM   1899  C  CB    . PRO C 3 206  ? -36.889 101.263 32.591  1.00 33.51  ? 206  PRO A CB    1 
ATOM   1900  C  CG    . PRO C 3 206  ? -36.630 102.188 33.756  1.00 34.11  ? 206  PRO A CG    1 
ATOM   1901  C  CD    . PRO C 3 206  ? -36.557 101.221 34.915  1.00 31.57  ? 206  PRO A CD    1 
ATOM   1902  N  N     . TYR C 3 207  ? -37.031 98.038  33.157  1.00 32.52  ? 207  TYR A N     1 
ATOM   1903  C  CA    . TYR C 3 207  ? -36.830 96.671  32.691  1.00 32.83  ? 207  TYR A CA    1 
ATOM   1904  C  C     . TYR C 3 207  ? -36.189 95.909  33.837  1.00 33.79  ? 207  TYR A C     1 
ATOM   1905  O  O     . TYR C 3 207  ? -35.645 96.513  34.770  1.00 33.08  ? 207  TYR A O     1 
ATOM   1906  C  CB    . TYR C 3 207  ? -35.923 96.623  31.452  1.00 33.07  ? 207  TYR A CB    1 
ATOM   1907  C  CG    . TYR C 3 207  ? -34.469 96.946  31.708  1.00 32.11  ? 207  TYR A CG    1 
ATOM   1908  C  CD1   . TYR C 3 207  ? -33.508 95.932  31.809  1.00 32.07  ? 207  TYR A CD1   1 
ATOM   1909  C  CD2   . TYR C 3 207  ? -34.045 98.268  31.840  1.00 33.47  ? 207  TYR A CD2   1 
ATOM   1910  C  CE1   . TYR C 3 207  ? -32.154 96.233  32.031  1.00 31.58  ? 207  TYR A CE1   1 
ATOM   1911  C  CE2   . TYR C 3 207  ? -32.691 98.581  32.067  1.00 33.20  ? 207  TYR A CE2   1 
ATOM   1912  C  CZ    . TYR C 3 207  ? -31.755 97.563  32.159  1.00 33.05  ? 207  TYR A CZ    1 
ATOM   1913  O  OH    . TYR C 3 207  ? -30.428 97.890  32.375  1.00 35.63  ? 207  TYR A OH    1 
ATOM   1914  N  N     . LEU C 3 208  ? -36.262 94.586  33.767  1.00 34.09  ? 208  LEU A N     1 
ATOM   1915  C  CA    . LEU C 3 208  ? -35.710 93.739  34.806  1.00 36.61  ? 208  LEU A CA    1 
ATOM   1916  C  C     . LEU C 3 208  ? -34.696 92.775  34.224  1.00 40.64  ? 208  LEU A C     1 
ATOM   1917  O  O     . LEU C 3 208  ? -35.021 91.994  33.321  1.00 41.26  ? 208  LEU A O     1 
ATOM   1918  C  CB    . LEU C 3 208  ? -36.818 92.930  35.473  1.00 34.20  ? 208  LEU A CB    1 
ATOM   1919  C  CG    . LEU C 3 208  ? -38.083 93.664  35.904  1.00 34.13  ? 208  LEU A CG    1 
ATOM   1920  C  CD1   . LEU C 3 208  ? -39.139 92.636  36.285  1.00 32.38  ? 208  LEU A CD1   1 
ATOM   1921  C  CD2   . LEU C 3 208  ? -37.774 94.609  37.058  1.00 32.18  ? 208  LEU A CD2   1 
ATOM   1922  N  N     . TYR C 3 209  ? -33.469 92.837  34.737  1.00 44.25  ? 209  TYR A N     1 
ATOM   1923  C  CA    . TYR C 3 209  ? -32.403 91.944  34.294  1.00 47.17  ? 209  TYR A CA    1 
ATOM   1924  C  C     . TYR C 3 209  ? -32.583 90.673  35.108  1.00 48.33  ? 209  TYR A C     1 
ATOM   1925  O  O     . TYR C 3 209  ? -32.377 90.674  36.322  1.00 48.65  ? 209  TYR A O     1 
ATOM   1926  C  CB    . TYR C 3 209  ? -31.028 92.565  34.582  1.00 48.64  ? 209  TYR A CB    1 
ATOM   1927  C  CG    . TYR C 3 209  ? -29.859 91.624  34.347  1.00 51.58  ? 209  TYR A CG    1 
ATOM   1928  C  CD1   . TYR C 3 209  ? -29.299 91.467  33.076  1.00 51.34  ? 209  TYR A CD1   1 
ATOM   1929  C  CD2   . TYR C 3 209  ? -29.335 90.861  35.394  1.00 52.15  ? 209  TYR A CD2   1 
ATOM   1930  C  CE1   . TYR C 3 209  ? -28.251 90.574  32.857  1.00 51.50  ? 209  TYR A CE1   1 
ATOM   1931  C  CE2   . TYR C 3 209  ? -28.293 89.966  35.182  1.00 52.70  ? 209  TYR A CE2   1 
ATOM   1932  C  CZ    . TYR C 3 209  ? -27.760 89.827  33.916  1.00 52.42  ? 209  TYR A CZ    1 
ATOM   1933  O  OH    . TYR C 3 209  ? -26.750 88.921  33.713  1.00 54.14  ? 209  TYR A OH    1 
ATOM   1934  N  N     . LEU C 3 210  ? -32.990 89.593  34.455  1.00 50.93  ? 210  LEU A N     1 
ATOM   1935  C  CA    . LEU C 3 210  ? -33.193 88.335  35.165  1.00 53.77  ? 210  LEU A CA    1 
ATOM   1936  C  C     . LEU C 3 210  ? -32.322 87.224  34.621  1.00 55.36  ? 210  LEU A C     1 
ATOM   1937  O  O     . LEU C 3 210  ? -31.374 87.452  33.866  1.00 53.87  ? 210  LEU A O     1 
ATOM   1938  C  CB    . LEU C 3 210  ? -34.655 87.869  35.077  1.00 54.20  ? 210  LEU A CB    1 
ATOM   1939  C  CG    . LEU C 3 210  ? -35.799 88.594  35.792  1.00 54.85  ? 210  LEU A CG    1 
ATOM   1940  C  CD1   . LEU C 3 210  ? -35.500 88.733  37.281  1.00 55.89  ? 210  LEU A CD1   1 
ATOM   1941  C  CD2   . LEU C 3 210  ? -35.998 89.947  35.161  1.00 55.45  ? 210  LEU A CD2   1 
ATOM   1942  N  N     . SER C 3 211  ? -32.673 86.012  35.034  1.00 58.21  ? 211  SER A N     1 
ATOM   1943  C  CA    . SER C 3 211  ? -31.998 84.798  34.605  1.00 60.98  ? 211  SER A CA    1 
ATOM   1944  C  C     . SER C 3 211  ? -32.897 84.181  33.533  1.00 61.60  ? 211  SER A C     1 
ATOM   1945  O  O     . SER C 3 211  ? -32.410 83.686  32.511  1.00 63.47  ? 211  SER A O     1 
ATOM   1946  C  CB    . SER C 3 211  ? -31.840 83.833  35.784  1.00 60.78  ? 211  SER A CB    1 
ATOM   1947  O  OG    . SER C 3 211  ? -33.095 83.561  36.384  1.00 62.42  ? 211  SER A OG    1 
ATOM   1948  N  N     . ALA C 3 212  ? -34.211 84.233  33.770  1.00 60.80  ? 212  ALA A N     1 
ATOM   1949  C  CA    . ALA C 3 212  ? -35.204 83.700  32.836  1.00 59.89  ? 212  ALA A CA    1 
ATOM   1950  C  C     . ALA C 3 212  ? -35.278 84.567  31.574  1.00 59.33  ? 212  ALA A C     1 
ATOM   1951  O  O     . ALA C 3 212  ? -36.051 84.280  30.651  1.00 59.38  ? 212  ALA A O     1 
ATOM   1952  C  CB    . ALA C 3 212  ? -36.578 83.641  33.510  1.00 59.10  ? 212  ALA A CB    1 
ATOM   1953  N  N     . GLY C 3 213  ? -34.465 85.625  31.549  1.00 58.38  ? 213  GLY A N     1 
ATOM   1954  C  CA    . GLY C 3 213  ? -34.428 86.544  30.419  1.00 54.71  ? 213  GLY A CA    1 
ATOM   1955  C  C     . GLY C 3 213  ? -34.811 87.965  30.816  1.00 51.58  ? 213  GLY A C     1 
ATOM   1956  O  O     . GLY C 3 213  ? -35.326 88.194  31.915  1.00 51.54  ? 213  GLY A O     1 
ATOM   1957  N  N     . VAL C 3 214  ? -34.555 88.924  29.931  1.00 46.67  ? 214  VAL A N     1 
ATOM   1958  C  CA    . VAL C 3 214  ? -34.906 90.312  30.201  1.00 41.29  ? 214  VAL A CA    1 
ATOM   1959  C  C     . VAL C 3 214  ? -36.409 90.520  29.987  1.00 38.50  ? 214  VAL A C     1 
ATOM   1960  O  O     . VAL C 3 214  ? -37.005 89.922  29.098  1.00 36.54  ? 214  VAL A O     1 
ATOM   1961  C  CB    . VAL C 3 214  ? -34.132 91.277  29.267  1.00 40.71  ? 214  VAL A CB    1 
ATOM   1962  C  CG1   . VAL C 3 214  ? -34.592 92.710  29.485  1.00 39.13  ? 214  VAL A CG1   1 
ATOM   1963  C  CG2   . VAL C 3 214  ? -32.645 91.163  29.527  1.00 40.67  ? 214  VAL A CG2   1 
ATOM   1964  N  N     . PHE C 3 215  ? -37.015 91.358  30.818  1.00 36.65  ? 215  PHE A N     1 
ATOM   1965  C  CA    . PHE C 3 215  ? -38.434 91.671  30.701  1.00 34.36  ? 215  PHE A CA    1 
ATOM   1966  C  C     . PHE C 3 215  ? -38.553 93.184  30.676  1.00 32.81  ? 215  PHE A C     1 
ATOM   1967  O  O     . PHE C 3 215  ? -37.900 93.870  31.460  1.00 31.87  ? 215  PHE A O     1 
ATOM   1968  C  CB    . PHE C 3 215  ? -39.206 91.102  31.883  1.00 34.77  ? 215  PHE A CB    1 
ATOM   1969  C  CG    . PHE C 3 215  ? -39.392 89.634  31.813  1.00 36.21  ? 215  PHE A CG    1 
ATOM   1970  C  CD1   . PHE C 3 215  ? -40.168 89.070  30.809  1.00 39.90  ? 215  PHE A CD1   1 
ATOM   1971  C  CD2   . PHE C 3 215  ? -38.780 88.800  32.730  1.00 38.66  ? 215  PHE A CD2   1 
ATOM   1972  C  CE1   . PHE C 3 215  ? -40.331 87.685  30.718  1.00 40.17  ? 215  PHE A CE1   1 
ATOM   1973  C  CE2   . PHE C 3 215  ? -38.936 87.414  32.650  1.00 40.03  ? 215  PHE A CE2   1 
ATOM   1974  C  CZ    . PHE C 3 215  ? -39.713 86.858  31.639  1.00 40.11  ? 215  PHE A CZ    1 
ATOM   1975  N  N     . TRP C 3 216  ? -39.373 93.705  29.772  1.00 31.03  ? 216  TRP A N     1 
ATOM   1976  C  CA    . TRP C 3 216  ? -39.527 95.148  29.655  1.00 29.90  ? 216  TRP A CA    1 
ATOM   1977  C  C     . TRP C 3 216  ? -40.804 95.656  30.321  1.00 30.94  ? 216  TRP A C     1 
ATOM   1978  O  O     . TRP C 3 216  ? -41.862 95.017  30.244  1.00 30.71  ? 216  TRP A O     1 
ATOM   1979  C  CB    . TRP C 3 216  ? -39.548 95.576  28.181  1.00 28.23  ? 216  TRP A CB    1 
ATOM   1980  C  CG    . TRP C 3 216  ? -38.490 94.953  27.330  1.00 28.38  ? 216  TRP A CG    1 
ATOM   1981  C  CD1   . TRP C 3 216  ? -38.392 93.634  26.985  1.00 28.57  ? 216  TRP A CD1   1 
ATOM   1982  C  CD2   . TRP C 3 216  ? -37.360 95.611  26.732  1.00 27.07  ? 216  TRP A CD2   1 
ATOM   1983  N  NE1   . TRP C 3 216  ? -37.273 93.430  26.214  1.00 29.62  ? 216  TRP A NE1   1 
ATOM   1984  C  CE2   . TRP C 3 216  ? -36.620 94.623  26.043  1.00 27.47  ? 216  TRP A CE2   1 
ATOM   1985  C  CE3   . TRP C 3 216  ? -36.900 96.935  26.715  1.00 26.82  ? 216  TRP A CE3   1 
ATOM   1986  C  CZ2   . TRP C 3 216  ? -35.440 94.916  25.345  1.00 24.38  ? 216  TRP A CZ2   1 
ATOM   1987  C  CZ3   . TRP C 3 216  ? -35.724 97.227  26.018  1.00 26.30  ? 216  TRP A CZ3   1 
ATOM   1988  C  CH2   . TRP C 3 216  ? -35.011 96.219  25.345  1.00 24.88  ? 216  TRP A CH2   1 
ATOM   1989  N  N     . LEU C 3 217  ? -40.692 96.810  30.980  1.00 30.20  ? 217  LEU A N     1 
ATOM   1990  C  CA    . LEU C 3 217  ? -41.839 97.432  31.621  1.00 29.66  ? 217  LEU A CA    1 
ATOM   1991  C  C     . LEU C 3 217  ? -42.782 97.748  30.471  1.00 30.66  ? 217  LEU A C     1 
ATOM   1992  O  O     . LEU C 3 217  ? -42.372 98.370  29.484  1.00 29.72  ? 217  LEU A O     1 
ATOM   1993  C  CB    . LEU C 3 217  ? -41.440 98.733  32.314  1.00 27.07  ? 217  LEU A CB    1 
ATOM   1994  C  CG    . LEU C 3 217  ? -42.619 99.452  32.967  1.00 27.76  ? 217  LEU A CG    1 
ATOM   1995  C  CD1   . LEU C 3 217  ? -43.051 98.653  34.191  1.00 27.45  ? 217  LEU A CD1   1 
ATOM   1996  C  CD2   . LEU C 3 217  ? -42.246 100.882 33.352  1.00 26.88  ? 217  LEU A CD2   1 
ATOM   1997  N  N     . MET C 3 218  ? -44.033 97.320  30.603  1.00 31.72  ? 218  MET A N     1 
ATOM   1998  C  CA    . MET C 3 218  ? -45.039 97.525  29.569  1.00 34.72  ? 218  MET A CA    1 
ATOM   1999  C  C     . MET C 3 218  ? -45.487 98.979  29.429  1.00 35.76  ? 218  MET A C     1 
ATOM   2000  O  O     . MET C 3 218  ? -46.653 99.307  29.670  1.00 37.87  ? 218  MET A O     1 
ATOM   2001  C  CB    . MET C 3 218  ? -46.250 96.641  29.858  1.00 36.45  ? 218  MET A CB    1 
ATOM   2002  C  CG    . MET C 3 218  ? -45.961 95.150  29.780  1.00 36.24  ? 218  MET A CG    1 
ATOM   2003  S  SD    . MET C 3 218  ? -45.599 94.655  28.100  1.00 40.32  ? 218  MET A SD    1 
ATOM   2004  C  CE    . MET C 3 218  ? -47.248 94.135  27.522  1.00 35.37  ? 218  MET A CE    1 
ATOM   2005  N  N     . SER C 3 219  ? -44.563 99.840  29.017  1.00 33.58  ? 219  SER A N     1 
ATOM   2006  C  CA    . SER C 3 219  ? -44.851 101.253 28.852  1.00 32.20  ? 219  SER A CA    1 
ATOM   2007  C  C     . SER C 3 219  ? -44.581 101.675 27.410  1.00 32.52  ? 219  SER A C     1 
ATOM   2008  O  O     . SER C 3 219  ? -43.564 101.302 26.832  1.00 32.50  ? 219  SER A O     1 
ATOM   2009  C  CB    . SER C 3 219  ? -43.987 102.072 29.812  1.00 30.17  ? 219  SER A CB    1 
ATOM   2010  O  OG    . SER C 3 219  ? -44.101 103.461 29.552  1.00 29.46  ? 219  SER A OG    1 
ATOM   2011  N  N     . PRO C 3 220  ? -45.492 102.469 26.818  1.00 31.57  ? 220  PRO A N     1 
ATOM   2012  C  CA    . PRO C 3 220  ? -45.387 102.961 25.441  1.00 31.35  ? 220  PRO A CA    1 
ATOM   2013  C  C     . PRO C 3 220  ? -44.215 103.924 25.249  1.00 31.75  ? 220  PRO A C     1 
ATOM   2014  O  O     . PRO C 3 220  ? -43.906 104.330 24.125  1.00 30.07  ? 220  PRO A O     1 
ATOM   2015  C  CB    . PRO C 3 220  ? -46.738 103.638 25.223  1.00 31.46  ? 220  PRO A CB    1 
ATOM   2016  C  CG    . PRO C 3 220  ? -47.027 104.208 26.563  1.00 31.45  ? 220  PRO A CG    1 
ATOM   2017  C  CD    . PRO C 3 220  ? -46.653 103.072 27.499  1.00 31.03  ? 220  PRO A CD    1 
ATOM   2018  N  N     . ARG C 3 221  ? -43.571 104.275 26.362  1.00 33.29  ? 221  ARG A N     1 
ATOM   2019  C  CA    . ARG C 3 221  ? -42.427 105.190 26.368  1.00 32.65  ? 221  ARG A CA    1 
ATOM   2020  C  C     . ARG C 3 221  ? -41.099 104.453 26.478  1.00 31.37  ? 221  ARG A C     1 
ATOM   2021  O  O     . ARG C 3 221  ? -40.042 105.071 26.417  1.00 30.37  ? 221  ARG A O     1 
ATOM   2022  C  CB    . ARG C 3 221  ? -42.536 106.166 27.535  1.00 31.96  ? 221  ARG A CB    1 
ATOM   2023  C  CG    . ARG C 3 221  ? -43.671 107.141 27.424  1.00 30.22  ? 221  ARG A CG    1 
ATOM   2024  C  CD    . ARG C 3 221  ? -44.142 107.550 28.802  1.00 30.89  ? 221  ARG A CD    1 
ATOM   2025  N  NE    . ARG C 3 221  ? -45.576 107.338 28.877  1.00 34.57  ? 221  ARG A NE    1 
ATOM   2026  C  CZ    . ARG C 3 221  ? -46.186 106.558 29.758  1.00 34.04  ? 221  ARG A CZ    1 
ATOM   2027  N  NH1   . ARG C 3 221  ? -45.492 105.900 30.682  1.00 30.17  ? 221  ARG A NH1   1 
ATOM   2028  N  NH2   . ARG C 3 221  ? -47.503 106.415 29.677  1.00 35.21  ? 221  ARG A NH2   1 
ATOM   2029  N  N     . MET C 3 222  ? -41.152 103.141 26.671  1.00 30.18  ? 222  MET A N     1 
ATOM   2030  C  CA    . MET C 3 222  ? -39.926 102.375 26.765  1.00 29.38  ? 222  MET A CA    1 
ATOM   2031  C  C     . MET C 3 222  ? -39.346 102.213 25.352  1.00 29.39  ? 222  MET A C     1 
ATOM   2032  O  O     . MET C 3 222  ? -40.075 102.160 24.358  1.00 29.51  ? 222  MET A O     1 
ATOM   2033  C  CB    . MET C 3 222  ? -40.186 101.009 27.404  1.00 28.18  ? 222  MET A CB    1 
ATOM   2034  C  CG    . MET C 3 222  ? -38.908 100.227 27.699  1.00 28.75  ? 222  MET A CG    1 
ATOM   2035  S  SD    . MET C 3 222  ? -37.716 101.178 28.693  1.00 29.99  ? 222  MET A SD    1 
ATOM   2036  C  CE    . MET C 3 222  ? -36.421 99.955  28.926  1.00 25.40  ? 222  MET A CE    1 
ATOM   2037  N  N     . THR C 3 223  ? -38.024 102.144 25.281  1.00 28.88  ? 223  THR A N     1 
ATOM   2038  C  CA    . THR C 3 223  ? -37.311 102.017 24.020  1.00 28.18  ? 223  THR A CA    1 
ATOM   2039  C  C     . THR C 3 223  ? -36.199 100.994 24.188  1.00 27.59  ? 223  THR A C     1 
ATOM   2040  O  O     . THR C 3 223  ? -35.782 100.708 25.311  1.00 30.01  ? 223  THR A O     1 
ATOM   2041  C  CB    . THR C 3 223  ? -36.710 103.378 23.628  1.00 27.80  ? 223  THR A CB    1 
ATOM   2042  O  OG1   . THR C 3 223  ? -37.727 104.185 23.021  1.00 29.71  ? 223  THR A OG1   1 
ATOM   2043  C  CG2   . THR C 3 223  ? -35.552 103.219 22.692  1.00 26.55  ? 223  THR A CG2   1 
ATOM   2044  N  N     . SER C 3 224  ? -35.728 100.445 23.074  1.00 26.22  ? 224  SER A N     1 
ATOM   2045  C  CA    . SER C 3 224  ? -34.648 99.461  23.084  1.00 24.33  ? 224  SER A CA    1 
ATOM   2046  C  C     . SER C 3 224  ? -33.351 100.125 23.500  1.00 22.32  ? 224  SER A C     1 
ATOM   2047  O  O     . SER C 3 224  ? -32.386 99.453  23.859  1.00 23.06  ? 224  SER A O     1 
ATOM   2048  C  CB    . SER C 3 224  ? -34.455 98.885  21.695  1.00 25.63  ? 224  SER A CB    1 
ATOM   2049  O  OG    . SER C 3 224  ? -34.061 99.926  20.823  1.00 27.65  ? 224  SER A OG    1 
ATOM   2050  N  N     . ALA C 3 225  ? -33.340 101.450 23.452  1.00 19.89  ? 225  ALA A N     1 
ATOM   2051  C  CA    . ALA C 3 225  ? -32.164 102.229 23.802  1.00 19.81  ? 225  ALA A CA    1 
ATOM   2052  C  C     . ALA C 3 225  ? -32.069 102.576 25.292  1.00 20.59  ? 225  ALA A C     1 
ATOM   2053  O  O     . ALA C 3 225  ? -31.021 103.017 25.762  1.00 23.23  ? 225  ALA A O     1 
ATOM   2054  C  CB    . ALA C 3 225  ? -32.122 103.521 22.945  1.00 14.09  ? 225  ALA A CB    1 
ATOM   2055  N  N     . ILE C 3 226  ? -33.141 102.368 26.047  1.00 21.78  ? 226  ILE A N     1 
ATOM   2056  C  CA    . ILE C 3 226  ? -33.107 102.709 27.466  1.00 22.02  ? 226  ILE A CA    1 
ATOM   2057  C  C     . ILE C 3 226  ? -32.121 101.913 28.336  1.00 22.04  ? 226  ILE A C     1 
ATOM   2058  O  O     . ILE C 3 226  ? -31.409 102.499 29.152  1.00 23.36  ? 226  ILE A O     1 
ATOM   2059  C  CB    . ILE C 3 226  ? -34.522 102.645 28.080  1.00 21.44  ? 226  ILE A CB    1 
ATOM   2060  C  CG1   . ILE C 3 226  ? -35.389 103.727 27.442  1.00 21.71  ? 226  ILE A CG1   1 
ATOM   2061  C  CG2   . ILE C 3 226  ? -34.459 102.843 29.597  1.00 16.20  ? 226  ILE A CG2   1 
ATOM   2062  C  CD1   . ILE C 3 226  ? -34.865 105.141 27.675  1.00 22.98  ? 226  ILE A CD1   1 
ATOM   2063  N  N     . PRO C 3 227  ? -32.072 100.578 28.191  1.00 23.43  ? 227  PRO A N     1 
ATOM   2064  C  CA    . PRO C 3 227  ? -31.117 99.836  29.028  1.00 24.03  ? 227  PRO A CA    1 
ATOM   2065  C  C     . PRO C 3 227  ? -29.677 100.359 28.912  1.00 25.75  ? 227  PRO A C     1 
ATOM   2066  O  O     . PRO C 3 227  ? -29.026 100.591 29.927  1.00 27.23  ? 227  PRO A O     1 
ATOM   2067  C  CB    . PRO C 3 227  ? -31.274 98.397  28.538  1.00 22.55  ? 227  PRO A CB    1 
ATOM   2068  C  CG    . PRO C 3 227  ? -32.747 98.336  28.206  1.00 21.22  ? 227  PRO A CG    1 
ATOM   2069  C  CD    . PRO C 3 227  ? -32.961 99.653  27.458  1.00 23.36  ? 227  PRO A CD    1 
ATOM   2070  N  N     . PRO C 3 228  ? -29.156 100.537 27.675  1.00 26.78  ? 228  PRO A N     1 
ATOM   2071  C  CA    . PRO C 3 228  ? -27.788 101.041 27.506  1.00 26.24  ? 228  PRO A CA    1 
ATOM   2072  C  C     . PRO C 3 228  ? -27.638 102.433 28.102  1.00 25.85  ? 228  PRO A C     1 
ATOM   2073  O  O     . PRO C 3 228  ? -26.672 102.709 28.825  1.00 25.30  ? 228  PRO A O     1 
ATOM   2074  C  CB    . PRO C 3 228  ? -27.602 101.051 25.994  1.00 27.18  ? 228  PRO A CB    1 
ATOM   2075  C  CG    . PRO C 3 228  ? -28.449 99.905  25.555  1.00 29.50  ? 228  PRO A CG    1 
ATOM   2076  C  CD    . PRO C 3 228  ? -29.702 100.092 26.380  1.00 27.96  ? 228  PRO A CD    1 
ATOM   2077  N  N     . LEU C 3 229  ? -28.591 103.310 27.792  1.00 24.70  ? 229  LEU A N     1 
ATOM   2078  C  CA    . LEU C 3 229  ? -28.566 104.671 28.322  1.00 24.61  ? 229  LEU A CA    1 
ATOM   2079  C  C     . LEU C 3 229  ? -28.473 104.675 29.844  1.00 24.27  ? 229  LEU A C     1 
ATOM   2080  O  O     . LEU C 3 229  ? -27.639 105.383 30.426  1.00 23.12  ? 229  LEU A O     1 
ATOM   2081  C  CB    . LEU C 3 229  ? -29.823 105.448 27.933  1.00 24.53  ? 229  LEU A CB    1 
ATOM   2082  C  CG    . LEU C 3 229  ? -29.869 106.781 28.692  1.00 26.06  ? 229  LEU A CG    1 
ATOM   2083  C  CD1   . LEU C 3 229  ? -28.726 107.659 28.202  1.00 24.81  ? 229  LEU A CD1   1 
ATOM   2084  C  CD2   . LEU C 3 229  ? -31.210 107.476 28.499  1.00 26.02  ? 229  LEU A CD2   1 
ATOM   2085  N  N     . LEU C 3 230  ? -29.339 103.893 30.486  1.00 22.29  ? 230  LEU A N     1 
ATOM   2086  C  CA    . LEU C 3 230  ? -29.348 103.839 31.940  1.00 23.05  ? 230  LEU A CA    1 
ATOM   2087  C  C     . LEU C 3 230  ? -28.065 103.241 32.493  1.00 23.13  ? 230  LEU A C     1 
ATOM   2088  O  O     . LEU C 3 230  ? -27.582 103.663 33.550  1.00 24.31  ? 230  LEU A O     1 
ATOM   2089  C  CB    . LEU C 3 230  ? -30.559 103.046 32.452  1.00 22.23  ? 230  LEU A CB    1 
ATOM   2090  C  CG    . LEU C 3 230  ? -31.935 103.606 32.056  1.00 21.19  ? 230  LEU A CG    1 
ATOM   2091  C  CD1   . LEU C 3 230  ? -33.032 102.785 32.723  1.00 16.97  ? 230  LEU A CD1   1 
ATOM   2092  C  CD2   . LEU C 3 230  ? -32.039 105.074 32.455  1.00 16.79  ? 230  LEU A CD2   1 
ATOM   2093  N  N     . SER C 3 231  ? -27.500 102.274 31.778  1.00 21.85  ? 231  SER A N     1 
ATOM   2094  C  CA    . SER C 3 231  ? -26.274 101.648 32.243  1.00 20.52  ? 231  SER A CA    1 
ATOM   2095  C  C     . SER C 3 231  ? -25.113 102.649 32.198  1.00 20.04  ? 231  SER A C     1 
ATOM   2096  O  O     . SER C 3 231  ? -24.248 102.612 33.069  1.00 20.97  ? 231  SER A O     1 
ATOM   2097  C  CB    . SER C 3 231  ? -25.966 100.379 31.431  1.00 18.86  ? 231  SER A CB    1 
ATOM   2098  O  OG    . SER C 3 231  ? -25.227 100.648 30.262  1.00 19.42  ? 231  SER A OG    1 
ATOM   2099  N  N     . ASP C 3 232  ? -25.094 103.551 31.212  1.00 19.17  ? 232  ASP A N     1 
ATOM   2100  C  CA    . ASP C 3 232  ? -24.024 104.558 31.138  1.00 18.97  ? 232  ASP A CA    1 
ATOM   2101  C  C     . ASP C 3 232  ? -24.197 105.559 32.275  1.00 19.44  ? 232  ASP A C     1 
ATOM   2102  O  O     . ASP C 3 232  ? -23.228 105.989 32.898  1.00 19.78  ? 232  ASP A O     1 
ATOM   2103  C  CB    . ASP C 3 232  ? -24.064 105.359 29.827  1.00 21.09  ? 232  ASP A CB    1 
ATOM   2104  C  CG    . ASP C 3 232  ? -23.328 104.683 28.673  1.00 22.93  ? 232  ASP A CG    1 
ATOM   2105  O  OD1   . ASP C 3 232  ? -22.327 103.971 28.901  1.00 21.73  ? 232  ASP A OD1   1 
ATOM   2106  O  OD2   . ASP C 3 232  ? -23.747 104.899 27.512  1.00 27.05  ? 232  ASP A OD2   1 
ATOM   2107  N  N     . LEU C 3 233  ? -25.445 105.943 32.523  1.00 19.68  ? 233  LEU A N     1 
ATOM   2108  C  CA    . LEU C 3 233  ? -25.750 106.902 33.571  1.00 21.13  ? 233  LEU A CA    1 
ATOM   2109  C  C     . LEU C 3 233  ? -25.333 106.392 34.953  1.00 21.20  ? 233  LEU A C     1 
ATOM   2110  O  O     . LEU C 3 233  ? -24.773 107.141 35.748  1.00 22.24  ? 233  LEU A O     1 
ATOM   2111  C  CB    . LEU C 3 233  ? -27.251 107.258 33.548  1.00 21.10  ? 233  LEU A CB    1 
ATOM   2112  C  CG    . LEU C 3 233  ? -27.761 108.006 32.297  1.00 22.94  ? 233  LEU A CG    1 
ATOM   2113  C  CD1   . LEU C 3 233  ? -29.266 108.219 32.389  1.00 22.17  ? 233  LEU A CD1   1 
ATOM   2114  C  CD2   . LEU C 3 233  ? -27.045 109.362 32.144  1.00 19.82  ? 233  LEU A CD2   1 
ATOM   2115  N  N     . VAL C 3 234  ? -25.586 105.122 35.244  1.00 22.09  ? 234  VAL A N     1 
ATOM   2116  C  CA    . VAL C 3 234  ? -25.204 104.603 36.547  1.00 22.54  ? 234  VAL A CA    1 
ATOM   2117  C  C     . VAL C 3 234  ? -23.693 104.650 36.715  1.00 22.46  ? 234  VAL A C     1 
ATOM   2118  O  O     . VAL C 3 234  ? -23.204 105.119 37.744  1.00 23.75  ? 234  VAL A O     1 
ATOM   2119  C  CB    . VAL C 3 234  ? -25.722 103.165 36.770  1.00 23.75  ? 234  VAL A CB    1 
ATOM   2120  C  CG1   . VAL C 3 234  ? -25.119 102.580 38.052  1.00 21.08  ? 234  VAL A CG1   1 
ATOM   2121  C  CG2   . VAL C 3 234  ? -27.248 103.183 36.873  1.00 22.60  ? 234  VAL A CG2   1 
ATOM   2122  N  N     . ASN C 3 235  ? -22.948 104.189 35.712  1.00 21.97  ? 235  ASN A N     1 
ATOM   2123  C  CA    . ASN C 3 235  ? -21.493 104.221 35.809  1.00 21.43  ? 235  ASN A CA    1 
ATOM   2124  C  C     . ASN C 3 235  ? -21.030 105.650 36.075  1.00 21.91  ? 235  ASN A C     1 
ATOM   2125  O  O     . ASN C 3 235  ? -20.234 105.885 36.982  1.00 23.22  ? 235  ASN A O     1 
ATOM   2126  C  CB    . ASN C 3 235  ? -20.817 103.724 34.524  1.00 20.96  ? 235  ASN A CB    1 
ATOM   2127  C  CG    . ASN C 3 235  ? -20.902 102.217 34.348  1.00 22.07  ? 235  ASN A CG    1 
ATOM   2128  O  OD1   . ASN C 3 235  ? -20.973 101.455 35.326  1.00 22.22  ? 235  ASN A OD1   1 
ATOM   2129  N  ND2   . ASN C 3 235  ? -20.870 101.773 33.092  1.00 17.93  ? 235  ASN A ND2   1 
ATOM   2130  N  N     . LEU C 3 236  ? -21.522 106.601 35.283  1.00 20.45  ? 236  LEU A N     1 
ATOM   2131  C  CA    . LEU C 3 236  ? -21.136 107.996 35.460  1.00 19.51  ? 236  LEU A CA    1 
ATOM   2132  C  C     . LEU C 3 236  ? -21.496 108.488 36.860  1.00 21.07  ? 236  LEU A C     1 
ATOM   2133  O  O     . LEU C 3 236  ? -20.734 109.239 37.489  1.00 20.76  ? 236  LEU A O     1 
ATOM   2134  C  CB    . LEU C 3 236  ? -21.818 108.865 34.407  1.00 19.46  ? 236  LEU A CB    1 
ATOM   2135  C  CG    . LEU C 3 236  ? -21.341 108.631 32.978  1.00 21.70  ? 236  LEU A CG    1 
ATOM   2136  C  CD1   . LEU C 3 236  ? -22.216 109.403 32.019  1.00 21.07  ? 236  LEU A CD1   1 
ATOM   2137  C  CD2   . LEU C 3 236  ? -19.877 109.047 32.848  1.00 20.45  ? 236  LEU A CD2   1 
ATOM   2138  N  N     . ALA C 3 237  ? -22.660 108.064 37.347  1.00 19.70  ? 237  ALA A N     1 
ATOM   2139  C  CA    . ALA C 3 237  ? -23.104 108.448 38.676  1.00 20.52  ? 237  ALA A CA    1 
ATOM   2140  C  C     . ALA C 3 237  ? -22.099 107.957 39.740  1.00 21.71  ? 237  ALA A C     1 
ATOM   2141  O  O     . ALA C 3 237  ? -21.678 108.730 40.613  1.00 20.29  ? 237  ALA A O     1 
ATOM   2142  C  CB    . ALA C 3 237  ? -24.488 107.871 38.943  1.00 20.76  ? 237  ALA A CB    1 
ATOM   2143  N  N     . ILE C 3 238  ? -21.723 106.678 39.661  1.00 21.46  ? 238  ILE A N     1 
ATOM   2144  C  CA    . ILE C 3 238  ? -20.774 106.104 40.612  1.00 23.62  ? 238  ILE A CA    1 
ATOM   2145  C  C     . ILE C 3 238  ? -19.422 106.802 40.512  1.00 24.03  ? 238  ILE A C     1 
ATOM   2146  O  O     . ILE C 3 238  ? -18.846 107.204 41.527  1.00 23.40  ? 238  ILE A O     1 
ATOM   2147  C  CB    . ILE C 3 238  ? -20.508 104.595 40.363  1.00 24.91  ? 238  ILE A CB    1 
ATOM   2148  C  CG1   . ILE C 3 238  ? -21.814 103.786 40.355  1.00 24.77  ? 238  ILE A CG1   1 
ATOM   2149  C  CG2   . ILE C 3 238  ? -19.579 104.070 41.441  1.00 22.86  ? 238  ILE A CG2   1 
ATOM   2150  C  CD1   . ILE C 3 238  ? -22.422 103.575 41.709  1.00 27.30  ? 238  ILE A CD1   1 
ATOM   2151  N  N     . LEU C 3 239  ? -18.921 106.934 39.283  1.00 24.78  ? 239  LEU A N     1 
ATOM   2152  C  CA    . LEU C 3 239  ? -17.622 107.561 39.030  1.00 25.55  ? 239  LEU A CA    1 
ATOM   2153  C  C     . LEU C 3 239  ? -17.520 109.010 39.481  1.00 25.32  ? 239  LEU A C     1 
ATOM   2154  O  O     . LEU C 3 239  ? -16.466 109.443 39.937  1.00 25.99  ? 239  LEU A O     1 
ATOM   2155  C  CB    . LEU C 3 239  ? -17.253 107.463 37.540  1.00 26.57  ? 239  LEU A CB    1 
ATOM   2156  C  CG    . LEU C 3 239  ? -16.900 106.079 36.970  1.00 26.60  ? 239  LEU A CG    1 
ATOM   2157  C  CD1   . LEU C 3 239  ? -16.348 106.237 35.559  1.00 23.57  ? 239  LEU A CD1   1 
ATOM   2158  C  CD2   . LEU C 3 239  ? -15.864 105.390 37.858  1.00 26.48  ? 239  LEU A CD2   1 
ATOM   2159  N  N     . GLN C 3 240  ? -18.601 109.771 39.351  1.00 26.46  ? 240  GLN A N     1 
ATOM   2160  C  CA    . GLN C 3 240  ? -18.551 111.163 39.781  1.00 25.53  ? 240  GLN A CA    1 
ATOM   2161  C  C     . GLN C 3 240  ? -18.299 111.218 41.276  1.00 23.00  ? 240  GLN A C     1 
ATOM   2162  O  O     . GLN C 3 240  ? -17.643 112.134 41.770  1.00 23.72  ? 240  GLN A O     1 
ATOM   2163  C  CB    . GLN C 3 240  ? -19.862 111.899 39.469  1.00 27.30  ? 240  GLN A CB    1 
ATOM   2164  C  CG    . GLN C 3 240  ? -19.914 113.298 40.096  1.00 29.28  ? 240  GLN A CG    1 
ATOM   2165  C  CD    . GLN C 3 240  ? -20.960 114.192 39.481  1.00 30.37  ? 240  GLN A CD    1 
ATOM   2166  O  OE1   . GLN C 3 240  ? -21.193 114.145 38.279  1.00 33.64  ? 240  GLN A OE1   1 
ATOM   2167  N  NE2   . GLN C 3 240  ? -21.587 115.030 40.300  1.00 32.35  ? 240  GLN A NE2   1 
ATOM   2168  N  N     . GLN C 3 241  ? -18.828 110.234 41.995  1.00 20.99  ? 241  GLN A N     1 
ATOM   2169  C  CA    . GLN C 3 241  ? -18.673 110.195 43.441  1.00 20.82  ? 241  GLN A CA    1 
ATOM   2170  C  C     . GLN C 3 241  ? -17.377 109.536 43.881  1.00 21.78  ? 241  GLN A C     1 
ATOM   2171  O  O     . GLN C 3 241  ? -16.826 109.902 44.906  1.00 22.24  ? 241  GLN A O     1 
ATOM   2172  C  CB    . GLN C 3 241  ? -19.845 109.449 44.105  1.00 18.65  ? 241  GLN A CB    1 
ATOM   2173  C  CG    . GLN C 3 241  ? -21.233 110.049 43.909  1.00 16.29  ? 241  GLN A CG    1 
ATOM   2174  C  CD    . GLN C 3 241  ? -21.289 111.546 44.149  1.00 16.28  ? 241  GLN A CD    1 
ATOM   2175  O  OE1   . GLN C 3 241  ? -21.430 112.333 43.208  1.00 19.20  ? 241  GLN A OE1   1 
ATOM   2176  N  NE2   . GLN C 3 241  ? -21.175 111.950 45.404  1.00 16.02  ? 241  GLN A NE2   1 
ATOM   2177  N  N     . THR C 3 242  ? -16.886 108.578 43.097  1.00 24.53  ? 242  THR A N     1 
ATOM   2178  C  CA    . THR C 3 242  ? -15.683 107.832 43.462  1.00 25.89  ? 242  THR A CA    1 
ATOM   2179  C  C     . THR C 3 242  ? -14.368 108.184 42.779  1.00 26.76  ? 242  THR A C     1 
ATOM   2180  O  O     . THR C 3 242  ? -13.294 107.874 43.303  1.00 28.59  ? 242  THR A O     1 
ATOM   2181  C  CB    . THR C 3 242  ? -15.915 106.331 43.288  1.00 23.74  ? 242  THR A CB    1 
ATOM   2182  O  OG1   . THR C 3 242  ? -16.253 106.066 41.928  1.00 24.29  ? 242  THR A OG1   1 
ATOM   2183  C  CG2   . THR C 3 242  ? -17.052 105.865 44.180  1.00 21.50  ? 242  THR A CG2   1 
ATOM   2184  N  N     . ALA C 3 243  ? -14.430 108.802 41.610  1.00 26.97  ? 243  ALA A N     1 
ATOM   2185  C  CA    . ALA C 3 243  ? -13.199 109.191 40.935  1.00 26.83  ? 243  ALA A CA    1 
ATOM   2186  C  C     . ALA C 3 243  ? -13.122 110.676 41.166  1.00 28.28  ? 243  ALA A C     1 
ATOM   2187  O  O     . ALA C 3 243  ? -12.173 111.336 40.740  1.00 30.49  ? 243  ALA A O     1 
ATOM   2188  C  CB    . ALA C 3 243  ? -13.271 108.892 39.448  1.00 26.85  ? 243  ALA A CB    1 
ATOM   2189  N  N     . GLY C 3 244  ? -14.143 111.188 41.855  1.00 27.48  ? 244  GLY A N     1 
ATOM   2190  C  CA    . GLY C 3 244  ? -14.218 112.602 42.159  1.00 25.35  ? 244  GLY A CA    1 
ATOM   2191  C  C     . GLY C 3 244  ? -14.220 113.435 40.896  1.00 26.18  ? 244  GLY A C     1 
ATOM   2192  O  O     . GLY C 3 244  ? -13.708 114.551 40.895  1.00 25.37  ? 244  GLY A O     1 
ATOM   2193  N  N     . LEU C 3 245  ? -14.805 112.892 39.827  1.00 26.17  ? 245  LEU A N     1 
ATOM   2194  C  CA    . LEU C 3 245  ? -14.869 113.579 38.542  1.00 26.62  ? 245  LEU A CA    1 
ATOM   2195  C  C     . LEU C 3 245  ? -15.552 114.931 38.620  1.00 27.46  ? 245  LEU A C     1 
ATOM   2196  O  O     . LEU C 3 245  ? -16.437 115.153 39.442  1.00 28.02  ? 245  LEU A O     1 
ATOM   2197  C  CB    . LEU C 3 245  ? -15.615 112.730 37.514  1.00 29.21  ? 245  LEU A CB    1 
ATOM   2198  C  CG    . LEU C 3 245  ? -15.078 111.352 37.119  1.00 30.18  ? 245  LEU A CG    1 
ATOM   2199  C  CD1   . LEU C 3 245  ? -16.090 110.656 36.212  1.00 29.41  ? 245  LEU A CD1   1 
ATOM   2200  C  CD2   . LEU C 3 245  ? -13.741 111.501 36.413  1.00 30.66  ? 245  LEU A CD2   1 
ATOM   2201  N  N     . ASP C 3 246  ? -15.128 115.830 37.742  1.00 29.22  ? 246  ASP A N     1 
ATOM   2202  C  CA    . ASP C 3 246  ? -15.695 117.169 37.648  1.00 29.27  ? 246  ASP A CA    1 
ATOM   2203  C  C     . ASP C 3 246  ? -17.132 117.024 37.144  1.00 29.13  ? 246  ASP A C     1 
ATOM   2204  O  O     . ASP C 3 246  ? -17.362 116.504 36.052  1.00 29.49  ? 246  ASP A O     1 
ATOM   2205  C  CB    . ASP C 3 246  ? -14.879 118.000 36.659  1.00 29.52  ? 246  ASP A CB    1 
ATOM   2206  C  CG    . ASP C 3 246  ? -15.371 119.424 36.549  1.00 30.78  ? 246  ASP A CG    1 
ATOM   2207  O  OD1   . ASP C 3 246  ? -16.536 119.693 36.921  1.00 32.11  ? 246  ASP A OD1   1 
ATOM   2208  O  OD2   . ASP C 3 246  ? -14.592 120.272 36.073  1.00 30.47  ? 246  ASP A OD2   1 
ATOM   2209  N  N     . PRO C 3 247  ? -18.118 117.490 37.930  1.00 28.96  ? 247  PRO A N     1 
ATOM   2210  C  CA    . PRO C 3 247  ? -19.533 117.394 37.545  1.00 28.46  ? 247  PRO A CA    1 
ATOM   2211  C  C     . PRO C 3 247  ? -19.864 118.038 36.200  1.00 28.82  ? 247  PRO A C     1 
ATOM   2212  O  O     . PRO C 3 247  ? -20.637 117.480 35.416  1.00 28.59  ? 247  PRO A O     1 
ATOM   2213  C  CB    . PRO C 3 247  ? -20.260 118.086 38.695  1.00 26.16  ? 247  PRO A CB    1 
ATOM   2214  C  CG    . PRO C 3 247  ? -19.359 117.871 39.840  1.00 29.38  ? 247  PRO A CG    1 
ATOM   2215  C  CD    . PRO C 3 247  ? -17.987 118.118 39.252  1.00 27.67  ? 247  PRO A CD    1 
ATOM   2216  N  N     . SER C 3 248  ? -19.287 119.211 35.946  1.00 28.80  ? 248  SER A N     1 
ATOM   2217  C  CA    . SER C 3 248  ? -19.542 119.934 34.704  1.00 29.95  ? 248  SER A CA    1 
ATOM   2218  C  C     . SER C 3 248  ? -19.136 119.091 33.501  1.00 29.21  ? 248  SER A C     1 
ATOM   2219  O  O     . SER C 3 248  ? -19.799 119.120 32.464  1.00 30.69  ? 248  SER A O     1 
ATOM   2220  C  CB    . SER C 3 248  ? -18.796 121.279 34.691  1.00 30.56  ? 248  SER A CB    1 
ATOM   2221  O  OG    . SER C 3 248  ? -17.390 121.102 34.674  1.00 32.38  ? 248  SER A OG    1 
ATOM   2222  N  N     . LEU C 3 249  ? -18.048 118.338 33.641  1.00 29.02  ? 249  LEU A N     1 
ATOM   2223  C  CA    . LEU C 3 249  ? -17.594 117.463 32.563  1.00 27.90  ? 249  LEU A CA    1 
ATOM   2224  C  C     . LEU C 3 249  ? -18.576 116.309 32.407  1.00 26.22  ? 249  LEU A C     1 
ATOM   2225  O  O     . LEU C 3 249  ? -19.018 115.989 31.307  1.00 26.08  ? 249  LEU A O     1 
ATOM   2226  C  CB    . LEU C 3 249  ? -16.201 116.907 32.870  1.00 27.72  ? 249  LEU A CB    1 
ATOM   2227  C  CG    . LEU C 3 249  ? -15.011 117.778 32.467  1.00 29.28  ? 249  LEU A CG    1 
ATOM   2228  C  CD1   . LEU C 3 249  ? -13.715 117.074 32.845  1.00 29.70  ? 249  LEU A CD1   1 
ATOM   2229  C  CD2   . LEU C 3 249  ? -15.056 118.050 30.962  1.00 28.71  ? 249  LEU A CD2   1 
ATOM   2230  N  N     . VAL C 3 250  ? -18.914 115.693 33.530  1.00 25.69  ? 250  VAL A N     1 
ATOM   2231  C  CA    . VAL C 3 250  ? -19.834 114.575 33.552  1.00 24.84  ? 250  VAL A CA    1 
ATOM   2232  C  C     . VAL C 3 250  ? -21.122 114.896 32.795  1.00 25.64  ? 250  VAL A C     1 
ATOM   2233  O  O     . VAL C 3 250  ? -21.637 114.059 32.059  1.00 26.48  ? 250  VAL A O     1 
ATOM   2234  C  CB    . VAL C 3 250  ? -20.154 114.187 35.011  1.00 24.30  ? 250  VAL A CB    1 
ATOM   2235  C  CG1   . VAL C 3 250  ? -21.144 113.039 35.051  1.00 23.06  ? 250  VAL A CG1   1 
ATOM   2236  C  CG2   . VAL C 3 250  ? -18.870 113.814 35.725  1.00 22.54  ? 250  VAL A CG2   1 
ATOM   2237  N  N     . LYS C 3 251  ? -21.641 116.104 32.964  1.00 27.25  ? 251  LYS A N     1 
ATOM   2238  C  CA    . LYS C 3 251  ? -22.866 116.481 32.265  1.00 30.02  ? 251  LYS A CA    1 
ATOM   2239  C  C     . LYS C 3 251  ? -22.632 116.387 30.764  1.00 30.11  ? 251  LYS A C     1 
ATOM   2240  O  O     . LYS C 3 251  ? -23.529 116.004 30.012  1.00 31.14  ? 251  LYS A O     1 
ATOM   2241  C  CB    . LYS C 3 251  ? -23.307 117.905 32.631  1.00 31.79  ? 251  LYS A CB    1 
ATOM   2242  C  CG    . LYS C 3 251  ? -23.655 118.082 34.094  1.00 34.30  ? 251  LYS A CG    1 
ATOM   2243  C  CD    . LYS C 3 251  ? -24.231 119.461 34.367  1.00 38.12  ? 251  LYS A CD    1 
ATOM   2244  C  CE    . LYS C 3 251  ? -25.552 119.666 33.643  1.00 38.34  ? 251  LYS A CE    1 
ATOM   2245  N  NZ    . LYS C 3 251  ? -26.214 120.919 34.097  1.00 40.45  ? 251  LYS A NZ    1 
ATOM   2246  N  N     . LEU C 3 252  ? -21.429 116.740 30.325  1.00 29.18  ? 252  LEU A N     1 
ATOM   2247  C  CA    . LEU C 3 252  ? -21.111 116.652 28.909  1.00 28.63  ? 252  LEU A CA    1 
ATOM   2248  C  C     . LEU C 3 252  ? -21.279 115.206 28.459  1.00 28.67  ? 252  LEU A C     1 
ATOM   2249  O  O     . LEU C 3 252  ? -21.800 114.936 27.377  1.00 28.63  ? 252  LEU A O     1 
ATOM   2250  C  CB    . LEU C 3 252  ? -19.680 117.121 28.649  1.00 28.17  ? 252  LEU A CB    1 
ATOM   2251  C  CG    . LEU C 3 252  ? -19.422 118.590 28.976  1.00 26.46  ? 252  LEU A CG    1 
ATOM   2252  C  CD1   . LEU C 3 252  ? -18.002 118.943 28.579  1.00 26.31  ? 252  LEU A CD1   1 
ATOM   2253  C  CD2   . LEU C 3 252  ? -20.434 119.464 28.234  1.00 24.14  ? 252  LEU A CD2   1 
ATOM   2254  N  N     . GLY C 3 253  ? -20.845 114.281 29.308  1.00 29.08  ? 253  GLY A N     1 
ATOM   2255  C  CA    . GLY C 3 253  ? -20.957 112.869 28.996  1.00 27.76  ? 253  GLY A CA    1 
ATOM   2256  C  C     . GLY C 3 253  ? -22.404 112.427 28.960  1.00 27.89  ? 253  GLY A C     1 
ATOM   2257  O  O     . GLY C 3 253  ? -22.775 111.559 28.174  1.00 27.68  ? 253  GLY A O     1 
ATOM   2258  N  N     . VAL C 3 254  ? -23.235 113.014 29.815  1.00 28.16  ? 254  VAL A N     1 
ATOM   2259  C  CA    . VAL C 3 254  ? -24.643 112.653 29.827  1.00 28.20  ? 254  VAL A CA    1 
ATOM   2260  C  C     . VAL C 3 254  ? -25.323 113.128 28.547  1.00 28.79  ? 254  VAL A C     1 
ATOM   2261  O  O     . VAL C 3 254  ? -26.137 112.410 27.967  1.00 28.78  ? 254  VAL A O     1 
ATOM   2262  C  CB    . VAL C 3 254  ? -25.354 113.243 31.053  1.00 28.30  ? 254  VAL A CB    1 
ATOM   2263  C  CG1   . VAL C 3 254  ? -26.865 113.071 30.924  1.00 25.90  ? 254  VAL A CG1   1 
ATOM   2264  C  CG2   . VAL C 3 254  ? -24.855 112.530 32.308  1.00 27.30  ? 254  VAL A CG2   1 
ATOM   2265  N  N     . GLN C 3 255  ? -24.979 114.338 28.111  1.00 28.84  ? 255  GLN A N     1 
ATOM   2266  C  CA    . GLN C 3 255  ? -25.538 114.903 26.894  1.00 28.51  ? 255  GLN A CA    1 
ATOM   2267  C  C     . GLN C 3 255  ? -25.293 113.965 25.732  1.00 27.51  ? 255  GLN A C     1 
ATOM   2268  O  O     . GLN C 3 255  ? -26.207 113.657 24.977  1.00 27.07  ? 255  GLN A O     1 
ATOM   2269  C  CB    . GLN C 3 255  ? -24.898 116.246 26.579  1.00 32.08  ? 255  GLN A CB    1 
ATOM   2270  C  CG    . GLN C 3 255  ? -25.478 117.404 27.341  1.00 39.25  ? 255  GLN A CG    1 
ATOM   2271  C  CD    . GLN C 3 255  ? -24.792 118.720 27.000  1.00 44.00  ? 255  GLN A CD    1 
ATOM   2272  O  OE1   . GLN C 3 255  ? -24.561 119.034 25.820  1.00 43.46  ? 255  GLN A OE1   1 
ATOM   2273  N  NE2   . GLN C 3 255  ? -24.472 119.503 28.034  1.00 43.09  ? 255  GLN A NE2   1 
ATOM   2274  N  N     . ILE C 3 256  ? -24.051 113.515 25.582  1.00 26.47  ? 256  ILE A N     1 
ATOM   2275  C  CA    . ILE C 3 256  ? -23.731 112.604 24.497  1.00 26.37  ? 256  ILE A CA    1 
ATOM   2276  C  C     . ILE C 3 256  ? -24.644 111.374 24.582  1.00 27.23  ? 256  ILE A C     1 
ATOM   2277  O  O     . ILE C 3 256  ? -25.263 110.995 23.593  1.00 26.50  ? 256  ILE A O     1 
ATOM   2278  C  CB    . ILE C 3 256  ? -22.228 112.193 24.531  1.00 26.45  ? 256  ILE A CB    1 
ATOM   2279  C  CG1   . ILE C 3 256  ? -21.362 113.453 24.372  1.00 26.71  ? 256  ILE A CG1   1 
ATOM   2280  C  CG2   . ILE C 3 256  ? -21.921 111.173 23.406  1.00 20.30  ? 256  ILE A CG2   1 
ATOM   2281  C  CD1   . ILE C 3 256  ? -19.871 113.214 24.428  1.00 28.74  ? 256  ILE A CD1   1 
ATOM   2282  N  N     . CYS C 3 257  ? -24.748 110.769 25.763  1.00 26.30  ? 257  CYS A N     1 
ATOM   2283  C  CA    . CYS C 3 257  ? -25.609 109.606 25.937  1.00 27.55  ? 257  CYS A CA    1 
ATOM   2284  C  C     . CYS C 3 257  ? -27.068 109.920 25.594  1.00 26.96  ? 257  CYS A C     1 
ATOM   2285  O  O     . CYS C 3 257  ? -27.758 109.107 24.962  1.00 26.56  ? 257  CYS A O     1 
ATOM   2286  C  CB    . CYS C 3 257  ? -25.513 109.086 27.373  1.00 28.38  ? 257  CYS A CB    1 
ATOM   2287  S  SG    . CYS C 3 257  ? -23.861 108.533 27.806  1.00 31.79  ? 257  CYS A SG    1 
ATOM   2288  N  N     . LEU C 3 258  ? -27.542 111.092 26.006  1.00 26.45  ? 258  LEU A N     1 
ATOM   2289  C  CA    . LEU C 3 258  ? -28.920 111.475 25.699  1.00 27.92  ? 258  LEU A CA    1 
ATOM   2290  C  C     . LEU C 3 258  ? -29.090 111.588 24.174  1.00 28.27  ? 258  LEU A C     1 
ATOM   2291  O  O     . LEU C 3 258  ? -30.125 111.196 23.627  1.00 28.27  ? 258  LEU A O     1 
ATOM   2292  C  CB    . LEU C 3 258  ? -29.285 112.797 26.392  1.00 26.20  ? 258  LEU A CB    1 
ATOM   2293  C  CG    . LEU C 3 258  ? -29.390 112.739 27.926  1.00 27.83  ? 258  LEU A CG    1 
ATOM   2294  C  CD1   . LEU C 3 258  ? -29.926 114.056 28.449  1.00 24.80  ? 258  LEU A CD1   1 
ATOM   2295  C  CD2   . LEU C 3 258  ? -30.315 111.601 28.361  1.00 26.20  ? 258  LEU A CD2   1 
ATOM   2296  N  N     . HIS C 3 259  ? -28.065 112.105 23.495  1.00 27.25  ? 259  HIS A N     1 
ATOM   2297  C  CA    . HIS C 3 259  ? -28.084 112.235 22.042  1.00 26.66  ? 259  HIS A CA    1 
ATOM   2298  C  C     . HIS C 3 259  ? -28.075 110.858 21.393  1.00 26.35  ? 259  HIS A C     1 
ATOM   2299  O  O     . HIS C 3 259  ? -28.710 110.647 20.362  1.00 26.66  ? 259  HIS A O     1 
ATOM   2300  C  CB    . HIS C 3 259  ? -26.869 113.017 21.556  1.00 27.80  ? 259  HIS A CB    1 
ATOM   2301  C  CG    . HIS C 3 259  ? -27.045 114.503 21.602  1.00 29.24  ? 259  HIS A CG    1 
ATOM   2302  N  ND1   . HIS C 3 259  ? -27.313 115.189 22.767  1.00 30.65  ? 259  HIS A ND1   1 
ATOM   2303  C  CD2   . HIS C 3 259  ? -26.970 115.437 20.624  1.00 29.49  ? 259  HIS A CD2   1 
ATOM   2304  C  CE1   . HIS C 3 259  ? -27.395 116.482 22.507  1.00 30.53  ? 259  HIS A CE1   1 
ATOM   2305  N  NE2   . HIS C 3 259  ? -27.190 116.659 21.213  1.00 31.20  ? 259  HIS A NE2   1 
ATOM   2306  N  N     . ALA C 3 260  ? -27.348 109.925 22.000  1.00 26.81  ? 260  ALA A N     1 
ATOM   2307  C  CA    . ALA C 3 260  ? -27.266 108.554 21.492  1.00 27.07  ? 260  ALA A CA    1 
ATOM   2308  C  C     . ALA C 3 260  ? -28.637 107.886 21.626  1.00 27.28  ? 260  ALA A C     1 
ATOM   2309  O  O     . ALA C 3 260  ? -29.070 107.143 20.744  1.00 27.11  ? 260  ALA A O     1 
ATOM   2310  C  CB    . ALA C 3 260  ? -26.210 107.761 22.268  1.00 25.72  ? 260  ALA A CB    1 
ATOM   2311  N  N     . ALA C 3 261  ? -29.321 108.157 22.732  1.00 25.95  ? 261  ALA A N     1 
ATOM   2312  C  CA    . ALA C 3 261  ? -30.648 107.591 22.936  1.00 25.56  ? 261  ALA A CA    1 
ATOM   2313  C  C     . ALA C 3 261  ? -31.667 108.310 22.050  1.00 24.82  ? 261  ALA A C     1 
ATOM   2314  O  O     . ALA C 3 261  ? -32.707 107.759 21.716  1.00 24.85  ? 261  ALA A O     1 
ATOM   2315  C  CB    . ALA C 3 261  ? -31.048 107.711 24.406  1.00 24.47  ? 261  ALA A CB    1 
ATOM   2316  N  N     . ALA C 3 262  ? -31.356 109.544 21.663  1.00 24.85  ? 262  ALA A N     1 
ATOM   2317  C  CA    . ALA C 3 262  ? -32.253 110.331 20.824  1.00 24.10  ? 262  ALA A CA    1 
ATOM   2318  C  C     . ALA C 3 262  ? -32.069 110.016 19.340  1.00 25.16  ? 262  ALA A C     1 
ATOM   2319  O  O     . ALA C 3 262  ? -32.932 110.324 18.517  1.00 23.80  ? 262  ALA A O     1 
ATOM   2320  C  CB    . ALA C 3 262  ? -32.026 111.819 21.073  1.00 21.35  ? 262  ALA A CB    1 
ATOM   2321  N  N     . SER C 3 263  ? -30.941 109.400 19.004  1.00 27.19  ? 263  SER A N     1 
ATOM   2322  C  CA    . SER C 3 263  ? -30.647 109.053 17.614  1.00 28.28  ? 263  SER A CA    1 
ATOM   2323  C  C     . SER C 3 263  ? -31.471 107.843 17.216  1.00 27.47  ? 263  SER A C     1 
ATOM   2324  O  O     . SER C 3 263  ? -32.376 107.435 17.938  1.00 26.70  ? 263  SER A O     1 
ATOM   2325  C  CB    . SER C 3 263  ? -29.164 108.718 17.445  1.00 28.96  ? 263  SER A CB    1 
ATOM   2326  O  OG    . SER C 3 263  ? -28.860 107.474 18.069  1.00 31.21  ? 263  SER A OG    1 
ATOM   2327  N  N     . SER C 3 264  ? -31.143 107.266 16.067  1.00 27.08  ? 264  SER A N     1 
ATOM   2328  C  CA    . SER C 3 264  ? -31.857 106.095 15.593  1.00 26.75  ? 264  SER A CA    1 
ATOM   2329  C  C     . SER C 3 264  ? -31.171 104.808 16.048  1.00 26.48  ? 264  SER A C     1 
ATOM   2330  O  O     . SER C 3 264  ? -31.696 103.722 15.824  1.00 26.54  ? 264  SER A O     1 
ATOM   2331  C  CB    . SER C 3 264  ? -31.955 106.125 14.068  1.00 27.20  ? 264  SER A CB    1 
ATOM   2332  O  OG    . SER C 3 264  ? -30.663 106.173 13.487  1.00 28.88  ? 264  SER A OG    1 
ATOM   2333  N  N     . SER C 3 265  ? -30.002 104.927 16.679  1.00 27.19  ? 265  SER A N     1 
ATOM   2334  C  CA    . SER C 3 265  ? -29.269 103.754 17.168  1.00 26.42  ? 265  SER A CA    1 
ATOM   2335  C  C     . SER C 3 265  ? -28.221 104.117 18.217  1.00 27.25  ? 265  SER A C     1 
ATOM   2336  O  O     . SER C 3 265  ? -27.152 104.635 17.890  1.00 28.23  ? 265  SER A O     1 
ATOM   2337  C  CB    . SER C 3 265  ? -28.592 103.039 16.004  1.00 28.37  ? 265  SER A CB    1 
ATOM   2338  O  OG    . SER C 3 265  ? -27.925 101.875 16.442  1.00 28.54  ? 265  SER A OG    1 
ATOM   2339  N  N     . TYR C 3 266  ? -28.522 103.820 19.477  1.00 26.32  ? 266  TYR A N     1 
ATOM   2340  C  CA    . TYR C 3 266  ? -27.622 104.141 20.572  1.00 26.55  ? 266  TYR A CA    1 
ATOM   2341  C  C     . TYR C 3 266  ? -26.189 103.686 20.326  1.00 28.27  ? 266  TYR A C     1 
ATOM   2342  O  O     . TYR C 3 266  ? -25.265 104.498 20.363  1.00 28.56  ? 266  TYR A O     1 
ATOM   2343  C  CB    . TYR C 3 266  ? -28.129 103.520 21.870  1.00 26.90  ? 266  TYR A CB    1 
ATOM   2344  C  CG    . TYR C 3 266  ? -27.494 104.116 23.102  1.00 27.63  ? 266  TYR A CG    1 
ATOM   2345  C  CD1   . TYR C 3 266  ? -28.013 105.274 23.690  1.00 26.49  ? 266  TYR A CD1   1 
ATOM   2346  C  CD2   . TYR C 3 266  ? -26.352 103.543 23.665  1.00 27.79  ? 266  TYR A CD2   1 
ATOM   2347  C  CE1   . TYR C 3 266  ? -27.405 105.850 24.812  1.00 27.08  ? 266  TYR A CE1   1 
ATOM   2348  C  CE2   . TYR C 3 266  ? -25.735 104.106 24.782  1.00 27.61  ? 266  TYR A CE2   1 
ATOM   2349  C  CZ    . TYR C 3 266  ? -26.262 105.259 25.352  1.00 27.83  ? 266  TYR A CZ    1 
ATOM   2350  O  OH    . TYR C 3 266  ? -25.635 105.823 26.445  1.00 25.09  ? 266  TYR A OH    1 
ATOM   2351  N  N     . SER C 3 267  ? -26.001 102.388 20.090  1.00 29.63  ? 267  SER A N     1 
ATOM   2352  C  CA    . SER C 3 267  ? -24.663 101.847 19.852  1.00 29.30  ? 267  SER A CA    1 
ATOM   2353  C  C     . SER C 3 267  ? -23.945 102.510 18.686  1.00 28.48  ? 267  SER A C     1 
ATOM   2354  O  O     . SER C 3 267  ? -22.805 102.952 18.827  1.00 28.43  ? 267  SER A O     1 
ATOM   2355  C  CB    . SER C 3 267  ? -24.726 100.341 19.610  1.00 30.22  ? 267  SER A CB    1 
ATOM   2356  O  OG    . SER C 3 267  ? -24.888 99.638  20.833  1.00 35.19  ? 267  SER A OG    1 
ATOM   2357  N  N     . TRP C 3 268  ? -24.614 102.569 17.538  1.00 26.94  ? 268  TRP A N     1 
ATOM   2358  C  CA    . TRP C 3 268  ? -24.044 103.180 16.343  1.00 24.79  ? 268  TRP A CA    1 
ATOM   2359  C  C     . TRP C 3 268  ? -23.579 104.612 16.655  1.00 23.66  ? 268  TRP A C     1 
ATOM   2360  O  O     . TRP C 3 268  ? -22.432 104.983 16.402  1.00 22.02  ? 268  TRP A O     1 
ATOM   2361  C  CB    . TRP C 3 268  ? -25.094 103.191 15.222  1.00 24.88  ? 268  TRP A CB    1 
ATOM   2362  C  CG    . TRP C 3 268  ? -24.629 103.869 13.973  1.00 27.02  ? 268  TRP A CG    1 
ATOM   2363  C  CD1   . TRP C 3 268  ? -23.798 103.356 13.017  1.00 27.74  ? 268  TRP A CD1   1 
ATOM   2364  C  CD2   . TRP C 3 268  ? -24.905 105.217 13.582  1.00 28.52  ? 268  TRP A CD2   1 
ATOM   2365  N  NE1   . TRP C 3 268  ? -23.539 104.300 12.063  1.00 27.89  ? 268  TRP A NE1   1 
ATOM   2366  C  CE2   . TRP C 3 268  ? -24.205 105.454 12.384  1.00 28.39  ? 268  TRP A CE2   1 
ATOM   2367  C  CE3   . TRP C 3 268  ? -25.676 106.252 14.133  1.00 30.47  ? 268  TRP A CE3   1 
ATOM   2368  C  CZ2   . TRP C 3 268  ? -24.250 106.686 11.720  1.00 31.79  ? 268  TRP A CZ2   1 
ATOM   2369  C  CZ3   . TRP C 3 268  ? -25.723 107.477 13.474  1.00 31.77  ? 268  TRP A CZ3   1 
ATOM   2370  C  CH2   . TRP C 3 268  ? -25.015 107.682 12.280  1.00 31.68  ? 268  TRP A CH2   1 
ATOM   2371  N  N     . PHE C 3 269  ? -24.476 105.412 17.212  1.00 22.42  ? 269  PHE A N     1 
ATOM   2372  C  CA    . PHE C 3 269  ? -24.144 106.787 17.550  1.00 24.06  ? 269  PHE A CA    1 
ATOM   2373  C  C     . PHE C 3 269  ? -22.921 106.840 18.488  1.00 23.93  ? 269  PHE A C     1 
ATOM   2374  O  O     . PHE C 3 269  ? -22.033 107.679 18.328  1.00 24.12  ? 269  PHE A O     1 
ATOM   2375  C  CB    . PHE C 3 269  ? -25.352 107.454 18.214  1.00 22.90  ? 269  PHE A CB    1 
ATOM   2376  C  CG    . PHE C 3 269  ? -25.213 108.942 18.369  1.00 25.21  ? 269  PHE A CG    1 
ATOM   2377  C  CD1   . PHE C 3 269  ? -25.624 109.803 17.348  1.00 25.46  ? 269  PHE A CD1   1 
ATOM   2378  C  CD2   . PHE C 3 269  ? -24.667 109.487 19.535  1.00 24.18  ? 269  PHE A CD2   1 
ATOM   2379  C  CE1   . PHE C 3 269  ? -25.498 111.185 17.482  1.00 25.67  ? 269  PHE A CE1   1 
ATOM   2380  C  CE2   . PHE C 3 269  ? -24.535 110.865 19.681  1.00 25.27  ? 269  PHE A CE2   1 
ATOM   2381  C  CZ    . PHE C 3 269  ? -24.951 111.719 18.654  1.00 25.53  ? 269  PHE A CZ    1 
ATOM   2382  N  N     . ILE C 3 270  ? -22.882 105.941 19.467  1.00 24.50  ? 270  ILE A N     1 
ATOM   2383  C  CA    . ILE C 3 270  ? -21.778 105.883 20.420  1.00 23.40  ? 270  ILE A CA    1 
ATOM   2384  C  C     . ILE C 3 270  ? -20.462 105.574 19.709  1.00 24.03  ? 270  ILE A C     1 
ATOM   2385  O  O     . ILE C 3 270  ? -19.426 106.179 19.997  1.00 23.81  ? 270  ILE A O     1 
ATOM   2386  C  CB    . ILE C 3 270  ? -22.050 104.812 21.514  1.00 22.34  ? 270  ILE A CB    1 
ATOM   2387  C  CG1   . ILE C 3 270  ? -23.110 105.328 22.481  1.00 20.05  ? 270  ILE A CG1   1 
ATOM   2388  C  CG2   . ILE C 3 270  ? -20.769 104.480 22.279  1.00 22.78  ? 270  ILE A CG2   1 
ATOM   2389  C  CD1   . ILE C 3 270  ? -22.754 106.644 23.131  1.00 19.74  ? 270  ILE A CD1   1 
ATOM   2390  N  N     . LEU C 3 271  ? -20.515 104.621 18.787  1.00 24.12  ? 271  LEU A N     1 
ATOM   2391  C  CA    . LEU C 3 271  ? -19.354 104.225 18.004  1.00 24.84  ? 271  LEU A CA    1 
ATOM   2392  C  C     . LEU C 3 271  ? -18.785 105.408 17.189  1.00 25.74  ? 271  LEU A C     1 
ATOM   2393  O  O     . LEU C 3 271  ? -17.570 105.626 17.159  1.00 24.86  ? 271  LEU A O     1 
ATOM   2394  C  CB    . LEU C 3 271  ? -19.752 103.086 17.058  1.00 26.63  ? 271  LEU A CB    1 
ATOM   2395  C  CG    . LEU C 3 271  ? -18.690 102.454 16.146  1.00 27.42  ? 271  LEU A CG    1 
ATOM   2396  C  CD1   . LEU C 3 271  ? -17.693 101.653 16.980  1.00 26.95  ? 271  LEU A CD1   1 
ATOM   2397  C  CD2   . LEU C 3 271  ? -19.381 101.537 15.148  1.00 27.21  ? 271  LEU A CD2   1 
ATOM   2398  N  N     . LYS C 3 272  ? -19.665 106.169 16.541  1.00 25.22  ? 272  LYS A N     1 
ATOM   2399  C  CA    . LYS C 3 272  ? -19.250 107.312 15.722  1.00 26.24  ? 272  LYS A CA    1 
ATOM   2400  C  C     . LYS C 3 272  ? -18.727 108.506 16.518  1.00 27.06  ? 272  LYS A C     1 
ATOM   2401  O  O     . LYS C 3 272  ? -17.918 109.276 16.008  1.00 30.58  ? 272  LYS A O     1 
ATOM   2402  C  CB    . LYS C 3 272  ? -20.413 107.817 14.856  1.00 25.22  ? 272  LYS A CB    1 
ATOM   2403  C  CG    . LYS C 3 272  ? -21.225 106.749 14.140  1.00 26.39  ? 272  LYS A CG    1 
ATOM   2404  C  CD    . LYS C 3 272  ? -20.820 106.571 12.685  1.00 23.36  ? 272  LYS A CD    1 
ATOM   2405  C  CE    . LYS C 3 272  ? -19.554 105.770 12.553  1.00 21.65  ? 272  LYS A CE    1 
ATOM   2406  N  NZ    . LYS C 3 272  ? -19.246 105.569 11.121  1.00 21.97  ? 272  LYS A NZ    1 
ATOM   2407  N  N     . THR C 3 273  ? -19.186 108.683 17.752  1.00 25.15  ? 273  THR A N     1 
ATOM   2408  C  CA    . THR C 3 273  ? -18.743 109.831 18.534  1.00 24.21  ? 273  THR A CA    1 
ATOM   2409  C  C     . THR C 3 273  ? -17.765 109.546 19.677  1.00 23.52  ? 273  THR A C     1 
ATOM   2410  O  O     . THR C 3 273  ? -17.356 110.468 20.372  1.00 22.65  ? 273  THR A O     1 
ATOM   2411  C  CB    . THR C 3 273  ? -19.955 110.570 19.125  1.00 25.33  ? 273  THR A CB    1 
ATOM   2412  O  OG1   . THR C 3 273  ? -20.678 109.687 19.989  1.00 25.42  ? 273  THR A OG1   1 
ATOM   2413  C  CG2   . THR C 3 273  ? -20.882 111.042 18.023  1.00 25.41  ? 273  THR A CG2   1 
ATOM   2414  N  N     . LYS C 3 274  ? -17.386 108.282 19.855  1.00 23.87  ? 274  LYS A N     1 
ATOM   2415  C  CA    . LYS C 3 274  ? -16.490 107.852 20.933  1.00 24.12  ? 274  LYS A CA    1 
ATOM   2416  C  C     . LYS C 3 274  ? -15.135 108.547 21.052  1.00 26.00  ? 274  LYS A C     1 
ATOM   2417  O  O     . LYS C 3 274  ? -14.438 108.378 22.064  1.00 27.13  ? 274  LYS A O     1 
ATOM   2418  C  CB    . LYS C 3 274  ? -16.221 106.353 20.817  1.00 26.84  ? 274  LYS A CB    1 
ATOM   2419  C  CG    . LYS C 3 274  ? -15.405 105.998 19.582  1.00 27.81  ? 274  LYS A CG    1 
ATOM   2420  C  CD    . LYS C 3 274  ? -15.079 104.524 19.528  1.00 32.86  ? 274  LYS A CD    1 
ATOM   2421  C  CE    . LYS C 3 274  ? -14.292 104.170 18.269  1.00 33.82  ? 274  LYS A CE    1 
ATOM   2422  N  NZ    . LYS C 3 274  ? -13.982 102.715 18.250  1.00 37.88  ? 274  LYS A NZ    1 
ATOM   2423  N  N     . SER C 3 275  ? -14.734 109.305 20.035  1.00 24.69  ? 275  SER A N     1 
ATOM   2424  C  CA    . SER C 3 275  ? -13.445 109.970 20.096  1.00 24.01  ? 275  SER A CA    1 
ATOM   2425  C  C     . SER C 3 275  ? -13.555 111.404 20.594  1.00 23.39  ? 275  SER A C     1 
ATOM   2426  O  O     . SER C 3 275  ? -12.548 112.061 20.823  1.00 23.09  ? 275  SER A O     1 
ATOM   2427  C  CB    . SER C 3 275  ? -12.759 109.945 18.717  1.00 24.89  ? 275  SER A CB    1 
ATOM   2428  O  OG    . SER C 3 275  ? -13.255 110.960 17.857  1.00 27.73  ? 275  SER A OG    1 
ATOM   2429  N  N     . ILE C 3 276  ? -14.776 111.890 20.775  1.00 23.61  ? 276  ILE A N     1 
ATOM   2430  C  CA    . ILE C 3 276  ? -14.973 113.261 21.231  1.00 24.76  ? 276  ILE A CA    1 
ATOM   2431  C  C     . ILE C 3 276  ? -14.108 113.685 22.428  1.00 26.46  ? 276  ILE A C     1 
ATOM   2432  O  O     . ILE C 3 276  ? -13.317 114.627 22.325  1.00 26.89  ? 276  ILE A O     1 
ATOM   2433  C  CB    . ILE C 3 276  ? -16.462 113.524 21.539  1.00 23.73  ? 276  ILE A CB    1 
ATOM   2434  C  CG1   . ILE C 3 276  ? -17.219 113.743 20.221  1.00 27.16  ? 276  ILE A CG1   1 
ATOM   2435  C  CG2   . ILE C 3 276  ? -16.609 114.731 22.432  1.00 23.82  ? 276  ILE A CG2   1 
ATOM   2436  C  CD1   . ILE C 3 276  ? -18.731 113.944 20.366  1.00 23.97  ? 276  ILE A CD1   1 
ATOM   2437  N  N     . PHE C 3 277  ? -14.242 113.002 23.559  1.00 25.73  ? 277  PHE A N     1 
ATOM   2438  C  CA    . PHE C 3 277  ? -13.457 113.379 24.724  1.00 27.13  ? 277  PHE A CA    1 
ATOM   2439  C  C     . PHE C 3 277  ? -11.943 113.231 24.530  1.00 27.93  ? 277  PHE A C     1 
ATOM   2440  O  O     . PHE C 3 277  ? -11.187 114.143 24.873  1.00 29.59  ? 277  PHE A O     1 
ATOM   2441  C  CB    . PHE C 3 277  ? -13.950 112.612 25.955  1.00 29.11  ? 277  PHE A CB    1 
ATOM   2442  C  CG    . PHE C 3 277  ? -15.308 113.077 26.451  1.00 30.58  ? 277  PHE A CG    1 
ATOM   2443  C  CD1   . PHE C 3 277  ? -15.476 114.372 26.959  1.00 29.92  ? 277  PHE A CD1   1 
ATOM   2444  C  CD2   . PHE C 3 277  ? -16.414 112.232 26.401  1.00 29.00  ? 277  PHE A CD2   1 
ATOM   2445  C  CE1   . PHE C 3 277  ? -16.720 114.813 27.407  1.00 29.14  ? 277  PHE A CE1   1 
ATOM   2446  C  CE2   . PHE C 3 277  ? -17.667 112.665 26.849  1.00 30.27  ? 277  PHE A CE2   1 
ATOM   2447  C  CZ    . PHE C 3 277  ? -17.819 113.959 27.353  1.00 30.43  ? 277  PHE A CZ    1 
ATOM   2448  N  N     . PRO C 3 278  ? -11.475 112.094 23.977  1.00 27.43  ? 278  PRO A N     1 
ATOM   2449  C  CA    . PRO C 3 278  ? -10.027 111.943 23.779  1.00 27.33  ? 278  PRO A CA    1 
ATOM   2450  C  C     . PRO C 3 278  ? -9.457  113.017 22.838  1.00 27.27  ? 278  PRO A C     1 
ATOM   2451  O  O     . PRO C 3 278  ? -8.475  113.679 23.160  1.00 26.83  ? 278  PRO A O     1 
ATOM   2452  C  CB    . PRO C 3 278  ? -9.905  110.538 23.194  1.00 26.44  ? 278  PRO A CB    1 
ATOM   2453  C  CG    . PRO C 3 278  ? -11.061 109.817 23.793  1.00 23.39  ? 278  PRO A CG    1 
ATOM   2454  C  CD    . PRO C 3 278  ? -12.171 110.823 23.700  1.00 27.31  ? 278  PRO A CD    1 
ATOM   2455  N  N     . GLN C 3 279  ? -10.092 113.192 21.685  1.00 28.15  ? 279  GLN A N     1 
ATOM   2456  C  CA    . GLN C 3 279  ? -9.656  114.173 20.695  1.00 30.32  ? 279  GLN A CA    1 
ATOM   2457  C  C     . GLN C 3 279  ? -9.619  115.613 21.185  1.00 30.16  ? 279  GLN A C     1 
ATOM   2458  O  O     . GLN C 3 279  ? -8.673  116.349 20.906  1.00 29.98  ? 279  GLN A O     1 
ATOM   2459  C  CB    . GLN C 3 279  ? -10.549 114.111 19.456  1.00 31.58  ? 279  GLN A CB    1 
ATOM   2460  C  CG    . GLN C 3 279  ? -10.258 112.939 18.566  1.00 37.44  ? 279  GLN A CG    1 
ATOM   2461  C  CD    . GLN C 3 279  ? -8.954  113.111 17.806  1.00 41.22  ? 279  GLN A CD    1 
ATOM   2462  O  OE1   . GLN C 3 279  ? -8.804  114.045 17.005  1.00 43.93  ? 279  GLN A OE1   1 
ATOM   2463  N  NE2   . GLN C 3 279  ? -8.002  112.215 18.051  1.00 39.44  ? 279  GLN A NE2   1 
ATOM   2464  N  N     . ASN C 3 280  ? -10.642 116.021 21.920  1.00 29.15  ? 280  ASN A N     1 
ATOM   2465  C  CA    . ASN C 3 280  ? -10.698 117.390 22.380  1.00 28.47  ? 280  ASN A CA    1 
ATOM   2466  C  C     . ASN C 3 280  ? -10.004 117.709 23.693  1.00 29.54  ? 280  ASN A C     1 
ATOM   2467  O  O     . ASN C 3 280  ? -10.178 118.801 24.233  1.00 29.67  ? 280  ASN A O     1 
ATOM   2468  C  CB    . ASN C 3 280  ? -12.149 117.823 22.416  1.00 29.12  ? 280  ASN A CB    1 
ATOM   2469  C  CG    . ASN C 3 280  ? -12.779 117.796 21.041  1.00 30.31  ? 280  ASN A CG    1 
ATOM   2470  O  OD1   . ASN C 3 280  ? -12.411 118.587 20.161  1.00 31.11  ? 280  ASN A OD1   1 
ATOM   2471  N  ND2   . ASN C 3 280  ? -13.718 116.881 20.837  1.00 29.38  ? 280  ASN A ND2   1 
ATOM   2472  N  N     . THR C 3 281  ? -9.218  116.764 24.207  1.00 30.05  ? 281  THR A N     1 
ATOM   2473  C  CA    . THR C 3 281  ? -8.477  116.975 25.447  1.00 30.29  ? 281  THR A CA    1 
ATOM   2474  C  C     . THR C 3 281  ? -7.097  116.352 25.300  1.00 29.90  ? 281  THR A C     1 
ATOM   2475  O  O     . THR C 3 281  ? -6.143  117.042 24.949  1.00 29.71  ? 281  THR A O     1 
ATOM   2476  C  CB    . THR C 3 281  ? -9.200  116.353 26.683  1.00 32.76  ? 281  THR A CB    1 
ATOM   2477  O  OG1   . THR C 3 281  ? -9.369  114.939 26.493  1.00 34.91  ? 281  THR A OG1   1 
ATOM   2478  C  CG2   . THR C 3 281  ? -10.565 117.011 26.895  1.00 30.42  ? 281  THR A CG2   1 
ATOM   2479  N  N     . LEU C 3 282  ? -7.000  115.045 25.548  1.00 29.40  ? 282  LEU A N     1 
ATOM   2480  C  CA    . LEU C 3 282  ? -5.737  114.313 25.439  1.00 28.26  ? 282  LEU A CA    1 
ATOM   2481  C  C     . LEU C 3 282  ? -4.939  114.705 24.196  1.00 28.22  ? 282  LEU A C     1 
ATOM   2482  O  O     . LEU C 3 282  ? -3.821  115.193 24.309  1.00 30.32  ? 282  LEU A O     1 
ATOM   2483  C  CB    . LEU C 3 282  ? -6.003  112.804 25.427  1.00 24.73  ? 282  LEU A CB    1 
ATOM   2484  C  CG    . LEU C 3 282  ? -4.847  111.810 25.257  1.00 22.27  ? 282  LEU A CG    1 
ATOM   2485  C  CD1   . LEU C 3 282  ? -3.835  111.923 26.402  1.00 19.15  ? 282  LEU A CD1   1 
ATOM   2486  C  CD2   . LEU C 3 282  ? -5.434  110.412 25.219  1.00 19.39  ? 282  LEU A CD2   1 
ATOM   2487  N  N     . HIS C 3 283  ? -5.518  114.515 23.017  1.00 28.06  ? 283  HIS A N     1 
ATOM   2488  C  CA    . HIS C 3 283  ? -4.829  114.845 21.771  1.00 29.18  ? 283  HIS A CA    1 
ATOM   2489  C  C     . HIS C 3 283  ? -4.829  116.341 21.370  1.00 29.41  ? 283  HIS A C     1 
ATOM   2490  O  O     . HIS C 3 283  ? -4.554  116.669 20.213  1.00 28.83  ? 283  HIS A O     1 
ATOM   2491  C  CB    . HIS C 3 283  ? -5.410  114.012 20.609  1.00 30.10  ? 283  HIS A CB    1 
ATOM   2492  C  CG    . HIS C 3 283  ? -5.550  112.546 20.905  1.00 31.70  ? 283  HIS A CG    1 
ATOM   2493  N  ND1   . HIS C 3 283  ? -4.596  111.821 21.588  1.00 34.00  ? 283  HIS A ND1   1 
ATOM   2494  C  CD2   . HIS C 3 283  ? -6.519  111.661 20.567  1.00 32.40  ? 283  HIS A CD2   1 
ATOM   2495  C  CE1   . HIS C 3 283  ? -4.970  110.555 21.658  1.00 33.83  ? 283  HIS A CE1   1 
ATOM   2496  N  NE2   . HIS C 3 283  ? -6.134  110.431 21.046  1.00 32.44  ? 283  HIS A NE2   1 
ATOM   2497  N  N     . SER C 3 284  ? -5.125  117.241 22.307  1.00 28.78  ? 284  SER A N     1 
ATOM   2498  C  CA    . SER C 3 284  ? -5.141  118.681 22.010  1.00 29.46  ? 284  SER A CA    1 
ATOM   2499  C  C     . SER C 3 284  ? -4.532  119.466 23.161  1.00 31.23  ? 284  SER A C     1 
ATOM   2500  O  O     . SER C 3 284  ? -4.701  120.686 23.260  1.00 32.95  ? 284  SER A O     1 
ATOM   2501  C  CB    . SER C 3 284  ? -6.569  119.196 21.804  1.00 27.90  ? 284  SER A CB    1 
ATOM   2502  O  OG    . SER C 3 284  ? -7.216  118.549 20.735  1.00 30.35  ? 284  SER A OG    1 
ATOM   2503  N  N     . MET C 3 285  ? -3.828  118.765 24.038  1.00 31.36  ? 285  MET A N     1 
ATOM   2504  C  CA    . MET C 3 285  ? -3.233  119.416 25.185  1.00 30.74  ? 285  MET A CA    1 
ATOM   2505  C  C     . MET C 3 285  ? -1.984  120.226 24.895  1.00 31.81  ? 285  MET A C     1 
ATOM   2506  O  O     . MET C 3 285  ? -1.169  119.884 24.036  1.00 31.22  ? 285  MET A O     1 
ATOM   2507  C  CB    . MET C 3 285  ? -2.909  118.383 26.259  1.00 28.27  ? 285  MET A CB    1 
ATOM   2508  C  CG    . MET C 3 285  ? -4.128  117.673 26.826  1.00 27.72  ? 285  MET A CG    1 
ATOM   2509  S  SD    . MET C 3 285  ? -5.306  118.785 27.618  1.00 23.98  ? 285  MET A SD    1 
ATOM   2510  C  CE    . MET C 3 285  ? -4.347  119.267 29.090  1.00 26.87  ? 285  MET A CE    1 
ATOM   2511  N  N     . TYR C 3 286  ? -1.866  121.326 25.622  1.00 32.69  ? 286  TYR A N     1 
ATOM   2512  C  CA    . TYR C 3 286  ? -0.705  122.185 25.546  1.00 34.61  ? 286  TYR A CA    1 
ATOM   2513  C  C     . TYR C 3 286  ? -0.317  122.817 24.215  1.00 37.67  ? 286  TYR A C     1 
ATOM   2514  O  O     . TYR C 3 286  ? 0.867   122.825 23.876  1.00 38.60  ? 286  TYR A O     1 
ATOM   2515  C  CB    . TYR C 3 286  ? 0.497   121.406 26.086  1.00 31.88  ? 286  TYR A CB    1 
ATOM   2516  C  CG    . TYR C 3 286  ? 0.192   120.607 27.340  1.00 27.63  ? 286  TYR A CG    1 
ATOM   2517  C  CD1   . TYR C 3 286  ? -0.350  121.220 28.466  1.00 24.08  ? 286  TYR A CD1   1 
ATOM   2518  C  CD2   . TYR C 3 286  ? 0.454   119.237 27.398  1.00 25.41  ? 286  TYR A CD2   1 
ATOM   2519  C  CE1   . TYR C 3 286  ? -0.623  120.493 29.617  1.00 23.12  ? 286  TYR A CE1   1 
ATOM   2520  C  CE2   . TYR C 3 286  ? 0.183   118.503 28.545  1.00 23.79  ? 286  TYR A CE2   1 
ATOM   2521  C  CZ    . TYR C 3 286  ? -0.352  119.136 29.648  1.00 22.81  ? 286  TYR A CZ    1 
ATOM   2522  O  OH    . TYR C 3 286  ? -0.615  118.417 30.786  1.00 21.42  ? 286  TYR A OH    1 
ATOM   2523  N  N     . GLU C 3 287  ? -1.273  123.349 23.454  1.00 40.79  ? 287  GLU A N     1 
ATOM   2524  C  CA    . GLU C 3 287  ? -0.900  123.994 22.195  1.00 42.67  ? 287  GLU A CA    1 
ATOM   2525  C  C     . GLU C 3 287  ? 0.064   125.098 22.632  1.00 42.57  ? 287  GLU A C     1 
ATOM   2526  O  O     . GLU C 3 287  ? 0.932   125.547 21.876  1.00 43.01  ? 287  GLU A O     1 
ATOM   2527  C  CB    . GLU C 3 287  ? -2.128  124.569 21.467  1.00 44.50  ? 287  GLU A CB    1 
ATOM   2528  C  CG    . GLU C 3 287  ? -3.069  123.490 20.894  1.00 50.19  ? 287  GLU A CG    1 
ATOM   2529  C  CD    . GLU C 3 287  ? -4.103  124.031 19.895  1.00 53.18  ? 287  GLU A CD    1 
ATOM   2530  O  OE1   . GLU C 3 287  ? -4.777  125.041 20.203  1.00 54.08  ? 287  GLU A OE1   1 
ATOM   2531  O  OE2   . GLU C 3 287  ? -4.253  123.432 18.803  1.00 54.19  ? 287  GLU A OE2   1 
ATOM   2532  N  N     . SER C 3 288  ? -0.100  125.499 23.885  1.00 42.00  ? 288  SER A N     1 
ATOM   2533  C  CA    . SER C 3 288  ? 0.737   126.498 24.525  1.00 43.43  ? 288  SER A CA    1 
ATOM   2534  C  C     . SER C 3 288  ? 1.257   125.787 25.776  1.00 43.33  ? 288  SER A C     1 
ATOM   2535  O  O     . SER C 3 288  ? 0.578   124.908 26.303  1.00 44.13  ? 288  SER A O     1 
ATOM   2536  C  CB    . SER C 3 288  ? -0.088  127.721 24.919  1.00 43.49  ? 288  SER A CB    1 
ATOM   2537  O  OG    . SER C 3 288  ? 0.708   128.635 25.651  1.00 46.32  ? 288  SER A OG    1 
ATOM   2538  N  N     . LEU C 3 289  ? 2.446   126.152 26.248  1.00 42.01  ? 289  LEU A N     1 
ATOM   2539  C  CA    . LEU C 3 289  ? 3.020   125.499 27.423  1.00 41.58  ? 289  LEU A CA    1 
ATOM   2540  C  C     . LEU C 3 289  ? 3.980   126.410 28.184  1.00 41.08  ? 289  LEU A C     1 
ATOM   2541  O  O     . LEU C 3 289  ? 5.030   126.775 27.669  1.00 41.16  ? 289  LEU A O     1 
ATOM   2542  C  CB    . LEU C 3 289  ? 3.756   124.229 26.988  1.00 41.56  ? 289  LEU A CB    1 
ATOM   2543  C  CG    . LEU C 3 289  ? 4.381   123.392 28.103  1.00 42.11  ? 289  LEU A CG    1 
ATOM   2544  C  CD1   . LEU C 3 289  ? 3.287   122.941 29.072  1.00 42.26  ? 289  LEU A CD1   1 
ATOM   2545  C  CD2   . LEU C 3 289  ? 5.097   122.192 27.503  1.00 40.81  ? 289  LEU A CD2   1 
ATOM   2546  N  N     . GLU C 3 290  ? 3.632   126.755 29.417  1.00 40.97  ? 290  GLU A N     1 
ATOM   2547  C  CA    . GLU C 3 290  ? 4.472   127.640 30.209  1.00 42.12  ? 290  GLU A CA    1 
ATOM   2548  C  C     . GLU C 3 290  ? 5.353   126.966 31.255  1.00 42.58  ? 290  GLU A C     1 
ATOM   2549  O  O     . GLU C 3 290  ? 6.356   127.543 31.676  1.00 42.27  ? 290  GLU A O     1 
ATOM   2550  C  CB    . GLU C 3 290  ? 3.612   128.682 30.912  1.00 44.00  ? 290  GLU A CB    1 
ATOM   2551  C  CG    . GLU C 3 290  ? 2.722   129.490 29.996  1.00 48.18  ? 290  GLU A CG    1 
ATOM   2552  C  CD    . GLU C 3 290  ? 1.779   130.389 30.778  1.00 51.56  ? 290  GLU A CD    1 
ATOM   2553  O  OE1   . GLU C 3 290  ? 0.897   131.016 30.149  1.00 53.98  ? 290  GLU A OE1   1 
ATOM   2554  O  OE2   . GLU C 3 290  ? 1.920   130.469 32.024  1.00 51.18  ? 290  GLU A OE2   1 
ATOM   2555  N  N     . GLY C 3 291  ? 4.981   125.767 31.699  1.00 42.78  ? 291  GLY A N     1 
ATOM   2556  C  CA    . GLY C 3 291  ? 5.786   125.106 32.711  1.00 41.80  ? 291  GLY A CA    1 
ATOM   2557  C  C     . GLY C 3 291  ? 5.367   123.697 33.078  1.00 42.28  ? 291  GLY A C     1 
ATOM   2558  O  O     . GLY C 3 291  ? 4.702   123.006 32.302  1.00 42.40  ? 291  GLY A O     1 
ATOM   2559  N  N     . GLY C 3 292  ? 5.766   123.273 34.274  1.00 40.77  ? 292  GLY A N     1 
ATOM   2560  C  CA    . GLY C 3 292  ? 5.440   121.937 34.735  1.00 39.11  ? 292  GLY A CA    1 
ATOM   2561  C  C     . GLY C 3 292  ? 6.647   121.023 34.627  1.00 38.89  ? 292  GLY A C     1 
ATOM   2562  O  O     . GLY C 3 292  ? 7.684   121.415 34.090  1.00 38.94  ? 292  GLY A O     1 
ATOM   2563  N  N     . TYR C 3 293  ? 6.522   119.801 35.129  1.00 37.66  ? 293  TYR A N     1 
ATOM   2564  C  CA    . TYR C 3 293  ? 7.626   118.851 35.075  1.00 36.98  ? 293  TYR A CA    1 
ATOM   2565  C  C     . TYR C 3 293  ? 7.193   117.503 34.515  1.00 37.03  ? 293  TYR A C     1 
ATOM   2566  O  O     . TYR C 3 293  ? 6.052   117.083 34.702  1.00 37.43  ? 293  TYR A O     1 
ATOM   2567  C  CB    . TYR C 3 293  ? 8.199   118.656 36.478  1.00 36.03  ? 293  TYR A CB    1 
ATOM   2568  C  CG    . TYR C 3 293  ? 8.634   119.952 37.107  1.00 38.05  ? 293  TYR A CG    1 
ATOM   2569  C  CD1   . TYR C 3 293  ? 9.918   120.454 36.895  1.00 38.31  ? 293  TYR A CD1   1 
ATOM   2570  C  CD2   . TYR C 3 293  ? 7.733   120.721 37.848  1.00 38.32  ? 293  TYR A CD2   1 
ATOM   2571  C  CE1   . TYR C 3 293  ? 10.297  121.693 37.401  1.00 40.24  ? 293  TYR A CE1   1 
ATOM   2572  C  CE2   . TYR C 3 293  ? 8.094   121.962 38.356  1.00 39.97  ? 293  TYR A CE2   1 
ATOM   2573  C  CZ    . TYR C 3 293  ? 9.380   122.445 38.130  1.00 42.10  ? 293  TYR A CZ    1 
ATOM   2574  O  OH    . TYR C 3 293  ? 9.752   123.669 38.642  1.00 43.34  ? 293  TYR A OH    1 
ATOM   2575  N  N     . CYS C 3 294  ? 8.097   116.835 33.807  1.00 34.55  ? 294  CYS A N     1 
ATOM   2576  C  CA    . CYS C 3 294  ? 7.791   115.518 33.279  1.00 34.59  ? 294  CYS A CA    1 
ATOM   2577  C  C     . CYS C 3 294  ? 8.971   114.617 33.623  1.00 34.27  ? 294  CYS A C     1 
ATOM   2578  O  O     . CYS C 3 294  ? 10.065  115.095 33.935  1.00 34.76  ? 294  CYS A O     1 
ATOM   2579  C  CB    . CYS C 3 294  ? 7.560   115.560 31.765  1.00 33.96  ? 294  CYS A CB    1 
ATOM   2580  S  SG    . CYS C 3 294  ? 9.045   115.665 30.784  1.00 38.38  ? 294  CYS A SG    1 
ATOM   2581  N  N     . PRO C 3 295  ? 8.765   113.298 33.586  1.00 32.91  ? 295  PRO A N     1 
ATOM   2582  C  CA    . PRO C 3 295  ? 9.835   112.355 33.907  1.00 32.26  ? 295  PRO A CA    1 
ATOM   2583  C  C     . PRO C 3 295  ? 11.079  112.490 33.033  1.00 31.75  ? 295  PRO A C     1 
ATOM   2584  O  O     . PRO C 3 295  ? 11.055  113.102 31.971  1.00 31.14  ? 295  PRO A O     1 
ATOM   2585  C  CB    . PRO C 3 295  ? 9.168   110.999 33.713  1.00 32.37  ? 295  PRO A CB    1 
ATOM   2586  C  CG    . PRO C 3 295  ? 7.730   111.281 33.990  1.00 33.78  ? 295  PRO A CG    1 
ATOM   2587  C  CD    . PRO C 3 295  ? 7.518   112.588 33.279  1.00 32.20  ? 295  PRO A CD    1 
ATOM   2588  N  N     . ASN C 3 296  ? 12.173  111.918 33.514  1.00 31.25  ? 296  ASN A N     1 
ATOM   2589  C  CA    . ASN C 3 296  ? 13.432  111.900 32.792  1.00 30.99  ? 296  ASN A CA    1 
ATOM   2590  C  C     . ASN C 3 296  ? 13.948  110.492 33.006  1.00 30.29  ? 296  ASN A C     1 
ATOM   2591  O  O     . ASN C 3 296  ? 14.625  110.196 34.001  1.00 30.26  ? 296  ASN A O     1 
ATOM   2592  C  CB    . ASN C 3 296  ? 14.432  112.922 33.346  1.00 31.17  ? 296  ASN A CB    1 
ATOM   2593  C  CG    . ASN C 3 296  ? 15.819  112.784 32.714  1.00 33.61  ? 296  ASN A CG    1 
ATOM   2594  O  OD1   . ASN C 3 296  ? 15.950  112.604 31.500  1.00 33.66  ? 296  ASN A OD1   1 
ATOM   2595  N  ND2   . ASN C 3 296  ? 16.861  112.872 33.542  1.00 34.59  ? 296  ASN A ND2   1 
ATOM   2596  N  N     . LEU C 3 297  ? 13.589  109.615 32.077  1.00 27.85  ? 297  LEU A N     1 
ATOM   2597  C  CA    . LEU C 3 297  ? 14.005  108.235 32.164  1.00 27.02  ? 297  LEU A CA    1 
ATOM   2598  C  C     . LEU C 3 297  ? 15.090  107.883 31.154  1.00 28.54  ? 297  LEU A C     1 
ATOM   2599  O  O     . LEU C 3 297  ? 15.218  108.500 30.089  1.00 27.47  ? 297  LEU A O     1 
ATOM   2600  C  CB    . LEU C 3 297  ? 12.797  107.312 31.969  1.00 22.80  ? 297  LEU A CB    1 
ATOM   2601  C  CG    . LEU C 3 297  ? 11.928  106.904 33.171  1.00 20.48  ? 297  LEU A CG    1 
ATOM   2602  C  CD1   . LEU C 3 297  ? 11.541  108.093 34.034  1.00 16.26  ? 297  LEU A CD1   1 
ATOM   2603  C  CD2   . LEU C 3 297  ? 10.696  106.199 32.640  1.00 16.58  ? 297  LEU A CD2   1 
ATOM   2604  N  N     . GLU C 3 298  ? 15.892  106.894 31.522  1.00 29.39  ? 298  GLU A N     1 
ATOM   2605  C  CA    . GLU C 3 298  ? 16.923  106.404 30.643  1.00 28.69  ? 298  GLU A CA    1 
ATOM   2606  C  C     . GLU C 3 298  ? 16.484  104.995 30.303  1.00 27.05  ? 298  GLU A C     1 
ATOM   2607  O  O     . GLU C 3 298  ? 16.045  104.253 31.175  1.00 26.70  ? 298  GLU A O     1 
ATOM   2608  C  CB    . GLU C 3 298  ? 18.281  106.381 31.337  1.00 30.38  ? 298  GLU A CB    1 
ATOM   2609  C  CG    . GLU C 3 298  ? 19.362  105.835 30.435  1.00 34.40  ? 298  GLU A CG    1 
ATOM   2610  C  CD    . GLU C 3 298  ? 20.760  106.226 30.865  1.00 39.16  ? 298  GLU A CD    1 
ATOM   2611  O  OE1   . GLU C 3 298  ? 21.042  107.448 30.951  1.00 39.17  ? 298  GLU A OE1   1 
ATOM   2612  O  OE2   . GLU C 3 298  ? 21.576  105.304 31.109  1.00 40.31  ? 298  GLU A OE2   1 
ATOM   2613  N  N     . TRP C 3 299  ? 16.572  104.631 29.032  1.00 27.51  ? 299  TRP A N     1 
ATOM   2614  C  CA    . TRP C 3 299  ? 16.184  103.294 28.612  1.00 26.08  ? 299  TRP A CA    1 
ATOM   2615  C  C     . TRP C 3 299  ? 17.442  102.441 28.708  1.00 25.48  ? 299  TRP A C     1 
ATOM   2616  O  O     . TRP C 3 299  ? 18.355  102.605 27.917  1.00 27.39  ? 299  TRP A O     1 
ATOM   2617  C  CB    . TRP C 3 299  ? 15.674  103.333 27.169  1.00 25.67  ? 299  TRP A CB    1 
ATOM   2618  C  CG    . TRP C 3 299  ? 14.937  102.092 26.718  1.00 26.02  ? 299  TRP A CG    1 
ATOM   2619  C  CD1   . TRP C 3 299  ? 14.911  100.867 27.335  1.00 26.08  ? 299  TRP A CD1   1 
ATOM   2620  C  CD2   . TRP C 3 299  ? 14.111  101.970 25.559  1.00 24.52  ? 299  TRP A CD2   1 
ATOM   2621  N  NE1   . TRP C 3 299  ? 14.112  99.998  26.632  1.00 22.29  ? 299  TRP A NE1   1 
ATOM   2622  C  CE2   . TRP C 3 299  ? 13.610  100.650 25.538  1.00 23.75  ? 299  TRP A CE2   1 
ATOM   2623  C  CE3   . TRP C 3 299  ? 13.742  102.850 24.532  1.00 25.32  ? 299  TRP A CE3   1 
ATOM   2624  C  CZ2   . TRP C 3 299  ? 12.760  100.192 24.529  1.00 23.57  ? 299  TRP A CZ2   1 
ATOM   2625  C  CZ3   . TRP C 3 299  ? 12.896  102.391 23.530  1.00 21.64  ? 299  TRP A CZ3   1 
ATOM   2626  C  CH2   . TRP C 3 299  ? 12.417  101.078 23.538  1.00 22.13  ? 299  TRP A CH2   1 
ATOM   2627  N  N     . LEU C 3 300  ? 17.498  101.554 29.694  1.00 25.62  ? 300  LEU A N     1 
ATOM   2628  C  CA    . LEU C 3 300  ? 18.653  100.682 29.881  1.00 24.82  ? 300  LEU A CA    1 
ATOM   2629  C  C     . LEU C 3 300  ? 18.870  99.720  28.710  1.00 26.53  ? 300  LEU A C     1 
ATOM   2630  O  O     . LEU C 3 300  ? 17.994  99.550  27.864  1.00 25.61  ? 300  LEU A O     1 
ATOM   2631  C  CB    . LEU C 3 300  ? 18.489  99.890  31.181  1.00 24.70  ? 300  LEU A CB    1 
ATOM   2632  C  CG    . LEU C 3 300  ? 19.146  100.500 32.433  1.00 28.73  ? 300  LEU A CG    1 
ATOM   2633  C  CD1   . LEU C 3 300  ? 19.280  102.018 32.285  1.00 29.22  ? 300  LEU A CD1   1 
ATOM   2634  C  CD2   . LEU C 3 300  ? 18.340  100.145 33.672  1.00 26.08  ? 300  LEU A CD2   1 
ATOM   2635  N  N     . GLU C 3 301  ? 20.045  99.099  28.675  1.00 26.95  ? 301  GLU A N     1 
ATOM   2636  C  CA    . GLU C 3 301  ? 20.405  98.145  27.629  1.00 28.69  ? 301  GLU A CA    1 
ATOM   2637  C  C     . GLU C 3 301  ? 20.405  96.726  28.205  1.00 29.25  ? 301  GLU A C     1 
ATOM   2638  O  O     . GLU C 3 301  ? 20.799  96.509  29.354  1.00 28.81  ? 301  GLU A O     1 
ATOM   2639  C  CB    . GLU C 3 301  ? 21.808  98.447  27.084  1.00 31.37  ? 301  GLU A CB    1 
ATOM   2640  C  CG    . GLU C 3 301  ? 22.009  99.834  26.483  1.00 31.97  ? 301  GLU A CG    1 
ATOM   2641  C  CD    . GLU C 3 301  ? 21.323  99.997  25.146  1.00 34.53  ? 301  GLU A CD    1 
ATOM   2642  O  OE1   . GLU C 3 301  ? 21.389  99.064  24.319  1.00 34.85  ? 301  GLU A OE1   1 
ATOM   2643  O  OE2   . GLU C 3 301  ? 20.725  101.066 24.914  1.00 39.95  ? 301  GLU A OE2   1 
ATOM   2644  N  N     . PRO C 3 302  ? 19.959  95.740  27.415  1.00 28.81  ? 302  PRO A N     1 
ATOM   2645  C  CA    . PRO C 3 302  ? 19.473  95.937  26.050  1.00 28.08  ? 302  PRO A CA    1 
ATOM   2646  C  C     . PRO C 3 302  ? 18.025  96.422  26.122  1.00 28.59  ? 302  PRO A C     1 
ATOM   2647  O  O     . PRO C 3 302  ? 17.251  95.978  26.983  1.00 28.22  ? 302  PRO A O     1 
ATOM   2648  C  CB    . PRO C 3 302  ? 19.584  94.540  25.456  1.00 28.82  ? 302  PRO A CB    1 
ATOM   2649  C  CG    . PRO C 3 302  ? 19.153  93.678  26.614  1.00 28.41  ? 302  PRO A CG    1 
ATOM   2650  C  CD    . PRO C 3 302  ? 19.904  94.313  27.792  1.00 28.42  ? 302  PRO A CD    1 
ATOM   2651  N  N     . ARG C 3 303  ? 17.662  97.330  25.225  1.00 28.59  ? 303  ARG A N     1 
ATOM   2652  C  CA    . ARG C 3 303  ? 16.314  97.866  25.207  1.00 29.37  ? 303  ARG A CA    1 
ATOM   2653  C  C     . ARG C 3 303  ? 15.235  96.782  25.285  1.00 30.75  ? 303  ARG A C     1 
ATOM   2654  O  O     . ARG C 3 303  ? 14.134  97.033  25.786  1.00 31.53  ? 303  ARG A O     1 
ATOM   2655  C  CB    . ARG C 3 303  ? 16.124  98.735  23.965  1.00 29.86  ? 303  ARG A CB    1 
ATOM   2656  C  CG    . ARG C 3 303  ? 16.634  100.186 24.112  1.00 29.45  ? 303  ARG A CG    1 
ATOM   2657  C  CD    . ARG C 3 303  ? 16.625  100.866 22.749  1.00 32.28  ? 303  ARG A CD    1 
ATOM   2658  N  NE    . ARG C 3 303  ? 16.485  102.320 22.762  1.00 32.20  ? 303  ARG A NE    1 
ATOM   2659  C  CZ    . ARG C 3 303  ? 17.186  103.142 23.532  1.00 36.37  ? 303  ARG A CZ    1 
ATOM   2660  N  NH1   . ARG C 3 303  ? 18.093  102.663 24.389  1.00 36.04  ? 303  ARG A NH1   1 
ATOM   2661  N  NH2   . ARG C 3 303  ? 17.006  104.456 23.416  1.00 35.29  ? 303  ARG A NH2   1 
ATOM   2662  N  N     . SER C 3 304  ? 15.558  95.577  24.824  1.00 30.32  ? 304  SER A N     1 
ATOM   2663  C  CA    . SER C 3 304  ? 14.614  94.463  24.849  1.00 31.99  ? 304  SER A CA    1 
ATOM   2664  C  C     . SER C 3 304  ? 14.136  94.071  26.255  1.00 33.19  ? 304  SER A C     1 
ATOM   2665  O  O     . SER C 3 304  ? 13.087  93.427  26.397  1.00 34.98  ? 304  SER A O     1 
ATOM   2666  C  CB    . SER C 3 304  ? 15.221  93.232  24.162  1.00 31.77  ? 304  SER A CB    1 
ATOM   2667  O  OG    . SER C 3 304  ? 16.287  92.692  24.921  1.00 34.49  ? 304  SER A OG    1 
ATOM   2668  N  N     . ASP C 3 305  ? 14.898  94.435  27.285  1.00 32.34  ? 305  ASP A N     1 
ATOM   2669  C  CA    . ASP C 3 305  ? 14.507  94.120  28.662  1.00 32.28  ? 305  ASP A CA    1 
ATOM   2670  C  C     . ASP C 3 305  ? 13.435  95.074  29.162  1.00 31.22  ? 305  ASP A C     1 
ATOM   2671  O  O     . ASP C 3 305  ? 12.862  94.860  30.229  1.00 30.39  ? 305  ASP A O     1 
ATOM   2672  C  CB    . ASP C 3 305  ? 15.699  94.206  29.616  1.00 35.54  ? 305  ASP A CB    1 
ATOM   2673  C  CG    . ASP C 3 305  ? 16.634  93.030  29.490  1.00 38.88  ? 305  ASP A CG    1 
ATOM   2674  O  OD1   . ASP C 3 305  ? 16.329  92.104  28.703  1.00 41.83  ? 305  ASP A OD1   1 
ATOM   2675  O  OD2   . ASP C 3 305  ? 17.674  93.030  30.185  1.00 40.13  ? 305  ASP A OD2   1 
ATOM   2676  N  N     . TYR C 3 306  ? 13.184  96.138  28.403  1.00 28.99  ? 306  TYR A N     1 
ATOM   2677  C  CA    . TYR C 3 306  ? 12.167  97.107  28.779  1.00 28.62  ? 306  TYR A CA    1 
ATOM   2678  C  C     . TYR C 3 306  ? 12.354  97.528  30.226  1.00 27.99  ? 306  TYR A C     1 
ATOM   2679  O  O     . TYR C 3 306  ? 11.413  97.543  31.008  1.00 27.38  ? 306  TYR A O     1 
ATOM   2680  C  CB    . TYR C 3 306  ? 10.789  96.488  28.579  1.00 27.97  ? 306  TYR A CB    1 
ATOM   2681  C  CG    . TYR C 3 306  ? 10.510  96.159  27.135  1.00 30.64  ? 306  TYR A CG    1 
ATOM   2682  C  CD1   . TYR C 3 306  ? 10.456  97.172  26.174  1.00 31.43  ? 306  TYR A CD1   1 
ATOM   2683  C  CD2   . TYR C 3 306  ? 10.318  94.841  26.717  1.00 31.79  ? 306  TYR A CD2   1 
ATOM   2684  C  CE1   . TYR C 3 306  ? 10.218  96.885  24.832  1.00 32.33  ? 306  TYR A CE1   1 
ATOM   2685  C  CE2   . TYR C 3 306  ? 10.080  94.541  25.375  1.00 32.55  ? 306  TYR A CE2   1 
ATOM   2686  C  CZ    . TYR C 3 306  ? 10.031  95.570  24.439  1.00 32.76  ? 306  TYR A CZ    1 
ATOM   2687  O  OH    . TYR C 3 306  ? 9.791   95.298  23.114  1.00 31.32  ? 306  TYR A OH    1 
ATOM   2688  N  N     . LYS C 3 307  ? 13.594  97.862  30.558  1.00 30.19  ? 307  LYS A N     1 
ATOM   2689  C  CA    . LYS C 3 307  ? 13.998  98.273  31.896  1.00 30.57  ? 307  LYS A CA    1 
ATOM   2690  C  C     . LYS C 3 307  ? 14.480  99.722  31.822  1.00 30.58  ? 307  LYS A C     1 
ATOM   2691  O  O     . LYS C 3 307  ? 15.321  100.065 30.985  1.00 29.54  ? 307  LYS A O     1 
ATOM   2692  C  CB    . LYS C 3 307  ? 15.116  97.348  32.361  1.00 32.16  ? 307  LYS A CB    1 
ATOM   2693  C  CG    . LYS C 3 307  ? 15.483  97.471  33.808  1.00 37.64  ? 307  LYS A CG    1 
ATOM   2694  C  CD    . LYS C 3 307  ? 16.450  96.366  34.196  1.00 38.44  ? 307  LYS A CD    1 
ATOM   2695  C  CE    . LYS C 3 307  ? 16.671  96.338  35.698  1.00 40.20  ? 307  LYS A CE    1 
ATOM   2696  N  NZ    . LYS C 3 307  ? 17.418  95.118  36.106  1.00 42.36  ? 307  LYS A NZ    1 
ATOM   2697  N  N     . PHE C 3 308  ? 13.934  100.568 32.694  1.00 30.42  ? 308  PHE A N     1 
ATOM   2698  C  CA    . PHE C 3 308  ? 14.261  101.999 32.721  1.00 28.44  ? 308  PHE A CA    1 
ATOM   2699  C  C     . PHE C 3 308  ? 14.642  102.462 34.107  1.00 28.80  ? 308  PHE A C     1 
ATOM   2700  O  O     . PHE C 3 308  ? 14.280  101.839 35.108  1.00 29.51  ? 308  PHE A O     1 
ATOM   2701  C  CB    . PHE C 3 308  ? 13.054  102.839 32.294  1.00 26.33  ? 308  PHE A CB    1 
ATOM   2702  C  CG    . PHE C 3 308  ? 12.454  102.432 30.987  1.00 25.63  ? 308  PHE A CG    1 
ATOM   2703  C  CD1   . PHE C 3 308  ? 12.657  103.202 29.844  1.00 24.63  ? 308  PHE A CD1   1 
ATOM   2704  C  CD2   . PHE C 3 308  ? 11.681  101.278 30.894  1.00 24.43  ? 308  PHE A CD2   1 
ATOM   2705  C  CE1   . PHE C 3 308  ? 12.097  102.830 28.622  1.00 24.51  ? 308  PHE A CE1   1 
ATOM   2706  C  CE2   . PHE C 3 308  ? 11.119  100.897 29.679  1.00 24.47  ? 308  PHE A CE2   1 
ATOM   2707  C  CZ    . PHE C 3 308  ? 11.329  101.677 28.539  1.00 25.14  ? 308  PHE A CZ    1 
ATOM   2708  N  N     . MET C 3 309  ? 15.355  103.581 34.163  1.00 29.28  ? 309  MET A N     1 
ATOM   2709  C  CA    . MET C 3 309  ? 15.756  104.155 35.435  1.00 28.99  ? 309  MET A CA    1 
ATOM   2710  C  C     . MET C 3 309  ? 15.410  105.637 35.479  1.00 28.71  ? 309  MET A C     1 
ATOM   2711  O  O     . MET C 3 309  ? 15.674  106.384 34.535  1.00 25.10  ? 309  MET A O     1 
ATOM   2712  C  CB    . MET C 3 309  ? 17.246  103.939 35.684  1.00 29.28  ? 309  MET A CB    1 
ATOM   2713  C  CG    . MET C 3 309  ? 17.584  102.503 36.026  1.00 30.79  ? 309  MET A CG    1 
ATOM   2714  S  SD    . MET C 3 309  ? 19.271  102.303 36.648  1.00 36.04  ? 309  MET A SD    1 
ATOM   2715  C  CE    . MET C 3 309  ? 19.021  102.837 38.357  1.00 31.16  ? 309  MET A CE    1 
ATOM   2716  N  N     . TYR C 3 310  ? 14.779  106.028 36.585  1.00 29.69  ? 310  TYR A N     1 
ATOM   2717  C  CA    . TYR C 3 310  ? 14.349  107.396 36.838  1.00 28.80  ? 310  TYR A CA    1 
ATOM   2718  C  C     . TYR C 3 310  ? 15.580  108.253 37.081  1.00 29.81  ? 310  TYR A C     1 
ATOM   2719  O  O     . TYR C 3 310  ? 16.446  107.877 37.868  1.00 28.65  ? 310  TYR A O     1 
ATOM   2720  C  CB    . TYR C 3 310  ? 13.438  107.408 38.067  1.00 28.34  ? 310  TYR A CB    1 
ATOM   2721  C  CG    . TYR C 3 310  ? 13.059  108.782 38.566  1.00 30.45  ? 310  TYR A CG    1 
ATOM   2722  C  CD1   . TYR C 3 310  ? 12.165  109.586 37.855  1.00 29.43  ? 310  TYR A CD1   1 
ATOM   2723  C  CD2   . TYR C 3 310  ? 13.602  109.284 39.756  1.00 30.32  ? 310  TYR A CD2   1 
ATOM   2724  C  CE1   . TYR C 3 310  ? 11.820  110.858 38.316  1.00 30.87  ? 310  TYR A CE1   1 
ATOM   2725  C  CE2   . TYR C 3 310  ? 13.265  110.550 40.222  1.00 30.68  ? 310  TYR A CE2   1 
ATOM   2726  C  CZ    . TYR C 3 310  ? 12.375  111.332 39.499  1.00 31.67  ? 310  TYR A CZ    1 
ATOM   2727  O  OH    . TYR C 3 310  ? 12.053  112.591 39.952  1.00 34.73  ? 310  TYR A OH    1 
ATOM   2728  N  N     . MET C 3 311  ? 15.661  109.402 36.411  1.00 31.04  ? 311  MET A N     1 
ATOM   2729  C  CA    . MET C 3 311  ? 16.815  110.280 36.576  1.00 32.11  ? 311  MET A CA    1 
ATOM   2730  C  C     . MET C 3 311  ? 16.508  111.691 37.076  1.00 32.18  ? 311  MET A C     1 
ATOM   2731  O  O     . MET C 3 311  ? 17.406  112.523 37.172  1.00 33.85  ? 311  MET A O     1 
ATOM   2732  C  CB    . MET C 3 311  ? 17.603  110.359 35.266  1.00 31.48  ? 311  MET A CB    1 
ATOM   2733  C  CG    . MET C 3 311  ? 18.199  109.025 34.851  1.00 33.92  ? 311  MET A CG    1 
ATOM   2734  S  SD    . MET C 3 311  ? 19.593  109.176 33.710  1.00 39.48  ? 311  MET A SD    1 
ATOM   2735  C  CE    . MET C 3 311  ? 18.763  109.629 32.135  1.00 36.41  ? 311  MET A CE    1 
ATOM   2736  N  N     . GLY C 3 312  ? 15.253  111.957 37.411  1.00 31.16  ? 312  GLY A N     1 
ATOM   2737  C  CA    . GLY C 3 312  ? 14.888  113.277 37.892  1.00 31.93  ? 312  GLY A CA    1 
ATOM   2738  C  C     . GLY C 3 312  ? 13.716  113.854 37.121  1.00 33.13  ? 312  GLY A C     1 
ATOM   2739  O  O     . GLY C 3 312  ? 12.898  113.115 36.571  1.00 32.09  ? 312  GLY A O     1 
ATOM   2740  N  N     . VAL C 3 313  ? 13.629  115.176 37.061  1.00 34.05  ? 313  VAL A N     1 
ATOM   2741  C  CA    . VAL C 3 313  ? 12.533  115.801 36.331  1.00 35.82  ? 313  VAL A CA    1 
ATOM   2742  C  C     . VAL C 3 313  ? 13.016  116.649 35.163  1.00 35.38  ? 313  VAL A C     1 
ATOM   2743  O  O     . VAL C 3 313  ? 14.110  117.208 35.203  1.00 34.45  ? 313  VAL A O     1 
ATOM   2744  C  CB    . VAL C 3 313  ? 11.693  116.685 37.261  1.00 35.55  ? 313  VAL A CB    1 
ATOM   2745  C  CG1   . VAL C 3 313  ? 11.178  115.857 38.422  1.00 38.03  ? 313  VAL A CG1   1 
ATOM   2746  C  CG2   . VAL C 3 313  ? 12.534  117.834 37.776  1.00 36.15  ? 313  VAL A CG2   1 
ATOM   2747  N  N     . MET C 3 314  ? 12.198  116.724 34.115  1.00 37.34  ? 314  MET A N     1 
ATOM   2748  C  CA    . MET C 3 314  ? 12.516  117.533 32.934  1.00 38.66  ? 314  MET A CA    1 
ATOM   2749  C  C     . MET C 3 314  ? 11.631  118.769 32.976  1.00 37.18  ? 314  MET A C     1 
ATOM   2750  O  O     . MET C 3 314  ? 10.420  118.682 32.772  1.00 37.26  ? 314  MET A O     1 
ATOM   2751  C  CB    . MET C 3 314  ? 12.236  116.761 31.638  1.00 40.31  ? 314  MET A CB    1 
ATOM   2752  C  CG    . MET C 3 314  ? 12.265  117.621 30.361  1.00 43.66  ? 314  MET A CG    1 
ATOM   2753  S  SD    . MET C 3 314  ? 13.911  117.936 29.654  1.00 47.38  ? 314  MET A SD    1 
ATOM   2754  C  CE    . MET C 3 314  ? 14.419  119.389 30.600  1.00 46.62  ? 314  MET A CE    1 
ATOM   2755  N  N     . PRO C 3 315  ? 12.219  119.933 33.275  1.00 36.39  ? 315  PRO A N     1 
ATOM   2756  C  CA    . PRO C 3 315  ? 11.446  121.178 33.335  1.00 36.36  ? 315  PRO A CA    1 
ATOM   2757  C  C     . PRO C 3 315  ? 10.828  121.458 31.973  1.00 34.78  ? 315  PRO A C     1 
ATOM   2758  O  O     . PRO C 3 315  ? 11.490  121.307 30.950  1.00 36.42  ? 315  PRO A O     1 
ATOM   2759  C  CB    . PRO C 3 315  ? 12.497  122.214 33.724  1.00 36.42  ? 315  PRO A CB    1 
ATOM   2760  C  CG    . PRO C 3 315  ? 13.431  121.414 34.581  1.00 36.99  ? 315  PRO A CG    1 
ATOM   2761  C  CD    . PRO C 3 315  ? 13.583  120.139 33.784  1.00 35.73  ? 315  PRO A CD    1 
ATOM   2762  N  N     . LEU C 3 316  ? 9.565   121.857 31.957  1.00 33.06  ? 316  LEU A N     1 
ATOM   2763  C  CA    . LEU C 3 316  ? 8.887   122.130 30.697  1.00 33.26  ? 316  LEU A CA    1 
ATOM   2764  C  C     . LEU C 3 316  ? 8.820   123.620 30.392  1.00 34.59  ? 316  LEU A C     1 
ATOM   2765  O  O     . LEU C 3 316  ? 8.891   124.459 31.296  1.00 34.19  ? 316  LEU A O     1 
ATOM   2766  C  CB    . LEU C 3 316  ? 7.474   121.531 30.726  1.00 31.24  ? 316  LEU A CB    1 
ATOM   2767  C  CG    . LEU C 3 316  ? 7.449   120.000 30.848  1.00 31.21  ? 316  LEU A CG    1 
ATOM   2768  C  CD1   . LEU C 3 316  ? 6.049   119.512 31.201  1.00 26.88  ? 316  LEU A CD1   1 
ATOM   2769  C  CD2   . LEU C 3 316  ? 7.955   119.378 29.545  1.00 29.36  ? 316  LEU A CD2   1 
ATOM   2770  N  N     . SER C 3 317  ? 8.699   123.944 29.109  1.00 35.03  ? 317  SER A N     1 
ATOM   2771  C  CA    . SER C 3 317  ? 8.611   125.336 28.685  1.00 37.60  ? 317  SER A CA    1 
ATOM   2772  C  C     . SER C 3 317  ? 7.982   125.377 27.304  1.00 38.08  ? 317  SER A C     1 
ATOM   2773  O  O     . SER C 3 317  ? 7.692   124.331 26.724  1.00 39.53  ? 317  SER A O     1 
ATOM   2774  C  CB    . SER C 3 317  ? 10.002  125.984 28.646  1.00 38.10  ? 317  SER A CB    1 
ATOM   2775  O  OG    . SER C 3 317  ? 10.790  125.467 27.584  1.00 39.59  ? 317  SER A OG    1 
ATOM   2776  N  N     . ALA C 3 318  ? 7.770   126.580 26.783  1.00 38.00  ? 318  ALA A N     1 
ATOM   2777  C  CA    . ALA C 3 318  ? 7.168   126.745 25.468  1.00 38.78  ? 318  ALA A CA    1 
ATOM   2778  C  C     . ALA C 3 318  ? 7.870   125.853 24.454  1.00 39.49  ? 318  ALA A C     1 
ATOM   2779  O  O     . ALA C 3 318  ? 7.255   125.372 23.510  1.00 39.28  ? 318  ALA A O     1 
ATOM   2780  C  CB    . ALA C 3 318  ? 7.255   128.201 25.034  1.00 37.28  ? 318  ALA A CB    1 
ATOM   2781  N  N     . LYS C 3 319  ? 9.160   125.633 24.667  1.00 41.74  ? 319  LYS A N     1 
ATOM   2782  C  CA    . LYS C 3 319  ? 9.973   124.803 23.785  1.00 44.83  ? 319  LYS A CA    1 
ATOM   2783  C  C     . LYS C 3 319  ? 9.334   123.440 23.502  1.00 45.69  ? 319  LYS A C     1 
ATOM   2784  O  O     . LYS C 3 319  ? 9.579   122.828 22.451  1.00 46.15  ? 319  LYS A O     1 
ATOM   2785  C  CB    . LYS C 3 319  ? 11.358  124.613 24.417  1.00 48.46  ? 319  LYS A CB    1 
ATOM   2786  C  CG    . LYS C 3 319  ? 12.261  123.578 23.753  1.00 51.62  ? 319  LYS A CG    1 
ATOM   2787  C  CD    . LYS C 3 319  ? 13.529  123.358 24.591  1.00 53.36  ? 319  LYS A CD    1 
ATOM   2788  C  CE    . LYS C 3 319  ? 14.492  122.378 23.923  1.00 55.95  ? 319  LYS A CE    1 
ATOM   2789  N  NZ    . LYS C 3 319  ? 15.752  122.196 24.714  1.00 57.79  ? 319  LYS A NZ    1 
ATOM   2790  N  N     . TYR C 3 320  ? 8.505   122.972 24.433  1.00 43.85  ? 320  TYR A N     1 
ATOM   2791  C  CA    . TYR C 3 320  ? 7.867   121.672 24.284  1.00 42.02  ? 320  TYR A CA    1 
ATOM   2792  C  C     . TYR C 3 320  ? 6.376   121.696 23.984  1.00 41.33  ? 320  TYR A C     1 
ATOM   2793  O  O     . TYR C 3 320  ? 5.723   120.654 24.014  1.00 40.53  ? 320  TYR A O     1 
ATOM   2794  C  CB    . TYR C 3 320  ? 8.138   120.828 25.529  1.00 40.98  ? 320  TYR A CB    1 
ATOM   2795  C  CG    . TYR C 3 320  ? 9.599   120.468 25.673  1.00 40.63  ? 320  TYR A CG    1 
ATOM   2796  C  CD1   . TYR C 3 320  ? 10.258  119.764 24.665  1.00 40.28  ? 320  TYR A CD1   1 
ATOM   2797  C  CD2   . TYR C 3 320  ? 10.335  120.857 26.797  1.00 40.97  ? 320  TYR A CD2   1 
ATOM   2798  C  CE1   . TYR C 3 320  ? 11.611  119.457 24.761  1.00 40.32  ? 320  TYR A CE1   1 
ATOM   2799  C  CE2   . TYR C 3 320  ? 11.698  120.552 26.905  1.00 42.23  ? 320  TYR A CE2   1 
ATOM   2800  C  CZ    . TYR C 3 320  ? 12.326  119.851 25.876  1.00 42.00  ? 320  TYR A CZ    1 
ATOM   2801  O  OH    . TYR C 3 320  ? 13.670  119.549 25.945  1.00 44.14  ? 320  TYR A OH    1 
ATOM   2802  N  N     . ALA C 3 321  ? 5.839   122.876 23.687  1.00 40.35  ? 321  ALA A N     1 
ATOM   2803  C  CA    . ALA C 3 321  ? 4.421   122.997 23.374  1.00 40.90  ? 321  ALA A CA    1 
ATOM   2804  C  C     . ALA C 3 321  ? 4.070   122.033 22.252  1.00 42.41  ? 321  ALA A C     1 
ATOM   2805  O  O     . ALA C 3 321  ? 4.941   121.583 21.510  1.00 43.54  ? 321  ALA A O     1 
ATOM   2806  C  CB    . ALA C 3 321  ? 4.091   124.415 22.962  1.00 38.52  ? 321  ALA A CB    1 
ATOM   2807  N  N     . ARG C 3 322  ? 2.789   121.715 22.133  1.00 43.46  ? 322  ARG A N     1 
ATOM   2808  C  CA    . ARG C 3 322  ? 2.331   120.795 21.109  1.00 45.14  ? 322  ARG A CA    1 
ATOM   2809  C  C     . ARG C 3 322  ? 2.853   121.247 19.753  1.00 47.45  ? 322  ARG A C     1 
ATOM   2810  O  O     . ARG C 3 322  ? 2.597   122.375 19.328  1.00 48.61  ? 322  ARG A O     1 
ATOM   2811  C  CB    . ARG C 3 322  ? 0.798   120.751 21.105  1.00 44.72  ? 322  ARG A CB    1 
ATOM   2812  C  CG    . ARG C 3 322  ? 0.194   119.675 20.221  1.00 43.89  ? 322  ARG A CG    1 
ATOM   2813  C  CD    . ARG C 3 322  ? -1.243  119.397 20.634  1.00 41.99  ? 322  ARG A CD    1 
ATOM   2814  N  NE    . ARG C 3 322  ? -1.852  118.312 19.870  1.00 41.99  ? 322  ARG A NE    1 
ATOM   2815  C  CZ    . ARG C 3 322  ? -2.152  118.377 18.576  1.00 41.79  ? 322  ARG A CZ    1 
ATOM   2816  N  NH1   . ARG C 3 322  ? -1.901  119.478 17.885  1.00 42.29  ? 322  ARG A NH1   1 
ATOM   2817  N  NH2   . ARG C 3 322  ? -2.716  117.342 17.975  1.00 42.49  ? 322  ARG A NH2   1 
ATOM   2818  N  N     . SER C 3 323  ? 3.602   120.372 19.087  1.00 48.88  ? 323  SER A N     1 
ATOM   2819  C  CA    . SER C 3 323  ? 4.150   120.679 17.769  1.00 49.58  ? 323  SER A CA    1 
ATOM   2820  C  C     . SER C 3 323  ? 3.454   119.803 16.737  1.00 51.18  ? 323  SER A C     1 
ATOM   2821  O  O     . SER C 3 323  ? 3.505   120.075 15.537  1.00 51.58  ? 323  SER A O     1 
ATOM   2822  C  CB    . SER C 3 323  ? 5.652   120.411 17.733  1.00 48.67  ? 323  SER A CB    1 
ATOM   2823  O  OG    . SER C 3 323  ? 5.915   119.025 17.833  1.00 48.75  ? 323  SER A OG    1 
ATOM   2824  N  N     . ALA C 3 324  ? 2.806   118.744 17.212  1.00 52.03  ? 324  ALA A N     1 
ATOM   2825  C  CA    . ALA C 3 324  ? 2.092   117.842 16.322  1.00 52.59  ? 324  ALA A CA    1 
ATOM   2826  C  C     . ALA C 3 324  ? 0.932   118.625 15.711  1.00 53.24  ? 324  ALA A C     1 
ATOM   2827  O  O     . ALA C 3 324  ? 0.415   119.558 16.331  1.00 53.85  ? 324  ALA A O     1 
ATOM   2828  C  CB    . ALA C 3 324  ? 1.576   116.639 17.098  1.00 51.66  ? 324  ALA A CB    1 
ATOM   2829  N  N     . PRO C 3 325  ? 0.512   118.259 14.487  1.00 52.87  ? 325  PRO A N     1 
ATOM   2830  C  CA    . PRO C 3 325  ? -0.587  118.904 13.748  1.00 52.31  ? 325  PRO A CA    1 
ATOM   2831  C  C     . PRO C 3 325  ? -1.872  119.125 14.565  1.00 51.84  ? 325  PRO A C     1 
ATOM   2832  O  O     . PRO C 3 325  ? -2.211  118.322 15.442  1.00 51.71  ? 325  PRO A O     1 
ATOM   2833  C  CB    . PRO C 3 325  ? -0.811  117.952 12.573  1.00 52.95  ? 325  PRO A CB    1 
ATOM   2834  C  CG    . PRO C 3 325  ? 0.560   117.393 12.331  1.00 53.68  ? 325  PRO A CG    1 
ATOM   2835  C  CD    . PRO C 3 325  ? 1.046   117.110 13.734  1.00 52.73  ? 325  PRO A CD    1 
ATOM   2836  N  N     . SER C 3 326  ? -2.584  120.213 14.273  1.00 49.61  ? 326  SER A N     1 
ATOM   2837  C  CA    . SER C 3 326  ? -3.827  120.522 14.977  1.00 47.60  ? 326  SER A CA    1 
ATOM   2838  C  C     . SER C 3 326  ? -4.990  119.716 14.406  1.00 45.55  ? 326  SER A C     1 
ATOM   2839  O  O     . SER C 3 326  ? -5.144  119.604 13.190  1.00 45.67  ? 326  SER A O     1 
ATOM   2840  C  CB    . SER C 3 326  ? -4.152  122.013 14.876  1.00 49.26  ? 326  SER A CB    1 
ATOM   2841  O  OG    . SER C 3 326  ? -5.400  122.296 15.493  1.00 48.09  ? 326  SER A OG    1 
ATOM   2842  N  N     . ASN C 3 327  ? -5.811  119.172 15.299  1.00 42.32  ? 327  ASN A N     1 
ATOM   2843  C  CA    . ASN C 3 327  ? -6.956  118.353 14.922  1.00 39.25  ? 327  ASN A CA    1 
ATOM   2844  C  C     . ASN C 3 327  ? -8.280  119.113 15.036  1.00 38.16  ? 327  ASN A C     1 
ATOM   2845  O  O     . ASN C 3 327  ? -9.354  118.559 14.806  1.00 36.40  ? 327  ASN A O     1 
ATOM   2846  C  CB    . ASN C 3 327  ? -6.976  117.081 15.789  1.00 38.50  ? 327  ASN A CB    1 
ATOM   2847  C  CG    . ASN C 3 327  ? -7.042  117.376 17.291  1.00 37.43  ? 327  ASN A CG    1 
ATOM   2848  O  OD1   . ASN C 3 327  ? -6.523  118.385 17.777  1.00 37.71  ? 327  ASN A OD1   1 
ATOM   2849  N  ND2   . ASN C 3 327  ? -7.664  116.472 18.032  1.00 36.71  ? 327  ASN A ND2   1 
ATOM   2850  N  N     . ASP C 3 328  ? -8.176  120.393 15.377  1.00 36.93  ? 328  ASP A N     1 
ATOM   2851  C  CA    . ASP C 3 328  ? -9.317  121.286 15.536  1.00 36.05  ? 328  ASP A CA    1 
ATOM   2852  C  C     . ASP C 3 328  ? -10.395 121.137 14.462  1.00 35.49  ? 328  ASP A C     1 
ATOM   2853  O  O     . ASP C 3 328  ? -11.562 120.892 14.773  1.00 34.60  ? 328  ASP A O     1 
ATOM   2854  C  CB    . ASP C 3 328  ? -8.813  122.736 15.560  1.00 36.99  ? 328  ASP A CB    1 
ATOM   2855  C  CG    . ASP C 3 328  ? -9.933  123.749 15.566  1.00 37.03  ? 328  ASP A CG    1 
ATOM   2856  O  OD1   . ASP C 3 328  ? -10.494 124.024 16.650  1.00 37.16  ? 328  ASP A OD1   1 
ATOM   2857  O  OD2   . ASP C 3 328  ? -10.255 124.262 14.472  1.00 37.97  ? 328  ASP A OD2   1 
ATOM   2858  N  N     . LYS C 3 329  ? -10.006 121.290 13.201  1.00 36.07  ? 329  LYS A N     1 
ATOM   2859  C  CA    . LYS C 3 329  ? -10.955 121.190 12.097  1.00 36.73  ? 329  LYS A CA    1 
ATOM   2860  C  C     . LYS C 3 329  ? -11.751 119.890 12.059  1.00 36.58  ? 329  LYS A C     1 
ATOM   2861  O  O     . LYS C 3 329  ? -12.979 119.924 12.092  1.00 36.09  ? 329  LYS A O     1 
ATOM   2862  C  CB    . LYS C 3 329  ? -10.244 121.393 10.759  1.00 39.25  ? 329  LYS A CB    1 
ATOM   2863  C  CG    . LYS C 3 329  ? -11.166 121.218 9.560   1.00 42.33  ? 329  LYS A CG    1 
ATOM   2864  C  CD    . LYS C 3 329  ? -10.619 121.875 8.304   1.00 44.30  ? 329  LYS A CD    1 
ATOM   2865  C  CE    . LYS C 3 329  ? -11.684 121.900 7.212   1.00 46.66  ? 329  LYS A CE    1 
ATOM   2866  N  NZ    . LYS C 3 329  ? -11.245 122.666 6.015   1.00 48.29  ? 329  LYS A NZ    1 
ATOM   2867  N  N     . LYS C 3 330  ? -11.064 118.752 11.975  1.00 36.07  ? 330  LYS A N     1 
ATOM   2868  C  CA    . LYS C 3 330  ? -11.749 117.460 11.941  1.00 37.93  ? 330  LYS A CA    1 
ATOM   2869  C  C     . LYS C 3 330  ? -12.603 117.232 13.193  1.00 36.33  ? 330  LYS A C     1 
ATOM   2870  O  O     . LYS C 3 330  ? -13.726 116.731 13.107  1.00 35.90  ? 330  LYS A O     1 
ATOM   2871  C  CB    . LYS C 3 330  ? -10.742 116.314 11.814  1.00 41.28  ? 330  LYS A CB    1 
ATOM   2872  C  CG    . LYS C 3 330  ? -10.149 116.131 10.431  1.00 44.91  ? 330  LYS A CG    1 
ATOM   2873  C  CD    . LYS C 3 330  ? -9.024  115.097 10.482  1.00 50.08  ? 330  LYS A CD    1 
ATOM   2874  C  CE    . LYS C 3 330  ? -8.269  115.015 9.151   1.00 52.69  ? 330  LYS A CE    1 
ATOM   2875  N  NZ    . LYS C 3 330  ? -6.959  114.300 9.273   1.00 53.02  ? 330  LYS A NZ    1 
ATOM   2876  N  N     . ALA C 3 331  ? -12.059 117.594 14.352  1.00 34.63  ? 331  ALA A N     1 
ATOM   2877  C  CA    . ALA C 3 331  ? -12.764 117.434 15.617  1.00 32.83  ? 331  ALA A CA    1 
ATOM   2878  C  C     . ALA C 3 331  ? -14.086 118.209 15.599  1.00 32.92  ? 331  ALA A C     1 
ATOM   2879  O  O     . ALA C 3 331  ? -15.125 117.683 16.006  1.00 33.73  ? 331  ALA A O     1 
ATOM   2880  C  CB    . ALA C 3 331  ? -11.880 117.904 16.768  1.00 29.44  ? 331  ALA A CB    1 
ATOM   2881  N  N     . ARG C 3 332  ? -14.050 119.453 15.125  1.00 32.19  ? 332  ARG A N     1 
ATOM   2882  C  CA    . ARG C 3 332  ? -15.263 120.273 15.044  1.00 31.43  ? 332  ARG A CA    1 
ATOM   2883  C  C     . ARG C 3 332  ? -16.219 119.785 13.957  1.00 31.45  ? 332  ARG A C     1 
ATOM   2884  O  O     . ARG C 3 332  ? -17.434 119.928 14.078  1.00 31.78  ? 332  ARG A O     1 
ATOM   2885  C  CB    . ARG C 3 332  ? -14.907 121.742 14.797  1.00 27.70  ? 332  ARG A CB    1 
ATOM   2886  C  CG    . ARG C 3 332  ? -14.315 122.432 16.015  1.00 26.17  ? 332  ARG A CG    1 
ATOM   2887  C  CD    . ARG C 3 332  ? -13.827 123.830 15.696  1.00 23.41  ? 332  ARG A CD    1 
ATOM   2888  N  NE    . ARG C 3 332  ? -13.123 124.421 16.832  1.00 22.21  ? 332  ARG A NE    1 
ATOM   2889  C  CZ    . ARG C 3 332  ? -13.720 124.863 17.939  1.00 21.04  ? 332  ARG A CZ    1 
ATOM   2890  N  NH1   . ARG C 3 332  ? -15.038 124.792 18.068  1.00 20.48  ? 332  ARG A NH1   1 
ATOM   2891  N  NH2   . ARG C 3 332  ? -12.997 125.374 18.922  1.00 18.53  ? 332  ARG A NH2   1 
ATOM   2892  N  N     . GLU C 3 333  ? -15.676 119.211 12.892  1.00 32.97  ? 333  GLU A N     1 
ATOM   2893  C  CA    . GLU C 3 333  ? -16.524 118.708 11.826  1.00 34.16  ? 333  GLU A CA    1 
ATOM   2894  C  C     . GLU C 3 333  ? -17.300 117.540 12.383  1.00 34.18  ? 333  GLU A C     1 
ATOM   2895  O  O     . GLU C 3 333  ? -18.501 117.398 12.129  1.00 33.50  ? 333  GLU A O     1 
ATOM   2896  C  CB    . GLU C 3 333  ? -15.692 118.248 10.633  1.00 36.36  ? 333  GLU A CB    1 
ATOM   2897  C  CG    . GLU C 3 333  ? -15.226 119.374 9.718   1.00 41.60  ? 333  GLU A CG    1 
ATOM   2898  C  CD    . GLU C 3 333  ? -14.444 118.857 8.518   1.00 45.34  ? 333  GLU A CD    1 
ATOM   2899  O  OE1   . GLU C 3 333  ? -14.952 117.946 7.823   1.00 47.24  ? 333  GLU A OE1   1 
ATOM   2900  O  OE2   . GLU C 3 333  ? -13.326 119.361 8.265   1.00 47.53  ? 333  GLU A OE2   1 
ATOM   2901  N  N     . LEU C 3 334  ? -16.605 116.712 13.160  1.00 33.92  ? 334  LEU A N     1 
ATOM   2902  C  CA    . LEU C 3 334  ? -17.211 115.530 13.772  1.00 33.26  ? 334  LEU A CA    1 
ATOM   2903  C  C     . LEU C 3 334  ? -18.352 115.938 14.701  1.00 32.23  ? 334  LEU A C     1 
ATOM   2904  O  O     . LEU C 3 334  ? -19.431 115.345 14.670  1.00 30.49  ? 334  LEU A O     1 
ATOM   2905  C  CB    . LEU C 3 334  ? -16.151 114.726 14.540  1.00 32.68  ? 334  LEU A CB    1 
ATOM   2906  C  CG    . LEU C 3 334  ? -16.601 113.353 15.054  1.00 34.62  ? 334  LEU A CG    1 
ATOM   2907  C  CD1   . LEU C 3 334  ? -15.394 112.444 15.195  1.00 36.68  ? 334  LEU A CD1   1 
ATOM   2908  C  CD2   . LEU C 3 334  ? -17.337 113.493 16.382  1.00 33.92  ? 334  LEU A CD2   1 
ATOM   2909  N  N     . GLY C 3 335  ? -18.108 116.956 15.522  1.00 32.26  ? 335  GLY A N     1 
ATOM   2910  C  CA    . GLY C 3 335  ? -19.132 117.431 16.433  1.00 32.55  ? 335  GLY A CA    1 
ATOM   2911  C  C     . GLY C 3 335  ? -20.347 117.960 15.687  1.00 33.75  ? 335  GLY A C     1 
ATOM   2912  O  O     . GLY C 3 335  ? -21.488 117.675 16.062  1.00 33.01  ? 335  GLY A O     1 
ATOM   2913  N  N     . GLU C 3 336  ? -20.101 118.735 14.629  1.00 34.73  ? 336  GLU A N     1 
ATOM   2914  C  CA    . GLU C 3 336  ? -21.175 119.304 13.819  1.00 34.30  ? 336  GLU A CA    1 
ATOM   2915  C  C     . GLU C 3 336  ? -22.020 118.215 13.175  1.00 33.90  ? 336  GLU A C     1 
ATOM   2916  O  O     . GLU C 3 336  ? -23.249 118.305 13.147  1.00 33.34  ? 336  GLU A O     1 
ATOM   2917  C  CB    . GLU C 3 336  ? -20.601 120.190 12.710  1.00 37.20  ? 336  GLU A CB    1 
ATOM   2918  C  CG    . GLU C 3 336  ? -20.072 121.547 13.159  1.00 40.59  ? 336  GLU A CG    1 
ATOM   2919  C  CD    . GLU C 3 336  ? -21.168 122.484 13.645  1.00 43.15  ? 336  GLU A CD    1 
ATOM   2920  O  OE1   . GLU C 3 336  ? -22.365 122.136 13.510  1.00 42.74  ? 336  GLU A OE1   1 
ATOM   2921  O  OE2   . GLU C 3 336  ? -20.824 123.575 14.156  1.00 44.55  ? 336  GLU A OE2   1 
ATOM   2922  N  N     . LYS C 3 337  ? -21.355 117.186 12.658  1.00 32.80  ? 337  LYS A N     1 
ATOM   2923  C  CA    . LYS C 3 337  ? -22.047 116.093 11.993  1.00 32.29  ? 337  LYS A CA    1 
ATOM   2924  C  C     . LYS C 3 337  ? -22.959 115.267 12.896  1.00 31.91  ? 337  LYS A C     1 
ATOM   2925  O  O     . LYS C 3 337  ? -23.982 114.755 12.432  1.00 31.62  ? 337  LYS A O     1 
ATOM   2926  C  CB    . LYS C 3 337  ? -21.047 115.163 11.304  1.00 32.04  ? 337  LYS A CB    1 
ATOM   2927  C  CG    . LYS C 3 337  ? -21.727 114.087 10.465  1.00 35.41  ? 337  LYS A CG    1 
ATOM   2928  C  CD    . LYS C 3 337  ? -20.756 113.212 9.675   1.00 36.58  ? 337  LYS A CD    1 
ATOM   2929  C  CE    . LYS C 3 337  ? -21.545 112.228 8.803   1.00 39.15  ? 337  LYS A CE    1 
ATOM   2930  N  NZ    . LYS C 3 337  ? -20.718 111.484 7.807   1.00 40.76  ? 337  LYS A NZ    1 
