data_1N3Q
# 
_entry.id   1N3Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1N3Q         
RCSB  RCSB017480   
WWPDB D_1000017480 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1N3O 'the same protein complex with glucose' unspecified 
PDB 1N3P 'the same protein complex with sucrose' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1N3Q 
_pdbx_database_status.recvd_initial_deposition_date   2002-10-29 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Loris, R.'         1 
'Imberty, A.'       2 
'Beeckmans, S.'     3 
'Van Driessche, E.' 4 
'Read, J.S.'        5 
'Bouckaert, J.'     6 
'De Greve, H.'      7 
'Buts, L.'          8 
'Wyns, L.'          9 
# 
_citation.id                        primary 
_citation.title                     
'Crystal structure of Pterocarpus angolensis lectin in complex with glucose, sucrose, and turanose' 
_citation.journal_abbrev            J.BIOL.CHEM. 
_citation.journal_volume            278 
_citation.page_first                16297 
_citation.page_last                 16303 
_citation.year                      2003 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12595543 
_citation.pdbx_database_id_DOI      10.1074/jbc.M211148200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Loris, R.'         1 ? 
primary 'Imberty, A.'       2 ? 
primary 'Beeckmans, S.'     3 ? 
primary 'Van Driessche, E.' 4 ? 
primary 'Read, J.S.'        5 ? 
primary 'Bouckaert, J.'     6 ? 
primary 'De Greve, H.'      7 ? 
primary 'Buts, L.'          8 ? 
primary 'Wyns, L.'          9 ? 
# 
_cell.entry_id           1N3Q 
_cell.length_a           56.66 
_cell.length_b           83.23 
_cell.length_c           123.16 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              8 
# 
_symmetry.entry_id                         1N3Q 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'lectin PAL'                                        27575.326 2   ? ? ? ? 
2 branched    man 'alpha-D-glucopyranose-(1-3)-beta-D-fructofuranose' 342.297   1   ? ? ? ? 
3 branched    man 'alpha-D-glucopyranose-(1-3)-beta-D-fructopyranose' 342.297   1   ? ? ? ? 
4 non-polymer syn 'MANGANESE (II) ION'                                54.938    2   ? ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                       40.078    2   ? ? ? ? 
6 water       nat water                                               18.015    184 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        beta-turanose 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;QDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSP
LSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTV
KWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
AQKKGENLALEM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;QDSLSFGFPTFPSDQKNLIFQGDAQIKNNAVQLTKTDSNGNPVASTVGRILFSAQVHLWEKSSSRVANFQSQFSFSLKSP
LSNGADGIAFFIAPPDTTIPSGSGGGLLGLFAPGTAQNTSANQVIAVEFDTFYAQDSNTWDPNYPHIGIDVNSIRSVKTV
KWDRRDGQSLNVLVTFNPSTRNLDVVATYSDGTRYEVSYEVDVRSVLPEWVRVGFSAASGEQYQTHTLESWSFTSTLLYT
AQKKGENLALEM
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLN n 
1 2   ASP n 
1 3   SER n 
1 4   LEU n 
1 5   SER n 
1 6   PHE n 
1 7   GLY n 
1 8   PHE n 
1 9   PRO n 
1 10  THR n 
1 11  PHE n 
1 12  PRO n 
1 13  SER n 
1 14  ASP n 
1 15  GLN n 
1 16  LYS n 
1 17  ASN n 
1 18  LEU n 
1 19  ILE n 
1 20  PHE n 
1 21  GLN n 
1 22  GLY n 
1 23  ASP n 
1 24  ALA n 
1 25  GLN n 
1 26  ILE n 
1 27  LYS n 
1 28  ASN n 
1 29  ASN n 
1 30  ALA n 
1 31  VAL n 
1 32  GLN n 
1 33  LEU n 
1 34  THR n 
1 35  LYS n 
1 36  THR n 
1 37  ASP n 
1 38  SER n 
1 39  ASN n 
1 40  GLY n 
1 41  ASN n 
1 42  PRO n 
1 43  VAL n 
1 44  ALA n 
1 45  SER n 
1 46  THR n 
1 47  VAL n 
1 48  GLY n 
1 49  ARG n 
1 50  ILE n 
1 51  LEU n 
1 52  PHE n 
1 53  SER n 
1 54  ALA n 
1 55  GLN n 
1 56  VAL n 
1 57  HIS n 
1 58  LEU n 
1 59  TRP n 
1 60  GLU n 
1 61  LYS n 
1 62  SER n 
1 63  SER n 
1 64  SER n 
1 65  ARG n 
1 66  VAL n 
1 67  ALA n 
1 68  ASN n 
1 69  PHE n 
1 70  GLN n 
1 71  SER n 
1 72  GLN n 
1 73  PHE n 
1 74  SER n 
1 75  PHE n 
1 76  SER n 
1 77  LEU n 
1 78  LYS n 
1 79  SER n 
1 80  PRO n 
1 81  LEU n 
1 82  SER n 
1 83  ASN n 
1 84  GLY n 
1 85  ALA n 
1 86  ASP n 
1 87  GLY n 
1 88  ILE n 
1 89  ALA n 
1 90  PHE n 
1 91  PHE n 
1 92  ILE n 
1 93  ALA n 
1 94  PRO n 
1 95  PRO n 
1 96  ASP n 
1 97  THR n 
1 98  THR n 
1 99  ILE n 
1 100 PRO n 
1 101 SER n 
1 102 GLY n 
1 103 SER n 
1 104 GLY n 
1 105 GLY n 
1 106 GLY n 
1 107 LEU n 
1 108 LEU n 
1 109 GLY n 
1 110 LEU n 
1 111 PHE n 
1 112 ALA n 
1 113 PRO n 
1 114 GLY n 
1 115 THR n 
1 116 ALA n 
1 117 GLN n 
1 118 ASN n 
1 119 THR n 
1 120 SER n 
1 121 ALA n 
1 122 ASN n 
1 123 GLN n 
1 124 VAL n 
1 125 ILE n 
1 126 ALA n 
1 127 VAL n 
1 128 GLU n 
1 129 PHE n 
1 130 ASP n 
1 131 THR n 
1 132 PHE n 
1 133 TYR n 
1 134 ALA n 
1 135 GLN n 
1 136 ASP n 
1 137 SER n 
1 138 ASN n 
1 139 THR n 
1 140 TRP n 
1 141 ASP n 
1 142 PRO n 
1 143 ASN n 
1 144 TYR n 
1 145 PRO n 
1 146 HIS n 
1 147 ILE n 
1 148 GLY n 
1 149 ILE n 
1 150 ASP n 
1 151 VAL n 
1 152 ASN n 
1 153 SER n 
1 154 ILE n 
1 155 ARG n 
1 156 SER n 
1 157 VAL n 
1 158 LYS n 
1 159 THR n 
1 160 VAL n 
1 161 LYS n 
1 162 TRP n 
1 163 ASP n 
1 164 ARG n 
1 165 ARG n 
1 166 ASP n 
1 167 GLY n 
1 168 GLN n 
1 169 SER n 
1 170 LEU n 
1 171 ASN n 
1 172 VAL n 
1 173 LEU n 
1 174 VAL n 
1 175 THR n 
1 176 PHE n 
1 177 ASN n 
1 178 PRO n 
1 179 SER n 
1 180 THR n 
1 181 ARG n 
1 182 ASN n 
1 183 LEU n 
1 184 ASP n 
1 185 VAL n 
1 186 VAL n 
1 187 ALA n 
1 188 THR n 
1 189 TYR n 
1 190 SER n 
1 191 ASP n 
1 192 GLY n 
1 193 THR n 
1 194 ARG n 
1 195 TYR n 
1 196 GLU n 
1 197 VAL n 
1 198 SER n 
1 199 TYR n 
1 200 GLU n 
1 201 VAL n 
1 202 ASP n 
1 203 VAL n 
1 204 ARG n 
1 205 SER n 
1 206 VAL n 
1 207 LEU n 
1 208 PRO n 
1 209 GLU n 
1 210 TRP n 
1 211 VAL n 
1 212 ARG n 
1 213 VAL n 
1 214 GLY n 
1 215 PHE n 
1 216 SER n 
1 217 ALA n 
1 218 ALA n 
1 219 SER n 
1 220 GLY n 
1 221 GLU n 
1 222 GLN n 
1 223 TYR n 
1 224 GLN n 
1 225 THR n 
1 226 HIS n 
1 227 THR n 
1 228 LEU n 
1 229 GLU n 
1 230 SER n 
1 231 TRP n 
1 232 SER n 
1 233 PHE n 
1 234 THR n 
1 235 SER n 
1 236 THR n 
1 237 LEU n 
1 238 LEU n 
1 239 TYR n 
1 240 THR n 
1 241 ALA n 
1 242 GLN n 
1 243 LYS n 
1 244 LYS n 
1 245 GLY n 
1 246 GLU n 
1 247 ASN n 
1 248 LEU n 
1 249 ALA n 
1 250 LEU n 
1 251 GLU n 
1 252 MET n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Pterocarpus angolensis' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      182271 
_entity_src_nat.genus                      Pterocarpus 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    Q8GSD2_PTEAG 
_struct_ref.pdbx_db_accession          Q8GSD2 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1N3Q A 1 ? 252 ? Q8GSD2 9 ? 260 ? 1 252 
2 1 1N3Q B 1 ? 252 ? Q8GSD2 9 ? 260 ? 1 252 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE               ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'           y ARGININE              ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'           y ASPARAGINE            ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'       ? 'C4 H7 N O4'     133.103 
BDF 'D-saccharide, beta linking'  . beta-D-fructopyranose ? 'C6 H12 O6'      180.156 
CA  non-polymer                   . 'CALCIUM ION'         ? 'Ca 2'           40.078  
FRU 'D-saccharide, beta linking'  . beta-D-fructofuranose ? 'C6 H12 O6'      180.156 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose ? 'C6 H12 O6'      180.156 
GLN 'L-peptide linking'           y GLUTAMINE             ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'       ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'             y GLYCINE               ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'           y HISTIDINE             ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                   . WATER                 ? 'H2 O'           18.015  
ILE 'L-peptide linking'           y ISOLEUCINE            ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'           y LEUCINE               ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'           y LYSINE                ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'           y METHIONINE            ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer                   . 'MANGANESE (II) ION'  ? 'Mn 2'           54.938  
PHE 'L-peptide linking'           y PHENYLALANINE         ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'           y PROLINE               ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'           y SERINE                ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'           y THREONINE             ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN            ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'           y TYROSINE              ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'           y VALINE                ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1N3Q 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.63 
_exptl_crystal.density_percent_sol   52.78 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'PEG-8000, Ca-acetate, Na-cacodylate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2001-10-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SAGITALLY FOCUSED Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X31' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   X31 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.00 
# 
_reflns.entry_id                     1N3Q 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.d_resolution_high            2.2 
_reflns.d_resolution_low             15.0 
_reflns.number_all                   29133 
_reflns.number_obs                   29133 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            0.149 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.41 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.70 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.2 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   96.3 
_reflns_shell.Rmerge_I_obs           0.546 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2875 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1N3Q 
_refine.ls_d_res_high                            2.2 
_refine.ls_d_res_low                             15.0 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     29133 
_refine.ls_number_reflns_obs                     29133 
_refine.ls_number_reflns_R_free                  2292 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_all                          0.1879 
_refine.ls_R_factor_obs                          0.1879 
_refine.ls_R_factor_R_work                       0.1836 
_refine.ls_R_factor_R_free                       0.2377 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3717 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         50 
_refine_hist.number_atoms_solvent             184 
_refine_hist.number_atoms_total               3951 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        15.0 
# 
_struct.entry_id                  1N3Q 
_struct.title                     'Pterocarpus angolensis lectin complexed with turanose' 
_struct.pdbx_descriptor           lectin 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1N3Q 
_struct_keywords.pdbx_keywords   'SUGAR BINDING PROTEIN' 
_struct_keywords.text            'lectin, carbohydrate recognition, turanose, sugar binding protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 4 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 104 ? LEU A 108 ? GLY A 104 LEU A 108 5 ? 5 
HELX_P HELX_P2 2 ALA A 112 ? ALA A 116 ? ALA A 112 ALA A 116 5 ? 5 
HELX_P HELX_P3 3 ASN A 118 ? ASN A 122 ? ASN A 118 ASN A 122 5 ? 5 
HELX_P HELX_P4 4 ASP A 202 ? VAL A 206 ? ASP A 202 VAL A 206 5 ? 5 
HELX_P HELX_P5 5 GLY B 104 ? LEU B 108 ? GLY B 104 LEU B 108 5 ? 5 
HELX_P HELX_P6 6 ALA B 112 ? ALA B 116 ? ALA B 112 ALA B 116 5 ? 5 
HELX_P HELX_P7 7 ASP B 202 ? VAL B 206 ? ASP B 202 VAL B 206 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale both ? C FRU .   O3  ? ? ? 1_555 C GLC . C1 ? ? C FRU 1   C GLC 2   1_555 ? ? ? ? ? ? ? 1.400 ? ? 
covale2  covale both ? D BDF .   O3  ? ? ? 1_555 D GLC . C1 ? ? D BDF 1   D GLC 2   1_555 ? ? ? ? ? ? ? 1.405 ? ? 
metalc1  metalc ?    ? A GLU 128 OE2 ? ? ? 1_555 E MN  . MN ? ? A GLU 128 A MN  271 1_555 ? ? ? ? ? ? ? 2.203 ? ? 
metalc2  metalc ?    ? A ASP 130 OD2 ? ? ? 1_555 E MN  . MN ? ? A ASP 130 A MN  271 1_555 ? ? ? ? ? ? ? 2.337 ? ? 
metalc3  metalc ?    ? A ASP 130 OD1 ? ? ? 1_555 F CA  . CA ? ? A ASP 130 A CA  272 1_555 ? ? ? ? ? ? ? 2.495 ? ? 
metalc4  metalc ?    ? A ASP 130 OD2 ? ? ? 1_555 F CA  . CA ? ? A ASP 130 A CA  272 1_555 ? ? ? ? ? ? ? 2.377 ? ? 
metalc5  metalc ?    ? A PHE 132 O   ? ? ? 1_555 F CA  . CA ? ? A PHE 132 A CA  272 1_555 ? ? ? ? ? ? ? 2.377 ? ? 
metalc6  metalc ?    ? A ASN 138 OD1 ? ? ? 1_555 F CA  . CA ? ? A ASN 138 A CA  272 1_555 ? ? ? ? ? ? ? 2.391 ? ? 
metalc7  metalc ?    ? A ASP 141 OD1 ? ? ? 1_555 E MN  . MN ? ? A ASP 141 A MN  271 1_555 ? ? ? ? ? ? ? 2.131 ? ? 
metalc8  metalc ?    ? A ASP 141 OD2 ? ? ? 1_555 F CA  . CA ? ? A ASP 141 A CA  272 1_555 ? ? ? ? ? ? ? 2.287 ? ? 
metalc9  metalc ?    ? A HIS 146 NE2 ? ? ? 1_555 E MN  . MN ? ? A HIS 146 A MN  271 1_555 ? ? ? ? ? ? ? 2.345 ? ? 
metalc10 metalc ?    ? E MN  .   MN  ? ? ? 1_555 I HOH . O  ? ? A MN  271 A HOH 275 1_555 ? ? ? ? ? ? ? 2.340 ? ? 
metalc11 metalc ?    ? E MN  .   MN  ? ? ? 1_555 I HOH . O  ? ? A MN  271 A HOH 276 1_555 ? ? ? ? ? ? ? 2.156 ? ? 
metalc12 metalc ?    ? F CA  .   CA  ? ? ? 1_555 I HOH . O  ? ? A CA  272 A HOH 273 1_555 ? ? ? ? ? ? ? 2.473 ? ? 
metalc13 metalc ?    ? F CA  .   CA  ? ? ? 1_555 I HOH . O  ? ? A CA  272 A HOH 274 1_555 ? ? ? ? ? ? ? 2.352 ? ? 
metalc14 metalc ?    ? B GLU 128 OE1 ? ? ? 1_555 G MN  . MN ? ? B GLU 128 B MN  273 1_555 ? ? ? ? ? ? ? 2.291 ? ? 
metalc15 metalc ?    ? B ASP 130 OD1 ? ? ? 1_555 G MN  . MN ? ? B ASP 130 B MN  273 1_555 ? ? ? ? ? ? ? 2.203 ? ? 
metalc16 metalc ?    ? B ASP 130 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 130 B CA  274 1_555 ? ? ? ? ? ? ? 2.378 ? ? 
metalc17 metalc ?    ? B ASP 130 OD2 ? ? ? 1_555 H CA  . CA ? ? B ASP 130 B CA  274 1_555 ? ? ? ? ? ? ? 2.459 ? ? 
metalc18 metalc ?    ? B PHE 132 O   ? ? ? 1_555 H CA  . CA ? ? B PHE 132 B CA  274 1_555 ? ? ? ? ? ? ? 2.293 ? ? 
metalc19 metalc ?    ? B ASN 138 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASN 138 B CA  274 1_555 ? ? ? ? ? ? ? 2.472 ? ? 
metalc20 metalc ?    ? B ASP 141 OD1 ? ? ? 1_555 G MN  . MN ? ? B ASP 141 B MN  273 1_555 ? ? ? ? ? ? ? 2.148 ? ? 
metalc21 metalc ?    ? B ASP 141 OD2 ? ? ? 1_555 H CA  . CA ? ? B ASP 141 B CA  274 1_555 ? ? ? ? ? ? ? 2.300 ? ? 
metalc22 metalc ?    ? B HIS 146 NE2 ? ? ? 1_555 G MN  . MN ? ? B HIS 146 B MN  273 1_555 ? ? ? ? ? ? ? 2.330 ? ? 
metalc23 metalc ?    ? G MN  .   MN  ? ? ? 1_555 J HOH . O  ? ? B MN  273 B HOH 275 1_555 ? ? ? ? ? ? ? 2.225 ? ? 
metalc24 metalc ?    ? G MN  .   MN  ? ? ? 1_555 J HOH . O  ? ? B MN  273 B HOH 276 1_555 ? ? ? ? ? ? ? 2.208 ? ? 
metalc25 metalc ?    ? H CA  .   CA  ? ? ? 1_555 J HOH . O  ? ? B CA  274 B HOH 277 1_555 ? ? ? ? ? ? ? 2.434 ? ? 
metalc26 metalc ?    ? H CA  .   CA  ? ? ? 1_555 J HOH . O  ? ? B CA  274 B HOH 278 1_555 ? ? ? ? ? ? ? 2.423 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 85 A . ? ALA 85 A ASP 86 A ? ASP 86 A 1 -0.05 
2 ALA 85 B . ? ALA 85 B ASP 86 B ? ASP 86 B 1 0.21  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 24 ? 
B ? 9  ? 
C ? 9  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? anti-parallel 
A 11 12 ? anti-parallel 
A 12 13 ? anti-parallel 
A 13 14 ? anti-parallel 
A 14 15 ? anti-parallel 
A 15 16 ? anti-parallel 
A 16 17 ? anti-parallel 
A 17 18 ? anti-parallel 
A 18 19 ? anti-parallel 
A 19 20 ? anti-parallel 
A 20 21 ? anti-parallel 
A 21 22 ? anti-parallel 
A 22 23 ? anti-parallel 
A 23 24 ? anti-parallel 
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? anti-parallel 
B 5  6  ? anti-parallel 
B 6  7  ? anti-parallel 
B 7  8  ? anti-parallel 
B 8  9  ? anti-parallel 
C 1  2  ? anti-parallel 
C 2  3  ? anti-parallel 
C 3  4  ? anti-parallel 
C 4  5  ? anti-parallel 
C 5  6  ? anti-parallel 
C 6  7  ? anti-parallel 
C 7  8  ? anti-parallel 
C 8  9  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  ARG A 194 ? GLU A 200 ? ARG A 194 GLU A 200 
A 2  ASN A 182 ? TYR A 189 ? ASN A 182 TYR A 189 
A 3  LEU A 170 ? ASN A 177 ? LEU A 170 ASN A 177 
A 4  ARG A 65  ? LYS A 78  ? ARG A 65  LYS A 78  
A 5  TRP A 59  ? GLU A 60  ? TRP A 59  GLU A 60  
A 6  ARG A 65  ? LYS A 78  ? ARG A 65  LYS A 78  
A 7  THR A 225 ? LEU A 238 ? THR A 225 LEU A 238 
A 8  ALA A 30  ? GLN A 32  ? ALA A 30  GLN A 32  
A 9  GLN A 25  ? LYS A 27  ? GLN A 25  LYS A 27  
A 10 ALA A 30  ? GLN A 32  ? ALA A 30  GLN A 32  
A 11 THR A 225 ? LEU A 238 ? THR A 225 LEU A 238 
A 12 SER A 3   ? PHE A 8   ? SER A 3   PHE A 8   
A 13 SER B 3   ? PHE B 8   ? SER B 3   PHE B 8   
A 14 THR B 225 ? TYR B 239 ? THR B 225 TYR B 239 
A 15 ALA B 30  ? GLN B 32  ? ALA B 30  GLN B 32  
A 16 GLN B 25  ? LYS B 27  ? GLN B 25  LYS B 27  
A 17 ALA B 30  ? GLN B 32  ? ALA B 30  GLN B 32  
A 18 THR B 225 ? TYR B 239 ? THR B 225 TYR B 239 
A 19 ARG B 65  ? LYS B 78  ? ARG B 65  LYS B 78  
A 20 TRP B 59  ? GLU B 60  ? TRP B 59  GLU B 60  
A 21 ARG B 65  ? LYS B 78  ? ARG B 65  LYS B 78  
A 22 LEU B 170 ? ASN B 177 ? LEU B 170 ASN B 177 
A 23 ASN B 182 ? TYR B 189 ? ASN B 182 TYR B 189 
A 24 ARG B 194 ? GLU B 200 ? ARG B 194 GLU B 200 
B 1  LEU A 18  ? GLY A 22  ? LEU A 18  GLY A 22  
B 2  THR A 46  ? PHE A 52  ? THR A 46  PHE A 52  
B 3  TRP A 210 ? SER A 219 ? TRP A 210 SER A 219 
B 4  VAL A 56  ? HIS A 57  ? VAL A 56  HIS A 57  
B 5  TRP A 210 ? SER A 219 ? TRP A 210 SER A 219 
B 6  GLY A 87  ? ALA A 93  ? GLY A 87  ALA A 93  
B 7  ILE A 125 ? ASP A 130 ? ILE A 125 ASP A 130 
B 8  HIS A 146 ? VAL A 151 ? HIS A 146 VAL A 151 
B 9  LYS A 158 ? LYS A 161 ? LYS A 158 LYS A 161 
C 1  LEU B 18  ? GLY B 22  ? LEU B 18  GLY B 22  
C 2  THR B 46  ? PHE B 52  ? THR B 46  PHE B 52  
C 3  TRP B 210 ? SER B 219 ? TRP B 210 SER B 219 
C 4  VAL B 56  ? HIS B 57  ? VAL B 56  HIS B 57  
C 5  TRP B 210 ? SER B 219 ? TRP B 210 SER B 219 
C 6  GLY B 87  ? ALA B 93  ? GLY B 87  ALA B 93  
C 7  ILE B 125 ? ASP B 130 ? ILE B 125 ASP B 130 
C 8  HIS B 146 ? VAL B 151 ? HIS B 146 VAL B 151 
C 9  LYS B 158 ? LYS B 161 ? LYS B 158 LYS B 161 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O TYR A 199 ? O TYR A 199 N LEU A 183 ? N LEU A 183 
A 2  3  O THR A 188 ? O THR A 188 N ASN A 171 ? N ASN A 171 
A 3  4  N PHE A 176 ? N PHE A 176 O PHE A 69  ? O PHE A 69  
A 4  5  O ARG A 65  ? O ARG A 65  N GLU A 60  ? N GLU A 60  
A 5  6  N GLU A 60  ? N GLU A 60  O ARG A 65  ? O ARG A 65  
A 6  7  O LYS A 78  ? O LYS A 78  N THR A 225 ? N THR A 225 
A 7  8  O LEU A 228 ? O LEU A 228 N VAL A 31  ? N VAL A 31  
A 8  9  N GLN A 32  ? N GLN A 32  O GLN A 25  ? O GLN A 25  
A 9  10 N LYS A 27  ? N LYS A 27  O ALA A 30  ? O ALA A 30  
A 10 11 N VAL A 31  ? N VAL A 31  O LEU A 228 ? O LEU A 228 
A 11 12 N SER A 235 ? N SER A 235 O LEU A 4   ? O LEU A 4   