ATOM   2931  N  N     . TYR C 3 338  ? -22.608 115.145 14.175  1.00 30.01  ? 338  TYR A N     1 
ATOM   2932  C  CA    . TYR C 3 338  ? -23.421 114.353 15.100  1.00 28.65  ? 338  TYR A CA    1 
ATOM   2933  C  C     . TYR C 3 338  ? -24.206 115.145 16.141  1.00 28.16  ? 338  TYR A C     1 
ATOM   2934  O  O     . TYR C 3 338  ? -24.618 114.596 17.168  1.00 26.56  ? 338  TYR A O     1 
ATOM   2935  C  CB    . TYR C 3 338  ? -22.538 113.306 15.783  1.00 28.11  ? 338  TYR A CB    1 
ATOM   2936  C  CG    . TYR C 3 338  ? -22.056 112.265 14.803  1.00 29.36  ? 338  TYR A CG    1 
ATOM   2937  C  CD1   . TYR C 3 338  ? -22.937 111.312 14.284  1.00 28.99  ? 338  TYR A CD1   1 
ATOM   2938  C  CD2   . TYR C 3 338  ? -20.739 112.277 14.330  1.00 28.51  ? 338  TYR A CD2   1 
ATOM   2939  C  CE1   . TYR C 3 338  ? -22.521 110.406 13.319  1.00 28.17  ? 338  TYR A CE1   1 
ATOM   2940  C  CE2   . TYR C 3 338  ? -20.317 111.379 13.369  1.00 26.88  ? 338  TYR A CE2   1 
ATOM   2941  C  CZ    . TYR C 3 338  ? -21.212 110.448 12.869  1.00 27.93  ? 338  TYR A CZ    1 
ATOM   2942  O  OH    . TYR C 3 338  ? -20.796 109.550 11.924  1.00 29.60  ? 338  TYR A OH    1 
ATOM   2943  N  N     . GLY C 3 339  ? -24.418 116.429 15.858  1.00 27.31  ? 339  GLY A N     1 
ATOM   2944  C  CA    . GLY C 3 339  ? -25.161 117.289 16.757  1.00 25.90  ? 339  GLY A CA    1 
ATOM   2945  C  C     . GLY C 3 339  ? -24.523 117.483 18.121  1.00 27.63  ? 339  GLY A C     1 
ATOM   2946  O  O     . GLY C 3 339  ? -25.234 117.664 19.106  1.00 28.04  ? 339  GLY A O     1 
ATOM   2947  N  N     . LEU C 3 340  ? -23.194 117.468 18.189  1.00 27.71  ? 340  LEU A N     1 
ATOM   2948  C  CA    . LEU C 3 340  ? -22.505 117.631 19.466  1.00 28.88  ? 340  LEU A CA    1 
ATOM   2949  C  C     . LEU C 3 340  ? -21.484 118.771 19.475  1.00 29.55  ? 340  LEU A C     1 
ATOM   2950  O  O     . LEU C 3 340  ? -20.596 118.810 20.339  1.00 28.79  ? 340  LEU A O     1 
ATOM   2951  C  CB    . LEU C 3 340  ? -21.810 116.315 19.834  1.00 28.68  ? 340  LEU A CB    1 
ATOM   2952  C  CG    . LEU C 3 340  ? -22.757 115.112 19.883  1.00 30.64  ? 340  LEU A CG    1 
ATOM   2953  C  CD1   . LEU C 3 340  ? -21.991 113.807 20.116  1.00 30.44  ? 340  LEU A CD1   1 
ATOM   2954  C  CD2   . LEU C 3 340  ? -23.762 115.345 20.993  1.00 30.61  ? 340  LEU A CD2   1 
ATOM   2955  N  N     . SER C 3 341  ? -21.615 119.698 18.528  1.00 29.43  ? 341  SER A N     1 
ATOM   2956  C  CA    . SER C 3 341  ? -20.678 120.817 18.420  1.00 30.22  ? 341  SER A CA    1 
ATOM   2957  C  C     . SER C 3 341  ? -20.635 121.661 19.685  1.00 28.92  ? 341  SER A C     1 
ATOM   2958  O  O     . SER C 3 341  ? -19.641 122.334 19.970  1.00 28.48  ? 341  SER A O     1 
ATOM   2959  C  CB    . SER C 3 341  ? -21.036 121.699 17.223  1.00 32.02  ? 341  SER A CB    1 
ATOM   2960  O  OG    . SER C 3 341  ? -22.265 122.364 17.443  1.00 37.04  ? 341  SER A OG    1 
ATOM   2961  N  N     . SER C 3 342  ? -21.720 121.623 20.445  1.00 29.06  ? 342  SER A N     1 
ATOM   2962  C  CA    . SER C 3 342  ? -21.788 122.367 21.690  1.00 28.84  ? 342  SER A CA    1 
ATOM   2963  C  C     . SER C 3 342  ? -20.783 121.762 22.678  1.00 29.16  ? 342  SER A C     1 
ATOM   2964  O  O     . SER C 3 342  ? -20.089 122.479 23.408  1.00 28.71  ? 342  SER A O     1 
ATOM   2965  C  CB    . SER C 3 342  ? -23.202 122.280 22.253  1.00 29.77  ? 342  SER A CB    1 
ATOM   2966  O  OG    . SER C 3 342  ? -23.320 122.999 23.466  1.00 34.64  ? 342  SER A OG    1 
ATOM   2967  N  N     . VAL C 3 343  ? -20.707 120.434 22.688  1.00 28.20  ? 343  VAL A N     1 
ATOM   2968  C  CA    . VAL C 3 343  ? -19.794 119.721 23.573  1.00 28.07  ? 343  VAL A CA    1 
ATOM   2969  C  C     . VAL C 3 343  ? -18.331 119.884 23.116  1.00 28.12  ? 343  VAL A C     1 
ATOM   2970  O  O     . VAL C 3 343  ? -17.455 120.277 23.898  1.00 29.92  ? 343  VAL A O     1 
ATOM   2971  C  CB    . VAL C 3 343  ? -20.173 118.222 23.632  1.00 27.23  ? 343  VAL A CB    1 
ATOM   2972  C  CG1   . VAL C 3 343  ? -19.251 117.477 24.573  1.00 24.09  ? 343  VAL A CG1   1 
ATOM   2973  C  CG2   . VAL C 3 343  ? -21.619 118.085 24.069  1.00 23.06  ? 343  VAL A CG2   1 
ATOM   2974  N  N     . VAL C 3 344  ? -18.064 119.587 21.854  1.00 25.02  ? 344  VAL A N     1 
ATOM   2975  C  CA    . VAL C 3 344  ? -16.714 119.733 21.340  1.00 25.33  ? 344  VAL A CA    1 
ATOM   2976  C  C     . VAL C 3 344  ? -16.175 121.141 21.632  1.00 27.45  ? 344  VAL A C     1 
ATOM   2977  O  O     . VAL C 3 344  ? -15.051 121.294 22.123  1.00 27.93  ? 344  VAL A O     1 
ATOM   2978  C  CB    . VAL C 3 344  ? -16.683 119.452 19.817  1.00 25.34  ? 344  VAL A CB    1 
ATOM   2979  C  CG1   . VAL C 3 344  ? -15.313 119.771 19.235  1.00 23.36  ? 344  VAL A CG1   1 
ATOM   2980  C  CG2   . VAL C 3 344  ? -17.038 117.999 19.566  1.00 21.31  ? 344  VAL A CG2   1 
ATOM   2981  N  N     . GLY C 3 345  ? -16.982 122.162 21.350  1.00 28.96  ? 345  GLY A N     1 
ATOM   2982  C  CA    . GLY C 3 345  ? -16.561 123.533 21.587  1.00 29.96  ? 345  GLY A CA    1 
ATOM   2983  C  C     . GLY C 3 345  ? -16.169 123.831 23.025  1.00 32.96  ? 345  GLY A C     1 
ATOM   2984  O  O     . GLY C 3 345  ? -15.160 124.512 23.286  1.00 33.35  ? 345  GLY A O     1 
ATOM   2985  N  N     . GLU C 3 346  ? -16.970 123.326 23.964  1.00 33.81  ? 346  GLU A N     1 
ATOM   2986  C  CA    . GLU C 3 346  ? -16.716 123.521 25.389  1.00 33.81  ? 346  GLU A CA    1 
ATOM   2987  C  C     . GLU C 3 346  ? -15.411 122.831 25.770  1.00 33.92  ? 346  GLU A C     1 
ATOM   2988  O  O     . GLU C 3 346  ? -14.592 123.393 26.500  1.00 33.18  ? 346  GLU A O     1 
ATOM   2989  C  CB    . GLU C 3 346  ? -17.868 122.940 26.210  1.00 34.83  ? 346  GLU A CB    1 
ATOM   2990  C  CG    . GLU C 3 346  ? -17.776 123.166 27.710  1.00 38.47  ? 346  GLU A CG    1 
ATOM   2991  C  CD    . GLU C 3 346  ? -17.580 124.631 28.083  1.00 43.91  ? 346  GLU A CD    1 
ATOM   2992  O  OE1   . GLU C 3 346  ? -18.164 125.513 27.404  1.00 44.17  ? 346  GLU A OE1   1 
ATOM   2993  O  OE2   . GLU C 3 346  ? -16.850 124.899 29.068  1.00 45.87  ? 346  GLU A OE2   1 
ATOM   2994  N  N     . LEU C 3 347  ? -15.219 121.613 25.264  1.00 32.96  ? 347  LEU A N     1 
ATOM   2995  C  CA    . LEU C 3 347  ? -14.012 120.852 25.556  1.00 31.10  ? 347  LEU A CA    1 
ATOM   2996  C  C     . LEU C 3 347  ? -12.793 121.565 24.980  1.00 30.92  ? 347  LEU A C     1 
ATOM   2997  O  O     . LEU C 3 347  ? -11.756 121.652 25.640  1.00 29.94  ? 347  LEU A O     1 
ATOM   2998  C  CB    . LEU C 3 347  ? -14.121 119.428 24.987  1.00 30.89  ? 347  LEU A CB    1 
ATOM   2999  C  CG    . LEU C 3 347  ? -15.185 118.492 25.587  1.00 30.58  ? 347  LEU A CG    1 
ATOM   3000  C  CD1   . LEU C 3 347  ? -15.207 117.190 24.818  1.00 29.27  ? 347  LEU A CD1   1 
ATOM   3001  C  CD2   . LEU C 3 347  ? -14.896 118.222 27.059  1.00 29.77  ? 347  LEU A CD2   1 
ATOM   3002  N  N     . ARG C 3 348  ? -12.923 122.081 23.757  1.00 31.15  ? 348  ARG A N     1 
ATOM   3003  C  CA    . ARG C 3 348  ? -11.819 122.798 23.104  1.00 31.29  ? 348  ARG A CA    1 
ATOM   3004  C  C     . ARG C 3 348  ? -11.411 124.033 23.920  1.00 30.67  ? 348  ARG A C     1 
ATOM   3005  O  O     . ARG C 3 348  ? -10.223 124.300 24.125  1.00 29.37  ? 348  ARG A O     1 
ATOM   3006  C  CB    . ARG C 3 348  ? -12.226 123.237 21.693  1.00 31.62  ? 348  ARG A CB    1 
ATOM   3007  C  CG    . ARG C 3 348  ? -12.198 122.140 20.633  1.00 31.85  ? 348  ARG A CG    1 
ATOM   3008  C  CD    . ARG C 3 348  ? -10.938 122.216 19.791  1.00 31.35  ? 348  ARG A CD    1 
ATOM   3009  N  NE    . ARG C 3 348  ? -10.566 120.894 19.303  1.00 34.74  ? 348  ARG A NE    1 
ATOM   3010  C  CZ    . ARG C 3 348  ? -9.350  120.567 18.880  1.00 35.75  ? 348  ARG A CZ    1 
ATOM   3011  N  NH1   . ARG C 3 348  ? -8.371  121.469 18.875  1.00 36.80  ? 348  ARG A NH1   1 
ATOM   3012  N  NH2   . ARG C 3 348  ? -9.105  119.325 18.494  1.00 36.37  ? 348  ARG A NH2   1 
ATOM   3013  N  N     . LYS C 3 349  ? -12.413 124.775 24.383  1.00 29.97  ? 349  LYS A N     1 
ATOM   3014  C  CA    . LYS C 3 349  ? -12.196 125.980 25.173  1.00 29.02  ? 349  LYS A CA    1 
ATOM   3015  C  C     . LYS C 3 349  ? -11.471 125.662 26.491  1.00 29.65  ? 349  LYS A C     1 
ATOM   3016  O  O     . LYS C 3 349  ? -10.450 126.279 26.825  1.00 29.40  ? 349  LYS A O     1 
ATOM   3017  C  CB    . LYS C 3 349  ? -13.548 126.646 25.449  1.00 27.44  ? 349  LYS A CB    1 
ATOM   3018  C  CG    . LYS C 3 349  ? -13.516 127.944 26.231  1.00 28.50  ? 349  LYS A CG    1 
ATOM   3019  C  CD    . LYS C 3 349  ? -14.585 127.908 27.336  1.00 33.30  ? 349  LYS A CD    1 
ATOM   3020  C  CE    . LYS C 3 349  ? -15.062 129.298 27.780  1.00 34.09  ? 349  LYS A CE    1 
ATOM   3021  N  NZ    . LYS C 3 349  ? -16.027 129.901 26.807  1.00 35.52  ? 349  LYS A NZ    1 
ATOM   3022  N  N     . ARG C 3 350  ? -11.987 124.694 27.240  1.00 29.29  ? 350  ARG A N     1 
ATOM   3023  C  CA    . ARG C 3 350  ? -11.364 124.345 28.506  1.00 30.80  ? 350  ARG A CA    1 
ATOM   3024  C  C     . ARG C 3 350  ? -9.943  123.809 28.311  1.00 30.50  ? 350  ARG A C     1 
ATOM   3025  O  O     . ARG C 3 350  ? -9.032  124.161 29.056  1.00 28.79  ? 350  ARG A O     1 
ATOM   3026  C  CB    . ARG C 3 350  ? -12.229 123.328 29.257  1.00 33.73  ? 350  ARG A CB    1 
ATOM   3027  C  CG    . ARG C 3 350  ? -13.611 123.858 29.608  1.00 36.50  ? 350  ARG A CG    1 
ATOM   3028  C  CD    . ARG C 3 350  ? -14.450 122.832 30.338  1.00 38.36  ? 350  ARG A CD    1 
ATOM   3029  N  NE    . ARG C 3 350  ? -13.821 122.446 31.595  1.00 41.85  ? 350  ARG A NE    1 
ATOM   3030  C  CZ    . ARG C 3 350  ? -14.418 121.730 32.540  1.00 41.07  ? 350  ARG A CZ    1 
ATOM   3031  N  NH1   . ARG C 3 350  ? -15.667 121.319 32.371  1.00 42.10  ? 350  ARG A NH1   1 
ATOM   3032  N  NH2   . ARG C 3 350  ? -13.765 121.432 33.656  1.00 40.78  ? 350  ARG A NH2   1 
ATOM   3033  N  N     . THR C 3 351  ? -9.755  122.975 27.295  1.00 29.22  ? 351  THR A N     1 
ATOM   3034  C  CA    . THR C 3 351  ? -8.454  122.403 27.028  1.00 28.95  ? 351  THR A CA    1 
ATOM   3035  C  C     . THR C 3 351  ? -7.401  123.466 26.799  1.00 29.68  ? 351  THR A C     1 
ATOM   3036  O  O     . THR C 3 351  ? -6.233  123.287 27.146  1.00 30.92  ? 351  THR A O     1 
ATOM   3037  C  CB    . THR C 3 351  ? -8.529  121.475 25.830  1.00 28.91  ? 351  THR A CB    1 
ATOM   3038  O  OG1   . THR C 3 351  ? -9.340  120.349 26.189  1.00 32.89  ? 351  THR A OG1   1 
ATOM   3039  C  CG2   . THR C 3 351  ? -7.141  120.994 25.411  1.00 28.32  ? 351  THR A CG2   1 
ATOM   3040  N  N     . LYS C 3 352  ? -7.815  124.582 26.223  1.00 31.50  ? 352  LYS A N     1 
ATOM   3041  C  CA    . LYS C 3 352  ? -6.887  125.670 25.962  1.00 32.41  ? 352  LYS A CA    1 
ATOM   3042  C  C     . LYS C 3 352  ? -6.448  126.383 27.249  1.00 31.90  ? 352  LYS A C     1 
ATOM   3043  O  O     . LYS C 3 352  ? -5.342  126.917 27.309  1.00 33.08  ? 352  LYS A O     1 
ATOM   3044  C  CB    . LYS C 3 352  ? -7.511  126.666 24.975  1.00 33.00  ? 352  LYS A CB    1 
ATOM   3045  C  CG    . LYS C 3 352  ? -7.565  126.128 23.559  1.00 36.95  ? 352  LYS A CG    1 
ATOM   3046  C  CD    . LYS C 3 352  ? -8.512  126.916 22.655  1.00 39.80  ? 352  LYS A CD    1 
ATOM   3047  C  CE    . LYS C 3 352  ? -8.413  126.431 21.198  1.00 40.86  ? 352  LYS A CE    1 
ATOM   3048  N  NZ    . LYS C 3 352  ? -8.614  124.956 21.030  1.00 40.37  ? 352  LYS A NZ    1 
ATOM   3049  N  N     . THR C 3 353  ? -7.289  126.374 28.281  1.00 30.52  ? 353  THR A N     1 
ATOM   3050  C  CA    . THR C 3 353  ? -6.930  127.044 29.530  1.00 30.54  ? 353  THR A CA    1 
ATOM   3051  C  C     . THR C 3 353  ? -5.780  126.375 30.293  1.00 30.92  ? 353  THR A C     1 
ATOM   3052  O  O     . THR C 3 353  ? -5.212  126.984 31.203  1.00 31.84  ? 353  THR A O     1 
ATOM   3053  C  CB    . THR C 3 353  ? -8.139  127.159 30.495  1.00 31.65  ? 353  THR A CB    1 
ATOM   3054  O  OG1   . THR C 3 353  ? -8.487  125.860 31.002  1.00 33.79  ? 353  THR A OG1   1 
ATOM   3055  C  CG2   . THR C 3 353  ? -9.337  127.754 29.778  1.00 29.16  ? 353  THR A CG2   1 
ATOM   3056  N  N     . TYR C 3 354  ? -5.439  125.137 29.937  1.00 29.67  ? 354  TYR A N     1 
ATOM   3057  C  CA    . TYR C 3 354  ? -4.348  124.428 30.614  1.00 30.37  ? 354  TYR A CA    1 
ATOM   3058  C  C     . TYR C 3 354  ? -3.029  124.679 29.910  1.00 31.89  ? 354  TYR A C     1 
ATOM   3059  O  O     . TYR C 3 354  ? -2.740  124.084 28.870  1.00 34.03  ? 354  TYR A O     1 
ATOM   3060  C  CB    . TYR C 3 354  ? -4.626  122.921 30.668  1.00 28.43  ? 354  TYR A CB    1 
ATOM   3061  C  CG    . TYR C 3 354  ? -5.785  122.563 31.564  1.00 26.19  ? 354  TYR A CG    1 
ATOM   3062  C  CD1   . TYR C 3 354  ? -5.599  122.327 32.929  1.00 22.10  ? 354  TYR A CD1   1 
ATOM   3063  C  CD2   . TYR C 3 354  ? -7.081  122.510 31.056  1.00 26.67  ? 354  TYR A CD2   1 
ATOM   3064  C  CE1   . TYR C 3 354  ? -6.671  122.048 33.756  1.00 20.96  ? 354  TYR A CE1   1 
ATOM   3065  C  CE2   . TYR C 3 354  ? -8.166  122.238 31.878  1.00 25.09  ? 354  TYR A CE2   1 
ATOM   3066  C  CZ    . TYR C 3 354  ? -7.957  122.006 33.222  1.00 24.57  ? 354  TYR A CZ    1 
ATOM   3067  O  OH    . TYR C 3 354  ? -9.047  121.731 34.015  1.00 27.31  ? 354  TYR A OH    1 
ATOM   3068  N  N     . VAL C 3 355  ? -2.224  125.556 30.494  1.00 33.19  ? 355  VAL A N     1 
ATOM   3069  C  CA    . VAL C 3 355  ? -0.946  125.927 29.915  1.00 33.19  ? 355  VAL A CA    1 
ATOM   3070  C  C     . VAL C 3 355  ? 0.221   125.346 30.685  1.00 33.94  ? 355  VAL A C     1 
ATOM   3071  O  O     . VAL C 3 355  ? 1.381   125.524 30.306  1.00 35.80  ? 355  VAL A O     1 
ATOM   3072  C  CB    . VAL C 3 355  ? -0.816  127.449 29.860  1.00 33.82  ? 355  VAL A CB    1 
ATOM   3073  C  CG1   . VAL C 3 355  ? -1.962  128.024 29.022  1.00 33.29  ? 355  VAL A CG1   1 
ATOM   3074  C  CG2   . VAL C 3 355  ? -0.838  128.021 31.275  1.00 32.64  ? 355  VAL A CG2   1 
ATOM   3075  N  N     . LYS C 3 356  ? -0.083  124.671 31.783  1.00 33.47  ? 356  LYS A N     1 
ATOM   3076  C  CA    . LYS C 3 356  ? 0.952   124.021 32.566  1.00 33.92  ? 356  LYS A CA    1 
ATOM   3077  C  C     . LYS C 3 356  ? 0.605   122.545 32.599  1.00 32.50  ? 356  LYS A C     1 
ATOM   3078  O  O     . LYS C 3 356  ? -0.570  122.183 32.698  1.00 32.22  ? 356  LYS A O     1 
ATOM   3079  C  CB    . LYS C 3 356  ? 1.006   124.566 33.997  1.00 36.32  ? 356  LYS A CB    1 
ATOM   3080  C  CG    . LYS C 3 356  ? 1.884   125.801 34.174  1.00 41.51  ? 356  LYS A CG    1 
ATOM   3081  C  CD    . LYS C 3 356  ? 1.656   126.484 35.530  1.00 45.29  ? 356  LYS A CD    1 
ATOM   3082  C  CE    . LYS C 3 356  ? 2.248   125.701 36.702  1.00 47.05  ? 356  LYS A CE    1 
ATOM   3083  N  NZ    . LYS C 3 356  ? 3.748   125.715 36.719  1.00 49.81  ? 356  LYS A NZ    1 
ATOM   3084  N  N     . HIS C 3 357  ? 1.624   121.702 32.470  1.00 30.77  ? 357  HIS A N     1 
ATOM   3085  C  CA    . HIS C 3 357  ? 1.431   120.269 32.542  1.00 29.94  ? 357  HIS A CA    1 
ATOM   3086  C  C     . HIS C 3 357  ? 1.631   119.919 34.003  1.00 29.35  ? 357  HIS A C     1 
ATOM   3087  O  O     . HIS C 3 357  ? 2.731   120.069 34.533  1.00 28.47  ? 357  HIS A O     1 
ATOM   3088  C  CB    . HIS C 3 357  ? 2.472   119.517 31.719  1.00 30.33  ? 357  HIS A CB    1 
ATOM   3089  C  CG    . HIS C 3 357  ? 2.510   118.047 32.010  1.00 30.58  ? 357  HIS A CG    1 
ATOM   3090  N  ND1   . HIS C 3 357  ? 1.677   117.141 31.389  1.00 30.76  ? 357  HIS A ND1   1 
ATOM   3091  C  CD2   . HIS C 3 357  ? 3.244   117.335 32.898  1.00 28.36  ? 357  HIS A CD2   1 
ATOM   3092  C  CE1   . HIS C 3 357  ? 1.895   115.936 31.884  1.00 30.16  ? 357  HIS A CE1   1 
ATOM   3093  N  NE2   . HIS C 3 357  ? 2.841   116.026 32.801  1.00 28.65  ? 357  HIS A NE2   1 
ATOM   3094  N  N     . ASP C 3 358  ? 0.568   119.462 34.652  1.00 28.87  ? 358  ASP A N     1 
ATOM   3095  C  CA    . ASP C 3 358  ? 0.646   119.099 36.056  1.00 28.43  ? 358  ASP A CA    1 
ATOM   3096  C  C     . ASP C 3 358  ? -0.487  118.172 36.481  1.00 28.46  ? 358  ASP A C     1 
ATOM   3097  O  O     . ASP C 3 358  ? -1.271  117.711 35.649  1.00 29.14  ? 358  ASP A O     1 
ATOM   3098  C  CB    . ASP C 3 358  ? 0.655   120.358 36.939  1.00 27.74  ? 358  ASP A CB    1 
ATOM   3099  C  CG    . ASP C 3 358  ? -0.485  121.322 36.626  1.00 27.53  ? 358  ASP A CG    1 
ATOM   3100  O  OD1   . ASP C 3 358  ? -1.611  120.881 36.313  1.00 27.88  ? 358  ASP A OD1   1 
ATOM   3101  O  OD2   . ASP C 3 358  ? -0.255  122.540 36.718  1.00 27.78  ? 358  ASP A OD2   1 
ATOM   3102  N  N     . PHE C 3 359  ? -0.566  117.901 37.780  1.00 27.18  ? 359  PHE A N     1 
ATOM   3103  C  CA    . PHE C 3 359  ? -1.597  117.021 38.316  1.00 26.58  ? 359  PHE A CA    1 
ATOM   3104  C  C     . PHE C 3 359  ? -2.973  117.477 37.849  1.00 25.67  ? 359  PHE A C     1 
ATOM   3105  O  O     . PHE C 3 359  ? -3.761  116.694 37.314  1.00 26.99  ? 359  PHE A O     1 
ATOM   3106  C  CB    . PHE C 3 359  ? -1.545  117.013 39.846  1.00 24.84  ? 359  PHE A CB    1 
ATOM   3107  C  CG    . PHE C 3 359  ? -0.238  116.520 40.410  1.00 25.89  ? 359  PHE A CG    1 
ATOM   3108  C  CD1   . PHE C 3 359  ? 0.264   115.261 40.058  1.00 25.05  ? 359  PHE A CD1   1 
ATOM   3109  C  CD2   . PHE C 3 359  ? 0.482   117.300 41.316  1.00 25.77  ? 359  PHE A CD2   1 
ATOM   3110  C  CE1   . PHE C 3 359  ? 1.460   114.786 40.597  1.00 22.45  ? 359  PHE A CE1   1 
ATOM   3111  C  CE2   . PHE C 3 359  ? 1.681   116.833 41.864  1.00 23.90  ? 359  PHE A CE2   1 
ATOM   3112  C  CZ    . PHE C 3 359  ? 2.169   115.571 41.500  1.00 25.05  ? 359  PHE A CZ    1 
ATOM   3113  N  N     . ALA C 3 360  ? -3.248  118.755 38.043  1.00 23.60  ? 360  ALA A N     1 
ATOM   3114  C  CA    . ALA C 3 360  ? -4.525  119.314 37.645  1.00 22.55  ? 360  ALA A CA    1 
ATOM   3115  C  C     . ALA C 3 360  ? -4.874  119.048 36.175  1.00 22.20  ? 360  ALA A C     1 
ATOM   3116  O  O     . ALA C 3 360  ? -5.983  118.607 35.877  1.00 24.59  ? 360  ALA A O     1 
ATOM   3117  C  CB    . ALA C 3 360  ? -4.540  120.813 37.933  1.00 19.51  ? 360  ALA A CB    1 
ATOM   3118  N  N     . SER C 3 361  ? -3.941  119.292 35.259  1.00 22.54  ? 361  SER A N     1 
ATOM   3119  C  CA    . SER C 3 361  ? -4.229  119.085 33.842  1.00 24.36  ? 361  SER A CA    1 
ATOM   3120  C  C     . SER C 3 361  ? -4.426  117.624 33.407  1.00 24.48  ? 361  SER A C     1 
ATOM   3121  O  O     . SER C 3 361  ? -5.273  117.344 32.559  1.00 24.39  ? 361  SER A O     1 
ATOM   3122  C  CB    . SER C 3 361  ? -3.160  119.754 32.971  1.00 23.94  ? 361  SER A CB    1 
ATOM   3123  O  OG    . SER C 3 361  ? -1.910  119.107 33.078  1.00 29.27  ? 361  SER A OG    1 
ATOM   3124  N  N     . VAL C 3 362  ? -3.668  116.687 33.972  1.00 24.18  ? 362  VAL A N     1 
ATOM   3125  C  CA    . VAL C 3 362  ? -3.858  115.291 33.579  1.00 24.50  ? 362  VAL A CA    1 
ATOM   3126  C  C     . VAL C 3 362  ? -5.153  114.740 34.191  1.00 24.12  ? 362  VAL A C     1 
ATOM   3127  O  O     . VAL C 3 362  ? -5.833  113.912 33.581  1.00 22.97  ? 362  VAL A O     1 
ATOM   3128  C  CB    . VAL C 3 362  ? -2.640  114.407 33.974  1.00 23.98  ? 362  VAL A CB    1 
ATOM   3129  C  CG1   . VAL C 3 362  ? -1.444  114.788 33.125  1.00 24.26  ? 362  VAL A CG1   1 
ATOM   3130  C  CG2   . VAL C 3 362  ? -2.302  114.579 35.431  1.00 21.53  ? 362  VAL A CG2   1 
ATOM   3131  N  N     . ARG C 3 363  ? -5.503  115.220 35.383  1.00 23.74  ? 363  ARG A N     1 
ATOM   3132  C  CA    . ARG C 3 363  ? -6.737  114.790 36.045  1.00 24.97  ? 363  ARG A CA    1 
ATOM   3133  C  C     . ARG C 3 363  ? -7.936  115.246 35.204  1.00 25.95  ? 363  ARG A C     1 
ATOM   3134  O  O     . ARG C 3 363  ? -8.974  114.583 35.161  1.00 25.21  ? 363  ARG A O     1 
ATOM   3135  C  CB    . ARG C 3 363  ? -6.833  115.383 37.462  1.00 24.14  ? 363  ARG A CB    1 
ATOM   3136  C  CG    . ARG C 3 363  ? -8.130  115.022 38.200  1.00 22.61  ? 363  ARG A CG    1 
ATOM   3137  C  CD    . ARG C 3 363  ? -8.145  115.559 39.631  1.00 20.91  ? 363  ARG A CD    1 
ATOM   3138  N  NE    . ARG C 3 363  ? -7.424  114.705 40.584  1.00 19.48  ? 363  ARG A NE    1 
ATOM   3139  C  CZ    . ARG C 3 363  ? -8.009  113.843 41.417  1.00 17.04  ? 363  ARG A CZ    1 
ATOM   3140  N  NH1   . ARG C 3 363  ? -9.330  113.709 41.422  1.00 10.86  ? 363  ARG A NH1   1 
ATOM   3141  N  NH2   . ARG C 3 363  ? -7.271  113.123 42.258  1.00 14.45  ? 363  ARG A NH2   1 
ATOM   3142  N  N     . TYR C 3 364  ? -7.771  116.387 34.539  1.00 27.06  ? 364  TYR A N     1 
ATOM   3143  C  CA    . TYR C 3 364  ? -8.801  116.950 33.675  1.00 27.17  ? 364  TYR A CA    1 
ATOM   3144  C  C     . TYR C 3 364  ? -9.027  116.015 32.484  1.00 27.39  ? 364  TYR A C     1 
ATOM   3145  O  O     . TYR C 3 364  ? -10.169 115.726 32.117  1.00 27.01  ? 364  TYR A O     1 
ATOM   3146  C  CB    . TYR C 3 364  ? -8.362  118.338 33.182  1.00 27.93  ? 364  TYR A CB    1 
ATOM   3147  C  CG    . TYR C 3 364  ? -9.132  118.850 31.973  1.00 29.68  ? 364  TYR A CG    1 
ATOM   3148  C  CD1   . TYR C 3 364  ? -10.473 119.215 32.075  1.00 28.85  ? 364  TYR A CD1   1 
ATOM   3149  C  CD2   . TYR C 3 364  ? -8.513  118.956 30.719  1.00 27.66  ? 364  TYR A CD2   1 
ATOM   3150  C  CE1   . TYR C 3 364  ? -11.175 119.671 30.958  1.00 30.11  ? 364  TYR A CE1   1 
ATOM   3151  C  CE2   . TYR C 3 364  ? -9.205  119.409 29.607  1.00 26.88  ? 364  TYR A CE2   1 
ATOM   3152  C  CZ    . TYR C 3 364  ? -10.532 119.764 29.730  1.00 28.94  ? 364  TYR A CZ    1 
ATOM   3153  O  OH    . TYR C 3 364  ? -11.224 120.208 28.626  1.00 28.95  ? 364  TYR A OH    1 
ATOM   3154  N  N     . ILE C 3 365  ? -7.931  115.554 31.883  1.00 26.34  ? 365  ILE A N     1 
ATOM   3155  C  CA    . ILE C 3 365  ? -7.994  114.637 30.743  1.00 25.95  ? 365  ILE A CA    1 
ATOM   3156  C  C     . ILE C 3 365  ? -8.668  113.355 31.207  1.00 25.96  ? 365  ILE A C     1 
ATOM   3157  O  O     . ILE C 3 365  ? -9.652  112.892 30.614  1.00 24.65  ? 365  ILE A O     1 
ATOM   3158  C  CB    . ILE C 3 365  ? -6.571  114.269 30.226  1.00 27.63  ? 365  ILE A CB    1 
ATOM   3159  C  CG1   . ILE C 3 365  ? -5.896  115.497 29.609  1.00 27.62  ? 365  ILE A CG1   1 
ATOM   3160  C  CG2   . ILE C 3 365  ? -6.654  113.119 29.224  1.00 27.77  ? 365  ILE A CG2   1 
ATOM   3161  C  CD1   . ILE C 3 365  ? -4.441  115.280 29.263  1.00 29.87  ? 365  ILE A CD1   1 
ATOM   3162  N  N     . ARG C 3 366  ? -8.123  112.792 32.283  1.00 24.39  ? 366  ARG A N     1 
ATOM   3163  C  CA    . ARG C 3 366  ? -8.643  111.565 32.847  1.00 22.44  ? 366  ARG A CA    1 
ATOM   3164  C  C     . ARG C 3 366  ? -10.136 111.708 33.073  1.00 22.25  ? 366  ARG A C     1 
ATOM   3165  O  O     . ARG C 3 366  ? -10.929 110.864 32.637  1.00 21.91  ? 366  ARG A O     1 
ATOM   3166  C  CB    . ARG C 3 366  ? -7.916  111.256 34.161  1.00 23.54  ? 366  ARG A CB    1 
ATOM   3167  C  CG    . ARG C 3 366  ? -8.433  110.060 34.934  1.00 22.49  ? 366  ARG A CG    1 
ATOM   3168  C  CD    . ARG C 3 366  ? -9.594  110.484 35.818  1.00 27.80  ? 366  ARG A CD    1 
ATOM   3169  N  NE    . ARG C 3 366  ? -9.601  109.746 37.070  1.00 29.00  ? 366  ARG A NE    1 
ATOM   3170  C  CZ    . ARG C 3 366  ? -9.845  110.287 38.253  1.00 27.36  ? 366  ARG A CZ    1 
ATOM   3171  N  NH1   . ARG C 3 366  ? -10.107 111.585 38.357  1.00 23.71  ? 366  ARG A NH1   1 
ATOM   3172  N  NH2   . ARG C 3 366  ? -9.814  109.521 39.333  1.00 31.81  ? 366  ARG A NH2   1 
ATOM   3173  N  N     . ASP C 3 367  ? -10.519 112.788 33.744  1.00 22.56  ? 367  ASP A N     1 
ATOM   3174  C  CA    . ASP C 3 367  ? -11.930 113.034 34.034  1.00 23.43  ? 367  ASP A CA    1 
ATOM   3175  C  C     . ASP C 3 367  ? -12.760 113.066 32.775  1.00 23.28  ? 367  ASP A C     1 
ATOM   3176  O  O     . ASP C 3 367  ? -13.819 112.441 32.713  1.00 25.04  ? 367  ASP A O     1 
ATOM   3177  C  CB    . ASP C 3 367  ? -12.103 114.345 34.803  1.00 22.87  ? 367  ASP A CB    1 
ATOM   3178  C  CG    . ASP C 3 367  ? -11.837 114.177 36.283  1.00 23.70  ? 367  ASP A CG    1 
ATOM   3179  O  OD1   . ASP C 3 367  ? -10.991 113.324 36.626  1.00 24.77  ? 367  ASP A OD1   1 
ATOM   3180  O  OD2   . ASP C 3 367  ? -12.463 114.889 37.097  1.00 24.22  ? 367  ASP A OD2   1 
ATOM   3181  N  N     . ALA C 3 368  ? -12.267 113.782 31.770  1.00 23.58  ? 368  ALA A N     1 
ATOM   3182  C  CA    . ALA C 3 368  ? -12.965 113.908 30.496  1.00 23.37  ? 368  ALA A CA    1 
ATOM   3183  C  C     . ALA C 3 368  ? -13.134 112.538 29.850  1.00 22.92  ? 368  ALA A C     1 
ATOM   3184  O  O     . ALA C 3 368  ? -14.205 112.198 29.353  1.00 22.78  ? 368  ALA A O     1 
ATOM   3185  C  CB    . ALA C 3 368  ? -12.182 114.842 29.563  1.00 22.74  ? 368  ALA A CB    1 
ATOM   3186  N  N     . MET C 3 369  ? -12.076 111.738 29.886  1.00 22.49  ? 369  MET A N     1 
ATOM   3187  C  CA    . MET C 3 369  ? -12.130 110.423 29.272  1.00 22.57  ? 369  MET A CA    1 
ATOM   3188  C  C     . MET C 3 369  ? -12.916 109.369 30.030  1.00 22.81  ? 369  MET A C     1 
ATOM   3189  O  O     . MET C 3 369  ? -13.084 108.253 29.537  1.00 22.22  ? 369  MET A O     1 
ATOM   3190  C  CB    . MET C 3 369  ? -10.718 109.924 28.984  1.00 20.44  ? 369  MET A CB    1 
ATOM   3191  C  CG    . MET C 3 369  ? -10.110 110.606 27.788  1.00 19.48  ? 369  MET A CG    1 
ATOM   3192  S  SD    . MET C 3 369  ? -8.407  110.202 27.605  1.00 24.49  ? 369  MET A SD    1 
ATOM   3193  C  CE    . MET C 3 369  ? -8.570  108.470 26.985  1.00 25.00  ? 369  MET A CE    1 
ATOM   3194  N  N     . ALA C 3 370  ? -13.404 109.708 31.219  1.00 21.42  ? 370  ALA A N     1 
ATOM   3195  C  CA    . ALA C 3 370  ? -14.187 108.739 31.986  1.00 20.10  ? 370  ALA A CA    1 
ATOM   3196  C  C     . ALA C 3 370  ? -15.650 108.870 31.573  1.00 19.84  ? 370  ALA A C     1 
ATOM   3197  O  O     . ALA C 3 370  ? -16.477 108.008 31.867  1.00 18.63  ? 370  ALA A O     1 
ATOM   3198  C  CB    . ALA C 3 370  ? -14.039 109.008 33.485  1.00 14.99  ? 370  ALA A CB    1 
ATOM   3199  N  N     . CYS C 3 371  ? -15.941 109.952 30.859  1.00 19.97  ? 371  CYS A N     1 
ATOM   3200  C  CA    . CYS C 3 371  ? -17.296 110.263 30.440  1.00 21.63  ? 371  CYS A CA    1 
ATOM   3201  C  C     . CYS C 3 371  ? -17.785 109.604 29.153  1.00 21.66  ? 371  CYS A C     1 
ATOM   3202  O  O     . CYS C 3 371  ? -18.940 109.782 28.780  1.00 22.23  ? 371  CYS A O     1 
ATOM   3203  C  CB    . CYS C 3 371  ? -17.450 111.788 30.345  1.00 23.03  ? 371  CYS A CB    1 
ATOM   3204  S  SG    . CYS C 3 371  ? -17.117 112.668 31.924  1.00 28.80  ? 371  CYS A SG    1 
ATOM   3205  N  N     . THR C 3 372  ? -16.918 108.842 28.489  1.00 21.87  ? 372  THR A N     1 
ATOM   3206  C  CA    . THR C 3 372  ? -17.262 108.149 27.243  1.00 20.51  ? 372  THR A CA    1 
ATOM   3207  C  C     . THR C 3 372  ? -18.126 106.936 27.584  1.00 20.61  ? 372  THR A C     1 
ATOM   3208  O  O     . THR C 3 372  ? -17.851 106.225 28.551  1.00 20.65  ? 372  THR A O     1 
ATOM   3209  C  CB    . THR C 3 372  ? -15.984 107.641 26.511  1.00 21.02  ? 372  THR A CB    1 
ATOM   3210  O  OG1   . THR C 3 372  ? -15.009 108.685 26.465  1.00 23.63  ? 372  THR A OG1   1 
ATOM   3211  C  CG2   . THR C 3 372  ? -16.297 107.198 25.097  1.00 20.24  ? 372  THR A CG2   1 
ATOM   3212  N  N     . SER C 3 373  ? -19.166 106.690 26.797  1.00 21.51  ? 373  SER A N     1 
ATOM   3213  C  CA    . SER C 3 373  ? -20.021 105.533 27.060  1.00 22.54  ? 373  SER A CA    1 
ATOM   3214  C  C     . SER C 3 373  ? -19.171 104.303 27.358  1.00 22.53  ? 373  SER A C     1 
ATOM   3215  O  O     . SER C 3 373  ? -18.082 104.147 26.804  1.00 23.54  ? 373  SER A O     1 
ATOM   3216  C  CB    . SER C 3 373  ? -20.912 105.227 25.865  1.00 21.95  ? 373  SER A CB    1 
ATOM   3217  O  OG    . SER C 3 373  ? -21.585 103.998 26.075  1.00 22.13  ? 373  SER A OG    1 
ATOM   3218  N  N     . GLY C 3 374  ? -19.677 103.437 28.232  1.00 21.83  ? 374  GLY A N     1 
ATOM   3219  C  CA    . GLY C 3 374  ? -18.955 102.240 28.606  1.00 19.50  ? 374  GLY A CA    1 
ATOM   3220  C  C     . GLY C 3 374  ? -19.671 100.980 28.176  1.00 20.60  ? 374  GLY A C     1 
ATOM   3221  O  O     . GLY C 3 374  ? -19.349 99.883  28.632  1.00 21.14  ? 374  GLY A O     1 
ATOM   3222  N  N     . ILE C 3 375  ? -20.643 101.118 27.284  1.00 19.22  ? 375  ILE A N     1 
ATOM   3223  C  CA    . ILE C 3 375  ? -21.376 99.953  26.836  1.00 18.28  ? 375  ILE A CA    1 
ATOM   3224  C  C     . ILE C 3 375  ? -20.595 99.064  25.879  1.00 21.41  ? 375  ILE A C     1 
ATOM   3225  O  O     . ILE C 3 375  ? -19.739 99.530  25.105  1.00 22.22  ? 375  ILE A O     1 
ATOM   3226  C  CB    . ILE C 3 375  ? -22.684 100.338 26.128  1.00 17.97  ? 375  ILE A CB    1 
ATOM   3227  C  CG1   . ILE C 3 375  ? -22.376 101.194 24.898  1.00 19.02  ? 375  ILE A CG1   1 
ATOM   3228  C  CG2   . ILE C 3 375  ? -23.604 101.081 27.096  1.00 20.31  ? 375  ILE A CG2   1 
ATOM   3229  C  CD1   . ILE C 3 375  ? -23.552 101.346 23.938  1.00 19.44  ? 375  ILE A CD1   1 
ATOM   3230  N  N     . PHE C 3 376  ? -20.905 97.775  25.952  1.00 21.69  ? 376  PHE A N     1 
ATOM   3231  C  CA    . PHE C 3 376  ? -20.326 96.764  25.080  1.00 23.15  ? 376  PHE A CA    1 
ATOM   3232  C  C     . PHE C 3 376  ? -21.272 96.754  23.889  1.00 25.03  ? 376  PHE A C     1 
ATOM   3233  O  O     . PHE C 3 376  ? -22.393 96.259  24.003  1.00 25.93  ? 376  PHE A O     1 
ATOM   3234  C  CB    . PHE C 3 376  ? -20.380 95.389  25.748  1.00 22.43  ? 376  PHE A CB    1 
ATOM   3235  C  CG    . PHE C 3 376  ? -19.338 95.174  26.798  1.00 20.89  ? 376  PHE A CG    1 
ATOM   3236  C  CD1   . PHE C 3 376  ? -18.075 94.669  26.451  1.00 20.11  ? 376  PHE A CD1   1 
ATOM   3237  C  CD2   . PHE C 3 376  ? -19.626 95.422  28.141  1.00 20.25  ? 376  PHE A CD2   1 
ATOM   3238  C  CE1   . PHE C 3 376  ? -17.119 94.408  27.428  1.00 18.29  ? 376  PHE A CE1   1 
ATOM   3239  C  CE2   . PHE C 3 376  ? -18.673 95.164  29.135  1.00 19.99  ? 376  PHE A CE2   1 
ATOM   3240  C  CZ    . PHE C 3 376  ? -17.417 94.654  28.778  1.00 18.45  ? 376  PHE A CZ    1 
ATOM   3241  N  N     . LEU C 3 377  ? -20.840 97.305  22.761  1.00 25.75  ? 377  LEU A N     1 
ATOM   3242  C  CA    . LEU C 3 377  ? -21.688 97.353  21.578  1.00 25.18  ? 377  LEU A CA    1 
ATOM   3243  C  C     . LEU C 3 377  ? -22.192 95.984  21.176  1.00 26.62  ? 377  LEU A C     1 
ATOM   3244  O  O     . LEU C 3 377  ? -21.489 94.981  21.309  1.00 27.64  ? 377  LEU A O     1 
ATOM   3245  C  CB    . LEU C 3 377  ? -20.950 97.995  20.402  1.00 24.34  ? 377  LEU A CB    1 
ATOM   3246  C  CG    . LEU C 3 377  ? -20.688 99.492  20.584  1.00 27.38  ? 377  LEU A CG    1 
ATOM   3247  C  CD1   . LEU C 3 377  ? -19.596 99.692  21.609  1.00 26.88  ? 377  LEU A CD1   1 
ATOM   3248  C  CD2   . LEU C 3 377  ? -20.297 100.118 19.259  1.00 29.02  ? 377  LEU A CD2   1 
ATOM   3249  N  N     . VAL C 3 378  ? -23.421 95.949  20.681  1.00 26.55  ? 378  VAL A N     1 
ATOM   3250  C  CA    . VAL C 3 378  ? -24.025 94.705  20.258  1.00 25.21  ? 378  VAL A CA    1 
ATOM   3251  C  C     . VAL C 3 378  ? -24.759 94.857  18.935  1.00 24.70  ? 378  VAL A C     1 
ATOM   3252  O  O     . VAL C 3 378  ? -25.338 95.898  18.648  1.00 26.30  ? 378  VAL A O     1 
ATOM   3253  C  CB    . VAL C 3 378  ? -25.019 94.195  21.337  1.00 27.29  ? 378  VAL A CB    1 
ATOM   3254  C  CG1   . VAL C 3 378  ? -26.034 93.242  20.731  1.00 24.30  ? 378  VAL A CG1   1 
ATOM   3255  C  CG2   . VAL C 3 378  ? -24.255 93.487  22.453  1.00 26.40  ? 378  VAL A CG2   1 
ATOM   3256  N  N     . ARG C 3 379  ? -24.699 93.808  18.127  1.00 24.49  ? 379  ARG A N     1 
ATOM   3257  C  CA    . ARG C 3 379  ? -25.390 93.742  16.847  1.00 23.48  ? 379  ARG A CA    1 
ATOM   3258  C  C     . ARG C 3 379  ? -25.548 92.250  16.621  1.00 23.52  ? 379  ARG A C     1 
ATOM   3259  O  O     . ARG C 3 379  ? -24.967 91.456  17.354  1.00 23.57  ? 379  ARG A O     1 
ATOM   3260  C  CB    . ARG C 3 379  ? -24.575 94.391  15.718  1.00 25.28  ? 379  ARG A CB    1 
ATOM   3261  C  CG    . ARG C 3 379  ? -23.265 93.708  15.367  1.00 24.65  ? 379  ARG A CG    1 
ATOM   3262  C  CD    . ARG C 3 379  ? -22.533 94.480  14.272  1.00 25.06  ? 379  ARG A CD    1 
ATOM   3263  N  NE    . ARG C 3 379  ? -21.161 94.001  14.100  1.00 26.83  ? 379  ARG A NE    1 
ATOM   3264  C  CZ    . ARG C 3 379  ? -20.272 94.558  13.287  1.00 27.36  ? 379  ARG A CZ    1 
ATOM   3265  N  NH1   . ARG C 3 379  ? -20.616 95.615  12.568  1.00 29.59  ? 379  ARG A NH1   1 
ATOM   3266  N  NH2   . ARG C 3 379  ? -19.041 94.068  13.203  1.00 28.69  ? 379  ARG A NH2   1 
ATOM   3267  N  N     . THR C 3 380  ? -26.336 91.844  15.639  1.00 23.82  ? 380  THR A N     1 
ATOM   3268  C  CA    . THR C 3 380  ? -26.503 90.412  15.425  1.00 25.07  ? 380  THR A CA    1 
ATOM   3269  C  C     . THR C 3 380  ? -25.259 89.770  14.799  1.00 27.61  ? 380  THR A C     1 
ATOM   3270  O  O     . THR C 3 380  ? -24.495 90.429  14.071  1.00 26.31  ? 380  THR A O     1 
ATOM   3271  C  CB    . THR C 3 380  ? -27.695 90.118  14.520  1.00 22.28  ? 380  THR A CB    1 
ATOM   3272  O  OG1   . THR C 3 380  ? -27.438 90.664  13.227  1.00 23.84  ? 380  THR A OG1   1 
ATOM   3273  C  CG2   . THR C 3 380  ? -28.964 90.741  15.086  1.00 19.65  ? 380  THR A CG2   1 
ATOM   3274  N  N     . PRO C 3 381  ? -25.033 88.475  15.096  1.00 28.70  ? 381  PRO A N     1 
ATOM   3275  C  CA    . PRO C 3 381  ? -23.906 87.676  14.595  1.00 27.57  ? 381  PRO A CA    1 
ATOM   3276  C  C     . PRO C 3 381  ? -23.802 87.790  13.079  1.00 27.37  ? 381  PRO A C     1 
ATOM   3277  O  O     . PRO C 3 381  ? -22.718 87.990  12.526  1.00 27.98  ? 381  PRO A O     1 
ATOM   3278  C  CB    . PRO C 3 381  ? -24.271 86.268  15.038  1.00 26.72  ? 381  PRO A CB    1 
ATOM   3279  C  CG    . PRO C 3 381  ? -24.938 86.519  16.361  1.00 27.76  ? 381  PRO A CG    1 
ATOM   3280  C  CD    . PRO C 3 381  ? -25.819 87.711  16.084  1.00 27.77  ? 381  PRO A CD    1 
ATOM   3281  N  N     . THR C 3 382  ? -24.946 87.649  12.418  1.00 26.28  ? 382  THR A N     1 
ATOM   3282  C  CA    . THR C 3 382  ? -25.028 87.747  10.968  1.00 25.69  ? 382  THR A CA    1 
ATOM   3283  C  C     . THR C 3 382  ? -24.375 89.037  10.483  1.00 26.93  ? 382  THR A C     1 
ATOM   3284  O  O     . THR C 3 382  ? -23.619 89.034  9.514   1.00 28.75  ? 382  THR A O     1 
ATOM   3285  C  CB    . THR C 3 382  ? -26.495 87.721  10.515  1.00 22.87  ? 382  THR A CB    1 
ATOM   3286  O  OG1   . THR C 3 382  ? -27.042 86.433  10.798  1.00 24.30  ? 382  THR A OG1   1 
ATOM   3287  C  CG2   . THR C 3 382  ? -26.619 88.001  9.038   1.00 20.08  ? 382  THR A CG2   1 
ATOM   3288  N  N     . GLU C 3 383  ? -24.665 90.140  11.164  1.00 27.53  ? 383  GLU A N     1 
ATOM   3289  C  CA    . GLU C 3 383  ? -24.091 91.429  10.797  1.00 28.83  ? 383  GLU A CA    1 
ATOM   3290  C  C     . GLU C 3 383  ? -22.573 91.500  11.013  1.00 28.32  ? 383  GLU A C     1 
ATOM   3291  O  O     . GLU C 3 383  ? -21.846 92.014  10.166  1.00 29.71  ? 383  GLU A O     1 
ATOM   3292  C  CB    . GLU C 3 383  ? -24.784 92.550  11.571  1.00 26.83  ? 383  GLU A CB    1 
ATOM   3293  C  CG    . GLU C 3 383  ? -26.248 92.760  11.203  1.00 29.13  ? 383  GLU A CG    1 
ATOM   3294  C  CD    . GLU C 3 383  ? -26.458 93.171  9.749   1.00 31.37  ? 383  GLU A CD    1 
ATOM   3295  O  OE1   . GLU C 3 383  ? -25.564 93.820  9.165   1.00 33.57  ? 383  GLU A OE1   1 
ATOM   3296  O  OE2   . GLU C 3 383  ? -27.530 92.861  9.190   1.00 32.47  ? 383  GLU A OE2   1 
ATOM   3297  N  N     . THR C 3 384  ? -22.094 90.982  12.137  1.00 27.63  ? 384  THR A N     1 
ATOM   3298  C  CA    . THR C 3 384  ? -20.667 91.003  12.408  1.00 27.97  ? 384  THR A CA    1 
ATOM   3299  C  C     . THR C 3 384  ? -19.915 90.246  11.315  1.00 29.94  ? 384  THR A C     1 
ATOM   3300  O  O     . THR C 3 384  ? -18.952 90.758  10.730  1.00 29.32  ? 384  THR A O     1 
ATOM   3301  C  CB    . THR C 3 384  ? -20.338 90.346  13.749  1.00 27.12  ? 384  THR A CB    1 
ATOM   3302  O  OG1   . THR C 3 384  ? -20.962 91.075  14.813  1.00 27.56  ? 384  THR A OG1   1 
ATOM   3303  C  CG2   . THR C 3 384  ? -18.831 90.327  13.964  1.00 28.01  ? 384  THR A CG2   1 
ATOM   3304  N  N     . VAL C 3 385  ? -20.370 89.028  11.038  1.00 30.38  ? 385  VAL A N     1 
ATOM   3305  C  CA    . VAL C 3 385  ? -19.747 88.188  10.026  1.00 30.85  ? 385  VAL A CA    1 
ATOM   3306  C  C     . VAL C 3 385  ? -19.775 88.824  8.639   1.00 32.33  ? 385  VAL A C     1 
ATOM   3307  O  O     . VAL C 3 385  ? -18.781 88.783  7.917   1.00 32.80  ? 385  VAL A O     1 
ATOM   3308  C  CB    . VAL C 3 385  ? -20.419 86.811  9.978   1.00 29.58  ? 385  VAL A CB    1 
ATOM   3309  C  CG1   . VAL C 3 385  ? -19.796 85.960  8.891   1.00 29.02  ? 385  VAL A CG1   1 
ATOM   3310  C  CG2   . VAL C 3 385  ? -20.265 86.129  11.326  1.00 30.38  ? 385  VAL A CG2   1 
ATOM   3311  N  N     . LEU C 3 386  ? -20.897 89.424  8.262   1.00 32.66  ? 386  LEU A N     1 
ATOM   3312  C  CA    . LEU C 3 386  ? -20.973 90.057  6.953   1.00 34.00  ? 386  LEU A CA    1 
ATOM   3313  C  C     . LEU C 3 386  ? -20.227 91.392  6.864   1.00 35.37  ? 386  LEU A C     1 
ATOM   3314  O  O     . LEU C 3 386  ? -20.009 91.900  5.768   1.00 36.08  ? 386  LEU A O     1 
ATOM   3315  C  CB    . LEU C 3 386  ? -22.433 90.251  6.531   1.00 32.15  ? 386  LEU A CB    1 
ATOM   3316  C  CG    . LEU C 3 386  ? -23.194 88.948  6.274   1.00 31.23  ? 386  LEU A CG    1 
ATOM   3317  C  CD1   . LEU C 3 386  ? -24.502 89.269  5.574   1.00 29.73  ? 386  LEU A CD1   1 
ATOM   3318  C  CD2   . LEU C 3 386  ? -22.355 88.004  5.420   1.00 27.87  ? 386  LEU A CD2   1 
ATOM   3319  N  N     . GLN C 3 387  ? -19.837 91.968  8.000   1.00 36.52  ? 387  GLN A N     1 
ATOM   3320  C  CA    . GLN C 3 387  ? -19.095 93.227  7.965   1.00 38.12  ? 387  GLN A CA    1 
ATOM   3321  C  C     . GLN C 3 387  ? -17.588 93.005  8.146   1.00 38.86  ? 387  GLN A C     1 
ATOM   3322  O  O     . GLN C 3 387  ? -16.782 93.769  7.631   1.00 39.29  ? 387  GLN A O     1 
ATOM   3323  C  CB    . GLN C 3 387  ? -19.601 94.202  9.038   1.00 39.91  ? 387  GLN A CB    1 
ATOM   3324  C  CG    . GLN C 3 387  ? -20.035 95.566  8.476   1.00 43.22  ? 387  GLN A CG    1 
ATOM   3325  C  CD    . GLN C 3 387  ? -19.664 96.767  9.371   1.00 46.06  ? 387  GLN A CD    1 
ATOM   3326  O  OE1   . GLN C 3 387  ? -19.891 97.921  8.992   1.00 46.32  ? 387  GLN A OE1   1 
ATOM   3327  N  NE2   . GLN C 3 387  ? -19.093 96.497  10.548  1.00 44.04  ? 387  GLN A NE2   1 
ATOM   3328  N  N     . GLU C 3 388  ? -17.207 91.945  8.853   1.00 40.80  ? 388  GLU A N     1 
ATOM   3329  C  CA    . GLU C 3 388  ? -15.792 91.668  9.102   1.00 42.33  ? 388  GLU A CA    1 
ATOM   3330  C  C     . GLU C 3 388  ? -15.119 90.723  8.109   1.00 43.71  ? 388  GLU A C     1 
ATOM   3331  O  O     . GLU C 3 388  ? -13.918 90.840  7.858   1.00 44.30  ? 388  GLU A O     1 
ATOM   3332  C  CB    . GLU C 3 388  ? -15.607 91.119  10.523  1.00 41.82  ? 388  GLU A CB    1 
ATOM   3333  C  CG    . GLU C 3 388  ? -16.196 92.003  11.614  1.00 44.04  ? 388  GLU A CG    1 
ATOM   3334  C  CD    . GLU C 3 388  ? -15.653 93.424  11.587  1.00 45.79  ? 388  GLU A CD    1 
ATOM   3335  O  OE1   . GLU C 3 388  ? -14.440 93.602  11.815  1.00 48.71  ? 388  GLU A OE1   1 
ATOM   3336  O  OE2   . GLU C 3 388  ? -16.436 94.366  11.337  1.00 46.95  ? 388  GLU A OE2   1 
ATOM   3337  N  N     . TYR C 3 389  ? -15.877 89.786  7.547   1.00 45.58  ? 389  TYR A N     1 
ATOM   3338  C  CA    . TYR C 3 389  ? -15.309 88.837  6.593   1.00 45.89  ? 389  TYR A CA    1 
ATOM   3339  C  C     . TYR C 3 389  ? -15.713 89.141  5.155   1.00 47.39  ? 389  TYR A C     1 
ATOM   3340  O  O     . TYR C 3 389  ? -16.001 88.238  4.377   1.00 48.21  ? 389  TYR A O     1 
ATOM   3341  C  CB    . TYR C 3 389  ? -15.723 87.406  6.951   1.00 43.84  ? 389  TYR A CB    1 
ATOM   3342  C  CG    . TYR C 3 389  ? -15.211 86.906  8.287   1.00 42.40  ? 389  TYR A CG    1 
ATOM   3343  C  CD1   . TYR C 3 389  ? -14.118 87.505  8.914   1.00 41.29  ? 389  TYR A CD1   1 
ATOM   3344  C  CD2   . TYR C 3 389  ? -15.805 85.805  8.910   1.00 43.41  ? 389  TYR A CD2   1 
ATOM   3345  C  CE1   . TYR C 3 389  ? -13.629 87.023  10.127  1.00 42.15  ? 389  TYR A CE1   1 
ATOM   3346  C  CE2   . TYR C 3 389  ? -15.326 85.308  10.124  1.00 42.91  ? 389  TYR A CE2   1 
ATOM   3347  C  CZ    . TYR C 3 389  ? -14.237 85.922  10.729  1.00 43.89  ? 389  TYR A CZ    1 
ATOM   3348  O  OH    . TYR C 3 389  ? -13.763 85.433  11.932  1.00 42.62  ? 389  TYR A OH    1 
ATOM   3349  N  N     . THR C 3 390  ? -15.721 90.418  4.799   1.00 49.64  ? 390  THR A N     1 
ATOM   3350  C  CA    . THR C 3 390  ? -16.095 90.821  3.453   1.00 53.09  ? 390  THR A CA    1 
ATOM   3351  C  C     . THR C 3 390  ? -15.016 91.663  2.780   1.00 55.57  ? 390  THR A C     1 
ATOM   3352  O  O     . THR C 3 390  ? -14.532 91.323  1.701   1.00 56.60  ? 390  THR A O     1 
ATOM   3353  C  CB    . THR C 3 390  ? -17.440 91.603  3.473   1.00 53.16  ? 390  THR A CB    1 
ATOM   3354  O  OG1   . THR C 3 390  ? -18.521 90.687  3.249   1.00 53.15  ? 390  THR A OG1   1 
ATOM   3355  C  CG2   . THR C 3 390  ? -17.466 92.704  2.407   1.00 53.19  ? 390  THR A CG2   1 
ATOM   3356  N  N     . GLN C 3 391  ? -14.641 92.762  3.422   1.00 58.48  ? 391  GLN A N     1 
ATOM   3357  C  CA    . GLN C 3 391  ? -13.632 93.653  2.872   1.00 61.24  ? 391  GLN A CA    1 
ATOM   3358  C  C     . GLN C 3 391  ? -12.310 92.946  2.578   1.00 60.95  ? 391  GLN A C     1 
ATOM   3359  O  O     . GLN C 3 391  ? -11.828 92.136  3.372   1.00 61.14  ? 391  GLN A O     1 
ATOM   3360  C  CB    . GLN C 3 391  ? -13.409 94.833  3.826   1.00 64.65  ? 391  GLN A CB    1 
ATOM   3361  C  CG    . GLN C 3 391  ? -14.664 95.680  4.035   1.00 68.49  ? 391  GLN A CG    1 
ATOM   3362  C  CD    . GLN C 3 391  ? -14.423 96.900  4.905   1.00 70.22  ? 391  GLN A CD    1 
ATOM   3363  O  OE1   . GLN C 3 391  ? -13.576 97.742  4.596   1.00 70.42  ? 391  GLN A OE1   1 
ATOM   3364  N  NE2   . GLN C 3 391  ? -15.175 97.006  6.000   1.00 71.82  ? 391  GLN A NE2   1 
ATOM   3365  N  N     . SER C 3 392  ? -11.740 93.255  1.417   1.00 59.70  ? 392  SER A N     1 
ATOM   3366  C  CA    . SER C 3 392  ? -10.475 92.674  0.995   1.00 58.90  ? 392  SER A CA    1 
ATOM   3367  C  C     . SER C 3 392  ? -9.432  93.777  0.812   1.00 57.72  ? 392  SER A C     1 
ATOM   3368  O  O     . SER C 3 392  ? -9.749  94.876  0.361   1.00 56.65  ? 392  SER A O     1 
ATOM   3369  C  CB    . SER C 3 392  ? -10.657 91.905  -0.317  1.00 59.55  ? 392  SER A CB    1 
ATOM   3370  O  OG    . SER C 3 392  ? -11.553 90.819  -0.153  1.00 60.44  ? 392  SER A OG    1 
ATOM   3371  N  N     . PRO C 3 393  ? -8.170  93.490  1.163   1.00 56.94  ? 393  PRO A N     1 
ATOM   3372  C  CA    . PRO C 3 393  ? -7.059  94.442  1.048   1.00 55.74  ? 393  PRO A CA    1 
ATOM   3373  C  C     . PRO C 3 393  ? -6.829  94.856  -0.395  1.00 53.59  ? 393  PRO A C     1 
ATOM   3374  O  O     . PRO C 3 393  ? -6.872  94.018  -1.295  1.00 53.57  ? 393  PRO A O     1 
ATOM   3375  C  CB    . PRO C 3 393  ? -5.861  93.650  1.579   1.00 57.08  ? 393  PRO A CB    1 
ATOM   3376  C  CG    . PRO C 3 393  ? -6.479  92.622  2.466   1.00 57.45  ? 393  PRO A CG    1 
ATOM   3377  C  CD    . PRO C 3 393  ? -7.700  92.204  1.702   1.00 57.27  ? 393  PRO A CD    1 
ATOM   3378  N  N     . GLU C 3 394  ? -6.588  96.138  -0.629  1.00 51.70  ? 394  GLU A N     1 
ATOM   3379  C  CA    . GLU C 3 394  ? -6.320  96.567  -1.992  1.00 50.45  ? 394  GLU A CA    1 
ATOM   3380  C  C     . GLU C 3 394  ? -4.813  96.597  -2.178  1.00 48.24  ? 394  GLU A C     1 
ATOM   3381  O  O     . GLU C 3 394  ? -4.146  97.537  -1.739  1.00 47.68  ? 394  GLU A O     1 
ATOM   3382  C  CB    . GLU C 3 394  ? -6.881  97.959  -2.273  1.00 53.11  ? 394  GLU A CB    1 
ATOM   3383  C  CG    . GLU C 3 394  ? -6.901  98.288  -3.767  1.00 57.23  ? 394  GLU A CG    1 
ATOM   3384  C  CD    . GLU C 3 394  ? -7.064  99.772  -4.067  1.00 59.72  ? 394  GLU A CD    1 
ATOM   3385  O  OE1   . GLU C 3 394  ? -7.944  100.417 -3.451  1.00 60.63  ? 394  GLU A OE1   1 
ATOM   3386  O  OE2   . GLU C 3 394  ? -6.314  100.287 -4.932  1.00 59.66  ? 394  GLU A OE2   1 
ATOM   3387  N  N     . ILE C 3 395  ? -4.283  95.555  -2.811  1.00 45.66  ? 395  ILE A N     1 
ATOM   3388  C  CA    . ILE C 3 395  ? -2.851  95.445  -3.077  1.00 43.20  ? 395  ILE A CA    1 
ATOM   3389  C  C     . ILE C 3 395  ? -2.510  96.327  -4.272  1.00 41.57  ? 395  ILE A C     1 
ATOM   3390  O  O     . ILE C 3 395  ? -2.534  95.867  -5.407  1.00 42.81  ? 395  ILE A O     1 
ATOM   3391  C  CB    . ILE C 3 395  ? -2.469  93.997  -3.428  1.00 43.70  ? 395  ILE A CB    1 
ATOM   3392  C  CG1   . ILE C 3 395  ? -3.074  93.035  -2.401  1.00 45.23  ? 395  ILE A CG1   1 
ATOM   3393  C  CG2   . ILE C 3 395  ? -0.963  93.859  -3.502  1.00 43.04  ? 395  ILE A CG2   1 
ATOM   3394  C  CD1   . ILE C 3 395  ? -2.895  93.473  -0.966  1.00 47.30  ? 395  ILE A CD1   1 
ATOM   3395  N  N     . LYS C 3 396  ? -2.187  97.589  -4.021  1.00 40.56  ? 396  LYS A N     1 
ATOM   3396  C  CA    . LYS C 3 396  ? -1.878  98.517  -5.104  1.00 39.87  ? 396  LYS A CA    1 
ATOM   3397  C  C     . LYS C 3 396  ? -0.672  98.167  -5.976  1.00 38.29  ? 396  LYS A C     1 
ATOM   3398  O  O     . LYS C 3 396  ? -0.562  98.670  -7.092  1.00 38.90  ? 396  LYS A O     1 
ATOM   3399  C  CB    . LYS C 3 396  ? -1.729  99.938  -4.558  1.00 40.24  ? 396  LYS A CB    1 
ATOM   3400  C  CG    . LYS C 3 396  ? -3.056  100.648 -4.318  1.00 42.07  ? 396  LYS A CG    1 
ATOM   3401  C  CD    . LYS C 3 396  ? -2.823  102.121 -4.026  1.00 44.13  ? 396  LYS A CD    1 
ATOM   3402  C  CE    . LYS C 3 396  ? -4.051  102.973 -4.315  1.00 45.75  ? 396  LYS A CE    1 
ATOM   3403  N  NZ    . LYS C 3 396  ? -3.722  104.435 -4.228  1.00 46.90  ? 396  LYS A NZ    1 
ATOM   3404  N  N     . VAL C 3 397  ? 0.228   97.322  -5.478  1.00 36.04  ? 397  VAL A N     1 
ATOM   3405  C  CA    . VAL C 3 397  ? 1.402   96.904  -6.256  1.00 33.84  ? 397  VAL A CA    1 
ATOM   3406  C  C     . VAL C 3 397  ? 1.620   95.395  -6.076  1.00 33.02  ? 397  VAL A C     1 
ATOM   3407  O  O     . VAL C 3 397  ? 2.499   94.970  -5.337  1.00 32.57  ? 397  VAL A O     1 
ATOM   3408  C  CB    . VAL C 3 397  ? 2.683   97.638  -5.801  1.00 34.08  ? 397  VAL A CB    1 
ATOM   3409  C  CG1   . VAL C 3 397  ? 3.812   97.387  -6.810  1.00 32.60  ? 397  VAL A CG1   1 
ATOM   3410  C  CG2   . VAL C 3 397  ? 2.416   99.123  -5.649  1.00 33.59  ? 397  VAL A CG2   1 
ATOM   3411  N  N     . PRO C 3 398  ? 0.828   94.571  -6.772  1.00 33.01  ? 398  PRO A N     1 
ATOM   3412  C  CA    . PRO C 3 398  ? 0.896   93.106  -6.706  1.00 32.96  ? 398  PRO A CA    1 
ATOM   3413  C  C     . PRO C 3 398  ? 2.238   92.477  -7.030  1.00 32.61  ? 398  PRO A C     1 
ATOM   3414  O  O     . PRO C 3 398  ? 3.085   93.068  -7.698  1.00 33.19  ? 398  PRO A O     1 
ATOM   3415  C  CB    . PRO C 3 398  ? -0.163  92.654  -7.719  1.00 32.75  ? 398  PRO A CB    1 
ATOM   3416  C  CG    . PRO C 3 398  ? -1.088  93.826  -7.828  1.00 34.49  ? 398  PRO A CG    1 
ATOM   3417  C  CD    . PRO C 3 398  ? -0.141  94.995  -7.797  1.00 34.45  ? 398  PRO A CD    1 
ATOM   3418  N  N     . ILE C 3 399  ? 2.421   91.257  -6.549  1.00 32.55  ? 399  ILE A N     1 
ATOM   3419  C  CA    . ILE C 3 399  ? 3.630   90.509  -6.840  1.00 32.04  ? 399  ILE A CA    1 
ATOM   3420  C  C     . ILE C 3 399  ? 3.365   89.993  -8.250  1.00 32.15  ? 399  ILE A C     1 
ATOM   3421  O  O     . ILE C 3 399  ? 2.367   89.312  -8.484  1.00 32.21  ? 399  ILE A O     1 
ATOM   3422  C  CB    . ILE C 3 399  ? 3.792   89.312  -5.881  1.00 30.79  ? 399  ILE A CB    1 
ATOM   3423  C  CG1   . ILE C 3 399  ? 3.915   89.816  -4.437  1.00 28.28  ? 399  ILE A CG1   1 
ATOM   3424  C  CG2   . ILE C 3 399  ? 5.001   88.480  -6.289  1.00 28.63  ? 399  ILE A CG2   1 
ATOM   3425  C  CD1   . ILE C 3 399  ? 3.921   88.710  -3.404  1.00 23.23  ? 399  ILE A CD1   1 
ATOM   3426  N  N     . PRO C 3 400  ? 4.245   90.316  -9.212  1.00 32.84  ? 400  PRO A N     1 
ATOM   3427  C  CA    . PRO C 3 400  ? 4.022   89.847  -10.583 1.00 31.84  ? 400  PRO A CA    1 
ATOM   3428  C  C     . PRO C 3 400  ? 3.878   88.326  -10.657 1.00 32.82  ? 400  PRO A C     1 
ATOM   3429  O  O     . PRO C 3 400  ? 4.562   87.592  -9.949  1.00 32.95  ? 400  PRO A O     1 
ATOM   3430  C  CB    . PRO C 3 400  ? 5.266   90.337  -11.331 1.00 31.34  ? 400  PRO A CB    1 
ATOM   3431  C  CG    . PRO C 3 400  ? 5.749   91.497  -10.527 1.00 31.18  ? 400  PRO A CG    1 
ATOM   3432  C  CD    . PRO C 3 400  ? 5.531   91.028  -9.103  1.00 33.25  ? 400  PRO A CD    1 
ATOM   3433  N  N     . GLN C 3 401  ? 2.985   87.859  -11.517 1.00 34.18  ? 401  GLN A N     1 
ATOM   3434  C  CA    . GLN C 3 401  ? 2.779   86.432  -11.695 1.00 35.39  ? 401  GLN A CA    1 
ATOM   3435  C  C     . GLN C 3 401  ? 4.083   85.798  -12.180 1.00 35.43  ? 401  GLN A C     1 
ATOM   3436  O  O     . GLN C 3 401  ? 4.437   84.684  -11.781 1.00 34.91  ? 401  GLN A O     1 
ATOM   3437  C  CB    . GLN C 3 401  ? 1.663   86.197  -12.715 1.00 37.48  ? 401  GLN A CB    1 
ATOM   3438  C  CG    . GLN C 3 401  ? 1.236   84.745  -12.873 1.00 44.63  ? 401  GLN A CG    1 
ATOM   3439  C  CD    . GLN C 3 401  ? 0.052   84.578  -13.827 1.00 50.07  ? 401  GLN A CD    1 
ATOM   3440  O  OE1   . GLN C 3 401  ? -1.063  85.045  -13.547 1.00 51.62  ? 401  GLN A OE1   1 
ATOM   3441  N  NE2   . GLN C 3 401  ? 0.291   83.911  -14.964 1.00 51.09  ? 401  GLN A NE2   1 
ATOM   3442  N  N     . LYS C 3 402  ? 4.809   86.520  -13.027 1.00 35.28  ? 402  LYS A N     1 
ATOM   3443  C  CA    . LYS C 3 402  ? 6.066   86.009  -13.565 1.00 36.99  ? 402  LYS A CA    1 
ATOM   3444  C  C     . LYS C 3 402  ? 7.112   85.741  -12.497 1.00 37.25  ? 402  LYS A C     1 
ATOM   3445  O  O     . LYS C 3 402  ? 8.081   85.030  -12.753 1.00 38.32  ? 402  LYS A O     1 
ATOM   3446  C  CB    . LYS C 3 402  ? 6.657   86.988  -14.589 1.00 38.13  ? 402  LYS A CB    1 
ATOM   3447  C  CG    . LYS C 3 402  ? 7.099   88.333  -14.003 1.00 40.92  ? 402  LYS A CG    1 
ATOM   3448  C  CD    . LYS C 3 402  ? 7.704   89.237  -15.071 1.00 42.15  ? 402  LYS A CD    1 
ATOM   3449  C  CE    . LYS C 3 402  ? 8.155   90.571  -14.485 1.00 43.12  ? 402  LYS A CE    1 
ATOM   3450  N  NZ    . LYS C 3 402  ? 9.283   90.415  -13.522 1.00 43.17  ? 402  LYS A NZ    1 
ATOM   3451  N  N     . ASP C 3 403  ? 6.927   86.311  -11.307 1.00 37.44  ? 403  ASP A N     1 
ATOM   3452  C  CA    . ASP C 3 403  ? 7.898   86.139  -10.232 1.00 36.86  ? 403  ASP A CA    1 
ATOM   3453  C  C     . ASP C 3 403  ? 7.768   84.875  -9.379  1.00 35.32  ? 403  ASP A C     1 
ATOM   3454  O  O     . ASP C 3 403  ? 8.508   84.692  -8.411  1.00 33.91  ? 403  ASP A O     1 
ATOM   3455  C  CB    . ASP C 3 403  ? 7.912   87.380  -9.334  1.00 39.01  ? 403  ASP A CB    1 
ATOM   3456  C  CG    . ASP C 3 403  ? 8.498   88.595  -10.033 1.00 40.77  ? 403  ASP A CG    1 
ATOM   3457  O  OD1   . ASP C 3 403  ? 9.199   88.416  -11.055 1.00 42.79  ? 403  ASP A OD1   1 
ATOM   3458  O  OD2   . ASP C 3 403  ? 8.273   89.728  -9.562  1.00 42.08  ? 403  ASP A OD2   1 
ATOM   3459  N  N     . TRP C 3 404  ? 6.840   83.998  -9.740  1.00 33.67  ? 404  TRP A N     1 
ATOM   3460  C  CA    . TRP C 3 404  ? 6.677   82.756  -9.005  1.00 33.73  ? 404  TRP A CA    1 
ATOM   3461  C  C     . TRP C 3 404  ? 7.223   81.592  -9.830  1.00 34.57  ? 404  TRP A C     1 
ATOM   3462  O  O     . TRP C 3 404  ? 7.195   81.626  -11.065 1.00 33.37  ? 404  TRP A O     1 
ATOM   3463  C  CB    . TRP C 3 404  ? 5.202   82.509  -8.676  1.00 32.62  ? 404  TRP A CB    1 
ATOM   3464  C  CG    . TRP C 3 404  ? 4.617   83.537  -7.766  1.00 31.59  ? 404  TRP A CG    1 
ATOM   3465  C  CD1   . TRP C 3 404  ? 3.864   84.615  -8.125  1.00 30.78  ? 404  TRP A CD1   1 
ATOM   3466  C  CD2   . TRP C 3 404  ? 4.797   83.624  -6.347  1.00 32.30  ? 404  TRP A CD2   1 
ATOM   3467  N  NE1   . TRP C 3 404  ? 3.567   85.375  -7.020  1.00 32.16  ? 404  TRP A NE1   1 
ATOM   3468  C  CE2   . TRP C 3 404  ? 4.127   84.791  -5.914  1.00 33.07  ? 404  TRP A CE2   1 
ATOM   3469  C  CE3   . TRP C 3 404  ? 5.461   82.831  -5.399  1.00 31.77  ? 404  TRP A CE3   1 
ATOM   3470  C  CZ2   . TRP C 3 404  ? 4.104   85.190  -4.566  1.00 33.31  ? 404  TRP A CZ2   1 
ATOM   3471  C  CZ3   . TRP C 3 404  ? 5.440   83.226  -4.057  1.00 31.52  ? 404  TRP A CZ3   1 
ATOM   3472  C  CH2   . TRP C 3 404  ? 4.764   84.397  -3.657  1.00 32.66  ? 404  TRP A CH2   1 
ATOM   3473  N  N     . THR C 3 405  ? 7.745   80.573  -9.155  1.00 34.25  ? 405  THR A N     1 
ATOM   3474  C  CA    . THR C 3 405  ? 8.249   79.410  -9.872  1.00 33.16  ? 405  THR A CA    1 
ATOM   3475  C  C     . THR C 3 405  ? 7.049   78.513  -10.094 1.00 32.48  ? 405  THR A C     1 
ATOM   3476  O  O     . THR C 3 405  ? 5.922   78.871  -9.758  1.00 31.46  ? 405  THR A O     1 
ATOM   3477  C  CB    . THR C 3 405  ? 9.243   78.593  -9.043  1.00 33.54  ? 405  THR A CB    1 
ATOM   3478  O  OG1   . THR C 3 405  ? 8.556   78.015  -7.923  1.00 33.77  ? 405  THR A OG1   1 
ATOM   3479  C  CG2   . THR C 3 405  ? 10.384  79.463  -8.558  1.00 34.21  ? 405  THR A CG2   1 
ATOM   3480  N  N     . GLY C 3 406  ? 7.295   77.346  -10.673 1.00 33.44  ? 406  GLY A N     1 
ATOM   3481  C  CA    . GLY C 3 406  ? 6.218   76.396  -10.856 1.00 33.57  ? 406  GLY A CA    1 
ATOM   3482  C  C     . GLY C 3 406  ? 5.951   75.879  -9.452  1.00 33.68  ? 406  GLY A C     1 
ATOM   3483  O  O     . GLY C 3 406  ? 6.760   76.114  -8.555  1.00 34.39  ? 406  GLY A O     1 
ATOM   3484  N  N     . PRO C 3 407  ? 4.841   75.176  -9.222  1.00 33.25  ? 407  PRO A N     1 
ATOM   3485  C  CA    . PRO C 3 407  ? 4.496   74.643  -7.901  1.00 33.78  ? 407  PRO A CA    1 
ATOM   3486  C  C     . PRO C 3 407  ? 5.410   73.562  -7.314  1.00 34.79  ? 407  PRO A C     1 
ATOM   3487  O  O     . PRO C 3 407  ? 6.144   72.869  -8.015  1.00 34.79  ? 407  PRO A O     1 
ATOM   3488  C  CB    . PRO C 3 407  ? 3.088   74.093  -8.108  1.00 34.21  ? 407  PRO A CB    1 
ATOM   3489  C  CG    . PRO C 3 407  ? 2.563   74.870  -9.278  1.00 34.89  ? 407  PRO A CG    1 
ATOM   3490  C  CD    . PRO C 3 407  ? 3.750   74.943  -10.180 1.00 34.03  ? 407  PRO A CD    1 
ATOM   3491  N  N     . ILE C 3 408  ? 5.348   73.451  -5.996  1.00 35.33  ? 408  ILE A N     1 
ATOM   3492  C  CA    . ILE C 3 408  ? 6.063   72.439  -5.240  1.00 35.36  ? 408  ILE A CA    1 
ATOM   3493  C  C     . ILE C 3 408  ? 4.936   72.121  -4.287  1.00 35.61  ? 408  ILE A C     1 
ATOM   3494  O  O     . ILE C 3 408  ? 4.871   72.618  -3.161  1.00 36.52  ? 408  ILE A O     1 
ATOM   3495  C  CB    . ILE C 3 408  ? 7.270   73.003  -4.489  1.00 36.34  ? 408  ILE A CB    1 
ATOM   3496  C  CG1   . ILE C 3 408  ? 8.277   73.572  -5.494  1.00 36.13  ? 408  ILE A CG1   1 
ATOM   3497  C  CG2   . ILE C 3 408  ? 7.931   71.897  -3.672  1.00 34.58  ? 408  ILE A CG2   1 
ATOM   3498  C  CD1   . ILE C 3 408  ? 9.516   74.171  -4.844  1.00 37.35  ? 408  ILE A CD1   1 
ATOM   3499  N  N     . GLY C 3 409  ? 4.006   71.328  -4.798  1.00 35.20  ? 409  GLY A N     1 
ATOM   3500  C  CA    . GLY C 3 409  ? 2.841   70.979  -4.032  1.00 35.76  ? 409  GLY A CA    1 
ATOM   3501  C  C     . GLY C 3 409  ? 1.897   72.160  -4.055  1.00 36.20  ? 409  GLY A C     1 
ATOM   3502  O  O     . GLY C 3 409  ? 1.336   72.506  -5.092  1.00 36.61  ? 409  GLY A O     1 
ATOM   3503  N  N     . GLU C 3 410  ? 1.750   72.802  -2.906  1.00 37.36  ? 410  GLU A N     1 
ATOM   3504  C  CA    . GLU C 3 410  ? 0.860   73.941  -2.757  1.00 38.12  ? 410  GLU A CA    1 
ATOM   3505  C  C     . GLU C 3 410  ? 1.600   75.263  -2.814  1.00 37.26  ? 410  GLU A C     1 
ATOM   3506  O  O     . GLU C 3 410  ? 0.974   76.315  -2.889  1.00 38.31  ? 410  GLU A O     1 
ATOM   3507  C  CB    . GLU C 3 410  ? 0.126   73.857  -1.414  1.00 38.97  ? 410  GLU A CB    1 
ATOM   3508  C  CG    . GLU C 3 410  ? -0.764  72.636  -1.230  1.00 38.10  ? 410  GLU A CG    1 
ATOM   3509  C  CD    . GLU C 3 410  ? -2.034  72.709  -2.055  1.00 39.05  ? 410  GLU A CD    1 
ATOM   3510  O  OE1   . GLU C 3 410  ? -2.398  73.827  -2.499  1.00 37.98  ? 410  GLU A OE1   1 
ATOM   3511  O  OE2   . GLU C 3 410  ? -2.672  71.649  -2.246  1.00 37.67  ? 410  GLU A OE2   1 
ATOM   3512  N  N     . ILE C 3 411  ? 2.926   75.225  -2.778  1.00 37.15  ? 411  ILE A N     1 
ATOM   3513  C  CA    . ILE C 3 411  ? 3.679   76.475  -2.788  1.00 36.83  ? 411  ILE A CA    1 
ATOM   3514  C  C     . ILE C 3 411  ? 4.499   76.764  -4.041  1.00 36.37  ? 411  ILE A C     1 
ATOM   3515  O  O     . ILE C 3 411  ? 4.836   75.868  -4.821  1.00 36.05  ? 411  ILE A O     1 
ATOM   3516  C  CB    . ILE C 3 411  ? 4.610   76.566  -1.547  1.00 36.38  ? 411  ILE A CB    1 
ATOM   3517  C  CG1   . ILE C 3 411  ? 5.736   75.538  -1.640  1.00 37.97  ? 411  ILE A CG1   1 
ATOM   3518  C  CG2   . ILE C 3 411  ? 3.811   76.308  -0.282  1.00 36.64  ? 411  ILE A CG2   1 
ATOM   3519  C  CD1   . ILE C 3 411  ? 6.930   75.995  -2.459  1.00 39.78  ? 411  ILE A CD1   1 
ATOM   3520  N  N     . ARG C 3 412  ? 4.800   78.044  -4.217  1.00 36.35  ? 412  ARG A N     1 
ATOM   3521  C  CA    . ARG C 3 412  ? 5.591   78.533  -5.332  1.00 35.44  ? 412  ARG A CA    1 
ATOM   3522  C  C     . ARG C 3 412  ? 6.646   79.422  -4.719  1.00 34.85  ? 412  ARG A C     1 
ATOM   3523  O  O     . ARG C 3 412  ? 6.337   80.275  -3.878  1.00 35.49  ? 412  ARG A O     1 
ATOM   3524  C  CB    . ARG C 3 412  ? 4.735   79.360  -6.287  1.00 37.12  ? 412  ARG A CB    1 
ATOM   3525  C  CG    . ARG C 3 412  ? 3.830   78.548  -7.160  1.00 39.36  ? 412  ARG A CG    1 
ATOM   3526  C  CD    . ARG C 3 412  ? 2.777   79.431  -7.777  1.00 44.02  ? 412  ARG A CD    1 
ATOM   3527  N  NE    . ARG C 3 412  ? 1.748   78.631  -8.432  1.00 48.20  ? 412  ARG A NE    1 
ATOM   3528  C  CZ    . ARG C 3 412  ? 1.840   78.155  -9.669  1.00 49.63  ? 412  ARG A CZ    1 
ATOM   3529  N  NH1   . ARG C 3 412  ? 2.922   78.406  -10.399 1.00 50.56  ? 412  ARG A NH1   1 
ATOM   3530  N  NH2   . ARG C 3 412  ? 0.851   77.418  -10.168 1.00 50.17  ? 412  ARG A NH2   1 
ATOM   3531  N  N     . ILE C 3 413  ? 7.891   79.223  -5.128  1.00 33.47  ? 413  ILE A N     1 
ATOM   3532  C  CA    . ILE C 3 413  ? 8.963   80.028  -4.591  1.00 33.47  ? 413  ILE A CA    1 
ATOM   3533  C  C     . ILE C 3 413  ? 8.984   81.385  -5.278  1.00 33.88  ? 413  ILE A C     1 
ATOM   3534  O  O     . ILE C 3 413  ? 8.697   81.499  -6.474  1.00 34.38  ? 413  ILE A O     1 
ATOM   3535  C  CB    . ILE C 3 413  ? 10.325  79.343  -4.785  1.00 34.15  ? 413  ILE A CB    1 
ATOM   3536  C  CG1   . ILE C 3 413  ? 10.330  77.995  -4.065  1.00 35.50  ? 413  ILE A CG1   1 
ATOM   3537  C  CG2   . ILE C 3 413  ? 11.445  80.232  -4.247  1.00 32.61  ? 413  ILE A CG2   1 
ATOM   3538  C  CD1   . ILE C 3 413  ? 11.622  77.198  -4.262  1.00 37.22  ? 413  ILE A CD1   1 
ATOM   3539  N  N     . LEU C 3 414  ? 9.304   82.412  -4.499  1.00 34.14  ? 414  LEU A N     1 
ATOM   3540  C  CA    . LEU C 3 414  ? 9.405   83.772  -5.007  1.00 35.36  ? 414  LEU A CA    1 
ATOM   3541  C  C     . LEU C 3 414  ? 10.812  83.880  -5.602  1.00 36.41  ? 414  LEU A C     1 
ATOM   3542  O  O     . LEU C 3 414  ? 11.796  83.933  -4.867  1.00 37.21  ? 414  LEU A O     1 
ATOM   3543  C  CB    . LEU C 3 414  ? 9.264   84.767  -3.857  1.00 34.27  ? 414  LEU A CB    1 
ATOM   3544  C  CG    . LEU C 3 414  ? 8.582   86.117  -4.100  1.00 34.19  ? 414  LEU A CG    1 
ATOM   3545  C  CD1   . LEU C 3 414  ? 9.200   87.131  -3.143  1.00 32.70  ? 414  LEU A CD1   1 
ATOM   3546  C  CD2   . LEU C 3 414  ? 8.747   86.573  -5.535  1.00 34.39  ? 414  LEU A CD2   1 
ATOM   3547  N  N     . LYS C 3 415  ? 10.908  83.894  -6.927  1.00 38.49  ? 415  LYS A N     1 
ATOM   3548  C  CA    . LYS C 3 415  ? 12.209  83.979  -7.591  1.00 40.24  ? 415  LYS A CA    1 
ATOM   3549  C  C     . LYS C 3 415  ? 13.028  85.121  -6.988  1.00 41.03  ? 415  LYS A C     1 
ATOM   3550  O  O     . LYS C 3 415  ? 12.483  86.174  -6.666  1.00 41.55  ? 415  LYS A O     1 
ATOM   3551  C  CB    . LYS C 3 415  ? 12.028  84.198  -9.105  1.00 39.17  ? 415  LYS A CB    1 
ATOM   3552  C  CG    . LYS C 3 415  ? 11.201  83.119  -9.820  1.00 38.65  ? 415  LYS A CG    1 
ATOM   3553  C  CD    . LYS C 3 415  ? 11.074  83.388  -11.327 1.00 39.36  ? 415  LYS A CD    1 
ATOM   3554  C  CE    . LYS C 3 415  ? 10.260  82.292  -12.022 1.00 41.48  ? 415  LYS A CE    1 
ATOM   3555  N  NZ    . LYS C 3 415  ? 10.133  82.458  -13.513 1.00 40.54  ? 415  LYS A NZ    1 
ATOM   3556  N  N     . ASP C 3 416  ? 14.329  84.906  -6.825  1.00 43.00  ? 416  ASP A N     1 
ATOM   3557  C  CA    . ASP C 3 416  ? 15.206  85.929  -6.263  1.00 45.99  ? 416  ASP A CA    1 
ATOM   3558  C  C     . ASP C 3 416  ? 15.462  87.109  -7.210  1.00 47.57  ? 416  ASP A C     1 
ATOM   3559  O  O     . ASP C 3 416  ? 16.227  88.012  -6.879  1.00 48.45  ? 416  ASP A O     1 
ATOM   3560  C  CB    . ASP C 3 416  ? 16.547  85.314  -5.850  1.00 48.05  ? 416  ASP A CB    1 
ATOM   3561  C  CG    . ASP C 3 416  ? 17.215  84.532  -6.979  1.00 50.31  ? 416  ASP A CG    1 
ATOM   3562  O  OD1   . ASP C 3 416  ? 17.139  84.973  -8.147  1.00 50.95  ? 416  ASP A OD1   1 
ATOM   3563  O  OD2   . ASP C 3 416  ? 17.830  83.481  -6.692  1.00 50.20  ? 416  ASP A OD2   1 
ATOM   3564  N  N     . THR C 3 417  ? 14.831  87.093  -8.384  1.00 48.01  ? 417  THR A N     1 
ATOM   3565  C  CA    . THR C 3 417  ? 14.978  88.166  -9.371  1.00 47.81  ? 417  THR A CA    1 
ATOM   3566  C  C     . THR C 3 417  ? 13.773  89.094  -9.307  1.00 48.43  ? 417  THR A C     1 
ATOM   3567  O  O     . THR C 3 417  ? 13.609  89.976  -10.157 1.00 49.34  ? 417  THR A O     1 
ATOM   3568  C  CB    . THR C 3 417  ? 15.038  87.620  -10.818 1.00 48.55  ? 417  THR A CB    1 
ATOM   3569  O  OG1   . THR C 3 417  ? 13.769  87.042  -11.167 1.00 47.03  ? 417  THR A OG1   1 
ATOM   3570  C  CG2   . THR C 3 417  ? 16.135  86.573  -10.952 1.00 49.36  ? 417  THR A CG2   1 
ATOM   3571  N  N     . THR C 3 418  ? 12.912  88.877  -8.318  1.00 47.42  ? 418  THR A N     1 
ATOM   3572  C  CA    . THR C 3 418  ? 11.727  89.705  -8.179  1.00 45.95  ? 418  THR A CA    1 
ATOM   3573  C  C     . THR C 3 418  ? 12.110  91.113  -7.765  1.00 46.10  ? 418  THR A C     1 
ATOM   3574  O  O     . THR C 3 418  ? 12.967  91.316  -6.904  1.00 47.24  ? 418  THR A O     1 
ATOM   3575  C  CB    . THR C 3 418  ? 10.759  89.144  -7.133  1.00 46.22  ? 418  THR A CB    1 
ATOM   3576  O  OG1   . THR C 3 418  ? 9.585   89.961  -7.101  1.00 45.53  ? 418  THR A OG1   1 
ATOM   3577  C  CG2   . THR C 3 418  ? 11.400  89.133  -5.747  1.00 44.28  ? 418  THR A CG2   1 
ATOM   3578  N  N     . SER C 3 419  ? 11.483  92.092  -8.391  1.00 45.33  ? 419  SER A N     1 
ATOM   3579  C  CA    . SER C 3 419  ? 11.769  93.471  -8.048  1.00 45.17  ? 419  SER A CA    1 
ATOM   3580  C  C     . SER C 3 419  ? 10.742  93.907  -7.011  1.00 43.22  ? 419  SER A C     1 
ATOM   3581  O  O     . SER C 3 419  ? 10.724  95.057  -6.590  1.00 43.48  ? 419  SER A O     1 
ATOM   3582  C  CB    . SER C 3 419  ? 11.688  94.354  -9.300  1.00 46.72  ? 419  SER A CB    1 
ATOM   3583  O  OG    . SER C 3 419  ? 10.481  94.120  -10.011 1.00 48.42  ? 419  SER A OG    1 
ATOM   3584  N  N     . SER C 3 420  ? 9.893   92.970  -6.600  1.00 41.40  ? 420  SER A N     1 
ATOM   3585  C  CA    . SER C 3 420  ? 8.846   93.242  -5.619  1.00 39.69  ? 420  SER A CA    1 
ATOM   3586  C  C     . SER C 3 420  ? 9.377   93.454  -4.216  1.00 39.24  ? 420  SER A C     1 
ATOM   3587  O  O     . SER C 3 420  ? 10.429  92.938  -3.848  1.00 39.52  ? 420  SER A O     1 
ATOM   3588  C  CB    . SER C 3 420  ? 7.834   92.098  -5.578  1.00 39.76  ? 420  SER A CB    1 
ATOM   3589  O  OG    . SER C 3 420  ? 6.859   92.326  -4.572  1.00 39.55  ? 420  SER A OG    1 
ATOM   3590  N  N     . ILE C 3 421  ? 8.624   94.212  -3.432  1.00 37.98  ? 421  ILE A N     1 
ATOM   3591  C  CA    . ILE C 3 421  ? 8.998   94.490  -2.061  1.00 36.32  ? 421  ILE A CA    1 
ATOM   3592  C  C     . ILE C 3 421  ? 8.851   93.203  -1.223  1.00 36.08  ? 421  ILE A C     1 
ATOM   3593  O  O     . ILE C 3 421  ? 9.374   93.105  -0.113  1.00 35.25  ? 421  ILE A O     1 
ATOM   3594  C  CB    . ILE C 3 421  ? 8.118   95.639  -1.494  1.00 36.13  ? 421  ILE A CB    1 
ATOM   3595  C  CG1   . ILE C 3 421  ? 8.802   96.261  -0.285  1.00 35.91  ? 421  ILE A CG1   1 
ATOM   3596  C  CG2   . ILE C 3 421  ? 6.735   95.132  -1.131  1.00 36.93  ? 421  ILE A CG2   1 
ATOM   3597  C  CD1   . ILE C 3 421  ? 10.186  96.775  -0.596  1.00 34.60  ? 421  ILE A CD1   1 
ATOM   3598  N  N     . ALA C 3 422  ? 8.152   92.216  -1.780  1.00 35.05  ? 422  ALA A N     1 
ATOM   3599  C  CA    . ALA C 3 422  ? 7.937   90.929  -1.120  1.00 33.98  ? 422  ALA A CA    1 
ATOM   3600  C  C     . ALA C 3 422  ? 9.284   90.246  -0.896  1.00 33.61  ? 422  ALA A C     1 
ATOM   3601  O  O     . ALA C 3 422  ? 9.429   89.359  -0.043  1.00 33.22  ? 422  ALA A O     1 
ATOM   3602  C  CB    . ALA C 3 422  ? 7.043   90.049  -1.989  1.00 32.93  ? 422  ALA A CB    1 
ATOM   3603  N  N     . ARG C 3 423  ? 10.254  90.666  -1.699  1.00 32.05  ? 423  ARG A N     1 
ATOM   3604  C  CA    . ARG C 3 423  ? 11.622  90.178  -1.657  1.00 32.00  ? 423  ARG A CA    1 
ATOM   3605  C  C     . ARG C 3 423  ? 12.084  90.146  -0.196  1.00 31.09  ? 423  ARG A C     1 
ATOM   3606  O  O     . ARG C 3 423  ? 12.534  89.121  0.314   1.00 29.84  ? 423  ARG A O     1 
ATOM   3607  C  CB    . ARG C 3 423  ? 12.477  91.142  -2.503  1.00 35.16  ? 423  ARG A CB    1 
ATOM   3608  C  CG    . ARG C 3 423  ? 13.995  90.956  -2.573  1.00 38.90  ? 423  ARG A CG    1 
ATOM   3609  C  CD    . ARG C 3 423  ? 14.559  91.967  -3.607  1.00 42.95  ? 423  ARG A CD    1 
ATOM   3610  N  NE    . ARG C 3 423  ? 16.025  92.019  -3.687  1.00 48.51  ? 423  ARG A NE    1 
ATOM   3611  C  CZ    . ARG C 3 423  ? 16.711  92.802  -4.532  1.00 50.38  ? 423  ARG A CZ    1 
ATOM   3612  N  NH1   . ARG C 3 423  ? 16.070  93.605  -5.379  1.00 50.11  ? 423  ARG A NH1   1 
ATOM   3613  N  NH2   . ARG C 3 423  ? 18.044  92.793  -4.533  1.00 47.79  ? 423  ARG A NH2   1 
ATOM   3614  N  N     . TYR C 3 424  ? 11.928  91.276  0.477   1.00 29.87  ? 424  TYR A N     1 
ATOM   3615  C  CA    . TYR C 3 424  ? 12.343  91.422  1.859   1.00 29.89  ? 424  TYR A CA    1 
ATOM   3616  C  C     . TYR C 3 424  ? 11.524  90.644  2.879   1.00 28.83  ? 424  TYR A C     1 
ATOM   3617  O  O     . TYR C 3 424  ? 12.075  90.093  3.836   1.00 28.80  ? 424  TYR A O     1 
ATOM   3618  C  CB    . TYR C 3 424  ? 12.369  92.908  2.191   1.00 30.63  ? 424  TYR A CB    1 
ATOM   3619  C  CG    . TYR C 3 424  ? 13.282  93.634  1.247   1.00 31.54  ? 424  TYR A CG    1 
ATOM   3620  C  CD1   . TYR C 3 424  ? 14.653  93.388  1.267   1.00 30.57  ? 424  TYR A CD1   1 
ATOM   3621  C  CD2   . TYR C 3 424  ? 12.773  94.494  0.265   1.00 32.04  ? 424  TYR A CD2   1 
ATOM   3622  C  CE1   . TYR C 3 424  ? 15.499  93.971  0.331   1.00 32.62  ? 424  TYR A CE1   1 
ATOM   3623  C  CE2   . TYR C 3 424  ? 13.613  95.083  -0.680  1.00 30.31  ? 424  TYR A CE2   1 
ATOM   3624  C  CZ    . TYR C 3 424  ? 14.974  94.813  -0.641  1.00 32.32  ? 424  TYR A CZ    1 
ATOM   3625  O  OH    . TYR C 3 424  ? 15.822  95.351  -1.582  1.00 35.11  ? 424  TYR A OH    1 
ATOM   3626  N  N     . LEU C 3 425  ? 10.216  90.607  2.677   1.00 26.71  ? 425  LEU A N     1 
ATOM   3627  C  CA    . LEU C 3 425  ? 9.327   89.875  3.565   1.00 27.13  ? 425  LEU A CA    1 
ATOM   3628  C  C     . LEU C 3 425  ? 9.699   88.394  3.531   1.00 27.29  ? 425  LEU A C     1 
ATOM   3629  O  O     . LEU C 3 425  ? 9.710   87.702  4.553   1.00 27.54  ? 425  LEU A O     1 
ATOM   3630  C  CB    . LEU C 3 425  ? 7.878   90.042  3.098   1.00 25.13  ? 425  LEU A CB    1 
ATOM   3631  C  CG    . LEU C 3 425  ? 6.880   89.053  3.699   1.00 23.30  ? 425  LEU A CG    1 
ATOM   3632  C  CD1   . LEU C 3 425  ? 6.757   89.298  5.190   1.00 21.84  ? 425  LEU A CD1   1 
ATOM   3633  C  CD2   . LEU C 3 425  ? 5.537   89.204  3.015   1.00 23.15  ? 425  LEU A CD2   1 
ATOM   3634  N  N     . TYR C 3 426  ? 10.002  87.918  2.333   1.00 27.32  ? 426  TYR A N     1 
ATOM   3635  C  CA    . TYR C 3 426  ? 10.350  86.528  2.138   1.00 27.53  ? 426  TYR A CA    1 
ATOM   3636  C  C     . TYR C 3 426  ? 11.690  86.169  2.780   1.00 28.54  ? 426  TYR A C     1 
ATOM   3637  O  O     . TYR C 3 426  ? 11.826  85.116  3.394   1.00 28.29  ? 426  TYR A O     1 
ATOM   3638  C  CB    . TYR C 3 426  ? 10.363  86.228  0.638   1.00 25.65  ? 426  TYR A CB    1 
ATOM   3639  C  CG    . TYR C 3 426  ? 10.741  84.816  0.287   1.00 25.47  ? 426  TYR A CG    1 
ATOM   3640  C  CD1   . TYR C 3 426  ? 12.088  84.412  0.260   1.00 26.21  ? 426  TYR A CD1   1 
ATOM   3641  C  CD2   . TYR C 3 426  ? 9.761   83.877  -0.026  1.00 23.60  ? 426  TYR A CD2   1 
ATOM   3642  C  CE1   . TYR C 3 426  ? 12.439  83.098  -0.081  1.00 26.11  ? 426  TYR A CE1   1 
ATOM   3643  C  CE2   . TYR C 3 426  ? 10.097  82.567  -0.364  1.00 24.01  ? 426  TYR A CE2   1 
ATOM   3644  C  CZ    . TYR C 3 426  ? 11.433  82.185  -0.393  1.00 25.95  ? 426  TYR A CZ    1 
ATOM   3645  O  OH    . TYR C 3 426  ? 11.755  80.899  -0.748  1.00 26.37  ? 426  TYR A OH    1 
ATOM   3646  N  N     . ARG C 3 427  ? 12.669  87.053  2.648   1.00 29.82  ? 427  ARG A N     1 
ATOM   3647  C  CA    . ARG C 3 427  ? 13.996  86.810  3.195   1.00 32.36  ? 427  ARG A CA    1 
ATOM   3648  C  C     . ARG C 3 427  ? 13.976  86.660  4.720   1.00 31.79  ? 427  ARG A C     1 
ATOM   3649  O  O     . ARG C 3 427  ? 14.622  85.759  5.275   1.00 30.97  ? 427  ARG A O     1 
ATOM   3650  C  CB    . ARG C 3 427  ? 14.937  87.948  2.778   1.00 36.78  ? 427  ARG A CB    1 
ATOM   3651  C  CG    . ARG C 3 427  ? 16.435  87.650  2.947   1.00 44.52  ? 427  ARG A CG    1 
ATOM   3652  C  CD    . ARG C 3 427  ? 17.308  88.743  2.291   1.00 51.84  ? 427  ARG A CD    1 
ATOM   3653  N  NE    . ARG C 3 427  ? 17.035  88.885  0.853   1.00 55.96  ? 427  ARG A NE    1 
ATOM   3654  C  CZ    . ARG C 3 427  ? 17.651  89.746  0.042   1.00 57.81  ? 427  ARG A CZ    1 
ATOM   3655  N  NH1   . ARG C 3 427  ? 18.589  90.559  0.517   1.00 60.36  ? 427  ARG A NH1   1 
ATOM   3656  N  NH2   . ARG C 3 427  ? 17.333  89.792  -1.247  1.00 58.47  ? 427  ARG A NH2   1 
ATOM   3657  N  N     . THR C 3 428  ? 13.230  87.538  5.387   1.00 29.53  ? 428  THR A N     1 
ATOM   3658  C  CA    . THR C 3 428  ? 13.120  87.516  6.839   1.00 28.10  ? 428  THR A CA    1 
ATOM   3659  C  C     . THR C 3 428  ? 12.507  86.210  7.362   1.00 28.48  ? 428  THR A C     1 
ATOM   3660  O  O     . THR C 3 428  ? 13.064  85.569  8.259   1.00 28.29  ? 428  THR A O     1 
ATOM   3661  C  CB    . THR C 3 428  ? 12.286  88.713  7.328   1.00 27.94  ? 428  THR A CB    1 
ATOM   3662  O  OG1   . THR C 3 428  ? 12.978  89.924  7.000   1.00 29.82  ? 428  THR A OG1   1 
ATOM   3663  C  CG2   . THR C 3 428  ? 12.061  88.649  8.836   1.00 25.18  ? 428  THR A CG2   1 
ATOM   3664  N  N     . TRP C 3 429  ? 11.366  85.813  6.805   1.00 27.56  ? 429  TRP A N     1 
ATOM   3665  C  CA    . TRP C 3 429  ? 10.722  84.582  7.232   1.00 26.06  ? 429  TRP A CA    1 
ATOM   3666  C  C     . TRP C 3 429  ? 11.567  83.353  6.900   1.00 27.41  ? 429  TRP A C     1 
ATOM   3667  O  O     . TRP C 3 429  ? 11.571  82.372  7.644   1.00 28.43  ? 429  TRP A O     1 
ATOM   3668  C  CB    . TRP C 3 429  ? 9.338   84.463  6.601   1.00 23.71  ? 429  TRP A CB    1 
ATOM   3669  C  CG    . TRP C 3 429  ? 8.329   85.320  7.286   1.00 23.80  ? 429  TRP A CG    1 
ATOM   3670  C  CD1   . TRP C 3 429  ? 8.079   86.644  7.055   1.00 24.06  ? 429  TRP A CD1   1 
ATOM   3671  C  CD2   . TRP C 3 429  ? 7.470   84.936  8.369   1.00 23.33  ? 429  TRP A CD2   1 
ATOM   3672  N  NE1   . TRP C 3 429  ? 7.119   87.108  7.926   1.00 21.77  ? 429  TRP A NE1   1 
ATOM   3673  C  CE2   . TRP C 3 429  ? 6.730   86.081  8.744   1.00 23.05  ? 429  TRP A CE2   1 
ATOM   3674  C  CE3   . TRP C 3 429  ? 7.255   83.737  9.058   1.00 23.00  ? 429  TRP A CE3   1 
ATOM   3675  C  CZ2   . TRP C 3 429  ? 5.790   86.061  9.779   1.00 22.45  ? 429  TRP A CZ2   1 
ATOM   3676  C  CZ3   . TRP C 3 429  ? 6.315   83.716  10.088  1.00 23.21  ? 429  TRP A CZ3   1 
ATOM   3677  C  CH2   . TRP C 3 429  ? 5.597   84.872  10.435  1.00 23.92  ? 429  TRP A CH2   1 
ATOM   3678  N  N     . TYR C 3 430  ? 12.296  83.421  5.790   1.00 27.25  ? 430  TYR A N     1 
ATOM   3679  C  CA    . TYR C 3 430  ? 13.159  82.330  5.352   1.00 27.13  ? 430  TYR A CA    1 
ATOM   3680  C  C     . TYR C 3 430  ? 14.290  82.162  6.359   1.00 26.81  ? 430  TYR A C     1 
ATOM   3681  O  O     . TYR C 3 430  ? 14.564  81.063  6.839   1.00 25.84  ? 430  TYR A O     1 
ATOM   3682  C  CB    . TYR C 3 430  ? 13.742  82.661  3.973   1.00 27.17  ? 430  TYR A CB    1 
ATOM   3683  C  CG    . TYR C 3 430  ? 14.680  81.615  3.401   1.00 27.52  ? 430  TYR A CG    1 
ATOM   3684  C  CD1   . TYR C 3 430  ? 14.209  80.613  2.549   1.00 28.03  ? 430  TYR A CD1   1 
ATOM   3685  C  CD2   . TYR C 3 430  ? 16.044  81.638  3.702   1.00 28.50  ? 430  TYR A CD2   1 
ATOM   3686  C  CE1   . TYR C 3 430  ? 15.067  79.663  2.005   1.00 27.46  ? 430  TYR A CE1   1 
ATOM   3687  C  CE2   . TYR C 3 430  ? 16.910  80.694  3.166   1.00 29.62  ? 430  TYR A CE2   1 
ATOM   3688  C  CZ    . TYR C 3 430  ? 16.412  79.711  2.319   1.00 30.80  ? 430  TYR A CZ    1 
ATOM   3689  O  OH    . TYR C 3 430  ? 17.271  78.786  1.786   1.00 33.45  ? 430  TYR A OH    1 
ATOM   3690  N  N     . LEU C 3 431  ? 14.941  83.276  6.659   1.00 28.41  ? 431  LEU A N     1 
ATOM   3691  C  CA    . LEU C 3 431  ? 16.055  83.314  7.597   1.00 30.80  ? 431  LEU A CA    1 
ATOM   3692  C  C     . LEU C 3 431  ? 15.636  82.754  8.948   1.00 31.11  ? 431  LEU A C     1 
ATOM   3693  O  O     . LEU C 3 431  ? 16.265  81.829  9.482   1.00 31.52  ? 431  LEU A O     1 
ATOM   3694  C  CB    . LEU C 3 431  ? 16.524  84.757  7.779   1.00 33.12  ? 431  LEU A CB    1 
ATOM   3695  C  CG    . LEU C 3 431  ? 17.989  85.044  7.476   1.00 35.14  ? 431  LEU A CG    1 
ATOM   3696  C  CD1   . LEU C 3 431  ? 18.853  84.181  8.387   1.00 34.72  ? 431  LEU A CD1   1 
ATOM   3697  C  CD2   . LEU C 3 431  ? 18.276  84.763  5.987   1.00 37.07  ? 431  LEU A CD2   1 
ATOM   3698  N  N     . ALA C 3 432  ? 14.572  83.335  9.495   1.00 29.35  ? 432  ALA A N     1 
ATOM   3699  C  CA    . ALA C 3 432  ? 14.045  82.914  10.783  1.00 28.03  ? 432  ALA A CA    1 
ATOM   3700  C  C     . ALA C 3 432  ? 13.630  81.439  10.757  1.00 27.01  ? 432  ALA A C     1 
ATOM   3701  O  O     . ALA C 3 432  ? 13.867  80.718  11.721  1.00 26.71  ? 432  ALA A O     1 
ATOM   3702  C  CB    . ALA C 3 432  ? 12.868  83.793  11.166  1.00 26.83  ? 432  ALA A CB    1 
ATOM   3703  N  N     . ALA C 3 433  ? 13.021  80.998  9.655   1.00 26.11  ? 433  ALA A N     1 
ATOM   3704  C  CA    . ALA C 3 433  ? 12.593  79.606  9.517   1.00 25.91  ? 433  ALA A CA    1 
ATOM   3705  C  C     . ALA C 3 433  ? 13.790  78.668  9.677   1.00 26.34  ? 433  ALA A C     1 
ATOM   3706  O  O     . ALA C 3 433  ? 13.754  77.719  10.474  1.00 26.26  ? 433  ALA A O     1 
ATOM   3707  C  CB    . ALA C 3 433  ? 11.930  79.385  8.162   1.00 22.27  ? 433  ALA A CB    1 
ATOM   3708  N  N     . ALA C 3 434  ? 14.855  78.951  8.934   1.00 24.97  ? 434  ALA A N     1 
ATOM   3709  C  CA    . ALA C 3 434  ? 16.073  78.150  8.991   1.00 24.93  ? 434  ALA A CA    1 
ATOM   3710  C  C     . ALA C 3 434  ? 16.696  78.105  10.388  1.00 25.60  ? 434  ALA A C     1 
ATOM   3711  O  O     . ALA C 3 434  ? 17.050  77.034  10.879  1.00 26.76  ? 434  ALA A O     1 
ATOM   3712  C  CB    . ALA C 3 434  ? 17.101  78.689  7.979   1.00 23.39  ? 434  ALA A CB    1 
ATOM   3713  N  N     . ARG C 3 435  ? 16.843  79.262  11.024  1.00 25.98  ? 435  ARG A N     1 
ATOM   3714  C  CA    . ARG C 3 435  ? 17.442  79.319  12.355  1.00 27.35  ? 435  ARG A CA    1 
ATOM   3715  C  C     . ARG C 3 435  ? 16.605  78.576  13.389  1.00 29.04  ? 435  ARG A C     1 
ATOM   3716  O  O     . ARG C 3 435  ? 17.133  77.834  14.232  1.00 27.87  ? 435  ARG A O     1 
ATOM   3717  C  CB    . ARG C 3 435  ? 17.627  80.772  12.777  1.00 27.94  ? 435  ARG A CB    1 
ATOM   3718  C  CG    . ARG C 3 435  ? 18.533  81.520  11.828  1.00 30.25  ? 435  ARG A CG    1 
ATOM   3719  C  CD    . ARG C 3 435  ? 18.955  82.855  12.379  1.00 31.78  ? 435  ARG A CD    1 
ATOM   3720  N  NE    . ARG C 3 435  ? 19.825  83.539  11.435  1.00 33.59  ? 435  ARG A NE    1 
ATOM   3721  C  CZ    . ARG C 3 435  ? 20.199  84.805  11.555  1.00 34.90  ? 435  ARG A CZ    1 
ATOM   3722  N  NH1   . ARG C 3 435  ? 19.778  85.519  12.590  1.00 38.48  ? 435  ARG A NH1   1 
ATOM   3723  N  NH2   . ARG C 3 435  ? 20.966  85.361  10.628  1.00 35.03  ? 435  ARG A NH2   1 
ATOM   3724  N  N     . MET C 3 436  ? 15.294  78.783  13.320  1.00 29.17  ? 436  MET A N     1 
ATOM   3725  C  CA    . MET C 3 436  ? 14.378  78.118  14.228  1.00 29.47  ? 436  MET A CA    1 
ATOM   3726  C  C     . MET C 3 436  ? 14.511  76.593  14.050  1.00 29.79  ? 436  MET A C     1 
ATOM   3727  O  O     . MET C 3 436  ? 14.805  75.872  15.004  1.00 30.63  ? 436  MET A O     1 
ATOM   3728  C  CB    . MET C 3 436  ? 12.948  78.600  13.949  1.00 27.04  ? 436  MET A CB    1 
ATOM   3729  C  CG    . MET C 3 436  ? 11.868  77.855  14.691  1.00 26.22  ? 436  MET A CG    1 
ATOM   3730  S  SD    . MET C 3 436  ? 11.249  76.436  13.777  1.00 30.31  ? 436  MET A SD    1 
ATOM   3731  C  CE    . MET C 3 436  ? 11.874  75.174  14.705  1.00 29.99  ? 436  MET A CE    1 
ATOM   3732  N  N     . ALA C 3 437  ? 14.320  76.107  12.828  1.00 28.30  ? 437  ALA A N     1 
ATOM   3733  C  CA    . ALA C 3 437  ? 14.426  74.675  12.561  1.00 28.36  ? 437  ALA A CA    1 
ATOM   3734  C  C     . ALA C 3 437  ? 15.826  74.136  12.837  1.00 28.92  ? 437  ALA A C     1 
ATOM   3735  O  O     . ALA C 3 437  ? 16.013  72.922  12.972  1.00 28.36  ? 437  ALA A O     1 
ATOM   3736  C  CB    . ALA C 3 437  ? 14.045  74.379  11.113  1.00 27.63  ? 437  ALA A CB    1 
ATOM   3737  N  N     . ALA C 3 438  ? 16.810  75.028  12.914  1.00 28.59  ? 438  ALA A N     1 
ATOM   3738  C  CA    . ALA C 3 438  ? 18.182  74.596  13.159  1.00 30.02  ? 438  ALA A CA    1 
ATOM   3739  C  C     . ALA C 3 438  ? 18.441  74.355  14.635  1.00 31.12  ? 438  ALA A C     1 
ATOM   3740  O  O     . ALA C 3 438  ? 19.313  73.564  14.993  1.00 32.23  ? 438  ALA A O     1 
ATOM   3741  C  CB    . ALA C 3 438  ? 19.166  75.622  12.621  1.00 29.27  ? 438  ALA A CB    1 
ATOM   3742  N  N     . GLN C 3 439  ? 17.683  75.034  15.491  1.00 30.59  ? 439  GLN A N     1 
ATOM   3743  C  CA    . GLN C 3 439  ? 17.856  74.881  16.928  1.00 31.70  ? 439  GLN A CA    1 
ATOM   3744  C  C     . GLN C 3 439  ? 17.631  73.437  17.354  1.00 31.73  ? 439  GLN A C     1 
ATOM   3745  O  O     . GLN C 3 439  ? 16.677  72.800  16.919  1.00 33.28  ? 439  GLN A O     1 
ATOM   3746  C  CB    . GLN C 3 439  ? 16.887  75.790  17.673  1.00 31.20  ? 439  GLN A CB    1 
ATOM   3747  C  CG    . GLN C 3 439  ? 17.108  77.245  17.401  1.00 32.24  ? 439  GLN A CG    1 
ATOM   3748  C  CD    . GLN C 3 439  ? 16.169  78.109  18.192  1.00 34.90  ? 439  GLN A CD    1 
ATOM   3749  O  OE1   . GLN C 3 439  ? 14.952  77.962  18.098  1.00 37.43  ? 439  GLN A OE1   1 
ATOM   3750  N  NE2   . GLN C 3 439  ? 16.724  79.021  18.982  1.00 35.51  ? 439  GLN A NE2   1 
ATOM   3751  N  N     . PRO C 3 440  ? 18.514  72.901  18.208  1.00 31.77  ? 440  PRO A N     1 
ATOM   3752  C  CA    . PRO C 3 440  ? 18.389  71.518  18.681  1.00 31.43  ? 440  PRO A CA    1 
ATOM   3753  C  C     . PRO C 3 440  ? 17.118  71.269  19.496  1.00 31.30  ? 440  PRO A C     1 
ATOM   3754  O  O     . PRO C 3 440  ? 16.514  70.210  19.388  1.00 30.97  ? 440  PRO A O     1 
ATOM   3755  C  CB    . PRO C 3 440  ? 19.660  71.322  19.506  1.00 30.93  ? 440  PRO A CB    1 
ATOM   3756  C  CG    . PRO C 3 440  ? 20.642  72.247  18.834  1.00 29.57  ? 440  PRO A CG    1 
ATOM   3757  C  CD    . PRO C 3 440  ? 19.804  73.479  18.624  1.00 31.37  ? 440  PRO A CD    1 
ATOM   3758  N  N     . ARG C 3 441  ? 16.719  72.245  20.308  1.00 32.04  ? 441  ARG A N     1 
ATOM   3759  C  CA    . ARG C 3 441  ? 15.516  72.116  21.127  1.00 32.34  ? 441  ARG A CA    1 
ATOM   3760  C  C     . ARG C 3 441  ? 14.312  71.772  20.255  1.00 31.61  ? 441  ARG A C     1 
ATOM   3761  O  O     . ARG C 3 441  ? 13.467  70.969  20.629  1.00 33.15  ? 441  ARG A O     1 
ATOM   3762  C  CB    . ARG C 3 441  ? 15.247  73.415  21.895  1.00 34.95  ? 441  ARG A CB    1 
ATOM   3763  C  CG    . ARG C 3 441  ? 13.873  73.451  22.547  1.00 40.92  ? 441  ARG A CG    1 
ATOM   3764  C  CD    . ARG C 3 441  ? 13.631  74.662  23.445  1.00 44.74  ? 441  ARG A CD    1 
ATOM   3765  N  NE    . ARG C 3 441  ? 12.327  74.543  24.107  1.00 50.49  ? 441  ARG A NE    1 
ATOM   3766  C  CZ    . ARG C 3 441  ? 11.937  75.246  25.172  1.00 52.42  ? 441  ARG A CZ    1 
ATOM   3767  N  NH1   . ARG C 3 441  ? 12.748  76.144  25.723  1.00 53.06  ? 441  ARG A NH1   1 
ATOM   3768  N  NH2   . ARG C 3 441  ? 10.735  75.038  25.700  1.00 51.80  ? 441  ARG A NH2   1 
ATOM   3769  N  N     . THR C 3 442  ? 14.246  72.383  19.084  1.00 30.42  ? 442  THR A N     1 
ATOM   3770  C  CA    . THR C 3 442  ? 13.159  72.143  18.152  1.00 29.11  ? 442  THR A CA    1 
ATOM   3771  C  C     . THR C 3 442  ? 12.929  70.667  17.892  1.00 30.43  ? 442  THR A C     1 
ATOM   3772  O  O     . THR C 3 442  ? 11.805  70.251  17.638  1.00 32.25  ? 442  THR A O     1 
ATOM   3773  C  CB    . THR C 3 442  ? 13.437  72.825  16.809  1.00 26.44  ? 442  THR A CB    1 
ATOM   3774  O  OG1   . THR C 3 442  ? 13.262  74.233  16.964  1.00 23.99  ? 442  THR A OG1   1 
ATOM   3775  C  CG2   . THR C 3 442  ? 12.506  72.290  15.718  1.00 23.82  ? 442  THR A CG2   1 
ATOM   3776  N  N     . TRP C 3 443  ? 13.996  69.881  17.953  1.00 31.77  ? 443  TRP A N     1 
ATOM   3777  C  CA    . TRP C 3 443  ? 13.903  68.449  17.703  1.00 32.14  ? 443  TRP A CA    1 
ATOM   3778  C  C     . TRP C 3 443  ? 13.865  67.606  18.968  1.00 33.16  ? 443  TRP A C     1 
ATOM   3779  O  O     . TRP C 3 443  ? 14.121  66.402  18.932  1.00 33.95  ? 443  TRP A O     1 
ATOM   3780  C  CB    . TRP C 3 443  ? 15.064  68.022  16.805  1.00 31.85  ? 443  TRP A CB    1 
ATOM   3781  C  CG    . TRP C 3 443  ? 15.084  68.850  15.579  1.00 31.42  ? 443  TRP A CG    1 
ATOM   3782  C  CD1   . TRP C 3 443  ? 15.945  69.875  15.280  1.00 29.45  ? 443  TRP A CD1   1 
ATOM   3783  C  CD2   . TRP C 3 443  ? 14.102  68.833  14.545  1.00 29.71  ? 443  TRP A CD2   1 
ATOM   3784  N  NE1   . TRP C 3 443  ? 15.546  70.503  14.126  1.00 29.12  ? 443  TRP A NE1   1 
ATOM   3785  C  CE2   . TRP C 3 443  ? 14.416  69.884  13.653  1.00 29.62  ? 443  TRP A CE2   1 
ATOM   3786  C  CE3   . TRP C 3 443  ? 12.977  68.035  14.289  1.00 28.55  ? 443  TRP A CE3   1 
ATOM   3787  C  CZ2   . TRP C 3 443  ? 13.642  70.158  12.521  1.00 29.83  ? 443  TRP A CZ2   1 
ATOM   3788  C  CZ3   . TRP C 3 443  ? 12.208  68.307  13.167  1.00 29.35  ? 443  TRP A CZ3   1 
ATOM   3789  C  CH2   . TRP C 3 443  ? 12.545  69.363  12.294  1.00 29.52  ? 443  TRP A CH2   1 
ATOM   3790  N  N     . ASP C 3 444  ? 13.542  68.238  20.091  1.00 33.53  ? 444  ASP A N     1 
ATOM   3791  C  CA    . ASP C 3 444  ? 13.457  67.510  21.343  1.00 34.42  ? 444  ASP A CA    1 
ATOM   3792  C  C     . ASP C 3 444  ? 11.999  67.124  21.608  1.00 34.99  ? 444  ASP A C     1 
ATOM   3793  O  O     . ASP C 3 444  ? 11.103  67.976  21.590  1.00 34.80  ? 444  ASP A O     1 
ATOM   3794  C  CB    . ASP C 3 444  ? 13.989  68.349  22.506  1.00 34.85  ? 444  ASP A CB    1 
ATOM   3795  C  CG    . ASP C 3 444  ? 13.971  67.581  23.825  1.00 35.83  ? 444  ASP A CG    1 
ATOM   3796  O  OD1   . ASP C 3 444  ? 12.863  67.314  24.342  1.00 30.75  ? 444  ASP A OD1   1 
ATOM   3797  O  OD2   . ASP C 3 444  ? 15.069  67.233  24.331  1.00 37.31  ? 444  ASP A OD2   1 
ATOM   3798  N  N     . PRO C 3 445  ? 11.748  65.824  21.843  1.00 33.15  ? 445  PRO A N     1 
ATOM   3799  C  CA    . PRO C 3 445  ? 10.421  65.274  22.116  1.00 31.63  ? 445  PRO A CA    1 
ATOM   3800  C  C     . PRO C 3 445  ? 9.600   66.096  23.108  1.00 30.45  ? 445  PRO A C     1 
ATOM   3801  O  O     . PRO C 3 445  ? 8.384   66.179  22.990  1.00 31.93  ? 445  PRO A O     1 
ATOM   3802  C  CB    . PRO C 3 445  ? 10.742  63.881  22.635  1.00 33.78  ? 445  PRO A CB    1 
ATOM   3803  C  CG    . PRO C 3 445  ? 11.915  63.506  21.806  1.00 32.92  ? 445  PRO A CG    1 
ATOM   3804  C  CD    . PRO C 3 445  ? 12.760  64.752  21.826  1.00 32.05  ? 445  PRO A CD    1 
ATOM   3805  N  N     . LEU C 3 446  ? 10.262  66.694  24.090  1.00 29.84  ? 446  LEU A N     1 
ATOM   3806  C  CA    . LEU C 3 446  ? 9.560   67.500  25.082  1.00 28.61  ? 446  LEU A CA    1 
ATOM   3807  C  C     . LEU C 3 446  ? 8.989   68.749  24.446  1.00 27.50  ? 446  LEU A C     1 
ATOM   3808  O  O     . LEU C 3 446  ? 7.814   69.075  24.618  1.00 26.90  ? 446  LEU A O     1 
ATOM   3809  C  CB    . LEU C 3 446  ? 10.495  67.909  26.218  1.00 27.96  ? 446  LEU A CB    1 
ATOM   3810  C  CG    . LEU C 3 446  ? 9.845   68.792  27.295  1.00 29.06  ? 446  LEU A CG    1 
ATOM   3811  C  CD1   . LEU C 3 446  ? 8.588   68.124  27.810  1.00 27.08  ? 446  LEU A CD1   1 
ATOM   3812  C  CD2   . LEU C 3 446  ? 10.816  69.031  28.431  1.00 28.84  ? 446  LEU A CD2   1 
ATOM   3813  N  N     . PHE C 3 447  ? 9.847   69.451  23.720  1.00 28.38  ? 447  PHE A N     1 
ATOM   3814  C  CA    . PHE C 3 447  ? 9.473   70.678  23.037  1.00 27.38  ? 447  PHE A CA    1 
ATOM   3815  C  C     . PHE C 3 447  ? 8.268   70.437  22.137  1.00 27.73  ? 447  PHE A C     1 
ATOM   3816  O  O     . PHE C 3 447  ? 7.334   71.241  22.095  1.00 29.55  ? 447  PHE A O     1 
ATOM   3817  C  CB    . PHE C 3 447  ? 10.643  71.175  22.198  1.00 26.12  ? 447  PHE A CB    1 
ATOM   3818  C  CG    . PHE C 3 447  ? 10.348  72.436  21.452  1.00 27.47  ? 447  PHE A CG    1 
ATOM   3819  C  CD1   . PHE C 3 447  ? 10.173  73.634  22.134  1.00 28.92  ? 447  PHE A CD1   1 
ATOM   3820  C  CD2   . PHE C 3 447  ? 10.203  72.422  20.073  1.00 25.46  ? 447  PHE A CD2   1 
ATOM   3821  C  CE1   . PHE C 3 447  ? 9.856   74.795  21.455  1.00 29.05  ? 447  PHE A CE1   1 
ATOM   3822  C  CE2   . PHE C 3 447  ? 9.889   73.570  19.390  1.00 28.23  ? 447  PHE A CE2   1 
ATOM   3823  C  CZ    . PHE C 3 447  ? 9.713   74.766  20.081  1.00 28.82  ? 447  PHE A CZ    1 
ATOM   3824  N  N     . GLN C 3 448  ? 8.293   69.318  21.423  1.00 27.27  ? 448  GLN A N     1 
ATOM   3825  C  CA    . GLN C 3 448  ? 7.211   68.969  20.524  1.00 25.25  ? 448  GLN A CA    1 
ATOM   3826  C  C     . GLN C 3 448  ? 5.962   68.532  21.274  1.00 24.61  ? 448  GLN A C     1 
ATOM   3827  O  O     . GLN C 3 448  ? 4.849   68.595  20.741  1.00 24.38  ? 448  GLN A O     1 
ATOM   3828  C  CB    . GLN C 3 448  ? 7.666   67.874  19.580  1.00 25.31  ? 448  GLN A CB    1 
ATOM   3829  C  CG    . GLN C 3 448  ? 8.816   68.301  18.712  1.00 27.20  ? 448  GLN A CG    1 
ATOM   3830  C  CD    . GLN C 3 448  ? 9.134   67.284  17.639  1.00 28.03  ? 448  GLN A CD    1 
ATOM   3831  O  OE1   . GLN C 3 448  ? 10.199  67.335  17.017  1.00 28.26  ? 448  GLN A OE1   1 
ATOM   3832  N  NE2   . GLN C 3 448  ? 8.207   66.356  17.409  1.00 27.13  ? 448  GLN A NE2   1 
ATOM   3833  N  N     . ALA C 3 449  ? 6.143   68.075  22.505  1.00 23.89  ? 449  ALA A N     1 
ATOM   3834  C  CA    . ALA C 3 449  ? 5.001   67.669  23.309  1.00 25.60  ? 449  ALA A CA    1 
ATOM   3835  C  C     . ALA C 3 449  ? 4.341   68.967  23.788  1.00 26.39  ? 449  ALA A C     1 
ATOM   3836  O  O     . ALA C 3 449  ? 3.117   69.106  23.766  1.00 26.66  ? 449  ALA A O     1 
ATOM   3837  C  CB    . ALA C 3 449  ? 5.459   66.824  24.493  1.00 22.40  ? 449  ALA A CB    1 
ATOM   3838  N  N     . ILE C 3 450  ? 5.167   69.924  24.201  1.00 27.15  ? 450  ILE A N     1 
ATOM   3839  C  CA    . ILE C 3 450  ? 4.660   71.202  24.671  1.00 28.59  ? 450  ILE A CA    1 
ATOM   3840  C  C     . ILE C 3 450  ? 3.852   71.844  23.546  1.00 30.06  ? 450  ILE A C     1 
ATOM   3841  O  O     . ILE C 3 450  ? 2.768   72.385  23.770  1.00 31.85  ? 450  ILE A O     1 
ATOM   3842  C  CB    . ILE C 3 450  ? 5.826   72.133  25.109  1.00 27.36  ? 450  ILE A CB    1 
ATOM   3843  C  CG1   . ILE C 3 450  ? 6.488   71.563  26.369  1.00 26.96  ? 450  ILE A CG1   1 
ATOM   3844  C  CG2   . ILE C 3 450  ? 5.321   73.541  25.379  1.00 24.22  ? 450  ILE A CG2   1 
ATOM   3845  C  CD1   . ILE C 3 450  ? 7.680   72.375  26.887  1.00 24.32  ? 450  ILE A CD1   1 
ATOM   3846  N  N     . MET C 3 451  ? 4.372   71.754  22.328  1.00 30.16  ? 451  MET A N     1 
ATOM   3847  C  CA    . MET C 3 451  ? 3.700   72.328  21.171  1.00 29.73  ? 451  MET A CA    1 
ATOM   3848  C  C     . MET C 3 451  ? 2.417   71.586  20.829  1.00 30.44  ? 451  MET A C     1 
ATOM   3849  O  O     . MET C 3 451  ? 1.408   72.205  20.480  1.00 30.88  ? 451  MET A O     1 
ATOM   3850  C  CB    . MET C 3 451  ? 4.656   72.341  19.982  1.00 27.49  ? 451  MET A CB    1 
ATOM   3851  C  CG    . MET C 3 451  ? 5.768   73.349  20.140  1.00 27.46  ? 451  MET A CG    1 
ATOM   3852  S  SD    . MET C 3 451  ? 5.177   75.039  19.917  1.00 28.86  ? 451  MET A SD    1 
ATOM   3853  C  CE    . MET C 3 451  ? 4.360   75.386  21.473  1.00 31.27  ? 451  MET A CE    1 
ATOM   3854  N  N     . ARG C 3 452  ? 2.451   70.260  20.925  1.00 30.63  ? 452  ARG A N     1 
ATOM   3855  C  CA    . ARG C 3 452  ? 1.258   69.472  20.645  1.00 30.77  ? 452  ARG A CA    1 
ATOM   3856  C  C     . ARG C 3 452  ? 0.237   69.685  21.756  1.00 30.17  ? 452  ARG A C     1 
ATOM   3857  O  O     . ARG C 3 452  ? -0.961  69.480  21.548  1.00 30.72  ? 452  ARG A O     1 
ATOM   3858  C  CB    . ARG C 3 452  ? 1.587   67.977  20.550  1.00 29.16  ? 452  ARG A CB    1 
ATOM   3859  C  CG    . ARG C 3 452  ? 2.052   67.519  19.182  1.00 30.22  ? 452  ARG A CG    1 
ATOM   3860  C  CD    . ARG C 3 452  ? 2.533   66.078  19.238  1.00 30.72  ? 452  ARG A CD    1 
ATOM   3861  N  NE    . ARG C 3 452  ? 1.483   65.157  19.666  1.00 31.41  ? 452  ARG A NE    1 
ATOM   3862  C  CZ    . ARG C 3 452  ? 0.500   64.727  18.882  1.00 31.85  ? 452  ARG A CZ    1 
ATOM   3863  N  NH1   . ARG C 3 452  ? 0.428   65.131  17.622  1.00 33.12  ? 452  ARG A NH1   1 
ATOM   3864  N  NH2   . ARG C 3 452  ? -0.414  63.894  19.355  1.00 31.47  ? 452  ARG A NH2   1 
ATOM   3865  N  N     . SER C 3 453  ? 0.710   70.110  22.928  1.00 28.89  ? 453  SER A N     1 
ATOM   3866  C  CA    . SER C 3 453  ? -0.168  70.317  24.075  1.00 29.42  ? 453  SER A CA    1 
ATOM   3867  C  C     . SER C 3 453  ? -0.746  71.724  24.164  1.00 30.51  ? 453  SER A C     1 
ATOM   3868  O  O     . SER C 3 453  ? -1.710  71.952  24.899  1.00 30.69  ? 453  SER A O     1 
ATOM   3869  C  CB    . SER C 3 453  ? 0.574   70.020  25.377  1.00 29.54  ? 453  SER A CB    1 
ATOM   3870  O  OG    . SER C 3 453  ? 1.061   71.225  25.963  1.00 29.85  ? 453  SER A OG    1 
ATOM   3871  N  N     . GLN C 3 454  ? -0.159  72.666  23.430  1.00 30.26  ? 454  GLN A N     1 
ATOM   3872  C  CA    . GLN C 3 454  ? -0.636  74.042  23.468  1.00 30.20  ? 454  GLN A CA    1 
ATOM   3873  C  C     . GLN C 3 454  ? -2.126  74.158  23.160  1.00 29.62  ? 454  GLN A C     1 
ATOM   3874  O  O     . GLN C 3 454  ? -2.877  74.806  23.886  1.00 28.57  ? 454  GLN A O     1 
ATOM   3875  C  CB    . GLN C 3 454  ? 0.157   74.906  22.483  1.00 31.96  ? 454  GLN A CB    1 
ATOM   3876  C  CG    . GLN C 3 454  ? -0.339  76.339  22.392  1.00 32.71  ? 454  GLN A CG    1 
ATOM   3877  C  CD    . GLN C 3 454  ? 0.483   77.200  21.448  1.00 35.56  ? 454  GLN A CD    1 
ATOM   3878  O  OE1   . GLN C 3 454  ? 1.139   76.695  20.527  1.00 35.72  ? 454  GLN A OE1   1 
ATOM   3879  N  NE2   . GLN C 3 454  ? 0.432   78.516  21.659  1.00 35.38  ? 454  GLN A NE2   1 
ATOM   3880  N  N     . TYR C 3 455  ? -2.556  73.518  22.084  1.00 29.55  ? 455  TYR A N     1 
ATOM   3881  C  CA    . TYR C 3 455  ? -3.947  73.596  21.695  1.00 28.65  ? 455  TYR A CA    1 
ATOM   3882  C  C     . TYR C 3 455  ? -4.869  72.530  22.268  1.00 29.95  ? 455  TYR A C     1 
ATOM   3883  O  O     . TYR C 3 455  ? -6.033  72.461  21.891  1.00 30.89  ? 455  TYR A O     1 
ATOM   3884  C  CB    . TYR C 3 455  ? -4.037  73.631  20.178  1.00 26.81  ? 455  TYR A CB    1 
ATOM   3885  C  CG    . TYR C 3 455  ? -3.127  72.650  19.501  1.00 26.47  ? 455  TYR A CG    1 
ATOM   3886  C  CD1   . TYR C 3 455  ? -3.490  71.314  19.371  1.00 26.62  ? 455  TYR A CD1   1 
ATOM   3887  C  CD2   . TYR C 3 455  ? -1.901  73.058  18.975  1.00 26.03  ? 455  TYR A CD2   1 
ATOM   3888  C  CE1   . TYR C 3 455  ? -2.665  70.409  18.732  1.00 24.65  ? 455  TYR A CE1   1 
ATOM   3889  C  CE2   . TYR C 3 455  ? -1.063  72.154  18.330  1.00 24.41  ? 455  TYR A CE2   1 
ATOM   3890  C  CZ    . TYR C 3 455  ? -1.456  70.835  18.209  1.00 24.05  ? 455  TYR A CZ    1 
ATOM   3891  O  OH    . TYR C 3 455  ? -0.671  69.937  17.526  1.00 26.53  ? 455  TYR A OH    1 
ATOM   3892  N  N     . VAL C 3 456  ? -4.358  71.699  23.173  1.00 31.88  ? 456  VAL A N     1 
ATOM   3893  C  CA    . VAL C 3 456  ? -5.195  70.683  23.812  1.00 31.75  ? 456  VAL A CA    1 
ATOM   3894  C  C     . VAL C 3 456  ? -5.725  71.406  25.032  1.00 32.00  ? 456  VAL A C     1 
ATOM   3895  O  O     . VAL C 3 456  ? -5.077  71.424  26.073  1.00 32.15  ? 456  VAL A O     1 
ATOM   3896  C  CB    . VAL C 3 456  ? -4.380  69.455  24.265  1.00 32.57  ? 456  VAL A CB    1 
ATOM   3897  C  CG1   . VAL C 3 456  ? -5.271  68.479  25.062  1.00 31.10  ? 456  VAL A CG1   1 
ATOM   3898  C  CG2   . VAL C 3 456  ? -3.795  68.764  23.051  1.00 31.15  ? 456  VAL A CG2   1 
ATOM   3899  N  N     . THR C 3 457  ? -6.902  72.009  24.893  1.00 32.37  ? 457  THR A N     1 
ATOM   3900  C  CA    . THR C 3 457  ? -7.487  72.789  25.975  1.00 32.29  ? 457  THR A CA    1 
ATOM   3901  C  C     . THR C 3 457  ? -8.977  72.543  26.191  1.00 33.07  ? 457  THR A C     1 
ATOM   3902  O  O     . THR C 3 457  ? -9.659  71.941  25.355  1.00 32.49  ? 457  THR A O     1 
ATOM   3903  C  CB    . THR C 3 457  ? -7.303  74.303  25.709  1.00 32.54  ? 457  THR A CB    1 
ATOM   3904  O  OG1   . THR C 3 457  ? -8.123  74.697  24.600  1.00 32.05  ? 457  THR A OG1   1 
ATOM   3905  C  CG2   . THR C 3 457  ? -5.858  74.617  25.383  1.00 31.31  ? 457  THR A CG2   1 
ATOM   3906  N  N     . ALA C 3 458  ? -9.475  73.042  27.319  1.00 33.67  ? 458  ALA A N     1 
ATOM   3907  C  CA    . ALA C 3 458  ? -10.881 72.896  27.679  1.00 33.29  ? 458  ALA A CA    1 
ATOM   3908  C  C     . ALA C 3 458  ? -11.795 73.838  26.887  1.00 32.78  ? 458  ALA A C     1 
ATOM   3909  O  O     . ALA C 3 458  ? -12.992 73.915  27.152  1.00 33.44  ? 458  ALA A O     1 
ATOM   3910  C  CB    . ALA C 3 458  ? -11.058 73.124  29.174  1.00 31.53  ? 458  ALA A CB    1 
ATOM   3911  N  N     . ARG C 3 459  ? -11.234 74.554  25.921  1.00 32.65  ? 459  ARG A N     1 
ATOM   3912  C  CA    . ARG C 3 459  ? -12.037 75.455  25.102  1.00 33.26  ? 459  ARG A CA    1 
ATOM   3913  C  C     . ARG C 3 459  ? -12.456 74.739  23.813  1.00 32.10  ? 459  ARG A C     1 
ATOM   3914  O  O     . ARG C 3 459  ? -11.987 73.637  23.523  1.00 31.83  ? 459  ARG A O     1 
ATOM   3915  C  CB    . ARG C 3 459  ? -11.244 76.722  24.781  1.00 35.43  ? 459  ARG A CB    1 
ATOM   3916  C  CG    . ARG C 3 459  ? -10.726 77.450  26.010  1.00 37.56  ? 459  ARG A CG    1 
ATOM   3917  C  CD    . ARG C 3 459  ? -11.843 78.087  26.820  1.00 40.35  ? 459  ARG A CD    1 
ATOM   3918  N  NE    . ARG C 3 459  ? -11.342 78.564  28.110  1.00 45.22  ? 459  ARG A NE    1 
ATOM   3919  C  CZ    . ARG C 3 459  ? -12.093 79.128  29.057  1.00 47.33  ? 459  ARG A CZ    1 
ATOM   3920  N  NH1   . ARG C 3 459  ? -13.398 79.303  28.868  1.00 48.31  ? 459  ARG A NH1   1 
ATOM   3921  N  NH2   . ARG C 3 459  ? -11.539 79.496  30.208  1.00 47.09  ? 459  ARG A NH2   1 
ATOM   3922  N  N     . GLY C 3 460  ? -13.332 75.366  23.037  1.00 31.60  ? 460  GLY A N     1 
ATOM   3923  C  CA    . GLY C 3 460  ? -13.816 74.740  21.813  1.00 30.63  ? 460  GLY A CA    1 
ATOM   3924  C  C     . GLY C 3 460  ? -12.882 74.721  20.613  1.00 30.04  ? 460  GLY A C     1 
ATOM   3925  O  O     . GLY C 3 460  ? -11.925 75.491  20.525  1.00 30.94  ? 460  GLY A O     1 
ATOM   3926  N  N     . GLY C 3 461  ? -13.165 73.830  19.674  1.00 29.07  ? 461  GLY A N     1 
ATOM   3927  C  CA    . GLY C 3 461  ? -12.342 73.750  18.481  1.00 27.60  ? 461  GLY A CA    1 
ATOM   3928  C  C     . GLY C 3 461  ? -13.121 73.272  17.271  1.00 25.63  ? 461  GLY A C     1 
ATOM   3929  O  O     . GLY C 3 461  ? -12.601 72.498  16.474  1.00 24.46  ? 461  GLY A O     1 
ATOM   3930  N  N     . SER C 3 462  ? -14.363 73.739  17.140  1.00 26.14  ? 462  SER A N     1 
ATOM   3931  C  CA    . SER C 3 462  ? -15.245 73.371  16.029  1.00 26.42  ? 462  SER A CA    1 
ATOM   3932  C  C     . SER C 3 462  ? -15.367 71.851  15.955  1.00 28.03  ? 462  SER A C     1 
ATOM   3933  O  O     . SER C 3 462  ? -15.253 71.260  14.872  1.00 28.76  ? 462  SER A O     1 
ATOM   3934  C  CB    . SER C 3 462  ? -14.693 73.912  14.706  1.00 25.99  ? 462  SER A CB    1 
ATOM   3935  O  OG    . SER C 3 462  ? -14.438 75.305  14.777  1.00 27.09  ? 462  SER A OG    1 
ATOM   3936  N  N     . GLY C 3 463  ? -15.596 71.237  17.119  1.00 28.13  ? 463  GLY A N     1 
ATOM   3937  C  CA    . GLY C 3 463  ? -15.717 69.793  17.225  1.00 27.68  ? 463  GLY A CA    1 
ATOM   3938  C  C     . GLY C 3 463  ? -16.672 69.103  16.270  1.00 28.44  ? 463  GLY A C     1 
ATOM   3939  O  O     . GLY C 3 463  ? -16.330 68.086  15.668  1.00 28.45  ? 463  GLY A O     1 
ATOM   3940  N  N     . ALA C 3 464  ? -17.873 69.644  16.126  1.00 30.38  ? 464  ALA A N     1 
ATOM   3941  C  CA    . ALA C 3 464  ? -18.863 69.040  15.241  1.00 32.38  ? 464  ALA A CA    1 
ATOM   3942  C  C     . ALA C 3 464  ? -18.416 68.999  13.769  1.00 32.67  ? 464  ALA A C     1 
ATOM   3943  O  O     . ALA C 3 464  ? -18.499 67.951  13.111  1.00 31.36  ? 464  ALA A O     1 
ATOM   3944  C  CB    . ALA C 3 464  ? -20.188 69.784  15.369  1.00 32.69  ? 464  ALA A CB    1 
ATOM   3945  N  N     . ALA C 3 465  ? -17.948 70.136  13.262  1.00 31.80  ? 465  ALA A N     1 
ATOM   3946  C  CA    . ALA C 3 465  ? -17.494 70.220  11.879  1.00 32.37  ? 465  ALA A CA    1 
ATOM   3947  C  C     . ALA C 3 465  ? -16.356 69.225  11.596  1.00 33.07  ? 465  ALA A C     1 
ATOM   3948  O  O     . ALA C 3 465  ? -16.292 68.629  10.516  1.00 32.84  ? 465  ALA A O     1 
ATOM   3949  C  CB    . ALA C 3 465  ? -17.047 71.649  11.558  1.00 27.97  ? 465  ALA A CB    1 
ATOM   3950  N  N     . LEU C 3 466  ? -15.463 69.042  12.560  1.00 33.31  ? 466  LEU A N     1 
ATOM   3951  C  CA    . LEU C 3 466  ? -14.358 68.108  12.372  1.00 35.59  ? 466  LEU A CA    1 
ATOM   3952  C  C     . LEU C 3 466  ? -14.882 66.677  12.235  1.00 37.43  ? 466  LEU A C     1 
ATOM   3953  O  O     . LEU C 3 466  ? -14.456 65.922  11.354  1.00 35.49  ? 466  LEU A O     1 
ATOM   3954  C  CB    . LEU C 3 466  ? -13.375 68.193  13.549  1.00 34.03  ? 466  LEU A CB    1 
ATOM   3955  C  CG    . LEU C 3 466  ? -12.271 67.133  13.569  1.00 31.35  ? 466  LEU A CG    1 
ATOM   3956  C  CD1   . LEU C 3 466  ? -10.943 67.761  13.975  1.00 32.34  ? 466  LEU A CD1   1 
ATOM   3957  C  CD2   . LEU C 3 466  ? -12.669 66.016  14.513  1.00 30.05  ? 466  LEU A CD2   1 
ATOM   3958  N  N     . ARG C 3 467  ? -15.810 66.314  13.116  1.00 40.80  ? 467  ARG A N     1 
ATOM   3959  C  CA    . ARG C 3 467  ? -16.392 64.982  13.097  1.00 43.98  ? 467  ARG A CA    1 
ATOM   3960  C  C     . ARG C 3 467  ? -17.014 64.672  11.739  1.00 44.02  ? 467  ARG A C     1 
ATOM   3961  O  O     . ARG C 3 467  ? -16.898 63.551  11.236  1.00 43.91  ? 467  ARG A O     1 
ATOM   3962  C  CB    . ARG C 3 467  ? -17.453 64.843  14.197  1.00 46.63  ? 467  ARG A CB    1 
ATOM   3963  C  CG    . ARG C 3 467  ? -18.238 63.539  14.116  1.00 51.28  ? 467  ARG A CG    1 
ATOM   3964  C  CD    . ARG C 3 467  ? -18.243 62.794  15.444  1.00 56.07  ? 467  ARG A CD    1 
ATOM   3965  N  NE    . ARG C 3 467  ? -18.412 61.351  15.253  1.00 59.75  ? 467  ARG A NE    1 
ATOM   3966  C  CZ    . ARG C 3 467  ? -18.332 60.452  16.232  1.00 61.47  ? 467  ARG A CZ    1 
ATOM   3967  N  NH1   . ARG C 3 467  ? -18.087 60.846  17.478  1.00 61.76  ? 467  ARG A NH1   1 
ATOM   3968  N  NH2   . ARG C 3 467  ? -18.489 59.160  15.965  1.00 60.50  ? 467  ARG A NH2   1 
ATOM   3969  N  N     . GLU C 3 468  ? -17.659 65.667  11.139  1.00 44.04  ? 468  GLU A N     1 
ATOM   3970  C  CA    . GLU C 3 468  ? -18.294 65.461  9.850   1.00 44.25  ? 468  GLU A CA    1 
ATOM   3971  C  C     . GLU C 3 468  ? -17.350 65.569  8.663   1.00 43.26  ? 468  GLU A C     1 
ATOM   3972  O  O     . GLU C 3 468  ? -17.547 64.891  7.656   1.00 43.55  ? 468  GLU A O     1 
ATOM   3973  C  CB    . GLU C 3 468  ? -19.499 66.400  9.690   1.00 47.20  ? 468  GLU A CB    1 
ATOM   3974  C  CG    . GLU C 3 468  ? -19.315 67.812  10.220  1.00 51.58  ? 468  GLU A CG    1 
ATOM   3975  C  CD    . GLU C 3 468  ? -20.652 68.472  10.569  1.00 55.16  ? 468  GLU A CD    1 
ATOM   3976  O  OE1   . GLU C 3 468  ? -21.312 68.028  11.541  1.00 53.29  ? 468  GLU A OE1   1 
ATOM   3977  O  OE2   . GLU C 3 468  ? -21.047 69.430  9.864   1.00 56.98  ? 468  GLU A OE2   1 
ATOM   3978  N  N     . SER C 3 469  ? -16.318 66.398  8.764   1.00 41.79  ? 469  SER A N     1 
ATOM   3979  C  CA    . SER C 3 469  ? -15.384 66.499  7.652   1.00 41.18  ? 469  SER A CA    1 
ATOM   3980  C  C     . SER C 3 469  ? -14.655 65.160  7.587   1.00 40.50  ? 469  SER A C     1 
ATOM   3981  O  O     . SER C 3 469  ? -14.145 64.760  6.539   1.00 39.66  ? 469  SER A O     1 
ATOM   3982  C  CB    . SER C 3 469  ? -14.378 67.639  7.861   1.00 40.40  ? 469  SER A CB    1 
ATOM   3983  O  OG    . SER C 3 469  ? -13.348 67.278  8.763   1.00 42.20  ? 469  SER A OG    1 
ATOM   3984  N  N     . LEU C 3 470  ? -14.621 64.471  8.723   1.00 39.38  ? 470  LEU A N     1 
ATOM   3985  C  CA    . LEU C 3 470  ? -13.969 63.175  8.819   1.00 39.24  ? 470  LEU A CA    1 
ATOM   3986  C  C     . LEU C 3 470  ? -14.928 62.083  8.350   1.00 40.83  ? 470  LEU A C     1 
ATOM   3987  O  O     . LEU C 3 470  ? -14.524 61.113  7.709   1.00 41.29  ? 470  LEU A O     1 
ATOM   3988  C  CB    . LEU C 3 470  ? -13.534 62.928  10.258  1.00 36.27  ? 470  LEU A CB    1 
ATOM   3989  C  CG    . LEU C 3 470  ? -12.041 62.675  10.466  1.00 36.55  ? 470  LEU A CG    1 
ATOM   3990  C  CD1   . LEU C 3 470  ? -11.213 63.733  9.763   1.00 33.03  ? 470  LEU A CD1   1 
ATOM   3991  C  CD2   . LEU C 3 470  ? -11.746 62.667  11.951  1.00 34.58  ? 470  LEU A CD2   1 
ATOM   3992  N  N     . TYR C 3 471  ? -16.206 62.252  8.668   1.00 42.39  ? 471  TYR A N     1 
ATOM   3993  C  CA    . TYR C 3 471  ? -17.230 61.300  8.260   1.00 43.19  ? 471  TYR A CA    1 
ATOM   3994  C  C     . TYR C 3 471  ? -17.272 61.232  6.727   1.00 42.96  ? 471  TYR A C     1 
ATOM   3995  O  O     . TYR C 3 471  ? -17.570 60.187  6.139   1.00 42.16  ? 471  TYR A O     1 
ATOM   3996  C  CB    . TYR C 3 471  ? -18.583 61.738  8.845   1.00 45.09  ? 471  TYR A CB    1 
ATOM   3997  C  CG    . TYR C 3 471  ? -19.797 61.127  8.184   1.00 50.18  ? 471  TYR A CG    1 
ATOM   3998  C  CD1   . TYR C 3 471  ? -20.248 61.602  6.947   1.00 53.28  ? 471  TYR A CD1   1 
ATOM   3999  C  CD2   . TYR C 3 471  ? -20.492 60.071  8.778   1.00 50.02  ? 471  TYR A CD2   1 
ATOM   4000  C  CE1   . TYR C 3 471  ? -21.357 61.040  6.315   1.00 54.31  ? 471  TYR A CE1   1 
ATOM   4001  C  CE2   . TYR C 3 471  ? -21.606 59.503  8.155   1.00 51.92  ? 471  TYR A CE2   1 
ATOM   4002  C  CZ    . TYR C 3 471  ? -22.031 59.993  6.921   1.00 53.65  ? 471  TYR A CZ    1 
ATOM   4003  O  OH    . TYR C 3 471  ? -23.115 59.446  6.274   1.00 53.46  ? 471  TYR A OH    1 
ATOM   4004  N  N     . ALA C 3 472  ? -16.945 62.353  6.093   1.00 43.46  ? 472  ALA A N     1 
ATOM   4005  C  CA    . ALA C 3 472  ? -16.936 62.465  4.639   1.00 43.60  ? 472  ALA A CA    1 
ATOM   4006  C  C     . ALA C 3 472  ? -15.939 61.528  3.958   1.00 43.90  ? 472  ALA A C     1 
ATOM   4007  O  O     . ALA C 3 472  ? -16.022 61.310  2.751   1.00 43.75  ? 472  ALA A O     1 
ATOM   4008  C  CB    . ALA C 3 472  ? -16.647 63.903  4.235   1.00 41.99  ? 472  ALA A CB    1 
ATOM   4009  N  N     . ILE C 3 473  ? -14.987 60.998  4.723   1.00 44.16  ? 473  ILE A N     1 
ATOM   4010  C  CA    . ILE C 3 473  ? -13.992 60.072  4.178   1.00 43.28  ? 473  ILE A CA    1 
ATOM   4011  C  C     . ILE C 3 473  ? -14.078 58.750  4.933   1.00 44.09  ? 473  ILE A C     1 
ATOM   4012  O  O     . ILE C 3 473  ? -13.127 57.970  4.978   1.00 42.98  ? 473  ILE A O     1 
ATOM   4013  C  CB    . ILE C 3 473  ? -12.546 60.631  4.276   1.00 41.91  ? 473  ILE A CB    1 
ATOM   4014  C  CG1   . ILE C 3 473  ? -12.124 60.781  5.739   1.00 40.56  ? 473  ILE A CG1   1 
ATOM   4015  C  CG2   . ILE C 3 473  ? -12.460 61.964  3.556   1.00 42.04  ? 473  ILE A CG2   1 
ATOM   4016  C  CD1   . ILE C 3 473  ? -10.687 61.231  5.910   1.00 39.35  ? 473  ILE A CD1   1 
ATOM   4017  N  N     . ASN C 3 474  ? -15.240 58.524  5.536   1.00 45.29  ? 474  ASN A N     1 
ATOM   4018  C  CA    . ASN C 3 474  ? -15.525 57.304  6.273   1.00 46.69  ? 474  ASN A CA    1 
ATOM   4019  C  C     . ASN C 3 474  ? -14.569 57.005  7.425   1.00 46.75  ? 474  ASN A C     1 
ATOM   4020  O  O     . ASN C 3 474  ? -14.071 55.888  7.561   1.00 46.36  ? 474  ASN A O     1 
ATOM   4021  C  CB    . ASN C 3 474  ? -15.558 56.127  5.299   1.00 49.48  ? 474  ASN A CB    1 
ATOM   4022  C  CG    . ASN C 3 474  ? -16.511 55.044  5.739   1.00 52.50  ? 474  ASN A CG    1 
ATOM   4023  O  OD1   . ASN C 3 474  ? -16.171 54.191  6.561   1.00 54.98  ? 474  ASN A OD1   1 
ATOM   4024  N  ND2   . ASN C 3 474  ? -17.728 55.083  5.206   1.00 54.38  ? 474  ASN A ND2   1 
ATOM   4025  N  N     . VAL C 3 475  ? -14.320 58.007  8.259   1.00 46.27  ? 475  VAL A N     1 
ATOM   4026  C  CA    . VAL C 3 475  ? -13.448 57.834  9.409   1.00 45.15  ? 475  VAL A CA    1 
ATOM   4027  C  C     . VAL C 3 475  ? -14.185 58.292  10.660  1.00 45.54  ? 475  VAL A C     1 
ATOM   4028  O  O     . VAL C 3 475  ? -14.264 59.492  10.927  1.00 45.60  ? 475  VAL A O     1 
ATOM   4029  C  CB    . VAL C 3 475  ? -12.164 58.657  9.261   1.00 43.47  ? 475  VAL A CB    1 
ATOM   4030  C  CG1   . VAL C 3 475  ? -11.343 58.565  10.525  1.00 42.39  ? 475  VAL A CG1   1 
ATOM   4031  C  CG2   . VAL C 3 475  ? -11.374 58.152  8.085   1.00 42.85  ? 475  VAL A CG2   1 
ATOM   4032  N  N     . SER C 3 476  ? -14.729 57.336  11.414  1.00 45.04  ? 476  SER A N     1 
ATOM   4033  C  CA    . SER C 3 476  ? -15.464 57.646  12.640  1.00 46.38  ? 476  SER A CA    1 
ATOM   4034  C  C     . SER C 3 476  ? -14.580 57.615  13.887  1.00 46.26  ? 476  SER A C     1 
ATOM   4035  O  O     . SER C 3 476  ? -13.840 56.655  14.135  1.00 47.25  ? 476  SER A O     1 
ATOM   4036  C  CB    . SER C 3 476  ? -16.649 56.689  12.807  1.00 47.68  ? 476  SER A CB    1 
ATOM   4037  O  OG    . SER C 3 476  ? -16.326 55.387  12.343  1.00 50.41  ? 476  SER A OG    1 
ATOM   4038  N  N     . LEU C 3 477  ? -14.669 58.683  14.668  1.00 44.70  ? 477  LEU A N     1 
ATOM   4039  C  CA    . LEU C 3 477  ? -13.885 58.829  15.884  1.00 43.17  ? 477  LEU A CA    1 
ATOM   4040  C  C     . LEU C 3 477  ? -14.571 58.187  17.088  1.00 42.28  ? 477  LEU A C     1 
ATOM   4041  O  O     . LEU C 3 477  ? -15.787 57.981  17.088  1.00 42.35  ? 477  LEU A O     1 
ATOM   4042  C  CB    . LEU C 3 477  ? -13.681 60.311  16.163  1.00 43.34  ? 477  LEU A CB    1 
ATOM   4043  C  CG    . LEU C 3 477  ? -13.183 61.160  14.999  1.00 42.98  ? 477  LEU A CG    1 
ATOM   4044  C  CD1   . LEU C 3 477  ? -13.397 62.636  15.319  1.00 43.40  ? 477  LEU A CD1   1 
ATOM   4045  C  CD2   . LEU C 3 477  ? -11.709 60.859  14.743  1.00 42.18  ? 477  LEU A CD2   1 
ATOM   4046  N  N     . PRO C 3 478  ? -13.799 57.862  18.137  1.00 41.64  ? 478  PRO A N     1 
ATOM   4047  C  CA    . PRO C 3 478  ? -14.389 57.252  19.331  1.00 40.51  ? 478  PRO A CA    1 
ATOM   4048  C  C     . PRO C 3 478  ? -15.337 58.273  19.938  1.00 40.80  ? 478  PRO A C     1 
ATOM   4049  O  O     . PRO C 3 478  ? -15.045 59.471  19.935  1.00 39.67  ? 478  PRO A O     1 
ATOM   4050  C  CB    . PRO C 3 478  ? -13.184 57.012  20.237  1.00 39.27  ? 478  PRO A CB    1 
ATOM   4051  C  CG    . PRO C 3 478  ? -12.055 56.878  19.293  1.00 41.16  ? 478  PRO A CG    1 
ATOM   4052  C  CD    . PRO C 3 478  ? -12.338 57.955  18.272  1.00 42.30  ? 478  PRO A CD    1 
ATOM   4053  N  N     . ASP C 3 479  ? -16.472 57.816  20.452  1.00 42.11  ? 479  ASP A N     1 
ATOM   4054  C  CA    . ASP C 3 479  ? -17.416 58.743  21.057  1.00 42.70  ? 479  ASP A CA    1 
ATOM   4055  C  C     . ASP C 3 479  ? -17.324 58.698  22.584  1.00 41.91  ? 479  ASP A C     1 
ATOM   4056  O  O     . ASP C 3 479  ? -17.842 59.583  23.266  1.00 41.39  ? 479  ASP A O     1 
ATOM   4057  C  CB    . ASP C 3 479  ? -18.842 58.439  20.577  1.00 43.78  ? 479  ASP A CB    1 
ATOM   4058  C  CG    . ASP C 3 479  ? -19.385 57.140  21.129  1.00 46.28  ? 479  ASP A CG    1 
ATOM   4059  O  OD1   . ASP C 3 479  ? -18.576 56.274  21.534  1.00 46.88  ? 479  ASP A OD1   1 
ATOM   4060  O  OD2   . ASP C 3 479  ? -20.627 56.980  21.146  1.00 48.07  ? 479  ASP A OD2   1 
ATOM   4061  N  N     . PHE C 3 480  ? -16.639 57.682  23.111  1.00 41.99  ? 480  PHE A N     1 
ATOM   4062  C  CA    . PHE C 3 480  ? -16.476 57.528  24.559  1.00 41.72  ? 480  PHE A CA    1 
ATOM   4063  C  C     . PHE C 3 480  ? -17.846 57.639  25.224  1.00 41.50  ? 480  PHE A C     1 
ATOM   4064  O  O     . PHE C 3 480  ? -18.016 58.391  26.186  1.00 41.47  ? 480  PHE A O     1 
ATOM   4065  C  CB    . PHE C 3 480  ? -15.550 58.629  25.120  1.00 41.46  ? 480  PHE A CB    1 
ATOM   4066  C  CG    . PHE C 3 480  ? -14.156 58.617  24.547  1.00 40.21  ? 480  PHE A CG    1 
ATOM   4067  C  CD1   . PHE C 3 480  ? -13.254 57.619  24.892  1.00 39.07  ? 480  PHE A CD1   1 
ATOM   4068  C  CD2   . PHE C 3 480  ? -13.751 59.603  23.651  1.00 41.00  ? 480  PHE A CD2   1 
ATOM   4069  C  CE1   . PHE C 3 480  ? -11.968 57.598  24.356  1.00 38.70  ? 480  PHE A CE1   1 
ATOM   4070  C  CE2   . PHE C 3 480  ? -12.463 59.591  23.106  1.00 40.01  ? 480  PHE A CE2   1 
ATOM   4071  C  CZ    . PHE C 3 480  ? -11.570 58.584  23.462  1.00 38.77  ? 480  PHE A CZ    1 
ATOM   4072  N  N     . LYS C 3 481  ? -18.827 56.902  24.715  1.00 41.78  ? 481  LYS A N     1 
ATOM   4073  C  CA    . LYS C 3 481  ? -20.165 56.978  25.280  1.00 43.39  ? 481  LYS A CA    1 
ATOM   4074  C  C     . LYS C 3 481  ? -20.186 56.720  26.783  1.00 44.51  ? 481  LYS A C     1 
ATOM   4075  O  O     . LYS C 3 481  ? -19.737 55.669  27.256  1.00 45.40  ? 481  LYS A O     1 
ATOM   4076  C  CB    . LYS C 3 481  ? -21.113 56.001  24.580  1.00 44.37  ? 481  LYS A CB    1 
ATOM   4077  C  CG    . LYS C 3 481  ? -22.549 56.077  25.111  1.00 46.85  ? 481  LYS A CG    1 
ATOM   4078  C  CD    . LYS C 3 481  ? -23.538 55.287  24.263  1.00 47.48  ? 481  LYS A CD    1 
ATOM   4079  C  CE    . LYS C 3 481  ? -24.969 55.481  24.755  1.00 47.29  ? 481  LYS A CE    1 
ATOM   4080  N  NZ    . LYS C 3 481  ? -25.976 54.890  23.824  1.00 47.22  ? 481  LYS A NZ    1 
ATOM   4081  N  N     . GLY C 3 482  ? -20.691 57.700  27.530  1.00 44.19  ? 482  GLY A N     1 
ATOM   4082  C  CA    . GLY C 3 482  ? -20.785 57.552  28.969  1.00 44.99  ? 482  GLY A CA    1 
ATOM   4083  C  C     . GLY C 3 482  ? -19.867 58.377  29.853  1.00 45.68  ? 482  GLY A C     1 
ATOM   4084  O  O     . GLY C 3 482  ? -19.965 58.276  31.082  1.00 45.49  ? 482  GLY A O     1 
ATOM   4085  N  N     . LEU C 3 483  ? -18.976 59.178  29.269  1.00 45.65  ? 483  LEU A N     1 
ATOM   4086  C  CA    . LEU C 3 483  ? -18.073 59.997  30.083  1.00 46.62  ? 483  LEU A CA    1 
ATOM   4087  C  C     . LEU C 3 483  ? -18.649 61.364  30.458  1.00 47.35  ? 483  LEU A C     1 
ATOM   4088  O  O     . LEU C 3 483  ? -19.207 62.064  29.616  1.00 47.00  ? 483  LEU A O     1 
ATOM   4089  C  CB    . LEU C 3 483  ? -16.732 60.183  29.383  1.00 47.04  ? 483  LEU A CB    1 
ATOM   4090  C  CG    . LEU C 3 483  ? -15.639 59.218  29.834  1.00 46.30  ? 483  LEU A CG    1 
ATOM   4091  C  CD1   . LEU C 3 483  ? -14.351 59.581  29.132  1.00 47.91  ? 483  LEU A CD1   1 
ATOM   4092  C  CD2   . LEU C 3 483  ? -15.452 59.303  31.334  1.00 46.85  ? 483  LEU A CD2   1 
ATOM   4093  N  N     . PRO C 3 484  ? -18.518 61.752  31.741  1.00 48.12  ? 484  PRO A N     1 
ATOM   4094  C  CA    . PRO C 3 484  ? -18.997 63.015  32.325  1.00 48.30  ? 484  PRO A CA    1 
ATOM   4095  C  C     . PRO C 3 484  ? -18.228 64.287  31.933  1.00 48.39  ? 484  PRO A C     1 
ATOM   4096  O  O     . PRO C 3 484  ? -18.241 65.289  32.669  1.00 49.31  ? 484  PRO A O     1 
ATOM   4097  C  CB    . PRO C 3 484  ? -18.918 62.751  33.832  1.00 49.33  ? 484  PRO A CB    1 
ATOM   4098  C  CG    . PRO C 3 484  ? -18.969 61.257  33.937  1.00 49.94  ? 484  PRO A CG    1 
ATOM   4099  C  CD    . PRO C 3 484  ? -18.079 60.839  32.806  1.00 48.50  ? 484  PRO A CD    1 
ATOM   4100  N  N     . VAL C 3 485  ? -17.566 64.249  30.781  1.00 45.71  ? 485  VAL A N     1 
ATOM   4101  C  CA    . VAL C 3 485  ? -16.812 65.397  30.299  1.00 42.95  ? 485  VAL A CA    1 
ATOM   4102  C  C     . VAL C 3 485  ? -17.553 66.061  29.148  1.00 41.75  ? 485  VAL A C     1 
ATOM   4103  O  O     . VAL C 3 485  ? -18.383 65.430  28.495  1.00 41.59  ? 485  VAL A O     1 
ATOM   4104  C  CB    . VAL C 3 485  ? -15.435 64.968  29.785  1.00 42.55  ? 485  VAL A CB    1 
ATOM   4105  C  CG1   . VAL C 3 485  ? -14.602 64.429  30.933  1.00 41.59  ? 485  VAL A CG1   1 
ATOM   4106  C  CG2   . VAL C 3 485  ? -15.601 63.909  28.697  1.00 41.47  ? 485  VAL A CG2   1 
ATOM   4107  N  N     . LYS C 3 486  ? -17.256 67.335  28.909  1.00 39.36  ? 486  LYS A N     1 
ATOM   4108  C  CA    . LYS C 3 486  ? -17.874 68.063  27.807  1.00 37.29  ? 486  LYS A CA    1 
ATOM   4109  C  C     . LYS C 3 486  ? -17.212 67.622  26.500  1.00 36.42  ? 486  LYS A C     1 
ATOM   4110  O  O     . LYS C 3 486  ? -15.988 67.642  26.377  1.00 37.03  ? 486  LYS A O     1 
ATOM   4111  C  CB    . LYS C 3 486  ? -17.684 69.571  27.984  1.00 36.71  ? 486  LYS A CB    1 
ATOM   4112  C  CG    . LYS C 3 486  ? -18.209 70.376  26.809  1.00 36.68  ? 486  LYS A CG    1 
ATOM   4113  C  CD    . LYS C 3 486  ? -18.092 71.873  27.035  1.00 37.99  ? 486  LYS A CD    1 
ATOM   4114  C  CE    . LYS C 3 486  ? -18.716 72.632  25.866  1.00 38.82  ? 486  LYS A CE    1 
ATOM   4115  N  NZ    . LYS C 3 486  ? -18.844 74.099  26.116  1.00 39.06  ? 486  LYS A NZ    1 
ATOM   4116  N  N     . ALA C 3 487  ? -18.016 67.236  25.518  1.00 35.20  ? 487  ALA A N     1 
ATOM   4117  C  CA    . ALA C 3 487  ? -17.478 66.784  24.236  1.00 33.58  ? 487  ALA A CA    1 
ATOM   4118  C  C     . ALA C 3 487  ? -16.938 67.898  23.333  1.00 32.23  ? 487  ALA A C     1 
ATOM   4119  O  O     . ALA C 3 487  ? -16.029 67.668  22.542  1.00 32.34  ? 487  ALA A O     1 
ATOM   4120  C  CB    . ALA C 3 487  ? -18.537 65.972  23.489  1.00 32.86  ? 487  ALA A CB    1 
ATOM   4121  N  N     . ALA C 3 488  ? -17.489 69.101  23.445  1.00 32.56  ? 488  ALA A N     1 
ATOM   4122  C  CA    . ALA C 3 488  ? -17.037 70.213  22.611  1.00 31.49  ? 488  ALA A CA    1 
ATOM   4123  C  C     . ALA C 3 488  ? -15.766 70.893  23.137  1.00 31.55  ? 488  ALA A C     1 
ATOM   4124  O  O     . ALA C 3 488  ? -15.716 72.113  23.304  1.00 33.04  ? 488  ALA A O     1 
ATOM   4125  C  CB    . ALA C 3 488  ? -18.164 71.241  22.454  1.00 29.11  ? 488  ALA A CB    1 
ATOM   4126  N  N     . THR C 3 489  ? -14.740 70.100  23.414  1.00 30.58  ? 489  THR A N     1 
ATOM   4127  C  CA    . THR C 3 489  ? -13.475 70.652  23.874  1.00 29.64  ? 489  THR A CA    1 
ATOM   4128  C  C     . THR C 3 489  ? -12.376 70.046  23.021  1.00 28.80  ? 489  THR A C     1 
ATOM   4129  O  O     . THR C 3 489  ? -12.500 68.910  22.568  1.00 28.67  ? 489  THR A O     1 
ATOM   4130  C  CB    . THR C 3 489  ? -13.183 70.318  25.357  1.00 30.14  ? 489  THR A CB    1 
ATOM   4131  O  OG1   . THR C 3 489  ? -13.192 68.900  25.545  1.00 29.30  ? 489  THR A OG1   1 
ATOM   4132  C  CG2   . THR C 3 489  ? -14.215 70.965  26.266  1.00 28.33  ? 489  THR A CG2   1 
ATOM   4133  N  N     . LYS C 3 490  ? -11.309 70.804  22.787  1.00 28.10  ? 490  LYS A N     1 
ATOM   4134  C  CA    . LYS C 3 490  ? -10.200 70.293  21.995  1.00 27.83  ? 490  LYS A CA    1 
ATOM   4135  C  C     . LYS C 3 490  ? -9.565  69.118  22.730  1.00 29.09  ? 490  LYS A C     1 
ATOM   4136  O  O     . LYS C 3 490  ? -8.907  68.278  22.118  1.00 29.81  ? 490  LYS A O     1 
ATOM   4137  C  CB    . LYS C 3 490  ? -9.180  71.405  21.712  1.00 25.02  ? 490  LYS A CB    1 
ATOM   4138  C  CG    . LYS C 3 490  ? -9.623  72.320  20.562  1.00 22.49  ? 490  LYS A CG    1 
ATOM   4139  C  CD    . LYS C 3 490  ? -8.531  73.278  20.105  1.00 22.09  ? 490  LYS A CD    1 
ATOM   4140  C  CE    . LYS C 3 490  ? -8.321  74.424  21.079  1.00 21.52  ? 490  LYS A CE    1 
ATOM   4141  N  NZ    . LYS C 3 490  ? -9.616  75.078  21.460  1.00 19.98  ? 490  LYS A NZ    1 
ATOM   4142  N  N     . ILE C 3 491  ? -9.793  69.054  24.042  1.00 30.26  ? 491  ILE A N     1 
ATOM   4143  C  CA    . ILE C 3 491  ? -9.284  67.965  24.871  1.00 31.00  ? 491  ILE A CA    1 
ATOM   4144  C  C     . ILE C 3 491  ? -9.980  66.664  24.449  1.00 32.98  ? 491  ILE A C     1 
ATOM   4145  O  O     . ILE C 3 491  ? -9.345  65.606  24.353  1.00 33.84  ? 491  ILE A O     1 
ATOM   4146  C  CB    . ILE C 3 491  ? -9.560  68.237  26.371  1.00 29.56  ? 491  ILE A CB    1 
ATOM   4147  C  CG1   . ILE C 3 491  ? -8.676  69.389  26.849  1.00 26.72  ? 491  ILE A CG1   1 
ATOM   4148  C  CG2   . ILE C 3 491  ? -9.321  66.968  27.201  1.00 27.26  ? 491  ILE A CG2   1 
ATOM   4149  C  CD1   . ILE C 3 491  ? -8.868  69.748  28.306  1.00 25.72  ? 491  ILE A CD1   1 
ATOM   4150  N  N     . PHE C 3 492  ? -11.287 66.755  24.204  1.00 32.26  ? 492  PHE A N     1 
ATOM   4151  C  CA    . PHE C 3 492  ? -12.078 65.610  23.761  1.00 32.61  ? 492  PHE A CA    1 
ATOM   4152  C  C     . PHE C 3 492  ? -11.550 65.256  22.374  1.00 32.59  ? 492  PHE A C     1 
ATOM   4153  O  O     . PHE C 3 492  ? -11.346 64.083  22.048  1.00 32.96  ? 492  PHE A O     1 
ATOM   4154  C  CB    . PHE C 3 492  ? -13.562 65.992  23.667  1.00 32.90  ? 492  PHE A CB    1 
ATOM   4155  C  CG    . PHE C 3 492  ? -14.497 64.816  23.554  1.00 33.26  ? 492  PHE A CG    1 
ATOM   4156  C  CD1   . PHE C 3 492  ? -14.688 63.952  24.631  1.00 34.74  ? 492  PHE A CD1   1 
ATOM   4157  C  CD2   . PHE C 3 492  ? -15.209 64.585  22.377  1.00 34.54  ? 492  PHE A CD2   1 
ATOM   4158  C  CE1   . PHE C 3 492  ? -15.581 62.871  24.545  1.00 35.14  ? 492  PHE A CE1   1 
ATOM   4159  C  CE2   . PHE C 3 492  ? -16.103 63.511  22.272  1.00 34.82  ? 492  PHE A CE2   1 
ATOM   4160  C  CZ    . PHE C 3 492  ? -16.290 62.651  23.363  1.00 35.76  ? 492  PHE A CZ    1 
ATOM   4161  N  N     . GLN C 3 493  ? -11.324 66.289  21.564  1.00 31.23  ? 493  GLN A N     1 
ATOM   4162  C  CA    . GLN C 3 493  ? -10.810 66.111  20.213  1.00 28.92  ? 493  GLN A CA    1 
ATOM   4163  C  C     . GLN C 3 493  ? -9.508  65.349  20.232  1.00 28.64  ? 493  GLN A C     1 
ATOM   4164  O  O     . GLN C 3 493  ? -9.306  64.442  19.433  1.00 29.03  ? 493  GLN A O     1 
ATOM   4165  C  CB    . GLN C 3 493  ? -10.575 67.466  19.533  1.00 27.99  ? 493  GLN A CB    1 
ATOM   4166  C  CG    . GLN C 3 493  ? -11.685 67.886  18.598  1.00 27.23  ? 493  GLN A CG    1 
ATOM   4167  C  CD    . GLN C 3 493  ? -11.400 69.179  17.872  1.00 27.01  ? 493  GLN A CD    1 
ATOM   4168  O  OE1   . GLN C 3 493  ? -10.396 69.313  17.168  1.00 29.73  ? 493  GLN A OE1   1 
ATOM   4169  N  NE2   . GLN C 3 493  ? -12.291 70.140  18.029  1.00 28.87  ? 493  GLN A NE2   1 
ATOM   4170  N  N     . ALA C 3 494  ? -8.619  65.733  21.140  1.00 29.31  ? 494  ALA A N     1 
ATOM   4171  C  CA    . ALA C 3 494  ? -7.316  65.089  21.237  1.00 30.15  ? 494  ALA A CA    1 
ATOM   4172  C  C     . ALA C 3 494  ? -7.481  63.612  21.525  1.00 30.32  ? 494  ALA A C     1 
ATOM   4173  O  O     . ALA C 3 494  ? -6.815  62.782  20.913  1.00 31.14  ? 494  ALA A O     1 
ATOM   4174  C  CB    . ALA C 3 494  ? -6.472  65.745  22.326  1.00 27.72  ? 494  ALA A CB    1 
ATOM   4175  N  N     . ALA C 3 495  ? -8.375  63.288  22.451  1.00 30.46  ? 495  ALA A N     1 
ATOM   4176  C  CA    . ALA C 3 495  ? -8.616  61.898  22.809  1.00 31.46  ? 495  ALA A CA    1 
ATOM   4177  C  C     . ALA C 3 495  ? -9.170  61.100  21.627  1.00 32.86  ? 495  ALA A C     1 
ATOM   4178  O  O     . ALA C 3 495  ? -8.845  59.920  21.469  1.00 34.05  ? 495  ALA A O     1 
ATOM   4179  C  CB    . ALA C 3 495  ? -9.571  61.816  23.992  1.00 28.80  ? 495  ALA A CB    1 
ATOM   4180  N  N     . GLN C 3 496  ? -9.997  61.730  20.796  1.00 31.96  ? 496  GLN A N     1 
ATOM   4181  C  CA    . GLN C 3 496  ? -10.564 61.028  19.649  1.00 33.32  ? 496  GLN A CA    1 
ATOM   4182  C  C     . GLN C 3 496  ? -9.526  60.758  18.562  1.00 33.04  ? 496  GLN A C     1 
ATOM   4183  O  O     . GLN C 3 496  ? -9.536  59.705  17.918  1.00 32.44  ? 496  GLN A O     1 
ATOM   4184  C  CB    . GLN C 3 496  ? -11.712 61.834  19.036  1.00 34.03  ? 496  GLN A CB    1 
ATOM   4185  C  CG    . GLN C 3 496  ? -12.904 61.999  19.933  1.00 36.90  ? 496  GLN A CG    1 
ATOM   4186  C  CD    . GLN C 3 496  ? -14.010 62.809  19.287  1.00 39.03  ? 496  GLN A CD    1 
ATOM   4187  O  OE1   . GLN C 3 496  ? -13.800 63.955  18.875  1.00 39.85  ? 496  GLN A OE1   1 
ATOM   4188  N  NE2   . GLN C 3 496  ? -15.200 62.221  19.198  1.00 39.36  ? 496  GLN A NE2   1 
ATOM   4189  N  N     . LEU C 3 497  ? -8.631  61.720  18.371  1.00 33.04  ? 497  LEU A N     1 
ATOM   4190  C  CA    . LEU C 3 497  ? -7.604  61.643  17.348  1.00 33.66  ? 497  LEU A CA    1 
ATOM   4191  C  C     . LEU C 3 497  ? -6.316  60.976  17.793  1.00 33.46  ? 497  LEU A C     1 
ATOM   4192  O  O     . LEU C 3 497  ? -5.483  60.624  16.971  1.00 33.49  ? 497  LEU A O     1 
ATOM   4193  C  CB    . LEU C 3 497  ? -7.278  63.054  16.847  1.00 34.28  ? 497  LEU A CB    1 
ATOM   4194  C  CG    . LEU C 3 497  ? -8.426  63.909  16.306  1.00 34.08  ? 497  LEU A CG    1 
ATOM   4195  C  CD1   . LEU C 3 497  ? -7.974  65.358  16.185  1.00 33.18  ? 497  LEU A CD1   1 
ATOM   4196  C  CD2   . LEU C 3 497  ? -8.881  63.368  14.963  1.00 33.97  ? 497  LEU A CD2   1 
ATOM   4197  N  N     . ALA C 3 498  ? -6.155  60.790  19.091  1.00 35.85  ? 498  ALA A N     1 
ATOM   4198  C  CA    . ALA C 3 498  ? -4.933  60.203  19.635  1.00 37.40  ? 498  ALA A CA    1 
ATOM   4199  C  C     . ALA C 3 498  ? -4.312  59.010  18.912  1.00 38.62  ? 498  ALA A C     1 
ATOM   4200  O  O     . ALA C 3 498  ? -3.092  58.934  18.775  1.00 38.14  ? 498  ALA A O     1 
ATOM   4201  C  CB    . ALA C 3 498  ? -5.156  59.839  21.091  1.00 37.43  ? 498  ALA A CB    1 
ATOM   4202  N  N     . ASN C 3 499  ? -5.134  58.080  18.446  1.00 39.84  ? 499  ASN A N     1 
ATOM   4203  C  CA    . ASN C 3 499  ? -4.593  56.887  17.816  1.00 42.05  ? 499  ASN A CA    1 
ATOM   4204  C  C     . ASN C 3 499  ? -4.873  56.733  16.331  1.00 44.07  ? 499  ASN A C     1 
ATOM   4205  O  O     . ASN C 3 499  ? -5.063  55.619  15.837  1.00 45.54  ? 499  ASN A O     1 
ATOM   4206  C  CB    . ASN C 3 499  ? -5.099  55.662  18.580  1.00 43.38  ? 499  ASN A CB    1 
ATOM   4207  C  CG    . ASN C 3 499  ? -4.675  55.675  20.049  1.00 45.46  ? 499  ASN A CG    1 
ATOM   4208  O  OD1   . ASN C 3 499  ? -3.482  55.579  20.361  1.00 47.11  ? 499  ASN A OD1   1 
ATOM   4209  N  ND2   . ASN C 3 499  ? -5.651  55.803  20.958  1.00 44.31  ? 499  ASN A ND2   1 
ATOM   4210  N  N     . LEU C 3 500  ? -4.889  57.852  15.619  1.00 44.29  ? 500  LEU A N     1 
ATOM   4211  C  CA    . LEU C 3 500  ? -5.138  57.841  14.190  1.00 43.41  ? 500  LEU A CA    1 
ATOM   4212  C  C     . LEU C 3 500  ? -3.968  58.505  13.495  1.00 44.09  ? 500  LEU A C     1 
ATOM   4213  O  O     . LEU C 3 500  ? -3.480  59.532  13.952  1.00 45.77  ? 500  LEU A O     1 
ATOM   4214  C  CB    . LEU C 3 500  ? -6.413  58.615  13.869  1.00 43.17  ? 500  LEU A CB    1 
ATOM   4215  C  CG    . LEU C 3 500  ? -7.745  58.092  14.413  1.00 42.62  ? 500  LEU A CG    1 
ATOM   4216  C  CD1   . LEU C 3 500  ? -8.809  59.164  14.223  1.00 41.37  ? 500  LEU A CD1   1 
ATOM   4217  C  CD2   . LEU C 3 500  ? -8.140  56.804  13.694  1.00 41.11  ? 500  LEU A CD2   1 
ATOM   4218  N  N     . PRO C 3 501  ? -3.486  57.917  12.393  1.00 44.64  ? 501  PRO A N     1 
ATOM   4219  C  CA    . PRO C 3 501  ? -2.359  58.489  11.643  1.00 44.17  ? 501  PRO A CA    1 
ATOM   4220  C  C     . PRO C 3 501  ? -2.741  59.820  10.986  1.00 42.65  ? 501  PRO A C     1 
ATOM   4221  O  O     . PRO C 3 501  ? -3.880  60.005  10.564  1.00 40.98  ? 501  PRO A O     1 
ATOM   4222  C  CB    . PRO C 3 501  ? -2.046  57.404  10.610  1.00 45.28  ? 501  PRO A CB    1 
ATOM   4223  C  CG    . PRO C 3 501  ? -2.421  56.143  11.336  1.00 46.15  ? 501  PRO A CG    1 
ATOM   4224  C  CD    . PRO C 3 501  ? -3.742  56.529  11.967  1.00 45.40  ? 501  PRO A CD    1 
ATOM   4225  N  N     . PHE C 3 502  ? -1.779  60.734  10.903  1.00 42.09  ? 502  PHE A N     1 
ATOM   4226  C  CA    . PHE C 3 502  ? -1.998  62.046  10.308  1.00 41.83  ? 502  PHE A CA    1 
ATOM   4227  C  C     . PHE C 3 502  ? -2.721  61.953  8.966   1.00 42.95  ? 502  PHE A C     1 
ATOM   4228  O  O     . PHE C 3 502  ? -3.523  62.825  8.632   1.00 44.09  ? 502  PHE A O     1 
ATOM   4229  C  CB    . PHE C 3 502  ? -0.660  62.774  10.117  1.00 40.06  ? 502  PHE A CB    1 
ATOM   4230  C  CG    . PHE C 3 502  ? -0.793  64.125  9.477   1.00 39.27  ? 502  PHE A CG    1 
ATOM   4231  C  CD1   . PHE C 3 502  ? -1.230  65.220  10.212  1.00 37.89  ? 502  PHE A CD1   1 
ATOM   4232  C  CD2   . PHE C 3 502  ? -0.526  64.298  8.115   1.00 39.32  ? 502  PHE A CD2   1 
ATOM   4233  C  CE1   . PHE C 3 502  ? -1.401  66.466  9.601   1.00 36.00  ? 502  PHE A CE1   1 
ATOM   4234  C  CE2   . PHE C 3 502  ? -0.698  65.546  7.498   1.00 36.81  ? 502  PHE A CE2   1 
ATOM   4235  C  CZ    . PHE C 3 502  ? -1.137  66.627  8.247   1.00 33.66  ? 502  PHE A CZ    1 
ATOM   4236  N  N     . SER C 3 503  ? -2.443  60.897  8.205   1.00 43.55  ? 503  SER A N     1 
ATOM   4237  C  CA    . SER C 3 503  ? -3.059  60.701  6.891   1.00 45.06  ? 503  SER A CA    1 
ATOM   4238  C  C     . SER C 3 503  ? -4.581  60.499  6.935   1.00 45.20  ? 503  SER A C     1 
ATOM   4239  O  O     . SER C 3 503  ? -5.287  60.782  5.960   1.00 44.32  ? 503  SER A O     1 
ATOM   4240  C  CB    . SER C 3 503  ? -2.410  59.503  6.181   1.00 47.47  ? 503  SER A CB    1 
ATOM   4241  O  OG    . SER C 3 503  ? -2.702  58.278  6.847   1.00 49.49  ? 503  SER A OG    1 
ATOM   4242  N  N     . HIS C 3 504  ? -5.084  60.007  8.062   1.00 44.94  ? 504  HIS A N     1 
ATOM   4243  C  CA    . HIS C 3 504  ? -6.510  59.767  8.215   1.00 45.03  ? 504  HIS A CA    1 
ATOM   4244  C  C     . HIS C 3 504  ? -7.262  60.994  8.709   1.00 43.79  ? 504  HIS A C     1 
ATOM   4245  O  O     . HIS C 3 504  ? -8.473  61.082  8.551   1.00 45.09  ? 504  HIS A O     1 
ATOM   4246  C  CB    . HIS C 3 504  ? -6.746  58.620  9.198   1.00 49.32  ? 504  HIS A CB    1 
ATOM   4247  C  CG    . HIS C 3 504  ? -6.277  57.287  8.704   1.00 53.38  ? 504  HIS A CG    1 
ATOM   4248  N  ND1   . HIS C 3 504  ? -6.943  56.579  7.725   1.00 54.84  ? 504  HIS A ND1   1 
ATOM   4249  C  CD2   . HIS C 3 504  ? -5.202  56.537  9.048   1.00 54.30  ? 504  HIS A CD2   1 
ATOM   4250  C  CE1   . HIS C 3 504  ? -6.299  55.451  7.487   1.00 55.65  ? 504  HIS A CE1   1 
ATOM   4251  N  NE2   . HIS C 3 504  ? -5.239  55.401  8.277   1.00 56.11  ? 504  HIS A NE2   1 
ATOM   4252  N  N     . THR C 3 505  ? -6.547  61.940  9.302   1.00 41.35  ? 505  THR A N     1 
ATOM   4253  C  CA    . THR C 3 505  ? -7.179  63.137  9.850   1.00 40.55  ? 505  THR A CA    1 
ATOM   4254  C  C     . THR C 3 505  ? -6.815  64.403  9.076   1.00 40.50  ? 505  THR A C     1 
ATOM   4255  O  O     . THR C 3 505  ? -7.270  65.501  9.401   1.00 41.18  ? 505  THR A O     1 
ATOM   4256  C  CB    . THR C 3 505  ? -6.759  63.348  11.342  1.00 40.46  ? 505  THR A CB    1 
ATOM   4257  O  OG1   . THR C 3 505  ? -5.369  63.714  11.407  1.00 38.35  ? 505  THR A OG1   1 
ATOM   4258  C  CG2   . THR C 3 505  ? -6.977  62.070  12.155  1.00 37.53  ? 505  THR A CG2   1 
ATOM   4259  N  N     . SER C 3 506  ? -5.989  64.246  8.055   1.00 39.15  ? 506  SER A N     1 
ATOM   4260  C  CA    . SER C 3 506  ? -5.542  65.378  7.261   1.00 38.55  ? 506  SER A CA    1 
ATOM   4261  C  C     . SER C 3 506  ? -6.691  66.233  6.738   1.00 36.80  ? 506  SER A C     1 
ATOM   4262  O  O     . SER C 3 506  ? -6.620  67.461  6.769   1.00 36.81  ? 506  SER A O     1 
ATOM   4263  C  CB    . SER C 3 506  ? -4.712  64.880  6.073   1.00 39.69  ? 506  SER A CB    1 
ATOM   4264  O  OG    . SER C 3 506  ? -4.204  63.582  6.317   1.00 39.09  ? 506  SER A OG    1 
ATOM   4265  N  N     . VAL C 3 507  ? -7.743  65.583  6.255   1.00 34.06  ? 507  VAL A N     1 
ATOM   4266  C  CA    . VAL C 3 507  ? -8.879  66.301  5.692   1.00 33.69  ? 507  VAL A CA    1 
ATOM   4267  C  C     . VAL C 3 507  ? -9.487  67.309  6.656   1.00 31.48  ? 507  VAL A C     1 
ATOM   4268  O  O     . VAL C 3 507  ? -10.039 68.328  6.233   1.00 29.46  ? 507  VAL A O     1 
ATOM   4269  C  CB    . VAL C 3 507  ? -10.010 65.325  5.220   1.00 34.51  ? 507  VAL A CB    1 
ATOM   4270  C  CG1   . VAL C 3 507  ? -9.452  64.316  4.238   1.00 35.22  ? 507  VAL A CG1   1 
ATOM   4271  C  CG2   . VAL C 3 507  ? -10.625 64.612  6.409   1.00 33.48  ? 507  VAL A CG2   1 
ATOM   4272  N  N     . ALA C 3 508  ? -9.382  67.019  7.948   1.00 29.03  ? 508  ALA A N     1 
ATOM   4273  C  CA    . ALA C 3 508  ? -9.953  67.888  8.962   1.00 28.82  ? 508  ALA A CA    1 
ATOM   4274  C  C     . ALA C 3 508  ? -9.344  69.278  8.911   1.00 28.24  ? 508  ALA A C     1 
ATOM   4275  O  O     . ALA C 3 508  ? -9.947  70.237  9.383   1.00 28.68  ? 508  ALA A O     1 
ATOM   4276  C  CB    . ALA C 3 508  ? -9.769  67.273  10.343  1.00 29.63  ? 508  ALA A CB    1 
ATOM   4277  N  N     . ILE C 3 509  ? -8.155  69.384  8.326   1.00 27.88  ? 509  ILE A N     1 
ATOM   4278  C  CA    . ILE C 3 509  ? -7.475  70.667  8.207   1.00 28.21  ? 509  ILE A CA    1 
ATOM   4279  C  C     . ILE C 3 509  ? -8.297  71.627  7.348   1.00 29.68  ? 509  ILE A C     1 
ATOM   4280  O  O     . ILE C 3 509  ? -8.154  72.847  7.451   1.00 30.26  ? 509  ILE A O     1 
ATOM   4281  C  CB    . ILE C 3 509  ? -6.056  70.493  7.600   1.00 26.54  ? 509  ILE A CB    1 
ATOM   4282  C  CG1   . ILE C 3 509  ? -5.196  69.649  8.552   1.00 27.31  ? 509  ILE A CG1   1 
ATOM   4283  C  CG2   . ILE C 3 509  ? -5.399  71.843  7.384   1.00 24.00  ? 509  ILE A CG2   1 
ATOM   4284  C  CD1   . ILE C 3 509  ? -3.774  69.386  8.058   1.00 25.97  ? 509  ILE A CD1   1 
ATOM   4285  N  N     . LEU C 3 510  ? -9.171  71.073  6.515   1.00 29.87  ? 510  LEU A N     1 
ATOM   4286  C  CA    . LEU C 3 510  ? -10.019 71.891  5.659   1.00 30.53  ? 510  LEU A CA    1 
ATOM   4287  C  C     . LEU C 3 510  ? -11.467 71.906  6.125   1.00 29.84  ? 510  LEU A C     1 
ATOM   4288  O  O     . LEU C 3 510  ? -12.323 72.437  5.432   1.00 30.31  ? 510  LEU A O     1 
ATOM   4289  C  CB    . LEU C 3 510  ? -9.978  71.391  4.216   1.00 30.65  ? 510  LEU A CB    1 
ATOM   4290  C  CG    . LEU C 3 510  ? -8.604  71.264  3.570   1.00 32.42  ? 510  LEU A CG    1 
ATOM   4291  C  CD1   . LEU C 3 510  ? -8.767  70.693  2.167   1.00 32.48  ? 510  LEU A CD1   1 
ATOM   4292  C  CD2   . LEU C 3 510  ? -7.922  72.623  3.535   1.00 33.28  ? 510  LEU A CD2   1 
ATOM   4293  N  N     . ALA C 3 511  ? -11.744 71.324  7.287   1.00 29.66  ? 511  ALA A N     1 
ATOM   4294  C  CA    . ALA C 3 511  ? -13.106 71.298  7.804   1.00 29.54  ? 511  ALA A CA    1 
ATOM   4295  C  C     . ALA C 3 511  ? -13.600 72.719  8.045   1.00 31.10  ? 511  ALA A C     1 
ATOM   4296  O  O     . ALA C 3 511  ? -12.801 73.656  8.079   1.00 30.24  ? 511  ALA A O     1 
ATOM   4297  C  CB    . ALA C 3 511  ? -13.155 70.504  9.087   1.00 28.12  ? 511  ALA A CB    1 
ATOM   4298  N  N     . ASP C 3 512  ? -14.915 72.881  8.205   1.00 33.17  ? 512  ASP A N     1 
ATOM   4299  C  CA    . ASP C 3 512  ? -15.488 74.203  8.451   1.00 33.90  ? 512  ASP A CA    1 
ATOM   4300  C  C     . ASP C 3 512  ? -15.016 74.733  9.794   1.00 34.76  ? 512  ASP A C     1 
ATOM   4301  O  O     . ASP C 3 512  ? -14.380 74.019  10.577  1.00 34.89  ? 512  ASP A O     1 
ATOM   4302  C  CB    . ASP C 3 512  ? -17.019 74.174  8.480   1.00 36.01  ? 512  ASP A CB    1 
ATOM   4303  C  CG    . ASP C 3 512  ? -17.637 73.857  7.137   1.00 37.63  ? 512  ASP A CG    1 
ATOM   4304  O  OD1   . ASP C 3 512  ? -17.186 74.411  6.114   1.00 37.40  ? 512  ASP A OD1   1 
ATOM   4305  O  OD2   . ASP C 3 512  ? -18.599 73.061  7.115   1.00 39.79  ? 512  ASP A OD2   1 
ATOM   4306  N  N     . THR C 3 513  ? -15.353 75.992  10.050  1.00 35.16  ? 513  THR A N     1 
ATOM   4307  C  CA    . THR C 3 513  ? -15.001 76.683  11.285  1.00 34.96  ? 513  THR A CA    1 
ATOM   4308  C  C     . THR C 3 513  ? -16.295 77.177  11.908  1.00 35.36  ? 513  THR A C     1 
ATOM   4309  O  O     . THR C 3 513  ? -17.105 77.798  11.222  1.00 35.36  ? 513  THR A O     1 
ATOM   4310  C  CB    . THR C 3 513  ? -14.118 77.910  10.999  1.00 34.85  ? 513  THR A CB    1 
ATOM   4311  O  OG1   . THR C 3 513  ? -12.829 77.482  10.550  1.00 35.84  ? 513  THR A OG1   1 
ATOM   4312  C  CG2   . THR C 3 513  ? -13.967 78.762  12.252  1.00 36.80  ? 513  THR A CG2   1 
ATOM   4313  N  N     . SER C 3 514  ? -16.498 76.908  13.194  1.00 35.66  ? 514  SER A N     1 
ATOM   4314  C  CA    . SER C 3 514  ? -17.716 77.357  13.860  1.00 37.05  ? 514  SER A CA    1 
ATOM   4315  C  C     . SER C 3 514  ? -17.651 78.820  14.264  1.00 36.56  ? 514  SER A C     1 
ATOM   4316  O  O     . SER C 3 514  ? -16.590 79.429  14.253  1.00 36.17  ? 514  SER A O     1 
ATOM   4317  C  CB    . SER C 3 514  ? -18.011 76.488  15.081  1.00 37.77  ? 514  SER A CB    1 
ATOM   4318  O  OG    . SER C 3 514  ? -18.554 75.247  14.663  1.00 41.28  ? 514  SER A OG    1 
ATOM   4319  N  N     . MET C 3 515  ? -18.794 79.391  14.613  1.00 38.08  ? 515  MET A N     1 
ATOM   4320  C  CA    . MET C 3 515  ? -18.813 80.792  15.002  1.00 38.59  ? 515  MET A CA    1 
ATOM   4321  C  C     . MET C 3 515  ? -18.513 81.024  16.475  1.00 37.77  ? 515  MET A C     1 
ATOM   4322  O  O     . MET C 3 515  ? -18.894 80.231  17.334  1.00 37.69  ? 515  MET A O     1 
ATOM   4323  C  CB    . MET C 3 515  ? -20.155 81.424  14.668  1.00 40.85  ? 515  MET A CB    1 
ATOM   4324  C  CG    . MET C 3 515  ? -20.196 82.895  15.022  1.00 44.69  ? 515  MET A CG    1 
ATOM   4325  S  SD    . MET C 3 515  ? -21.650 83.699  14.369  1.00 48.30  ? 515  MET A SD    1 
ATOM   4326  C  CE    . MET C 3 515  ? -22.939 82.907  15.401  1.00 44.88  ? 515  MET A CE    1 
ATOM   4327  N  N     . GLY C 3 516  ? -17.820 82.126  16.744  1.00 36.18  ? 516  GLY A N     1 
ATOM   4328  C  CA    . GLY C 3 516  ? -17.458 82.509  18.095  1.00 34.37  ? 516  GLY A CA    1 
ATOM   4329  C  C     . GLY C 3 516  ? -17.397 84.020  18.077  1.00 34.28  ? 516  GLY A C     1 
ATOM   4330  O  O     . GLY C 3 516  ? -16.702 84.602  17.245  1.00 34.54  ? 516  GLY A O     1 
ATOM   4331  N  N     . LEU C 3 517  ? -18.111 84.670  18.987  1.00 32.59  ? 517  LEU A N     1 
ATOM   4332  C  CA    . LEU C 3 517  ? -18.134 86.123  18.995  1.00 32.41  ? 517  LEU A CA    1 
ATOM   4333  C  C     . LEU C 3 517  ? -17.687 86.743  20.298  1.00 31.38  ? 517  LEU A C     1 
ATOM   4334  O  O     . LEU C 3 517  ? -17.702 86.097  21.344  1.00 33.14  ? 517  LEU A O     1 
ATOM   4335  C  CB    . LEU C 3 517  ? -19.548 86.611  18.659  1.00 32.73  ? 517  LEU A CB    1 
ATOM   4336  C  CG    . LEU C 3 517  ? -20.061 86.116  17.307  1.00 35.11  ? 517  LEU A CG    1 
ATOM   4337  C  CD1   . LEU C 3 517  ? -21.521 86.519  17.106  1.00 36.03  ? 517  LEU A CD1   1 
ATOM   4338  C  CD2   . LEU C 3 517  ? -19.180 86.685  16.201  1.00 34.47  ? 517  LEU A CD2   1 
ATOM   4339  N  N     . ARG C 3 518  ? -17.304 88.014  20.224  1.00 32.21  ? 518  ARG A N     1 
ATOM   4340  C  CA    . ARG C 3 518  ? -16.871 88.753  21.396  1.00 31.92  ? 518  ARG A CA    1 
ATOM   4341  C  C     . ARG C 3 518  ? -17.268 90.226  21.307  1.00 29.91  ? 518  ARG A C     1 
ATOM   4342  O  O     . ARG C 3 518  ? -16.947 90.910  20.333  1.00 29.01  ? 518  ARG A O     1 
ATOM   4343  C  CB    . ARG C 3 518  ? -15.358 88.644  21.554  1.00 36.16  ? 518  ARG A CB    1 
ATOM   4344  C  CG    . ARG C 3 518  ? -14.931 88.631  22.998  1.00 42.51  ? 518  ARG A CG    1 
ATOM   4345  C  CD    . ARG C 3 518  ? -13.424 88.682  23.158  1.00 47.23  ? 518  ARG A CD    1 
ATOM   4346  N  NE    . ARG C 3 518  ? -13.055 88.499  24.560  1.00 51.44  ? 518  ARG A NE    1 
ATOM   4347  C  CZ    . ARG C 3 518  ? -13.211 87.359  25.229  1.00 53.75  ? 518  ARG A CZ    1 
ATOM   4348  N  NH1   . ARG C 3 518  ? -13.726 86.292  24.624  1.00 55.56  ? 518  ARG A NH1   1 
ATOM   4349  N  NH2   . ARG C 3 518  ? -12.857 87.288  26.506  1.00 54.22  ? 518  ARG A NH2   1 
ATOM   4350  N  N     . ASN C 3 519  ? -17.976 90.707  22.325  1.00 26.68  ? 519  ASN A N     1 
ATOM   4351  C  CA    . ASN C 3 519  ? -18.400 92.101  22.373  1.00 24.77  ? 519  ASN A CA    1 
ATOM   4352  C  C     . ASN C 3 519  ? -17.359 92.942  23.095  1.00 25.15  ? 519  ASN A C     1 
ATOM   4353  O  O     . ASN C 3 519  ? -16.676 92.468  23.997  1.00 22.48  ? 519  ASN A O     1 
ATOM   4354  C  CB    . ASN C 3 519  ? -19.746 92.235  23.078  1.00 23.64  ? 519  ASN A CB    1 
ATOM   4355  C  CG    . ASN C 3 519  ? -20.855 91.519  22.345  1.00 22.99  ? 519  ASN A CG    1 
ATOM   4356  O  OD1   . ASN C 3 519  ? -20.812 91.375  21.120  1.00 23.08  ? 519  ASN A OD1   1 
ATOM   4357  N  ND2   . ASN C 3 519  ? -21.864 91.072  23.087  1.00 21.83  ? 519  ASN A ND2   1 
ATOM   4358  N  N     . GLN C 3 520  ? -17.237 94.199  22.695  1.00 27.58  ? 520  GLN A N     1 
ATOM   4359  C  CA    . GLN C 3 520  ? -16.242 95.068  23.303  1.00 28.74  ? 520  GLN A CA    1 
ATOM   4360  C  C     . GLN C 3 520  ? -16.786 96.430  23.664  1.00 27.95  ? 520  GLN A C     1 
ATOM   4361  O  O     . GLN C 3 520  ? -17.808 96.863  23.143  1.00 28.42  ? 520  GLN A O     1 
ATOM   4362  C  CB    . GLN C 3 520  ? -15.058 95.240  22.349  1.00 29.33  ? 520  GLN A CB    1 
ATOM   4363  C  CG    . GLN C 3 520  ? -14.507 93.920  21.835  1.00 34.97  ? 520  GLN A CG    1 
ATOM   4364  C  CD    . GLN C 3 520  ? -13.185 94.080  21.110  1.00 39.04  ? 520  GLN A CD    1 
ATOM   4365  O  OE1   . GLN C 3 520  ? -12.157 94.395  21.726  1.00 39.54  ? 520  GLN A OE1   1 
ATOM   4366  N  NE2   . GLN C 3 520  ? -13.203 93.868  19.793  1.00 39.29  ? 520  GLN A NE2   1 
ATOM   4367  N  N     . VAL C 3 521  ? -16.099 97.105  24.570  1.00 28.31  ? 521  VAL A N     1 
ATOM   4368  C  CA    . VAL C 3 521  ? -16.510 98.438  24.958  1.00 29.14  ? 521  VAL A CA    1 
ATOM   4369  C  C     . VAL C 3 521  ? -15.930 99.387  23.914  1.00 30.52  ? 521  VAL A C     1 
ATOM   4370  O  O     . VAL C 3 521  ? -14.785 99.222  23.487  1.00 30.68  ? 521  VAL A O     1 
ATOM   4371  C  CB    . VAL C 3 521  ? -15.965 98.797  26.355  1.00 28.78  ? 521  VAL A CB    1 
ATOM   4372  C  CG1   . VAL C 3 521  ? -16.294 100.249 26.699  1.00 26.15  ? 521  VAL A CG1   1 
ATOM   4373  C  CG2   . VAL C 3 521  ? -16.544 97.836  27.394  1.00 26.41  ? 521  VAL A CG2   1 
ATOM   4374  N  N     . GLN C 3 522  ? -16.736 100.350 23.478  1.00 31.32  ? 522  GLN A N     1 
ATOM   4375  C  CA    . GLN C 3 522  ? -16.301 101.339 22.498  1.00 31.93  ? 522  GLN A CA    1 
ATOM   4376  C  C     . GLN C 3 522  ? -15.783 100.807 21.171  1.00 34.22  ? 522  GLN A C     1 
ATOM   4377  O  O     . GLN C 3 522  ? -15.156 101.546 20.408  1.00 35.73  ? 522  GLN A O     1 
ATOM   4378  C  CB    . GLN C 3 522  ? -15.237 102.227 23.114  1.00 30.55  ? 522  GLN A CB    1 
ATOM   4379  C  CG    . GLN C 3 522  ? -15.800 103.279 24.011  1.00 30.50  ? 522  GLN A CG    1 
ATOM   4380  C  CD    . GLN C 3 522  ? -14.740 103.907 24.869  1.00 29.92  ? 522  GLN A CD    1 
ATOM   4381  O  OE1   . GLN C 3 522  ? -13.664 104.275 24.390  1.00 31.70  ? 522  GLN A OE1   1 
ATOM   4382  N  NE2   . GLN C 3 522  ? -15.035 104.040 26.147  1.00 29.92  ? 522  GLN A NE2   1 
ATOM   4383  N  N     . ARG C 3 523  ? -16.037 99.535  20.889  1.00 35.56  ? 523  ARG A N     1 
ATOM   4384  C  CA    . ARG C 3 523  ? -15.594 98.937  19.636  1.00 36.79  ? 523  ARG A CA    1 
ATOM   4385  C  C     . ARG C 3 523  ? -16.722 98.069  19.074  1.00 35.19  ? 523  ARG A C     1 
ATOM   4386  O  O     . ARG C 3 523  ? -17.758 97.924  19.708  1.00 35.60  ? 523  ARG A O     1 
ATOM   4387  C  CB    . ARG C 3 523  ? -14.323 98.106  19.871  1.00 39.95  ? 523  ARG A CB    1 
ATOM   4388  C  CG    . ARG C 3 523  ? -13.696 97.574  18.591  1.00 45.21  ? 523  ARG A CG    1 
ATOM   4389  C  CD    . ARG C 3 523  ? -12.396 96.810  18.835  1.00 49.45  ? 523  ARG A CD    1 
ATOM   4390  N  NE    . ARG C 3 523  ? -11.879 96.238  17.591  1.00 53.09  ? 523  ARG A NE    1 
ATOM   4391  C  CZ    . ARG C 3 523  ? -12.522 95.323  16.864  1.00 54.96  ? 523  ARG A CZ    1 
ATOM   4392  N  NH1   . ARG C 3 523  ? -13.705 94.870  17.260  1.00 54.89  ? 523  ARG A NH1   1 
ATOM   4393  N  NH2   . ARG C 3 523  ? -11.994 94.870  15.731  1.00 55.23  ? 523  ARG A NH2   1 
ATOM   4394  N  N     . ARG C 3 524  ? -16.531 97.508  17.885  1.00 34.52  ? 524  ARG A N     1 
ATOM   4395  C  CA    . ARG C 3 524  ? -17.554 96.660  17.277  1.00 34.37  ? 524  ARG A CA    1 
ATOM   4396  C  C     . ARG C 3 524  ? -17.309 95.202  17.662  1.00 32.63  ? 524  ARG A C     1 
ATOM   4397  O  O     . ARG C 3 524  ? -16.214 94.844  18.076  1.00 33.77  ? 524  ARG A O     1 
ATOM   4398  C  CB    . ARG C 3 524  ? -17.523 96.809  15.751  1.00 36.41  ? 524  ARG A CB    1 
ATOM   4399  C  CG    . ARG C 3 524  ? -16.219 96.366  15.107  1.00 39.25  ? 524  ARG A CG    1 
ATOM   4400  C  CD    . ARG C 3 524  ? -16.139 96.776  13.642  1.00 42.14  ? 524  ARG A CD    1 
ATOM   4401  N  NE    . ARG C 3 524  ? -14.926 96.272  12.993  1.00 47.47  ? 524  ARG A NE    1 
ATOM   4402  C  CZ    . ARG C 3 524  ? -13.679 96.582  13.360  1.00 49.96  ? 524  ARG A CZ    1 
ATOM   4403  N  NH1   . ARG C 3 524  ? -13.454 97.407  14.379  1.00 50.72  ? 524  ARG A NH1   1 
ATOM   4404  N  NH2   . ARG C 3 524  ? -12.646 96.058  12.710  1.00 50.51  ? 524  ARG A NH2   1 
ATOM   4405  N  N     . PRO C 3 525  ? -18.331 94.345  17.557  1.00 31.33  ? 525  PRO A N     1 
ATOM   4406  C  CA    . PRO C 3 525  ? -18.072 92.956  17.926  1.00 31.76  ? 525  PRO A CA    1 
ATOM   4407  C  C     . PRO C 3 525  ? -17.086 92.345  16.947  1.00 33.25  ? 525  PRO A C     1 
ATOM   4408  O  O     . PRO C 3 525  ? -17.044 92.728  15.773  1.00 33.60  ? 525  PRO A O     1 
ATOM   4409  C  CB    . PRO C 3 525  ? -19.446 92.315  17.826  1.00 27.85  ? 525  PRO A CB    1 
ATOM   4410  C  CG    . PRO C 3 525  ? -20.347 93.433  18.188  1.00 29.41  ? 525  PRO A CG    1 
ATOM   4411  C  CD    . PRO C 3 525  ? -19.771 94.567  17.380  1.00 30.71  ? 525  PRO A CD    1 
ATOM   4412  N  N     . ARG C 3 526  ? -16.287 91.405  17.427  1.00 35.18  ? 526  ARG A N     1 
ATOM   4413  C  CA    . ARG C 3 526  ? -15.325 90.756  16.560  1.00 39.37  ? 526  ARG A CA    1 
ATOM   4414  C  C     . ARG C 3 526  ? -15.629 89.267  16.442  1.00 40.07  ? 526  ARG A C     1 
ATOM   4415  O  O     . ARG C 3 526  ? -15.959 88.607  17.428  1.00 40.44  ? 526  ARG A O     1 
ATOM   4416  C  CB    . ARG C 3 526  ? -13.896 90.962  17.079  1.00 42.01  ? 526  ARG A CB    1 
ATOM   4417  C  CG    . ARG C 3 526  ? -13.570 90.281  18.393  1.00 45.21  ? 526  ARG A CG    1 
ATOM   4418  C  CD    . ARG C 3 526  ? -12.098 89.872  18.417  1.00 50.87  ? 526  ARG A CD    1 
ATOM   4419  N  NE    . ARG C 3 526  ? -11.208 90.991  18.103  1.00 55.53  ? 526  ARG A NE    1 
ATOM   4420  C  CZ    . ARG C 3 526  ? -10.882 91.954  18.961  1.00 57.26  ? 526  ARG A CZ    1 
ATOM   4421  N  NH1   . ARG C 3 526  ? -11.364 91.941  20.201  1.00 58.35  ? 526  ARG A NH1   1 
ATOM   4422  N  NH2   . ARG C 3 526  ? -10.078 92.937  18.576  1.00 56.81  ? 526  ARG A NH2   1 
ATOM   4423  N  N     . SER C 3 527  ? -15.547 88.746  15.225  1.00 40.71  ? 527  SER A N     1 
ATOM   4424  C  CA    . SER C 3 527  ? -15.796 87.330  15.013  1.00 41.30  ? 527  SER A CA    1 
ATOM   4425  C  C     . SER C 3 527  ? -14.530 86.578  15.398  1.00 40.40  ? 527  SER A C     1 
ATOM   4426  O  O     . SER C 3 527  ? -13.421 87.111  15.316  1.00 41.00  ? 527  SER A O     1 
ATOM   4427  C  CB    . SER C 3 527  ? -16.170 87.062  13.553  1.00 41.90  ? 527  SER A CB    1 
ATOM   4428  O  OG    . SER C 3 527  ? -15.305 87.763  12.679  1.00 46.29  ? 527  SER A OG    1 
ATOM   4429  N  N     . ILE C 3 528  ? -14.698 85.338  15.829  1.00 39.75  ? 528  ILE A N     1 
ATOM   4430  C  CA    . ILE C 3 528  ? -13.567 84.534  16.247  1.00 38.69  ? 528  ILE A CA    1 
ATOM   4431  C  C     . ILE C 3 528  ? -13.603 83.174  15.561  1.00 37.21  ? 528  ILE A C     1 
ATOM   4432  O  O     . ILE C 3 528  ? -14.676 82.631  15.321  1.00 37.88  ? 528  ILE A O     1 
ATOM   4433  C  CB    . ILE C 3 528  ? -13.593 84.380  17.791  1.00 40.22  ? 528  ILE A CB    1 
ATOM   4434  C  CG1   . ILE C 3 528  ? -12.222 84.737  18.352  1.00 41.53  ? 528  ILE A CG1   1 
ATOM   4435  C  CG2   . ILE C 3 528  ? -14.021 82.976  18.193  1.00 38.15  ? 528  ILE A CG2   1 
ATOM   4436  C  CD1   . ILE C 3 528  ? -11.735 86.118  17.942  1.00 43.25  ? 528  ILE A CD1   1 
ATOM   4437  N  N     . MET C 3 529  ? -12.437 82.631  15.230  1.00 35.62  ? 529  MET A N     1 
ATOM   4438  C  CA    . MET C 3 529  ? -12.381 81.324  14.578  1.00 33.93  ? 529  MET A CA    1 
ATOM   4439  C  C     . MET C 3 529  ? -11.752 80.248  15.464  1.00 31.45  ? 529  MET A C     1 
ATOM   4440  O  O     . MET C 3 529  ? -10.541 80.209  15.655  1.00 30.63  ? 529  MET A O     1 
ATOM   4441  C  CB    . MET C 3 529  ? -11.617 81.419  13.255  1.00 36.86  ? 529  MET A CB    1 
ATOM   4442  C  CG    . MET C 3 529  ? -12.413 82.062  12.124  1.00 40.11  ? 529  MET A CG    1 
ATOM   4443  S  SD    . MET C 3 529  ? -11.542 81.975  10.546  1.00 44.32  ? 529  MET A SD    1 
ATOM   4444  C  CE    . MET C 3 529  ? -11.752 83.662  9.907   1.00 41.74  ? 529  MET A CE    1 
ATOM   4445  N  N     . PRO C 3 530  ? -12.579 79.352  16.012  1.00 29.75  ? 530  PRO A N     1 
ATOM   4446  C  CA    . PRO C 3 530  ? -12.090 78.274  16.882  1.00 28.25  ? 530  PRO A CA    1 
ATOM   4447  C  C     . PRO C 3 530  ? -11.534 77.131  16.044  1.00 27.02  ? 530  PRO A C     1 
ATOM   4448  O  O     . PRO C 3 530  ? -12.245 76.179  15.742  1.00 26.18  ? 530  PRO A O     1 
ATOM   4449  C  CB    . PRO C 3 530  ? -13.344 77.839  17.656  1.00 28.34  ? 530  PRO A CB    1 
ATOM   4450  C  CG    . PRO C 3 530  ? -14.498 78.710  17.101  1.00 27.80  ? 530  PRO A CG    1 
ATOM   4451  C  CD    . PRO C 3 530  ? -14.024 79.222  15.780  1.00 27.99  ? 530  PRO A CD    1 
ATOM   4452  N  N     . LEU C 3 531  ? -10.272 77.240  15.652  1.00 26.66  ? 531  LEU A N     1 
ATOM   4453  C  CA    . LEU C 3 531  ? -9.634  76.211  14.841  1.00 24.86  ? 531  LEU A CA    1 
ATOM   4454  C  C     . LEU C 3 531  ? -9.600  74.857  15.558  1.00 24.75  ? 531  LEU A C     1 
ATOM   4455  O  O     . LEU C 3 531  ? -9.585  74.802  16.800  1.00 21.80  ? 531  LEU A O     1 
ATOM   4456  C  CB    . LEU C 3 531  ? -8.221  76.668  14.470  1.00 24.03  ? 531  LEU A CB    1 
ATOM   4457  C  CG    . LEU C 3 531  ? -8.210  77.961  13.644  1.00 24.92  ? 531  LEU A CG    1 
ATOM   4458  C  CD1   . LEU C 3 531  ? -6.821  78.201  13.063  1.00 22.41  ? 531  LEU A CD1   1 
ATOM   4459  C  CD2   . LEU C 3 531  ? -9.227  77.848  12.516  1.00 23.54  ? 531  LEU A CD2   1 
ATOM   4460  N  N     . ASN C 3 532  ? -9.602  73.766  14.784  1.00 24.53  ? 532  ASN A N     1 
ATOM   4461  C  CA    . ASN C 3 532  ? -9.581  72.418  15.368  1.00 25.94  ? 532  ASN A CA    1 
ATOM   4462  C  C     . ASN C 3 532  ? -8.159  71.918  15.604  1.00 25.49  ? 532  ASN A C     1 
ATOM   4463  O  O     . ASN C 3 532  ? -7.197  72.464  15.055  1.00 26.97  ? 532  ASN A O     1 
ATOM   4464  C  CB    . ASN C 3 532  ? -10.357 71.419  14.483  1.00 25.72  ? 532  ASN A CB    1 
ATOM   4465  C  CG    . ASN C 3 532  ? -9.791  71.309  13.078  1.00 27.00  ? 532  ASN A CG    1 
ATOM   4466  O  OD1   . ASN C 3 532  ? -8.603  71.026  12.895  1.00 28.65  ? 532  ASN A OD1   1 
ATOM   4467  N  ND2   . ASN C 3 532  ? -10.640 71.526  12.076  1.00 23.31  ? 532  ASN A ND2   1 
ATOM   4468  N  N     . VAL C 3 533  ? -8.020  70.883  16.425  1.00 24.74  ? 533  VAL A N     1 
ATOM   4469  C  CA    . VAL C 3 533  ? -6.695  70.340  16.729  1.00 24.41  ? 533  VAL A CA    1 
ATOM   4470  C  C     . VAL C 3 533  ? -5.789  70.104  15.508  1.00 24.08  ? 533  VAL A C     1 
ATOM   4471  O  O     . VAL C 3 533  ? -4.620  70.495  15.518  1.00 23.03  ? 533  VAL A O     1 
ATOM   4472  C  CB    . VAL C 3 533  ? -6.804  69.025  17.533  1.00 25.58  ? 533  VAL A CB    1 
ATOM   4473  C  CG1   . VAL C 3 533  ? -5.416  68.494  17.845  1.00 25.32  ? 533  VAL A CG1   1 
ATOM   4474  C  CG2   . VAL C 3 533  ? -7.571  69.267  18.823  1.00 25.48  ? 533  VAL A CG2   1 
ATOM   4475  N  N     . PRO C 3 534  ? -6.300  69.449  14.446  1.00 23.36  ? 534  PRO A N     1 
ATOM   4476  C  CA    . PRO C 3 534  ? -5.401  69.248  13.300  1.00 23.80  ? 534  PRO A CA    1 
ATOM   4477  C  C     . PRO C 3 534  ? -5.027  70.585  12.656  1.00 23.93  ? 534  PRO A C     1 
ATOM   4478  O  O     . PRO C 3 534  ? -3.922  70.749  12.150  1.00 23.36  ? 534  PRO A O     1 
ATOM   4479  C  CB    . PRO C 3 534  ? -6.216  68.349  12.363  1.00 23.49  ? 534  PRO A CB    1 
ATOM   4480  C  CG    . PRO C 3 534  ? -7.133  67.618  13.287  1.00 22.54  ? 534  PRO A CG    1 
ATOM   4481  C  CD    . PRO C 3 534  ? -7.552  68.694  14.267  1.00 22.35  ? 534  PRO A CD    1 
ATOM   4482  N  N     . GLN C 3 535  ? -5.954  71.541  12.674  1.00 25.04  ? 535  GLN A N     1 
ATOM   4483  C  CA    . GLN C 3 535  ? -5.690  72.862  12.104  1.00 24.90  ? 535  GLN A CA    1 
ATOM   4484  C  C     . GLN C 3 535  ? -4.658  73.609  12.945  1.00 23.55  ? 535  GLN A C     1 
ATOM   4485  O  O     . GLN C 3 535  ? -3.811  74.319  12.413  1.00 22.08  ? 535  GLN A O     1 
ATOM   4486  C  CB    . GLN C 3 535  ? -6.972  73.694  12.020  1.00 26.47  ? 535  GLN A CB    1 
ATOM   4487  C  CG    . GLN C 3 535  ? -8.005  73.135  11.071  1.00 29.70  ? 535  GLN A CG    1 
ATOM   4488  C  CD    . GLN C 3 535  ? -9.196  74.050  10.913  1.00 31.09  ? 535  GLN A CD    1 
ATOM   4489  O  OE1   . GLN C 3 535  ? -9.792  74.481  11.896  1.00 33.18  ? 535  GLN A OE1   1 
ATOM   4490  N  NE2   . GLN C 3 535  ? -9.556  74.347  9.668   1.00 31.67  ? 535  GLN A NE2   1 
ATOM   4491  N  N     . GLN C 3 536  ? -4.728  73.460  14.261  1.00 23.93  ? 536  GLN A N     1 
ATOM   4492  C  CA    . GLN C 3 536  ? -3.758  74.135  15.111  1.00 25.17  ? 536  GLN A CA    1 
ATOM   4493  C  C     . GLN C 3 536  ? -2.406  73.441  14.983  1.00 25.17  ? 536  GLN A C     1 
ATOM   4494  O  O     . GLN C 3 536  ? -1.361  74.092  14.950  1.00 24.70  ? 536  GLN A O     1 
ATOM   4495  C  CB    . GLN C 3 536  ? -4.223  74.136  16.566  1.00 27.19  ? 536  GLN A CB    1 
ATOM   4496  C  CG    . GLN C 3 536  ? -5.402  75.069  16.876  1.00 26.87  ? 536  GLN A CG    1 
ATOM   4497  C  CD    . GLN C 3 536  ? -5.021  76.562  16.895  1.00 31.18  ? 536  GLN A CD    1 
ATOM   4498  O  OE1   . GLN C 3 536  ? -5.692  77.367  17.549  1.00 31.81  ? 536  GLN A OE1   1 
ATOM   4499  N  NE2   . GLN C 3 536  ? -3.956  76.935  16.170  1.00 26.76  ? 536  GLN A NE2   1 
ATOM   4500  N  N     . GLN C 3 537  ? -2.434  72.118  14.877  1.00 24.48  ? 537  GLN A N     1 
ATOM   4501  C  CA    . GLN C 3 537  ? -1.206  71.344  14.757  1.00 26.20  ? 537  GLN A CA    1 
ATOM   4502  C  C     . GLN C 3 537  ? -0.395  71.760  13.548  1.00 26.56  ? 537  GLN A C     1 
ATOM   4503  O  O     . GLN C 3 537  ? 0.791   72.079  13.645  1.00 28.61  ? 537  GLN A O     1 
ATOM   4504  C  CB    . GLN C 3 537  ? -1.517  69.849  14.647  1.00 25.17  ? 537  GLN A CB    1 
ATOM   4505  C  CG    . GLN C 3 537  ? -0.316  69.009  14.271  1.00 24.12  ? 537  GLN A CG    1 
ATOM   4506  C  CD    . GLN C 3 537  ? -0.632  67.527  14.166  1.00 25.51  ? 537  GLN A CD    1 
ATOM   4507  O  OE1   . GLN C 3 537  ? -1.638  67.129  13.567  1.00 26.84  ? 537  GLN A OE1   1 
ATOM   4508  N  NE2   . GLN C 3 537  ? 0.239   66.696  14.739  1.00 22.44  ? 537  GLN A NE2   1 
ATOM   4509  N  N     . VAL C 3 538  ? -1.052  71.748  12.403  1.00 26.82  ? 538  VAL A N     1 
ATOM   4510  C  CA    . VAL C 3 538  ? -0.426  72.080  11.141  1.00 24.99  ? 538  VAL A CA    1 
ATOM   4511  C  C     . VAL C 3 538  ? 0.043   73.532  11.079  1.00 25.10  ? 538  VAL A C     1 
ATOM   4512  O  O     . VAL C 3 538  ? 0.858   73.889  10.236  1.00 28.04  ? 538  VAL A O     1 
ATOM   4513  C  CB    . VAL C 3 538  ? -1.419  71.759  10.002  1.00 26.12  ? 538  VAL A CB    1 
ATOM   4514  C  CG1   . VAL C 3 538  ? -1.839  73.030  9.275   1.00 26.14  ? 538  VAL A CG1   1 
ATOM   4515  C  CG2   . VAL C 3 538  ? -0.813  70.724  9.078   1.00 25.95  ? 538  VAL A CG2   1 
ATOM   4516  N  N     . SER C 3 539  ? -0.462  74.365  11.979  1.00 24.88  ? 539  SER A N     1 
ATOM   4517  C  CA    . SER C 3 539  ? -0.082  75.778  12.021  1.00 24.45  ? 539  SER A CA    1 
ATOM   4518  C  C     . SER C 3 539  ? 1.222   76.027  12.784  1.00 24.21  ? 539  SER A C     1 
ATOM   4519  O  O     . SER C 3 539  ? 1.732   77.155  12.804  1.00 24.17  ? 539  SER A O     1 
ATOM   4520  C  CB    . SER C 3 539  ? -1.183  76.600  12.699  1.00 23.82  ? 539  SER A CB    1 
ATOM   4521  O  OG    . SER C 3 539  ? -2.383  76.583  11.958  1.00 26.96  ? 539  SER A OG    1 
ATOM   4522  N  N     . ALA C 3 540  ? 1.751   74.982  13.414  1.00 23.58  ? 540  ALA A N     1 
ATOM   4523  C  CA    . ALA C 3 540  ? 2.958   75.107  14.228  1.00 24.69  ? 540  ALA A CA    1 
ATOM   4524  C  C     . ALA C 3 540  ? 4.142   75.826  13.584  1.00 24.87  ? 540  ALA A C     1 
ATOM   4525  O  O     . ALA C 3 540  ? 4.697   76.760  14.160  1.00 23.67  ? 540  ALA A O     1 
ATOM   4526  C  CB    . ALA C 3 540  ? 3.395   73.726  14.718  1.00 26.69  ? 540  ALA A CB    1 
ATOM   4527  N  N     . PRO C 3 541  ? 4.548   75.398  12.380  1.00 25.43  ? 541  PRO A N     1 
ATOM   4528  C  CA    . PRO C 3 541  ? 5.681   76.036  11.704  1.00 26.12  ? 541  PRO A CA    1 
ATOM   4529  C  C     . PRO C 3 541  ? 5.511   77.542  11.532  1.00 25.34  ? 541  PRO A C     1 
ATOM   4530  O  O     . PRO C 3 541  ? 6.461   78.298  11.638  1.00 25.82  ? 541  PRO A O     1 
ATOM   4531  C  CB    . PRO C 3 541  ? 5.731   75.303  10.368  1.00 25.71  ? 541  PRO A CB    1 
ATOM   4532  C  CG    . PRO C 3 541  ? 5.203   73.965  10.717  1.00 24.71  ? 541  PRO A CG    1 
ATOM   4533  C  CD    . PRO C 3 541  ? 4.013   74.305  11.558  1.00 23.24  ? 541  PRO A CD    1 
ATOM   4534  N  N     . HIS C 3 542  ? 4.286   77.962  11.258  1.00 25.69  ? 542  HIS A N     1 
ATOM   4535  C  CA    . HIS C 3 542  ? 3.980   79.368  11.066  1.00 25.38  ? 542  HIS A CA    1 
ATOM   4536  C  C     . HIS C 3 542  ? 4.189   80.088  12.405  1.00 25.33  ? 542  HIS A C     1 
ATOM   4537  O  O     . HIS C 3 542  ? 4.836   81.133  12.470  1.00 24.66  ? 542  HIS A O     1 
ATOM   4538  C  CB    . HIS C 3 542  ? 2.530   79.493  10.581  1.00 24.26  ? 542  HIS A CB    1 
ATOM   4539  C  CG    . HIS C 3 542  ? 2.153   80.864  10.118  1.00 25.20  ? 542  HIS A CG    1 
ATOM   4540  N  ND1   . HIS C 3 542  ? 0.934   81.139  9.538   1.00 27.36  ? 542  HIS A ND1   1 
ATOM   4541  C  CD2   . HIS C 3 542  ? 2.815   82.042  10.173  1.00 26.56  ? 542  HIS A CD2   1 
ATOM   4542  C  CE1   . HIS C 3 542  ? 0.860   82.427  9.256   1.00 25.73  ? 542  HIS A CE1   1 
ATOM   4543  N  NE2   . HIS C 3 542  ? 1.989   82.997  9.631   1.00 26.44  ? 542  HIS A NE2   1 
ATOM   4544  N  N     . THR C 3 543  ? 3.659   79.502  13.474  1.00 25.51  ? 543  THR A N     1 
ATOM   4545  C  CA    . THR C 3 543  ? 3.771   80.067  14.817  1.00 24.94  ? 543  THR A CA    1 
ATOM   4546  C  C     . THR C 3 543  ? 5.224   80.149  15.327  1.00 25.28  ? 543  THR A C     1 
ATOM   4547  O  O     . THR C 3 543  ? 5.653   81.189  15.844  1.00 25.05  ? 543  THR A O     1 
ATOM   4548  C  CB    . THR C 3 543  ? 2.937   79.236  15.831  1.00 25.57  ? 543  THR A CB    1 
ATOM   4549  O  OG1   . THR C 3 543  ? 1.592   79.096  15.358  1.00 21.04  ? 543  THR A OG1   1 
ATOM   4550  C  CG2   . THR C 3 543  ? 2.921   79.912  17.190  1.00 23.37  ? 543  THR A CG2   1 
ATOM   4551  N  N     . LEU C 3 544  ? 5.970   79.054  15.177  1.00 23.72  ? 544  LEU A N     1 
ATOM   4552  C  CA    . LEU C 3 544  ? 7.363   78.978  15.630  1.00 21.90  ? 544  LEU A CA    1 
ATOM   4553  C  C     . LEU C 3 544  ? 8.276   79.968  14.933  1.00 22.60  ? 544  LEU A C     1 
ATOM   4554  O  O     . LEU C 3 544  ? 9.130   80.594  15.566  1.00 22.39  ? 544  LEU A O     1 
ATOM   4555  C  CB    . LEU C 3 544  ? 7.918   77.568  15.414  1.00 19.61  ? 544  LEU A CB    1 
ATOM   4556  C  CG    . LEU C 3 544  ? 7.223   76.449  16.190  1.00 18.60  ? 544  LEU A CG    1 
ATOM   4557  C  CD1   . LEU C 3 544  ? 7.691   75.093  15.661  1.00 16.30  ? 544  LEU A CD1   1 
ATOM   4558  C  CD2   . LEU C 3 544  ? 7.517   76.602  17.682  1.00 16.96  ? 544  LEU A CD2   1 
ATOM   4559  N  N     . THR C 3 545  ? 8.117   80.096  13.623  1.00 23.38  ? 545  THR A N     1 
ATOM   4560  C  CA    . THR C 3 545  ? 8.953   81.023  12.872  1.00 24.87  ? 545  THR A CA    1 
ATOM   4561  C  C     . THR C 3 545  ? 8.656   82.448  13.315  1.00 25.08  ? 545  THR A C     1 
ATOM   4562  O  O     . THR C 3 545  ? 9.563   83.268  13.430  1.00 24.63  ? 545  THR A O     1 
ATOM   4563  C  CB    . THR C 3 545  ? 8.711   80.921  11.358  1.00 22.82  ? 545  THR A CB    1 
ATOM   4564  O  OG1   . THR C 3 545  ? 9.009   79.594  10.909  1.00 23.99  ? 545  THR A OG1   1 
ATOM   4565  C  CG2   . THR C 3 545  ? 9.606   81.894  10.630  1.00 23.30  ? 545  THR A CG2   1 
ATOM   4566  N  N     . ALA C 3 546  ? 7.376   82.728  13.560  1.00 25.76  ? 546  ALA A N     1 
ATOM   4567  C  CA    . ALA C 3 546  ? 6.947   84.050  13.997  1.00 25.03  ? 546  ALA A CA    1 
ATOM   4568  C  C     . ALA C 3 546  ? 7.546   84.345  15.373  1.00 24.16  ? 546  ALA A C     1 
ATOM   4569  O  O     . ALA C 3 546  ? 7.971   85.464  15.641  1.00 23.04  ? 546  ALA A O     1 
ATOM   4570  C  CB    . ALA C 3 546  ? 5.425   84.114  14.054  1.00 23.22  ? 546  ALA A CB    1 
ATOM   4571  N  N     . ASP C 3 547  ? 7.579   83.334  16.237  1.00 23.73  ? 547  ASP A N     1 
ATOM   4572  C  CA    . ASP C 3 547  ? 8.137   83.502  17.570  1.00 24.58  ? 547  ASP A CA    1 
ATOM   4573  C  C     . ASP C 3 547  ? 9.629   83.780  17.470  1.00 24.33  ? 547  ASP A C     1 
ATOM   4574  O  O     . ASP C 3 547  ? 10.161  84.616  18.199  1.00 23.65  ? 547  ASP A O     1 
ATOM   4575  C  CB    . ASP C 3 547  ? 7.901   82.253  18.441  1.00 25.26  ? 547  ASP A CB    1 
ATOM   4576  C  CG    . ASP C 3 547  ? 6.475   82.173  18.990  1.00 26.03  ? 547  ASP A CG    1 
ATOM   4577  O  OD1   . ASP C 3 547  ? 5.769   83.198  18.957  1.00 27.64  ? 547  ASP A OD1   1 
ATOM   4578  O  OD2   . ASP C 3 547  ? 6.061   81.094  19.470  1.00 27.17  ? 547  ASP A OD2   1 
ATOM   4579  N  N     . TYR C 3 548  ? 10.301  83.087  16.559  1.00 24.98  ? 548  TYR A N     1 
ATOM   4580  C  CA    . TYR C 3 548  ? 11.728  83.286  16.396  1.00 26.41  ? 548  TYR A CA    1 
ATOM   4581  C  C     . TYR C 3 548  ? 12.021  84.725  15.965  1.00 28.29  ? 548  TYR A C     1 
ATOM   4582  O  O     . TYR C 3 548  ? 12.987  85.339  16.423  1.00 29.58  ? 548  TYR A O     1 
ATOM   4583  C  CB    . TYR C 3 548  ? 12.308  82.319  15.365  1.00 25.03  ? 548  TYR A CB    1 
ATOM   4584  C  CG    . TYR C 3 548  ? 13.813  82.355  15.365  1.00 26.08  ? 548  TYR A CG    1 
ATOM   4585  C  CD1   . TYR C 3 548  ? 14.550  81.472  16.155  1.00 27.35  ? 548  TYR A CD1   1 
ATOM   4586  C  CD2   . TYR C 3 548  ? 14.500  83.333  14.648  1.00 28.03  ? 548  TYR A CD2   1 
ATOM   4587  C  CE1   . TYR C 3 548  ? 15.928  81.564  16.236  1.00 29.23  ? 548  TYR A CE1   1 
ATOM   4588  C  CE2   . TYR C 3 548  ? 15.881  83.441  14.722  1.00 31.24  ? 548  TYR A CE2   1 
ATOM   4589  C  CZ    . TYR C 3 548  ? 16.593  82.554  15.518  1.00 32.95  ? 548  TYR A CZ    1 
ATOM   4590  O  OH    . TYR C 3 548  ? 17.965  82.667  15.595  1.00 35.63  ? 548  TYR A OH    1 
ATOM   4591  N  N     . ILE C 3 549  ? 11.189  85.268  15.086  1.00 27.98  ? 549  ILE A N     1 
ATOM   4592  C  CA    . ILE C 3 549  ? 11.402  86.626  14.634  1.00 28.42  ? 549  ILE A CA    1 
ATOM   4593  C  C     . ILE C 3 549  ? 11.233  87.589  15.801  1.00 29.74  ? 549  ILE A C     1 
ATOM   4594  O  O     . ILE C 3 549  ? 12.064  88.471  16.013  1.00 30.48  ? 549  ILE A O     1 
ATOM   4595  C  CB    . ILE C 3 549  ? 10.420  86.992  13.494  1.00 28.33  ? 549  ILE A CB    1 
ATOM   4596  C  CG1   . ILE C 3 549  ? 10.714  86.132  12.262  1.00 26.91  ? 549  ILE A CG1   1 
ATOM   4597  C  CG2   . ILE C 3 549  ? 10.563  88.460  13.125  1.00 26.56  ? 549  ILE A CG2   1 
ATOM   4598  C  CD1   . ILE C 3 549  ? 9.681   86.252  11.178  1.00 28.97  ? 549  ILE A CD1   1 
ATOM   4599  N  N     . ASN C 3 550  ? 10.165  87.398  16.572  1.00 31.06  ? 550  ASN A N     1 
ATOM   4600  C  CA    . ASN C 3 550  ? 9.868   88.263  17.709  1.00 31.88  ? 550  ASN A CA    1 
ATOM   4601  C  C     . ASN C 3 550  ? 10.865  88.191  18.859  1.00 34.10  ? 550  ASN A C     1 
ATOM   4602  O  O     . ASN C 3 550  ? 11.065  89.176  19.583  1.00 34.42  ? 550  ASN A O     1 
ATOM   4603  C  CB    . ASN C 3 550  ? 8.467   87.966  18.250  1.00 28.78  ? 550  ASN A CB    1 
ATOM   4604  C  CG    . ASN C 3 550  ? 7.383   88.197  17.220  1.00 29.67  ? 550  ASN A CG    1 
ATOM   4605  O  OD1   . ASN C 3 550  ? 7.399   89.188  16.484  1.00 27.92  ? 550  ASN A OD1   1 
ATOM   4606  N  ND2   . ASN C 3 550  ? 6.419   87.286  17.171  1.00 31.15  ? 550  ASN A ND2   1 
ATOM   4607  N  N     . TYR C 3 551  ? 11.486  87.032  19.042  1.00 36.79  ? 551  TYR A N     1 
ATOM   4608  C  CA    . TYR C 3 551  ? 12.433  86.880  20.132  1.00 39.84  ? 551  TYR A CA    1 
ATOM   4609  C  C     . TYR C 3 551  ? 13.836  87.325  19.749  1.00 39.53  ? 551  TYR A C     1 
ATOM   4610  O  O     . TYR C 3 551  ? 14.581  87.824  20.588  1.00 39.00  ? 551  TYR A O     1 
ATOM   4611  C  CB    . TYR C 3 551  ? 12.477  85.421  20.607  1.00 42.60  ? 551  TYR A CB    1 
ATOM   4612  C  CG    . TYR C 3 551  ? 13.350  85.202  21.834  1.00 46.94  ? 551  TYR A CG    1 
ATOM   4613  C  CD1   . TYR C 3 551  ? 12.805  85.232  23.125  1.00 49.32  ? 551  TYR A CD1   1 
ATOM   4614  C  CD2   . TYR C 3 551  ? 14.728  84.993  21.708  1.00 48.19  ? 551  TYR A CD2   1 
ATOM   4615  C  CE1   . TYR C 3 551  ? 13.619  85.055  24.266  1.00 50.34  ? 551  TYR A CE1   1 
ATOM   4616  C  CE2   . TYR C 3 551  ? 15.546  84.819  22.834  1.00 50.07  ? 551  TYR A CE2   1 
ATOM   4617  C  CZ    . TYR C 3 551  ? 14.987  84.849  24.108  1.00 50.62  ? 551  TYR A CZ    1 
ATOM   4618  O  OH    . TYR C 3 551  ? 15.793  84.652  25.214  1.00 50.94  ? 551  TYR A OH    1 
ATOM   4619  N  N     . HIS C 3 552  ? 14.180  87.171  18.474  1.00 40.92  ? 552  HIS A N     1 
ATOM   4620  C  CA    . HIS C 3 552  ? 15.527  87.492  17.993  1.00 40.82  ? 552  HIS A CA    1 
ATOM   4621  C  C     . HIS C 3 552  ? 15.711  88.642  17.004  1.00 40.60  ? 552  HIS A C     1 
ATOM   4622  O  O     . HIS C 3 552  ? 16.784  89.243  16.963  1.00 40.91  ? 552  HIS A O     1 
ATOM   4623  C  CB    . HIS C 3 552  ? 16.133  86.248  17.341  1.00 40.92  ? 552  HIS A CB    1 
ATOM   4624  C  CG    . HIS C 3 552  ? 16.083  85.024  18.198  1.00 41.56  ? 552  HIS A CG    1 
ATOM   4625  N  ND1   . HIS C 3 552  ? 17.085  84.695  19.084  1.00 41.42  ? 552  HIS A ND1   1 
ATOM   4626  C  CD2   . HIS C 3 552  ? 15.160  84.037  18.288  1.00 41.99  ? 552  HIS A CD2   1 
ATOM   4627  C  CE1   . HIS C 3 552  ? 16.786  83.552  19.678  1.00 43.49  ? 552  HIS A CE1   1 
ATOM   4628  N  NE2   . HIS C 3 552  ? 15.624  83.132  19.212  1.00 43.76  ? 552  HIS A NE2   1 
ATOM   4629  N  N     . MET C 3 553  ? 14.696  88.957  16.207  1.00 40.21  ? 553  MET A N     1 
ATOM   4630  C  CA    . MET C 3 553  ? 14.880  89.992  15.197  1.00 39.59  ? 553  MET A CA    1 
ATOM   4631  C  C     . MET C 3 553  ? 14.239  91.364  15.391  1.00 40.03  ? 553  MET A C     1 
ATOM   4632  O  O     . MET C 3 553  ? 14.607  92.313  14.696  1.00 41.19  ? 553  MET A O     1 
ATOM   4633  C  CB    . MET C 3 553  ? 14.506  89.404  13.837  1.00 37.17  ? 553  MET A CB    1 
ATOM   4634  C  CG    . MET C 3 553  ? 14.989  87.963  13.723  1.00 35.29  ? 553  MET A CG    1 
ATOM   4635  S  SD    . MET C 3 553  ? 14.838  87.173  12.116  1.00 35.61  ? 553  MET A SD    1 
ATOM   4636  C  CE    . MET C 3 553  ? 16.397  86.243  12.051  1.00 34.83  ? 553  MET A CE    1 
ATOM   4637  N  N     . ASN C 3 554  ? 13.310  91.494  16.334  1.00 39.83  ? 554  ASN A N     1 
ATOM   4638  C  CA    . ASN C 3 554  ? 12.684  92.797  16.565  1.00 37.86  ? 554  ASN A CA    1 
ATOM   4639  C  C     . ASN C 3 554  ? 12.575  93.198  18.033  1.00 38.42  ? 554  ASN A C     1 
ATOM   4640  O  O     . ASN C 3 554  ? 13.213  92.617  18.911  1.00 38.65  ? 554  ASN A O     1 
ATOM   4641  C  CB    . ASN C 3 554  ? 11.292  92.852  15.938  1.00 35.46  ? 554  ASN A CB    1 
ATOM   4642  C  CG    . ASN C 3 554  ? 10.307  91.929  16.620  1.00 33.21  ? 554  ASN A CG    1 
ATOM   4643  O  OD1   . ASN C 3 554  ? 10.240  91.877  17.846  1.00 31.48  ? 554  ASN A OD1   1 
ATOM   4644  N  ND2   . ASN C 3 554  ? 9.526   91.203  15.825  1.00 32.57  ? 554  ASN A ND2   1 
ATOM   4645  N  N     . LEU C 3 555  ? 11.750  94.208  18.276  1.00 39.11  ? 555  LEU A N     1 
ATOM   4646  C  CA    . LEU C 3 555  ? 11.503  94.740  19.604  1.00 39.54  ? 555  LEU A CA    1 
ATOM   4647  C  C     . LEU C 3 555  ? 9.990   94.630  19.817  1.00 40.61  ? 555  LEU A C     1 
ATOM   4648  O  O     . LEU C 3 555  ? 9.219   95.439  19.300  1.00 41.85  ? 555  LEU A O     1 
ATOM   4649  C  CB    . LEU C 3 555  ? 11.971  96.203  19.647  1.00 38.57  ? 555  LEU A CB    1 
ATOM   4650  C  CG    . LEU C 3 555  ? 12.118  96.953  20.975  1.00 38.43  ? 555  LEU A CG    1 
ATOM   4651  C  CD1   . LEU C 3 555  ? 13.065  96.203  21.907  1.00 37.64  ? 555  LEU A CD1   1 
ATOM   4652  C  CD2   . LEU C 3 555  ? 12.652  98.352  20.695  1.00 36.41  ? 555  LEU A CD2   1 
ATOM   4653  N  N     . SER C 3 556  ? 9.564   93.614  20.560  1.00 42.72  ? 556  SER A N     1 
ATOM   4654  C  CA    . SER C 3 556  ? 8.137   93.398  20.804  1.00 45.76  ? 556  SER A CA    1 
ATOM   4655  C  C     . SER C 3 556  ? 7.813   92.887  22.209  1.00 49.71  ? 556  SER A C     1 
ATOM   4656  O  O     . SER C 3 556  ? 8.688   92.371  22.905  1.00 48.00  ? 556  SER A O     1 
ATOM   4657  C  CB    . SER C 3 556  ? 7.592   92.407  19.770  1.00 44.55  ? 556  SER A CB    1 
ATOM   4658  O  OG    . SER C 3 556  ? 8.335   91.204  19.782  1.00 38.68  ? 556  SER A OG    1 
ATOM   4659  N  N     . PRO C 3 557  ? 6.552   93.065  22.655  1.00 54.18  ? 557  PRO A N     1 
ATOM   4660  C  CA    . PRO C 3 557  ? 6.105   92.613  23.976  1.00 58.30  ? 557  PRO A CA    1 
ATOM   4661  C  C     . PRO C 3 557  ? 5.061   91.510  23.812  1.00 62.19  ? 557  PRO A C     1 
ATOM   4662  O  O     . PRO C 3 557  ? 4.004   91.738  23.222  1.00 63.43  ? 557  PRO A O     1 
ATOM   4663  C  CB    . PRO C 3 557  ? 5.501   93.876  24.566  1.00 54.99  ? 557  PRO A CB    1 
ATOM   4664  C  CG    . PRO C 3 557  ? 4.736   94.397  23.408  1.00 54.25  ? 557  PRO A CG    1 
ATOM   4665  C  CD    . PRO C 3 557  ? 5.697   94.182  22.207  1.00 55.75  ? 557  PRO A CD    1 
ATOM   4666  N  N     . THR C 3 558  ? 5.348   90.316  24.321  1.00 67.09  ? 558  THR A N     1 
ATOM   4667  C  CA    . THR C 3 558  ? 4.389   89.222  24.199  1.00 70.96  ? 558  THR A CA    1 
ATOM   4668  C  C     . THR C 3 558  ? 3.408   89.227  25.358  1.00 75.17  ? 558  THR A C     1 
ATOM   4669  O  O     . THR C 3 558  ? 3.804   89.301  26.524  1.00 76.01  ? 558  THR A O     1 
ATOM   4670  C  CB    . THR C 3 558  ? 5.075   87.837  24.156  1.00 70.97  ? 558  THR A CB    1 
ATOM   4671  O  OG1   . THR C 3 558  ? 5.931   87.759  23.011  1.00 69.04  ? 558  THR A OG1   1 
ATOM   4672  C  CG2   . THR C 3 558  ? 4.026   86.726  24.068  1.00 69.29  ? 558  THR A CG2   1 
ATOM   4673  N  N     . SER C 3 559  ? 2.125   89.151  25.019  1.00 79.91  ? 559  SER A N     1 
ATOM   4674  C  CA    . SER C 3 559  ? 1.045   89.128  26.000  1.00 84.06  ? 559  SER A CA    1 
ATOM   4675  C  C     . SER C 3 559  ? -0.248  89.494  25.297  1.00 86.28  ? 559  SER A C     1 
ATOM   4676  O  O     . SER C 3 559  ? -0.406  89.279  24.094  1.00 85.89  ? 559  SER A O     1 
ATOM   4677  C  CB    . SER C 3 559  ? 1.295   90.143  27.126  1.00 85.31  ? 559  SER A CB    1 
ATOM   4678  O  OG    . SER C 3 559  ? 1.094   91.477  26.680  1.00 86.33  ? 559  SER A OG    1 
ATOM   4679  N  N     . GLY C 3 560  ? -1.172  90.041  26.073  1.00 88.55  ? 560  GLY A N     1 
ATOM   4680  C  CA    . GLY C 3 560  ? -2.439  90.484  25.537  1.00 91.75  ? 560  GLY A CA    1 
ATOM   4681  C  C     . GLY C 3 560  ? -2.539  91.919  26.003  1.00 93.94  ? 560  GLY A C     1 
ATOM   4682  O  O     . GLY C 3 560  ? -2.727  92.844  25.209  1.00 93.40  ? 560  GLY A O     1 
ATOM   4683  N  N     . SER C 3 561  ? -2.374  92.087  27.313  1.00 96.18  ? 561  SER A N     1 
ATOM   4684  C  CA    . SER C 3 561  ? -2.426  93.390  27.963  1.00 97.70  ? 561  SER A CA    1 
ATOM   4685  C  C     . SER C 3 561  ? -2.271  93.252  29.482  1.00 97.72  ? 561  SER A C     1 
ATOM   4686  O  O     . SER C 3 561  ? -1.217  92.829  29.956  1.00 98.28  ? 561  SER A O     1 
ATOM   4687  C  CB    . SER C 3 561  ? -3.738  94.106  27.622  1.00 98.46  ? 561  SER A CB    1 
ATOM   4688  O  OG    . SER C 3 561  ? -3.695  94.694  26.330  1.00 99.11  ? 561  SER A OG    1 
ATOM   4689  N  N     . ALA C 3 562  ? -3.318  93.596  30.235  1.00 97.43  ? 562  ALA A N     1 
ATOM   4690  C  CA    . ALA C 3 562  ? -3.296  93.534  31.702  1.00 97.06  ? 562  ALA A CA    1 
ATOM   4691  C  C     . ALA C 3 562  ? -2.391  94.641  32.252  1.00 96.60  ? 562  ALA A C     1 
ATOM   4692  O  O     . ALA C 3 562  ? -1.168  94.523  32.191  1.00 96.91  ? 562  ALA A O     1 
ATOM   4693  C  CB    . ALA C 3 562  ? -2.795  92.165  32.172  1.00 97.14  ? 562  ALA A CB    1 
ATOM   4694  N  N     . VAL C 3 563  ? -2.994  95.704  32.790  1.00 95.60  ? 563  VAL A N     1 
ATOM   4695  C  CA    . VAL C 3 563  ? -2.245  96.848  33.334  1.00 94.68  ? 563  VAL A CA    1 
ATOM   4696  C  C     . VAL C 3 563  ? -0.899  96.451  33.960  1.00 93.95  ? 563  VAL A C     1 
ATOM   4697  O  O     . VAL C 3 563  ? -0.836  95.536  34.783  1.00 94.28  ? 563  VAL A O     1 
ATOM   4698  C  CB    . VAL C 3 563  ? -3.087  97.625  34.381  1.00 94.57  ? 563  VAL A CB    1 
ATOM   4699  C  CG1   . VAL C 3 563  ? -2.364  98.900  34.792  1.00 93.45  ? 563  VAL A CG1   1 
ATOM   4700  C  CG2   . VAL C 3 563  ? -4.453  97.963  33.802  1.00 94.43  ? 563  VAL A CG2   1 
ATOM   4701  N  N     . ILE C 3 564  ? 0.155   97.164  33.550  1.00 92.39  ? 564  ILE A N     1 
ATOM   4702  C  CA    . ILE C 3 564  ? 1.559   96.969  33.960  1.00 90.38  ? 564  ILE A CA    1 
ATOM   4703  C  C     . ILE C 3 564  ? 2.207   95.926  33.053  1.00 89.41  ? 564  ILE A C     1 
ATOM   4704  O  O     . ILE C 3 564  ? 3.401   96.003  32.747  1.00 89.74  ? 564  ILE A O     1 
ATOM   4705  C  CB    . ILE C 3 564  ? 1.735   96.524  35.447  1.00 89.97  ? 564  ILE A CB    1 
ATOM   4706  C  CG1   . ILE C 3 564  ? 3.158   96.862  35.920  1.00 88.94  ? 564  ILE A CG1   1 
ATOM   4707  C  CG2   . ILE C 3 564  ? 1.578   95.005  35.588  1.00 89.87  ? 564  ILE A CG2   1 
ATOM   4708  C  CD1   . ILE C 3 564  ? 3.530   98.331  35.833  1.00 87.72  ? 564  ILE A CD1   1 
ATOM   4709  N  N     . GLU C 3 565  ? 1.412   94.946  32.632  1.00 87.79  ? 565  GLU A N     1 
ATOM   4710  C  CA    . GLU C 3 565  ? 1.897   93.917  31.729  1.00 86.33  ? 565  GLU A CA    1 
ATOM   4711  C  C     . GLU C 3 565  ? 1.895   94.578  30.362  1.00 83.09  ? 565  GLU A C     1 
ATOM   4712  O  O     . GLU C 3 565  ? 2.381   94.026  29.380  1.00 82.39  ? 565  GLU A O     1 
ATOM   4713  C  CB    . GLU C 3 565  ? 0.977   92.690  31.749  1.00 89.21  ? 565  GLU A CB    1 
ATOM   4714  C  CG    . GLU C 3 565  ? 1.339   91.614  30.724  1.00 92.29  ? 565  GLU A CG    1 
ATOM   4715  C  CD    . GLU C 3 565  ? 2.839   91.527  30.453  1.00 93.58  ? 565  GLU A CD    1 
ATOM   4716  O  OE1   . GLU C 3 565  ? 3.631   91.505  31.425  1.00 93.76  ? 565  GLU A OE1   1 
ATOM   4717  O  OE2   . GLU C 3 565  ? 3.224   91.478  29.262  1.00 94.73  ? 565  GLU A OE2   1 
ATOM   4718  N  N     . LYS C 3 566  ? 1.331   95.780  30.322  1.00 80.07  ? 566  LYS A N     1 
ATOM   4719  C  CA    . LYS C 3 566  ? 1.281   96.575  29.104  1.00 77.12  ? 566  LYS A CA    1 
ATOM   4720  C  C     . LYS C 3 566  ? 2.480   97.517  29.181  1.00 73.69  ? 566  LYS A C     1 
ATOM   4721  O  O     . LYS C 3 566  ? 2.437   98.643  28.680  1.00 74.40  ? 566  LYS A O     1 
ATOM   4722  C  CB    . LYS C 3 566  ? -0.010  97.400  29.037  1.00 78.99  ? 566  LYS A CB    1 
ATOM   4723  C  CG    . LYS C 3 566  ? -1.310  96.601  28.950  1.00 79.49  ? 566  LYS A CG    1 
ATOM   4724  C  CD    . LYS C 3 566  ? -2.504  97.557  28.958  1.00 79.93  ? 566  LYS A CD    1 
ATOM   4725  C  CE    . LYS C 3 566  ? -3.833  96.841  29.114  1.00 79.93  ? 566  LYS A CE    1 
ATOM   4726  N  NZ    . LYS C 3 566  ? -4.972  97.771  29.372  1.00 79.44  ? 566  LYS A NZ    1 
ATOM   4727  N  N     . VAL C 3 567  ? 3.539   97.041  29.835  1.00 68.74  ? 567  VAL A N     1 
ATOM   4728  C  CA    . VAL C 3 567  ? 4.779   97.793  30.015  1.00 62.84  ? 567  VAL A CA    1 
ATOM   4729  C  C     . VAL C 3 567  ? 4.559   99.299  30.146  1.00 58.74  ? 567  VAL A C     1 
ATOM   4730  O  O     . VAL C 3 567  ? 4.801   100.061 29.208  1.00 58.67  ? 567  VAL A O     1 
ATOM   4731  C  CB    . VAL C 3 567  ? 5.767   97.530  28.852  1.00 62.69  ? 567  VAL A CB    1 
ATOM   4732  C  CG1   . VAL C 3 567  ? 7.063   98.302  29.084  1.00 61.12  ? 567  VAL A CG1   1 
ATOM   4733  C  CG2   . VAL C 3 567  ? 6.046   96.034  28.734  1.00 61.03  ? 567  VAL A CG2   1 
ATOM   4734  N  N     . ILE C 3 568  ? 4.094   99.717  31.318  1.00 53.12  ? 568  ILE A N     1 
ATOM   4735  C  CA    . ILE C 3 568  ? 3.854   101.127 31.585  1.00 47.73  ? 568  ILE A CA    1 
ATOM   4736  C  C     . ILE C 3 568  ? 5.118   101.969 31.361  1.00 44.07  ? 568  ILE A C     1 
ATOM   4737  O  O     . ILE C 3 568  ? 5.059   103.026 30.739  1.00 45.09  ? 568  ILE A O     1 
ATOM   4738  C  CB    . ILE C 3 568  ? 3.323   101.331 33.045  1.00 48.06  ? 568  ILE A CB    1 
ATOM   4739  C  CG1   . ILE C 3 568  ? 1.878   100.821 33.141  1.00 46.65  ? 568  ILE A CG1   1 
ATOM   4740  C  CG2   . ILE C 3 568  ? 3.425   102.802 33.463  1.00 46.65  ? 568  ILE A CG2   1 
ATOM   4741  C  CD1   . ILE C 3 568  ? 1.236   100.997 34.508  1.00 45.21  ? 568  ILE A CD1   1 
ATOM   4742  N  N     . PRO C 3 569  ? 6.280   101.497 31.839  1.00 40.03  ? 569  PRO A N     1 
ATOM   4743  C  CA    . PRO C 3 569  ? 7.532   102.244 31.675  1.00 37.38  ? 569  PRO A CA    1 
ATOM   4744  C  C     . PRO C 3 569  ? 7.818   102.762 30.267  1.00 34.74  ? 569  PRO A C     1 
ATOM   4745  O  O     . PRO C 3 569  ? 8.286   103.888 30.100  1.00 33.02  ? 569  PRO A O     1 
ATOM   4746  C  CB    . PRO C 3 569  ? 8.591   101.247 32.142  1.00 37.03  ? 569  PRO A CB    1 
ATOM   4747  C  CG    . PRO C 3 569  ? 7.879   100.459 33.156  1.00 37.71  ? 569  PRO A CG    1 
ATOM   4748  C  CD    . PRO C 3 569  ? 6.542   100.209 32.503  1.00 38.76  ? 569  PRO A CD    1 
ATOM   4749  N  N     . LEU C 3 570  ? 7.539   101.935 29.264  1.00 32.12  ? 570  LEU A N     1 
ATOM   4750  C  CA    . LEU C 3 570  ? 7.785   102.303 27.872  1.00 30.76  ? 570  LEU A CA    1 
ATOM   4751  C  C     . LEU C 3 570  ? 7.016   103.552 27.451  1.00 29.53  ? 570  LEU A C     1 
ATOM   4752  O  O     . LEU C 3 570  ? 7.540   104.411 26.730  1.00 26.77  ? 570  LEU A O     1 
ATOM   4753  C  CB    . LEU C 3 570  ? 7.416   101.136 26.951  1.00 31.24  ? 570  LEU A CB    1 
ATOM   4754  C  CG    . LEU C 3 570  ? 7.855   101.236 25.489  1.00 30.06  ? 570  LEU A CG    1 
ATOM   4755  C  CD1   . LEU C 3 570  ? 9.350   101.471 25.412  1.00 27.90  ? 570  LEU A CD1   1 
ATOM   4756  C  CD2   . LEU C 3 570  ? 7.485   99.966  24.770  1.00 29.15  ? 570  LEU A CD2   1 
ATOM   4757  N  N     . GLY C 3 571  ? 5.775   103.650 27.915  1.00 29.09  ? 571  GLY A N     1 
ATOM   4758  C  CA    . GLY C 3 571  ? 4.949   104.792 27.574  1.00 28.26  ? 571  GLY A CA    1 
ATOM   4759  C  C     . GLY C 3 571  ? 5.428   106.065 28.228  1.00 28.00  ? 571  GLY A C     1 
ATOM   4760  O  O     . GLY C 3 571  ? 5.341   107.140 27.639  1.00 29.22  ? 571  GLY A O     1 
ATOM   4761  N  N     . VAL C 3 572  ? 5.940   105.945 29.448  1.00 28.13  ? 572  VAL A N     1 
ATOM   4762  C  CA    . VAL C 3 572  ? 6.436   107.102 30.188  1.00 26.71  ? 572  VAL A CA    1 
ATOM   4763  C  C     . VAL C 3 572  ? 7.593   107.710 29.399  1.00 27.08  ? 572  VAL A C     1 
ATOM   4764  O  O     . VAL C 3 572  ? 7.608   108.912 29.124  1.00 27.13  ? 572  VAL A O     1 
ATOM   4765  C  CB    . VAL C 3 572  ? 6.929   106.691 31.601  1.00 25.41  ? 572  VAL A CB    1 
ATOM   4766  C  CG1   . VAL C 3 572  ? 7.117   107.924 32.472  1.00 25.05  ? 572  VAL A CG1   1 
ATOM   4767  C  CG2   . VAL C 3 572  ? 5.940   105.747 32.241  1.00 23.01  ? 572  VAL A CG2   1 
ATOM   4768  N  N     . TYR C 3 573  ? 8.545   106.859 29.026  1.00 27.09  ? 573  TYR A N     1 
ATOM   4769  C  CA    . TYR C 3 573  ? 9.724   107.252 28.256  1.00 28.14  ? 573  TYR A CA    1 
ATOM   4770  C  C     . TYR C 3 573  ? 9.347   107.876 26.908  1.00 29.18  ? 573  TYR A C     1 
ATOM   4771  O  O     . TYR C 3 573  ? 9.733   109.006 26.589  1.00 27.95  ? 573  TYR A O     1 
ATOM   4772  C  CB    . TYR C 3 573  ? 10.600  106.019 27.996  1.00 29.17  ? 573  TYR A CB    1 
ATOM   4773  C  CG    . TYR C 3 573  ? 11.821  106.294 27.146  1.00 30.43  ? 573  TYR A CG    1 
ATOM   4774  C  CD1   . TYR C 3 573  ? 12.995  106.795 27.716  1.00 30.62  ? 573  TYR A CD1   1 
ATOM   4775  C  CD2   . TYR C 3 573  ? 11.801  106.073 25.769  1.00 30.89  ? 573  TYR A CD2   1 
ATOM   4776  C  CE1   . TYR C 3 573  ? 14.115  107.068 26.937  1.00 31.12  ? 573  TYR A CE1   1 
ATOM   4777  C  CE2   . TYR C 3 573  ? 12.914  106.343 24.980  1.00 31.98  ? 573  TYR A CE2   1 
ATOM   4778  C  CZ    . TYR C 3 573  ? 14.068  106.840 25.573  1.00 32.74  ? 573  TYR A CZ    1 
ATOM   4779  O  OH    . TYR C 3 573  ? 15.176  107.105 24.802  1.00 34.48  ? 573  TYR A OH    1 
ATOM   4780  N  N     . ALA C 3 574  ? 8.600   107.113 26.117  1.00 28.80  ? 574  ALA A N     1 
ATOM   4781  C  CA    . ALA C 3 574  ? 8.176   107.542 24.795  1.00 27.76  ? 574  ALA A CA    1 
ATOM   4782  C  C     . ALA C 3 574  ? 7.410   108.860 24.802  1.00 27.46  ? 574  ALA A C     1 
ATOM   4783  O  O     . ALA C 3 574  ? 7.560   109.677 23.893  1.00 27.26  ? 574  ALA A O     1 
ATOM   4784  C  CB    . ALA C 3 574  ? 7.325   106.447 24.147  1.00 26.52  ? 574  ALA A CB    1 
ATOM   4785  N  N     . SER C 3 575  ? 6.596   109.078 25.828  1.00 26.37  ? 575  SER A N     1 
ATOM   4786  C  CA    . SER C 3 575  ? 5.810   110.300 25.882  1.00 26.10  ? 575  SER A CA    1 
ATOM   4787  C  C     . SER C 3 575  ? 6.464   111.487 26.587  1.00 26.58  ? 575  SER A C     1 
ATOM   4788  O  O     . SER C 3 575  ? 5.877   112.559 26.636  1.00 30.73  ? 575  SER A O     1 
ATOM   4789  C  CB    . SER C 3 575  ? 4.444   110.014 26.520  1.00 26.53  ? 575  SER A CB    1 
ATOM   4790  O  OG    . SER C 3 575  ? 4.572   109.626 27.884  1.00 27.13  ? 575  SER A OG    1 
ATOM   4791  N  N     . SER C 3 576  ? 7.665   111.320 27.129  1.00 26.65  ? 576  SER A N     1 
ATOM   4792  C  CA    . SER C 3 576  ? 8.321   112.430 27.823  1.00 27.39  ? 576  SER A CA    1 
ATOM   4793  C  C     . SER C 3 576  ? 9.258   113.271 26.954  1.00 28.64  ? 576  SER A C     1 
ATOM   4794  O  O     . SER C 3 576  ? 10.199  112.753 26.347  1.00 27.54  ? 576  SER A O     1 
ATOM   4795  C  CB    . SER C 3 576  ? 9.136   111.935 29.025  1.00 25.35  ? 576  SER A CB    1 
ATOM   4796  O  OG    . SER C 3 576  ? 8.331   111.360 30.026  1.00 24.36  ? 576  SER A OG    1 
ATOM   4797  N  N     . PRO C 3 577  ? 9.012   114.588 26.889  1.00 29.69  ? 577  PRO A N     1 
ATOM   4798  C  CA    . PRO C 3 577  ? 9.892   115.441 26.082  1.00 30.69  ? 577  PRO A CA    1 
ATOM   4799  C  C     . PRO C 3 577  ? 11.280  115.318 26.708  1.00 31.82  ? 577  PRO A C     1 
ATOM   4800  O  O     . PRO C 3 577  ? 11.391  115.145 27.924  1.00 32.97  ? 577  PRO A O     1 
ATOM   4801  C  CB    . PRO C 3 577  ? 9.288   116.827 26.277  1.00 29.50  ? 577  PRO A CB    1 
ATOM   4802  C  CG    . PRO C 3 577  ? 7.820   116.521 26.446  1.00 29.35  ? 577  PRO A CG    1 
ATOM   4803  C  CD    . PRO C 3 577  ? 7.839   115.338 27.373  1.00 27.14  ? 577  PRO A CD    1 
ATOM   4804  N  N     . PRO C 3 578  ? 12.358  115.419 25.909  1.00 33.12  ? 578  PRO A N     1 
ATOM   4805  C  CA    . PRO C 3 578  ? 12.501  115.646 24.468  1.00 33.05  ? 578  PRO A CA    1 
ATOM   4806  C  C     . PRO C 3 578  ? 12.047  114.507 23.559  1.00 33.76  ? 578  PRO A C     1 
ATOM   4807  O  O     . PRO C 3 578  ? 12.130  114.640 22.340  1.00 34.99  ? 578  PRO A O     1 
ATOM   4808  C  CB    . PRO C 3 578  ? 14.004  115.895 24.294  1.00 33.07  ? 578  PRO A CB    1 
ATOM   4809  C  CG    . PRO C 3 578  ? 14.534  116.075 25.691  1.00 32.25  ? 578  PRO A CG    1 
ATOM   4810  C  CD    . PRO C 3 578  ? 13.681  115.183 26.506  1.00 32.28  ? 578  PRO A CD    1 
ATOM   4811  N  N     . ASN C 3 579  ? 11.603  113.387 24.124  1.00 32.83  ? 579  ASN A N     1 
ATOM   4812  C  CA    . ASN C 3 579  ? 11.167  112.272 23.286  1.00 32.91  ? 579  ASN A CA    1 
ATOM   4813  C  C     . ASN C 3 579  ? 9.772   112.490 22.729  1.00 34.07  ? 579  ASN A C     1 
ATOM   4814  O  O     . ASN C 3 579  ? 8.982   113.248 23.282  1.00 34.17  ? 579  ASN A O     1 
ATOM   4815  C  CB    . ASN C 3 579  ? 11.170  110.959 24.061  1.00 33.71  ? 579  ASN A CB    1 
ATOM   4816  C  CG    . ASN C 3 579  ? 12.517  110.632 24.648  1.00 34.50  ? 579  ASN A CG    1 
ATOM   4817  O  OD1   . ASN C 3 579  ? 13.551  110.802 24.000  1.00 37.04  ? 579  ASN A OD1   1 
ATOM   4818  N  ND2   . ASN C 3 579  ? 12.517  110.138 25.878  1.00 35.40  ? 579  ASN A ND2   1 
ATOM   4819  N  N     . GLN C 3 580  ? 9.481   111.807 21.628  1.00 35.80  ? 580  GLN A N     1 
ATOM   4820  C  CA    . GLN C 3 580  ? 8.184   111.892 20.960  1.00 36.25  ? 580  GLN A CA    1 
ATOM   4821  C  C     . GLN C 3 580  ? 7.850   110.508 20.431  1.00 36.60  ? 580  GLN A C     1 
ATOM   4822  O  O     . GLN C 3 580  ? 8.744   109.691 20.205  1.00 37.24  ? 580  GLN A O     1 
ATOM   4823  C  CB    . GLN C 3 580  ? 8.242   112.854 19.777  1.00 35.14  ? 580  GLN A CB    1 
ATOM   4824  C  CG    . GLN C 3 580  ? 8.455   114.302 20.131  1.00 36.96  ? 580  GLN A CG    1 
ATOM   4825  C  CD    . GLN C 3 580  ? 8.740   115.144 18.902  1.00 37.63  ? 580  GLN A CD    1 
ATOM   4826  O  OE1   . GLN C 3 580  ? 9.864   115.143 18.381  1.00 38.57  ? 580  GLN A OE1   1 
ATOM   4827  N  NE2   . GLN C 3 580  ? 7.720   115.851 18.417  1.00 34.91  ? 580  GLN A NE2   1 
ATOM   4828  N  N     . SER C 3 581  ? 6.570   110.250 20.213  1.00 36.71  ? 581  SER A N     1 
ATOM   4829  C  CA    . SER C 3 581  ? 6.166   108.954 19.706  1.00 38.47  ? 581  SER A CA    1 
ATOM   4830  C  C     . SER C 3 581  ? 5.031   109.046 18.701  1.00 39.05  ? 581  SER A C     1 
ATOM   4831  O  O     . SER C 3 581  ? 4.183   109.941 18.776  1.00 40.73  ? 581  SER A O     1 
ATOM   4832  C  CB    . SER C 3 581  ? 5.750   108.049 20.864  1.00 39.95  ? 581  SER A CB    1 
ATOM   4833  O  OG    . SER C 3 581  ? 4.768   108.682 21.668  1.00 43.27  ? 581  SER A OG    1 
ATOM   4834  N  N     . ILE C 3 582  ? 5.038   108.117 17.751  1.00 37.98  ? 582  ILE A N     1 
ATOM   4835  C  CA    . ILE C 3 582  ? 4.007   108.036 16.728  1.00 37.36  ? 582  ILE A CA    1 
ATOM   4836  C  C     . ILE C 3 582  ? 3.286   106.748 17.086  1.00 36.73  ? 582  ILE A C     1 
ATOM   4837  O  O     . ILE C 3 582  ? 3.923   105.716 17.268  1.00 36.13  ? 582  ILE A O     1 
ATOM   4838  C  CB    . ILE C 3 582  ? 4.613   107.888 15.303  1.00 38.04  ? 582  ILE A CB    1 
ATOM   4839  C  CG1   . ILE C 3 582  ? 5.748   108.902 15.095  1.00 38.09  ? 582  ILE A CG1   1 
ATOM   4840  C  CG2   . ILE C 3 582  ? 3.516   108.052 14.256  1.00 35.30  ? 582  ILE A CG2   1 
ATOM   4841  C  CD1   . ILE C 3 582  ? 5.355   110.356 15.297  1.00 39.03  ? 582  ILE A CD1   1 
ATOM   4842  N  N     . ASN C 3 583  ? 1.968   106.800 17.196  1.00 37.42  ? 583  ASN A N     1 
ATOM   4843  C  CA    . ASN C 3 583  ? 1.209   105.616 17.563  1.00 39.16  ? 583  ASN A CA    1 
ATOM   4844  C  C     . ASN C 3 583  ? 0.655   104.931 16.324  1.00 42.03  ? 583  ASN A C     1 
ATOM   4845  O  O     . ASN C 3 583  ? -0.466  105.204 15.882  1.00 44.30  ? 583  ASN A O     1 
ATOM   4846  C  CB    . ASN C 3 583  ? 0.089   106.012 18.520  1.00 37.14  ? 583  ASN A CB    1 
ATOM   4847  C  CG    . ASN C 3 583  ? 0.574   106.945 19.606  1.00 36.64  ? 583  ASN A CG    1 
ATOM   4848  O  OD1   . ASN C 3 583  ? 1.538   106.643 20.307  1.00 36.15  ? 583  ASN A OD1   1 
ATOM   4849  N  ND2   . ASN C 3 583  ? -0.085  108.088 19.751  1.00 37.00  ? 583  ASN A ND2   1 
ATOM   4850  N  N     . ILE C 3 584  ? 1.459   104.037 15.763  1.00 42.75  ? 584  ILE A N     1 
ATOM   4851  C  CA    . ILE C 3 584  ? 1.072   103.312 14.569  1.00 43.39  ? 584  ILE A CA    1 
ATOM   4852  C  C     . ILE C 3 584  ? 0.115   102.156 14.865  1.00 43.68  ? 584  ILE A C     1 
ATOM   4853  O  O     . ILE C 3 584  ? 0.260   101.442 15.854  1.00 45.67  ? 584  ILE A O     1 
ATOM   4854  C  CB    . ILE C 3 584  ? 2.324   102.791 13.843  1.00 43.65  ? 584  ILE A CB    1 
ATOM   4855  C  CG1   . ILE C 3 584  ? 3.256   103.963 13.550  1.00 41.81  ? 584  ILE A CG1   1 
ATOM   4856  C  CG2   . ILE C 3 584  ? 1.939   102.101 12.544  1.00 45.28  ? 584  ILE A CG2   1 
ATOM   4857  C  CD1   . ILE C 3 584  ? 4.420   103.610 12.664  1.00 43.05  ? 584  ILE A CD1   1 
ATOM   4858  N  N     . ASP C 3 585  ? -0.878  101.996 14.002  1.00 44.28  ? 585  ASP A N     1 
ATOM   4859  C  CA    . ASP C 3 585  ? -1.869  100.934 14.132  1.00 44.45  ? 585  ASP A CA    1 
ATOM   4860  C  C     . ASP C 3 585  ? -2.264  100.555 12.703  1.00 43.84  ? 585  ASP A C     1 
ATOM   4861  O  O     . ASP C 3 585  ? -2.220  101.392 11.803  1.00 45.07  ? 585  ASP A O     1 
ATOM   4862  C  CB    . ASP C 3 585  ? -3.082  101.446 14.934  1.00 44.88  ? 585  ASP A CB    1 
ATOM   4863  C  CG    . ASP C 3 585  ? -4.110  100.345 15.245  1.00 46.34  ? 585  ASP A CG    1 
ATOM   4864  O  OD1   . ASP C 3 585  ? -4.988  100.078 14.390  1.00 44.91  ? 585  ASP A OD1   1 
ATOM   4865  O  OD2   . ASP C 3 585  ? -4.039  99.746  16.349  1.00 45.32  ? 585  ASP A OD2   1 
ATOM   4866  N  N     . ILE C 3 586  ? -2.613  99.296  12.477  1.00 42.09  ? 586  ILE A N     1 
ATOM   4867  C  CA    . ILE C 3 586  ? -3.007  98.869  11.139  1.00 41.24  ? 586  ILE A CA    1 
ATOM   4868  C  C     . ILE C 3 586  ? -4.461  98.423  11.189  1.00 41.06  ? 586  ILE A C     1 
ATOM   4869  O  O     . ILE C 3 586  ? -4.799  97.508  11.940  1.00 42.68  ? 586  ILE A O     1 
ATOM   4870  C  CB    . ILE C 3 586  ? -2.132  97.699  10.653  1.00 41.11  ? 586  ILE A CB    1 
ATOM   4871  C  CG1   . ILE C 3 586  ? -0.656  98.089  10.744  1.00 40.20  ? 586  ILE A CG1   1 
ATOM   4872  C  CG2   . ILE C 3 586  ? -2.490  97.340  9.221   1.00 38.28  ? 586  ILE A CG2   1 
ATOM   4873  C  CD1   . ILE C 3 586  ? 0.274   96.911  10.752  1.00 40.58  ? 586  ILE A CD1   1 
ATOM   4874  N  N     . SER C 3 587  ? -5.325  99.064  10.408  1.00 39.38  ? 587  SER A N     1 
ATOM   4875  C  CA    . SER C 3 587  ? -6.732  98.687  10.423  1.00 40.32  ? 587  SER A CA    1 
ATOM   4876  C  C     . SER C 3 587  ? -7.045  97.505  9.506   1.00 40.33  ? 587  SER A C     1 
ATOM   4877  O  O     . SER C 3 587  ? -6.436  97.335  8.443   1.00 39.54  ? 587  SER A O     1 
ATOM   4878  C  CB    . SER C 3 587  ? -7.624  99.893  10.077  1.00 41.52  ? 587  SER A CB    1 
ATOM   4879  O  OG    . SER C 3 587  ? -7.321  100.441 8.807   1.00 43.47  ? 587  SER A OG    1 
ATOM   4880  N  N     . ALA C 3 588  ? -8.001  96.685  9.938   1.00 40.56  ? 588  ALA A N     1 
ATOM   4881  C  CA    . ALA C 3 588  ? -8.406  95.505  9.184   1.00 40.29  ? 588  ALA A CA    1 
ATOM   4882  C  C     . ALA C 3 588  ? -7.212  94.550  9.106   1.00 39.48  ? 588  ALA A C     1 
ATOM   4883  O  O     . ALA C 3 588  ? -7.027  93.850  8.110   1.00 39.30  ? 588  ALA A O     1 
ATOM   4884  C  CB    . ALA C 3 588  ? -8.850  95.918  7.783   1.00 39.80  ? 588  ALA A CB    1 
ATOM   4885  N  N     . CYS C 3 589  ? -6.408  94.531  10.165  1.00 38.03  ? 589  CYS A N     1 
ATOM   4886  C  CA    . CYS C 3 589  ? -5.223  93.688  10.205  1.00 38.04  ? 589  CYS A CA    1 
ATOM   4887  C  C     . CYS C 3 589  ? -5.457  92.269  9.699   1.00 37.79  ? 589  CYS A C     1 
ATOM   4888  O  O     . CYS C 3 589  ? -4.836  91.858  8.720   1.00 36.66  ? 589  CYS A O     1 
ATOM   4889  C  CB    . CYS C 3 589  ? -4.643  93.627  11.621  1.00 37.22  ? 589  CYS A CB    1 
ATOM   4890  S  SG    . CYS C 3 589  ? -3.077  92.703  11.691  1.00 42.01  ? 589  CYS A SG    1 
ATOM   4891  N  N     . ASP C 3 590  ? -6.341  91.527  10.371  1.00 38.83  ? 590  ASP A N     1 
ATOM   4892  C  CA    . ASP C 3 590  ? -6.645  90.145  9.995   1.00 39.19  ? 590  ASP A CA    1 
ATOM   4893  C  C     . ASP C 3 590  ? -7.082  89.988  8.547   1.00 37.94  ? 590  ASP A C     1 
ATOM   4894  O  O     . ASP C 3 590  ? -6.703  89.027  7.887   1.00 39.89  ? 590  ASP A O     1 
ATOM   4895  C  CB    . ASP C 3 590  ? -7.736  89.558  10.896  1.00 42.87  ? 590  ASP A CB    1 
ATOM   4896  C  CG    . ASP C 3 590  ? -7.299  89.428  12.341  1.00 46.88  ? 590  ASP A CG    1 
ATOM   4897  O  OD1   . ASP C 3 590  ? -6.156  88.985  12.583  1.00 48.59  ? 590  ASP A OD1   1 
ATOM   4898  O  OD2   . ASP C 3 590  ? -8.104  89.756  13.241  1.00 50.57  ? 590  ASP A OD2   1 
ATOM   4899  N  N     . ALA C 3 591  ? -7.892  90.915  8.050   1.00 36.53  ? 591  ALA A N     1 
ATOM   4900  C  CA    . ALA C 3 591  ? -8.355  90.831  6.669   1.00 34.18  ? 591  ALA A CA    1 
ATOM   4901  C  C     . ALA C 3 591  ? -7.267  91.254  5.686   1.00 32.81  ? 591  ALA A C     1 
ATOM   4902  O  O     . ALA C 3 591  ? -7.407  91.047  4.479   1.00 32.67  ? 591  ALA A O     1 
ATOM   4903  C  CB    . ALA C 3 591  ? -9.600  91.684  6.475   1.00 32.95  ? 591  ALA A CB    1 
ATOM   4904  N  N     . SER C 3 592  ? -6.185  91.832  6.207   1.00 30.88  ? 592  SER A N     1 
ATOM   4905  C  CA    . SER C 3 592  ? -5.064  92.282  5.378   1.00 30.93  ? 592  SER A CA    1 
ATOM   4906  C  C     . SER C 3 592  ? -3.991  91.214  5.192   1.00 30.74  ? 592  SER A C     1 
ATOM   4907  O  O     . SER C 3 592  ? -3.120  91.348  4.338   1.00 30.37  ? 592  SER A O     1 
ATOM   4908  C  CB    . SER C 3 592  ? -4.420  93.546  5.966   1.00 30.69  ? 592  SER A CB    1 
ATOM   4909  O  OG    . SER C 3 592  ? -5.247  94.687  5.773   1.00 30.33  ? 592  SER A OG    1 
ATOM   4910  N  N     . ILE C 3 593  ? -4.049  90.157  5.997   1.00 31.67  ? 593  ILE A N     1 
ATOM   4911  C  CA    . ILE C 3 593  ? -3.077  89.072  5.886   1.00 29.98  ? 593  ILE A CA    1 
ATOM   4912  C  C     . ILE C 3 593  ? -3.716  87.953  5.064   1.00 29.27  ? 593  ILE A C     1 
ATOM   4913  O  O     . ILE C 3 593  ? -4.317  87.023  5.593   1.00 28.78  ? 593  ILE A O     1 
ATOM   4914  C  CB    . ILE C 3 593  ? -2.647  88.553  7.283   1.00 28.53  ? 593  ILE A CB    1 
ATOM   4915  C  CG1   . ILE C 3 593  ? -2.157  89.725  8.134   1.00 28.76  ? 593  ILE A CG1   1 
ATOM   4916  C  CG2   . ILE C 3 593  ? -1.508  87.542  7.151   1.00 24.28  ? 593  ILE A CG2   1 
ATOM   4917  C  CD1   . ILE C 3 593  ? -0.958  90.447  7.544   1.00 28.93  ? 593  ILE A CD1   1 
ATOM   4918  N  N     . THR C 3 594  ? -3.583  88.069  3.750   1.00 28.10  ? 594  THR A N     1 
ATOM   4919  C  CA    . THR C 3 594  ? -4.159  87.098  2.847   1.00 28.27  ? 594  THR A CA    1 
ATOM   4920  C  C     . THR C 3 594  ? -3.088  86.431  2.014   1.00 29.76  ? 594  THR A C     1 
ATOM   4921  O  O     . THR C 3 594  ? -1.920  86.808  2.059   1.00 31.54  ? 594  THR A O     1 
ATOM   4922  C  CB    . THR C 3 594  ? -5.166  87.764  1.909   1.00 27.27  ? 594  THR A CB    1 
ATOM   4923  O  OG1   . THR C 3 594  ? -4.471  88.614  0.993   1.00 27.89  ? 594  THR A OG1   1 
ATOM   4924  C  CG2   . THR C 3 594  ? -6.153  88.601  2.705   1.00 27.87  ? 594  THR A CG2   1 
ATOM   4925  N  N     . TRP C 3 595  ? -3.498  85.440  1.240   1.00 30.89  ? 595  TRP A N     1 
ATOM   4926  C  CA    . TRP C 3 595  ? -2.581  84.695  0.395   1.00 31.38  ? 595  TRP A CA    1 
ATOM   4927  C  C     . TRP C 3 595  ? -1.906  85.520  -0.705  1.00 31.89  ? 595  TRP A C     1 
ATOM   4928  O  O     . TRP C 3 595  ? -0.725  85.319  -0.999  1.00 30.71  ? 595  TRP A O     1 
ATOM   4929  C  CB    . TRP C 3 595  ? -3.326  83.513  -0.227  1.00 30.33  ? 595  TRP A CB    1 
ATOM   4930  C  CG    . TRP C 3 595  ? -2.463  82.672  -1.067  1.00 29.98  ? 595  TRP A CG    1 
ATOM   4931  C  CD1   . TRP C 3 595  ? -2.258  82.788  -2.411  1.00 28.97  ? 595  TRP A CD1   1 
ATOM   4932  C  CD2   . TRP C 3 595  ? -1.615  81.617  -0.617  1.00 30.59  ? 595  TRP A CD2   1 
ATOM   4933  N  NE1   . TRP C 3 595  ? -1.329  81.869  -2.827  1.00 29.79  ? 595  TRP A NE1   1 
ATOM   4934  C  CE2   . TRP C 3 595  ? -0.917  81.135  -1.746  1.00 30.72  ? 595  TRP A CE2   1 
ATOM   4935  C  CE3   . TRP C 3 595  ? -1.372  81.032  0.635   1.00 29.52  ? 595  TRP A CE3   1 
ATOM   4936  C  CZ2   . TRP C 3 595  ? 0.009   80.094  -1.664  1.00 29.83  ? 595  TRP A CZ2   1 
ATOM   4937  C  CZ3   . TRP C 3 595  ? -0.452  80.000  0.719   1.00 28.70  ? 595  TRP A CZ3   1 
ATOM   4938  C  CH2   . TRP C 3 595  ? 0.228   79.540  -0.427  1.00 30.28  ? 595  TRP A CH2   1 
ATOM   4939  N  N     . ASP C 3 596  ? -2.651  86.451  -1.297  1.00 32.85  ? 596  ASP A N     1 
ATOM   4940  C  CA    . ASP C 3 596  ? -2.137  87.282  -2.392  1.00 33.99  ? 596  ASP A CA    1 
ATOM   4941  C  C     . ASP C 3 596  ? -0.792  87.966  -2.211  1.00 32.52  ? 596  ASP A C     1 
ATOM   4942  O  O     . ASP C 3 596  ? -0.037  88.119  -3.171  1.00 33.69  ? 596  ASP A O     1 
ATOM   4943  C  CB    . ASP C 3 596  ? -3.173  88.335  -2.792  1.00 36.66  ? 596  ASP A CB    1 
ATOM   4944  C  CG    . ASP C 3 596  ? -4.383  87.723  -3.469  1.00 39.94  ? 596  ASP A CG    1 
ATOM   4945  O  OD1   . ASP C 3 596  ? -4.188  86.940  -4.429  1.00 39.35  ? 596  ASP A OD1   1 
ATOM   4946  O  OD2   . ASP C 3 596  ? -5.521  88.021  -3.036  1.00 41.36  ? 596  ASP A OD2   1 
ATOM   4947  N  N     . PHE C 3 597  ? -0.475  88.394  -1.000  1.00 31.63  ? 597  PHE A N     1 
ATOM   4948  C  CA    . PHE C 3 597  ? 0.809   89.046  -0.807  1.00 29.03  ? 597  PHE A CA    1 
ATOM   4949  C  C     . PHE C 3 597  ? 1.606   88.480  0.361   1.00 27.34  ? 597  PHE A C     1 
ATOM   4950  O  O     . PHE C 3 597  ? 2.805   88.238  0.238   1.00 29.07  ? 597  PHE A O     1 
ATOM   4951  C  CB    . PHE C 3 597  ? 0.627   90.556  -0.608  1.00 27.70  ? 597  PHE A CB    1 
ATOM   4952  C  CG    . PHE C 3 597  ? 1.923   91.299  -0.462  1.00 26.36  ? 597  PHE A CG    1 
ATOM   4953  C  CD1   . PHE C 3 597  ? 2.584   91.796  -1.579  1.00 25.98  ? 597  PHE A CD1   1 
ATOM   4954  C  CD2   . PHE C 3 597  ? 2.508   91.459  0.788   1.00 25.55  ? 597  PHE A CD2   1 
ATOM   4955  C  CE1   . PHE C 3 597  ? 3.806   92.442  -1.458  1.00 25.96  ? 597  PHE A CE1   1 
ATOM   4956  C  CE2   . PHE C 3 597  ? 3.734   92.104  0.921   1.00 26.13  ? 597  PHE A CE2   1 
ATOM   4957  C  CZ    . PHE C 3 597  ? 4.384   92.596  -0.206  1.00 26.51  ? 597  PHE A CZ    1 
ATOM   4958  N  N     . PHE C 3 598  ? 0.945   88.266  1.489   1.00 25.07  ? 598  PHE A N     1 
ATOM   4959  C  CA    . PHE C 3 598  ? 1.634   87.767  2.672   1.00 23.19  ? 598  PHE A CA    1 
ATOM   4960  C  C     . PHE C 3 598  ? 1.770   86.253  2.797   1.00 21.56  ? 598  PHE A C     1 
ATOM   4961  O  O     . PHE C 3 598  ? 2.870   85.713  2.672   1.00 21.77  ? 598  PHE A O     1 
ATOM   4962  C  CB    . PHE C 3 598  ? 0.970   88.342  3.930   1.00 22.26  ? 598  PHE A CB    1 
ATOM   4963  C  CG    . PHE C 3 598  ? 1.379   89.766  4.235   1.00 23.21  ? 598  PHE A CG    1 
ATOM   4964  C  CD1   . PHE C 3 598  ? 2.615   90.040  4.828   1.00 21.33  ? 598  PHE A CD1   1 
ATOM   4965  C  CD2   . PHE C 3 598  ? 0.545   90.839  3.904   1.00 23.74  ? 598  PHE A CD2   1 
ATOM   4966  C  CE1   . PHE C 3 598  ? 3.020   91.356  5.087   1.00 19.85  ? 598  PHE A CE1   1 
ATOM   4967  C  CE2   . PHE C 3 598  ? 0.941   92.159  4.156   1.00 21.88  ? 598  PHE A CE2   1 
ATOM   4968  C  CZ    . PHE C 3 598  ? 2.188   92.416  4.752   1.00 20.65  ? 598  PHE A CZ    1 
ATOM   4969  N  N     . LEU C 3 599  ? 0.661   85.564  3.033   1.00 21.53  ? 599  LEU A N     1 
ATOM   4970  C  CA    . LEU C 3 599  ? 0.702   84.116  3.224   1.00 21.84  ? 599  LEU A CA    1 
ATOM   4971  C  C     . LEU C 3 599  ? 1.385   83.272  2.151   1.00 21.19  ? 599  LEU A C     1 
ATOM   4972  O  O     . LEU C 3 599  ? 2.081   82.312  2.485   1.00 22.38  ? 599  LEU A O     1 
ATOM   4973  C  CB    . LEU C 3 599  ? -0.709  83.589  3.501   1.00 21.37  ? 599  LEU A CB    1 
ATOM   4974  C  CG    . LEU C 3 599  ? -1.348  84.338  4.686   1.00 22.25  ? 599  LEU A CG    1 
ATOM   4975  C  CD1   . LEU C 3 599  ? -2.721  83.776  4.999   1.00 21.37  ? 599  LEU A CD1   1 
ATOM   4976  C  CD2   . LEU C 3 599  ? -0.439  84.231  5.898   1.00 21.22  ? 599  LEU A CD2   1 
ATOM   4977  N  N     . SER C 3 600  ? 1.213   83.610  0.878   1.00 21.72  ? 600  SER A N     1 
ATOM   4978  C  CA    . SER C 3 600  ? 1.849   82.814  -0.175  1.00 23.40  ? 600  SER A CA    1 
ATOM   4979  C  C     . SER C 3 600  ? 3.359   82.960  -0.065  1.00 23.65  ? 600  SER A C     1 
ATOM   4980  O  O     . SER C 3 600  ? 4.109   82.055  -0.394  1.00 22.84  ? 600  SER A O     1 
ATOM   4981  C  CB    . SER C 3 600  ? 1.389   83.267  -1.565  1.00 23.86  ? 600  SER A CB    1 
ATOM   4982  O  OG    . SER C 3 600  ? 1.711   84.631  -1.802  1.00 28.69  ? 600  SER A OG    1 
ATOM   4983  N  N     . VAL C 3 601  ? 3.794   84.120  0.406   1.00 25.40  ? 601  VAL A N     1 
ATOM   4984  C  CA    . VAL C 3 601  ? 5.207   84.397  0.563   1.00 24.55  ? 601  VAL A CA    1 
ATOM   4985  C  C     . VAL C 3 601  ? 5.707   83.740  1.835   1.00 26.72  ? 601  VAL A C     1 
ATOM   4986  O  O     . VAL C 3 601  ? 6.722   83.037  1.824   1.00 27.37  ? 601  VAL A O     1 
ATOM   4987  C  CB    . VAL C 3 601  ? 5.452   85.915  0.629   1.00 24.96  ? 601  VAL A CB    1 
ATOM   4988  C  CG1   . VAL C 3 601  ? 6.858   86.203  1.114   1.00 23.56  ? 601  VAL A CG1   1 
ATOM   4989  C  CG2   . VAL C 3 601  ? 5.214   86.526  -0.745  1.00 23.01  ? 601  VAL A CG2   1 
ATOM   4990  N  N     . ILE C 3 602  ? 4.982   83.950  2.932   1.00 26.45  ? 602  ILE A N     1 
ATOM   4991  C  CA    . ILE C 3 602  ? 5.385   83.375  4.207   1.00 26.43  ? 602  ILE A CA    1 
ATOM   4992  C  C     . ILE C 3 602  ? 5.429   81.853  4.129   1.00 25.76  ? 602  ILE A C     1 
ATOM   4993  O  O     . ILE C 3 602  ? 6.404   81.236  4.540   1.00 25.95  ? 602  ILE A O     1 
ATOM   4994  C  CB    . ILE C 3 602  ? 4.443   83.839  5.336   1.00 27.59  ? 602  ILE A CB    1 