A 12 13 N GLY A 7   ? N GLY A 7   O SER B 3   ? O SER B 3   
A 13 14 N PHE B 8   ? N PHE B 8   O TRP B 231 ? O TRP B 231 
A 14 15 O LEU B 228 ? O LEU B 228 N VAL B 31  ? N VAL B 31  
A 15 16 N GLN B 32  ? N GLN B 32  O GLN B 25  ? O GLN B 25  
A 16 17 N LYS B 27  ? N LYS B 27  O ALA B 30  ? O ALA B 30  
A 17 18 N VAL B 31  ? N VAL B 31  O LEU B 228 ? O LEU B 228 
A 18 19 O LEU B 238 ? O LEU B 238 N VAL B 66  ? N VAL B 66  
A 19 20 O ARG B 65  ? O ARG B 65  N GLU B 60  ? N GLU B 60  
A 20 21 N GLU B 60  ? N GLU B 60  O ARG B 65  ? O ARG B 65  
A 21 22 O PHE B 75  ? O PHE B 75  N LEU B 170 ? N LEU B 170 
A 22 23 N ASN B 177 ? N ASN B 177 O ASN B 182 ? O ASN B 182 
A 23 24 N ALA B 187 ? N ALA B 187 O TYR B 195 ? O TYR B 195 
B 1  2  N GLN A 21  ? N GLN A 21  O ARG A 49  ? O ARG A 49  
B 2  3  N PHE A 52  ? N PHE A 52  O VAL A 213 ? O VAL A 213 
B 3  4  O VAL A 211 ? O VAL A 211 N VAL A 56  ? N VAL A 56  
B 4  5  N VAL A 56  ? N VAL A 56  O VAL A 211 ? O VAL A 211 
B 5  6  N ALA A 218 ? N ALA A 218 O GLY A 87  ? O GLY A 87  
B 6  7  N ILE A 92  ? N ILE A 92  O ILE A 125 ? O ILE A 125 
B 7  8  O ASP A 130 ? O ASP A 130 N HIS A 146 ? N HIS A 146 
B 8  9  N ILE A 149 ? N ILE A 149 O LYS A 158 ? O LYS A 158 
C 1  2  N GLN B 21  ? N GLN B 21  O ARG B 49  ? O ARG B 49  
C 2  3  N PHE B 52  ? N PHE B 52  O VAL B 213 ? O VAL B 213 
C 3  4  O VAL B 211 ? O VAL B 211 N VAL B 56  ? N VAL B 56  
C 4  5  N VAL B 56  ? N VAL B 56  O VAL B 211 ? O VAL B 211 
C 5  6  N ALA B 218 ? N ALA B 218 O GLY B 87  ? O GLY B 87  
C 6  7  N ILE B 92  ? N ILE B 92  O ILE B 125 ? O ILE B 125 
C 7  8  O ASP B 130 ? O ASP B 130 N HIS B 146 ? N HIS B 146 
C 8  9  N ILE B 149 ? N ILE B 149 O LYS B 158 ? O LYS B 158 
# 
_database_PDB_matrix.entry_id          1N3Q 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1N3Q 
_atom_sites.fract_transf_matrix[1][1]   0.017649 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012015 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008120 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
MN 
N  
O  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLN A 1 1   ? -5.995  4.094   13.761  1.00 12.02 ? 1   GLN A N   1 
ATOM   2    C  CA  . GLN A 1 1   ? -5.625  3.086   14.801  1.00 12.70 ? 1   GLN A CA  1 
ATOM   3    C  C   . GLN A 1 1   ? -6.278  3.322   16.150  1.00 15.88 ? 1   GLN A C   1 
ATOM   4    O  O   . GLN A 1 1   ? -6.479  4.462   16.569  1.00 17.60 ? 1   GLN A O   1 
ATOM   5    C  CB  . GLN A 1 1   ? -4.113  3.130   14.948  1.00 16.64 ? 1   GLN A CB  1 
ATOM   6    C  CG  . GLN A 1 1   ? -3.694  4.459   14.428  1.00 11.93 ? 1   GLN A CG  1 
ATOM   7    C  CD  . GLN A 1 1   ? -4.763  4.907   13.457  1.00 11.36 ? 1   GLN A CD  1 
ATOM   8    O  OE1 . GLN A 1 1   ? -4.646  5.959   12.844  1.00 17.76 ? 1   GLN A OE1 1 
ATOM   9    N  N   . ASP A 1 2   ? -6.605  2.227   16.826  1.00 15.53 ? 2   ASP A N   1 
ATOM   10   C  CA  . ASP A 1 2   ? -7.202  2.281   18.152  1.00 16.58 ? 2   ASP A CA  1 
ATOM   11   C  C   . ASP A 1 2   ? -6.140  2.713   19.160  1.00 17.57 ? 2   ASP A C   1 
ATOM   12   O  O   . ASP A 1 2   ? -6.434  3.404   20.136  1.00 18.07 ? 2   ASP A O   1 
ATOM   13   C  CB  . ASP A 1 2   ? -7.745  0.901   18.525  1.00 15.79 ? 2   ASP A CB  1 
ATOM   14   C  CG  . ASP A 1 2   ? -9.077  0.611   17.879  1.00 14.50 ? 2   ASP A CG  1 
ATOM   15   O  OD1 . ASP A 1 2   ? -9.332  1.119   16.767  1.00 18.53 ? 2   ASP A OD1 1 
ATOM   16   O  OD2 . ASP A 1 2   ? -9.865  -0.138  18.480  1.00 19.95 ? 2   ASP A OD2 1 
ATOM   17   N  N   . SER A 1 3   ? -4.903  2.295   18.925  1.00 13.94 ? 3   SER A N   1 
ATOM   18   C  CA  . SER A 1 3   ? -3.814  2.653   19.821  1.00 15.06 ? 3   SER A CA  1 
ATOM   19   C  C   . SER A 1 3   ? -2.638  3.192   19.024  1.00 13.60 ? 3   SER A C   1 
ATOM   20   O  O   . SER A 1 3   ? -2.407  2.790   17.886  1.00 13.49 ? 3   SER A O   1 
ATOM   21   C  CB  . SER A 1 3   ? -3.381  1.442   20.646  1.00 15.91 ? 3   SER A CB  1 
ATOM   22   O  OG  . SER A 1 3   ? -2.988  0.372   19.807  1.00 21.24 ? 3   SER A OG  1 
ATOM   23   N  N   . LEU A 1 4   ? -1.908  4.116   19.635  1.00 12.30 ? 4   LEU A N   1 
ATOM   24   C  CA  . LEU A 1 4   ? -0.758  4.746   19.011  1.00 12.23 ? 4   LEU A CA  1 
ATOM   25   C  C   . LEU A 1 4   ? 0.204   5.195   20.094  1.00 16.10 ? 4   LEU A C   1 
ATOM   26   O  O   . LEU A 1 4   ? -0.209  5.653   21.160  1.00 15.05 ? 4   LEU A O   1 
ATOM   27   C  CB  . LEU A 1 4   ? -1.191  5.979   18.203  1.00 11.27 ? 4   LEU A CB  1 
ATOM   28   C  CG  . LEU A 1 4   ? -0.072  6.919   17.725  1.00 18.13 ? 4   LEU A CG  1 
ATOM   29   C  CD1 . LEU A 1 4   ? 0.839   6.192   16.752  1.00 19.05 ? 4   LEU A CD1 1 
ATOM   30   C  CD2 . LEU A 1 4   ? -0.667  8.149   17.058  1.00 18.13 ? 4   LEU A CD2 1 
ATOM   31   N  N   . SER A 1 5   ? 1.491   5.058   19.819  1.00 13.57 ? 5   SER A N   1 
ATOM   32   C  CA  . SER A 1 5   ? 2.503   5.505   20.756  1.00 16.66 ? 5   SER A CA  1 
ATOM   33   C  C   . SER A 1 5   ? 3.791   5.759   19.998  1.00 16.37 ? 5   SER A C   1 
ATOM   34   O  O   . SER A 1 5   ? 4.027   5.181   18.938  1.00 15.36 ? 5   SER A O   1 
ATOM   35   C  CB  . SER A 1 5   ? 2.715   4.480   21.882  1.00 16.42 ? 5   SER A CB  1 
ATOM   36   O  OG  . SER A 1 5   ? 2.982   3.192   21.375  1.00 29.40 ? 5   SER A OG  1 
ATOM   37   N  N   . PHE A 1 6   ? 4.602   6.665   20.526  1.00 15.37 ? 6   PHE A N   1 
ATOM   38   C  CA  . PHE A 1 6   ? 5.878   7.001   19.917  1.00 15.83 ? 6   PHE A CA  1 
ATOM   39   C  C   . PHE A 1 6   ? 6.730   7.605   21.009  1.00 16.04 ? 6   PHE A C   1 
ATOM   40   O  O   . PHE A 1 6   ? 6.207   8.189   21.956  1.00 15.46 ? 6   PHE A O   1 
ATOM   41   C  CB  . PHE A 1 6   ? 5.682   7.981   18.744  1.00 15.75 ? 6   PHE A CB  1 
ATOM   42   C  CG  . PHE A 1 6   ? 4.918   9.235   19.100  1.00 15.01 ? 6   PHE A CG  1 
ATOM   43   C  CD1 . PHE A 1 6   ? 5.528   10.272  19.809  1.00 13.80 ? 6   PHE A CD1 1 
ATOM   44   C  CD2 . PHE A 1 6   ? 3.582   9.377   18.725  1.00 14.42 ? 6   PHE A CD2 1 
ATOM   45   C  CE1 . PHE A 1 6   ? 4.817   11.436  20.139  1.00 11.52 ? 6   PHE A CE1 1 
ATOM   46   C  CE2 . PHE A 1 6   ? 2.859   10.538  19.050  1.00 12.61 ? 6   PHE A CE2 1 
ATOM   47   C  CZ  . PHE A 1 6   ? 3.481   11.567  19.757  1.00 14.11 ? 6   PHE A CZ  1 
ATOM   48   N  N   . GLY A 1 7   ? 8.040   7.436   20.904  1.00 15.27 ? 7   GLY A N   1 
ATOM   49   C  CA  . GLY A 1 7   ? 8.907   7.986   21.921  1.00 14.08 ? 7   GLY A CA  1 
ATOM   50   C  C   . GLY A 1 7   ? 10.134  8.635   21.330  1.00 14.72 ? 7   GLY A C   1 
ATOM   51   O  O   . GLY A 1 7   ? 10.777  8.068   20.438  1.00 10.86 ? 7   GLY A O   1 
ATOM   52   N  N   . PHE A 1 8   ? 10.434  9.838   21.811  1.00 13.69 ? 8   PHE A N   1 
ATOM   53   C  CA  . PHE A 1 8   ? 11.608  10.583  21.380  1.00 13.04 ? 8   PHE A CA  1 
ATOM   54   C  C   . PHE A 1 8   ? 12.535  10.752  22.581  1.00 15.34 ? 8   PHE A C   1 
ATOM   55   O  O   . PHE A 1 8   ? 12.385  11.706  23.346  1.00 15.11 ? 8   PHE A O   1 
ATOM   56   C  CB  . PHE A 1 8   ? 11.264  11.997  20.894  1.00 14.53 ? 8   PHE A CB  1 
ATOM   57   C  CG  . PHE A 1 8   ? 10.418  12.060  19.651  1.00 17.14 ? 8   PHE A CG  1 
ATOM   58   C  CD1 . PHE A 1 8   ? 9.033   11.958  19.723  1.00 16.53 ? 8   PHE A CD1 1 
ATOM   59   C  CD2 . PHE A 1 8   ? 11.009  12.306  18.411  1.00 16.76 ? 8   PHE A CD2 1 
ATOM   60   C  CE1 . PHE A 1 8   ? 8.245   12.114  18.579  1.00 15.27 ? 8   PHE A CE1 1 
ATOM   61   C  CE2 . PHE A 1 8   ? 10.236  12.461  17.265  1.00 15.36 ? 8   PHE A CE2 1 
ATOM   62   C  CZ  . PHE A 1 8   ? 8.849   12.367  17.349  1.00 15.83 ? 8   PHE A CZ  1 
ATOM   63   N  N   . PRO A 1 9   ? 13.467  9.813   22.804  1.00 16.80 ? 9   PRO A N   1 
ATOM   64   C  CA  . PRO A 1 9   ? 14.365  9.991   23.951  1.00 16.20 ? 9   PRO A CA  1 
ATOM   65   C  C   . PRO A 1 9   ? 15.127  11.309  23.770  1.00 19.49 ? 9   PRO A C   1 
ATOM   66   O  O   . PRO A 1 9   ? 15.416  12.016  24.734  1.00 22.02 ? 9   PRO A O   1 
ATOM   67   C  CB  . PRO A 1 9   ? 15.267  8.762   23.862  1.00 16.00 ? 9   PRO A CB  1 
ATOM   68   C  CG  . PRO A 1 9   ? 14.320  7.723   23.280  1.00 18.48 ? 9   PRO A CG  1 
ATOM   69   C  CD  . PRO A 1 9   ? 13.769  8.544   22.124  1.00 17.62 ? 9   PRO A CD  1 
ATOM   70   N  N   . THR A 1 10  ? 15.444  11.624  22.516  1.00 18.36 ? 10  THR A N   1 
ATOM   71   C  CA  . THR A 1 10  ? 16.128  12.862  22.159  1.00 21.37 ? 10  THR A CA  1 
ATOM   72   C  C   . THR A 1 10  ? 15.567  13.270  20.807  1.00 21.47 ? 10  THR A C   1 
ATOM   73   O  O   . THR A 1 10  ? 14.723  12.572  20.239  1.00 21.37 ? 10  THR A O   1 
ATOM   74   C  CB  . THR A 1 10  ? 17.653  12.691  21.991  1.00 22.25 ? 10  THR A CB  1 
ATOM   75   O  OG1 . THR A 1 10  ? 17.918  11.835  20.872  1.00 25.18 ? 10  THR A OG1 1 
ATOM   76   C  CG2 . THR A 1 10  ? 18.267  12.097  23.239  1.00 23.09 ? 10  THR A CG2 1 
ATOM   77   N  N   . PHE A 1 11  ? 16.046  14.393  20.288  1.00 22.87 ? 11  PHE A N   1 
ATOM   78   C  CA  . PHE A 1 11  ? 15.587  14.891  19.004  1.00 22.45 ? 11  PHE A CA  1 
ATOM   79   C  C   . PHE A 1 11  ? 16.708  15.079  17.987  1.00 24.18 ? 11  PHE A C   1 
ATOM   80   O  O   . PHE A 1 11  ? 17.243  16.177  17.832  1.00 22.15 ? 11  PHE A O   1 
ATOM   81   C  CB  . PHE A 1 11  ? 14.834  16.208  19.204  1.00 21.74 ? 11  PHE A CB  1 
ATOM   82   C  CG  . PHE A 1 11  ? 13.463  16.039  19.797  1.00 21.36 ? 11  PHE A CG  1 
ATOM   83   C  CD1 . PHE A 1 11  ? 12.393  15.637  19.002  1.00 19.53 ? 11  PHE A CD1 1 
ATOM   84   C  CD2 . PHE A 1 11  ? 13.241  16.275  21.149  1.00 21.21 ? 11  PHE A CD2 1 
ATOM   85   C  CE1 . PHE A 1 11  ? 11.121  15.476  19.543  1.00 18.52 ? 11  PHE A CE1 1 
ATOM   86   C  CE2 . PHE A 1 11  ? 11.972  16.114  21.700  1.00 20.28 ? 11  PHE A CE2 1 
ATOM   87   C  CZ  . PHE A 1 11  ? 10.910  15.714  20.893  1.00 21.55 ? 11  PHE A CZ  1 
ATOM   88   N  N   . PRO A 1 12  ? 17.092  13.998  17.289  1.00 25.29 ? 12  PRO A N   1 
ATOM   89   C  CA  . PRO A 1 12  ? 18.155  14.105  16.285  1.00 27.00 ? 12  PRO A CA  1 
ATOM   90   C  C   . PRO A 1 12  ? 17.682  15.097  15.225  1.00 30.40 ? 12  PRO A C   1 
ATOM   91   O  O   . PRO A 1 12  ? 16.490  15.385  15.133  1.00 32.60 ? 12  PRO A O   1 
ATOM   92   C  CB  . PRO A 1 12  ? 18.260  12.677  15.759  1.00 27.40 ? 12  PRO A CB  1 
ATOM   93   C  CG  . PRO A 1 12  ? 17.851  11.851  16.986  1.00 28.16 ? 12  PRO A CG  1 
ATOM   94   C  CD  . PRO A 1 12  ? 16.604  12.611  17.361  1.00 25.79 ? 12  PRO A CD  1 
ATOM   95   N  N   . SER A 1 13  ? 18.600  15.616  14.420  1.00 32.17 ? 13  SER A N   1 
ATOM   96   C  CA  . SER A 1 13  ? 18.220  16.598  13.414  1.00 34.15 ? 13  SER A CA  1 
ATOM   97   C  C   . SER A 1 13  ? 17.393  16.115  12.219  1.00 32.34 ? 13  SER A C   1 
ATOM   98   O  O   . SER A 1 13  ? 16.653  16.905  11.640  1.00 34.22 ? 13  SER A O   1 
ATOM   99   C  CB  . SER A 1 13  ? 19.469  17.340  12.921  1.00 36.57 ? 13  SER A CB  1 
ATOM   100  O  OG  . SER A 1 13  ? 20.457  16.430  12.476  1.00 45.86 ? 13  SER A OG  1 
ATOM   101  N  N   . ASP A 1 14  ? 17.490  14.839  11.847  1.00 32.57 ? 14  ASP A N   1 
ATOM   102  C  CA  . ASP A 1 14  ? 16.716  14.351  10.701  1.00 35.09 ? 14  ASP A CA  1 
ATOM   103  C  C   . ASP A 1 14  ? 15.318  13.837  11.056  1.00 33.46 ? 14  ASP A C   1 
ATOM   104  O  O   . ASP A 1 14  ? 15.056  12.640  11.004  1.00 37.74 ? 14  ASP A O   1 
ATOM   105  C  CB  . ASP A 1 14  ? 17.473  13.247  9.940   1.00 39.32 ? 14  ASP A CB  1 
ATOM   106  C  CG  . ASP A 1 14  ? 17.628  11.965  10.748  1.00 45.38 ? 14  ASP A CG  1 
ATOM   107  O  OD1 . ASP A 1 14  ? 18.061  10.942  10.166  1.00 47.57 ? 14  ASP A OD1 1 
ATOM   108  O  OD2 . ASP A 1 14  ? 17.324  11.978  11.962  1.00 47.12 ? 14  ASP A OD2 1 
ATOM   109  N  N   . GLN A 1 15  ? 14.415  14.743  11.410  1.00 31.32 ? 15  GLN A N   1 
ATOM   110  C  CA  . GLN A 1 15  ? 13.057  14.346  11.747  1.00 27.43 ? 15  GLN A CA  1 
ATOM   111  C  C   . GLN A 1 15  ? 12.226  14.177  10.488  1.00 26.21 ? 15  GLN A C   1 
ATOM   112  O  O   . GLN A 1 15  ? 12.455  14.853  9.485   1.00 27.21 ? 15  GLN A O   1 
ATOM   113  C  CB  . GLN A 1 15  ? 12.406  15.382  12.658  1.00 25.56 ? 15  GLN A CB  1 
ATOM   114  C  CG  . GLN A 1 15  ? 13.010  15.428  14.037  1.00 28.30 ? 15  GLN A CG  1 
ATOM   115  C  CD  . GLN A 1 15  ? 12.922  14.090  14.734  1.00 27.14 ? 15  GLN A CD  1 
ATOM   116  O  OE1 . GLN A 1 15  ? 11.845  13.508  14.844  1.00 33.96 ? 15  GLN A OE1 1 
ATOM   117  N  NE2 . GLN A 1 15  ? 14.053  13.596  15.211  1.00 20.43 ? 15  GLN A NE2 1 
ATOM   118  N  N   . LYS A 1 16  ? 11.258  13.272  10.547  1.00 22.06 ? 16  LYS A N   1 
ATOM   119  C  CA  . LYS A 1 16  ? 10.391  13.003  9.408   1.00 21.17 ? 16  LYS A CA  1 
ATOM   120  C  C   . LYS A 1 16  ? 8.912   13.067  9.783   1.00 18.47 ? 16  LYS A C   1 
ATOM   121  O  O   . LYS A 1 16  ? 8.069   13.325  8.930   1.00 14.97 ? 16  LYS A O   1 
ATOM   122  C  CB  . LYS A 1 16  ? 10.712  11.619  8.826   1.00 19.89 ? 16  LYS A CB  1 
ATOM   123  C  CG  . LYS A 1 16  ? 12.123  11.489  8.246   1.00 25.48 ? 16  LYS A CG  1 
ATOM   124  C  CD  . LYS A 1 16  ? 12.262  12.270  6.954   1.00 23.45 ? 16  LYS A CD  1 
ATOM   125  C  CE  . LYS A 1 16  ? 13.720  12.460  6.561   1.00 32.27 ? 16  LYS A CE  1 
ATOM   126  N  NZ  . LYS A 1 16  ? 14.475  11.186  6.501   1.00 35.56 ? 16  LYS A NZ  1 
ATOM   127  N  N   . ASN A 1 17  ? 8.597   12.848  11.057  1.00 16.24 ? 17  ASN A N   1 
ATOM   128  C  CA  . ASN A 1 17  ? 7.203   12.851  11.489  1.00 17.22 ? 17  ASN A CA  1 
ATOM   129  C  C   . ASN A 1 17  ? 6.777   14.030  12.357  1.00 19.96 ? 17  ASN A C   1 
ATOM   130  O  O   . ASN A 1 17  ? 5.763   13.963  13.051  1.00 21.29 ? 17  ASN A O   1 
ATOM   131  C  CB  . ASN A 1 17  ? 6.886   11.540  12.210  1.00 16.81 ? 17  ASN A CB  1 
ATOM   132  C  CG  . ASN A 1 17  ? 7.080   10.330  11.317  1.00 18.16 ? 17  ASN A CG  1 
ATOM   133  O  OD1 . ASN A 1 17  ? 6.547   10.274  10.208  1.00 17.25 ? 17  ASN A OD1 1 
ATOM   134  N  ND2 . ASN A 1 17  ? 7.838   9.352   11.796  1.00 16.59 ? 17  ASN A ND2 1 
ATOM   135  N  N   . LEU A 1 18  ? 7.544   15.111  12.311  1.00 19.58 ? 18  LEU A N   1 
ATOM   136  C  CA  . LEU A 1 18  ? 7.218   16.299  13.085  1.00 20.50 ? 18  LEU A CA  1 
ATOM   137  C  C   . LEU A 1 18  ? 6.843   17.474  12.190  1.00 19.26 ? 18  LEU A C   1 
ATOM   138  O  O   . LEU A 1 18  ? 7.506   17.743  11.196  1.00 18.72 ? 18  LEU A O   1 
ATOM   139  C  CB  . LEU A 1 18  ? 8.404   16.715  13.962  1.00 18.32 ? 18  LEU A CB  1 
ATOM   140  C  CG  . LEU A 1 18  ? 8.772   15.819  15.137  1.00 18.68 ? 18  LEU A CG  1 
ATOM   141  C  CD1 . LEU A 1 18  ? 9.980   16.394  15.864  1.00 19.78 ? 18  LEU A CD1 1 
ATOM   142  C  CD2 . LEU A 1 18  ? 7.578   15.726  16.073  1.00 18.87 ? 18  LEU A CD2 1 
ATOM   143  N  N   . ILE A 1 19  ? 5.768   18.162  12.548  1.00 19.98 ? 19  ILE A N   1 
ATOM   144  C  CA  . ILE A 1 19  ? 5.333   19.339  11.810  1.00 18.44 ? 19  ILE A CA  1 
ATOM   145  C  C   . ILE A 1 19  ? 5.873   20.539  12.586  1.00 19.22 ? 19  ILE A C   1 
ATOM   146  O  O   . ILE A 1 19  ? 5.549   20.724  13.761  1.00 15.61 ? 19  ILE A O   1 
ATOM   147  C  CB  . ILE A 1 19  ? 3.801   19.432  11.752  1.00 18.67 ? 19  ILE A CB  1 
ATOM   148  C  CG1 . ILE A 1 19  ? 3.244   18.238  10.979  1.00 18.76 ? 19  ILE A CG1 1 
ATOM   149  C  CG2 . ILE A 1 19  ? 3.383   20.752  11.114  1.00 17.04 ? 19  ILE A CG2 1 
ATOM   150  C  CD1 . ILE A 1 19  ? 1.726   18.189  10.947  1.00 19.94 ? 19  ILE A CD1 1 
ATOM   151  N  N   . PHE A 1 20  ? 6.714   21.331  11.935  1.00 18.32 ? 20  PHE A N   1 
ATOM   152  C  CA  . PHE A 1 20  ? 7.305   22.509  12.557  1.00 18.39 ? 20  PHE A CA  1 
ATOM   153  C  C   . PHE A 1 20  ? 6.550   23.753  12.132  1.00 17.77 ? 20  PHE A C   1 
ATOM   154  O  O   . PHE A 1 20  ? 6.324   23.968  10.947  1.00 17.60 ? 20  PHE A O   1 
ATOM   155  C  CB  . PHE A 1 20  ? 8.766   22.639  12.136  1.00 18.67 ? 20  PHE A CB  1 
ATOM   156  C  CG  . PHE A 1 20  ? 9.652   21.554  12.672  1.00 20.06 ? 20  PHE A CG  1 
ATOM   157  C  CD1 . PHE A 1 20  ? 10.170  21.634  13.955  1.00 18.61 ? 20  PHE A CD1 1 
ATOM   158  C  CD2 . PHE A 1 20  ? 9.962   20.440  11.891  1.00 23.56 ? 20  PHE A CD2 1 
ATOM   159  C  CE1 . PHE A 1 20  ? 10.991  20.621  14.458  1.00 19.52 ? 20  PHE A CE1 1 
ATOM   160  C  CE2 . PHE A 1 20  ? 10.781  19.423  12.386  1.00 17.74 ? 20  PHE A CE2 1 
ATOM   161  C  CZ  . PHE A 1 20  ? 11.295  19.517  13.669  1.00 18.23 ? 20  PHE A CZ  1 
ATOM   162  N  N   . GLN A 1 21  ? 6.155   24.572  13.099  1.00 17.32 ? 21  GLN A N   1 
ATOM   163  C  CA  . GLN A 1 21  ? 5.437   25.799  12.786  1.00 17.92 ? 21  GLN A CA  1 
ATOM   164  C  C   . GLN A 1 21  ? 6.124   26.967  13.485  1.00 20.73 ? 21  GLN A C   1 
ATOM   165  O  O   . GLN A 1 21  ? 6.646   26.814  14.589  1.00 22.09 ? 21  GLN A O   1 
ATOM   166  C  CB  . GLN A 1 21  ? 3.983   25.695  13.246  1.00 20.65 ? 21  GLN A CB  1 
ATOM   167  C  CG  . GLN A 1 21  ? 3.252   24.461  12.727  1.00 18.93 ? 21  GLN A CG  1 
ATOM   168  C  CD  . GLN A 1 21  ? 1.783   24.454  13.117  1.00 22.82 ? 21  GLN A CD  1 
ATOM   169  O  OE1 . GLN A 1 21  ? 1.432   24.790  14.251  1.00 20.46 ? 21  GLN A OE1 1 
ATOM   170  N  NE2 . GLN A 1 21  ? 0.918   24.044  12.189  1.00 16.67 ? 21  GLN A NE2 1 
ATOM   171  N  N   . GLY A 1 22  ? 6.138   28.131  12.845  1.00 22.24 ? 22  GLY A N   1 
ATOM   172  C  CA  . GLY A 1 22  ? 6.775   29.283  13.461  1.00 22.54 ? 22  GLY A CA  1 
ATOM   173  C  C   . GLY A 1 22  ? 8.287   29.175  13.447  1.00 23.74 ? 22  GLY A C   1 
ATOM   174  O  O   . GLY A 1 22  ? 8.871   28.867  12.410  1.00 27.76 ? 22  GLY A O   1 
ATOM   175  N  N   . ASP A 1 23  ? 8.929   29.400  14.590  1.00 21.65 ? 23  ASP A N   1 
ATOM   176  C  CA  . ASP A 1 23  ? 10.389  29.341  14.655  1.00 19.84 ? 23  ASP A CA  1 
ATOM   177  C  C   . ASP A 1 23  ? 10.965  28.068  15.261  1.00 20.21 ? 23  ASP A C   1 
ATOM   178  O  O   . ASP A 1 23  ? 12.162  28.012  15.552  1.00 20.54 ? 23  ASP A O   1 
ATOM   179  C  CB  . ASP A 1 23  ? 10.930  30.531  15.450  1.00 22.51 ? 23  ASP A CB  1 
ATOM   180  C  CG  . ASP A 1 23  ? 10.353  31.848  14.987  1.00 25.50 ? 23  ASP A CG  1 
ATOM   181  O  OD1 . ASP A 1 23  ? 10.397  32.126  13.772  1.00 25.89 ? 23  ASP A OD1 1 
ATOM   182  O  OD2 . ASP A 1 23  ? 9.860   32.606  15.843  1.00 25.19 ? 23  ASP A OD2 1 
ATOM   183  N  N   . ALA A 1 24  ? 10.137  27.049  15.459  1.00 18.62 ? 24  ALA A N   1 
ATOM   184  C  CA  . ALA A 1 24  ? 10.630  25.811  16.056  1.00 19.00 ? 24  ALA A CA  1 
ATOM   185  C  C   . ALA A 1 24  ? 11.645  25.114  15.169  1.00 19.22 ? 24  ALA A C   1 
ATOM   186  O  O   . ALA A 1 24  ? 11.466  25.030  13.963  1.00 19.17 ? 24  ALA A O   1 
ATOM   187  C  CB  . ALA A 1 24  ? 9.473   24.867  16.341  1.00 17.88 ? 24  ALA A CB  1 
ATOM   188  N  N   . GLN A 1 25  ? 12.714  24.613  15.768  1.00 21.49 ? 25  GLN A N   1 
ATOM   189  C  CA  . GLN A 1 25  ? 13.728  23.900  15.005  1.00 27.46 ? 25  GLN A CA  1 
ATOM   190  C  C   . GLN A 1 25  ? 14.581  23.074  15.950  1.00 26.99 ? 25  GLN A C   1 
ATOM   191  O  O   . GLN A 1 25  ? 14.604  23.321  17.156  1.00 27.26 ? 25  GLN A O   1 