ATOM   4995  C  CG1   . ILE C 3 602  ? 4.570   85.358  5.499   1.00 26.18  ? 602  ILE A CG1   1 
ATOM   4996  C  CG2   . ILE C 3 602  ? 4.781   83.117  6.649   1.00 25.70  ? 602  ILE A CG2   1 
ATOM   4997  C  CD1   . ILE C 3 602  ? 3.614   85.954  6.518   1.00 26.20  ? 602  ILE A CD1   1 
ATOM   4998  N  N     . MET C 3 603  ? 4.382   81.247  3.587   1.00 26.19  ? 603  MET A N     1 
ATOM   4999  C  CA    . MET C 3 603  ? 4.356   79.797  3.454   1.00 27.69  ? 603  MET A CA    1 
ATOM   5000  C  C     . MET C 3 603  ? 5.570   79.303  2.663   1.00 29.17  ? 603  MET A C     1 
ATOM   5001  O  O     . MET C 3 603  ? 6.196   78.293  3.010   1.00 28.83  ? 603  MET A O     1 
ATOM   5002  C  CB    . MET C 3 603  ? 3.063   79.360  2.766   1.00 28.10  ? 603  MET A CB    1 
ATOM   5003  C  CG    . MET C 3 603  ? 1.817   79.616  3.604   1.00 28.84  ? 603  MET A CG    1 
ATOM   5004  S  SD    . MET C 3 603  ? 2.027   78.979  5.292   1.00 30.58  ? 603  MET A SD    1 
ATOM   5005  C  CE    . MET C 3 603  ? 1.810   77.326  4.996   1.00 33.76  ? 603  MET A CE    1 
ATOM   5006  N  N     . ALA C 3 604  ? 5.918   80.038  1.613   1.00 29.39  ? 604  ALA A N     1 
ATOM   5007  C  CA    . ALA C 3 604  ? 7.045   79.674  0.771   1.00 29.02  ? 604  ALA A CA    1 
ATOM   5008  C  C     . ALA C 3 604  ? 8.385   79.751  1.504   1.00 29.08  ? 604  ALA A C     1 
ATOM   5009  O  O     . ALA C 3 604  ? 9.165   78.797  1.507   1.00 29.94  ? 604  ALA A O     1 
ATOM   5010  C  CB    . ALA C 3 604  ? 7.066   80.569  -0.467  1.00 27.94  ? 604  ALA A CB    1 
ATOM   5011  N  N     . ALA C 3 605  ? 8.644   80.891  2.132   1.00 29.57  ? 605  ALA A N     1 
ATOM   5012  C  CA    . ALA C 3 605  ? 9.900   81.118  2.842   1.00 28.69  ? 605  ALA A CA    1 
ATOM   5013  C  C     . ALA C 3 605  ? 10.162  80.099  3.940   1.00 28.35  ? 605  ALA A C     1 
ATOM   5014  O  O     . ALA C 3 605  ? 11.305  79.667  4.142   1.00 28.52  ? 605  ALA A O     1 
ATOM   5015  C  CB    . ALA C 3 605  ? 9.912   82.531  3.424   1.00 29.20  ? 605  ALA A CB    1 
ATOM   5016  N  N     . ILE C 3 606  ? 9.106   79.729  4.662   1.00 27.32  ? 606  ILE A N     1 
ATOM   5017  C  CA    . ILE C 3 606  ? 9.214   78.752  5.742   1.00 24.55  ? 606  ILE A CA    1 
ATOM   5018  C  C     . ILE C 3 606  ? 9.445   77.370  5.145   1.00 24.64  ? 606  ILE A C     1 
ATOM   5019  O  O     . ILE C 3 606  ? 10.359  76.653  5.541   1.00 25.31  ? 606  ILE A O     1 
ATOM   5020  C  CB    . ILE C 3 606  ? 7.928   78.726  6.598   1.00 23.64  ? 606  ILE A CB    1 
ATOM   5021  C  CG1   . ILE C 3 606  ? 7.749   80.075  7.309   1.00 23.74  ? 606  ILE A CG1   1 
ATOM   5022  C  CG2   . ILE C 3 606  ? 7.995   77.581  7.601   1.00 22.40  ? 606  ILE A CG2   1 
ATOM   5023  C  CD1   . ILE C 3 606  ? 6.496   80.166  8.165   1.00 21.66  ? 606  ILE A CD1   1 
ATOM   5024  N  N     . HIS C 3 607  ? 8.621   77.011  4.171   1.00 25.33  ? 607  HIS A N     1 
ATOM   5025  C  CA    . HIS C 3 607  ? 8.741   75.718  3.532   1.00 27.27  ? 607  HIS A CA    1 
ATOM   5026  C  C     . HIS C 3 607  ? 10.158  75.477  3.018   1.00 28.19  ? 607  HIS A C     1 
ATOM   5027  O  O     . HIS C 3 607  ? 10.673  74.364  3.117   1.00 27.84  ? 607  HIS A O     1 
ATOM   5028  C  CB    . HIS C 3 607  ? 7.738   75.604  2.379   1.00 30.39  ? 607  HIS A CB    1 
ATOM   5029  C  CG    . HIS C 3 607  ? 7.757   74.272  1.702   1.00 30.73  ? 607  HIS A CG    1 
ATOM   5030  N  ND1   . HIS C 3 607  ? 8.720   73.920  0.784   1.00 30.10  ? 607  HIS A ND1   1 
ATOM   5031  C  CD2   . HIS C 3 607  ? 6.979   73.176  1.871   1.00 31.86  ? 607  HIS A CD2   1 
ATOM   5032  C  CE1   . HIS C 3 607  ? 8.539   72.663  0.421   1.00 31.36  ? 607  HIS A CE1   1 
ATOM   5033  N  NE2   . HIS C 3 607  ? 7.489   72.189  1.067   1.00 31.29  ? 607  HIS A NE2   1 
ATOM   5034  N  N     . GLU C 3 608  ? 10.786  76.521  2.480   1.00 27.80  ? 608  GLU A N     1 
ATOM   5035  C  CA    . GLU C 3 608  ? 12.140  76.407  1.942   1.00 29.02  ? 608  GLU A CA    1 
ATOM   5036  C  C     . GLU C 3 608  ? 13.238  76.604  2.990   1.00 30.61  ? 608  GLU A C     1 
ATOM   5037  O  O     . GLU C 3 608  ? 14.157  75.792  3.089   1.00 30.75  ? 608  GLU A O     1 
ATOM   5038  C  CB    . GLU C 3 608  ? 12.332  77.407  0.796   1.00 29.34  ? 608  GLU A CB    1 
ATOM   5039  C  CG    . GLU C 3 608  ? 11.430  77.142  -0.418  1.00 33.57  ? 608  GLU A CG    1 
ATOM   5040  C  CD    . GLU C 3 608  ? 11.739  75.815  -1.123  1.00 36.24  ? 608  GLU A CD    1 
ATOM   5041  O  OE1   . GLU C 3 608  ? 12.714  75.770  -1.908  1.00 36.67  ? 608  GLU A OE1   1 
ATOM   5042  O  OE2   . GLU C 3 608  ? 11.015  74.816  -0.883  1.00 34.87  ? 608  GLU A OE2   1 
ATOM   5043  N  N     . GLY C 3 609  ? 13.144  77.677  3.775   1.00 30.93  ? 609  GLY A N     1 
ATOM   5044  C  CA    . GLY C 3 609  ? 14.154  77.941  4.788   1.00 30.14  ? 609  GLY A CA    1 
ATOM   5045  C  C     . GLY C 3 609  ? 14.251  76.866  5.857   1.00 29.21  ? 609  GLY A C     1 
ATOM   5046  O  O     . GLY C 3 609  ? 15.253  76.738  6.550   1.00 30.62  ? 609  GLY A O     1 
ATOM   5047  N  N     . VAL C 3 610  ? 13.201  76.078  5.985   1.00 29.14  ? 610  VAL A N     1 
ATOM   5048  C  CA    . VAL C 3 610  ? 13.155  75.014  6.975   1.00 28.97  ? 610  VAL A CA    1 
ATOM   5049  C  C     . VAL C 3 610  ? 13.697  73.686  6.431   1.00 29.91  ? 610  VAL A C     1 
ATOM   5050  O  O     . VAL C 3 610  ? 13.985  72.759  7.188   1.00 29.27  ? 610  VAL A O     1 
ATOM   5051  C  CB    . VAL C 3 610  ? 11.697  74.850  7.447   1.00 27.31  ? 610  VAL A CB    1 
ATOM   5052  C  CG1   . VAL C 3 610  ? 11.392  73.410  7.762   1.00 26.47  ? 610  VAL A CG1   1 
ATOM   5053  C  CG2   . VAL C 3 610  ? 11.453  75.755  8.652   1.00 24.73  ? 610  VAL A CG2   1 
ATOM   5054  N  N     . ALA C 3 611  ? 13.853  73.621  5.113   1.00 30.72  ? 611  ALA A N     1 
ATOM   5055  C  CA    . ALA C 3 611  ? 14.312  72.419  4.422   1.00 31.69  ? 611  ALA A CA    1 
ATOM   5056  C  C     . ALA C 3 611  ? 15.495  71.620  4.994   1.00 32.19  ? 611  ALA A C     1 
ATOM   5057  O  O     . ALA C 3 611  ? 15.307  70.547  5.560   1.00 34.60  ? 611  ALA A O     1 
ATOM   5058  C  CB    . ALA C 3 611  ? 14.584  72.752  2.962   1.00 29.32  ? 611  ALA A CB    1 
ATOM   5059  N  N     . SER C 3 612  ? 16.706  72.138  4.843   1.00 30.90  ? 612  SER A N     1 
ATOM   5060  C  CA    . SER C 3 612  ? 17.900  71.430  5.287   1.00 30.50  ? 612  SER A CA    1 
ATOM   5061  C  C     . SER C 3 612  ? 17.980  70.884  6.714   1.00 31.19  ? 612  SER A C     1 
ATOM   5062  O  O     . SER C 3 612  ? 18.612  69.852  6.931   1.00 32.12  ? 612  SER A O     1 
ATOM   5063  C  CB    . SER C 3 612  ? 19.140  72.291  5.021   1.00 30.14  ? 612  SER A CB    1 
ATOM   5064  O  OG    . SER C 3 612  ? 19.105  73.498  5.766   1.00 29.88  ? 612  SER A OG    1 
ATOM   5065  N  N     . SER C 3 613  ? 17.364  71.555  7.683   1.00 31.12  ? 613  SER A N     1 
ATOM   5066  C  CA    . SER C 3 613  ? 17.438  71.101  9.073   1.00 30.00  ? 613  SER A CA    1 
ATOM   5067  C  C     . SER C 3 613  ? 16.309  70.158  9.495   1.00 31.08  ? 613  SER A C     1 
ATOM   5068  O  O     . SER C 3 613  ? 16.447  69.401  10.454  1.00 31.99  ? 613  SER A O     1 
ATOM   5069  C  CB    . SER C 3 613  ? 17.456  72.303  10.023  1.00 28.27  ? 613  SER A CB    1 
ATOM   5070  O  OG    . SER C 3 613  ? 18.605  73.103  9.825   1.00 26.09  ? 613  SER A OG    1 
ATOM   5071  N  N     . SER C 3 614  ? 15.196  70.205  8.780   1.00 30.23  ? 614  SER A N     1 
ATOM   5072  C  CA    . SER C 3 614  ? 14.055  69.368  9.101   1.00 30.39  ? 614  SER A CA    1 
ATOM   5073  C  C     . SER C 3 614  ? 14.055  68.090  8.266   1.00 31.20  ? 614  SER A C     1 
ATOM   5074  O  O     . SER C 3 614  ? 13.312  67.147  8.543   1.00 30.96  ? 614  SER A O     1 
ATOM   5075  C  CB    . SER C 3 614  ? 12.776  70.146  8.814   1.00 30.13  ? 614  SER A CB    1 
ATOM   5076  O  OG    . SER C 3 614  ? 12.697  70.453  7.429   1.00 28.88  ? 614  SER A OG    1 
ATOM   5077  N  N     . ILE C 3 615  ? 14.898  68.073  7.243   1.00 31.12  ? 615  ILE A N     1 
ATOM   5078  C  CA    . ILE C 3 615  ? 14.983  66.953  6.309   1.00 32.63  ? 615  ILE A CA    1 
ATOM   5079  C  C     . ILE C 3 615  ? 14.924  65.551  6.940   1.00 32.81  ? 615  ILE A C     1 
ATOM   5080  O  O     . ILE C 3 615  ? 15.430  65.328  8.039   1.00 32.01  ? 615  ILE A O     1 
ATOM   5081  C  CB    . ILE C 3 615  ? 16.255  67.094  5.443   1.00 32.30  ? 615  ILE A CB    1 
ATOM   5082  C  CG1   . ILE C 3 615  ? 16.138  66.228  4.196   1.00 31.76  ? 615  ILE A CG1   1 
ATOM   5083  C  CG2   . ILE C 3 615  ? 17.481  66.727  6.259   1.00 30.33  ? 615  ILE A CG2   1 
ATOM   5084  C  CD1   . ILE C 3 615  ? 17.117  66.607  3.108   1.00 32.68  ? 615  ILE A CD1   1 
ATOM   5085  N  N     . GLY C 3 616  ? 14.281  64.625  6.226   1.00 34.14  ? 616  GLY A N     1 
ATOM   5086  C  CA    . GLY C 3 616  ? 14.138  63.247  6.680   1.00 34.01  ? 616  GLY A CA    1 
ATOM   5087  C  C     . GLY C 3 616  ? 13.695  63.093  8.126   1.00 34.56  ? 616  GLY A C     1 
ATOM   5088  O  O     . GLY C 3 616  ? 14.319  62.359  8.894   1.00 35.83  ? 616  GLY A O     1 
ATOM   5089  N  N     . LYS C 3 617  ? 12.610  63.765  8.497   1.00 32.21  ? 617  LYS A N     1 
ATOM   5090  C  CA    . LYS C 3 617  ? 12.116  63.714  9.864   1.00 30.55  ? 617  LYS A CA    1 
ATOM   5091  C  C     . LYS C 3 617  ? 10.677  64.182  10.009  1.00 30.00  ? 617  LYS A C     1 
ATOM   5092  O  O     . LYS C 3 617  ? 10.249  65.136  9.357   1.00 29.85  ? 617  LYS A O     1 
ATOM   5093  C  CB    . LYS C 3 617  ? 12.964  64.609  10.774  1.00 30.98  ? 617  LYS A CB    1 
ATOM   5094  C  CG    . LYS C 3 617  ? 14.311  64.074  11.191  1.00 30.19  ? 617  LYS A CG    1 
ATOM   5095  C  CD    . LYS C 3 617  ? 14.953  65.016  12.217  1.00 29.18  ? 617  LYS A CD    1 
ATOM   5096  C  CE    . LYS C 3 617  ? 15.217  66.382  11.610  1.00 29.21  ? 617  LYS A CE    1 
ATOM   5097  N  NZ    . LYS C 3 617  ? 16.031  66.247  10.368  1.00 29.39  ? 617  LYS A NZ    1 
ATOM   5098  N  N     . PRO C 3 618  ? 9.914   63.522  10.890  1.00 29.53  ? 618  PRO A N     1 
ATOM   5099  C  CA    . PRO C 3 618  ? 8.519   63.890  11.129  1.00 28.66  ? 618  PRO A CA    1 
ATOM   5100  C  C     . PRO C 3 618  ? 8.558   65.074  12.093  1.00 27.87  ? 618  PRO A C     1 
ATOM   5101  O  O     . PRO C 3 618  ? 9.628   65.503  12.530  1.00 27.75  ? 618  PRO A O     1 
ATOM   5102  C  CB    . PRO C 3 618  ? 7.957   62.641  11.791  1.00 28.39  ? 618  PRO A CB    1 
ATOM   5103  C  CG    . PRO C 3 618  ? 9.094   62.219  12.656  1.00 27.66  ? 618  PRO A CG    1 
ATOM   5104  C  CD    . PRO C 3 618  ? 10.287  62.356  11.713  1.00 29.72  ? 618  PRO A CD    1 
ATOM   5105  N  N     . PHE C 3 619  ? 7.403   65.608  12.438  1.00 27.64  ? 619  PHE A N     1 
ATOM   5106  C  CA    . PHE C 3 619  ? 7.394   66.723  13.372  1.00 26.84  ? 619  PHE A CA    1 
ATOM   5107  C  C     . PHE C 3 619  ? 6.038   66.822  14.043  1.00 25.81  ? 619  PHE A C     1 
ATOM   5108  O  O     . PHE C 3 619  ? 5.017   66.958  13.383  1.00 25.87  ? 619  PHE A O     1 
ATOM   5109  C  CB    . PHE C 3 619  ? 7.719   68.024  12.643  1.00 24.24  ? 619  PHE A CB    1 
ATOM   5110  C  CG    . PHE C 3 619  ? 7.872   69.201  13.552  1.00 23.42  ? 619  PHE A CG    1 
ATOM   5111  C  CD1   . PHE C 3 619  ? 8.950   69.286  14.424  1.00 22.68  ? 619  PHE A CD1   1 
ATOM   5112  C  CD2   . PHE C 3 619  ? 6.933   70.225  13.549  1.00 20.22  ? 619  PHE A CD2   1 
ATOM   5113  C  CE1   . PHE C 3 619  ? 9.087   70.379  15.282  1.00 19.89  ? 619  PHE A CE1   1 
ATOM   5114  C  CE2   . PHE C 3 619  ? 7.069   71.318  14.405  1.00 20.20  ? 619  PHE A CE2   1 
ATOM   5115  C  CZ    . PHE C 3 619  ? 8.146   71.391  15.269  1.00 17.75  ? 619  PHE A CZ    1 
ATOM   5116  N  N     . MET C 3 620  ? 6.032   66.731  15.363  1.00 25.90  ? 620  MET A N     1 
ATOM   5117  C  CA    . MET C 3 620  ? 4.788   66.815  16.111  1.00 26.77  ? 620  MET A CA    1 
ATOM   5118  C  C     . MET C 3 620  ? 3.729   65.826  15.634  1.00 26.99  ? 620  MET A C     1 
ATOM   5119  O  O     . MET C 3 620  ? 2.537   66.134  15.647  1.00 27.88  ? 620  MET A O     1 
ATOM   5120  C  CB    . MET C 3 620  ? 4.246   68.244  16.041  1.00 26.78  ? 620  MET A CB    1 
ATOM   5121  C  CG    . MET C 3 620  ? 5.140   69.255  16.736  1.00 26.71  ? 620  MET A CG    1 
ATOM   5122  S  SD    . MET C 3 620  ? 4.590   70.957  16.579  1.00 29.56  ? 620  MET A SD    1 
ATOM   5123  C  CE    . MET C 3 620  ? 3.006   70.888  17.508  1.00 27.23  ? 620  MET A CE    1 
ATOM   5124  N  N     . GLY C 3 621  ? 4.168   64.639  15.220  1.00 27.84  ? 621  GLY A N     1 
ATOM   5125  C  CA    . GLY C 3 621  ? 3.242   63.619  14.754  1.00 28.19  ? 621  GLY A CA    1 
ATOM   5126  C  C     . GLY C 3 621  ? 2.970   63.639  13.257  1.00 29.05  ? 621  GLY A C     1 
ATOM   5127  O  O     . GLY C 3 621  ? 2.340   62.723  12.723  1.00 29.58  ? 621  GLY A O     1 
ATOM   5128  N  N     . VAL C 3 622  ? 3.444   64.679  12.578  1.00 28.46  ? 622  VAL A N     1 
ATOM   5129  C  CA    . VAL C 3 622  ? 3.240   64.825  11.140  1.00 29.28  ? 622  VAL A CA    1 
ATOM   5130  C  C     . VAL C 3 622  ? 4.381   64.160  10.365  1.00 29.71  ? 622  VAL A C     1 
ATOM   5131  O  O     . VAL C 3 622  ? 5.557   64.480  10.559  1.00 31.45  ? 622  VAL A O     1 
ATOM   5132  C  CB    . VAL C 3 622  ? 3.144   66.316  10.764  1.00 28.60  ? 622  VAL A CB    1 
ATOM   5133  C  CG1   . VAL C 3 622  ? 2.893   66.471  9.273   1.00 29.53  ? 622  VAL A CG1   1 
ATOM   5134  C  CG2   . VAL C 3 622  ? 2.030   66.968  11.567  1.00 28.79  ? 622  VAL A CG2   1 
ATOM   5135  N  N     . PRO C 3 623  ? 4.046   63.219  9.474   1.00 27.84  ? 623  PRO A N     1 
ATOM   5136  C  CA    . PRO C 3 623  ? 5.081   62.531  8.704   1.00 27.97  ? 623  PRO A CA    1 
ATOM   5137  C  C     . PRO C 3 623  ? 5.659   63.295  7.526   1.00 28.78  ? 623  PRO A C     1 
ATOM   5138  O  O     . PRO C 3 623  ? 5.112   64.308  7.082   1.00 29.47  ? 623  PRO A O     1 
ATOM   5139  C  CB    . PRO C 3 623  ? 4.375   61.260  8.247   1.00 25.32  ? 623  PRO A CB    1 
ATOM   5140  C  CG    . PRO C 3 623  ? 2.991   61.745  8.005   1.00 24.82  ? 623  PRO A CG    1 
ATOM   5141  C  CD    . PRO C 3 623  ? 2.722   62.626  9.215   1.00 26.92  ? 623  PRO A CD    1 
ATOM   5142  N  N     . ALA C 3 624  ? 6.782   62.785  7.035   1.00 27.98  ? 624  ALA A N     1 
ATOM   5143  C  CA    . ALA C 3 624  ? 7.448   63.344  5.874   1.00 28.10  ? 624  ALA A CA    1 
ATOM   5144  C  C     . ALA C 3 624  ? 6.637   62.774  4.720   1.00 28.46  ? 624  ALA A C     1 
ATOM   5145  O  O     . ALA C 3 624  ? 5.838   61.868  4.927   1.00 29.29  ? 624  ALA A O     1 
ATOM   5146  C  CB    . ALA C 3 624  ? 8.886   62.845  5.808   1.00 24.56  ? 624  ALA A CB    1 
ATOM   5147  N  N     . SER C 3 625  ? 6.807   63.312  3.519   1.00 29.60  ? 625  SER A N     1 
ATOM   5148  C  CA    . SER C 3 625  ? 6.083   62.791  2.371   1.00 31.46  ? 625  SER A CA    1 
ATOM   5149  C  C     . SER C 3 625  ? 6.690   63.264  1.057   1.00 32.96  ? 625  SER A C     1 
ATOM   5150  O  O     . SER C 3 625  ? 7.789   63.824  1.033   1.00 33.44  ? 625  SER A O     1 
ATOM   5151  C  CB    . SER C 3 625  ? 4.595   63.166  2.449   1.00 31.25  ? 625  SER A CB    1 
ATOM   5152  O  OG    . SER C 3 625  ? 4.404   64.565  2.460   1.00 33.54  ? 625  SER A OG    1 
ATOM   5153  N  N     . ILE C 3 626  ? 5.984   63.009  -0.038  1.00 34.78  ? 626  ILE A N     1 
ATOM   5154  C  CA    . ILE C 3 626  ? 6.445   63.403  -1.362  1.00 35.86  ? 626  ILE A CA    1 
ATOM   5155  C  C     . ILE C 3 626  ? 5.420   64.350  -1.947  1.00 36.82  ? 626  ILE A C     1 
ATOM   5156  O  O     . ILE C 3 626  ? 4.224   64.196  -1.716  1.00 37.69  ? 626  ILE A O     1 
ATOM   5157  C  CB    . ILE C 3 626  ? 6.564   62.191  -2.321  1.00 35.65  ? 626  ILE A CB    1 
ATOM   5158  C  CG1   . ILE C 3 626  ? 7.359   61.066  -1.664  1.00 35.21  ? 626  ILE A CG1   1 
ATOM   5159  C  CG2   . ILE C 3 626  ? 7.242   62.613  -3.610  1.00 35.65  ? 626  ILE A CG2   1 
ATOM   5160  C  CD1   . ILE C 3 626  ? 6.496   59.911  -1.212  1.00 35.78  ? 626  ILE A CD1   1 
ATOM   5161  N  N     . VAL C 3 627  ? 5.885   65.326  -2.714  1.00 38.02  ? 627  VAL A N     1 
ATOM   5162  C  CA    . VAL C 3 627  ? 4.980   66.283  -3.327  1.00 39.23  ? 627  VAL A CA    1 
ATOM   5163  C  C     . VAL C 3 627  ? 5.452   66.568  -4.753  1.00 39.96  ? 627  VAL A C     1 
ATOM   5164  O  O     . VAL C 3 627  ? 6.630   66.399  -5.066  1.00 38.19  ? 627  VAL A O     1 
ATOM   5165  C  CB    . VAL C 3 627  ? 4.924   67.592  -2.486  1.00 39.33  ? 627  VAL A CB    1 
ATOM   5166  C  CG1   . VAL C 3 627  ? 6.109   68.488  -2.807  1.00 37.55  ? 627  VAL A CG1   1 
ATOM   5167  C  CG2   . VAL C 3 627  ? 3.616   68.300  -2.726  1.00 40.96  ? 627  VAL A CG2   1 
ATOM   5168  N  N     . ASN C 3 628  ? 4.532   66.984  -5.618  1.00 41.95  ? 628  ASN A N     1 
ATOM   5169  C  CA    . ASN C 3 628  ? 4.866   67.275  -7.010  1.00 43.97  ? 628  ASN A CA    1 
ATOM   5170  C  C     . ASN C 3 628  ? 5.741   68.523  -7.113  1.00 45.30  ? 628  ASN A C     1 
ATOM   5171  O  O     . ASN C 3 628  ? 5.447   69.556  -6.511  1.00 45.49  ? 628  ASN A O     1 
ATOM   5172  C  CB    . ASN C 3 628  ? 3.573   67.438  -7.819  1.00 47.02  ? 628  ASN A CB    1 
ATOM   5173  C  CG    . ASN C 3 628  ? 3.820   67.815  -9.268  1.00 49.71  ? 628  ASN A CG    1 
ATOM   5174  O  OD1   . ASN C 3 628  ? 4.076   68.979  -9.579  1.00 52.25  ? 628  ASN A OD1   1 
ATOM   5175  N  ND2   . ASN C 3 628  ? 3.746   66.829  -10.164 1.00 49.27  ? 628  ASN A ND2   1 
ATOM   5176  N  N     . ASP C 3 629  ? 6.833   68.416  -7.864  1.00 46.10  ? 629  ASP A N     1 
ATOM   5177  C  CA    . ASP C 3 629  ? 7.746   69.540  -8.032  1.00 47.42  ? 629  ASP A CA    1 
ATOM   5178  C  C     . ASP C 3 629  ? 7.721   70.061  -9.466  1.00 48.50  ? 629  ASP A C     1 
ATOM   5179  O  O     . ASP C 3 629  ? 7.883   69.295  -10.420 1.00 49.46  ? 629  ASP A O     1 
ATOM   5180  C  CB    . ASP C 3 629  ? 9.171   69.121  -7.654  1.00 47.13  ? 629  ASP A CB    1 
ATOM   5181  C  CG    . ASP C 3 629  ? 10.169  70.265  -7.757  1.00 48.79  ? 629  ASP A CG    1 
ATOM   5182  O  OD1   . ASP C 3 629  ? 11.298  70.114  -7.250  1.00 50.51  ? 629  ASP A OD1   1 
ATOM   5183  O  OD2   . ASP C 3 629  ? 9.840   71.316  -8.343  1.00 48.59  ? 629  ASP A OD2   1 
ATOM   5184  N  N     . GLU C 3 630  ? 7.519   71.369  -9.607  1.00 48.71  ? 630  GLU A N     1 
ATOM   5185  C  CA    . GLU C 3 630  ? 7.470   72.015  -10.910 1.00 49.87  ? 630  GLU A CA    1 
ATOM   5186  C  C     . GLU C 3 630  ? 8.185   73.357  -10.898 1.00 51.32  ? 630  GLU A C     1 
ATOM   5187  O  O     . GLU C 3 630  ? 7.938   74.202  -11.754 1.00 51.16  ? 630  GLU A O     1 
ATOM   5188  C  CB    . GLU C 3 630  ? 6.019   72.209  -11.343 1.00 48.52  ? 630  GLU A CB    1 
ATOM   5189  C  CG    . GLU C 3 630  ? 5.383   70.965  -11.931 1.00 50.34  ? 630  GLU A CG    1 
ATOM   5190  C  CD    . GLU C 3 630  ? 3.878   71.084  -12.033 1.00 53.37  ? 630  GLU A CD    1 
ATOM   5191  O  OE1   . GLU C 3 630  ? 3.215   71.061  -10.973 1.00 54.78  ? 630  GLU A OE1   1 
ATOM   5192  O  OE2   . GLU C 3 630  ? 3.357   71.209  -13.164 1.00 53.92  ? 630  GLU A OE2   1 
ATOM   5193  N  N     . SER C 3 631  ? 9.077   73.539  -9.929  1.00 53.70  ? 631  SER A N     1 
ATOM   5194  C  CA    . SER C 3 631  ? 9.837   74.776  -9.788  1.00 56.61  ? 631  SER A CA    1 
ATOM   5195  C  C     . SER C 3 631  ? 10.428  75.175  -11.136 1.00 59.47  ? 631  SER A C     1 
ATOM   5196  O  O     . SER C 3 631  ? 10.045  76.187  -11.737 1.00 59.41  ? 631  SER A O     1 
ATOM   5197  C  CB    . SER C 3 631  ? 10.987  74.585  -8.794  1.00 56.69  ? 631  SER A CB    1 
ATOM   5198  O  OG    . SER C 3 631  ? 10.625  73.730  -7.723  1.00 57.61  ? 631  SER A OG    1 
ATOM   5199  N  N     . VAL C 3 632  ? 11.372  74.356  -11.594 1.00 61.69  ? 632  VAL A N     1 
ATOM   5200  C  CA    . VAL C 3 632  ? 12.064  74.574  -12.855 1.00 63.19  ? 632  VAL A CA    1 
ATOM   5201  C  C     . VAL C 3 632  ? 11.128  74.400  -14.045 1.00 65.21  ? 632  VAL A C     1 
ATOM   5202  O  O     . VAL C 3 632  ? 10.147  73.657  -13.976 1.00 65.56  ? 632  VAL A O     1 
ATOM   5203  C  CB    . VAL C 3 632  ? 13.235  73.593  -13.002 1.00 62.94  ? 632  VAL A CB    1 
ATOM   5204  C  CG1   . VAL C 3 632  ? 14.092  73.991  -14.192 1.00 64.07  ? 632  VAL A CG1   1 
ATOM   5205  C  CG2   . VAL C 3 632  ? 14.052  73.565  -11.719 1.00 62.01  ? 632  VAL A CG2   1 
ATOM   5206  N  N     . VAL C 3 633  ? 11.432  75.096  -15.137 1.00 67.01  ? 633  VAL A N     1 
ATOM   5207  C  CA    . VAL C 3 633  ? 10.612  75.001  -16.339 1.00 68.65  ? 633  VAL A CA    1 
ATOM   5208  C  C     . VAL C 3 633  ? 10.895  73.663  -17.025 1.00 69.02  ? 633  VAL A C     1 
ATOM   5209  O  O     . VAL C 3 633  ? 12.058  73.285  -17.219 1.00 68.69  ? 633  VAL A O     1 
ATOM   5210  C  CB    . VAL C 3 633  ? 10.912  76.160  -17.318 1.00 69.48  ? 633  VAL A CB    1 
ATOM   5211  C  CG1   . VAL C 3 633  ? 9.898   76.150  -18.465 1.00 69.75  ? 633  VAL A CG1   1 
ATOM   5212  C  CG2   . VAL C 3 633  ? 10.871  77.490  -16.571 1.00 69.34  ? 633  VAL A CG2   1 
ATOM   5213  N  N     . GLY C 3 634  ? 9.826   72.951  -17.380 1.00 68.56  ? 634  GLY A N     1 
ATOM   5214  C  CA    . GLY C 3 634  ? 9.973   71.654  -18.015 1.00 67.90  ? 634  GLY A CA    1 
ATOM   5215  C  C     . GLY C 3 634  ? 10.181  70.572  -16.970 1.00 67.48  ? 634  GLY A C     1 
ATOM   5216  O  O     . GLY C 3 634  ? 9.316   69.720  -16.765 1.00 67.74  ? 634  GLY A O     1 
ATOM   5217  N  N     . VAL C 3 635  ? 11.331  70.619  -16.302 1.00 66.85  ? 635  VAL A N     1 
ATOM   5218  C  CA    . VAL C 3 635  ? 11.688  69.656  -15.261 1.00 66.75  ? 635  VAL A CA    1 
ATOM   5219  C  C     . VAL C 3 635  ? 10.557  69.435  -14.258 1.00 66.37  ? 635  VAL A C     1 
ATOM   5220  O  O     . VAL C 3 635  ? 10.197  70.340  -13.496 1.00 67.30  ? 635  VAL A O     1 
ATOM   5221  C  CB    . VAL C 3 635  ? 12.935  70.126  -14.469 1.00 67.74  ? 635  VAL A CB    1 
ATOM   5222  C  CG1   . VAL C 3 635  ? 13.362  69.051  -13.478 1.00 68.08  ? 635  VAL A CG1   1 
ATOM   5223  C  CG2   . VAL C 3 635  ? 14.071  70.465  -15.423 1.00 68.98  ? 635  VAL A CG2   1 
ATOM   5224  N  N     . ARG C 3 636  ? 10.001  68.228  -14.251 1.00 65.22  ? 636  ARG A N     1 
ATOM   5225  C  CA    . ARG C 3 636  ? 8.921   67.902  -13.325 1.00 64.31  ? 636  ARG A CA    1 
ATOM   5226  C  C     . ARG C 3 636  ? 9.196   66.570  -12.627 1.00 62.17  ? 636  ARG A C     1 
ATOM   5227  O  O     . ARG C 3 636  ? 9.106   65.505  -13.239 1.00 61.87  ? 636  ARG A O     1 
ATOM   5228  C  CB    . ARG C 3 636  ? 7.585   67.861  -14.073 1.00 65.44  ? 636  ARG A CB    1 
ATOM   5229  C  CG    . ARG C 3 636  ? 6.418   67.345  -13.252 1.00 68.32  ? 636  ARG A CG    1 
ATOM   5230  C  CD    . ARG C 3 636  ? 5.091   67.635  -13.943 1.00 71.12  ? 636  ARG A CD    1 
ATOM   5231  N  NE    . ARG C 3 636  ? 4.010   66.792  -13.437 1.00 72.78  ? 636  ARG A NE    1 
ATOM   5232  C  CZ    . ARG C 3 636  ? 3.862   65.504  -13.741 1.00 73.57  ? 636  ARG A CZ    1 
ATOM   5233  N  NH1   . ARG C 3 636  ? 4.726   64.907  -14.553 1.00 73.65  ? 636  ARG A NH1   1 
ATOM   5234  N  NH2   . ARG C 3 636  ? 2.850   64.811  -13.235 1.00 73.53  ? 636  ARG A NH2   1 
ATOM   5235  N  N     . ALA C 3 637  ? 9.538   66.641  -11.343 1.00 59.30  ? 637  ALA A N     1 
ATOM   5236  C  CA    . ALA C 3 637  ? 9.841   65.447  -10.566 1.00 56.76  ? 637  ALA A CA    1 
ATOM   5237  C  C     . ALA C 3 637  ? 9.091   65.410  -9.244  1.00 54.92  ? 637  ALA A C     1 
ATOM   5238  O  O     . ALA C 3 637  ? 8.218   66.235  -8.981  1.00 55.21  ? 637  ALA A O     1 
ATOM   5239  C  CB    . ALA C 3 637  ? 11.338  65.369  -10.303 1.00 57.07  ? 637  ALA A CB    1 
ATOM   5240  N  N     . ALA C 3 638  ? 9.436   64.433  -8.416  1.00 51.76  ? 638  ALA A N     1 
ATOM   5241  C  CA    . ALA C 3 638  ? 8.820   64.296  -7.112  1.00 49.37  ? 638  ALA A CA    1 
ATOM   5242  C  C     . ALA C 3 638  ? 9.851   64.808  -6.127  1.00 48.71  ? 638  ALA A C     1 
ATOM   5243  O  O     . ALA C 3 638  ? 11.048  64.639  -6.342  1.00 48.72  ? 638  ALA A O     1 
ATOM   5244  C  CB    . ALA C 3 638  ? 8.500   62.847  -6.833  1.00 48.54  ? 638  ALA A CB    1 
ATOM   5245  N  N     . ARG C 3 639  ? 9.396   65.443  -5.054  1.00 47.70  ? 639  ARG A N     1 
ATOM   5246  C  CA    . ARG C 3 639  ? 10.325  65.967  -4.066  1.00 45.83  ? 639  ARG A CA    1 
ATOM   5247  C  C     . ARG C 3 639  ? 10.041  65.524  -2.642  1.00 43.81  ? 639  ARG A C     1 
ATOM   5248  O  O     . ARG C 3 639  ? 8.938   65.692  -2.122  1.00 44.46  ? 639  ARG A O     1 
ATOM   5249  C  CB    . ARG C 3 639  ? 10.359  67.499  -4.114  1.00 46.32  ? 639  ARG A CB    1 
ATOM   5250  C  CG    . ARG C 3 639  ? 11.199  68.120  -2.998  1.00 48.40  ? 639  ARG A CG    1 
ATOM   5251  C  CD    . ARG C 3 639  ? 11.325  69.625  -3.136  1.00 51.50  ? 639  ARG A CD    1 
ATOM   5252  N  NE    . ARG C 3 639  ? 12.008  70.016  -4.368  1.00 56.07  ? 639  ARG A NE    1 
ATOM   5253  C  CZ    . ARG C 3 639  ? 12.352  71.266  -4.672  1.00 58.46  ? 639  ARG A CZ    1 
ATOM   5254  N  NH1   . ARG C 3 639  ? 12.081  72.261  -3.830  1.00 58.37  ? 639  ARG A NH1   1 
ATOM   5255  N  NH2   . ARG C 3 639  ? 12.964  71.527  -5.823  1.00 59.24  ? 639  ARG A NH2   1 
ATOM   5256  N  N     . PRO C 3 640  ? 11.040  64.922  -1.994  1.00 42.26  ? 640  PRO A N     1 
ATOM   5257  C  CA    . PRO C 3 640  ? 10.848  64.478  -0.612  1.00 40.10  ? 640  PRO A CA    1 
ATOM   5258  C  C     . PRO C 3 640  ? 10.844  65.715  0.290   1.00 37.96  ? 640  PRO A C     1 
ATOM   5259  O  O     . PRO C 3 640  ? 11.744  66.555  0.209   1.00 36.59  ? 640  PRO A O     1 
ATOM   5260  C  CB    . PRO C 3 640  ? 12.075  63.595  -0.359  1.00 39.88  ? 640  PRO A CB    1 
ATOM   5261  C  CG    . PRO C 3 640  ? 12.432  63.095  -1.737  1.00 40.43  ? 640  PRO A CG    1 
ATOM   5262  C  CD    . PRO C 3 640  ? 12.259  64.332  -2.574  1.00 41.20  ? 640  PRO A CD    1 
ATOM   5263  N  N     . ILE C 3 641  ? 9.824   65.842  1.129   1.00 35.82  ? 641  ILE A N     1 
ATOM   5264  C  CA    . ILE C 3 641  ? 9.762   66.971  2.044   1.00 32.93  ? 641  ILE A CA    1 
ATOM   5265  C  C     . ILE C 3 641  ? 9.622   66.449  3.468   1.00 32.81  ? 641  ILE A C     1 
ATOM   5266  O  O     . ILE C 3 641  ? 9.193   65.309  3.682   1.00 31.24  ? 641  ILE A O     1 
ATOM   5267  C  CB    . ILE C 3 641  ? 8.593   67.925  1.701   1.00 31.91  ? 641  ILE A CB    1 
ATOM   5268  C  CG1   . ILE C 3 641  ? 7.268   67.166  1.670   1.00 30.38  ? 641  ILE A CG1   1 
ATOM   5269  C  CG2   . ILE C 3 641  ? 8.854   68.598  0.358   1.00 29.40  ? 641  ILE A CG2   1 
ATOM   5270  C  CD1   . ILE C 3 641  ? 6.058   68.080  1.536   1.00 28.64  ? 641  ILE A CD1   1 
ATOM   5271  N  N     . SER C 3 642  ? 10.007  67.270  4.443   1.00 32.44  ? 642  SER A N     1 
ATOM   5272  C  CA    . SER C 3 642  ? 9.928   66.860  5.844   1.00 31.59  ? 642  SER A CA    1 
ATOM   5273  C  C     . SER C 3 642  ? 8.503   66.967  6.385   1.00 31.51  ? 642  SER A C     1 
ATOM   5274  O  O     . SER C 3 642  ? 7.604   67.471  5.710   1.00 30.00  ? 642  SER A O     1 
ATOM   5275  C  CB    . SER C 3 642  ? 10.875  67.711  6.696   1.00 32.36  ? 642  SER A CB    1 
ATOM   5276  O  OG    . SER C 3 642  ? 10.554  69.091  6.609   1.00 29.89  ? 642  SER A OG    1 
ATOM   5277  N  N     . GLY C 3 643  ? 8.297   66.472  7.600   1.00 32.03  ? 643  GLY A N     1 
ATOM   5278  C  CA    . GLY C 3 643  ? 6.979   66.550  8.201   1.00 32.00  ? 643  GLY A CA    1 
ATOM   5279  C  C     . GLY C 3 643  ? 6.658   68.014  8.428   1.00 31.02  ? 643  GLY A C     1 
ATOM   5280  O  O     . GLY C 3 643  ? 5.523   68.462  8.245   1.00 29.96  ? 643  GLY A O     1 
ATOM   5281  N  N     . MET C 3 644  ? 7.678   68.763  8.826   1.00 30.22  ? 644  MET A N     1 
ATOM   5282  C  CA    . MET C 3 644  ? 7.526   70.189  9.060   1.00 31.11  ? 644  MET A CA    1 
ATOM   5283  C  C     . MET C 3 644  ? 7.023   70.831  7.775   1.00 29.80  ? 644  MET A C     1 
ATOM   5284  O  O     . MET C 3 644  ? 6.121   71.668  7.797   1.00 30.10  ? 644  MET A O     1 
ATOM   5285  C  CB    . MET C 3 644  ? 8.867   70.802  9.475   1.00 31.98  ? 644  MET A CB    1 
ATOM   5286  C  CG    . MET C 3 644  ? 8.766   72.239  9.954   1.00 33.30  ? 644  MET A CG    1 
ATOM   5287  S  SD    . MET C 3 644  ? 10.236  72.787  10.834  1.00 35.53  ? 644  MET A SD    1 
ATOM   5288  C  CE    . MET C 3 644  ? 9.918   72.151  12.494  1.00 31.85  ? 644  MET A CE    1 
ATOM   5289  N  N     . GLN C 3 645  ? 7.598   70.410  6.654   1.00 29.75  ? 645  GLN A N     1 
ATOM   5290  C  CA    . GLN C 3 645  ? 7.215   70.932  5.340   1.00 29.34  ? 645  GLN A CA    1 
ATOM   5291  C  C     . GLN C 3 645  ? 5.832   70.443  4.962   1.00 28.48  ? 645  GLN A C     1 
ATOM   5292  O  O     . GLN C 3 645  ? 5.079   71.133  4.279   1.00 28.49  ? 645  GLN A O     1 
ATOM   5293  C  CB    . GLN C 3 645  ? 8.227   70.494  4.270   1.00 27.70  ? 645  GLN A CB    1 
ATOM   5294  C  CG    . GLN C 3 645  ? 9.625   71.081  4.476   1.00 28.90  ? 645  GLN A CG    1 
ATOM   5295  C  CD    . GLN C 3 645  ? 10.597  70.749  3.345   1.00 29.36  ? 645  GLN A CD    1 
ATOM   5296  O  OE1   . GLN C 3 645  ? 10.983  69.585  3.143   1.00 28.51  ? 645  GLN A OE1   1 
ATOM   5297  N  NE2   . GLN C 3 645  ? 11.001  71.775  2.606   1.00 25.62  ? 645  GLN A NE2   1 
ATOM   5298  N  N     . ASN C 3 646  ? 5.502   69.239  5.407   1.00 29.17  ? 646  ASN A N     1 
ATOM   5299  C  CA    . ASN C 3 646  ? 4.207   68.654  5.111   1.00 28.85  ? 646  ASN A CA    1 
ATOM   5300  C  C     . ASN C 3 646  ? 3.161   69.560  5.750   1.00 28.82  ? 646  ASN A C     1 
ATOM   5301  O  O     . ASN C 3 646  ? 2.110   69.811  5.164   1.00 28.66  ? 646  ASN A O     1 
ATOM   5302  C  CB    . ASN C 3 646  ? 4.132   67.232  5.689   1.00 30.33  ? 646  ASN A CB    1 
ATOM   5303  C  CG    . ASN C 3 646  ? 3.132   66.331  4.946   1.00 32.15  ? 646  ASN A CG    1 
ATOM   5304  O  OD1   . ASN C 3 646  ? 2.371   66.778  4.074   1.00 28.67  ? 646  ASN A OD1   1 
ATOM   5305  N  ND2   . ASN C 3 646  ? 3.132   65.049  5.304   1.00 31.91  ? 646  ASN A ND2   1 
ATOM   5306  N  N     . MET C 3 647  ? 3.463   70.064  6.949   1.00 28.72  ? 647  MET A N     1 
ATOM   5307  C  CA    . MET C 3 647  ? 2.543   70.956  7.651   1.00 27.07  ? 647  MET A CA    1 
ATOM   5308  C  C     . MET C 3 647  ? 2.281   72.207  6.817   1.00 25.85  ? 647  MET A C     1 
ATOM   5309  O  O     . MET C 3 647  ? 1.134   72.550  6.549   1.00 26.79  ? 647  MET A O     1 
ATOM   5310  C  CB    . MET C 3 647  ? 3.115   71.378  9.005   1.00 27.47  ? 647  MET A CB    1 
ATOM   5311  C  CG    . MET C 3 647  ? 3.341   70.252  9.978   1.00 29.37  ? 647  MET A CG    1 
ATOM   5312  S  SD    . MET C 3 647  ? 4.177   70.881  11.448  1.00 32.66  ? 647  MET A SD    1 
ATOM   5313  C  CE    . MET C 3 647  ? 3.062   70.416  12.737  1.00 32.54  ? 647  MET A CE    1 
ATOM   5314  N  N     . ILE C 3 648  ? 3.348   72.895  6.424   1.00 23.61  ? 648  ILE A N     1 
ATOM   5315  C  CA    . ILE C 3 648  ? 3.214   74.098  5.622   1.00 23.57  ? 648  ILE A CA    1 
ATOM   5316  C  C     . ILE C 3 648  ? 2.404   73.764  4.376   1.00 25.75  ? 648  ILE A C     1 
ATOM   5317  O  O     . ILE C 3 648  ? 1.555   74.536  3.929   1.00 25.27  ? 648  ILE A O     1 
ATOM   5318  C  CB    . ILE C 3 648  ? 4.598   74.632  5.216   1.00 23.27  ? 648  ILE A CB    1 
ATOM   5319  C  CG1   . ILE C 3 648  ? 5.304   75.214  6.445   1.00 23.67  ? 648  ILE A CG1   1 
ATOM   5320  C  CG2   . ILE C 3 648  ? 4.469   75.661  4.103   1.00 23.26  ? 648  ILE A CG2   1 
ATOM   5321  C  CD1   . ILE C 3 648  ? 4.542   76.322  7.132   1.00 20.96  ? 648  ILE A CD1   1 
ATOM   5322  N  N     . GLN C 3 649  ? 2.675   72.584  3.836   1.00 28.47  ? 649  GLN A N     1 
ATOM   5323  C  CA    . GLN C 3 649  ? 2.010   72.077  2.647   1.00 28.35  ? 649  GLN A CA    1 
ATOM   5324  C  C     . GLN C 3 649  ? 0.493   72.050  2.907   1.00 28.34  ? 649  GLN A C     1 
ATOM   5325  O  O     . GLN C 3 649  ? -0.285  72.602  2.132   1.00 29.86  ? 649  GLN A O     1 
ATOM   5326  C  CB    . GLN C 3 649  ? 2.578   70.682  2.346   1.00 28.48  ? 649  GLN A CB    1 
ATOM   5327  C  CG    . GLN C 3 649  ? 2.514   70.215  0.904   1.00 31.16  ? 649  GLN A CG    1 
ATOM   5328  C  CD    . GLN C 3 649  ? 3.287   71.090  -0.075  1.00 31.62  ? 649  GLN A CD    1 
ATOM   5329  O  OE1   . GLN C 3 649  ? 4.481   71.368  0.094   1.00 34.15  ? 649  GLN A OE1   1 
ATOM   5330  N  NE2   . GLN C 3 649  ? 2.608   71.509  -1.120  1.00 32.30  ? 649  GLN A NE2   1 
ATOM   5331  N  N     . HIS C 3 650  ? 0.068   71.438  4.009   1.00 28.39  ? 650  HIS A N     1 
ATOM   5332  C  CA    . HIS C 3 650  ? -1.362  71.380  4.336   1.00 27.90  ? 650  HIS A CA    1 
ATOM   5333  C  C     . HIS C 3 650  ? -1.951  72.722  4.788   1.00 27.73  ? 650  HIS A C     1 
ATOM   5334  O  O     . HIS C 3 650  ? -3.114  73.023  4.522   1.00 28.50  ? 650  HIS A O     1 
ATOM   5335  C  CB    . HIS C 3 650  ? -1.623  70.321  5.420   1.00 28.80  ? 650  HIS A CB    1 
ATOM   5336  C  CG    . HIS C 3 650  ? -1.611  68.917  4.901   1.00 32.32  ? 650  HIS A CG    1 
ATOM   5337  N  ND1   . HIS C 3 650  ? -0.453  68.272  4.520   1.00 32.63  ? 650  HIS A ND1   1 
ATOM   5338  C  CD2   . HIS C 3 650  ? -2.626  68.057  4.639   1.00 31.26  ? 650  HIS A CD2   1 
ATOM   5339  C  CE1   . HIS C 3 650  ? -0.756  67.077  4.042   1.00 33.57  ? 650  HIS A CE1   1 
ATOM   5340  N  NE2   . HIS C 3 650  ? -2.067  66.923  4.102   1.00 32.22  ? 650  HIS A NE2   1 
ATOM   5341  N  N     . LEU C 3 651  ? -1.153  73.520  5.484   1.00 26.03  ? 651  LEU A N     1 
ATOM   5342  C  CA    . LEU C 3 651  ? -1.612  74.814  5.958   1.00 25.48  ? 651  LEU A CA    1 
ATOM   5343  C  C     . LEU C 3 651  ? -1.816  75.733  4.769   1.00 25.81  ? 651  LEU A C     1 
ATOM   5344  O  O     . LEU C 3 651  ? -2.765  76.524  4.740   1.00 24.87  ? 651  LEU A O     1 
ATOM   5345  C  CB    . LEU C 3 651  ? -0.577  75.428  6.896   1.00 25.49  ? 651  LEU A CB    1 
ATOM   5346  C  CG    . LEU C 3 651  ? -0.897  76.791  7.505   1.00 25.50  ? 651  LEU A CG    1 
ATOM   5347  C  CD1   . LEU C 3 651  ? -2.060  76.707  8.500   1.00 24.36  ? 651  LEU A CD1   1 
ATOM   5348  C  CD2   . LEU C 3 651  ? 0.351   77.276  8.212   1.00 26.98  ? 651  LEU A CD2   1 
ATOM   5349  N  N     . SER C 3 652  ? -0.909  75.630  3.796   1.00 24.70  ? 652  SER A N     1 
ATOM   5350  C  CA    . SER C 3 652  ? -0.975  76.452  2.591   1.00 24.27  ? 652  SER A CA    1 
ATOM   5351  C  C     . SER C 3 652  ? -2.257  76.149  1.832   1.00 25.09  ? 652  SER A C     1 
ATOM   5352  O  O     . SER C 3 652  ? -2.862  77.041  1.235   1.00 24.45  ? 652  SER A O     1 
ATOM   5353  C  CB    . SER C 3 652  ? 0.223   76.180  1.674   1.00 22.74  ? 652  SER A CB    1 
ATOM   5354  O  OG    . SER C 3 652  ? 1.455   76.446  2.322   1.00 21.90  ? 652  SER A OG    1 
ATOM   5355  N  N     . LYS C 3 653  ? -2.675  74.888  1.859   1.00 25.13  ? 653  LYS A N     1 
ATOM   5356  C  CA    . LYS C 3 653  ? -3.881  74.524  1.151   1.00 27.35  ? 653  LYS A CA    1 
ATOM   5357  C  C     . LYS C 3 653  ? -5.076  75.237  1.781   1.00 28.05  ? 653  LYS A C     1 
ATOM   5358  O  O     . LYS C 3 653  ? -5.972  75.697  1.073   1.00 29.91  ? 653  LYS A O     1 
ATOM   5359  C  CB    . LYS C 3 653  ? -4.085  73.004  1.161   1.00 28.70  ? 653  LYS A CB    1 
ATOM   5360  C  CG    . LYS C 3 653  ? -5.257  72.567  0.302   1.00 32.55  ? 653  LYS A CG    1 
ATOM   5361  C  CD    . LYS C 3 653  ? -5.364  71.055  0.133   1.00 35.24  ? 653  LYS A CD    1 
ATOM   5362  C  CE    . LYS C 3 653  ? -6.425  70.745  -0.923  1.00 37.90  ? 653  LYS A CE    1 
ATOM   5363  N  NZ    . LYS C 3 653  ? -6.461  69.327  -1.392  1.00 40.55  ? 653  LYS A NZ    1 
ATOM   5364  N  N     . LEU C 3 654  ? -5.078  75.340  3.108   1.00 26.36  ? 654  LEU A N     1 
ATOM   5365  C  CA    . LEU C 3 654  ? -6.158  76.014  3.822   1.00 26.49  ? 654  LEU A CA    1 
ATOM   5366  C  C     . LEU C 3 654  ? -6.123  77.536  3.626   1.00 26.92  ? 654  LEU A C     1 
ATOM   5367  O  O     . LEU C 3 654  ? -7.145  78.150  3.315   1.00 25.82  ? 654  LEU A O     1 
ATOM   5368  C  CB    . LEU C 3 654  ? -6.092  75.691  5.318   1.00 24.75  ? 654  LEU A CB    1 
ATOM   5369  C  CG    . LEU C 3 654  ? -7.090  76.406  6.232   1.00 23.74  ? 654  LEU A CG    1 
ATOM   5370  C  CD1   . LEU C 3 654  ? -8.504  75.971  5.889   1.00 22.65  ? 654  LEU A CD1   1 
ATOM   5371  C  CD2   . LEU C 3 654  ? -6.768  76.094  7.694   1.00 23.50  ? 654  LEU A CD2   1 
ATOM   5372  N  N     . TYR C 3 655  ? -4.956  78.147  3.815   1.00 27.70  ? 655  TYR A N     1 
ATOM   5373  C  CA    . TYR C 3 655  ? -4.845  79.593  3.639   1.00 28.80  ? 655  TYR A CA    1 
ATOM   5374  C  C     . TYR C 3 655  ? -5.245  80.000  2.228   1.00 30.44  ? 655  TYR A C     1 
ATOM   5375  O  O     . TYR C 3 655  ? -5.800  81.074  2.031   1.00 31.24  ? 655  TYR A O     1 
ATOM   5376  C  CB    . TYR C 3 655  ? -3.422  80.087  3.893   1.00 26.87  ? 655  TYR A CB    1 
ATOM   5377  C  CG    . TYR C 3 655  ? -2.950  80.038  5.333   1.00 27.49  ? 655  TYR A CG    1 
ATOM   5378  C  CD1   . TYR C 3 655  ? -3.842  80.183  6.397   1.00 24.72  ? 655  TYR A CD1   1 
ATOM   5379  C  CD2   . TYR C 3 655  ? -1.587  79.928  5.628   1.00 26.24  ? 655  TYR A CD2   1 
ATOM   5380  C  CE1   . TYR C 3 655  ? -3.385  80.225  7.711   1.00 25.25  ? 655  TYR A CE1   1 
ATOM   5381  C  CE2   . TYR C 3 655  ? -1.123  79.975  6.938   1.00 25.59  ? 655  TYR A CE2   1 
ATOM   5382  C  CZ    . TYR C 3 655  ? -2.023  80.125  7.975   1.00 25.53  ? 655  TYR A CZ    1 
ATOM   5383  O  OH    . TYR C 3 655  ? -1.550  80.211  9.267   1.00 26.13  ? 655  TYR A OH    1 
ATOM   5384  N  N     . LYS C 3 656  ? -4.955  79.154  1.244   1.00 31.57  ? 656  LYS A N     1 
ATOM   5385  C  CA    . LYS C 3 656  ? -5.311  79.471  -0.136  1.00 34.35  ? 656  LYS A CA    1 
ATOM   5386  C  C     . LYS C 3 656  ? -6.819  79.430  -0.372  1.00 34.62  ? 656  LYS A C     1 
ATOM   5387  O  O     . LYS C 3 656  ? -7.384  80.365  -0.935  1.00 33.17  ? 656  LYS A O     1 
ATOM   5388  C  CB    . LYS C 3 656  ? -4.622  78.509  -1.106  1.00 35.82  ? 656  LYS A CB    1 
ATOM   5389  C  CG    . LYS C 3 656  ? -3.122  78.685  -1.158  1.00 39.09  ? 656  LYS A CG    1 
ATOM   5390  C  CD    . LYS C 3 656  ? -2.448  77.554  -1.923  1.00 40.21  ? 656  LYS A CD    1 
ATOM   5391  C  CE    . LYS C 3 656  ? -2.746  77.606  -3.408  1.00 39.21  ? 656  LYS A CE    1 
ATOM   5392  N  NZ    . LYS C 3 656  ? -1.900  76.615  -4.143  1.00 40.63  ? 656  LYS A NZ    1 
ATOM   5393  N  N     . ARG C 3 657  ? -7.464  78.347  0.062   1.00 34.71  ? 657  ARG A N     1 
ATOM   5394  C  CA    . ARG C 3 657  ? -8.901  78.194  -0.120  1.00 36.77  ? 657  ARG A CA    1 
ATOM   5395  C  C     . ARG C 3 657  ? -9.702  79.225  0.654   1.00 37.18  ? 657  ARG A C     1 
ATOM   5396  O  O     . ARG C 3 657  ? -10.617 79.841  0.116   1.00 37.88  ? 657  ARG A O     1 
ATOM   5397  C  CB    . ARG C 3 657  ? -9.372  76.809  0.325   1.00 37.35  ? 657  ARG A CB    1 
ATOM   5398  C  CG    . ARG C 3 657  ? -10.874 76.619  0.126   1.00 38.25  ? 657  ARG A CG    1 
ATOM   5399  C  CD    . ARG C 3 657  ? -11.448 75.516  0.992   1.00 39.62  ? 657  ARG A CD    1 
ATOM   5400  N  NE    . ARG C 3 657  ? -11.390 75.874  2.406   1.00 41.19  ? 657  ARG A NE    1 
ATOM   5401  C  CZ    . ARG C 3 657  ? -11.831 75.103  3.392   1.00 39.23  ? 657  ARG A CZ    1 
ATOM   5402  N  NH1   . ARG C 3 657  ? -12.373 73.921  3.122   1.00 37.30  ? 657  ARG A NH1   1 
ATOM   5403  N  NH2   . ARG C 3 657  ? -11.716 75.510  4.646   1.00 38.19  ? 657  ARG A NH2   1 
ATOM   5404  N  N     . GLY C 3 658  ? -9.357  79.392  1.925   1.00 37.14  ? 658  GLY A N     1 
ATOM   5405  C  CA    . GLY C 3 658  ? -10.063 80.327  2.775   1.00 36.26  ? 658  GLY A CA    1 
ATOM   5406  C  C     . GLY C 3 658  ? -10.712 79.526  3.882   1.00 36.29  ? 658  GLY A C     1 
ATOM   5407  O  O     . GLY C 3 658  ? -10.585 78.304  3.916   1.00 36.26  ? 658  GLY A O     1 
ATOM   5408  N  N     . PHE C 3 659  ? -11.414 80.201  4.782   1.00 36.52  ? 659  PHE A N     1 
ATOM   5409  C  CA    . PHE C 3 659  ? -12.077 79.524  5.890   1.00 37.33  ? 659  PHE A CA    1 
ATOM   5410  C  C     . PHE C 3 659  ? -13.591 79.497  5.712   1.00 37.13  ? 659  PHE A C     1 
ATOM   5411  O  O     . PHE C 3 659  ? -14.205 80.518  5.401   1.00 37.52  ? 659  PHE A O     1 
ATOM   5412  C  CB    . PHE C 3 659  ? -11.704 80.219  7.207   1.00 37.66  ? 659  PHE A CB    1 
ATOM   5413  C  CG    . PHE C 3 659  ? -10.265 80.025  7.596   1.00 37.98  ? 659  PHE A CG    1 
ATOM   5414  C  CD1   . PHE C 3 659  ? -9.901  79.022  8.492   1.00 37.68  ? 659  PHE A CD1   1 
ATOM   5415  C  CD2   . PHE C 3 659  ? -9.260  80.776  6.988   1.00 36.01  ? 659  PHE A CD2   1 
ATOM   5416  C  CE1   . PHE C 3 659  ? -8.558  78.767  8.766   1.00 36.45  ? 659  PHE A CE1   1 
ATOM   5417  C  CE2   . PHE C 3 659  ? -7.922  80.526  7.256   1.00 33.38  ? 659  PHE A CE2   1 
ATOM   5418  C  CZ    . PHE C 3 659  ? -7.570  79.521  8.141   1.00 33.87  ? 659  PHE A CZ    1 
ATOM   5419  N  N     . SER C 3 660  ? -14.185 78.320  5.884   1.00 37.91  ? 660  SER A N     1 
ATOM   5420  C  CA    . SER C 3 660  ? -15.634 78.175  5.767   1.00 38.29  ? 660  SER A CA    1 
ATOM   5421  C  C     . SER C 3 660  ? -16.240 78.448  7.131   1.00 38.27  ? 660  SER A C     1 
ATOM   5422  O  O     . SER C 3 660  ? -16.282 77.569  7.993   1.00 38.14  ? 660  SER A O     1 
ATOM   5423  C  CB    . SER C 3 660  ? -16.010 76.767  5.326   1.00 38.23  ? 660  SER A CB    1 
ATOM   5424  O  OG    . SER C 3 660  ? -15.886 76.623  3.929   1.00 42.51  ? 660  SER A OG    1 
ATOM   5425  N  N     . TYR C 3 661  ? -16.703 79.676  7.320   1.00 36.83  ? 661  TYR A N     1 
ATOM   5426  C  CA    . TYR C 3 661  ? -17.281 80.074  8.587   1.00 36.34  ? 661  TYR A CA    1 
ATOM   5427  C  C     . TYR C 3 661  ? -18.754 79.691  8.646   1.00 35.54  ? 661  TYR A C     1 
ATOM   5428  O  O     . TYR C 3 661  ? -19.568 80.190  7.872   1.00 34.71  ? 661  TYR A O     1 
ATOM   5429  C  CB    . TYR C 3 661  ? -17.115 81.580  8.767   1.00 36.95  ? 661  TYR A CB    1 
ATOM   5430  C  CG    . TYR C 3 661  ? -17.113 82.037  10.203  1.00 37.95  ? 661  TYR A CG    1 
ATOM   5431  C  CD1   . TYR C 3 661  ? -16.068 81.692  11.067  1.00 37.56  ? 661  TYR A CD1   1 
ATOM   5432  C  CD2   . TYR C 3 661  ? -18.148 82.833  10.699  1.00 39.41  ? 661  TYR A CD2   1 
ATOM   5433  C  CE1   . TYR C 3 661  ? -16.054 82.134  12.390  1.00 38.34  ? 661  TYR A CE1   1 
ATOM   5434  C  CE2   . TYR C 3 661  ? -18.145 83.280  12.022  1.00 39.01  ? 661  TYR A CE2   1 
ATOM   5435  C  CZ    . TYR C 3 661  ? -17.098 82.930  12.858  1.00 38.26  ? 661  TYR A CZ    1 
ATOM   5436  O  OH    . TYR C 3 661  ? -17.096 83.393  14.149  1.00 36.84  ? 661  TYR A OH    1 
ATOM   5437  N  N     . ARG C 3 662  ? -19.085 78.794  9.569   1.00 35.32  ? 662  ARG A N     1 
ATOM   5438  C  CA    . ARG C 3 662  ? -20.456 78.324  9.748   1.00 34.61  ? 662  ARG A CA    1 
ATOM   5439  C  C     . ARG C 3 662  ? -21.186 79.260  10.716  1.00 32.52  ? 662  ARG A C     1 
ATOM   5440  O  O     . ARG C 3 662  ? -20.879 79.306  11.903  1.00 32.96  ? 662  ARG A O     1 
ATOM   5441  C  CB    . ARG C 3 662  ? -20.429 76.892  10.285  1.00 36.90  ? 662  ARG A CB    1 
ATOM   5442  C  CG    . ARG C 3 662  ? -21.783 76.225  10.416  1.00 42.55  ? 662  ARG A CG    1 
ATOM   5443  C  CD    . ARG C 3 662  ? -21.614 74.771  10.846  1.00 44.87  ? 662  ARG A CD    1 
ATOM   5444  N  NE    . ARG C 3 662  ? -20.831 74.010  9.872   1.00 46.94  ? 662  ARG A NE    1 
ATOM   5445  C  CZ    . ARG C 3 662  ? -20.488 72.732  10.015  1.00 47.44  ? 662  ARG A CZ    1 
ATOM   5446  N  NH1   . ARG C 3 662  ? -20.856 72.055  11.101  1.00 45.24  ? 662  ARG A NH1   1 
ATOM   5447  N  NH2   . ARG C 3 662  ? -19.780 72.129  9.067   1.00 44.83  ? 662  ARG A NH2   1 
ATOM   5448  N  N     . VAL C 3 663  ? -22.153 80.007  10.198  1.00 30.49  ? 663  VAL A N     1 
ATOM   5449  C  CA    . VAL C 3 663  ? -22.898 80.963  11.005  1.00 28.89  ? 663  VAL A CA    1 
ATOM   5450  C  C     . VAL C 3 663  ? -24.313 80.532  11.409  1.00 31.08  ? 663  VAL A C     1 
ATOM   5451  O  O     . VAL C 3 663  ? -25.229 80.502  10.577  1.00 32.38  ? 663  VAL A O     1 
ATOM   5452  C  CB    . VAL C 3 663  ? -23.005 82.318  10.267  1.00 27.03  ? 663  VAL A CB    1 
ATOM   5453  C  CG1   . VAL C 3 663  ? -23.669 83.350  11.163  1.00 25.54  ? 663  VAL A CG1   1 
ATOM   5454  C  CG2   . VAL C 3 663  ? -21.630 82.791  9.843   1.00 23.82  ? 663  VAL A CG2   1 
ATOM   5455  N  N     . ASN C 3 664  ? -24.477 80.203  12.688  1.00 32.07  ? 664  ASN A N     1 
ATOM   5456  C  CA    . ASN C 3 664  ? -25.769 79.818  13.260  1.00 32.16  ? 664  ASN A CA    1 
ATOM   5457  C  C     . ASN C 3 664  ? -26.154 80.940  14.220  1.00 30.35  ? 664  ASN A C     1 
ATOM   5458  O  O     . ASN C 3 664  ? -25.848 80.891  15.406  1.00 29.81  ? 664  ASN A O     1 
ATOM   5459  C  CB    . ASN C 3 664  ? -25.656 78.488  14.011  1.00 35.48  ? 664  ASN A CB    1 
ATOM   5460  C  CG    . ASN C 3 664  ? -25.685 77.288  13.077  1.00 38.94  ? 664  ASN A CG    1 
ATOM   5461  O  OD1   . ASN C 3 664  ? -26.725 76.968  12.494  1.00 39.15  ? 664  ASN A OD1   1 
ATOM   5462  N  ND2   . ASN C 3 664  ? -24.537 76.623  12.919  1.00 39.99  ? 664  ASN A ND2   1 
ATOM   5463  N  N     . ASP C 3 665  ? -26.819 81.954  13.673  1.00 29.28  ? 665  ASP A N     1 
ATOM   5464  C  CA    . ASP C 3 665  ? -27.242 83.151  14.400  1.00 28.28  ? 665  ASP A CA    1 
ATOM   5465  C  C     . ASP C 3 665  ? -28.514 82.933  15.239  1.00 28.24  ? 665  ASP A C     1 
ATOM   5466  O  O     . ASP C 3 665  ? -29.631 83.114  14.754  1.00 29.77  ? 665  ASP A O     1 
ATOM   5467  C  CB    . ASP C 3 665  ? -27.457 84.268  13.368  1.00 26.28  ? 665  ASP A CB    1 
ATOM   5468  C  CG    . ASP C 3 665  ? -27.667 85.617  13.993  1.00 26.32  ? 665  ASP A CG    1 
ATOM   5469  O  OD1   . ASP C 3 665  ? -28.095 85.680  15.163  1.00 28.68  ? 665  ASP A OD1   1 
ATOM   5470  O  OD2   . ASP C 3 665  ? -27.420 86.623  13.305  1.00 26.69  ? 665  ASP A OD2   1 
ATOM   5471  N  N     . SER C 3 666  ? -28.346 82.573  16.506  1.00 28.45  ? 666  SER A N     1 
ATOM   5472  C  CA    . SER C 3 666  ? -29.494 82.310  17.379  1.00 28.60  ? 666  SER A CA    1 
ATOM   5473  C  C     . SER C 3 666  ? -30.332 83.537  17.732  1.00 27.40  ? 666  SER A C     1 
ATOM   5474  O  O     . SER C 3 666  ? -31.391 83.415  18.340  1.00 26.66  ? 666  SER A O     1 
ATOM   5475  C  CB    . SER C 3 666  ? -29.029 81.619  18.665  1.00 28.79  ? 666  SER A CB    1 
ATOM   5476  O  OG    . SER C 3 666  ? -28.104 82.429  19.362  1.00 32.43  ? 666  SER A OG    1 
ATOM   5477  N  N     . PHE C 3 667  ? -29.853 84.716  17.365  1.00 27.70  ? 667  PHE A N     1 
ATOM   5478  C  CA    . PHE C 3 667  ? -30.590 85.945  17.623  1.00 27.58  ? 667  PHE A CA    1 
ATOM   5479  C  C     . PHE C 3 667  ? -31.472 86.267  16.409  1.00 29.04  ? 667  PHE A C     1 
ATOM   5480  O  O     . PHE C 3 667  ? -32.454 86.990  16.528  1.00 31.28  ? 667  PHE A O     1 
ATOM   5481  C  CB    . PHE C 3 667  ? -29.614 87.097  17.879  1.00 27.27  ? 667  PHE A CB    1 
ATOM   5482  C  CG    . PHE C 3 667  ? -28.835 86.962  19.162  1.00 27.86  ? 667  PHE A CG    1 
ATOM   5483  C  CD1   . PHE C 3 667  ? -29.422 87.272  20.389  1.00 26.56  ? 667  PHE A CD1   1 
ATOM   5484  C  CD2   . PHE C 3 667  ? -27.517 86.511  19.149  1.00 26.99  ? 667  PHE A CD2   1 
ATOM   5485  C  CE1   . PHE C 3 667  ? -28.706 87.132  21.584  1.00 25.31  ? 667  PHE A CE1   1 
ATOM   5486  C  CE2   . PHE C 3 667  ? -26.795 86.369  20.339  1.00 25.68  ? 667  PHE A CE2   1 
ATOM   5487  C  CZ    . PHE C 3 667  ? -27.394 86.681  21.558  1.00 25.39  ? 667  PHE A CZ    1 
ATOM   5488  N  N     . SER C 3 668  ? -31.122 85.721  15.246  1.00 29.36  ? 668  SER A N     1 
ATOM   5489  C  CA    . SER C 3 668  ? -31.876 85.951  14.012  1.00 31.11  ? 668  SER A CA    1 
ATOM   5490  C  C     . SER C 3 668  ? -32.455 84.637  13.469  1.00 32.37  ? 668  SER A C     1 
ATOM   5491  O  O     . SER C 3 668  ? -31.786 83.918  12.725  1.00 32.58  ? 668  SER A O     1 
ATOM   5492  C  CB    . SER C 3 668  ? -30.974 86.570  12.940  1.00 30.38  ? 668  SER A CB    1 
ATOM   5493  O  OG    . SER C 3 668  ? -30.383 87.776  13.384  1.00 32.11  ? 668  SER A OG    1 
ATOM   5494  N  N     . PRO C 3 669  ? -33.718 84.325  13.815  1.00 32.48  ? 669  PRO A N     1 
ATOM   5495  C  CA    . PRO C 3 669  ? -34.392 83.100  13.372  1.00 31.55  ? 669  PRO A CA    1 
ATOM   5496  C  C     . PRO C 3 669  ? -34.214 82.811  11.881  1.00 32.26  ? 669  PRO A C     1 
ATOM   5497  O  O     . PRO C 3 669  ? -34.534 83.648  11.025  1.00 29.96  ? 669  PRO A O     1 
ATOM   5498  C  CB    . PRO C 3 669  ? -35.857 83.364  13.723  1.00 32.04  ? 669  PRO A CB    1 
ATOM   5499  C  CG    . PRO C 3 669  ? -35.773 84.267  14.893  1.00 31.98  ? 669  PRO A CG    1 
ATOM   5500  C  CD    . PRO C 3 669  ? -34.676 85.222  14.491  1.00 32.94  ? 669  PRO A CD    1 
ATOM   5501  N  N     . GLY C 3 670  ? -33.703 81.623  11.575  1.00 31.76  ? 670  GLY A N     1 
ATOM   5502  C  CA    . GLY C 3 670  ? -33.512 81.248  10.191  1.00 31.89  ? 670  GLY A CA    1 
ATOM   5503  C  C     . GLY C 3 670  ? -32.267 81.798  9.526   1.00 33.07  ? 670  GLY A C     1 
ATOM   5504  O  O     . GLY C 3 670  ? -32.152 81.738  8.308   1.00 33.35  ? 670  GLY A O     1 
ATOM   5505  N  N     . ASN C 3 671  ? -31.336 82.359  10.291  1.00 34.74  ? 671  ASN A N     1 
ATOM   5506  C  CA    . ASN C 3 671  ? -30.113 82.861  9.666   1.00 36.43  ? 671  ASN A CA    1 
ATOM   5507  C  C     . ASN C 3 671  ? -28.990 81.851  9.844   1.00 37.27  ? 671  ASN A C     1 
ATOM   5508  O  O     . ASN C 3 671  ? -28.100 82.017  10.679  1.00 38.12  ? 671  ASN A O     1 
ATOM   5509  C  CB    . ASN C 3 671  ? -29.697 84.227  10.226  1.00 34.79  ? 671  ASN A CB    1 
ATOM   5510  C  CG    . ASN C 3 671  ? -30.462 85.373  9.593   1.00 33.94  ? 671  ASN A CG    1 
ATOM   5511  O  OD1   . ASN C 3 671  ? -30.011 86.518  9.612   1.00 36.16  ? 671  ASN A OD1   1 
ATOM   5512  N  ND2   . ASN C 3 671  ? -31.630 85.074  9.038   1.00 30.74  ? 671  ASN A ND2   1 
ATOM   5513  N  N     . ASP C 3 672  ? -29.068 80.787  9.052   1.00 37.62  ? 672  ASP A N     1 
ATOM   5514  C  CA    . ASP C 3 672  ? -28.084 79.719  9.065   1.00 38.95  ? 672  ASP A CA    1 
ATOM   5515  C  C     . ASP C 3 672  ? -27.406 79.715  7.698   1.00 36.74  ? 672  ASP A C     1 
ATOM   5516  O  O     . ASP C 3 672  ? -28.047 79.467  6.680   1.00 36.06  ? 672  ASP A O     1 
ATOM   5517  C  CB    . ASP C 3 672  ? -28.773 78.373  9.308   1.00 42.73  ? 672  ASP A CB    1 
ATOM   5518  C  CG    . ASP C 3 672  ? -29.569 78.353  10.600  1.00 48.11  ? 672  ASP A CG    1 
ATOM   5519  O  OD1   . ASP C 3 672  ? -28.946 78.291  11.686  1.00 49.35  ? 672  ASP A OD1   1 
ATOM   5520  O  OD2   . ASP C 3 672  ? -30.822 78.414  10.527  1.00 51.03  ? 672  ASP A OD2   1 
ATOM   5521  N  N     . PHE C 3 673  ? -26.112 80.008  7.677   1.00 34.51  ? 673  PHE A N     1 
ATOM   5522  C  CA    . PHE C 3 673  ? -25.375 80.031  6.421   1.00 31.31  ? 673  PHE A CA    1 
ATOM   5523  C  C     . PHE C 3 673  ? -23.888 79.823  6.657   1.00 29.56  ? 673  PHE A C     1 
ATOM   5524  O  O     . PHE C 3 673  ? -23.387 80.044  7.751   1.00 27.93  ? 673  PHE A O     1 
ATOM   5525  C  CB    . PHE C 3 673  ? -25.624 81.357  5.684   1.00 28.76  ? 673  PHE A CB    1 
ATOM   5526  C  CG    . PHE C 3 673  ? -25.226 82.579  6.468   1.00 27.58  ? 673  PHE A CG    1 
ATOM   5527  C  CD1   . PHE C 3 673  ? -24.018 83.220  6.217   1.00 23.99  ? 673  PHE A CD1   1 
ATOM   5528  C  CD2   . PHE C 3 673  ? -26.052 83.073  7.481   1.00 26.64  ? 673  PHE A CD2   1 
ATOM   5529  C  CE1   . PHE C 3 673  ? -23.633 84.333  6.958   1.00 24.89  ? 673  PHE A CE1   1 
ATOM   5530  C  CE2   . PHE C 3 673  ? -25.675 84.185  8.230   1.00 26.54  ? 673  PHE A CE2   1 
ATOM   5531  C  CZ    . PHE C 3 673  ? -24.459 84.819  7.966   1.00 24.34  ? 673  PHE A CZ    1 
ATOM   5532  N  N     . THR C 3 674  ? -23.203 79.353  5.625   1.00 30.09  ? 674  THR A N     1 
ATOM   5533  C  CA    . THR C 3 674  ? -21.777 79.117  5.690   1.00 30.42  ? 674  THR A CA    1 
ATOM   5534  C  C     . THR C 3 674  ? -21.165 80.178  4.798   1.00 33.29  ? 674  THR A C     1 
ATOM   5535  O  O     . THR C 3 674  ? -21.456 80.261  3.608   1.00 32.73  ? 674  THR A O     1 
ATOM   5536  C  CB    . THR C 3 674  ? -21.423 77.718  5.181   1.00 30.32  ? 674  THR A CB    1 
ATOM   5537  O  OG1   . THR C 3 674  ? -22.016 76.748  6.045   1.00 28.50  ? 674  THR A OG1   1 
ATOM   5538  C  CG2   . THR C 3 674  ? -19.912 77.506  5.166   1.00 29.85  ? 674  THR A CG2   1 
ATOM   5539  N  N     . HIS C 3 675  ? -20.326 81.005  5.398   1.00 35.50  ? 675  HIS A N     1 
ATOM   5540  C  CA    . HIS C 3 675  ? -19.692 82.094  4.697   1.00 36.96  ? 675  HIS A CA    1 
ATOM   5541  C  C     . HIS C 3 675  ? -18.220 81.784  4.476   1.00 37.83  ? 675  HIS A C     1 
ATOM   5542  O  O     . HIS C 3 675  ? -17.494 81.445  5.413   1.00 38.01  ? 675  HIS A O     1 
ATOM   5543  C  CB    . HIS C 3 675  ? -19.868 83.366  5.529   1.00 38.46  ? 675  HIS A CB    1 
ATOM   5544  C  CG    . HIS C 3 675  ? -19.489 84.617  4.810   1.00 41.48  ? 675  HIS A CG    1 
ATOM   5545  N  ND1   . HIS C 3 675  ? -18.204 85.115  4.810   1.00 43.62  ? 675  HIS A ND1   1 
ATOM   5546  C  CD2   . HIS C 3 675  ? -20.220 85.453  4.037   1.00 42.56  ? 675  HIS A CD2   1 
ATOM   5547  C  CE1   . HIS C 3 675  ? -18.158 86.206  4.067   1.00 43.70  ? 675  HIS A CE1   1 
ATOM   5548  N  NE2   . HIS C 3 675  ? -19.368 86.433  3.586   1.00 44.23  ? 675  HIS A NE2   1 
ATOM   5549  N  N     . MET C 3 676  ? -17.781 81.877  3.227   1.00 38.25  ? 676  MET A N     1 
ATOM   5550  C  CA    . MET C 3 676  ? -16.385 81.616  2.913   1.00 39.03  ? 676  MET A CA    1 
ATOM   5551  C  C     . MET C 3 676  ? -15.680 82.961  3.001   1.00 37.46  ? 676  MET A C     1 
ATOM   5552  O  O     . MET C 3 676  ? -16.218 83.981  2.555   1.00 37.39  ? 676  MET A O     1 
ATOM   5553  C  CB    . MET C 3 676  ? -16.261 81.006  1.507   1.00 41.01  ? 676  MET A CB    1 
ATOM   5554  C  CG    . MET C 3 676  ? -14.841 80.596  1.088   1.00 46.40  ? 676  MET A CG    1 
ATOM   5555  S  SD    . MET C 3 676  ? -14.018 79.352  2.148   1.00 52.63  ? 676  MET A SD    1 
ATOM   5556  C  CE    . MET C 3 676  ? -14.840 77.834  1.608   1.00 50.24  ? 676  MET A CE    1 
ATOM   5557  N  N     . THR C 3 677  ? -14.496 82.978  3.607   1.00 36.06  ? 677  THR A N     1 
ATOM   5558  C  CA    . THR C 3 677  ? -13.750 84.228  3.744   1.00 35.48  ? 677  THR A CA    1 
ATOM   5559  C  C     . THR C 3 677  ? -12.248 84.022  3.666   1.00 35.43  ? 677  THR A C     1 
ATOM   5560  O  O     . THR C 3 677  ? -11.744 82.947  3.998   1.00 37.46  ? 677  THR A O     1 
ATOM   5561  C  CB    . THR C 3 677  ? -14.063 84.933  5.085   1.00 34.12  ? 677  THR A CB    1 
ATOM   5562  O  OG1   . THR C 3 677  ? -13.248 86.103  5.210   1.00 31.57  ? 677  THR A OG1   1 
ATOM   5563  C  CG2   . THR C 3 677  ? -13.782 84.008  6.248   1.00 31.91  ? 677  THR A CG2   1 
ATOM   5564  N  N     . THR C 3 678  ? -11.538 85.061  3.242   1.00 34.31  ? 678  THR A N     1 
ATOM   5565  C  CA    . THR C 3 678  ? -10.088 85.000  3.129   1.00 34.05  ? 678  THR A CA    1 
ATOM   5566  C  C     . THR C 3 678  ? -9.422  85.772  4.268   1.00 34.11  ? 678  THR A C     1 
ATOM   5567  O  O     . THR C 3 678  ? -8.204  85.954  4.278   1.00 35.43  ? 678  THR A O     1 
ATOM   5568  C  CB    . THR C 3 678  ? -9.605  85.587  1.798   1.00 33.58  ? 678  THR A CB    1 
ATOM   5569  O  OG1   . THR C 3 678  ? -9.827  87.000  1.795   1.00 33.41  ? 678  THR A OG1   1 
ATOM   5570  C  CG2   . THR C 3 678  ? -10.351 84.956  0.640   1.00 32.39  ? 678  THR A CG2   1 
ATOM   5571  N  N     . THR C 3 679  ? -10.222 86.226  5.224   1.00 33.46  ? 679  THR A N     1 
ATOM   5572  C  CA    . THR C 3 679  ? -9.686  86.957  6.358   1.00 33.81  ? 679  THR A CA    1 
ATOM   5573  C  C     . THR C 3 679  ? -8.923  85.990  7.244   1.00 35.04  ? 679  THR A C     1 
ATOM   5574  O  O     . THR C 3 679  ? -9.314  84.831  7.403   1.00 34.20  ? 679  THR A O     1 
ATOM   5575  C  CB    . THR C 3 679  ? -10.805 87.625  7.177   1.00 33.78  ? 679  THR A CB    1 
ATOM   5576  O  OG1   . THR C 3 679  ? -11.397 88.672  6.396   1.00 37.38  ? 679  THR A OG1   1 
ATOM   5577  C  CG2   . THR C 3 679  ? -10.253 88.213  8.470   1.00 31.29  ? 679  THR A CG2   1 
ATOM   5578  N  N     . PHE C 3 680  ? -7.830  86.469  7.826   1.00 35.87  ? 680  PHE A N     1 
ATOM   5579  C  CA    . PHE C 3 680  ? -7.011  85.628  8.682   1.00 35.99  ? 680  PHE A CA    1 
ATOM   5580  C  C     . PHE C 3 680  ? -7.724  85.261  9.990   1.00 37.43  ? 680  PHE A C     1 
ATOM   5581  O  O     . PHE C 3 680  ? -8.416  86.087  10.586  1.00 37.66  ? 680  PHE A O     1 
ATOM   5582  C  CB    . PHE C 3 680  ? -5.690  86.331  8.991   1.00 35.04  ? 680  PHE A CB    1 
ATOM   5583  C  CG    . PHE C 3 680  ? -4.645  85.416  9.535   1.00 36.97  ? 680  PHE A CG    1 
ATOM   5584  C  CD1   . PHE C 3 680  ? -3.787  84.733  8.676   1.00 37.47  ? 680  PHE A CD1   1 
ATOM   5585  C  CD2   . PHE C 3 680  ? -4.558  85.174  10.906  1.00 35.84  ? 680  PHE A CD2   1 
ATOM   5586  C  CE1   . PHE C 3 680  ? -2.855  83.814  9.177   1.00 37.30  ? 680  PHE A CE1   1 
ATOM   5587  C  CE2   . PHE C 3 680  ? -3.633  84.259  11.417  1.00 35.64  ? 680  PHE A CE2   1 
ATOM   5588  C  CZ    . PHE C 3 680  ? -2.782  83.579  10.554  1.00 36.14  ? 680  PHE A CZ    1 
ATOM   5589  N  N     . PRO C 3 681  ? -7.562  84.006  10.447  1.00 37.60  ? 681  PRO A N     1 
ATOM   5590  C  CA    . PRO C 3 681  ? -8.154  83.460  11.676  1.00 38.23  ? 681  PRO A CA    1 
ATOM   5591  C  C     . PRO C 3 681  ? -7.616  84.113  12.941  1.00 37.86  ? 681  PRO A C     1 
ATOM   5592  O  O     . PRO C 3 681  ? -6.427  84.375  13.045  1.00 37.79  ? 681  PRO A O     1 
ATOM   5593  C  CB    . PRO C 3 681  ? -7.751  81.988  11.635  1.00 38.64  ? 681  PRO A CB    1 
ATOM   5594  C  CG    . PRO C 3 681  ? -7.605  81.716  10.213  1.00 39.01  ? 681  PRO A CG    1 
ATOM   5595  C  CD    . PRO C 3 681  ? -6.903  82.935  9.686   1.00 38.13  ? 681  PRO A CD    1 
ATOM   5596  N  N     . SER C 3 682  ? -8.491  84.351  13.910  1.00 37.76  ? 682  SER A N     1 
ATOM   5597  C  CA    . SER C 3 682  ? -8.070  84.941  15.171  1.00 36.40  ? 682  SER A CA    1 
ATOM   5598  C  C     . SER C 3 682  ? -7.749  83.842  16.187  1.00 35.56  ? 682  SER A C     1 
ATOM   5599  O  O     . SER C 3 682  ? -6.742  83.903  16.902  1.00 36.73  ? 682  SER A O     1 
ATOM   5600  C  CB    . SER C 3 682  ? -9.162  85.858  15.720  1.00 38.23  ? 682  SER A CB    1 
ATOM   5601  O  OG    . SER C 3 682  ? -9.180  87.097  15.030  1.00 39.13  ? 682  SER A OG    1 
ATOM   5602  N  N     . GLY C 3 683  ? -8.597  82.827  16.245  1.00 32.07  ? 683  GLY A N     1 
ATOM   5603  C  CA    . GLY C 3 683  ? -8.354  81.749  17.183  1.00 30.04  ? 683  GLY A CA    1 
ATOM   5604  C  C     . GLY C 3 683  ? -7.131  80.888  16.921  1.00 28.12  ? 683  GLY A C     1 
ATOM   5605  O  O     . GLY C 3 683  ? -6.904  79.919  17.639  1.00 29.36  ? 683  GLY A O     1 
ATOM   5606  N  N     . SER C 3 684  ? -6.340  81.219  15.904  1.00 27.88  ? 684  SER A N     1 
ATOM   5607  C  CA    . SER C 3 684  ? -5.135  80.442  15.580  1.00 26.14  ? 684  SER A CA    1 
ATOM   5608  C  C     . SER C 3 684  ? -3.960  80.727  16.522  1.00 24.95  ? 684  SER A C     1 
ATOM   5609  O  O     . SER C 3 684  ? -3.774  81.859  16.964  1.00 25.00  ? 684  SER A O     1 
ATOM   5610  C  CB    . SER C 3 684  ? -4.702  80.735  14.148  1.00 25.78  ? 684  SER A CB    1 
ATOM   5611  O  OG    . SER C 3 684  ? -3.450  80.142  13.858  1.00 27.91  ? 684  SER A OG    1 
ATOM   5612  N  N     . THR C 3 685  ? -3.163  79.713  16.840  1.00 24.83  ? 685  THR A N     1 
ATOM   5613  C  CA    . THR C 3 685  ? -2.012  79.958  17.714  1.00 25.93  ? 685  THR A CA    1 
ATOM   5614  C  C     . THR C 3 685  ? -1.004  80.863  17.010  1.00 26.07  ? 685  THR A C     1 
ATOM   5615  O  O     . THR C 3 685  ? -0.106  81.409  17.642  1.00 28.09  ? 685  THR A O     1 
ATOM   5616  C  CB    . THR C 3 685  ? -1.242  78.675  18.090  1.00 23.26  ? 685  THR A CB    1 
ATOM   5617  O  OG1   . THR C 3 685  ? -0.718  78.076  16.901  1.00 26.16  ? 685  THR A OG1   1 
ATOM   5618  C  CG2   . THR C 3 685  ? -2.129  77.692  18.810  1.00 22.62  ? 685  THR A CG2   1 
ATOM   5619  N  N     . ALA C 3 686  ? -1.146  81.027  15.701  1.00 25.80  ? 686  ALA A N     1 
ATOM   5620  C  CA    . ALA C 3 686  ? -0.190  81.843  14.968  1.00 26.06  ? 686  ALA A CA    1 
ATOM   5621  C  C     . ALA C 3 686  ? -0.533  83.314  14.941  1.00 26.50  ? 686  ALA A C     1 
ATOM   5622  O  O     . ALA C 3 686  ? 0.351   84.159  14.919  1.00 27.11  ? 686  ALA A O     1 
ATOM   5623  C  CB    . ALA C 3 686  ? -0.052  81.329  13.541  1.00 22.95  ? 686  ALA A CB    1 
ATOM   5624  N  N     . THR C 3 687  ? -1.824  83.603  14.971  1.00 27.72  ? 687  THR A N     1 
ATOM   5625  C  CA    . THR C 3 687  ? -2.329  84.957  14.872  1.00 29.90  ? 687  THR A CA    1 
ATOM   5626  C  C     . THR C 3 687  ? -1.481  86.085  15.463  1.00 31.95  ? 687  THR A C     1 
ATOM   5627  O  O     . THR C 3 687  ? -0.802  86.819  14.723  1.00 32.20  ? 687  THR A O     1 
ATOM   5628  C  CB    . THR C 3 687  ? -3.764  85.042  15.444  1.00 31.49  ? 687  THR A CB    1 
ATOM   5629  O  OG1   . THR C 3 687  ? -4.525  83.904  15.004  1.00 30.92  ? 687  THR A OG1   1 
ATOM   5630  C  CG2   . THR C 3 687  ? -4.452  86.324  14.952  1.00 28.64  ? 687  THR A CG2   1 
ATOM   5631  N  N     . SER C 3 688  ? -1.522  86.235  16.782  1.00 31.13  ? 688  SER A N     1 
ATOM   5632  C  CA    . SER C 3 688  ? -0.785  87.305  17.438  1.00 31.19  ? 688  SER A CA    1 
ATOM   5633  C  C     . SER C 3 688  ? 0.690   87.415  17.056  1.00 31.15  ? 688  SER A C     1 
ATOM   5634  O  O     . SER C 3 688  ? 1.152   88.450  16.564  1.00 30.51  ? 688  SER A O     1 
ATOM   5635  C  CB    . SER C 3 688  ? -0.896  87.156  18.948  1.00 31.83  ? 688  SER A CB    1 
ATOM   5636  O  OG    . SER C 3 688  ? -0.260  88.245  19.585  1.00 36.21  ? 688  SER A OG    1 
ATOM   5637  N  N     . THR C 3 689  ? 1.434   86.345  17.287  1.00 30.85  ? 689  THR A N     1 
ATOM   5638  C  CA    . THR C 3 689  ? 2.856   86.356  16.990  1.00 29.98  ? 689  THR A CA    1 
ATOM   5639  C  C     . THR C 3 689  ? 3.141   86.646  15.502  1.00 29.90  ? 689  THR A C     1 
ATOM   5640  O  O     . THR C 3 689  ? 4.080   87.375  15.160  1.00 29.98  ? 689  THR A O     1 
ATOM   5641  C  CB    . THR C 3 689  ? 3.494   85.013  17.435  1.00 29.09  ? 689  THR A CB    1 
ATOM   5642  O  OG1   . THR C 3 689  ? 4.916   85.098  17.309  1.00 29.08  ? 689  THR A OG1   1 
ATOM   5643  C  CG2   . THR C 3 689  ? 2.955   83.844  16.596  1.00 29.96  ? 689  THR A CG2   1 
ATOM   5644  N  N     . GLU C 3 690  ? 2.300   86.100  14.631  1.00 28.21  ? 690  GLU A N     1 
ATOM   5645  C  CA    . GLU C 3 690  ? 2.418   86.259  13.181  1.00 25.83  ? 690  GLU A CA    1 
ATOM   5646  C  C     . GLU C 3 690  ? 2.335   87.727  12.772  1.00 26.20  ? 690  GLU A C     1 
ATOM   5647  O  O     . GLU C 3 690  ? 3.202   88.251  12.066  1.00 25.51  ? 690  GLU A O     1 
ATOM   5648  C  CB    . GLU C 3 690  ? 1.285   85.484  12.520  1.00 25.91  ? 690  GLU A CB    1 
ATOM   5649  C  CG    . GLU C 3 690  ? 1.468   85.131  11.084  1.00 27.13  ? 690  GLU A CG    1 
ATOM   5650  C  CD    . GLU C 3 690  ? 1.209   86.281  10.131  1.00 27.94  ? 690  GLU A CD    1 
ATOM   5651  O  OE1   . GLU C 3 690  ? 0.467   87.220  10.490  1.00 23.51  ? 690  GLU A OE1   1 
ATOM   5652  O  OE2   . GLU C 3 690  ? 1.745   86.224  9.007   1.00 27.27  ? 690  GLU A OE2   1 
ATOM   5653  N  N     . HIS C 3 691  ? 1.272   88.380  13.220  1.00 25.36  ? 691  HIS A N     1 
ATOM   5654  C  CA    . HIS C 3 691  ? 1.044   89.774  12.909  1.00 25.22  ? 691  HIS A CA    1 
ATOM   5655  C  C     . HIS C 3 691  ? 2.137   90.665  13.495  1.00 26.69  ? 691  HIS A C     1 
ATOM   5656  O  O     . HIS C 3 691  ? 2.482   91.701  12.928  1.00 27.62  ? 691  HIS A O     1 
ATOM   5657  C  CB    . HIS C 3 691  ? -0.324  90.199  13.440  1.00 27.27  ? 691  HIS A CB    1 
ATOM   5658  C  CG    . HIS C 3 691  ? -1.477  89.489  12.794  1.00 27.65  ? 691  HIS A CG    1 
ATOM   5659  N  ND1   . HIS C 3 691  ? -1.322  88.605  11.748  1.00 28.59  ? 691  HIS A ND1   1 
ATOM   5660  C  CD2   . HIS C 3 691  ? -2.809  89.548  13.040  1.00 27.96  ? 691  HIS A CD2   1 
ATOM   5661  C  CE1   . HIS C 3 691  ? -2.506  88.150  11.378  1.00 26.30  ? 691  HIS A CE1   1 
ATOM   5662  N  NE2   . HIS C 3 691  ? -3.425  88.707  12.147  1.00 26.02  ? 691  HIS A NE2   1 
ATOM   5663  N  N     . THR C 3 692  ? 2.682   90.272  14.637  1.00 27.36  ? 692  THR A N     1 
ATOM   5664  C  CA    . THR C 3 692  ? 3.736   91.063  15.249  1.00 25.89  ? 692  THR A CA    1 
ATOM   5665  C  C     . THR C 3 692  ? 4.955   91.002  14.347  1.00 25.90  ? 692  THR A C     1 
ATOM   5666  O  O     . THR C 3 692  ? 5.619   92.015  14.093  1.00 25.90  ? 692  THR A O     1 
ATOM   5667  C  CB    . THR C 3 692  ? 4.136   90.501  16.622  1.00 26.43  ? 692  THR A CB    1 
ATOM   5668  O  OG1   . THR C 3 692  ? 2.965   90.336  17.423  1.00 25.87  ? 692  THR A OG1   1 
ATOM   5669  C  CG2   . THR C 3 692  ? 5.109   91.448  17.333  1.00 23.51  ? 692  THR A CG2   1 
ATOM   5670  N  N     . ALA C 3 693  ? 5.240   89.798  13.864  1.00 23.69  ? 693  ALA A N     1 
ATOM   5671  C  CA    . ALA C 3 693  ? 6.392   89.576  13.011  1.00 22.13  ? 693  ALA A CA    1 
ATOM   5672  C  C     . ALA C 3 693  ? 6.314   90.360  11.708  1.00 22.05  ? 693  ALA A C     1 
ATOM   5673  O  O     . ALA C 3 693  ? 7.304   90.975  11.296  1.00 21.50  ? 693  ALA A O     1 
ATOM   5674  C  CB    . ALA C 3 693  ? 6.557   88.079  12.732  1.00 22.52  ? 693  ALA A CB    1 
ATOM   5675  N  N     . ASN C 3 694  ? 5.154   90.345  11.055  1.00 21.48  ? 694  ASN A N     1 
ATOM   5676  C  CA    . ASN C 3 694  ? 5.014   91.082  9.805   1.00 22.10  ? 694  ASN A CA    1 
ATOM   5677  C  C     . ASN C 3 694  ? 5.082   92.575  10.062  1.00 23.20  ? 694  ASN A C     1 
ATOM   5678  O  O     . ASN C 3 694  ? 5.684   93.320  9.284   1.00 24.03  ? 694  ASN A O     1 
ATOM   5679  C  CB    . ASN C 3 694  ? 3.705   90.740  9.103   1.00 21.52  ? 694  ASN A CB    1 
ATOM   5680  C  CG    . ASN C 3 694  ? 3.682   89.320  8.590   1.00 21.81  ? 694  ASN A CG    1 
ATOM   5681  O  OD1   . ASN C 3 694  ? 4.642   88.854  7.977   1.00 17.36  ? 694  ASN A OD1   1 
ATOM   5682  N  ND2   . ASN C 3 694  ? 2.579   88.620  8.838   1.00 22.29  ? 694  ASN A ND2   1 
ATOM   5683  N  N     . ASN C 3 695  ? 4.472   93.009  11.159  1.00 23.18  ? 695  ASN A N     1 
ATOM   5684  C  CA    . ASN C 3 695  ? 4.490   94.413  11.528  1.00 24.30  ? 695  ASN A CA    1 
ATOM   5685  C  C     . ASN C 3 695  ? 5.928   94.928  11.489  1.00 26.42  ? 695  ASN A C     1 
ATOM   5686  O  O     . ASN C 3 695  ? 6.253   95.806  10.688  1.00 29.34  ? 695  ASN A O     1 
ATOM   5687  C  CB    . ASN C 3 695  ? 3.933   94.603  12.929  1.00 23.63  ? 695  ASN A CB    1 
ATOM   5688  C  CG    . ASN C 3 695  ? 3.523   96.035  13.202  1.00 24.82  ? 695  ASN A CG    1 
ATOM   5689  O  OD1   . ASN C 3 695  ? 4.124   96.982  12.681  1.00 22.66  ? 695  ASN A OD1   1 
ATOM   5690  N  ND2   . ASN C 3 695  ? 2.496   96.203  14.036  1.00 24.32  ? 695  ASN A ND2   1 
ATOM   5691  N  N     . SER C 3 696  ? 6.791   94.369  12.336  1.00 26.10  ? 696  SER A N     1 
ATOM   5692  C  CA    . SER C 3 696  ? 8.190   94.795  12.390  1.00 26.25  ? 696  SER A CA    1 
ATOM   5693  C  C     . SER C 3 696  ? 8.943   94.594  11.082  1.00 26.24  ? 696  SER A C     1 
ATOM   5694  O  O     . SER C 3 696  ? 9.756   95.438  10.693  1.00 27.73  ? 696  SER A O     1 
ATOM   5695  C  CB    . SER C 3 696  ? 8.932   94.062  13.510  1.00 26.34  ? 696  SER A CB    1 
ATOM   5696  O  OG    . SER C 3 696  ? 8.902   92.663  13.311  1.00 28.67  ? 696  SER A OG    1 
ATOM   5697  N  N     . THR C 3 697  ? 8.681   93.478  10.406  1.00 25.48  ? 697  THR A N     1 
ATOM   5698  C  CA    . THR C 3 697  ? 9.351   93.178  9.142   1.00 23.15  ? 697  THR A CA    1 
ATOM   5699  C  C     . THR C 3 697  ? 9.091   94.258  8.082   1.00 24.33  ? 697  THR A C     1 
ATOM   5700  O  O     . THR C 3 697  ? 10.007  94.711  7.400   1.00 24.03  ? 697  THR A O     1 
ATOM   5701  C  CB    . THR C 3 697  ? 8.894   91.809  8.586   1.00 21.31  ? 697  THR A CB    1 
ATOM   5702  O  OG1   . THR C 3 697  ? 9.157   90.784  9.554   1.00 21.86  ? 697  THR A OG1   1 
ATOM   5703  C  CG2   . THR C 3 697  ? 9.639   91.472  7.310   1.00 21.28  ? 697  THR A CG2   1 
ATOM   5704  N  N     . MET C 3 698  ? 7.845   94.686  7.949   1.00 24.43  ? 698  MET A N     1 
ATOM   5705  C  CA    . MET C 3 698  ? 7.528   95.696  6.962   1.00 25.77  ? 698  MET A CA    1 
ATOM   5706  C  C     . MET C 3 698  ? 8.074   97.062  7.363   1.00 26.79  ? 698  MET A C     1 
ATOM   5707  O  O     . MET C 3 698  ? 8.539   97.824  6.513   1.00 25.95  ? 698  MET A O     1 
ATOM   5708  C  CB    . MET C 3 698  ? 6.016   95.748  6.753   1.00 26.83  ? 698  MET A CB    1 
ATOM   5709  C  CG    . MET C 3 698  ? 5.448   94.431  6.262   1.00 27.88  ? 698  MET A CG    1 
ATOM   5710  S  SD    . MET C 3 698  ? 6.139   93.936  4.651   1.00 31.77  ? 698  MET A SD    1 
ATOM   5711  C  CE    . MET C 3 698  ? 7.160   92.604  5.103   1.00 33.19  ? 698  MET A CE    1 
ATOM   5712  N  N     . MET C 3 699  ? 8.032   97.364  8.659   1.00 28.90  ? 699  MET A N     1 
ATOM   5713  C  CA    . MET C 3 699  ? 8.533   98.642  9.176   1.00 29.48  ? 699  MET A CA    1 
ATOM   5714  C  C     . MET C 3 699  ? 10.044  98.692  8.976   1.00 30.66  ? 699  MET A C     1 
ATOM   5715  O  O     . MET C 3 699  ? 10.625  99.747  8.722   1.00 31.87  ? 699  MET A O     1 
ATOM   5716  C  CB    . MET C 3 699  ? 8.211   98.783  10.665  1.00 25.39  ? 699  MET A CB    1 
ATOM   5717  C  CG    . MET C 3 699  ? 8.605   100.120 11.244  1.00 25.70  ? 699  MET A CG    1 
ATOM   5718  S  SD    . MET C 3 699  ? 7.894   101.509 10.328  1.00 28.20  ? 699  MET A SD    1 
ATOM   5719  C  CE    . MET C 3 699  ? 6.163   101.315 10.679  1.00 28.19  ? 699  MET A CE    1 
ATOM   5720  N  N     . GLU C 3 700  ? 10.672  97.533  9.104   1.00 30.19  ? 700  GLU A N     1 
ATOM   5721  C  CA    . GLU C 3 700  ? 12.105  97.417  8.913   1.00 31.46  ? 700  GLU A CA    1 
ATOM   5722  C  C     . GLU C 3 700  ? 12.389  97.689  7.425   1.00 29.63  ? 700  GLU A C     1 
ATOM   5723  O  O     . GLU C 3 700  ? 13.246  98.501  7.083   1.00 29.17  ? 700  GLU A O     1 
ATOM   5724  C  CB    . GLU C 3 700  ? 12.539  96.000  9.306   1.00 34.41  ? 700  GLU A CB    1 
ATOM   5725  C  CG    . GLU C 3 700  ? 13.967  95.858  9.772   1.00 38.92  ? 700  GLU A CG    1 
ATOM   5726  C  CD    . GLU C 3 700  ? 14.950  95.828  8.640   1.00 43.86  ? 700  GLU A CD    1 
ATOM   5727  O  OE1   . GLU C 3 700  ? 16.161  95.647  8.917   1.00 46.29  ? 700  GLU A OE1   1 
ATOM   5728  O  OE2   . GLU C 3 700  ? 14.516  95.978  7.476   1.00 46.40  ? 700  GLU A OE2   1 
ATOM   5729  N  N     . THR C 3 701  ? 11.644  97.020  6.550   1.00 27.67  ? 701  THR A N     1 
ATOM   5730  C  CA    . THR C 3 701  ? 11.819  97.183  5.121   1.00 29.03  ? 701  THR A CA    1 
ATOM   5731  C  C     . THR C 3 701  ? 11.601  98.630  4.688   1.00 29.70  ? 701  THR A C     1 
ATOM   5732  O  O     . THR C 3 701  ? 12.277  99.126  3.780   1.00 29.43  ? 701  THR A O     1 
ATOM   5733  C  CB    . THR C 3 701  ? 10.865  96.262  4.348   1.00 31.18  ? 701  THR A CB    1 
ATOM   5734  O  OG1   . THR C 3 701  ? 11.238  94.895  4.579   1.00 34.40  ? 701  THR A OG1   1 
ATOM   5735  C  CG2   . THR C 3 701  ? 10.915  96.563  2.850   1.00 30.89  ? 701  THR A CG2   1 
ATOM   5736  N  N     . PHE C 3 702  ? 10.660  99.307  5.339   1.00 29.75  ? 702  PHE A N     1 
ATOM   5737  C  CA    . PHE C 3 702  ? 10.385  100.699 5.020   1.00 29.12  ? 702  PHE A CA    1 
ATOM   5738  C  C     . PHE C 3 702  ? 11.596  101.560 5.370   1.00 29.47  ? 702  PHE A C     1 
ATOM   5739  O  O     . PHE C 3 702  ? 12.114  102.290 4.530   1.00 31.12  ? 702  PHE A O     1 
ATOM   5740  C  CB    . PHE C 3 702  ? 9.178   101.201 5.806   1.00 29.11  ? 702  PHE A CB    1 
ATOM   5741  C  CG    . PHE C 3 702  ? 8.996   102.691 5.734   1.00 29.20  ? 702  PHE A CG    1 
ATOM   5742  C  CD1   . PHE C 3 702  ? 8.367   103.274 4.636   1.00 25.74  ? 702  PHE A CD1   1 
ATOM   5743  C  CD2   . PHE C 3 702  ? 9.514   103.517 6.743   1.00 26.89  ? 702  PHE A CD2   1 
ATOM   5744  C  CE1   . PHE C 3 702  ? 8.254   104.657 4.532   1.00 27.11  ? 702  PHE A CE1   1 
ATOM   5745  C  CE2   . PHE C 3 702  ? 9.411   104.898 6.652   1.00 26.75  ? 702  PHE A CE2   1 
ATOM   5746  C  CZ    . PHE C 3 702  ? 8.780   105.474 5.541   1.00 28.34  ? 702  PHE A CZ    1 
ATOM   5747  N  N     . LEU C 3 703  ? 12.040  101.462 6.618   1.00 29.06  ? 703  LEU A N     1 
ATOM   5748  C  CA    . LEU C 3 703  ? 13.183  102.232 7.114   1.00 28.71  ? 703  LEU A CA    1 
ATOM   5749  C  C     . LEU C 3 703  ? 14.511  101.925 6.433   1.00 29.37  ? 703  LEU A C     1 
ATOM   5750  O  O     . LEU C 3 703  ? 15.386  102.778 6.345   1.00 29.41  ? 703  LEU A O     1 
ATOM   5751  C  CB    . LEU C 3 703  ? 13.336  101.999 8.615   1.00 26.14  ? 703  LEU A CB    1 
ATOM   5752  C  CG    . LEU C 3 703  ? 12.241  102.607 9.489   1.00 22.73  ? 703  LEU A CG    1 
ATOM   5753  C  CD1   . LEU C 3 703  ? 12.361  102.075 10.904  1.00 21.34  ? 703  LEU A CD1   1 
ATOM   5754  C  CD2   . LEU C 3 703  ? 12.368  104.125 9.458   1.00 21.24  ? 703  LEU A CD2   1 
ATOM   5755  N  N     . THR C 3 704  ? 14.654  100.697 5.954   1.00 30.79  ? 704  THR A N     1 
ATOM   5756  C  CA    . THR C 3 704  ? 15.876  100.263 5.308   1.00 30.80  ? 704  THR A CA    1 
ATOM   5757  C  C     . THR C 3 704  ? 15.900  100.393 3.788   1.00 32.10  ? 704  THR A C     1 
ATOM   5758  O  O     . THR C 3 704  ? 16.943  100.690 3.206   1.00 31.70  ? 704  THR A O     1 
ATOM   5759  C  CB    . THR C 3 704  ? 16.155  98.795  5.656   1.00 32.11  ? 704  THR A CB    1 
ATOM   5760  O  OG1   . THR C 3 704  ? 16.547  98.705  7.032   1.00 31.75  ? 704  THR A OG1   1 
ATOM   5761  C  CG2   . THR C 3 704  ? 17.252  98.220  4.754   1.00 31.88  ? 704  THR A CG2   1 
ATOM   5762  N  N     . VAL C 3 705  ? 14.755  100.179 3.148   1.00 30.49  ? 705  VAL A N     1 
ATOM   5763  C  CA    . VAL C 3 705  ? 14.711  100.213 1.702   1.00 29.72  ? 705  VAL A CA    1 
ATOM   5764  C  C     . VAL C 3 705  ? 13.786  101.242 1.076   1.00 30.68  ? 705  VAL A C     1 
ATOM   5765  O  O     . VAL C 3 705  ? 14.235  102.248 0.521   1.00 31.17  ? 705  VAL A O     1 
ATOM   5766  C  CB    . VAL C 3 705  ? 14.307  98.832  1.155   1.00 29.88  ? 705  VAL A CB    1 
ATOM   5767  C  CG1   . VAL C 3 705  ? 14.279  98.866  -0.360  1.00 30.69  ? 705  VAL A CG1   1 
ATOM   5768  C  CG2   . VAL C 3 705  ? 15.281  97.765  1.651   1.00 29.86  ? 705  VAL A CG2   1 
ATOM   5769  N  N     . TRP C 3 706  ? 12.490  100.967 1.154   1.00 29.71  ? 706  TRP A N     1 
ATOM   5770  C  CA    . TRP C 3 706  ? 11.480  101.822 0.566   1.00 28.36  ? 706  TRP A CA    1 
ATOM   5771  C  C     . TRP C 3 706  ? 11.683  103.297 0.894   1.00 29.94  ? 706  TRP A C     1 
ATOM   5772  O  O     . TRP C 3 706  ? 12.008  104.091 0.011   1.00 30.72  ? 706  TRP A O     1 
ATOM   5773  C  CB    . TRP C 3 706  ? 10.102  101.363 1.016   1.00 25.55  ? 706  TRP A CB    1 
ATOM   5774  C  CG    . TRP C 3 706  ? 9.034   101.688 0.041   1.00 25.11  ? 706  TRP A CG    1 
ATOM   5775  C  CD1   . TRP C 3 706  ? 8.609   100.914 -0.997  1.00 22.24  ? 706  TRP A CD1   1 
ATOM   5776  C  CD2   . TRP C 3 706  ? 8.243   102.883 0.003   1.00 24.74  ? 706  TRP A CD2   1 
ATOM   5777  N  NE1   . TRP C 3 706  ? 7.597   101.547 -1.678  1.00 22.27  ? 706  TRP A NE1   1 
ATOM   5778  C  CE2   . TRP C 3 706  ? 7.353   102.759 -1.087  1.00 24.81  ? 706  TRP A CE2   1 
ATOM   5779  C  CE3   . TRP C 3 706  ? 8.202   104.046 0.782   1.00 22.94  ? 706  TRP A CE3   1 
ATOM   5780  C  CZ2   . TRP C 3 706  ? 6.428   103.758 -1.418  1.00 24.16  ? 706  TRP A CZ2   1 
ATOM   5781  C  CZ3   . TRP C 3 706  ? 7.280   105.038 0.453   1.00 25.02  ? 706  TRP A CZ3   1 
ATOM   5782  C  CH2   . TRP C 3 706  ? 6.405   104.885 -0.639  1.00 23.05  ? 706  TRP A CH2   1 
ATOM   5783  N  N     . GLY C 3 707  ? 11.491  103.663 2.157   1.00 30.61  ? 707  GLY A N     1 
ATOM   5784  C  CA    . GLY C 3 707  ? 11.665  105.049 2.561   1.00 31.40  ? 707  GLY A CA    1 
ATOM   5785  C  C     . GLY C 3 707  ? 12.792  105.722 1.801   1.00 32.64  ? 707  GLY A C     1 
ATOM   5786  O  O     . GLY C 3 707  ? 12.543  106.536 0.909   1.00 31.19  ? 707  GLY A O     1 
ATOM   5787  N  N     . PRO C 3 708  ? 14.051  105.374 2.111   1.00 33.00  ? 708  PRO A N     1 
ATOM   5788  C  CA    . PRO C 3 708  ? 15.247  105.932 1.471   1.00 33.65  ? 708  PRO A CA    1 
ATOM   5789  C  C     . PRO C 3 708  ? 15.139  106.063 -0.055  1.00 35.31  ? 708  PRO A C     1 
ATOM   5790  O  O     . PRO C 3 708  ? 15.588  107.053 -0.642  1.00 36.28  ? 708  PRO A O     1 
ATOM   5791  C  CB    . PRO C 3 708  ? 16.340  104.955 1.890   1.00 31.94  ? 708  PRO A CB    1 
ATOM   5792  C  CG    . PRO C 3 708  ? 15.893  104.528 3.235   1.00 31.44  ? 708  PRO A CG    1 
ATOM   5793  C  CD    . PRO C 3 708  ? 14.418  104.296 3.046   1.00 32.18  ? 708  PRO A CD    1 
ATOM   5794  N  N     . GLU C 3 709  ? 14.537  105.062 -0.688  1.00 35.71  ? 709  GLU A N     1 
ATOM   5795  C  CA    . GLU C 3 709  ? 14.372  105.057 -2.133  1.00 35.51  ? 709  GLU A CA    1 
ATOM   5796  C  C     . GLU C 3 709  ? 13.230  105.933 -2.636  1.00 36.04  ? 709  GLU A C     1 
ATOM   5797  O  O     . GLU C 3 709  ? 13.064  106.094 -3.843  1.00 38.39  ? 709  GLU A O     1 
ATOM   5798  C  CB    . GLU C 3 709  ? 14.168  103.617 -2.622  1.00 35.78  ? 709  GLU A CB    1 
ATOM   5799  C  CG    . GLU C 3 709  ? 15.469  102.853 -2.850  1.00 39.24  ? 709  GLU A CG    1 
ATOM   5800  C  CD    . GLU C 3 709  ? 15.269  101.349 -3.031  1.00 42.16  ? 709  GLU A CD    1 
ATOM   5801  O  OE1   . GLU C 3 709  ? 14.273  100.940 -3.666  1.00 42.95  ? 709  GLU A OE1   1 
ATOM   5802  O  OE2   . GLU C 3 709  ? 16.126  100.571 -2.548  1.00 44.85  ? 709  GLU A OE2   1 
ATOM   5803  N  N     . HIS C 3 710  ? 12.451  106.517 -1.734  1.00 35.74  ? 710  HIS A N     1 
ATOM   5804  C  CA    . HIS C 3 710  ? 11.319  107.326 -2.171  1.00 35.65  ? 710  HIS A CA    1 
ATOM   5805  C  C     . HIS C 3 710  ? 11.350  108.779 -1.756  1.00 36.82  ? 710  HIS A C     1 
ATOM   5806  O  O     . HIS C 3 710  ? 10.320  109.450 -1.744  1.00 37.57  ? 710  HIS A O     1 
ATOM   5807  C  CB    . HIS C 3 710  ? 10.014  106.676 -1.705  1.00 33.02  ? 710  HIS A CB    1 
ATOM   5808  C  CG    . HIS C 3 710  ? 9.655   105.451 -2.482  1.00 31.99  ? 710  HIS A CG    1 
ATOM   5809  N  ND1   . HIS C 3 710  ? 8.855   105.489 -3.603  1.00 32.67  ? 710  HIS A ND1   1 
ATOM   5810  C  CD2   . HIS C 3 710  ? 10.054  104.164 -2.349  1.00 33.14  ? 710  HIS A CD2   1 
ATOM   5811  C  CE1   . HIS C 3 710  ? 8.777   104.280 -4.128  1.00 33.20  ? 710  HIS A CE1   1 
ATOM   5812  N  NE2   . HIS C 3 710  ? 9.496   103.457 -3.386  1.00 33.39  ? 710  HIS A NE2   1 
ATOM   5813  N  N     . THR C 3 711  ? 12.534  109.267 -1.421  1.00 37.93  ? 711  THR A N     1 
ATOM   5814  C  CA    . THR C 3 711  ? 12.690  110.656 -1.031  1.00 39.06  ? 711  THR A CA    1 
ATOM   5815  C  C     . THR C 3 711  ? 14.170  110.991 -1.005  1.00 40.82  ? 711  THR A C     1 
ATOM   5816  O  O     . THR C 3 711  ? 15.013  110.112 -0.798  1.00 39.81  ? 711  THR A O     1 
ATOM   5817  C  CB    . THR C 3 711  ? 12.092  110.925 0.368   1.00 38.88  ? 711  THR A CB    1 
ATOM   5818  O  OG1   . THR C 3 711  ? 12.167  112.329 0.665   1.00 37.90  ? 711  THR A OG1   1 
ATOM   5819  C  CG2   . THR C 3 711  ? 12.862  110.156 1.426   1.00 37.94  ? 711  THR A CG2   1 
ATOM   5820  N  N     . ASP C 3 712  ? 14.480  112.262 -1.239  1.00 43.36  ? 712  ASP A N     1 
ATOM   5821  C  CA    . ASP C 3 712  ? 15.860  112.732 -1.222  1.00 46.01  ? 712  ASP A CA    1 
ATOM   5822  C  C     . ASP C 3 712  ? 15.977  113.849 -0.194  1.00 46.12  ? 712  ASP A C     1 
ATOM   5823  O  O     . ASP C 3 712  ? 17.018  114.503 -0.074  1.00 46.62  ? 712  ASP A O     1 
ATOM   5824  C  CB    . ASP C 3 712  ? 16.281  113.213 -2.615  1.00 48.77  ? 712  ASP A CB    1 
ATOM   5825  C  CG    . ASP C 3 712  ? 17.248  112.244 -3.294  1.00 53.25  ? 712  ASP A CG    1 
ATOM   5826  O  OD1   . ASP C 3 712  ? 17.145  111.018 -3.039  1.00 53.42  ? 712  ASP A OD1   1 
ATOM   5827  O  OD2   . ASP C 3 712  ? 18.107  112.703 -4.085  1.00 55.68  ? 712  ASP A OD2   1 
ATOM   5828  N  N     . ASP C 3 713  ? 14.890  114.038 0.553   1.00 45.37  ? 713  ASP A N     1 
ATOM   5829  C  CA    . ASP C 3 713  ? 14.806  115.042 1.607   1.00 44.69  ? 713  ASP A CA    1 
ATOM   5830  C  C     . ASP C 3 713  ? 15.793  114.641 2.700   1.00 44.47  ? 713  ASP A C     1 
ATOM   5831  O  O     . ASP C 3 713  ? 15.577  113.665 3.416   1.00 44.81  ? 713  ASP A O     1 
ATOM   5832  C  CB    . ASP C 3 713  ? 13.390  115.068 2.163   1.00 45.94  ? 713  ASP A CB    1 
ATOM   5833  C  CG    . ASP C 3 713  ? 13.171  116.192 3.137   1.00 47.37  ? 713  ASP A CG    1 
ATOM   5834  O  OD1   . ASP C 3 713  ? 13.973  116.316 4.092   1.00 47.97  ? 713  ASP A OD1   1 
ATOM   5835  O  OD2   . ASP C 3 713  ? 12.190  116.945 2.945   1.00 47.15  ? 713  ASP A OD2   1 
ATOM   5836  N  N     . PRO C 3 714  ? 16.891  115.398 2.841   1.00 44.27  ? 714  PRO A N     1 
ATOM   5837  C  CA    . PRO C 3 714  ? 17.947  115.154 3.825   1.00 43.48  ? 714  PRO A CA    1 
ATOM   5838  C  C     . PRO C 3 714  ? 17.509  114.942 5.273   1.00 43.89  ? 714  PRO A C     1 
ATOM   5839  O  O     . PRO C 3 714  ? 18.064  114.097 5.968   1.00 45.18  ? 714  PRO A O     1 
ATOM   5840  C  CB    . PRO C 3 714  ? 18.849  116.373 3.661   1.00 42.76  ? 714  PRO A CB    1 
ATOM   5841  C  CG    . PRO C 3 714  ? 18.688  116.704 2.230   1.00 42.55  ? 714  PRO A CG    1 
ATOM   5842  C  CD    . PRO C 3 714  ? 17.196  116.608 2.063   1.00 42.75  ? 714  PRO A CD    1 
ATOM   5843  N  N     . ASP C 3 715  ? 16.528  115.698 5.744   1.00 43.77  ? 715  ASP A N     1 
ATOM   5844  C  CA    . ASP C 3 715  ? 16.099  115.515 7.120   1.00 44.02  ? 715  ASP A CA    1 
ATOM   5845  C  C     . ASP C 3 715  ? 15.368  114.194 7.290   1.00 43.06  ? 715  ASP A C     1 
ATOM   5846  O  O     . ASP C 3 715  ? 15.623  113.456 8.244   1.00 41.98  ? 715  ASP A O     1 
ATOM   5847  C  CB    . ASP C 3 715  ? 15.213  116.672 7.568   1.00 46.20  ? 715  ASP A CB    1 
ATOM   5848  C  CG    . ASP C 3 715  ? 15.935  117.995 7.511   1.00 48.11  ? 715  ASP A CG    1 
ATOM   5849  O  OD1   . ASP C 3 715  ? 17.140  118.022 7.849   1.00 48.09  ? 715  ASP A OD1   1 
ATOM   5850  O  OD2   . ASP C 3 715  ? 15.298  119.004 7.138   1.00 49.66  ? 715  ASP A OD2   1 
ATOM   5851  N  N     . VAL C 3 716  ? 14.461  113.898 6.365   1.00 40.89  ? 716  VAL A N     1 
ATOM   5852  C  CA    . VAL C 3 716  ? 13.721  112.651 6.428   1.00 39.75  ? 716  VAL A CA    1 
ATOM   5853  C  C     . VAL C 3 716  ? 14.711  111.500 6.292   1.00 40.07  ? 716  VAL A C     1 
ATOM   5854  O  O     . VAL C 3 716  ? 14.647  110.523 7.038   1.00 40.77  ? 716  VAL A O     1 
ATOM   5855  C  CB    . VAL C 3 716  ? 12.675  112.557 5.309   1.00 38.09  ? 716  VAL A CB    1 
ATOM   5856  C  CG1   . VAL C 3 716  ? 11.832  111.304 5.492   1.00 36.77  ? 716  VAL A CG1   1 
ATOM   5857  C  CG2   . VAL C 3 716  ? 11.798  113.793 5.324   1.00 37.33  ? 716  VAL A CG2   1 
ATOM   5858  N  N     . LEU C 3 717  ? 15.636  111.616 5.349   1.00 38.73  ? 717  LEU A N     1 
ATOM   5859  C  CA    . LEU C 3 717  ? 16.630  110.566 5.169   1.00 39.87  ? 717  LEU A CA    1 
ATOM   5860  C  C     . LEU C 3 717  ? 17.457  110.391 6.433   1.00 40.00  ? 717  LEU A C     1 
ATOM   5861  O  O     . LEU C 3 717  ? 17.866  109.283 6.773   1.00 39.42  ? 717  LEU A O     1 
ATOM   5862  C  CB    . LEU C 3 717  ? 17.566  110.893 4.004   1.00 38.22  ? 717  LEU A CB    1 
ATOM   5863  C  CG    . LEU C 3 717  ? 17.042  110.572 2.609   1.00 38.34  ? 717  LEU A CG    1 
ATOM   5864  C  CD1   . LEU C 3 717  ? 18.027  111.085 1.565   1.00 38.12  ? 717  LEU A CD1   1 
ATOM   5865  C  CD2   . LEU C 3 717  ? 16.836  109.065 2.483   1.00 34.57  ? 717  LEU A CD2   1 
ATOM   5866  N  N     . ARG C 3 718  ? 17.701  111.493 7.130   1.00 41.06  ? 718  ARG A N     1 
ATOM   5867  C  CA    . ARG C 3 718  ? 18.494  111.434 8.346   1.00 42.37  ? 718  ARG A CA    1 
ATOM   5868  C  C     . ARG C 3 718  ? 17.648  110.832 9.463   1.00 40.91  ? 718  ARG A C     1 
ATOM   5869  O  O     . ARG C 3 718  ? 18.126  110.000 10.231  1.00 41.69  ? 718  ARG A O     1 
ATOM   5870  C  CB    . ARG C 3 718  ? 19.001  112.838 8.724   1.00 44.32  ? 718  ARG A CB    1 
ATOM   5871  C  CG    . ARG C 3 718  ? 20.147  112.828 9.738   1.00 49.47  ? 718  ARG A CG    1 
ATOM   5872  C  CD    . ARG C 3 718  ? 20.822  114.197 9.911   1.00 52.48  ? 718  ARG A CD    1 
ATOM   5873  N  NE    . ARG C 3 718  ? 21.384  114.698 8.658   1.00 54.59  ? 718  ARG A NE    1 
ATOM   5874  C  CZ    . ARG C 3 718  ? 20.812  115.631 7.901   1.00 56.00  ? 718  ARG A CZ    1 
ATOM   5875  N  NH1   . ARG C 3 718  ? 19.658  116.180 8.271   1.00 55.38  ? 718  ARG A NH1   1 
ATOM   5876  N  NH2   . ARG C 3 718  ? 21.386  116.008 6.766   1.00 56.13  ? 718  ARG A NH2   1 
ATOM   5877  N  N     . LEU C 3 719  ? 16.386  111.241 9.534   1.00 39.09  ? 719  LEU A N     1 
ATOM   5878  C  CA    . LEU C 3 719  ? 15.479  110.736 10.553  1.00 37.65  ? 719  LEU A CA    1 
ATOM   5879  C  C     . LEU C 3 719  ? 15.299  109.230 10.436  1.00 37.82  ? 719  LEU A C     1 
ATOM   5880  O  O     . LEU C 3 719  ? 15.474  108.509 11.414  1.00 38.75  ? 719  LEU A O     1 
ATOM   5881  C  CB    . LEU C 3 719  ? 14.117  111.419 10.442  1.00 36.73  ? 719  LEU A CB    1 
ATOM   5882  C  CG    . LEU C 3 719  ? 13.052  110.902 11.411  1.00 36.76  ? 719  LEU A CG    1 
ATOM   5883  C  CD1   . LEU C 3 719  ? 13.563  110.989 12.858  1.00 35.43  ? 719  LEU A CD1   1 
ATOM   5884  C  CD2   . LEU C 3 719  ? 11.773  111.697 11.222  1.00 34.09  ? 719  LEU A CD2   1 
ATOM   5885  N  N     . MET C 3 720  ? 14.943  108.759 9.241   1.00 37.74  ? 720  MET A N     1 
ATOM   5886  C  CA    . MET C 3 720  ? 14.750  107.332 9.012   1.00 36.76  ? 720  MET A CA    1 
ATOM   5887  C  C     . MET C 3 720  ? 16.014  106.563 9.324   1.00 36.78  ? 720  MET A C     1 
ATOM   5888  O  O     . MET C 3 720  ? 15.963  105.481 9.912   1.00 37.98  ? 720  MET A O     1 
ATOM   5889  C  CB    . MET C 3 720  ? 14.353  107.044 7.560   1.00 37.18  ? 720  MET A CB    1 
ATOM   5890  C  CG    . MET C 3 720  ? 12.982  107.556 7.157   1.00 38.06  ? 720  MET A CG    1 
ATOM   5891  S  SD    . MET C 3 720  ? 12.561  107.112 5.462   1.00 38.95  ? 720  MET A SD    1 
ATOM   5892  C  CE    . MET C 3 720  ? 13.958  107.807 4.565   1.00 36.74  ? 720  MET A CE    1 
ATOM   5893  N  N     . LYS C 3 721  ? 17.156  107.117 8.942   1.00 36.09  ? 721  LYS A N     1 
ATOM   5894  C  CA    . LYS C 3 721  ? 18.409  106.425 9.193   1.00 37.53  ? 721  LYS A CA    1 
ATOM   5895  C  C     . LYS C 3 721  ? 18.660  106.208 10.688  1.00 37.12  ? 721  LYS A C     1 
ATOM   5896  O  O     . LYS C 3 721  ? 19.240  105.194 11.082  1.00 37.47  ? 721  LYS A O     1 
ATOM   5897  C  CB    . LYS C 3 721  ? 19.582  107.183 8.560   1.00 38.66  ? 721  LYS A CB    1 
ATOM   5898  C  CG    . LYS C 3 721  ? 20.795  106.296 8.325   1.00 42.10  ? 721  LYS A CG    1 
ATOM   5899  C  CD    . LYS C 3 721  ? 21.877  106.966 7.488   1.00 45.72  ? 721  LYS A CD    1 
ATOM   5900  C  CE    . LYS C 3 721  ? 23.049  105.998 7.252   1.00 48.16  ? 721  LYS A CE    1 
ATOM   5901  N  NZ    . LYS C 3 721  ? 24.122  106.534 6.351   1.00 48.38  ? 721  LYS A NZ    1 
ATOM   5902  N  N     . SER C 3 722  ? 18.204  107.144 11.517  1.00 35.67  ? 722  SER A N     1 
ATOM   5903  C  CA    . SER C 3 722  ? 18.397  107.053 12.961  1.00 33.58  ? 722  SER A CA    1 
ATOM   5904  C  C     . SER C 3 722  ? 17.375  106.159 13.651  1.00 34.02  ? 722  SER A C     1 
ATOM   5905  O  O     . SER C 3 722  ? 17.397  106.009 14.871  1.00 33.97  ? 722  SER A O     1 
ATOM   5906  C  CB    . SER C 3 722  ? 18.327  108.438 13.586  1.00 30.73  ? 722  SER A CB    1 
ATOM   5907  O  OG    . SER C 3 722  ? 17.002  108.930 13.529  1.00 31.10  ? 722  SER A OG    1 
ATOM   5908  N  N     . LEU C 3 723  ? 16.469  105.572 12.881  1.00 34.05  ? 723  LEU A N     1 
ATOM   5909  C  CA    . LEU C 3 723  ? 15.456  104.702 13.466  1.00 33.94  ? 723  LEU A CA    1 
ATOM   5910  C  C     . LEU C 3 723  ? 15.719  103.245 13.128  1.00 34.59  ? 723  LEU A C     1 
ATOM   5911  O  O     . LEU C 3 723  ? 16.066  102.912 12.003  1.00 37.20  ? 723  LEU A O     1 
ATOM   5912  C  CB    . LEU C 3 723  ? 14.074  105.107 12.974  1.00 31.28  ? 723  LEU A CB    1 
ATOM   5913  C  CG    . LEU C 3 723  ? 13.703  106.544 13.327  1.00 30.48  ? 723  LEU A CG    1 
ATOM   5914  C  CD1   . LEU C 3 723  ? 12.351  106.892 12.698  1.00 27.78  ? 723  LEU A CD1   1 
ATOM   5915  C  CD2   . LEU C 3 723  ? 13.671  106.698 14.848  1.00 28.11  ? 723  LEU A CD2   1 
ATOM   5916  N  N     . THR C 3 724  ? 15.544  102.373 14.105  1.00 34.92  ? 724  THR A N     1 
ATOM   5917  C  CA    . THR C 3 724  ? 15.784  100.959 13.889  1.00 35.00  ? 724  THR A CA    1 
ATOM   5918  C  C     . THR C 3 724  ? 14.667  100.158 14.518  1.00 34.84  ? 724  THR A C     1 
ATOM   5919  O  O     . THR C 3 724  ? 14.162  100.528 15.574  1.00 36.06  ? 724  THR A O     1 
ATOM   5920  C  CB    . THR C 3 724  ? 17.145  100.580 14.489  1.00 36.18  ? 724  THR A CB    1 
ATOM   5921  O  OG1   . THR C 3 724  ? 18.170  100.951 13.563  1.00 36.53  ? 724  THR A OG1   1 
ATOM   5922  C  CG2   . THR C 3 724  ? 17.236  99.102  14.782  1.00 38.03  ? 724  THR A CG2   1 
ATOM   5923  N  N     . ILE C 3 725  ? 14.257  99.070  13.877  1.00 34.90  ? 725  ILE A N     1 
ATOM   5924  C  CA    . ILE C 3 725  ? 13.180  98.282  14.457  1.00 35.13  ? 725  ILE A CA    1 
ATOM   5925  C  C     . ILE C 3 725  ? 13.656  97.552  15.691  1.00 35.30  ? 725  ILE A C     1 
ATOM   5926  O  O     . ILE C 3 725  ? 12.858  96.938  16.380  1.00 37.66  ? 725  ILE A O     1 
ATOM   5927  C  CB    . ILE C 3 725  ? 12.601  97.235  13.492  1.00 33.63  ? 725  ILE A CB    1 
ATOM   5928  C  CG1   . ILE C 3 725  ? 13.636  96.156  13.213  1.00 33.26  ? 725  ILE A CG1   1 
ATOM   5929  C  CG2   . ILE C 3 725  ? 12.124  97.906  12.228  1.00 33.52  ? 725  ILE A CG2   1 
ATOM   5930  C  CD1   . ILE C 3 725  ? 13.015  94.822  12.881  1.00 33.60  ? 725  ILE A CD1   1 
ATOM   5931  N  N     . GLN C 3 726  ? 14.952  97.616  15.964  1.00 35.54  ? 726  GLN A N     1 
ATOM   5932  C  CA    . GLN C 3 726  ? 15.513  96.954  17.134  1.00 37.42  ? 726  GLN A CA    1 
ATOM   5933  C  C     . GLN C 3 726  ? 15.655  97.907  18.316  1.00 37.19  ? 726  GLN A C     1 
ATOM   5934  O  O     . GLN C 3 726  ? 15.795  97.470  19.461  1.00 36.51  ? 726  GLN A O     1 
ATOM   5935  C  CB    . GLN C 3 726  ? 16.892  96.367  16.818  1.00 39.40  ? 726  GLN A CB    1 
ATOM   5936  C  CG    . GLN C 3 726  ? 16.904  95.275  15.766  1.00 41.36  ? 726  GLN A CG    1 
ATOM   5937  C  CD    . GLN C 3 726  ? 17.500  95.743  14.458  1.00 43.45  ? 726  GLN A CD    1 
ATOM   5938  O  OE1   . GLN C 3 726  ? 16.927  96.577  13.762  1.00 44.40  ? 726  GLN A OE1   1 
ATOM   5939  N  NE2   . GLN C 3 726  ? 18.662  95.207  14.115  1.00 46.18  ? 726  GLN A NE2   1 
ATOM   5940  N  N     . ARG C 3 727  ? 15.622  99.207  18.035  1.00 36.54  ? 727  ARG A N     1 
ATOM   5941  C  CA    . ARG C 3 727  ? 15.781  100.211 19.078  1.00 35.37  ? 727  ARG A CA    1 
ATOM   5942  C  C     . ARG C 3 727  ? 14.652  101.218 19.210  1.00 35.01  ? 727  ARG A C     1 
ATOM   5943  O  O     . ARG C 3 727  ? 14.373  101.693 20.308  1.00 37.39  ? 727  ARG A O     1 
ATOM   5944  C  CB    . ARG C 3 727  ? 17.075  100.994 18.853  1.00 34.83  ? 727  ARG A CB    1 
ATOM   5945  C  CG    . ARG C 3 727  ? 18.345  100.206 19.073  1.00 33.98  ? 727  ARG A CG    1 
ATOM   5946  C  CD    . ARG C 3 727  ? 19.560  101.099 18.907  1.00 33.93  ? 727  ARG A CD    1 
ATOM   5947  N  NE    . ARG C 3 727  ? 19.529  102.279 19.775  1.00 34.87  ? 727  ARG A NE    1 
ATOM   5948  C  CZ    . ARG C 3 727  ? 19.794  102.277 21.084  1.00 37.65  ? 727  ARG A CZ    1 
ATOM   5949  N  NH1   . ARG C 3 727  ? 20.117  101.151 21.721  1.00 36.86  ? 727  ARG A NH1   1 
ATOM   5950  N  NH2   . ARG C 3 727  ? 19.757  103.418 21.765  1.00 38.70  ? 727  ARG A NH2   1 
ATOM   5951  N  N     . ASN C 3 728  ? 13.994  101.534 18.103  1.00 33.53  ? 728  ASN A N     1 
ATOM   5952  C  CA    . ASN C 3 728  ? 12.953  102.549 18.124  1.00 32.72  ? 728  ASN A CA    1 
ATOM   5953  C  C     . ASN C 3 728  ? 11.525  102.151 17.787  1.00 32.47  ? 728  ASN A C     1 
ATOM   5954  O  O     . ASN C 3 728  ? 10.647  103.013 17.753  1.00 31.87  ? 728  ASN A O     1 
ATOM   5955  C  CB    . ASN C 3 728  ? 13.378  103.682 17.193  1.00 32.71  ? 728  ASN A CB    1 
ATOM   5956  C  CG    . ASN C 3 728  ? 14.743  104.220 17.537  1.00 32.33  ? 728  ASN A CG    1 
ATOM   5957  O  OD1   . ASN C 3 728  ? 14.864  105.243 18.198  1.00 36.03  ? 728  ASN A OD1   1 
ATOM   5958  N  ND2   . ASN C 3 728  ? 15.782  103.518 17.111  1.00 31.79  ? 728  ASN A ND2   1 
ATOM   5959  N  N     . TYR C 3 729  ? 11.276  100.869 17.533  1.00 32.66  ? 729  TYR A N     1 
ATOM   5960  C  CA    . TYR C 3 729  ? 9.921   100.441 17.188  1.00 31.70  ? 729  TYR A CA    1 
ATOM   5961  C  C     . TYR C 3 729  ? 9.465   99.226  17.979  1.00 31.43  ? 729  TYR A C     1 
ATOM   5962  O  O     . TYR C 3 729  ? 9.999   98.132  17.823  1.00 32.66  ? 729  TYR A O     1 
ATOM   5963  C  CB    . TYR C 3 729  ? 9.838   100.142 15.693  1.00 31.86  ? 729  TYR A CB    1 
ATOM   5964  C  CG    . TYR C 3 729  ? 8.442   99.873  15.198  1.00 30.67  ? 729  TYR A CG    1 
ATOM   5965  C  CD1   . TYR C 3 729  ? 7.485   100.881 15.194  1.00 31.14  ? 729  TYR A CD1   1 
ATOM   5966  C  CD2   . TYR C 3 729  ? 8.078   98.608  14.730  1.00 30.46  ? 729  TYR A CD2   1 
ATOM   5967  C  CE1   . TYR C 3 729  ? 6.186   100.644 14.731  1.00 32.05  ? 729  TYR A CE1   1 
ATOM   5968  C  CE2   . TYR C 3 729  ? 6.790   98.357  14.266  1.00 31.48  ? 729  TYR A CE2   1 
ATOM   5969  C  CZ    . TYR C 3 729  ? 5.844   99.381  14.266  1.00 31.55  ? 729  TYR A CZ    1 
ATOM   5970  O  OH    . TYR C 3 729  ? 4.571   99.153  13.791  1.00 29.35  ? 729  TYR A OH    1 
ATOM   5971  N  N     . VAL C 3 730  ? 8.468   99.429  18.831  1.00 31.65  ? 730  VAL A N     1 
ATOM   5972  C  CA    . VAL C 3 730  ? 7.930   98.354  19.654  1.00 31.74  ? 730  VAL A CA    1 
ATOM   5973  C  C     . VAL C 3 730  ? 6.556   98.004  19.129  1.00 30.66  ? 730  VAL A C     1 
ATOM   5974  O  O     . VAL C 3 730  ? 5.742   98.890  18.892  1.00 30.43  ? 730  VAL A O     1 
ATOM   5975  C  CB    . VAL C 3 730  ? 7.771   98.792  21.123  1.00 32.71  ? 730  VAL A CB    1 
ATOM   5976  C  CG1   . VAL C 3 730  ? 7.224   97.640  21.952  1.00 31.35  ? 730  VAL A CG1   1 
ATOM   5977  C  CG2   . VAL C 3 730  ? 9.105   99.288  21.664  1.00 34.49  ? 730  VAL A CG2   1 
ATOM   5978  N  N     . CYS C 3 731  ? 6.286   96.720  18.948  1.00 30.17  ? 731  CYS A N     1 
ATOM   5979  C  CA    . CYS C 3 731  ? 4.983   96.337  18.448  1.00 30.70  ? 731  CYS A CA    1 
ATOM   5980  C  C     . CYS C 3 731  ? 4.497   95.016  19.001  1.00 30.93  ? 731  CYS A C     1 
ATOM   5981  O  O     . CYS C 3 731  ? 5.286   94.208  19.486  1.00 29.46  ? 731  CYS A O     1 
ATOM   5982  C  CB    . CYS C 3 731  ? 5.000   96.281  16.913  1.00 32.01  ? 731  CYS A CB    1 
ATOM   5983  S  SG    . CYS C 3 731  ? 6.141   95.067  16.183  1.00 33.91  ? 731  CYS A SG    1 
ATOM   5984  N  N     . GLN C 3 732  ? 3.176   94.841  18.956  1.00 32.41  ? 732  GLN A N     1 
ATOM   5985  C  CA    . GLN C 3 732  ? 2.497   93.617  19.376  1.00 33.42  ? 732  GLN A CA    1 
ATOM   5986  C  C     . GLN C 3 732  ? 1.269   93.511  18.484  1.00 34.27  ? 732  GLN A C     1 
ATOM   5987  O  O     . GLN C 3 732  ? 0.418   94.404  18.470  1.00 33.69  ? 732  GLN A O     1 
ATOM   5988  C  CB    . GLN C 3 732  ? 2.054   93.661  20.838  1.00 33.83  ? 732  GLN A CB    1 
ATOM   5989  C  CG    . GLN C 3 732  ? 1.437   92.335  21.296  1.00 34.63  ? 732  GLN A CG    1 
ATOM   5990  C  CD    . GLN C 3 732  ? 0.802   92.403  22.681  1.00 36.62  ? 732  GLN A CD    1 
ATOM   5991  O  OE1   . GLN C 3 732  ? 1.478   92.649  23.684  1.00 35.47  ? 732  GLN A OE1   1 
ATOM   5992  N  NE2   . GLN C 3 732  ? -0.511  92.183  22.738  1.00 36.96  ? 732  GLN A NE2   1 
ATOM   5993  N  N     . GLY C 3 733  ? 1.175   92.422  17.735  1.00 35.29  ? 733  GLY A N     1 
ATOM   5994  C  CA    . GLY C 3 733  ? 0.049   92.268  16.843  1.00 35.83  ? 733  GLY A CA    1 
ATOM   5995  C  C     . GLY C 3 733  ? 0.123   93.391  15.830  1.00 37.71  ? 733  GLY A C     1 
ATOM   5996  O  O     . GLY C 3 733  ? 1.133   93.543  15.138  1.00 38.22  ? 733  GLY A O     1 
ATOM   5997  N  N     . ASP C 3 734  ? -0.926  94.203  15.761  1.00 38.65  ? 734  ASP A N     1 
ATOM   5998  C  CA    . ASP C 3 734  ? -0.966  95.301  14.808  1.00 39.98  ? 734  ASP A CA    1 
ATOM   5999  C  C     . ASP C 3 734  ? -0.788  96.662  15.469  1.00 39.81  ? 734  ASP A C     1 
ATOM   6000  O  O     . ASP C 3 734  ? -1.084  97.698  14.869  1.00 39.79  ? 734  ASP A O     1 
ATOM   6001  C  CB    . ASP C 3 734  ? -2.276  95.258  14.012  1.00 41.95  ? 734  ASP A CB    1 
ATOM   6002  C  CG    . ASP C 3 734  ? -3.489  95.598  14.858  1.00 45.91  ? 734  ASP A CG    1 
ATOM   6003  O  OD1   . ASP C 3 734  ? -3.413  95.474  16.102  1.00 48.35  ? 734  ASP A OD1   1 
ATOM   6004  O  OD2   . ASP C 3 734  ? -4.528  95.979  14.275  1.00 49.07  ? 734  ASP A OD2   1 
ATOM   6005  N  N     . ASP C 3 735  ? -0.306  96.667  16.708  1.00 40.15  ? 735  ASP A N     1 
ATOM   6006  C  CA    . ASP C 3 735  ? -0.070  97.930  17.394  1.00 38.99  ? 735  ASP A CA    1 
ATOM   6007  C  C     . ASP C 3 735  ? 1.404   98.271  17.361  1.00 37.54  ? 735  ASP A C     1 
ATOM   6008  O  O     . ASP C 3 735  ? 2.258   97.411  17.569  1.00 37.37  ? 735  ASP A O     1 
ATOM   6009  C  CB    . ASP C 3 735  ? -0.545  97.887  18.843  1.00 41.10  ? 735  ASP A CB    1 
ATOM   6010  C  CG    . ASP C 3 735  ? -1.594  98.935  19.126  1.00 43.46  ? 735  ASP A CG    1 
ATOM   6011  O  OD1   . ASP C 3 735  ? -2.779  98.605  18.927  1.00 46.19  ? 735  ASP A OD1   1 
ATOM   6012  O  OD2   . ASP C 3 735  ? -1.241  100.083 19.511  1.00 43.54  ? 735  ASP A OD2   1 
ATOM   6013  N  N     . GLY C 3 736  ? 1.697   99.537  17.098  1.00 36.49  ? 736  GLY A N     1 
ATOM   6014  C  CA    . GLY C 3 736  ? 3.079   99.959  17.029  1.00 35.34  ? 736  GLY A CA    1 
ATOM   6015  C  C     . GLY C 3 736  ? 3.345   101.312 17.649  1.00 33.82  ? 736  GLY A C     1 
ATOM   6016  O  O     . GLY C 3 736  ? 2.519   102.219 17.588  1.00 33.19  ? 736  GLY A O     1 
ATOM   6017  N  N     . LEU C 3 737  ? 4.522   101.437 18.243  1.00 31.81  ? 737  LEU A N     1 
ATOM   6018  C  CA    . LEU C 3 737  ? 4.932   102.664 18.886  1.00 31.64  ? 737  LEU A CA    1 
ATOM   6019  C  C     . LEU C 3 737  ? 6.314   103.048 18.372  1.00 33.41  ? 737  LEU A C     1 
ATOM   6020  O  O     . LEU C 3 737  ? 7.306   102.407 18.708  1.00 32.51  ? 737  LEU A O     1 
ATOM   6021  C  CB    . LEU C 3 737  ? 4.967   102.452 20.401  1.00 30.65  ? 737  LEU A CB    1 
ATOM   6022  C  CG    . LEU C 3 737  ? 5.175   103.671 21.294  1.00 27.52  ? 737  LEU A CG    1 
ATOM   6023  C  CD1   . LEU C 3 737  ? 4.056   104.675 21.055  1.00 25.90  ? 737  LEU A CD1   1 
ATOM   6024  C  CD2   . LEU C 3 737  ? 5.211   103.224 22.748  1.00 23.80  ? 737  LEU A CD2   1 
ATOM   6025  N  N     . MET C 3 738  ? 6.368   104.077 17.531  1.00 36.40  ? 738  MET A N     1 
ATOM   6026  C  CA    . MET C 3 738  ? 7.635   104.558 16.987  1.00 38.37  ? 738  MET A CA    1 
ATOM   6027  C  C     . MET C 3 738  ? 8.173   105.624 17.938  1.00 38.61  ? 738  MET A C     1 