ATOM   192  C  CB  . GLN A 1 25  ? 14.620  24.877  14.235  1.00 30.56 ? 25  GLN A CB  1 
ATOM   193  C  CG  . GLN A 1 25  ? 15.478  25.764  15.112  1.00 36.55 ? 25  GLN A CG  1 
ATOM   194  C  CD  . GLN A 1 25  ? 16.400  26.665  14.306  1.00 42.20 ? 25  GLN A CD  1 
ATOM   195  O  OE1 . GLN A 1 25  ? 17.213  26.191  13.508  1.00 42.81 ? 25  GLN A OE1 1 
ATOM   196  N  NE2 . GLN A 1 25  ? 16.281  27.973  14.516  1.00 45.10 ? 25  GLN A NE2 1 
ATOM   197  N  N   . ILE A 1 26  ? 15.283  22.094  15.400  1.00 24.98 ? 26  ILE A N   1 
ATOM   198  C  CA  . ILE A 1 26  ? 16.136  21.248  16.212  1.00 26.68 ? 26  ILE A CA  1 
ATOM   199  C  C   . ILE A 1 26  ? 17.554  21.793  16.294  1.00 27.48 ? 26  ILE A C   1 
ATOM   200  O  O   . ILE A 1 26  ? 18.104  22.270  15.306  1.00 26.08 ? 26  ILE A O   1 
ATOM   201  C  CB  . ILE A 1 26  ? 16.167  19.809  15.660  1.00 26.57 ? 26  ILE A CB  1 
ATOM   202  C  CG1 . ILE A 1 26  ? 14.788  19.174  15.829  1.00 24.84 ? 26  ILE A CG1 1 
ATOM   203  C  CG2 . ILE A 1 26  ? 17.249  18.994  16.363  1.00 24.33 ? 26  ILE A CG2 1 
ATOM   204  C  CD1 . ILE A 1 26  ? 14.724  17.742  15.392  1.00 30.39 ? 26  ILE A CD1 1 
ATOM   205  N  N   . LYS A 1 27  ? 18.122  21.725  17.493  1.00 29.11 ? 27  LYS A N   1 
ATOM   206  C  CA  . LYS A 1 27  ? 19.484  22.178  17.765  1.00 32.63 ? 27  LYS A CA  1 
ATOM   207  C  C   . LYS A 1 27  ? 20.010  21.353  18.930  1.00 33.41 ? 27  LYS A C   1 
ATOM   208  O  O   . LYS A 1 27  ? 19.358  21.257  19.968  1.00 33.51 ? 27  LYS A O   1 
ATOM   209  C  CB  . LYS A 1 27  ? 19.515  23.650  18.182  1.00 36.38 ? 27  LYS A CB  1 
ATOM   210  C  CG  . LYS A 1 27  ? 19.075  24.652  17.142  1.00 42.43 ? 27  LYS A CG  1 
ATOM   211  C  CD  . LYS A 1 27  ? 19.146  26.058  17.731  1.00 48.26 ? 27  LYS A CD  1 
ATOM   212  C  CE  . LYS A 1 27  ? 18.738  27.119  16.726  1.00 52.73 ? 27  LYS A CE  1 
ATOM   213  N  NZ  . LYS A 1 27  ? 19.658  27.137  15.557  1.00 56.24 ? 27  LYS A NZ  1 
ATOM   214  N  N   . ASN A 1 28  ? 21.184  20.758  18.758  1.00 33.44 ? 28  ASN A N   1 
ATOM   215  C  CA  . ASN A 1 28  ? 21.793  19.959  19.815  1.00 35.59 ? 28  ASN A CA  1 
ATOM   216  C  C   . ASN A 1 28  ? 20.867  18.865  20.348  1.00 32.76 ? 28  ASN A C   1 
ATOM   217  O  O   . ASN A 1 28  ? 20.688  18.731  21.558  1.00 31.78 ? 28  ASN A O   1 
ATOM   218  C  CB  . ASN A 1 28  ? 22.217  20.870  20.970  1.00 41.94 ? 28  ASN A CB  1 
ATOM   219  C  CG  . ASN A 1 28  ? 23.122  22.001  20.517  1.00 48.10 ? 28  ASN A CG  1 
ATOM   220  O  OD1 . ASN A 1 28  ? 22.719  22.857  19.729  1.00 51.14 ? 28  ASN A OD1 1 
ATOM   221  N  ND2 . ASN A 1 28  ? 24.354  22.008  21.012  1.00 51.18 ? 28  ASN A ND2 1 
ATOM   222  N  N   . ASN A 1 29  ? 20.280  18.093  19.439  1.00 28.82 ? 29  ASN A N   1 
ATOM   223  C  CA  . ASN A 1 29  ? 19.380  16.999  19.799  1.00 28.26 ? 29  ASN A CA  1 
ATOM   224  C  C   . ASN A 1 29  ? 18.192  17.373  20.682  1.00 25.41 ? 29  ASN A C   1 
ATOM   225  O  O   . ASN A 1 29  ? 17.686  16.544  21.436  1.00 23.55 ? 29  ASN A O   1 
ATOM   226  C  CB  . ASN A 1 29  ? 20.160  15.864  20.463  1.00 31.96 ? 29  ASN A CB  1 
ATOM   227  C  CG  . ASN A 1 29  ? 21.251  15.314  19.573  1.00 37.73 ? 29  ASN A CG  1 
ATOM   228  O  OD1 . ASN A 1 29  ? 21.004  14.934  18.426  1.00 40.57 ? 29  ASN A OD1 1 
ATOM   229  N  ND2 . ASN A 1 29  ? 22.467  15.260  20.098  1.00 40.23 ? 29  ASN A ND2 1 
ATOM   230  N  N   . ALA A 1 30  ? 17.750  18.619  20.585  1.00 22.48 ? 30  ALA A N   1 
ATOM   231  C  CA  . ALA A 1 30  ? 16.603  19.080  21.347  1.00 21.76 ? 30  ALA A CA  1 
ATOM   232  C  C   . ALA A 1 30  ? 15.817  20.028  20.455  1.00 20.34 ? 30  ALA A C   1 
ATOM   233  O  O   . ALA A 1 30  ? 16.344  20.545  19.475  1.00 20.44 ? 30  ALA A O   1 
ATOM   234  C  CB  . ALA A 1 30  ? 17.053  19.794  22.605  1.00 20.48 ? 30  ALA A CB  1 
ATOM   235  N  N   . VAL A 1 31  ? 14.553  20.246  20.785  1.00 17.83 ? 31  VAL A N   1 
ATOM   236  C  CA  . VAL A 1 31  ? 13.733  21.149  19.998  1.00 18.07 ? 31  VAL A CA  1 
ATOM   237  C  C   . VAL A 1 31  ? 13.693  22.532  20.644  1.00 20.39 ? 31  VAL A C   1 
ATOM   238  O  O   . VAL A 1 31  ? 13.248  22.680  21.786  1.00 18.27 ? 31  VAL A O   1 
ATOM   239  C  CB  . VAL A 1 31  ? 12.284  20.631  19.877  1.00 19.72 ? 31  VAL A CB  1 
ATOM   240  C  CG1 . VAL A 1 31  ? 11.457  21.607  19.054  1.00 16.90 ? 31  VAL A CG1 1 
ATOM   241  C  CG2 . VAL A 1 31  ? 12.274  19.232  19.248  1.00 14.86 ? 31  VAL A CG2 1 
ATOM   242  N  N   . GLN A 1 32  ? 14.182  23.538  19.925  1.00 17.61 ? 32  GLN A N   1 
ATOM   243  C  CA  . GLN A 1 32  ? 14.142  24.905  20.424  1.00 18.56 ? 32  GLN A CA  1 
ATOM   244  C  C   . GLN A 1 32  ? 12.857  25.477  19.846  1.00 18.89 ? 32  GLN A C   1 
ATOM   245  O  O   . GLN A 1 32  ? 12.828  25.901  18.695  1.00 20.24 ? 32  GLN A O   1 
ATOM   246  C  CB  . GLN A 1 32  ? 15.331  25.732  19.919  1.00 19.47 ? 32  GLN A CB  1 
ATOM   247  C  CG  . GLN A 1 32  ? 16.698  25.245  20.348  1.00 21.63 ? 32  GLN A CG  1 
ATOM   248  C  CD  . GLN A 1 32  ? 16.810  25.070  21.850  1.00 29.19 ? 32  GLN A CD  1 
ATOM   249  O  OE1 . GLN A 1 32  ? 16.382  25.931  22.625  1.00 27.10 ? 32  GLN A OE1 1 
ATOM   250  N  NE2 . GLN A 1 32  ? 17.407  23.959  22.272  1.00 28.05 ? 32  GLN A NE2 1 
ATOM   251  N  N   . LEU A 1 33  ? 11.793  25.471  20.641  1.00 20.18 ? 33  LEU A N   1 
ATOM   252  C  CA  . LEU A 1 33  ? 10.503  25.978  20.195  1.00 17.25 ? 33  LEU A CA  1 
ATOM   253  C  C   . LEU A 1 33  ? 10.573  27.449  19.815  1.00 18.87 ? 33  LEU A C   1 
ATOM   254  O  O   . LEU A 1 33  ? 9.935   27.886  18.859  1.00 19.95 ? 33  LEU A O   1 
ATOM   255  C  CB  . LEU A 1 33  ? 9.458   25.757  21.286  1.00 16.96 ? 33  LEU A CB  1 
ATOM   256  C  CG  . LEU A 1 33  ? 9.121   24.287  21.535  1.00 18.49 ? 33  LEU A CG  1 
ATOM   257  C  CD1 . LEU A 1 33  ? 8.236   24.133  22.763  1.00 17.42 ? 33  LEU A CD1 1 
ATOM   258  C  CD2 . LEU A 1 33  ? 8.432   23.737  20.302  1.00 18.49 ? 33  LEU A CD2 1 
ATOM   259  N  N   . THR A 1 34  ? 11.358  28.212  20.562  1.00 20.11 ? 34  THR A N   1 
ATOM   260  C  CA  . THR A 1 34  ? 11.507  29.630  20.284  1.00 18.31 ? 34  THR A CA  1 
ATOM   261  C  C   . THR A 1 34  ? 12.895  29.943  19.740  1.00 20.43 ? 34  THR A C   1 
ATOM   262  O  O   . THR A 1 34  ? 13.875  29.269  20.067  1.00 21.14 ? 34  THR A O   1 
ATOM   263  C  CB  . THR A 1 34  ? 11.236  30.471  21.537  1.00 17.17 ? 34  THR A CB  1 
ATOM   264  O  OG1 . THR A 1 34  ? 11.992  29.954  22.638  1.00 16.68 ? 34  THR A OG1 1 
ATOM   265  C  CG2 . THR A 1 34  ? 9.760   30.447  21.870  1.00 15.57 ? 34  THR A CG2 1 
ATOM   266  N  N   . LYS A 1 35  ? 12.958  30.980  18.910  1.00 21.28 ? 35  LYS A N   1 
ATOM   267  C  CA  . LYS A 1 35  ? 14.189  31.411  18.260  1.00 24.07 ? 35  LYS A CA  1 
ATOM   268  C  C   . LYS A 1 35  ? 15.341  31.793  19.188  1.00 26.55 ? 35  LYS A C   1 
ATOM   269  O  O   . LYS A 1 35  ? 15.139  32.328  20.277  1.00 25.77 ? 35  LYS A O   1 
ATOM   270  C  CB  . LYS A 1 35  ? 13.872  32.578  17.316  1.00 25.45 ? 35  LYS A CB  1 
ATOM   271  C  CG  . LYS A 1 35  ? 15.056  33.074  16.502  1.00 29.97 ? 35  LYS A CG  1 
ATOM   272  C  CD  . LYS A 1 35  ? 14.627  34.144  15.504  1.00 28.84 ? 35  LYS A CD  1 
ATOM   273  N  N   . THR A 1 36  ? 16.555  31.500  18.736  1.00 29.63 ? 36  THR A N   1 
ATOM   274  C  CA  . THR A 1 36  ? 17.768  31.813  19.477  1.00 36.61 ? 36  THR A CA  1 
ATOM   275  C  C   . THR A 1 36  ? 18.765  32.373  18.468  1.00 40.39 ? 36  THR A C   1 
ATOM   276  O  O   . THR A 1 36  ? 18.626  32.133  17.268  1.00 41.52 ? 36  THR A O   1 
ATOM   277  C  CB  . THR A 1 36  ? 18.362  30.554  20.132  1.00 39.74 ? 36  THR A CB  1 
ATOM   278  O  OG1 . THR A 1 36  ? 18.650  29.582  19.120  1.00 44.97 ? 36  THR A OG1 1 
ATOM   279  C  CG2 . THR A 1 36  ? 17.381  29.960  21.132  1.00 35.97 ? 36  THR A CG2 1 
ATOM   280  N  N   . ASP A 1 37  ? 19.759  33.123  18.939  1.00 44.79 ? 37  ASP A N   1 
ATOM   281  C  CA  . ASP A 1 37  ? 20.749  33.707  18.034  1.00 47.72 ? 37  ASP A CA  1 
ATOM   282  C  C   . ASP A 1 37  ? 21.923  32.779  17.739  1.00 51.16 ? 37  ASP A C   1 
ATOM   283  O  O   . ASP A 1 37  ? 21.882  31.588  18.048  1.00 52.53 ? 37  ASP A O   1 
ATOM   284  C  CB  . ASP A 1 37  ? 21.287  35.035  18.586  1.00 47.87 ? 37  ASP A CB  1 
ATOM   285  C  CG  . ASP A 1 37  ? 21.968  34.883  19.933  1.00 48.89 ? 37  ASP A CG  1 
ATOM   286  O  OD1 . ASP A 1 37  ? 22.795  33.960  20.092  1.00 48.16 ? 37  ASP A OD1 1 
ATOM   287  O  OD2 . ASP A 1 37  ? 21.690  35.704  20.830  1.00 51.89 ? 37  ASP A OD2 1 
ATOM   288  N  N   . SER A 1 38  ? 22.969  33.345  17.142  1.00 53.26 ? 38  SER A N   1 
ATOM   289  C  CA  . SER A 1 38  ? 24.173  32.603  16.780  1.00 56.18 ? 38  SER A CA  1 
ATOM   290  C  C   . SER A 1 38  ? 24.809  31.895  17.970  1.00 56.80 ? 38  SER A C   1 
ATOM   291  O  O   . SER A 1 38  ? 25.129  30.707  17.900  1.00 56.79 ? 38  SER A O   1 
ATOM   292  C  CB  . SER A 1 38  ? 25.194  33.552  16.153  1.00 58.61 ? 38  SER A CB  1 
ATOM   293  O  OG  . SER A 1 38  ? 24.653  34.195  15.014  1.00 64.13 ? 38  SER A OG  1 
ATOM   294  N  N   . ASN A 1 39  ? 24.999  32.633  19.058  1.00 57.53 ? 39  ASN A N   1 
ATOM   295  C  CA  . ASN A 1 39  ? 25.599  32.077  20.261  1.00 58.05 ? 39  ASN A CA  1 
ATOM   296  C  C   . ASN A 1 39  ? 24.615  31.336  21.169  1.00 55.81 ? 39  ASN A C   1 
ATOM   297  O  O   . ASN A 1 39  ? 24.918  31.062  22.329  1.00 56.83 ? 39  ASN A O   1 
ATOM   298  C  CB  . ASN A 1 39  ? 26.334  33.179  21.040  1.00 61.11 ? 39  ASN A CB  1 
ATOM   299  C  CG  . ASN A 1 39  ? 25.638  34.525  20.953  1.00 65.69 ? 39  ASN A CG  1 
ATOM   300  O  OD1 . ASN A 1 39  ? 25.561  35.125  19.879  1.00 66.43 ? 39  ASN A OD1 1 
ATOM   301  N  ND2 . ASN A 1 39  ? 25.124  35.004  22.081  1.00 69.04 ? 39  ASN A ND2 1 
ATOM   302  N  N   . GLY A 1 40  ? 23.439  31.016  20.634  1.00 53.18 ? 40  GLY A N   1 
ATOM   303  C  CA  . GLY A 1 40  ? 22.443  30.272  21.391  1.00 49.94 ? 40  GLY A CA  1 
ATOM   304  C  C   . GLY A 1 40  ? 21.581  31.007  22.405  1.00 47.73 ? 40  GLY A C   1 
ATOM   305  O  O   . GLY A 1 40  ? 20.918  30.371  23.224  1.00 47.31 ? 40  GLY A O   1 
ATOM   306  N  N   . ASN A 1 41  ? 21.575  32.334  22.359  1.00 45.70 ? 41  ASN A N   1 
ATOM   307  C  CA  . ASN A 1 41  ? 20.774  33.112  23.297  1.00 42.62 ? 41  ASN A CA  1 
ATOM   308  C  C   . ASN A 1 41  ? 19.360  33.367  22.804  1.00 37.28 ? 41  ASN A C   1 
ATOM   309  O  O   . ASN A 1 41  ? 19.127  33.546  21.611  1.00 37.92 ? 41  ASN A O   1 
ATOM   310  C  CB  . ASN A 1 41  ? 21.451  34.448  23.594  1.00 46.47 ? 41  ASN A CB  1 
ATOM   311  C  CG  . ASN A 1 41  ? 22.738  34.285  24.362  1.00 50.19 ? 41  ASN A CG  1 
ATOM   312  O  OD1 . ASN A 1 41  ? 23.436  35.260  24.636  1.00 55.85 ? 41  ASN A OD1 1 
ATOM   313  N  ND2 . ASN A 1 41  ? 23.060  33.047  24.722  1.00 48.86 ? 41  ASN A ND2 1 
ATOM   314  N  N   . PRO A 1 42  ? 18.392  33.389  23.730  1.00 33.11 ? 42  PRO A N   1 
ATOM   315  C  CA  . PRO A 1 42  ? 16.985  33.624  23.406  1.00 29.83 ? 42  PRO A CA  1 
ATOM   316  C  C   . PRO A 1 42  ? 16.767  35.039  22.879  1.00 27.20 ? 42  PRO A C   1 
ATOM   317  O  O   . PRO A 1 42  ? 17.496  35.962  23.245  1.00 26.49 ? 42  PRO A O   1 
ATOM   318  C  CB  . PRO A 1 42  ? 16.299  33.398  24.749  1.00 30.11 ? 42  PRO A CB  1 
ATOM   319  C  CG  . PRO A 1 42  ? 17.349  33.921  25.720  1.00 32.17 ? 42  PRO A CG  1 
ATOM   320  C  CD  . PRO A 1 42  ? 18.547  33.177  25.180  1.00 31.45 ? 42  PRO A CD  1 
ATOM   321  N  N   . VAL A 1 43  ? 15.768  35.207  22.021  1.00 24.51 ? 43  VAL A N   1 
ATOM   322  C  CA  . VAL A 1 43  ? 15.462  36.520  21.468  1.00 24.92 ? 43  VAL A CA  1 
ATOM   323  C  C   . VAL A 1 43  ? 13.998  36.871  21.704  1.00 24.98 ? 43  VAL A C   1 
ATOM   324  O  O   . VAL A 1 43  ? 13.181  36.007  22.033  1.00 22.78 ? 43  VAL A O   1 
ATOM   325  C  CB  . VAL A 1 43  ? 15.750  36.577  19.951  1.00 24.04 ? 43  VAL A CB  1 
ATOM   326  C  CG1 . VAL A 1 43  ? 17.205  36.234  19.691  1.00 25.05 ? 43  VAL A CG1 1 
ATOM   327  C  CG2 . VAL A 1 43  ? 14.833  35.623  19.204  1.00 27.74 ? 43  VAL A CG2 1 
ATOM   328  N  N   . ALA A 1 44  ? 13.673  38.148  21.536  1.00 24.80 ? 44  ALA A N   1 
ATOM   329  C  CA  . ALA A 1 44  ? 12.312  38.627  21.729  1.00 26.40 ? 44  ALA A CA  1 
ATOM   330  C  C   . ALA A 1 44  ? 11.442  38.364  20.506  1.00 28.43 ? 44  ALA A C   1 
ATOM   331  O  O   . ALA A 1 44  ? 11.942  38.030  19.434  1.00 30.02 ? 44  ALA A O   1 
ATOM   332  C  CB  . ALA A 1 44  ? 12.331  40.119  22.037  1.00 26.01 ? 44  ALA A CB  1 
ATOM   333  N  N   . SER A 1 45  ? 10.134  38.509  20.684  1.00 29.43 ? 45  SER A N   1 
ATOM   334  C  CA  . SER A 1 45  ? 9.166   38.324  19.610  1.00 30.56 ? 45  SER A CA  1 
ATOM   335  C  C   . SER A 1 45  ? 9.360   37.049  18.809  1.00 29.64 ? 45  SER A C   1 
ATOM   336  O  O   . SER A 1 45  ? 9.768   37.095  17.651  1.00 29.44 ? 45  SER A O   1 
ATOM   337  C  CB  . SER A 1 45  ? 9.219   39.518  18.659  1.00 31.70 ? 45  SER A CB  1 
ATOM   338  O  OG  . SER A 1 45  ? 8.984   40.724  19.359  1.00 42.53 ? 45  SER A OG  1 
ATOM   339  N  N   . THR A 1 46  ? 9.059   35.911  19.417  1.00 27.09 ? 46  THR A N   1 
ATOM   340  C  CA  . THR A 1 46  ? 9.206   34.644  18.723  1.00 24.60 ? 46  THR A CA  1 
ATOM   341  C  C   . THR A 1 46  ? 8.185   33.623  19.210  1.00 24.36 ? 46  THR A C   1 
ATOM   342  O  O   . THR A 1 46  ? 7.918   33.518  20.407  1.00 23.02 ? 46  THR A O   1 
ATOM   343  C  CB  . THR A 1 46  ? 10.628  34.074  18.911  1.00 23.92 ? 46  THR A CB  1 
ATOM   344  O  OG1 . THR A 1 46  ? 10.721  32.790  18.279  1.00 22.71 ? 46  THR A OG1 1 
ATOM   345  C  CG2 . THR A 1 46  ? 10.957  33.937  20.388  1.00 24.08 ? 46  THR A CG2 1 
ATOM   346  N  N   . VAL A 1 47  ? 7.603   32.891  18.267  1.00 22.04 ? 47  VAL A N   1 
ATOM   347  C  CA  . VAL A 1 47  ? 6.622   31.854  18.573  1.00 24.08 ? 47  VAL A CA  1 
ATOM   348  C  C   . VAL A 1 47  ? 7.023   30.608  17.796  1.00 24.69 ? 47  VAL A C   1 
ATOM   349  O  O   . VAL A 1 47  ? 7.505   30.706  16.670  1.00 24.14 ? 47  VAL A O   1 
ATOM   350  C  CB  . VAL A 1 47  ? 5.200   32.249  18.127  1.00 23.79 ? 47  VAL A CB  1 
ATOM   351  C  CG1 . VAL A 1 47  ? 4.213   31.166  18.528  1.00 24.26 ? 47  VAL A CG1 1 
ATOM   352  C  CG2 . VAL A 1 47  ? 4.807   33.575  18.740  1.00 30.32 ? 47  VAL A CG2 1 
ATOM   353  N  N   . GLY A 1 48  ? 6.830   29.439  18.398  1.00 25.42 ? 48  GLY A N   1 
ATOM   354  C  CA  . GLY A 1 48  ? 7.173   28.199  17.725  1.00 22.77 ? 48  GLY A CA  1 
ATOM   355  C  C   . GLY A 1 48  ? 6.330   27.047  18.239  1.00 22.67 ? 48  GLY A C   1 
ATOM   356  O  O   . GLY A 1 48  ? 5.942   27.038  19.413  1.00 21.78 ? 48  GLY A O   1 
ATOM   357  N  N   . ARG A 1 49  ? 6.032   26.083  17.369  1.00 18.60 ? 49  ARG A N   1 
ATOM   358  C  CA  . ARG A 1 49  ? 5.232   24.928  17.771  1.00 18.73 ? 49  ARG A CA  1 
ATOM   359  C  C   . ARG A 1 49  ? 5.633   23.697  16.969  1.00 18.91 ? 49  ARG A C   1 
ATOM   360  O  O   . ARG A 1 49  ? 6.214   23.816  15.892  1.00 19.36 ? 49  ARG A O   1 
ATOM   361  C  CB  . ARG A 1 49  ? 3.733   25.185  17.537  1.00 18.41 ? 49  ARG A CB  1 
ATOM   362  C  CG  . ARG A 1 49  ? 3.270   26.616  17.775  1.00 20.09 ? 49  ARG A CG  1 
ATOM   363  C  CD  . ARG A 1 49  ? 1.756   26.718  17.954  1.00 17.93 ? 49  ARG A CD  1 
ATOM   364  N  NE  . ARG A 1 49  ? 0.991   25.982  16.950  1.00 17.63 ? 49  ARG A NE  1 
ATOM   365  C  CZ  . ARG A 1 49  ? -0.338  26.012  16.857  1.00 15.78 ? 49  ARG A CZ  1 
ATOM   366  N  NH1 . ARG A 1 49  ? -1.051  26.744  17.704  1.00 16.53 ? 49  ARG A NH1 1 
ATOM   367  N  NH2 . ARG A 1 49  ? -0.961  25.297  15.932  1.00 7.15  ? 49  ARG A NH2 1 
ATOM   368  N  N   . ILE A 1 50  ? 5.346   22.517  17.511  1.00 18.52 ? 50  ILE A N   1 
ATOM   369  C  CA  . ILE A 1 50  ? 5.617   21.269  16.808  1.00 20.65 ? 50  ILE A CA  1 
ATOM   370  C  C   . ILE A 1 50  ? 4.429   20.356  17.058  1.00 22.19 ? 50  ILE A C   1 
ATOM   371  O  O   . ILE A 1 50  ? 3.782   20.438  18.105  1.00 21.90 ? 50  ILE A O   1 
ATOM   372  C  CB  . ILE A 1 50  ? 6.908   20.539  17.284  1.00 23.33 ? 50  ILE A CB  1 
ATOM   373  C  CG1 . ILE A 1 50  ? 6.790   20.149  18.756  1.00 23.38 ? 50  ILE A CG1 1 
ATOM   374  C  CG2 . ILE A 1 50  ? 8.132   21.408  17.032  1.00 22.01 ? 50  ILE A CG2 1 
ATOM   375  C  CD1 . ILE A 1 50  ? 7.923   19.245  19.221  1.00 25.47 ? 50  ILE A CD1 1 
ATOM   376  N  N   . LEU A 1 51  ? 4.139   19.498  16.084  1.00 20.20 ? 51  LEU A N   1 
ATOM   377  C  CA  . LEU A 1 51  ? 3.025   18.560  16.176  1.00 18.17 ? 51  LEU A CA  1 
ATOM   378  C  C   . LEU A 1 51  ? 3.491   17.245  15.584  1.00 18.35 ? 51  LEU A C   1 
ATOM   379  O  O   . LEU A 1 51  ? 4.249   17.239  14.618  1.00 19.20 ? 51  LEU A O   1 
ATOM   380  C  CB  . LEU A 1 51  ? 1.844   19.052  15.343  1.00 16.62 ? 51  LEU A CB  1 
ATOM   381  C  CG  . LEU A 1 51  ? 1.185   20.396  15.652  1.00 21.46 ? 51  LEU A CG  1 
ATOM   382  C  CD1 . LEU A 1 51  ? 0.331   20.832  14.472  1.00 21.87 ? 51  LEU A CD1 1 
ATOM   383  C  CD2 . LEU A 1 51  ? 0.361   20.273  16.909  1.00 20.41 ? 51  LEU A CD2 1 
ATOM   384  N  N   . PHE A 1 52  ? 3.051   16.129  16.150  1.00 17.03 ? 52  PHE A N   1 
ATOM   385  C  CA  . PHE A 1 52  ? 3.429   14.850  15.577  1.00 15.69 ? 52  PHE A CA  1 
ATOM   386  C  C   . PHE A 1 52  ? 2.501   14.741  14.360  1.00 14.75 ? 52  PHE A C   1 
ATOM   387  O  O   . PHE A 1 52  ? 1.326   15.097  14.443  1.00 13.84 ? 52  PHE A O   1 
ATOM   388  C  CB  . PHE A 1 52  ? 3.167   13.707  16.558  1.00 12.61 ? 52  PHE A CB  1 
ATOM   389  C  CG  . PHE A 1 52  ? 3.753   12.395  16.115  1.00 15.28 ? 52  PHE A CG  1 
ATOM   390  C  CD1 . PHE A 1 52  ? 5.130   12.246  15.996  1.00 9.70  ? 52  PHE A CD1 1 
ATOM   391  C  CD2 . PHE A 1 52  ? 2.932   11.314  15.814  1.00 15.43 ? 52  PHE A CD2 1 
ATOM   392  C  CE1 . PHE A 1 52  ? 5.686   11.039  15.582  1.00 16.51 ? 52  PHE A CE1 1 
ATOM   393  C  CE2 . PHE A 1 52  ? 3.474   10.102  15.398  1.00 16.42 ? 52  PHE A CE2 1 
ATOM   394  C  CZ  . PHE A 1 52  ? 4.858   9.963   15.282  1.00 14.74 ? 52  PHE A CZ  1 
ATOM   395  N  N   . SER A 1 53  ? 3.025   14.264  13.237  1.00 16.43 ? 53  SER A N   1 
ATOM   396  C  CA  . SER A 1 53  ? 2.231   14.163  12.010  1.00 16.59 ? 53  SER A CA  1 
ATOM   397  C  C   . SER A 1 53  ? 1.020   13.244  12.066  1.00 14.85 ? 53  SER A C   1 
ATOM   398  O  O   . SER A 1 53  ? -0.056  13.617  11.607  1.00 17.11 ? 53  SER A O   1 
ATOM   399  C  CB  . SER A 1 53  ? 3.122   13.748  10.843  1.00 16.85 ? 53  SER A CB  1 
ATOM   400  O  OG  . SER A 1 53  ? 3.733   12.499  11.094  1.00 25.13 ? 53  SER A OG  1 
ATOM   401  N  N   . ALA A 1 54  ? 1.188   12.045  12.615  1.00 15.07 ? 54  ALA A N   1 
ATOM   402  C  CA  . ALA A 1 54  ? 0.081   11.095  12.703  1.00 15.48 ? 54  ALA A CA  1 
ATOM   403  C  C   . ALA A 1 54  ? -1.020  11.619  13.620  1.00 18.68 ? 54  ALA A C   1 
ATOM   404  O  O   . ALA A 1 54  ? -0.754  12.077  14.735  1.00 20.25 ? 54  ALA A O   1 
ATOM   405  C  CB  . ALA A 1 54  ? 0.584   9.746   13.208  1.00 15.18 ? 54  ALA A CB  1 
ATOM   406  N  N   . GLN A 1 55  ? -2.257  11.549  13.145  1.00 16.21 ? 55  GLN A N   1 
ATOM   407  C  CA  . GLN A 1 55  ? -3.396  12.014  13.917  1.00 18.40 ? 55  GLN A CA  1 
ATOM   408  C  C   . GLN A 1 55  ? -3.767  11.006  14.993  1.00 19.80 ? 55  GLN A C   1 
ATOM   409  O  O   . GLN A 1 55  ? -3.671  9.795   14.787  1.00 19.58 ? 55  GLN A O   1 
ATOM   410  C  CB  . GLN A 1 55  ? -4.590  12.270  12.990  1.00 18.56 ? 55  GLN A CB  1 
ATOM   411  C  CG  . GLN A 1 55  ? -4.346  13.400  12.000  1.00 23.09 ? 55  GLN A CG  1 
ATOM   412  C  CD  . GLN A 1 55  ? -5.565  13.724  11.164  1.00 24.64 ? 55  GLN A CD  1 
ATOM   413  O  OE1 . GLN A 1 55  ? -6.661  13.906  11.690  1.00 26.69 ? 55  GLN A OE1 1 
ATOM   414  N  NE2 . GLN A 1 55  ? -5.376  13.818  9.857   1.00 28.41 ? 55  GLN A NE2 1 
ATOM   415  N  N   . VAL A 1 56  ? -4.187  11.519  16.145  1.00 19.62 ? 56  VAL A N   1 
ATOM   416  C  CA  . VAL A 1 56  ? -4.568  10.685  17.275  1.00 17.05 ? 56  VAL A CA  1 
ATOM   417  C  C   . VAL A 1 56  ? -6.082  10.558  17.364  1.00 18.75 ? 56  VAL A C   1 
ATOM   418  O  O   . VAL A 1 56  ? -6.811  11.552  17.280  1.00 15.68 ? 56  VAL A O   1 
ATOM   419  C  CB  . VAL A 1 56  ? -4.038  11.281  18.595  1.00 18.50 ? 56  VAL A CB  1 
ATOM   420  C  CG1 . VAL A 1 56  ? -4.400  10.377  19.765  1.00 14.49 ? 56  VAL A CG1 1 
ATOM   421  C  CG2 . VAL A 1 56  ? -2.536  11.473  18.501  1.00 18.23 ? 56  VAL A CG2 1 
ATOM   422  N  N   . HIS A 1 57  ? -6.553  9.327   17.533  1.00 17.61 ? 57  HIS A N   1 
ATOM   423  C  CA  . HIS A 1 57  ? -7.981  9.070   17.633  1.00 17.16 ? 57  HIS A CA  1 
ATOM   424  C  C   . HIS A 1 57  ? -8.353  9.237   19.107  1.00 19.17 ? 57  HIS A C   1 
ATOM   425  O  O   . HIS A 1 57  ? -8.257  8.297   19.893  1.00 18.98 ? 57  HIS A O   1 
ATOM   426  C  CB  . HIS A 1 57  ? -8.276  7.650   17.148  1.00 17.94 ? 57  HIS A CB  1 
ATOM   427  C  CG  . HIS A 1 57  ? -9.676  7.456   16.661  1.00 20.63 ? 57  HIS A CG  1 
ATOM   428  N  ND1 . HIS A 1 57  ? -10.136 6.248   16.180  1.00 24.38 ? 57  HIS A ND1 1 
ATOM   429  C  CD2 . HIS A 1 57  ? -10.712 8.320   16.561  1.00 21.27 ? 57  HIS A CD2 1 
ATOM   430  C  CE1 . HIS A 1 57  ? -11.396 6.377   15.806  1.00 22.32 ? 57  HIS A CE1 1 
ATOM   431  N  NE2 . HIS A 1 57  ? -11.770 7.624   16.025  1.00 22.93 ? 57  HIS A NE2 1 
ATOM   432  N  N   . LEU A 1 58  ? -8.768  10.450  19.465  1.00 20.29 ? 58  LEU A N   1 
ATOM   433  C  CA  . LEU A 1 58  ? -9.123  10.801  20.840  1.00 20.32 ? 58  LEU A CA  1 
ATOM   434  C  C   . LEU A 1 58  ? -10.398 10.129  21.333  1.00 20.91 ? 58  LEU A C   1 
ATOM   435  O  O   . LEU A 1 58  ? -10.480 9.691   22.480  1.00 20.26 ? 58  LEU A O   1 
ATOM   436  C  CB  . LEU A 1 58  ? -9.256  12.316  20.960  1.00 17.46 ? 58  LEU A CB  1 
ATOM   437  C  CG  . LEU A 1 58  ? -9.380  12.845  22.382  1.00 18.52 ? 58  LEU A CG  1 
ATOM   438  C  CD1 . LEU A 1 58  ? -8.154  12.436  23.180  1.00 19.38 ? 58  LEU A CD1 1 
ATOM   439  C  CD2 . LEU A 1 58  ? -9.517  14.358  22.342  1.00 19.27 ? 58  LEU A CD2 1 
ATOM   440  N  N   . TRP A 1 59  ? -11.409 10.083  20.476  1.00 22.94 ? 59  TRP A N   1 
ATOM   441  C  CA  . TRP A 1 59  ? -12.650 9.417   20.824  1.00 23.36 ? 59  TRP A CA  1 
ATOM   442  C  C   . TRP A 1 59  ? -13.388 9.000   19.567  1.00 25.79 ? 59  TRP A C   1 
ATOM   443  O  O   . TRP A 1 59  ? -13.227 9.602   18.505  1.00 25.83 ? 59  TRP A O   1 
ATOM   444  C  CB  . TRP A 1 59  ? -13.546 10.283  21.721  1.00 24.94 ? 59  TRP A CB  1 
ATOM   445  C  CG  . TRP A 1 59  ? -13.955 11.606  21.173  1.00 26.06 ? 59  TRP A CG  1 
ATOM   446  C  CD1 . TRP A 1 59  ? -13.190 12.731  21.080  1.00 26.64 ? 59  TRP A CD1 1 
ATOM   447  C  CD2 . TRP A 1 59  ? -15.246 11.952  20.661  1.00 27.99 ? 59  TRP A CD2 1 
ATOM   448  N  NE1 . TRP A 1 59  ? -13.929 13.763  20.543  1.00 27.16 ? 59  TRP A NE1 1 
ATOM   449  C  CE2 . TRP A 1 59  ? -15.194 13.310  20.276  1.00 24.62 ? 59  TRP A CE2 1 
ATOM   450  C  CE3 . TRP A 1 59  ? -16.446 11.244  20.489  1.00 27.73 ? 59  TRP A CE3 1 
ATOM   451  C  CZ2 . TRP A 1 59  ? -16.294 13.977  19.730  1.00 26.06 ? 59  TRP A CZ2 1 
ATOM   452  C  CZ3 . TRP A 1 59  ? -17.542 11.909  19.945  1.00 26.62 ? 59  TRP A CZ3 1 
ATOM   453  C  CH2 . TRP A 1 59  ? -17.456 13.262  19.573  1.00 26.97 ? 59  TRP A CH2 1 
ATOM   454  N  N   . GLU A 1 60  ? -14.194 7.954   19.701  1.00 27.47 ? 60  GLU A N   1 
ATOM   455  C  CA  . GLU A 1 60  ? -14.937 7.403   18.583  1.00 31.61 ? 60  GLU A CA  1 
ATOM   456  C  C   . GLU A 1 60  ? -16.420 7.372   18.925  1.00 33.77 ? 60  GLU A C   1 
ATOM   457  O  O   . GLU A 1 60  ? -16.841 6.672   19.845  1.00 35.51 ? 60  GLU A O   1 
ATOM   458  C  CB  . GLU A 1 60  ? -14.410 5.994   18.304  1.00 30.33 ? 60  GLU A CB  1 
ATOM   459  C  CG  . GLU A 1 60  ? -14.919 5.332   17.047  1.00 33.10 ? 60  GLU A CG  1 
ATOM   460  C  CD  . GLU A 1 60  ? -14.248 3.990   16.811  1.00 35.04 ? 60  GLU A CD  1 
ATOM   461  O  OE1 . GLU A 1 60  ? -14.392 3.098   17.674  1.00 34.51 ? 60  GLU A OE1 1 
ATOM   462  O  OE2 . GLU A 1 60  ? -13.570 3.829   15.770  1.00 35.17 ? 60  GLU A OE2 1 
ATOM   463  N  N   . LYS A 1 61  ? -17.206 8.141   18.181  1.00 36.00 ? 61  LYS A N   1 
ATOM   464  C  CA  . LYS A 1 61  ? -18.644 8.223   18.407  1.00 40.07 ? 61  LYS A CA  1 
ATOM   465  C  C   . LYS A 1 61  ? -19.392 6.891   18.268  1.00 39.25 ? 61  LYS A C   1 
ATOM   466  O  O   . LYS A 1 61  ? -20.160 6.514   19.152  1.00 42.71 ? 61  LYS A O   1 
ATOM   467  C  CB  . LYS A 1 61  ? -19.258 9.254   17.455  1.00 43.11 ? 61  LYS A CB  1 
ATOM   468  C  CG  . LYS A 1 61  ? -20.754 9.447   17.633  1.00 48.42 ? 61  LYS A CG  1 
ATOM   469  C  CD  . LYS A 1 61  ? -21.307 10.451  16.633  1.00 53.83 ? 61  LYS A CD  1 
ATOM   470  C  CE  . LYS A 1 61  ? -22.817 10.601  16.791  1.00 60.02 ? 61  LYS A CE  1 
ATOM   471  N  NZ  . LYS A 1 61  ? -23.416 11.541  15.797  1.00 61.54 ? 61  LYS A NZ  1 
ATOM   472  N  N   . SER A 1 62  ? -19.165 6.178   17.170  1.00 38.29 ? 62  SER A N   1 
ATOM   473  C  CA  . SER A 1 62  ? -19.853 4.907   16.936  1.00 39.82 ? 62  SER A CA  1 
ATOM   474  C  C   . SER A 1 62  ? -19.693 3.868   18.049  1.00 40.26 ? 62  SER A C   1 
ATOM   475  O  O   . SER A 1 62  ? -20.674 3.265   18.480  1.00 40.93 ? 62  SER A O   1 
ATOM   476  C  CB  . SER A 1 62  ? -19.396 4.295   15.611  1.00 36.82 ? 62  SER A CB  1 
ATOM   477  O  OG  . SER A 1 62  ? -18.021 3.966   15.654  1.00 39.49 ? 62  SER A OG  1 
ATOM   478  N  N   . SER A 1 63  ? -18.466 3.651   18.509  1.00 40.00 ? 63  SER A N   1 
ATOM   479  C  CA  . SER A 1 63  ? -18.221 2.668   19.560  1.00 40.37 ? 63  SER A CA  1 
ATOM   480  C  C   . SER A 1 63  ? -18.420 3.266   20.944  1.00 40.09 ? 63  SER A C   1 
ATOM   481  O  O   . SER A 1 63  ? -18.445 2.545   21.944  1.00 40.57 ? 63  SER A O   1 
ATOM   482  C  CB  . SER A 1 63  ? -16.794 2.117   19.456  1.00 44.58 ? 63  SER A CB  1 
ATOM   483  O  OG  . SER A 1 63  ? -15.831 3.133   19.688  1.00 44.28 ? 63  SER A OG  1 
ATOM   484  N  N   . SER A 1 64  ? -18.559 4.586   20.994  1.00 39.32 ? 64  SER A N   1 
ATOM   485  C  CA  . SER A 1 64  ? -18.736 5.298   22.253  1.00 36.11 ? 64  SER A CA  1 
ATOM   486  C  C   . SER A 1 64  ? -17.500 5.128   23.146  1.00 33.21 ? 64  SER A C   1 
ATOM   487  O  O   . SER A 1 64  ? -17.601 5.044   24.369  1.00 31.66 ? 64  SER A O   1 
ATOM   488  C  CB  . SER A 1 64  ? -19.983 4.787   22.977  1.00 38.17 ? 64  SER A CB  1 
ATOM   489  O  OG  . SER A 1 64  ? -20.223 5.531   24.162  1.00 45.86 ? 64  SER A OG  1 
ATOM   490  N  N   . ARG A 1 65  ? -16.327 5.077   22.524  1.00 29.19 ? 65  ARG A N   1 
ATOM   491  C  CA  . ARG A 1 65  ? -15.091 4.925   23.275  1.00 24.98 ? 65  ARG A CA  1 
ATOM   492  C  C   . ARG A 1 65  ? -14.326 6.233   23.346  1.00 21.76 ? 65  ARG A C   1 
ATOM   493  O  O   . ARG A 1 65  ? -14.434 7.079   22.456  1.00 20.16 ? 65  ARG A O   1 
ATOM   494  C  CB  . ARG A 1 65  ? -14.188 3.866   22.638  1.00 24.42 ? 65  ARG A CB  1 
ATOM   495  C  CG  . ARG A 1 65  ? -14.724 2.456   22.696  1.00 21.41 ? 65  ARG A CG  1 
ATOM   496  C  CD  . ARG A 1 65  ? -13.730 1.500   22.075  1.00 21.68 ? 65  ARG A CD  1 
ATOM   497  N  NE  . ARG A 1 65  ? -13.555 1.758   20.651  1.00 24.25 ? 65  ARG A NE  1 
ATOM   498  C  CZ  . ARG A 1 65  ? -12.643 1.160   19.892  1.00 26.12 ? 65  ARG A CZ  1 
ATOM   499  N  NH1 . ARG A 1 65  ? -11.819 0.269   20.423  1.00 26.74 ? 65  ARG A NH1 1 
ATOM   500  N  NH2 . ARG A 1 65  ? -12.560 1.447   18.601  1.00 26.98 ? 65  ARG A NH2 1 
ATOM   501  N  N   . VAL A 1 66  ? -13.555 6.387   24.415  1.00 17.97 ? 66  VAL A N   1 
ATOM   502  C  CA  . VAL A 1 66  ? -12.742 7.576   24.611  1.00 19.41 ? 66  VAL A CA  1 
ATOM   503  C  C   . VAL A 1 66  ? -11.330 7.112   24.922  1.00 18.99 ? 66  VAL A C   1 
ATOM   504  O  O   . VAL A 1 66  ? -11.126 6.134   25.639  1.00 21.04 ? 66  VAL A O   1 
ATOM   505  C  CB  . VAL A 1 66  ? -13.275 8.439   25.769  1.00 19.17 ? 66  VAL A CB  1 
ATOM   506  C  CG1 . VAL A 1 66  ? -12.403 9.665   25.955  1.00 13.28 ? 66  VAL A CG1 1 
ATOM   507  C  CG2 . VAL A 1 66  ? -14.705 8.850   25.479  1.00 18.35 ? 66  VAL A CG2 1 
ATOM   508  N  N   . ALA A 1 67  ? -10.355 7.820   24.379  1.00 18.55 ? 67  ALA A N   1 
ATOM   509  C  CA  . ALA A 1 67  ? -8.969  7.456   24.582  1.00 19.03 ? 67  ALA A CA  1 
ATOM   510  C  C   . ALA A 1 67  ? -8.420  7.760   25.966  1.00 22.07 ? 67  ALA A C   1 
ATOM   511  O  O   . ALA A 1 67  ? -8.759  8.761   26.597  1.00 21.11 ? 67  ALA A O   1 
ATOM   512  C  CB  . ALA A 1 67  ? -8.097  8.135   23.527  1.00 17.91 ? 67  ALA A CB  1 
ATOM   513  N  N   . ASN A 1 68  ? -7.574  6.850   26.426  1.00 22.92 ? 68  ASN A N   1 
ATOM   514  C  CA  . ASN A 1 68  ? -6.863  6.970   27.684  1.00 23.73 ? 68  ASN A CA  1 
ATOM   515  C  C   . ASN A 1 68  ? -5.457  7.297   27.183  1.00 25.13 ? 68  ASN A C   1 
ATOM   516  O  O   . ASN A 1 68  ? -4.842  6.471   26.502  1.00 29.38 ? 68  ASN A O   1 
ATOM   517  C  CB  . ASN A 1 68  ? -6.857  5.629   28.415  1.00 25.85 ? 68  ASN A CB  1 
ATOM   518  C  CG  . ASN A 1 68  ? -5.908  5.613   29.593  1.00 34.69 ? 68  ASN A CG  1 
ATOM   519  O  OD1 . ASN A 1 68  ? -4.689  5.707   29.425  1.00 34.23 ? 68  ASN A OD1 1 
ATOM   520  N  ND2 . ASN A 1 68  ? -6.460  5.501   30.800  1.00 37.82 ? 68  ASN A ND2 1 
ATOM   521  N  N   . PHE A 1 69  ? -4.950  8.489   27.479  1.00 18.74 ? 69  PHE A N   1 
ATOM   522  C  CA  . PHE A 1 69  ? -3.620  8.830   26.997  1.00 17.10 ? 69  PHE A CA  1 
ATOM   523  C  C   . PHE A 1 69  ? -2.678  9.307   28.082  1.00 17.42 ? 69  PHE A C   1 
ATOM   524  O  O   . PHE A 1 69  ? -3.094  9.689   29.176  1.00 14.29 ? 69  PHE A O   1 
ATOM   525  C  CB  . PHE A 1 69  ? -3.699  9.871   25.863  1.00 18.04 ? 69  PHE A CB  1 
ATOM   526  C  CG  . PHE A 1 69  ? -4.146  11.240  26.308  1.00 18.86 ? 69  PHE A CG  1 
ATOM   527  C  CD1 . PHE A 1 69  ? -3.273  12.091  26.981  1.00 20.66 ? 69  PHE A CD1 1 
ATOM   528  C  CD2 . PHE A 1 69  ? -5.437  11.681  26.048  1.00 18.72 ? 69  PHE A CD2 1 
ATOM   529  C  CE1 . PHE A 1 69  ? -3.683  13.363  27.383  1.00 21.89 ? 69  PHE A CE1 1 
ATOM   530  C  CE2 . PHE A 1 69  ? -5.856  12.954  26.448  1.00 18.31 ? 69  PHE A CE2 1 
ATOM   531  C  CZ  . PHE A 1 69  ? -4.976  13.794  27.114  1.00 16.71 ? 69  PHE A CZ  1 
ATOM   532  N  N   . GLN A 1 70  ? -1.393  9.265   27.755  1.00 16.71 ? 70  GLN A N   1 
ATOM   533  C  CA  . GLN A 1 70  ? -0.341  9.674   28.659  1.00 17.06 ? 70  GLN A CA  1 
ATOM   534  C  C   . GLN A 1 70  ? 0.790   10.297  27.859  1.00 19.64 ? 70  GLN A C   1 
ATOM   535  O  O   . GLN A 1 70  ? 1.283   9.714   26.892  1.00 23.62 ? 70  GLN A O   1 
ATOM   536  C  CB  . GLN A 1 70  ? 0.183   8.472   29.440  1.00 14.31 ? 70  GLN A CB  1 
ATOM   537  C  CG  . GLN A 1 70  ? 1.464   8.767   30.184  1.00 22.91 ? 70  GLN A CG  1 
ATOM   538  C  CD  . GLN A 1 70  ? 1.922   7.612   31.038  1.00 25.44 ? 70  GLN A CD  1 
ATOM   539  O  OE1 . GLN A 1 70  ? 1.301   7.292   32.051  1.00 28.82 ? 70  GLN A OE1 1 
ATOM   540  N  NE2 . GLN A 1 70  ? 3.007   6.968   30.627  1.00 23.41 ? 70  GLN A NE2 1 
ATOM   541  N  N   . SER A 1 71  ? 1.190   11.492  28.262  1.00 18.75 ? 71  SER A N   1 
ATOM   542  C  CA  . SER A 1 71  ? 2.262   12.199  27.590  1.00 17.84 ? 71  SER A CA  1 
ATOM   543  C  C   . SER A 1 71  ? 3.322   12.511  28.631  1.00 17.54 ? 71  SER A C   1 
ATOM   544  O  O   . SER A 1 71  ? 3.037   13.124  29.657  1.00 18.56 ? 71  SER A O   1 
ATOM   545  C  CB  . SER A 1 71  ? 1.739   13.494  26.967  1.00 17.14 ? 71  SER A CB  1 
ATOM   546  O  OG  . SER A 1 71  ? 2.775   14.183  26.288  1.00 20.39 ? 71  SER A OG  1 
ATOM   547  N  N   . GLN A 1 72  ? 4.541   12.065  28.361  1.00 15.98 ? 72  GLN A N   1 
ATOM   548  C  CA  . GLN A 1 72  ? 5.660   12.278  29.258  1.00 17.64 ? 72  GLN A CA  1 
ATOM   549  C  C   . GLN A 1 72  ? 6.688   13.093  28.489  1.00 16.12 ? 72  GLN A C   1 
ATOM   550  O  O   . GLN A 1 72  ? 6.972   12.800  27.331  1.00 16.39 ? 72  GLN A O   1 
ATOM   551  C  CB  . GLN A 1 72  ? 6.256   10.932  29.666  1.00 19.50 ? 72  GLN A CB  1 
ATOM   552  C  CG  . GLN A 1 72  ? 7.317   11.019  30.742  1.00 32.41 ? 72  GLN A CG  1 
ATOM   553  C  CD  . GLN A 1 72  ? 7.879   9.656   31.100  1.00 41.28 ? 72  GLN A CD  1 
ATOM   554  O  OE1 . GLN A 1 72  ? 7.132   8.722   31.395  1.00 41.87 ? 72  GLN A OE1 1 
ATOM   555  N  NE2 . GLN A 1 72  ? 9.203   9.537   31.085  1.00 47.86 ? 72  GLN A NE2 1 
ATOM   556  N  N   . PHE A 1 73  ? 7.241   14.117  29.126  1.00 13.94 ? 73  PHE A N   1 
ATOM   557  C  CA  . PHE A 1 73  ? 8.224   14.957  28.461  1.00 13.67 ? 73  PHE A CA  1 
ATOM   558  C  C   . PHE A 1 73  ? 9.004   15.795  29.462  1.00 13.36 ? 73  PHE A C   1 
ATOM   559  O  O   . PHE A 1 73  ? 8.643   15.884  30.634  1.00 12.97 ? 73  PHE A O   1 
ATOM   560  C  CB  . PHE A 1 73  ? 7.511   15.862  27.447  1.00 13.32 ? 73  PHE A CB  1 
ATOM   561  C  CG  . PHE A 1 73  ? 6.477   16.778  28.061  1.00 16.83 ? 73  PHE A CG  1 
ATOM   562  C  CD1 . PHE A 1 73  ? 6.848   17.981  28.649  1.00 18.33 ? 73  PHE A CD1 1 
ATOM   563  C  CD2 . PHE A 1 73  ? 5.127   16.430  28.050  1.00 16.96 ? 73  PHE A CD2 1 
ATOM   564  C  CE1 . PHE A 1 73  ? 5.889   18.829  29.215  1.00 16.83 ? 73  PHE A CE1 1 
ATOM   565  C  CE2 . PHE A 1 73  ? 4.163   17.269  28.614  1.00 15.35 ? 73  PHE A CE2 1 
ATOM   566  C  CZ  . PHE A 1 73  ? 4.546   18.471  29.197  1.00 14.52 ? 73  PHE A CZ  1 
ATOM   567  N  N   . SER A 1 74  ? 10.088  16.404  29.007  1.00 13.15 ? 74  SER A N   1 
ATOM   568  C  CA  . SER A 1 74  ? 10.875  17.240  29.896  1.00 15.06 ? 74  SER A CA  1 
ATOM   569  C  C   . SER A 1 74  ? 11.416  18.413  29.096  1.00 17.45 ? 74  SER A C   1 
ATOM   570  O  O   . SER A 1 74  ? 11.762  18.274  27.918  1.00 16.71 ? 74  SER A O   1 
ATOM   571  C  CB  . SER A 1 74  ? 12.028  16.445  30.520  1.00 14.94 ? 74  SER A CB  1 
ATOM   572  O  OG  . SER A 1 74  ? 13.030  16.172  29.565  1.00 24.06 ? 74  SER A OG  1 
ATOM   573  N  N   . PHE A 1 75  ? 11.463  19.577  29.730  1.00 15.27 ? 75  PHE A N   1 
ATOM   574  C  CA  . PHE A 1 75  ? 11.965  20.768  29.067  1.00 17.25 ? 75  PHE A CA  1 
ATOM   575  C  C   . PHE A 1 75  ? 12.763  21.587  30.059  1.00 17.51 ? 75  PHE A C   1 
ATOM   576  O  O   . PHE A 1 75  ? 12.692  21.363  31.270  1.00 17.90 ? 75  PHE A O   1 
ATOM   577  C  CB  . PHE A 1 75  ? 10.819  21.640  28.524  1.00 12.41 ? 75  PHE A CB  1 
ATOM   578  C  CG  . PHE A 1 75  ? 9.921   22.204  29.591  1.00 14.58 ? 75  PHE A CG  1 
ATOM   579  C  CD1 . PHE A 1 75  ? 8.842   21.469  30.082  1.00 14.13 ? 75  PHE A CD1 1 
ATOM   580  C  CD2 . PHE A 1 75  ? 10.183  23.456  30.143  1.00 15.45 ? 75  PHE A CD2 1 
ATOM   581  C  CE1 . PHE A 1 75  ? 8.035   21.972  31.111  1.00 12.41 ? 75  PHE A CE1 1 
ATOM   582  C  CE2 . PHE A 1 75  ? 9.384   23.969  31.172  1.00 14.19 ? 75  PHE A CE2 1 
ATOM   583  C  CZ  . PHE A 1 75  ? 8.306   23.221  31.656  1.00 12.09 ? 75  PHE A CZ  1 
ATOM   584  N  N   . SER A 1 76  ? 13.531  22.532  29.535  1.00 16.50 ? 76  SER A N   1 
ATOM   585  C  CA  . SER A 1 76  ? 14.313  23.423  30.374  1.00 18.51 ? 76  SER A CA  1 
ATOM   586  C  C   . SER A 1 76  ? 14.136  24.818  29.806  1.00 17.83 ? 76  SER A C   1 
ATOM   587  O  O   . SER A 1 76  ? 13.893  24.990  28.609  1.00 16.95 ? 76  SER A O   1 
ATOM   588  C  CB  . SER A 1 76  ? 15.790  23.029  30.368  1.00 17.82 ? 76  SER A CB  1 
ATOM   589  O  OG  . SER A 1 76  ? 16.320  23.080  29.058  1.00 25.27 ? 76  SER A OG  1 
ATOM   590  N  N   . LEU A 1 77  ? 14.244  25.812  30.674  1.00 17.88 ? 77  LEU A N   1 
ATOM   591  C  CA  . LEU A 1 77  ? 14.102  27.199  30.272  1.00 15.81 ? 77  LEU A CA  1 
ATOM   592  C  C   . LEU A 1 77  ? 15.393  27.896  30.685  1.00 18.44 ? 77  LEU A C   1 
ATOM   593  O  O   . LEU A 1 77  ? 15.888  27.681  31.790  1.00 20.29 ? 77  LEU A O   1 
ATOM   594  C  CB  . LEU A 1 77  ? 12.906  27.821  30.999  1.00 16.57 ? 77  LEU A CB  1 
ATOM   595  C  CG  . LEU A 1 77  ? 11.551  27.107  30.884  1.00 16.32 ? 77  LEU A CG  1 
ATOM   596  C  CD1 . LEU A 1 77  ? 10.531  27.806  31.782  1.00 16.25 ? 77  LEU A CD1 1 
ATOM   597  C  CD2 . LEU A 1 77  ? 11.076  27.113  29.442  1.00 14.21 ? 77  LEU A CD2 1 
ATOM   598  N  N   . LYS A 1 78  ? 15.949  28.713  29.801  1.00 18.31 ? 78  LYS A N   1 
ATOM   599  C  CA  . LYS A 1 78  ? 17.181  29.426  30.111  1.00 22.06 ? 78  LYS A CA  1 
ATOM   600  C  C   . LYS A 1 78  ? 17.090  30.855  29.596  1.00 24.02 ? 78  LYS A C   1 
ATOM   601  O  O   . LYS A 1 78  ? 16.614  31.101  28.487  1.00 26.08 ? 78  LYS A O   1 
ATOM   602  C  CB  . LYS A 1 78  ? 18.387  28.716  29.481  1.00 24.16 ? 78  LYS A CB  1 
ATOM   603  N  N   . SER A 1 79  ? 17.542  31.798  30.412  1.00 26.16 ? 79  SER A N   1 
ATOM   604  C  CA  . SER A 1 79  ? 17.499  33.199  30.030  1.00 28.03 ? 79  SER A CA  1 
ATOM   605  C  C   . SER A 1 79  ? 18.485  34.050  30.810  1.00 29.89 ? 79  SER A C   1 
ATOM   606  O  O   . SER A 1 79  ? 18.697  33.839  32.002  1.00 28.37 ? 79  SER A O   1 
ATOM   607  C  CB  . SER A 1 79  ? 16.093  33.754  30.240  1.00 28.09 ? 79  SER A CB  1 
ATOM   608  O  OG  . SER A 1 79  ? 16.066  35.149  30.000  1.00 29.24 ? 79  SER A OG  1 
ATOM   609  N  N   . PRO A 1 80  ? 19.115  35.020  30.133  1.00 32.93 ? 80  PRO A N   1 
ATOM   610  C  CA  . PRO A 1 80  ? 20.087  35.934  30.737  1.00 35.75 ? 80  PRO A CA  1 
ATOM   611  C  C   . PRO A 1 80  ? 19.374  36.804  31.773  1.00 38.19 ? 80  PRO A C   1 
ATOM   612  O  O   . PRO A 1 80  ? 19.973  37.262  32.743  1.00 39.91 ? 80  PRO A O   1 
ATOM   613  C  CB  . PRO A 1 80  ? 20.571  36.743  29.535  1.00 34.16 ? 80  PRO A CB  1 
ATOM   614  C  CG  . PRO A 1 80  ? 20.388  35.759  28.381  1.00 35.96 ? 80  PRO A CG  1 
ATOM   615  C  CD  . PRO A 1 80  ? 18.984  35.317  28.699  1.00 32.30 ? 80  PRO A CD  1 
ATOM   616  N  N   . LEU A 1 81  ? 18.081  37.017  31.545  1.00 40.89 ? 81  LEU A N   1 
ATOM   617  C  CA  . LEU A 1 81  ? 17.239  37.812  32.432  1.00 43.12 ? 81  LEU A CA  1 
ATOM   618  C  C   . LEU A 1 81  ? 16.704  36.925  33.551  1.00 45.84 ? 81  LEU A C   1 
ATOM   619  O  O   . LEU A 1 81  ? 16.908  35.713  33.546  1.00 46.73 ? 81  LEU A O   1 
ATOM   620  C  CB  . LEU A 1 81  ? 16.047  38.375  31.658  1.00 42.90 ? 81  LEU A CB  1 