ATOM   6028  O  O     . MET C 3 738  ? 7.661   106.742 17.991  1.00 39.41  ? 738  MET A O     1 
ATOM   6029  C  CB    . MET C 3 738  ? 7.435   105.152 15.591  1.00 40.17  ? 738  MET A CB    1 
ATOM   6030  C  CG    . MET C 3 738  ? 8.716   105.676 14.946  1.00 44.15  ? 738  MET A CG    1 
ATOM   6031  S  SD    . MET C 3 738  ? 10.039  104.428 14.907  1.00 50.73  ? 738  MET A SD    1 
ATOM   6032  C  CE    . MET C 3 738  ? 9.539   103.461 13.451  1.00 46.75  ? 738  MET A CE    1 
ATOM   6033  N  N     . ILE C 3 739  ? 9.206   105.259 18.688  1.00 37.98  ? 739  ILE A N     1 
ATOM   6034  C  CA    . ILE C 3 739  ? 9.818   106.150 19.665  1.00 37.40  ? 739  ILE A CA    1 
ATOM   6035  C  C     . ILE C 3 739  ? 11.002  106.950 19.120  1.00 38.24  ? 739  ILE A C     1 
ATOM   6036  O  O     . ILE C 3 739  ? 12.080  106.399 18.869  1.00 37.07  ? 739  ILE A O     1 
ATOM   6037  C  CB    . ILE C 3 739  ? 10.278  105.341 20.893  1.00 35.49  ? 739  ILE A CB    1 
ATOM   6038  C  CG1   . ILE C 3 739  ? 9.097   104.536 21.436  1.00 34.68  ? 739  ILE A CG1   1 
ATOM   6039  C  CG2   . ILE C 3 739  ? 10.852  106.271 21.946  1.00 34.17  ? 739  ILE A CG2   1 
ATOM   6040  C  CD1   . ILE C 3 739  ? 9.470   103.513 22.473  1.00 36.17  ? 739  ILE A CD1   1 
ATOM   6041  N  N     . ILE C 3 740  ? 10.795  108.252 18.940  1.00 40.12  ? 740  ILE A N     1 
ATOM   6042  C  CA    . ILE C 3 740  ? 11.856  109.120 18.448  1.00 43.87  ? 740  ILE A CA    1 
ATOM   6043  C  C     . ILE C 3 740  ? 12.535  109.795 19.634  1.00 45.80  ? 740  ILE A C     1 
ATOM   6044  O  O     . ILE C 3 740  ? 12.031  110.779 20.172  1.00 46.46  ? 740  ILE A O     1 
ATOM   6045  C  CB    . ILE C 3 740  ? 11.325  110.231 17.494  1.00 43.84  ? 740  ILE A CB    1 
ATOM   6046  C  CG1   . ILE C 3 740  ? 10.682  109.612 16.248  1.00 44.95  ? 740  ILE A CG1   1 
ATOM   6047  C  CG2   . ILE C 3 740  ? 12.466  111.141 17.062  1.00 42.20  ? 740  ILE A CG2   1 
ATOM   6048  C  CD1   . ILE C 3 740  ? 9.260   109.121 16.465  1.00 46.24  ? 740  ILE A CD1   1 
ATOM   6049  N  N     . ASP C 3 741  ? 13.672  109.254 20.048  1.00 48.58  ? 741  ASP A N     1 
ATOM   6050  C  CA    . ASP C 3 741  ? 14.407  109.829 21.159  1.00 51.93  ? 741  ASP A CA    1 
ATOM   6051  C  C     . ASP C 3 741  ? 14.710  111.285 20.849  1.00 55.25  ? 741  ASP A C     1 
ATOM   6052  O  O     . ASP C 3 741  ? 14.773  111.679 19.685  1.00 55.74  ? 741  ASP A O     1 
ATOM   6053  C  CB    . ASP C 3 741  ? 15.712  109.065 21.388  1.00 52.82  ? 741  ASP A CB    1 
ATOM   6054  C  CG    . ASP C 3 741  ? 15.484  107.679 21.966  1.00 52.75  ? 741  ASP A CG    1 
ATOM   6055  O  OD1   . ASP C 3 741  ? 16.476  107.017 22.328  1.00 52.55  ? 741  ASP A OD1   1 
ATOM   6056  O  OD2   . ASP C 3 741  ? 14.315  107.252 22.062  1.00 52.35  ? 741  ASP A OD2   1 
ATOM   6057  N  N     . GLY C 3 742  ? 14.886  112.085 21.895  1.00 58.23  ? 742  GLY A N     1 
ATOM   6058  C  CA    . GLY C 3 742  ? 15.183  113.494 21.705  1.00 61.22  ? 742  GLY A CA    1 
ATOM   6059  C  C     . GLY C 3 742  ? 16.642  113.793 21.983  1.00 64.09  ? 742  GLY A C     1 
ATOM   6060  O  O     . GLY C 3 742  ? 17.336  112.989 22.616  1.00 63.13  ? 742  GLY A O     1 
ATOM   6061  N  N     . THR C 3 743  ? 17.109  114.945 21.509  1.00 66.93  ? 743  THR A N     1 
ATOM   6062  C  CA    . THR C 3 743  ? 18.499  115.362 21.705  1.00 69.94  ? 743  THR A CA    1 
ATOM   6063  C  C     . THR C 3 743  ? 18.532  116.514 22.712  1.00 71.78  ? 743  THR A C     1 
ATOM   6064  O  O     . THR C 3 743  ? 17.512  116.823 23.340  1.00 71.73  ? 743  THR A O     1 
ATOM   6065  C  CB    . THR C 3 743  ? 19.129  115.829 20.359  1.00 69.81  ? 743  THR A CB    1 
ATOM   6066  O  OG1   . THR C 3 743  ? 18.898  114.831 19.353  1.00 69.21  ? 743  THR A OG1   1 
ATOM   6067  C  CG2   . THR C 3 743  ? 20.639  116.048 20.505  1.00 69.59  ? 743  THR A CG2   1 
ATOM   6068  N  N     . THR C 3 744  ? 19.700  117.135 22.881  1.00 73.16  ? 744  THR A N     1 
ATOM   6069  C  CA    . THR C 3 744  ? 19.835  118.272 23.794  1.00 73.22  ? 744  THR A CA    1 
ATOM   6070  C  C     . THR C 3 744  ? 19.286  119.504 23.058  1.00 74.00  ? 744  THR A C     1 
ATOM   6071  O  O     . THR C 3 744  ? 18.866  120.492 23.678  1.00 73.91  ? 744  THR A O     1 
ATOM   6072  C  CB    . THR C 3 744  ? 21.320  118.514 24.197  1.00 72.86  ? 744  THR A CB    1 
ATOM   6073  O  OG1   . THR C 3 744  ? 21.834  117.347 24.849  1.00 72.80  ? 744  THR A OG1   1 
ATOM   6074  C  CG2   . THR C 3 744  ? 21.436  119.699 25.156  1.00 73.29  ? 744  THR A CG2   1 
ATOM   6075  N  N     . ALA C 3 745  ? 19.287  119.420 21.727  1.00 73.39  ? 745  ALA A N     1 
ATOM   6076  C  CA    . ALA C 3 745  ? 18.779  120.484 20.871  1.00 72.77  ? 745  ALA A CA    1 
ATOM   6077  C  C     . ALA C 3 745  ? 17.253  120.449 20.917  1.00 72.97  ? 745  ALA A C     1 
ATOM   6078  O  O     . ALA C 3 745  ? 16.579  121.143 20.156  1.00 73.25  ? 745  ALA A O     1 
ATOM   6079  C  CB    . ALA C 3 745  ? 19.261  120.275 19.442  1.00 72.42  ? 745  ALA A CB    1 
ATOM   6080  N  N     . GLY C 3 746  ? 16.722  119.630 21.822  1.00 73.35  ? 746  GLY A N     1 
ATOM   6081  C  CA    . GLY C 3 746  ? 15.284  119.494 21.968  1.00 72.68  ? 746  GLY A CA    1 
ATOM   6082  C  C     . GLY C 3 746  ? 14.780  118.231 21.292  1.00 71.72  ? 746  GLY A C     1 
ATOM   6083  O  O     . GLY C 3 746  ? 15.423  117.179 21.357  1.00 71.87  ? 746  GLY A O     1 
ATOM   6084  N  N     . LYS C 3 747  ? 13.630  118.340 20.635  1.00 70.06  ? 747  LYS A N     1 
ATOM   6085  C  CA    . LYS C 3 747  ? 13.030  117.213 19.934  1.00 68.08  ? 747  LYS A CA    1 
ATOM   6086  C  C     . LYS C 3 747  ? 13.162  117.382 18.418  1.00 67.94  ? 747  LYS A C     1 
ATOM   6087  O  O     . LYS C 3 747  ? 13.357  118.500 17.930  1.00 68.13  ? 747  LYS A O     1 
ATOM   6088  C  CB    . LYS C 3 747  ? 11.556  117.077 20.342  1.00 67.01  ? 747  LYS A CB    1 
ATOM   6089  C  CG    . LYS C 3 747  ? 10.741  118.365 20.282  1.00 63.92  ? 747  LYS A CG    1 
ATOM   6090  C  CD    . LYS C 3 747  ? 9.324   118.138 20.805  1.00 62.72  ? 747  LYS A CD    1 
ATOM   6091  C  CE    . LYS C 3 747  ? 8.479   119.402 20.713  1.00 62.24  ? 747  LYS A CE    1 
ATOM   6092  N  NZ    . LYS C 3 747  ? 7.060   119.159 21.082  1.00 59.02  ? 747  LYS A NZ    1 
ATOM   6093  N  N     . VAL C 3 748  ? 13.067  116.274 17.681  1.00 66.59  ? 748  VAL A N     1 
ATOM   6094  C  CA    . VAL C 3 748  ? 13.182  116.295 16.217  1.00 65.43  ? 748  VAL A CA    1 
ATOM   6095  C  C     . VAL C 3 748  ? 12.054  117.086 15.554  1.00 64.18  ? 748  VAL A C     1 
ATOM   6096  O  O     . VAL C 3 748  ? 10.904  117.027 15.994  1.00 63.57  ? 748  VAL A O     1 
ATOM   6097  C  CB    . VAL C 3 748  ? 13.195  114.856 15.639  1.00 65.24  ? 748  VAL A CB    1 
ATOM   6098  C  CG1   . VAL C 3 748  ? 13.168  114.894 14.122  1.00 64.80  ? 748  VAL A CG1   1 
ATOM   6099  C  CG2   . VAL C 3 748  ? 14.437  114.129 16.106  1.00 66.32  ? 748  VAL A CG2   1 
ATOM   6100  N  N     . ASN C 3 749  ? 12.393  117.816 14.489  1.00 62.55  ? 749  ASN A N     1 
ATOM   6101  C  CA    . ASN C 3 749  ? 11.422  118.636 13.762  1.00 61.30  ? 749  ASN A CA    1 
ATOM   6102  C  C     . ASN C 3 749  ? 10.118  117.915 13.423  1.00 60.23  ? 749  ASN A C     1 
ATOM   6103  O  O     . ASN C 3 749  ? 10.124  116.811 12.879  1.00 60.48  ? 749  ASN A O     1 
ATOM   6104  C  CB    . ASN C 3 749  ? 12.034  119.182 12.469  1.00 60.80  ? 749  ASN A CB    1 
ATOM   6105  C  CG    . ASN C 3 749  ? 11.048  120.023 11.671  1.00 60.20  ? 749  ASN A CG    1 
ATOM   6106  O  OD1   . ASN C 3 749  ? 10.687  121.134 12.065  1.00 59.82  ? 749  ASN A OD1   1 
ATOM   6107  N  ND2   . ASN C 3 749  ? 10.596  119.486 10.551  1.00 59.60  ? 749  ASN A ND2   1 
ATOM   6108  N  N     . SER C 3 750  ? 9.005   118.571 13.735  1.00 59.00  ? 750  SER A N     1 
ATOM   6109  C  CA    . SER C 3 750  ? 7.671   118.037 13.494  1.00 57.89  ? 750  SER A CA    1 
ATOM   6110  C  C     . SER C 3 750  ? 7.345   117.876 12.008  1.00 57.61  ? 750  SER A C     1 
ATOM   6111  O  O     . SER C 3 750  ? 6.643   116.943 11.608  1.00 57.60  ? 750  SER A O     1 
ATOM   6112  C  CB    . SER C 3 750  ? 6.635   118.953 14.150  1.00 57.12  ? 750  SER A CB    1 
ATOM   6113  O  OG    . SER C 3 750  ? 5.315   118.555 13.824  1.00 58.90  ? 750  SER A OG    1 
ATOM   6114  N  N     . GLU C 3 751  ? 7.852   118.790 11.191  1.00 56.72  ? 751  GLU A N     1 
ATOM   6115  C  CA    . GLU C 3 751  ? 7.603   118.752 9.755   1.00 55.43  ? 751  GLU A CA    1 
ATOM   6116  C  C     . GLU C 3 751  ? 8.328   117.562 9.105   1.00 53.27  ? 751  GLU A C     1 
ATOM   6117  O  O     . GLU C 3 751  ? 7.781   116.894 8.220   1.00 52.86  ? 751  GLU A O     1 
ATOM   6118  C  CB    . GLU C 3 751  ? 8.050   120.082 9.143   1.00 57.83  ? 751  GLU A CB    1 
ATOM   6119  C  CG    . GLU C 3 751  ? 7.789   120.255 7.663   1.00 61.62  ? 751  GLU A CG    1 
ATOM   6120  C  CD    . GLU C 3 751  ? 8.049   121.686 7.217   1.00 64.58  ? 751  GLU A CD    1 
ATOM   6121  O  OE1   . GLU C 3 751  ? 7.295   122.587 7.651   1.00 65.49  ? 751  GLU A OE1   1 
ATOM   6122  O  OE2   . GLU C 3 751  ? 9.009   121.913 6.445   1.00 64.71  ? 751  GLU A OE2   1 
ATOM   6123  N  N     . THR C 3 752  ? 9.553   117.295 9.552   1.00 49.20  ? 752  THR A N     1 
ATOM   6124  C  CA    . THR C 3 752  ? 10.316  116.178 9.023   1.00 46.39  ? 752  THR A CA    1 
ATOM   6125  C  C     . THR C 3 752  ? 9.598   114.888 9.417   1.00 46.66  ? 752  THR A C     1 
ATOM   6126  O  O     . THR C 3 752  ? 9.524   113.947 8.630   1.00 48.63  ? 752  THR A O     1 
ATOM   6127  C  CB    . THR C 3 752  ? 11.755  116.135 9.593   1.00 45.56  ? 752  THR A CB    1 
ATOM   6128  O  OG1   . THR C 3 752  ? 12.444  117.347 9.274   1.00 42.93  ? 752  THR A OG1   1 
ATOM   6129  C  CG2   . THR C 3 752  ? 12.525  114.966 8.997   1.00 44.69  ? 752  THR A CG2   1 
ATOM   6130  N  N     . ILE C 3 753  ? 9.078   114.843 10.641  1.00 44.47  ? 753  ILE A N     1 
ATOM   6131  C  CA    . ILE C 3 753  ? 8.363   113.666 11.109  1.00 43.33  ? 753  ILE A CA    1 
ATOM   6132  C  C     . ILE C 3 753  ? 7.121   113.476 10.254  1.00 42.82  ? 753  ILE A C     1 
ATOM   6133  O  O     . ILE C 3 753  ? 6.824   112.364 9.816   1.00 41.66  ? 753  ILE A O     1 
ATOM   6134  C  CB    . ILE C 3 753  ? 7.939   113.804 12.598  1.00 43.24  ? 753  ILE A CB    1 
ATOM   6135  C  CG1   . ILE C 3 753  ? 9.172   113.715 13.497  1.00 43.80  ? 753  ILE A CG1   1 
ATOM   6136  C  CG2   . ILE C 3 753  ? 6.944   112.707 12.981  1.00 41.58  ? 753  ILE A CG2   1 
ATOM   6137  C  CD1   . ILE C 3 753  ? 8.880   114.004 14.959  1.00 43.78  ? 753  ILE A CD1   1 
ATOM   6138  N  N     . GLN C 3 754  ? 6.401   114.564 10.010  1.00 42.98  ? 754  GLN A N     1 
ATOM   6139  C  CA    . GLN C 3 754  ? 5.194   114.489 9.202   1.00 44.66  ? 754  GLN A CA    1 
ATOM   6140  C  C     . GLN C 3 754  ? 5.469   113.952 7.802   1.00 43.75  ? 754  GLN A C     1 
ATOM   6141  O  O     . GLN C 3 754  ? 4.611   113.310 7.205   1.00 41.77  ? 754  GLN A O     1 
ATOM   6142  C  CB    . GLN C 3 754  ? 4.516   115.858 9.113   1.00 47.34  ? 754  GLN A CB    1 
ATOM   6143  C  CG    . GLN C 3 754  ? 3.386   116.058 10.119  1.00 51.68  ? 754  GLN A CG    1 
ATOM   6144  C  CD    . GLN C 3 754  ? 2.395   114.896 10.129  1.00 54.54  ? 754  GLN A CD    1 
ATOM   6145  O  OE1   . GLN C 3 754  ? 1.945   114.434 9.076   1.00 56.60  ? 754  GLN A OE1   1 
ATOM   6146  N  NE2   . GLN C 3 754  ? 2.048   114.424 11.323  1.00 55.82  ? 754  GLN A NE2   1 
ATOM   6147  N  N     . ASN C 3 755  ? 6.662   114.222 7.280   1.00 44.36  ? 755  ASN A N     1 
ATOM   6148  C  CA    . ASN C 3 755  ? 7.037   113.734 5.955   1.00 45.62  ? 755  ASN A CA    1 
ATOM   6149  C  C     . ASN C 3 755  ? 7.231   112.217 6.012   1.00 44.79  ? 755  ASN A C     1 
ATOM   6150  O  O     . ASN C 3 755  ? 6.734   111.486 5.154   1.00 43.88  ? 755  ASN A O     1 
ATOM   6151  C  CB    . ASN C 3 755  ? 8.343   114.394 5.476   1.00 50.54  ? 755  ASN A CB    1 
ATOM   6152  C  CG    . ASN C 3 755  ? 8.144   115.833 4.988   1.00 56.04  ? 755  ASN A CG    1 
ATOM   6153  O  OD1   . ASN C 3 755  ? 7.220   116.118 4.220   1.00 60.39  ? 755  ASN A OD1   1 
ATOM   6154  N  ND2   . ASN C 3 755  ? 9.025   116.740 5.418   1.00 57.25  ? 755  ASN A ND2   1 
ATOM   6155  N  N     . ASP C 3 756  ? 7.959   111.759 7.031   1.00 43.01  ? 756  ASP A N     1 
ATOM   6156  C  CA    . ASP C 3 756  ? 8.244   110.341 7.232   1.00 41.35  ? 756  ASP A CA    1 
ATOM   6157  C  C     . ASP C 3 756  ? 6.919   109.582 7.310   1.00 41.40  ? 756  ASP A C     1 
ATOM   6158  O  O     . ASP C 3 756  ? 6.717   108.601 6.604   1.00 40.78  ? 756  ASP A O     1 
ATOM   6159  C  CB    . ASP C 3 756  ? 9.076   110.160 8.524   1.00 41.34  ? 756  ASP A CB    1 
ATOM   6160  C  CG    . ASP C 3 756  ? 9.607   108.725 8.715   1.00 41.59  ? 756  ASP A CG    1 
ATOM   6161  O  OD1   . ASP C 3 756  ? 9.449   107.913 7.785   1.00 44.45  ? 756  ASP A OD1   1 
ATOM   6162  O  OD2   . ASP C 3 756  ? 10.186  108.407 9.789   1.00 33.28  ? 756  ASP A OD2   1 
ATOM   6163  N  N     . LEU C 3 757  ? 6.000   110.060 8.142   1.00 42.28  ? 757  LEU A N     1 
ATOM   6164  C  CA    . LEU C 3 757  ? 4.705   109.400 8.304   1.00 43.58  ? 757  LEU A CA    1 
ATOM   6165  C  C     . LEU C 3 757  ? 3.908   109.262 7.015   1.00 44.43  ? 757  LEU A C     1 
ATOM   6166  O  O     . LEU C 3 757  ? 3.336   108.205 6.745   1.00 44.82  ? 757  LEU A O     1 
ATOM   6167  C  CB    . LEU C 3 757  ? 3.846   110.145 9.331   1.00 43.56  ? 757  LEU A CB    1 
ATOM   6168  C  CG    . LEU C 3 757  ? 4.432   110.270 10.737  1.00 45.17  ? 757  LEU A CG    1 
ATOM   6169  C  CD1   . LEU C 3 757  ? 3.463   111.019 11.644  1.00 45.81  ? 757  LEU A CD1   1 
ATOM   6170  C  CD2   . LEU C 3 757  ? 4.723   108.881 11.285  1.00 44.66  ? 757  LEU A CD2   1 
ATOM   6171  N  N     . GLU C 3 758  ? 3.858   110.329 6.226   1.00 45.07  ? 758  GLU A N     1 
ATOM   6172  C  CA    . GLU C 3 758  ? 3.102   110.301 4.981   1.00 46.46  ? 758  GLU A CA    1 
ATOM   6173  C  C     . GLU C 3 758  ? 3.651   109.237 4.034   1.00 44.85  ? 758  GLU A C     1 
ATOM   6174  O  O     . GLU C 3 758  ? 2.896   108.604 3.292   1.00 44.00  ? 758  GLU A O     1 
ATOM   6175  C  CB    . GLU C 3 758  ? 3.109   111.695 4.331   1.00 49.44  ? 758  GLU A CB    1 
ATOM   6176  C  CG    . GLU C 3 758  ? 2.528   112.770 5.263   1.00 54.59  ? 758  GLU A CG    1 
ATOM   6177  C  CD    . GLU C 3 758  ? 2.457   114.165 4.643   1.00 57.78  ? 758  GLU A CD    1 
ATOM   6178  O  OE1   . GLU C 3 758  ? 3.478   114.625 4.077   1.00 57.60  ? 758  GLU A OE1   1 
ATOM   6179  O  OE2   . GLU C 3 758  ? 1.378   114.804 4.740   1.00 58.16  ? 758  GLU A OE2   1 
ATOM   6180  N  N     . LEU C 3 759  ? 4.965   109.031 4.087   1.00 42.67  ? 759  LEU A N     1 
ATOM   6181  C  CA    . LEU C 3 759  ? 5.629   108.036 3.255   1.00 41.08  ? 759  LEU A CA    1 
ATOM   6182  C  C     . LEU C 3 759  ? 5.290   106.636 3.743   1.00 40.77  ? 759  LEU A C     1 
ATOM   6183  O  O     . LEU C 3 759  ? 5.145   105.707 2.940   1.00 41.23  ? 759  LEU A O     1 
ATOM   6184  C  CB    . LEU C 3 759  ? 7.146   108.231 3.294   1.00 40.48  ? 759  LEU A CB    1 
ATOM   6185  C  CG    . LEU C 3 759  ? 7.659   109.542 2.705   1.00 39.22  ? 759  LEU A CG    1 
ATOM   6186  C  CD1   . LEU C 3 759  ? 9.164   109.607 2.866   1.00 40.77  ? 759  LEU A CD1   1 
ATOM   6187  C  CD2   . LEU C 3 759  ? 7.266   109.639 1.242   1.00 37.45  ? 759  LEU A CD2   1 
ATOM   6188  N  N     . ILE C 3 760  ? 5.181   106.481 5.061   1.00 38.68  ? 760  ILE A N     1 
ATOM   6189  C  CA    . ILE C 3 760  ? 4.841   105.188 5.637   1.00 36.37  ? 760  ILE A CA    1 
ATOM   6190  C  C     . ILE C 3 760  ? 3.444   104.834 5.146   1.00 35.11  ? 760  ILE A C     1 
ATOM   6191  O  O     . ILE C 3 760  ? 3.201   103.727 4.661   1.00 35.70  ? 760  ILE A O     1 
ATOM   6192  C  CB    . ILE C 3 760  ? 4.860   105.232 7.197   1.00 35.71  ? 760  ILE A CB    1 
ATOM   6193  C  CG1   . ILE C 3 760  ? 6.303   105.331 7.689   1.00 33.55  ? 760  ILE A CG1   1 
ATOM   6194  C  CG2   . ILE C 3 760  ? 4.183   103.987 7.783   1.00 34.29  ? 760  ILE A CG2   1 
ATOM   6195  C  CD1   . ILE C 3 760  ? 6.450   105.433 9.190   1.00 32.24  ? 760  ILE A CD1   1 
ATOM   6196  N  N     . SER C 3 761  ? 2.538   105.798 5.257   1.00 34.32  ? 761  SER A N     1 
ATOM   6197  C  CA    . SER C 3 761  ? 1.150   105.626 4.841   1.00 34.30  ? 761  SER A CA    1 
ATOM   6198  C  C     . SER C 3 761  ? 1.074   105.186 3.377   1.00 33.74  ? 761  SER A C     1 
ATOM   6199  O  O     . SER C 3 761  ? 0.429   104.192 3.050   1.00 34.53  ? 761  SER A O     1 
ATOM   6200  C  CB    . SER C 3 761  ? 0.394   106.949 5.040   1.00 35.29  ? 761  SER A CB    1 
ATOM   6201  O  OG    . SER C 3 761  ? -1.011  106.773 5.016   1.00 37.57  ? 761  SER A OG    1 
ATOM   6202  N  N     . LYS C 3 762  ? 1.743   105.924 2.500   1.00 33.54  ? 762  LYS A N     1 
ATOM   6203  C  CA    . LYS C 3 762  ? 1.736   105.597 1.082   1.00 35.02  ? 762  LYS A CA    1 
ATOM   6204  C  C     . LYS C 3 762  ? 2.357   104.226 0.854   1.00 33.58  ? 762  LYS A C     1 
ATOM   6205  O  O     . LYS C 3 762  ? 1.933   103.462 -0.021  1.00 33.53  ? 762  LYS A O     1 
ATOM   6206  C  CB    . LYS C 3 762  ? 2.508   106.658 0.295   1.00 38.27  ? 762  LYS A CB    1 
ATOM   6207  C  CG    . LYS C 3 762  ? 1.852   108.035 0.287   1.00 42.28  ? 762  LYS A CG    1 
ATOM   6208  C  CD    . LYS C 3 762  ? 2.771   109.104 -0.331  1.00 46.04  ? 762  LYS A CD    1 
ATOM   6209  C  CE    . LYS C 3 762  ? 3.112   108.800 -1.791  1.00 48.02  ? 762  LYS A CE    1 
ATOM   6210  N  NZ    . LYS C 3 762  ? 3.858   109.925 -2.428  1.00 48.45  ? 762  LYS A NZ    1 
ATOM   6211  N  N     . TYR C 3 763  ? 3.366   103.924 1.656   1.00 31.75  ? 763  TYR A N     1 
ATOM   6212  C  CA    . TYR C 3 763  ? 4.074   102.656 1.582   1.00 30.95  ? 763  TYR A CA    1 
ATOM   6213  C  C     . TYR C 3 763  ? 3.167   101.427 1.767   1.00 31.32  ? 763  TYR A C     1 
ATOM   6214  O  O     . TYR C 3 763  ? 3.246   100.480 0.988   1.00 29.86  ? 763  TYR A O     1 
ATOM   6215  C  CB    . TYR C 3 763  ? 5.190   102.664 2.632   1.00 29.56  ? 763  TYR A CB    1 
ATOM   6216  C  CG    . TYR C 3 763  ? 5.820   101.322 2.939   1.00 26.13  ? 763  TYR A CG    1 
ATOM   6217  C  CD1   . TYR C 3 763  ? 6.632   100.671 2.013   1.00 25.68  ? 763  TYR A CD1   1 
ATOM   6218  C  CD2   . TYR C 3 763  ? 5.629   100.722 4.182   1.00 25.34  ? 763  TYR A CD2   1 
ATOM   6219  C  CE1   . TYR C 3 763  ? 7.246   99.447  2.328   1.00 25.25  ? 763  TYR A CE1   1 
ATOM   6220  C  CE2   . TYR C 3 763  ? 6.232   99.514  4.503   1.00 24.22  ? 763  TYR A CE2   1 
ATOM   6221  C  CZ    . TYR C 3 763  ? 7.038   98.882  3.580   1.00 23.64  ? 763  TYR A CZ    1 
ATOM   6222  O  OH    . TYR C 3 763  ? 7.640   97.700  3.932   1.00 21.72  ? 763  TYR A OH    1 
ATOM   6223  N  N     . GLY C 3 764  ? 2.308   101.453 2.786   1.00 32.24  ? 764  GLY A N     1 
ATOM   6224  C  CA    . GLY C 3 764  ? 1.426   100.326 3.060   1.00 33.42  ? 764  GLY A CA    1 
ATOM   6225  C  C     . GLY C 3 764  ? 0.350   100.023 2.029   1.00 35.13  ? 764  GLY A C     1 
ATOM   6226  O  O     . GLY C 3 764  ? -0.133  98.885  1.938   1.00 35.16  ? 764  GLY A O     1 
ATOM   6227  N  N     . GLU C 3 765  ? -0.040  101.035 1.258   1.00 35.53  ? 765  GLU A N     1 
ATOM   6228  C  CA    . GLU C 3 765  ? -1.060  100.869 0.229   1.00 34.94  ? 765  GLU A CA    1 
ATOM   6229  C  C     . GLU C 3 765  ? -0.558  99.869  -0.790  1.00 34.10  ? 765  GLU A C     1 
ATOM   6230  O  O     . GLU C 3 765  ? -1.339  99.231  -1.489  1.00 32.44  ? 765  GLU A O     1 
ATOM   6231  C  CB    . GLU C 3 765  ? -1.322  102.193 -0.485  1.00 38.22  ? 765  GLU A CB    1 
ATOM   6232  C  CG    . GLU C 3 765  ? -2.121  103.243 0.282   1.00 42.26  ? 765  GLU A CG    1 
ATOM   6233  C  CD    . GLU C 3 765  ? -1.963  104.635 -0.336  1.00 46.76  ? 765  GLU A CD    1 
ATOM   6234  O  OE1   . GLU C 3 765  ? -1.977  104.742 -1.589  1.00 45.36  ? 765  GLU A OE1   1 
ATOM   6235  O  OE2   . GLU C 3 765  ? -1.822  105.622 0.429   1.00 48.87  ? 765  GLU A OE2   1 
ATOM   6236  N  N     . GLU C 3 766  ? 0.761   99.743  -0.873  1.00 34.43  ? 766  GLU A N     1 
ATOM   6237  C  CA    . GLU C 3 766  ? 1.381   98.838  -1.830  1.00 34.98  ? 766  GLU A CA    1 
ATOM   6238  C  C     . GLU C 3 766  ? 1.158   97.354  -1.550  1.00 35.08  ? 766  GLU A C     1 
ATOM   6239  O  O     . GLU C 3 766  ? 1.320   96.524  -2.449  1.00 36.45  ? 766  GLU A O     1 
ATOM   6240  C  CB    . GLU C 3 766  ? 2.882   99.109  -1.908  1.00 37.38  ? 766  GLU A CB    1 
ATOM   6241  C  CG    . GLU C 3 766  ? 3.237   100.558 -2.156  1.00 40.41  ? 766  GLU A CG    1 
ATOM   6242  C  CD    . GLU C 3 766  ? 4.287   100.719 -3.236  1.00 43.73  ? 766  GLU A CD    1 
ATOM   6243  O  OE1   . GLU C 3 766  ? 5.328   100.026 -3.163  1.00 43.59  ? 766  GLU A OE1   1 
ATOM   6244  O  OE2   . GLU C 3 766  ? 4.070   101.544 -4.156  1.00 45.67  ? 766  GLU A OE2   1 
ATOM   6245  N  N     . PHE C 3 767  ? 0.802   97.006  -0.319  1.00 33.01  ? 767  PHE A N     1 
ATOM   6246  C  CA    . PHE C 3 767  ? 0.572   95.607  0.000   1.00 32.50  ? 767  PHE A CA    1 
ATOM   6247  C  C     . PHE C 3 767  ? -0.681  95.354  0.826   1.00 33.38  ? 767  PHE A C     1 
ATOM   6248  O  O     . PHE C 3 767  ? -0.766  94.376  1.580   1.00 32.93  ? 767  PHE A O     1 
ATOM   6249  C  CB    . PHE C 3 767  ? 1.811   95.010  0.679   1.00 31.22  ? 767  PHE A CB    1 
ATOM   6250  C  CG    . PHE C 3 767  ? 2.403   95.880  1.747   1.00 31.69  ? 767  PHE A CG    1 
ATOM   6251  C  CD1   . PHE C 3 767  ? 1.902   95.848  3.054   1.00 30.60  ? 767  PHE A CD1   1 
ATOM   6252  C  CD2   . PHE C 3 767  ? 3.471   96.725  1.454   1.00 29.11  ? 767  PHE A CD2   1 
ATOM   6253  C  CE1   . PHE C 3 767  ? 2.459   96.639  4.051   1.00 29.35  ? 767  PHE A CE1   1 
ATOM   6254  C  CE2   . PHE C 3 767  ? 4.036   97.522  2.445   1.00 29.90  ? 767  PHE A CE2   1 
ATOM   6255  C  CZ    . PHE C 3 767  ? 3.529   97.479  3.747   1.00 30.60  ? 767  PHE A CZ    1 
ATOM   6256  N  N     . GLY C 3 768  ? -1.652  96.250  0.671   1.00 33.87  ? 768  GLY A N     1 
ATOM   6257  C  CA    . GLY C 3 768  ? -2.928  96.115  1.354   1.00 32.99  ? 768  GLY A CA    1 
ATOM   6258  C  C     . GLY C 3 768  ? -3.039  96.507  2.810   1.00 32.17  ? 768  GLY A C     1 
ATOM   6259  O  O     . GLY C 3 768  ? -3.964  96.066  3.474   1.00 33.33  ? 768  GLY A O     1 
ATOM   6260  N  N     . TRP C 3 769  ? -2.117  97.320  3.313   1.00 33.34  ? 769  TRP A N     1 
ATOM   6261  C  CA    . TRP C 3 769  ? -2.167  97.757  4.712   1.00 33.16  ? 769  TRP A CA    1 
ATOM   6262  C  C     . TRP C 3 769  ? -2.499  99.236  4.823   1.00 35.45  ? 769  TRP A C     1 
ATOM   6263  O  O     . TRP C 3 769  ? -1.803  100.087 4.256   1.00 35.88  ? 769  TRP A O     1 
ATOM   6264  C  CB    . TRP C 3 769  ? -0.830  97.526  5.422   1.00 31.24  ? 769  TRP A CB    1 
ATOM   6265  C  CG    . TRP C 3 769  ? -0.596  96.130  5.924   1.00 30.96  ? 769  TRP A CG    1 
ATOM   6266  C  CD1   . TRP C 3 769  ? -1.264  94.994  5.555   1.00 31.29  ? 769  TRP A CD1   1 
ATOM   6267  C  CD2   . TRP C 3 769  ? 0.441   95.710  6.816   1.00 28.79  ? 769  TRP A CD2   1 
ATOM   6268  N  NE1   . TRP C 3 769  ? -0.702  93.896  6.155   1.00 29.54  ? 769  TRP A NE1   1 
ATOM   6269  C  CE2   . TRP C 3 769  ? 0.347   94.303  6.933   1.00 29.54  ? 769  TRP A CE2   1 
ATOM   6270  C  CE3   . TRP C 3 769  ? 1.444   96.383  7.522   1.00 26.95  ? 769  TRP A CE3   1 
ATOM   6271  C  CZ2   . TRP C 3 769  ? 1.223   93.555  7.729   1.00 28.95  ? 769  TRP A CZ2   1 
ATOM   6272  C  CZ3   . TRP C 3 769  ? 2.313   95.644  8.309   1.00 28.01  ? 769  TRP A CZ3   1 
ATOM   6273  C  CH2   . TRP C 3 769  ? 2.197   94.240  8.407   1.00 29.56  ? 769  TRP A CH2   1 
ATOM   6274  N  N     . LYS C 3 770  ? -3.563  99.533  5.560   1.00 37.18  ? 770  LYS A N     1 
ATOM   6275  C  CA    . LYS C 3 770  ? -3.983  100.910 5.787   1.00 37.94  ? 770  LYS A CA    1 
ATOM   6276  C  C     . LYS C 3 770  ? -3.472  101.280 7.177   1.00 38.09  ? 770  LYS A C     1 
ATOM   6277  O  O     . LYS C 3 770  ? -4.047  100.882 8.191   1.00 36.80  ? 770  LYS A O     1 
ATOM   6278  C  CB    . LYS C 3 770  ? -5.508  101.016 5.733   1.00 38.70  ? 770  LYS A CB    1 
ATOM   6279  C  CG    . LYS C 3 770  ? -6.060  102.410 5.969   1.00 40.97  ? 770  LYS A CG    1 
ATOM   6280  C  CD    . LYS C 3 770  ? -7.586  102.373 6.006   1.00 43.45  ? 770  LYS A CD    1 
ATOM   6281  C  CE    . LYS C 3 770  ? -8.192  103.740 6.305   1.00 45.68  ? 770  LYS A CE    1 
ATOM   6282  N  NZ    . LYS C 3 770  ? -7.912  104.729 5.217   1.00 47.27  ? 770  LYS A NZ    1 
ATOM   6283  N  N     . TYR C 3 771  ? -2.368  102.017 7.219   1.00 37.96  ? 771  TYR A N     1 
ATOM   6284  C  CA    . TYR C 3 771  ? -1.791  102.418 8.485   1.00 37.59  ? 771  TYR A CA    1 
ATOM   6285  C  C     . TYR C 3 771  ? -2.621  103.484 9.162   1.00 38.61  ? 771  TYR A C     1 
ATOM   6286  O  O     . TYR C 3 771  ? -2.995  104.481 8.551   1.00 39.54  ? 771  TYR A O     1 
ATOM   6287  C  CB    . TYR C 3 771  ? -0.378  102.963 8.292   1.00 36.42  ? 771  TYR A CB    1 
ATOM   6288  C  CG    . TYR C 3 771  ? 0.698   101.918 8.140   1.00 36.32  ? 771  TYR A CG    1 
ATOM   6289  C  CD1   . TYR C 3 771  ? 1.006   101.048 9.183   1.00 35.77  ? 771  TYR A CD1   1 
ATOM   6290  C  CD2   . TYR C 3 771  ? 1.436   101.823 6.964   1.00 37.36  ? 771  TYR A CD2   1 
ATOM   6291  C  CE1   . TYR C 3 771  ? 2.025   100.111 9.058   1.00 36.22  ? 771  TYR A CE1   1 
ATOM   6292  C  CE2   . TYR C 3 771  ? 2.457   100.890 6.828   1.00 37.76  ? 771  TYR A CE2   1 
ATOM   6293  C  CZ    . TYR C 3 771  ? 2.747   100.037 7.877   1.00 36.77  ? 771  TYR A CZ    1 
ATOM   6294  O  OH    . TYR C 3 771  ? 3.757   99.116  7.736   1.00 35.09  ? 771  TYR A OH    1 
ATOM   6295  N  N     . ASP C 3 772  ? -2.915  103.255 10.430  1.00 39.74  ? 772  ASP A N     1 
ATOM   6296  C  CA    . ASP C 3 772  ? -3.654  104.213 11.232  1.00 41.23  ? 772  ASP A CA    1 
ATOM   6297  C  C     . ASP C 3 772  ? -2.536  104.834 12.066  1.00 39.55  ? 772  ASP A C     1 
ATOM   6298  O  O     . ASP C 3 772  ? -2.196  104.343 13.137  1.00 38.80  ? 772  ASP A O     1 
ATOM   6299  C  CB    . ASP C 3 772  ? -4.672  103.491 12.127  1.00 45.92  ? 772  ASP A CB    1 
ATOM   6300  C  CG    . ASP C 3 772  ? -5.531  104.455 12.945  1.00 50.91  ? 772  ASP A CG    1 
ATOM   6301  O  OD1   . ASP C 3 772  ? -4.964  105.303 13.677  1.00 53.44  ? 772  ASP A OD1   1 
ATOM   6302  O  OD2   . ASP C 3 772  ? -6.779  104.358 12.864  1.00 53.07  ? 772  ASP A OD2   1 
ATOM   6303  N  N     . ILE C 3 773  ? -1.937  105.893 11.534  1.00 38.75  ? 773  ILE A N     1 
ATOM   6304  C  CA    . ILE C 3 773  ? -0.843  106.582 12.201  1.00 38.17  ? 773  ILE A CA    1 
ATOM   6305  C  C     . ILE C 3 773  ? -1.386  107.761 12.981  1.00 38.66  ? 773  ILE A C     1 
ATOM   6306  O  O     . ILE C 3 773  ? -2.320  108.419 12.550  1.00 39.58  ? 773  ILE A O     1 
ATOM   6307  C  CB    . ILE C 3 773  ? 0.198   107.089 11.166  1.00 37.11  ? 773  ILE A CB    1 
ATOM   6308  C  CG1   . ILE C 3 773  ? 0.831   105.898 10.452  1.00 37.06  ? 773  ILE A CG1   1 
ATOM   6309  C  CG2   . ILE C 3 773  ? 1.276   107.921 11.846  1.00 35.16  ? 773  ILE A CG2   1 
ATOM   6310  C  CD1   . ILE C 3 773  ? 1.801   106.283 9.351   1.00 37.10  ? 773  ILE A CD1   1 
ATOM   6311  N  N     . ALA C 3 774  ? -0.806  108.025 14.140  1.00 40.95  ? 774  ALA A N     1 
ATOM   6312  C  CA    . ALA C 3 774  ? -1.244  109.151 14.951  1.00 42.66  ? 774  ALA A CA    1 
ATOM   6313  C  C     . ALA C 3 774  ? -0.056  109.893 15.552  1.00 43.95  ? 774  ALA A C     1 
ATOM   6314  O  O     . ALA C 3 774  ? 0.746   109.329 16.292  1.00 45.36  ? 774  ALA A O     1 
ATOM   6315  C  CB    . ALA C 3 774  ? -2.191  108.675 16.060  1.00 41.31  ? 774  ALA A CB    1 
ATOM   6316  N  N     . TYR C 3 775  ? 0.058   111.165 15.204  1.00 45.90  ? 775  TYR A N     1 
ATOM   6317  C  CA    . TYR C 3 775  ? 1.123   112.018 15.710  1.00 47.49  ? 775  TYR A CA    1 
ATOM   6318  C  C     . TYR C 3 775  ? 0.360   113.166 16.370  1.00 48.29  ? 775  TYR A C     1 
ATOM   6319  O  O     . TYR C 3 775  ? -0.170  114.046 15.682  1.00 48.91  ? 775  TYR A O     1 
ATOM   6320  C  CB    . TYR C 3 775  ? 1.990   112.496 14.540  1.00 46.54  ? 775  TYR A CB    1 
ATOM   6321  C  CG    . TYR C 3 775  ? 3.135   113.410 14.909  1.00 45.92  ? 775  TYR A CG    1 
ATOM   6322  C  CD1   . TYR C 3 775  ? 3.831   113.249 16.108  1.00 46.40  ? 775  TYR A CD1   1 
ATOM   6323  C  CD2   . TYR C 3 775  ? 3.550   114.413 14.034  1.00 45.25  ? 775  TYR A CD2   1 
ATOM   6324  C  CE1   . TYR C 3 775  ? 4.918   114.069 16.428  1.00 45.89  ? 775  TYR A CE1   1 
ATOM   6325  C  CE2   . TYR C 3 775  ? 4.628   115.232 14.339  1.00 45.72  ? 775  TYR A CE2   1 
ATOM   6326  C  CZ    . TYR C 3 775  ? 5.310   115.059 15.536  1.00 45.94  ? 775  TYR A CZ    1 
ATOM   6327  O  OH    . TYR C 3 775  ? 6.377   115.879 15.834  1.00 46.23  ? 775  TYR A OH    1 
ATOM   6328  N  N     . ASP C 3 776  ? 0.292   113.131 17.704  1.00 48.31  ? 776  ASP A N     1 
ATOM   6329  C  CA    . ASP C 3 776  ? -0.456  114.126 18.482  1.00 47.37  ? 776  ASP A CA    1 
ATOM   6330  C  C     . ASP C 3 776  ? 0.167   114.542 19.816  1.00 46.32  ? 776  ASP A C     1 
ATOM   6331  O  O     . ASP C 3 776  ? -0.519  115.134 20.645  1.00 48.48  ? 776  ASP A O     1 
ATOM   6332  C  CB    . ASP C 3 776  ? -1.856  113.581 18.770  1.00 46.13  ? 776  ASP A CB    1 
ATOM   6333  C  CG    . ASP C 3 776  ? -1.813  112.177 19.355  1.00 45.24  ? 776  ASP A CG    1 
ATOM   6334  O  OD1   . ASP C 3 776  ? -0.865  111.897 20.124  1.00 44.36  ? 776  ASP A OD1   1 
ATOM   6335  O  OD2   . ASP C 3 776  ? -2.713  111.361 19.056  1.00 42.72  ? 776  ASP A OD2   1 
ATOM   6336  N  N     . GLY C 3 777  ? 1.441   114.230 20.031  1.00 44.65  ? 777  GLY A N     1 
ATOM   6337  C  CA    . GLY C 3 777  ? 2.094   114.586 21.282  1.00 42.46  ? 777  GLY A CA    1 
ATOM   6338  C  C     . GLY C 3 777  ? 1.749   113.616 22.397  1.00 41.79  ? 777  GLY A C     1 
ATOM   6339  O  O     . GLY C 3 777  ? 2.055   113.844 23.567  1.00 42.64  ? 777  GLY A O     1 
ATOM   6340  N  N     . THR C 3 778  ? 1.129   112.509 22.014  1.00 41.49  ? 778  THR A N     1 
ATOM   6341  C  CA    . THR C 3 778  ? 0.686   111.483 22.949  1.00 40.13  ? 778  THR A CA    1 
ATOM   6342  C  C     . THR C 3 778  ? 1.274   110.117 22.613  1.00 39.18  ? 778  THR A C     1 
ATOM   6343  O  O     . THR C 3 778  ? 1.791   109.903 21.516  1.00 40.60  ? 778  THR A O     1 
ATOM   6344  C  CB    . THR C 3 778  ? -0.863  111.410 22.906  1.00 41.11  ? 778  THR A CB    1 
ATOM   6345  O  OG1   . THR C 3 778  ? -1.399  112.302 23.889  1.00 43.88  ? 778  THR A OG1   1 
ATOM   6346  C  CG2   . THR C 3 778  ? -1.382  109.987 23.116  1.00 41.27  ? 778  THR A CG2   1 
ATOM   6347  N  N     . ALA C 3 779  ? 1.211   109.200 23.570  1.00 36.87  ? 779  ALA A N     1 
ATOM   6348  C  CA    . ALA C 3 779  ? 1.687   107.840 23.355  1.00 35.29  ? 779  ALA A CA    1 
ATOM   6349  C  C     . ALA C 3 779  ? 0.529   106.910 23.693  1.00 34.09  ? 779  ALA A C     1 
ATOM   6350  O  O     . ALA C 3 779  ? -0.061  107.002 24.763  1.00 35.26  ? 779  ALA A O     1 
ATOM   6351  C  CB    . ALA C 3 779  ? 2.898   107.540 24.238  1.00 35.25  ? 779  ALA A CB    1 
ATOM   6352  N  N     . GLU C 3 780  ? 0.190   106.031 22.766  1.00 34.64  ? 780  GLU A N     1 
ATOM   6353  C  CA    . GLU C 3 780  ? -0.903  105.103 22.971  1.00 37.03  ? 780  GLU A CA    1 
ATOM   6354  C  C     . GLU C 3 780  ? -0.453  103.743 22.455  1.00 37.12  ? 780  GLU A C     1 
ATOM   6355  O  O     . GLU C 3 780  ? -0.177  103.568 21.266  1.00 38.53  ? 780  GLU A O     1 
ATOM   6356  C  CB    . GLU C 3 780  ? -2.155  105.578 22.225  1.00 39.00  ? 780  GLU A CB    1 
ATOM   6357  C  CG    . GLU C 3 780  ? -3.450  104.940 22.724  1.00 45.68  ? 780  GLU A CG    1 
ATOM   6358  C  CD    . GLU C 3 780  ? -4.679  105.304 21.880  1.00 50.02  ? 780  GLU A CD    1 
ATOM   6359  O  OE1   . GLU C 3 780  ? -4.926  106.519 21.653  1.00 51.66  ? 780  GLU A OE1   1 
ATOM   6360  O  OE2   . GLU C 3 780  ? -5.403  104.366 21.457  1.00 50.00  ? 780  GLU A OE2   1 
ATOM   6361  N  N     . TYR C 3 781  ? -0.392  102.784 23.369  1.00 37.10  ? 781  TYR A N     1 
ATOM   6362  C  CA    . TYR C 3 781  ? 0.056   101.438 23.062  1.00 37.02  ? 781  TYR A CA    1 
ATOM   6363  C  C     . TYR C 3 781  ? -0.733  100.430 23.897  1.00 36.41  ? 781  TYR A C     1 
ATOM   6364  O  O     . TYR C 3 781  ? -0.801  100.546 25.119  1.00 37.04  ? 781  TYR A O     1 
ATOM   6365  C  CB    . TYR C 3 781  ? 1.553   101.351 23.388  1.00 37.70  ? 781  TYR A CB    1 
ATOM   6366  C  CG    . TYR C 3 781  ? 2.232   100.073 22.964  1.00 38.92  ? 781  TYR A CG    1 
ATOM   6367  C  CD1   . TYR C 3 781  ? 2.254   99.683  21.626  1.00 39.46  ? 781  TYR A CD1   1 
ATOM   6368  C  CD2   . TYR C 3 781  ? 2.867   99.259  23.899  1.00 39.19  ? 781  TYR A CD2   1 
ATOM   6369  C  CE1   . TYR C 3 781  ? 2.895   98.505  21.230  1.00 40.55  ? 781  TYR A CE1   1 
ATOM   6370  C  CE2   . TYR C 3 781  ? 3.508   98.083  23.518  1.00 39.59  ? 781  TYR A CE2   1 
ATOM   6371  C  CZ    . TYR C 3 781  ? 3.516   97.710  22.183  1.00 39.62  ? 781  TYR A CZ    1 
ATOM   6372  O  OH    . TYR C 3 781  ? 4.119   96.537  21.807  1.00 37.57  ? 781  TYR A OH    1 
ATOM   6373  N  N     . LEU C 3 782  ? -1.333  99.448  23.235  1.00 36.10  ? 782  LEU A N     1 
ATOM   6374  C  CA    . LEU C 3 782  ? -2.108  98.415  23.926  1.00 36.73  ? 782  LEU A CA    1 
ATOM   6375  C  C     . LEU C 3 782  ? -3.174  98.986  24.886  1.00 36.56  ? 782  LEU A C     1 
ATOM   6376  O  O     . LEU C 3 782  ? -3.312  98.534  26.026  1.00 35.24  ? 782  LEU A O     1 
ATOM   6377  C  CB    . LEU C 3 782  ? -1.161  97.477  24.700  1.00 37.79  ? 782  LEU A CB    1 
ATOM   6378  C  CG    . LEU C 3 782  ? 0.088   96.888  24.010  1.00 39.17  ? 782  LEU A CG    1 
ATOM   6379  C  CD1   . LEU C 3 782  ? 0.833   96.031  25.021  1.00 37.69  ? 782  LEU A CD1   1 
ATOM   6380  C  CD2   . LEU C 3 782  ? -0.278  96.059  22.773  1.00 36.51  ? 782  LEU A CD2   1 
ATOM   6381  N  N     . LYS C 3 783  ? -3.930  99.972  24.409  1.00 37.00  ? 783  LYS A N     1 
ATOM   6382  C  CA    . LYS C 3 783  ? -4.992  100.609 25.192  1.00 37.51  ? 783  LYS A CA    1 
ATOM   6383  C  C     . LYS C 3 783  ? -4.515  101.269 26.493  1.00 36.18  ? 783  LYS A C     1 
ATOM   6384  O  O     . LYS C 3 783  ? -5.253  101.370 27.471  1.00 33.88  ? 783  LYS A O     1 
ATOM   6385  C  CB    . LYS C 3 783  ? -6.118  99.603  25.477  1.00 37.82  ? 783  LYS A CB    1 
ATOM   6386  C  CG    . LYS C 3 783  ? -6.898  99.188  24.227  1.00 41.58  ? 783  LYS A CG    1 
ATOM   6387  C  CD    . LYS C 3 783  ? -7.596  100.384 23.575  1.00 42.37  ? 783  LYS A CD    1 
ATOM   6388  C  CE    . LYS C 3 783  ? -8.322  100.000 22.283  1.00 43.46  ? 783  LYS A CE    1 
ATOM   6389  N  NZ    . LYS C 3 783  ? -7.407  99.622  21.168  1.00 40.71  ? 783  LYS A NZ    1 
ATOM   6390  N  N     . LEU C 3 784  ? -3.265  101.713 26.482  1.00 35.06  ? 784  LEU A N     1 
ATOM   6391  C  CA    . LEU C 3 784  ? -2.670  102.409 27.610  1.00 33.70  ? 784  LEU A CA    1 
ATOM   6392  C  C     . LEU C 3 784  ? -2.367  103.794 27.040  1.00 32.84  ? 784  LEU A C     1 
ATOM   6393  O  O     . LEU C 3 784  ? -1.794  103.899 25.957  1.00 33.82  ? 784  LEU A O     1 
ATOM   6394  C  CB    . LEU C 3 784  ? -1.398  101.691 28.045  1.00 35.36  ? 784  LEU A CB    1 
ATOM   6395  C  CG    . LEU C 3 784  ? -1.425  101.105 29.458  1.00 37.51  ? 784  LEU A CG    1 
ATOM   6396  C  CD1   . LEU C 3 784  ? -1.031  102.178 30.452  1.00 38.04  ? 784  LEU A CD1   1 
ATOM   6397  C  CD2   . LEU C 3 784  ? -2.812  100.554 29.777  1.00 36.90  ? 784  LEU A CD2   1 
ATOM   6398  N  N     . TYR C 3 785  ? -2.767  104.847 27.750  1.00 31.56  ? 785  TYR A N     1 
ATOM   6399  C  CA    . TYR C 3 785  ? -2.587  106.221 27.273  1.00 29.50  ? 785  TYR A CA    1 
ATOM   6400  C  C     . TYR C 3 785  ? -1.544  107.010 28.043  1.00 29.13  ? 785  TYR A C     1 
ATOM   6401  O  O     . TYR C 3 785  ? -1.508  106.982 29.280  1.00 28.00  ? 785  TYR A O     1 
ATOM   6402  C  CB    . TYR C 3 785  ? -3.931  106.940 27.322  1.00 30.61  ? 785  TYR A CB    1 
ATOM   6403  C  CG    . TYR C 3 785  ? -5.023  106.160 26.624  1.00 32.16  ? 785  TYR A CG    1 
ATOM   6404  C  CD1   . TYR C 3 785  ? -5.375  106.441 25.301  1.00 32.19  ? 785  TYR A CD1   1 
ATOM   6405  C  CD2   . TYR C 3 785  ? -5.655  105.086 27.264  1.00 31.41  ? 785  TYR A CD2   1 
ATOM   6406  C  CE1   . TYR C 3 785  ? -6.323  105.669 24.629  1.00 33.82  ? 785  TYR A CE1   1 
ATOM   6407  C  CE2   . TYR C 3 785  ? -6.600  104.308 26.602  1.00 33.21  ? 785  TYR A CE2   1 
ATOM   6408  C  CZ    . TYR C 3 785  ? -6.928  104.602 25.284  1.00 34.29  ? 785  TYR A CZ    1 
ATOM   6409  O  OH    . TYR C 3 785  ? -7.836  103.812 24.611  1.00 36.89  ? 785  TYR A OH    1 
ATOM   6410  N  N     . PHE C 3 786  ? -0.706  107.729 27.298  1.00 28.25  ? 786  PHE A N     1 
ATOM   6411  C  CA    . PHE C 3 786  ? 0.377   108.511 27.891  1.00 27.47  ? 786  PHE A CA    1 
ATOM   6412  C  C     . PHE C 3 786  ? 0.567   109.914 27.323  1.00 27.17  ? 786  PHE A C     1 
ATOM   6413  O  O     . PHE C 3 786  ? 0.474   110.116 26.114  1.00 28.51  ? 786  PHE A O     1 
ATOM   6414  C  CB    . PHE C 3 786  ? 1.704   107.761 27.718  1.00 25.93  ? 786  PHE A CB    1 
ATOM   6415  C  CG    . PHE C 3 786  ? 1.754   106.437 28.424  1.00 26.15  ? 786  PHE A CG    1 
ATOM   6416  C  CD1   . PHE C 3 786  ? 2.069   106.367 29.775  1.00 24.82  ? 786  PHE A CD1   1 
ATOM   6417  C  CD2   . PHE C 3 786  ? 1.447   105.262 27.745  1.00 25.72  ? 786  PHE A CD2   1 
ATOM   6418  C  CE1   . PHE C 3 786  ? 2.074   105.145 30.446  1.00 25.27  ? 786  PHE A CE1   1 
ATOM   6419  C  CE2   . PHE C 3 786  ? 1.449   104.032 28.407  1.00 25.57  ? 786  PHE A CE2   1 
ATOM   6420  C  CZ    . PHE C 3 786  ? 1.763   103.975 29.760  1.00 26.02  ? 786  PHE A CZ    1 
ATOM   6421  N  N     . ILE C 3 787  ? 0.846   110.872 28.204  1.00 25.46  ? 787  ILE A N     1 
ATOM   6422  C  CA    . ILE C 3 787  ? 1.144   112.237 27.791  1.00 24.31  ? 787  ILE A CA    1 
ATOM   6423  C  C     . ILE C 3 787  ? 2.202   112.858 28.709  1.00 25.71  ? 787  ILE A C     1 
ATOM   6424  O  O     . ILE C 3 787  ? 2.052   112.886 29.930  1.00 25.68  ? 787  ILE A O     1 
ATOM   6425  C  CB    . ILE C 3 787  ? -0.108  113.151 27.761  1.00 24.86  ? 787  ILE A CB    1 
ATOM   6426  C  CG1   . ILE C 3 787  ? 0.297   114.538 27.238  1.00 22.79  ? 787  ILE A CG1   1 
ATOM   6427  C  CG2   . ILE C 3 787  ? -0.756  113.232 29.147  1.00 21.56  ? 787  ILE A CG2   1 
ATOM   6428  C  CD1   . ILE C 3 787  ? -0.866  115.407 26.825  1.00 22.07  ? 787  ILE A CD1   1 
ATOM   6429  N  N     . PHE C 3 788  ? 3.279   113.350 28.106  1.00 26.86  ? 788  PHE A N     1 
ATOM   6430  C  CA    . PHE C 3 788  ? 4.361   113.972 28.855  1.00 26.59  ? 788  PHE A CA    1 
ATOM   6431  C  C     . PHE C 3 788  ? 4.819   113.101 30.012  1.00 27.10  ? 788  PHE A C     1 
ATOM   6432  O  O     . PHE C 3 788  ? 5.049   113.585 31.124  1.00 29.97  ? 788  PHE A O     1 
ATOM   6433  C  CB    . PHE C 3 788  ? 3.927   115.349 29.365  1.00 26.55  ? 788  PHE A CB    1 
ATOM   6434  C  CG    . PHE C 3 788  ? 4.000   116.435 28.321  1.00 26.40  ? 788  PHE A CG    1 
ATOM   6435  C  CD1   . PHE C 3 788  ? 3.877   116.135 26.967  1.00 25.74  ? 788  PHE A CD1   1 
ATOM   6436  C  CD2   . PHE C 3 788  ? 4.151   117.766 28.694  1.00 27.72  ? 788  PHE A CD2   1 
ATOM   6437  C  CE1   . PHE C 3 788  ? 3.899   117.152 26.001  1.00 23.13  ? 788  PHE A CE1   1 
ATOM   6438  C  CE2   . PHE C 3 788  ? 4.173   118.787 27.728  1.00 26.24  ? 788  PHE A CE2   1 
ATOM   6439  C  CZ    . PHE C 3 788  ? 4.046   118.474 26.388  1.00 23.49  ? 788  PHE A CZ    1 
ATOM   6440  N  N     . GLY C 3 789  ? 4.937   111.807 29.741  1.00 25.07  ? 789  GLY A N     1 
ATOM   6441  C  CA    . GLY C 3 789  ? 5.396   110.885 30.752  1.00 22.82  ? 789  GLY A CA    1 
ATOM   6442  C  C     . GLY C 3 789  ? 4.385   110.515 31.807  1.00 22.45  ? 789  GLY A C     1 
ATOM   6443  O  O     . GLY C 3 789  ? 4.734   109.840 32.769  1.00 21.99  ? 789  GLY A O     1 
ATOM   6444  N  N     . CYS C 3 790  ? 3.139   110.950 31.642  1.00 23.49  ? 790  CYS A N     1 
ATOM   6445  C  CA    . CYS C 3 790  ? 2.091   110.633 32.616  1.00 21.80  ? 790  CYS A CA    1 
ATOM   6446  C  C     . CYS C 3 790  ? 1.044   109.682 32.055  1.00 21.47  ? 790  CYS A C     1 
ATOM   6447  O  O     . CYS C 3 790  ? 0.485   109.909 30.977  1.00 20.67  ? 790  CYS A O     1 
ATOM   6448  C  CB    . CYS C 3 790  ? 1.393   111.902 33.090  1.00 19.99  ? 790  CYS A CB    1 
ATOM   6449  S  SG    . CYS C 3 790  ? 0.142   111.575 34.342  1.00 25.78  ? 790  CYS A SG    1 
ATOM   6450  N  N     . ARG C 3 791  ? 0.775   108.612 32.791  1.00 22.36  ? 791  ARG A N     1 
ATOM   6451  C  CA    . ARG C 3 791  ? -0.214  107.650 32.350  1.00 24.27  ? 791  ARG A CA    1 
ATOM   6452  C  C     . ARG C 3 791  ? -1.611  108.187 32.657  1.00 24.62  ? 791  ARG A C     1 
ATOM   6453  O  O     . ARG C 3 791  ? -1.866  108.718 33.743  1.00 24.28  ? 791  ARG A O     1 
ATOM   6454  C  CB    . ARG C 3 791  ? 0.004   106.297 33.029  1.00 25.72  ? 791  ARG A CB    1 
ATOM   6455  C  CG    . ARG C 3 791  ? -1.046  105.267 32.653  1.00 27.61  ? 791  ARG A CG    1 
ATOM   6456  C  CD    . ARG C 3 791  ? -0.685  103.862 33.117  1.00 30.38  ? 791  ARG A CD    1 
ATOM   6457  N  NE    . ARG C 3 791  ? -1.897  103.121 33.447  1.00 35.26  ? 791  ARG A NE    1 
ATOM   6458  C  CZ    . ARG C 3 791  ? -2.374  103.000 34.679  1.00 36.89  ? 791  ARG A CZ    1 
ATOM   6459  N  NH1   . ARG C 3 791  ? -1.727  103.558 35.699  1.00 36.55  ? 791  ARG A NH1   1 
ATOM   6460  N  NH2   . ARG C 3 791  ? -3.512  102.353 34.886  1.00 39.50  ? 791  ARG A NH2   1 
ATOM   6461  N  N     . ILE C 3 792  ? -2.498  108.057 31.673  1.00 23.32  ? 792  ILE A N     1 
ATOM   6462  C  CA    . ILE C 3 792  ? -3.868  108.519 31.790  1.00 22.04  ? 792  ILE A CA    1 
ATOM   6463  C  C     . ILE C 3 792  ? -4.826  107.337 31.791  1.00 22.08  ? 792  ILE A C     1 
ATOM   6464  O  O     . ILE C 3 792  ? -5.207  106.851 30.730  1.00 21.16  ? 792  ILE A O     1 
ATOM   6465  C  CB    . ILE C 3 792  ? -4.253  109.448 30.612  1.00 21.56  ? 792  ILE A CB    1 
ATOM   6466  C  CG1   . ILE C 3 792  ? -3.223  110.572 30.459  1.00 21.31  ? 792  ILE A CG1   1 
ATOM   6467  C  CG2   . ILE C 3 792  ? -5.628  110.042 30.852  1.00 19.65  ? 792  ILE A CG2   1 
ATOM   6468  C  CD1   . ILE C 3 792  ? -3.000  111.396 31.711  1.00 23.20  ? 792  ILE A CD1   1 
ATOM   6469  N  N     . PRO C 3 793  ? -5.221  106.850 32.984  1.00 21.97  ? 793  PRO A N     1 
ATOM   6470  C  CA    . PRO C 3 793  ? -6.147  105.713 33.005  1.00 21.96  ? 793  PRO A CA    1 
ATOM   6471  C  C     . PRO C 3 793  ? -7.426  106.080 32.251  1.00 22.71  ? 793  PRO A C     1 
ATOM   6472  O  O     . PRO C 3 793  ? -7.873  107.222 32.311  1.00 24.49  ? 793  PRO A O     1 
ATOM   6473  C  CB    . PRO C 3 793  ? -6.406  105.494 34.501  1.00 20.25  ? 793  PRO A CB    1 
ATOM   6474  C  CG    . PRO C 3 793  ? -5.196  106.050 35.158  1.00 16.67  ? 793  PRO A CG    1 
ATOM   6475  C  CD    . PRO C 3 793  ? -4.889  107.286 34.351  1.00 17.77  ? 793  PRO A CD    1 
ATOM   6476  N  N     . ASN C 3 794  ? -7.998  105.119 31.533  1.00 23.19  ? 794  ASN A N     1 
ATOM   6477  C  CA    . ASN C 3 794  ? -9.230  105.340 30.778  1.00 22.81  ? 794  ASN A CA    1 
ATOM   6478  C  C     . ASN C 3 794  ? -10.351 104.607 31.533  1.00 22.99  ? 794  ASN A C     1 
ATOM   6479  O  O     . ASN C 3 794  ? -10.550 103.413 31.352  1.00 24.09  ? 794  ASN A O     1 
ATOM   6480  C  CB    . ASN C 3 794  ? -9.080  104.777 29.361  1.00 21.75  ? 794  ASN A CB    1 
ATOM   6481  C  CG    . ASN C 3 794  ? -10.240 105.166 28.442  1.00 22.33  ? 794  ASN A CG    1 
ATOM   6482  O  OD1   . ASN C 3 794  ? -11.325 105.532 28.898  1.00 22.30  ? 794  ASN A OD1   1 
ATOM   6483  N  ND2   . ASN C 3 794  ? -10.013 105.064 27.140  1.00 21.31  ? 794  ASN A ND2   1 
ATOM   6484  N  N     . LEU C 3 795  ? -11.078 105.330 32.378  1.00 23.78  ? 795  LEU A N     1 
ATOM   6485  C  CA    . LEU C 3 795  ? -12.135 104.734 33.188  1.00 24.11  ? 795  LEU A CA    1 
ATOM   6486  C  C     . LEU C 3 795  ? -13.316 104.224 32.352  1.00 25.21  ? 795  LEU A C     1 
ATOM   6487  O  O     . LEU C 3 795  ? -14.065 103.347 32.783  1.00 26.86  ? 795  LEU A O     1 
ATOM   6488  C  CB    . LEU C 3 795  ? -12.591 105.750 34.252  1.00 21.42  ? 795  LEU A CB    1 
ATOM   6489  C  CG    . LEU C 3 795  ? -11.655 106.009 35.455  1.00 19.95  ? 795  LEU A CG    1 
ATOM   6490  C  CD1   . LEU C 3 795  ? -10.246 106.318 34.975  1.00 18.06  ? 795  LEU A CD1   1 
ATOM   6491  C  CD2   . LEU C 3 795  ? -12.191 107.175 36.300  1.00 15.52  ? 795  LEU A CD2   1 
ATOM   6492  N  N     . SER C 3 796  ? -13.447 104.778 31.153  1.00 25.18  ? 796  SER A N     1 
ATOM   6493  C  CA    . SER C 3 796  ? -14.488 104.445 30.179  1.00 23.79  ? 796  SER A CA    1 
ATOM   6494  C  C     . SER C 3 796  ? -14.500 102.984 29.769  1.00 24.67  ? 796  SER A C     1 
ATOM   6495  O  O     . SER C 3 796  ? -15.562 102.388 29.561  1.00 22.37  ? 796  SER A O     1 
ATOM   6496  C  CB    . SER C 3 796  ? -14.274 105.271 28.908  1.00 21.55  ? 796  SER A CB    1 
ATOM   6497  O  OG    . SER C 3 796  ? -15.181 106.338 28.875  1.00 24.79  ? 796  SER A OG    1 
ATOM   6498  N  N     . ARG C 3 797  ? -13.302 102.434 29.608  1.00 26.22  ? 797  ARG A N     1 
ATOM   6499  C  CA    . ARG C 3 797  ? -13.139 101.053 29.187  1.00 29.42  ? 797  ARG A CA    1 
ATOM   6500  C  C     . ARG C 3 797  ? -13.317 100.051 30.308  1.00 28.88  ? 797  ARG A C     1 
ATOM   6501  O  O     . ARG C 3 797  ? -13.231 98.849  30.072  1.00 28.86  ? 797  ARG A O     1 
ATOM   6502  C  CB    . ARG C 3 797  ? -11.764 100.856 28.557  1.00 32.26  ? 797  ARG A CB    1 
ATOM   6503  C  CG    . ARG C 3 797  ? -11.582 101.587 27.252  1.00 36.22  ? 797  ARG A CG    1 
ATOM   6504  C  CD    . ARG C 3 797  ? -10.287 101.165 26.593  1.00 40.28  ? 797  ARG A CD    1 
ATOM   6505  N  NE    . ARG C 3 797  ? -10.172 101.710 25.244  1.00 46.11  ? 797  ARG A NE    1 
ATOM   6506  C  CZ    . ARG C 3 797  ? -10.964 101.368 24.233  1.00 47.77  ? 797  ARG A CZ    1 
ATOM   6507  N  NH1   . ARG C 3 797  ? -11.929 100.477 24.428  1.00 48.69  ? 797  ARG A NH1   1 
ATOM   6508  N  NH2   . ARG C 3 797  ? -10.792 101.911 23.030  1.00 47.72  ? 797  ARG A NH2   1 
ATOM   6509  N  N     . HIS C 3 798  ? -13.557 100.534 31.523  1.00 27.74  ? 798  HIS A N     1 
ATOM   6510  C  CA    . HIS C 3 798  ? -13.741 99.628  32.657  1.00 29.85  ? 798  HIS A CA    1 
ATOM   6511  C  C     . HIS C 3 798  ? -15.118 99.812  33.297  1.00 27.27  ? 798  HIS A C     1 
ATOM   6512  O  O     . HIS C 3 798  ? -15.233 100.090 34.484  1.00 24.46  ? 798  HIS A O     1 
ATOM   6513  C  CB    . HIS C 3 798  ? -12.635 99.850  33.693  1.00 30.91  ? 798  HIS A CB    1 
ATOM   6514  C  CG    . HIS C 3 798  ? -11.261 99.585  33.167  1.00 35.51  ? 798  HIS A CG    1 
ATOM   6515  N  ND1   . HIS C 3 798  ? -10.121 99.999  33.822  1.00 37.41  ? 798  HIS A ND1   1 
ATOM   6516  C  CD2   . HIS C 3 798  ? -10.842 98.960  32.041  1.00 36.51  ? 798  HIS A CD2   1 
ATOM   6517  C  CE1   . HIS C 3 798  ? -9.059  99.644  33.120  1.00 37.46  ? 798  HIS A CE1   1 
ATOM   6518  N  NE2   . HIS C 3 798  ? -9.470  99.013  32.035  1.00 38.62  ? 798  HIS A NE2   1 
ATOM   6519  N  N     . PRO C 3 799  ? -16.182 99.628  32.503  1.00 27.04  ? 799  PRO A N     1 
ATOM   6520  C  CA    . PRO C 3 799  ? -17.563 99.775  32.970  1.00 26.82  ? 799  PRO A CA    1 
ATOM   6521  C  C     . PRO C 3 799  ? -17.793 99.032  34.277  1.00 26.50  ? 799  PRO A C     1 
ATOM   6522  O  O     . PRO C 3 799  ? -17.599 97.816  34.363  1.00 28.43  ? 799  PRO A O     1 
ATOM   6523  C  CB    . PRO C 3 799  ? -18.379 99.186  31.830  1.00 25.93  ? 799  PRO A CB    1 
ATOM   6524  C  CG    . PRO C 3 799  ? -17.480 99.378  30.642  1.00 27.96  ? 799  PRO A CG    1 
ATOM   6525  C  CD    . PRO C 3 799  ? -16.147 99.027  31.160  1.00 24.83  ? 799  PRO A CD    1 
ATOM   6526  N  N     . ILE C 3 800  ? -18.208 99.769  35.294  1.00 24.51  ? 800  ILE A N     1 
ATOM   6527  C  CA    . ILE C 3 800  ? -18.462 99.173  36.588  1.00 24.37  ? 800  ILE A CA    1 
ATOM   6528  C  C     . ILE C 3 800  ? -19.605 98.174  36.534  1.00 23.06  ? 800  ILE A C     1 
ATOM   6529  O  O     . ILE C 3 800  ? -19.516 97.100  37.126  1.00 24.08  ? 800  ILE A O     1 
ATOM   6530  C  CB    . ILE C 3 800  ? -18.775 100.265 37.634  1.00 24.84  ? 800  ILE A CB    1 
ATOM   6531  C  CG1   . ILE C 3 800  ? -17.480 101.001 37.989  1.00 23.19  ? 800  ILE A CG1   1 
ATOM   6532  C  CG2   . ILE C 3 800  ? -19.433 99.652  38.857  1.00 22.41  ? 800  ILE A CG2   1 
ATOM   6533  C  CD1   . ILE C 3 800  ? -17.690 102.253 38.770  1.00 26.03  ? 800  ILE A CD1   1 
ATOM   6534  N  N     . VAL C 3 801  ? -20.665 98.517  35.813  1.00 21.08  ? 801  VAL A N     1 
ATOM   6535  C  CA    . VAL C 3 801  ? -21.829 97.642  35.717  1.00 20.06  ? 801  VAL A CA    1 
ATOM   6536  C  C     . VAL C 3 801  ? -21.812 96.759  34.488  1.00 20.77  ? 801  VAL A C     1 
ATOM   6537  O  O     . VAL C 3 801  ? -22.641 95.848  34.359  1.00 20.04  ? 801  VAL A O     1 
ATOM   6538  C  CB    . VAL C 3 801  ? -23.156 98.449  35.660  1.00 21.65  ? 801  VAL A CB    1 
ATOM   6539  C  CG1   . VAL C 3 801  ? -23.260 99.363  36.875  1.00 17.21  ? 801  VAL A CG1   1 
ATOM   6540  C  CG2   . VAL C 3 801  ? -23.236 99.251  34.324  1.00 18.56  ? 801  VAL A CG2   1 
ATOM   6541  N  N     . GLY C 3 802  ? -20.867 97.017  33.592  1.00 19.32  ? 802  GLY A N     1 
ATOM   6542  C  CA    . GLY C 3 802  ? -20.823 96.261  32.360  1.00 19.85  ? 802  GLY A CA    1 
ATOM   6543  C  C     . GLY C 3 802  ? -20.202 94.886  32.364  1.00 21.85  ? 802  GLY A C     1 
ATOM   6544  O  O     . GLY C 3 802  ? -19.313 94.577  33.153  1.00 20.41  ? 802  GLY A O     1 
ATOM   6545  N  N     . LYS C 3 803  ? -20.695 94.048  31.464  1.00 24.23  ? 803  LYS A N     1 
ATOM   6546  C  CA    . LYS C 3 803  ? -20.164 92.708  31.300  1.00 27.36  ? 803  LYS A CA    1 
ATOM   6547  C  C     . LYS C 3 803  ? -20.520 92.177  29.930  1.00 27.04  ? 803  LYS A C     1 
ATOM   6548  O  O     . LYS C 3 803  ? -21.692 92.114  29.572  1.00 28.49  ? 803  LYS A O     1 
ATOM   6549  C  CB    . LYS C 3 803  ? -20.701 91.741  32.356  1.00 30.23  ? 803  LYS A CB    1 
ATOM   6550  C  CG    . LYS C 3 803  ? -20.079 90.353  32.212  1.00 30.42  ? 803  LYS A CG    1 
ATOM   6551  C  CD    . LYS C 3 803  ? -20.416 89.436  33.364  1.00 35.56  ? 803  LYS A CD    1 
ATOM   6552  C  CE    . LYS C 3 803  ? -19.783 88.068  33.153  1.00 37.86  ? 803  LYS A CE    1 
ATOM   6553  N  NZ    . LYS C 3 803  ? -18.335 88.200  32.810  1.00 41.08  ? 803  LYS A NZ    1 
ATOM   6554  N  N     . GLU C 3 804  ? -19.506 91.798  29.164  1.00 26.58  ? 804  GLU A N     1 
ATOM   6555  C  CA    . GLU C 3 804  ? -19.753 91.248  27.843  1.00 27.19  ? 804  GLU A CA    1 
ATOM   6556  C  C     . GLU C 3 804  ? -20.513 89.930  27.949  1.00 26.30  ? 804  GLU A C     1 
ATOM   6557  O  O     . GLU C 3 804  ? -20.233 89.109  28.818  1.00 24.67  ? 804  GLU A O     1 
ATOM   6558  C  CB    . GLU C 3 804  ? -18.437 90.996  27.100  1.00 27.02  ? 804  GLU A CB    1 
ATOM   6559  C  CG    . GLU C 3 804  ? -18.339 89.580  26.561  1.00 31.01  ? 804  GLU A CG    1 
ATOM   6560  C  CD    . GLU C 3 804  ? -17.293 89.414  25.487  1.00 36.24  ? 804  GLU A CD    1 
ATOM   6561  O  OE1   . GLU C 3 804  ? -16.085 89.617  25.786  1.00 37.05  ? 804  GLU A OE1   1 
ATOM   6562  O  OE2   . GLU C 3 804  ? -17.689 89.074  24.342  1.00 36.29  ? 804  GLU A OE2   1 
ATOM   6563  N  N     . ARG C 3 805  ? -21.475 89.740  27.054  1.00 28.39  ? 805  ARG A N     1 
ATOM   6564  C  CA    . ARG C 3 805  ? -22.260 88.511  26.989  1.00 31.15  ? 805  ARG A CA    1 
ATOM   6565  C  C     . ARG C 3 805  ? -22.595 88.301  25.520  1.00 32.47  ? 805  ARG A C     1 
ATOM   6566  O  O     . ARG C 3 805  ? -23.555 88.861  25.012  1.00 31.67  ? 805  ARG A O     1 
ATOM   6567  C  CB    . ARG C 3 805  ? -23.559 88.627  27.795  1.00 30.04  ? 805  ARG A CB    1 
ATOM   6568  C  CG    . ARG C 3 805  ? -23.377 88.763  29.304  1.00 30.94  ? 805  ARG A CG    1 
ATOM   6569  C  CD    . ARG C 3 805  ? -24.739 88.773  30.018  1.00 30.91  ? 805  ARG A CD    1 
ATOM   6570  N  NE    . ARG C 3 805  ? -24.637 89.070  31.447  1.00 29.19  ? 805  ARG A NE    1 
ATOM   6571  C  CZ    . ARG C 3 805  ? -24.068 88.265  32.337  1.00 30.26  ? 805  ARG A CZ    1 
ATOM   6572  N  NH1   . ARG C 3 805  ? -23.551 87.105  31.948  1.00 28.90  ? 805  ARG A NH1   1 
ATOM   6573  N  NH2   . ARG C 3 805  ? -24.003 88.626  33.615  1.00 31.29  ? 805  ARG A NH2   1 
ATOM   6574  N  N     . ALA C 3 806  ? -21.791 87.506  24.827  1.00 35.29  ? 806  ALA A N     1 
ATOM   6575  C  CA    . ALA C 3 806  ? -22.044 87.263  23.417  1.00 37.14  ? 806  ALA A CA    1 
ATOM   6576  C  C     . ALA C 3 806  ? -23.191 86.277  23.242  1.00 38.88  ? 806  ALA A C     1 
ATOM   6577  O  O     . ALA C 3 806  ? -24.171 86.571  22.565  1.00 39.63  ? 806  ALA A O     1 
ATOM   6578  C  CB    . ALA C 3 806  ? -20.788 86.742  22.742  1.00 36.34  ? 806  ALA A CB    1 
ATOM   6579  N  N     . ASN C 3 807  ? -23.065 85.115  23.872  1.00 41.46  ? 807  ASN A N     1 
ATOM   6580  C  CA    . ASN C 3 807  ? -24.071 84.058  23.798  1.00 44.05  ? 807  ASN A CA    1 
ATOM   6581  C  C     . ASN C 3 807  ? -25.379 84.372  24.521  1.00 44.47  ? 807  ASN A C     1 
ATOM   6582  O  O     . ASN C 3 807  ? -25.534 85.421  25.146  1.00 44.38  ? 807  ASN A O     1 
ATOM   6583  C  CB    . ASN C 3 807  ? -23.493 82.772  24.376  1.00 46.90  ? 807  ASN A CB    1 
ATOM   6584  C  CG    . ASN C 3 807  ? -22.662 83.032  25.607  1.00 50.53  ? 807  ASN A CG    1 
ATOM   6585  O  OD1   . ASN C 3 807  ? -22.972 83.932  26.394  1.00 51.53  ? 807  ASN A OD1   1 
ATOM   6586  N  ND2   . ASN C 3 807  ? -21.598 82.254  25.787  1.00 52.08  ? 807  ASN A ND2   1 
ATOM   6587  N  N     . SER C 3 808  ? -26.314 83.432  24.430  1.00 45.39  ? 808  SER A N     1 
ATOM   6588  C  CA    . SER C 3 808  ? -27.622 83.559  25.064  1.00 45.99  ? 808  SER A CA    1 
ATOM   6589  C  C     . SER C 3 808  ? -27.630 82.877  26.432  1.00 44.82  ? 808  SER A C     1 
ATOM   6590  O  O     . SER C 3 808  ? -28.478 83.172  27.273  1.00 43.79  ? 808  SER A O     1 
ATOM   6591  C  CB    . SER C 3 808  ? -28.708 82.918  24.183  1.00 47.39  ? 808  SER A CB    1 
ATOM   6592  O  OG    . SER C 3 808  ? -28.768 83.518  22.899  1.00 49.66  ? 808  SER A OG    1 
ATOM   6593  N  N     . SER C 3 809  ? -26.693 81.958  26.644  1.00 44.62  ? 809  SER A N     1 
ATOM   6594  C  CA    . SER C 3 809  ? -26.609 81.237  27.910  1.00 45.22  ? 809  SER A CA    1 
ATOM   6595  C  C     . SER C 3 809  ? -26.775 82.170  29.110  1.00 44.49  ? 809  SER A C     1 
ATOM   6596  O  O     . SER C 3 809  ? -26.391 83.339  29.066  1.00 43.14  ? 809  SER A O     1 
ATOM   6597  C  CB    . SER C 3 809  ? -25.283 80.464  27.999  1.00 45.44  ? 809  SER A CB    1 
ATOM   6598  O  OG    . SER C 3 809  ? -24.185 81.245  27.561  1.00 46.31  ? 809  SER A OG    1 
ATOM   6599  N  N     . ALA C 3 810  ? -27.369 81.643  30.175  1.00 44.78  ? 810  ALA A N     1 
ATOM   6600  C  CA    . ALA C 3 810  ? -27.614 82.417  31.384  1.00 45.68  ? 810  ALA A CA    1 
ATOM   6601  C  C     . ALA C 3 810  ? -26.321 82.703  32.139  1.00 46.32  ? 810  ALA A C     1 
ATOM   6602  O  O     . ALA C 3 810  ? -25.313 82.013  31.953  1.00 45.84  ? 810  ALA A O     1 
ATOM   6603  C  CB    . ALA C 3 810  ? -28.597 81.667  32.285  1.00 44.08  ? 810  ALA A CB    1 
ATOM   6604  N  N     . GLU C 3 811  ? -26.354 83.724  32.992  1.00 46.94  ? 811  GLU A N     1 
ATOM   6605  C  CA    . GLU C 3 811  ? -25.181 84.083  33.779  1.00 48.38  ? 811  GLU A CA    1 
ATOM   6606  C  C     . GLU C 3 811  ? -24.902 82.985  34.801  1.00 47.53  ? 811  GLU A C     1 
ATOM   6607  O  O     . GLU C 3 811  ? -25.806 82.238  35.180  1.00 46.98  ? 811  GLU A O     1 
ATOM   6608  C  CB    . GLU C 3 811  ? -25.406 85.417  34.499  1.00 50.71  ? 811  GLU A CB    1 
ATOM   6609  C  CG    . GLU C 3 811  ? -26.327 85.342  35.713  1.00 53.45  ? 811  GLU A CG    1 
ATOM   6610  C  CD    . GLU C 3 811  ? -26.651 86.715  36.279  1.00 56.06  ? 811  GLU A CD    1 
ATOM   6611  O  OE1   . GLU C 3 811  ? -25.710 87.505  36.520  1.00 57.35  ? 811  GLU A OE1   1 
ATOM   6612  O  OE2   . GLU C 3 811  ? -27.849 87.003  36.487  1.00 57.82  ? 811  GLU A OE2   1 
ATOM   6613  N  N     . GLU C 3 812  ? -23.650 82.890  35.240  1.00 46.73  ? 812  GLU A N     1 
ATOM   6614  C  CA    . GLU C 3 812  ? -23.256 81.883  36.219  1.00 46.13  ? 812  GLU A CA    1 
ATOM   6615  C  C     . GLU C 3 812  ? -24.010 82.077  37.536  1.00 44.58  ? 812  GLU A C     1 
ATOM   6616  O  O     . GLU C 3 812  ? -24.323 83.206  37.915  1.00 42.63  ? 812  GLU A O     1 
ATOM   6617  C  CB    . GLU C 3 812  ? -21.747 81.957  36.442  1.00 47.98  ? 812  GLU A CB    1 
ATOM   6618  C  CG    . GLU C 3 812  ? -20.941 81.520  35.219  1.00 50.54  ? 812  GLU A CG    1 
ATOM   6619  C  CD    . GLU C 3 812  ? -19.623 82.270  35.072  1.00 53.46  ? 812  GLU A CD    1 
ATOM   6620  O  OE1   . GLU C 3 812  ? -18.757 82.172  35.975  1.00 54.30  ? 812  GLU A OE1   1 
ATOM   6621  O  OE2   . GLU C 3 812  ? -19.453 82.966  34.044  1.00 54.46  ? 812  GLU A OE2   1 
ATOM   6622  N  N     . PRO C 3 813  ? -24.325 80.969  38.240  1.00 44.04  ? 813  PRO A N     1 
ATOM   6623  C  CA    . PRO C 3 813  ? -25.050 81.004  39.519  1.00 42.96  ? 813  PRO A CA    1 
ATOM   6624  C  C     . PRO C 3 813  ? -24.382 81.917  40.542  1.00 42.68  ? 813  PRO A C     1 
ATOM   6625  O  O     . PRO C 3 813  ? -23.151 81.975  40.633  1.00 42.03  ? 813  PRO A O     1 
ATOM   6626  C  CB    . PRO C 3 813  ? -25.055 79.538  39.960  1.00 42.93  ? 813  PRO A CB    1 
ATOM   6627  C  CG    . PRO C 3 813  ? -25.037 78.796  38.659  1.00 43.94  ? 813  PRO A CG    1 
ATOM   6628  C  CD    . PRO C 3 813  ? -24.020 79.580  37.854  1.00 43.31  ? 813  PRO A CD    1 
ATOM   6629  N  N     . TRP C 3 814  ? -25.216 82.603  41.320  1.00 42.22  ? 814  TRP A N     1 
ATOM   6630  C  CA    . TRP C 3 814  ? -24.780 83.562  42.333  1.00 41.39  ? 814  TRP A CA    1 
ATOM   6631  C  C     . TRP C 3 814  ? -23.310 83.689  42.673  1.00 43.38  ? 814  TRP A C     1 
ATOM   6632  O  O     . TRP C 3 814  ? -22.608 84.519  42.084  1.00 48.42  ? 814  TRP A O     1 
ATOM   6633  C  CB    . TRP C 3 814  ? -25.533 83.378  43.654  1.00 38.32  ? 814  TRP A CB    1 
ATOM   6634  C  CG    . TRP C 3 814  ? -24.969 84.242  44.752  1.00 34.40  ? 814  TRP A CG    1 
ATOM   6635  C  CD1   . TRP C 3 814  ? -24.835 85.601  44.735  1.00 33.86  ? 814  TRP A CD1   1 
ATOM   6636  C  CD2   . TRP C 3 814  ? -24.451 83.807  46.021  1.00 33.58  ? 814  TRP A CD2   1 
ATOM   6637  N  NE1   . TRP C 3 814  ? -24.269 86.042  45.910  1.00 31.99  ? 814  TRP A NE1   1 
ATOM   6638  C  CE2   . TRP C 3 814  ? -24.024 84.965  46.718  1.00 31.95  ? 814  TRP A CE2   1 
ATOM   6639  C  CE3   . TRP C 3 814  ? -24.309 82.552  46.638  1.00 33.87  ? 814  TRP A CE3   1 
ATOM   6640  C  CZ2   . TRP C 3 814  ? -23.464 84.908  47.999  1.00 31.98  ? 814  TRP A CZ2   1 
ATOM   6641  C  CZ3   . TRP C 3 814  ? -23.747 82.494  47.922  1.00 32.38  ? 814  TRP A CZ3   1 
ATOM   6642  C  CH2   . TRP C 3 814  ? -23.334 83.669  48.584  1.00 33.39  ? 814  TRP A CH2   1 
ATOM   6643  N  N     . PRO C 3 815  ? -22.809 82.843  43.591  1.00 41.62  ? 815  PRO A N     1 
ATOM   6644  C  CA    . PRO C 3 815  ? -21.397 82.941  43.981  1.00 39.23  ? 815  PRO A CA    1 
ATOM   6645  C  C     . PRO C 3 815  ? -20.495 83.663  42.968  1.00 37.77  ? 815  PRO A C     1 
ATOM   6646  O  O     . PRO C 3 815  ? -19.820 84.632  43.310  1.00 37.90  ? 815  PRO A O     1 
ATOM   6647  C  CB    . PRO C 3 815  ? -20.996 81.484  44.195  1.00 39.42  ? 815  PRO A CB    1 
ATOM   6648  C  CG    . PRO C 3 815  ? -22.254 80.860  44.645  1.00 38.94  ? 815  PRO A CG    1 
ATOM   6649  C  CD    . PRO C 3 815  ? -23.271 81.444  43.711  1.00 38.77  ? 815  PRO A CD    1 
ATOM   6650  N  N     . ALA C 3 816  ? -20.509 83.201  41.721  1.00 35.67  ? 816  ALA A N     1 
ATOM   6651  C  CA    . ALA C 3 816  ? -19.675 83.773  40.664  1.00 34.86  ? 816  ALA A CA    1 
ATOM   6652  C  C     . ALA C 3 816  ? -19.588 85.299  40.616  1.00 33.35  ? 816  ALA A C     1 
ATOM   6653  O  O     . ALA C 3 816  ? -18.519 85.849  40.361  1.00 35.02  ? 816  ALA A O     1 
ATOM   6654  C  CB    . ALA C 3 816  ? -20.133 83.245  39.310  1.00 35.39  ? 816  ALA A CB    1 
ATOM   6655  N  N     . ILE C 3 817  ? -20.702 85.977  40.862  1.00 30.82  ? 817  ILE A N     1 
ATOM   6656  C  CA    . ILE C 3 817  ? -20.739 87.434  40.816  1.00 28.69  ? 817  ILE A CA    1 
ATOM   6657  C  C     . ILE C 3 817  ? -19.726 88.103  41.743  1.00 29.27  ? 817  ILE A C     1 
ATOM   6658  O  O     . ILE C 3 817  ? -19.217 89.186  41.441  1.00 29.64  ? 817  ILE A O     1 
ATOM   6659  C  CB    . ILE C 3 817  ? -22.169 87.965  41.154  1.00 27.89  ? 817  ILE A CB    1 
ATOM   6660  C  CG1   . ILE C 3 817  ? -22.208 89.498  41.075  1.00 29.23  ? 817  ILE A CG1   1 
ATOM   6661  C  CG2   . ILE C 3 817  ? -22.583 87.525  42.553  1.00 23.13  ? 817  ILE A CG2   1 
ATOM   6662  C  CD1   . ILE C 3 817  ? -22.028 90.069  39.683  1.00 27.70  ? 817  ILE A CD1   1 
ATOM   6663  N  N     . LEU C 3 818  ? -19.424 87.461  42.867  1.00 28.60  ? 818  LEU A N     1 
ATOM   6664  C  CA    . LEU C 3 818  ? -18.486 88.038  43.816  1.00 29.47  ? 818  LEU A CA    1 
ATOM   6665  C  C     . LEU C 3 818  ? -17.099 88.251  43.217  1.00 30.78  ? 818  LEU A C     1 
ATOM   6666  O  O     . LEU C 3 818  ? -16.463 89.280  43.468  1.00 31.99  ? 818  LEU A O     1 
ATOM   6667  C  CB    . LEU C 3 818  ? -18.407 87.177  45.079  1.00 29.11  ? 818  LEU A CB    1 
ATOM   6668  C  CG    . LEU C 3 818  ? -19.699 87.114  45.915  1.00 29.44  ? 818  LEU A CG    1 
ATOM   6669  C  CD1   . LEU C 3 818  ? -19.431 86.384  47.234  1.00 29.37  ? 818  LEU A CD1   1 
ATOM   6670  C  CD2   . LEU C 3 818  ? -20.214 88.519  46.195  1.00 27.46  ? 818  LEU A CD2   1 
ATOM   6671  N  N     . ASP C 3 819  ? -16.623 87.302  42.415  1.00 30.23  ? 819  ASP A N     1 
ATOM   6672  C  CA    . ASP C 3 819  ? -15.310 87.472  41.811  1.00 29.34  ? 819  ASP A CA    1 
ATOM   6673  C  C     . ASP C 3 819  ? -15.321 88.703  40.907  1.00 28.98  ? 819  ASP A C     1 
ATOM   6674  O  O     . ASP C 3 819  ? -14.341 89.441  40.847  1.00 28.95  ? 819  ASP A O     1 
ATOM   6675  C  CB    . ASP C 3 819  ? -14.906 86.222  41.025  1.00 30.91  ? 819  ASP A CB    1 
ATOM   6676  C  CG    . ASP C 3 819  ? -14.563 85.046  41.936  1.00 33.85  ? 819  ASP A CG    1 
ATOM   6677  O  OD1   . ASP C 3 819  ? -13.977 85.290  43.011  1.00 33.67  ? 819  ASP A OD1   1 
ATOM   6678  O  OD2   . ASP C 3 819  ? -14.865 83.884  41.580  1.00 35.91  ? 819  ASP A OD2   1 
ATOM   6679  N  N     . GLN C 3 820  ? -16.446 88.926  40.230  1.00 28.03  ? 820  GLN A N     1 
ATOM   6680  C  CA    . GLN C 3 820  ? -16.613 90.067  39.341  1.00 27.60  ? 820  GLN A CA    1 
ATOM   6681  C  C     . GLN C 3 820  ? -16.634 91.374  40.116  1.00 26.97  ? 820  GLN A C     1 
ATOM   6682  O  O     . GLN C 3 820  ? -16.091 92.380  39.671  1.00 25.64  ? 820  GLN A O     1 
ATOM   6683  C  CB    . GLN C 3 820  ? -17.910 89.932  38.549  1.00 30.07  ? 820  GLN A CB    1 
ATOM   6684  C  CG    . GLN C 3 820  ? -17.834 88.958  37.388  1.00 34.31  ? 820  GLN A CG    1 
ATOM   6685  C  CD    . GLN C 3 820  ? -19.197 88.652  36.794  1.00 36.64  ? 820  GLN A CD    1 
ATOM   6686  O  OE1   . GLN C 3 820  ? -19.971 89.561  36.483  1.00 36.18  ? 820  GLN A OE1   1 
ATOM   6687  N  NE2   . GLN C 3 820  ? -19.498 87.362  36.631  1.00 38.14  ? 820  GLN A NE2   1 
ATOM   6688  N  N     . ILE C 3 821  ? -17.277 91.362  41.276  1.00 27.99  ? 821  ILE A N     1 
ATOM   6689  C  CA    . ILE C 3 821  ? -17.353 92.554  42.106  1.00 27.99  ? 821  ILE A CA    1 
ATOM   6690  C  C     . ILE C 3 821  ? -15.945 92.863  42.634  1.00 28.05  ? 821  ILE A C     1 
ATOM   6691  O  O     . ILE C 3 821  ? -15.538 94.031  42.726  1.00 27.18  ? 821  ILE A O     1 
ATOM   6692  C  CB    . ILE C 3 821  ? -18.341 92.331  43.277  1.00 29.57  ? 821  ILE A CB    1 
ATOM   6693  C  CG1   . ILE C 3 821  ? -19.734 92.026  42.720  1.00 28.89  ? 821  ILE A CG1   1 
ATOM   6694  C  CG2   . ILE C 3 821  ? -18.397 93.560  44.173  1.00 31.01  ? 821  ILE A CG2   1 
ATOM   6695  C  CD1   . ILE C 3 821  ? -20.305 93.126  41.842  1.00 30.08  ? 821  ILE A CD1   1 
ATOM   6696  N  N     . MET C 3 822  ? -15.192 91.816  42.968  1.00 27.07  ? 822  MET A N     1 
ATOM   6697  C  CA    . MET C 3 822  ? -13.832 92.030  43.455  1.00 27.51  ? 822  MET A CA    1 
ATOM   6698  C  C     . MET C 3 822  ? -12.981 92.598  42.333  1.00 27.16  ? 822  MET A C     1 
ATOM   6699  O  O     . MET C 3 822  ? -12.124 93.453  42.574  1.00 26.56  ? 822  MET A O     1 
ATOM   6700  C  CB    . MET C 3 822  ? -13.210 90.736  43.987  1.00 24.12  ? 822  MET A CB    1 
ATOM   6701  C  CG    . MET C 3 822  ? -13.688 90.380  45.394  1.00 24.78  ? 822  MET A CG    1 
ATOM   6702  S  SD    . MET C 3 822  ? -13.673 91.790  46.582  1.00 25.71  ? 822  MET A SD    1 
ATOM   6703  C  CE    . MET C 3 822  ? -11.909 92.068  46.819  1.00 20.83  ? 822  MET A CE    1 
ATOM   6704  N  N     . GLY C 3 823  ? -13.234 92.126  41.111  1.00 26.27  ? 823  GLY A N     1 
ATOM   6705  C  CA    . GLY C 3 823  ? -12.504 92.609  39.952  1.00 25.66  ? 823  GLY A CA    1 
ATOM   6706  C  C     . GLY C 3 823  ? -12.799 94.085  39.720  1.00 26.72  ? 823  GLY A C     1 
ATOM   6707  O  O     . GLY C 3 823  ? -11.929 94.844  39.283  1.00 26.97  ? 823  GLY A O     1 
ATOM   6708  N  N     . VAL C 3 824  ? -14.036 94.489  40.007  1.00 25.74  ? 824  VAL A N     1 
ATOM   6709  C  CA    . VAL C 3 824  ? -14.444 95.883  39.867  1.00 24.85  ? 824  VAL A CA    1 
ATOM   6710  C  C     . VAL C 3 824  ? -13.667 96.700  40.902  1.00 25.34  ? 824  VAL A C     1 
ATOM   6711  O  O     . VAL C 3 824  ? -13.249 97.821  40.626  1.00 27.26  ? 824  VAL A O     1 
ATOM   6712  C  CB    . VAL C 3 824  ? -15.953 96.049  40.118  1.00 24.98  ? 824  VAL A CB    1 
ATOM   6713  C  CG1   . VAL C 3 824  ? -16.312 97.513  40.196  1.00 22.83  ? 824  VAL A CG1   1 
ATOM   6714  C  CG2   . VAL C 3 824  ? -16.735 95.354  39.018  1.00 23.69  ? 824  VAL A CG2   1 
ATOM   6715  N  N     . PHE C 3 825  ? -13.483 96.143  42.096  1.00 22.50  ? 825  PHE A N     1 
ATOM   6716  C  CA    . PHE C 3 825  ? -12.720 96.844  43.115  1.00 22.55  ? 825  PHE A CA    1 
ATOM   6717  C  C     . PHE C 3 825  ? -11.262 96.988  42.677  1.00 22.60  ? 825  PHE A C     1 
ATOM   6718  O  O     . PHE C 3 825  ? -10.698 98.083  42.722  1.00 23.61  ? 825  PHE A O     1 
ATOM   6719  C  CB    . PHE C 3 825  ? -12.749 96.098  44.453  1.00 21.72  ? 825  PHE A CB    1 
ATOM   6720  C  CG    . PHE C 3 825  ? -11.767 96.643  45.464  1.00 21.33  ? 825  PHE A CG    1 
ATOM   6721  C  CD1   . PHE C 3 825  ? -11.926 97.925  45.988  1.00 22.02  ? 825  PHE A CD1   1 
ATOM   6722  C  CD2   . PHE C 3 825  ? -10.665 95.886  45.869  1.00 20.45  ? 825  PHE A CD2   1 
ATOM   6723  C  CE1   . PHE C 3 825  ? -11.004 98.444  46.899  1.00 20.56  ? 825  PHE A CE1   1 
ATOM   6724  C  CE2   . PHE C 3 825  ? -9.740  96.391  46.777  1.00 18.53  ? 825  PHE A CE2   1 
ATOM   6725  C  CZ    . PHE C 3 825  ? -9.907  97.673  47.294  1.00 21.15  ? 825  PHE A CZ    1 
ATOM   6726  N  N     . PHE C 3 826  ? -10.653 95.881  42.250  1.00 21.91  ? 826  PHE A N     1 
ATOM   6727  C  CA    . PHE C 3 826  ? -9.255  95.909  41.828  1.00 21.99  ? 826  PHE A CA    1 
ATOM   6728  C  C     . PHE C 3 826  ? -9.004  96.854  40.659  1.00 23.17  ? 826  PHE A C     1 
ATOM   6729  O  O     . PHE C 3 826  ? -7.932  97.451  40.574  1.00 23.56  ? 826  PHE A O     1 
ATOM   6730  C  CB    . PHE C 3 826  ? -8.748  94.493  41.504  1.00 20.25  ? 826  PHE A CB    1 
ATOM   6731  C  CG    . PHE C 3 826  ? -8.681  93.578  42.709  1.00 18.56  ? 826  PHE A CG    1 
ATOM   6732  C  CD1   . PHE C 3 826  ? -8.041  93.987  43.878  1.00 18.39  ? 826  PHE A CD1   1 
ATOM   6733  C  CD2   . PHE C 3 826  ? -9.275  92.314  42.680  1.00 17.67  ? 826  PHE A CD2   1 
ATOM   6734  C  CE1   . PHE C 3 826  ? -7.996  93.151  45.012  1.00 19.06  ? 826  PHE A CE1   1 
ATOM   6735  C  CE2   . PHE C 3 826  ? -9.241  91.474  43.799  1.00 16.94  ? 826  PHE A CE2   1 
ATOM   6736  C  CZ    . PHE C 3 826  ? -8.599  91.896  44.971  1.00 18.18  ? 826  PHE A CZ    1 
ATOM   6737  N  N     . ASN C 3 827  ? -9.979  96.997  39.761  1.00 24.47  ? 827  ASN A N     1 
ATOM   6738  C  CA    . ASN C 3 827  ? -9.819  97.921  38.639  1.00 26.33  ? 827  ASN A CA    1 
ATOM   6739  C  C     . ASN C 3 827  ? -9.726  99.350  39.166  1.00 27.23  ? 827  ASN A C     1 
ATOM   6740  O  O     . ASN C 3 827  ? -8.939  100.148 38.666  1.00 29.35  ? 827  ASN A O     1 
ATOM   6741  C  CB    . ASN C 3 827  ? -10.999 97.847  37.665  1.00 28.55  ? 827  ASN A CB    1 
ATOM   6742  C  CG    . ASN C 3 827  ? -10.884 96.699  36.681  1.00 30.58  ? 827  ASN A CG    1 
ATOM   6743  O  OD1   . ASN C 3 827  ? -9.788  96.203  36.386  1.00 30.32  ? 827  ASN A OD1   1 
ATOM   6744  N  ND2   . ASN C 3 827  ? -12.022 96.284  36.143  1.00 30.30  ? 827  ASN A ND2   1 
ATOM   6745  N  N     . GLY C 3 828  ? -10.538 99.670  40.171  1.00 26.63  ? 828  GLY A N     1 
ATOM   6746  C  CA    . GLY C 3 828  ? -10.511 101.005 40.737  1.00 26.51  ? 828  GLY A CA    1 
ATOM   6747  C  C     . GLY C 3 828  ? -9.157  101.311 41.356  1.00 27.47  ? 828  GLY A C     1 
ATOM   6748  O  O     . GLY C 3 828  ? -8.691  102.464 41.331  1.00 26.95  ? 828  GLY A O     1 
ATOM   6749  N  N     . VAL C 3 829  ? -8.525  100.281 41.918  1.00 25.42  ? 829  VAL A N     1 
ATOM   6750  C  CA    . VAL C 3 829  ? -7.218  100.450 42.536  1.00 24.82  ? 829  VAL A CA    1 
ATOM   6751  C  C     . VAL C 3 829  ? -6.179  100.727 41.449  1.00 25.94  ? 829  VAL A C     1 
ATOM   6752  O  O     . VAL C 3 829  ? -5.286  101.556 41.633  1.00 27.76  ? 829  VAL A O     1 
ATOM   6753  C  CB    . VAL C 3 829  ? -6.790  99.190  43.350  1.00 24.95  ? 829  VAL A CB    1 
ATOM   6754  C  CG1   . VAL C 3 829  ? -5.402  99.420  43.966  1.00 21.79  ? 829  VAL A CG1   1 
ATOM   6755  C  CG2   . VAL C 3 829  ? -7.815  98.890  44.463  1.00 21.29  ? 829  VAL A CG2   1 
ATOM   6756  N  N     . HIS C 3 830  ? -6.304  100.047 40.313  1.00 25.14  ? 830  HIS A N     1 
ATOM   6757  C  CA    . HIS C 3 830  ? -5.368  100.239 39.214  1.00 25.81  ? 830  HIS A CA    1 
ATOM   6758  C  C     . HIS C 3 830  ? -5.668  101.508 38.436  1.00 25.94  ? 830  HIS A C     1 
ATOM   6759  O  O     . HIS C 3 830  ? -4.774  102.065 37.804  1.00 28.07  ? 830  HIS A O     1 
ATOM   6760  C  CB    . HIS C 3 830  ? -5.407  99.048  38.249  1.00 26.93  ? 830  HIS A CB    1 
ATOM   6761  C  CG    . HIS C 3 830  ? -4.879  97.778  38.834  1.00 28.71  ? 830  HIS A CG    1 
ATOM   6762  N  ND1   . HIS C 3 830  ? -3.564  97.625  39.215  1.00 29.51  ? 830  HIS A ND1   1 
ATOM   6763  C  CD2   . HIS C 3 830  ? -5.487  96.597  39.101  1.00 29.47  ? 830  HIS A CD2   1 
ATOM   6764  C  CE1   . HIS C 3 830  ? -3.383  96.405  39.688  1.00 27.89  ? 830  HIS A CE1   1 
ATOM   6765  N  NE2   . HIS C 3 830  ? -4.535  95.760  39.630  1.00 29.61  ? 830  HIS A NE2   1 
ATOM   6766  N  N     . ASP C 3 831  ? -6.926  101.943 38.456  1.00 24.06  ? 831  ASP A N     1 
ATOM   6767  C  CA    . ASP C 3 831  ? -7.341  103.151 37.751  1.00 23.07  ? 831  ASP A CA    1 
ATOM   6768  C  C     . ASP C 3 831  ? -7.137  104.389 38.600  1.00 23.88  ? 831  ASP A C     1 
ATOM   6769  O  O     . ASP C 3 831  ? -7.360  105.519 38.143  1.00 22.81  ? 831  ASP A O     1 
ATOM   6770  C  CB    . ASP C 3 831  ? -8.808  103.069 37.358  1.00 25.69  ? 831  ASP A CB    1 
ATOM   6771  C  CG    . ASP C 3 831  ? -9.022  102.281 36.102  1.00 28.49  ? 831  ASP A CG    1 
ATOM   6772  O  OD1   . ASP C 3 831  ? -8.152  102.362 35.212  1.00 32.65  ? 831  ASP A OD1   1 
ATOM   6773  O  OD2   . ASP C 3 831  ? -10.063 101.598 35.991  1.00 32.45  ? 831  ASP A OD2   1 
ATOM   6774  N  N     . GLY C 3 832  ? -6.740  104.163 39.850  1.00 25.03  ? 832  GLY A N     1 
ATOM   6775  C  CA    . GLY C 3 832  ? -6.482  105.257 40.770  1.00 24.60  ? 832  GLY A CA    1 
ATOM   6776  C  C     . GLY C 3 832  ? -7.638  106.120 41.243  1.00 22.74  ? 832  GLY A C     1 
ATOM   6777  O  O     . GLY C 3 832  ? -7.500  107.336 41.323  1.00 22.51  ? 832  GLY A O     1 
ATOM   6778  N  N     . LEU C 3 833  ? -8.770  105.514 41.573  1.00 21.33  ? 833  LEU A N     1 
ATOM   6779  C  CA    . LEU C 3 833  ? -9.898  106.297 42.067  1.00 21.25  ? 833  LEU A CA    1 
ATOM   6780  C  C     . LEU C 3 833  ? -9.572  106.853 43.464  1.00 22.63  ? 833  LEU A C     1 
ATOM   6781  O  O     . LEU C 3 833  ? -8.520  106.542 44.031  1.00 24.20  ? 833  LEU A O     1 
ATOM   6782  C  CB    . LEU C 3 833  ? -11.148 105.421 42.131  1.00 19.31  ? 833  LEU A CB    1 
ATOM   6783  C  CG    . LEU C 3 833  ? -11.424 104.639 40.846  1.00 19.02  ? 833  LEU A CG    1 
ATOM   6784  C  CD1   . LEU C 3 833  ? -12.826 104.083 40.865  1.00 16.44  ? 833  LEU A CD1   1 
ATOM   6785  C  CD2   . LEU C 3 833  ? -11.240 105.549 39.657  1.00 18.67  ? 833  LEU A CD2   1 
ATOM   6786  N  N     . GLN C 3 834  ? -10.460 107.673 44.022  1.00 21.21  ? 834  GLN A N     1 
ATOM   6787  C  CA    . GLN C 3 834  ? -10.226 108.235 45.353  1.00 20.36  ? 834  GLN A CA    1 
ATOM   6788  C  C     . GLN C 3 834  ? -10.328 107.077 46.352  1.00 20.51  ? 834  GLN A C     1 
ATOM   6789  O  O     . GLN C 3 834  ? -11.420 106.599 46.649  1.00 21.29  ? 834  GLN A O     1 
ATOM   6790  C  CB    . GLN C 3 834  ? -11.268 109.320 45.636  1.00 20.80  ? 834  GLN A CB    1 
ATOM   6791  C  CG    . GLN C 3 834  ? -11.204 110.496 44.654  1.00 17.77  ? 834  GLN A CG    1 
ATOM   6792  C  CD    . GLN C 3 834  ? -9.846  111.188 44.664  1.00 18.05  ? 834  GLN A CD    1 
ATOM   6793  O  OE1   . GLN C 3 834  ? -9.391  111.648 45.707  1.00 20.53  ? 834  GLN A OE1   1 
ATOM   6794  N  NE2   . GLN C 3 834  ? -9.197  111.263 43.503  1.00 19.05  ? 834  GLN A NE2   1 
ATOM   6795  N  N     . TRP C 3 835  ? -9.188  106.638 46.881  1.00 20.42  ? 835  TRP A N     1 
ATOM   6796  C  CA    . TRP C 3 835  ? -9.176  105.472 47.754  1.00 21.04  ? 835  TRP A CA    1 
ATOM   6797  C  C     . TRP C 3 835  ? -10.290 105.351 48.780  1.00 21.97  ? 835  TRP A C     1 
ATOM   6798  O  O     . TRP C 3 835  ? -10.962 104.324 48.812  1.00 23.09  ? 835  TRP A O     1 
ATOM   6799  C  CB    . TRP C 3 835  ? -7.785  105.250 48.415  1.00 20.58  ? 835  TRP A CB    1 
ATOM   6800  C  CG    . TRP C 3 835  ? -7.317  106.246 49.472  1.00 19.56  ? 835  TRP A CG    1 
ATOM   6801  C  CD1   . TRP C 3 835  ? -6.931  107.536 49.269  1.00 19.34  ? 835  TRP A CD1   1 
ATOM   6802  C  CD2   . TRP C 3 835  ? -7.179  106.005 50.883  1.00 19.51  ? 835  TRP A CD2   1 
ATOM   6803  N  NE1   . TRP C 3 835  ? -6.562  108.120 50.459  1.00 20.83  ? 835  TRP A NE1   1 
ATOM   6804  C  CE2   . TRP C 3 835  ? -6.707  107.204 51.468  1.00 20.64  ? 835  TRP A CE2   1 
ATOM   6805  C  CE3   . TRP C 3 835  ? -7.409  104.895 51.712  1.00 20.65  ? 835  TRP A CE3   1 
ATOM   6806  C  CZ2   . TRP C 3 835  ? -6.462  107.326 52.848  1.00 21.12  ? 835  TRP A CZ2   1 
ATOM   6807  C  CZ3   . TRP C 3 835  ? -7.166  105.016 53.089  1.00 20.47  ? 835  TRP A CZ3   1 
ATOM   6808  C  CH2   . TRP C 3 835  ? -6.698  106.225 53.639  1.00 20.98  ? 835  TRP A CH2   1 
ATOM   6809  N  N     . GLN C 3 836  ? -10.520 106.366 49.606  1.00 22.06  ? 836  GLN A N     1 
ATOM   6810  C  CA    . GLN C 3 836  ? -11.579 106.229 50.594  1.00 22.49  ? 836  GLN A CA    1 
ATOM   6811  C  C     . GLN C 3 836  ? -12.956 106.067 49.962  1.00 22.78  ? 836  GLN A C     1 
ATOM   6812  O  O     . GLN C 3 836  ? -13.658 105.102 50.261  1.00 21.97  ? 836  GLN A O     1 
ATOM   6813  C  CB    . GLN C 3 836  ? -11.579 107.409 51.569  1.00 23.48  ? 836  GLN A CB    1 
ATOM   6814  C  CG    . GLN C 3 836  ? -10.471 107.348 52.600  1.00 24.65  ? 836  GLN A CG    1 
ATOM   6815  C  CD    . GLN C 3 836  ? -10.402 108.590 53.466  1.00 24.29  ? 836  GLN A CD    1 
ATOM   6816  O  OE1   . GLN C 3 836  ? -9.993  109.653 53.006  1.00 25.47  ? 836  GLN A OE1   1 
ATOM   6817  N  NE2   . GLN C 3 836  ? -10.810 108.463 54.726  1.00 24.68  ? 836  GLN A NE2   1 
ATOM   6818  N  N     . ARG C 3 837  ? -13.345 106.991 49.087  1.00 22.37  ? 837  ARG A N     1 
ATOM   6819  C  CA    . ARG C 3 837  ? -14.657 106.897 48.460  1.00 22.78  ? 837  ARG A CA    1 
ATOM   6820  C  C     . ARG C 3 837  ? -14.826 105.530 47.806  1.00 22.99  ? 837  ARG A C     1 
ATOM   6821  O  O     . ARG C 3 837  ? -15.883 104.906 47.915  1.00 23.56  ? 837  ARG A O     1 
ATOM   6822  C  CB    . ARG C 3 837  ? -14.841 107.981 47.395  1.00 25.55  ? 837  ARG A CB    1 
ATOM   6823  C  CG    . ARG C 3 837  ? -14.503 109.393 47.842  1.00 28.62  ? 837  ARG A CG    1 
ATOM   6824  C  CD    . ARG C 3 837  ? -15.383 109.869 48.975  1.00 29.95  ? 837  ARG A CD    1 
ATOM   6825  N  NE    . ARG C 3 837  ? -16.787 109.855 48.607  1.00 32.55  ? 837  ARG A NE    1 
ATOM   6826  C  CZ    . ARG C 3 837  ? -17.613 110.884 48.764  1.00 32.29  ? 837  ARG A CZ    1 
ATOM   6827  N  NH1   . ARG C 3 837  ? -17.175 112.021 49.287  1.00 31.24  ? 837  ARG A NH1   1 
ATOM   6828  N  NH2   . ARG C 3 837  ? -18.880 110.772 48.392  1.00 33.20  ? 837  ARG A NH2   1 
ATOM   6829  N  N     . TRP C 3 838  ? -13.779 105.070 47.125  1.00 22.01  ? 838  TRP A N     1 
ATOM   6830  C  CA    . TRP C 3 838  ? -13.810 103.780 46.434  1.00 20.79  ? 838  TRP A CA    1 
ATOM   6831  C  C     . TRP C 3 838  ? -13.917 102.582 47.370  1.00 21.21  ? 838  TRP A C     1 
ATOM   6832  O  O     . TRP C 3 838  ? -14.678 101.644 47.115  1.00 19.13  ? 838  TRP A O     1 
ATOM   6833  C  CB    . TRP C 3 838  ? -12.566 103.608 45.566  1.00 19.23  ? 838  TRP A CB    1 
ATOM   6834  C  CG    . TRP C 3 838  ? -12.661 102.402 44.682  1.00 18.63  ? 838  TRP A CG    1 
ATOM   6835  C  CD1   . TRP C 3 838  ? -11.745 101.397 44.567  1.00 16.90  ? 838  TRP A CD1   1 
ATOM   6836  C  CD2   . TRP C 3 838  ? -13.722 102.086 43.774  1.00 15.60  ? 838  TRP A CD2   1 
ATOM   6837  N  NE1   . TRP C 3 838  ? -12.165 100.481 43.644  1.00 17.24  ? 838  TRP A NE1   1 
ATOM   6838  C  CE2   . TRP C 3 838  ? -13.375 100.875 43.138  1.00 16.73  ? 838  TRP A CE2   1 
ATOM   6839  C  CE3   . TRP C 3 838  ? -14.932 102.708 43.437  1.00 15.99  ? 838  TRP A CE3   1 
ATOM   6840  C  CZ2   . TRP C 3 838  ? -14.194 100.267 42.174  1.00 16.15  ? 838  TRP A CZ2   1 
ATOM   6841  C  CZ3   . TRP C 3 838  ? -15.752 102.106 42.477  1.00 17.02  ? 838  TRP A CZ3   1 
ATOM   6842  C  CH2   . TRP C 3 838  ? -15.374 100.893 41.856  1.00 17.65  ? 838  TRP A CH2   1 
ATOM   6843  N  N     . ILE C 3 839  ? -13.138 102.613 48.446  1.00 21.59  ? 839  ILE A N     1 
ATOM   6844  C  CA    . ILE C 3 839  ? -13.152 101.535 49.411  1.00 20.56  ? 839  ILE A CA    1 
ATOM   6845  C  C     . ILE C 3 839  ? -14.506 101.449 50.080  1.00 20.05  ? 839  ILE A C     1 
ATOM   6846  O  O     . ILE C 3 839  ? -15.063 100.362 50.208  1.00 20.75  ? 839  ILE A O     1 
ATOM   6847  C  CB    . ILE C 3 839  ? -12.039 101.722 50.467  1.00 21.99  ? 839  ILE A CB    1 
ATOM   6848  C  CG1   . ILE C 3 839  ? -10.685 101.436 49.805  1.00 20.76  ? 839  ILE A CG1   1 
ATOM   6849  C  CG2   . ILE C 3 839  ? -12.280 100.800 51.687  1.00 20.09  ? 839  ILE A CG2   1 
ATOM   6850  C  CD1   . ILE C 3 839  ? -9.499  101.634 50.705  1.00 24.68  ? 839  ILE A CD1   1 
ATOM   6851  N  N     . ARG C 3 840  ? -15.049 102.590 50.491  1.00 21.08  ? 840  ARG A N     1 
ATOM   6852  C  CA    . ARG C 3 840  ? -16.354 102.599 51.146  1.00 21.74  ? 840  ARG A CA    1 
ATOM   6853  C  C     . ARG C 3 840  ? -17.437 102.061 50.212  1.00 21.44  ? 840  ARG A C     1 
ATOM   6854  O  O     . ARG C 3 840  ? -18.259 101.227 50.604  1.00 22.28  ? 840  ARG A O     1 
ATOM   6855  C  CB    . ARG C 3 840  ? -16.743 104.008 51.601  1.00 21.86  ? 840  ARG A CB    1 
ATOM   6856  C  CG    . ARG C 3 840  ? -18.154 104.048 52.194  1.00 23.55  ? 840  ARG A CG    1 
ATOM   6857  C  CD    . ARG C 3 840  ? -18.527 105.408 52.718  1.00 24.28  ? 840  ARG A CD    1 
ATOM   6858  N  NE    . ARG C 3 840  ? -18.535 106.423 51.669  1.00 25.86  ? 840  ARG A NE    1 
ATOM   6859  C  CZ    . ARG C 3 840  ? -18.882 107.690 51.872  1.00 25.87  ? 840  ARG A CZ    1 
ATOM   6860  N  NH1   . ARG C 3 840  ? -19.249 108.094 53.086  1.00 24.34  ? 840  ARG A NH1   1 
ATOM   6861  N  NH2   . ARG C 3 840  ? -18.867 108.552 50.862  1.00 26.71  ? 840  ARG A NH2   1 
ATOM   6862  N  N     . TYR C 3 841  ? -17.438 102.540 48.977  1.00 19.78  ? 841  TYR A N     1 
ATOM   6863  C  CA    . TYR C 3 841  ? -18.425 102.080 48.013  1.00 21.58  ? 841  TYR A CA    1 
ATOM   6864  C  C     . TYR C 3 841  ? -18.304 100.569 47.789  1.00 21.78  ? 841  TYR A C     1 
ATOM   6865  O  O     . TYR C 3 841  ? -19.308 99.867  47.708  1.00 23.40  ? 841  TYR A O     1 
ATOM   6866  C  CB    . TYR C 3 841  ? -18.254 102.802 46.677  1.00 19.12  ? 841  TYR A CB    1 
ATOM   6867  C  CG    . TYR C 3 841  ? -19.213 102.295 45.634  1.00 19.12  ? 841  TYR A CG    1 
ATOM   6868  C  CD1   . TYR C 3 841  ? -20.576 102.560 45.733  1.00 17.06  ? 841  TYR A CD1   1 
ATOM   6869  C  CD2   . TYR C 3 841  ? -18.769 101.497 44.577  1.00 16.50  ? 841  TYR A CD2   1 
ATOM   6870  C  CE1   . TYR C 3 841  ? -21.466 102.047 44.814  1.00 16.09  ? 841  TYR A CE1   1 
ATOM   6871  C  CE2   . TYR C 3 841  ? -19.648 100.975 43.661  1.00 14.21  ? 841  TYR A CE2   1 
ATOM   6872  C  CZ    . TYR C 3 841  ? -21.001 101.253 43.780  1.00 16.36  ? 841  TYR A CZ    1 
ATOM   6873  O  OH    . TYR C 3 841  ? -21.895 100.735 42.870  1.00 13.01  ? 841  TYR A OH    1 
ATOM   6874  N  N     . SER C 3 842  ? -17.073 100.082 47.685  1.00 21.69  ? 842  SER A N     1 
ATOM   6875  C  CA    . SER C 3 842  ? -16.823 98.660  47.471  1.00 21.56  ? 842  SER A CA    1 
ATOM   6876  C  C     . SER C 3 842  ? -17.367 97.808  48.612  1.00 21.24  ? 842  SER A C     1 
ATOM   6877  O  O     . SER C 3 842  ? -17.828 96.686  48.385  1.00 18.72  ? 842  SER A O     1 
ATOM   6878  C  CB    . SER C 3 842  ? -15.323 98.399  47.299  1.00 19.73  ? 842  SER A CB    1 
ATOM   6879  O  OG    . SER C 3 842  ? -14.847 98.960  46.089  1.00 20.61  ? 842  SER A OG    1 
ATOM   6880  N  N     . TRP C 3 843  ? -17.300 98.333  49.834  1.00 20.87  ? 843  TRP A N     1 
ATOM   6881  C  CA    . TRP C 3 843  ? -17.830 97.603  50.977  1.00 22.69  ? 843  TRP A CA    1 
ATOM   6882  C  C     . TRP C 3 843  ? -19.350 97.532  50.836  1.00 23.31  ? 843  TRP A C     1 
ATOM   6883  O  O     . TRP C 3 843  ? -19.965 96.514  51.154  1.00 25.31  ? 843  TRP A O     1 
ATOM   6884  C  CB    . TRP C 3 843  ? -17.460 98.288  52.296  1.00 22.80  ? 843  TRP A CB    1 
ATOM   6885  C  CG    . TRP C 3 843  ? -16.198 97.772  52.889  1.00 22.65  ? 843  TRP A CG    1 
ATOM   6886  C  CD1   . TRP C 3 843  ? -15.001 98.419  52.963  1.00 22.91  ? 843  TRP A CD1   1 
ATOM   6887  C  CD2   . TRP C 3 843  ? -15.985 96.466  53.438  1.00 23.56  ? 843  TRP A CD2   1 
ATOM   6888  N  NE1   . TRP C 3 843  ? -14.048 97.594  53.519  1.00 23.36  ? 843  TRP A NE1   1 
ATOM   6889  C  CE2   . TRP C 3 843  ? -14.626 96.387  53.818  1.00 23.72  ? 843  TRP A CE2   1 
ATOM   6890  C  CE3   . TRP C 3 843  ? -16.811 95.354  53.645  1.00 23.21  ? 843  TRP A CE3   1 
ATOM   6891  C  CZ2   . TRP C 3 843  ? -14.070 95.235  54.393  1.00 23.88  ? 843  TRP A CZ2   1 
ATOM   6892  C  CZ3   . TRP C 3 843  ? -16.260 94.209  54.219  1.00 24.72  ? 843  TRP A CZ3   1 
ATOM   6893  C  CH2   . TRP C 3 843  ? -14.898 94.160  54.584  1.00 25.08  ? 843  TRP A CH2   1 
ATOM   6894  N  N     . ALA C 3 844  ? -19.951 98.610  50.347  1.00 22.36  ? 844  ALA A N     1 
ATOM   6895  C  CA    . ALA C 3 844  ? -21.396 98.647  50.155  1.00 22.74  ? 844  ALA A CA    1 
ATOM   6896  C  C     . ALA C 3 844  ? -21.800 97.652  49.067  1.00 23.16  ? 844  ALA A C     1 
ATOM   6897  O  O     . ALA C 3 844  ? -22.739 96.859  49.248  1.00 23.02  ? 844  ALA A O     1 
ATOM   6898  C  CB    . ALA C 3 844  ? -21.848 100.065 49.767  1.00 21.89  ? 844  ALA A CB    1 
ATOM   6899  N  N     . LEU C 3 845  ? -21.090 97.702  47.941  1.00 22.59  ? 845  LEU A N     1 
ATOM   6900  C  CA    . LEU C 3 845  ? -21.363 96.821  46.818  1.00 21.48  ? 845  LEU A CA    1 
ATOM   6901  C  C     . LEU C 3 845  ? -21.217 95.380  47.269  1.00 22.04  ? 845  LEU A C     1 
ATOM   6902  O  O     . LEU C 3 845  ? -22.119 94.567  47.054  1.00 20.73  ? 845  LEU A O     1 
ATOM   6903  C  CB    . LEU C 3 845  ? -20.383 97.089  45.676  1.00 20.78  ? 845  LEU A CB    1 
ATOM   6904  C  CG    . LEU C 3 845  ? -20.864 97.216  44.219  1.00 21.66  ? 845  LEU A CG    1 
ATOM   6905  C  CD1   . LEU C 3 845  ? -19.916 96.435  43.327  1.00 20.11  ? 845  LEU A CD1   1 
ATOM   6906  C  CD2   . LEU C 3 845  ? -22.281 96.714  44.040  1.00 19.74  ? 845  LEU A CD2   1 
ATOM   6907  N  N     . CYS C 3 846  ? -20.081 95.068  47.898  1.00 23.39  ? 846  CYS A N     1 
ATOM   6908  C  CA    . CYS C 3 846  ? -19.819 93.708  48.375  1.00 26.19  ? 846  CYS A CA    1 
ATOM   6909  C  C     . CYS C 3 846  ? -20.918 93.226  49.302  1.00 27.79  ? 846  CYS A C     1 
ATOM   6910  O  O     . CYS C 3 846  ? -21.442 92.119  49.142  1.00 30.17  ? 846  CYS A O     1 
ATOM   6911  C  CB    . CYS C 3 846  ? -18.484 93.623  49.106  1.00 25.20  ? 846  CYS A CB    1 
ATOM   6912  S  SG    . CYS C 3 846  ? -17.071 93.527  48.019  1.00 28.29  ? 846  CYS A SG    1 
ATOM   6913  N  N     . CYS C 3 847  ? -21.262 94.060  50.274  1.00 26.91  ? 847  CYS A N     1 
ATOM   6914  C  CA    . CYS C 3 847  ? -22.306 93.715  51.210  1.00 27.20  ? 847  CYS A CA    1 
ATOM   6915  C  C     . CYS C 3 847  ? -23.596 93.394  50.440  1.00 27.00  ? 847  CYS A C     1 
ATOM   6916  O  O     . CYS C 3 847  ? -24.293 92.429  50.757  1.00 28.70  ? 847  CYS A O     1 
ATOM   6917  C  CB    . CYS C 3 847  ? -22.526 94.879  52.186  1.00 26.05  ? 847  CYS A CB    1 
ATOM   6918  S  SG    . CYS C 3 847  ? -23.877 94.639  53.364  1.00 28.44  ? 847  CYS A SG    1 
ATOM   6919  N  N     . ALA C 3 848  ? -23.887 94.183  49.412  1.00 25.33  ? 848  ALA A N     1 
ATOM   6920  C  CA    . ALA C 3 848  ? -25.102 94.003  48.619  1.00 24.37  ? 848  ALA A CA    1 
ATOM   6921  C  C     . ALA C 3 848  ? -25.135 92.776  47.720  1.00 24.00  ? 848  ALA A C     1 
ATOM   6922  O  O     . ALA C 3 848  ? -26.123 92.554  47.014  1.00 24.16  ? 848  ALA A O     1 
ATOM   6923  C  CB    . ALA C 3 848  ? -25.363 95.248  47.779  1.00 24.38  ? 848  ALA A CB    1 
ATOM   6924  N  N     . PHE C 3 849  ? -24.064 91.989  47.729  1.00 23.77  ? 849  PHE A N     1 
ATOM   6925  C  CA    . PHE C 3 849  ? -24.003 90.781  46.905  1.00 23.65  ? 849  PHE A CA    1 
ATOM   6926  C  C     . PHE C 3 849  ? -23.548 89.589  47.745  1.00 24.48  ? 849  PHE A C     1 
ATOM   6927  O  O     . PHE C 3 849  ? -23.407 88.474  47.229  1.00 23.55  ? 849  PHE A O     1 
ATOM   6928  C  CB    . PHE C 3 849  ? -23.026 90.979  45.738  1.00 23.93  ? 849  PHE A CB    1 
ATOM   6929  C  CG    . PHE C 3 849  ? -23.622 91.685  44.552  1.00 25.37  ? 849  PHE A CG    1 
ATOM   6930  C  CD1   . PHE C 3 849  ? -24.484 91.008  43.681  1.00 26.19  ? 849  PHE A CD1   1 
ATOM   6931  C  CD2   . PHE C 3 849  ? -23.358 93.034  44.321  1.00 24.05  ? 849  PHE A CD2   1 
ATOM   6932  C  CE1   . PHE C 3 849  ? -25.078 91.665  42.602  1.00 23.31  ? 849  PHE A CE1   1 
ATOM   6933  C  CE2   . PHE C 3 849  ? -23.945 93.702  43.249  1.00 24.38  ? 849  PHE A CE2   1 
ATOM   6934  C  CZ    . PHE C 3 849  ? -24.809 93.014  42.386  1.00 25.69  ? 849  PHE A CZ    1 
ATOM   6935  N  N     . SER C 3 850  ? -23.337 89.838  49.037  1.00 24.50  ? 850  SER A N     1 
ATOM   6936  C  CA    . SER C 3 850  ? -22.853 88.833  49.988  1.00 26.48  ? 850  SER A CA    1 
ATOM   6937  C  C     . SER C 3 850  ? -23.875 87.825  50.512  1.00 27.90  ? 850  SER A C     1 
ATOM   6938  O  O     . SER C 3 850  ? -23.524 86.928  51.283  1.00 26.01  ? 850  SER A O     1 
ATOM   6939  C  CB    . SER C 3 850  ? -22.219 89.542  51.192  1.00 26.31  ? 850  SER A CB    1 
ATOM   6940  O  OG    . SER C 3 850  ? -23.191 90.272  51.926  1.00 23.87  ? 850  SER A OG    1 
ATOM   6941  N  N     . ARG C 3 851  ? -25.123 87.952  50.082  1.00 30.15  ? 851  ARG A N     1 
ATOM   6942  C  CA    . ARG C 3 851  ? -26.171 87.077  50.577  1.00 33.76  ? 851  ARG A CA    1 
ATOM   6943  C  C     . ARG C 3 851  ? -27.005 86.493  49.449  1.00 35.65  ? 851  ARG A C     1 
ATOM   6944  O  O     . ARG C 3 851  ? -27.379 87.200  48.519  1.00 36.58  ? 851  ARG A O     1 
ATOM   6945  C  CB    . ARG C 3 851  ? -27.060 87.890  51.529  1.00 34.90  ? 851  ARG A CB    1 
ATOM   6946  C  CG    . ARG C 3 851  ? -28.129 87.135  52.303  1.00 34.93  ? 851  ARG A CG    1 
ATOM   6947  C  CD    . ARG C 3 851  ? -28.978 88.140  53.066  1.00 33.93  ? 851  ARG A CD    1 
ATOM   6948  N  NE    . ARG C 3 851  ? -29.967 87.529  53.949  1.00 34.80  ? 851  ARG A NE    1 
ATOM   6949  C  CZ    . ARG C 3 851  ? -29.695 86.970  55.125  1.00 35.56  ? 851  ARG A CZ    1 
ATOM   6950  N  NH1   . ARG C 3 851  ? -28.448 86.928  55.584  1.00 34.95  ? 851  ARG A NH1   1 
ATOM   6951  N  NH2   . ARG C 3 851  ? -30.681 86.468  55.855  1.00 36.09  ? 851  ARG A NH2   1 
ATOM   6952  N  N     . GLN C 3 852  ? -27.303 85.201  49.539  1.00 37.90  ? 852  GLN A N     1 
ATOM   6953  C  CA    . GLN C 3 852  ? -28.107 84.535  48.525  1.00 39.32  ? 852  GLN A CA    1 
ATOM   6954  C  C     . GLN C 3 852  ? -29.112 83.566  49.124  1.00 42.05  ? 852  GLN A C     1 
ATOM   6955  O  O     . GLN C 3 852  ? -28.802 82.845  50.073  1.00 40.99  ? 852  GLN A O     1 
ATOM   6956  C  CB    . GLN C 3 852  ? -27.213 83.769  47.564  1.00 38.55  ? 852  GLN A CB    1 
ATOM   6957  C  CG    . GLN C 3 852  ? -27.980 82.869  46.614  1.00 38.95  ? 852  GLN A CG    1 
ATOM   6958  C  CD    . GLN C 3 852  ? -28.842 83.648  45.637  1.00 39.97  ? 852  GLN A CD    1 
ATOM   6959  O  OE1   . GLN C 3 852  ? -29.960 83.240  45.319  1.00 38.96  ? 852  GLN A OE1   1 
ATOM   6960  N  NE2   . GLN C 3 852  ? -28.321 84.768  45.146  1.00 39.97  ? 852  GLN A NE2   1 
ATOM   6961  N  N     . ARG C 3 853  ? -30.312 83.544  48.554  1.00 44.84  ? 853  ARG A N     1 
ATOM   6962  C  CA    . ARG C 3 853  ? -31.364 82.643  49.006  1.00 50.15  ? 853  ARG A CA    1 
ATOM   6963  C  C     . ARG C 3 853  ? -31.080 81.243  48.461  1.00 53.27  ? 853  ARG A C     1 
ATOM   6964  O  O     . ARG C 3 853  ? -30.869 81.077  47.266  1.00 53.59  ? 853  ARG A O     1 
ATOM   6965  C  CB    . ARG C 3 853  ? -32.714 83.121  48.490  1.00 52.40  ? 853  ARG A CB    1 
ATOM   6966  C  CG    . ARG C 3 853  ? -33.865 82.236  48.895  1.00 56.73  ? 853  ARG A CG    1 
ATOM   6967  C  CD    . ARG C 3 853  ? -35.093 82.529  48.060  1.00 60.62  ? 853  ARG A CD    1 
ATOM   6968  N  NE    . ARG C 3 853  ? -36.167 81.592  48.365  1.00 64.72  ? 853  ARG A NE    1 
ATOM   6969  C  CZ    . ARG C 3 853  ? -37.217 81.383  47.581  1.00 67.08  ? 853  ARG A CZ    1 
ATOM   6970  N  NH1   . ARG C 3 853  ? -37.335 82.048  46.435  1.00 68.70  ? 853  ARG A NH1   1 
ATOM   6971  N  NH2   . ARG C 3 853  ? -38.146 80.509  47.943  1.00 67.04  ? 853  ARG A NH2   1 
ATOM   6972  N  N     . THR C 3 854  ? -31.078 80.238  49.330  1.00 57.53  ? 854  THR A N     1 
ATOM   6973  C  CA    . THR C 3 854  ? -30.798 78.871  48.899  1.00 61.69  ? 854  THR A CA    1 
ATOM   6974  C  C     . THR C 3 854  ? -31.979 77.931  49.090  1.00 65.00  ? 854  THR A C     1 
ATOM   6975  O  O     . THR C 3 854  ? -32.818 78.131  49.971  1.00 64.75  ? 854  THR A O     1 
ATOM   6976  C  CB    . THR C 3 854  ? -29.588 78.287  49.647  1.00 62.54  ? 854  THR A CB    1 
ATOM   6977  O  OG1   . THR C 3 854  ? -29.825 78.349  51.060  1.00 63.44  ? 854  THR A OG1   1 
ATOM   6978  C  CG2   . THR C 3 854  ? -28.318 79.070  49.305  1.00 62.76  ? 854  THR A CG2   1 
ATOM   6979  N  N     . MET C 3 855  ? -32.029 76.900  48.250  1.00 68.64  ? 855  MET A N     1 
ATOM   6980  C  CA    . MET C 3 855  ? -33.097 75.908  48.283  1.00 71.99  ? 855  MET A CA    1 
ATOM   6981  C  C     . MET C 3 855  ? -32.544 74.492  48.355  1.00 73.20  ? 855  MET A C     1 
ATOM   6982  O  O     . MET C 3 855  ? -31.571 74.156  47.679  1.00 72.86  ? 855  MET A O     1 
ATOM   6983  C  CB    . MET C 3 855  ? -33.979 76.038  47.035  1.00 73.70  ? 855  MET A CB    1 
ATOM   6984  C  CG    . MET C 3 855  ? -35.106 77.056  47.147  1.00 76.13  ? 855  MET A CG    1 
ATOM   6985  S  SD    . MET C 3 855  ? -36.335 76.564  48.383  1.00 78.66  ? 855  MET A SD    1 
ATOM   6986  C  CE    . MET C 3 855  ? -36.900 74.991  47.680  1.00 77.58  ? 855  MET A CE    1 
ATOM   6987  N  N     . ILE C 3 856  ? -33.178 73.667  49.181  1.00 75.16  ? 856  ILE A N     1 
ATOM   6988  C  CA    . ILE C 3 856  ? -32.780 72.273  49.348  1.00 76.74  ? 856  ILE A CA    1 
ATOM   6989  C  C     . ILE C 3 856  ? -34.052 71.408  49.350  1.00 77.58  ? 856  ILE A C     1 
ATOM   6990  O  O     . ILE C 3 856  ? -34.014 70.220  49.673  1.00 78.05  ? 856  ILE A O     1 
ATOM   6991  C  CB    . ILE C 3 856  ? -32.006 72.071  50.681  1.00 76.42  ? 856  ILE A CB    1 
ATOM   6992  C  CG1   . ILE C 3 856  ? -30.889 73.120  50.809  1.00 76.70  ? 856  ILE A CG1   1 
ATOM   6993  C  CG2   . ILE C 3 856  ? -31.403 70.669  50.734  1.00 76.41  ? 856  ILE A CG2   1 
ATOM   6994  C  CD1   . ILE C 3 856  ? -29.760 72.983  49.791  1.00 75.43  ? 856  ILE A CD1   1 
ATOM   6995  N  N     . GLY C 3 857  ? -35.173 72.020  48.966  1.00 77.84  ? 857  GLY A N     1 
ATOM   6996  C  CA    . GLY C 3 857  ? -36.449 71.326  48.938  1.00 78.12  ? 857  GLY A CA    1 
ATOM   6997  C  C     . GLY C 3 857  ? -37.315 71.879  50.053  1.00 78.67  ? 857  GLY A C     1 
ATOM   6998  O  O     . GLY C 3 857  ? -37.538 71.214  51.066  1.00 78.55  ? 857  GLY A O     1 
ATOM   6999  N  N     . GLU C 3 858  ? -37.809 73.100  49.849  1.00 78.72  ? 858  GLU A N     1 
ATOM   7000  C  CA    . GLU C 3 858  ? -38.623 73.820  50.835  1.00 78.33  ? 858  GLU A CA    1 
ATOM   7001  C  C     . GLU C 3 858  ? -37.697 74.190  52.000  1.00 77.75  ? 858  GLU A C     1 
ATOM   7002  O  O     . GLU C 3 858  ? -38.100 74.867  52.954  1.00 77.71  ? 858  GLU A O     1 
ATOM   7003  C  CB    . GLU C 3 858  ? -39.812 72.974  51.331  1.00 78.90  ? 858  GLU A CB    1 
ATOM   7004  C  CG    . GLU C 3 858  ? -40.768 73.744  52.266  1.00 78.89  ? 858  GLU A CG    1 
ATOM   7005  C  CD    . GLU C 3 858  ? -42.038 72.972  52.630  1.00 79.04  ? 858  GLU A CD    1 
ATOM   7006  O  OE1   . GLU C 3 858  ? -42.823 73.472  53.467  1.00 78.43  ? 858  GLU A OE1   1 
ATOM   7007  O  OE2   . GLU C 3 858  ? -42.261 71.873  52.080  1.00 79.11  ? 858  GLU A OE2   1 
ATOM   7008  N  N     . SER C 3 859  ? -36.447 73.738  51.901  1.00 76.14  ? 859  SER A N     1 
ATOM   7009  C  CA    . SER C 3 859  ? -35.431 74.024  52.904  1.00 73.76  ? 859  SER A CA    1 
ATOM   7010  C  C     . SER C 3 859  ? -34.871 75.404  52.573  1.00 71.89  ? 859  SER A C     1 
ATOM   7011  O  O     . SER C 3 859  ? -33.711 75.541  52.174  1.00 72.08  ? 859  SER A O     1 
ATOM   7012  C  CB    . SER C 3 859  ? -34.313 72.981  52.845  1.00 73.76  ? 859  SER A CB    1 
ATOM   7013  O  OG    . SER C 3 859  ? -34.823 71.672  53.021  1.00 74.18  ? 859  SER A OG    1 
ATOM   7014  N  N     . VAL C 3 860  ? -35.712 76.422  52.730  1.00 68.99  ? 860  VAL A N     1 
ATOM   7015  C  CA    . VAL C 3 860  ? -35.319 77.792  52.441  1.00 65.95  ? 860  VAL A CA    1 
ATOM   7016  C  C     . VAL C 3 860  ? -34.398 78.389  53.500  1.00 64.32  ? 860  VAL A C     1 
ATOM   7017  O  O     . VAL C 3 860  ? -34.846 78.828  54.563  1.00 64.46  ? 860  VAL A O     1 
ATOM   7018  C  CB    . VAL C 3 860  ? -36.555 78.710  52.287  1.00 65.85  ? 860  VAL A CB    1 
ATOM   7019  C  CG1   . VAL C 3 860  ? -36.114 80.163  52.118  1.00 65.78  ? 860  VAL A CG1   1 
ATOM   7020  C  CG2   . VAL C 3 860  ? -37.371 78.279  51.086  1.00 64.93  ? 860  VAL A CG2   1 
ATOM   7021  N  N     . GLY C 3 861  ? -33.105 78.395  53.198  1.00 61.36  ? 861  GLY A N     1 
ATOM   7022  C  CA    . GLY C 3 861  ? -32.132 78.969  54.102  1.00 57.39  ? 861  GLY A CA    1 
ATOM   7023  C  C     . GLY C 3 861  ? -31.472 80.138  53.394  1.00 55.13  ? 861  GLY A C     1 
ATOM   7024  O  O     . GLY C 3 861  ? -31.958 80.604  52.364  1.00 54.68  ? 861  GLY A O     1 
ATOM   7025  N  N     . TYR C 3 862  ? -30.358 80.613  53.933  1.00 52.37  ? 862  TYR A N     1 
ATOM   7026  C  CA    . TYR C 3 862  ? -29.652 81.727  53.327  1.00 48.78  ? 862  TYR A CA    1 
ATOM   7027  C  C     . TYR C 3 862  ? -28.147 81.587  53.441  1.00 46.66  ? 862  TYR A C     1 
ATOM   7028  O  O     . TYR C 3 862  ? -27.616 81.228  54.494  1.00 46.52  ? 862  TYR A O     1 
ATOM   7029  C  CB    . TYR C 3 862  ? -30.096 83.038  53.973  1.00 49.67  ? 862  TYR A CB    1 
ATOM   7030  C  CG    . TYR C 3 862  ? -31.519 83.387  53.640  1.00 51.94  ? 862  TYR A CG    1 
ATOM   7031  C  CD1   . TYR C 3 862  ? -31.858 83.851  52.373  1.00 52.68  ? 862  TYR A CD1   1 
ATOM   7032  C  CD2   . TYR C 3 862  ? -32.541 83.199  54.567  1.00 53.38  ? 862  TYR A CD2   1 
ATOM   7033  C  CE1   . TYR C 3 862  ? -33.178 84.115  52.032  1.00 53.82  ? 862  TYR A CE1   1 
ATOM   7034  C  CE2   . TYR C 3 862  ? -33.872 83.461  54.236  1.00 54.36  ? 862  TYR A CE2   1 
ATOM   7035  C  CZ    . TYR C 3 862  ? -34.180 83.919  52.965  1.00 54.64  ? 862  TYR A CZ    1 
ATOM   7036  O  OH    . TYR C 3 862  ? -35.487 84.190  52.619  1.00 56.44  ? 862  TYR A OH    1 
ATOM   7037  N  N     . LEU C 3 863  ? -27.466 81.856  52.335  1.00 43.38  ? 863  LEU A N     1 
ATOM   7038  C  CA    . LEU C 3 863  ? -26.019 81.811  52.295  1.00 38.88  ? 863  LEU A CA    1 
ATOM   7039  C  C     . LEU C 3 863  ? -25.510 83.222  52.542  1.00 36.34  ? 863  LEU A C     1 
ATOM   7040  O  O     . LEU C 3 863  ? -25.865 84.166  51.837  1.00 36.66  ? 863  LEU A O     1 
ATOM   7041  C  CB    . LEU C 3 863  ? -25.542 81.305  50.943  1.00 41.27  ? 863  LEU A CB    1 
ATOM   7042  C  CG    . LEU C 3 863  ? -25.361 79.793  50.897  1.00 43.32  ? 863  LEU A CG    1 
ATOM   7043  C  CD1   . LEU C 3 863  ? -24.989 79.367  49.483  1.00 44.30  ? 863  LEU A CD1   1 
ATOM   7044  C  CD2   . LEU C 3 863  ? -24.277 79.391  51.899  1.00 44.20  ? 863  LEU A CD2   1 
ATOM   7045  N  N     . GLN C 3 864  ? -24.672 83.364  53.553  1.00 32.59  ? 864  GLN A N     1 
ATOM   7046  C  CA    . GLN C 3 864  ? -24.150 84.664  53.898  1.00 28.95  ? 864  GLN A CA    1 
ATOM   7047  C  C     . GLN C 3 864  ? -22.639 84.624  54.055  1.00 27.97  ? 864  GLN A C     1 
ATOM   7048  O  O     . GLN C 3 864  ? -22.110 83.799  54.807  1.00 26.76  ? 864  GLN A O     1 
ATOM   7049  C  CB    . GLN C 3 864  ? -24.789 85.114  55.212  1.00 27.57  ? 864  GLN A CB    1 
ATOM   7050  C  CG    . GLN C 3 864  ? -24.336 86.458  55.706  1.00 25.23  ? 864  GLN A CG    1 
ATOM   7051  C  CD    . GLN C 3 864  ? -24.717 87.549  54.753  1.00 24.45  ? 864  GLN A CD    1 
ATOM   7052  O  OE1   . GLN C 3 864  ? -23.884 88.064  54.020  1.00 26.90  ? 864  GLN A OE1   1 
ATOM   7053  N  NE2   . GLN C 3 864  ? -25.994 87.899  54.740  1.00 26.64  ? 864  GLN A NE2   1 
ATOM   7054  N  N     . TYR C 3 865  ? -21.944 85.509  53.344  1.00 25.04  ? 865  TYR A N     1 
ATOM   7055  C  CA    . TYR C 3 865  ? -20.494 85.587  53.461  1.00 23.17  ? 865  TYR A CA    1 
ATOM   7056  C  C     . TYR C 3 865  ? -20.173 86.657  54.506  1.00 23.09  ? 865  TYR A C     1 
ATOM   7057  O  O     . TYR C 3 865  ? -20.666 87.783  54.422  1.00 24.15  ? 865  TYR A O     1 
ATOM   7058  C  CB    . TYR C 3 865  ? -19.861 85.981  52.130  1.00 22.37  ? 865  TYR A CB    1 
ATOM   7059  C  CG    . TYR C 3 865  ? -19.519 84.831  51.205  1.00 21.88  ? 865  TYR A CG    1 