ATOM   621  C  CG  . LEU A 1 81  ? 16.297  39.242  30.425  1.00 43.11 ? 81  LEU A CG  1 
ATOM   622  C  CD1 . LEU A 1 81  ? 14.970  39.507  29.722  1.00 44.84 ? 81  LEU A CD1 1 
ATOM   623  C  CD2 . LEU A 1 81  ? 16.973  40.539  30.831  1.00 43.00 ? 81  LEU A CD2 1 
ATOM   624  N  N   . SER A 1 82  ? 16.010  37.534  34.505  1.00 47.69 ? 82  SER A N   1 
ATOM   625  C  CA  . SER A 1 82  ? 15.420  36.789  35.610  1.00 48.95 ? 82  SER A CA  1 
ATOM   626  C  C   . SER A 1 82  ? 13.908  36.858  35.450  1.00 47.57 ? 82  SER A C   1 
ATOM   627  O  O   . SER A 1 82  ? 13.153  36.400  36.307  1.00 50.42 ? 82  SER A O   1 
ATOM   628  C  CB  . SER A 1 82  ? 15.830  37.400  36.949  1.00 51.80 ? 82  SER A CB  1 
ATOM   629  O  OG  . SER A 1 82  ? 17.238  37.408  37.095  1.00 59.31 ? 82  SER A OG  1 
ATOM   630  N  N   . ASN A 1 83  ? 13.484  37.442  34.333  1.00 46.57 ? 83  ASN A N   1 
ATOM   631  C  CA  . ASN A 1 83  ? 12.073  37.601  34.000  1.00 43.11 ? 83  ASN A CA  1 
ATOM   632  C  C   . ASN A 1 83  ? 11.783  36.858  32.705  1.00 39.47 ? 83  ASN A C   1 
ATOM   633  O  O   . ASN A 1 83  ? 11.128  37.397  31.813  1.00 40.24 ? 83  ASN A O   1 
ATOM   634  C  CB  . ASN A 1 83  ? 11.741  39.081  33.799  1.00 46.91 ? 83  ASN A CB  1 
ATOM   635  C  CG  . ASN A 1 83  ? 11.981  39.906  35.040  1.00 50.26 ? 83  ASN A CG  1 
ATOM   636  O  OD1 . ASN A 1 83  ? 11.894  41.131  35.008  1.00 50.71 ? 83  ASN A OD1 1 
ATOM   637  N  ND2 . ASN A 1 83  ? 12.274  39.238  36.149  1.00 55.98 ? 83  ASN A ND2 1 
ATOM   638  N  N   . GLY A 1 84  ? 12.282  35.632  32.592  1.00 32.46 ? 84  GLY A N   1 
ATOM   639  C  CA  . GLY A 1 84  ? 12.047  34.861  31.386  1.00 30.67 ? 84  GLY A CA  1 
ATOM   640  C  C   . GLY A 1 84  ? 10.571  34.747  31.041  1.00 26.55 ? 84  GLY A C   1 
ATOM   641  O  O   . GLY A 1 84  ? 9.730   34.578  31.921  1.00 23.20 ? 84  GLY A O   1 
ATOM   642  N  N   . ALA A 1 85  ? 10.254  34.844  29.755  1.00 24.34 ? 85  ALA A N   1 
ATOM   643  C  CA  . ALA A 1 85  ? 8.870   34.748  29.292  1.00 21.88 ? 85  ALA A CA  1 
ATOM   644  C  C   . ALA A 1 85  ? 8.872   34.036  27.940  1.00 18.20 ? 85  ALA A C   1 
ATOM   645  O  O   . ALA A 1 85  ? 9.920   33.943  27.304  1.00 20.59 ? 85  ALA A O   1 
ATOM   646  C  CB  . ALA A 1 85  ? 8.266   36.144  29.160  1.00 15.20 ? 85  ALA A CB  1 
ATOM   647  N  N   . ASP A 1 86  ? 7.725   33.527  27.496  1.00 15.95 ? 86  ASP A N   1 
ATOM   648  C  CA  . ASP A 1 86  ? 6.464   33.604  28.218  1.00 15.12 ? 86  ASP A CA  1 
ATOM   649  C  C   . ASP A 1 86  ? 6.016   32.262  28.755  1.00 17.70 ? 86  ASP A C   1 
ATOM   650  O  O   . ASP A 1 86  ? 5.155   32.198  29.636  1.00 18.02 ? 86  ASP A O   1 
ATOM   651  C  CB  . ASP A 1 86  ? 5.377   34.171  27.311  1.00 16.45 ? 86  ASP A CB  1 
ATOM   652  C  CG  . ASP A 1 86  ? 5.351   35.675  27.322  1.00 22.62 ? 86  ASP A CG  1 
ATOM   653  O  OD1 . ASP A 1 86  ? 4.797   36.241  28.291  1.00 22.26 ? 86  ASP A OD1 1 
ATOM   654  O  OD2 . ASP A 1 86  ? 5.900   36.289  26.382  1.00 22.00 ? 86  ASP A OD2 1 
ATOM   655  N  N   . GLY A 1 87  ? 6.594   31.189  28.226  1.00 16.22 ? 87  GLY A N   1 
ATOM   656  C  CA  . GLY A 1 87  ? 6.218   29.870  28.697  1.00 16.86 ? 87  GLY A CA  1 
ATOM   657  C  C   . GLY A 1 87  ? 6.072   28.840  27.604  1.00 14.53 ? 87  GLY A C   1 
ATOM   658  O  O   . GLY A 1 87  ? 6.092   29.160  26.416  1.00 15.83 ? 87  GLY A O   1 
ATOM   659  N  N   . ILE A 1 88  ? 5.924   27.589  28.016  1.00 13.70 ? 88  ILE A N   1 
ATOM   660  C  CA  . ILE A 1 88  ? 5.785   26.483  27.079  1.00 12.66 ? 88  ILE A CA  1 
ATOM   661  C  C   . ILE A 1 88  ? 4.502   25.734  27.411  1.00 13.70 ? 88  ILE A C   1 
ATOM   662  O  O   . ILE A 1 88  ? 4.054   25.726  28.561  1.00 14.96 ? 88  ILE A O   1 
ATOM   663  C  CB  . ILE A 1 88  ? 7.003   25.526  27.187  1.00 14.35 ? 88  ILE A CB  1 
ATOM   664  C  CG1 . ILE A 1 88  ? 6.830   24.334  26.248  1.00 11.54 ? 88  ILE A CG1 1 
ATOM   665  C  CG2 . ILE A 1 88  ? 7.163   25.040  28.627  1.00 10.33 ? 88  ILE A CG2 1 
ATOM   666  C  CD1 . ILE A 1 88  ? 7.987   23.349  26.304  1.00 14.04 ? 88  ILE A CD1 1 
ATOM   667  N  N   . ALA A 1 89  ? 3.909   25.098  26.412  1.00 13.11 ? 89  ALA A N   1 
ATOM   668  C  CA  . ALA A 1 89  ? 2.672   24.377  26.641  1.00 13.97 ? 89  ALA A CA  1 
ATOM   669  C  C   . ALA A 1 89  ? 2.517   23.118  25.807  1.00 15.26 ? 89  ALA A C   1 
ATOM   670  O  O   . ALA A 1 89  ? 2.927   23.061  24.648  1.00 15.32 ? 89  ALA A O   1 
ATOM   671  C  CB  . ALA A 1 89  ? 1.492   25.301  26.382  1.00 15.09 ? 89  ALA A CB  1 
ATOM   672  N  N   . PHE A 1 90  ? 1.937   22.101  26.426  1.00 12.94 ? 90  PHE A N   1 
ATOM   673  C  CA  . PHE A 1 90  ? 1.639   20.857  25.742  1.00 14.51 ? 90  PHE A CA  1 
ATOM   674  C  C   . PHE A 1 90  ? 0.187   21.052  25.343  1.00 14.54 ? 90  PHE A C   1 
ATOM   675  O  O   . PHE A 1 90  ? -0.626  21.441  26.181  1.00 13.34 ? 90  PHE A O   1 
ATOM   676  C  CB  . PHE A 1 90  ? 1.730   19.668  26.701  1.00 15.13 ? 90  PHE A CB  1 
ATOM   677  C  CG  . PHE A 1 90  ? 1.139   18.404  26.143  1.00 17.15 ? 90  PHE A CG  1 
ATOM   678  C  CD1 . PHE A 1 90  ? 1.709   17.777  25.044  1.00 16.74 ? 90  PHE A CD1 1 
ATOM   679  C  CD2 . PHE A 1 90  ? -0.019  17.865  26.692  1.00 14.85 ? 90  PHE A CD2 1 
ATOM   680  C  CE1 . PHE A 1 90  ? 1.133   16.630  24.497  1.00 17.62 ? 90  PHE A CE1 1 
ATOM   681  C  CE2 . PHE A 1 90  ? -0.602  16.722  26.153  1.00 16.22 ? 90  PHE A CE2 1 
ATOM   682  C  CZ  . PHE A 1 90  ? -0.025  16.101  25.052  1.00 13.82 ? 90  PHE A CZ  1 
ATOM   683  N  N   . PHE A 1 91  ? -0.156  20.815  24.084  1.00 14.04 ? 91  PHE A N   1 
ATOM   684  C  CA  . PHE A 1 91  ? -1.551  20.980  23.700  1.00 14.37 ? 91  PHE A CA  1 
ATOM   685  C  C   . PHE A 1 91  ? -2.089  19.902  22.769  1.00 16.50 ? 91  PHE A C   1 
ATOM   686  O  O   . PHE A 1 91  ? -1.336  19.133  22.166  1.00 14.18 ? 91  PHE A O   1 
ATOM   687  C  CB  . PHE A 1 91  ? -1.797  22.370  23.085  1.00 13.92 ? 91  PHE A CB  1 
ATOM   688  C  CG  . PHE A 1 91  ? -1.173  22.573  21.729  1.00 15.13 ? 91  PHE A CG  1 
ATOM   689  C  CD1 . PHE A 1 91  ? 0.209   22.602  21.572  1.00 13.71 ? 91  PHE A CD1 1 
ATOM   690  C  CD2 . PHE A 1 91  ? -1.978  22.755  20.607  1.00 14.51 ? 91  PHE A CD2 1 
ATOM   691  C  CE1 . PHE A 1 91  ? 0.783   22.811  20.318  1.00 16.55 ? 91  PHE A CE1 1 
ATOM   692  C  CE2 . PHE A 1 91  ? -1.415  22.965  19.343  1.00 15.83 ? 91  PHE A CE2 1 
ATOM   693  C  CZ  . PHE A 1 91  ? -0.032  22.994  19.197  1.00 14.86 ? 91  PHE A CZ  1 
ATOM   694  N  N   . ILE A 1 92  ? -3.412  19.852  22.685  1.00 16.64 ? 92  ILE A N   1 
ATOM   695  C  CA  . ILE A 1 92  ? -4.130  18.906  21.848  1.00 16.98 ? 92  ILE A CA  1 
ATOM   696  C  C   . ILE A 1 92  ? -5.133  19.778  21.113  1.00 18.76 ? 92  ILE A C   1 
ATOM   697  O  O   . ILE A 1 92  ? -5.845  20.562  21.744  1.00 18.11 ? 92  ILE A O   1 
ATOM   698  C  CB  . ILE A 1 92  ? -4.898  17.897  22.701  1.00 19.66 ? 92  ILE A CB  1 
ATOM   699  C  CG1 . ILE A 1 92  ? -3.956  17.280  23.735  1.00 21.06 ? 92  ILE A CG1 1 
ATOM   700  C  CG2 . ILE A 1 92  ? -5.512  16.826  21.809  1.00 14.53 ? 92  ILE A CG2 1 
ATOM   701  C  CD1 . ILE A 1 92  ? -4.655  16.406  24.740  1.00 23.51 ? 92  ILE A CD1 1 
ATOM   702  N  N   . ALA A 1 93  ? -5.196  19.648  19.793  1.00 16.05 ? 93  ALA A N   1 
ATOM   703  C  CA  . ALA A 1 93  ? -6.103  20.473  19.006  1.00 19.97 ? 93  ALA A CA  1 
ATOM   704  C  C   . ALA A 1 93  ? -6.455  19.825  17.670  1.00 19.82 ? 93  ALA A C   1 
ATOM   705  O  O   . ALA A 1 93  ? -5.892  18.793  17.305  1.00 21.72 ? 93  ALA A O   1 
ATOM   706  C  CB  . ALA A 1 93  ? -5.457  21.845  18.765  1.00 17.89 ? 93  ALA A CB  1 
ATOM   707  N  N   . PRO A 1 94  ? -7.401  20.424  16.922  1.00 21.57 ? 94  PRO A N   1 
ATOM   708  C  CA  . PRO A 1 94  ? -7.784  19.862  15.624  1.00 20.71 ? 94  PRO A CA  1 
ATOM   709  C  C   . PRO A 1 94  ? -6.533  19.666  14.774  1.00 19.96 ? 94  PRO A C   1 
ATOM   710  O  O   . PRO A 1 94  ? -5.583  20.445  14.870  1.00 19.59 ? 94  PRO A O   1 
ATOM   711  C  CB  . PRO A 1 94  ? -8.733  20.922  15.073  1.00 17.56 ? 94  PRO A CB  1 
ATOM   712  C  CG  . PRO A 1 94  ? -9.419  21.398  16.349  1.00 22.77 ? 94  PRO A CG  1 
ATOM   713  C  CD  . PRO A 1 94  ? -8.179  21.649  17.185  1.00 20.34 ? 94  PRO A CD  1 
ATOM   714  N  N   . PRO A 1 95  ? -6.530  18.644  13.909  1.00 15.68 ? 95  PRO A N   1 
ATOM   715  C  CA  . PRO A 1 95  ? -5.406  18.305  13.033  1.00 18.24 ? 95  PRO A CA  1 
ATOM   716  C  C   . PRO A 1 95  ? -4.826  19.425  12.170  1.00 21.20 ? 95  PRO A C   1 
ATOM   717  O  O   . PRO A 1 95  ? -3.632  19.418  11.866  1.00 21.29 ? 95  PRO A O   1 
ATOM   718  C  CB  . PRO A 1 95  ? -5.974  17.161  12.195  1.00 18.18 ? 95  PRO A CB  1 
ATOM   719  C  CG  . PRO A 1 95  ? -6.938  16.514  13.158  1.00 22.07 ? 95  PRO A CG  1 
ATOM   720  C  CD  . PRO A 1 95  ? -7.663  17.749  13.628  1.00 17.26 ? 95  PRO A CD  1 
ATOM   721  N  N   . ASP A 1 96  ? -5.661  20.385  11.780  1.00 22.13 ? 96  ASP A N   1 
ATOM   722  C  CA  . ASP A 1 96  ? -5.210  21.485  10.926  1.00 22.46 ? 96  ASP A CA  1 
ATOM   723  C  C   . ASP A 1 96  ? -4.824  22.762  11.671  1.00 23.00 ? 96  ASP A C   1 
ATOM   724  O  O   . ASP A 1 96  ? -4.720  23.827  11.067  1.00 22.47 ? 96  ASP A O   1 
ATOM   725  C  CB  . ASP A 1 96  ? -6.297  21.817  9.901   1.00 27.33 ? 96  ASP A CB  1 
ATOM   726  C  CG  . ASP A 1 96  ? -7.605  22.224  10.551  1.00 30.81 ? 96  ASP A CG  1 
ATOM   727  O  OD1 . ASP A 1 96  ? -8.557  22.559  9.817   1.00 36.48 ? 96  ASP A OD1 1 
ATOM   728  O  OD2 . ASP A 1 96  ? -7.687  22.206  11.797  1.00 35.89 ? 96  ASP A OD2 1 
ATOM   729  N  N   . THR A 1 97  ? -4.601  22.663  12.976  1.00 22.99 ? 97  THR A N   1 
ATOM   730  C  CA  . THR A 1 97  ? -4.249  23.838  13.756  1.00 20.30 ? 97  THR A CA  1 
ATOM   731  C  C   . THR A 1 97  ? -2.992  24.539  13.239  1.00 22.11 ? 97  THR A C   1 
ATOM   732  O  O   . THR A 1 97  ? -2.040  23.894  12.789  1.00 19.75 ? 97  THR A O   1 
ATOM   733  C  CB  . THR A 1 97  ? -4.048  23.478  15.243  1.00 22.27 ? 97  THR A CB  1 
ATOM   734  O  OG1 . THR A 1 97  ? -3.705  24.660  15.978  1.00 19.00 ? 97  THR A OG1 1 
ATOM   735  C  CG2 . THR A 1 97  ? -2.941  22.440  15.402  1.00 23.42 ? 97  THR A CG2 1 
ATOM   736  N  N   . THR A 1 98  ? -3.017  25.869  13.286  1.00 22.57 ? 98  THR A N   1 
ATOM   737  C  CA  . THR A 1 98  ? -1.891  26.699  12.861  1.00 26.07 ? 98  THR A CA  1 
ATOM   738  C  C   . THR A 1 98  ? -1.752  27.838  13.861  1.00 25.99 ? 98  THR A C   1 
ATOM   739  O  O   . THR A 1 98  ? -2.678  28.120  14.621  1.00 27.63 ? 98  THR A O   1 
ATOM   740  C  CB  . THR A 1 98  ? -2.105  27.325  11.452  1.00 26.52 ? 98  THR A CB  1 
ATOM   741  O  OG1 . THR A 1 98  ? -3.298  28.121  11.452  1.00 25.89 ? 98  THR A OG1 1 
ATOM   742  C  CG2 . THR A 1 98  ? -2.211  26.242  10.386  1.00 25.86 ? 98  THR A CG2 1 
ATOM   743  N  N   . ILE A 1 99  ? -0.594  28.486  13.864  1.00 26.54 ? 99  ILE A N   1 
ATOM   744  C  CA  . ILE A 1 99  ? -0.354  29.599  14.769  1.00 26.59 ? 99  ILE A CA  1 
ATOM   745  C  C   . ILE A 1 99  ? -1.304  30.740  14.413  1.00 26.51 ? 99  ILE A C   1 
ATOM   746  O  O   . ILE A 1 99  ? -1.259  31.266  13.305  1.00 27.28 ? 99  ILE A O   1 
ATOM   747  C  CB  . ILE A 1 99  ? 1.101   30.102  14.653  1.00 24.38 ? 99  ILE A CB  1 
ATOM   748  C  CG1 . ILE A 1 99  ? 2.069   28.974  15.009  1.00 25.13 ? 99  ILE A CG1 1 
ATOM   749  C  CG2 . ILE A 1 99  ? 1.318   31.291  15.579  1.00 23.97 ? 99  ILE A CG2 1 
ATOM   750  C  CD1 . ILE A 1 99  ? 3.531   29.336  14.839  1.00 24.93 ? 99  ILE A CD1 1 
ATOM   751  N  N   . PRO A 1 100 ? -2.192  31.122  15.342  1.00 26.65 ? 100 PRO A N   1 
ATOM   752  C  CA  . PRO A 1 100 ? -3.140  32.210  15.091  1.00 25.40 ? 100 PRO A CA  1 
ATOM   753  C  C   . PRO A 1 100 ? -2.397  33.542  15.002  1.00 27.02 ? 100 PRO A C   1 
ATOM   754  O  O   . PRO A 1 100 ? -1.330  33.699  15.603  1.00 23.58 ? 100 PRO A O   1 
ATOM   755  C  CB  . PRO A 1 100 ? -4.054  32.148  16.318  1.00 25.37 ? 100 PRO A CB  1 
ATOM   756  C  CG  . PRO A 1 100 ? -3.915  30.703  16.785  1.00 25.94 ? 100 PRO A CG  1 
ATOM   757  C  CD  . PRO A 1 100 ? -2.418  30.573  16.686  1.00 27.00 ? 100 PRO A CD  1 
ATOM   758  N  N   . SER A 1 101 ? -2.959  34.494  14.259  1.00 28.87 ? 101 SER A N   1 
ATOM   759  C  CA  . SER A 1 101 ? -2.346  35.816  14.111  1.00 29.66 ? 101 SER A CA  1 
ATOM   760  C  C   . SER A 1 101 ? -2.297  36.544  15.450  1.00 26.53 ? 101 SER A C   1 
ATOM   761  O  O   . SER A 1 101 ? -3.291  36.594  16.172  1.00 26.71 ? 101 SER A O   1 
ATOM   762  C  CB  . SER A 1 101 ? -3.138  36.674  13.118  1.00 32.43 ? 101 SER A CB  1 
ATOM   763  O  OG  . SER A 1 101 ? -3.147  36.098  11.824  1.00 43.28 ? 101 SER A OG  1 
ATOM   764  N  N   . GLY A 1 102 ? -1.138  37.113  15.768  1.00 27.47 ? 102 GLY A N   1 
ATOM   765  C  CA  . GLY A 1 102 ? -0.978  37.839  17.015  1.00 26.82 ? 102 GLY A CA  1 
ATOM   766  C  C   . GLY A 1 102 ? -1.103  36.989  18.269  1.00 29.28 ? 102 GLY A C   1 
ATOM   767  O  O   . GLY A 1 102 ? -1.618  37.454  19.284  1.00 29.81 ? 102 GLY A O   1 
ATOM   768  N  N   . SER A 1 103 ? -0.627  35.748  18.212  1.00 27.77 ? 103 SER A N   1 
ATOM   769  C  CA  . SER A 1 103 ? -0.714  34.854  19.362  1.00 23.90 ? 103 SER A CA  1 
ATOM   770  C  C   . SER A 1 103 ? 0.600   34.784  20.137  1.00 23.66 ? 103 SER A C   1 
ATOM   771  O  O   . SER A 1 103 ? 0.797   33.887  20.952  1.00 22.35 ? 103 SER A O   1 
ATOM   772  C  CB  . SER A 1 103 ? -1.105  33.452  18.902  1.00 23.55 ? 103 SER A CB  1 
ATOM   773  O  OG  . SER A 1 103 ? -0.119  32.905  18.045  1.00 28.64 ? 103 SER A OG  1 
ATOM   774  N  N   . GLY A 1 104 ? 1.497   35.730  19.879  1.00 21.06 ? 104 GLY A N   1 
ATOM   775  C  CA  . GLY A 1 104 ? 2.773   35.733  20.564  1.00 17.17 ? 104 GLY A CA  1 
ATOM   776  C  C   . GLY A 1 104 ? 2.657   36.146  22.020  1.00 21.08 ? 104 GLY A C   1 
ATOM   777  O  O   . GLY A 1 104 ? 1.557   36.350  22.536  1.00 23.08 ? 104 GLY A O   1 
ATOM   778  N  N   . GLY A 1 105 ? 3.797   36.276  22.687  1.00 16.97 ? 105 GLY A N   1 
ATOM   779  C  CA  . GLY A 1 105 ? 3.794   36.671  24.083  1.00 19.37 ? 105 GLY A CA  1 
ATOM   780  C  C   . GLY A 1 105 ? 2.981   35.768  24.994  1.00 18.86 ? 105 GLY A C   1 
ATOM   781  O  O   . GLY A 1 105 ? 3.061   34.542  24.914  1.00 18.63 ? 105 GLY A O   1 
ATOM   782  N  N   . GLY A 1 106 ? 2.187   36.391  25.858  1.00 17.84 ? 106 GLY A N   1 
ATOM   783  C  CA  . GLY A 1 106 ? 1.372   35.657  26.808  1.00 16.70 ? 106 GLY A CA  1 
ATOM   784  C  C   . GLY A 1 106 ? 0.293   34.756  26.241  1.00 16.43 ? 106 GLY A C   1 
ATOM   785  O  O   . GLY A 1 106 ? -0.311  33.984  26.985  1.00 15.01 ? 106 GLY A O   1 
ATOM   786  N  N   . LEU A 1 107 ? 0.025   34.850  24.944  1.00 14.57 ? 107 LEU A N   1 
ATOM   787  C  CA  . LEU A 1 107 ? -0.989  33.987  24.354  1.00 17.67 ? 107 LEU A CA  1 
ATOM   788  C  C   . LEU A 1 107 ? -0.366  32.651  23.976  1.00 18.07 ? 107 LEU A C   1 
ATOM   789  O  O   . LEU A 1 107 ? -1.038  31.763  23.456  1.00 16.31 ? 107 LEU A O   1 
ATOM   790  C  CB  . LEU A 1 107 ? -1.641  34.651  23.137  1.00 19.76 ? 107 LEU A CB  1 
ATOM   791  C  CG  . LEU A 1 107 ? -2.480  35.885  23.472  1.00 21.36 ? 107 LEU A CG  1 
ATOM   792  C  CD1 . LEU A 1 107 ? -3.106  36.432  22.208  1.00 20.69 ? 107 LEU A CD1 1 
ATOM   793  C  CD2 . LEU A 1 107 ? -3.561  35.517  24.481  1.00 17.36 ? 107 LEU A CD2 1 
ATOM   794  N  N   . LEU A 1 108 ? 0.933   32.529  24.231  1.00 18.48 ? 108 LEU A N   1 
ATOM   795  C  CA  . LEU A 1 108 ? 1.668   31.292  24.001  1.00 19.05 ? 108 LEU A CA  1 
ATOM   796  C  C   . LEU A 1 108 ? 1.552   30.652  22.612  1.00 21.05 ? 108 LEU A C   1 
ATOM   797  O  O   . LEU A 1 108 ? 1.821   29.462  22.460  1.00 21.70 ? 108 LEU A O   1 
ATOM   798  C  CB  . LEU A 1 108 ? 1.238   30.267  25.056  1.00 16.64 ? 108 LEU A CB  1 
ATOM   799  C  CG  . LEU A 1 108 ? 1.363   30.683  26.525  1.00 17.86 ? 108 LEU A CG  1 
ATOM   800  C  CD1 . LEU A 1 108 ? 0.842   29.565  27.413  1.00 15.60 ? 108 LEU A CD1 1 
ATOM   801  C  CD2 . LEU A 1 108 ? 2.818   30.988  26.856  1.00 21.37 ? 108 LEU A CD2 1 
ATOM   802  N  N   . GLY A 1 109 ? 1.155   31.423  21.606  1.00 18.91 ? 109 GLY A N   1 
ATOM   803  C  CA  . GLY A 1 109 ? 1.032   30.869  20.271  1.00 17.06 ? 109 GLY A CA  1 
ATOM   804  C  C   . GLY A 1 109 ? -0.141  29.917  20.126  1.00 18.97 ? 109 GLY A C   1 
ATOM   805  O  O   . GLY A 1 109 ? -0.245  29.182  19.139  1.00 17.71 ? 109 GLY A O   1 
ATOM   806  N  N   . LEU A 1 110 ? -1.037  29.944  21.107  1.00 15.91 ? 110 LEU A N   1 
ATOM   807  C  CA  . LEU A 1 110 ? -2.206  29.080  21.101  1.00 16.71 ? 110 LEU A CA  1 
ATOM   808  C  C   . LEU A 1 110 ? -3.526  29.781  20.813  1.00 17.10 ? 110 LEU A C   1 
ATOM   809  O  O   . LEU A 1 110 ? -4.420  29.188  20.221  1.00 16.98 ? 110 LEU A O   1 
ATOM   810  C  CB  . LEU A 1 110 ? -2.323  28.347  22.439  1.00 16.38 ? 110 LEU A CB  1 
ATOM   811  C  CG  . LEU A 1 110 ? -1.259  27.298  22.756  1.00 17.77 ? 110 LEU A CG  1 
ATOM   812  C  CD1 . LEU A 1 110 ? -1.468  26.767  24.165  1.00 14.80 ? 110 LEU A CD1 1 
ATOM   813  C  CD2 . LEU A 1 110 ? -1.344  26.171  21.735  1.00 13.38 ? 110 LEU A CD2 1 
ATOM   814  N  N   . PHE A 1 111 ? -3.668  31.030  21.235  1.00 17.95 ? 111 PHE A N   1 
ATOM   815  C  CA  . PHE A 1 111 ? -4.926  31.729  21.002  1.00 20.68 ? 111 PHE A CA  1 
ATOM   816  C  C   . PHE A 1 111 ? -4.777  33.033  20.250  1.00 22.56 ? 111 PHE A C   1 
ATOM   817  O  O   . PHE A 1 111 ? -3.707  33.645  20.240  1.00 23.15 ? 111 PHE A O   1 
ATOM   818  C  CB  . PHE A 1 111 ? -5.639  32.042  22.321  1.00 18.95 ? 111 PHE A CB  1 
ATOM   819  C  CG  . PHE A 1 111 ? -5.851  30.853  23.204  1.00 18.52 ? 111 PHE A CG  1 
ATOM   820  C  CD1 . PHE A 1 111 ? -4.802  30.328  23.951  1.00 16.35 ? 111 PHE A CD1 1 
ATOM   821  C  CD2 . PHE A 1 111 ? -7.104  30.256  23.291  1.00 20.93 ? 111 PHE A CD2 1 
ATOM   822  C  CE1 . PHE A 1 111 ? -4.998  29.229  24.773  1.00 21.24 ? 111 PHE A CE1 1 
ATOM   823  C  CE2 . PHE A 1 111 ? -7.312  29.153  24.111  1.00 22.14 ? 111 PHE A CE2 1 
ATOM   824  C  CZ  . PHE A 1 111 ? -6.259  28.638  24.854  1.00 18.66 ? 111 PHE A CZ  1 
ATOM   825  N  N   . ALA A 1 112 ? -5.874  33.456  19.633  1.00 24.06 ? 112 ALA A N   1 
ATOM   826  C  CA  . ALA A 1 112 ? -5.918  34.715  18.906  1.00 29.03 ? 112 ALA A CA  1 
ATOM   827  C  C   . ALA A 1 112 ? -6.342  35.748  19.946  1.00 30.47 ? 112 ALA A C   1 
ATOM   828  O  O   . ALA A 1 112 ? -7.142  35.450  20.836  1.00 30.74 ? 112 ALA A O   1 
ATOM   829  C  CB  . ALA A 1 112 ? -6.942  34.644  17.780  1.00 27.75 ? 112 ALA A CB  1 
ATOM   830  N  N   . PRO A 1 113 ? -5.822  36.977  19.843  1.00 29.63 ? 113 PRO A N   1 
ATOM   831  C  CA  . PRO A 1 113 ? -6.158  38.037  20.792  1.00 30.99 ? 113 PRO A CA  1 
ATOM   832  C  C   . PRO A 1 113 ? -7.653  38.277  20.966  1.00 32.03 ? 113 PRO A C   1 
ATOM   833  O  O   . PRO A 1 113 ? -8.151  38.338  22.088  1.00 33.31 ? 113 PRO A O   1 
ATOM   834  C  CB  . PRO A 1 113 ? -5.439  39.247  20.202  1.00 31.16 ? 113 PRO A CB  1 
ATOM   835  C  CG  . PRO A 1 113 ? -4.226  38.610  19.573  1.00 30.96 ? 113 PRO A CG  1 
ATOM   836  C  CD  . PRO A 1 113 ? -4.911  37.502  18.813  1.00 31.50 ? 113 PRO A CD  1 
ATOM   837  N  N   . GLY A 1 114 ? -8.366  38.401  19.853  1.00 32.65 ? 114 GLY A N   1 
ATOM   838  C  CA  . GLY A 1 114 ? -9.792  38.662  19.916  1.00 31.10 ? 114 GLY A CA  1 
ATOM   839  C  C   . GLY A 1 114 ? -10.661 37.600  20.562  1.00 31.16 ? 114 GLY A C   1 
ATOM   840  O  O   . GLY A 1 114 ? -11.754 37.902  21.041  1.00 30.80 ? 114 GLY A O   1 
ATOM   841  N  N   . THR A 1 115 ? -10.190 36.359  20.589  1.00 29.26 ? 115 THR A N   1 
ATOM   842  C  CA  . THR A 1 115 ? -10.978 35.277  21.168  1.00 27.16 ? 115 THR A CA  1 
ATOM   843  C  C   . THR A 1 115 ? -10.255 34.485  22.257  1.00 25.59 ? 115 THR A C   1 
ATOM   844  O  O   . THR A 1 115 ? -10.730 33.430  22.681  1.00 25.72 ? 115 THR A O   1 
ATOM   845  C  CB  . THR A 1 115 ? -11.432 34.300  20.065  1.00 29.28 ? 115 THR A CB  1 
ATOM   846  O  OG1 . THR A 1 115 ? -10.285 33.840  19.338  1.00 26.55 ? 115 THR A OG1 1 
ATOM   847  C  CG2 . THR A 1 115 ? -12.394 34.988  19.099  1.00 31.30 ? 115 THR A CG2 1 
ATOM   848  N  N   . ALA A 1 116 ? -9.123  35.008  22.718  1.00 25.98 ? 116 ALA A N   1 
ATOM   849  C  CA  . ALA A 1 116 ? -8.313  34.347  23.742  1.00 24.21 ? 116 ALA A CA  1 
ATOM   850  C  C   . ALA A 1 116 ? -9.097  33.842  24.949  1.00 23.80 ? 116 ALA A C   1 
ATOM   851  O  O   . ALA A 1 116 ? -8.742  32.820  25.533  1.00 25.88 ? 116 ALA A O   1 
ATOM   852  C  CB  . ALA A 1 116 ? -7.194  35.279  24.203  1.00 23.42 ? 116 ALA A CB  1 
ATOM   853  N  N   . GLN A 1 117 ? -10.153 34.548  25.337  1.00 23.34 ? 117 GLN A N   1 
ATOM   854  C  CA  . GLN A 1 117 ? -10.936 34.111  26.486  1.00 26.37 ? 117 GLN A CA  1 
ATOM   855  C  C   . GLN A 1 117 ? -12.374 33.746  26.144  1.00 27.35 ? 117 GLN A C   1 
ATOM   856  O  O   . GLN A 1 117 ? -13.234 33.738  27.017  1.00 29.15 ? 117 GLN A O   1 
ATOM   857  C  CB  . GLN A 1 117 ? -10.921 35.183  27.577  1.00 25.83 ? 117 GLN A CB  1 
ATOM   858  C  CG  . GLN A 1 117 ? -9.521  35.549  28.048  1.00 26.62 ? 117 GLN A CG  1 
ATOM   859  C  CD  . GLN A 1 117 ? -9.523  36.498  29.232  1.00 27.43 ? 117 GLN A CD  1 
ATOM   860  O  OE1 . GLN A 1 117 ? -9.950  36.139  30.330  1.00 26.25 ? 117 GLN A OE1 1 
ATOM   861  N  NE2 . GLN A 1 117 ? -9.049  37.718  29.011  1.00 24.61 ? 117 GLN A NE2 1 
ATOM   862  N  N   . ASN A 1 118 ? -12.628 33.438  24.874  1.00 30.03 ? 118 ASN A N   1 
ATOM   863  C  CA  . ASN A 1 118 ? -13.969 33.063  24.412  1.00 32.58 ? 118 ASN A CA  1 
ATOM   864  C  C   . ASN A 1 118 ? -13.989 31.543  24.250  1.00 29.59 ? 118 ASN A C   1 
ATOM   865  O  O   . ASN A 1 118 ? -13.545 31.021  23.232  1.00 28.58 ? 118 ASN A O   1 
ATOM   866  C  CB  . ASN A 1 118 ? -14.268 33.733  23.062  1.00 35.65 ? 118 ASN A CB  1 
ATOM   867  C  CG  . ASN A 1 118 ? -15.689 33.484  22.584  1.00 39.13 ? 118 ASN A CG  1 
ATOM   868  O  OD1 . ASN A 1 118 ? -16.174 32.355  22.616  1.00 42.64 ? 118 ASN A OD1 1 
ATOM   869  N  ND2 . ASN A 1 118 ? -16.354 34.537  22.113  1.00 37.80 ? 118 ASN A ND2 1 
ATOM   870  N  N   . THR A 1 119 ? -14.510 30.840  25.249  1.00 28.10 ? 119 THR A N   1 
ATOM   871  C  CA  . THR A 1 119 ? -14.540 29.383  25.220  1.00 31.00 ? 119 THR A CA  1 
ATOM   872  C  C   . THR A 1 119 ? -15.240 28.750  24.026  1.00 33.32 ? 119 THR A C   1 
ATOM   873  O  O   . THR A 1 119 ? -14.767 27.748  23.493  1.00 36.11 ? 119 THR A O   1 
ATOM   874  C  CB  . THR A 1 119 ? -15.171 28.808  26.500  1.00 29.17 ? 119 THR A CB  1 
ATOM   875  O  OG1 . THR A 1 119 ? -16.501 29.312  26.645  1.00 33.00 ? 119 THR A OG1 1 
ATOM   876  C  CG2 . THR A 1 119 ? -14.352 29.191  27.712  1.00 28.94 ? 119 THR A CG2 1 
ATOM   877  N  N   . SER A 1 120 ? -16.361 29.317  23.600  1.00 32.24 ? 120 SER A N   1 
ATOM   878  C  CA  . SER A 1 120 ? -17.082 28.749  22.468  1.00 34.85 ? 120 SER A CA  1 
ATOM   879  C  C   . SER A 1 120 ? -16.431 29.075  21.119  1.00 34.64 ? 120 SER A C   1 
ATOM   880  O  O   . SER A 1 120 ? -16.953 28.706  20.069  1.00 36.31 ? 120 SER A O   1 
ATOM   881  C  CB  . SER A 1 120 ? -18.539 29.229  22.477  1.00 37.86 ? 120 SER A CB  1 
ATOM   882  O  OG  . SER A 1 120 ? -18.618 30.641  22.410  1.00 38.59 ? 120 SER A OG  1 
ATOM   883  N  N   . ALA A 1 121 ? -15.286 29.750  21.147  1.00 32.06 ? 121 ALA A N   1 
ATOM   884  C  CA  . ALA A 1 121 ? -14.599 30.109  19.910  1.00 31.42 ? 121 ALA A CA  1 
ATOM   885  C  C   . ALA A 1 121 ? -13.282 29.368  19.726  1.00 31.26 ? 121 ALA A C   1 
ATOM   886  O  O   . ALA A 1 121 ? -12.523 29.680  18.812  1.00 33.57 ? 121 ALA A O   1 
ATOM   887  C  CB  . ALA A 1 121 ? -14.350 31.614  19.871  1.00 30.53 ? 121 ALA A CB  1 
ATOM   888  N  N   . ASN A 1 122 ? -13.007 28.391  20.587  1.00 29.52 ? 122 ASN A N   1 
ATOM   889  C  CA  . ASN A 1 122 ? -11.763 27.629  20.498  1.00 26.29 ? 122 ASN A CA  1 
ATOM   890  C  C   . ASN A 1 122 ? -11.964 26.130  20.684  1.00 26.41 ? 122 ASN A C   1 
ATOM   891  O  O   . ASN A 1 122 ? -13.008 25.678  21.155  1.00 27.33 ? 122 ASN A O   1 
ATOM   892  C  CB  . ASN A 1 122 ? -10.763 28.104  21.559  1.00 26.48 ? 122 ASN A CB  1 
ATOM   893  C  CG  . ASN A 1 122 ? -10.327 29.538  21.362  1.00 25.98 ? 122 ASN A CG  1 
ATOM   894  O  OD1 . ASN A 1 122 ? -9.674  29.873  20.376  1.00 28.88 ? 122 ASN A OD1 1 
ATOM   895  N  ND2 . ASN A 1 122 ? -10.685 30.396  22.308  1.00 29.95 ? 122 ASN A ND2 1 
ATOM   896  N  N   . GLN A 1 123 ? -10.946 25.370  20.294  1.00 25.03 ? 123 GLN A N   1 
ATOM   897  C  CA  . GLN A 1 123 ? -10.925 23.916  20.439  1.00 25.93 ? 123 GLN A CA  1 
ATOM   898  C  C   . GLN A 1 123 ? -9.493  23.551  20.772  1.00 22.86 ? 123 GLN A C   1 
ATOM   899  O  O   . GLN A 1 123 ? -8.693  23.240  19.885  1.00 20.87 ? 123 GLN A O   1 
ATOM   900  C  CB  . GLN A 1 123 ? -11.324 23.198  19.153  1.00 27.54 ? 123 GLN A CB  1 
ATOM   901  C  CG  . GLN A 1 123 ? -12.785 23.260  18.812  1.00 33.24 ? 123 GLN A CG  1 
ATOM   902  C  CD  . GLN A 1 123 ? -13.090 22.442  17.584  1.00 34.73 ? 123 GLN A CD  1 
ATOM   903  O  OE1 . GLN A 1 123 ? -12.533 22.686  16.515  1.00 36.80 ? 123 GLN A OE1 1 
ATOM   904  N  NE2 . GLN A 1 123 ? -13.970 21.459  17.728  1.00 37.34 ? 123 GLN A NE2 1 
ATOM   905  N  N   . VAL A 1 124 ? -9.170  23.597  22.054  1.00 21.93 ? 124 VAL A N   1 
ATOM   906  C  CA  . VAL A 1 124 ? -7.826  23.289  22.478  1.00 20.90 ? 124 VAL A CA  1 
ATOM   907  C  C   . VAL A 1 124 ? -7.765  23.011  23.956  1.00 21.39 ? 124 VAL A C   1 
ATOM   908  O  O   . VAL A 1 124 ? -8.438  23.659  24.752  1.00 22.88 ? 124 VAL A O   1 
ATOM   909  C  CB  . VAL A 1 124 ? -6.879  24.464  22.170  1.00 24.68 ? 124 VAL A CB  1 
ATOM   910  C  CG1 . VAL A 1 124 ? -7.397  25.722  22.840  1.00 26.53 ? 124 VAL A CG1 1 
ATOM   911  C  CG2 . VAL A 1 124 ? -5.470  24.154  22.663  1.00 22.95 ? 124 VAL A CG2 1 
ATOM   912  N  N   . ILE A 1 125 ? -6.971  22.012  24.308  1.00 19.75 ? 125 ILE A N   1 
ATOM   913  C  CA  . ILE A 1 125 ? -6.738  21.657  25.693  1.00 17.44 ? 125 ILE A CA  1 
ATOM   914  C  C   . ILE A 1 125 ? -5.228  21.763  25.794  1.00 19.82 ? 125 ILE A C   1 
ATOM   915  O  O   . ILE A 1 125 ? -4.503  21.167  24.993  1.00 19.32 ? 125 ILE A O   1 
ATOM   916  C  CB  . ILE A 1 125 ? -7.157  20.217  26.013  1.00 18.05 ? 125 ILE A CB  1 
ATOM   917  C  CG1 . ILE A 1 125 ? -8.674  20.079  25.907  1.00 18.50 ? 125 ILE A CG1 1 
ATOM   918  C  CG2 . ILE A 1 125 ? -6.678  19.839  27.416  1.00 18.58 ? 125 ILE A CG2 1 
ATOM   919  C  CD1 . ILE A 1 125 ? -9.175  18.695  26.251  1.00 21.36 ? 125 ILE A CD1 1 
ATOM   920  N  N   . ALA A 1 126 ? -4.745  22.539  26.753  1.00 17.22 ? 126 ALA A N   1 
ATOM   921  C  CA  . ALA A 1 126 ? -3.313  22.694  26.898  1.00 14.46 ? 126 ALA A CA  1 
ATOM   922  C  C   . ALA A 1 126 ? -2.884  22.716  28.349  1.00 15.18 ? 126 ALA A C   1 
ATOM   923  O  O   . ALA A 1 126 ? -3.651  23.091  29.237  1.00 15.96 ? 126 ALA A O   1 
ATOM   924  C  CB  . ALA A 1 126 ? -2.857  23.966  26.200  1.00 13.94 ? 126 ALA A CB  1 
ATOM   925  N  N   . VAL A 1 127 ? -1.656  22.277  28.585  1.00 13.32 ? 127 VAL A N   1 
ATOM   926  C  CA  . VAL A 1 127 ? -1.082  22.283  29.917  1.00 11.55 ? 127 VAL A CA  1 
ATOM   927  C  C   . VAL A 1 127 ? 0.029   23.303  29.751  1.00 13.08 ? 127 VAL A C   1 
ATOM   928  O  O   . VAL A 1 127 ? 1.000   23.083  29.025  1.00 9.18  ? 127 VAL A O   1 
ATOM   929  C  CB  . VAL A 1 127 ? -0.524  20.897  30.304  1.00 12.75 ? 127 VAL A CB  1 
ATOM   930  C  CG1 . VAL A 1 127 ? 0.202   20.973  31.640  1.00 11.12 ? 127 VAL A CG1 1 
ATOM   931  C  CG2 . VAL A 1 127 ? -1.672  19.893  30.398  1.00 7.34  ? 127 VAL A CG2 1 
ATOM   932  N  N   . GLU A 1 128 ? -0.141  24.447  30.395  1.00 12.52 ? 128 GLU A N   1 
ATOM   933  C  CA  . GLU A 1 128 ? 0.832   25.512  30.270  1.00 11.91 ? 128 GLU A CA  1 
ATOM   934  C  C   . GLU A 1 128 ? 1.744   25.635  31.474  1.00 13.81 ? 128 GLU A C   1 
ATOM   935  O  O   . GLU A 1 128 ? 1.344   25.358  32.605  1.00 10.24 ? 128 GLU A O   1 
ATOM   936  C  CB  . GLU A 1 128 ? 0.120   26.853  30.060  1.00 8.79  ? 128 GLU A CB  1 
ATOM   937  C  CG  . GLU A 1 128 ? -0.776  27.230  31.222  1.00 12.11 ? 128 GLU A CG  1 
ATOM   938  C  CD  . GLU A 1 128 ? -1.239  28.669  31.171  1.00 13.75 ? 128 GLU A CD  1 
ATOM   939  O  OE1 . GLU A 1 128 ? -1.968  29.044  30.233  1.00 16.08 ? 128 GLU A OE1 1 
ATOM   940  O  OE2 . GLU A 1 128 ? -0.863  29.434  32.078  1.00 13.87 ? 128 GLU A OE2 1 
ATOM   941  N  N   . PHE A 1 129 ? 2.979   26.044  31.201  1.00 12.33 ? 129 PHE A N   1 
ATOM   942  C  CA  . PHE A 1 129 ? 3.975   26.295  32.226  1.00 12.36 ? 129 PHE A CA  1 
ATOM   943  C  C   . PHE A 1 129 ? 4.283   27.758  31.936  1.00 13.78 ? 129 PHE A C   1 
ATOM   944  O  O   . PHE A 1 129 ? 5.098   28.096  31.080  1.00 12.67 ? 129 PHE A O   1 
ATOM   945  C  CB  . PHE A 1 129 ? 5.175   25.369  32.039  1.00 10.87 ? 129 PHE A CB  1 
ATOM   946  C  CG  . PHE A 1 129 ? 4.817   23.911  32.157  1.00 13.73 ? 129 PHE A CG  1 
ATOM   947  C  CD1 . PHE A 1 129 ? 4.173   23.252  31.114  1.00 16.61 ? 129 PHE A CD1 1 
ATOM   948  C  CD2 . PHE A 1 129 ? 5.044   23.220  33.341  1.00 15.09 ? 129 PHE A CD2 1 
ATOM   949  C  CE1 . PHE A 1 129 ? 3.759   21.926  31.250  1.00 14.39 ? 129 PHE A CE1 1 
ATOM   950  C  CE2 . PHE A 1 129 ? 4.633   21.898  33.488  1.00 18.56 ? 129 PHE A CE2 1 
ATOM   951  C  CZ  . PHE A 1 129 ? 3.988   21.251  32.437  1.00 18.16 ? 129 PHE A CZ  1 
ATOM   952  N  N   . ASP A 1 130 ? 3.557   28.612  32.648  1.00 12.50 ? 130 ASP A N   1 
ATOM   953  C  CA  . ASP A 1 130 ? 3.590   30.059  32.485  1.00 13.09 ? 130 ASP A CA  1 
ATOM   954  C  C   . ASP A 1 130 ? 4.537   30.736  33.466  1.00 13.76 ? 130 ASP A C   1 
ATOM   955  O  O   . ASP A 1 130 ? 4.354   30.631  34.678  1.00 12.18 ? 130 ASP A O   1 
ATOM   956  C  CB  . ASP A 1 130 ? 2.167   30.579  32.698  1.00 14.82 ? 130 ASP A CB  1 
ATOM   957  C  CG  . ASP A 1 130 ? 1.952   31.968  32.140  1.00 17.31 ? 130 ASP A CG  1 
ATOM   958  O  OD1 . ASP A 1 130 ? 2.933   32.733  32.032  1.00 18.96 ? 130 ASP A OD1 1 
ATOM   959  O  OD2 . ASP A 1 130 ? 0.783   32.297  31.834  1.00 12.84 ? 130 ASP A OD2 1 
ATOM   960  N  N   . THR A 1 131 ? 5.530   31.450  32.943  1.00 15.10 ? 131 THR A N   1 
ATOM   961  C  CA  . THR A 1 131 ? 6.502   32.132  33.796  1.00 15.18 ? 131 THR A CA  1 
ATOM   962  C  C   . THR A 1 131 ? 6.338   33.646  33.843  1.00 17.20 ? 131 THR A C   1 
ATOM   963  O  O   . THR A 1 131 ? 7.035   34.311  34.601  1.00 19.34 ? 131 THR A O   1 
ATOM   964  C  CB  . THR A 1 131 ? 7.939   31.866  33.335  1.00 13.78 ? 131 THR A CB  1 
ATOM   965  O  OG1 . THR A 1 131 ? 8.116   32.426  32.030  1.00 16.53 ? 131 THR A OG1 1 
ATOM   966  C  CG2 . THR A 1 131 ? 8.228   30.362  33.286  1.00 11.47 ? 131 THR A CG2 1 
ATOM   967  N  N   . PHE A 1 132 ? 5.437   34.199  33.037  1.00 19.59 ? 132 PHE A N   1 
ATOM   968  C  CA  . PHE A 1 132 ? 5.245   35.651  33.015  1.00 20.96 ? 132 PHE A CA  1 
ATOM   969  C  C   . PHE A 1 132 ? 3.794   35.985  33.356  1.00 20.82 ? 132 PHE A C   1 
ATOM   970  O  O   . PHE A 1 132 ? 2.867   35.431  32.764  1.00 19.53 ? 132 PHE A O   1 
ATOM   971  C  CB  . PHE A 1 132 ? 5.591   36.209  31.635  1.00 21.26 ? 132 PHE A CB  1 
ATOM   972  C  CG  . PHE A 1 132 ? 5.769   37.690  31.619  1.00 16.76 ? 132 PHE A CG  1 
ATOM   973  C  CD1 . PHE A 1 132 ? 6.952   38.260  32.075  1.00 15.23 ? 132 PHE A CD1 1 
ATOM   974  C  CD2 . PHE A 1 132 ? 4.742   38.520  31.197  1.00 21.38 ? 132 PHE A CD2 1 
ATOM   975  C  CE1 . PHE A 1 132 ? 7.114   39.640  32.112  1.00 13.90 ? 132 PHE A CE1 1 
ATOM   976  C  CE2 . PHE A 1 132 ? 4.891   39.908  31.231  1.00 21.78 ? 132 PHE A CE2 1 
ATOM   977  C  CZ  . PHE A 1 132 ? 6.084   40.465  31.692  1.00 20.32 ? 132 PHE A CZ  1 
ATOM   978  N  N   . TYR A 1 133 ? 3.600   36.911  34.289  1.00 19.71 ? 133 TYR A N   1 
ATOM   979  C  CA  . TYR A 1 133 ? 2.259   37.260  34.743  1.00 19.01 ? 133 TYR A CA  1 
ATOM   980  C  C   . TYR A 1 133 ? 1.955   38.736  34.973  1.00 21.16 ? 133 TYR A C   1 
ATOM   981  O  O   . TYR A 1 133 ? 1.019   39.056  35.702  1.00 21.06 ? 133 TYR A O   1 
ATOM   982  C  CB  . TYR A 1 133 ? 1.964   36.498  36.034  1.00 18.26 ? 133 TYR A CB  1 
ATOM   983  C  CG  . TYR A 1 133 ? 3.150   36.478  36.970  1.00 22.08 ? 133 TYR A CG  1 
ATOM   984  C  CD1 . TYR A 1 133 ? 4.220   35.608  36.749  1.00 22.54 ? 133 TYR A CD1 1 
ATOM   985  C  CD2 . TYR A 1 133 ? 3.243   37.378  38.026  1.00 21.94 ? 133 TYR A CD2 1 
ATOM   986  C  CE1 . TYR A 1 133 ? 5.349   35.637  37.553  1.00 27.48 ? 133 TYR A CE1 1 
ATOM   987  C  CE2 . TYR A 1 133 ? 4.376   37.417  38.840  1.00 27.61 ? 133 TYR A CE2 1 
ATOM   988  C  CZ  . TYR A 1 133 ? 5.422   36.544  38.595  1.00 28.00 ? 133 TYR A CZ  1 
ATOM   989  O  OH  . TYR A 1 133 ? 6.545   36.575  39.391  1.00 38.22 ? 133 TYR A OH  1 
ATOM   990  N  N   . ALA A 1 134 ? 2.731   39.633  34.374  1.00 20.44 ? 134 ALA A N   1 
ATOM   991  C  CA  . ALA A 1 134 ? 2.478   41.060  34.543  1.00 22.92 ? 134 ALA A CA  1 
ATOM   992  C  C   . ALA A 1 134 ? 0.984   41.295  34.310  1.00 24.68 ? 134 ALA A C   1 
ATOM   993  O  O   . ALA A 1 134 ? 0.451   40.957  33.255  1.00 24.17 ? 134 ALA A O   1 
ATOM   994  C  CB  . ALA A 1 134 ? 3.305   41.861  33.550  1.00 24.31 ? 134 ALA A CB  1 
ATOM   995  N  N   . GLN A 1 135 ? 0.320   41.872  35.307  1.00 26.46 ? 135 GLN A N   1 
ATOM   996  C  CA  . GLN A 1 135 ? -1.116  42.122  35.255  1.00 27.24 ? 135 GLN A CA  1 
ATOM   997  C  C   . GLN A 1 135 ? -1.579  43.131  34.207  1.00 30.38 ? 135 GLN A C   1 
ATOM   998  O  O   . GLN A 1 135 ? -2.780  43.302  33.999  1.00 32.43 ? 135 GLN A O   1 
ATOM   999  C  CB  . GLN A 1 135 ? -1.603  42.557  36.637  1.00 27.46 ? 135 GLN A CB  1 
ATOM   1000 C  CG  . GLN A 1 135 ? -1.306  41.540  37.726  1.00 30.90 ? 135 GLN A CG  1 
ATOM   1001 C  CD  . GLN A 1 135 ? -1.985  40.215  37.470  1.00 34.80 ? 135 GLN A CD  1 
ATOM   1002 O  OE1 . GLN A 1 135 ? -3.211  40.121  37.500  1.00 37.12 ? 135 GLN A OE1 1 
ATOM   1003 N  NE2 . GLN A 1 135 ? -1.192  39.181  37.203  1.00 35.35 ? 135 GLN A NE2 1 
ATOM   1004 N  N   . ASP A 1 136 ? -0.643  43.803  33.547  1.00 28.78 ? 136 ASP A N   1 
ATOM   1005 C  CA  . ASP A 1 136 ? -1.032  44.765  32.534  1.00 28.55 ? 136 ASP A CA  1 
ATOM   1006 C  C   . ASP A 1 136 ? -1.244  44.076  31.184  1.00 27.97 ? 136 ASP A C   1 
ATOM   1007 O  O   . ASP A 1 136 ? -2.208  44.379  30.481  1.00 29.10 ? 136 ASP A O   1 
ATOM   1008 C  CB  . ASP A 1 136 ? 0.011   45.885  32.423  1.00 29.38 ? 136 ASP A CB  1 
ATOM   1009 C  CG  . ASP A 1 136 ? 1.376   45.379  32.018  1.00 32.31 ? 136 ASP A CG  1 
ATOM   1010 O  OD1 . ASP A 1 136 ? 1.949   44.540  32.743  1.00 31.55 ? 136 ASP A OD1 1 
ATOM   1011 O  OD2 . ASP A 1 136 ? 1.881   45.832  30.970  1.00 37.11 ? 136 ASP A OD2 1 
ATOM   1012 N  N   . SER A 1 137 ? -0.363  43.142  30.831  1.00 24.02 ? 137 SER A N   1 
ATOM   1013 C  CA  . SER A 1 137 ? -0.482  42.418  29.565  1.00 23.36 ? 137 SER A CA  1 
ATOM   1014 C  C   . SER A 1 137 ? -1.087  41.013  29.706  1.00 23.63 ? 137 SER A C   1 
ATOM   1015 O  O   . SER A 1 137 ? -1.700  40.511  28.765  1.00 23.53 ? 137 SER A O   1 
ATOM   1016 C  CB  . SER A 1 137 ? 0.881   42.322  28.878  1.00 22.29 ? 137 SER A CB  1 
ATOM   1017 O  OG  . SER A 1 137 ? 1.822   41.686  29.718  1.00 22.58 ? 137 SER A OG  1 
ATOM   1018 N  N   . ASN A 1 138 ? -0.906  40.372  30.861  1.00 21.57 ? 138 ASN A N   1 
ATOM   1019 C  CA  . ASN A 1 138 ? -1.475  39.039  31.090  1.00 21.20 ? 138 ASN A CA  1 
ATOM   1020 C  C   . ASN A 1 138 ? -2.522  39.136  32.196  1.00 21.05 ? 138 ASN A C   1 
ATOM   1021 O  O   . ASN A 1 138 ? -2.439  38.450  33.213  1.00 21.04 ? 138 ASN A O   1 
ATOM   1022 C  CB  . ASN A 1 138 ? -0.392  38.020  31.494  1.00 18.00 ? 138 ASN A CB  1 
ATOM   1023 C  CG  . ASN A 1 138 ? 0.647   37.790  30.401  1.00 24.18 ? 138 ASN A CG  1 
ATOM   1024 O  OD1 . ASN A 1 138 ? 1.116   36.665  30.198  1.00 16.54 ? 138 ASN A OD1 1 
ATOM   1025 N  ND2 . ASN A 1 138 ? 1.031   38.860  29.710  1.00 24.32 ? 138 ASN A ND2 1 
ATOM   1026 N  N   . THR A 1 139 ? -3.517  39.986  31.975  1.00 20.60 ? 139 THR A N   1 
ATOM   1027 C  CA  . THR A 1 139 ? -4.571  40.235  32.951  1.00 21.40 ? 139 THR A CA  1 
ATOM   1028 C  C   . THR A 1 139 ? -5.321  39.007  33.430  1.00 21.99 ? 139 THR A C   1 
ATOM   1029 O  O   . THR A 1 139 ? -5.993  39.056  34.453  1.00 25.54 ? 139 THR A O   1 
ATOM   1030 C  CB  . THR A 1 139 ? -5.604  41.227  32.391  1.00 24.78 ? 139 THR A CB  1 
ATOM   1031 O  OG1 . THR A 1 139 ? -6.262  40.645  31.259  1.00 31.24 ? 139 THR A OG1 1 
ATOM   1032 C  CG2 . THR A 1 139 ? -4.918  42.501  31.946  1.00 24.87 ? 139 THR A CG2 1 
ATOM   1033 N  N   . TRP A 1 140 ? -5.204  37.908  32.696  1.00 22.30 ? 140 TRP A N   1 
ATOM   1034 C  CA  . TRP A 1 140 ? -5.900  36.671  33.039  1.00 18.67 ? 140 TRP A CA  1 
ATOM   1035 C  C   . TRP A 1 140 ? -5.120  35.765  33.982  1.00 17.27 ? 140 TRP A C   1 
ATOM   1036 O  O   . TRP A 1 140 ? -5.675  34.808  34.517  1.00 20.22 ? 140 TRP A O   1 
ATOM   1037 C  CB  . TRP A 1 140 ? -6.217  35.913  31.750  1.00 20.28 ? 140 TRP A CB  1 
ATOM   1038 C  CG  . TRP A 1 140 ? -4.985  35.730  30.911  1.00 19.84 ? 140 TRP A CG  1 
ATOM   1039 C  CD1 . TRP A 1 140 ? -3.948  34.879  31.153  1.00 16.68 ? 140 TRP A CD1 1 
ATOM   1040 C  CD2 . TRP A 1 140 ? -4.602  36.514  29.775  1.00 19.66 ? 140 TRP A CD2 1 
ATOM   1041 N  NE1 . TRP A 1 140 ? -2.942  35.085  30.245  1.00 17.73 ? 140 TRP A NE1 1 
ATOM   1042 C  CE2 . TRP A 1 140 ? -3.316  36.084  29.386  1.00 18.74 ? 140 TRP A CE2 1 
ATOM   1043 C  CE3 . TRP A 1 140 ? -5.221  37.541  29.049  1.00 19.47 ? 140 TRP A CE3 1 
ATOM   1044 C  CZ2 . TRP A 1 140 ? -2.632  36.645  28.300  1.00 21.47 ? 140 TRP A CZ2 1 
ATOM   1045 C  CZ3 . TRP A 1 140 ? -4.541  38.100  27.970  1.00 21.50 ? 140 TRP A CZ3 1 
ATOM   1046 C  CH2 . TRP A 1 140 ? -3.259  37.650  27.607  1.00 23.23 ? 140 TRP A CH2 1 
ATOM   1047 N  N   . ASP A 1 141 ? -3.840  36.060  34.186  1.00 14.94 ? 141 ASP A N   1 
ATOM   1048 C  CA  . ASP A 1 141 ? -2.997  35.234  35.053  1.00 16.08 ? 141 ASP A CA  1 
ATOM   1049 C  C   . ASP A 1 141 ? -3.023  35.504  36.543  1.00 16.33 ? 141 ASP A C   1 