ATOM   7060  C  CD1   . TYR C 3 865  ? -18.351 84.085  51.383  1.00 20.57  ? 865  TYR A CD1   1 
ATOM   7061  C  CD2   . TYR C 3 865  ? -20.332 84.528  50.110  1.00 21.22  ? 865  TYR A CD2   1 
ATOM   7062  C  CE1   . TYR C 3 865  ? -17.994 83.070  50.481  1.00 21.41  ? 865  TYR A CE1   1 
ATOM   7063  C  CE2   . TYR C 3 865  ? -19.990 83.516  49.209  1.00 22.00  ? 865  TYR A CE2   1 
ATOM   7064  C  CZ    . TYR C 3 865  ? -18.821 82.792  49.394  1.00 23.14  ? 865  TYR A CZ    1 
ATOM   7065  O  OH    . TYR C 3 865  ? -18.486 81.800  48.489  1.00 23.82  ? 865  TYR A OH    1 
ATOM   7066  N  N     . PRO C 3 866  ? -19.363 86.311  55.521  1.00 21.57  ? 866  PRO A N     1 
ATOM   7067  C  CA    . PRO C 3 866  ? -19.017 87.299  56.547  1.00 21.10  ? 866  PRO A CA    1 
ATOM   7068  C  C     . PRO C 3 866  ? -18.191 88.413  55.907  1.00 21.13  ? 866  PRO A C     1 
ATOM   7069  O  O     . PRO C 3 866  ? -17.596 88.214  54.854  1.00 23.53  ? 866  PRO A O     1 
ATOM   7070  C  CB    . PRO C 3 866  ? -18.186 86.489  57.551  1.00 20.72  ? 866  PRO A CB    1 
ATOM   7071  C  CG    . PRO C 3 866  ? -18.639 85.078  57.334  1.00 20.75  ? 866  PRO A CG    1 
ATOM   7072  C  CD    . PRO C 3 866  ? -18.794 84.990  55.845  1.00 18.63  ? 866  PRO A CD    1 
ATOM   7073  N  N     . MET C 3 867  ? -18.142 89.578  56.537  1.00 21.32  ? 867  MET A N     1 
ATOM   7074  C  CA    . MET C 3 867  ? -17.360 90.685  55.994  1.00 20.94  ? 867  MET A CA    1 
ATOM   7075  C  C     . MET C 3 867  ? -15.903 90.252  55.824  1.00 21.35  ? 867  MET A C     1 
ATOM   7076  O  O     . MET C 3 867  ? -15.217 90.656  54.884  1.00 19.88  ? 867  MET A O     1 
ATOM   7077  C  CB    . MET C 3 867  ? -17.428 91.883  56.933  1.00 21.59  ? 867  MET A CB    1 
ATOM   7078  C  CG    . MET C 3 867  ? -16.993 91.572  58.351  1.00 23.20  ? 867  MET A CG    1 
ATOM   7079  S  SD    . MET C 3 867  ? -16.865 93.028  59.397  1.00 27.29  ? 867  MET A SD    1 
ATOM   7080  C  CE    . MET C 3 867  ? -15.159 93.476  59.083  1.00 28.03  ? 867  MET A CE    1 
ATOM   7081  N  N     . TRP C 3 868  ? -15.452 89.414  56.748  1.00 21.57  ? 868  TRP A N     1 
ATOM   7082  C  CA    . TRP C 3 868  ? -14.091 88.906  56.759  1.00 23.53  ? 868  TRP A CA    1 
ATOM   7083  C  C     . TRP C 3 868  ? -13.664 88.141  55.498  1.00 23.66  ? 868  TRP A C     1 
ATOM   7084  O  O     . TRP C 3 868  ? -12.470 88.003  55.232  1.00 23.82  ? 868  TRP A O     1 
ATOM   7085  C  CB    . TRP C 3 868  ? -13.898 88.026  57.996  1.00 25.52  ? 868  TRP A CB    1 
ATOM   7086  C  CG    . TRP C 3 868  ? -14.335 88.716  59.234  1.00 28.21  ? 868  TRP A CG    1 
ATOM   7087  C  CD1   . TRP C 3 868  ? -15.446 88.444  59.978  1.00 28.04  ? 868  TRP A CD1   1 
ATOM   7088  C  CD2   . TRP C 3 868  ? -13.702 89.844  59.853  1.00 29.91  ? 868  TRP A CD2   1 
ATOM   7089  N  NE1   . TRP C 3 868  ? -15.545 89.334  61.021  1.00 28.48  ? 868  TRP A NE1   1 
ATOM   7090  C  CE2   . TRP C 3 868  ? -14.488 90.203  60.968  1.00 30.44  ? 868  TRP A CE2   1 
ATOM   7091  C  CE3   . TRP C 3 868  ? -12.547 90.588  59.571  1.00 29.17  ? 868  TRP A CE3   1 
ATOM   7092  C  CZ2   . TRP C 3 868  ? -14.154 91.277  61.805  1.00 32.32  ? 868  TRP A CZ2   1 
ATOM   7093  C  CZ3   . TRP C 3 868  ? -12.216 91.650  60.399  1.00 29.85  ? 868  TRP A CZ3   1 
ATOM   7094  C  CH2   . TRP C 3 868  ? -13.015 91.985  61.504  1.00 30.99  ? 868  TRP A CH2   1 
ATOM   7095  N  N     . SER C 3 869  ? -14.621 87.639  54.726  1.00 23.43  ? 869  SER A N     1 
ATOM   7096  C  CA    . SER C 3 869  ? -14.270 86.918  53.513  1.00 24.23  ? 869  SER A CA    1 
ATOM   7097  C  C     . SER C 3 869  ? -13.742 87.909  52.477  1.00 24.60  ? 869  SER A C     1 
ATOM   7098  O  O     . SER C 3 869  ? -12.811 87.608  51.712  1.00 23.90  ? 869  SER A O     1 
ATOM   7099  C  CB    . SER C 3 869  ? -15.485 86.178  52.957  1.00 25.19  ? 869  SER A CB    1 
ATOM   7100  O  OG    . SER C 3 869  ? -15.807 85.053  53.756  1.00 27.24  ? 869  SER A OG    1 
ATOM   7101  N  N     . PHE C 3 870  ? -14.334 89.097  52.462  1.00 23.58  ? 870  PHE A N     1 
ATOM   7102  C  CA    . PHE C 3 870  ? -13.911 90.135  51.528  1.00 23.15  ? 870  PHE A CA    1 
ATOM   7103  C  C     . PHE C 3 870  ? -12.515 90.633  51.889  1.00 22.46  ? 870  PHE A C     1 
ATOM   7104  O  O     . PHE C 3 870  ? -11.706 90.941  51.001  1.00 22.51  ? 870  PHE A O     1 
ATOM   7105  C  CB    . PHE C 3 870  ? -14.927 91.277  51.531  1.00 21.46  ? 870  PHE A CB    1 
ATOM   7106  C  CG    . PHE C 3 870  ? -16.252 90.882  50.963  1.00 20.64  ? 870  PHE A CG    1 
ATOM   7107  C  CD1   . PHE C 3 870  ? -16.436 90.815  49.586  1.00 20.77  ? 870  PHE A CD1   1 
ATOM   7108  C  CD2   . PHE C 3 870  ? -17.290 90.478  51.798  1.00 22.82  ? 870  PHE A CD2   1 
ATOM   7109  C  CE1   . PHE C 3 870  ? -17.625 90.344  49.038  1.00 19.60  ? 870  PHE A CE1   1 
ATOM   7110  C  CE2   . PHE C 3 870  ? -18.490 90.003  51.260  1.00 23.60  ? 870  PHE A CE2   1 
ATOM   7111  C  CZ    . PHE C 3 870  ? -18.651 89.936  49.874  1.00 22.95  ? 870  PHE A CZ    1 
ATOM   7112  N  N     . VAL C 3 871  ? -12.218 90.704  53.185  1.00 20.35  ? 871  VAL A N     1 
ATOM   7113  C  CA    . VAL C 3 871  ? -10.889 91.141  53.586  1.00 21.40  ? 871  VAL A CA    1 
ATOM   7114  C  C     . VAL C 3 871  ? -9.916  90.124  52.998  1.00 21.00  ? 871  VAL A C     1 
ATOM   7115  O  O     . VAL C 3 871  ? -8.937  90.489  52.351  1.00 19.39  ? 871  VAL A O     1 
ATOM   7116  C  CB    . VAL C 3 871  ? -10.722 91.189  55.125  1.00 21.61  ? 871  VAL A CB    1 
ATOM   7117  C  CG1   . VAL C 3 871  ? -9.246  91.415  55.487  1.00 19.77  ? 871  VAL A CG1   1 
ATOM   7118  C  CG2   . VAL C 3 871  ? -11.588 92.304  55.704  1.00 21.23  ? 871  VAL A CG2   1 
ATOM   7119  N  N     . TYR C 3 872  ? -10.211 88.844  53.210  1.00 21.31  ? 872  TYR A N     1 
ATOM   7120  C  CA    . TYR C 3 872  ? -9.374  87.778  52.683  1.00 22.47  ? 872  TYR A CA    1 
ATOM   7121  C  C     . TYR C 3 872  ? -9.161  87.947  51.181  1.00 22.39  ? 872  TYR A C     1 
ATOM   7122  O  O     . TYR C 3 872  ? -8.056  87.733  50.688  1.00 24.37  ? 872  TYR A O     1 
ATOM   7123  C  CB    . TYR C 3 872  ? -10.012 86.420  52.938  1.00 22.36  ? 872  TYR A CB    1 
ATOM   7124  C  CG    . TYR C 3 872  ? -9.116  85.261  52.561  1.00 23.43  ? 872  TYR A CG    1 
ATOM   7125  C  CD1   . TYR C 3 872  ? -8.174  84.765  53.467  1.00 22.96  ? 872  TYR A CD1   1 
ATOM   7126  C  CD2   . TYR C 3 872  ? -9.204  84.661  51.294  1.00 23.43  ? 872  TYR A CD2   1 
ATOM   7127  C  CE1   . TYR C 3 872  ? -7.345  83.702  53.128  1.00 24.43  ? 872  TYR A CE1   1 
ATOM   7128  C  CE2   . TYR C 3 872  ? -8.374  83.592  50.942  1.00 22.46  ? 872  TYR A CE2   1 
ATOM   7129  C  CZ    . TYR C 3 872  ? -7.449  83.119  51.867  1.00 24.16  ? 872  TYR A CZ    1 
ATOM   7130  O  OH    . TYR C 3 872  ? -6.632  82.059  51.550  1.00 24.63  ? 872  TYR A OH    1 
ATOM   7131  N  N     . TRP C 3 873  ? -10.217 88.329  50.462  1.00 22.21  ? 873  TRP A N     1 
ATOM   7132  C  CA    . TRP C 3 873  ? -10.134 88.532  49.017  1.00 21.73  ? 873  TRP A CA    1 
ATOM   7133  C  C     . TRP C 3 873  ? -9.361  89.787  48.606  1.00 21.21  ? 873  TRP A C     1 
ATOM   7134  O  O     . TRP C 3 873  ? -9.010  89.950  47.442  1.00 21.14  ? 873  TRP A O     1 
ATOM   7135  C  CB    . TRP C 3 873  ? -11.541 88.545  48.386  1.00 21.21  ? 873  TRP A CB    1 
ATOM   7136  C  CG    . TRP C 3 873  ? -12.217 87.187  48.416  1.00 19.97  ? 873  TRP A CG    1 
ATOM   7137  C  CD1   . TRP C 3 873  ? -11.610 85.965  48.305  1.00 17.59  ? 873  TRP A CD1   1 
ATOM   7138  C  CD2   . TRP C 3 873  ? -13.622 86.924  48.529  1.00 20.64  ? 873  TRP A CD2   1 
ATOM   7139  N  NE1   . TRP C 3 873  ? -12.544 84.963  48.342  1.00 16.80  ? 873  TRP A NE1   1 
ATOM   7140  C  CE2   . TRP C 3 873  ? -13.788 85.516  48.478  1.00 18.83  ? 873  TRP A CE2   1 
ATOM   7141  C  CE3   . TRP C 3 873  ? -14.757 87.736  48.666  1.00 19.49  ? 873  TRP A CE3   1 
ATOM   7142  C  CZ2   . TRP C 3 873  ? -15.043 84.904  48.561  1.00 16.68  ? 873  TRP A CZ2   1 
ATOM   7143  C  CZ3   . TRP C 3 873  ? -16.007 87.126  48.748  1.00 19.54  ? 873  TRP A CZ3   1 
ATOM   7144  C  CH2   . TRP C 3 873  ? -16.138 85.719  48.694  1.00 19.07  ? 873  TRP A CH2   1 
ATOM   7145  N  N     . GLY C 3 874  ? -9.098  90.672  49.558  1.00 23.16  ? 874  GLY A N     1 
ATOM   7146  C  CA    . GLY C 3 874  ? -8.330  91.868  49.252  1.00 23.07  ? 874  GLY A CA    1 
ATOM   7147  C  C     . GLY C 3 874  ? -8.933  93.206  49.641  1.00 23.48  ? 874  GLY A C     1 
ATOM   7148  O  O     . GLY C 3 874  ? -8.271  94.237  49.496  1.00 22.42  ? 874  GLY A O     1 
ATOM   7149  N  N     . LEU C 3 875  ? -10.171 93.205  50.134  1.00 22.67  ? 875  LEU A N     1 
ATOM   7150  C  CA    . LEU C 3 875  ? -10.832 94.456  50.511  1.00 22.37  ? 875  LEU A CA    1 
ATOM   7151  C  C     . LEU C 3 875  ? -10.389 94.909  51.897  1.00 21.31  ? 875  LEU A C     1 
ATOM   7152  O  O     . LEU C 3 875  ? -10.656 94.248  52.897  1.00 20.56  ? 875  LEU A O     1 
ATOM   7153  C  CB    . LEU C 3 875  ? -12.355 94.283  50.470  1.00 22.80  ? 875  LEU A CB    1 
ATOM   7154  C  CG    . LEU C 3 875  ? -13.210 95.544  50.607  1.00 22.99  ? 875  LEU A CG    1 
ATOM   7155  C  CD1   . LEU C 3 875  ? -12.907 96.483  49.440  1.00 23.58  ? 875  LEU A CD1   1 
ATOM   7156  C  CD2   . LEU C 3 875  ? -14.681 95.171  50.624  1.00 20.44  ? 875  LEU A CD2   1 
ATOM   7157  N  N     . PRO C 3 876  ? -9.700  96.056  51.970  1.00 21.38  ? 876  PRO A N     1 
ATOM   7158  C  CA    . PRO C 3 876  ? -9.217  96.585  53.247  1.00 19.83  ? 876  PRO A CA    1 
ATOM   7159  C  C     . PRO C 3 876  ? -10.293 97.065  54.214  1.00 21.27  ? 876  PRO A C     1 
ATOM   7160  O  O     . PRO C 3 876  ? -11.307 97.637  53.818  1.00 23.14  ? 876  PRO A O     1 
ATOM   7161  C  CB    . PRO C 3 876  ? -8.284  97.712  52.814  1.00 18.25  ? 876  PRO A CB    1 
ATOM   7162  C  CG    . PRO C 3 876  ? -8.959  98.238  51.593  1.00 18.37  ? 876  PRO A CG    1 
ATOM   7163  C  CD    . PRO C 3 876  ? -9.330  96.955  50.860  1.00 20.93  ? 876  PRO A CD    1 
ATOM   7164  N  N     . LEU C 3 877  ? -10.050 96.820  55.494  1.00 23.45  ? 877  LEU A N     1 
ATOM   7165  C  CA    . LEU C 3 877  ? -10.946 97.236  56.556  1.00 23.76  ? 877  LEU A CA    1 
ATOM   7166  C  C     . LEU C 3 877  ? -10.887 98.746  56.652  1.00 24.73  ? 877  LEU A C     1 
ATOM   7167  O  O     . LEU C 3 877  ? -9.850  99.348  56.379  1.00 24.66  ? 877  LEU A O     1 
ATOM   7168  C  CB    . LEU C 3 877  ? -10.500 96.642  57.888  1.00 24.13  ? 877  LEU A CB    1 
ATOM   7169  C  CG    . LEU C 3 877  ? -10.664 95.128  58.026  1.00 25.92  ? 877  LEU A CG    1 
ATOM   7170  C  CD1   . LEU C 3 877  ? -9.864  94.634  59.229  1.00 25.95  ? 877  LEU A CD1   1 
ATOM   7171  C  CD2   . LEU C 3 877  ? -12.141 94.777  58.162  1.00 23.32  ? 877  LEU A CD2   1 
ATOM   7172  N  N     . VAL C 3 878  ? -12.008 99.355  57.023  1.00 25.54  ? 878  VAL A N     1 
ATOM   7173  C  CA    . VAL C 3 878  ? -12.072 100.799 57.179  1.00 26.21  ? 878  VAL A CA    1 
ATOM   7174  C  C     . VAL C 3 878  ? -11.703 101.125 58.625  1.00 26.54  ? 878  VAL A C     1 
ATOM   7175  O  O     . VAL C 3 878  ? -10.915 102.030 58.892  1.00 26.80  ? 878  VAL A O     1 
ATOM   7176  C  CB    . VAL C 3 878  ? -13.487 101.338 56.913  1.00 25.15  ? 878  VAL A CB    1 
ATOM   7177  C  CG1   . VAL C 3 878  ? -13.496 102.855 57.045  1.00 23.82  ? 878  VAL A CG1   1 
ATOM   7178  C  CG2   . VAL C 3 878  ? -13.946 100.919 55.548  1.00 25.16  ? 878  VAL A CG2   1 
ATOM   7179  N  N     . LYS C 3 879  ? -12.274 100.369 59.555  1.00 26.88  ? 879  LYS A N     1 
ATOM   7180  C  CA    . LYS C 3 879  ? -12.014 100.578 60.970  1.00 25.71  ? 879  LYS A CA    1 
ATOM   7181  C  C     . LYS C 3 879  ? -12.515 99.375  61.747  1.00 25.21  ? 879  LYS A C     1 
ATOM   7182  O  O     . LYS C 3 879  ? -13.658 98.953  61.587  1.00 22.55  ? 879  LYS A O     1 
ATOM   7183  C  CB    . LYS C 3 879  ? -12.714 101.855 61.427  1.00 26.24  ? 879  LYS A CB    1 
ATOM   7184  C  CG    . LYS C 3 879  ? -12.644 102.144 62.907  1.00 26.91  ? 879  LYS A CG    1 
ATOM   7185  C  CD    . LYS C 3 879  ? -13.223 103.537 63.189  1.00 26.94  ? 879  LYS A CD    1 
ATOM   7186  C  CE    . LYS C 3 879  ? -13.668 103.700 64.640  1.00 24.59  ? 879  LYS A CE    1 
ATOM   7187  N  NZ    . LYS C 3 879  ? -12.618 103.274 65.605  1.00 24.39  ? 879  LYS A NZ    1 
ATOM   7188  N  N     . ALA C 3 880  ? -11.641 98.816  62.580  1.00 27.21  ? 880  ALA A N     1 
ATOM   7189  C  CA    . ALA C 3 880  ? -11.981 97.645  63.385  1.00 25.66  ? 880  ALA A CA    1 
ATOM   7190  C  C     . ALA C 3 880  ? -11.218 97.596  64.706  1.00 25.42  ? 880  ALA A C     1 
ATOM   7191  O  O     . ALA C 3 880  ? -10.148 98.195  64.838  1.00 24.77  ? 880  ALA A O     1 
ATOM   7192  C  CB    . ALA C 3 880  ? -11.714 96.367  62.586  1.00 25.14  ? 880  ALA A CB    1 
ATOM   7193  N  N     . PHE C 3 881  ? -11.798 96.880  65.673  1.00 25.70  ? 881  PHE A N     1 
ATOM   7194  C  CA    . PHE C 3 881  ? -11.230 96.672  67.006  1.00 24.90  ? 881  PHE A CA    1 
ATOM   7195  C  C     . PHE C 3 881  ? -10.834 97.941  67.757  1.00 24.72  ? 881  PHE A C     1 
ATOM   7196  O  O     . PHE C 3 881  ? -9.879  97.941  68.527  1.00 25.30  ? 881  PHE A O     1 
ATOM   7197  C  CB    . PHE C 3 881  ? -10.027 95.730  66.900  1.00 25.38  ? 881  PHE A CB    1 
ATOM   7198  C  CG    . PHE C 3 881  ? -10.379 94.350  66.413  1.00 27.62  ? 881  PHE A CG    1 
ATOM   7199  C  CD1   . PHE C 3 881  ? -11.016 93.438  67.256  1.00 26.91  ? 881  PHE A CD1   1 
ATOM   7200  C  CD2   . PHE C 3 881  ? -10.080 93.960  65.105  1.00 28.24  ? 881  PHE A CD2   1 
ATOM   7201  C  CE1   . PHE C 3 881  ? -11.350 92.153  66.806  1.00 27.78  ? 881  PHE A CE1   1 
ATOM   7202  C  CE2   . PHE C 3 881  ? -10.411 92.673  64.641  1.00 27.80  ? 881  PHE A CE2   1 
ATOM   7203  C  CZ    . PHE C 3 881  ? -11.046 91.771  65.493  1.00 27.95  ? 881  PHE A CZ    1 
ATOM   7204  N  N     . GLY C 3 882  ? -11.572 99.022  67.536  1.00 25.15  ? 882  GLY A N     1 
ATOM   7205  C  CA    . GLY C 3 882  ? -11.270 100.270 68.215  1.00 24.51  ? 882  GLY A CA    1 
ATOM   7206  C  C     . GLY C 3 882  ? -10.076 101.005 67.634  1.00 24.97  ? 882  GLY A C     1 
ATOM   7207  O  O     . GLY C 3 882  ? -9.485  101.851 68.296  1.00 27.28  ? 882  GLY A O     1 
ATOM   7208  N  N     . SER C 3 883  ? -9.715  100.698 66.394  1.00 24.55  ? 883  SER A N     1 
ATOM   7209  C  CA    . SER C 3 883  ? -8.570  101.357 65.769  1.00 23.66  ? 883  SER A CA    1 
ATOM   7210  C  C     . SER C 3 883  ? -8.959  102.699 65.159  1.00 22.48  ? 883  SER A C     1 
ATOM   7211  O  O     . SER C 3 883  ? -10.128 103.077 65.138  1.00 21.33  ? 883  SER A O     1 
ATOM   7212  C  CB    . SER C 3 883  ? -7.976  100.469 64.674  1.00 22.86  ? 883  SER A CB    1 
ATOM   7213  O  OG    . SER C 3 883  ? -8.849  100.407 63.569  1.00 22.90  ? 883  SER A OG    1 
ATOM   7214  N  N     . ASP C 3 884  ? -7.972  103.433 64.674  1.00 22.60  ? 884  ASP A N     1 
ATOM   7215  C  CA    . ASP C 3 884  ? -8.283  104.698 64.048  1.00 23.99  ? 884  ASP A CA    1 
ATOM   7216  C  C     . ASP C 3 884  ? -8.873  104.331 62.696  1.00 24.81  ? 884  ASP A C     1 
ATOM   7217  O  O     . ASP C 3 884  ? -8.675  103.217 62.203  1.00 24.36  ? 884  ASP A O     1 
ATOM   7218  C  CB    . ASP C 3 884  ? -7.030  105.550 63.856  1.00 23.95  ? 884  ASP A CB    1 
ATOM   7219  C  CG    . ASP C 3 884  ? -6.397  105.973 65.175  1.00 25.21  ? 884  ASP A CG    1 
ATOM   7220  O  OD1   . ASP C 3 884  ? -7.143  106.168 66.169  1.00 23.39  ? 884  ASP A OD1   1 
ATOM   7221  O  OD2   . ASP C 3 884  ? -5.150  106.124 65.203  1.00 24.85  ? 884  ASP A OD2   1 
ATOM   7222  N  N     . PRO C 3 885  ? -9.623  105.255 62.084  1.00 25.49  ? 885  PRO A N     1 
ATOM   7223  C  CA    . PRO C 3 885  ? -10.210 104.945 60.780  1.00 22.30  ? 885  PRO A CA    1 
ATOM   7224  C  C     . PRO C 3 885  ? -9.242  105.144 59.616  1.00 21.79  ? 885  PRO A C     1 
ATOM   7225  O  O     . PRO C 3 885  ? -8.320  105.965 59.687  1.00 20.24  ? 885  PRO A O     1 
ATOM   7226  C  CB    . PRO C 3 885  ? -11.406 105.895 60.707  1.00 23.46  ? 885  PRO A CB    1 
ATOM   7227  C  CG    . PRO C 3 885  ? -10.892 107.126 61.419  1.00 21.66  ? 885  PRO A CG    1 
ATOM   7228  C  CD    . PRO C 3 885  ? -10.123 106.543 62.611  1.00 24.01  ? 885  PRO A CD    1 
ATOM   7229  N  N     . TRP C 3 886  ? -9.469  104.370 58.556  1.00 21.28  ? 886  TRP A N     1 
ATOM   7230  C  CA    . TRP C 3 886  ? -8.694  104.427 57.320  1.00 21.05  ? 886  TRP A CA    1 
ATOM   7231  C  C     . TRP C 3 886  ? -7.194  104.213 57.453  1.00 21.35  ? 886  TRP A C     1 
ATOM   7232  O  O     . TRP C 3 886  ? -6.392  104.838 56.746  1.00 20.58  ? 886  TRP A O     1 
ATOM   7233  C  CB    . TRP C 3 886  ? -8.974  105.745 56.599  1.00 19.63  ? 886  TRP A CB    1 
ATOM   7234  C  CG    . TRP C 3 886  ? -10.442 105.982 56.396  1.00 19.82  ? 886  TRP A CG    1 
ATOM   7235  C  CD1   . TRP C 3 886  ? -11.258 106.752 57.164  1.00 19.33  ? 886  TRP A CD1   1 
ATOM   7236  C  CD2   . TRP C 3 886  ? -11.276 105.390 55.392  1.00 20.56  ? 886  TRP A CD2   1 
ATOM   7237  N  NE1   . TRP C 3 886  ? -12.554 106.680 56.708  1.00 21.96  ? 886  TRP A NE1   1 
ATOM   7238  C  CE2   . TRP C 3 886  ? -12.596 105.849 55.620  1.00 22.62  ? 886  TRP A CE2   1 
ATOM   7239  C  CE3   . TRP C 3 886  ? -11.039 104.515 54.324  1.00 18.77  ? 886  TRP A CE3   1 
ATOM   7240  C  CZ2   . TRP C 3 886  ? -13.680 105.461 54.818  1.00 22.64  ? 886  TRP A CZ2   1 
ATOM   7241  C  CZ3   . TRP C 3 886  ? -12.114 104.127 53.526  1.00 23.28  ? 886  TRP A CZ3   1 
ATOM   7242  C  CH2   . TRP C 3 886  ? -13.422 104.603 53.779  1.00 22.28  ? 886  TRP A CH2   1 
ATOM   7243  N  N     . ILE C 3 887  ? -6.812  103.319 58.355  1.00 19.80  ? 887  ILE A N     1 
ATOM   7244  C  CA    . ILE C 3 887  ? -5.407  103.032 58.526  1.00 21.00  ? 887  ILE A CA    1 
ATOM   7245  C  C     . ILE C 3 887  ? -4.964  101.962 57.544  1.00 21.23  ? 887  ILE A C     1 
ATOM   7246  O  O     . ILE C 3 887  ? -3.779  101.753 57.371  1.00 25.14  ? 887  ILE A O     1 
ATOM   7247  C  CB    . ILE C 3 887  ? -5.085  102.565 59.963  1.00 20.70  ? 887  ILE A CB    1 
ATOM   7248  C  CG1   . ILE C 3 887  ? -6.050  101.460 60.383  1.00 19.51  ? 887  ILE A CG1   1 
ATOM   7249  C  CG2   . ILE C 3 887  ? -5.136  103.754 60.924  1.00 17.16  ? 887  ILE A CG2   1 
ATOM   7250  C  CD1   . ILE C 3 887  ? -5.683  100.841 61.715  1.00 20.63  ? 887  ILE A CD1   1 
ATOM   7251  N  N     . PHE C 3 888  ? -5.909  101.289 56.895  1.00 20.77  ? 888  PHE A N     1 
ATOM   7252  C  CA    . PHE C 3 888  ? -5.561  100.239 55.936  1.00 19.67  ? 888  PHE A CA    1 
ATOM   7253  C  C     . PHE C 3 888  ? -5.678  100.705 54.481  1.00 19.37  ? 888  PHE A C     1 
ATOM   7254  O  O     . PHE C 3 888  ? -6.705  101.248 54.062  1.00 19.13  ? 888  PHE A O     1 
ATOM   7255  C  CB    . PHE C 3 888  ? -6.436  98.994  56.158  1.00 18.56  ? 888  PHE A CB    1 
ATOM   7256  C  CG    . PHE C 3 888  ? -6.378  98.453  57.560  1.00 20.02  ? 888  PHE A CG    1 
ATOM   7257  C  CD1   . PHE C 3 888  ? -5.161  98.081  58.132  1.00 23.19  ? 888  PHE A CD1   1 
ATOM   7258  C  CD2   . PHE C 3 888  ? -7.533  98.352  58.331  1.00 21.37  ? 888  PHE A CD2   1 
ATOM   7259  C  CE1   . PHE C 3 888  ? -5.097  97.619  59.461  1.00 24.09  ? 888  PHE A CE1   1 
ATOM   7260  C  CE2   . PHE C 3 888  ? -7.481  97.893  59.657  1.00 20.59  ? 888  PHE A CE2   1 
ATOM   7261  C  CZ    . PHE C 3 888  ? -6.266  97.528  60.223  1.00 20.58  ? 888  PHE A CZ    1 
ATOM   7262  N  N     . SER C 3 889  ? -4.603  100.492 53.723  1.00 19.49  ? 889  SER A N     1 
ATOM   7263  C  CA    . SER C 3 889  ? -4.531  100.873 52.314  1.00 18.04  ? 889  SER A CA    1 
ATOM   7264  C  C     . SER C 3 889  ? -5.041  99.753  51.417  1.00 18.31  ? 889  SER A C     1 
ATOM   7265  O  O     . SER C 3 889  ? -5.035  98.585  51.808  1.00 18.31  ? 889  SER A O     1 
ATOM   7266  C  CB    . SER C 3 889  ? -3.080  101.205 51.934  1.00 17.38  ? 889  SER A CB    1 
ATOM   7267  O  OG    . SER C 3 889  ? -2.837  100.963 50.549  1.00 16.35  ? 889  SER A OG    1 
ATOM   7268  N  N     . TRP C 3 890  ? -5.487  100.100 50.214  1.00 19.18  ? 890  TRP A N     1 
ATOM   7269  C  CA    . TRP C 3 890  ? -5.952  99.062  49.309  1.00 20.23  ? 890  TRP A CA    1 
ATOM   7270  C  C     . TRP C 3 890  ? -4.785  98.238  48.749  1.00 21.44  ? 890  TRP A C     1 
ATOM   7271  O  O     . TRP C 3 890  ? -4.997  97.314  47.970  1.00 21.61  ? 890  TRP A O     1 
ATOM   7272  C  CB    . TRP C 3 890  ? -6.788  99.643  48.165  1.00 20.38  ? 890  TRP A CB    1 
ATOM   7273  C  CG    . TRP C 3 890  ? -6.113  100.650 47.273  1.00 21.02  ? 890  TRP A CG    1 
ATOM   7274  C  CD1   . TRP C 3 890  ? -4.769  100.778 47.019  1.00 21.77  ? 890  TRP A CD1   1 
ATOM   7275  C  CD2   . TRP C 3 890  ? -6.770  101.603 46.432  1.00 20.82  ? 890  TRP A CD2   1 
ATOM   7276  N  NE1   . TRP C 3 890  ? -4.558  101.749 46.066  1.00 20.24  ? 890  TRP A NE1   1 
ATOM   7277  C  CE2   . TRP C 3 890  ? -5.769  102.270 45.689  1.00 22.66  ? 890  TRP A CE2   1 
ATOM   7278  C  CE3   . TRP C 3 890  ? -8.113  101.957 46.232  1.00 20.61  ? 890  TRP A CE3   1 
ATOM   7279  C  CZ2   . TRP C 3 890  ? -6.073  103.276 44.754  1.00 24.01  ? 890  TRP A CZ2   1 
ATOM   7280  C  CZ3   . TRP C 3 890  ? -8.416  102.954 45.306  1.00 21.06  ? 890  TRP A CZ3   1 
ATOM   7281  C  CH2   . TRP C 3 890  ? -7.398  103.603 44.578  1.00 21.50  ? 890  TRP A CH2   1 
ATOM   7282  N  N     . TYR C 3 891  ? -3.554  98.569  49.136  1.00 20.91  ? 891  TYR A N     1 
ATOM   7283  C  CA    . TYR C 3 891  ? -2.422  97.788  48.661  1.00 20.96  ? 891  TYR A CA    1 
ATOM   7284  C  C     . TYR C 3 891  ? -2.196  96.642  49.640  1.00 21.38  ? 891  TYR A C     1 
ATOM   7285  O  O     . TYR C 3 891  ? -1.176  95.956  49.583  1.00 21.97  ? 891  TYR A O     1 
ATOM   7286  C  CB    . TYR C 3 891  ? -1.150  98.635  48.528  1.00 19.35  ? 891  TYR A CB    1 
ATOM   7287  C  CG    . TYR C 3 891  ? -1.214  99.716  47.459  1.00 19.77  ? 891  TYR A CG    1 
ATOM   7288  C  CD1   . TYR C 3 891  ? -1.253  99.400  46.094  1.00 20.68  ? 891  TYR A CD1   1 
ATOM   7289  C  CD2   . TYR C 3 891  ? -1.244  101.055 47.817  1.00 19.23  ? 891  TYR A CD2   1 
ATOM   7290  C  CE1   . TYR C 3 891  ? -1.320  100.413 45.117  1.00 20.04  ? 891  TYR A CE1   1 
ATOM   7291  C  CE2   . TYR C 3 891  ? -1.313  102.061 46.862  1.00 20.04  ? 891  TYR A CE2   1 
ATOM   7292  C  CZ    . TYR C 3 891  ? -1.349  101.746 45.522  1.00 21.46  ? 891  TYR A CZ    1 
ATOM   7293  O  OH    . TYR C 3 891  ? -1.412  102.790 44.617  1.00 21.75  ? 891  TYR A OH    1 
ATOM   7294  N  N     . MET C 3 892  ? -3.147  96.444  50.547  1.00 21.30  ? 892  MET A N     1 
ATOM   7295  C  CA    . MET C 3 892  ? -3.055  95.336  51.497  1.00 22.89  ? 892  MET A CA    1 
ATOM   7296  C  C     . MET C 3 892  ? -3.036  94.067  50.659  1.00 22.00  ? 892  MET A C     1 
ATOM   7297  O  O     . MET C 3 892  ? -3.860  93.907  49.771  1.00 22.48  ? 892  MET A O     1 
ATOM   7298  C  CB    . MET C 3 892  ? -4.283  95.285  52.418  1.00 23.95  ? 892  MET A CB    1 
ATOM   7299  C  CG    . MET C 3 892  ? -4.410  93.952  53.184  1.00 24.51  ? 892  MET A CG    1 
ATOM   7300  S  SD    . MET C 3 892  ? -5.982  93.705  54.065  1.00 22.15  ? 892  MET A SD    1 
ATOM   7301  C  CE    . MET C 3 892  ? -7.069  93.353  52.686  1.00 21.00  ? 892  MET A CE    1 
ATOM   7302  N  N     . PRO C 3 893  ? -2.100  93.147  50.929  1.00 23.35  ? 893  PRO A N     1 
ATOM   7303  C  CA    . PRO C 3 893  ? -2.049  91.909  50.141  1.00 23.37  ? 893  PRO A CA    1 
ATOM   7304  C  C     . PRO C 3 893  ? -3.349  91.104  50.208  1.00 24.58  ? 893  PRO A C     1 
ATOM   7305  O  O     . PRO C 3 893  ? -4.287  91.440  50.930  1.00 24.79  ? 893  PRO A O     1 
ATOM   7306  C  CB    . PRO C 3 893  ? -0.882  91.141  50.771  1.00 23.71  ? 893  PRO A CB    1 
ATOM   7307  C  CG    . PRO C 3 893  ? -0.006  92.215  51.318  1.00 23.62  ? 893  PRO A CG    1 
ATOM   7308  C  CD    . PRO C 3 893  ? -1.017  93.173  51.928  1.00 24.52  ? 893  PRO A CD    1 
ATOM   7309  N  N     . THR C 3 894  ? -3.374  90.015  49.459  1.00 26.13  ? 894  THR A N     1 
ATOM   7310  C  CA    . THR C 3 894  ? -4.519  89.121  49.400  1.00 24.54  ? 894  THR A CA    1 
ATOM   7311  C  C     . THR C 3 894  ? -4.196  87.901  50.274  1.00 23.81  ? 894  THR A C     1 
ATOM   7312  O  O     . THR C 3 894  ? -3.030  87.686  50.635  1.00 23.61  ? 894  THR A O     1 
ATOM   7313  C  CB    . THR C 3 894  ? -4.748  88.701  47.909  1.00 25.93  ? 894  THR A CB    1 
ATOM   7314  O  OG1   . THR C 3 894  ? -6.134  88.823  47.592  1.00 27.78  ? 894  THR A OG1   1 
ATOM   7315  C  CG2   . THR C 3 894  ? -4.288  87.270  47.642  1.00 22.78  ? 894  THR A CG2   1 
ATOM   7316  N  N     . GLY C 3 895  ? -5.221  87.122  50.624  1.00 21.56  ? 895  GLY A N     1 
ATOM   7317  C  CA    . GLY C 3 895  ? -5.023  85.915  51.423  1.00 19.26  ? 895  GLY A CA    1 
ATOM   7318  C  C     . GLY C 3 895  ? -4.246  86.000  52.733  1.00 19.82  ? 895  GLY A C     1 
ATOM   7319  O  O     . GLY C 3 895  ? -4.240  87.028  53.421  1.00 21.27  ? 895  GLY A O     1 
ATOM   7320  N  N     . ASP C 3 896  ? -3.580  84.912  53.095  1.00 18.30  ? 896  ASP A N     1 
ATOM   7321  C  CA    . ASP C 3 896  ? -2.825  84.894  54.340  1.00 18.60  ? 896  ASP A CA    1 
ATOM   7322  C  C     . ASP C 3 896  ? -1.851  86.054  54.520  1.00 18.57  ? 896  ASP A C     1 
ATOM   7323  O  O     . ASP C 3 896  ? -1.745  86.620  55.605  1.00 17.91  ? 896  ASP A O     1 
ATOM   7324  C  CB    . ASP C 3 896  ? -2.083  83.571  54.490  1.00 17.35  ? 896  ASP A CB    1 
ATOM   7325  C  CG    . ASP C 3 896  ? -3.021  82.431  54.758  1.00 19.27  ? 896  ASP A CG    1 
ATOM   7326  O  OD1   . ASP C 3 896  ? -4.116  82.722  55.289  1.00 16.82  ? 896  ASP A OD1   1 
ATOM   7327  O  OD2   . ASP C 3 896  ? -2.674  81.264  54.450  1.00 16.91  ? 896  ASP A OD2   1 
ATOM   7328  N  N     . LEU C 3 897  ? -1.139  86.419  53.463  1.00 19.42  ? 897  LEU A N     1 
ATOM   7329  C  CA    . LEU C 3 897  ? -0.191  87.509  53.583  1.00 19.55  ? 897  LEU A CA    1 
ATOM   7330  C  C     . LEU C 3 897  ? -0.904  88.789  54.016  1.00 21.05  ? 897  LEU A C     1 
ATOM   7331  O  O     . LEU C 3 897  ? -0.414  89.519  54.885  1.00 20.07  ? 897  LEU A O     1 
ATOM   7332  C  CB    . LEU C 3 897  ? 0.531   87.733  52.260  1.00 16.97  ? 897  LEU A CB    1 
ATOM   7333  C  CG    . LEU C 3 897  ? 1.594   88.818  52.399  1.00 15.90  ? 897  LEU A CG    1 
ATOM   7334  C  CD1   . LEU C 3 897  ? 2.633   88.381  53.433  1.00 14.84  ? 897  LEU A CD1   1 
ATOM   7335  C  CD2   . LEU C 3 897  ? 2.228   89.080  51.056  1.00 11.27  ? 897  LEU A CD2   1 
ATOM   7336  N  N     . GLY C 3 898  ? -2.064  89.038  53.406  1.00 21.15  ? 898  GLY A N     1 
ATOM   7337  C  CA    . GLY C 3 898  ? -2.850  90.209  53.726  1.00 20.74  ? 898  GLY A CA    1 
ATOM   7338  C  C     . GLY C 3 898  ? -3.460  90.113  55.113  1.00 22.10  ? 898  GLY A C     1 
ATOM   7339  O  O     . GLY C 3 898  ? -3.525  91.118  55.829  1.00 22.28  ? 898  GLY A O     1 
ATOM   7340  N  N     . MET C 3 899  ? -3.916  88.918  55.495  1.00 22.07  ? 899  MET A N     1 
ATOM   7341  C  CA    . MET C 3 899  ? -4.509  88.711  56.819  1.00 22.39  ? 899  MET A CA    1 
ATOM   7342  C  C     . MET C 3 899  ? -3.448  88.991  57.885  1.00 24.13  ? 899  MET A C     1 
ATOM   7343  O  O     . MET C 3 899  ? -3.714  89.614  58.916  1.00 24.87  ? 899  MET A O     1 
ATOM   7344  C  CB    . MET C 3 899  ? -5.018  87.274  56.963  1.00 19.98  ? 899  MET A CB    1 
ATOM   7345  C  CG    . MET C 3 899  ? -6.273  86.956  56.177  1.00 22.66  ? 899  MET A CG    1 
ATOM   7346  S  SD    . MET C 3 899  ? -7.754  87.847  56.764  1.00 25.53  ? 899  MET A SD    1 
ATOM   7347  C  CE    . MET C 3 899  ? -8.030  87.032  58.372  1.00 24.42  ? 899  MET A CE    1 
ATOM   7348  N  N     . TYR C 3 900  ? -2.238  88.521  57.615  1.00 25.61  ? 900  TYR A N     1 
ATOM   7349  C  CA    . TYR C 3 900  ? -1.120  88.711  58.517  1.00 24.80  ? 900  TYR A CA    1 
ATOM   7350  C  C     . TYR C 3 900  ? -0.862  90.194  58.666  1.00 24.28  ? 900  TYR A C     1 
ATOM   7351  O  O     . TYR C 3 900  ? -0.724  90.699  59.781  1.00 25.65  ? 900  TYR A O     1 
ATOM   7352  C  CB    . TYR C 3 900  ? 0.128   88.027  57.955  1.00 25.12  ? 900  TYR A CB    1 
ATOM   7353  C  CG    . TYR C 3 900  ? 1.408   88.459  58.632  1.00 26.92  ? 900  TYR A CG    1 
ATOM   7354  C  CD1   . TYR C 3 900  ? 1.761   87.965  59.893  1.00 27.13  ? 900  TYR A CD1   1 
ATOM   7355  C  CD2   . TYR C 3 900  ? 2.238   89.419  58.039  1.00 27.07  ? 900  TYR A CD2   1 
ATOM   7356  C  CE1   . TYR C 3 900  ? 2.909   88.421  60.548  1.00 26.87  ? 900  TYR A CE1   1 
ATOM   7357  C  CE2   . TYR C 3 900  ? 3.379   89.883  58.683  1.00 27.43  ? 900  TYR A CE2   1 
ATOM   7358  C  CZ    . TYR C 3 900  ? 3.708   89.384  59.936  1.00 28.02  ? 900  TYR A CZ    1 
ATOM   7359  O  OH    . TYR C 3 900  ? 4.821   89.869  60.580  1.00 28.85  ? 900  TYR A OH    1 
ATOM   7360  N  N     . SER C 3 901  ? -0.806  90.889  57.534  1.00 23.31  ? 901  SER A N     1 
ATOM   7361  C  CA    . SER C 3 901  ? -0.533  92.325  57.516  1.00 21.84  ? 901  SER A CA    1 
ATOM   7362  C  C     . SER C 3 901  ? -1.482  93.184  58.346  1.00 21.53  ? 901  SER A C     1 
ATOM   7363  O  O     . SER C 3 901  ? -1.046  93.906  59.240  1.00 20.70  ? 901  SER A O     1 
ATOM   7364  C  CB    . SER C 3 901  ? -0.526  92.848  56.079  1.00 21.12  ? 901  SER A CB    1 
ATOM   7365  O  OG    . SER C 3 901  ? 0.533   92.296  55.338  1.00 20.22  ? 901  SER A OG    1 
ATOM   7366  N  N     . TRP C 3 902  ? -2.779  93.120  58.062  1.00 22.50  ? 902  TRP A N     1 
ATOM   7367  C  CA    . TRP C 3 902  ? -3.692  93.959  58.818  1.00 23.07  ? 902  TRP A CA    1 
ATOM   7368  C  C     . TRP C 3 902  ? -3.775  93.533  60.267  1.00 23.36  ? 902  TRP A C     1 
ATOM   7369  O  O     . TRP C 3 902  ? -3.928  94.381  61.143  1.00 24.98  ? 902  TRP A O     1 
ATOM   7370  C  CB    . TRP C 3 902  ? -5.090  94.035  58.162  1.00 20.82  ? 902  TRP A CB    1 
ATOM   7371  C  CG    . TRP C 3 902  ? -5.970  92.832  58.300  1.00 23.28  ? 902  TRP A CG    1 
ATOM   7372  C  CD1   . TRP C 3 902  ? -6.166  91.839  57.375  1.00 22.64  ? 902  TRP A CD1   1 
ATOM   7373  C  CD2   . TRP C 3 902  ? -6.806  92.507  59.421  1.00 24.34  ? 902  TRP A CD2   1 
ATOM   7374  N  NE1   . TRP C 3 902  ? -7.075  90.918  57.852  1.00 24.10  ? 902  TRP A NE1   1 
ATOM   7375  C  CE2   . TRP C 3 902  ? -7.483  91.302  59.104  1.00 23.89  ? 902  TRP A CE2   1 
ATOM   7376  C  CE3   . TRP C 3 902  ? -7.048  93.116  60.663  1.00 24.44  ? 902  TRP A CE3   1 
ATOM   7377  C  CZ2   . TRP C 3 902  ? -8.387  90.694  59.987  1.00 25.15  ? 902  TRP A CZ2   1 
ATOM   7378  C  CZ3   . TRP C 3 902  ? -7.950  92.510  61.543  1.00 25.26  ? 902  TRP A CZ3   1 
ATOM   7379  C  CH2   . TRP C 3 902  ? -8.607  91.309  61.198  1.00 25.63  ? 902  TRP A CH2   1 
ATOM   7380  N  N     . ILE C 3 903  ? -3.637  92.236  60.540  1.00 23.54  ? 903  ILE A N     1 
ATOM   7381  C  CA    . ILE C 3 903  ? -3.691  91.775  61.929  1.00 23.40  ? 903  ILE A CA    1 
ATOM   7382  C  C     . ILE C 3 903  ? -2.482  92.218  62.750  1.00 24.12  ? 903  ILE A C     1 
ATOM   7383  O  O     . ILE C 3 903  ? -2.620  92.543  63.926  1.00 26.07  ? 903  ILE A O     1 
ATOM   7384  C  CB    . ILE C 3 903  ? -3.826  90.247  62.026  1.00 21.58  ? 903  ILE A CB    1 
ATOM   7385  C  CG1   . ILE C 3 903  ? -5.260  89.841  61.701  1.00 18.22  ? 903  ILE A CG1   1 
ATOM   7386  C  CG2   . ILE C 3 903  ? -3.440  89.759  63.432  1.00 18.77  ? 903  ILE A CG2   1 
ATOM   7387  C  CD1   . ILE C 3 903  ? -5.438  88.364  61.632  1.00 18.96  ? 903  ILE A CD1   1 
ATOM   7388  N  N     . SER C 3 904  ? -1.305  92.234  62.135  1.00 24.87  ? 904  SER A N     1 
ATOM   7389  C  CA    . SER C 3 904  ? -0.086  92.652  62.825  1.00 24.59  ? 904  SER A CA    1 
ATOM   7390  C  C     . SER C 3 904  ? -0.051  94.156  63.086  1.00 25.40  ? 904  SER A C     1 
ATOM   7391  O  O     . SER C 3 904  ? 0.540   94.601  64.075  1.00 25.73  ? 904  SER A O     1 
ATOM   7392  C  CB    . SER C 3 904  ? 1.149   92.268  62.012  1.00 25.58  ? 904  SER A CB    1 
ATOM   7393  O  OG    . SER C 3 904  ? 1.291   90.865  61.941  1.00 28.84  ? 904  SER A OG    1 
ATOM   7394  N  N     . LEU C 3 905  ? -0.659  94.939  62.194  1.00 25.15  ? 905  LEU A N     1 
ATOM   7395  C  CA    . LEU C 3 905  ? -0.689  96.388  62.363  1.00 23.96  ? 905  LEU A CA    1 
ATOM   7396  C  C     . LEU C 3 905  ? -1.503  96.784  63.581  1.00 25.51  ? 905  LEU A C     1 
ATOM   7397  O  O     . LEU C 3 905  ? -1.354  97.887  64.087  1.00 28.14  ? 905  LEU A O     1 
ATOM   7398  C  CB    . LEU C 3 905  ? -1.280  97.082  61.130  1.00 22.79  ? 905  LEU A CB    1 
ATOM   7399  C  CG    . LEU C 3 905  ? -0.357  97.342  59.936  1.00 22.01  ? 905  LEU A CG    1 
ATOM   7400  C  CD1   . LEU C 3 905  ? -1.151  97.943  58.802  1.00 21.79  ? 905  LEU A CD1   1 
ATOM   7401  C  CD2   . LEU C 3 905  ? 0.776   98.259  60.350  1.00 20.78  ? 905  LEU A CD2   1 
ATOM   7402  N  N     . ILE C 3 906  ? -2.376  95.902  64.051  1.00 25.49  ? 906  ILE A N     1 
ATOM   7403  C  CA    . ILE C 3 906  ? -3.178  96.229  65.216  1.00 26.35  ? 906  ILE A CA    1 
ATOM   7404  C  C     . ILE C 3 906  ? -3.253  95.095  66.230  1.00 28.57  ? 906  ILE A C     1 
ATOM   7405  O  O     . ILE C 3 906  ? -4.191  95.030  67.029  1.00 28.28  ? 906  ILE A O     1 
ATOM   7406  C  CB    . ILE C 3 906  ? -4.615  96.642  64.816  1.00 24.24  ? 906  ILE A CB    1 
ATOM   7407  C  CG1   . ILE C 3 906  ? -5.296  95.514  64.034  1.00 23.78  ? 906  ILE A CG1   1 
ATOM   7408  C  CG2   . ILE C 3 906  ? -4.566  97.931  64.025  1.00 22.36  ? 906  ILE A CG2   1 
ATOM   7409  C  CD1   . ILE C 3 906  ? -6.763  95.758  63.737  1.00 21.65  ? 906  ILE A CD1   1 
ATOM   7410  N  N     . ARG C 3 907  ? -2.264  94.204  66.197  1.00 30.38  ? 907  ARG A N     1 
ATOM   7411  C  CA    . ARG C 3 907  ? -2.228  93.082  67.128  1.00 32.90  ? 907  ARG A CA    1 
ATOM   7412  C  C     . ARG C 3 907  ? -2.638  93.537  68.549  1.00 33.36  ? 907  ARG A C     1 
ATOM   7413  O  O     . ARG C 3 907  ? -3.584  92.992  69.135  1.00 32.44  ? 907  ARG A O     1 
ATOM   7414  C  CB    . ARG C 3 907  ? -0.827  92.451  67.140  1.00 32.92  ? 907  ARG A CB    1 
ATOM   7415  C  CG    . ARG C 3 907  ? -0.662  91.349  68.171  1.00 40.81  ? 907  ARG A CG    1 
ATOM   7416  C  CD    . ARG C 3 907  ? 0.794   90.911  68.328  1.00 44.74  ? 907  ARG A CD    1 
ATOM   7417  N  NE    . ARG C 3 907  ? 1.293   90.256  67.122  1.00 50.42  ? 907  ARG A NE    1 
ATOM   7418  C  CZ    . ARG C 3 907  ? 2.189   89.269  67.116  1.00 53.48  ? 907  ARG A CZ    1 
ATOM   7419  N  NH1   . ARG C 3 907  ? 2.690   88.813  68.263  1.00 54.98  ? 907  ARG A NH1   1 
ATOM   7420  N  NH2   . ARG C 3 907  ? 2.585   88.733  65.963  1.00 51.38  ? 907  ARG A NH2   1 
ATOM   7421  N  N     . PRO C 3 908  ? -1.949  94.555  69.104  1.00 32.88  ? 908  PRO A N     1 
ATOM   7422  C  CA    . PRO C 3 908  ? -2.241  95.079  70.447  1.00 34.06  ? 908  PRO A CA    1 
ATOM   7423  C  C     . PRO C 3 908  ? -3.672  95.601  70.602  1.00 33.89  ? 908  PRO A C     1 
ATOM   7424  O  O     . PRO C 3 908  ? -4.346  95.301  71.584  1.00 32.89  ? 908  PRO A O     1 
ATOM   7425  C  CB    . PRO C 3 908  ? -1.203  96.193  70.622  1.00 33.96  ? 908  PRO A CB    1 
ATOM   7426  C  CG    . PRO C 3 908  ? -0.065  95.732  69.781  1.00 34.68  ? 908  PRO A CG    1 
ATOM   7427  C  CD    . PRO C 3 908  ? -0.769  95.232  68.537  1.00 34.56  ? 908  PRO A CD    1 
ATOM   7428  N  N     . LEU C 3 909  ? -4.123  96.397  69.639  1.00 33.48  ? 909  LEU A N     1 
ATOM   7429  C  CA    . LEU C 3 909  ? -5.473  96.935  69.682  1.00 32.81  ? 909  LEU A CA    1 
ATOM   7430  C  C     . LEU C 3 909  ? -6.441  95.766  69.801  1.00 32.59  ? 909  LEU A C     1 
ATOM   7431  O  O     . LEU C 3 909  ? -7.384  95.795  70.593  1.00 31.77  ? 909  LEU A O     1 
ATOM   7432  C  CB    . LEU C 3 909  ? -5.782  97.705  68.399  1.00 34.72  ? 909  LEU A CB    1 
ATOM   7433  C  CG    . LEU C 3 909  ? -6.427  99.095  68.469  1.00 39.83  ? 909  LEU A CG    1 
ATOM   7434  C  CD1   . LEU C 3 909  ? -7.410  99.168  69.651  1.00 39.95  ? 909  LEU A CD1   1 
ATOM   7435  C  CD2   . LEU C 3 909  ? -5.335  100.151 68.627  1.00 40.56  ? 909  LEU A CD2   1 
ATOM   7436  N  N     . MET C 3 910  ? -6.200  94.732  69.000  1.00 32.68  ? 910  MET A N     1 
ATOM   7437  C  CA    . MET C 3 910  ? -7.061  93.556  68.991  1.00 32.94  ? 910  MET A CA    1 
ATOM   7438  C  C     . MET C 3 910  ? -7.077  92.848  70.341  1.00 33.40  ? 910  MET A C     1 
ATOM   7439  O  O     . MET C 3 910  ? -8.139  92.598  70.907  1.00 33.56  ? 910  MET A O     1 
ATOM   7440  C  CB    . MET C 3 910  ? -6.618  92.600  67.885  1.00 31.14  ? 910  MET A CB    1 
ATOM   7441  C  CG    . MET C 3 910  ? -6.860  93.136  66.480  1.00 30.12  ? 910  MET A CG    1 
ATOM   7442  S  SD    . MET C 3 910  ? -6.130  92.098  65.184  1.00 31.49  ? 910  MET A SD    1 
ATOM   7443  C  CE    . MET C 3 910  ? -7.372  90.774  65.043  1.00 28.35  ? 910  MET A CE    1 
ATOM   7444  N  N     . THR C 3 911  ? -5.892  92.535  70.851  1.00 34.71  ? 911  THR A N     1 
ATOM   7445  C  CA    . THR C 3 911  ? -5.752  91.874  72.139  1.00 35.30  ? 911  THR A CA    1 
ATOM   7446  C  C     . THR C 3 911  ? -6.495  92.655  73.230  1.00 36.22  ? 911  THR A C     1 
ATOM   7447  O  O     . THR C 3 911  ? -7.207  92.074  74.060  1.00 37.39  ? 911  THR A O     1 
ATOM   7448  C  CB    . THR C 3 911  ? -4.257  91.764  72.533  1.00 35.67  ? 911  THR A CB    1 
ATOM   7449  O  OG1   . THR C 3 911  ? -3.580  90.914  71.599  1.00 36.74  ? 911  THR A OG1   1 
ATOM   7450  C  CG2   . THR C 3 911  ? -4.101  91.194  73.941  1.00 34.25  ? 911  THR A CG2   1 
ATOM   7451  N  N     . ARG C 3 912  ? -6.328  93.973  73.218  1.00 35.50  ? 912  ARG A N     1 
ATOM   7452  C  CA    . ARG C 3 912  ? -6.955  94.840  74.209  1.00 36.67  ? 912  ARG A CA    1 
ATOM   7453  C  C     . ARG C 3 912  ? -8.462  94.820  74.038  1.00 34.96  ? 912  ARG A C     1 
ATOM   7454  O  O     . ARG C 3 912  ? -9.210  94.679  75.007  1.00 35.25  ? 912  ARG A O     1 
ATOM   7455  C  CB    . ARG C 3 912  ? -6.427  96.273  74.062  1.00 40.29  ? 912  ARG A CB    1 
ATOM   7456  C  CG    . ARG C 3 912  ? -6.725  97.200  75.234  1.00 45.12  ? 912  ARG A CG    1 
ATOM   7457  C  CD    . ARG C 3 912  ? -5.981  98.531  75.062  1.00 51.11  ? 912  ARG A CD    1 
ATOM   7458  N  NE    . ARG C 3 912  ? -6.652  99.474  74.158  1.00 54.86  ? 912  ARG A NE    1 
ATOM   7459  C  CZ    . ARG C 3 912  ? -6.019  100.347 73.372  1.00 55.84  ? 912  ARG A CZ    1 
ATOM   7460  N  NH1   . ARG C 3 912  ? -4.690  100.400 73.358  1.00 55.53  ? 912  ARG A NH1   1 
ATOM   7461  N  NH2   . ARG C 3 912  ? -6.713  101.187 72.615  1.00 56.61  ? 912  ARG A NH2   1 
ATOM   7462  N  N     . TRP C 3 913  ? -8.908  94.957  72.799  1.00 32.64  ? 913  TRP A N     1 
ATOM   7463  C  CA    . TRP C 3 913  ? -10.333 94.954  72.537  1.00 31.79  ? 913  TRP A CA    1 
ATOM   7464  C  C     . TRP C 3 913  ? -10.950 93.630  72.982  1.00 31.88  ? 913  TRP A C     1 
ATOM   7465  O  O     . TRP C 3 913  ? -11.995 93.613  73.638  1.00 31.65  ? 913  TRP A O     1 
ATOM   7466  C  CB    . TRP C 3 913  ? -10.607 95.169  71.050  1.00 29.61  ? 913  TRP A CB    1 
ATOM   7467  C  CG    . TRP C 3 913  ? -12.064 95.181  70.738  1.00 27.03  ? 913  TRP A CG    1 
ATOM   7468  C  CD1   . TRP C 3 913  ? -12.888 96.268  70.703  1.00 25.49  ? 913  TRP A CD1   1 
ATOM   7469  C  CD2   . TRP C 3 913  ? -12.894 94.038  70.483  1.00 25.36  ? 913  TRP A CD2   1 
ATOM   7470  N  NE1   . TRP C 3 913  ? -14.181 95.875  70.446  1.00 25.23  ? 913  TRP A NE1   1 
ATOM   7471  C  CE2   . TRP C 3 913  ? -14.213 94.511  70.305  1.00 24.95  ? 913  TRP A CE2   1 
ATOM   7472  C  CE3   . TRP C 3 913  ? -12.651 92.660  70.388  1.00 24.03  ? 913  TRP A CE3   1 
ATOM   7473  C  CZ2   . TRP C 3 913  ? -15.291 93.652  70.035  1.00 23.07  ? 913  TRP A CZ2   1 
ATOM   7474  C  CZ3   . TRP C 3 913  ? -13.725 91.804  70.117  1.00 24.81  ? 913  TRP A CZ3   1 
ATOM   7475  C  CH2   . TRP C 3 913  ? -15.026 92.308  69.944  1.00 23.03  ? 913  TRP A CH2   1 
ATOM   7476  N  N     . MET C 3 914  ? -10.303 92.523  72.626  1.00 31.58  ? 914  MET A N     1 
ATOM   7477  C  CA    . MET C 3 914  ? -10.821 91.206  72.984  1.00 31.36  ? 914  MET A CA    1 
ATOM   7478  C  C     . MET C 3 914  ? -11.012 91.014  74.479  1.00 31.29  ? 914  MET A C     1 
ATOM   7479  O  O     . MET C 3 914  ? -12.053 90.517  74.916  1.00 31.94  ? 914  MET A O     1 
ATOM   7480  C  CB    . MET C 3 914  ? -9.921  90.104  72.423  1.00 31.32  ? 914  MET A CB    1 
ATOM   7481  C  CG    . MET C 3 914  ? -10.142 89.840  70.932  1.00 29.57  ? 914  MET A CG    1 
ATOM   7482  S  SD    . MET C 3 914  ? -9.290  88.375  70.328  1.00 29.72  ? 914  MET A SD    1 
ATOM   7483  C  CE    . MET C 3 914  ? -7.836  89.113  69.548  1.00 28.92  ? 914  MET A CE    1 
ATOM   7484  N  N     . VAL C 3 915  ? -10.013 91.412  75.261  1.00 31.79  ? 915  VAL A N     1 
ATOM   7485  C  CA    . VAL C 3 915  ? -10.087 91.284  76.712  1.00 31.63  ? 915  VAL A CA    1 
ATOM   7486  C  C     . VAL C 3 915  ? -11.179 92.174  77.284  1.00 32.36  ? 915  VAL A C     1 
ATOM   7487  O  O     . VAL C 3 915  ? -11.998 91.725  78.076  1.00 32.79  ? 915  VAL A O     1 
ATOM   7488  C  CB    . VAL C 3 915  ? -8.753  91.663  77.386  1.00 31.48  ? 915  VAL A CB    1 
ATOM   7489  C  CG1   . VAL C 3 915  ? -8.943  91.756  78.885  1.00 29.99  ? 915  VAL A CG1   1 
ATOM   7490  C  CG2   . VAL C 3 915  ? -7.688  90.623  77.061  1.00 30.45  ? 915  VAL A CG2   1 
ATOM   7491  N  N     . ALA C 3 916  ? -11.191 93.436  76.875  1.00 33.47  ? 916  ALA A N     1 
ATOM   7492  C  CA    . ALA C 3 916  ? -12.184 94.377  77.366  1.00 34.64  ? 916  ALA A CA    1 
ATOM   7493  C  C     . ALA C 3 916  ? -13.610 93.984  76.989  1.00 36.47  ? 916  ALA A C     1 
ATOM   7494  O  O     . ALA C 3 916  ? -14.565 94.641  77.407  1.00 38.11  ? 916  ALA A O     1 
ATOM   7495  C  CB    . ALA C 3 916  ? -11.875 95.775  76.854  1.00 35.26  ? 916  ALA A CB    1 
ATOM   7496  N  N     . ASN C 3 917  ? -13.765 92.924  76.199  1.00 37.16  ? 917  ASN A N     1 
ATOM   7497  C  CA    . ASN C 3 917  ? -15.098 92.476  75.807  1.00 36.11  ? 917  ASN A CA    1 
ATOM   7498  C  C     . ASN C 3 917  ? -15.401 91.057  76.259  1.00 35.68  ? 917  ASN A C     1 
ATOM   7499  O  O     . ASN C 3 917  ? -16.221 90.366  75.653  1.00 35.15  ? 917  ASN A O     1 
ATOM   7500  C  CB    . ASN C 3 917  ? -15.295 92.588  74.290  1.00 37.62  ? 917  ASN A CB    1 
ATOM   7501  C  CG    . ASN C 3 917  ? -15.699 93.993  73.852  1.00 38.37  ? 917  ASN A CG    1 
ATOM   7502  O  OD1   . ASN C 3 917  ? -14.854 94.883  73.727  1.00 37.61  ? 917  ASN A OD1   1 
ATOM   7503  N  ND2   . ASN C 3 917  ? -17.001 94.198  73.631  1.00 35.79  ? 917  ASN A ND2   1 
ATOM   7504  N  N     . GLY C 3 918  ? -14.732 90.623  77.322  1.00 35.58  ? 918  GLY A N     1 
ATOM   7505  C  CA    . GLY C 3 918  ? -14.969 89.291  77.856  1.00 36.11  ? 918  GLY A CA    1 
ATOM   7506  C  C     . GLY C 3 918  ? -14.174 88.127  77.283  1.00 37.01  ? 918  GLY A C     1 
ATOM   7507  O  O     . GLY C 3 918  ? -14.187 87.034  77.860  1.00 35.69  ? 918  GLY A O     1 
ATOM   7508  N  N     . TYR C 3 919  ? -13.490 88.337  76.158  1.00 36.96  ? 919  TYR A N     1 
ATOM   7509  C  CA    . TYR C 3 919  ? -12.714 87.261  75.548  1.00 37.04  ? 919  TYR A CA    1 
ATOM   7510  C  C     . TYR C 3 919  ? -11.352 87.159  76.233  1.00 38.88  ? 919  TYR A C     1 
ATOM   7511  O  O     . TYR C 3 919  ? -10.322 87.528  75.663  1.00 39.82  ? 919  TYR A O     1 
ATOM   7512  C  CB    . TYR C 3 919  ? -12.559 87.525  74.051  1.00 36.19  ? 919  TYR A CB    1 
ATOM   7513  C  CG    . TYR C 3 919  ? -13.878 87.628  73.305  1.00 35.59  ? 919  TYR A CG    1 
ATOM   7514  C  CD1   . TYR C 3 919  ? -14.639 86.489  73.019  1.00 35.72  ? 919  TYR A CD1   1 
ATOM   7515  C  CD2   . TYR C 3 919  ? -14.367 88.866  72.885  1.00 35.72  ? 919  TYR A CD2   1 
ATOM   7516  C  CE1   . TYR C 3 919  ? -15.857 86.582  72.327  1.00 34.47  ? 919  TYR A CE1   1 
ATOM   7517  C  CE2   . TYR C 3 919  ? -15.583 88.973  72.196  1.00 35.27  ? 919  TYR A CE2   1 
ATOM   7518  C  CZ    . TYR C 3 919  ? -16.319 87.829  71.919  1.00 35.48  ? 919  TYR A CZ    1 
ATOM   7519  O  OH    . TYR C 3 919  ? -17.501 87.943  71.220  1.00 33.82  ? 919  TYR A OH    1 
ATOM   7520  N  N     . VAL C 3 920  ? -11.362 86.639  77.461  1.00 39.14  ? 920  VAL A N     1 
ATOM   7521  C  CA    . VAL C 3 920  ? -10.151 86.511  78.267  1.00 39.16  ? 920  VAL A CA    1 
ATOM   7522  C  C     . VAL C 3 920  ? -9.854  85.062  78.643  1.00 39.14  ? 920  VAL A C     1 
ATOM   7523  O  O     . VAL C 3 920  ? -10.764 84.237  78.721  1.00 40.34  ? 920  VAL A O     1 
ATOM   7524  C  CB    . VAL C 3 920  ? -10.283 87.308  79.590  1.00 39.42  ? 920  VAL A CB    1 
ATOM   7525  C  CG1   . VAL C 3 920  ? -8.914  87.813  80.037  1.00 39.60  ? 920  VAL A CG1   1 
ATOM   7526  C  CG2   . VAL C 3 920  ? -11.261 88.452  79.424  1.00 39.41  ? 920  VAL A CG2   1 
ATOM   7527  N  N     . THR C 3 921  ? -8.581  84.765  78.888  1.00 38.26  ? 921  THR A N     1 
ATOM   7528  C  CA    . THR C 3 921  ? -8.157  83.427  79.289  1.00 39.44  ? 921  THR A CA    1 
ATOM   7529  C  C     . THR C 3 921  ? -6.895  83.529  80.137  1.00 40.83  ? 921  THR A C     1 
ATOM   7530  O  O     . THR C 3 921  ? -6.270  84.586  80.197  1.00 41.40  ? 921  THR A O     1 
ATOM   7531  C  CB    . THR C 3 921  ? -7.860  82.508  78.060  1.00 38.91  ? 921  THR A CB    1 
ATOM   7532  O  OG1   . THR C 3 921  ? -7.344  81.247  78.516  1.00 37.03  ? 921  THR A OG1   1 
ATOM   7533  C  CG2   . THR C 3 921  ? -6.843  83.158  77.126  1.00 36.07  ? 921  THR A CG2   1 
ATOM   7534  N  N     . ASP C 3 922  ? -6.529  82.431  80.791  1.00 42.60  ? 922  ASP A N     1 
ATOM   7535  C  CA    . ASP C 3 922  ? -5.334  82.392  81.625  1.00 45.59  ? 922  ASP A CA    1 
ATOM   7536  C  C     . ASP C 3 922  ? -4.126  81.987  80.792  1.00 47.42  ? 922  ASP A C     1 
ATOM   7537  O  O     . ASP C 3 922  ? -2.979  82.309  81.126  1.00 46.11  ? 922  ASP A O     1 
ATOM   7538  C  CB    . ASP C 3 922  ? -5.524  81.403  82.771  1.00 46.22  ? 922  ASP A CB    1 
ATOM   7539  C  CG    . ASP C 3 922  ? -6.478  81.917  83.819  1.00 46.20  ? 922  ASP A CG    1 
ATOM   7540  O  OD1   . ASP C 3 922  ? -6.112  82.891  84.511  1.00 46.23  ? 922  ASP A OD1   1 
ATOM   7541  O  OD2   . ASP C 3 922  ? -7.589  81.356  83.944  1.00 46.02  ? 922  ASP A OD2   1 
ATOM   7542  N  N     . ARG C 3 923  ? -4.396  81.269  79.708  1.00 49.17  ? 923  ARG A N     1 
ATOM   7543  C  CA    . ARG C 3 923  ? -3.344  80.831  78.806  1.00 51.66  ? 923  ARG A CA    1 
ATOM   7544  C  C     . ARG C 3 923  ? -2.844  82.077  78.084  1.00 52.06  ? 923  ARG A C     1 
ATOM   7545  O  O     . ARG C 3 923  ? -3.640  82.864  77.571  1.00 52.53  ? 923  ARG A O     1 
ATOM   7546  C  CB    . ARG C 3 923  ? -3.912  79.816  77.813  1.00 51.96  ? 923  ARG A CB    1 
ATOM   7547  C  CG    . ARG C 3 923  ? -4.571  78.620  78.502  1.00 55.67  ? 923  ARG A CG    1 
ATOM   7548  C  CD    . ARG C 3 923  ? -5.950  78.326  77.925  1.00 58.27  ? 923  ARG A CD    1 
ATOM   7549  N  NE    . ARG C 3 923  ? -6.015  77.021  77.268  1.00 60.76  ? 923  ARG A NE    1 
ATOM   7550  C  CZ    . ARG C 3 923  ? -5.234  76.643  76.258  1.00 62.43  ? 923  ARG A CZ    1 
ATOM   7551  N  NH1   . ARG C 3 923  ? -4.312  77.469  75.775  1.00 62.67  ? 923  ARG A NH1   1 
ATOM   7552  N  NH2   . ARG C 3 923  ? -5.376  75.438  75.721  1.00 63.53  ? 923  ARG A NH2   1 
ATOM   7553  N  N     . CYS C 3 924  ? -1.533  82.277  78.062  1.00 51.88  ? 924  CYS A N     1 
ATOM   7554  C  CA    . CYS C 3 924  ? -0.996  83.452  77.402  1.00 52.51  ? 924  CYS A CA    1 
ATOM   7555  C  C     . CYS C 3 924  ? -0.610  83.148  75.964  1.00 51.98  ? 924  CYS A C     1 
ATOM   7556  O  O     . CYS C 3 924  ? 0.398   82.487  75.704  1.00 52.16  ? 924  CYS A O     1 
ATOM   7557  C  CB    . CYS C 3 924  ? 0.220   83.990  78.159  1.00 53.79  ? 924  CYS A CB    1 
ATOM   7558  S  SG    . CYS C 3 924  ? 0.805   85.591  77.540  1.00 57.88  ? 924  CYS A SG    1 
ATOM   7559  N  N     . SER C 3 925  ? -1.423  83.634  75.030  1.00 50.49  ? 925  SER A N     1 
ATOM   7560  C  CA    . SER C 3 925  ? -1.167  83.427  73.611  1.00 48.52  ? 925  SER A CA    1 
ATOM   7561  C  C     . SER C 3 925  ? 0.069   84.173  73.154  1.00 47.74  ? 925  SER A C     1 
ATOM   7562  O  O     . SER C 3 925  ? 0.328   85.309  73.561  1.00 47.35  ? 925  SER A O     1 
ATOM   7563  C  CB    . SER C 3 925  ? -2.351  83.889  72.759  1.00 48.55  ? 925  SER A CB    1 
ATOM   7564  O  OG    . SER C 3 925  ? -1.958  84.027  71.399  1.00 44.90  ? 925  SER A OG    1 
ATOM   7565  N  N     . THR C 3 926  ? 0.822   83.519  72.286  1.00 46.28  ? 926  THR A N     1 
ATOM   7566  C  CA    . THR C 3 926  ? 2.034   84.095  71.739  1.00 44.12  ? 926  THR A CA    1 
ATOM   7567  C  C     . THR C 3 926  ? 1.758   85.306  70.850  1.00 42.57  ? 926  THR A C     1 
ATOM   7568  O  O     . THR C 3 926  ? 2.583   86.213  70.742  1.00 42.99  ? 926  THR A O     1 
ATOM   7569  C  CB    . THR C 3 926  ? 2.750   83.077  70.903  1.00 43.11  ? 926  THR A CB    1 
ATOM   7570  O  OG1   . THR C 3 926  ? 2.886   81.866  71.649  1.00 42.98  ? 926  THR A OG1   1 
ATOM   7571  C  CG2   . THR C 3 926  ? 4.089   83.600  70.517  1.00 43.49  ? 926  THR A CG2   1 
ATOM   7572  N  N     . VAL C 3 927  ? 0.603   85.300  70.194  1.00 39.83  ? 927  VAL A N     1 
ATOM   7573  C  CA    . VAL C 3 927  ? 0.234   86.388  69.311  1.00 38.20  ? 927  VAL A CA    1 
ATOM   7574  C  C     . VAL C 3 927  ? -0.671  87.385  70.028  1.00 38.26  ? 927  VAL A C     1 
ATOM   7575  O  O     . VAL C 3 927  ? -0.392  88.588  70.055  1.00 37.97  ? 927  VAL A O     1 
ATOM   7576  C  CB    . VAL C 3 927  ? -0.517  85.860  68.049  1.00 36.15  ? 927  VAL A CB    1 
ATOM   7577  C  CG1   . VAL C 3 927  ? -0.854  87.008  67.121  1.00 33.09  ? 927  VAL A CG1   1 
ATOM   7578  C  CG2   . VAL C 3 927  ? 0.336   84.834  67.316  1.00 37.22  ? 927  VAL A CG2   1 
ATOM   7579  N  N     . PHE C 3 928  ? -1.738  86.869  70.633  1.00 36.94  ? 928  PHE A N     1 
ATOM   7580  C  CA    . PHE C 3 928  ? -2.731  87.703  71.289  1.00 36.63  ? 928  PHE A CA    1 
ATOM   7581  C  C     . PHE C 3 928  ? -2.736  87.721  72.810  1.00 36.79  ? 928  PHE A C     1 
ATOM   7582  O  O     . PHE C 3 928  ? -3.760  88.017  73.424  1.00 36.55  ? 928  PHE A O     1 
ATOM   7583  C  CB    . PHE C 3 928  ? -4.104  87.296  70.777  1.00 35.66  ? 928  PHE A CB    1 
ATOM   7584  C  CG    . PHE C 3 928  ? -4.187  87.233  69.282  1.00 33.73  ? 928  PHE A CG    1 
ATOM   7585  C  CD1   . PHE C 3 928  ? -4.342  88.395  68.532  1.00 32.90  ? 928  PHE A CD1   1 
ATOM   7586  C  CD2   . PHE C 3 928  ? -4.109  86.013  68.621  1.00 31.45  ? 928  PHE A CD2   1 
ATOM   7587  C  CE1   . PHE C 3 928  ? -4.423  88.343  67.139  1.00 31.45  ? 928  PHE A CE1   1 
ATOM   7588  C  CE2   . PHE C 3 928  ? -4.188  85.954  67.237  1.00 33.01  ? 928  PHE A CE2   1 
ATOM   7589  C  CZ    . PHE C 3 928  ? -4.348  87.128  66.493  1.00 30.44  ? 928  PHE A CZ    1 
ATOM   7590  N  N     . GLY C 3 929  ? -1.596  87.411  73.417  1.00 37.65  ? 929  GLY A N     1 
ATOM   7591  C  CA    . GLY C 3 929  ? -1.509  87.425  74.863  1.00 36.86  ? 929  GLY A CA    1 
ATOM   7592  C  C     . GLY C 3 929  ? -2.624  86.676  75.564  1.00 37.95  ? 929  GLY A C     1 
ATOM   7593  O  O     . GLY C 3 929  ? -2.947  85.548  75.201  1.00 37.22  ? 929  GLY A O     1 
ATOM   7594  N  N     . ASN C 3 930  ? -3.230  87.306  76.565  1.00 38.86  ? 930  ASN A N     1 
ATOM   7595  C  CA    . ASN C 3 930  ? -4.285  86.652  77.324  1.00 40.70  ? 930  ASN A CA    1 
ATOM   7596  C  C     . ASN C 3 930  ? -5.688  86.842  76.759  1.00 40.44  ? 930  ASN A C     1 
ATOM   7597  O  O     . ASN C 3 930  ? -6.677  86.815  77.497  1.00 40.47  ? 930  ASN A O     1 
ATOM   7598  C  CB    . ASN C 3 930  ? -4.226  87.106  78.786  1.00 43.50  ? 930  ASN A CB    1 
ATOM   7599  C  CG    . ASN C 3 930  ? -2.891  86.753  79.452  1.00 47.80  ? 930  ASN A CG    1 
ATOM   7600  O  OD1   . ASN C 3 930  ? -1.919  87.517  79.384  1.00 48.54  ? 930  ASN A OD1   1 
ATOM   7601  N  ND2   . ASN C 3 930  ? -2.837  85.578  80.082  1.00 47.80  ? 930  ASN A ND2   1 
ATOM   7602  N  N     . ALA C 3 931  ? -5.773  87.018  75.444  1.00 39.62  ? 931  ALA A N     1 
ATOM   7603  C  CA    . ALA C 3 931  ? -7.064  87.193  74.789  1.00 39.00  ? 931  ALA A CA    1 
ATOM   7604  C  C     . ALA C 3 931  ? -7.550  85.844  74.288  1.00 37.90  ? 931  ALA A C     1 
ATOM   7605  O  O     . ALA C 3 931  ? -6.792  85.077  73.695  1.00 36.69  ? 931  ALA A O     1 
ATOM   7606  C  CB    . ALA C 3 931  ? -6.946  88.175  73.631  1.00 38.51  ? 931  ALA A CB    1 
ATOM   7607  N  N     . ASP C 3 932  ? -8.819  85.558  74.541  1.00 38.00  ? 932  ASP A N     1 
ATOM   7608  C  CA    . ASP C 3 932  ? -9.414  84.302  74.122  1.00 37.97  ? 932  ASP A CA    1 
ATOM   7609  C  C     . ASP C 3 932  ? -9.739  84.415  72.631  1.00 38.17  ? 932  ASP A C     1 
ATOM   7610  O  O     . ASP C 3 932  ? -10.897 84.359  72.224  1.00 37.02  ? 932  ASP A O     1 
ATOM   7611  C  CB    . ASP C 3 932  ? -10.682 84.052  74.934  1.00 37.69  ? 932  ASP A CB    1 
ATOM   7612  C  CG    . ASP C 3 932  ? -11.180 82.639  74.802  1.00 37.89  ? 932  ASP A CG    1 
ATOM   7613  O  OD1   . ASP C 3 932  ? -10.690 81.919  73.902  1.00 38.41  ? 932  ASP A OD1   1 
ATOM   7614  O  OD2   . ASP C 3 932  ? -12.063 82.252  75.593  1.00 38.95  ? 932  ASP A OD2   1 
ATOM   7615  N  N     . TYR C 3 933  ? -8.696  84.563  71.819  1.00 40.09  ? 933  TYR A N     1 
ATOM   7616  C  CA    . TYR C 3 933  ? -8.858  84.740  70.375  1.00 40.12  ? 933  TYR A CA    1 
ATOM   7617  C  C     . TYR C 3 933  ? -9.704  83.681  69.678  1.00 39.37  ? 933  TYR A C     1 
ATOM   7618  O  O     . TYR C 3 933  ? -10.467 84.005  68.766  1.00 39.55  ? 933  TYR A O     1 
ATOM   7619  C  CB    . TYR C 3 933  ? -7.484  84.843  69.703  1.00 40.21  ? 933  TYR A CB    1 
ATOM   7620  C  CG    . TYR C 3 933  ? -6.706  83.559  69.710  1.00 42.07  ? 933  TYR A CG    1 
ATOM   7621  C  CD1   . TYR C 3 933  ? -6.837  82.638  68.671  1.00 42.41  ? 933  TYR A CD1   1 
ATOM   7622  C  CD2   . TYR C 3 933  ? -5.867  83.239  70.778  1.00 44.06  ? 933  TYR A CD2   1 
ATOM   7623  C  CE1   . TYR C 3 933  ? -6.150  81.426  68.696  1.00 44.80  ? 933  TYR A CE1   1 
ATOM   7624  C  CE2   . TYR C 3 933  ? -5.176  82.026  70.818  1.00 44.46  ? 933  TYR A CE2   1 
ATOM   7625  C  CZ    . TYR C 3 933  ? -5.324  81.124  69.774  1.00 45.83  ? 933  TYR A CZ    1 
ATOM   7626  O  OH    . TYR C 3 933  ? -4.660  79.915  69.815  1.00 47.65  ? 933  TYR A OH    1 
ATOM   7627  N  N     . ARG C 3 934  ? -9.583  82.426  70.102  1.00 39.10  ? 934  ARG A N     1 
ATOM   7628  C  CA    . ARG C 3 934  ? -10.352 81.348  69.483  1.00 37.78  ? 934  ARG A CA    1 
ATOM   7629  C  C     . ARG C 3 934  ? -11.855 81.570  69.614  1.00 35.72  ? 934  ARG A C     1 
ATOM   7630  O  O     . ARG C 3 934  ? -12.607 81.419  68.648  1.00 33.55  ? 934  ARG A O     1 
ATOM   7631  C  CB    . ARG C 3 934  ? -9.981  79.996  70.091  1.00 38.95  ? 934  ARG A CB    1 
ATOM   7632  C  CG    . ARG C 3 934  ? -8.603  79.512  69.711  1.00 43.02  ? 934  ARG A CG    1 
ATOM   7633  C  CD    . ARG C 3 934  ? -8.393  78.076  70.160  1.00 47.12  ? 934  ARG A CD    1 
ATOM   7634  N  NE    . ARG C 3 934  ? -7.012  77.646  69.982  1.00 50.79  ? 934  ARG A NE    1 
ATOM   7635  C  CZ    . ARG C 3 934  ? -6.589  76.399  70.171  1.00 53.97  ? 934  ARG A CZ    1 
ATOM   7636  N  NH1   . ARG C 3 934  ? -7.449  75.451  70.543  1.00 53.32  ? 934  ARG A NH1   1 
ATOM   7637  N  NH2   . ARG C 3 934  ? -5.304  76.102  70.002  1.00 52.44  ? 934  ARG A NH2   1 
ATOM   7638  N  N     . ARG C 3 935  ? -12.296 81.930  70.809  1.00 33.91  ? 935  ARG A N     1 
ATOM   7639  C  CA    . ARG C 3 935  ? -13.712 82.169  71.004  1.00 34.32  ? 935  ARG A CA    1 
ATOM   7640  C  C     . ARG C 3 935  ? -14.140 83.428  70.252  1.00 33.12  ? 935  ARG A C     1 
ATOM   7641  O  O     . ARG C 3 935  ? -15.192 83.446  69.615  1.00 34.30  ? 935  ARG A O     1 
ATOM   7642  C  CB    . ARG C 3 935  ? -14.034 82.309  72.491  1.00 35.29  ? 935  ARG A CB    1 
ATOM   7643  C  CG    . ARG C 3 935  ? -15.516 82.429  72.763  1.00 35.51  ? 935  ARG A CG    1 
ATOM   7644  C  CD    . ARG C 3 935  ? -15.789 82.658  74.232  1.00 36.83  ? 935  ARG A CD    1 
ATOM   7645  N  NE    . ARG C 3 935  ? -16.906 83.577  74.381  1.00 36.51  ? 935  ARG A NE    1 
ATOM   7646  C  CZ    . ARG C 3 935  ? -16.859 84.685  75.106  1.00 36.70  ? 935  ARG A CZ    1 
ATOM   7647  N  NH1   . ARG C 3 935  ? -15.746 85.003  75.759  1.00 35.87  ? 935  ARG A NH1   1 
ATOM   7648  N  NH2   . ARG C 3 935  ? -17.911 85.492  75.146  1.00 38.04  ? 935  ARG A NH2   1 
ATOM   7649  N  N     . CYS C 3 936  ? -13.323 84.475  70.315  1.00 30.97  ? 936  CYS A N     1 
ATOM   7650  C  CA    . CYS C 3 936  ? -13.637 85.720  69.626  1.00 29.15  ? 936  CYS A CA    1 
ATOM   7651  C  C     . CYS C 3 936  ? -13.797 85.528  68.118  1.00 29.21  ? 936  CYS A C     1 
ATOM   7652  O  O     . CYS C 3 936  ? -14.833 85.885  67.546  1.00 30.88  ? 936  CYS A O     1 
ATOM   7653  C  CB    . CYS C 3 936  ? -12.547 86.760  69.885  1.00 29.75  ? 936  CYS A CB    1 
ATOM   7654  S  SG    . CYS C 3 936  ? -12.824 88.343  69.038  1.00 27.73  ? 936  CYS A SG    1 
ATOM   7655  N  N     . PHE C 3 937  ? -12.787 84.952  67.468  1.00 28.20  ? 937  PHE A N     1 
ATOM   7656  C  CA    . PHE C 3 937  ? -12.851 84.762  66.014  1.00 27.26  ? 937  PHE A CA    1 
ATOM   7657  C  C     . PHE C 3 937  ? -13.948 83.838  65.490  1.00 26.70  ? 937  PHE A C     1 
ATOM   7658  O  O     . PHE C 3 937  ? -14.307 83.914  64.316  1.00 27.79  ? 937  PHE A O     1 
ATOM   7659  C  CB    . PHE C 3 937  ? -11.496 84.299  65.470  1.00 25.44  ? 937  PHE A CB    1 
ATOM   7660  C  CG    . PHE C 3 937  ? -10.369 85.263  65.742  1.00 21.86  ? 937  PHE A CG    1 
ATOM   7661  C  CD1   . PHE C 3 937  ? -10.630 86.547  66.228  1.00 16.69  ? 937  PHE A CD1   1 
ATOM   7662  C  CD2   . PHE C 3 937  ? -9.049  84.878  65.531  1.00 18.68  ? 937  PHE A CD2   1 
ATOM   7663  C  CE1   . PHE C 3 937  ? -9.598  87.422  66.501  1.00 15.94  ? 937  PHE A CE1   1 
ATOM   7664  C  CE2   . PHE C 3 937  ? -8.006  85.750  65.801  1.00 18.67  ? 937  PHE A CE2   1 
ATOM   7665  C  CZ    . PHE C 3 937  ? -8.280  87.026  66.289  1.00 18.79  ? 937  PHE A CZ    1 
ATOM   7666  N  N     . ASN C 3 938  ? -14.471 82.960  66.339  1.00 26.54  ? 938  ASN A N     1 
ATOM   7667  C  CA    . ASN C 3 938  ? -15.537 82.063  65.914  1.00 25.75  ? 938  ASN A CA    1 
ATOM   7668  C  C     . ASN C 3 938  ? -16.852 82.812  65.992  1.00 27.25  ? 938  ASN A C     1 
ATOM   7669  O  O     . ASN C 3 938  ? -17.725 82.656  65.140  1.00 25.87  ? 938  ASN A O     1 
ATOM   7670  C  CB    . ASN C 3 938  ? -15.602 80.832  66.811  1.00 23.26  ? 938  ASN A CB    1 
ATOM   7671  C  CG    . ASN C 3 938  ? -14.833 79.659  66.245  1.00 25.46  ? 938  ASN A CG    1 
ATOM   7672  O  OD1   . ASN C 3 938  ? -15.136 79.164  65.153  1.00 25.00  ? 938  ASN A OD1   1 
ATOM   7673  N  ND2   . ASN C 3 938  ? -13.833 79.200  66.985  1.00 25.66  ? 938  ASN A ND2   1 
ATOM   7674  N  N     . GLU C 3 939  ? -16.975 83.632  67.033  1.00 30.72  ? 939  GLU A N     1 
ATOM   7675  C  CA    . GLU C 3 939  ? -18.170 84.428  67.264  1.00 30.84  ? 939  GLU A CA    1 
ATOM   7676  C  C     . GLU C 3 939  ? -18.302 85.578  66.277  1.00 30.56  ? 939  GLU A C     1 
ATOM   7677  O  O     . GLU C 3 939  ? -19.403 85.858  65.807  1.00 32.46  ? 939  GLU A O     1 
ATOM   7678  C  CB    . GLU C 3 939  ? -18.184 84.956  68.695  1.00 32.10  ? 939  GLU A CB    1 
ATOM   7679  C  CG    . GLU C 3 939  ? -18.410 83.864  69.717  1.00 36.88  ? 939  GLU A CG    1 
ATOM   7680  C  CD    . GLU C 3 939  ? -18.850 84.398  71.068  1.00 40.77  ? 939  GLU A CD    1 
ATOM   7681  O  OE1   . GLU C 3 939  ? -19.492 85.473  71.102  1.00 41.95  ? 939  GLU A OE1   1 
ATOM   7682  O  OE2   . GLU C 3 939  ? -18.572 83.731  72.090  1.00 43.05  ? 939  GLU A OE2   1 
ATOM   7683  N  N     . LEU C 3 940  ? -17.199 86.244  65.950  1.00 28.55  ? 940  LEU A N     1 
ATOM   7684  C  CA    . LEU C 3 940  ? -17.278 87.343  64.983  1.00 27.91  ? 940  LEU A CA    1 
ATOM   7685  C  C     . LEU C 3 940  ? -17.401 86.829  63.540  1.00 26.70  ? 940  LEU A C     1 
ATOM   7686  O  O     . LEU C 3 940  ? -17.679 87.607  62.619  1.00 25.51  ? 940  LEU A O     1 
ATOM   7687  C  CB    . LEU C 3 940  ? -16.048 88.256  65.085  1.00 25.43  ? 940  LEU A CB    1 
ATOM   7688  C  CG    . LEU C 3 940  ? -15.754 88.930  66.426  1.00 24.25  ? 940  LEU A CG    1 
ATOM   7689  C  CD1   . LEU C 3 940  ? -14.564 89.827  66.237  1.00 24.60  ? 940  LEU A CD1   1 
ATOM   7690  C  CD2   . LEU C 3 940  ? -16.944 89.732  66.921  1.00 22.04  ? 940  LEU A CD2   1 
ATOM   7691  N  N     . LYS C 3 941  ? -17.197 85.521  63.362  1.00 25.88  ? 941  LYS A N     1 
ATOM   7692  C  CA    . LYS C 3 941  ? -17.249 84.868  62.052  1.00 25.44  ? 941  LYS A CA    1 
ATOM   7693  C  C     . LYS C 3 941  ? -16.002 85.156  61.212  1.00 24.28  ? 941  LYS A C     1 
ATOM   7694  O  O     . LYS C 3 941  ? -16.018 85.010  59.994  1.00 23.84  ? 941  LYS A O     1 
ATOM   7695  C  CB    . LYS C 3 941  ? -18.491 85.300  61.278  1.00 28.80  ? 941  LYS A CB    1 
ATOM   7696  C  CG    . LYS C 3 941  ? -19.787 84.843  61.889  1.00 31.02  ? 941  LYS A CG    1 
ATOM   7697  C  CD    . LYS C 3 941  ? -19.920 83.337  61.810  1.00 35.92  ? 941  LYS A CD    1 
ATOM   7698  C  CE    . LYS C 3 941  ? -21.233 82.892  62.442  1.00 39.36  ? 941  LYS A CE    1 
ATOM   7699  N  NZ    . LYS C 3 941  ? -21.466 81.442  62.226  1.00 42.69  ? 941  LYS A NZ    1 
ATOM   7700  N  N     . LEU C 3 942  ? -14.924 85.558  61.880  1.00 23.39  ? 942  LEU A N     1 
ATOM   7701  C  CA    . LEU C 3 942  ? -13.664 85.851  61.220  1.00 22.05  ? 942  LEU A CA    1 
ATOM   7702  C  C     . LEU C 3 942  ? -13.034 84.553  60.714  1.00 22.20  ? 942  LEU A C     1 
ATOM   7703  O  O     . LEU C 3 942  ? -12.448 84.521  59.635  1.00 21.78  ? 942  LEU A O     1 
ATOM   7704  C  CB    . LEU C 3 942  ? -12.738 86.581  62.191  1.00 21.44  ? 942  LEU A CB    1 
ATOM   7705  C  CG    . LEU C 3 942  ? -11.302 86.910  61.767  1.00 23.47  ? 942  LEU A CG    1 
ATOM   7706  C  CD1   . LEU C 3 942  ? -10.792 88.127  62.550  1.00 21.37  ? 942  LEU A CD1   1 
ATOM   7707  C  CD2   . LEU C 3 942  ? -10.412 85.697  62.017  1.00 24.08  ? 942  LEU A CD2   1 
ATOM   7708  N  N     . TYR C 3 943  ? -13.149 83.476  61.484  1.00 22.44  ? 943  TYR A N     1 
ATOM   7709  C  CA    . TYR C 3 943  ? -12.609 82.204  61.022  1.00 22.59  ? 943  TYR A CA    1 
ATOM   7710  C  C     . TYR C 3 943  ? -13.513 81.740  59.895  1.00 22.68  ? 943  TYR A C     1 
ATOM   7711  O  O     . TYR C 3 943  ? -13.059 81.370  58.819  1.00 24.33  ? 943  TYR A O     1 
ATOM   7712  C  CB    . TYR C 3 943  ? -12.625 81.140  62.123  1.00 23.37  ? 943  TYR A CB    1 
ATOM   7713  C  CG    . TYR C 3 943  ? -11.464 81.188  63.091  1.00 22.84  ? 943  TYR A CG    1 
ATOM   7714  C  CD1   . TYR C 3 943  ? -10.185 81.565  62.670  1.00 23.64  ? 943  TYR A CD1   1 
ATOM   7715  C  CD2   . TYR C 3 943  ? -11.629 80.789  64.419  1.00 24.55  ? 943  TYR A CD2   1 
ATOM   7716  C  CE1   . TYR C 3 943  ? -9.094  81.538  63.555  1.00 24.05  ? 943  TYR A CE1   1 
ATOM   7717  C  CE2   . TYR C 3 943  ? -10.549 80.758  65.308  1.00 23.98  ? 943  TYR A CE2   1 
ATOM   7718  C  CZ    . TYR C 3 943  ? -9.291  81.133  64.869  1.00 24.43  ? 943  TYR A CZ    1 
ATOM   7719  O  OH    . TYR C 3 943  ? -8.236  81.100  65.749  1.00 27.42  ? 943  TYR A OH    1 
ATOM   7720  N  N     . GLN C 3 944  ? -14.811 81.772  60.149  1.00 22.20  ? 944  GLN A N     1 
ATOM   7721  C  CA    . GLN C 3 944  ? -15.768 81.338  59.156  1.00 23.81  ? 944  GLN A CA    1 
ATOM   7722  C  C     . GLN C 3 944  ? -15.534 82.034  57.816  1.00 24.13  ? 944  GLN A C     1 
ATOM   7723  O  O     . GLN C 3 944  ? -15.348 81.379  56.786  1.00 25.04  ? 944  GLN A O     1 
ATOM   7724  C  CB    . GLN C 3 944  ? -17.188 81.605  59.657  1.00 24.45  ? 944  GLN A CB    1 
ATOM   7725  C  CG    . GLN C 3 944  ? -17.628 80.739  60.842  1.00 24.75  ? 944  GLN A CG    1 
ATOM   7726  C  CD    . GLN C 3 944  ? -16.706 80.852  62.041  1.00 25.77  ? 944  GLN A CD    1 
ATOM   7727  O  OE1   . GLN C 3 944  ? -16.292 81.941  62.420  1.00 27.41  ? 944  GLN A OE1   1 
ATOM   7728  N  NE2   . GLN C 3 944  ? -16.388 79.717  62.653  1.00 29.83  ? 944  GLN A NE2   1 
ATOM   7729  N  N     . GLY C 3 945  ? -15.539 83.359  57.829  1.00 23.73  ? 945  GLY A N     1 
ATOM   7730  C  CA    . GLY C 3 945  ? -15.333 84.098  56.598  1.00 23.26  ? 945  GLY A CA    1 
ATOM   7731  C  C     . GLY C 3 945  ? -14.002 83.763  55.968  1.00 23.79  ? 945  GLY A C     1 
ATOM   7732  O  O     . GLY C 3 945  ? -13.884 83.637  54.746  1.00 20.69  ? 945  GLY A O     1 
ATOM   7733  N  N     . TYR C 3 946  ? -12.994 83.621  56.825  1.00 24.80  ? 946  TYR A N     1 
ATOM   7734  C  CA    . TYR C 3 946  ? -11.641 83.291  56.401  1.00 25.33  ? 946  TYR A CA    1 
ATOM   7735  C  C     . TYR C 3 946  ? -11.604 82.003  55.583  1.00 26.56  ? 946  TYR A C     1 
ATOM   7736  O  O     . TYR C 3 946  ? -10.954 81.941  54.544  1.00 28.72  ? 946  TYR A O     1 
ATOM   7737  C  CB    . TYR C 3 946  ? -10.753 83.128  57.626  1.00 23.61  ? 946  TYR A CB    1 
ATOM   7738  C  CG    . TYR C 3 946  ? -9.384  82.583  57.317  1.00 22.86  ? 946  TYR A CG    1 
ATOM   7739  C  CD1   . TYR C 3 946  ? -8.369  83.418  56.874  1.00 22.54  ? 946  TYR A CD1   1 
ATOM   7740  C  CD2   . TYR C 3 946  ? -9.096  81.231  57.508  1.00 23.02  ? 946  TYR A CD2   1 
ATOM   7741  C  CE1   . TYR C 3 946  ? -7.094  82.924  56.640  1.00 25.68  ? 946  TYR A CE1   1 
ATOM   7742  C  CE2   . TYR C 3 946  ? -7.831  80.723  57.278  1.00 22.85  ? 946  TYR A CE2   1 
ATOM   7743  C  CZ    . TYR C 3 946  ? -6.831  81.574  56.850  1.00 25.05  ? 946  TYR A CZ    1 
ATOM   7744  O  OH    . TYR C 3 946  ? -5.555  81.091  56.685  1.00 25.07  ? 946  TYR A OH    1 
ATOM   7745  N  N     . TYR C 3 947  ? -12.299 80.977  56.066  1.00 26.94  ? 947  TYR A N     1 
ATOM   7746  C  CA    . TYR C 3 947  ? -12.345 79.686  55.393  1.00 27.03  ? 947  TYR A CA    1 
ATOM   7747  C  C     . TYR C 3 947  ? -13.348 79.639  54.246  1.00 26.93  ? 947  TYR A C     1 
ATOM   7748  O  O     . TYR C 3 947  ? -13.120 78.962  53.246  1.00 26.52  ? 947  TYR A O     1 
ATOM   7749  C  CB    . TYR C 3 947  ? -12.627 78.581  56.423  1.00 25.94  ? 947  TYR A CB    1 
ATOM   7750  C  CG    . TYR C 3 947  ? -11.421 78.306  57.285  1.00 26.76  ? 947  TYR A CG    1 
ATOM   7751  C  CD1   . TYR C 3 947  ? -10.269 77.749  56.727  1.00 26.55  ? 947  TYR A CD1   1 
ATOM   7752  C  CD2   . TYR C 3 947  ? -11.397 78.663  58.637  1.00 24.80  ? 947  TYR A CD2   1 
ATOM   7753  C  CE1   . TYR C 3 947  ? -9.119  77.557  57.478  1.00 26.71  ? 947  TYR A CE1   1 
ATOM   7754  C  CE2   . TYR C 3 947  ? -10.250 78.473  59.410  1.00 25.59  ? 947  TYR A CE2   1 
ATOM   7755  C  CZ    . TYR C 3 947  ? -9.108  77.920  58.820  1.00 29.09  ? 947  TYR A CZ    1 
ATOM   7756  O  OH    . TYR C 3 947  ? -7.943  77.752  59.543  1.00 28.45  ? 947  TYR A OH    1 
ATOM   7757  N  N     . MET C 3 948  ? -14.455 80.356  54.383  1.00 27.35  ? 948  MET A N     1 
ATOM   7758  C  CA    . MET C 3 948  ? -15.453 80.380  53.319  1.00 28.84  ? 948  MET A CA    1 
ATOM   7759  C  C     . MET C 3 948  ? -14.888 80.996  52.049  1.00 29.63  ? 948  MET A C     1 
ATOM   7760  O  O     . MET C 3 948  ? -15.240 80.591  50.935  1.00 30.45  ? 948  MET A O     1 
ATOM   7761  C  CB    . MET C 3 948  ? -16.678 81.167  53.758  1.00 28.74  ? 948  MET A CB    1 
ATOM   7762  C  CG    . MET C 3 948  ? -17.580 80.376  54.680  1.00 33.79  ? 948  MET A CG    1 
ATOM   7763  S  SD    . MET C 3 948  ? -19.083 81.265  55.079  1.00 36.48  ? 948  MET A SD    1 
ATOM   7764  C  CE    . MET C 3 948  ? -18.706 81.691  56.746  1.00 35.44  ? 948  MET A CE    1 
ATOM   7765  N  N     . ALA C 3 949  ? -14.003 81.971  52.227  1.00 29.56  ? 949  ALA A N     1 
ATOM   7766  C  CA    . ALA C 3 949  ? -13.382 82.670  51.107  1.00 28.95  ? 949  ALA A CA    1 
ATOM   7767  C  C     . ALA C 3 949  ? -12.530 81.748  50.252  1.00 27.62  ? 949  ALA A C     1 
ATOM   7768  O  O     . ALA C 3 949  ? -12.321 82.006  49.067  1.00 25.70  ? 949  ALA A O     1 
ATOM   7769  C  CB    . ALA C 3 949  ? -12.529 83.826  51.624  1.00 29.65  ? 949  ALA A CB    1 
ATOM   7770  N  N     . GLN C 3 950  ? -12.061 80.663  50.856  1.00 27.64  ? 950  GLN A N     1 
ATOM   7771  C  CA    . GLN C 3 950  ? -11.208 79.705  50.165  1.00 27.88  ? 950  GLN A CA    1 
ATOM   7772  C  C     . GLN C 3 950  ? -11.954 78.539  49.526  1.00 28.30  ? 950  GLN A C     1 
ATOM   7773  O  O     . GLN C 3 950  ? -11.336 77.584  49.062  1.00 30.45  ? 950  GLN A O     1 
ATOM   7774  C  CB    . GLN C 3 950  ? -10.175 79.160  51.139  1.00 27.03  ? 950  GLN A CB    1 
ATOM   7775  C  CG    . GLN C 3 950  ? -9.365  80.235  51.845  1.00 29.57  ? 950  GLN A CG    1 
ATOM   7776  C  CD    . GLN C 3 950  ? -8.515  79.667  52.967  1.00 29.30  ? 950  GLN A CD    1 
ATOM   7777  O  OE1   . GLN C 3 950  ? -7.762  78.706  52.771  1.00 29.26  ? 950  GLN A OE1   1 
ATOM   7778  N  NE2   . GLN C 3 950  ? -8.630  80.256  54.149  1.00 30.00  ? 950  GLN A NE2   1 
ATOM   7779  N  N     . LEU C 3 951  ? -13.275 78.601  49.507  1.00 28.70  ? 951  LEU A N     1 
ATOM   7780  C  CA    . LEU C 3 951  ? -14.058 77.528  48.918  1.00 29.69  ? 951  LEU A CA    1 
ATOM   7781  C  C     . LEU C 3 951  ? -14.555 77.916  47.527  1.00 30.90  ? 951  LEU A C     1 
ATOM   7782  O  O     . LEU C 3 951  ? -14.825 79.087  47.258  1.00 31.68  ? 951  LEU A O     1 
ATOM   7783  C  CB    . LEU C 3 951  ? -15.233 77.170  49.835  1.00 28.52  ? 951  LEU A CB    1 
ATOM   7784  C  CG    . LEU C 3 951  ? -14.829 76.619  51.216  1.00 28.14  ? 951  LEU A CG    1 
ATOM   7785  C  CD1   . LEU C 3 951  ? -16.055 76.495  52.109  1.00 27.19  ? 951  LEU A CD1   1 
ATOM   7786  C  CD2   . LEU C 3 951  ? -14.135 75.271  51.058  1.00 25.62  ? 951  LEU A CD2   1 
ATOM   7787  N  N     . PRO C 3 952  ? -14.668 76.927  46.625  1.00 32.29  ? 952  PRO A N     1 
ATOM   7788  C  CA    . PRO C 3 952  ? -15.119 77.065  45.234  1.00 32.42  ? 952  PRO A CA    1 
ATOM   7789  C  C     . PRO C 3 952  ? -16.371 77.918  45.110  1.00 32.71  ? 952  PRO A C     1 
ATOM   7790  O  O     . PRO C 3 952  ? -17.365 77.652  45.783  1.00 33.09  ? 952  PRO A O     1 
ATOM   7791  C  CB    . PRO C 3 952  ? -15.385 75.624  44.813  1.00 31.61  ? 952  PRO A CB    1 
ATOM   7792  C  CG    . PRO C 3 952  ? -14.375 74.858  45.601  1.00 32.84  ? 952  PRO A CG    1 
ATOM   7793  C  CD    . PRO C 3 952  ? -14.461 75.505  46.963  1.00 32.44  ? 952  PRO A CD    1 
ATOM   7794  N  N     . ARG C 3 953  ? -16.326 78.932  44.246  1.00 32.01  ? 953  ARG A N     1 
ATOM   7795  C  CA    . ARG C 3 953  ? -17.474 79.808  44.051  1.00 31.07  ? 953  ARG A CA    1 
ATOM   7796  C  C     . ARG C 3 953  ? -18.296 79.382  42.847  1.00 31.12  ? 953  ARG A C     1 
ATOM   7797  O  O     . ARG C 3 953  ? -19.056 80.172  42.292  1.00 29.24  ? 953  ARG A O     1 
ATOM   7798  C  CB    . ARG C 3 953  ? -17.026 81.262  43.894  1.00 30.02  ? 953  ARG A CB    1 
ATOM   7799  C  CG    . ARG C 3 953  ? -16.715 81.966  45.203  1.00 28.53  ? 953  ARG A CG    1 
ATOM   7800  C  CD    . ARG C 3 953  ? -15.616 82.995  45.004  1.00 28.71  ? 953  ARG A CD    1 
ATOM   7801  N  NE    . ARG C 3 953  ? -14.459 82.690  45.836  1.00 32.79  ? 953  ARG A NE    1 
ATOM   7802  C  CZ    . ARG C 3 953  ? -13.204 83.012  45.537  1.00 35.81  ? 953  ARG A CZ    1 
ATOM   7803  N  NH1   . ARG C 3 953  ? -12.922 83.655  44.412  1.00 35.02  ? 953  ARG A NH1   1 
ATOM   7804  N  NH2   . ARG C 3 953  ? -12.220 82.684  46.368  1.00 40.71  ? 953  ARG A NH2   1 
ATOM   7805  N  N     . ASN C 3 954  ? -18.131 78.128  42.447  1.00 32.61  ? 954  ASN A N     1 
ATOM   7806  C  CA    . ASN C 3 954  ? -18.891 77.569  41.335  1.00 36.75  ? 954  ASN A CA    1 
ATOM   7807  C  C     . ASN C 3 954  ? -18.997 76.046  41.502  1.00 38.36  ? 954  ASN A C     1 
ATOM   7808  O  O     . ASN C 3 954  ? -18.106 75.406  42.071  1.00 36.87  ? 954  ASN A O     1 
ATOM   7809  C  CB    . ASN C 3 954  ? -18.242 77.928  39.994  1.00 39.46  ? 954  ASN A CB    1 
ATOM   7810  C  CG    . ASN C 3 954  ? -16.870 77.316  39.826  1.00 43.59  ? 954  ASN A CG    1 
ATOM   7811  O  OD1   . ASN C 3 954  ? -15.960 77.551  40.632  1.00 46.87  ? 954  ASN A OD1   1 
ATOM   7812  N  ND2   . ASN C 3 954  ? -16.707 76.526  38.771  1.00 45.21  ? 954  ASN A ND2   1 
ATOM   7813  N  N     . PRO C 3 955  ? -20.095 75.449  41.006  1.00 39.96  ? 955  PRO A N     1 
ATOM   7814  C  CA    . PRO C 3 955  ? -20.363 74.010  41.085  1.00 40.85  ? 955  PRO A CA    1 
ATOM   7815  C  C     . PRO C 3 955  ? -19.236 73.167  40.533  1.00 42.35  ? 955  PRO A C     1 
ATOM   7816  O  O     . PRO C 3 955  ? -18.532 73.584  39.625  1.00 43.21  ? 955  PRO A O     1 
ATOM   7817  C  CB    . PRO C 3 955  ? -21.624 73.843  40.249  1.00 41.06  ? 955  PRO A CB    1 
ATOM   7818  C  CG    . PRO C 3 955  ? -22.269 75.178  40.319  1.00 41.71  ? 955  PRO A CG    1 
ATOM   7819  C  CD    . PRO C 3 955  ? -21.109 76.107  40.169  1.00 40.20  ? 955  PRO A CD    1 
ATOM   7820  N  N     . LYS C 3 956  ? -19.077 71.973  41.082  1.00 44.67  ? 956  LYS A N     1 
ATOM   7821  C  CA    . LYS C 3 956  ? -18.048 71.056  40.617  1.00 47.92  ? 956  LYS A CA    1 
ATOM   7822  C  C     . LYS C 3 956  ? -18.721 69.886  39.894  1.00 48.46  ? 956  LYS A C     1 
ATOM   7823  O  O     . LYS C 3 956  ? -19.833 69.477  40.261  1.00 47.25  ? 956  LYS A O     1 
ATOM   7824  C  CB    . LYS C 3 956  ? -17.227 70.536  41.797  1.00 48.92  ? 956  LYS A CB    1 
ATOM   7825  C  CG    . LYS C 3 956  ? -16.339 71.579  42.444  1.00 52.44  ? 956  LYS A CG    1 
ATOM   7826  C  CD    . LYS C 3 956  ? -15.512 70.947  43.545  1.00 54.99  ? 956  LYS A CD    1 
ATOM   7827  C  CE    . LYS C 3 956  ? -14.348 71.836  43.953  1.00 56.89  ? 956  LYS A CE    1 
ATOM   7828  N  NZ    . LYS C 3 956  ? -13.514 71.189  45.012  1.00 58.88  ? 956  LYS A NZ    1 
ATOM   7829  N  N     . LYS C 3 957  ? -18.060 69.360  38.863  1.00 48.53  ? 957  LYS A N     1 
ATOM   7830  C  CA    . LYS C 3 957  ? -18.615 68.236  38.116  1.00 48.58  ? 957  LYS A CA    1 
ATOM   7831  C  C     . LYS C 3 957  ? -17.866 66.955  38.431  1.00 49.24  ? 957  LYS A C     1 
ATOM   7832  O  O     . LYS C 3 957  ? -18.289 65.869  38.038  1.00 48.97  ? 957  LYS A O     1 
ATOM   7833  C  CB    . LYS C 3 957  ? -18.594 68.500  36.608  1.00 47.67  ? 957  LYS A CB    1 
ATOM   7834  C  CG    . LYS C 3 957  ? -19.491 69.650  36.162  1.00 47.21  ? 957  LYS A CG    1 
ATOM   7835  C  CD    . LYS C 3 957  ? -18.876 70.996  36.528  1.00 47.78  ? 957  LYS A CD    1 
ATOM   7836  C  CE    . LYS C 3 957  ? -19.725 72.150  36.032  1.00 48.66  ? 957  LYS A CE    1 
ATOM   7837  N  NZ    . LYS C 3 957  ? -19.009 73.454  36.116  1.00 49.68  ? 957  LYS A NZ    1 
ATOM   7838  N  N     . SER C 3 958  ? -16.752 67.077  39.145  1.00 50.74  ? 958  SER A N     1 
ATOM   7839  C  CA    . SER C 3 958  ? -15.995 65.891  39.529  1.00 51.70  ? 958  SER A CA    1 
ATOM   7840  C  C     . SER C 3 958  ? -16.947 65.083  40.416  1.00 52.28  ? 958  SER A C     1 
ATOM   7841  O  O     . SER C 3 958  ? -17.820 65.652  41.080  1.00 52.88  ? 958  SER A O     1 
ATOM   7842  C  CB    . SER C 3 958  ? -14.737 66.278  40.316  1.00 52.21  ? 958  SER A CB    1 
ATOM   7843  O  OG    . SER C 3 958  ? -15.064 66.812  41.591  1.00 52.97  ? 958  SER A OG    1 
ATOM   7844  N  N     . GLY C 3 959  ? -16.799 63.765  40.425  1.00 52.27  ? 959  GLY A N     1 
ATOM   7845  C  CA    . GLY C 3 959  ? -17.687 62.960  41.242  1.00 52.76  ? 959  GLY A CA    1 
ATOM   7846  C  C     . GLY C 3 959  ? -18.889 62.473  40.451  1.00 53.42  ? 959  GLY A C     1 
ATOM   7847  O  O     . GLY C 3 959  ? -19.721 61.722  40.963  1.00 53.60  ? 959  GLY A O     1 
ATOM   7848  N  N     . ARG C 3 960  ? -19.004 62.916  39.205  1.00 53.24  ? 960  ARG A N     1 
ATOM   7849  C  CA    . ARG C 3 960  ? -20.103 62.457  38.375  1.00 53.17  ? 960  ARG A CA    1 
ATOM   7850  C  C     . ARG C 3 960  ? -19.759 61.006  38.071  1.00 53.76  ? 960  ARG A C     1 
ATOM   7851  O  O     . ARG C 3 960  ? -18.605 60.692  37.767  1.00 53.58  ? 960  ARG A O     1 
ATOM   7852  C  CB    . ARG C 3 960  ? -20.187 63.258  37.072  1.00 51.23  ? 960  ARG A CB    1 
ATOM   7853  C  CG    . ARG C 3 960  ? -20.807 64.637  37.215  1.00 48.09  ? 960  ARG A CG    1 
ATOM   7854  C  CD    . ARG C 3 960  ? -21.064 65.283  35.845  1.00 45.05  ? 960  ARG A CD    1 
ATOM   7855  N  NE    . ARG C 3 960  ? -21.836 66.514  35.969  1.00 41.77  ? 960  ARG A NE    1 
ATOM   7856  C  CZ    . ARG C 3 960  ? -22.251 67.260  34.951  1.00 40.56  ? 960  ARG A CZ    1 
ATOM   7857  N  NH1   . ARG C 3 960  ? -21.974 66.914  33.707  1.00 39.32  ? 960  ARG A NH1   1 
ATOM   7858  N  NH2   . ARG C 3 960  ? -22.954 68.358  35.186  1.00 40.84  ? 960  ARG A NH2   1 
ATOM   7859  N  N     . ALA C 3 961  ? -20.746 60.123  38.173  1.00 54.27  ? 961  ALA A N     1 
ATOM   7860  C  CA    . ALA C 3 961  ? -20.519 58.706  37.904  1.00 54.24  ? 961  ALA A CA    1 
ATOM   7861  C  C     . ALA C 3 961  ? -19.810 58.521  36.561  1.00 54.30  ? 961  ALA A C     1 
ATOM   7862  O  O     . ALA C 3 961  ? -20.359 58.835  35.499  1.00 53.52  ? 961  ALA A O     1 
ATOM   7863  C  CB    . ALA C 3 961  ? -21.843 57.951  37.912  1.00 54.09  ? 961  ALA A CB    1 
ATOM   7864  N  N     . ALA C 3 962  ? -18.586 58.010  36.622  1.00 53.14  ? 962  ALA A N     1 
ATOM   7865  C  CA    . ALA C 3 962  ? -17.787 57.783  35.429  1.00 52.83  ? 962  ALA A CA    1 
ATOM   7866  C  C     . ALA C 3 962  ? -17.468 56.304  35.249  1.00 52.86  ? 962  ALA A C     1 
ATOM   7867  O  O     . ALA C 3 962  ? -16.616 55.755  35.946  1.00 52.85  ? 962  ALA A O     1 
ATOM   7868  C  CB    . ALA C 3 962  ? -16.500 58.587  35.516  1.00 51.79  ? 962  ALA A CB    1 
ATOM   7869  N  N     . SER C 3 963  ? -18.160 55.669  34.309  1.00 53.23  ? 963  SER A N     1 
ATOM   7870  C  CA    . SER C 3 963  ? -17.953 54.257  34.009  1.00 55.41  ? 963  SER A CA    1 
ATOM   7871  C  C     . SER C 3 963  ? -16.473 53.939  33.751  1.00 56.73  ? 963  SER A C     1 
ATOM   7872  O  O     . SER C 3 963  ? -15.963 54.095  32.638  1.00 58.56  ? 963  SER A O     1 
ATOM   7873  C  CB    . SER C 3 963  ? -18.802 53.874  32.802  1.00 53.31  ? 963  SER A CB    1 
ATOM   7874  O  OG    . SER C 3 963  ? -18.936 54.985  31.931  1.00 54.90  ? 963  SER A OG    1 
ATOM   7875  N  N     . ARG C 3 964  ? -15.807 53.483  34.807  1.00 57.14  ? 964  ARG A N     1 
ATOM   7876  C  CA    . ARG C 3 964  ? -14.389 53.140  34.811  1.00 56.79  ? 964  ARG A CA    1 
ATOM   7877  C  C     . ARG C 3 964  ? -13.727 52.737  33.496  1.00 56.58  ? 964  ARG A C     1 
ATOM   7878  O  O     . ARG C 3 964  ? -12.633 53.212  33.189  1.00 54.66  ? 964  ARG A O     1 
ATOM   7879  C  CB    . ARG C 3 964  ? -14.140 52.048  35.862  1.00 58.22  ? 964  ARG A CB    1 
ATOM   7880  C  CG    . ARG C 3 964  ? -12.715 51.506  35.913  1.00 59.41  ? 964  ARG A CG    1 
ATOM   7881  C  CD    . ARG C 3 964  ? -12.596 50.230  35.102  1.00 61.99  ? 964  ARG A CD    1 
ATOM   7882  N  NE    . ARG C 3 964  ? -13.539 49.223  35.579  1.00 65.06  ? 964  ARG A NE    1 
ATOM   7883  C  CZ    . ARG C 3 964  ? -13.733 48.039  35.007  1.00 66.26  ? 964  ARG A CZ    1 
ATOM   7884  N  NH1   . ARG C 3 964  ? -13.044 47.700  33.922  1.00 65.77  ? 964  ARG A NH1   1 
ATOM   7885  N  NH2   . ARG C 3 964  ? -14.621 47.194  35.524  1.00 65.15  ? 964  ARG A NH2   1 
ATOM   7886  N  N     . GLU C 3 965  ? -14.374 51.869  32.724  1.00 56.56  ? 965  GLU A N     1 
ATOM   7887  C  CA    . GLU C 3 965  ? -13.795 51.401  31.465  1.00 56.21  ? 965  GLU A CA    1 
ATOM   7888  C  C     . GLU C 3 965  ? -13.619 52.491  30.406  1.00 55.54  ? 965  GLU A C     1 
ATOM   7889  O  O     . GLU C 3 965  ? -12.533 52.640  29.843  1.00 54.75  ? 965  GLU A O     1 
ATOM   7890  C  CB    . GLU C 3 965  ? -14.636 50.254  30.891  1.00 57.52  ? 965  GLU A CB    1 
ATOM   7891  C  CG    . GLU C 3 965  ? -13.988 49.515  29.724  1.00 59.13  ? 965  GLU A CG    1 
ATOM   7892  C  CD    . GLU C 3 965  ? -14.851 48.371  29.204  1.00 62.02  ? 965  GLU A CD    1 
ATOM   7893  O  OE1   . GLU C 3 965  ? -15.118 47.425  29.981  1.00 61.08  ? 965  GLU A OE1   1 
ATOM   7894  O  OE2   . GLU C 3 965  ? -15.265 48.419  28.021  1.00 61.85  ? 965  GLU A OE2   1 
ATOM   7895  N  N     . VAL C 3 966  ? -14.678 53.245  30.124  1.00 54.40  ? 966  VAL A N     1 
ATOM   7896  C  CA    . VAL C 3 966  ? -14.586 54.300  29.120  1.00 53.74  ? 966  VAL A CA    1 
ATOM   7897  C  C     . VAL C 3 966  ? -13.737 55.432  29.682  1.00 53.14  ? 966  VAL A C     1 
ATOM   7898  O  O     . VAL C 3 966  ? -13.093 56.180  28.942  1.00 51.66  ? 966  VAL A O     1 
ATOM   7899  C  CB    . VAL C 3 966  ? -15.984 54.838  28.729  1.00 53.26  ? 966  VAL A CB    1 
ATOM   7900  C  CG1   . VAL C 3 966  ? -16.663 55.460  29.931  1.00 52.78  ? 966  VAL A CG1   1 
ATOM   7901  C  CG2   . VAL C 3 966  ? -15.854 55.844  27.599  1.00 52.28  ? 966  VAL A CG2   1 
ATOM   7902  N  N     . ARG C 3 967  ? -13.735 55.534  31.005  1.00 52.75  ? 967  ARG A N     1 
ATOM   7903  C  CA    . ARG C 3 967  ? -12.967 56.548  31.707  1.00 52.58  ? 967  ARG A CA    1 
ATOM   7904  C  C     . ARG C 3 967  ? -11.475 56.268  31.492  1.00 51.15  ? 967  ARG A C     1 
ATOM   7905  O  O     . ARG C 3 967  ? -10.688 57.188  31.321  1.00 51.64  ? 967  ARG A O     1 
ATOM   7906  C  CB    . ARG C 3 967  ? -13.338 56.511  33.196  1.00 54.79  ? 967  ARG A CB    1 
ATOM   7907  C  CG    . ARG C 3 967  ? -12.907 57.719  34.021  1.00 58.17  ? 967  ARG A CG    1 
ATOM   7908  C  CD    . ARG C 3 967  ? -11.464 57.593  34.463  1.00 61.68  ? 967  ARG A CD    1 
ATOM   7909  N  NE    . ARG C 3 967  ? -11.243 56.357  35.209  1.00 64.65  ? 967  ARG A NE    1 
ATOM   7910  C  CZ    . ARG C 3 967  ? -10.045 55.905  35.566  1.00 65.59  ? 967  ARG A CZ    1 
ATOM   7911  N  NH1   . ARG C 3 967  ? -8.953  56.590  35.246  1.00 65.91  ? 967  ARG A NH1   1 
ATOM   7912  N  NH2   . ARG C 3 967  ? -9.939  54.762  36.233  1.00 65.59  ? 967  ARG A NH2   1 
ATOM   7913  N  N     . GLU C 3 968  ? -11.096 54.993  31.479  1.00 50.27  ? 968  GLU A N     1 
ATOM   7914  C  CA    . GLU C 3 968  ? -9.699  54.604  31.273  1.00 49.70  ? 968  GLU A CA    1 
ATOM   7915  C  C     . GLU C 3 968  ? -9.304  54.684  29.794  1.00 47.81  ? 968  GLU A C     1 
ATOM   7916  O  O     . GLU C 3 968  ? -8.151  54.973  29.469  1.00 46.86  ? 968  GLU A O     1 
ATOM   7917  C  CB    . GLU C 3 968  ? -9.447  53.176  31.790  1.00 51.79  ? 968  GLU A CB    1 
ATOM   7918  C  CG    . GLU C 3 968  ? -9.605  52.983  33.303  1.00 54.55  ? 968  GLU A CG    1 
ATOM   7919  C  CD    . GLU C 3 968  ? -9.321  51.546  33.757  1.00 56.57  ? 968  GLU A CD    1 
ATOM   7920  O  OE1   . GLU C 3 968  ? -9.953  50.606  33.219  1.00 56.39  ? 968  GLU A OE1   1 
ATOM   7921  O  OE2   . GLU C 3 968  ? -8.468  51.359  34.658  1.00 57.59  ? 968  GLU A OE2   1 
ATOM   7922  N  N     . GLN C 3 969  ? -10.257 54.413  28.906  1.00 46.18  ? 969  GLN A N     1 
ATOM   7923  C  CA    . GLN C 3 969  ? -10.011 54.479  27.466  1.00 45.53  ? 969  GLN A CA    1 
ATOM   7924  C  C     . GLN C 3 969  ? -9.637  55.911  27.101  1.00 43.25  ? 969  GLN A C     1 
ATOM   7925  O  O     . GLN C 3 969  ? -8.688  56.155  26.360  1.00 40.90  ? 969  GLN A O     1 
ATOM   7926  C  CB    . GLN C 3 969  ? -11.271 54.105  26.682  1.00 47.71  ? 969  GLN A CB    1 
ATOM   7927  C  CG    . GLN C 3 969  ? -11.735 52.666  26.796  1.00 51.08  ? 969  GLN A CG    1 
ATOM   7928  C  CD    . GLN C 3 969  ? -13.129 52.478  26.200  1.00 53.57  ? 969  GLN A CD    1 
ATOM   7929  O  OE1   . GLN C 3 969  ? -13.414 52.948  25.097  1.00 54.82  ? 969  GLN A OE1   1 
ATOM   7930  N  NE2   . GLN C 3 969  ? -14.001 51.791  26.929  1.00 53.72  ? 969  GLN A NE2   1 
ATOM   7931  N  N     . PHE C 3 970  ? -10.419 56.843  27.637  1.00 42.50  ? 970  PHE A N     1 
ATOM   7932  C  CA    . PHE C 3 970  ? -10.252 58.273  27.417  1.00 41.10  ? 970  PHE A CA    1 
ATOM   7933  C  C     . PHE C 3 970  ? -8.885  58.778  27.869  1.00 40.82  ? 970  PHE A C     1 
ATOM   7934  O  O     . PHE C 3 970  ? -8.125  59.359  27.082  1.00 39.80  ? 970  PHE A O     1 
ATOM   7935  C  CB    . PHE C 3 970  ? -11.339 59.029  28.179  1.00 39.77  ? 970  PHE A CB    1 
ATOM   7936  C  CG    . PHE C 3 970  ? -11.458 60.477  27.796  1.00 39.57  ? 970  PHE A CG    1 
ATOM   7937  C  CD1   . PHE C 3 970  ? -11.994 60.843  26.563  1.00 38.79  ? 970  PHE A CD1   1 
ATOM   7938  C  CD2   . PHE C 3 970  ? -11.038 61.479  28.669  1.00 38.82  ? 970  PHE A CD2   1 
ATOM   7939  C  CE1   . PHE C 3 970  ? -12.112 62.191  26.205  1.00 38.88  ? 970  PHE A CE1   1 
ATOM   7940  C  CE2   . PHE C 3 970  ? -11.151 62.831  28.319  1.00 38.89  ? 970  PHE A CE2   1 
ATOM   7941  C  CZ    . PHE C 3 970  ? -11.689 63.186  27.086  1.00 37.11  ? 970  PHE A CZ    1 
ATOM   7942  N  N     . THR C 3 971  ? -8.587  58.559  29.147  1.00 39.89  ? 971  THR A N     1 
ATOM   7943  C  CA    . THR C 3 971  ? -7.326  58.994  29.724  1.00 38.90  ? 971  THR A CA    1 
ATOM   7944  C  C     . THR C 3 971  ? -6.149  58.302  29.056  1.00 38.31  ? 971  THR A C     1 
ATOM   7945  O  O     . THR C 3 971  ? -5.023  58.792  29.099  1.00 39.03  ? 971  THR A O     1 
ATOM   7946  C  CB    . THR C 3 971  ? -7.299  58.739  31.246  1.00 38.81  ? 971  THR A CB    1 
ATOM   7947  O  OG1   . THR C 3 971  ? -7.412  57.333  31.507  1.00 40.01  ? 971  THR A OG1   1 
ATOM   7948  C  CG2   . THR C 3 971  ? -8.454  59.474  31.921  1.00 36.81  ? 971  THR A CG2   1 
ATOM   7949  N  N     . GLN C 3 972  ? -6.420  57.163  28.432  1.00 38.86  ? 972  GLN A N     1 
ATOM   7950  C  CA    . GLN C 3 972  ? -5.392  56.411  27.724  1.00 39.06  ? 972  GLN A CA    1 
ATOM   7951  C  C     . GLN C 3 972  ? -5.134  57.120  26.401  1.00 37.92  ? 972  GLN A C     1 
ATOM   7952  O  O     . GLN C 3 972  ? -3.991  57.262  25.965  1.00 37.11  ? 972  GLN A O     1 
ATOM   7953  C  CB    . GLN C 3 972  ? -5.870  54.991  27.427  1.00 42.25  ? 972  GLN A CB    1 
ATOM   7954  C  CG    . GLN C 3 972  ? -4.780  54.086  26.879  1.00 42.60  ? 972  GLN A CG    1 
ATOM   7955  C  CD    . GLN C 3 972  ? -3.713  53.826  27.913  1.00 43.87  ? 972  GLN A CD    1 
ATOM   7956  O  OE1   . GLN C 3 972  ? -3.988  53.257  28.972  1.00 44.53  ? 972  GLN A OE1   1 
ATOM   7957  N  NE2   . GLN C 3 972  ? -2.488  54.251  27.623  1.00 44.82  ? 972  GLN A NE2   1 
ATOM   7958  N  N     . ALA C 3 973  ? -6.215  57.546  25.760  1.00 37.27  ? 973  ALA A N     1 
ATOM   7959  C  CA    . ALA C 3 973  ? -6.118  58.256  24.494  1.00 36.84  ? 973  ALA A CA    1 
ATOM   7960  C  C     . ALA C 3 973  ? -5.314  59.518  24.760  1.00 36.07  ? 973  ALA A C     1 
ATOM   7961  O  O     . ALA C 3 973  ? -4.350  59.808  24.056  1.00 37.38  ? 973  ALA A O     1 
ATOM   7962  C  CB    . ALA C 3 973  ? -7.511  58.605  23.968  1.00 34.00  ? 973  ALA A CB    1 
ATOM   7963  N  N     . LEU C 3 974  ? -5.694  60.257  25.795  1.00 35.34  ? 974  LEU A N     1 
ATOM   7964  C  CA    . LEU C 3 974  ? -4.975  61.473  26.134  1.00 35.57  ? 974  LEU A CA    1 
ATOM   7965  C  C     . LEU C 3 974  ? -3.499  61.157  26.312  1.00 35.58  ? 974  LEU A C     1 
ATOM   7966  O  O     . LEU C 3 974  ? -2.640  61.841  25.759  1.00 37.93  ? 974  LEU A O     1 
ATOM   7967  C  CB    . LEU C 3 974  ? -5.555  62.099  27.407  1.00 34.93  ? 974  LEU A CB    1 
ATOM   7968  C  CG    . LEU C 3 974  ? -6.979  62.625  27.183  1.00 34.79  ? 974  LEU A CG    1 
ATOM   7969  C  CD1   . LEU C 3 974  ? -7.576  63.135  28.470  1.00 33.34  ? 974  LEU A CD1   1 
ATOM   7970  C  CD2   . LEU C 3 974  ? -6.938  63.735  26.142  1.00 35.25  ? 974  LEU A CD2   1 
ATOM   7971  N  N     . SER C 3 975  ? -3.204  60.105  27.066  1.00 35.11  ? 975  SER A N     1 
ATOM   7972  C  CA    . SER C 3 975  ? -1.824  59.709  27.301  1.00 34.46  ? 975  SER A CA    1 
ATOM   7973  C  C     . SER C 3 975  ? -1.051  59.431  26.003  1.00 34.47  ? 975  SER A C     1 
ATOM   7974  O  O     . SER C 3 975  ? 0.085   59.867  25.854  1.00 33.02  ? 975  SER A O     1 
ATOM   7975  C  CB    . SER C 3 975  ? -1.786  58.470  28.196  1.00 34.83  ? 975  SER A CB    1 
ATOM   7976  O  OG    . SER C 3 975  ? -0.452  58.040  28.411  1.00 36.34  ? 975  SER A OG    1 
ATOM   7977  N  N     . ASP C 3 976  ? -1.665  58.704  25.071  1.00 35.67  ? 976  ASP A N     1 
ATOM   7978  C  CA    . ASP C 3 976  ? -1.016  58.372  23.801  1.00 35.95  ? 976  ASP A CA    1 
ATOM   7979  C  C     . ASP C 3 976  ? -0.732  59.620  22.974  1.00 37.29  ? 976  ASP A C     1 
ATOM   7980  O  O     . ASP C 3 976  ? 0.285   59.703  22.272  1.00 36.82  ? 976  ASP A O     1 
ATOM   7981  C  CB    . ASP C 3 976  ? -1.885  57.423  22.966  1.00 37.45  ? 976  ASP A CB    1 
ATOM   7982  C  CG    . ASP C 3 976  ? -1.993  56.039  23.567  1.00 38.45  ? 976  ASP A CG    1 
ATOM   7983  O  OD1   . ASP C 3 976  ? -1.019  55.596  24.214  1.00 39.73  ? 976  ASP A OD1   1 
ATOM   7984  O  OD2   . ASP C 3 976  ? -3.047  55.386  23.374  1.00 39.34  ? 976  ASP A OD2   1 
ATOM   7985  N  N     . TYR C 3 977  ? -1.652  60.580  23.048  1.00 37.31  ? 977  TYR A N     1 
ATOM   7986  C  CA    . TYR C 3 977  ? -1.523  61.832  22.318  1.00 36.64  ? 977  TYR A CA    1 
ATOM   7987  C  C     . TYR C 3 977  ? -0.267  62.525  22.804  1.00 38.25  ? 977  TYR A C     1 
ATOM   7988  O  O     . TYR C 3 977  ? 0.560   62.977  22.013  1.00 38.48  ? 977  TYR A O     1 
ATOM   7989  C  CB    . TYR C 3 977  ? -2.729  62.737  22.595  1.00 35.19  ? 977  TYR A CB    1 
ATOM   7990  C  CG    . TYR C 3 977  ? -2.659  64.089  21.911  1.00 33.34  ? 977  TYR A CG    1 
ATOM   7991  C  CD1   . TYR C 3 977  ? -3.190  64.277  20.631  1.00 31.98  ? 977  TYR A CD1   1 
ATOM   7992  C  CD2   . TYR C 3 977  ? -2.032  65.170  22.529  1.00 32.59  ? 977  TYR A CD2   1 
ATOM   7993  C  CE1   . TYR C 3 977  ? -3.098  65.506  19.982  1.00 30.18  ? 977  TYR A CE1   1 
ATOM   7994  C  CE2   . TYR C 3 977  ? -1.933  66.398  21.888  1.00 32.43  ? 977  TYR A CE2   1 
ATOM   7995  C  CZ    . TYR C 3 977  ? -2.468  66.559  20.617  1.00 31.72  ? 977  TYR A CZ    1 
ATOM   7996  O  OH    . TYR C 3 977  ? -2.371  67.774  19.988  1.00 31.83  ? 977  TYR A OH    1 
ATOM   7997  N  N     . LEU C 3 978  ? -0.139  62.600  24.122  1.00 39.81  ? 978  LEU A N     1 
ATOM   7998  C  CA    . LEU C 3 978  ? 0.994   63.258  24.749  1.00 41.95  ? 978  LEU A CA    1 
ATOM   7999  C  C     . LEU C 3 978  ? 2.275   62.442  24.656  1.00 42.88  ? 978  LEU A C     1 
ATOM   8000  O  O     . LEU C 3 978  ? 3.333   62.969  24.294  1.00 42.66  ? 978  LEU A O     1 
ATOM   8001  C  CB    . LEU C 3 978  ? 0.671   63.538  26.219  1.00 42.53  ? 978  LEU A CB    1 
ATOM   8002  C  CG    . LEU C 3 978  ? 1.729   64.292  27.023  1.00 43.56  ? 978  LEU A CG    1 
ATOM   8003  C  CD1   . LEU C 3 978  ? 1.926   65.680  26.421  1.00 41.85  ? 978  LEU A CD1   1 
ATOM   8004  C  CD2   . LEU C 3 978  ? 1.287   64.396  28.479  1.00 42.74  ? 978  LEU A CD2   1 
ATOM   8005  N  N     . MET C 3 979  ? 2.174   61.154  24.980  1.00 43.80  ? 979  MET A N     1 
ATOM   8006  C  CA    . MET C 3 979  ? 3.332   60.270  24.966  1.00 45.68  ? 979  MET A CA    1 
ATOM   8007  C  C     . MET C 3 979  ? 3.590   59.600  23.627  1.00 46.48  ? 979  MET A C     1 
ATOM   8008  O  O     . MET C 3 979  ? 4.124   58.490  23.570  1.00 47.34  ? 979  MET A O     1 
ATOM   8009  C  CB    . MET C 3 979  ? 3.191   59.205  26.057  1.00 46.04  ? 979  MET A CB    1 
ATOM   8010  C  CG    . MET C 3 979  ? 3.177   59.770  27.469  1.00 46.82  ? 979  MET A CG    1 
ATOM   8011  S  SD    . MET C 3 979  ? 4.669   60.712  27.845  1.00 49.60  ? 979  MET A SD    1 
ATOM   8012  C  CE    . MET C 3 979  ? 4.169   61.616  29.310  1.00 47.94  ? 979  MET A CE    1 
ATOM   8013  N  N     . GLN C 3 980  ? 3.209   60.278  22.550  1.00 47.36  ? 980  GLN A N     1 
ATOM   8014  C  CA    . GLN C 3 980  ? 3.423   59.756  21.208  1.00 47.22  ? 980  GLN A CA    1 
ATOM   8015  C  C     . GLN C 3 980  ? 4.843   59.208  21.119  1.00 46.63  ? 980  GLN A C     1 
ATOM   8016  O  O     . GLN C 3 980  ? 5.056   58.008  20.936  1.00 48.40  ? 980  GLN A O     1 
ATOM   8017  C  CB    . GLN C 3 980  ? 3.259   60.871  20.172  1.00 48.39  ? 980  GLN A CB    1 
ATOM   8018  C  CG    . GLN C 3 980  ? 1.927   60.907  19.439  1.00 50.23  ? 980  GLN A CG    1 
ATOM   8019  C  CD    . GLN C 3 980  ? 2.027   61.672  18.117  1.00 52.08  ? 980  GLN A CD    1 
ATOM   8020  O  OE1   . GLN C 3 980  ? 1.063   61.749  17.347  1.00 51.52  ? 980  GLN A OE1   1 
ATOM   8021  N  NE2   . GLN C 3 980  ? 3.203   62.239  17.852  1.00 51.81  ? 980  GLN A NE2   1 
ATOM   8022  N  N     . ASN C 3 981  ? 5.807   60.109  21.279  1.00 45.18  ? 981  ASN A N     1 
ATOM   8023  C  CA    . ASN C 3 981  ? 7.228   59.788  21.204  1.00 42.63  ? 981  ASN A CA    1 
ATOM   8024  C  C     . ASN C 3 981  ? 7.749   58.955  22.384  1.00 41.95  ? 981  ASN A C     1 
ATOM   8025  O  O     . ASN C 3 981  ? 7.814   59.432  23.509  1.00 39.81  ? 981  ASN A O     1 
ATOM   8026  C  CB    . ASN C 3 981  ? 8.014   61.091  21.100  1.00 41.44  ? 981  ASN A CB    1 
ATOM   8027  C  CG    . ASN C 3 981  ? 9.440   60.875  20.678  1.00 39.44  ? 981  ASN A CG    1 
ATOM   8028  O  OD1   . ASN C 3 981  ? 10.194  60.163  21.336  1.00 40.50  ? 981  ASN A OD1   1 
ATOM   8029  N  ND2   . ASN C 3 981  ? 9.823   61.496  19.578  1.00 37.22  ? 981  ASN A ND2   1 
ATOM   8030  N  N     . PRO C 3 982  ? 8.131   57.692  22.130  1.00 42.66  ? 982  PRO A N     1 
ATOM   8031  C  CA    . PRO C 3 982  ? 8.647   56.796  23.171  1.00 42.58  ? 982  PRO A CA    1 
ATOM   8032  C  C     . PRO C 3 982  ? 9.809   57.387  23.974  1.00 43.39  ? 982  PRO A C     1 
ATOM   8033  O  O     . PRO C 3 982  ? 9.990   57.058  25.147  1.00 43.51  ? 982  PRO A O     1 
ATOM   8034  C  CB    . PRO C 3 982  ? 9.076   55.561  22.374  1.00 41.41  ? 982  PRO A CB    1 
ATOM   8035  C  CG    . PRO C 3 982  ? 8.098   55.532  21.266  1.00 41.50  ? 982  PRO A CG    1 
ATOM   8036  C  CD    . PRO C 3 982  ? 8.046   56.986  20.838  1.00 42.14  ? 982  PRO A CD    1 
ATOM   8037  N  N     . GLU C 3 983  ? 10.592  58.255  23.335  1.00 43.62  ? 983  GLU A N     1 
ATOM   8038  C  CA    . GLU C 3 983  ? 11.745  58.875  23.978  1.00 44.33  ? 983  GLU A CA    1 
ATOM   8039  C  C     . GLU C 3 983  ? 11.305  59.704  25.172  1.00 43.79  ? 983  GLU A C     1 
ATOM   8040  O  O     . GLU C 3 983  ? 11.933  59.673  26.231  1.00 43.60  ? 983  GLU A O     1 
ATOM   8041  C  CB    . GLU C 3 983  ? 12.485  59.772  22.983  1.00 45.95  ? 983  GLU A CB    1 
ATOM   8042  C  CG    . GLU C 3 983  ? 13.929  60.073  23.355  1.00 49.01  ? 983  GLU A CG    1 
ATOM   8043  C  CD    . GLU C 3 983  ? 14.590  61.066  22.400  1.00 52.30  ? 983  GLU A CD    1 
ATOM   8044  O  OE1   . GLU C 3 983  ? 14.303  61.005  21.175  1.00 50.69  ? 983  GLU A OE1   1 
ATOM   8045  O  OE2   . GLU C 3 983  ? 15.404  61.898  22.880  1.00 51.87  ? 983  GLU A OE2   1 
ATOM   8046  N  N     . LEU C 3 984  ? 10.225  60.453  24.985  1.00 43.69  ? 984  LEU A N     1 
ATOM   8047  C  CA    . LEU C 3 984  ? 9.686   61.301  26.038  1.00 44.27  ? 984  LEU A CA    1 
ATOM   8048  C  C     . LEU C 3 984  ? 9.257   60.416  27.205  1.00 45.31  ? 984  LEU A C     1 
ATOM   8049  O  O     . LEU C 3 984  ? 9.658   60.638  28.352  1.00 45.48  ? 984  LEU A O     1 
ATOM   8050  C  CB    . LEU C 3 984  ? 8.474   62.087  25.520  1.00 42.81  ? 984  LEU A CB    1 
ATOM   8051  C  CG    . LEU C 3 984  ? 8.281   63.552  25.938  1.00 41.92  ? 984  LEU A CG    1 
ATOM   8052  C  CD1   . LEU C 3 984  ? 6.794   63.856  25.958  1.00 40.01  ? 984  LEU A CD1   1 
ATOM   8053  C  CD2   . LEU C 3 984  ? 8.878   63.819  27.303  1.00 39.93  ? 984  LEU A CD2   1 
ATOM   8054  N  N     . LYS C 3 985  ? 8.439   59.413  26.895  1.00 45.48  ? 985  LYS A N     1 
ATOM   8055  C  CA    . LYS C 3 985  ? 7.929   58.478  27.890  1.00 45.94  ? 985  LYS A CA    1 
ATOM   8056  C  C     . LYS C 3 985  ? 9.065   57.831  28.667  1.00 44.28  ? 985  LYS A C     1 
ATOM   8057  O  O     . LYS C 3 985  ? 9.038   57.765  29.897  1.00 44.74  ? 985  LYS A O     1 
ATOM   8058  C  CB    . LYS C 3 985  ? 7.088   57.390  27.211  1.00 47.97  ? 985  LYS A CB    1 
ATOM   8059  C  CG    . LYS C 3 985  ? 6.454   56.412  28.187  1.00 51.36  ? 985  LYS A CG    1 
ATOM   8060  C  CD    . LYS C 3 985  ? 5.432   55.529  27.496  1.00 54.25  ? 985  LYS A CD    1 
ATOM   8061  C  CE    . LYS C 3 985  ? 4.649   54.687  28.501  1.00 55.53  ? 985  LYS A CE    1 
ATOM   8062  N  NZ    . LYS C 3 985  ? 3.585   53.883  27.818  1.00 55.89  ? 985  LYS A NZ    1 
ATOM   8063  N  N     . SER C 3 986  ? 10.063  57.350  27.940  1.00 42.43  ? 986  SER A N     1 
ATOM   8064  C  CA    . SER C 3 986  ? 11.206  56.711  28.566  1.00 40.67  ? 986  SER A CA    1 
ATOM   8065  C  C     . SER C 3 986  ? 11.828  57.672  29.581  1.00 40.32  ? 986  SER A C     1 
ATOM   8066  O  O     . SER C 3 986  ? 12.306  57.258  30.637  1.00 41.01  ? 986  SER A O     1 
ATOM   8067  C  CB    . SER C 3 986  ? 12.226  56.327  27.501  1.00 39.25  ? 986  SER A CB    1 
ATOM   8068  O  OG    . SER C 3 986  ? 13.266  55.559  28.068  1.00 42.16  ? 986  SER A OG    1 
ATOM   8069  N  N     . ARG C 3 987  ? 11.815  58.959  29.255  1.00 38.99  ? 987  ARG A N     1 
ATOM   8070  C  CA    . ARG C 3 987  ? 12.360  59.972  30.144  1.00 38.80  ? 987  ARG A CA    1 
ATOM   8071  C  C     . ARG C 3 987  ? 11.587  60.059  31.459  1.00 39.29  ? 987  ARG A C     1 
ATOM   8072  O  O     . ARG C 3 987  ? 12.181  60.181  32.528  1.00 39.32  ? 987  ARG A O     1 
ATOM   8073  C  CB    . ARG C 3 987  ? 12.321  61.343  29.475  1.00 37.85  ? 987  ARG A CB    1 
ATOM   8074  C  CG    . ARG C 3 987  ? 13.310  61.538  28.357  1.00 35.95  ? 987  ARG A CG    1 
ATOM   8075  C  CD    . ARG C 3 987  ? 13.257  62.974  27.883  1.00 33.49  ? 987  ARG A CD    1 
ATOM   8076  N  NE    . ARG C 3 987  ? 14.070  63.181  26.694  1.00 32.59  ? 987  ARG A NE    1 
ATOM   8077  C  CZ    . ARG C 3 987  ? 14.167  64.339  26.056  1.00 30.78  ? 987  ARG A CZ    1 
ATOM   8078  N  NH1   . ARG C 3 987  ? 13.498  65.393  26.503  1.00 27.73  ? 987  ARG A NH1   1 
ATOM   8079  N  NH2   . ARG C 3 987  ? 14.926  64.439  24.970  1.00 29.68  ? 987  ARG A NH2   1 
ATOM   8080  N  N     . VAL C 3 988  ? 10.261  60.013  31.377  1.00 39.15  ? 988  VAL A N     1 
ATOM   8081  C  CA    . VAL C 3 988  ? 9.442   60.113  32.573  1.00 40.29  ? 988  VAL A CA    1 
ATOM   8082  C  C     . VAL C 3 988  ? 9.570   58.878  33.455  1.00 40.90  ? 988  VAL A C     1 
ATOM   8083  O  O     . VAL C 3 988  ? 9.653   58.989  34.679  1.00 42.53  ? 988  VAL A O     1 
ATOM   8084  C  CB    . VAL C 3 988  ? 7.965   60.343  32.217  1.00 40.05  ? 988  VAL A CB    1 
ATOM   8085  C  CG1   . VAL C 3 988  ? 7.137   60.499  33.493  1.00 39.99  ? 988  VAL A CG1   1 
ATOM   8086  C  CG2   . VAL C 3 988  ? 7.841   61.583  31.350  1.00 39.78  ? 988  VAL A CG2   1 
ATOM   8087  N  N     . LEU C 3 989  ? 9.589   57.706  32.833  1.00 40.53  ? 989  LEU A N     1 
ATOM   8088  C  CA    . LEU C 3 989  ? 9.731   56.456  33.564  1.00 40.29  ? 989  LEU A CA    1 
ATOM   8089  C  C     . LEU C 3 989  ? 11.028  56.489  34.363  1.00 40.41  ? 989  LEU A C     1 
ATOM   8090  O  O     . LEU C 3 989  ? 11.098  55.983  35.483  1.00 41.33  ? 989  LEU A O     1 
ATOM   8091  C  CB    . LEU C 3 989  ? 9.754   55.280  32.587  1.00 39.87  ? 989  LEU A CB    1 