ATOM   1050 O  O   . ASP A 1 141 ? -3.240  36.630  36.982  1.00 19.89 ? 141 ASP A O   1 
ATOM   1051 C  CB  . ASP A 1 141 ? -1.516  35.322  34.651  1.00 15.72 ? 141 ASP A CB  1 
ATOM   1052 C  CG  . ASP A 1 141 ? -1.189  34.519  33.419  1.00 17.45 ? 141 ASP A CG  1 
ATOM   1053 O  OD1 . ASP A 1 141 ? -1.860  33.494  33.194  1.00 16.94 ? 141 ASP A OD1 1 
ATOM   1054 O  OD2 . ASP A 1 141 ? -0.238  34.893  32.701  1.00 17.68 ? 141 ASP A OD2 1 
ATOM   1055 N  N   . PRO A 1 142 ? -2.813  34.453  37.347  1.00 17.56 ? 142 PRO A N   1 
ATOM   1056 C  CA  . PRO A 1 142 ? -2.789  34.636  38.796  1.00 18.30 ? 142 PRO A CA  1 
ATOM   1057 C  C   . PRO A 1 142 ? -1.486  35.422  38.932  1.00 19.45 ? 142 PRO A C   1 
ATOM   1058 O  O   . PRO A 1 142 ? -0.680  35.421  38.003  1.00 19.24 ? 142 PRO A O   1 
ATOM   1059 C  CB  . PRO A 1 142 ? -2.681  33.205  39.305  1.00 16.57 ? 142 PRO A CB  1 
ATOM   1060 C  CG  . PRO A 1 142 ? -1.862  32.550  38.222  1.00 19.04 ? 142 PRO A CG  1 
ATOM   1061 C  CD  . PRO A 1 142 ? -2.637  33.030  37.017  1.00 17.57 ? 142 PRO A CD  1 
ATOM   1062 N  N   . ASN A 1 143 ? -1.258  36.079  40.059  1.00 23.06 ? 143 ASN A N   1 
ATOM   1063 C  CA  . ASN A 1 143 ? -0.057  36.897  40.191  1.00 26.00 ? 143 ASN A CA  1 
ATOM   1064 C  C   . ASN A 1 143 ? 1.210   36.168  40.666  1.00 24.57 ? 143 ASN A C   1 
ATOM   1065 O  O   . ASN A 1 143 ? 1.840   36.572  41.644  1.00 24.65 ? 143 ASN A O   1 
ATOM   1066 C  CB  . ASN A 1 143 ? -0.375  38.091  41.104  1.00 32.68 ? 143 ASN A CB  1 
ATOM   1067 C  CG  . ASN A 1 143 ? 0.539   39.273  40.857  1.00 41.92 ? 143 ASN A CG  1 
ATOM   1068 O  OD1 . ASN A 1 143 ? 0.623   39.779  39.735  1.00 46.18 ? 143 ASN A OD1 1 
ATOM   1069 N  ND2 . ASN A 1 143 ? 1.221   39.729  41.902  1.00 44.54 ? 143 ASN A ND2 1 
ATOM   1070 N  N   . TYR A 1 144 ? 1.581   35.101  39.959  1.00 21.08 ? 144 TYR A N   1 
ATOM   1071 C  CA  . TYR A 1 144 ? 2.777   34.313  40.275  1.00 20.32 ? 144 TYR A CA  1 
ATOM   1072 C  C   . TYR A 1 144 ? 3.003   33.238  39.213  1.00 19.83 ? 144 TYR A C   1 
ATOM   1073 O  O   . TYR A 1 144 ? 2.088   32.909  38.461  1.00 19.22 ? 144 TYR A O   1 
ATOM   1074 C  CB  . TYR A 1 144 ? 2.658   33.678  41.672  1.00 18.62 ? 144 TYR A CB  1 
ATOM   1075 C  CG  . TYR A 1 144 ? 1.342   32.978  41.935  1.00 18.57 ? 144 TYR A CG  1 
ATOM   1076 C  CD1 . TYR A 1 144 ? 1.037   31.756  41.334  1.00 18.79 ? 144 TYR A CD1 1 
ATOM   1077 C  CD2 . TYR A 1 144 ? 0.375   33.571  42.746  1.00 18.84 ? 144 TYR A CD2 1 
ATOM   1078 C  CE1 . TYR A 1 144 ? -0.207  31.145  41.535  1.00 20.47 ? 144 TYR A CE1 1 
ATOM   1079 C  CE2 . TYR A 1 144 ? -0.862  32.973  42.951  1.00 20.95 ? 144 TYR A CE2 1 
ATOM   1080 C  CZ  . TYR A 1 144 ? -1.149  31.765  42.342  1.00 19.75 ? 144 TYR A CZ  1 
ATOM   1081 O  OH  . TYR A 1 144 ? -2.389  31.200  42.520  1.00 22.90 ? 144 TYR A OH  1 
ATOM   1082 N  N   . PRO A 1 145 ? 4.230   32.692  39.123  1.00 17.41 ? 145 PRO A N   1 
ATOM   1083 C  CA  . PRO A 1 145 ? 4.506   31.655  38.123  1.00 17.66 ? 145 PRO A CA  1 
ATOM   1084 C  C   . PRO A 1 145 ? 3.566   30.486  38.380  1.00 17.11 ? 145 PRO A C   1 
ATOM   1085 O  O   . PRO A 1 145 ? 3.239   30.188  39.530  1.00 16.67 ? 145 PRO A O   1 
ATOM   1086 C  CB  . PRO A 1 145 ? 5.969   31.310  38.391  1.00 15.04 ? 145 PRO A CB  1 
ATOM   1087 C  CG  . PRO A 1 145 ? 6.511   32.625  38.908  1.00 20.28 ? 145 PRO A CG  1 
ATOM   1088 C  CD  . PRO A 1 145 ? 5.440   32.946  39.918  1.00 14.10 ? 145 PRO A CD  1 
ATOM   1089 N  N   . HIS A 1 146 ? 3.134   29.813  37.322  1.00 12.15 ? 146 HIS A N   1 
ATOM   1090 C  CA  . HIS A 1 146 ? 2.195   28.728  37.522  1.00 12.99 ? 146 HIS A CA  1 
ATOM   1091 C  C   . HIS A 1 146 ? 2.124   27.707  36.402  1.00 12.71 ? 146 HIS A C   1 
ATOM   1092 O  O   . HIS A 1 146 ? 2.622   27.923  35.298  1.00 13.12 ? 146 HIS A O   1 
ATOM   1093 C  CB  . HIS A 1 146 ? 0.803   29.323  37.715  1.00 14.23 ? 146 HIS A CB  1 
ATOM   1094 C  CG  . HIS A 1 146 ? 0.413   30.270  36.624  1.00 17.34 ? 146 HIS A CG  1 
ATOM   1095 N  ND1 . HIS A 1 146 ? 0.989   31.514  36.482  1.00 13.03 ? 146 HIS A ND1 1 
ATOM   1096 C  CD2 . HIS A 1 146 ? -0.426  30.122  35.571  1.00 18.07 ? 146 HIS A CD2 1 
ATOM   1097 C  CE1 . HIS A 1 146 ? 0.522   32.092  35.390  1.00 13.89 ? 146 HIS A CE1 1 
ATOM   1098 N  NE2 . HIS A 1 146 ? -0.338  31.269  34.818  1.00 16.07 ? 146 HIS A NE2 1 
ATOM   1099 N  N   . ILE A 1 147 ? 1.503   26.580  36.727  1.00 15.34 ? 147 ILE A N   1 
ATOM   1100 C  CA  . ILE A 1 147 ? 1.259   25.509  35.780  1.00 12.62 ? 147 ILE A CA  1 
ATOM   1101 C  C   . ILE A 1 147 ? -0.252  25.582  35.687  1.00 14.03 ? 147 ILE A C   1 
ATOM   1102 O  O   . ILE A 1 147 ? -0.932  25.687  36.705  1.00 13.40 ? 147 ILE A O   1 
ATOM   1103 C  CB  . ILE A 1 147 ? 1.663   24.134  36.334  1.00 14.27 ? 147 ILE A CB  1 
ATOM   1104 C  CG1 . ILE A 1 147 ? 3.174   24.084  36.558  1.00 16.40 ? 147 ILE A CG1 1 
ATOM   1105 C  CG2 . ILE A 1 147 ? 1.254   23.039  35.356  1.00 11.54 ? 147 ILE A CG2 1 
ATOM   1106 C  CD1 . ILE A 1 147 ? 3.658   22.765  37.125  1.00 20.27 ? 147 ILE A CD1 1 
ATOM   1107 N  N   . GLY A 1 148 ? -0.791  25.565  34.479  1.00 13.62 ? 148 GLY A N   1 
ATOM   1108 C  CA  . GLY A 1 148 ? -2.228  25.654  34.373  1.00 11.50 ? 148 GLY A CA  1 
ATOM   1109 C  C   . GLY A 1 148 ? -2.802  24.726  33.339  1.00 14.69 ? 148 GLY A C   1 
ATOM   1110 O  O   . GLY A 1 148 ? -2.109  24.300  32.417  1.00 12.75 ? 148 GLY A O   1 
ATOM   1111 N  N   . ILE A 1 149 ? -4.072  24.387  33.518  1.00 14.88 ? 149 ILE A N   1 
ATOM   1112 C  CA  . ILE A 1 149 ? -4.772  23.538  32.571  1.00 15.49 ? 149 ILE A CA  1 
ATOM   1113 C  C   . ILE A 1 149 ? -5.680  24.503  31.819  1.00 17.60 ? 149 ILE A C   1 
ATOM   1114 O  O   . ILE A 1 149 ? -6.496  25.191  32.425  1.00 17.94 ? 149 ILE A O   1 
ATOM   1115 C  CB  . ILE A 1 149 ? -5.599  22.461  33.292  1.00 13.71 ? 149 ILE A CB  1 
ATOM   1116 C  CG1 . ILE A 1 149 ? -4.650  21.494  34.013  1.00 13.82 ? 149 ILE A CG1 1 
ATOM   1117 C  CG2 . ILE A 1 149 ? -6.495  21.743  32.294  1.00 9.56  ? 149 ILE A CG2 1 
ATOM   1118 C  CD1 . ILE A 1 149 ? -5.338  20.418  34.822  1.00 19.10 ? 149 ILE A CD1 1 
ATOM   1119 N  N   . ASP A 1 150 ? -5.506  24.575  30.504  1.00 17.17 ? 150 ASP A N   1 
ATOM   1120 C  CA  . ASP A 1 150 ? -6.291  25.478  29.673  1.00 17.69 ? 150 ASP A CA  1 
ATOM   1121 C  C   . ASP A 1 150 ? -7.291  24.708  28.825  1.00 18.40 ? 150 ASP A C   1 
ATOM   1122 O  O   . ASP A 1 150 ? -6.910  23.800  28.085  1.00 19.95 ? 150 ASP A O   1 
ATOM   1123 C  CB  . ASP A 1 150 ? -5.372  26.266  28.734  1.00 16.92 ? 150 ASP A CB  1 
ATOM   1124 C  CG  . ASP A 1 150 ? -4.356  27.107  29.475  1.00 15.56 ? 150 ASP A CG  1 
ATOM   1125 O  OD1 . ASP A 1 150 ? -3.418  27.600  28.823  1.00 16.90 ? 150 ASP A OD1 1 
ATOM   1126 O  OD2 . ASP A 1 150 ? -4.496  27.287  30.698  1.00 17.03 ? 150 ASP A OD2 1 
ATOM   1127 N  N   . VAL A 1 151 ? -8.563  25.079  28.932  1.00 16.46 ? 151 VAL A N   1 
ATOM   1128 C  CA  . VAL A 1 151 ? -9.620  24.446  28.152  1.00 18.46 ? 151 VAL A CA  1 
ATOM   1129 C  C   . VAL A 1 151 ? -10.353 25.543  27.385  1.00 19.61 ? 151 VAL A C   1 
ATOM   1130 O  O   . VAL A 1 151 ? -11.170 26.265  27.949  1.00 21.49 ? 151 VAL A O   1 
ATOM   1131 C  CB  . VAL A 1 151 ? -10.615 23.686  29.057  1.00 19.08 ? 151 VAL A CB  1 
ATOM   1132 C  CG1 . VAL A 1 151 ? -11.698 23.034  28.212  1.00 16.62 ? 151 VAL A CG1 1 
ATOM   1133 C  CG2 . VAL A 1 151 ? -9.876  22.619  29.857  1.00 13.28 ? 151 VAL A CG2 1 
ATOM   1134 N  N   . ASN A 1 152 ? -10.028 25.663  26.100  1.00 19.57 ? 152 ASN A N   1 
ATOM   1135 C  CA  . ASN A 1 152 ? -10.611 26.659  25.201  1.00 22.10 ? 152 ASN A CA  1 
ATOM   1136 C  C   . ASN A 1 152 ? -10.395 28.116  25.616  1.00 23.06 ? 152 ASN A C   1 
ATOM   1137 O  O   . ASN A 1 152 ? -11.051 29.011  25.085  1.00 26.90 ? 152 ASN A O   1 
ATOM   1138 C  CB  . ASN A 1 152 ? -12.117 26.422  25.009  1.00 22.73 ? 152 ASN A CB  1 
ATOM   1139 C  CG  . ASN A 1 152 ? -12.425 25.094  24.331  1.00 23.36 ? 152 ASN A CG  1 
ATOM   1140 O  OD1 . ASN A 1 152 ? -11.694 24.652  23.450  1.00 20.52 ? 152 ASN A OD1 1 
ATOM   1141 N  ND2 . ASN A 1 152 ? -13.531 24.471  24.719  1.00 21.71 ? 152 ASN A ND2 1 
ATOM   1142 N  N   . SER A 1 153 ? -9.484  28.361  26.552  1.00 22.01 ? 153 SER A N   1 
ATOM   1143 C  CA  . SER A 1 153 ? -9.229  29.728  27.001  1.00 21.45 ? 153 SER A CA  1 
ATOM   1144 C  C   . SER A 1 153 ? -7.839  29.919  27.587  1.00 19.88 ? 153 SER A C   1 
ATOM   1145 O  O   . SER A 1 153 ? -7.295  29.014  28.216  1.00 19.60 ? 153 SER A O   1 
ATOM   1146 C  CB  . SER A 1 153 ? -10.266 30.142  28.048  1.00 22.11 ? 153 SER A CB  1 
ATOM   1147 O  OG  . SER A 1 153 ? -9.990  31.446  28.533  1.00 19.21 ? 153 SER A OG  1 
ATOM   1148 N  N   . ILE A 1 154 ? -7.271  31.107  27.389  1.00 19.53 ? 154 ILE A N   1 
ATOM   1149 C  CA  . ILE A 1 154 ? -5.948  31.402  27.919  1.00 17.13 ? 154 ILE A CA  1 
ATOM   1150 C  C   . ILE A 1 154 ? -6.022  31.554  29.438  1.00 16.70 ? 154 ILE A C   1 
ATOM   1151 O  O   . ILE A 1 154 ? -5.005  31.539  30.124  1.00 15.92 ? 154 ILE A O   1 
ATOM   1152 C  CB  . ILE A 1 154 ? -5.354  32.695  27.314  1.00 17.37 ? 154 ILE A CB  1 
ATOM   1153 C  CG1 . ILE A 1 154 ? -3.872  32.789  27.671  1.00 17.06 ? 154 ILE A CG1 1 
ATOM   1154 C  CG2 . ILE A 1 154 ? -6.063  33.922  27.875  1.00 14.59 ? 154 ILE A CG2 1 
ATOM   1155 C  CD1 . ILE A 1 154 ? -3.053  31.602  27.190  1.00 18.77 ? 154 ILE A CD1 1 
ATOM   1156 N  N   . ARG A 1 155 ? -7.231  31.717  29.961  1.00 17.79 ? 155 ARG A N   1 
ATOM   1157 C  CA  . ARG A 1 155 ? -7.406  31.838  31.402  1.00 19.38 ? 155 ARG A CA  1 
ATOM   1158 C  C   . ARG A 1 155 ? -7.677  30.432  31.914  1.00 18.19 ? 155 ARG A C   1 
ATOM   1159 O  O   . ARG A 1 155 ? -8.781  29.910  31.773  1.00 20.38 ? 155 ARG A O   1 
ATOM   1160 C  CB  . ARG A 1 155 ? -8.579  32.765  31.737  1.00 20.81 ? 155 ARG A CB  1 
ATOM   1161 C  CG  . ARG A 1 155 ? -8.794  32.942  33.245  1.00 27.54 ? 155 ARG A CG  1 
ATOM   1162 C  CD  . ARG A 1 155 ? -9.819  34.022  33.537  1.00 39.44 ? 155 ARG A CD  1 
ATOM   1163 N  NE  . ARG A 1 155 ? -11.099 33.731  32.902  1.00 53.98 ? 155 ARG A NE  1 
ATOM   1164 C  CZ  . ARG A 1 155 ? -12.149 34.545  32.926  1.00 59.67 ? 155 ARG A CZ  1 
ATOM   1165 N  NH1 . ARG A 1 155 ? -12.072 35.711  33.558  1.00 64.12 ? 155 ARG A NH1 1 
ATOM   1166 N  NH2 . ARG A 1 155 ? -13.275 34.195  32.317  1.00 60.86 ? 155 ARG A NH2 1 
ATOM   1167 N  N   . SER A 1 156 ? -6.652  29.824  32.497  1.00 15.89 ? 156 SER A N   1 
ATOM   1168 C  CA  . SER A 1 156 ? -6.727  28.460  33.000  1.00 13.77 ? 156 SER A CA  1 
ATOM   1169 C  C   . SER A 1 156 ? -7.941  28.174  33.870  1.00 17.62 ? 156 SER A C   1 
ATOM   1170 O  O   . SER A 1 156 ? -8.325  28.998  34.695  1.00 16.28 ? 156 SER A O   1 
ATOM   1171 C  CB  . SER A 1 156 ? -5.471  28.144  33.814  1.00 13.97 ? 156 SER A CB  1 
ATOM   1172 O  OG  . SER A 1 156 ? -4.297  28.439  33.085  1.00 15.33 ? 156 SER A OG  1 
ATOM   1173 N  N   . VAL A 1 157 ? -8.536  26.997  33.695  1.00 16.38 ? 157 VAL A N   1 
ATOM   1174 C  CA  . VAL A 1 157 ? -9.670  26.613  34.521  1.00 17.27 ? 157 VAL A CA  1 
ATOM   1175 C  C   . VAL A 1 157 ? -9.124  26.129  35.869  1.00 18.80 ? 157 VAL A C   1 
ATOM   1176 O  O   . VAL A 1 157 ? -9.865  25.998  36.839  1.00 20.72 ? 157 VAL A O   1 
ATOM   1177 C  CB  . VAL A 1 157 ? -10.492 25.471  33.878  1.00 19.01 ? 157 VAL A CB  1 
ATOM   1178 C  CG1 . VAL A 1 157 ? -11.024 25.914  32.541  1.00 19.11 ? 157 VAL A CG1 1 
ATOM   1179 C  CG2 . VAL A 1 157 ? -9.639  24.218  33.730  1.00 21.57 ? 157 VAL A CG2 1 
ATOM   1180 N  N   . LYS A 1 158 ? -7.816  25.881  35.923  1.00 17.91 ? 158 LYS A N   1 
ATOM   1181 C  CA  . LYS A 1 158 ? -7.171  25.399  37.142  1.00 16.27 ? 158 LYS A CA  1 
ATOM   1182 C  C   . LYS A 1 158 ? -5.658  25.654  37.070  1.00 17.69 ? 158 LYS A C   1 
ATOM   1183 O  O   . LYS A 1 158 ? -5.042  25.456  36.020  1.00 17.88 ? 158 LYS A O   1 
ATOM   1184 C  CB  . LYS A 1 158 ? -7.425  23.899  37.277  1.00 20.53 ? 158 LYS A CB  1 
ATOM   1185 C  CG  . LYS A 1 158 ? -7.183  23.315  38.656  1.00 25.52 ? 158 LYS A CG  1 
ATOM   1186 C  CD  . LYS A 1 158 ? -8.235  23.798  39.639  1.00 31.11 ? 158 LYS A CD  1 
ATOM   1187 C  CE  . LYS A 1 158 ? -8.142  23.044  40.953  1.00 38.17 ? 158 LYS A CE  1 
ATOM   1188 N  NZ  . LYS A 1 158 ? -8.394  21.586  40.753  1.00 39.18 ? 158 LYS A NZ  1 
ATOM   1189 N  N   . THR A 1 159 ? -5.060  26.090  38.177  1.00 15.29 ? 159 THR A N   1 
ATOM   1190 C  CA  . THR A 1 159 ? -3.620  26.348  38.217  1.00 16.39 ? 159 THR A CA  1 
ATOM   1191 C  C   . THR A 1 159 ? -3.021  25.987  39.568  1.00 17.96 ? 159 THR A C   1 
ATOM   1192 O  O   . THR A 1 159 ? -3.732  25.765  40.543  1.00 19.34 ? 159 THR A O   1 
ATOM   1193 C  CB  . THR A 1 159 ? -3.281  27.829  38.008  1.00 16.92 ? 159 THR A CB  1 
ATOM   1194 O  OG1 . THR A 1 159 ? -3.794  28.586  39.109  1.00 17.78 ? 159 THR A OG1 1 
ATOM   1195 C  CG2 . THR A 1 159 ? -3.876  28.345  36.726  1.00 17.99 ? 159 THR A CG2 1 
ATOM   1196 N  N   . VAL A 1 160 ? -1.697  25.947  39.617  1.00 17.01 ? 160 VAL A N   1 
ATOM   1197 C  CA  . VAL A 1 160 ? -0.987  25.661  40.850  1.00 16.26 ? 160 VAL A CA  1 
ATOM   1198 C  C   . VAL A 1 160 ? 0.281   26.504  40.805  1.00 18.59 ? 160 VAL A C   1 
ATOM   1199 O  O   . VAL A 1 160 ? 0.909   26.630  39.749  1.00 18.96 ? 160 VAL A O   1 
ATOM   1200 C  CB  . VAL A 1 160 ? -0.633  24.154  40.975  1.00 14.43 ? 160 VAL A CB  1 
ATOM   1201 C  CG1 . VAL A 1 160 ? 0.309   23.734  39.871  1.00 11.78 ? 160 VAL A CG1 1 
ATOM   1202 C  CG2 . VAL A 1 160 ? -0.016  23.875  42.334  1.00 15.81 ? 160 VAL A CG2 1 
ATOM   1203 N  N   . LYS A 1 161 ? 0.643   27.114  41.930  1.00 17.66 ? 161 LYS A N   1 
ATOM   1204 C  CA  . LYS A 1 161 ? 1.848   27.924  41.958  1.00 18.16 ? 161 LYS A CA  1 
ATOM   1205 C  C   . LYS A 1 161 ? 3.015   27.047  41.534  1.00 18.37 ? 161 LYS A C   1 
ATOM   1206 O  O   . LYS A 1 161 ? 3.104   25.889  41.935  1.00 15.84 ? 161 LYS A O   1 
ATOM   1207 C  CB  . LYS A 1 161 ? 2.118   28.480  43.352  1.00 21.87 ? 161 LYS A CB  1 
ATOM   1208 C  CG  . LYS A 1 161 ? 3.394   29.297  43.392  1.00 27.40 ? 161 LYS A CG  1 
ATOM   1209 C  CD  . LYS A 1 161 ? 3.740   29.776  44.780  1.00 33.83 ? 161 LYS A CD  1 
ATOM   1210 C  CE  . LYS A 1 161 ? 5.093   30.448  44.759  1.00 32.62 ? 161 LYS A CE  1 
ATOM   1211 N  NZ  . LYS A 1 161 ? 6.122   29.490  44.275  1.00 39.30 ? 161 LYS A NZ  1 
ATOM   1212 N  N   . TRP A 1 162 ? 3.908   27.616  40.735  1.00 17.34 ? 162 TRP A N   1 
ATOM   1213 C  CA  . TRP A 1 162 ? 5.061   26.896  40.217  1.00 18.80 ? 162 TRP A CA  1 
ATOM   1214 C  C   . TRP A 1 162 ? 6.346   27.718  40.370  1.00 21.21 ? 162 TRP A C   1 
ATOM   1215 O  O   . TRP A 1 162 ? 6.308   28.950  40.423  1.00 21.84 ? 162 TRP A O   1 
ATOM   1216 C  CB  . TRP A 1 162 ? 4.799   26.552  38.739  1.00 17.19 ? 162 TRP A CB  1 
ATOM   1217 C  CG  . TRP A 1 162 ? 5.933   25.888  38.015  1.00 17.46 ? 162 TRP A CG  1 
ATOM   1218 C  CD1 . TRP A 1 162 ? 6.599   24.753  38.386  1.00 16.00 ? 162 TRP A CD1 1 
ATOM   1219 C  CD2 . TRP A 1 162 ? 6.531   26.323  36.790  1.00 17.83 ? 162 TRP A CD2 1 
ATOM   1220 N  NE1 . TRP A 1 162 ? 7.581   24.458  37.464  1.00 15.72 ? 162 TRP A NE1 1 
ATOM   1221 C  CE2 . TRP A 1 162 ? 7.560   25.407  36.477  1.00 16.72 ? 162 TRP A CE2 1 
ATOM   1222 C  CE3 . TRP A 1 162 ? 6.298   27.402  35.925  1.00 18.00 ? 162 TRP A CE3 1 
ATOM   1223 C  CZ2 . TRP A 1 162 ? 8.358   25.537  35.334  1.00 17.61 ? 162 TRP A CZ2 1 
ATOM   1224 C  CZ3 . TRP A 1 162 ? 7.091   27.531  34.788  1.00 16.50 ? 162 TRP A CZ3 1 
ATOM   1225 C  CH2 . TRP A 1 162 ? 8.109   26.603  34.506  1.00 15.74 ? 162 TRP A CH2 1 
ATOM   1226 N  N   . ASP A 1 163 ? 7.481   27.027  40.447  1.00 21.81 ? 163 ASP A N   1 
ATOM   1227 C  CA  . ASP A 1 163 ? 8.774   27.683  40.592  1.00 21.33 ? 163 ASP A CA  1 
ATOM   1228 C  C   . ASP A 1 163 ? 9.612   27.514  39.334  1.00 21.23 ? 163 ASP A C   1 
ATOM   1229 O  O   . ASP A 1 163 ? 9.926   26.392  38.936  1.00 22.73 ? 163 ASP A O   1 
ATOM   1230 C  CB  . ASP A 1 163 ? 9.541   27.084  41.772  1.00 23.81 ? 163 ASP A CB  1 
ATOM   1231 C  CG  . ASP A 1 163 ? 8.787   27.199  43.072  1.00 25.11 ? 163 ASP A CG  1 
ATOM   1232 O  OD1 . ASP A 1 163 ? 8.489   28.339  43.487  1.00 28.44 ? 163 ASP A OD1 1 
ATOM   1233 O  OD2 . ASP A 1 163 ? 8.492   26.149  43.678  1.00 24.96 ? 163 ASP A OD2 1 
ATOM   1234 N  N   . ARG A 1 164 ? 9.973   28.625  38.705  1.00 20.08 ? 164 ARG A N   1 
ATOM   1235 C  CA  . ARG A 1 164 ? 10.799  28.563  37.507  1.00 20.44 ? 164 ARG A CA  1 
ATOM   1236 C  C   . ARG A 1 164 ? 12.255  28.427  37.950  1.00 20.67 ? 164 ARG A C   1 
ATOM   1237 O  O   . ARG A 1 164 ? 12.708  29.175  38.811  1.00 21.81 ? 164 ARG A O   1 
ATOM   1238 C  CB  . ARG A 1 164 ? 10.629  29.839  36.678  1.00 17.62 ? 164 ARG A CB  1 
ATOM   1239 C  CG  . ARG A 1 164 ? 11.495  29.899  35.428  1.00 18.14 ? 164 ARG A CG  1 
ATOM   1240 C  CD  . ARG A 1 164 ? 11.334  31.228  34.707  1.00 19.05 ? 164 ARG A CD  1 
ATOM   1241 N  NE  . ARG A 1 164 ? 12.134  31.297  33.486  1.00 23.38 ? 164 ARG A NE  1 
ATOM   1242 C  CZ  . ARG A 1 164 ? 13.463  31.257  33.453  1.00 23.00 ? 164 ARG A CZ  1 
ATOM   1243 N  NH1 . ARG A 1 164 ? 14.103  31.325  32.293  1.00 22.73 ? 164 ARG A NH1 1 
ATOM   1244 N  NH2 . ARG A 1 164 ? 14.156  31.160  34.579  1.00 21.09 ? 164 ARG A NH2 1 
ATOM   1245 N  N   . ARG A 1 165 ? 12.973  27.462  37.383  1.00 16.98 ? 165 ARG A N   1 
ATOM   1246 C  CA  . ARG A 1 165 ? 14.379  27.256  37.713  1.00 20.40 ? 165 ARG A CA  1 
ATOM   1247 C  C   . ARG A 1 165 ? 15.195  27.276  36.427  1.00 21.57 ? 165 ARG A C   1 
ATOM   1248 O  O   . ARG A 1 165 ? 15.119  26.354  35.616  1.00 21.93 ? 165 ARG A O   1 
ATOM   1249 C  CB  . ARG A 1 165 ? 14.582  25.921  38.429  1.00 21.73 ? 165 ARG A CB  1 
ATOM   1250 C  CG  . ARG A 1 165 ? 13.931  25.830  39.794  1.00 20.38 ? 165 ARG A CG  1 
ATOM   1251 C  CD  . ARG A 1 165 ? 14.273  24.504  40.447  1.00 20.54 ? 165 ARG A CD  1 
ATOM   1252 N  NE  . ARG A 1 165 ? 13.617  24.351  41.737  1.00 24.84 ? 165 ARG A NE  1 
ATOM   1253 C  CZ  . ARG A 1 165 ? 13.711  23.266  42.499  1.00 26.88 ? 165 ARG A CZ  1 
ATOM   1254 N  NH1 . ARG A 1 165 ? 13.076  23.214  43.663  1.00 27.28 ? 165 ARG A NH1 1 
ATOM   1255 N  NH2 . ARG A 1 165 ? 14.440  22.232  42.100  1.00 24.28 ? 165 ARG A NH2 1 
ATOM   1256 N  N   . ASP A 1 166 ? 15.975  28.335  36.252  1.00 20.71 ? 166 ASP A N   1 
ATOM   1257 C  CA  . ASP A 1 166 ? 16.792  28.514  35.060  1.00 22.55 ? 166 ASP A CA  1 
ATOM   1258 C  C   . ASP A 1 166 ? 17.720  27.325  34.803  1.00 22.73 ? 166 ASP A C   1 
ATOM   1259 O  O   . ASP A 1 166 ? 18.465  26.899  35.686  1.00 21.14 ? 166 ASP A O   1 
ATOM   1260 C  CB  . ASP A 1 166 ? 17.625  29.794  35.192  1.00 24.82 ? 166 ASP A CB  1 
ATOM   1261 C  CG  . ASP A 1 166 ? 18.206  30.255  33.869  1.00 29.68 ? 166 ASP A CG  1 
ATOM   1262 O  OD1 . ASP A 1 166 ? 17.440  30.766  33.026  1.00 31.98 ? 166 ASP A OD1 1 
ATOM   1263 O  OD2 . ASP A 1 166 ? 19.427  30.095  33.663  1.00 36.19 ? 166 ASP A OD2 1 
ATOM   1264 N  N   . GLY A 1 167 ? 17.657  26.789  33.588  1.00 21.34 ? 167 GLY A N   1 