ATOM   8092  C  CG    . LEU C 3 989  ? 8.430   55.002  31.875  1.00 40.63  ? 989  LEU A CG    1 
ATOM   8093  C  CD1   . LEU C 3 989  ? 8.645   53.983  30.774  1.00 40.29  ? 989  LEU A CD1   1 
ATOM   8094  C  CD2   . LEU C 3 989  ? 7.402   54.506  32.882  1.00 37.88  ? 989  LEU A CD2   1 
ATOM   8095  N  N     . ARG C 3 990  ? 12.057  57.092  33.780  1.00 41.02  ? 990  ARG A N     1 
ATOM   8096  C  CA    . ARG C 3 990  ? 13.346  57.196  34.446  1.00 42.37  ? 990  ARG A CA    1 
ATOM   8097  C  C     . ARG C 3 990  ? 13.164  58.078  35.676  1.00 42.79  ? 990  ARG A C     1 
ATOM   8098  O  O     . ARG C 3 990  ? 13.511  57.685  36.796  1.00 42.97  ? 990  ARG A O     1 
ATOM   8099  C  CB    . ARG C 3 990  ? 14.381  57.807  33.498  1.00 43.28  ? 990  ARG A CB    1 
ATOM   8100  C  CG    . ARG C 3 990  ? 15.712  57.077  33.474  1.00 45.93  ? 990  ARG A CG    1 
ATOM   8101  C  CD    . ARG C 3 990  ? 16.581  57.433  34.661  1.00 49.44  ? 990  ARG A CD    1 
ATOM   8102  N  NE    . ARG C 3 990  ? 17.609  56.421  34.899  1.00 53.57  ? 990  ARG A NE    1 
ATOM   8103  C  CZ    . ARG C 3 990  ? 18.580  56.540  35.800  1.00 55.25  ? 990  ARG A CZ    1 
ATOM   8104  N  NH1   . ARG C 3 990  ? 18.661  57.635  36.543  1.00 57.10  ? 990  ARG A NH1   1 
ATOM   8105  N  NH2   . ARG C 3 990  ? 19.455  55.556  35.976  1.00 55.91  ? 990  ARG A NH2   1 
ATOM   8106  N  N     . GLY C 3 991  ? 12.608  59.267  35.467  1.00 42.09  ? 991  GLY A N     1 
ATOM   8107  C  CA    . GLY C 3 991  ? 12.385  60.166  36.582  1.00 42.25  ? 991  GLY A CA    1 
ATOM   8108  C  C     . GLY C 3 991  ? 11.623  59.441  37.676  1.00 42.51  ? 991  GLY A C     1 
ATOM   8109  O  O     . GLY C 3 991  ? 11.902  59.596  38.867  1.00 42.51  ? 991  GLY A O     1 
ATOM   8110  N  N     . ARG C 3 992  ? 10.665  58.625  37.264  1.00 41.12  ? 992  ARG A N     1 
ATOM   8111  C  CA    . ARG C 3 992  ? 9.850   57.885  38.202  1.00 42.39  ? 992  ARG A CA    1 
ATOM   8112  C  C     . ARG C 3 992  ? 10.624  56.985  39.161  1.00 43.28  ? 992  ARG A C     1 
ATOM   8113  O  O     . ARG C 3 992  ? 10.592  57.191  40.375  1.00 44.35  ? 992  ARG A O     1 
ATOM   8114  C  CB    . ARG C 3 992  ? 8.839   57.053  37.444  1.00 43.12  ? 992  ARG A CB    1 
ATOM   8115  C  CG    . ARG C 3 992  ? 7.444   57.563  37.547  1.00 42.71  ? 992  ARG A CG    1 
ATOM   8116  C  CD    . ARG C 3 992  ? 6.517   56.472  37.096  1.00 45.90  ? 992  ARG A CD    1 
ATOM   8117  N  NE    . ARG C 3 992  ? 5.123   56.787  37.362  1.00 48.05  ? 992  ARG A NE    1 
ATOM   8118  C  CZ    . ARG C 3 992  ? 4.116   56.000  37.011  1.00 49.46  ? 992  ARG A CZ    1 
ATOM   8119  N  NH1   . ARG C 3 992  ? 4.364   54.854  36.382  1.00 48.90  ? 992  ARG A NH1   1 
ATOM   8120  N  NH2   . ARG C 3 992  ? 2.867   56.363  37.282  1.00 51.45  ? 992  ARG A NH2   1 
ATOM   8121  N  N     . SER C 3 993  ? 11.302  55.975  38.633  1.00 43.45  ? 993  SER A N     1 
ATOM   8122  C  CA    . SER C 3 993  ? 12.059  55.081  39.496  1.00 43.96  ? 993  SER A CA    1 
ATOM   8123  C  C     . SER C 3 993  ? 13.147  55.851  40.237  1.00 43.32  ? 993  SER A C     1 
ATOM   8124  O  O     . SER C 3 993  ? 13.522  55.497  41.350  1.00 44.20  ? 993  SER A O     1 
ATOM   8125  C  CB    . SER C 3 993  ? 12.663  53.920  38.686  1.00 44.59  ? 993  SER A CB    1 
ATOM   8126  O  OG    . SER C 3 993  ? 13.444  54.374  37.600  1.00 44.28  ? 993  SER A OG    1 
ATOM   8127  N  N     . GLU C 3 994  ? 13.654  56.907  39.619  1.00 44.45  ? 994  GLU A N     1 
ATOM   8128  C  CA    . GLU C 3 994  ? 14.679  57.724  40.257  1.00 45.86  ? 994  GLU A CA    1 
ATOM   8129  C  C     . GLU C 3 994  ? 14.048  58.470  41.429  1.00 44.90  ? 994  GLU A C     1 
ATOM   8130  O  O     . GLU C 3 994  ? 14.683  58.706  42.453  1.00 44.29  ? 994  GLU A O     1 
ATOM   8131  C  CB    . GLU C 3 994  ? 15.262  58.726  39.254  1.00 47.10  ? 994  GLU A CB    1 
ATOM   8132  C  CG    . GLU C 3 994  ? 16.431  58.181  38.447  1.00 50.24  ? 994  GLU A CG    1 
ATOM   8133  C  CD    . GLU C 3 994  ? 17.737  58.194  39.231  1.00 52.80  ? 994  GLU A CD    1 
ATOM   8134  O  OE1   . GLU C 3 994  ? 18.244  59.302  39.513  1.00 54.45  ? 994  GLU A OE1   1 
ATOM   8135  O  OE2   . GLU C 3 994  ? 18.254  57.104  39.566  1.00 51.95  ? 994  GLU A OE2   1 
ATOM   8136  N  N     . TRP C 3 995  ? 12.781  58.827  41.275  1.00 44.29  ? 995  TRP A N     1 
ATOM   8137  C  CA    . TRP C 3 995  ? 12.079  59.550  42.316  1.00 44.48  ? 995  TRP A CA    1 
ATOM   8138  C  C     . TRP C 3 995  ? 11.879  58.686  43.554  1.00 46.07  ? 995  TRP A C     1 
ATOM   8139  O  O     . TRP C 3 995  ? 12.123  59.140  44.672  1.00 47.51  ? 995  TRP A O     1 
ATOM   8140  C  CB    . TRP C 3 995  ? 10.734  60.045  41.788  1.00 41.25  ? 995  TRP A CB    1 
ATOM   8141  C  CG    . TRP C 3 995  ? 9.958   60.867  42.769  1.00 39.17  ? 995  TRP A CG    1 
ATOM   8142  C  CD1   . TRP C 3 995  ? 8.828   60.491  43.436  1.00 38.78  ? 995  TRP A CD1   1 
ATOM   8143  C  CD2   . TRP C 3 995  ? 10.225  62.221  43.162  1.00 37.60  ? 995  TRP A CD2   1 
ATOM   8144  N  NE1   . TRP C 3 995  ? 8.370   61.525  44.213  1.00 38.46  ? 995  TRP A NE1   1 
ATOM   8145  C  CE2   . TRP C 3 995  ? 9.208   62.601  44.067  1.00 38.42  ? 995  TRP A CE2   1 
ATOM   8146  C  CE3   . TRP C 3 995  ? 11.221  63.153  42.836  1.00 36.61  ? 995  TRP A CE3   1 
ATOM   8147  C  CZ2   . TRP C 3 995  ? 9.156   63.883  44.652  1.00 36.05  ? 995  TRP A CZ2   1 
ATOM   8148  C  CZ3   . TRP C 3 995  ? 11.167  64.433  43.419  1.00 35.42  ? 995  TRP A CZ3   1 
ATOM   8149  C  CH2   . TRP C 3 995  ? 10.140  64.778  44.314  1.00 35.85  ? 995  TRP A CH2   1 
ATOM   8150  N  N     . GLU C 3 996  ? 11.446  57.443  43.362  1.00 46.78  ? 996  GLU A N     1 
ATOM   8151  C  CA    . GLU C 3 996  ? 11.221  56.538  44.487  1.00 47.35  ? 996  GLU A CA    1 
ATOM   8152  C  C     . GLU C 3 996  ? 12.444  56.403  45.384  1.00 47.29  ? 996  GLU A C     1 
ATOM   8153  O  O     . GLU C 3 996  ? 12.321  56.132  46.578  1.00 46.45  ? 996  GLU A O     1 
ATOM   8154  C  CB    . GLU C 3 996  ? 10.812  55.149  43.993  1.00 48.27  ? 996  GLU A CB    1 
ATOM   8155  C  CG    . GLU C 3 996  ? 9.409   55.069  43.426  1.00 51.30  ? 996  GLU A CG    1 
ATOM   8156  C  CD    . GLU C 3 996  ? 8.375   55.686  44.352  1.00 54.98  ? 996  GLU A CD    1 
ATOM   8157  O  OE1   . GLU C 3 996  ? 8.387   55.372  45.569  1.00 56.24  ? 996  GLU A OE1   1 
ATOM   8158  O  OE2   . GLU C 3 996  ? 7.545   56.485  43.859  1.00 56.84  ? 996  GLU A OE2   1 
ATOM   8159  N  N     . LYS C 3 997  ? 13.624  56.602  44.805  1.00 47.78  ? 997  LYS A N     1 
ATOM   8160  C  CA    . LYS C 3 997  ? 14.871  56.479  45.546  1.00 47.82  ? 997  LYS A CA    1 
ATOM   8161  C  C     . LYS C 3 997  ? 15.318  57.765  46.236  1.00 48.48  ? 997  LYS A C     1 
ATOM   8162  O  O     . LYS C 3 997  ? 15.638  57.752  47.424  1.00 49.55  ? 997  LYS A O     1 
ATOM   8163  C  CB    . LYS C 3 997  ? 15.992  56.017  44.615  1.00 48.37  ? 997  LYS A CB    1 
ATOM   8164  C  CG    . LYS C 3 997  ? 15.689  54.769  43.794  1.00 49.84  ? 997  LYS A CG    1 
ATOM   8165  C  CD    . LYS C 3 997  ? 16.754  54.566  42.713  1.00 48.25  ? 997  LYS A CD    1 
ATOM   8166  C  CE    . LYS C 3 997  ? 16.433  53.374  41.816  1.00 49.35  ? 997  LYS A CE    1 
ATOM   8167  N  NZ    . LYS C 3 997  ? 17.418  53.228  40.698  1.00 49.23  ? 997  LYS A NZ    1 
ATOM   8168  N  N     . TYR C 3 998  ? 15.328  58.876  45.503  1.00 48.23  ? 998  TYR A N     1 
ATOM   8169  C  CA    . TYR C 3 998  ? 15.804  60.137  46.068  1.00 47.67  ? 998  TYR A CA    1 
ATOM   8170  C  C     . TYR C 3 998  ? 14.799  61.226  46.448  1.00 46.40  ? 998  TYR A C     1 
ATOM   8171  O  O     . TYR C 3 998  ? 15.095  62.065  47.304  1.00 45.30  ? 998  TYR A O     1 
ATOM   8172  C  CB    . TYR C 3 998  ? 16.859  60.732  45.129  1.00 49.35  ? 998  TYR A CB    1 
ATOM   8173  C  CG    . TYR C 3 998  ? 17.923  59.733  44.744  1.00 53.10  ? 998  TYR A CG    1 
ATOM   8174  C  CD1   . TYR C 3 998  ? 17.737  58.865  43.668  1.00 54.35  ? 998  TYR A CD1   1 
ATOM   8175  C  CD2   . TYR C 3 998  ? 19.087  59.599  45.503  1.00 54.19  ? 998  TYR A CD2   1 
ATOM   8176  C  CE1   . TYR C 3 998  ? 18.682  57.882  43.363  1.00 56.48  ? 998  TYR A CE1   1 
ATOM   8177  C  CE2   . TYR C 3 998  ? 20.038  58.621  45.207  1.00 55.09  ? 998  TYR A CE2   1 
ATOM   8178  C  CZ    . TYR C 3 998  ? 19.829  57.764  44.141  1.00 56.04  ? 998  TYR A CZ    1 
ATOM   8179  O  OH    . TYR C 3 998  ? 20.751  56.774  43.869  1.00 56.29  ? 998  TYR A OH    1 
ATOM   8180  N  N     . GLY C 3 999  ? 13.622  61.224  45.835  1.00 44.49  ? 999  GLY A N     1 
ATOM   8181  C  CA    . GLY C 3 999  ? 12.658  62.257  46.151  1.00 43.81  ? 999  GLY A CA    1 
ATOM   8182  C  C     . GLY C 3 999  ? 11.410  61.820  46.883  1.00 44.41  ? 999  GLY A C     1 
ATOM   8183  O  O     . GLY C 3 999  ? 10.846  62.591  47.658  1.00 44.84  ? 999  GLY A O     1 
ATOM   8184  N  N     . ALA C 3 1000 ? 10.963  60.594  46.637  1.00 45.00  ? 1000 ALA A N     1 
ATOM   8185  C  CA    . ALA C 3 1000 ? 9.757   60.087  47.281  1.00 45.94  ? 1000 ALA A CA    1 
ATOM   8186  C  C     . ALA C 3 1000 ? 9.861   60.257  48.790  1.00 46.61  ? 1000 ALA A C     1 
ATOM   8187  O  O     . ALA C 3 1000 ? 10.855  59.856  49.400  1.00 47.98  ? 1000 ALA A O     1 
ATOM   8188  C  CB    . ALA C 3 1000 ? 9.549   58.613  46.928  1.00 45.40  ? 1000 ALA A CB    1 
ATOM   8189  N  N     . GLY C 3 1001 ? 8.840   60.860  49.391  1.00 45.72  ? 1001 GLY A N     1 
ATOM   8190  C  CA    . GLY C 3 1001 ? 8.860   61.062  50.825  1.00 44.36  ? 1001 GLY A CA    1 
ATOM   8191  C  C     . GLY C 3 1001 ? 9.194   62.482  51.239  1.00 43.26  ? 1001 GLY A C     1 
ATOM   8192  O  O     . GLY C 3 1001 ? 8.609   63.002  52.189  1.00 43.34  ? 1001 GLY A O     1 
ATOM   8193  N  N     . ILE C 3 1002 ? 10.135  63.113  50.543  1.00 42.32  ? 1002 ILE A N     1 
ATOM   8194  C  CA    . ILE C 3 1002 ? 10.511  64.482  50.869  1.00 41.07  ? 1002 ILE A CA    1 
ATOM   8195  C  C     . ILE C 3 1002 ? 9.327   65.413  50.591  1.00 41.15  ? 1002 ILE A C     1 
ATOM   8196  O  O     . ILE C 3 1002 ? 8.863   66.108  51.494  1.00 41.48  ? 1002 ILE A O     1 
ATOM   8197  C  CB    . ILE C 3 1002 ? 11.743  64.912  50.075  1.00 39.61  ? 1002 ILE A CB    1 
ATOM   8198  C  CG1   . ILE C 3 1002 ? 12.880  63.927  50.351  1.00 37.70  ? 1002 ILE A CG1   1 
ATOM   8199  C  CG2   . ILE C 3 1002 ? 12.162  66.320  50.482  1.00 37.86  ? 1002 ILE A CG2   1 
ATOM   8200  C  CD1   . ILE C 3 1002 ? 14.087  64.102  49.458  1.00 39.16  ? 1002 ILE A CD1   1 
ATOM   8201  N  N     . ILE C 3 1003 ? 8.843   65.444  49.352  1.00 40.91  ? 1003 ILE A N     1 
ATOM   8202  C  CA    . ILE C 3 1003 ? 7.665   66.255  49.047  1.00 40.23  ? 1003 ILE A CA    1 
ATOM   8203  C  C     . ILE C 3 1003 ? 6.611   65.309  48.496  1.00 40.33  ? 1003 ILE A C     1 
ATOM   8204  O  O     . ILE C 3 1003 ? 6.925   64.174  48.126  1.00 39.67  ? 1003 ILE A O     1 
ATOM   8205  C  CB    . ILE C 3 1003 ? 7.925   67.391  48.018  1.00 39.52  ? 1003 ILE A CB    1 
ATOM   8206  C  CG1   . ILE C 3 1003 ? 8.399   66.817  46.681  1.00 38.90  ? 1003 ILE A CG1   1 
ATOM   8207  C  CG2   . ILE C 3 1003 ? 8.895   68.398  48.606  1.00 36.24  ? 1003 ILE A CG2   1 
ATOM   8208  C  CD1   . ILE C 3 1003 ? 8.320   67.811  45.524  1.00 38.38  ? 1003 ILE A CD1   1 
ATOM   8209  N  N     . HIS C 3 1004 ? 5.365   65.772  48.454  1.00 41.56  ? 1004 HIS A N     1 
ATOM   8210  C  CA    . HIS C 3 1004 ? 4.258   64.956  47.970  1.00 42.31  ? 1004 HIS A CA    1 
ATOM   8211  C  C     . HIS C 3 1004 ? 3.561   65.548  46.752  1.00 41.90  ? 1004 HIS A C     1 
ATOM   8212  O  O     . HIS C 3 1004 ? 2.597   64.983  46.248  1.00 43.13  ? 1004 HIS A O     1 
ATOM   8213  C  CB    . HIS C 3 1004 ? 3.260   64.728  49.115  1.00 44.34  ? 1004 HIS A CB    1 
ATOM   8214  C  CG    . HIS C 3 1004 ? 3.813   63.879  50.221  1.00 47.06  ? 1004 HIS A CG    1 
ATOM   8215  N  ND1   . HIS C 3 1004 ? 3.769   62.501  50.195  1.00 47.70  ? 1004 HIS A ND1   1 
ATOM   8216  C  CD2   . HIS C 3 1004 ? 4.514   64.210  51.333  1.00 47.85  ? 1004 HIS A CD2   1 
ATOM   8217  C  CE1   . HIS C 3 1004 ? 4.423   62.020  51.237  1.00 46.29  ? 1004 HIS A CE1   1 
ATOM   8218  N  NE2   . HIS C 3 1004 ? 4.887   63.036  51.943  1.00 47.08  ? 1004 HIS A NE2   1 
ATOM   8219  N  N     . ASN C 3 1005 ? 4.079   66.671  46.265  1.00 42.77  ? 1005 ASN A N     1 
ATOM   8220  C  CA    . ASN C 3 1005 ? 3.535   67.360  45.091  1.00 42.93  ? 1005 ASN A CA    1 
ATOM   8221  C  C     . ASN C 3 1005 ? 4.324   67.129  43.797  1.00 42.42  ? 1005 ASN A C     1 
ATOM   8222  O  O     . ASN C 3 1005 ? 4.238   67.945  42.889  1.00 45.29  ? 1005 ASN A O     1 
ATOM   8223  C  CB    . ASN C 3 1005 ? 3.537   68.871  45.320  1.00 44.05  ? 1005 ASN A CB    1 
ATOM   8224  C  CG    . ASN C 3 1005 ? 2.372   69.346  46.123  1.00 43.96  ? 1005 ASN A CG    1 
ATOM   8225  O  OD1   . ASN C 3 1005 ? 1.244   68.902  45.923  1.00 46.96  ? 1005 ASN A OD1   1 
ATOM   8226  N  ND2   . ASN C 3 1005 ? 2.625   70.285  47.023  1.00 44.69  ? 1005 ASN A ND2   1 
ATOM   8227  N  N     . PRO C 3 1006 ? 5.062   66.017  43.670  1.00 41.10  ? 1006 PRO A N     1 
ATOM   8228  C  CA    . PRO C 3 1006 ? 5.817   65.856  42.420  1.00 38.69  ? 1006 PRO A CA    1 
ATOM   8229  C  C     . PRO C 3 1006 ? 5.034   66.066  41.127  1.00 35.86  ? 1006 PRO A C     1 
ATOM   8230  O  O     . PRO C 3 1006 ? 4.184   65.249  40.778  1.00 34.85  ? 1006 PRO A O     1 
ATOM   8231  C  CB    . PRO C 3 1006 ? 6.359   64.421  42.504  1.00 39.62  ? 1006 PRO A CB    1 
ATOM   8232  C  CG    . PRO C 3 1006 ? 6.113   63.988  43.934  1.00 41.10  ? 1006 PRO A CG    1 
ATOM   8233  C  CD    . PRO C 3 1006 ? 4.863   64.709  44.314  1.00 41.87  ? 1006 PRO A CD    1 
ATOM   8234  N  N     . PRO C 3 1007 ? 5.294   67.178  40.413  1.00 34.26  ? 1007 PRO A N     1 
ATOM   8235  C  CA    . PRO C 3 1007 ? 4.597   67.441  39.149  1.00 33.08  ? 1007 PRO A CA    1 
ATOM   8236  C  C     . PRO C 3 1007 ? 5.125   66.392  38.178  1.00 32.97  ? 1007 PRO A C     1 
ATOM   8237  O  O     . PRO C 3 1007 ? 6.315   66.065  38.195  1.00 33.25  ? 1007 PRO A O     1 
ATOM   8238  C  CB    . PRO C 3 1007 ? 5.067   68.843  38.773  1.00 31.30  ? 1007 PRO A CB    1 
ATOM   8239  C  CG    . PRO C 3 1007 ? 5.334   69.467  40.091  1.00 33.79  ? 1007 PRO A CG    1 
ATOM   8240  C  CD    . PRO C 3 1007 ? 6.047   68.369  40.839  1.00 33.79  ? 1007 PRO A CD    1 
ATOM   8241  N  N     . SER C 3 1008 ? 4.258   65.858  37.336  1.00 32.27  ? 1008 SER A N     1 
ATOM   8242  C  CA    . SER C 3 1008 ? 4.692   64.828  36.407  1.00 31.29  ? 1008 SER A CA    1 
ATOM   8243  C  C     . SER C 3 1008 ? 3.900   64.876  35.101  1.00 30.50  ? 1008 SER A C     1 
ATOM   8244  O  O     . SER C 3 1008 ? 2.730   65.246  35.096  1.00 29.23  ? 1008 SER A O     1 
ATOM   8245  C  CB    . SER C 3 1008 ? 4.540   63.456  37.090  1.00 29.69  ? 1008 SER A CB    1 
ATOM   8246  O  OG    . SER C 3 1008 ? 4.663   62.374  36.178  1.00 32.02  ? 1008 SER A OG    1 
ATOM   8247  N  N     . LEU C 3 1009 ? 4.544   64.522  33.992  1.00 31.68  ? 1009 LEU A N     1 
ATOM   8248  C  CA    . LEU C 3 1009 ? 3.850   64.499  32.720  1.00 32.59  ? 1009 LEU A CA    1 
ATOM   8249  C  C     . LEU C 3 1009 ? 2.733   63.482  32.831  1.00 33.45  ? 1009 LEU A C     1 
ATOM   8250  O  O     . LEU C 3 1009 ? 1.687   63.642  32.202  1.00 34.67  ? 1009 LEU A O     1 
ATOM   8251  C  CB    . LEU C 3 1009 ? 4.781   64.105  31.579  1.00 33.13  ? 1009 LEU A CB    1 
ATOM   8252  C  CG    . LEU C 3 1009 ? 5.732   65.170  31.031  1.00 35.50  ? 1009 LEU A CG    1 
ATOM   8253  C  CD1   . LEU C 3 1009 ? 6.481   64.601  29.844  1.00 35.28  ? 1009 LEU A CD1   1 
ATOM   8254  C  CD2   . LEU C 3 1009 ? 4.957   66.402  30.607  1.00 35.78  ? 1009 LEU A CD2   1 
ATOM   8255  N  N     . PHE C 3 1010 ? 2.944   62.445  33.644  1.00 33.72  ? 1010 PHE A N     1 
ATOM   8256  C  CA    . PHE C 3 1010 ? 1.927   61.409  33.826  1.00 35.39  ? 1010 PHE A CA    1 
ATOM   8257  C  C     . PHE C 3 1010 ? 0.635   61.916  34.449  1.00 36.04  ? 1010 PHE A C     1 
ATOM   8258  O  O     . PHE C 3 1010 ? -0.365  61.201  34.465  1.00 36.93  ? 1010 PHE A O     1 
ATOM   8259  C  CB    . PHE C 3 1010 ? 2.463   60.248  34.676  1.00 36.56  ? 1010 PHE A CB    1 
ATOM   8260  C  CG    . PHE C 3 1010 ? 3.449   59.371  33.957  1.00 38.55  ? 1010 PHE A CG    1 
ATOM   8261  C  CD1   . PHE C 3 1010 ? 3.628   59.478  32.579  1.00 39.73  ? 1010 PHE A CD1   1 
ATOM   8262  C  CD2   . PHE C 3 1010 ? 4.201   58.437  34.657  1.00 41.14  ? 1010 PHE A CD2   1 
ATOM   8263  C  CE1   . PHE C 3 1010 ? 4.545   58.667  31.906  1.00 41.94  ? 1010 PHE A CE1   1 
ATOM   8264  C  CE2   . PHE C 3 1010 ? 5.123   57.618  33.999  1.00 42.78  ? 1010 PHE A CE2   1 
ATOM   8265  C  CZ    . PHE C 3 1010 ? 5.297   57.733  32.618  1.00 42.77  ? 1010 PHE A CZ    1 
ATOM   8266  N  N     . ASP C 3 1011 ? 0.652   63.141  34.966  1.00 37.27  ? 1011 ASP A N     1 
ATOM   8267  C  CA    . ASP C 3 1011 ? -0.542  63.715  35.575  1.00 39.50  ? 1011 ASP A CA    1 
ATOM   8268  C  C     . ASP C 3 1011 ? -1.400  64.419  34.525  1.00 39.42  ? 1011 ASP A C     1 
ATOM   8269  O  O     . ASP C 3 1011 ? -2.631  64.436  34.611  1.00 39.59  ? 1011 ASP A O     1 
ATOM   8270  C  CB    . ASP C 3 1011 ? -0.169  64.722  36.672  1.00 41.71  ? 1011 ASP A CB    1 
ATOM   8271  C  CG    . ASP C 3 1011 ? 0.613   64.088  37.817  1.00 46.14  ? 1011 ASP A CG    1 
ATOM   8272  O  OD1   . ASP C 3 1011 ? 0.500   62.850  38.000  1.00 47.38  ? 1011 ASP A OD1   1 
ATOM   8273  O  OD2   . ASP C 3 1011 ? 1.328   64.832  38.540  1.00 45.36  ? 1011 ASP A OD2   1 
ATOM   8274  N  N     . VAL C 3 1012 ? -0.735  64.984  33.525  1.00 38.78  ? 1012 VAL A N     1 
ATOM   8275  C  CA    . VAL C 3 1012 ? -1.407  65.722  32.470  1.00 38.89  ? 1012 VAL A CA    1 
ATOM   8276  C  C     . VAL C 3 1012 ? -2.675  65.072  31.931  1.00 37.86  ? 1012 VAL A C     1 
ATOM   8277  O  O     . VAL C 3 1012 ? -3.689  65.742  31.755  1.00 36.64  ? 1012 VAL A O     1 
ATOM   8278  C  CB    . VAL C 3 1012 ? -0.437  66.016  31.304  1.00 39.43  ? 1012 VAL A CB    1 
ATOM   8279  C  CG1   . VAL C 3 1012 ? -1.149  66.814  30.214  1.00 39.99  ? 1012 VAL A CG1   1 
ATOM   8280  C  CG2   . VAL C 3 1012 ? 0.755   66.798  31.826  1.00 39.79  ? 1012 VAL A CG2   1 
ATOM   8281  N  N     . PRO C 3 1013 ? -2.638  63.762  31.648  1.00 38.48  ? 1013 PRO A N     1 
ATOM   8282  C  CA    . PRO C 3 1013 ? -3.874  63.167  31.134  1.00 38.46  ? 1013 PRO A CA    1 
ATOM   8283  C  C     . PRO C 3 1013 ? -5.017  63.362  32.131  1.00 39.32  ? 1013 PRO A C     1 
ATOM   8284  O  O     . PRO C 3 1013 ? -6.151  63.668  31.743  1.00 38.48  ? 1013 PRO A O     1 
ATOM   8285  C  CB    . PRO C 3 1013 ? -3.496  61.702  30.949  1.00 37.88  ? 1013 PRO A CB    1 
ATOM   8286  C  CG    . PRO C 3 1013 ? -2.036  61.781  30.604  1.00 36.57  ? 1013 PRO A CG    1 
ATOM   8287  C  CD    . PRO C 3 1013 ? -1.521  62.803  31.587  1.00 37.06  ? 1013 PRO A CD    1 
ATOM   8288  N  N     . HIS C 3 1014 ? -4.702  63.206  33.416  1.00 39.53  ? 1014 HIS A N     1 
ATOM   8289  C  CA    . HIS C 3 1014 ? -5.696  63.361  34.477  1.00 41.16  ? 1014 HIS A CA    1 
ATOM   8290  C  C     . HIS C 3 1014 ? -6.146  64.809  34.630  1.00 39.78  ? 1014 HIS A C     1 
ATOM   8291  O  O     . HIS C 3 1014 ? -7.334  65.078  34.825  1.00 39.15  ? 1014 HIS A O     1 
ATOM   8292  C  CB    . HIS C 3 1014 ? -5.146  62.826  35.809  1.00 43.62  ? 1014 HIS A CB    1 
ATOM   8293  C  CG    . HIS C 3 1014 ? -4.722  61.391  35.743  1.00 47.59  ? 1014 HIS A CG    1 
ATOM   8294  N  ND1   . HIS C 3 1014 ? -3.598  60.979  35.055  1.00 49.08  ? 1014 HIS A ND1   1 
ATOM   8295  C  CD2   . HIS C 3 1014 ? -5.313  60.264  36.209  1.00 48.53  ? 1014 HIS A CD2   1 
ATOM   8296  C  CE1   . HIS C 3 1014 ? -3.518  59.660  35.097  1.00 50.22  ? 1014 HIS A CE1   1 
ATOM   8297  N  NE2   . HIS C 3 1014 ? -4.546  59.202  35.791  1.00 50.08  ? 1014 HIS A NE2   1 
ATOM   8298  N  N     . LYS C 3 1015 ? -5.206  65.743  34.544  1.00 38.21  ? 1015 LYS A N     1 
ATOM   8299  C  CA    . LYS C 3 1015 ? -5.572  67.144  34.651  1.00 37.92  ? 1015 LYS A CA    1 
ATOM   8300  C  C     . LYS C 3 1015 ? -6.412  67.544  33.440  1.00 36.03  ? 1015 LYS A C     1 
ATOM   8301  O  O     . LYS C 3 1015 ? -7.337  68.347  33.559  1.00 35.33  ? 1015 LYS A O     1 
ATOM   8302  C  CB    . LYS C 3 1015 ? -4.330  68.027  34.763  1.00 40.28  ? 1015 LYS A CB    1 
ATOM   8303  C  CG    . LYS C 3 1015 ? -3.677  67.955  36.138  1.00 45.06  ? 1015 LYS A CG    1 
ATOM   8304  C  CD    . LYS C 3 1015 ? -2.629  69.043  36.336  1.00 48.64  ? 1015 LYS A CD    1 
ATOM   8305  C  CE    . LYS C 3 1015 ? -2.098  69.059  37.766  1.00 50.12  ? 1015 LYS A CE    1 
ATOM   8306  N  NZ    . LYS C 3 1015 ? -1.037  70.100  37.930  1.00 52.83  ? 1015 LYS A NZ    1 
ATOM   8307  N  N     . TRP C 3 1016 ? -6.097  66.973  32.280  1.00 33.50  ? 1016 TRP A N     1 
ATOM   8308  C  CA    . TRP C 3 1016 ? -6.849  67.261  31.063  1.00 32.57  ? 1016 TRP A CA    1 
ATOM   8309  C  C     . TRP C 3 1016 ? -8.288  66.771  31.183  1.00 33.18  ? 1016 TRP A C     1 
ATOM   8310  O  O     . TRP C 3 1016 ? -9.227  67.469  30.786  1.00 31.78  ? 1016 TRP A O     1 
ATOM   8311  C  CB    . TRP C 3 1016 ? -6.197  66.600  29.851  1.00 31.93  ? 1016 TRP A CB    1 
ATOM   8312  C  CG    . TRP C 3 1016 ? -5.077  67.388  29.263  1.00 30.24  ? 1016 TRP A CG    1 
ATOM   8313  C  CD1   . TRP C 3 1016 ? -4.710  68.659  29.586  1.00 28.67  ? 1016 TRP A CD1   1 
ATOM   8314  C  CD2   . TRP C 3 1016 ? -4.193  66.965  28.219  1.00 30.05  ? 1016 TRP A CD2   1 
ATOM   8315  N  NE1   . TRP C 3 1016 ? -3.653  69.058  28.808  1.00 29.95  ? 1016 TRP A NE1   1 
ATOM   8316  C  CE2   . TRP C 3 1016 ? -3.315  68.036  27.959  1.00 30.76  ? 1016 TRP A CE2   1 
ATOM   8317  C  CE3   . TRP C 3 1016 ? -4.060  65.786  27.477  1.00 29.46  ? 1016 TRP A CE3   1 
ATOM   8318  C  CZ2   . TRP C 3 1016 ? -2.315  67.963  26.986  1.00 29.70  ? 1016 TRP A CZ2   1 
ATOM   8319  C  CZ3   . TRP C 3 1016 ? -3.069  65.715  26.513  1.00 30.17  ? 1016 TRP A CZ3   1 
ATOM   8320  C  CH2   . TRP C 3 1016 ? -2.209  66.799  26.277  1.00 28.42  ? 1016 TRP A CH2   1 
ATOM   8321  N  N     . TYR C 3 1017 ? -8.450  65.561  31.717  1.00 33.42  ? 1017 TYR A N     1 
ATOM   8322  C  CA    . TYR C 3 1017 ? -9.770  64.980  31.922  1.00 35.01  ? 1017 TYR A CA    1 
ATOM   8323  C  C     . TYR C 3 1017 ? -10.582 65.889  32.849  1.00 34.82  ? 1017 TYR A C     1 
ATOM   8324  O  O     . TYR C 3 1017 ? -11.720 66.247  32.546  1.00 33.34  ? 1017 TYR A O     1 
ATOM   8325  C  CB    . TYR C 3 1017 ? -9.633  63.585  32.537  1.00 37.29  ? 1017 TYR A CB    1 
ATOM   8326  C  CG    . TYR C 3 1017 ? -10.941 62.954  32.943  1.00 37.95  ? 1017 TYR A CG    1 
ATOM   8327  C  CD1   . TYR C 3 1017 ? -11.309 62.874  34.281  1.00 40.57  ? 1017 TYR A CD1   1 
ATOM   8328  C  CD2   . TYR C 3 1017 ? -11.814 62.443  31.988  1.00 39.94  ? 1017 TYR A CD2   1 
ATOM   8329  C  CE1   . TYR C 3 1017 ? -12.519 62.293  34.663  1.00 42.27  ? 1017 TYR A CE1   1 
ATOM   8330  C  CE2   . TYR C 3 1017 ? -13.027 61.862  32.355  1.00 41.04  ? 1017 TYR A CE2   1 
ATOM   8331  C  CZ    . TYR C 3 1017 ? -13.370 61.789  33.693  1.00 42.09  ? 1017 TYR A CZ    1 
ATOM   8332  O  OH    . TYR C 3 1017 ? -14.554 61.196  34.060  1.00 43.74  ? 1017 TYR A OH    1 
ATOM   8333  N  N     . GLN C 3 1018 ? -9.985  66.266  33.976  1.00 36.28  ? 1018 GLN A N     1 
ATOM   8334  C  CA    . GLN C 3 1018 ? -10.657 67.140  34.929  1.00 37.65  ? 1018 GLN A CA    1 
ATOM   8335  C  C     . GLN C 3 1018 ? -11.113 68.419  34.224  1.00 36.51  ? 1018 GLN A C     1 
ATOM   8336  O  O     . GLN C 3 1018 ? -12.249 68.866  34.396  1.00 35.98  ? 1018 GLN A O     1 
ATOM   8337  C  CB    . GLN C 3 1018 ? -9.717  67.487  36.090  1.00 40.73  ? 1018 GLN A CB    1 
ATOM   8338  C  CG    . GLN C 3 1018 ? -9.272  66.290  36.932  1.00 45.13  ? 1018 GLN A CG    1 
ATOM   8339  C  CD    . GLN C 3 1018 ? -8.444  66.698  38.155  1.00 48.52  ? 1018 GLN A CD    1 
ATOM   8340  O  OE1   . GLN C 3 1018 ? -8.905  67.471  39.000  1.00 49.24  ? 1018 GLN A OE1   1 
ATOM   8341  N  NE2   . GLN C 3 1018 ? -7.218  66.177  38.250  1.00 49.62  ? 1018 GLN A NE2   1 
ATOM   8342  N  N     . GLY C 3 1019 ? -10.221 69.001  33.426  1.00 35.47  ? 1019 GLY A N     1 
ATOM   8343  C  CA    . GLY C 3 1019 ? -10.554 70.213  32.702  1.00 34.34  ? 1019 GLY A CA    1 
ATOM   8344  C  C     . GLY C 3 1019 ? -11.758 70.056  31.785  1.00 34.48  ? 1019 GLY A C     1 
ATOM   8345  O  O     . GLY C 3 1019 ? -12.616 70.931  31.729  1.00 34.62  ? 1019 GLY A O     1 
ATOM   8346  N  N     . ALA C 3 1020 ? -11.825 68.949  31.055  1.00 34.15  ? 1020 ALA A N     1 
ATOM   8347  C  CA    . ALA C 3 1020 ? -12.949 68.712  30.159  1.00 35.91  ? 1020 ALA A CA    1 
ATOM   8348  C  C     . ALA C 3 1020 ? -14.227 68.522  30.985  1.00 37.56  ? 1020 ALA A C     1 
ATOM   8349  O  O     . ALA C 3 1020 ? -15.330 68.874  30.548  1.00 37.05  ? 1020 ALA A O     1 
ATOM   8350  C  CB    . ALA C 3 1020 ? -12.681 67.483  29.297  1.00 34.94  ? 1020 ALA A CB    1 
ATOM   8351  N  N     . GLN C 3 1021 ? -14.067 67.959  32.180  1.00 38.56  ? 1021 GLN A N     1 
ATOM   8352  C  CA    . GLN C 3 1021 ? -15.191 67.745  33.080  1.00 39.55  ? 1021 GLN A CA    1 
ATOM   8353  C  C     . GLN C 3 1021 ? -15.722 69.087  33.553  1.00 39.59  ? 1021 GLN A C     1 
ATOM   8354  O  O     . GLN C 3 1021 ? -16.864 69.451  33.267  1.00 40.47  ? 1021 GLN A O     1 
ATOM   8355  C  CB    . GLN C 3 1021 ? -14.768 66.938  34.311  1.00 41.02  ? 1021 GLN A CB    1 
ATOM   8356  C  CG    . GLN C 3 1021 ? -15.244 65.502  34.321  1.00 45.26  ? 1021 GLN A CG    1 
ATOM   8357  C  CD    . GLN C 3 1021 ? -15.391 64.952  35.731  1.00 47.57  ? 1021 GLN A CD    1 
ATOM   8358  O  OE1   . GLN C 3 1021 ? -14.417 64.867  36.484  1.00 49.87  ? 1021 GLN A OE1   1 
ATOM   8359  N  NE2   . GLN C 3 1021 ? -16.617 64.579  36.096  1.00 47.22  ? 1021 GLN A NE2   1 
ATOM   8360  N  N     . GLU C 3 1022 ? -14.880 69.821  34.275  1.00 38.72  ? 1022 GLU A N     1 
ATOM   8361  C  CA    . GLU C 3 1022 ? -15.268 71.114  34.817  1.00 38.63  ? 1022 GLU A CA    1 
ATOM   8362  C  C     . GLU C 3 1022 ? -15.735 72.121  33.781  1.00 37.85  ? 1022 GLU A C     1 
ATOM   8363  O  O     . GLU C 3 1022 ? -16.134 73.234  34.136  1.00 39.45  ? 1022 GLU A O     1 
ATOM   8364  C  CB    . GLU C 3 1022 ? -14.120 71.715  35.631  1.00 37.82  ? 1022 GLU A CB    1 
ATOM   8365  C  CG    . GLU C 3 1022 ? -13.724 70.879  36.847  1.00 41.63  ? 1022 GLU A CG    1 
ATOM   8366  C  CD    . GLU C 3 1022 ? -14.928 70.304  37.608  1.00 43.45  ? 1022 GLU A CD    1 
ATOM   8367  O  OE1   . GLU C 3 1022 ? -15.836 71.080  37.983  1.00 44.63  ? 1022 GLU A OE1   1 
ATOM   8368  O  OE2   . GLU C 3 1022 ? -14.959 69.070  37.837  1.00 44.16  ? 1022 GLU A OE2   1 
ATOM   8369  N  N     . ALA C 3 1023 ? -15.695 71.745  32.505  1.00 36.60  ? 1023 ALA A N     1 
ATOM   8370  C  CA    . ALA C 3 1023 ? -16.121 72.655  31.442  1.00 36.08  ? 1023 ALA A CA    1 
ATOM   8371  C  C     . ALA C 3 1023 ? -17.603 72.486  31.111  1.00 36.03  ? 1023 ALA A C     1 
ATOM   8372  O  O     . ALA C 3 1023 ? -18.251 73.420  30.640  1.00 34.12  ? 1023 ALA A O     1 
ATOM   8373  C  CB    . ALA C 3 1023 ? -15.265 72.445  30.189  1.00 34.94  ? 1023 ALA A CB    1 
ATOM   8374  N  N     . ALA C 3 1024 ? -18.125 71.289  31.369  1.00 36.23  ? 1024 ALA A N     1 
ATOM   8375  C  CA    . ALA C 3 1024 ? -19.528 70.966  31.119  1.00 37.76  ? 1024 ALA A CA    1 
ATOM   8376  C  C     . ALA C 3 1024 ? -20.486 71.749  32.031  1.00 37.90  ? 1024 ALA A C     1 
ATOM   8377  O  O     . ALA C 3 1024 ? -20.081 72.270  33.071  1.00 36.75  ? 1024 ALA A O     1 
ATOM   8378  C  CB    . ALA C 3 1024 ? -19.750 69.460  31.314  1.00 36.60  ? 1024 ALA A CB    1 
ATOM   8379  N  N     . ILE C 3 1025 ? -21.753 71.825  31.626  1.00 38.15  ? 1025 ILE A N     1 
ATOM   8380  C  CA    . ILE C 3 1025 ? -22.787 72.508  32.406  1.00 40.87  ? 1025 ILE A CA    1 
ATOM   8381  C  C     . ILE C 3 1025 ? -23.039 71.760  33.720  1.00 39.72  ? 1025 ILE A C     1 
ATOM   8382  O  O     . ILE C 3 1025 ? -23.100 70.530  33.742  1.00 39.59  ? 1025 ILE A O     1 
ATOM   8383  C  CB    . ILE C 3 1025 ? -24.126 72.582  31.615  1.00 43.37  ? 1025 ILE A CB    1 
ATOM   8384  C  CG1   . ILE C 3 1025 ? -24.125 73.802  30.690  1.00 45.32  ? 1025 ILE A CG1   1 
ATOM   8385  C  CG2   . ILE C 3 1025 ? -25.309 72.643  32.573  1.00 46.01  ? 1025 ILE A CG2   1 
ATOM   8386  C  CD1   . ILE C 3 1025 ? -25.315 73.855  29.742  1.00 45.00  ? 1025 ILE A CD1   1 
ATOM   8387  N  N     . ALA C 3 1026 ? -23.183 72.503  34.811  1.00 38.41  ? 1026 ALA A N     1 
ATOM   8388  C  CA    . ALA C 3 1026 ? -23.436 71.889  36.106  1.00 38.74  ? 1026 ALA A CA    1 
ATOM   8389  C  C     . ALA C 3 1026 ? -24.928 71.599  36.277  1.00 38.92  ? 1026 ALA A C     1 
ATOM   8390  O  O     . ALA C 3 1026 ? -25.766 72.183  35.589  1.00 38.78  ? 1026 ALA A O     1 
ATOM   8391  C  CB    . ALA C 3 1026 ? -22.948 72.800  37.216  1.00 37.18  ? 1026 ALA A CB    1 
ATOM   8392  N  N     . THR C 3 1027 ? -25.248 70.689  37.192  1.00 39.79  ? 1027 THR A N     1 
ATOM   8393  C  CA    . THR C 3 1027 ? -26.633 70.310  37.486  1.00 40.46  ? 1027 THR A CA    1 
ATOM   8394  C  C     . THR C 3 1027 ? -27.114 71.090  38.713  1.00 40.87  ? 1027 THR A C     1 
ATOM   8395  O  O     . THR C 3 1027 ? -26.302 71.629  39.455  1.00 39.74  ? 1027 THR A O     1 
ATOM   8396  C  CB    . THR C 3 1027 ? -26.730 68.802  37.803  1.00 39.24  ? 1027 THR A CB    1 
ATOM   8397  O  OG1   . THR C 3 1027 ? -25.967 68.514  38.983  1.00 38.34  ? 1027 THR A OG1   1 
ATOM   8398  C  CG2   . THR C 3 1027 ? -26.180 67.979  36.657  1.00 36.84  ? 1027 THR A CG2   1 
ATOM   8399  N  N     . ARG C 3 1028 ? -28.424 71.146  38.938  1.00 43.35  ? 1028 ARG A N     1 
ATOM   8400  C  CA    . ARG C 3 1028 ? -28.937 71.879  40.097  1.00 45.51  ? 1028 ARG A CA    1 
ATOM   8401  C  C     . ARG C 3 1028 ? -28.503 71.191  41.385  1.00 44.64  ? 1028 ARG A C     1 
ATOM   8402  O  O     . ARG C 3 1028 ? -28.442 71.811  42.445  1.00 44.39  ? 1028 ARG A O     1 
ATOM   8403  C  CB    . ARG C 3 1028 ? -30.471 71.992  40.060  1.00 48.42  ? 1028 ARG A CB    1 
ATOM   8404  C  CG    . ARG C 3 1028 ? -31.014 73.013  41.080  1.00 54.63  ? 1028 ARG A CG    1 
ATOM   8405  C  CD    . ARG C 3 1028 ? -32.481 73.392  40.850  1.00 59.08  ? 1028 ARG A CD    1 
ATOM   8406  N  NE    . ARG C 3 1028 ? -32.845 74.622  41.565  1.00 63.90  ? 1028 ARG A NE    1 
ATOM   8407  C  CZ    . ARG C 3 1028 ? -34.080 75.124  41.638  1.00 66.98  ? 1028 ARG A CZ    1 
ATOM   8408  N  NH1   . ARG C 3 1028 ? -35.093 74.502  41.041  1.00 67.90  ? 1028 ARG A NH1   1 
ATOM   8409  N  NH2   . ARG C 3 1028 ? -34.307 76.256  42.303  1.00 66.70  ? 1028 ARG A NH2   1 
ATOM   8410  N  N     . GLU C 3 1029 ? -28.191 69.906  41.278  1.00 44.50  ? 1029 GLU A N     1 
ATOM   8411  C  CA    . GLU C 3 1029 ? -27.753 69.119  42.418  1.00 44.98  ? 1029 GLU A CA    1 
ATOM   8412  C  C     . GLU C 3 1029 ? -26.328 69.518  42.773  1.00 43.50  ? 1029 GLU A C     1 
ATOM   8413  O  O     . GLU C 3 1029 ? -26.021 69.811  43.922  1.00 43.42  ? 1029 GLU A O     1 
ATOM   8414  C  CB    . GLU C 3 1029 ? -27.812 67.628  42.080  1.00 48.84  ? 1029 GLU A CB    1 
ATOM   8415  C  CG    . GLU C 3 1029 ? -29.190 67.145  41.596  1.00 54.04  ? 1029 GLU A CG    1 
ATOM   8416  C  CD    . GLU C 3 1029 ? -29.477 67.467  40.123  1.00 55.94  ? 1029 GLU A CD    1 
ATOM   8417  O  OE1   . GLU C 3 1029 ? -29.466 68.658  39.738  1.00 56.86  ? 1029 GLU A OE1   1 
ATOM   8418  O  OE2   . GLU C 3 1029 ? -29.722 66.517  39.345  1.00 57.91  ? 1029 GLU A OE2   1 
ATOM   8419  N  N     . GLU C 3 1030 ? -25.455 69.530  41.776  1.00 42.82  ? 1030 GLU A N     1 
ATOM   8420  C  CA    . GLU C 3 1030 ? -24.070 69.919  41.995  1.00 41.62  ? 1030 GLU A CA    1 
ATOM   8421  C  C     . GLU C 3 1030 ? -24.030 71.325  42.575  1.00 40.48  ? 1030 GLU A C     1 
ATOM   8422  O  O     . GLU C 3 1030 ? -23.109 71.674  43.309  1.00 39.55  ? 1030 GLU A O     1 
ATOM   8423  C  CB    . GLU C 3 1030 ? -23.302 69.871  40.678  1.00 42.73  ? 1030 GLU A CB    1 
ATOM   8424  C  CG    . GLU C 3 1030 ? -23.035 68.457  40.191  1.00 44.09  ? 1030 GLU A CG    1 
ATOM   8425  C  CD    . GLU C 3 1030 ? -22.499 68.416  38.772  1.00 46.33  ? 1030 GLU A CD    1 
ATOM   8426  O  OE1   . GLU C 3 1030 ? -21.781 67.442  38.453  1.00 47.28  ? 1030 GLU A OE1   1 
ATOM   8427  O  OE2   . GLU C 3 1030 ? -22.803 69.342  37.978  1.00 43.39  ? 1030 GLU A OE2   1 
ATOM   8428  N  N     . LEU C 3 1031 ? -25.043 72.122  42.242  1.00 39.41  ? 1031 LEU A N     1 
ATOM   8429  C  CA    . LEU C 3 1031 ? -25.148 73.489  42.733  1.00 39.40  ? 1031 LEU A CA    1 
ATOM   8430  C  C     . LEU C 3 1031 ? -25.458 73.462  44.228  1.00 39.44  ? 1031 LEU A C     1 
ATOM   8431  O  O     . LEU C 3 1031 ? -24.835 74.174  45.023  1.00 38.45  ? 1031 LEU A O     1 
ATOM   8432  C  CB    . LEU C 3 1031 ? -26.250 74.240  41.982  1.00 40.00  ? 1031 LEU A CB    1 
ATOM   8433  C  CG    . LEU C 3 1031 ? -26.423 75.705  42.393  1.00 41.61  ? 1031 LEU A CG    1 
ATOM   8434  C  CD1   . LEU C 3 1031 ? -25.084 76.417  42.295  1.00 41.82  ? 1031 LEU A CD1   1 
ATOM   8435  C  CD2   . LEU C 3 1031 ? -27.454 76.380  41.504  1.00 41.47  ? 1031 LEU A CD2   1 
ATOM   8436  N  N     . ALA C 3 1032 ? -26.430 72.639  44.604  1.00 38.94  ? 1032 ALA A N     1 
ATOM   8437  C  CA    . ALA C 3 1032 ? -26.796 72.500  46.005  1.00 38.54  ? 1032 ALA A CA    1 
ATOM   8438  C  C     . ALA C 3 1032 ? -25.556 72.055  46.767  1.00 37.78  ? 1032 ALA A C     1 
ATOM   8439  O  O     . ALA C 3 1032 ? -25.242 72.595  47.823  1.00 39.93  ? 1032 ALA A O     1 
ATOM   8440  C  CB    . ALA C 3 1032 ? -27.910 71.469  46.161  1.00 38.29  ? 1032 ALA A CB    1 
ATOM   8441  N  N     . GLU C 3 1033 ? -24.845 71.077  46.221  1.00 37.23  ? 1033 GLU A N     1 
ATOM   8442  C  CA    . GLU C 3 1033 ? -23.645 70.574  46.866  1.00 38.80  ? 1033 GLU A CA    1 
ATOM   8443  C  C     . GLU C 3 1033 ? -22.667 71.710  47.128  1.00 37.98  ? 1033 GLU A C     1 
ATOM   8444  O  O     . GLU C 3 1033 ? -22.061 71.775  48.195  1.00 38.04  ? 1033 GLU A O     1 
ATOM   8445  C  CB    . GLU C 3 1033 ? -22.983 69.492  46.006  1.00 42.36  ? 1033 GLU A CB    1 
ATOM   8446  C  CG    . GLU C 3 1033 ? -23.891 68.291  45.699  1.00 47.20  ? 1033 GLU A CG    1 
ATOM   8447  C  CD    . GLU C 3 1033 ? -23.150 67.138  45.016  1.00 51.14  ? 1033 GLU A CD    1 
ATOM   8448  O  OE1   . GLU C 3 1033 ? -22.257 66.534  45.652  1.00 51.94  ? 1033 GLU A OE1   1 
ATOM   8449  O  OE2   . GLU C 3 1033 ? -23.460 66.832  43.842  1.00 52.44  ? 1033 GLU A OE2   1 
ATOM   8450  N  N     . MET C 3 1034 ? -22.516 72.613  46.162  1.00 37.81  ? 1034 MET A N     1 
ATOM   8451  C  CA    . MET C 3 1034 ? -21.605 73.744  46.340  1.00 36.66  ? 1034 MET A CA    1 
ATOM   8452  C  C     . MET C 3 1034 ? -22.073 74.628  47.501  1.00 36.36  ? 1034 MET A C     1 
ATOM   8453  O  O     . MET C 3 1034 ? -21.266 75.096  48.305  1.00 35.71  ? 1034 MET A O     1 
ATOM   8454  C  CB    . MET C 3 1034 ? -21.517 74.595  45.072  1.00 33.81  ? 1034 MET A CB    1 
ATOM   8455  C  CG    . MET C 3 1034 ? -20.695 75.865  45.279  1.00 33.42  ? 1034 MET A CG    1 
ATOM   8456  S  SD    . MET C 3 1034 ? -20.989 77.181  44.081  1.00 32.56  ? 1034 MET A SD    1 
ATOM   8457  C  CE    . MET C 3 1034 ? -22.645 77.666  44.523  1.00 30.49  ? 1034 MET A CE    1 
ATOM   8458  N  N     . ASP C 3 1035 ? -23.378 74.853  47.588  1.00 35.46  ? 1035 ASP A N     1 
ATOM   8459  C  CA    . ASP C 3 1035 ? -23.910 75.680  48.657  1.00 36.93  ? 1035 ASP A CA    1 
ATOM   8460  C  C     . ASP C 3 1035 ? -23.710 75.026  50.017  1.00 37.31  ? 1035 ASP A C     1 
ATOM   8461  O  O     . ASP C 3 1035 ? -23.240 75.663  50.962  1.00 35.58  ? 1035 ASP A O     1 
ATOM   8462  C  CB    . ASP C 3 1035 ? -25.396 75.973  48.426  1.00 35.54  ? 1035 ASP A CB    1 
ATOM   8463  C  CG    . ASP C 3 1035 ? -25.625 76.931  47.278  1.00 36.62  ? 1035 ASP A CG    1 
ATOM   8464  O  OD1   . ASP C 3 1035 ? -24.719 77.734  46.982  1.00 38.05  ? 1035 ASP A OD1   1 
ATOM   8465  O  OD2   . ASP C 3 1035 ? -26.714 76.903  46.677  1.00 38.90  ? 1035 ASP A OD2   1 
ATOM   8466  N  N     . GLU C 3 1036 ? -24.069 73.749  50.103  1.00 38.55  ? 1036 GLU A N     1 
ATOM   8467  C  CA    . GLU C 3 1036 ? -23.935 72.986  51.339  1.00 39.16  ? 1036 GLU A CA    1 
ATOM   8468  C  C     . GLU C 3 1036 ? -22.503 73.102  51.874  1.00 37.53  ? 1036 GLU A C     1 
ATOM   8469  O  O     . GLU C 3 1036 ? -22.294 73.234  53.076  1.00 36.97  ? 1036 GLU A O     1 
ATOM   8470  C  CB    . GLU C 3 1036 ? -24.294 71.516  51.074  1.00 41.27  ? 1036 GLU A CB    1 
ATOM   8471  C  CG    . GLU C 3 1036 ? -24.474 70.656  52.324  1.00 47.02  ? 1036 GLU A CG    1 
ATOM   8472  C  CD    . GLU C 3 1036 ? -25.559 71.187  53.255  1.00 50.27  ? 1036 GLU A CD    1 
ATOM   8473  O  OE1   . GLU C 3 1036 ? -26.653 71.536  52.753  1.00 51.08  ? 1036 GLU A OE1   1 
ATOM   8474  O  OE2   . GLU C 3 1036 ? -25.322 71.248  54.487  1.00 50.71  ? 1036 GLU A OE2   1 
ATOM   8475  N  N     . THR C 3 1037 ? -21.529 73.060  50.968  1.00 36.20  ? 1037 THR A N     1 
ATOM   8476  C  CA    . THR C 3 1037 ? -20.117 73.156  51.324  1.00 35.69  ? 1037 THR A CA    1 
ATOM   8477  C  C     . THR C 3 1037 ? -19.824 74.484  52.008  1.00 37.02  ? 1037 THR A C     1 
ATOM   8478  O  O     . THR C 3 1037 ? -19.200 74.525  53.071  1.00 36.17  ? 1037 THR A O     1 
ATOM   8479  C  CB    . THR C 3 1037 ? -19.232 73.025  50.068  1.00 34.75  ? 1037 THR A CB    1 
ATOM   8480  O  OG1   . THR C 3 1037 ? -19.405 71.723  49.504  1.00 33.08  ? 1037 THR A OG1   1 
ATOM   8481  C  CG2   . THR C 3 1037 ? -17.768 73.229  50.406  1.00 33.19  ? 1037 THR A CG2   1 
ATOM   8482  N  N     . LEU C 3 1038 ? -20.280 75.565  51.386  1.00 39.51  ? 1038 LEU A N     1 
ATOM   8483  C  CA    . LEU C 3 1038 ? -20.103 76.911  51.927  1.00 41.91  ? 1038 LEU A CA    1 
ATOM   8484  C  C     . LEU C 3 1038 ? -20.855 77.045  53.244  1.00 42.41  ? 1038 LEU A C     1 
ATOM   8485  O  O     . LEU C 3 1038 ? -20.381 77.680  54.186  1.00 43.52  ? 1038 LEU A O     1 
ATOM   8486  C  CB    . LEU C 3 1038 ? -20.629 77.954  50.935  1.00 42.10  ? 1038 LEU A CB    1 
ATOM   8487  C  CG    . LEU C 3 1038 ? -19.736 78.266  49.730  1.00 43.88  ? 1038 LEU A CG    1 
ATOM   8488  C  CD1   . LEU C 3 1038 ? -20.521 79.028  48.677  1.00 44.03  ? 1038 LEU A CD1   1 
ATOM   8489  C  CD2   . LEU C 3 1038 ? -18.537 79.078  50.199  1.00 43.17  ? 1038 LEU A CD2   1 
ATOM   8490  N  N     . MET C 3 1039 ? -22.029 76.434  53.308  1.00 43.60  ? 1039 MET A N     1 
ATOM   8491  C  CA    . MET C 3 1039 ? -22.848 76.500  54.506  1.00 45.29  ? 1039 MET A CA    1 
ATOM   8492  C  C     . MET C 3 1039 ? -22.315 75.651  55.653  1.00 44.17  ? 1039 MET A C     1 
ATOM   8493  O  O     . MET C 3 1039 ? -22.572 75.940  56.816  1.00 43.82  ? 1039 MET A O     1 
ATOM   8494  C  CB    . MET C 3 1039 ? -24.260 76.066  54.176  1.00 48.19  ? 1039 MET A CB    1 
ATOM   8495  C  CG    . MET C 3 1039 ? -25.293 76.782  54.983  1.00 55.15  ? 1039 MET A CG    1 
ATOM   8496  S  SD    . MET C 3 1039 ? -26.878 76.427  54.278  1.00 64.35  ? 1039 MET A SD    1 
ATOM   8497  C  CE    . MET C 3 1039 ? -26.639 77.090  52.609  1.00 61.60  ? 1039 MET A CE    1 
ATOM   8498  N  N     . ARG C 3 1040 ? -21.573 74.602  55.322  1.00 43.53  ? 1040 ARG A N     1 
ATOM   8499  C  CA    . ARG C 3 1040 ? -21.021 73.727  56.336  1.00 40.84  ? 1040 ARG A CA    1 
ATOM   8500  C  C     . ARG C 3 1040 ? -19.832 74.424  56.957  1.00 38.92  ? 1040 ARG A C     1 
ATOM   8501  O  O     . ARG C 3 1040 ? -19.593 74.319  58.159  1.00 38.11  ? 1040 ARG A O     1 
ATOM   8502  C  CB    . ARG C 3 1040 ? -20.576 72.412  55.707  1.00 44.15  ? 1040 ARG A CB    1 
ATOM   8503  C  CG    . ARG C 3 1040 ? -20.706 71.199  56.616  1.00 47.39  ? 1040 ARG A CG    1 
ATOM   8504  C  CD    . ARG C 3 1040 ? -20.233 69.967  55.882  1.00 51.30  ? 1040 ARG A CD    1 
ATOM   8505  N  NE    . ARG C 3 1040 ? -20.748 69.956  54.514  1.00 54.40  ? 1040 ARG A NE    1 
ATOM   8506  C  CZ    . ARG C 3 1040 ? -20.194 69.283  53.510  1.00 55.88  ? 1040 ARG A CZ    1 
ATOM   8507  N  NH1   . ARG C 3 1040 ? -19.099 68.556  53.716  1.00 55.89  ? 1040 ARG A NH1   1 
ATOM   8508  N  NH2   . ARG C 3 1040 ? -20.725 69.352  52.295  1.00 56.40  ? 1040 ARG A NH2   1 
ATOM   8509  N  N     . ALA C 3 1041 ? -19.079 75.133  56.127  1.00 36.38  ? 1041 ALA A N     1 
ATOM   8510  C  CA    . ALA C 3 1041 ? -17.919 75.852  56.614  1.00 34.26  ? 1041 ALA A CA    1 
ATOM   8511  C  C     . ALA C 3 1041 ? -18.375 76.969  57.550  1.00 33.60  ? 1041 ALA A C     1 
ATOM   8512  O  O     . ALA C 3 1041 ? -17.688 77.284  58.515  1.00 31.86  ? 1041 ALA A O     1 
ATOM   8513  C  CB    . ALA C 3 1041 ? -17.126 76.426  55.448  1.00 35.42  ? 1041 ALA A CB    1 
ATOM   8514  N  N     . ARG C 3 1042 ? -19.538 77.552  57.265  1.00 33.71  ? 1042 ARG A N     1 
ATOM   8515  C  CA    . ARG C 3 1042 ? -20.079 78.634  58.089  1.00 35.70  ? 1042 ARG A CA    1 
ATOM   8516  C  C     . ARG C 3 1042 ? -20.572 78.137  59.442  1.00 37.72  ? 1042 ARG A C     1 
ATOM   8517  O  O     . ARG C 3 1042 ? -20.559 78.885  60.428  1.00 37.54  ? 1042 ARG A O     1 
ATOM   8518  C  CB    . ARG C 3 1042 ? -21.238 79.349  57.382  1.00 34.26  ? 1042 ARG A CB    1 
ATOM   8519  C  CG    . ARG C 3 1042 ? -21.706 80.588  58.121  1.00 30.25  ? 1042 ARG A CG    1 
ATOM   8520  C  CD    . ARG C 3 1042 ? -22.999 81.167  57.567  1.00 27.71  ? 1042 ARG A CD    1 
ATOM   8521  N  NE    . ARG C 3 1042 ? -23.580 82.100  58.532  1.00 24.15  ? 1042 ARG A NE    1 
ATOM   8522  C  CZ    . ARG C 3 1042 ? -23.334 83.406  58.570  1.00 23.74  ? 1042 ARG A CZ    1 
ATOM   8523  N  NH1   . ARG C 3 1042 ? -22.521 83.973  57.679  1.00 21.06  ? 1042 ARG A NH1   1 
ATOM   8524  N  NH2   . ARG C 3 1042 ? -23.874 84.144  59.532  1.00 19.85  ? 1042 ARG A NH2   1 
ATOM   8525  N  N     . ARG C 3 1043 ? -21.018 76.883  59.483  1.00 39.33  ? 1043 ARG A N     1 
ATOM   8526  C  CA    . ARG C 3 1043 ? -21.508 76.289  60.724  1.00 40.45  ? 1043 ARG A CA    1 
ATOM   8527  C  C     . ARG C 3 1043 ? -20.357 75.846  61.615  1.00 40.43  ? 1043 ARG A C     1 
ATOM   8528  O  O     . ARG C 3 1043 ? -20.361 76.081  62.821  1.00 41.79  ? 1043 ARG A O     1 
ATOM   8529  C  CB    . ARG C 3 1043 ? -22.385 75.067  60.440  1.00 41.73  ? 1043 ARG A CB    1 
ATOM   8530  C  CG    . ARG C 3 1043 ? -23.772 75.361  59.909  1.00 44.85  ? 1043 ARG A CG    1 
ATOM   8531  C  CD    . ARG C 3 1043 ? -24.633 74.114  60.037  1.00 47.64  ? 1043 ARG A CD    1 
ATOM   8532  N  NE    . ARG C 3 1043 ? -24.036 72.972  59.343  1.00 51.74  ? 1043 ARG A NE    1 
ATOM   8533  C  CZ    . ARG C 3 1043 ? -24.289 72.640  58.078  1.00 52.47  ? 1043 ARG A CZ    1 
ATOM   8534  N  NH1   . ARG C 3 1043 ? -25.142 73.358  57.349  1.00 51.91  ? 1043 ARG A NH1   1 
ATOM   8535  N  NH2   . ARG C 3 1043 ? -23.681 71.590  57.540  1.00 52.06  ? 1043 ARG A NH2   1 
ATOM   8536  N  N     . HIS C 3 1044 ? -19.380 75.195  60.999  1.00 40.07  ? 1044 HIS A N     1 
ATOM   8537  C  CA    . HIS C 3 1044 ? -18.212 74.671  61.686  1.00 40.41  ? 1044 HIS A CA    1 
ATOM   8538  C  C     . HIS C 3 1044 ? -17.534 75.769  62.509  1.00 39.86  ? 1044 HIS A C     1 
ATOM   8539  O  O     . HIS C 3 1044 ? -17.653 76.951  62.190  1.00 40.02  ? 1044 HIS A O     1 
ATOM   8540  C  CB    . HIS C 3 1044 ? -17.255 74.099  60.627  1.00 44.37  ? 1044 HIS A CB    1 
ATOM   8541  C  CG    . HIS C 3 1044 ? -16.234 73.140  61.161  1.00 49.20  ? 1044 HIS A CG    1 
ATOM   8542  N  ND1   . HIS C 3 1044 ? -15.062 73.552  61.763  1.00 50.57  ? 1044 HIS A ND1   1 
ATOM   8543  C  CD2   . HIS C 3 1044 ? -16.201 71.785  61.162  1.00 49.74  ? 1044 HIS A CD2   1 
ATOM   8544  C  CE1   . HIS C 3 1044 ? -14.351 72.492  62.109  1.00 50.88  ? 1044 HIS A CE1   1 
ATOM   8545  N  NE2   . HIS C 3 1044 ? -15.020 71.408  61.757  1.00 50.11  ? 1044 HIS A NE2   1 
ATOM   8546  N  N     . SER C 3 1045 ? -16.852 75.381  63.584  1.00 37.49  ? 1045 SER A N     1 
ATOM   8547  C  CA    . SER C 3 1045 ? -16.131 76.339  64.422  1.00 36.54  ? 1045 SER A CA    1 
ATOM   8548  C  C     . SER C 3 1045 ? -14.660 75.937  64.303  1.00 35.24  ? 1045 SER A C     1 
ATOM   8549  O  O     . SER C 3 1045 ? -14.363 74.755  64.170  1.00 36.35  ? 1045 SER A O     1 
ATOM   8550  C  CB    . SER C 3 1045 ? -16.583 76.249  65.880  1.00 36.23  ? 1045 SER A CB    1 
ATOM   8551  O  OG    . SER C 3 1045 ? -15.631 75.542  66.661  1.00 37.47  ? 1045 SER A OG    1 
ATOM   8552  N  N     . TYR C 3 1046 ? -13.745 76.900  64.354  1.00 32.32  ? 1046 TYR A N     1 
ATOM   8553  C  CA    . TYR C 3 1046 ? -12.320 76.597  64.197  1.00 29.94  ? 1046 TYR A CA    1 
ATOM   8554  C  C     . TYR C 3 1046 ? -11.463 76.990  65.396  1.00 29.48  ? 1046 TYR A C     1 
ATOM   8555  O  O     . TYR C 3 1046 ? -11.917 77.676  66.308  1.00 30.14  ? 1046 TYR A O     1 
ATOM   8556  C  CB    . TYR C 3 1046 ? -11.795 77.304  62.944  1.00 29.13  ? 1046 TYR A CB    1 
ATOM   8557  C  CG    . TYR C 3 1046 ? -12.615 77.022  61.702  1.00 26.43  ? 1046 TYR A CG    1 
ATOM   8558  C  CD1   . TYR C 3 1046 ? -12.206 76.061  60.771  1.00 25.37  ? 1046 TYR A CD1   1 
ATOM   8559  C  CD2   . TYR C 3 1046 ? -13.821 77.682  61.482  1.00 26.78  ? 1046 TYR A CD2   1 
ATOM   8560  C  CE1   . TYR C 3 1046 ? -12.976 75.760  59.653  1.00 24.80  ? 1046 TYR A CE1   1 
ATOM   8561  C  CE2   . TYR C 3 1046 ? -14.607 77.391  60.366  1.00 29.68  ? 1046 TYR A CE2   1 
ATOM   8562  C  CZ    . TYR C 3 1046 ? -14.178 76.424  59.456  1.00 28.14  ? 1046 TYR A CZ    1 
ATOM   8563  O  OH    . TYR C 3 1046 ? -14.969 76.113  58.377  1.00 27.69  ? 1046 TYR A OH    1 
ATOM   8564  N  N     . SER C 3 1047 ? -10.209 76.564  65.385  1.00 28.95  ? 1047 SER A N     1 
ATOM   8565  C  CA    . SER C 3 1047 ? -9.308  76.883  66.484  1.00 29.87  ? 1047 SER A CA    1 
ATOM   8566  C  C     . SER C 3 1047 ? -8.003  77.541  66.002  1.00 29.91  ? 1047 SER A C     1 
ATOM   8567  O  O     . SER C 3 1047 ? -7.108  77.828  66.800  1.00 31.29  ? 1047 SER A O     1 
ATOM   8568  C  CB    . SER C 3 1047 ? -8.995  75.613  67.269  1.00 29.04  ? 1047 SER A CB    1 
ATOM   8569  O  OG    . SER C 3 1047 ? -8.326  74.687  66.436  1.00 31.60  ? 1047 SER A OG    1 
ATOM   8570  N  N     . SER C 3 1048 ? -7.897  77.782  64.701  1.00 28.34  ? 1048 SER A N     1 
ATOM   8571  C  CA    . SER C 3 1048 ? -6.709  78.421  64.153  1.00 27.86  ? 1048 SER A CA    1 
ATOM   8572  C  C     . SER C 3 1048 ? -6.870  78.784  62.678  1.00 27.97  ? 1048 SER A C     1 
ATOM   8573  O  O     . SER C 3 1048 ? -7.875  78.458  62.041  1.00 28.14  ? 1048 SER A O     1 
ATOM   8574  C  CB    . SER C 3 1048 ? -5.492  77.503  64.316  1.00 28.10  ? 1048 SER A CB    1 
ATOM   8575  O  OG    . SER C 3 1048 ? -5.540  76.422  63.406  1.00 23.98  ? 1048 SER A OG    1 
ATOM   8576  N  N     . PHE C 3 1049 ? -5.879  79.492  62.151  1.00 27.22  ? 1049 PHE A N     1 
ATOM   8577  C  CA    . PHE C 3 1049 ? -5.867  79.871  60.749  1.00 25.99  ? 1049 PHE A CA    1 
ATOM   8578  C  C     . PHE C 3 1049 ? -5.079  78.758  60.055  1.00 26.69  ? 1049 PHE A C     1 
ATOM   8579  O  O     . PHE C 3 1049 ? -4.873  77.688  60.629  1.00 26.18  ? 1049 PHE A O     1 
ATOM   8580  C  CB    . PHE C 3 1049 ? -5.134  81.197  60.573  1.00 25.97  ? 1049 PHE A CB    1 
ATOM   8581  C  CG    . PHE C 3 1049 ? -5.884  82.395  61.097  1.00 26.66  ? 1049 PHE A CG    1 
ATOM   8582  C  CD1   . PHE C 3 1049 ? -7.035  82.842  60.464  1.00 25.39  ? 1049 PHE A CD1   1 
ATOM   8583  C  CD2   . PHE C 3 1049 ? -5.407  83.102  62.200  1.00 25.46  ? 1049 PHE A CD2   1 
ATOM   8584  C  CE1   . PHE C 3 1049 ? -7.695  83.973  60.915  1.00 26.64  ? 1049 PHE A CE1   1 
ATOM   8585  C  CE2   . PHE C 3 1049 ? -6.063  84.233  62.659  1.00 25.55  ? 1049 PHE A CE2   1 
ATOM   8586  C  CZ    . PHE C 3 1049 ? -7.206  84.673  62.017  1.00 27.71  ? 1049 PHE A CZ    1 
ATOM   8587  N  N     . SER C 3 1050 ? -4.634  79.008  58.829  1.00 27.37  ? 1050 SER A N     1 
ATOM   8588  C  CA    . SER C 3 1050 ? -3.846  78.027  58.089  1.00 28.68  ? 1050 SER A CA    1 
ATOM   8589  C  C     . SER C 3 1050 ? -2.484  77.843  58.769  1.00 30.97  ? 1050 SER A C     1 
ATOM   8590  O  O     . SER C 3 1050 ? -2.037  78.702  59.534  1.00 31.16  ? 1050 SER A O     1 
ATOM   8591  C  CB    . SER C 3 1050 ? -3.627  78.504  56.653  1.00 27.87  ? 1050 SER A CB    1 
ATOM   8592  O  OG    . SER C 3 1050 ? -2.780  79.644  56.617  1.00 28.97  ? 1050 SER A OG    1 
ATOM   8593  N  N     . LYS C 3 1051 ? -1.818  76.730  58.487  1.00 31.69  ? 1051 LYS A N     1 
ATOM   8594  C  CA    . LYS C 3 1051 ? -0.510  76.484  59.082  1.00 32.13  ? 1051 LYS A CA    1 
ATOM   8595  C  C     . LYS C 3 1051 ? 0.498   77.572  58.722  1.00 30.45  ? 1051 LYS A C     1 
ATOM   8596  O  O     . LYS C 3 1051 ? 1.392   77.881  59.503  1.00 32.21  ? 1051 LYS A O     1 
ATOM   8597  C  CB    . LYS C 3 1051 ? 0.025   75.111  58.648  1.00 34.29  ? 1051 LYS A CB    1 
ATOM   8598  C  CG    . LYS C 3 1051 ? -0.668  73.938  59.338  1.00 35.68  ? 1051 LYS A CG    1 
ATOM   8599  C  CD    . LYS C 3 1051 ? -0.164  72.589  58.841  1.00 38.61  ? 1051 LYS A CD    1 
ATOM   8600  C  CE    . LYS C 3 1051 ? -0.785  71.456  59.662  1.00 38.94  ? 1051 LYS A CE    1 
ATOM   8601  N  NZ    . LYS C 3 1051 ? -0.415  70.093  59.187  1.00 38.22  ? 1051 LYS A NZ    1 
ATOM   8602  N  N     . LEU C 3 1052 ? 0.353   78.157  57.541  1.00 29.64  ? 1052 LEU A N     1 
ATOM   8603  C  CA    . LEU C 3 1052 ? 1.264   79.206  57.092  1.00 27.45  ? 1052 LEU A CA    1 
ATOM   8604  C  C     . LEU C 3 1052 ? 0.971   80.537  57.786  1.00 26.95  ? 1052 LEU A C     1 
ATOM   8605  O  O     . LEU C 3 1052 ? 1.897   81.251  58.177  1.00 26.89  ? 1052 LEU A O     1 
ATOM   8606  C  CB    . LEU C 3 1052 ? 1.177   79.351  55.566  1.00 26.79  ? 1052 LEU A CB    1 
ATOM   8607  C  CG    . LEU C 3 1052 ? 2.365   78.871  54.709  1.00 25.03  ? 1052 LEU A CG    1 
ATOM   8608  C  CD1   . LEU C 3 1052 ? 3.122   77.798  55.413  1.00 25.49  ? 1052 LEU A CD1   1 
ATOM   8609  C  CD2   . LEU C 3 1052 ? 1.874   78.383  53.359  1.00 21.33  ? 1052 LEU A CD2   1 
ATOM   8610  N  N     . LEU C 3 1053 ? -0.308  80.870  57.953  1.00 25.71  ? 1053 LEU A N     1 
ATOM   8611  C  CA    . LEU C 3 1053 ? -0.673  82.115  58.630  1.00 24.21  ? 1053 LEU A CA    1 
ATOM   8612  C  C     . LEU C 3 1053 ? -0.312  82.076  60.129  1.00 25.07  ? 1053 LEU A C     1 
ATOM   8613  O  O     . LEU C 3 1053 ? 0.073   83.097  60.710  1.00 25.27  ? 1053 LEU A O     1 
ATOM   8614  C  CB    . LEU C 3 1053 ? -2.168  82.415  58.458  1.00 21.70  ? 1053 LEU A CB    1 
ATOM   8615  C  CG    . LEU C 3 1053 ? -2.646  83.692  59.178  1.00 23.40  ? 1053 LEU A CG    1 
ATOM   8616  C  CD1   . LEU C 3 1053 ? -1.720  84.881  58.841  1.00 23.44  ? 1053 LEU A CD1   1 
ATOM   8617  C  CD2   . LEU C 3 1053 ? -4.076  84.003  58.791  1.00 21.00  ? 1053 LEU A CD2   1 
ATOM   8618  N  N     . GLU C 3 1054 ? -0.436  80.912  60.760  1.00 25.19  ? 1054 GLU A N     1 
ATOM   8619  C  CA    . GLU C 3 1054 ? -0.077  80.813  62.169  1.00 27.59  ? 1054 GLU A CA    1 
ATOM   8620  C  C     . GLU C 3 1054 ? 1.440   80.973  62.292  1.00 28.24  ? 1054 GLU A C     1 
ATOM   8621  O  O     . GLU C 3 1054 ? 1.945   81.501  63.284  1.00 30.05  ? 1054 GLU A O     1 
ATOM   8622  C  CB    . GLU C 3 1054 ? -0.517  79.471  62.766  1.00 26.03  ? 1054 GLU A CB    1 
ATOM   8623  C  CG    . GLU C 3 1054 ? -2.026  79.282  62.885  1.00 26.49  ? 1054 GLU A CG    1 
ATOM   8624  C  CD    . GLU C 3 1054 ? -2.703  80.267  63.831  1.00 28.91  ? 1054 GLU A CD    1 
ATOM   8625  O  OE1   . GLU C 3 1054 ? -2.007  80.849  64.697  1.00 30.37  ? 1054 GLU A OE1   1 
ATOM   8626  O  OE2   . GLU C 3 1054 ? -3.944  80.444  63.718  1.00 27.14  ? 1054 GLU A OE2   1 
ATOM   8627  N  N     . ALA C 3 1055 ? 2.169   80.530  61.275  1.00 28.20  ? 1055 ALA A N     1 
ATOM   8628  C  CA    . ALA C 3 1055 ? 3.618   80.668  61.296  1.00 26.93  ? 1055 ALA A CA    1 
ATOM   8629  C  C     . ALA C 3 1055 ? 4.056   82.130  61.084  1.00 26.95  ? 1055 ALA A C     1 
ATOM   8630  O  O     . ALA C 3 1055 ? 4.987   82.597  61.744  1.00 26.09  ? 1055 ALA A O     1 
ATOM   8631  C  CB    . ALA C 3 1055 ? 4.240   79.773  60.241  1.00 26.96  ? 1055 ALA A CB    1 
ATOM   8632  N  N     . TYR C 3 1056 ? 3.394   82.859  60.183  1.00 27.02  ? 1056 TYR A N     1 
ATOM   8633  C  CA    . TYR C 3 1056 ? 3.774   84.258  59.949  1.00 27.84  ? 1056 TYR A CA    1 
ATOM   8634  C  C     . TYR C 3 1056 ? 3.500   85.112  61.181  1.00 27.93  ? 1056 TYR A C     1 
ATOM   8635  O  O     . TYR C 3 1056 ? 4.260   86.034  61.488  1.00 27.96  ? 1056 TYR A O     1 
ATOM   8636  C  CB    . TYR C 3 1056 ? 3.011   84.888  58.775  1.00 26.61  ? 1056 TYR A CB    1 
ATOM   8637  C  CG    . TYR C 3 1056 ? 3.068   84.156  57.456  1.00 26.40  ? 1056 TYR A CG    1 
ATOM   8638  C  CD1   . TYR C 3 1056 ? 4.231   83.508  57.028  1.00 26.50  ? 1056 TYR A CD1   1 
ATOM   8639  C  CD2   . TYR C 3 1056 ? 1.962   84.144  56.615  1.00 26.33  ? 1056 TYR A CD2   1 
ATOM   8640  C  CE1   . TYR C 3 1056 ? 4.283   82.863  55.791  1.00 24.77  ? 1056 TYR A CE1   1 
ATOM   8641  C  CE2   . TYR C 3 1056 ? 2.005   83.515  55.384  1.00 27.29  ? 1056 TYR A CE2   1 
ATOM   8642  C  CZ    . TYR C 3 1056 ? 3.164   82.875  54.975  1.00 27.28  ? 1056 TYR A CZ    1 
ATOM   8643  O  OH    . TYR C 3 1056 ? 3.178   82.257  53.744  1.00 28.91  ? 1056 TYR A OH    1 
ATOM   8644  N  N     . LEU C 3 1057 ? 2.405   84.806  61.874  1.00 27.76  ? 1057 LEU A N     1 
ATOM   8645  C  CA    . LEU C 3 1057 ? 2.007   85.549  63.067  1.00 27.77  ? 1057 LEU A CA    1 
ATOM   8646  C  C     . LEU C 3 1057 ? 3.012   85.516  64.212  1.00 27.84  ? 1057 LEU A C     1 
ATOM   8647  O  O     . LEU C 3 1057 ? 2.942   86.345  65.119  1.00 28.85  ? 1057 LEU A O     1 
ATOM   8648  C  CB    . LEU C 3 1057 ? 0.651   85.048  63.559  1.00 28.17  ? 1057 LEU A CB    1 
ATOM   8649  C  CG    . LEU C 3 1057 ? -0.513  85.443  62.657  1.00 27.29  ? 1057 LEU A CG    1 
ATOM   8650  C  CD1   . LEU C 3 1057 ? -1.777  84.744  63.107  1.00 27.47  ? 1057 LEU A CD1   1 
ATOM   8651  C  CD2   . LEU C 3 1057 ? -0.683  86.955  62.697  1.00 27.60  ? 1057 LEU A CD2   1 
ATOM   8652  N  N     . LEU C 3 1058 ? 3.934   84.559  64.178  1.00 27.63  ? 1058 LEU A N     1 
ATOM   8653  C  CA    . LEU C 3 1058 ? 4.967   84.453  65.211  1.00 27.67  ? 1058 LEU A CA    1 
ATOM   8654  C  C     . LEU C 3 1058 ? 6.010   85.556  65.022  1.00 26.75  ? 1058 LEU A C     1 
ATOM   8655  O  O     . LEU C 3 1058 ? 6.798   85.836  65.923  1.00 26.78  ? 1058 LEU A O     1 
ATOM   8656  C  CB    . LEU C 3 1058 ? 5.681   83.090  65.134  1.00 27.12  ? 1058 LEU A CB    1 
ATOM   8657  C  CG    . LEU C 3 1058 ? 4.876   81.791  65.269  1.00 26.86  ? 1058 LEU A CG    1 
ATOM   8658  C  CD1   . LEU C 3 1058 ? 5.832   80.623  65.150  1.00 25.22  ? 1058 LEU A CD1   1 
ATOM   8659  C  CD2   . LEU C 3 1058 ? 4.139   81.735  66.598  1.00 23.06  ? 1058 LEU A CD2   1 
ATOM   8660  N  N     . VAL C 3 1059 ? 6.003   86.168  63.839  1.00 26.05  ? 1059 VAL A N     1 
ATOM   8661  C  CA    . VAL C 3 1059 ? 6.947   87.228  63.473  1.00 25.28  ? 1059 VAL A CA    1 
ATOM   8662  C  C     . VAL C 3 1059 ? 6.413   88.632  63.736  1.00 24.41  ? 1059 VAL A C     1 
ATOM   8663  O  O     . VAL C 3 1059 ? 5.350   88.989  63.241  1.00 23.15  ? 1059 VAL A O     1 
ATOM   8664  C  CB    . VAL C 3 1059 ? 7.304   87.147  61.962  1.00 25.58  ? 1059 VAL A CB    1 
ATOM   8665  C  CG1   . VAL C 3 1059 ? 8.363   88.184  61.611  1.00 19.72  ? 1059 VAL A CG1   1 
ATOM   8666  C  CG2   . VAL C 3 1059 ? 7.764   85.733  61.613  1.00 25.52  ? 1059 VAL A CG2   1 
ATOM   8667  N  N     . LYS C 3 1060 ? 7.172   89.423  64.493  1.00 25.69  ? 1060 LYS A N     1 
ATOM   8668  C  CA    . LYS C 3 1060 ? 6.797   90.803  64.821  1.00 27.73  ? 1060 LYS A CA    1 
ATOM   8669  C  C     . LYS C 3 1060 ? 7.814   91.812  64.269  1.00 26.56  ? 1060 LYS A C     1 
ATOM   8670  O  O     . LYS C 3 1060 ? 8.989   91.503  64.095  1.00 27.09  ? 1060 LYS A O     1 
ATOM   8671  C  CB    . LYS C 3 1060 ? 6.675   90.993  66.343  1.00 30.16  ? 1060 LYS A CB    1 
ATOM   8672  C  CG    . LYS C 3 1060 ? 5.735   90.023  67.063  1.00 33.97  ? 1060 LYS A CG    1 
ATOM   8673  C  CD    . LYS C 3 1060 ? 6.502   88.824  67.632  1.00 36.79  ? 1060 LYS A CD    1 
ATOM   8674  C  CE    . LYS C 3 1060 ? 5.672   88.043  68.648  1.00 38.89  ? 1060 LYS A CE    1 
ATOM   8675  N  NZ    . LYS C 3 1060 ? 6.503   87.077  69.451  1.00 40.03  ? 1060 LYS A NZ    1 
ATOM   8676  N  N     . TRP C 3 1061 ? 7.356   93.031  64.018  1.00 26.73  ? 1061 TRP A N     1 
ATOM   8677  C  CA    . TRP C 3 1061 ? 8.214   94.072  63.460  1.00 26.15  ? 1061 TRP A CA    1 
ATOM   8678  C  C     . TRP C 3 1061 ? 8.069   95.396  64.187  1.00 27.53  ? 1061 TRP A C     1 
ATOM   8679  O  O     . TRP C 3 1061 ? 7.267   95.547  65.106  1.00 27.46  ? 1061 TRP A O     1 
ATOM   8680  C  CB    . TRP C 3 1061 ? 7.864   94.331  61.986  1.00 23.18  ? 1061 TRP A CB    1 
ATOM   8681  C  CG    . TRP C 3 1061 ? 7.872   93.131  61.120  1.00 22.35  ? 1061 TRP A CG    1 
ATOM   8682  C  CD1   . TRP C 3 1061 ? 6.930   92.144  61.080  1.00 21.36  ? 1061 TRP A CD1   1 
ATOM   8683  C  CD2   . TRP C 3 1061 ? 8.904   92.745  60.199  1.00 20.57  ? 1061 TRP A CD2   1 
ATOM   8684  N  NE1   . TRP C 3 1061 ? 7.316   91.162  60.191  1.00 22.61  ? 1061 TRP A NE1   1 
ATOM   8685  C  CE2   . TRP C 3 1061 ? 8.524   91.507  59.640  1.00 20.73  ? 1061 TRP A CE2   1 
ATOM   8686  C  CE3   . TRP C 3 1061 ? 10.113  93.322  59.800  1.00 21.72  ? 1061 TRP A CE3   1 
ATOM   8687  C  CZ2   . TRP C 3 1061 ? 9.315   90.833  58.701  1.00 21.78  ? 1061 TRP A CZ2   1 
ATOM   8688  C  CZ3   . TRP C 3 1061 ? 10.905  92.650  58.864  1.00 22.68  ? 1061 TRP A CZ3   1 
ATOM   8689  C  CH2   . TRP C 3 1061 ? 10.500  91.418  58.327  1.00 22.45  ? 1061 TRP A CH2   1 
ATOM   8690  N  N     . ARG C 3 1062 ? 8.877   96.352  63.755  1.00 29.49  ? 1062 ARG A N     1 
ATOM   8691  C  CA    . ARG C 3 1062 ? 8.834   97.705  64.274  1.00 30.89  ? 1062 ARG A CA    1 
ATOM   8692  C  C     . ARG C 3 1062 ? 8.845   98.595  63.041  1.00 29.78  ? 1062 ARG A C     1 
ATOM   8693  O  O     . ARG C 3 1062 ? 9.791   98.562  62.251  1.00 25.98  ? 1062 ARG A O     1 
ATOM   8694  C  CB    . ARG C 3 1062 ? 10.054  98.022  65.135  1.00 34.55  ? 1062 ARG A CB    1 
ATOM   8695  C  CG    . ARG C 3 1062 ? 10.094  97.323  66.471  1.00 36.68  ? 1062 ARG A CG    1 
ATOM   8696  C  CD    . ARG C 3 1062 ? 11.305  97.810  67.239  1.00 39.04  ? 1062 ARG A CD    1 
ATOM   8697  N  NE    . ARG C 3 1062 ? 11.233  99.247  67.474  1.00 40.59  ? 1062 ARG A NE    1 
ATOM   8698  C  CZ    . ARG C 3 1062 ? 12.190  99.953  68.061  1.00 41.59  ? 1062 ARG A CZ    1 
ATOM   8699  N  NH1   . ARG C 3 1062 ? 13.303  99.348  68.468  1.00 42.91  ? 1062 ARG A NH1   1 
ATOM   8700  N  NH2   . ARG C 3 1062 ? 12.026  101.255 68.255  1.00 39.12  ? 1062 ARG A NH2   1 
ATOM   8701  N  N     . MET C 3 1063 ? 7.769   99.356  62.874  1.00 30.18  ? 1063 MET A N     1 
ATOM   8702  C  CA    . MET C 3 1063 ? 7.621   100.276 61.757  1.00 30.59  ? 1063 MET A CA    1 
ATOM   8703  C  C     . MET C 3 1063 ? 8.376   101.533 62.173  1.00 31.01  ? 1063 MET A C     1 
ATOM   8704  O  O     . MET C 3 1063 ? 8.206   102.029 63.287  1.00 29.23  ? 1063 MET A O     1 
ATOM   8705  C  CB    . MET C 3 1063 ? 6.134   100.578 61.527  1.00 30.75  ? 1063 MET A CB    1 
ATOM   8706  C  CG    . MET C 3 1063 ? 5.681   100.335 60.099  1.00 36.72  ? 1063 MET A CG    1 
ATOM   8707  S  SD    . MET C 3 1063 ? 4.221   99.287  59.988  1.00 39.01  ? 1063 MET A SD    1 
ATOM   8708  C  CE    . MET C 3 1063 ? 4.707   97.974  61.048  1.00 39.80  ? 1063 MET A CE    1 
ATOM   8709  N  N     . CYS C 3 1064 ? 9.212   102.057 61.290  1.00 31.35  ? 1064 CYS A N     1 
ATOM   8710  C  CA    . CYS C 3 1064 ? 9.985   103.220 61.669  1.00 33.55  ? 1064 CYS A CA    1 
ATOM   8711  C  C     . CYS C 3 1064 ? 9.865   104.446 60.777  1.00 33.65  ? 1064 CYS A C     1 
ATOM   8712  O  O     . CYS C 3 1064 ? 8.777   104.803 60.343  1.00 33.03  ? 1064 CYS A O     1 
ATOM   8713  C  CB    . CYS C 3 1064 ? 11.452  102.810 61.836  1.00 33.24  ? 1064 CYS A CB    1 
ATOM   8714  S  SG    . CYS C 3 1064 ? 11.700  101.625 63.184  1.00 39.26  ? 1064 CYS A SG    1 
ATOM   8715  N  N     . GLU C 3 1065 ? 10.998  105.088 60.523  1.00 35.94  ? 1065 GLU A N     1 
ATOM   8716  C  CA    . GLU C 3 1065 ? 11.057  106.308 59.726  1.00 38.61  ? 1065 GLU A CA    1 
ATOM   8717  C  C     . GLU C 3 1065 ? 10.476  106.179 58.321  1.00 38.56  ? 1065 GLU A C     1 
ATOM   8718  O  O     . GLU C 3 1065 ? 10.719  105.196 57.616  1.00 39.32  ? 1065 GLU A O     1 
ATOM   8719  C  CB    . GLU C 3 1065 ? 12.509  106.801 59.608  1.00 40.36  ? 1065 GLU A CB    1 
ATOM   8720  C  CG    . GLU C 3 1065 ? 13.449  106.432 60.771  1.00 45.13  ? 1065 GLU A CG    1 
ATOM   8721  C  CD    . GLU C 3 1065 ? 13.852  104.950 60.783  1.00 45.95  ? 1065 GLU A CD    1 
ATOM   8722  O  OE1   . GLU C 3 1065 ? 14.214  104.398 59.715  1.00 45.33  ? 1065 GLU A OE1   1 
ATOM   8723  O  OE2   . GLU C 3 1065 ? 13.820  104.340 61.873  1.00 48.09  ? 1065 GLU A OE2   1 
ATOM   8724  N  N     . ALA C 3 1066 ? 9.709   107.186 57.917  1.00 37.52  ? 1066 ALA A N     1 
ATOM   8725  C  CA    . ALA C 3 1066 ? 9.130   107.200 56.583  1.00 36.80  ? 1066 ALA A CA    1 
ATOM   8726  C  C     . ALA C 3 1066 ? 10.296  107.233 55.597  1.00 35.51  ? 1066 ALA A C     1 
ATOM   8727  O  O     . ALA C 3 1066 ? 11.335  107.840 55.876  1.00 34.54  ? 1066 ALA A O     1 
ATOM   8728  C  CB    . ALA C 3 1066 ? 8.254   108.436 56.401  1.00 33.98  ? 1066 ALA A CB    1 
ATOM   8729  N  N     . ARG C 3 1067 ? 10.135  106.569 54.460  1.00 34.45  ? 1067 ARG A N     1 
ATOM   8730  C  CA    . ARG C 3 1067 ? 11.181  106.555 53.451  1.00 34.58  ? 1067 ARG A CA    1 
ATOM   8731  C  C     . ARG C 3 1067 ? 11.269  107.930 52.789  1.00 35.53  ? 1067 ARG A C     1 
ATOM   8732  O  O     . ARG C 3 1067 ? 10.336  108.723 52.851  1.00 34.44  ? 1067 ARG A O     1 
ATOM   8733  C  CB    . ARG C 3 1067 ? 10.880  105.515 52.372  1.00 32.56  ? 1067 ARG A CB    1 
ATOM   8734  C  CG    . ARG C 3 1067 ? 10.895  104.079 52.832  1.00 31.29  ? 1067 ARG A CG    1 
ATOM   8735  C  CD    . ARG C 3 1067 ? 10.563  103.137 51.677  1.00 27.93  ? 1067 ARG A CD    1 
ATOM   8736  N  NE    . ARG C 3 1067 ? 11.381  103.405 50.499  1.00 28.80  ? 1067 ARG A NE    1 
ATOM   8737  C  CZ    . ARG C 3 1067 ? 11.423  102.619 49.425  1.00 30.65  ? 1067 ARG A CZ    1 
ATOM   8738  N  NH1   . ARG C 3 1067 ? 10.687  101.512 49.384  1.00 31.80  ? 1067 ARG A NH1   1 
ATOM   8739  N  NH2   . ARG C 3 1067 ? 12.210  102.927 48.399  1.00 26.54  ? 1067 ARG A NH2   1 
ATOM   8740  N  N     . GLU C 3 1068 ? 12.401  108.212 52.163  1.00 36.99  ? 1068 GLU A N     1 
ATOM   8741  C  CA    . GLU C 3 1068 ? 12.561  109.471 51.458  1.00 38.48  ? 1068 GLU A CA    1 
ATOM   8742  C  C     . GLU C 3 1068 ? 11.921  109.262 50.098  1.00 38.16  ? 1068 GLU A C     1 
ATOM   8743  O  O     . GLU C 3 1068 ? 11.726  108.124 49.663  1.00 39.85  ? 1068 GLU A O     1 
ATOM   8744  C  CB    . GLU C 3 1068 ? 14.039  109.800 51.281  1.00 40.88  ? 1068 GLU A CB    1 
ATOM   8745  C  CG    . GLU C 3 1068 ? 14.682  110.368 52.516  1.00 43.90  ? 1068 GLU A CG    1 
ATOM   8746  C  CD    . GLU C 3 1068 ? 14.060  111.687 52.913  1.00 46.98  ? 1068 GLU A CD    1 
ATOM   8747  O  OE1   . GLU C 3 1068 ? 14.020  112.601 52.051  1.00 47.83  ? 1068 GLU A OE1   1 
ATOM   8748  O  OE2   . GLU C 3 1068 ? 13.617  111.807 54.079  1.00 48.23  ? 1068 GLU A OE2   1 
ATOM   8749  N  N     . PRO C 3 1069 ? 11.575  110.353 49.408  1.00 36.63  ? 1069 PRO A N     1 
ATOM   8750  C  CA    . PRO C 3 1069 ? 10.953  110.249 48.084  1.00 36.17  ? 1069 PRO A CA    1 
ATOM   8751  C  C     . PRO C 3 1069 ? 11.836  109.512 47.069  1.00 35.76  ? 1069 PRO A C     1 
ATOM   8752  O  O     . PRO C 3 1069 ? 13.043  109.743 47.001  1.00 35.05  ? 1069 PRO A O     1 
ATOM   8753  C  CB    . PRO C 3 1069 ? 10.731  111.710 47.695  1.00 36.39  ? 1069 PRO A CB    1 
ATOM   8754  C  CG    . PRO C 3 1069 ? 10.526  112.383 49.022  1.00 35.71  ? 1069 PRO A CG    1 
ATOM   8755  C  CD    . PRO C 3 1069 ? 11.601  111.749 49.871  1.00 35.47  ? 1069 PRO A CD    1 
ATOM   8756  N  N     . SER C 3 1070 ? 11.225  108.626 46.286  1.00 35.59  ? 1070 SER A N     1 
ATOM   8757  C  CA    . SER C 3 1070 ? 11.944  107.872 45.268  1.00 33.87  ? 1070 SER A CA    1 
ATOM   8758  C  C     . SER C 3 1070 ? 11.813  108.614 43.948  1.00 32.64  ? 1070 SER A C     1 
ATOM   8759  O  O     . SER C 3 1070 ? 12.574  108.378 43.011  1.00 32.71  ? 1070 SER A O     1 
ATOM   8760  C  CB    . SER C 3 1070 ? 11.367  106.464 45.146  1.00 35.97  ? 1070 SER A CB    1 
ATOM   8761  O  OG    . SER C 3 1070 ? 11.448  105.788 46.390  1.00 39.39  ? 1070 SER A OG    1 
ATOM   8762  N  N     . VAL C 3 1071 ? 10.826  109.502 43.882  1.00 31.12  ? 1071 VAL A N     1 
ATOM   8763  C  CA    . VAL C 3 1071 ? 10.595  110.334 42.708  1.00 30.17  ? 1071 VAL A CA    1 
ATOM   8764  C  C     . VAL C 3 1071 ? 10.051  111.677 43.187  1.00 31.07  ? 1071 VAL A C     1 
ATOM   8765  O  O     . VAL C 3 1071 ? 9.481   111.783 44.282  1.00 29.63  ? 1071 VAL A O     1 
ATOM   8766  C  CB    . VAL C 3 1071 ? 9.577   109.711 41.709  1.00 31.45  ? 1071 VAL A CB    1 
ATOM   8767  C  CG1   . VAL C 3 1071 ? 10.096  108.386 41.183  1.00 29.48  ? 1071 VAL A CG1   1 
ATOM   8768  C  CG2   . VAL C 3 1071 ? 8.217   109.537 42.376  1.00 32.61  ? 1071 VAL A CG2   1 
ATOM   8769  N  N     . ASP C 3 1072 ? 10.230  112.698 42.355  1.00 30.62  ? 1072 ASP A N     1 
ATOM   8770  C  CA    . ASP C 3 1072 ? 9.788   114.048 42.661  1.00 29.71  ? 1072 ASP A CA    1 
ATOM   8771  C  C     . ASP C 3 1072 ? 8.276   114.182 42.870  1.00 30.33  ? 1072 ASP A C     1 
ATOM   8772  O  O     . ASP C 3 1072 ? 7.485   113.767 42.023  1.00 30.05  ? 1072 ASP A O     1 
ATOM   8773  C  CB    . ASP C 3 1072 ? 10.239  114.984 41.549  1.00 29.02  ? 1072 ASP A CB    1 
ATOM   8774  C  CG    . ASP C 3 1072 ? 10.091  116.428 41.929  1.00 29.92  ? 1072 ASP A CG    1 
ATOM   8775  O  OD1   . ASP C 3 1072 ? 8.949   116.837 42.219  1.00 26.59  ? 1072 ASP A OD1   1 
ATOM   8776  O  OD2   . ASP C 3 1072 ? 11.119  117.144 41.948  1.00 31.73  ? 1072 ASP A OD2   1 
ATOM   8777  N  N     . LEU C 3 1073 ? 7.893   114.788 43.994  1.00 31.15  ? 1073 LEU A N     1 
ATOM   8778  C  CA    . LEU C 3 1073 ? 6.491   114.981 44.363  1.00 31.65  ? 1073 LEU A CA    1 
ATOM   8779  C  C     . LEU C 3 1073 ? 5.661   115.958 43.525  1.00 32.85  ? 1073 LEU A C     1 
ATOM   8780  O  O     . LEU C 3 1073 ? 4.467   116.137 43.803  1.00 32.82  ? 1073 LEU A O     1 
ATOM   8781  C  CB    . LEU C 3 1073 ? 6.385   115.405 45.827  1.00 34.67  ? 1073 LEU A CB    1 
ATOM   8782  C  CG    . LEU C 3 1073 ? 6.699   114.366 46.901  1.00 38.28  ? 1073 LEU A CG    1 
ATOM   8783  C  CD1   . LEU C 3 1073 ? 8.204   114.139 47.001  1.00 39.56  ? 1073 LEU A CD1   1 
ATOM   8784  C  CD2   . LEU C 3 1073 ? 6.145   114.855 48.226  1.00 38.93  ? 1073 LEU A CD2   1 
ATOM   8785  N  N     . ARG C 3 1074 ? 6.275   116.601 42.531  1.00 31.13  ? 1074 ARG A N     1 
ATOM   8786  C  CA    . ARG C 3 1074 ? 5.553   117.532 41.656  1.00 30.48  ? 1074 ARG A CA    1 
ATOM   8787  C  C     . ARG C 3 1074 ? 5.350   116.825 40.321  1.00 30.92  ? 1074 ARG A C     1 
ATOM   8788  O  O     . ARG C 3 1074 ? 4.833   117.407 39.362  1.00 31.59  ? 1074 ARG A O     1 
ATOM   8789  C  CB    . ARG C 3 1074 ? 6.364   118.812 41.394  1.00 31.52  ? 1074 ARG A CB    1 
ATOM   8790  C  CG    . ARG C 3 1074 ? 6.875   119.539 42.626  1.00 32.25  ? 1074 ARG A CG    1 
ATOM   8791  C  CD    . ARG C 3 1074 ? 8.392   119.576 42.613  1.00 33.24  ? 1074 ARG A CD    1 
ATOM   8792  N  NE    . ARG C 3 1074 ? 8.911   120.592 41.705  1.00 34.75  ? 1074 ARG A NE    1 
ATOM   8793  C  CZ    . ARG C 3 1074 ? 10.150  120.613 41.220  1.00 34.31  ? 1074 ARG A CZ    1 
ATOM   8794  N  NH1   . ARG C 3 1074 ? 11.024  119.663 41.533  1.00 31.33  ? 1074 ARG A NH1   1 
ATOM   8795  N  NH2   . ARG C 3 1074 ? 10.530  121.616 40.445  1.00 35.84  ? 1074 ARG A NH2   1 
ATOM   8796  N  N     . LEU C 3 1075 ? 5.752   115.560 40.276  1.00 29.51  ? 1075 LEU A N     1 
ATOM   8797  C  CA    . LEU C 3 1075 ? 5.698   114.759 39.062  1.00 28.13  ? 1075 LEU A CA    1 
ATOM   8798  C  C     . LEU C 3 1075 ? 4.431   113.950 38.801  1.00 28.35  ? 1075 LEU A C     1 
ATOM   8799  O  O     . LEU C 3 1075 ? 4.131   113.007 39.523  1.00 29.52  ? 1075 LEU A O     1 
ATOM   8800  C  CB    . LEU C 3 1075 ? 6.888   113.821 39.072  1.00 28.36  ? 1075 LEU A CB    1 
ATOM   8801  C  CG    . LEU C 3 1075 ? 7.349   113.256 37.750  1.00 28.94  ? 1075 LEU A CG    1 
ATOM   8802  C  CD1   . LEU C 3 1075 ? 7.654   114.388 36.780  1.00 28.98  ? 1075 LEU A CD1   1 
ATOM   8803  C  CD2   . LEU C 3 1075 ? 8.584   112.424 38.008  1.00 31.15  ? 1075 LEU A CD2   1 
ATOM   8804  N  N     . PRO C 3 1076 ? 3.674   114.306 37.754  1.00 27.75  ? 1076 PRO A N     1 
ATOM   8805  C  CA    . PRO C 3 1076 ? 2.441   113.583 37.416  1.00 28.00  ? 1076 PRO A CA    1 
ATOM   8806  C  C     . PRO C 3 1076 ? 2.778   112.213 36.799  1.00 28.45  ? 1076 PRO A C     1 
ATOM   8807  O  O     . PRO C 3 1076 ? 3.211   112.133 35.653  1.00 30.35  ? 1076 PRO A O     1 
ATOM   8808  C  CB    . PRO C 3 1076 ? 1.763   114.501 36.393  1.00 27.52  ? 1076 PRO A CB    1 
ATOM   8809  C  CG    . PRO C 3 1076 ? 2.426   115.852 36.606  1.00 26.38  ? 1076 PRO A CG    1 
ATOM   8810  C  CD    . PRO C 3 1076 ? 3.841   115.490 36.897  1.00 26.03  ? 1076 PRO A CD    1 
ATOM   8811  N  N     . LEU C 3 1077 ? 2.590   111.137 37.551  1.00 29.70  ? 1077 LEU A N     1 
ATOM   8812  C  CA    . LEU C 3 1077 ? 2.888   109.803 37.029  1.00 29.42  ? 1077 LEU A CA    1 
ATOM   8813  C  C     . LEU C 3 1077 ? 1.664   109.064 36.504  1.00 27.90  ? 1077 LEU A C     1 
ATOM   8814  O  O     . LEU C 3 1077 ? 1.737   108.356 35.499  1.00 25.84  ? 1077 LEU A O     1 
ATOM   8815  C  CB    . LEU C 3 1077 ? 3.580   108.946 38.092  1.00 28.77  ? 1077 LEU A CB    1 
ATOM   8816  C  CG    . LEU C 3 1077 ? 5.110   108.964 38.077  1.00 29.46  ? 1077 LEU A CG    1 
ATOM   8817  C  CD1   . LEU C 3 1077 ? 5.603   109.162 36.634  1.00 27.79  ? 1077 LEU A CD1   1 
ATOM   8818  C  CD2   . LEU C 3 1077 ? 5.621   110.066 38.973  1.00 31.44  ? 1077 LEU A CD2   1 
ATOM   8819  N  N     . CYS C 3 1078 ? 0.547   109.234 37.202  1.00 27.50  ? 1078 CYS A N     1 
ATOM   8820  C  CA    . CYS C 3 1078 ? -0.717  108.608 36.837  1.00 28.36  ? 1078 CYS A CA    1 
ATOM   8821  C  C     . CYS C 3 1078 ? -1.848  109.564 37.209  1.00 27.07  ? 1078 CYS A C     1 
ATOM   8822  O  O     . CYS C 3 1078 ? -2.014  109.912 38.380  1.00 26.72  ? 1078 CYS A O     1 
ATOM   8823  C  CB    . CYS C 3 1078 ? -0.894  107.283 37.582  1.00 27.44  ? 1078 CYS A CB    1 
ATOM   8824  S  SG    . CYS C 3 1078 ? -2.417  106.433 37.139  1.00 29.83  ? 1078 CYS A SG    1 
ATOM   8825  N  N     . ALA C 3 1079 ? -2.618  109.996 36.216  1.00 26.79  ? 1079 ALA A N     1 
ATOM   8826  C  CA    . ALA C 3 1079 ? -3.698  110.933 36.486  1.00 27.03  ? 1079 ALA A CA    1 
ATOM   8827  C  C     . ALA C 3 1079 ? -4.598  110.326 37.548  1.00 27.52  ? 1079 ALA A C     1 
ATOM   8828  O  O     . ALA C 3 1079 ? -4.866  109.123 37.530  1.00 29.75  ? 1079 ALA A O     1 
ATOM   8829  C  CB    . ALA C 3 1079 ? -4.477  111.226 35.214  1.00 25.24  ? 1079 ALA A CB    1 
ATOM   8830  N  N     . GLY C 3 1080 ? -5.048  111.153 38.483  1.00 27.87  ? 1080 GLY A N     1 
ATOM   8831  C  CA    . GLY C 3 1080 ? -5.901  110.661 39.549  1.00 27.49  ? 1080 GLY A CA    1 
ATOM   8832  C  C     . GLY C 3 1080 ? -5.044  110.346 40.753  1.00 28.49  ? 1080 GLY A C     1 
ATOM   8833  O  O     . GLY C 3 1080 ? -5.511  110.406 41.894  1.00 30.49  ? 1080 GLY A O     1 
ATOM   8834  N  N     . ILE C 3 1081 ? -3.785  109.994 40.503  1.00 28.22  ? 1081 ILE A N     1 
ATOM   8835  C  CA    . ILE C 3 1081 ? -2.862  109.697 41.581  1.00 27.69  ? 1081 ILE A CA    1 
ATOM   8836  C  C     . ILE C 3 1081 ? -2.078  110.979 41.811  1.00 28.86  ? 1081 ILE A C     1 
ATOM   8837  O  O     . ILE C 3 1081 ? -0.995  111.160 41.274  1.00 28.34  ? 1081 ILE A O     1 
ATOM   8838  C  CB    . ILE C 3 1081 ? -1.883  108.564 41.219  1.00 28.13  ? 1081 ILE A CB    1 
ATOM   8839  C  CG1   . ILE C 3 1081 ? -2.656  107.342 40.729  1.00 28.36  ? 1081 ILE A CG1   1 
ATOM   8840  C  CG2   . ILE C 3 1081 ? -1.063  108.162 42.447  1.00 23.44  ? 1081 ILE A CG2   1 
ATOM   8841  C  CD1   . ILE C 3 1081 ? -3.587  106.770 41.761  1.00 31.60  ? 1081 ILE A CD1   1 
ATOM   8842  N  N     . ASP C 3 1082 ? -2.648  111.870 42.611  1.00 29.89  ? 1082 ASP A N     1 
ATOM   8843  C  CA    . ASP C 3 1082 ? -2.027  113.151 42.913  1.00 29.77  ? 1082 ASP A CA    1 
ATOM   8844  C  C     . ASP C 3 1082 ? -2.211  113.482 44.395  1.00 28.37  ? 1082 ASP A C     1 
ATOM   8845  O  O     . ASP C 3 1082 ? -2.769  112.692 45.144  1.00 26.78  ? 1082 ASP A O     1 
ATOM   8846  C  CB    . ASP C 3 1082 ? -2.662  114.246 42.052  1.00 29.95  ? 1082 ASP A CB    1 
ATOM   8847  C  CG    . ASP C 3 1082 ? -4.168  114.219 42.104  1.00 31.30  ? 1082 ASP A CG    1 
ATOM   8848  O  OD1   . ASP C 3 1082 ? -4.715  113.834 43.156  1.00 34.99  ? 1082 ASP A OD1   1 
ATOM   8849  O  OD2   . ASP C 3 1082 ? -4.812  114.590 41.101  1.00 34.31  ? 1082 ASP A OD2   1 
ATOM   8850  N  N     . PRO C 3 1083 ? -1.742  114.663 44.829  1.00 27.43  ? 1083 PRO A N     1 
ATOM   8851  C  CA    . PRO C 3 1083 ? -1.881  115.049 46.232  1.00 27.61  ? 1083 PRO A CA    1 
ATOM   8852  C  C     . PRO C 3 1083 ? -3.318  115.064 46.763  1.00 28.66  ? 1083 PRO A C     1 
ATOM   8853  O  O     . PRO C 3 1083 ? -3.540  115.251 47.960  1.00 29.57  ? 1083 PRO A O     1 
ATOM   8854  C  CB    . PRO C 3 1083 ? -1.219  116.421 46.263  1.00 28.03  ? 1083 PRO A CB    1 
ATOM   8855  C  CG    . PRO C 3 1083 ? -0.111  116.262 45.255  1.00 26.23  ? 1083 PRO A CG    1 
ATOM   8856  C  CD    . PRO C 3 1083 ? -0.853  115.604 44.120  1.00 25.53  ? 1083 PRO A CD    1 
ATOM   8857  N  N     . LEU C 3 1084 ? -4.292  114.865 45.881  1.00 28.01  ? 1084 LEU A N     1 
ATOM   8858  C  CA    . LEU C 3 1084 ? -5.697  114.832 46.293  1.00 27.40  ? 1084 LEU A CA    1 
ATOM   8859  C  C     . LEU C 3 1084 ? -6.136  113.391 46.603  1.00 26.89  ? 1084 LEU A C     1 
ATOM   8860  O  O     . LEU C 3 1084 ? -7.256  113.154 47.077  1.00 24.19  ? 1084 LEU A O     1 
ATOM   8861  C  CB    . LEU C 3 1084 ? -6.584  115.399 45.181  1.00 27.78  ? 1084 LEU A CB    1 
ATOM   8862  C  CG    . LEU C 3 1084 ? -6.221  116.816 44.731  1.00 29.25  ? 1084 LEU A CG    1 
ATOM   8863  C  CD1   . LEU C 3 1084 ? -7.109  117.250 43.569  1.00 24.92  ? 1084 LEU A CD1   1 
ATOM   8864  C  CD2   . LEU C 3 1084 ? -6.368  117.758 45.926  1.00 29.00  ? 1084 LEU A CD2   1 
ATOM   8865  N  N     . ASN C 3 1085 ? -5.248  112.438 46.312  1.00 25.72  ? 1085 ASN A N     1 
ATOM   8866  C  CA    . ASN C 3 1085 ? -5.507  111.016 46.534  1.00 25.66  ? 1085 ASN A CA    1 
ATOM   8867  C  C     . ASN C 3 1085 ? -4.355  110.482 47.393  1.00 25.66  ? 1085 ASN A C     1 
ATOM   8868  O  O     . ASN C 3 1085 ? -3.611  109.596 46.978  1.00 26.69  ? 1085 ASN A O     1 
ATOM   8869  C  CB    . ASN C 3 1085 ? -5.556  110.294 45.184  1.00 24.49  ? 1085 ASN A CB    1 
ATOM   8870  C  CG    . ASN C 3 1085 ? -6.397  109.030 45.227  1.00 25.63  ? 1085 ASN A CG    1 
ATOM   8871  O  OD1   . ASN C 3 1085 ? -6.819  108.590 46.295  1.00 22.59  ? 1085 ASN A OD1   1 
ATOM   8872  N  ND2   . ASN C 3 1085 ? -6.643  108.441 44.059  1.00 23.06  ? 1085 ASN A ND2   1 
ATOM   8873  N  N     . SER C 3 1086 ? -4.248  111.034 48.600  1.00 26.30  ? 1086 SER A N     1 
ATOM   8874  C  CA    . SER C 3 1086 ? -3.184  110.748 49.570  1.00 26.28  ? 1086 SER A CA    1 
ATOM   8875  C  C     . SER C 3 1086 ? -2.502  109.381 49.644  1.00 25.33  ? 1086 SER A C     1 
ATOM   8876  O  O     . SER C 3 1086 ? -1.297  109.290 49.400  1.00 24.87  ? 1086 SER A O     1 
ATOM   8877  C  CB    . SER C 3 1086 ? -3.650  111.154 50.968  1.00 26.04  ? 1086 SER A CB    1 
ATOM   8878  O  OG    . SER C 3 1086 ? -4.782  110.406 51.360  1.00 31.76  ? 1086 SER A OG    1 
ATOM   8879  N  N     . ASP C 3 1087 ? -3.228  108.322 49.985  1.00 24.53  ? 1087 ASP A N     1 
ATOM   8880  C  CA    . ASP C 3 1087 ? -2.583  107.015 50.078  1.00 24.54  ? 1087 ASP A CA    1 
ATOM   8881  C  C     . ASP C 3 1087 ? -1.912  106.586 48.761  1.00 24.48  ? 1087 ASP A C     1 
ATOM   8882  O  O     . ASP C 3 1087 ? -0.711  106.344 48.734  1.00 26.01  ? 1087 ASP A O     1 
ATOM   8883  C  CB    . ASP C 3 1087 ? -3.583  105.952 50.550  1.00 23.95  ? 1087 ASP A CB    1 
ATOM   8884  C  CG    . ASP C 3 1087 ? -2.962  104.570 50.665  1.00 23.87  ? 1087 ASP A CG    1 
ATOM   8885  O  OD1   . ASP C 3 1087 ? -2.054  104.372 51.506  1.00 24.22  ? 1087 ASP A OD1   1 
ATOM   8886  O  OD2   . ASP C 3 1087 ? -3.387  103.677 49.905  1.00 23.89  ? 1087 ASP A OD2   1 
ATOM   8887  N  N     . PRO C 3 1088 ? -2.673  106.486 47.653  1.00 23.90  ? 1088 PRO A N     1 
ATOM   8888  C  CA    . PRO C 3 1088 ? -2.073  106.082 46.373  1.00 22.82  ? 1088 PRO A CA    1 
ATOM   8889  C  C     . PRO C 3 1088 ? -0.884  106.955 45.992  1.00 23.11  ? 1088 PRO A C     1 
ATOM   8890  O  O     . PRO C 3 1088 ? 0.136   106.453 45.534  1.00 23.92  ? 1088 PRO A O     1 
ATOM   8891  C  CB    . PRO C 3 1088 ? -3.227  106.230 45.383  1.00 20.97  ? 1088 PRO A CB    1 
ATOM   8892  C  CG    . PRO C 3 1088 ? -4.412  105.927 46.216  1.00 22.08  ? 1088 PRO A CG    1 
ATOM   8893  C  CD    . PRO C 3 1088 ? -4.132  106.634 47.518  1.00 22.90  ? 1088 PRO A CD    1 
ATOM   8894  N  N     . PHE C 3 1089 ? -1.031  108.263 46.182  1.00 22.90  ? 1089 PHE A N     1 
ATOM   8895  C  CA    . PHE C 3 1089 ? 0.021   109.224 45.855  1.00 23.91  ? 1089 PHE A CA    1 
ATOM   8896  C  C     . PHE C 3 1089 ? 1.282   109.051 46.713  1.00 25.56  ? 1089 PHE A C     1 
ATOM   8897  O  O     . PHE C 3 1089 ? 2.403   109.079 46.201  1.00 24.29  ? 1089 PHE A O     1 
ATOM   8898  C  CB    . PHE C 3 1089 ? -0.495  110.655 46.036  1.00 23.13  ? 1089 PHE A CB    1 
ATOM   8899  C  CG    . PHE C 3 1089 ? 0.521   111.700 45.697  1.00 21.93  ? 1089 PHE A CG    1 
ATOM   8900  C  CD1   . PHE C 3 1089 ? 0.901   111.912 44.372  1.00 22.20  ? 1089 PHE A CD1   1 
ATOM   8901  C  CD2   . PHE C 3 1089 ? 1.147   112.431 46.697  1.00 22.53  ? 1089 PHE A CD2   1 
ATOM   8902  C  CE1   . PHE C 3 1089 ? 1.890   112.828 44.049  1.00 17.51  ? 1089 PHE A CE1   1 
ATOM   8903  C  CE2   . PHE C 3 1089 ? 2.148   113.361 46.381  1.00 21.04  ? 1089 PHE A CE2   1 
ATOM   8904  C  CZ    . PHE C 3 1089 ? 2.516   113.554 45.057  1.00 20.25  ? 1089 PHE A CZ    1 
ATOM   8905  N  N     . LEU C 3 1090 ? 1.082   108.903 48.020  1.00 25.71  ? 1090 LEU A N     1 
ATOM   8906  C  CA    . LEU C 3 1090 ? 2.179   108.735 48.954  1.00 26.48  ? 1090 LEU A CA    1 
ATOM   8907  C  C     . LEU C 3 1090 ? 2.881   107.409 48.727  1.00 28.21  ? 1090 LEU A C     1 
ATOM   8908  O  O     . LEU C 3 1090 ? 4.095   107.309 48.906  1.00 28.17  ? 1090 LEU A O     1 
ATOM   8909  C  CB    . LEU C 3 1090 ? 1.669   108.828 50.398  1.00 26.53  ? 1090 LEU A CB    1 
ATOM   8910  C  CG    . LEU C 3 1090 ? 1.132   110.206 50.819  1.00 27.26  ? 1090 LEU A CG    1 
ATOM   8911  C  CD1   . LEU C 3 1090 ? 0.723   110.183 52.274  1.00 23.33  ? 1090 LEU A CD1   1 
ATOM   8912  C  CD2   . LEU C 3 1090 ? 2.210   111.272 50.586  1.00 26.83  ? 1090 LEU A CD2   1 
ATOM   8913  N  N     . LYS C 3 1091 ? 2.123   106.391 48.324  1.00 29.09  ? 1091 LYS A N     1 
ATOM   8914  C  CA    . LYS C 3 1091 ? 2.712   105.082 48.076  1.00 30.11  ? 1091 LYS A CA    1 
ATOM   8915  C  C     . LYS C 3 1091 ? 3.545   105.148 46.805  1.00 30.68  ? 1091 LYS A C     1 
ATOM   8916  O  O     . LYS C 3 1091 ? 4.658   104.629 46.749  1.00 31.43  ? 1091 LYS A O     1 
ATOM   8917  C  CB    . LYS C 3 1091 ? 1.618   104.021 47.945  1.00 30.37  ? 1091 LYS A CB    1 
ATOM   8918  C  CG    . LYS C 3 1091 ? 1.088   103.521 49.275  1.00 32.58  ? 1091 LYS A CG    1 
ATOM   8919  C  CD    . LYS C 3 1091 ? 2.064   102.565 49.945  1.00 34.46  ? 1091 LYS A CD    1 
ATOM   8920  C  CE    . LYS C 3 1091 ? 1.824   102.499 51.459  1.00 35.36  ? 1091 LYS A CE    1 
ATOM   8921  N  NZ    . LYS C 3 1091 ? 0.387   102.362 51.812  1.00 35.26  ? 1091 LYS A NZ    1 
ATOM   8922  N  N     . MET C 3 1092 ? 2.995   105.799 45.786  1.00 31.16  ? 1092 MET A N     1 
ATOM   8923  C  CA    . MET C 3 1092 ? 3.684   105.964 44.515  1.00 31.22  ? 1092 MET A CA    1 
ATOM   8924  C  C     . MET C 3 1092 ? 5.013   106.697 44.711  1.00 30.63  ? 1092 MET A C     1 
ATOM   8925  O  O     . MET C 3 1092 ? 6.061   106.257 44.231  1.00 28.79  ? 1092 MET A O     1 
ATOM   8926  C  CB    . MET C 3 1092 ? 2.797   106.760 43.553  1.00 34.69  ? 1092 MET A CB    1 
ATOM   8927  C  CG    . MET C 3 1092 ? 3.466   107.197 42.246  1.00 38.38  ? 1092 MET A CG    1 
ATOM   8928  S  SD    . MET C 3 1092 ? 4.043   105.780 41.307  1.00 44.68  ? 1092 MET A SD    1 
ATOM   8929  C  CE    . MET C 3 1092 ? 2.451   104.911 41.041  1.00 45.38  ? 1092 MET A CE    1 
ATOM   8930  N  N     . VAL C 3 1093 ? 4.958   107.807 45.440  1.00 28.84  ? 1093 VAL A N     1 
ATOM   8931  C  CA    . VAL C 3 1093 ? 6.135   108.624 45.674  1.00 28.82  ? 1093 VAL A CA    1 
ATOM   8932  C  C     . VAL C 3 1093 ? 7.217   108.003 46.551  1.00 28.16  ? 1093 VAL A C     1 
ATOM   8933  O  O     . VAL C 3 1093 ? 8.406   108.084 46.229  1.00 27.70  ? 1093 VAL A O     1 
ATOM   8934  C  CB    . VAL C 3 1093 ? 5.738   110.004 46.268  1.00 28.83  ? 1093 VAL A CB    1 
ATOM   8935  C  CG1   . VAL C 3 1093 ? 6.976   110.829 46.520  1.00 28.84  ? 1093 VAL A CG1   1 
ATOM   8936  C  CG2   . VAL C 3 1093 ? 4.812   110.747 45.298  1.00 24.47  ? 1093 VAL A CG2   1 
ATOM   8937  N  N     . SER C 3 1094 ? 6.821   107.378 47.650  1.00 27.62  ? 1094 SER A N     1 
ATOM   8938  C  CA    . SER C 3 1094 ? 7.810   106.797 48.544  1.00 26.27  ? 1094 SER A CA    1 
ATOM   8939  C  C     . SER C 3 1094 ? 8.349   105.452 48.097  1.00 27.30  ? 1094 SER A C     1 
ATOM   8940  O  O     . SER C 3 1094 ? 9.545   105.187 48.240  1.00 26.94  ? 1094 SER A O     1 
ATOM   8941  C  CB    . SER C 3 1094 ? 7.245   106.679 49.964  1.00 25.56  ? 1094 SER A CB    1 
ATOM   8942  O  OG    . SER C 3 1094 ? 6.144   105.804 50.006  1.00 22.96  ? 1094 SER A OG    1 
ATOM   8943  N  N     . VAL C 3 1095 ? 7.471   104.603 47.566  1.00 27.79  ? 1095 VAL A N     1 
ATOM   8944  C  CA    . VAL C 3 1095 ? 7.871   103.269 47.111  1.00 28.32  ? 1095 VAL A CA    1 
ATOM   8945  C  C     . VAL C 3 1095 ? 8.494   103.360 45.727  1.00 27.15  ? 1095 VAL A C     1 
ATOM   8946  O  O     . VAL C 3 1095 ? 9.461   102.656 45.419  1.00 26.92  ? 1095 VAL A O     1 
ATOM   8947  C  CB    . VAL C 3 1095 ? 6.661   102.302 47.063  1.00 29.69  ? 1095 VAL A CB    1 
ATOM   8948  C  CG1   . VAL C 3 1095 ? 7.071   100.984 46.439  1.00 29.55  ? 1095 VAL A CG1   1 
ATOM   8949  C  CG2   . VAL C 3 1095 ? 6.122   102.070 48.473  1.00 28.96  ? 1095 VAL A CG2   1 
ATOM   8950  N  N     . GLY C 3 1096 ? 7.930   104.238 44.904  1.00 25.92  ? 1096 GLY A N     1 
ATOM   8951  C  CA    . GLY C 3 1096 ? 8.439   104.437 43.562  1.00 24.12  ? 1096 GLY A CA    1 
ATOM   8952  C  C     . GLY C 3 1096 ? 7.735   103.594 42.522  1.00 24.04  ? 1096 GLY A C     1 
ATOM   8953  O  O     . GLY C 3 1096 ? 7.264   102.502 42.823  1.00 25.02  ? 1096 GLY A O     1 
ATOM   8954  N  N     . PRO C 3 1097 ? 7.637   104.080 41.278  1.00 24.58  ? 1097 PRO A N     1 
ATOM   8955  C  CA    . PRO C 3 1097 ? 6.969   103.308 40.225  1.00 25.27  ? 1097 PRO A CA    1 
ATOM   8956  C  C     . PRO C 3 1097 ? 7.800   102.129 39.725  1.00 26.92  ? 1097 PRO A C     1 
ATOM   8957  O  O     . PRO C 3 1097 ? 9.036   102.147 39.789  1.00 25.48  ? 1097 PRO A O     1 
ATOM   8958  C  CB    . PRO C 3 1097 ? 6.761   104.343 39.123  1.00 23.47  ? 1097 PRO A CB    1 
ATOM   8959  C  CG    . PRO C 3 1097 ? 7.962   105.215 39.270  1.00 22.08  ? 1097 PRO A CG    1 
ATOM   8960  C  CD    . PRO C 3 1097 ? 8.038   105.408 40.775  1.00 22.44  ? 1097 PRO A CD    1 
ATOM   8961  N  N     . MET C 3 1098 ? 7.107   101.108 39.232  1.00 27.79  ? 1098 MET A N     1 
ATOM   8962  C  CA    . MET C 3 1098 ? 7.753   99.932  38.667  1.00 29.11  ? 1098 MET A CA    1 
ATOM   8963  C  C     . MET C 3 1098 ? 8.258   100.363 37.281  1.00 29.95  ? 1098 MET A C     1 
ATOM   8964  O  O     . MET C 3 1098 ? 7.462   100.552 36.358  1.00 30.34  ? 1098 MET A O     1 
ATOM   8965  C  CB    . MET C 3 1098 ? 6.728   98.800  38.520  1.00 30.56  ? 1098 MET A CB    1 
ATOM   8966  C  CG    . MET C 3 1098 ? 7.229   97.618  37.732  1.00 29.31  ? 1098 MET A CG    1 
ATOM   8967  S  SD    . MET C 3 1098 ? 8.764   96.961  38.427  1.00 32.41  ? 1098 MET A SD    1 
ATOM   8968  C  CE    . MET C 3 1098 ? 8.645   95.219  37.847  1.00 28.84  ? 1098 MET A CE    1 
ATOM   8969  N  N     . LEU C 3 1099 ? 9.571   100.509 37.124  1.00 29.20  ? 1099 LEU A N     1 
ATOM   8970  C  CA    . LEU C 3 1099 ? 10.104  100.951 35.842  1.00 27.66  ? 1099 LEU A CA    1 
ATOM   8971  C  C     . LEU C 3 1099 ? 10.624  99.869  34.903  1.00 28.19  ? 1099 LEU A C     1 
ATOM   8972  O  O     . LEU C 3 1099 ? 11.379  100.152 33.972  1.00 29.71  ? 1099 LEU A O     1 
ATOM   8973  C  CB    . LEU C 3 1099 ? 11.164  102.028 36.072  1.00 25.35  ? 1099 LEU A CB    1 
ATOM   8974  C  CG    . LEU C 3 1099 ? 10.534  103.301 36.644  1.00 23.61  ? 1099 LEU A CG    1 
ATOM   8975  C  CD1   . LEU C 3 1099 ? 11.602  104.262 37.107  1.00 24.46  ? 1099 LEU A CD1   1 
ATOM   8976  C  CD2   . LEU C 3 1099 ? 9.656   103.935 35.591  1.00 16.97  ? 1099 LEU A CD2   1 
ATOM   8977  N  N     . GLN C 3 1100 ? 10.223  98.629  35.146  1.00 27.97  ? 1100 GLN A N     1 
ATOM   8978  C  CA    . GLN C 3 1100 ? 10.606  97.536  34.265  1.00 27.98  ? 1100 GLN A CA    1 
ATOM   8979  C  C     . GLN C 3 1100 ? 9.372   96.728  33.892  1.00 27.31  ? 1100 GLN A C     1 
ATOM   8980  O  O     . GLN C 3 1100 ? 8.393   96.689  34.639  1.00 26.73  ? 1100 GLN A O     1 
ATOM   8981  C  CB    . GLN C 3 1100 ? 11.629  96.603  34.922  1.00 28.66  ? 1100 GLN A CB    1 
ATOM   8982  C  CG    . GLN C 3 1100 ? 11.698  95.241  34.203  1.00 28.06  ? 1100 GLN A CG    1 
ATOM   8983  C  CD    . GLN C 3 1100 ? 12.936  94.424  34.524  1.00 27.78  ? 1100 GLN A CD    1 
ATOM   8984  O  OE1   . GLN C 3 1100 ? 13.293  94.220  35.690  1.00 27.23  ? 1100 GLN A OE1   1 
ATOM   8985  N  NE2   . GLN C 3 1100 ? 13.591  93.937  33.480  1.00 26.61  ? 1100 GLN A NE2   1 
ATOM   8986  N  N     . SER C 3 1101 ? 9.418   96.087  32.732  1.00 28.90  ? 1101 SER A N     1 
ATOM   8987  C  CA    . SER C 3 1101 ? 8.307   95.252  32.293  1.00 28.75  ? 1101 SER A CA    1 
ATOM   8988  C  C     . SER C 3 1101 ? 8.129   94.134  33.305  1.00 28.41  ? 1101 SER A C     1 
ATOM   8989  O  O     . SER C 3 1101 ? 9.095   93.471  33.680  1.00 28.53  ? 1101 SER A O     1 
ATOM   8990  C  CB    . SER C 3 1101 ? 8.603   94.637  30.933  1.00 29.63  ? 1101 SER A CB    1 
ATOM   8991  O  OG    . SER C 3 1101 ? 7.714   93.562  30.690  1.00 34.09  ? 1101 SER A OG    1 
ATOM   8992  N  N     . THR C 3 1102 ? 6.897   93.925  33.751  1.00 28.97  ? 1102 THR A N     1 
ATOM   8993  C  CA    . THR C 3 1102 ? 6.616   92.877  34.721  1.00 29.94  ? 1102 THR A CA    1 
ATOM   8994  C  C     . THR C 3 1102 ? 6.757   91.472  34.132  1.00 31.55  ? 1102 THR A C     1 
ATOM   8995  O  O     . THR C 3 1102 ? 6.903   90.495  34.862  1.00 32.52  ? 1102 THR A O     1 
ATOM   8996  C  CB    . THR C 3 1102 ? 5.209   93.052  35.312  1.00 30.00  ? 1102 THR A CB    1 
ATOM   8997  O  OG1   . THR C 3 1102 ? 4.289   93.393  34.267  1.00 31.65  ? 1102 THR A OG1   1 
ATOM   8998  C  CG2   . THR C 3 1102 ? 5.211   94.156  36.362  1.00 30.81  ? 1102 THR A CG2   1 
ATOM   8999  N  N     . ARG C 3 1103 ? 6.724   91.365  32.810  1.00 33.97  ? 1103 ARG A N     1 
ATOM   9000  C  CA    . ARG C 3 1103 ? 6.859   90.069  32.165  1.00 36.19  ? 1103 ARG A CA    1 
ATOM   9001  C  C     . ARG C 3 1103 ? 8.339   89.693  32.156  1.00 36.42  ? 1103 ARG A C     1 
ATOM   9002  O  O     . ARG C 3 1103 ? 8.700   88.541  32.390  1.00 36.81  ? 1103 ARG A O     1 
ATOM   9003  C  CB    . ARG C 3 1103 ? 6.321   90.137  30.737  1.00 38.83  ? 1103 ARG A CB    1 
ATOM   9004  C  CG    . ARG C 3 1103 ? 6.273   88.806  30.006  1.00 44.18  ? 1103 ARG A CG    1 
ATOM   9005  C  CD    . ARG C 3 1103 ? 4.839   88.302  29.865  1.00 50.89  ? 1103 ARG A CD    1 
ATOM   9006  N  NE    . ARG C 3 1103 ? 4.658   87.443  28.690  1.00 54.50  ? 1103 ARG A NE    1 
ATOM   9007  C  CZ    . ARG C 3 1103 ? 5.181   86.226  28.550  1.00 56.13  ? 1103 ARG A CZ    1 
ATOM   9008  N  NH1   . ARG C 3 1103 ? 5.928   85.703  29.517  1.00 54.93  ? 1103 ARG A NH1   1 
ATOM   9009  N  NH2   . ARG C 3 1103 ? 4.958   85.532  27.439  1.00 56.95  ? 1103 ARG A NH2   1 
ATOM   9010  N  N     . LYS C 3 1104 ? 9.196   90.674  31.892  1.00 35.99  ? 1104 LYS A N     1 
ATOM   9011  C  CA    . LYS C 3 1104 ? 10.632  90.428  31.862  1.00 36.53  ? 1104 LYS A CA    1 
ATOM   9012  C  C     . LYS C 3 1104 ? 11.121  90.138  33.264  1.00 35.77  ? 1104 LYS A C     1 
ATOM   9013  O  O     . LYS C 3 1104 ? 11.849  89.175  33.493  1.00 37.54  ? 1104 LYS A O     1 
ATOM   9014  C  CB    . LYS C 3 1104 ? 11.391  91.648  31.314  1.00 38.58  ? 1104 LYS A CB    1 
ATOM   9015  C  CG    . LYS C 3 1104 ? 11.261  91.873  29.809  1.00 39.25  ? 1104 LYS A CG    1 
ATOM   9016  C  CD    . LYS C 3 1104 ? 11.880  90.734  28.997  1.00 41.28  ? 1104 LYS A CD    1 
ATOM   9017  C  CE    . LYS C 3 1104 ? 11.543  90.889  27.508  1.00 44.32  ? 1104 LYS A CE    1 
ATOM   9018  N  NZ    . LYS C 3 1104 ? 12.076  89.787  26.663  1.00 44.07  ? 1104 LYS A NZ    1 
ATOM   9019  N  N     . TYR C 3 1105 ? 10.721  90.986  34.202  1.00 34.66  ? 1105 TYR A N     1 
ATOM   9020  C  CA    . TYR C 3 1105 ? 11.121  90.833  35.593  1.00 32.87  ? 1105 TYR A CA    1 
ATOM   9021  C  C     . TYR C 3 1105 ? 10.801  89.432  36.124  1.00 31.92  ? 1105 TYR A C     1 
ATOM   9022  O  O     . TYR C 3 1105 ? 11.671  88.739  36.655  1.00 30.25  ? 1105 TYR A O     1 
ATOM   9023  C  CB    . TYR C 3 1105 ? 10.406  91.872  36.465  1.00 31.45  ? 1105 TYR A CB    1 
ATOM   9024  C  CG    . TYR C 3 1105 ? 10.722  91.731  37.939  1.00 30.50  ? 1105 TYR A CG    1 
ATOM   9025  C  CD1   . TYR C 3 1105 ? 11.842  92.358  38.495  1.00 29.45  ? 1105 TYR A CD1   1 
ATOM   9026  C  CD2   . TYR C 3 1105 ? 9.932   90.929  38.766  1.00 28.41  ? 1105 TYR A CD2   1 
ATOM   9027  C  CE1   . TYR C 3 1105 ? 12.167  92.193  39.828  1.00 29.42  ? 1105 TYR A CE1   1 
ATOM   9028  C  CE2   . TYR C 3 1105 ? 10.250  90.751  40.104  1.00 28.83  ? 1105 TYR A CE2   1 
ATOM   9029  C  CZ    . TYR C 3 1105 ? 11.369  91.385  40.631  1.00 30.70  ? 1105 TYR A CZ    1 
ATOM   9030  O  OH    . TYR C 3 1105 ? 11.699  91.206  41.954  1.00 30.75  ? 1105 TYR A OH    1 
ATOM   9031  N  N     . PHE C 3 1106 ? 9.544   89.027  35.979  1.00 30.26  ? 1106 PHE A N     1 
ATOM   9032  C  CA    . PHE C 3 1106 ? 9.118   87.731  36.472  1.00 30.71  ? 1106 PHE A CA    1 
ATOM   9033  C  C     . PHE C 3 1106 ? 9.651   86.548  35.696  1.00 30.16  ? 1106 PHE A C     1 
ATOM   9034  O  O     . PHE C 3 1106 ? 9.687   85.436  36.217  1.00 30.77  ? 1106 PHE A O     1 
ATOM   9035  C  CB    . PHE C 3 1106 ? 7.590   87.675  36.553  1.00 30.18  ? 1106 PHE A CB    1 
ATOM   9036  C  CG    . PHE C 3 1106 ? 7.034   88.400  37.739  1.00 28.51  ? 1106 PHE A CG    1 
ATOM   9037  C  CD1   . PHE C 3 1106 ? 7.095   87.829  39.002  1.00 27.34  ? 1106 PHE A CD1   1 
ATOM   9038  C  CD2   . PHE C 3 1106 ? 6.505   89.682  37.605  1.00 27.89  ? 1106 PHE A CD2   1 
ATOM   9039  C  CE1   . PHE C 3 1106 ? 6.642   88.525  40.118  1.00 25.79  ? 1106 PHE A CE1   1 
ATOM   9040  C  CE2   . PHE C 3 1106 ? 6.052   90.386  38.715  1.00 27.36  ? 1106 PHE A CE2   1 
ATOM   9041  C  CZ    . PHE C 3 1106 ? 6.122   89.803  39.976  1.00 26.91  ? 1106 PHE A CZ    1 
ATOM   9042  N  N     . ALA C 3 1107 ? 10.079  86.769  34.460  1.00 30.83  ? 1107 ALA A N     1 
ATOM   9043  C  CA    . ALA C 3 1107 ? 10.622  85.664  33.684  1.00 31.40  ? 1107 ALA A CA    1 
ATOM   9044  C  C     . ALA C 3 1107 ? 11.964  85.262  34.316  1.00 32.65  ? 1107 ALA A C     1 
ATOM   9045  O  O     . ALA C 3 1107 ? 12.501  84.180  34.043  1.00 31.20  ? 1107 ALA A O     1 
ATOM   9046  C  CB    . ALA C 3 1107 ? 10.801  86.075  32.243  1.00 30.56  ? 1107 ALA A CB    1 
ATOM   9047  N  N     . GLN C 3 1108 ? 12.491  86.132  35.177  1.00 32.87  ? 1108 GLN A N     1 
ATOM   9048  C  CA    . GLN C 3 1108 ? 13.748  85.857  35.864  1.00 34.71  ? 1108 GLN A CA    1 
ATOM   9049  C  C     . GLN C 3 1108 ? 13.547  85.200  37.238  1.00 35.69  ? 1108 GLN A C     1 
ATOM   9050  O  O     . GLN C 3 1108 ? 14.491  85.088  38.023  1.00 35.49  ? 1108 GLN A O     1 
ATOM   9051  C  CB    . GLN C 3 1108 ? 14.558  87.145  36.029  1.00 36.55  ? 1108 GLN A CB    1 
ATOM   9052  C  CG    . GLN C 3 1108 ? 14.987  87.795  34.715  1.00 41.03  ? 1108 GLN A CG    1 
ATOM   9053  C  CD    . GLN C 3 1108 ? 15.672  86.816  33.748  1.00 43.52  ? 1108 GLN A CD    1 
ATOM   9054  O  OE1   . GLN C 3 1108 ? 16.718  86.236  34.059  1.00 42.76  ? 1108 GLN A OE1   1 
ATOM   9055  N  NE2   . GLN C 3 1108 ? 15.072  86.633  32.569  1.00 43.49  ? 1108 GLN A NE2   1 
ATOM   9056  N  N     . THR C 3 1109 ? 12.320  84.771  37.533  1.00 35.65  ? 1109 THR A N     1 
ATOM   9057  C  CA    . THR C 3 1109 ? 12.029  84.123  38.813  1.00 36.06  ? 1109 THR A CA    1 
ATOM   9058  C  C     . THR C 3 1109 ? 11.651  82.639  38.661  1.00 36.41  ? 1109 THR A C     1 
ATOM   9059  O  O     . THR C 3 1109 ? 11.098  82.027  39.583  1.00 35.79  ? 1109 THR A O     1 
ATOM   9060  C  CB    . THR C 3 1109 ? 10.886  84.850  39.557  1.00 35.19  ? 1109 THR A CB    1 
ATOM   9061  O  OG1   . THR C 3 1109 ? 9.692   84.821  38.763  1.00 37.03  ? 1109 THR A OG1   1 
ATOM   9062  C  CG2   . THR C 3 1109 ? 11.266  86.280  39.825  1.00 35.48  ? 1109 THR A CG2   1 
ATOM   9063  N  N     . LEU C 3 1110 ? 11.951  82.070  37.496  1.00 36.40  ? 1110 LEU A N     1 
ATOM   9064  C  CA    . LEU C 3 1110 ? 11.652  80.668  37.211  1.00 37.86  ? 1110 LEU A CA    1 
ATOM   9065  C  C     . LEU C 3 1110 ? 12.843  80.009  36.515  1.00 37.79  ? 1110 LEU A C     1 
ATOM   9066  O  O     . LEU C 3 1110 ? 13.576  80.668  35.775  1.00 38.46  ? 1110 LEU A O     1 
ATOM   9067  C  CB    . LEU C 3 1110 ? 10.426  80.567  36.296  1.00 38.94  ? 1110 LEU A CB    1 
ATOM   9068  C  CG    . LEU C 3 1110 ? 9.124   81.206  36.799  1.00 41.24  ? 1110 LEU A CG    1 
ATOM   9069  C  CD1   . LEU C 3 1110 ? 8.145   81.344  35.635  1.00 40.62  ? 1110 LEU A CD1   1 
ATOM   9070  C  CD2   . LEU C 3 1110 ? 8.524   80.369  37.927  1.00 38.09  ? 1110 LEU A CD2   1 
ATOM   9071  N  N     . PHE C 3 1111 ? 13.040  78.713  36.745  1.00 36.39  ? 1111 PHE A N     1 
ATOM   9072  C  CA    . PHE C 3 1111 ? 14.137  78.014  36.091  1.00 34.28  ? 1111 PHE A CA    1 
ATOM   9073  C  C     . PHE C 3 1111 ? 13.696  77.573  34.707  1.00 34.50  ? 1111 PHE A C     1 
ATOM   9074  O  O     . PHE C 3 1111 ? 14.521  77.425  33.815  1.00 37.26  ? 1111 PHE A O     1 
ATOM   9075  C  CB    . PHE C 3 1111 ? 14.579  76.807  36.914  1.00 32.74  ? 1111 PHE A CB    1 
ATOM   9076  C  CG    . PHE C 3 1111 ? 15.076  77.165  38.283  1.00 33.09  ? 1111 PHE A CG    1 
ATOM   9077  C  CD1   . PHE C 3 1111 ? 16.205  77.959  38.438  1.00 32.42  ? 1111 PHE A CD1   1 
ATOM   9078  C  CD2   . PHE C 3 1111 ? 14.392  76.738  39.421  1.00 32.44  ? 1111 PHE A CD2   1 
ATOM   9079  C  CE1   . PHE C 3 1111 ? 16.645  78.327  39.709  1.00 34.22  ? 1111 PHE A CE1   1 
ATOM   9080  C  CE2   . PHE C 3 1111 ? 14.823  77.099  40.694  1.00 33.11  ? 1111 PHE A CE2   1 
ATOM   9081  C  CZ    . PHE C 3 1111 ? 15.950  77.895  40.842  1.00 33.04  ? 1111 PHE A CZ    1 
ATOM   9082  N  N     . MET C 3 1112 ? 12.393  77.368  34.530  1.00 35.40  ? 1112 MET A N     1 
ATOM   9083  C  CA    . MET C 3 1112 ? 11.833  76.964  33.241  1.00 36.71  ? 1112 MET A CA    1 
ATOM   9084  C  C     . MET C 3 1112 ? 10.642  77.859  32.909  1.00 37.46  ? 1112 MET A C     1 
ATOM   9085  O  O     . MET C 3 1112 ? 9.741   78.036  33.729  1.00 38.29  ? 1112 MET A O     1 
ATOM   9086  C  CB    . MET C 3 1112 ? 11.372  75.513  33.281  1.00 38.69  ? 1112 MET A CB    1 
ATOM   9087  C  CG    . MET C 3 1112 ? 12.412  74.565  33.815  1.00 44.64  ? 1112 MET A CG    1 
ATOM   9088  S  SD    . MET C 3 1112 ? 11.883  72.857  33.715  1.00 49.97  ? 1112 MET A SD    1 
ATOM   9089  C  CE    . MET C 3 1112 ? 12.518  72.462  32.109  1.00 47.34  ? 1112 MET A CE    1 
ATOM   9090  N  N     . ALA C 3 1113 ? 10.646  78.408  31.700  1.00 36.64  ? 1113 ALA A N     1 
ATOM   9091  C  CA    . ALA C 3 1113 ? 9.599   79.309  31.239  1.00 36.35  ? 1113 ALA A CA    1 
ATOM   9092  C  C     . ALA C 3 1113 ? 8.319   78.607  30.801  1.00 36.06  ? 1113 ALA A C     1 
ATOM   9093  O  O     . ALA C 3 1113 ? 7.213   79.081  31.066  1.00 34.95  ? 1113 ALA A O     1 
ATOM   9094  C  CB    . ALA C 3 1113 ? 10.135  80.160  30.088  1.00 35.90  ? 1113 ALA A CB    1 
ATOM   9095  N  N     . LYS C 3 1114 ? 8.470   77.485  30.113  1.00 35.97  ? 1114 LYS A N     1 
ATOM   9096  C  CA    . LYS C 3 1114 ? 7.315   76.744  29.639  1.00 36.81  ? 1114 LYS A CA    1 
ATOM   9097  C  C     . LYS C 3 1114 ? 7.360   75.277  30.018  1.00 35.11  ? 1114 LYS A C     1 
ATOM   9098  O  O     . LYS C 3 1114 ? 8.397   74.751  30.424  1.00 34.38  ? 1114 LYS A O     1 
ATOM   9099  C  CB    . LYS C 3 1114 ? 7.182   76.863  28.106  1.00 39.24  ? 1114 LYS A CB    1 
ATOM   9100  C  CG    . LYS C 3 1114 ? 6.379   78.073  27.632  1.00 41.28  ? 1114 LYS A CG    1 
ATOM   9101  C  CD    . LYS C 3 1114 ? 6.080   78.023  26.139  1.00 43.65  ? 1114 LYS A CD    1 
ATOM   9102  C  CE    . LYS C 3 1114 ? 7.334   78.247  25.289  1.00 46.83  ? 1114 LYS A CE    1 
ATOM   9103  N  NZ    . LYS C 3 1114 ? 7.032   78.275  23.814  1.00 47.17  ? 1114 LYS A NZ    1 
ATOM   9104  N  N     . THR C 3 1115 ? 6.206   74.633  29.892  1.00 32.36  ? 1115 THR A N     1 
ATOM   9105  C  CA    . THR C 3 1115 ? 6.073   73.215  30.165  1.00 31.97  ? 1115 THR A CA    1 
ATOM   9106  C  C     . THR C 3 1115 ? 4.796   72.789  29.459  1.00 32.23  ? 1115 THR A C     1 
ATOM   9107  O  O     . THR C 3 1115 ? 4.083   73.624  28.914  1.00 32.40  ? 1115 THR A O     1 
ATOM   9108  C  CB    . THR C 3 1115 ? 5.991   72.905  31.686  1.00 30.79  ? 1115 THR A CB    1 
ATOM   9109  O  OG1   . THR C 3 1115 ? 6.119   71.490  31.883  1.00 30.06  ? 1115 THR A OG1   1 
ATOM   9110  C  CG2   . THR C 3 1115 ? 4.660   73.381  32.280  1.00 30.31  ? 1115 THR A CG2   1 
ATOM   9111  N  N     . VAL C 3 1116 ? 4.507   71.497  29.449  1.00 32.75  ? 1116 VAL A N     1 
ATOM   9112  C  CA    . VAL C 3 1116 ? 3.311   71.027  28.775  1.00 33.89  ? 1116 VAL A CA    1 
ATOM   9113  C  C     . VAL C 3 1116 ? 2.085   71.701  29.378  1.00 34.56  ? 1116 VAL A C     1 
ATOM   9114  O  O     . VAL C 3 1116 ? 1.974   71.837  30.592  1.00 33.68  ? 1116 VAL A O     1 
ATOM   9115  C  CB    . VAL C 3 1116 ? 3.184   69.498  28.896  1.00 34.17  ? 1116 VAL A CB    1 
ATOM   9116  C  CG1   . VAL C 3 1116 ? 2.059   68.997  28.031  1.00 36.00  ? 1116 VAL A CG1   1 
ATOM   9117  C  CG2   . VAL C 3 1116 ? 4.490   68.842  28.482  1.00 34.63  ? 1116 VAL A CG2   1 
ATOM   9118  N  N     . SER C 3 1117 ? 1.179   72.159  28.523  1.00 36.59  ? 1117 SER A N     1 
ATOM   9119  C  CA    . SER C 3 1117 ? -0.036  72.797  29.007  1.00 37.01  ? 1117 SER A CA    1 
ATOM   9120  C  C     . SER C 3 1117 ? -0.733  71.743  29.845  1.00 37.64  ? 1117 SER A C     1 
ATOM   9121  O  O     . SER C 3 1117 ? -0.986  70.636  29.376  1.00 38.85  ? 1117 SER A O     1 
ATOM   9122  C  CB    . SER C 3 1117 ? -0.926  73.214  27.844  1.00 37.30  ? 1117 SER A CB    1 
ATOM   9123  O  OG    . SER C 3 1117 ? -2.123  73.781  28.327  1.00 37.33  ? 1117 SER A OG    1 
ATOM   9124  N  N     . GLY C 3 1118 ? -1.033  72.090  31.088  1.00 38.56  ? 1118 GLY A N     1 
ATOM   9125  C  CA    . GLY C 3 1118 ? -1.660  71.144  31.990  1.00 39.06  ? 1118 GLY A CA    1 
ATOM   9126  C  C     . GLY C 3 1118 ? -0.865  71.139  33.285  1.00 39.23  ? 1118 GLY A C     1 
ATOM   9127  O  O     . GLY C 3 1118 ? -1.420  70.939  34.371  1.00 41.09  ? 1118 GLY A O     1 
ATOM   9128  N  N     . LEU C 3 1119 ? 0.445   71.342  33.170  1.00 36.89  ? 1119 LEU A N     1 
ATOM   9129  C  CA    . LEU C 3 1119 ? 1.301   71.406  34.343  1.00 35.84  ? 1119 LEU A CA    1 
ATOM   9130  C  C     . LEU C 3 1119 ? 1.512   72.882  34.662  1.00 35.54  ? 1119 LEU A C     1 
ATOM   9131  O  O     . LEU C 3 1119 ? 1.339   73.744  33.807  1.00 32.94  ? 1119 LEU A O     1 
ATOM   9132  C  CB    . LEU C 3 1119 ? 2.645   70.711  34.093  1.00 33.89  ? 1119 LEU A CB    1 
ATOM   9133  C  CG    . LEU C 3 1119 ? 2.603   69.183  33.983  1.00 33.20  ? 1119 LEU A CG    1 
ATOM   9134  C  CD1   . LEU C 3 1119 ? 4.014   68.627  33.972  1.00 32.71  ? 1119 LEU A CD1   1 
ATOM   9135  C  CD2   . LEU C 3 1119 ? 1.837   68.606  35.144  1.00 28.76  ? 1119 LEU A CD2   1 
ATOM   9136  N  N     . ASP C 3 1120 ? 1.876   73.169  35.902  1.00 37.50  ? 1120 ASP A N     1 
ATOM   9137  C  CA    . ASP C 3 1120 ? 2.077   74.544  36.322  1.00 38.04  ? 1120 ASP A CA    1 
ATOM   9138  C  C     . ASP C 3 1120 ? 3.561   74.853  36.477  1.00 37.92  ? 1120 ASP A C     1 
ATOM   9139  O  O     . ASP C 3 1120 ? 4.254   74.264  37.306  1.00 39.40  ? 1120 ASP A O     1 
ATOM   9140  C  CB    . ASP C 3 1120 ? 1.350   74.789  37.648  1.00 38.35  ? 1120 ASP A CB    1 
ATOM   9141  C  CG    . ASP C 3 1120 ? 1.239   76.260  37.993  1.00 40.21  ? 1120 ASP A CG    1 
ATOM   9142  O  OD1   . ASP C 3 1120 ? 2.009   77.072  37.429  1.00 40.76  ? 1120 ASP A OD1   1 
ATOM   9143  O  OD2   . ASP C 3 1120 ? 0.385   76.603  38.841  1.00 41.37  ? 1120 ASP A OD2   1 
ATOM   9144  N  N     . VAL C 3 1121 ? 4.041   75.786  35.669  1.00 37.04  ? 1121 VAL A N     1 
ATOM   9145  C  CA    . VAL C 3 1121 ? 5.435   76.190  35.714  1.00 36.02  ? 1121 VAL A CA    1 
ATOM   9146  C  C     . VAL C 3 1121 ? 5.793   76.643  37.134  1.00 34.86  ? 1121 VAL A C     1 
ATOM   9147  O  O     . VAL C 3 1121 ? 6.856   76.303  37.647  1.00 34.79  ? 1121 VAL A O     1 
ATOM   9148  C  CB    . VAL C 3 1121 ? 5.688   77.342  34.713  1.00 36.97  ? 1121 VAL A CB    1 
ATOM   9149  C  CG1   . VAL C 3 1121 ? 7.081   77.233  34.137  1.00 35.24  ? 1121 VAL A CG1   1 
ATOM   9150  C  CG2   . VAL C 3 1121 ? 4.633   77.297  33.591  1.00 38.34  ? 1121 VAL A CG2   1 
ATOM   9151  N  N     . ASN C 3 1122 ? 4.903   77.398  37.773  1.00 34.00  ? 1122 ASN A N     1 
ATOM   9152  C  CA    . ASN C 3 1122 ? 5.170   77.871  39.126  1.00 33.45  ? 1122 ASN A CA    1 
ATOM   9153  C  C     . ASN C 3 1122 ? 5.174   76.704  40.094  1.00 33.90  ? 1122 ASN A C     1 
ATOM   9154  O  O     . ASN C 3 1122 ? 5.834   76.753  41.134  1.00 34.37  ? 1122 ASN A O     1 
ATOM   9155  C  CB    . ASN C 3 1122 ? 4.126   78.894  39.590  1.00 33.69  ? 1122 ASN A CB    1 
ATOM   9156  C  CG    . ASN C 3 1122 ? 4.204   80.210  38.832  1.00 31.97  ? 1122 ASN A CG    1 
ATOM   9157  O  OD1   . ASN C 3 1122 ? 5.274   80.650  38.417  1.00 31.71  ? 1122 ASN A OD1   1 
ATOM   9158  N  ND2   . ASN C 3 1122 ? 3.062   80.853  38.671  1.00 31.45  ? 1122 ASN A ND2   1 
ATOM   9159  N  N     . ALA C 3 1123 ? 4.431   75.656  39.755  1.00 32.45  ? 1123 ALA A N     1 
ATOM   9160  C  CA    . ALA C 3 1123 ? 4.373   74.480  40.607  1.00 31.33  ? 1123 ALA A CA    1 
ATOM   9161  C  C     . ALA C 3 1123 ? 5.692   73.738  40.505  1.00 31.67  ? 1123 ALA A C     1 
ATOM   9162  O  O     . ALA C 3 1123 ? 6.260   73.331  41.519  1.00 32.32  ? 1123 ALA A O     1 
ATOM   9163  C  CB    . ALA C 3 1123 ? 3.229   73.568  40.184  1.00 30.85  ? 1123 ALA A CB    1 
ATOM   9164  N  N     . ILE C 3 1124 ? 6.186   73.568  39.280  1.00 30.55  ? 1124 ILE A N     1 
ATOM   9165  C  CA    . ILE C 3 1124 ? 7.449   72.866  39.081  1.00 30.18  ? 1124 ILE A CA    1 
ATOM   9166  C  C     . ILE C 3 1124 ? 8.587   73.595  39.785  1.00 30.07  ? 1124 ILE A C     1 
ATOM   9167  O  O     . ILE C 3 1124 ? 9.462   72.978  40.391  1.00 31.68  ? 1124 ILE A O     1 
ATOM   9168  C  CB    . ILE C 3 1124 ? 7.791   72.728  37.581  1.00 28.65  ? 1124 ILE A CB    1 
ATOM   9169  C  CG1   . ILE C 3 1124 ? 6.725   71.868  36.900  1.00 28.28  ? 1124 ILE A CG1   1 
ATOM   9170  C  CG2   . ILE C 3 1124 ? 9.190   72.127  37.411  1.00 25.34  ? 1124 ILE A CG2   1 
ATOM   9171  C  CD1   . ILE C 3 1124 ? 7.005   71.539  35.450  1.00 27.86  ? 1124 ILE A CD1   1 
ATOM   9172  N  N     . ASP C 3 1125 ? 8.554   74.917  39.716  1.00 29.93  ? 1125 ASP A N     1 
ATOM   9173  C  CA    . ASP C 3 1125 ? 9.582   75.743  40.332  1.00 29.50  ? 1125 ASP A CA    1 
ATOM   9174  C  C     . ASP C 3 1125 ? 9.533   75.608  41.857  1.00 28.64  ? 1125 ASP A C     1 
ATOM   9175  O  O     . ASP C 3 1125 ? 10.572  75.621  42.535  1.00 27.50  ? 1125 ASP A O     1 
ATOM   9176  C  CB    . ASP C 3 1125 ? 9.373   77.210  39.924  1.00 29.18  ? 1125 ASP A CB    1 
ATOM   9177  C  CG    . ASP C 3 1125 ? 10.599  78.065  40.173  1.00 33.55  ? 1125 ASP A CG    1 
ATOM   9178  O  OD1   . ASP C 3 1125 ? 11.519  78.047  39.320  1.00 34.31  ? 1125 ASP A OD1   1 
ATOM   9179  O  OD2   . ASP C 3 1125 ? 10.648  78.746  41.228  1.00 36.96  ? 1125 ASP A OD2   1 
ATOM   9180  N  N     . SER C 3 1126 ? 8.318   75.473  42.387  1.00 27.05  ? 1126 SER A N     1 
ATOM   9181  C  CA    . SER C 3 1126 ? 8.117   75.357  43.822  1.00 27.25  ? 1126 SER A CA    1 
ATOM   9182  C  C     . SER C 3 1126 ? 8.583   74.006  44.361  1.00 26.18  ? 1126 SER A C     1 
ATOM   9183  O  O     . SER C 3 1126 ? 9.123   73.919  45.463  1.00 24.56  ? 1126 SER A O     1 
ATOM   9184  C  CB    . SER C 3 1126 ? 6.636   75.572  44.165  1.00 27.40  ? 1126 SER A CB    1 
ATOM   9185  O  OG    . SER C 3 1126 ? 6.412   75.443  45.564  1.00 30.35  ? 1126 SER A OG    1 
ATOM   9186  N  N     . ALA C 3 1127 ? 8.367   72.956  43.580  1.00 25.36  ? 1127 ALA A N     1 
ATOM   9187  C  CA    . ALA C 3 1127 ? 8.762   71.619  43.984  1.00 26.02  ? 1127 ALA A CA    1 
ATOM   9188  C  C     . ALA C 3 1127 ? 10.272  71.517  44.051  1.00 26.67  ? 1127 ALA A C     1 
ATOM   9189  O  O     . ALA C 3 1127 ? 10.825  70.949  44.992  1.00 28.80  ? 1127 ALA A O     1 
ATOM   9190  C  CB    . ALA C 3 1127 ? 8.222   70.599  43.003  1.00 27.31  ? 1127 ALA A CB    1 
ATOM   9191  N  N     . LEU C 3 1128 ? 10.936  72.067  43.043  1.00 26.31  ? 1128 LEU A N     1 
ATOM   9192  C  CA    . LEU C 3 1128 ? 12.392  72.032  42.975  1.00 25.78  ? 1128 LEU A CA    1 
ATOM   9193  C  C     . LEU C 3 1128 ? 13.015  72.778  44.147  1.00 26.86  ? 1128 LEU A C     1 
ATOM   9194  O  O     . LEU C 3 1128 ? 13.938  72.277  44.799  1.00 29.78  ? 1128 LEU A O     1 
ATOM   9195  C  CB    . LEU C 3 1128 ? 12.854  72.641  41.647  1.00 24.96  ? 1128 LEU A CB    1 
ATOM   9196  C  CG    . LEU C 3 1128 ? 12.512  71.803  40.407  1.00 26.67  ? 1128 LEU A CG    1 
ATOM   9197  C  CD1   . LEU C 3 1128 ? 12.406  72.680  39.153  1.00 24.40  ? 1128 LEU A CD1   1 
ATOM   9198  C  CD2   . LEU C 3 1128 ? 13.585  70.721  40.246  1.00 25.31  ? 1128 LEU A CD2   1 
ATOM   9199  N  N     . LEU C 3 1129 ? 12.507  73.974  44.424  1.00 25.89  ? 1129 LEU A N     1 
ATOM   9200  C  CA    . LEU C 3 1129 ? 13.038  74.758  45.516  1.00 25.81  ? 1129 LEU A CA    1 
ATOM   9201  C  C     . LEU C 3 1129 ? 12.704  74.104  46.864  1.00 25.47  ? 1129 LEU A C     1 
ATOM   9202  O  O     . LEU C 3 1129 ? 13.531  74.090  47.791  1.00 23.72  ? 1129 LEU A O     1 
ATOM   9203  C  CB    . LEU C 3 1129 ? 12.508  76.194  45.425  1.00 27.55  ? 1129 LEU A CB    1 
ATOM   9204  C  CG    . LEU C 3 1129 ? 13.187  77.013  44.315  1.00 28.86  ? 1129 LEU A CG    1 
ATOM   9205  C  CD1   . LEU C 3 1129 ? 12.307  78.158  43.871  1.00 29.71  ? 1129 LEU A CD1   1 
ATOM   9206  C  CD2   . LEU C 3 1129 ? 14.527  77.525  44.812  1.00 29.11  ? 1129 LEU A CD2   1 
ATOM   9207  N  N     . ARG C 3 1130 ? 11.506  73.545  46.972  1.00 23.74  ? 1130 ARG A N     1 
ATOM   9208  C  CA    . ARG C 3 1130 ? 11.122  72.890  48.208  1.00 25.41  ? 1130 ARG A CA    1 
ATOM   9209  C  C     . ARG C 3 1130 ? 12.048  71.696  48.477  1.00 26.46  ? 1130 ARG A C     1 
ATOM   9210  O  O     . ARG C 3 1130 ? 12.577  71.551  49.588  1.00 26.34  ? 1130 ARG A O     1 
ATOM   9211  C  CB    . ARG C 3 1130 ? 9.653   72.457  48.150  1.00 25.76  ? 1130 ARG A CB    1 
ATOM   9212  C  CG    . ARG C 3 1130 ? 8.667   73.606  48.394  1.00 28.26  ? 1130 ARG A CG    1 
ATOM   9213  C  CD    . ARG C 3 1130 ? 7.225   73.122  48.523  1.00 29.56  ? 1130 ARG A CD    1 
ATOM   9214  N  NE    . ARG C 3 1130 ? 6.705   72.540  47.283  1.00 33.83  ? 1130 ARG A NE    1 
ATOM   9215  C  CZ    . ARG C 3 1130 ? 6.157   71.327  47.193  1.00 33.70  ? 1130 ARG A CZ    1 
ATOM   9216  N  NH1   . ARG C 3 1130 ? 6.055   70.553  48.269  1.00 33.90  ? 1130 ARG A NH1   1 
ATOM   9217  N  NH2   . ARG C 3 1130 ? 5.705   70.888  46.025  1.00 33.55  ? 1130 ARG A NH2   1 
ATOM   9218  N  N     . LEU C 3 1131 ? 12.253  70.850  47.467  1.00 26.04  ? 1131 LEU A N     1 
ATOM   9219  C  CA    . LEU C 3 1131 ? 13.142  69.696  47.617  1.00 27.64  ? 1131 LEU A CA    1 
ATOM   9220  C  C     . LEU C 3 1131 ? 14.505  70.180  48.106  1.00 27.00  ? 1131 LEU A C     1 
ATOM   9221  O  O     . LEU C 3 1131 ? 15.097  69.586  49.000  1.00 24.52  ? 1131 LEU A O     1 
ATOM   9222  C  CB    . LEU C 3 1131 ? 13.330  68.966  46.282  1.00 27.60  ? 1131 LEU A CB    1 
ATOM   9223  C  CG    . LEU C 3 1131 ? 12.186  68.119  45.722  1.00 28.01  ? 1131 LEU A CG    1 
ATOM   9224  C  CD1   . LEU C 3 1131 ? 12.396  67.897  44.227  1.00 25.61  ? 1131 LEU A CD1   1 
ATOM   9225  C  CD2   . LEU C 3 1131 ? 12.121  66.793  46.473  1.00 27.08  ? 1131 LEU A CD2   1 
ATOM   9226  N  N     . ARG C 3 1132 ? 14.998  71.262  47.508  1.00 28.82  ? 1132 ARG A N     1 
ATOM   9227  C  CA    . ARG C 3 1132 ? 16.288  71.808  47.906  1.00 29.26  ? 1132 ARG A CA    1 
ATOM   9228  C  C     . ARG C 3 1132 ? 16.238  72.246  49.360  1.00 30.12  ? 1132 ARG A C     1 
ATOM   9229  O  O     . ARG C 3 1132 ? 17.119  71.913  50.150  1.00 31.93  ? 1132 ARG A O     1 
ATOM   9230  C  CB    . ARG C 3 1132 ? 16.680  73.010  47.042  1.00 28.00  ? 1132 ARG A CB    1 
ATOM   9231  C  CG    . ARG C 3 1132 ? 18.095  73.494  47.346  1.00 27.27  ? 1132 ARG A CG    1 
ATOM   9232  C  CD    . ARG C 3 1132 ? 18.517  74.705  46.532  1.00 26.61  ? 1132 ARG A CD    1 
ATOM   9233  N  NE    . ARG C 3 1132 ? 17.942  75.944  47.051  1.00 27.69  ? 1132 ARG A NE    1 
ATOM   9234  C  CZ    . ARG C 3 1132 ? 18.343  77.162  46.692  1.00 28.17  ? 1132 ARG A CZ    1 
ATOM   9235  N  NH1   . ARG C 3 1132 ? 19.321  77.307  45.806  1.00 29.11  ? 1132 ARG A NH1   1 
ATOM   9236  N  NH2   . ARG C 3 1132 ? 17.777  78.240  47.224  1.00 29.20  ? 1132 ARG A NH2   1 
ATOM   9237  N  N     . THR C 3 1133 ? 15.189  72.976  49.716  1.00 30.96  ? 1133 THR A N     1 
ATOM   9238  C  CA    . THR C 3 1133 ? 15.033  73.485  51.074  1.00 31.21  ? 1133 THR A CA    1 
ATOM   9239  C  C     . THR C 3 1133 ? 14.849  72.369  52.093  1.00 31.89  ? 1133 THR A C     1 
ATOM   9240  O  O     . THR C 3 1133 ? 15.219  72.513  53.257  1.00 34.03  ? 1133 THR A O     1 
ATOM   9241  C  CB    . THR C 3 1133 ? 13.834  74.448  51.152  1.00 31.38  ? 1133 THR A CB    1 
ATOM   9242  O  OG1   . THR C 3 1133 ? 13.967  75.448  50.134  1.00 30.71  ? 1133 THR A OG1   1 
ATOM   9243  C  CG2   . THR C 3 1133 ? 13.767  75.121  52.510  1.00 29.14  ? 1133 THR A CG2   1 
ATOM   9244  N  N     . LEU C 3 1134 ? 14.288  71.253  51.653  1.00 31.58  ? 1134 LEU A N     1 
ATOM   9245  C  CA    . LEU C 3 1134 ? 14.057  70.137  52.547  1.00 31.72  ? 1134 LEU A CA    1 
ATOM   9246  C  C     . LEU C 3 1134 ? 15.249  69.196  52.664  1.00 32.72  ? 1134 LEU A C     1 
ATOM   9247  O  O     . LEU C 3 1134 ? 15.128  68.084  53.179  1.00 33.72  ? 1134 LEU A O     1 
ATOM   9248  C  CB    . LEU C 3 1134 ? 12.798  69.385  52.112  1.00 31.73  ? 1134 LEU A CB    1 
ATOM   9249  C  CG    . LEU C 3 1134 ? 11.535  70.210  52.423  1.00 33.38  ? 1134 LEU A CG    1 
ATOM   9250  C  CD1   . LEU C 3 1134 ? 10.293  69.592  51.797  1.00 32.36  ? 1134 LEU A CD1   1 
ATOM   9251  C  CD2   . LEU C 3 1134 ? 11.374  70.316  53.948  1.00 32.31  ? 1134 LEU A CD2   1 
ATOM   9252  N  N     . GLY C 3 1135 ? 16.406  69.657  52.203  1.00 32.80  ? 1135 GLY A N     1 
ATOM   9253  C  CA    . GLY C 3 1135 ? 17.612  68.852  52.279  1.00 32.74  ? 1135 GLY A CA    1 
ATOM   9254  C  C     . GLY C 3 1135 ? 17.769  67.763  51.227  1.00 33.81  ? 1135 GLY A C     1 
ATOM   9255  O  O     . GLY C 3 1135 ? 18.730  67.001  51.280  1.00 33.92  ? 1135 GLY A O     1 
ATOM   9256  N  N     . ALA C 3 1136 ? 16.847  67.679  50.272  1.00 33.45  ? 1136 ALA A N     1 
ATOM   9257  C  CA    . ALA C 3 1136 ? 16.926  66.651  49.234  1.00 33.73  ? 1136 ALA A CA    1 
ATOM   9258  C  C     . ALA C 3 1136 ? 18.242  66.694  48.464  1.00 35.31  ? 1136 ALA A C     1 
ATOM   9259  O  O     . ALA C 3 1136 ? 18.885  67.746  48.348  1.00 35.56  ? 1136 ALA A O     1 
ATOM   9260  C  CB    . ALA C 3 1136 ? 15.753  66.785  48.268  1.00 30.90  ? 1136 ALA A CB    1 
ATOM   9261  N  N     . ASP C 3 1137 ? 18.644  65.536  47.945  1.00 37.18  ? 1137 ASP A N     1 
ATOM   9262  C  CA    . ASP C 3 1137 ? 19.877  65.435  47.177  1.00 38.81  ? 1137 ASP A CA    1 
ATOM   9263  C  C     . ASP C 3 1137 ? 19.632  65.825  45.720  1.00 39.04  ? 1137 ASP A C     1 
ATOM   9264  O  O     . ASP C 3 1137 ? 18.526  65.666  45.198  1.00 38.45  ? 1137 ASP A O     1 
ATOM   9265  C  CB    . ASP C 3 1137 ? 20.432  64.006  47.247  1.00 42.26  ? 1137 ASP A CB    1 
ATOM   9266  C  CG    . ASP C 3 1137 ? 21.537  63.752  46.222  1.00 45.65  ? 1137 ASP A CG    1 
ATOM   9267  O  OD1   . ASP C 3 1137 ? 22.577  64.452  46.266  1.00 46.98  ? 1137 ASP A OD1   1 
ATOM   9268  O  OD2   . ASP C 3 1137 ? 21.359  62.854  45.367  1.00 45.24  ? 1137 ASP A OD2   1 
ATOM   9269  N  N     . LYS C 3 1138 ? 20.673  66.338  45.072  1.00 38.59  ? 1138 LYS A N     1 
ATOM   9270  C  CA    . LYS C 3 1138 ? 20.592  66.748  43.679  1.00 38.30  ? 1138 LYS A CA    1 
ATOM   9271  C  C     . LYS C 3 1138 ? 19.844  65.722  42.828  1.00 38.61  ? 1138 LYS A C     1 
ATOM   9272  O  O     . LYS C 3 1138 ? 18.946  66.072  42.059  1.00 39.38  ? 1138 LYS A O     1 
ATOM   9273  C  CB    . LYS C 3 1138 ? 22.007  66.960  43.137  1.00 38.31  ? 1138 LYS A CB    1 
ATOM   9274  C  CG    . LYS C 3 1138 ? 22.100  67.378  41.677  1.00 38.68  ? 1138 LYS A CG    1 
ATOM   9275  C  CD    . LYS C 3 1138 ? 23.564  67.530  41.272  1.00 38.52  ? 1138 LYS A CD    1 
ATOM   9276  C  CE    . LYS C 3 1138 ? 23.751  67.454  39.766  1.00 41.32  ? 1138 LYS A CE    1 
ATOM   9277  N  NZ    . LYS C 3 1138 ? 25.192  67.519  39.367  1.00 43.31  ? 1138 LYS A NZ    1 
ATOM   9278  N  N     . LYS C 3 1139 ? 20.198  64.450  42.975  1.00 38.25  ? 1139 LYS A N     1 
ATOM   9279  C  CA    . LYS C 3 1139 ? 19.549  63.406  42.192  1.00 38.32  ? 1139 LYS A CA    1 
ATOM   9280  C  C     . LYS C 3 1139 ? 18.030  63.478  42.257  1.00 36.62  ? 1139 LYS A C     1 
ATOM   9281  O  O     . LYS C 3 1139 ? 17.341  62.986  41.360  1.00 37.09  ? 1139 LYS A O     1 
ATOM   9282  C  CB    . LYS C 3 1139 ? 20.031  62.016  42.635  1.00 40.32  ? 1139 LYS A CB    1 
ATOM   9283  C  CG    . LYS C 3 1139 ? 21.488  61.737  42.274  1.00 42.78  ? 1139 LYS A CG    1 
ATOM   9284  C  CD    . LYS C 3 1139 ? 21.898  60.297  42.575  1.00 46.30  ? 1139 LYS A CD    1 
ATOM   9285  C  CE    . LYS C 3 1139 ? 21.242  59.306  41.617  1.00 47.64  ? 1139 LYS A CE    1 
ATOM   9286  N  NZ    . LYS C 3 1139 ? 21.667  59.492  40.196  1.00 49.83  ? 1139 LYS A NZ    1 
ATOM   9287  N  N     . ALA C 3 1140 ? 17.514  64.094  43.317  1.00 35.21  ? 1140 ALA A N     1 
ATOM   9288  C  CA    . ALA C 3 1140 ? 16.073  64.233  43.502  1.00 33.17  ? 1140 ALA A CA    1 
ATOM   9289  C  C     . ALA C 3 1140 ? 15.530  65.348  42.609  1.00 32.81  ? 1140 ALA A C     1 
ATOM   9290  O  O     . ALA C 3 1140 ? 14.403  65.256  42.114  1.00 31.85  ? 1140 ALA A O     1 
ATOM   9291  C  CB    . ALA C 3 1140 ? 15.755  64.526  44.962  1.00 33.20  ? 1140 ALA A CB    1 
ATOM   9292  N  N     . LEU C 3 1141 ? 16.313  66.409  42.411  1.00 30.96  ? 1141 LEU A N     1 
ATOM   9293  C  CA    . LEU C 3 1141 ? 15.850  67.479  41.540  1.00 29.88  ? 1141 LEU A CA    1 
ATOM   9294  C  C     . LEU C 3 1141 ? 16.000  66.970  40.116  1.00 30.92  ? 1141 LEU A C     1 
ATOM   9295  O  O     . LEU C 3 1141 ? 15.169  67.256  39.247  1.00 31.28  ? 1141 LEU A O     1 
ATOM   9296  C  CB    . LEU C 3 1141 ? 16.640  68.771  41.757  1.00 26.99  ? 1141 LEU A CB    1 
ATOM   9297  C  CG    . LEU C 3 1141 ? 16.165  69.570  42.981  1.00 25.56  ? 1141 LEU A CG    1 
ATOM   9298  C  CD1   . LEU C 3 1141 ? 16.569  68.813  44.236  1.00 26.09  ? 1141 LEU A CD1   1 
ATOM   9299  C  CD2   . LEU C 3 1141 ? 16.770  70.973  43.008  1.00 23.45  ? 1141 LEU A CD2   1 
ATOM   9300  N  N     . THR C 3 1142 ? 17.042  66.177  39.884  1.00 30.14  ? 1142 THR A N     1 
ATOM   9301  C  CA    . THR C 3 1142 ? 17.252  65.622  38.561  1.00 29.08  ? 1142 THR A CA    1 
ATOM   9302  C  C     . THR C 3 1142 ? 16.086  64.705  38.254  1.00 29.16  ? 1142 THR A C     1 
ATOM   9303  O  O     . THR C 3 1142 ? 15.648  64.607  37.110  1.00 30.80  ? 1142 THR A O     1 
ATOM   9304  C  CB    . THR C 3 1142 ? 18.552  64.823  38.484  1.00 29.19  ? 1142 THR A CB    1 
ATOM   9305  O  OG1   . THR C 3 1142 ? 19.656  65.692  38.768  1.00 31.13  ? 1142 THR A OG1   1 
ATOM   9306  C  CG2   . THR C 3 1142 ? 18.727  64.226  37.096  1.00 26.22  ? 1142 THR A CG2   1 
ATOM   9307  N  N     . ALA C 3 1143 ? 15.569  64.037  39.276  1.00 27.75  ? 1143 ALA A N     1 
ATOM   9308  C  CA    . ALA C 3 1143 ? 14.442  63.142  39.062  1.00 29.56  ? 1143 ALA A CA    1 
ATOM   9309  C  C     . ALA C 3 1143 ? 13.188  63.954  38.726  1.00 30.61  ? 1143 ALA A C     1 
ATOM   9310  O  O     . ALA C 3 1143 ? 12.444  63.622  37.793  1.00 31.54  ? 1143 ALA A O     1 
ATOM   9311  C  CB    . ALA C 3 1143 ? 14.204  62.285  40.297  1.00 26.38  ? 1143 ALA A CB    1 
ATOM   9312  N  N     . GLN C 3 1144 ? 12.963  65.023  39.487  1.00 30.52  ? 1144 GLN A N     1 
ATOM   9313  C  CA    . GLN C 3 1144 ? 11.805  65.880  39.273  1.00 29.41  ? 1144 GLN A CA    1 
ATOM   9314  C  C     . GLN C 3 1144 ? 11.793  66.400  37.842  1.00 29.16  ? 1144 GLN A C     1 
ATOM   9315  O  O     . GLN C 3 1144 ? 10.759  66.404  37.180  1.00 29.95  ? 1144 GLN A O     1 
ATOM   9316  C  CB    . GLN C 3 1144 ? 11.841  67.063  40.245  1.00 28.90  ? 1144 GLN A CB    1 
ATOM   9317  C  CG    . GLN C 3 1144 ? 10.731  68.067  40.033  1.00 27.53  ? 1144 GLN A CG    1 
ATOM   9318  C  CD    . GLN C 3 1144 ? 9.355   67.476  40.276  1.00 28.97  ? 1144 GLN A CD    1 
ATOM   9319  O  OE1   . GLN C 3 1144 ? 8.968   67.222  41.418  1.00 31.95  ? 1144 GLN A OE1   1 
ATOM   9320  N  NE2   . GLN C 3 1144 ? 8.608   67.246  39.199  1.00 29.30  ? 1144 GLN A NE2   1 
ATOM   9321  N  N     . LEU C 3 1145 ? 12.955  66.840  37.375  1.00 28.28  ? 1145 LEU A N     1 
ATOM   9322  C  CA    . LEU C 3 1145 ? 13.085  67.374  36.032  1.00 27.67  ? 1145 LEU A CA    1 
ATOM   9323  C  C     . LEU C 3 1145 ? 12.831  66.318  34.959  1.00 28.47  ? 1145 LEU A C     1 
ATOM   9324  O  O     . LEU C 3 1145 ? 12.253  66.616  33.917  1.00 30.13  ? 1145 LEU A O     1 
ATOM   9325  C  CB    . LEU C 3 1145 ? 14.466  68.008  35.875  1.00 28.22  ? 1145 LEU A CB    1 
ATOM   9326  C  CG    . LEU C 3 1145 ? 14.658  69.275  36.723  1.00 30.37  ? 1145 LEU A CG    1 
ATOM   9327  C  CD1   . LEU C 3 1145 ? 16.091  69.783  36.614  1.00 29.56  ? 1145 LEU A CD1   1 
ATOM   9328  C  CD2   . LEU C 3 1145 ? 13.668  70.353  36.255  1.00 29.84  ? 1145 LEU A CD2   1 
ATOM   9329  N  N     . LEU C 3 1146 ? 13.246  65.081  35.210  1.00 28.81  ? 1146 LEU A N     1 
ATOM   9330  C  CA    . LEU C 3 1146 ? 13.018  64.006  34.248  1.00 27.82  ? 1146 LEU A CA    1 
ATOM   9331  C  C     . LEU C 3 1146 ? 11.527  63.738  34.107  1.00 28.08  ? 1146 LEU A C     1 
ATOM   9332  O  O     . LEU C 3 1146 ? 11.040  63.476  33.010  1.00 28.02  ? 1146 LEU A O     1 
ATOM   9333  C  CB    . LEU C 3 1146 ? 13.711  62.723  34.700  1.00 28.30  ? 1146 LEU A CB    1 
ATOM   9334  C  CG    . LEU C 3 1146 ? 15.235  62.645  34.584  1.00 30.02  ? 1146 LEU A CG    1 
ATOM   9335  C  CD1   . LEU C 3 1146 ? 15.757  61.550  35.519  1.00 29.14  ? 1146 LEU A CD1   1 
ATOM   9336  C  CD2   . LEU C 3 1146 ? 15.631  62.393  33.130  1.00 27.77  ? 1146 LEU A CD2   1 
ATOM   9337  N  N     . MET C 3 1147 ? 10.805  63.807  35.223  1.00 28.35  ? 1147 MET A N     1 
ATOM   9338  C  CA    . MET C 3 1147 ? 9.368   63.566  35.224  1.00 28.63  ? 1147 MET A CA    1 
ATOM   9339  C  C     . MET C 3 1147 ? 8.538   64.616  34.484  1.00 29.30  ? 1147 MET A C     1 
ATOM   9340  O  O     . MET C 3 1147 ? 7.386   64.365  34.136  1.00 28.48  ? 1147 MET A O     1 
ATOM   9341  C  CB    . MET C 3 1147 ? 8.867   63.415  36.658  1.00 28.17  ? 1147 MET A CB    1 
ATOM   9342  C  CG    . MET C 3 1147 ? 9.350   62.135  37.318  1.00 28.81  ? 1147 MET A CG    1 
ATOM   9343  S  SD    . MET C 3 1147 ? 8.701   61.920  38.973  1.00 30.87  ? 1147 MET A SD    1 
ATOM   9344  C  CE    . MET C 3 1147 ? 7.174   60.995  38.628  1.00 31.65  ? 1147 MET A CE    1 
ATOM   9345  N  N     . VAL C 3 1148 ? 9.111   65.792  34.246  1.00 30.32  ? 1148 VAL A N     1 
ATOM   9346  C  CA    . VAL C 3 1148 ? 8.393   66.817  33.511  1.00 29.94  ? 1148 VAL A CA    1 
ATOM   9347  C  C     . VAL C 3 1148 ? 8.887   66.912  32.068  1.00 30.73  ? 1148 VAL A C     1 
ATOM   9348  O  O     . VAL C 3 1148 ? 8.589   67.871  31.358  1.00 31.34  ? 1148 VAL A O     1 
ATOM   9349  C  CB    . VAL C 3 1148 ? 8.474   68.185  34.206  1.00 29.52  ? 1148 VAL A CB    1 
ATOM   9350  C  CG1   . VAL C 3 1148 ? 7.698   68.136  35.505  1.00 28.27  ? 1148 VAL A CG1   1 
ATOM   9351  C  CG2   . VAL C 3 1148 ? 9.911   68.564  34.464  1.00 30.11  ? 1148 VAL A CG2   1 
ATOM   9352  N  N     . GLY C 3 1149 ? 9.653   65.908  31.646  1.00 32.35  ? 1149 GLY A N     1 
ATOM   9353  C  CA    . GLY C 3 1149 ? 10.117  65.847  30.266  1.00 32.70  ? 1149 GLY A CA    1 
ATOM   9354  C  C     . GLY C 3 1149 ? 11.549  66.124  29.841  1.00 32.38  ? 1149 GLY A C     1 
ATOM   9355  O  O     . GLY C 3 1149 ? 11.860  65.955  28.671  1.00 32.82  ? 1149 GLY A O     1 
ATOM   9356  N  N     . LEU C 3 1150 ? 12.422  66.537  30.750  1.00 32.33  ? 1150 LEU A N     1 
ATOM   9357  C  CA    . LEU C 3 1150 ? 13.799  66.830  30.373  1.00 33.63  ? 1150 LEU A CA    1 
ATOM   9358  C  C     . LEU C 3 1150 ? 14.695  65.624  30.163  1.00 35.33  ? 1150 LEU A C     1 
ATOM   9359  O  O     . LEU C 3 1150 ? 14.513  64.579  30.778  1.00 35.55  ? 1150 LEU A O     1 
ATOM   9360  C  CB    . LEU C 3 1150 ? 14.459  67.737  31.408  1.00 33.99  ? 1150 LEU A CB    1 
ATOM   9361  C  CG    . LEU C 3 1150 ? 14.063  69.208  31.353  1.00 34.94  ? 1150 LEU A CG    1 
ATOM   9362  C  CD1   . LEU C 3 1150 ? 12.569  69.325  31.594  1.00 36.22  ? 1150 LEU A CD1   1 
ATOM   9363  C  CD2   . LEU C 3 1150 ? 14.851  69.997  32.393  1.00 34.66  ? 1150 LEU A CD2   1 
ATOM   9364  N  N     . GLN C 3 1151 ? 15.674  65.797  29.282  1.00 38.39  ? 1151 GLN A N     1 
ATOM   9365  C  CA    . GLN C 3 1151 ? 16.659  64.767  28.968  1.00 39.29  ? 1151 GLN A CA    1 
ATOM   9366  C  C     . GLN C 3 1151 ? 17.600  64.732  30.177  1.00 39.57  ? 1151 GLN A C     1 
ATOM   9367  O  O     . GLN C 3 1151 ? 17.848  65.777  30.780  1.00 40.32  ? 1151 GLN A O     1 
ATOM   9368  C  CB    . GLN C 3 1151 ? 17.419  65.172  27.707  1.00 39.06  ? 1151 GLN A CB    1 
ATOM   9369  C  CG    . GLN C 3 1151 ? 18.124  64.036  26.999  1.00 41.96  ? 1151 GLN A CG    1 
ATOM   9370  C  CD    . GLN C 3 1151 ? 19.630  64.245  26.923  1.00 44.73  ? 1151 GLN A CD    1 
ATOM   9371  O  OE1   . GLN C 3 1151 ? 20.389  63.800  27.803  1.00 43.18  ? 1151 GLN A OE1   1 
ATOM   9372  N  NE2   . GLN C 3 1151 ? 20.072  64.935  25.872  1.00 45.61  ? 1151 GLN A NE2   1 
ATOM   9373  N  N     . GLU C 3 1152 ? 18.117  63.555  30.538  1.00 39.23  ? 1152 GLU A N     1 
ATOM   9374  C  CA    . GLU C 3 1152 ? 18.999  63.451  31.705  1.00 40.57  ? 1152 GLU A CA    1 
ATOM   9375  C  C     . GLU C 3 1152 ? 20.106  64.486  31.783  1.00 39.00  ? 1152 GLU A C     1 
ATOM   9376  O  O     . GLU C 3 1152 ? 20.391  65.002  32.855  1.00 39.14  ? 1152 GLU A O     1 
ATOM   9377  C  CB    . GLU C 3 1152 ? 19.611  62.050  31.819  1.00 43.48  ? 1152 GLU A CB    1 
ATOM   9378  C  CG    . GLU C 3 1152 ? 18.677  61.042  32.470  1.00 49.03  ? 1152 GLU A CG    1 
ATOM   9379  C  CD    . GLU C 3 1152 ? 19.341  59.711  32.769  1.00 52.40  ? 1152 GLU A CD    1 
ATOM   9380  O  OE1   . GLU C 3 1152 ? 19.875  59.082  31.828  1.00 54.23  ? 1152 GLU A OE1   1 
ATOM   9381  O  OE2   . GLU C 3 1152 ? 19.320  59.290  33.947  1.00 54.30  ? 1152 GLU A OE2   1 
ATOM   9382  N  N     . SER C 3 1153 ? 20.726  64.790  30.653  1.00 38.37  ? 1153 SER A N     1 
ATOM   9383  C  CA    . SER C 3 1153 ? 21.806  65.772  30.612  1.00 39.06  ? 1153 SER A CA    1 
ATOM   9384  C  C     . SER C 3 1153 ? 21.346  67.156  31.063  1.00 38.59  ? 1153 SER A C     1 
ATOM   9385  O  O     . SER C 3 1153 ? 21.999  67.788  31.894  1.00 38.14  ? 1153 SER A O     1 
ATOM   9386  C  CB    . SER C 3 1153 ? 22.375  65.863  29.195  1.00 39.93  ? 1153 SER A CB    1 
ATOM   9387  O  OG    . SER C 3 1153 ? 22.755  64.581  28.724  1.00 43.23  ? 1153 SER A OG    1 
ATOM   9388  N  N     . GLU C 3 1154 ? 20.237  67.632  30.499  1.00 38.48  ? 1154 GLU A N     1 
ATOM   9389  C  CA    . GLU C 3 1154 ? 19.705  68.940  30.870  1.00 39.29  ? 1154 GLU A CA    1 
ATOM   9390  C  C     . GLU C 3 1154 ? 19.224  68.884  32.309  1.00 37.89  ? 1154 GLU A C     1 
ATOM   9391  O  O     . GLU C 3 1154 ? 19.442  69.815  33.086  1.00 38.66  ? 1154 GLU A O     1 
ATOM   9392  C  CB    . GLU C 3 1154 ? 18.531  69.339  29.976  1.00 40.91  ? 1154 GLU A CB    1 
ATOM   9393  C  CG    . GLU C 3 1154 ? 18.894  69.656  28.548  1.00 45.12  ? 1154 GLU A CG    1 
ATOM   9394  C  CD    . GLU C 3 1154 ? 17.720  70.238  27.782  1.00 48.52  ? 1154 GLU A CD    1 
ATOM   9395  O  OE1   . GLU C 3 1154 ? 17.240  71.330  28.165  1.00 49.03  ? 1154 GLU A OE1   1 
ATOM   9396  O  OE2   . GLU C 3 1154 ? 17.274  69.602  26.801  1.00 51.22  ? 1154 GLU A OE2   1 
ATOM   9397  N  N     . ALA C 3 1155 ? 18.569  67.780  32.650  1.00 35.19  ? 1155 ALA A N     1 
ATOM   9398  C  CA    . ALA C 3 1155 ? 18.047  67.570  33.993  1.00 34.44  ? 1155 ALA A CA    1 
ATOM   9399  C  C     . ALA C 3 1155 ? 19.146  67.705  35.040  1.00 33.41  ? 1155 ALA A C     1 
ATOM   9400  O  O     . ALA C 3 1155 ? 19.033  68.502  35.967  1.00 32.49  ? 1155 ALA A O     1 
ATOM   9401  C  CB    . ALA C 3 1155 ? 17.403  66.191  34.090  1.00 33.97  ? 1155 ALA A CB    1 
ATOM   9402  N  N     . ASP C 3 1156 ? 20.204  66.912  34.884  1.00 33.82  ? 1156 ASP A N     1 
ATOM   9403  C  CA    . ASP C 3 1156 ? 21.341  66.924  35.805  1.00 32.91  ? 1156 ASP A CA    1 
ATOM   9404  C  C     . ASP C 3 1156 ? 21.999  68.299  35.870  1.00 31.35  ? 1156 ASP A C     1 
ATOM   9405  O  O     . ASP C 3 1156 ? 22.441  68.739  36.939  1.00 31.20  ? 1156 ASP A O     1 
ATOM   9406  C  CB    . ASP C 3 1156 ? 22.389  65.892  35.376  1.00 34.28  ? 1156 ASP A CB    1 
ATOM   9407  C  CG    . ASP C 3 1156 ? 23.592  65.865  36.303  1.00 36.14  ? 1156 ASP A CG    1 
ATOM   9408  O  OD1   . ASP C 3 1156 ? 23.491  65.247  37.387  1.00 36.32  ? 1156 ASP A OD1   1 
ATOM   9409  O  OD2   . ASP C 3 1156 ? 24.628  66.474  35.953  1.00 36.00  ? 1156 ASP A OD2   1 
ATOM   9410  N  N     . ALA C 3 1157 ? 22.070  68.969  34.725  1.00 29.28  ? 1157 ALA A N     1 
ATOM   9411  C  CA    . ALA C 3 1157 ? 22.677  70.296  34.659  1.00 29.20  ? 1157 ALA A CA    1 
ATOM   9412  C  C     . ALA C 3 1157 ? 21.828  71.339  35.389  1.00 28.27  ? 1157 ALA A C     1 
ATOM   9413  O  O     . ALA C 3 1157 ? 22.345  72.075  36.228  1.00 28.16  ? 1157 ALA A O     1 
ATOM   9414  C  CB    . ALA C 3 1157 ? 22.884  70.711  33.210  1.00 28.59  ? 1157 ALA A CB    1 
ATOM   9415  N  N     . LEU C 3 1158 ? 20.536  71.411  35.070  1.00 26.25  ? 1158 LEU A N     1 
ATOM   9416  C  CA    . LEU C 3 1158 ? 19.669  72.375  35.743  1.00 26.98  ? 1158 LEU A CA    1 
ATOM   9417  C  C     . LEU C 3 1158 ? 19.576  72.040  37.237  1.00 27.32  ? 1158 LEU A C     1 
ATOM   9418  O  O     . LEU C 3 1158 ? 19.576  72.935  38.085  1.00 26.38  ? 1158 LEU A O     1 
ATOM   9419  C  CB    . LEU C 3 1158 ? 18.271  72.394  35.121  1.00 25.51  ? 1158 LEU A CB    1 
ATOM   9420  C  CG    . LEU C 3 1158 ? 17.316  73.359  35.833  1.00 27.67  ? 1158 LEU A CG    1 
ATOM   9421  C  CD1   . LEU C 3 1158 ? 17.891  74.767  35.783  1.00 24.95  ? 1158 LEU A CD1   1 
ATOM   9422  C  CD2   . LEU C 3 1158 ? 15.940  73.315  35.193  1.00 25.01  ? 1158 LEU A CD2   1 
ATOM   9423  N  N     . ALA C 3 1159 ? 19.507  70.749  37.554  1.00 27.09  ? 1159 ALA A N     1 
ATOM   9424  C  CA    . ALA C 3 1159 ? 19.448  70.314  38.943  1.00 29.36  ? 1159 ALA A CA    1 
ATOM   9425  C  C     . ALA C 3 1159 ? 20.695  70.838  39.672  1.00 30.62  ? 1159 ALA A C     1 
ATOM   9426  O  O     . ALA C 3 1159 ? 20.591  71.546  40.683  1.00 31.32  ? 1159 ALA A O     1 
ATOM   9427  C  CB    . ALA C 3 1159 ? 19.391  68.786  39.014  1.00 28.29  ? 1159 ALA A CB    1 
ATOM   9428  N  N     . GLY C 3 1160 ? 21.871  70.497  39.142  1.00 32.18  ? 1160 GLY A N     1 
ATOM   9429  C  CA    . GLY C 3 1160 ? 23.120  70.943  39.737  1.00 31.71  ? 1160 GLY A CA    1 
ATOM   9430  C  C     . GLY C 3 1160 ? 23.205  72.457  39.787  1.00 32.18  ? 1160 GLY A C     1 
ATOM   9431  O  O     . GLY C 3 1160 ? 23.841  73.027  40.674  1.00 31.92  ? 1160 GLY A O     1 
ATOM   9432  N  N     . LYS C 3 1161 ? 22.560  73.114  38.829  1.00 32.77  ? 1161 LYS A N     1 
ATOM   9433  C  CA    . LYS C 3 1161 ? 22.563  74.567  38.790  1.00 34.25  ? 1161 LYS A CA    1 
ATOM   9434  C  C     . LYS C 3 1161 ? 21.675  75.125  39.908  1.00 34.51  ? 1161 LYS A C     1 
ATOM   9435  O  O     . LYS C 3 1161 ? 22.053  76.070  40.595  1.00 35.60  ? 1161 LYS A O     1 
ATOM   9436  C  CB    . LYS C 3 1161 ? 22.067  75.065  37.429  1.00 34.57  ? 1161 LYS A CB    1 
ATOM   9437  C  CG    . LYS C 3 1161 ? 22.099  76.577  37.288  1.00 35.89  ? 1161 LYS A CG    1 
ATOM   9438  C  CD    . LYS C 3 1161 ? 21.557  77.017  35.940  1.00 37.69  ? 1161 LYS A CD    1 
ATOM   9439  C  CE    . LYS C 3 1161 ? 21.471  78.535  35.846  1.00 38.48  ? 1161 LYS A CE    1 
ATOM   9440  N  NZ    . LYS C 3 1161 ? 21.077  78.961  34.472  1.00 40.41  ? 1161 LYS A NZ    1 
ATOM   9441  N  N     . ILE C 3 1162 ? 20.501  74.530  40.089  1.00 34.48  ? 1162 ILE A N     1 
ATOM   9442  C  CA    . ILE C 3 1162 ? 19.570  74.965  41.125  1.00 35.07  ? 1162 ILE A CA    1 
ATOM   9443  C  C     . ILE C 3 1162 ? 20.166  74.811  42.532  1.00 35.98  ? 1162 ILE A C     1 
ATOM   9444  O  O     . ILE C 3 1162 ? 19.963  75.664  43.401  1.00 36.87  ? 1162 ILE A O     1 
ATOM   9445  C  CB    . ILE C 3 1162 ? 18.243  74.163  41.045  1.00 34.17  ? 1162 ILE A CB    1 
ATOM   9446  C  CG1   . ILE C 3 1162 ? 17.521  74.481  39.737  1.00 32.91  ? 1162 ILE A CG1   1 
ATOM   9447  C  CG2   . ILE C 3 1162 ? 17.360  74.488  42.227  1.00 32.75  ? 1162 ILE A CG2   1 
ATOM   9448  C  CD1   . ILE C 3 1162 ? 16.287  73.650  39.492  1.00 32.41  ? 1162 ILE A CD1   1 
ATOM   9449  N  N     . MET C 3 1163 ? 20.909  73.733  42.755  1.00 35.32  ? 1163 MET A N     1 
ATOM   9450  C  CA    . MET C 3 1163 ? 21.507  73.486  44.068  1.00 34.73  ? 1163 MET A CA    1 
ATOM   9451  C  C     . MET C 3 1163 ? 22.448  74.582  44.571  1.00 34.21  ? 1163 MET A C     1 
ATOM   9452  O  O     . MET C 3 1163 ? 22.429  74.939  45.743  1.00 35.55  ? 1163 MET A O     1 
ATOM   9453  C  CB    . MET C 3 1163 ? 22.270  72.164  44.051  1.00 33.86  ? 1163 MET A CB    1 
ATOM   9454  C  CG    . MET C 3 1163 ? 21.413  70.940  43.786  1.00 34.90  ? 1163 MET A CG    1 
ATOM   9455  S  SD    . MET C 3 1163 ? 20.274  70.589  45.138  1.00 37.66  ? 1163 MET A SD    1 
ATOM   9456  C  CE    . MET C 3 1163 ? 21.449  70.271  46.496  1.00 35.30  ? 1163 MET A CE    1 
ATOM   9457  N  N     . LEU C 3 1164 ? 23.269  75.120  43.683  1.00 33.96  ? 1164 LEU A N     1 
ATOM   9458  C  CA    . LEU C 3 1164 ? 24.238  76.131  44.077  1.00 33.37  ? 1164 LEU A CA    1 
ATOM   9459  C  C     . LEU C 3 1164 ? 23.803  77.567  43.831  1.00 32.60  ? 1164 LEU A C     1 
ATOM   9460  O  O     . LEU C 3 1164 ? 24.572  78.494  44.061  1.00 31.27  ? 1164 LEU A O     1 
ATOM   9461  C  CB    . LEU C 3 1164 ? 25.553  75.883  43.331  1.00 34.81  ? 1164 LEU A CB    1 
ATOM   9462  C  CG    . LEU C 3 1164 ? 26.147  74.484  43.459  1.00 34.92  ? 1164 LEU A CG    1 
ATOM   9463  C  CD1   . LEU C 3 1164 ? 27.343  74.357  42.550  1.00 37.13  ? 1164 LEU A CD1   1 
ATOM   9464  C  CD2   . LEU C 3 1164 ? 26.529  74.214  44.906  1.00 35.10  ? 1164 LEU A CD2   1 
ATOM   9465  N  N     . GLN C 3 1165 ? 22.575  77.767  43.384  1.00 33.70  ? 1165 GLN A N     1 
ATOM   9466  C  CA    . GLN C 3 1165 ? 22.131  79.117  43.076  1.00 34.18  ? 1165 GLN A CA    1 
ATOM   9467  C  C     . GLN C 3 1165 ? 21.636  79.979  44.225  1.00 33.68  ? 1165 GLN A C     1 
ATOM   9468  O  O     . GLN C 3 1165 ? 21.039  79.488  45.180  1.00 33.61  ? 1165 GLN A O     1 
ATOM   9469  C  CB    . GLN C 3 1165 ? 21.062  79.052  41.986  1.00 35.17  ? 1165 GLN A CB    1 
ATOM   9470  C  CG    . GLN C 3 1165 ? 20.396  80.375  41.675  1.00 38.79  ? 1165 GLN A CG    1 
ATOM   9471  C  CD    . GLN C 3 1165 ? 19.646  80.336  40.362  1.00 40.47  ? 1165 GLN A CD    1 
ATOM   9472  O  OE1   . GLN C 3 1165 ? 18.589  80.956  40.215  1.00 41.86  ? 1165 GLN A OE1   1 
ATOM   9473  N  NE2   . GLN C 3 1165 ? 20.196  79.614  39.391  1.00 40.12  ? 1165 GLN A NE2   1 
ATOM   9474  N  N     . ASP C 3 1166 ? 21.921  81.271  44.133  1.00 33.65  ? 1166 ASP A N     1 
ATOM   9475  C  CA    . ASP C 3 1166 ? 21.441  82.224  45.121  1.00 34.57  ? 1166 ASP A CA    1 
ATOM   9476  C  C     . ASP C 3 1166 ? 20.107  82.683  44.551  1.00 33.73  ? 1166 ASP A C     1 
ATOM   9477  O  O     . ASP C 3 1166 ? 20.062  83.524  43.655  1.00 33.22  ? 1166 ASP A O     1 
ATOM   9478  C  CB    . ASP C 3 1166 ? 22.388  83.414  45.252  1.00 36.98  ? 1166 ASP A CB    1 
ATOM   9479  C  CG    . ASP C 3 1166 ? 23.439  83.201  46.324  1.00 42.39  ? 1166 ASP A CG    1 
ATOM   9480  O  OD1   . ASP C 3 1166 ? 23.057  83.001  47.499  1.00 45.51  ? 1166 ASP A OD1   1 
ATOM   9481  O  OD2   . ASP C 3 1166 ? 24.648  83.233  46.002  1.00 46.27  ? 1166 ASP A OD2   1 
ATOM   9482  N  N     . VAL C 3 1167 ? 19.028  82.102  45.062  1.00 34.10  ? 1167 VAL A N     1 
ATOM   9483  C  CA    . VAL C 3 1167 ? 17.677  82.405  44.600  1.00 33.68  ? 1167 VAL A CA    1 
ATOM   9484  C  C     . VAL C 3 1167 ? 17.118  83.729  45.129  1.00 33.34  ? 1167 VAL A C     1 
ATOM   9485  O  O     . VAL C 3 1167 ? 17.204  84.021  46.325  1.00 32.43  ? 1167 VAL A O     1 
ATOM   9486  C  CB    . VAL C 3 1167 ? 16.722  81.248  44.971  1.00 34.57  ? 1167 VAL A CB    1 
ATOM   9487  C  CG1   . VAL C 3 1167 ? 15.303  81.559  44.490  1.00 35.90  ? 1167 VAL A CG1   1 
ATOM   9488  C  CG2   . VAL C 3 1167 ? 17.230  79.937  44.347  1.00 33.39  ? 1167 VAL A CG2   1 
ATOM   9489  N  N     . ASN C 3 1168 ? 16.543  84.521  44.222  1.00 32.55  ? 1168 ASN A N     1 
ATOM   9490  C  CA    . ASN C 3 1168 ? 15.976  85.826  44.554  1.00 31.70  ? 1168 ASN A CA    1 
ATOM   9491  C  C     . ASN C 3 1168 ? 14.735  85.729  45.424  1.00 29.44  ? 1168 ASN A C     1 
ATOM   9492  O  O     . ASN C 3 1168 ? 14.030  84.712  45.413  1.00 29.42  ? 1168 ASN A O     1 
ATOM   9493  C  CB    . ASN C 3 1168 ? 15.645  86.605  43.268  1.00 36.83  ? 1168 ASN A CB    1 
ATOM   9494  C  CG    . ASN C 3 1168 ? 14.576  85.909  42.396  1.00 40.60  ? 1168 ASN A CG    1 
ATOM   9495  O  OD1   . ASN C 3 1168 ? 13.382  85.921  42.720  1.00 39.96  ? 1168 ASN A OD1   1 
ATOM   9496  N  ND2   . ASN C 3 1168 ? 15.013  85.303  41.284  1.00 42.24  ? 1168 ASN A ND2   1 
ATOM   9497  N  N     . THR C 3 1169 ? 14.485  86.800  46.174  1.00 26.89  ? 1169 THR A N     1 
ATOM   9498  C  CA    . THR C 3 1169 ? 13.340  86.911  47.076  1.00 25.52  ? 1169 THR A CA    1 
ATOM   9499  C  C     . THR C 3 1169 ? 12.028  86.399  46.496  1.00 26.31  ? 1169 THR A C     1 
ATOM   9500  O  O     . THR C 3 1169 ? 11.363  85.554  47.100  1.00 26.88  ? 1169 THR A O     1 
ATOM   9501  C  CB    . THR C 3 1169 ? 13.098  88.367  47.480  1.00 25.23  ? 1169 THR A CB    1 
ATOM   9502  O  OG1   . THR C 3 1169 ? 14.207  88.845  48.251  1.00 27.51  ? 1169 THR A OG1   1 
ATOM   9503  C  CG2   . THR C 3 1169 ? 11.818  88.487  48.277  1.00 22.97  ? 1169 THR A CG2   1 
ATOM   9504  N  N     . VAL C 3 1170 ? 11.655  86.919  45.328  1.00 25.22  ? 1170 VAL A N     1 
ATOM   9505  C  CA    . VAL C 3 1170 ? 10.410  86.532  44.686  1.00 24.69  ? 1170 VAL A CA    1 
ATOM   9506  C  C     . VAL C 3 1170 ? 10.336  85.066  44.295  1.00 24.52  ? 1170 VAL A C     1 
ATOM   9507  O  O     . VAL C 3 1170 ? 9.328   84.406  44.536  1.00 26.55  ? 1170 VAL A O     1 
ATOM   9508  C  CB    . VAL C 3 1170 ? 10.134  87.408  43.437  1.00 24.99  ? 1170 VAL A CB    1 
ATOM   9509  C  CG1   . VAL C 3 1170 ? 8.933   86.863  42.639  1.00 19.29  ? 1170 VAL A CG1   1 
ATOM   9510  C  CG2   . VAL C 3 1170 ? 9.868   88.848  43.879  1.00 23.86  ? 1170 VAL A CG2   1 
ATOM   9511  N  N     . GLN C 3 1171 ? 11.391  84.544  43.704  1.00 23.21  ? 1171 GLN A N     1 
ATOM   9512  C  CA    . GLN C 3 1171 ? 11.351  83.161  43.280  1.00 26.23  ? 1171 GLN A CA    1 
ATOM   9513  C  C     . GLN C 3 1171 ? 11.363  82.217  44.461  1.00 28.50  ? 1171 GLN A C     1 
ATOM   9514  O  O     . GLN C 3 1171 ? 10.682  81.191  44.459  1.00 27.09  ? 1171 GLN A O     1 
ATOM   9515  C  CB    . GLN C 3 1171 ? 12.530  82.862  42.360  1.00 27.52  ? 1171 GLN A CB    1 
ATOM   9516  C  CG    . GLN C 3 1171 ? 12.655  81.418  41.937  1.00 28.94  ? 1171 GLN A CG    1 
ATOM   9517  C  CD    . GLN C 3 1171 ? 13.666  81.251  40.825  1.00 31.01  ? 1171 GLN A CD    1 
ATOM   9518  O  OE1   . GLN C 3 1171 ? 14.586  82.060  40.684  1.00 32.96  ? 1171 GLN A OE1   1 
ATOM   9519  N  NE2   . GLN C 3 1171 ? 13.512  80.197  40.035  1.00 31.63  ? 1171 GLN A NE2   1 
ATOM   9520  N  N     . LEU C 3 1172 ? 12.124  82.584  45.484  1.00 29.85  ? 1172 LEU A N     1 
ATOM   9521  C  CA    . LEU C 3 1172 ? 12.242  81.750  46.663  1.00 30.23  ? 1172 LEU A CA    1 
ATOM   9522  C  C     . LEU C 3 1172 ? 10.963  81.716  47.494  1.00 30.80  ? 1172 LEU A C     1 
ATOM   9523  O  O     . LEU C 3 1172 ? 10.608  80.679  48.074  1.00 29.24  ? 1172 LEU A O     1 
ATOM   9524  C  CB    . LEU C 3 1172 ? 13.420  82.232  47.503  1.00 28.74  ? 1172 LEU A CB    1 
ATOM   9525  C  CG    . LEU C 3 1172 ? 13.934  81.269  48.573  1.00 27.58  ? 1172 LEU A CG    1 
ATOM   9526  C  CD1   . LEU C 3 1172 ? 14.066  79.851  48.021  1.00 24.05  ? 1172 LEU A CD1   1 
ATOM   9527  C  CD2   . LEU C 3 1172 ? 15.275  81.785  49.069  1.00 25.39  ? 1172 LEU A CD2   1 
ATOM   9528  N  N     . ALA C 3 1173 ? 10.258  82.842  47.532  1.00 30.83  ? 1173 ALA A N     1 
ATOM   9529  C  CA    . ALA C 3 1173 ? 9.021   82.932  48.305  1.00 29.79  ? 1173 ALA A CA    1 
ATOM   9530  C  C     . ALA C 3 1173 ? 7.953   81.940  47.852  1.00 29.20  ? 1173 ALA A C     1 
ATOM   9531  O  O     . ALA C 3 1173 ? 7.000   81.686  48.588  1.00 29.13  ? 1173 ALA A O     1 
ATOM   9532  C  CB    . ALA C 3 1173 ? 8.471   84.357  48.252  1.00 29.47  ? 1173 ALA A CB    1 
ATOM   9533  N  N     . ARG C 3 1174 ? 8.095   81.382  46.653  1.00 28.31  ? 1174 ARG A N     1 
ATOM   9534  C  CA    . ARG C 3 1174 ? 7.106   80.413  46.181  1.00 30.52  ? 1174 ARG A CA    1 
ATOM   9535  C  C     . ARG C 3 1174 ? 7.160   79.096  46.960  1.00 31.50  ? 1174 ARG A C     1 
ATOM   9536  O  O     . ARG C 3 1174 ? 6.211   78.315  46.918  1.00 32.57  ? 1174 ARG A O     1 
ATOM   9537  C  CB    . ARG C 3 1174 ? 7.271   80.109  44.685  1.00 29.52  ? 1174 ARG A CB    1 
ATOM   9538  C  CG    . ARG C 3 1174 ? 7.042   81.301  43.790  1.00 30.83  ? 1174 ARG A CG    1 
ATOM   9539  C  CD    . ARG C 3 1174 ? 6.328   80.931  42.502  1.00 30.47  ? 1174 ARG A CD    1 
ATOM   9540  N  NE    . ARG C 3 1174 ? 6.384   82.039  41.553  1.00 29.93  ? 1174 ARG A NE    1 
ATOM   9541  C  CZ    . ARG C 3 1174 ? 7.489   82.413  40.915  1.00 30.54  ? 1174 ARG A CZ    1 
ATOM   9542  N  NH1   . ARG C 3 1174 ? 8.629   81.758  41.114  1.00 32.10  ? 1174 ARG A NH1   1 
ATOM   9543  N  NH2   . ARG C 3 1174 ? 7.468   83.458  40.101  1.00 30.14  ? 1174 ARG A NH2   1 
ATOM   9544  N  N     . VAL C 3 1175 ? 8.256   78.844  47.678  1.00 32.58  ? 1175 VAL A N     1 
ATOM   9545  C  CA    . VAL C 3 1175 ? 8.355   77.597  48.438  1.00 32.37  ? 1175 VAL A CA    1 
ATOM   9546  C  C     . VAL C 3 1175 ? 7.228   77.550  49.449  1.00 31.77  ? 1175 VAL A C     1 
ATOM   9547  O  O     . VAL C 3 1175 ? 6.936   76.500  50.018  1.00 32.57  ? 1175 VAL A O     1 
ATOM   9548  C  CB    . VAL C 3 1175 ? 9.696   77.458  49.210  1.00 33.22  ? 1175 VAL A CB    1 
ATOM   9549  C  CG1   . VAL C 3 1175 ? 10.869  77.670  48.264  1.00 35.10  ? 1175 VAL A CG1   1 
ATOM   9550  C  CG2   . VAL C 3 1175 ? 9.741   78.424  50.384  1.00 31.57  ? 1175 VAL A CG2   1 
ATOM   9551  N  N     . VAL C 3 1176 ? 6.591   78.693  49.666  1.00 30.93  ? 1176 VAL A N     1 
ATOM   9552  C  CA    . VAL C 3 1176 ? 5.500   78.750  50.621  1.00 30.92  ? 1176 VAL A CA    1 
ATOM   9553  C  C     . VAL C 3 1176 ? 4.278   79.467  50.037  1.00 30.67  ? 1176 VAL A C     1 
ATOM   9554  O  O     . VAL C 3 1176 ? 3.416   79.981  50.755  1.00 29.64  ? 1176 VAL A O     1 
ATOM   9555  C  CB    . VAL C 3 1176 ? 5.992   79.404  51.937  1.00 29.73  ? 1176 VAL A CB    1 
ATOM   9556  C  CG1   . VAL C 3 1176 ? 5.748   80.890  51.931  1.00 28.95  ? 1176 VAL A CG1   1 
ATOM   9557  C  CG2   . VAL C 3 1176 ? 5.344   78.723  53.108  1.00 32.02  ? 1176 VAL A CG2   1 
ATOM   9558  N  N     . ASN C 3 1177 ? 4.219   79.485  48.710  1.00 30.45  ? 1177 ASN A N     1 
ATOM   9559  C  CA    . ASN C 3 1177 ? 3.112   80.098  47.991  1.00 29.69  ? 1177 ASN A CA    1 
ATOM   9560  C  C     . ASN C 3 1177 ? 2.882   81.588  48.243  1.00 29.14  ? 1177 ASN A C     1 
ATOM   9561  O  O     . ASN C 3 1177 ? 1.742   82.039  48.346  1.00 30.21  ? 1177 ASN A O     1 
ATOM   9562  C  CB    . ASN C 3 1177 ? 1.815   79.327  48.270  1.00 29.11  ? 1177 ASN A CB    1 
ATOM   9563  C  CG    . ASN C 3 1177 ? 1.890   77.869  47.826  1.00 31.05  ? 1177 ASN A CG    1 
ATOM   9564  O  OD1   . ASN C 3 1177 ? 2.634   77.519  46.893  1.00 30.46  ? 1177 ASN A OD1   1 
ATOM   9565  N  ND2   . ASN C 3 1177 ? 1.106   77.011  48.484  1.00 28.71  ? 1177 ASN A ND2   1 
ATOM   9566  N  N     . LEU C 3 1178 ? 3.956   82.355  48.358  1.00 27.61  ? 1178 LEU A N     1 
ATOM   9567  C  CA    . LEU C 3 1178 ? 3.817   83.793  48.541  1.00 25.41  ? 1178 LEU A CA    1 
ATOM   9568  C  C     . LEU C 3 1178 ? 4.038   84.411  47.161  1.00 23.71  ? 1178 LEU A C     1 
ATOM   9569  O  O     . LEU C 3 1178 ? 5.031   84.122  46.484  1.00 25.33  ? 1178 LEU A O     1 
ATOM   9570  C  CB    . LEU C 3 1178 ? 4.848   84.331  49.546  1.00 22.79  ? 1178 LEU A CB    1 
ATOM   9571  C  CG    . LEU C 3 1178 ? 4.497   84.132  51.028  1.00 22.05  ? 1178 LEU A CG    1 
ATOM   9572  C  CD1   . LEU C 3 1178 ? 5.691   84.456  51.907  1.00 18.74  ? 1178 LEU A CD1   1 
ATOM   9573  C  CD2   . LEU C 3 1178 ? 3.317   85.012  51.397  1.00 22.16  ? 1178 LEU A CD2   1 
ATOM   9574  N  N     . ALA C 3 1179 ? 3.103   85.244  46.730  1.00 20.69  ? 1179 ALA A N     1 
ATOM   9575  C  CA    . ALA C 3 1179 ? 3.225   85.876  45.429  1.00 18.63  ? 1179 ALA A CA    1 
ATOM   9576  C  C     . ALA C 3 1179 ? 3.144   87.389  45.529  1.00 18.71  ? 1179 ALA A C     1 
ATOM   9577  O  O     . ALA C 3 1179 ? 2.504   87.931  46.431  1.00 16.81  ? 1179 ALA A O     1 
ATOM   9578  C  CB    . ALA C 3 1179 ? 2.135   85.359  44.500  1.00 16.06  ? 1179 ALA A CB    1 
ATOM   9579  N  N     . VAL C 3 1180 ? 3.816   88.074  44.610  1.00 19.10  ? 1180 VAL A N     1 
ATOM   9580  C  CA    . VAL C 3 1180 ? 3.754   89.525  44.598  1.00 19.15  ? 1180 VAL A CA    1 
ATOM   9581  C  C     . VAL C 3 1180 ? 2.302   89.885  44.301  1.00 19.89  ? 1180 VAL A C     1 
ATOM   9582  O  O     . VAL C 3 1180 ? 1.709   89.400  43.336  1.00 19.44  ? 1180 VAL A O     1 
ATOM   9583  C  CB    . VAL C 3 1180 ? 4.658   90.127  43.506  1.00 19.55  ? 1180 VAL A CB    1 
ATOM   9584  C  CG1   . VAL C 3 1180 ? 4.478   91.645  43.466  1.00 19.82  ? 1180 VAL A CG1   1 
ATOM   9585  C  CG2   . VAL C 3 1180 ? 6.111   89.775  43.791  1.00 18.55  ? 1180 VAL A CG2   1 
ATOM   9586  N  N     . PRO C 3 1181 ? 1.697   90.718  45.148  1.00 21.70  ? 1181 PRO A N     1 
ATOM   9587  C  CA    . PRO C 3 1181 ? 0.303   91.106  44.928  1.00 20.11  ? 1181 PRO A CA    1 
ATOM   9588  C  C     . PRO C 3 1181 ? 0.116   91.842  43.595  1.00 22.18  ? 1181 PRO A C     1 
ATOM   9589  O  O     . PRO C 3 1181 ? 0.992   92.587  43.159  1.00 23.71  ? 1181 PRO A O     1 
ATOM   9590  C  CB    . PRO C 3 1181 ? 0.008   91.999  46.140  1.00 21.48  ? 1181 PRO A CB    1 
ATOM   9591  C  CG    . PRO C 3 1181 ? 0.932   91.449  47.215  1.00 16.93  ? 1181 PRO A CG    1 
ATOM   9592  C  CD    . PRO C 3 1181 ? 2.202   91.233  46.436  1.00 20.06  ? 1181 PRO A CD    1 
ATOM   9593  N  N     . ASP C 3 1182 ? -1.019  91.628  42.941  1.00 23.95  ? 1182 ASP A N     1 
ATOM   9594  C  CA    . ASP C 3 1182 ? -1.287  92.304  41.678  1.00 24.88  ? 1182 ASP A CA    1 
ATOM   9595  C  C     . ASP C 3 1182 ? -1.347  93.804  41.866  1.00 24.44  ? 1182 ASP A C     1 
ATOM   9596  O  O     . ASP C 3 1182 ? -0.849  94.554  41.039  1.00 23.96  ? 1182 ASP A O     1 
ATOM   9597  C  CB    . ASP C 3 1182 ? -2.607  91.838  41.085  1.00 28.51  ? 1182 ASP A CB    1 
ATOM   9598  C  CG    . ASP C 3 1182 ? -2.441  90.642  40.202  1.00 34.33  ? 1182 ASP A CG    1 
ATOM   9599  O  OD1   . ASP C 3 1182 ? -1.334  90.052  40.211  1.00 37.76  ? 1182 ASP A OD1   1 
ATOM   9600  O  OD2   . ASP C 3 1182 ? -3.413  90.290  39.500  1.00 37.74  ? 1182 ASP A OD2   1 
ATOM   9601  N  N     . THR C 3 1183 ? -1.962  94.243  42.955  1.00 22.09  ? 1183 THR A N     1 
ATOM   9602  C  CA    . THR C 3 1183 ? -2.074  95.661  43.206  1.00 22.46  ? 1183 THR A CA    1 
ATOM   9603  C  C     . THR C 3 1183 ? -0.710  96.335  43.344  1.00 22.70  ? 1183 THR A C     1 
ATOM   9604  O  O     . THR C 3 1183 ? -0.576  97.540  43.128  1.00 24.49  ? 1183 THR A O     1 
ATOM   9605  C  CB    . THR C 3 1183 ? -2.929  95.931  44.462  1.00 22.04  ? 1183 THR A CB    1 
ATOM   9606  O  OG1   . THR C 3 1183 ? -2.431  95.165  45.564  1.00 23.52  ? 1183 THR A OG1   1 
ATOM   9607  C  CG2   . THR C 3 1183 ? -4.384  95.571  44.190  1.00 18.39  ? 1183 THR A CG2   1 
ATOM   9608  N  N     . TRP C 3 1184 ? 0.304   95.548  43.673  1.00 22.52  ? 1184 TRP A N     1 
ATOM   9609  C  CA    . TRP C 3 1184 ? 1.662   96.058  43.844  1.00 23.97  ? 1184 TRP A CA    1 
ATOM   9610  C  C     . TRP C 3 1184 ? 2.434   96.236  42.538  1.00 25.35  ? 1184 TRP A C     1 
ATOM   9611  O  O     . TRP C 3 1184 ? 3.408   96.990  42.486  1.00 26.16  ? 1184 TRP A O     1 
ATOM   9612  C  CB    . TRP C 3 1184 ? 2.469   95.098  44.716  1.00 23.89  ? 1184 TRP A CB    1 
ATOM   9613  C  CG    . TRP C 3 1184 ? 2.106   95.065  46.157  1.00 23.01  ? 1184 TRP A CG    1 
ATOM   9614  C  CD1   . TRP C 3 1184 ? 0.943   95.485  46.724  1.00 22.51  ? 1184 TRP A CD1   1 
ATOM   9615  C  CD2   . TRP C 3 1184 ? 2.899   94.514  47.217  1.00 21.96  ? 1184 TRP A CD2   1 
ATOM   9616  N  NE1   . TRP C 3 1184 ? 0.958   95.224  48.077  1.00 24.94  ? 1184 TRP A NE1   1 
ATOM   9617  C  CE2   . TRP C 3 1184 ? 2.146   94.627  48.404  1.00 20.55  ? 1184 TRP A CE2   1 
ATOM   9618  C  CE3   . TRP C 3 1184 ? 4.174   93.932  47.274  1.00 20.17  ? 1184 TRP A CE3   1 
ATOM   9619  C  CZ2   . TRP C 3 1184 ? 2.619   94.182  49.636  1.00 20.50  ? 1184 TRP A CZ2   1 
ATOM   9620  C  CZ3   . TRP C 3 1184 ? 4.647   93.489  48.500  1.00 21.66  ? 1184 TRP A CZ3   1 
ATOM   9621  C  CH2   . TRP C 3 1184 ? 3.867   93.617  49.668  1.00 22.59  ? 1184 TRP A CH2   1 
ATOM   9622  N  N     . MET C 3 1185 ? 2.011   95.522  41.501  1.00 25.49  ? 1185 MET A N     1 
ATOM   9623  C  CA    . MET C 3 1185 ? 2.683   95.540  40.204  1.00 28.01  ? 1185 MET A CA    1 
ATOM   9624  C  C     . MET C 3 1185 ? 3.123   96.888  39.623  1.00 27.38  ? 1185 MET A C     1 
ATOM   9625  O  O     . MET C 3 1185 ? 4.121   96.962  38.909  1.00 28.11  ? 1185 MET A O     1 
ATOM   9626  C  CB    . MET C 3 1185 ? 1.817   94.816  39.168  1.00 29.84  ? 1185 MET A CB    1 
ATOM   9627  C  CG    . MET C 3 1185 ? 1.472   93.388  39.534  1.00 32.46  ? 1185 MET A CG    1 
ATOM   9628  S  SD    . MET C 3 1185 ? 2.886   92.291  39.483  1.00 39.80  ? 1185 MET A SD    1 
ATOM   9629  C  CE    . MET C 3 1185 ? 2.085   90.694  39.857  1.00 35.70  ? 1185 MET A CE    1 
ATOM   9630  N  N     . SER C 3 1186 ? 2.392   97.952  39.909  1.00 26.74  ? 1186 SER A N     1 
ATOM   9631  C  CA    . SER C 3 1186 ? 2.757   99.243  39.347  1.00 25.29  ? 1186 SER A CA    1 
ATOM   9632  C  C     . SER C 3 1186 ? 3.812   99.947  40.180  1.00 25.25  ? 1186 SER A C     1 
ATOM   9633  O  O     . SER C 3 1186 ? 4.240   101.050 39.837  1.00 26.65  ? 1186 SER A O     1 
ATOM   9634  C  CB    . SER C 3 1186 ? 1.513   100.136 39.210  1.00 26.04  ? 1186 SER A CB    1 
ATOM   9635  O  OG    . SER C 3 1186 ? 0.894   100.391 40.470  1.00 26.56  ? 1186 SER A OG    1 
ATOM   9636  N  N     . LEU C 3 1187 ? 4.244   99.305  41.262  1.00 24.14  ? 1187 LEU A N     1 
ATOM   9637  C  CA    . LEU C 3 1187 ? 5.239   99.899  42.151  1.00 23.71  ? 1187 LEU A CA    1 
ATOM   9638  C  C     . LEU C 3 1187 ? 6.571   99.154  42.180  1.00 23.56  ? 1187 LEU A C     1 
ATOM   9639  O  O     . LEU C 3 1187 ? 6.675   98.029  41.707  1.00 22.81  ? 1187 LEU A O     1 
ATOM   9640  C  CB    . LEU C 3 1187 ? 4.668   99.986  43.560  1.00 22.31  ? 1187 LEU A CB    1 
ATOM   9641  C  CG    . LEU C 3 1187 ? 3.367   100.781 43.634  1.00 21.66  ? 1187 LEU A CG    1 
ATOM   9642  C  CD1   . LEU C 3 1187 ? 2.636   100.452 44.931  1.00 21.29  ? 1187 LEU A CD1   1 
ATOM   9643  C  CD2   . LEU C 3 1187 ? 3.670   102.272 43.520  1.00 21.19  ? 1187 LEU A CD2   1 
ATOM   9644  N  N     . ASP C 3 1188 ? 7.586   99.786  42.759  1.00 23.98  ? 1188 ASP A N     1 
ATOM   9645  C  CA    . ASP C 3 1188 ? 8.908   99.181  42.823  1.00 25.35  ? 1188 ASP A CA    1 
ATOM   9646  C  C     . ASP C 3 1188 ? 9.026   98.308  44.073  1.00 25.70  ? 1188 ASP A C     1 
ATOM   9647  O  O     . ASP C 3 1188 ? 9.677   98.688  45.061  1.00 27.18  ? 1188 ASP A O     1 
ATOM   9648  C  CB    . ASP C 3 1188 ? 9.984   100.285 42.786  1.00 24.78  ? 1188 ASP A CB    1 
ATOM   9649  C  CG    . ASP C 3 1188 ? 11.410  99.732  42.756  1.00 27.10  ? 1188 ASP A CG    1 
ATOM   9650  O  OD1   . ASP C 3 1188 ? 11.573  98.511  42.532  1.00 26.73  ? 1188 ASP A OD1   1 
ATOM   9651  O  OD2   . ASP C 3 1188 ? 12.371  100.528 42.949  1.00 24.15  ? 1188 ASP A OD2   1 
ATOM   9652  N  N     . PHE C 3 1189 ? 8.392   97.134  44.014  1.00 24.35  ? 1189 PHE A N     1 
ATOM   9653  C  CA    . PHE C 3 1189 ? 8.400   96.191  45.131  1.00 25.46  ? 1189 PHE A CA    1 
ATOM   9654  C  C     . PHE C 3 1189 ? 9.762   95.509  45.300  1.00 26.49  ? 1189 PHE A C     1 
ATOM   9655  O  O     . PHE C 3 1189 ? 10.134  95.096  46.398  1.00 25.89  ? 1189 PHE A O     1 
ATOM   9656  C  CB    . PHE C 3 1189 ? 7.295   95.151  44.942  1.00 23.01  ? 1189 PHE A CB    1 
ATOM   9657  C  CG    . PHE C 3 1189 ? 7.410   94.371  43.665  1.00 24.86  ? 1189 PHE A CG    1 
ATOM   9658  C  CD1   . PHE C 3 1189 ? 8.188   93.216  43.605  1.00 23.08  ? 1189 PHE A CD1   1 
ATOM   9659  C  CD2   . PHE C 3 1189 ? 6.762   94.806  42.510  1.00 23.57  ? 1189 PHE A CD2   1 
ATOM   9660  C  CE1   . PHE C 3 1189 ? 8.323   92.505  42.414  1.00 22.41  ? 1189 PHE A CE1   1 
ATOM   9661  C  CE2   . PHE C 3 1189 ? 6.891   94.102  41.315  1.00 24.15  ? 1189 PHE A CE2   1 
ATOM   9662  C  CZ    . PHE C 3 1189 ? 7.676   92.946  41.269  1.00 22.79  ? 1189 PHE A CZ    1 
ATOM   9663  N  N     . ASP C 3 1190 ? 10.509  95.412  44.208  1.00 29.00  ? 1190 ASP A N     1 
ATOM   9664  C  CA    . ASP C 3 1190 ? 11.832  94.804  44.235  1.00 29.81  ? 1190 ASP A CA    1 
ATOM   9665  C  C     . ASP C 3 1190 ? 12.716  95.590  45.207  1.00 29.36  ? 1190 ASP A C     1 
ATOM   9666  O  O     . ASP C 3 1190 ? 13.423  95.002  46.026  1.00 30.20  ? 1190 ASP A O     1 
ATOM   9667  C  CB    . ASP C 3 1190 ? 12.435  94.824  42.824  1.00 31.91  ? 1190 ASP A CB    1 
ATOM   9668  C  CG    . ASP C 3 1190 ? 13.742  94.061  42.729  1.00 32.85  ? 1190 ASP A CG    1 
ATOM   9669  O  OD1   . ASP C 3 1190 ? 13.723  92.812  42.789  1.00 33.73  ? 1190 ASP A OD1   1 
ATOM   9670  O  OD2   . ASP C 3 1190 ? 14.794  94.715  42.594  1.00 35.13  ? 1190 ASP A OD2   1 
ATOM   9671  N  N     . SER C 3 1191 ? 12.663  96.919  45.121  1.00 29.03  ? 1191 SER A N     1 
ATOM   9672  C  CA    . SER C 3 1191 ? 13.458  97.784  46.004  1.00 28.37  ? 1191 SER A CA    1 
ATOM   9673  C  C     . SER C 3 1191 ? 12.980  97.718  47.437  1.00 27.66  ? 1191 SER A C     1 
ATOM   9674  O  O     . SER C 3 1191 ? 13.769  97.833  48.371  1.00 27.91  ? 1191 SER A O     1 
ATOM   9675  C  CB    . SER C 3 1191 ? 13.396  99.244  45.553  1.00 27.74  ? 1191 SER A CB    1 
ATOM   9676  O  OG    . SER C 3 1191 ? 14.049  99.414  44.311  1.00 33.14  ? 1191 SER A OG    1 
ATOM   9677  N  N     . MET C 3 1192 ? 11.677  97.559  47.623  1.00 27.50  ? 1192 MET A N     1 
ATOM   9678  C  CA    . MET C 3 1192 ? 11.175  97.485  48.971  1.00 27.06  ? 1192 MET A CA    1 
ATOM   9679  C  C     . MET C 3 1192 ? 11.742  96.241  49.645  1.00 27.71  ? 1192 MET A C     1 
ATOM   9680  O  O     . MET C 3 1192 ? 12.243  96.319  50.765  1.00 29.81  ? 1192 MET A O     1 
ATOM   9681  C  CB    . MET C 3 1192 ? 9.657   97.455  48.976  1.00 26.49  ? 1192 MET A CB    1 
ATOM   9682  C  CG    . MET C 3 1192 ? 9.073   97.302  50.371  1.00 23.15  ? 1192 MET A CG    1 
ATOM   9683  S  SD    . MET C 3 1192 ? 7.302   97.475  50.344  1.00 24.15  ? 1192 MET A SD    1 
ATOM   9684  C  CE    . MET C 3 1192 ? 6.877   96.332  48.964  1.00 21.96  ? 1192 MET A CE    1 
ATOM   9685  N  N     . PHE C 3 1193 ? 11.685  95.102  48.960  1.00 27.57  ? 1193 PHE A N     1 
ATOM   9686  C  CA    . PHE C 3 1193 ? 12.207  93.856  49.522  1.00 28.53  ? 1193 PHE A CA    1 
ATOM   9687  C  C     . PHE C 3 1193 ? 13.701  93.968  49.853  1.00 31.10  ? 1193 PHE A C     1 
ATOM   9688  O  O     . PHE C 3 1193 ? 14.133  93.552  50.930  1.00 31.95  ? 1193 PHE A O     1 
ATOM   9689  C  CB    . PHE C 3 1193 ? 12.017  92.667  48.554  1.00 24.55  ? 1193 PHE A CB    1 
ATOM   9690  C  CG    . PHE C 3 1193 ? 10.576  92.265  48.311  1.00 20.98  ? 1193 PHE A CG    1 
ATOM   9691  C  CD1   . PHE C 3 1193 ? 9.662   92.165  49.362  1.00 20.97  ? 1193 PHE A CD1   1 
ATOM   9692  C  CD2   . PHE C 3 1193 ? 10.150  91.930  47.027  1.00 19.79  ? 1193 PHE A CD2   1 
ATOM   9693  C  CE1   . PHE C 3 1193 ? 8.343   91.733  49.139  1.00 19.06  ? 1193 PHE A CE1   1 
ATOM   9694  C  CE2   . PHE C 3 1193 ? 8.835   91.498  46.788  1.00 20.83  ? 1193 PHE A CE2   1 
ATOM   9695  C  CZ    . PHE C 3 1193 ? 7.929   91.398  47.851  1.00 19.26  ? 1193 PHE A CZ    1 
ATOM   9696  N  N     . LYS C 3 1194 ? 14.483  94.536  48.935  1.00 32.84  ? 1194 LYS A N     1 
ATOM   9697  C  CA    . LYS C 3 1194 ? 15.933  94.652  49.121  1.00 35.46  ? 1194 LYS A CA    1 
ATOM   9698  C  C     . LYS C 3 1194 ? 16.484  95.717  50.064  1.00 36.77  ? 1194 LYS A C     1 
ATOM   9699  O  O     . LYS C 3 1194 ? 17.453  95.462  50.788  1.00 37.96  ? 1194 LYS A O     1 
ATOM   9700  C  CB    . LYS C 3 1194 ? 16.638  94.840  47.769  1.00 34.65  ? 1194 LYS A CB    1 
ATOM   9701  C  CG    . LYS C 3 1194 ? 16.455  93.697  46.790  1.00 37.81  ? 1194 LYS A CG    1 
ATOM   9702  C  CD    . LYS C 3 1194 ? 17.158  93.979  45.464  1.00 38.56  ? 1194 LYS A CD    1 
ATOM   9703  C  CE    . LYS C 3 1194 ? 16.703  93.000  44.379  1.00 40.27  ? 1194 LYS A CE    1 
ATOM   9704  N  NZ    . LYS C 3 1194 ? 17.224  93.358  43.021  1.00 40.98  ? 1194 LYS A NZ    1 
ATOM   9705  N  N     . HIS C 3 1195 ? 15.892  96.904  50.077  1.00 36.61  ? 1195 HIS A N     1 
ATOM   9706  C  CA    . HIS C 3 1195 ? 16.457  97.960  50.912  1.00 37.30  ? 1195 HIS A CA    1 
ATOM   9707  C  C     . HIS C 3 1195 ? 15.576  98.557  51.998  1.00 36.27  ? 1195 HIS A C     1 
ATOM   9708  O  O     . HIS C 3 1195 ? 16.027  99.430  52.740  1.00 37.94  ? 1195 HIS A O     1 
ATOM   9709  C  CB    . HIS C 3 1195 ? 16.945  99.099  50.012  1.00 38.85  ? 1195 HIS A CB    1 
ATOM   9710  C  CG    . HIS C 3 1195 ? 17.804  98.648  48.868  1.00 40.79  ? 1195 HIS A CG    1 
ATOM   9711  N  ND1   . HIS C 3 1195 ? 19.098  98.203  49.035  1.00 40.65  ? 1195 HIS A ND1   1 
ATOM   9712  C  CD2   . HIS C 3 1195 ? 17.551  98.576  47.539  1.00 40.55  ? 1195 HIS A CD2   1 
ATOM   9713  C  CE1   . HIS C 3 1195 ? 19.605  97.879  47.859  1.00 40.70  ? 1195 HIS A CE1   1 
ATOM   9714  N  NE2   . HIS C 3 1195 ? 18.688  98.097  46.934  1.00 40.51  ? 1195 HIS A NE2   1 
ATOM   9715  N  N     . HIS C 3 1196 ? 14.341  98.099  52.132  1.00 33.83  ? 1196 HIS A N     1 
ATOM   9716  C  CA    . HIS C 3 1196 ? 13.494  98.732  53.122  1.00 32.38  ? 1196 HIS A CA    1 
ATOM   9717  C  C     . HIS C 3 1196 ? 12.758  97.806  54.066  1.00 31.66  ? 1196 HIS A C     1 
ATOM   9718  O  O     . HIS C 3 1196 ? 11.795  98.192  54.722  1.00 31.43  ? 1196 HIS A O     1 
ATOM   9719  C  CB    . HIS C 3 1196 ? 12.565  99.704  52.384  1.00 30.21  ? 1196 HIS A CB    1 
ATOM   9720  C  CG    . HIS C 3 1196 ? 13.320  100.708 51.567  1.00 28.79  ? 1196 HIS A CG    1 
ATOM   9721  N  ND1   . HIS C 3 1196 ? 13.874  101.847 52.114  1.00 28.91  ? 1196 HIS A ND1   1 
ATOM   9722  C  CD2   . HIS C 3 1196 ? 13.758  100.660 50.285  1.00 28.88  ? 1196 HIS A CD2   1 
ATOM   9723  C  CE1   . HIS C 3 1196 ? 14.623  102.452 51.210  1.00 24.60  ? 1196 HIS A CE1   1 
ATOM   9724  N  NE2   . HIS C 3 1196 ? 14.572  101.751 50.092  1.00 26.94  ? 1196 HIS A NE2   1 
ATOM   9725  N  N     . VAL C 3 1197 ? 13.252  96.579  54.141  1.00 31.39  ? 1197 VAL A N     1 
ATOM   9726  C  CA    . VAL C 3 1197 ? 12.714  95.569  55.040  1.00 30.57  ? 1197 VAL A CA    1 
ATOM   9727  C  C     . VAL C 3 1197 ? 13.948  94.989  55.700  1.00 31.89  ? 1197 VAL A C     1 
ATOM   9728  O  O     . VAL C 3 1197 ? 14.512  93.987  55.241  1.00 32.12  ? 1197 VAL A O     1 
ATOM   9729  C  CB    . VAL C 3 1197 ? 11.962  94.448  54.293  1.00 29.34  ? 1197 VAL A CB    1 
ATOM   9730  C  CG1   . VAL C 3 1197 ? 11.478  93.395  55.294  1.00 24.16  ? 1197 VAL A CG1   1 
ATOM   9731  C  CG2   . VAL C 3 1197 ? 10.792  95.045  53.503  1.00 24.19  ? 1197 VAL A CG2   1 
ATOM   9732  N  N     . LYS C 3 1198 ? 14.384  95.654  56.762  1.00 33.00  ? 1198 LYS A N     1 
ATOM   9733  C  CA    . LYS C 3 1198 ? 15.561  95.230  57.495  1.00 33.05  ? 1198 LYS A CA    1 
ATOM   9734  C  C     . LYS C 3 1198 ? 15.267  93.997  58.336  1.00 33.21  ? 1198 LYS A C     1 
ATOM   9735  O  O     . LYS C 3 1198 ? 14.312  93.977  59.116  1.00 33.50  ? 1198 LYS A O     1 
ATOM   9736  C  CB    . LYS C 3 1198 ? 16.053  96.362  58.399  1.00 34.64  ? 1198 LYS A CB    1 
ATOM   9737  C  CG    . LYS C 3 1198 ? 16.734  97.519  57.672  1.00 34.79  ? 1198 LYS A CG    1 
ATOM   9738  C  CD    . LYS C 3 1198 ? 15.768  98.304  56.808  1.00 34.22  ? 1198 LYS A CD    1 
ATOM   9739  C  CE    . LYS C 3 1198 ? 16.403  99.613  56.347  1.00 34.45  ? 1198 LYS A CE    1 
ATOM   9740  N  NZ    . LYS C 3 1198 ? 17.711  99.411  55.652  1.00 34.18  ? 1198 LYS A NZ    1 
ATOM   9741  N  N     . LEU C 3 1199 ? 16.095  92.969  58.167  1.00 32.94  ? 1199 LEU A N     1 
ATOM   9742  C  CA    . LEU C 3 1199 ? 15.954  91.728  58.915  1.00 31.63  ? 1199 LEU A CA    1 
ATOM   9743  C  C     . LEU C 3 1199 ? 16.830  91.772  60.168  1.00 32.38  ? 1199 LEU A C     1 
ATOM   9744  O  O     . LEU C 3 1199 ? 16.760  90.886  61.015  1.00 33.26  ? 1199 LEU A O     1 
ATOM   9745  C  CB    . LEU C 3 1199 ? 16.346  90.547  58.037  1.00 30.13  ? 1199 LEU A CB    1 
ATOM   9746  C  CG    . LEU C 3 1199 ? 15.656  90.485  56.669  1.00 30.68  ? 1199 LEU A CG    1 
ATOM   9747  C  CD1   . LEU C 3 1199 ? 16.012  89.167  56.016  1.00 30.31  ? 1199 LEU A CD1   1 
ATOM   9748  C  CD2   . LEU C 3 1199 ? 14.135  90.616  56.806  1.00 30.03  ? 1199 LEU A CD2   1 
ATOM   9749  N  N     . LEU C 3 1200 ? 17.650  92.814  60.275  1.00 33.09  ? 1200 LEU A N     1 
ATOM   9750  C  CA    . LEU C 3 1200 ? 18.539  93.024  61.420  1.00 34.28  ? 1200 LEU A CA    1 
ATOM   9751  C  C     . LEU C 3 1200 ? 17.811  94.035  62.307  1.00 34.76  ? 1200 LEU A C     1 
ATOM   9752  O  O     . LEU C 3 1200 ? 17.638  95.184  61.911  1.00 32.87  ? 1200 LEU A O     1 
ATOM   9753  C  CB    . LEU C 3 1200 ? 19.867  93.605  60.933  1.00 34.40  ? 1200 LEU A CB    1 
ATOM   9754  C  CG    . LEU C 3 1200 ? 21.035  93.863  61.896  1.00 37.89  ? 1200 LEU A CG    1 
ATOM   9755  C  CD1   . LEU C 3 1200 ? 22.196  94.441  61.097  1.00 36.30  ? 1200 LEU A CD1   1 
ATOM   9756  C  CD2   . LEU C 3 1200 ? 20.641  94.832  63.000  1.00 38.18  ? 1200 LEU A CD2   1 
ATOM   9757  N  N     . PRO C 3 1201 ? 17.387  93.624  63.519  1.00 36.38  ? 1201 PRO A N     1 
ATOM   9758  C  CA    . PRO C 3 1201 ? 16.667  94.512  64.445  1.00 38.10  ? 1201 PRO A CA    1 
ATOM   9759  C  C     . PRO C 3 1201 ? 17.263  95.912  64.473  1.00 40.26  ? 1201 PRO A C     1 
ATOM   9760  O  O     . PRO C 3 1201 ? 18.471  96.076  64.295  1.00 40.32  ? 1201 PRO A O     1 
ATOM   9761  C  CB    . PRO C 3 1201 ? 16.783  93.788  65.781  1.00 35.86  ? 1201 PRO A CB    1 
ATOM   9762  C  CG    . PRO C 3 1201 ? 16.807  92.360  65.377  1.00 35.88  ? 1201 PRO A CG    1 
ATOM   9763  C  CD    . PRO C 3 1201 ? 17.757  92.370  64.197  1.00 35.31  ? 1201 PRO A CD    1 
ATOM   9764  N  N     . LYS C 3 1202 ? 16.425  96.922  64.695  1.00 41.59  ? 1202 LYS A N     1 
ATOM   9765  C  CA    . LYS C 3 1202 ? 16.928  98.287  64.693  1.00 44.55  ? 1202 LYS A CA    1 
ATOM   9766  C  C     . LYS C 3 1202 ? 17.990  98.535  65.766  1.00 45.87  ? 1202 LYS A C     1 
ATOM   9767  O  O     . LYS C 3 1202 ? 18.923  99.311  65.552  1.00 43.88  ? 1202 LYS A O     1 
ATOM   9768  C  CB    . LYS C 3 1202 ? 15.787  99.299  64.842  1.00 46.24  ? 1202 LYS A CB    1 
ATOM   9769  C  CG    . LYS C 3 1202 ? 16.161  100.656 64.249  1.00 48.19  ? 1202 LYS A CG    1 
ATOM   9770  C  CD    . LYS C 3 1202 ? 15.159  101.743 64.562  1.00 50.30  ? 1202 LYS A CD    1 
ATOM   9771  C  CE    . LYS C 3 1202 ? 15.634  103.075 63.986  1.00 51.96  ? 1202 LYS A CE    1 
ATOM   9772  N  NZ    . LYS C 3 1202 ? 14.807  104.232 64.453  1.00 54.38  ? 1202 LYS A NZ    1 
ATOM   9773  N  N     . ASP C 3 1203 ? 17.854  97.869  66.912  1.00 47.20  ? 1203 ASP A N     1 
ATOM   9774  C  CA    . ASP C 3 1203 ? 18.814  98.026  68.000  1.00 47.74  ? 1203 ASP A CA    1 
ATOM   9775  C  C     . ASP C 3 1203 ? 19.789  96.851  68.068  1.00 47.93  ? 1203 ASP A C     1 
ATOM   9776  O  O     . ASP C 3 1203 ? 20.163  96.414  69.155  1.00 48.27  ? 1203 ASP A O     1 
ATOM   9777  C  CB    . ASP C 3 1203 ? 18.092  98.148  69.342  1.00 48.30  ? 1203 ASP A CB    1 
ATOM   9778  C  CG    . ASP C 3 1203 ? 17.367  96.875  69.724  1.00 50.52  ? 1203 ASP A CG    1 
ATOM   9779  O  OD1   . ASP C 3 1203 ? 17.162  96.642  70.936  1.00 51.13  ? 1203 ASP A OD1   1 
ATOM   9780  O  OD2   . ASP C 3 1203 ? 16.995  96.109  68.811  1.00 51.27  ? 1203 ASP A OD2   1 
ATOM   9781  N  N     . GLY C 3 1204 ? 20.188  96.333  66.911  1.00 47.27  ? 1204 GLY A N     1 
ATOM   9782  C  CA    . GLY C 3 1204 ? 21.128  95.228  66.889  1.00 46.83  ? 1204 GLY A CA    1 
ATOM   9783  C  C     . GLY C 3 1204 ? 20.510  93.841  66.870  1.00 46.95  ? 1204 GLY A C     1 
ATOM   9784  O  O     . GLY C 3 1204 ? 19.295  93.687  66.859  1.00 46.25  ? 1204 GLY A O     1 
ATOM   9785  N  N     . ARG C 3 1205 ? 21.367  92.826  66.888  1.00 47.73  ? 1205 ARG A N     1 
ATOM   9786  C  CA    . ARG C 3 1205 ? 20.941  91.431  66.849  1.00 48.07  ? 1205 ARG A CA    1 
ATOM   9787  C  C     . ARG C 3 1205 ? 20.173  90.902  68.062  1.00 47.71  ? 1205 ARG A C     1 
ATOM   9788  O  O     . ARG C 3 1205 ? 20.446  91.261  69.209  1.00 48.34  ? 1205 ARG A O     1 
ATOM   9789  C  CB    . ARG C 3 1205 ? 22.153  90.535  66.585  1.00 48.19  ? 1205 ARG A CB    1 
ATOM   9790  C  CG    . ARG C 3 1205 ? 22.731  90.695  65.181  1.00 50.47  ? 1205 ARG A CG    1 
ATOM   9791  C  CD    . ARG C 3 1205 ? 23.949  89.808  64.967  1.00 51.06  ? 1205 ARG A CD    1 
ATOM   9792  N  NE    . ARG C 3 1205 ? 23.727  88.459  65.488  1.00 52.35  ? 1205 ARG A NE    1 
ATOM   9793  C  CZ    . ARG C 3 1205 ? 24.606  87.465  65.399  1.00 52.43  ? 1205 ARG A CZ    1 
ATOM   9794  N  NH1   . ARG C 3 1205 ? 25.778  87.655  64.806  1.00 52.40  ? 1205 ARG A NH1   1 
ATOM   9795  N  NH2   . ARG C 3 1205 ? 24.312  86.277  65.905  1.00 52.06  ? 1205 ARG A NH2   1 
ATOM   9796  N  N     . HIS C 3 1206 ? 19.203  90.039  67.772  1.00 46.66  ? 1206 HIS A N     1 
ATOM   9797  C  CA    . HIS C 3 1206 ? 18.365  89.398  68.777  1.00 45.94  ? 1206 HIS A CA    1 
ATOM   9798  C  C     . HIS C 3 1206 ? 18.540  87.893  68.606  1.00 44.76  ? 1206 HIS A C     1 
ATOM   9799  O  O     . HIS C 3 1206 ? 18.710  87.413  67.484  1.00 44.23  ? 1206 HIS A O     1 
ATOM   9800  C  CB    . HIS C 3 1206 ? 16.897  89.766  68.555  1.00 47.18  ? 1206 HIS A CB    1 
ATOM   9801  C  CG    . HIS C 3 1206 ? 16.566  91.184  68.903  1.00 48.31  ? 1206 HIS A CG    1 
ATOM   9802  N  ND1   . HIS C 3 1206 ? 15.300  91.710  68.755  1.00 49.27  ? 1206 HIS A ND1   1 
ATOM   9803  C  CD2   . HIS C 3 1206 ? 17.330  92.181  69.410  1.00 48.63  ? 1206 HIS A CD2   1 
ATOM   9804  C  CE1   . HIS C 3 1206 ? 15.297  92.969  69.157  1.00 48.72  ? 1206 HIS A CE1   1 
ATOM   9805  N  NE2   . HIS C 3 1206 ? 16.516  93.278  69.560  1.00 49.37  ? 1206 HIS A NE2   1 
ATOM   9806  N  N     . LEU C 3 1207 ? 18.501  87.147  69.705  1.00 43.54  ? 1207 LEU A N     1 
ATOM   9807  C  CA    . LEU C 3 1207 ? 18.668  85.701  69.618  1.00 42.96  ? 1207 LEU A CA    1 
ATOM   9808  C  C     . LEU C 3 1207 ? 17.618  85.057  68.715  1.00 43.09  ? 1207 LEU A C     1 
ATOM   9809  O  O     . LEU C 3 1207 ? 17.926  84.146  67.936  1.00 41.62  ? 1207 LEU A O     1 
ATOM   9810  C  CB    . LEU C 3 1207 ? 18.607  85.072  71.009  1.00 43.25  ? 1207 LEU A CB    1 
ATOM   9811  C  CG    . LEU C 3 1207 ? 19.862  85.276  71.859  1.00 45.61  ? 1207 LEU A CG    1 
ATOM   9812  C  CD1   . LEU C 3 1207 ? 19.649  84.745  73.273  1.00 43.99  ? 1207 LEU A CD1   1 
ATOM   9813  C  CD2   . LEU C 3 1207 ? 21.031  84.569  71.182  1.00 45.49  ? 1207 LEU A CD2   1 
ATOM   9814  N  N     . ASN C 3 1208 ? 16.382  85.540  68.816  1.00 42.55  ? 1208 ASN A N     1 
ATOM   9815  C  CA    . ASN C 3 1208 ? 15.287  85.012  68.014  1.00 42.10  ? 1208 ASN A CA    1 
ATOM   9816  C  C     . ASN C 3 1208 ? 15.360  85.400  66.538  1.00 42.64  ? 1208 ASN A C     1 
ATOM   9817  O  O     . ASN C 3 1208 ? 15.001  84.607  65.671  1.00 44.39  ? 1208 ASN A O     1 
ATOM   9818  C  CB    . ASN C 3 1208 ? 13.945  85.475  68.581  1.00 41.84  ? 1208 ASN A CB    1 
ATOM   9819  C  CG    . ASN C 3 1208 ? 13.726  85.023  70.015  1.00 40.91  ? 1208 ASN A CG    1 
ATOM   9820  O  OD1   . ASN C 3 1208 ? 14.363  84.081  70.490  1.00 40.06  ? 1208 ASN A OD1   1 
ATOM   9821  N  ND2   . ASN C 3 1208 ? 12.805  85.686  70.707  1.00 39.53  ? 1208 ASN A ND2   1 
ATOM   9822  N  N     . THR C 3 1209 ? 15.829  86.612  66.252  1.00 41.90  ? 1209 THR A N     1 
ATOM   9823  C  CA    . THR C 3 1209 ? 15.912  87.096  64.878  1.00 39.79  ? 1209 THR A CA    1 
ATOM   9824  C  C     . THR C 3 1209 ? 17.061  86.538  64.043  1.00 39.82  ? 1209 THR A C     1 
ATOM   9825  O  O     . THR C 3 1209 ? 17.014  86.584  62.818  1.00 40.80  ? 1209 THR A O     1 
ATOM   9826  C  CB    . THR C 3 1209 ? 15.975  88.644  64.838  1.00 39.72  ? 1209 THR A CB    1 
ATOM   9827  O  OG1   . THR C 3 1209 ? 17.214  89.106  65.398  1.00 39.94  ? 1209 THR A OG1   1 
ATOM   9828  C  CG2   . THR C 3 1209 ? 14.826  89.229  65.636  1.00 40.01  ? 1209 THR A CG2   1 
ATOM   9829  N  N     . ASP C 3 1210 ? 18.096  86.011  64.683  1.00 39.44  ? 1210 ASP A N     1 
ATOM   9830  C  CA    . ASP C 3 1210 ? 19.209  85.470  63.913  1.00 39.91  ? 1210 ASP A CA    1 
ATOM   9831  C  C     . ASP C 3 1210 ? 18.715  84.384  62.976  1.00 38.85  ? 1210 ASP A C     1 
ATOM   9832  O  O     . ASP C 3 1210 ? 17.896  83.552  63.359  1.00 38.90  ? 1210 ASP A O     1 
ATOM   9833  C  CB    . ASP C 3 1210 ? 20.287  84.885  64.828  1.00 41.79  ? 1210 ASP A CB    1 
ATOM   9834  C  CG    . ASP C 3 1210 ? 20.894  85.920  65.747  1.00 43.75  ? 1210 ASP A CG    1 
ATOM   9835  O  OD1   . ASP C 3 1210 ? 21.100  87.068  65.297  1.00 44.47  ? 1210 ASP A OD1   1 
ATOM   9836  O  OD2   . ASP C 3 1210 ? 21.174  85.581  66.916  1.00 44.79  ? 1210 ASP A OD2   1 
ATOM   9837  N  N     . ILE C 3 1211 ? 19.223  84.396  61.749  1.00 38.86  ? 1211 ILE A N     1 
ATOM   9838  C  CA    . ILE C 3 1211 ? 18.840  83.408  60.747  1.00 37.91  ? 1211 ILE A CA    1 
ATOM   9839  C  C     . ILE C 3 1211 ? 19.851  82.277  60.702  1.00 37.71  ? 1211 ILE A C     1 
ATOM   9840  O  O     . ILE C 3 1211 ? 21.022  82.502  60.425  1.00 36.97  ? 1211 ILE A O     1 
ATOM   9841  C  CB    . ILE C 3 1211 ? 18.751  84.045  59.342  1.00 37.78  ? 1211 ILE A CB    1 
ATOM   9842  C  CG1   . ILE C 3 1211 ? 17.691  85.148  59.342  1.00 35.95  ? 1211 ILE A CG1   1 
ATOM   9843  C  CG2   . ILE C 3 1211 ? 18.440  82.986  58.310  1.00 37.96  ? 1211 ILE A CG2   1 
ATOM   9844  C  CD1   . ILE C 3 1211 ? 16.422  84.753  60.062  1.00 35.00  ? 1211 ILE A CD1   1 
ATOM   9845  N  N     . PRO C 3 1212 ? 19.408  81.045  60.993  1.00 39.03  ? 1212 PRO A N     1 
ATOM   9846  C  CA    . PRO C 3 1212 ? 20.265  79.856  60.989  1.00 39.83  ? 1212 PRO A CA    1 
ATOM   9847  C  C     . PRO C 3 1212 ? 21.064  79.722  59.700  1.00 43.02  ? 1212 PRO A C     1 
ATOM   9848  O  O     . PRO C 3 1212 ? 20.621  80.143  58.629  1.00 42.91  ? 1212 PRO A O     1 
ATOM   9849  C  CB    . PRO C 3 1212 ? 19.271  78.722  61.170  1.00 38.84  ? 1212 PRO A CB    1 
ATOM   9850  C  CG    . PRO C 3 1212 ? 18.262  79.333  62.085  1.00 38.69  ? 1212 PRO A CG    1 
ATOM   9851  C  CD    . PRO C 3 1212 ? 18.059  80.709  61.485  1.00 39.13  ? 1212 PRO A CD    1 
ATOM   9852  N  N     . PRO C 3 1213 ? 22.253  79.112  59.787  1.00 45.33  ? 1213 PRO A N     1 
ATOM   9853  C  CA    . PRO C 3 1213 ? 23.138  78.914  58.637  1.00 46.23  ? 1213 PRO A CA    1 
ATOM   9854  C  C     . PRO C 3 1213 ? 22.473  78.305  57.405  1.00 45.99  ? 1213 PRO A C     1 
ATOM   9855  O  O     . PRO C 3 1213 ? 22.536  78.872  56.314  1.00 48.01  ? 1213 PRO A O     1 
ATOM   9856  C  CB    . PRO C 3 1213 ? 24.235  78.007  59.200  1.00 47.21  ? 1213 PRO A CB    1 
ATOM   9857  C  CG    . PRO C 3 1213 ? 24.280  78.391  60.650  1.00 46.79  ? 1213 PRO A CG    1 
ATOM   9858  C  CD    . PRO C 3 1213 ? 22.817  78.481  60.994  1.00 45.84  ? 1213 PRO A CD    1 
ATOM   9859  N  N     . ARG C 3 1214 ? 21.835  77.155  57.578  1.00 44.51  ? 1214 ARG A N     1 
ATOM   9860  C  CA    . ARG C 3 1214 ? 21.207  76.478  56.450  1.00 44.70  ? 1214 ARG A CA    1 
ATOM   9861  C  C     . ARG C 3 1214 ? 19.790  76.954  56.107  1.00 42.64  ? 1214 ARG A C     1 
ATOM   9862  O  O     . ARG C 3 1214 ? 19.161  76.432  55.185  1.00 41.42  ? 1214 ARG A O     1 
ATOM   9863  C  CB    . ARG C 3 1214 ? 21.185  74.969  56.711  1.00 48.06  ? 1214 ARG A CB    1 
ATOM   9864  C  CG    . ARG C 3 1214 ? 22.548  74.338  56.976  1.00 52.23  ? 1214 ARG A CG    1 
ATOM   9865  C  CD    . ARG C 3 1214 ? 22.380  72.867  57.344  1.00 57.16  ? 1214 ARG A CD    1 
ATOM   9866  N  NE    . ARG C 3 1214 ? 23.650  72.148  57.449  1.00 61.45  ? 1214 ARG A NE    1 
ATOM   9867  C  CZ    . ARG C 3 1214 ? 23.761  70.878  57.839  1.00 62.82  ? 1214 ARG A CZ    1 
ATOM   9868  N  NH1   . ARG C 3 1214 ? 22.678  70.180  58.167  1.00 63.04  ? 1214 ARG A NH1   1 
ATOM   9869  N  NH2   . ARG C 3 1214 ? 24.957  70.302  57.899  1.00 62.16  ? 1214 ARG A NH2   1 
ATOM   9870  N  N     . MET C 3 1215 ? 19.287  77.941  56.841  1.00 40.65  ? 1215 MET A N     1 
ATOM   9871  C  CA    . MET C 3 1215 ? 17.937  78.448  56.597  1.00 37.96  ? 1215 MET A CA    1 
ATOM   9872  C  C     . MET C 3 1215 ? 17.909  79.868  56.031  1.00 36.83  ? 1215 MET A C     1 
ATOM   9873  O  O     . MET C 3 1215 ? 17.089  80.698  56.436  1.00 36.01  ? 1215 MET A O     1 
ATOM   9874  C  CB    . MET C 3 1215 ? 17.123  78.394  57.891  1.00 34.61  ? 1215 MET A CB    1 
ATOM   9875  C  CG    . MET C 3 1215 ? 16.866  76.991  58.397  1.00 32.23  ? 1215 MET A CG    1 
ATOM   9876  S  SD    . MET C 3 1215 ? 15.889  76.997  59.911  1.00 29.89  ? 1215 MET A SD    1 
ATOM   9877  C  CE    . MET C 3 1215 ? 16.533  75.523  60.774  1.00 30.64  ? 1215 MET A CE    1 
ATOM   9878  N  N     . GLY C 3 1216 ? 18.802  80.139  55.088  1.00 35.61  ? 1216 GLY A N     1 
ATOM   9879  C  CA    . GLY C 3 1216 ? 18.860  81.462  54.493  1.00 33.70  ? 1216 GLY A CA    1 
ATOM   9880  C  C     . GLY C 3 1216 ? 17.614  81.781  53.695  1.00 31.30  ? 1216 GLY A C     1 
ATOM   9881  O  O     . GLY C 3 1216 ? 17.272  82.946  53.491  1.00 31.28  ? 1216 GLY A O     1 
ATOM   9882  N  N     . TRP C 3 1217 ? 16.931  80.738  53.241  1.00 28.67  ? 1217 TRP A N     1 
ATOM   9883  C  CA    . TRP C 3 1217 ? 15.718  80.919  52.474  1.00 27.49  ? 1217 TRP A CA    1 
ATOM   9884  C  C     . TRP C 3 1217 ? 14.672  81.667  53.300  1.00 28.41  ? 1217 TRP A C     1 
ATOM   9885  O  O     . TRP C 3 1217 ? 13.719  82.207  52.747  1.00 28.15  ? 1217 TRP A O     1 
ATOM   9886  C  CB    . TRP C 3 1217 ? 15.173  79.562  52.018  1.00 25.57  ? 1217 TRP A CB    1 
ATOM   9887  C  CG    . TRP C 3 1217 ? 15.113  78.539  53.100  1.00 26.69  ? 1217 TRP A CG    1 
ATOM   9888  C  CD1   . TRP C 3 1217 ? 16.124  77.712  53.501  1.00 24.77  ? 1217 TRP A CD1   1 
ATOM   9889  C  CD2   . TRP C 3 1217 ? 13.991  78.248  53.952  1.00 26.92  ? 1217 TRP A CD2   1 
ATOM   9890  N  NE1   . TRP C 3 1217 ? 15.703  76.924  54.545  1.00 27.48  ? 1217 TRP A NE1   1 
ATOM   9891  C  CE2   . TRP C 3 1217 ? 14.399  77.230  54.844  1.00 27.26  ? 1217 TRP A CE2   1 
ATOM   9892  C  CE3   . TRP C 3 1217 ? 12.680  78.748  54.046  1.00 24.88  ? 1217 TRP A CE3   1 
ATOM   9893  C  CZ2   . TRP C 3 1217 ? 13.539  76.695  55.824  1.00 28.01  ? 1217 TRP A CZ2   1 
ATOM   9894  C  CZ3   . TRP C 3 1217 ? 11.824  78.218  55.017  1.00 24.65  ? 1217 TRP A CZ3   1 
ATOM   9895  C  CH2   . TRP C 3 1217 ? 12.259  77.200  55.894  1.00 26.16  ? 1217 TRP A CH2   1 
ATOM   9896  N  N     . LEU C 3 1218 ? 14.850  81.697  54.620  1.00 29.49  ? 1218 LEU A N     1 
ATOM   9897  C  CA    . LEU C 3 1218 ? 13.920  82.398  55.502  1.00 30.68  ? 1218 LEU A CA    1 
ATOM   9898  C  C     . LEU C 3 1218 ? 13.840  83.884  55.184  1.00 31.31  ? 1218 LEU A C     1 
ATOM   9899  O  O     . LEU C 3 1218 ? 12.777  84.492  55.303  1.00 32.05  ? 1218 LEU A O     1 
ATOM   9900  C  CB    . LEU C 3 1218 ? 14.335  82.260  56.970  1.00 29.78  ? 1218 LEU A CB    1 
ATOM   9901  C  CG    . LEU C 3 1218 ? 13.853  81.064  57.790  1.00 33.10  ? 1218 LEU A CG    1 
ATOM   9902  C  CD1   . LEU C 3 1218 ? 14.547  81.073  59.153  1.00 29.10  ? 1218 LEU A CD1   1 
ATOM   9903  C  CD2   . LEU C 3 1218 ? 12.331  81.110  57.941  1.00 32.29  ? 1218 LEU A CD2   1 
ATOM   9904  N  N     . ARG C 3 1219 ? 14.969  84.467  54.794  1.00 32.58  ? 1219 ARG A N     1 
ATOM   9905  C  CA    . ARG C 3 1219 ? 15.028  85.899  54.510  1.00 33.17  ? 1219 ARG A CA    1 
ATOM   9906  C  C     . ARG C 3 1219 ? 14.062  86.357  53.429  1.00 32.14  ? 1219 ARG A C     1 
ATOM   9907  O  O     . ARG C 3 1219 ? 13.577  87.489  53.475  1.00 31.98  ? 1219 ARG A O     1 
ATOM   9908  C  CB    . ARG C 3 1219 ? 16.464  86.321  54.164  1.00 35.29  ? 1219 ARG A CB    1 
ATOM   9909  C  CG    . ARG C 3 1219 ? 17.440  86.117  55.332  1.00 39.78  ? 1219 ARG A CG    1 
ATOM   9910  C  CD    . ARG C 3 1219 ? 18.632  87.091  55.344  1.00 42.46  ? 1219 ARG A CD    1 
ATOM   9911  N  NE    . ARG C 3 1219 ? 19.246  87.114  56.676  1.00 47.94  ? 1219 ARG A NE    1 
ATOM   9912  C  CZ    . ARG C 3 1219 ? 19.801  88.186  57.247  1.00 50.60  ? 1219 ARG A CZ    1 
ATOM   9913  N  NH1   . ARG C 3 1219 ? 19.835  89.352  56.603  1.00 50.23  ? 1219 ARG A NH1   1 
ATOM   9914  N  NH2   . ARG C 3 1219 ? 20.302  88.100  58.482  1.00 48.55  ? 1219 ARG A NH2   1 
ATOM   9915  N  N     . ALA C 3 1220 ? 13.766  85.477  52.475  1.00 29.42  ? 1220 ALA A N     1 
ATOM   9916  C  CA    . ALA C 3 1220 ? 12.851  85.815  51.391  1.00 27.05  ? 1220 ALA A CA    1 
ATOM   9917  C  C     . ALA C 3 1220 ? 11.423  85.859  51.919  1.00 26.42  ? 1220 ALA A C     1 
ATOM   9918  O  O     . ALA C 3 1220 ? 10.650  86.764  51.592  1.00 25.25  ? 1220 ALA A O     1 
ATOM   9919  C  CB    . ALA C 3 1220 ? 12.959  84.791  50.272  1.00 27.44  ? 1220 ALA A CB    1 
ATOM   9920  N  N     . ILE C 3 1221 ? 11.075  84.872  52.735  1.00 24.55  ? 1221 ILE A N     1 
ATOM   9921  C  CA    . ILE C 3 1221 ? 9.741   84.806  53.302  1.00 22.43  ? 1221 ILE A CA    1 
ATOM   9922  C  C     . ILE C 3 1221 ? 9.556   85.989  54.233  1.00 23.86  ? 1221 ILE A C     1 
ATOM   9923  O  O     . ILE C 3 1221 ? 8.519   86.658  54.216  1.00 26.18  ? 1221 ILE A O     1 
ATOM   9924  C  CB    . ILE C 3 1221 ? 9.538   83.490  54.076  1.00 21.78  ? 1221 ILE A CB    1 
ATOM   9925  C  CG1   . ILE C 3 1221 ? 9.432   82.324  53.083  1.00 21.15  ? 1221 ILE A CG1   1 
ATOM   9926  C  CG2   . ILE C 3 1221 ? 8.319   83.597  54.976  1.00 18.48  ? 1221 ILE A CG2   1 
ATOM   9927  C  CD1   . ILE C 3 1221 ? 9.269   80.955  53.719  1.00 18.72  ? 1221 ILE A CD1   1 
ATOM   9928  N  N     . LEU C 3 1222 ? 10.572  86.252  55.041  1.00 23.02  ? 1222 LEU A N     1 
ATOM   9929  C  CA    . LEU C 3 1222 ? 10.519  87.363  55.965  1.00 23.25  ? 1222 LEU A CA    1 
ATOM   9930  C  C     . LEU C 3 1222 ? 10.383  88.702  55.234  1.00 24.89  ? 1222 LEU A C     1 
ATOM   9931  O  O     . LEU C 3 1222 ? 9.798   89.652  55.761  1.00 25.45  ? 1222 LEU A O     1 
ATOM   9932  C  CB    . LEU C 3 1222 ? 11.778  87.374  56.836  1.00 24.36  ? 1222 LEU A CB    1 
ATOM   9933  C  CG    . LEU C 3 1222 ? 11.895  86.271  57.890  1.00 23.23  ? 1222 LEU A CG    1 
ATOM   9934  C  CD1   . LEU C 3 1222 ? 13.241  86.379  58.580  1.00 22.30  ? 1222 LEU A CD1   1 
ATOM   9935  C  CD2   . LEU C 3 1222 ? 10.749  86.397  58.899  1.00 21.66  ? 1222 LEU A CD2   1 
ATOM   9936  N  N     . ARG C 3 1223 ? 10.907  88.792  54.017  1.00 25.45  ? 1223 ARG A N     1 
ATOM   9937  C  CA    . ARG C 3 1223 ? 10.809  90.057  53.308  1.00 26.00  ? 1223 ARG A CA    1 
ATOM   9938  C  C     . ARG C 3 1223 ? 9.394   90.351  52.895  1.00 27.07  ? 1223 ARG A C     1 
ATOM   9939  O  O     . ARG C 3 1223 ? 8.951   91.503  52.940  1.00 26.20  ? 1223 ARG A O     1 
ATOM   9940  C  CB    . ARG C 3 1223 ? 11.744  90.089  52.110  1.00 24.04  ? 1223 ARG A CB    1 
ATOM   9941  C  CG    . ARG C 3 1223 ? 13.180  90.287  52.541  1.00 25.31  ? 1223 ARG A CG    1 
ATOM   9942  C  CD    . ARG C 3 1223 ? 14.126  90.374  51.364  1.00 27.34  ? 1223 ARG A CD    1 
ATOM   9943  N  NE    . ARG C 3 1223 ? 15.507  90.398  51.827  1.00 29.00  ? 1223 ARG A NE    1 
ATOM   9944  C  CZ    . ARG C 3 1223 ? 16.389  89.439  51.576  1.00 30.34  ? 1223 ARG A CZ    1 
ATOM   9945  N  NH1   . ARG C 3 1223 ? 16.035  88.381  50.860  1.00 30.17  ? 1223 ARG A NH1   1 
ATOM   9946  N  NH2   . ARG C 3 1223 ? 17.623  89.530  52.050  1.00 32.61  ? 1223 ARG A NH2   1 
ATOM   9947  N  N     . PHE C 3 1224 ? 8.672   89.308  52.515  1.00 28.03  ? 1224 PHE A N     1 
ATOM   9948  C  CA    . PHE C 3 1224 ? 7.288   89.487  52.115  1.00 27.95  ? 1224 PHE A CA    1 
ATOM   9949  C  C     . PHE C 3 1224 ? 6.435   89.962  53.294  1.00 26.98  ? 1224 PHE A C     1 
ATOM   9950  O  O     . PHE C 3 1224 ? 5.591   90.838  53.136  1.00 28.68  ? 1224 PHE A O     1 
ATOM   9951  C  CB    . PHE C 3 1224 ? 6.708   88.181  51.557  1.00 27.03  ? 1224 PHE A CB    1 
ATOM   9952  C  CG    . PHE C 3 1224 ? 6.728   88.093  50.055  1.00 25.77  ? 1224 PHE A CG    1 
ATOM   9953  C  CD1   . PHE C 3 1224 ? 7.881   87.715  49.374  1.00 27.64  ? 1224 PHE A CD1   1 
ATOM   9954  C  CD2   . PHE C 3 1224 ? 5.584   88.383  49.319  1.00 24.84  ? 1224 PHE A CD2   1 
ATOM   9955  C  CE1   . PHE C 3 1224 ? 7.894   87.625  47.973  1.00 26.60  ? 1224 PHE A CE1   1 
ATOM   9956  C  CE2   . PHE C 3 1224 ? 5.585   88.298  47.927  1.00 26.68  ? 1224 PHE A CE2   1 
ATOM   9957  C  CZ    . PHE C 3 1224 ? 6.743   87.917  47.253  1.00 26.46  ? 1224 PHE A CZ    1 
ATOM   9958  N  N     . LEU C 3 1225 ? 6.664   89.398  54.475  1.00 26.20  ? 1225 LEU A N     1 
ATOM   9959  C  CA    . LEU C 3 1225 ? 5.871   89.761  55.656  1.00 26.03  ? 1225 LEU A CA    1 
ATOM   9960  C  C     . LEU C 3 1225 ? 6.057   91.219  56.066  1.00 26.12  ? 1225 LEU A C     1 
ATOM   9961  O  O     . LEU C 3 1225 ? 5.098   91.898  56.434  1.00 25.25  ? 1225 LEU A O     1 
ATOM   9962  C  CB    . LEU C 3 1225 ? 6.210   88.833  56.844  1.00 24.01  ? 1225 LEU A CB    1 
ATOM   9963  C  CG    . LEU C 3 1225 ? 6.074   87.324  56.587  1.00 22.18  ? 1225 LEU A CG    1 
ATOM   9964  C  CD1   . LEU C 3 1225 ? 6.395   86.556  57.847  1.00 21.94  ? 1225 LEU A CD1   1 
ATOM   9965  C  CD2   . LEU C 3 1225 ? 4.666   86.999  56.101  1.00 20.14  ? 1225 LEU A CD2   1 
ATOM   9966  N  N     . GLY C 3 1226 ? 7.296   91.693  56.008  1.00 26.49  ? 1226 GLY A N     1 
ATOM   9967  C  CA    . GLY C 3 1226 ? 7.561   93.068  56.360  1.00 26.33  ? 1226 GLY A CA    1 
ATOM   9968  C  C     . GLY C 3 1226 ? 6.895   93.957  55.333  1.00 26.59  ? 1226 GLY A C     1 
ATOM   9969  O  O     . GLY C 3 1226 ? 6.185   94.910  55.672  1.00 26.41  ? 1226 GLY A O     1 
ATOM   9970  N  N     . ALA C 3 1227 ? 7.119   93.643  54.064  1.00 25.34  ? 1227 ALA A N     1 
ATOM   9971  C  CA    . ALA C 3 1227 ? 6.531   94.434  52.995  1.00 25.51  ? 1227 ALA A CA    1 
ATOM   9972  C  C     . ALA C 3 1227 ? 5.019   94.516  53.182  1.00 25.89  ? 1227 ALA A C     1 
ATOM   9973  O  O     . ALA C 3 1227 ? 4.419   95.583  53.031  1.00 26.07  ? 1227 ALA A O     1 
ATOM   9974  C  CB    . ALA C 3 1227 ? 6.867   93.823  51.647  1.00 23.12  ? 1227 ALA A CB    1 
ATOM   9975  N  N     . GLY C 3 1228 ? 4.412   93.385  53.530  1.00 25.76  ? 1228 GLY A N     1 
ATOM   9976  C  CA    . GLY C 3 1228 ? 2.977   93.346  53.729  1.00 23.90  ? 1228 GLY A CA    1 
ATOM   9977  C  C     . GLY C 3 1228 ? 2.498   94.433  54.665  1.00 24.34  ? 1228 GLY A C     1 
ATOM   9978  O  O     . GLY C 3 1228 ? 1.592   95.188  54.331  1.00 25.39  ? 1228 GLY A O     1 
ATOM   9979  N  N     . MET C 3 1229 ? 3.106   94.528  55.842  1.00 24.91  ? 1229 MET A N     1 
ATOM   9980  C  CA    . MET C 3 1229 ? 2.685   95.535  56.805  1.00 24.34  ? 1229 MET A CA    1 
ATOM   9981  C  C     . MET C 3 1229 ? 2.912   96.953  56.311  1.00 22.87  ? 1229 MET A C     1 
ATOM   9982  O  O     . MET C 3 1229 ? 2.092   97.834  56.557  1.00 23.85  ? 1229 MET A O     1 
ATOM   9983  C  CB    . MET C 3 1229 ? 3.406   95.345  58.128  1.00 25.17  ? 1229 MET A CB    1 
ATOM   9984  C  CG    . MET C 3 1229 ? 3.064   94.065  58.846  1.00 26.93  ? 1229 MET A CG    1 
ATOM   9985  S  SD    . MET C 3 1229 ? 3.922   94.028  60.439  1.00 32.27  ? 1229 MET A SD    1 
ATOM   9986  C  CE    . MET C 3 1229 ? 2.879   95.185  61.413  1.00 26.89  ? 1229 MET A CE    1 
ATOM   9987  N  N     . VAL C 3 1230 ? 4.022   97.177  55.621  1.00 21.37  ? 1230 VAL A N     1 
ATOM   9988  C  CA    . VAL C 3 1230 ? 4.323   98.499  55.110  1.00 20.50  ? 1230 VAL A CA    1 
ATOM   9989  C  C     . VAL C 3 1230 ? 3.296   98.916  54.079  1.00 22.31  ? 1230 VAL A C     1 
ATOM   9990  O  O     . VAL C 3 1230 ? 2.739   100.005 54.163  1.00 25.38  ? 1230 VAL A O     1 
ATOM   9991  C  CB    . VAL C 3 1230 ? 5.715   98.555  54.466  1.00 20.99  ? 1230 VAL A CB    1 
ATOM   9992  C  CG1   . VAL C 3 1230 ? 5.898   99.873  53.710  1.00 21.23  ? 1230 VAL A CG1   1 
ATOM   9993  C  CG2   . VAL C 3 1230 ? 6.778   98.427  55.536  1.00 22.74  ? 1230 VAL A CG2   1 
ATOM   9994  N  N     . MET C 3 1231 ? 3.034   98.047  53.112  1.00 22.06  ? 1231 MET A N     1 
ATOM   9995  C  CA    . MET C 3 1231 ? 2.084   98.359  52.061  1.00 22.20  ? 1231 MET A CA    1 
ATOM   9996  C  C     . MET C 3 1231 ? 0.641   98.451  52.544  1.00 23.61  ? 1231 MET A C     1 
ATOM   9997  O  O     . MET C 3 1231 ? -0.166  99.177  51.962  1.00 23.52  ? 1231 MET A O     1 
ATOM   9998  C  CB    . MET C 3 1231 ? 2.188   97.321  50.946  1.00 23.28  ? 1231 MET A CB    1 
ATOM   9999  C  CG    . MET C 3 1231 ? 3.520   97.335  50.217  1.00 24.04  ? 1231 MET A CG    1 
ATOM   10000 S  SD    . MET C 3 1231 ? 3.917   98.964  49.539  1.00 29.58  ? 1231 MET A SD    1 
ATOM   10001 C  CE    . MET C 3 1231 ? 2.640   99.118  48.266  1.00 26.14  ? 1231 MET A CE    1 
ATOM   10002 N  N     . THR C 3 1232 ? 0.317   97.720  53.607  1.00 23.89  ? 1232 THR A N     1 
ATOM   10003 C  CA    . THR C 3 1232 ? -1.040  97.710  54.150  1.00 23.19  ? 1232 THR A CA    1 
ATOM   10004 C  C     . THR C 3 1232 ? -1.344  98.949  54.991  1.00 23.39  ? 1232 THR A C     1 
ATOM   10005 O  O     . THR C 3 1232 ? -2.501  99.311  55.181  1.00 23.14  ? 1232 THR A O     1 
ATOM   10006 C  CB    . THR C 3 1232 ? -1.273  96.426  54.988  1.00 21.86  ? 1232 THR A CB    1 
ATOM   10007 O  OG1   . THR C 3 1232 ? -1.158  95.284  54.134  1.00 23.27  ? 1232 THR A OG1   1 
ATOM   10008 C  CG2   . THR C 3 1232 ? -2.651  96.416  55.618  1.00 20.64  ? 1232 THR A CG2   1 
ATOM   10009 N  N     . ALA C 3 1233 ? -0.304  99.605  55.484  1.00 24.56  ? 1233 ALA A N     1 
ATOM   10010 C  CA    . ALA C 3 1233 ? -0.486  100.806 56.301  1.00 27.32  ? 1233 ALA A CA    1 
ATOM   10011 C  C     . ALA C 3 1233 ? -0.696  102.062 55.448  1.00 27.75  ? 1233 ALA A C     1 
ATOM   10012 O  O     . ALA C 3 1233 ? 0.108   102.385 54.567  1.00 28.32  ? 1233 ALA A O     1 
ATOM   10013 C  CB    . ALA C 3 1233 ? 0.721   100.998 57.226  1.00 26.95  ? 1233 ALA A CB    1 
ATOM   10014 N  N     . THR C 3 1234 ? -1.783  102.771 55.711  1.00 27.14  ? 1234 THR A N     1 
ATOM   10015 C  CA    . THR C 3 1234 ? -2.078  103.984 54.969  1.00 27.80  ? 1234 THR A CA    1 
ATOM   10016 C  C     . THR C 3 1234 ? -0.934  104.986 55.070  1.00 27.43  ? 1234 THR A C     1 
ATOM   10017 O  O     . THR C 3 1234 ? -0.251  105.062 56.089  1.00 27.56  ? 1234 THR A O     1 
ATOM   10018 C  CB    . THR C 3 1234 ? -3.353  104.642 55.498  1.00 27.66  ? 1234 THR A CB    1 
ATOM   10019 O  OG1   . THR C 3 1234 ? -4.478  103.822 55.165  1.00 31.07  ? 1234 THR A OG1   1 
ATOM   10020 C  CG2   . THR C 3 1234 ? -3.534  106.025 54.898  1.00 28.46  ? 1234 THR A CG2   1 
ATOM   10021 N  N     . GLY C 3 1235 ? -0.721  105.747 54.004  1.00 27.75  ? 1235 GLY A N     1 
ATOM   10022 C  CA    . GLY C 3 1235 ? 0.321   106.758 54.021  1.00 26.54  ? 1235 GLY A CA    1 
ATOM   10023 C  C     . GLY C 3 1235 ? 1.586   106.436 53.260  1.00 27.12  ? 1235 GLY A C     1 
ATOM   10024 O  O     . GLY C 3 1235 ? 1.576   105.679 52.287  1.00 26.73  ? 1235 GLY A O     1 
ATOM   10025 N  N     . VAL C 3 1236 ? 2.686   107.030 53.709  1.00 27.73  ? 1236 VAL A N     1 
ATOM   10026 C  CA    . VAL C 3 1236 ? 3.985   106.824 53.086  1.00 28.65  ? 1236 VAL A CA    1 
ATOM   10027 C  C     . VAL C 3 1236 ? 4.578   105.466 53.454  1.00 29.02  ? 1236 VAL A C     1 
ATOM   10028 O  O     . VAL C 3 1236 ? 4.329   104.939 54.541  1.00 27.64  ? 1236 VAL A O     1 
ATOM   10029 C  CB    . VAL C 3 1236 ? 4.986   107.910 53.530  1.00 28.83  ? 1236 VAL A CB    1 
ATOM   10030 C  CG1   . VAL C 3 1236 ? 4.513   109.276 53.063  1.00 31.41  ? 1236 VAL A CG1   1 
ATOM   10031 C  CG2   . VAL C 3 1236 ? 5.123   107.890 55.042  1.00 27.36  ? 1236 VAL A CG2   1 
ATOM   10032 N  N     . ALA C 3 1237 ? 5.358   104.907 52.536  1.00 28.88  ? 1237 ALA A N     1 
ATOM   10033 C  CA    . ALA C 3 1237 ? 6.014   103.636 52.782  1.00 27.87  ? 1237 ALA A CA    1 
ATOM   10034 C  C     . ALA C 3 1237 ? 6.979   103.972 53.885  1.00 27.90  ? 1237 ALA A C     1 
ATOM   10035 O  O     . ALA C 3 1237 ? 7.624   105.015 53.860  1.00 28.60  ? 1237 ALA A O     1 
ATOM   10036 C  CB    . ALA C 3 1237 ? 6.781   103.166 51.553  1.00 29.09  ? 1237 ALA A CB    1 
ATOM   10037 N  N     . VAL C 3 1238 ? 7.068   103.082 54.855  1.00 28.45  ? 1238 VAL A N     1 
ATOM   10038 C  CA    . VAL C 3 1238 ? 7.934   103.266 56.000  1.00 27.55  ? 1238 VAL A CA    1 
ATOM   10039 C  C     . VAL C 3 1238 ? 8.990   102.158 55.978  1.00 29.28  ? 1238 VAL A C     1 
ATOM   10040 O  O     . VAL C 3 1238 ? 8.796   101.123 55.338  1.00 29.23  ? 1238 VAL A O     1 
ATOM   10041 C  CB    . VAL C 3 1238 ? 7.064   103.197 57.291  1.00 26.74  ? 1238 VAL A CB    1 
ATOM   10042 C  CG1   . VAL C 3 1238 ? 7.778   102.469 58.394  1.00 28.46  ? 1238 VAL A CG1   1 
ATOM   10043 C  CG2   . VAL C 3 1238 ? 6.678   104.602 57.731  1.00 26.09  ? 1238 VAL A CG2   1 
ATOM   10044 N  N     . ASP C 3 1239 ? 10.125  102.388 56.628  1.00 29.46  ? 1239 ASP A N     1 
ATOM   10045 C  CA    . ASP C 3 1239 ? 11.132  101.346 56.702  1.00 29.84  ? 1239 ASP A CA    1 
ATOM   10046 C  C     . ASP C 3 1239 ? 10.679  100.482 57.867  1.00 29.85  ? 1239 ASP A C     1 
ATOM   10047 O  O     . ASP C 3 1239 ? 10.281  101.003 58.910  1.00 29.74  ? 1239 ASP A O     1 
ATOM   10048 C  CB    . ASP C 3 1239 ? 12.516  101.920 56.994  1.00 30.97  ? 1239 ASP A CB    1 
ATOM   10049 C  CG    . ASP C 3 1239 ? 13.196  102.438 55.760  1.00 31.13  ? 1239 ASP A CG    1 
ATOM   10050 O  OD1   . ASP C 3 1239 ? 13.206  101.705 54.745  1.00 28.40  ? 1239 ASP A OD1   1 
ATOM   10051 O  OD2   . ASP C 3 1239 ? 13.727  103.570 55.812  1.00 34.17  ? 1239 ASP A OD2   1 
ATOM   10052 N  N     . ILE C 3 1240 ? 10.725  99.168  57.697  1.00 28.75  ? 1240 ILE A N     1 
ATOM   10053 C  CA    . ILE C 3 1240 ? 10.293  98.277  58.761  1.00 27.87  ? 1240 ILE A CA    1 
ATOM   10054 C  C     . ILE C 3 1240 ? 11.463  97.390  59.228  1.00 28.29  ? 1240 ILE A C     1 
ATOM   10055 O  O     . ILE C 3 1240 ? 12.298  96.960  58.418  1.00 28.40  ? 1240 ILE A O     1 
ATOM   10056 C  CB    . ILE C 3 1240 ? 9.050   97.458  58.271  1.00 25.60  ? 1240 ILE A CB    1 
ATOM   10057 C  CG1   . ILE C 3 1240 ? 8.380   96.742  59.444  1.00 24.27  ? 1240 ILE A CG1   1 
ATOM   10058 C  CG2   . ILE C 3 1240 ? 9.450   96.505  57.153  1.00 22.99  ? 1240 ILE A CG2   1 
ATOM   10059 C  CD1   . ILE C 3 1240 ? 7.017   96.156  59.094  1.00 22.49  ? 1240 ILE A CD1   1 
ATOM   10060 N  N     . TYR C 3 1241 ? 11.540  97.144  60.536  1.00 29.37  ? 1241 TYR A N     1 
ATOM   10061 C  CA    . TYR C 3 1241 ? 12.626  96.337  61.111  1.00 29.67  ? 1241 TYR A CA    1 
ATOM   10062 C  C     . TYR C 3 1241 ? 12.154  95.081  61.847  1.00 29.38  ? 1241 TYR A C     1 
ATOM   10063 O  O     . TYR C 3 1241 ? 11.276  95.152  62.720  1.00 27.41  ? 1241 TYR A O     1 
ATOM   10064 C  CB    . TYR C 3 1241 ? 13.447  97.188  62.081  1.00 31.37  ? 1241 TYR A CB    1 
ATOM   10065 C  CG    . TYR C 3 1241 ? 14.199  98.325  61.441  1.00 35.93  ? 1241 TYR A CG    1 
ATOM   10066 C  CD1   . TYR C 3 1241 ? 15.577  98.235  61.207  1.00 38.23  ? 1241 TYR A CD1   1 
ATOM   10067 C  CD2   . TYR C 3 1241 ? 13.540  99.502  61.066  1.00 38.29  ? 1241 TYR A CD2   1 
ATOM   10068 C  CE1   . TYR C 3 1241 ? 16.288  99.295  60.616  1.00 37.74  ? 1241 TYR A CE1   1 
ATOM   10069 C  CE2   . TYR C 3 1241 ? 14.239  100.568 60.468  1.00 38.21  ? 1241 TYR A CE2   1 
ATOM   10070 C  CZ    . TYR C 3 1241 ? 15.610  100.453 60.248  1.00 39.21  ? 1241 TYR A CZ    1 
ATOM   10071 O  OH    . TYR C 3 1241 ? 16.293  101.487 59.645  1.00 40.39  ? 1241 TYR A OH    1 
ATOM   10072 N  N     . LEU C 3 1242 ? 12.742  93.934  61.504  1.00 28.29  ? 1242 LEU A N     1 
ATOM   10073 C  CA    . LEU C 3 1242 ? 12.371  92.687  62.164  1.00 29.91  ? 1242 LEU A CA    1 
ATOM   10074 C  C     . LEU C 3 1242 ? 12.648  92.875  63.650  1.00 31.72  ? 1242 LEU A C     1 
ATOM   10075 O  O     . LEU C 3 1242 ? 13.780  93.166  64.054  1.00 33.03  ? 1242 LEU A O     1 
ATOM   10076 C  CB    . LEU C 3 1242 ? 13.187  91.512  61.614  1.00 29.88  ? 1242 LEU A CB    1 
ATOM   10077 C  CG    . LEU C 3 1242 ? 12.972  90.105  62.195  1.00 30.44  ? 1242 LEU A CG    1 
ATOM   10078 C  CD1   . LEU C 3 1242 ? 11.506  89.687  62.089  1.00 28.42  ? 1242 LEU A CD1   1 
ATOM   10079 C  CD2   . LEU C 3 1242 ? 13.858  89.118  61.441  1.00 28.75  ? 1242 LEU A CD2   1 
ATOM   10080 N  N     . GLU C 3 1243 ? 11.605  92.725  64.457  1.00 32.33  ? 1243 GLU A N     1 
ATOM   10081 C  CA    . GLU C 3 1243 ? 11.712  92.898  65.896  1.00 33.78  ? 1243 GLU A CA    1 
ATOM   10082 C  C     . GLU C 3 1243 ? 11.761  91.577  66.657  1.00 34.04  ? 1243 GLU A C     1 
ATOM   10083 O  O     . GLU C 3 1243 ? 12.484  91.455  67.647  1.00 31.66  ? 1243 GLU A O     1 
ATOM   10084 C  CB    . GLU C 3 1243 ? 10.530  93.731  66.400  1.00 36.68  ? 1243 GLU A CB    1 
ATOM   10085 C  CG    . GLU C 3 1243 ? 10.362  93.755  67.913  1.00 42.45  ? 1243 GLU A CG    1 
ATOM   10086 C  CD    . GLU C 3 1243 ? 11.254  94.781  68.601  1.00 47.32  ? 1243 GLU A CD    1 
ATOM   10087 O  OE1   . GLU C 3 1243 ? 12.489  94.780  68.362  1.00 48.99  ? 1243 GLU A OE1   1 
ATOM   10088 O  OE2   . GLU C 3 1243 ? 10.710  95.592  69.387  1.00 48.46  ? 1243 GLU A OE2   1 
ATOM   10089 N  N     . ASP C 3 1244 ? 11.007  90.582  66.195  1.00 34.63  ? 1244 ASP A N     1 
ATOM   10090 C  CA    . ASP C 3 1244 ? 10.985  89.313  66.905  1.00 35.83  ? 1244 ASP A CA    1 
ATOM   10091 C  C     . ASP C 3 1244 ? 10.372  88.127  66.162  1.00 35.66  ? 1244 ASP A C     1 
ATOM   10092 O  O     . ASP C 3 1244 ? 9.539   88.286  65.273  1.00 36.24  ? 1244 ASP A O     1 
ATOM   10093 C  CB    . ASP C 3 1244 ? 10.230  89.511  68.222  1.00 36.24  ? 1244 ASP A CB    1 
ATOM   10094 C  CG    . ASP C 3 1244 ? 10.322  88.314  69.137  1.00 37.25  ? 1244 ASP A CG    1 
ATOM   10095 O  OD1   . ASP C 3 1244 ? 9.363   88.087  69.909  1.00 37.98  ? 1244 ASP A OD1   1 
ATOM   10096 O  OD2   . ASP C 3 1244 ? 11.357  87.614  69.098  1.00 37.52  ? 1244 ASP A OD2   1 
ATOM   10097 N  N     . ILE C 3 1245 ? 10.805  86.935  66.551  1.00 34.62  ? 1245 ILE A N     1 
ATOM   10098 C  CA    . ILE C 3 1245 ? 10.293  85.681  66.007  1.00 34.74  ? 1245 ILE A CA    1 
ATOM   10099 C  C     . ILE C 3 1245 ? 10.095  84.848  67.265  1.00 35.50  ? 1245 ILE A C     1 
ATOM   10100 O  O     . ILE C 3 1245 ? 11.062  84.354  67.845  1.00 36.95  ? 1245 ILE A O     1 
ATOM   10101 C  CB    . ILE C 3 1245 ? 11.308  84.962  65.084  1.00 33.11  ? 1245 ILE A CB    1 
ATOM   10102 C  CG1   . ILE C 3 1245 ? 11.559  85.784  63.822  1.00 33.68  ? 1245 ILE A CG1   1 
ATOM   10103 C  CG2   . ILE C 3 1245 ? 10.769  83.602  64.689  1.00 31.92  ? 1245 ILE A CG2   1 
ATOM   10104 C  CD1   . ILE C 3 1245 ? 12.460  85.097  62.831  1.00 31.94  ? 1245 ILE A CD1   1 
ATOM   10105 N  N     . HIS C 3 1246 ? 8.848   84.690  67.685  1.00 35.17  ? 1246 HIS A N     1 
ATOM   10106 C  CA    . HIS C 3 1246 ? 8.566   83.972  68.911  1.00 36.90  ? 1246 HIS A CA    1 
ATOM   10107 C  C     . HIS C 3 1246 ? 9.499   82.860  69.353  1.00 37.76  ? 1246 HIS A C     1 
ATOM   10108 O  O     . HIS C 3 1246 ? 10.159  82.978  70.395  1.00 41.90  ? 1246 HIS A O     1 
ATOM   10109 C  CB    . HIS C 3 1246 ? 7.170   83.386  68.929  1.00 37.53  ? 1246 HIS A CB    1 
ATOM   10110 C  CG    . HIS C 3 1246 ? 6.842   82.750  70.242  1.00 39.42  ? 1246 HIS A CG    1 
ATOM   10111 N  ND1   . HIS C 3 1246 ? 6.215   81.527  70.350  1.00 40.14  ? 1246 HIS A ND1   1 
ATOM   10112 C  CD2   . HIS C 3 1246 ? 7.087   83.163  71.508  1.00 37.56  ? 1246 HIS A CD2   1 
ATOM   10113 C  CE1   . HIS C 3 1246 ? 6.092   81.212  71.628  1.00 39.94  ? 1246 HIS A CE1   1 
ATOM   10114 N  NE2   . HIS C 3 1246 ? 6.614   82.189  72.350  1.00 38.54  ? 1246 HIS A NE2   1 
ATOM   10115 N  N     . GLY C 3 1247 ? 9.532   81.767  68.603  1.00 35.67  ? 1247 GLY A N     1 
ATOM   10116 C  CA    . GLY C 3 1247 ? 10.384  80.656  68.997  1.00 31.64  ? 1247 GLY A CA    1 
ATOM   10117 C  C     . GLY C 3 1247 ? 11.747  80.638  68.342  1.00 30.47  ? 1247 GLY A C     1 
ATOM   10118 O  O     . GLY C 3 1247 ? 12.449  79.625  68.386  1.00 29.42  ? 1247 GLY A O     1 
ATOM   10119 N  N     . GLY C 3 1248 ? 12.123  81.757  67.729  1.00 30.06  ? 1248 GLY A N     1 
ATOM   10120 C  CA    . GLY C 3 1248 ? 13.411  81.843  67.073  1.00 28.13  ? 1248 GLY A CA    1 
ATOM   10121 C  C     . GLY C 3 1248 ? 13.343  81.444  65.614  1.00 28.61  ? 1248 GLY A C     1 
ATOM   10122 O  O     . GLY C 3 1248 ? 12.423  80.741  65.187  1.00 29.78  ? 1248 GLY A O     1 
ATOM   10123 N  N     . GLY C 3 1249 ? 14.332  81.893  64.847  1.00 29.10  ? 1249 GLY A N     1 
ATOM   10124 C  CA    . GLY C 3 1249 ? 14.387  81.587  63.432  1.00 28.67  ? 1249 GLY A CA    1 
ATOM   10125 C  C     . GLY C 3 1249 ? 14.395  80.105  63.128  1.00 28.13  ? 1249 GLY A C     1 
ATOM   10126 O  O     . GLY C 3 1249 ? 13.685  79.636  62.241  1.00 28.36  ? 1249 GLY A O     1 
ATOM   10127 N  N     . ARG C 3 1250 ? 15.194  79.359  63.871  1.00 28.25  ? 1250 ARG A N     1 
ATOM   10128 C  CA    . ARG C 3 1250 ? 15.296  77.930  63.640  1.00 29.96  ? 1250 ARG A CA    1 
ATOM   10129 C  C     . ARG C 3 1250 ? 13.962  77.208  63.738  1.00 29.90  ? 1250 ARG A C     1 
ATOM   10130 O  O     . ARG C 3 1250 ? 13.611  76.423  62.846  1.00 29.07  ? 1250 ARG A O     1 
ATOM   10131 C  CB    . ARG C 3 1250 ? 16.286  77.303  64.619  1.00 30.21  ? 1250 ARG A CB    1 
ATOM   10132 C  CG    . ARG C 3 1250 ? 16.630  75.880  64.269  1.00 33.22  ? 1250 ARG A CG    1 
ATOM   10133 C  CD    . ARG C 3 1250 ? 17.577  75.301  65.283  1.00 38.04  ? 1250 ARG A CD    1 
ATOM   10134 N  NE    . ARG C 3 1250 ? 17.885  73.896  65.023  1.00 41.84  ? 1250 ARG A NE    1 
ATOM   10135 C  CZ    . ARG C 3 1250 ? 18.594  73.131  65.853  1.00 43.16  ? 1250 ARG A CZ    1 
ATOM   10136 N  NH1   . ARG C 3 1250 ? 19.060  73.645  66.989  1.00 41.99  ? 1250 ARG A NH1   1 
ATOM   10137 N  NH2   . ARG C 3 1250 ? 18.838  71.857  65.552  1.00 41.80  ? 1250 ARG A NH2   1 
ATOM   10138 N  N     . SER C 3 1251 ? 13.211  77.464  64.809  1.00 29.75  ? 1251 SER A N     1 
ATOM   10139 C  CA    . SER C 3 1251 ? 11.938  76.776  64.957  1.00 30.24  ? 1251 SER A CA    1 
ATOM   10140 C  C     . SER C 3 1251 ? 10.943  77.275  63.914  1.00 29.98  ? 1251 SER A C     1 
ATOM   10141 O  O     . SER C 3 1251 ? 10.054  76.529  63.479  1.00 29.88  ? 1251 SER A O     1 
ATOM   10142 C  CB    . SER C 3 1251 ? 11.390  76.912  66.392  1.00 30.76  ? 1251 SER A CB    1 
ATOM   10143 O  OG    . SER C 3 1251 ? 11.206  78.255  66.786  1.00 33.96  ? 1251 SER A OG    1 
ATOM   10144 N  N     . LEU C 3 1252 ? 11.100  78.525  63.487  1.00 28.19  ? 1252 LEU A N     1 
ATOM   10145 C  CA    . LEU C 3 1252 ? 10.210  79.045  62.462  1.00 25.62  ? 1252 LEU A CA    1 
ATOM   10146 C  C     . LEU C 3 1252 ? 10.431  78.242  61.171  1.00 24.55  ? 1252 LEU A C     1 
ATOM   10147 O  O     . LEU C 3 1252 ? 9.479   77.827  60.506  1.00 23.26  ? 1252 LEU A O     1 
ATOM   10148 C  CB    . LEU C 3 1252 ? 10.478  80.529  62.196  1.00 25.75  ? 1252 LEU A CB    1 
ATOM   10149 C  CG    . LEU C 3 1252 ? 9.496   81.053  61.135  1.00 26.56  ? 1252 LEU A CG    1 
ATOM   10150 C  CD1   . LEU C 3 1252 ? 8.055   80.914  61.681  1.00 26.29  ? 1252 LEU A CD1   1 
ATOM   10151 C  CD2   . LEU C 3 1252 ? 9.807   82.495  60.772  1.00 25.21  ? 1252 LEU A CD2   1 
ATOM   10152 N  N     . GLY C 3 1253 ? 11.696  78.022  60.831  1.00 21.96  ? 1253 GLY A N     1 
ATOM   10153 C  CA    . GLY C 3 1253 ? 12.020  77.273  59.633  1.00 23.71  ? 1253 GLY A CA    1 
ATOM   10154 C  C     . GLY C 3 1253 ? 11.482  75.850  59.617  1.00 25.06  ? 1253 GLY A C     1 
ATOM   10155 O  O     . GLY C 3 1253 ? 10.953  75.388  58.601  1.00 24.43  ? 1253 GLY A O     1 
ATOM   10156 N  N     . GLN