ATOM   1265 C  CA  . GLY A 1 167 ? 18.510  25.676  33.213  1.00 22.76 ? 167 GLY A CA  1 
ATOM   1266 C  C   . GLY A 1 167 ? 18.263  24.355  33.913  1.00 25.86 ? 167 GLY A C   1 
ATOM   1267 O  O   . GLY A 1 167 ? 19.101  23.458  33.847  1.00 29.02 ? 167 GLY A O   1 
ATOM   1268 N  N   . GLN A 1 168 ? 17.128  24.227  34.591  1.00 24.92 ? 168 GLN A N   1 
ATOM   1269 C  CA  . GLN A 1 168 ? 16.794  22.989  35.286  1.00 25.11 ? 168 GLN A CA  1 
ATOM   1270 C  C   . GLN A 1 168 ? 15.725  22.271  34.476  1.00 23.00 ? 168 GLN A C   1 
ATOM   1271 O  O   . GLN A 1 168 ? 14.721  22.879  34.102  1.00 21.61 ? 168 GLN A O   1 
ATOM   1272 C  CB  . GLN A 1 168 ? 16.233  23.291  36.675  1.00 30.73 ? 168 GLN A CB  1 
ATOM   1273 C  CG  . GLN A 1 168 ? 17.176  24.025  37.613  1.00 42.95 ? 168 GLN A CG  1 
ATOM   1274 C  CD  . GLN A 1 168 ? 18.316  23.162  38.100  1.00 47.78 ? 168 GLN A CD  1 
ATOM   1275 O  OE1 . GLN A 1 168 ? 19.157  22.717  37.317  1.00 51.68 ? 168 GLN A OE1 1 
ATOM   1276 N  NE2 . GLN A 1 168 ? 18.347  22.914  39.406  1.00 50.42 ? 168 GLN A NE2 1 
ATOM   1277 N  N   . SER A 1 169 ? 15.933  20.985  34.208  1.00 19.90 ? 169 SER A N   1 
ATOM   1278 C  CA  . SER A 1 169 ? 14.955  20.208  33.451  1.00 19.92 ? 169 SER A CA  1 
ATOM   1279 C  C   . SER A 1 169 ? 13.767  19.847  34.331  1.00 18.99 ? 169 SER A C   1 
ATOM   1280 O  O   . SER A 1 169 ? 13.935  19.418  35.473  1.00 17.30 ? 169 SER A O   1 
ATOM   1281 C  CB  . SER A 1 169 ? 15.575  18.913  32.922  1.00 16.82 ? 169 SER A CB  1 
ATOM   1282 O  OG  . SER A 1 169 ? 16.635  19.180  32.028  1.00 24.60 ? 169 SER A OG  1 
ATOM   1283 N  N   . LEU A 1 170 ? 12.564  20.033  33.799  1.00 18.42 ? 170 LEU A N   1 
ATOM   1284 C  CA  . LEU A 1 170 ? 11.357  19.689  34.529  1.00 15.25 ? 170 LEU A CA  1 
ATOM   1285 C  C   . LEU A 1 170 ? 10.788  18.444  33.859  1.00 15.82 ? 170 LEU A C   1 
ATOM   1286 O  O   . LEU A 1 170 ? 10.581  18.434  32.647  1.00 14.85 ? 170 LEU A O   1 
ATOM   1287 C  CB  . LEU A 1 170 ? 10.336  20.819  34.450  1.00 15.78 ? 170 LEU A CB  1 
ATOM   1288 C  CG  . LEU A 1 170 ? 9.053   20.589  35.255  1.00 17.73 ? 170 LEU A CG  1 
ATOM   1289 C  CD1 . LEU A 1 170 ? 9.379   20.622  36.744  1.00 19.31 ? 170 LEU A CD1 1 
ATOM   1290 C  CD2 . LEU A 1 170 ? 8.033   21.658  34.920  1.00 16.39 ? 170 LEU A CD2 1 
ATOM   1291 N  N   . ASN A 1 171 ? 10.559  17.395  34.639  1.00 14.20 ? 171 ASN A N   1 
ATOM   1292 C  CA  . ASN A 1 171 ? 9.996   16.159  34.107  1.00 17.71 ? 171 ASN A CA  1 
ATOM   1293 C  C   . ASN A 1 171 ? 8.490   16.260  34.290  1.00 17.96 ? 171 ASN A C   1 
ATOM   1294 O  O   . ASN A 1 171 ? 8.008   16.536  35.387  1.00 17.88 ? 171 ASN A O   1 
ATOM   1295 C  CB  . ASN A 1 171 ? 10.530  14.954  34.875  1.00 20.08 ? 171 ASN A CB  1 
ATOM   1296 C  CG  . ASN A 1 171 ? 12.040  14.917  34.912  1.00 34.52 ? 171 ASN A CG  1 
ATOM   1297 O  OD1 . ASN A 1 171 ? 12.696  14.804  33.873  1.00 38.86 ? 171 ASN A OD1 1 
ATOM   1298 N  ND2 . ASN A 1 171 ? 12.607  15.027  36.115  1.00 39.35 ? 171 ASN A ND2 1 
ATOM   1299 N  N   . VAL A 1 172 ? 7.742   16.025  33.222  1.00 14.46 ? 172 VAL A N   1 
ATOM   1300 C  CA  . VAL A 1 172 ? 6.299   16.143  33.306  1.00 14.73 ? 172 VAL A CA  1 
ATOM   1301 C  C   . VAL A 1 172 ? 5.558   14.927  32.810  1.00 14.83 ? 172 VAL A C   1 
ATOM   1302 O  O   . VAL A 1 172 ? 5.910   14.350  31.781  1.00 15.05 ? 172 VAL A O   1 
ATOM   1303 C  CB  . VAL A 1 172 ? 5.803   17.345  32.499  1.00 13.43 ? 172 VAL A CB  1 
ATOM   1304 C  CG1 . VAL A 1 172 ? 4.313   17.533  32.712  1.00 13.74 ? 172 VAL A CG1 1 
ATOM   1305 C  CG2 . VAL A 1 172 ? 6.575   18.587  32.899  1.00 12.56 ? 172 VAL A CG2 1 
ATOM   1306 N  N   . LEU A 1 173 ? 4.524   14.551  33.554  1.00 12.62 ? 173 LEU A N   1 
ATOM   1307 C  CA  . LEU A 1 173 ? 3.679   13.425  33.197  1.00 12.95 ? 173 LEU A CA  1 
ATOM   1308 C  C   . LEU A 1 173 ? 2.250   13.948  33.108  1.00 16.15 ? 173 LEU A C   1 
ATOM   1309 O  O   . LEU A 1 173 ? 1.735   14.529  34.068  1.00 15.96 ? 173 LEU A O   1 
ATOM   1310 C  CB  . LEU A 1 173 ? 3.741   12.334  34.264  1.00 14.50 ? 173 LEU A CB  1 
ATOM   1311 C  CG  . LEU A 1 173 ? 2.949   11.077  33.896  1.00 20.10 ? 173 LEU A CG  1 
ATOM   1312 C  CD1 . LEU A 1 173 ? 3.625   10.414  32.694  1.00 23.14 ? 173 LEU A CD1 1 
ATOM   1313 C  CD2 . LEU A 1 173 ? 2.896   10.107  35.074  1.00 19.75 ? 173 LEU A CD2 1 
ATOM   1314 N  N   . VAL A 1 174 ? 1.621   13.764  31.953  1.00 12.11 ? 174 VAL A N   1 
ATOM   1315 C  CA  . VAL A 1 174 ? 0.242   14.197  31.762  1.00 11.53 ? 174 VAL A CA  1 
ATOM   1316 C  C   . VAL A 1 174 ? -0.575  12.969  31.410  1.00 10.60 ? 174 VAL A C   1 
ATOM   1317 O  O   . VAL A 1 174 ? -0.252  12.248  30.462  1.00 13.08 ? 174 VAL A O   1 
ATOM   1318 C  CB  . VAL A 1 174 ? 0.112   15.221  30.615  1.00 13.41 ? 174 VAL A CB  1 
ATOM   1319 C  CG1 . VAL A 1 174 ? -1.350  15.609  30.426  1.00 11.14 ? 174 VAL A CG1 1 
ATOM   1320 C  CG2 . VAL A 1 174 ? 0.954   16.450  30.918  1.00 12.66 ? 174 VAL A CG2 1 
ATOM   1321 N  N   . THR A 1 175 ? -1.631  12.729  32.172  1.00 10.62 ? 175 THR A N   1 
ATOM   1322 C  CA  . THR A 1 175 ? -2.478  11.573  31.941  1.00 14.58 ? 175 THR A CA  1 
ATOM   1323 C  C   . THR A 1 175 ? -3.955  11.922  31.902  1.00 18.61 ? 175 THR A C   1 
ATOM   1324 O  O   . THR A 1 175 ? -4.432  12.756  32.678  1.00 20.20 ? 175 THR A O   1 
ATOM   1325 C  CB  . THR A 1 175 ? -2.295  10.542  33.050  1.00 15.74 ? 175 THR A CB  1 
ATOM   1326 O  OG1 . THR A 1 175 ? -2.695  11.124  34.297  1.00 26.02 ? 175 THR A OG1 1 
ATOM   1327 C  CG2 . THR A 1 175 ? -0.840  10.123  33.154  1.00 18.72 ? 175 THR A CG2 1 
ATOM   1328 N  N   . PHE A 1 176 ? -4.680  11.291  30.985  1.00 16.29 ? 176 PHE A N   1 
ATOM   1329 C  CA  . PHE A 1 176 ? -6.119  11.493  30.903  1.00 16.26 ? 176 PHE A CA  1 
ATOM   1330 C  C   . PHE A 1 176 ? -6.761  10.131  31.110  1.00 17.18 ? 176 PHE A C   1 
ATOM   1331 O  O   . PHE A 1 176 ? -6.472  9.185   30.381  1.00 16.57 ? 176 PHE A O   1 
ATOM   1332 C  CB  . PHE A 1 176 ? -6.560  12.039  29.543  1.00 15.18 ? 176 PHE A CB  1 
ATOM   1333 C  CG  . PHE A 1 176 ? -8.057  12.210  29.423  1.00 18.49 ? 176 PHE A CG  1 
ATOM   1334 C  CD1 . PHE A 1 176 ? -8.730  13.147  30.203  1.00 19.71 ? 176 PHE A CD1 1 
ATOM   1335 C  CD2 . PHE A 1 176 ? -8.800  11.402  28.566  1.00 19.49 ? 176 PHE A CD2 1 
ATOM   1336 C  CE1 . PHE A 1 176 ? -10.123 13.278  30.131  1.00 21.76 ? 176 PHE A CE1 1 
ATOM   1337 C  CE2 . PHE A 1 176 ? -10.193 11.521  28.486  1.00 21.24 ? 176 PHE A CE2 1 
ATOM   1338 C  CZ  . PHE A 1 176 ? -10.856 12.460  29.270  1.00 20.93 ? 176 PHE A CZ  1 
ATOM   1339 N  N   . ASN A 1 177 ? -7.618  10.028  32.112  1.00 16.98 ? 177 ASN A N   1 
ATOM   1340 C  CA  . ASN A 1 177 ? -8.303  8.776   32.390  1.00 17.88 ? 177 ASN A CA  1 
ATOM   1341 C  C   . ASN A 1 177 ? -9.752  8.963   31.936  1.00 17.85 ? 177 ASN A C   1 
ATOM   1342 O  O   . ASN A 1 177 ? -10.508 9.704   32.557  1.00 18.15 ? 177 ASN A O   1 
ATOM   1343 C  CB  . ASN A 1 177 ? -8.252  8.484   33.887  1.00 17.45 ? 177 ASN A CB  1 
ATOM   1344 C  CG  . ASN A 1 177 ? -8.835  7.135   34.232  1.00 19.21 ? 177 ASN A CG  1 
ATOM   1345 O  OD1 . ASN A 1 177 ? -9.861  6.737   33.691  1.00 24.53 ? 177 ASN A OD1 1 
ATOM   1346 N  ND2 . ASN A 1 177 ? -8.195  6.434   35.157  1.00 22.62 ? 177 ASN A ND2 1 
ATOM   1347 N  N   . PRO A 1 178 ? -10.154 8.305   30.837  1.00 17.87 ? 178 PRO A N   1 
ATOM   1348 C  CA  . PRO A 1 178 ? -11.524 8.431   30.329  1.00 19.89 ? 178 PRO A CA  1 
ATOM   1349 C  C   . PRO A 1 178 ? -12.596 7.895   31.279  1.00 23.68 ? 178 PRO A C   1 
ATOM   1350 O  O   . PRO A 1 178 ? -13.760 8.289   31.204  1.00 24.98 ? 178 PRO A O   1 
ATOM   1351 C  CB  . PRO A 1 178 ? -11.465 7.648   29.020  1.00 19.52 ? 178 PRO A CB  1 
ATOM   1352 C  CG  . PRO A 1 178 ? -10.474 6.549   29.366  1.00 22.11 ? 178 PRO A CG  1 
ATOM   1353 C  CD  . PRO A 1 178 ? -9.376  7.413   29.962  1.00 17.56 ? 178 PRO A CD  1 
ATOM   1354 N  N   . SER A 1 179 ? -12.198 6.998   32.171  1.00 24.18 ? 179 SER A N   1 
ATOM   1355 C  CA  . SER A 1 179 ? -13.129 6.406   33.122  1.00 29.71 ? 179 SER A CA  1 
ATOM   1356 C  C   . SER A 1 179 ? -13.614 7.421   34.164  1.00 30.66 ? 179 SER A C   1 
ATOM   1357 O  O   . SER A 1 179 ? -14.780 7.403   34.561  1.00 32.34 ? 179 SER A O   1 
ATOM   1358 C  CB  . SER A 1 179 ? -12.465 5.214   33.814  1.00 29.68 ? 179 SER A CB  1 
ATOM   1359 O  OG  . SER A 1 179 ? -13.388 4.529   34.636  1.00 40.81 ? 179 SER A OG  1 
ATOM   1360 N  N   . THR A 1 180 ? -12.719 8.305   34.596  1.00 30.04 ? 180 THR A N   1 
ATOM   1361 C  CA  . THR A 1 180 ? -13.048 9.331   35.586  1.00 26.42 ? 180 THR A CA  1 
ATOM   1362 C  C   . THR A 1 180 ? -13.053 10.725  34.968  1.00 25.67 ? 180 THR A C   1 
ATOM   1363 O  O   . THR A 1 180 ? -13.510 11.681  35.591  1.00 24.80 ? 180 THR A O   1 
ATOM   1364 C  CB  . THR A 1 180 ? -12.027 9.349   36.728  1.00 28.10 ? 180 THR A CB  1 
ATOM   1365 O  OG1 . THR A 1 180 ? -10.723 9.601   36.188  1.00 28.92 ? 180 THR A OG1 1 
ATOM   1366 C  CG2 . THR A 1 180 ? -12.022 8.019   37.469  1.00 24.90 ? 180 THR A CG2 1 
ATOM   1367 N  N   . ARG A 1 181 ? -12.541 10.826  33.743  1.00 23.99 ? 181 ARG A N   1 
ATOM   1368 C  CA  . ARG A 1 181 ? -12.447 12.091  33.018  1.00 24.44 ? 181 ARG A CA  1 
ATOM   1369 C  C   . ARG A 1 181 ? -11.485 13.071  33.674  1.00 21.76 ? 181 ARG A C   1 
ATOM   1370 O  O   . ARG A 1 181 ? -11.619 14.281  33.529  1.00 22.13 ? 181 ARG A O   1 
ATOM   1371 C  CB  . ARG A 1 181 ? -13.820 12.743  32.870  1.00 29.69 ? 181 ARG A CB  1 
ATOM   1372 C  CG  . ARG A 1 181 ? -14.791 11.928  32.041  1.00 34.74 ? 181 ARG A CG  1 
ATOM   1373 C  CD  . ARG A 1 181 ? -16.077 12.687  31.828  1.00 44.04 ? 181 ARG A CD  1 
ATOM   1374 N  NE  . ARG A 1 181 ? -17.059 11.895  31.097  1.00 56.03 ? 181 ARG A NE  1 
ATOM   1375 C  CZ  . ARG A 1 181 ? -18.253 12.346  30.729  1.00 60.95 ? 181 ARG A CZ  1 
ATOM   1376 N  NH1 . ARG A 1 181 ? -18.614 13.589  31.026  1.00 63.64 ? 181 ARG A NH1 1 
ATOM   1377 N  NH2 . ARG A 1 181 ? -19.090 11.554  30.073  1.00 62.79 ? 181 ARG A NH2 1 
ATOM   1378 N  N   . ASN A 1 182 ? -10.510 12.535  34.393  1.00 21.34 ? 182 ASN A N   1 
ATOM   1379 C  CA  . ASN A 1 182 ? -9.514  13.358  35.053  1.00 23.51 ? 182 ASN A CA  1 
ATOM   1380 C  C   . ASN A 1 182 ? -8.270  13.545  34.207  1.00 21.68 ? 182 ASN A C   1 
ATOM   1381 O  O   . ASN A 1 182 ? -7.706  12.581  33.692  1.00 21.35 ? 182 ASN A O   1 
ATOM   1382 C  CB  . ASN A 1 182 ? -9.106  12.743  36.391  1.00 27.89 ? 182 ASN A CB  1 
ATOM   1383 C  CG  . ASN A 1 182 ? -9.832  13.366  37.560  1.00 36.64 ? 182 ASN A CG  1 
ATOM   1384 O  OD1 . ASN A 1 182 ? -11.063 13.411  37.594  1.00 38.00 ? 182 ASN A OD1 1 
ATOM   1385 N  ND2 . ASN A 1 182 ? -9.070  13.851  38.534  1.00 41.32 ? 182 ASN A ND2 1 
ATOM   1386 N  N   . LEU A 1 183 ? -7.855  14.797  34.071  1.00 19.57 ? 183 LEU A N   1 
ATOM   1387 C  CA  . LEU A 1 183 ? -6.652  15.143  33.329  1.00 19.70 ? 183 LEU A CA  1 
ATOM   1388 C  C   . LEU A 1 183 ? -5.683  15.468  34.459  1.00 18.18 ? 183 LEU A C   1 
ATOM   1389 O  O   . LEU A 1 183 ? -5.855  16.472  35.147  1.00 19.26 ? 183 LEU A O   1 
ATOM   1390 C  CB  . LEU A 1 183 ? -6.914  16.378  32.458  1.00 17.96 ? 183 LEU A CB  1 
ATOM   1391 C  CG  . LEU A 1 183 ? -5.869  16.928  31.479  1.00 21.42 ? 183 LEU A CG  1 
ATOM   1392 C  CD1 . LEU A 1 183 ? -4.664  17.449  32.224  1.00 27.37 ? 183 LEU A CD1 1 
ATOM   1393 C  CD2 . LEU A 1 183 ? -5.466  15.843  30.509  1.00 22.58 ? 183 LEU A CD2 1 
ATOM   1394 N  N   . ASP A 1 184 ? -4.697  14.604  34.679  1.00 13.41 ? 184 ASP A N   1 
ATOM   1395 C  CA  . ASP A 1 184 ? -3.727  14.819  35.751  1.00 18.07 ? 184 ASP A CA  1 
ATOM   1396 C  C   . ASP A 1 184 ? -2.373  15.261  35.226  1.00 15.53 ? 184 ASP A C   1 
ATOM   1397 O  O   . ASP A 1 184 ? -1.882  14.740  34.229  1.00 14.82 ? 184 ASP A O   1 
ATOM   1398 C  CB  . ASP A 1 184 ? -3.532  13.545  36.583  1.00 21.88 ? 184 ASP A CB  1 
ATOM   1399 C  CG  . ASP A 1 184 ? -4.829  13.018  37.160  1.00 32.02 ? 184 ASP A CG  1 
ATOM   1400 O  OD1 . ASP A 1 184 ? -5.547  13.793  37.825  1.00 38.53 ? 184 ASP A OD1 1 
ATOM   1401 O  OD2 . ASP A 1 184 ? -5.131  11.821  36.959  1.00 38.10 ? 184 ASP A OD2 1 
ATOM   1402 N  N   . VAL A 1 185 ? -1.777  16.226  35.915  1.00 13.50 ? 185 VAL A N   1 
ATOM   1403 C  CA  . VAL A 1 185 ? -0.472  16.748  35.558  1.00 12.51 ? 185 VAL A CA  1 
ATOM   1404 C  C   . VAL A 1 185 ? 0.457   16.628  36.756  1.00 15.73 ? 185 VAL A C   1 
ATOM   1405 O  O   . VAL A 1 185 ? 0.142   17.095  37.845  1.00 18.02 ? 185 VAL A O   1 
ATOM   1406 C  CB  . VAL A 1 185 ? -0.551  18.232  35.157  1.00 14.65 ? 185 VAL A CB  1 
ATOM   1407 C  CG1 . VAL A 1 185 ? 0.839   18.757  34.817  1.00 9.48  ? 185 VAL A CG1 1 
ATOM   1408 C  CG2 . VAL A 1 185 ? -1.497  18.394  33.972  1.00 16.15 ? 185 VAL A CG2 1 
ATOM   1409 N  N   . VAL A 1 186 ? 1.599   15.988  36.555  1.00 16.78 ? 186 VAL A N   1 
ATOM   1410 C  CA  . VAL A 1 186 ? 2.577   15.836  37.617  1.00 17.19 ? 186 VAL A CA  1 
ATOM   1411 C  C   . VAL A 1 186 ? 3.918   16.306  37.068  1.00 19.51 ? 186 VAL A C   1 
ATOM   1412 O  O   . VAL A 1 186 ? 4.404   15.790  36.060  1.00 20.25 ? 186 VAL A O   1 
ATOM   1413 C  CB  . VAL A 1 186 ? 2.669   14.365  38.075  1.00 18.19 ? 186 VAL A CB  1 
ATOM   1414 C  CG1 . VAL A 1 186 ? 3.784   14.192  39.096  1.00 17.88 ? 186 VAL A CG1 1 
ATOM   1415 C  CG2 . VAL A 1 186 ? 1.336   13.940  38.679  1.00 19.28 ? 186 VAL A CG2 1 
ATOM   1416 N  N   . ALA A 1 187 ? 4.502   17.308  37.716  1.00 17.01 ? 187 ALA A N   1 
ATOM   1417 C  CA  . ALA A 1 187 ? 5.780   17.848  37.270  1.00 17.30 ? 187 ALA A CA  1 
ATOM   1418 C  C   . ALA A 1 187 ? 6.782   17.816  38.417  1.00 17.57 ? 187 ALA A C   1 
ATOM   1419 O  O   . ALA A 1 187 ? 6.469   18.196  39.547  1.00 18.57 ? 187 ALA A O   1 
ATOM   1420 C  CB  . ALA A 1 187 ? 5.593   19.274  36.759  1.00 14.99 ? 187 ALA A CB  1 
ATOM   1421 N  N   . THR A 1 188 ? 7.996   17.372  38.123  1.00 16.23 ? 188 THR A N   1 
ATOM   1422 C  CA  . THR A 1 188 ? 9.011   17.266  39.152  1.00 19.22 ? 188 THR A CA  1 
ATOM   1423 C  C   . THR A 1 188 ? 10.410  17.636  38.682  1.00 20.37 ? 188 THR A C   1 
ATOM   1424 O  O   . THR A 1 188 ? 10.804  17.316  37.561  1.00 20.27 ? 188 THR A O   1 
ATOM   1425 C  CB  . THR A 1 188 ? 9.086   15.830  39.677  1.00 22.67 ? 188 THR A CB  1 
ATOM   1426 O  OG1 . THR A 1 188 ? 9.489   14.968  38.608  1.00 27.66 ? 188 THR A OG1 1 
ATOM   1427 C  CG2 . THR A 1 188 ? 7.725   15.368  40.185  1.00 26.50 ? 188 THR A CG2 1 
ATOM   1428 N  N   . TYR A 1 189 ? 11.150  18.322  39.547  1.00 19.14 ? 189 TYR A N   1 
ATOM   1429 C  CA  . TYR A 1 189 ? 12.530  18.673  39.255  1.00 18.42 ? 189 TYR A CA  1 
ATOM   1430 C  C   . TYR A 1 189 ? 13.352  17.505  39.788  1.00 18.51 ? 189 TYR A C   1 
ATOM   1431 O  O   . TYR A 1 189 ? 12.881  16.755  40.645  1.00 14.92 ? 189 TYR A O   1 
ATOM   1432 C  CB  . TYR A 1 189 ? 12.939  19.970  39.956  1.00 13.44 ? 189 TYR A CB  1 
ATOM   1433 C  CG  . TYR A 1 189 ? 12.410  21.211  39.293  1.00 11.37 ? 189 TYR A CG  1 
ATOM   1434 C  CD1 . TYR A 1 189 ? 11.466  22.019  39.922  1.00 9.66  ? 189 TYR A CD1 1 
ATOM   1435 C  CD2 . TYR A 1 189 ? 12.864  21.587  38.028  1.00 13.33 ? 189 TYR A CD2 1 
ATOM   1436 C  CE1 . TYR A 1 189 ? 10.987  23.177  39.309  1.00 8.86  ? 189 TYR A CE1 1 
ATOM   1437 C  CE2 . TYR A 1 189 ? 12.397  22.736  37.409  1.00 11.37 ? 189 TYR A CE2 1 
ATOM   1438 C  CZ  . TYR A 1 189 ? 11.460  23.527  38.053  1.00 11.40 ? 189 TYR A CZ  1 
ATOM   1439 O  OH  . TYR A 1 189 ? 11.016  24.672  37.439  1.00 13.34 ? 189 TYR A OH  1 
ATOM   1440 N  N   . SER A 1 190 ? 14.572  17.351  39.288  1.00 20.77 ? 190 SER A N   1 
ATOM   1441 C  CA  . SER A 1 190 ? 15.434  16.242  39.700  1.00 24.86 ? 190 SER A CA  1 
ATOM   1442 C  C   . SER A 1 190 ? 15.604  16.066  41.207  1.00 23.66 ? 190 SER A C   1 
ATOM   1443 O  O   . SER A 1 190 ? 15.830  14.952  41.675  1.00 24.68 ? 190 SER A O   1 
ATOM   1444 C  CB  . SER A 1 190 ? 16.820  16.387  39.064  1.00 26.00 ? 190 SER A CB  1 
ATOM   1445 O  OG  . SER A 1 190 ? 17.457  17.572  39.508  1.00 29.56 ? 190 SER A OG  1 
ATOM   1446 N  N   . ASP A 1 191 ? 15.488  17.150  41.968  1.00 18.90 ? 191 ASP A N   1 
ATOM   1447 C  CA  . ASP A 1 191 ? 15.682  17.061  43.408  1.00 20.40 ? 191 ASP A CA  1 
ATOM   1448 C  C   . ASP A 1 191 ? 14.451  16.537  44.138  1.00 20.67 ? 191 ASP A C   1 
ATOM   1449 O  O   . ASP A 1 191 ? 14.448  16.423  45.364  1.00 23.46 ? 191 ASP A O   1 
ATOM   1450 C  CB  . ASP A 1 191 ? 16.091  18.430  43.963  1.00 21.15 ? 191 ASP A CB  1 
ATOM   1451 C  CG  . ASP A 1 191 ? 14.943  19.412  44.005  1.00 20.83 ? 191 ASP A CG  1 
ATOM   1452 O  OD1 . ASP A 1 191 ? 14.009  19.283  43.188  1.00 22.58 ? 191 ASP A OD1 1 
ATOM   1453 O  OD2 . ASP A 1 191 ? 14.989  20.333  44.844  1.00 25.60 ? 191 ASP A OD2 1 
ATOM   1454 N  N   . GLY A 1 192 ? 13.409  16.212  43.382  1.00 18.26 ? 192 GLY A N   1 
ATOM   1455 C  CA  . GLY A 1 192 ? 12.199  15.694  43.991  1.00 14.92 ? 192 GLY A CA  1 
ATOM   1456 C  C   . GLY A 1 192 ? 11.100  16.715  44.222  1.00 17.52 ? 192 GLY A C   1 
ATOM   1457 O  O   . GLY A 1 192 ? 10.006  16.349  44.645  1.00 18.76 ? 192 GLY A O   1 
ATOM   1458 N  N   . THR A 1 193 ? 11.372  17.992  43.967  1.00 15.09 ? 193 THR A N   1 
ATOM   1459 C  CA  . THR A 1 193 ? 10.344  19.007  44.152  1.00 16.73 ? 193 THR A CA  1 
ATOM   1460 C  C   . THR A 1 193 ? 9.215   18.618  43.200  1.00 17.31 ? 193 THR A C   1 
ATOM   1461 O  O   . THR A 1 193 ? 9.449   18.379  42.013  1.00 21.43 ? 193 THR A O   1 
ATOM   1462 C  CB  . THR A 1 193 ? 10.880  20.391  43.814  1.00 16.79 ? 193 THR A CB  1 
ATOM   1463 O  OG1 . THR A 1 193 ? 12.053  20.643  44.600  1.00 17.53 ? 193 THR A OG1 1 
ATOM   1464 C  CG2 . THR A 1 193 ? 9.828   21.452  44.126  1.00 16.29 ? 193 THR A CG2 1 
ATOM   1465 N  N   . ARG A 1 194 ? 7.994   18.569  43.713  1.00 13.55 ? 194 ARG A N   1 
ATOM   1466 C  CA  . ARG A 1 194 ? 6.864   18.109  42.918  1.00 15.99 ? 194 ARG A CA  1 
ATOM   1467 C  C   . ARG A 1 194 ? 5.681   19.079  42.841  1.00 17.13 ? 194 ARG A C   1 
ATOM   1468 O  O   . ARG A 1 194 ? 5.385   19.789  43.799  1.00 15.00 ? 194 ARG A O   1 
ATOM   1469 C  CB  . ARG A 1 194 ? 6.410   16.777  43.519  1.00 16.97 ? 194 ARG A CB  1 
ATOM   1470 C  CG  . ARG A 1 194 ? 5.380   15.965  42.765  1.00 18.55 ? 194 ARG A CG  1 
ATOM   1471 C  CD  . ARG A 1 194 ? 4.907   14.866  43.714  1.00 24.24 ? 194 ARG A CD  1 
ATOM   1472 N  NE  . ARG A 1 194 ? 3.933   13.939  43.153  1.00 25.46 ? 194 ARG A NE  1 
ATOM   1473 C  CZ  . ARG A 1 194 ? 4.238   12.917  42.358  1.00 32.76 ? 194 ARG A CZ  1 
ATOM   1474 N  NH1 . ARG A 1 194 ? 5.503   12.683  42.023  1.00 32.33 ? 194 ARG A NH1 1 
ATOM   1475 N  NH2 . ARG A 1 194 ? 3.276   12.118  41.914  1.00 32.50 ? 194 ARG A NH2 1 
ATOM   1476 N  N   . TYR A 1 195 ? 5.002   19.093  41.697  1.00 14.90 ? 195 TYR A N   1 
ATOM   1477 C  CA  . TYR A 1 195 ? 3.836   19.953  41.508  1.00 14.09 ? 195 TYR A CA  1 
ATOM   1478 C  C   . TYR A 1 195 ? 2.719   19.149  40.865  1.00 16.01 ? 195 TYR A C   1 
ATOM   1479 O  O   . TYR A 1 195 ? 2.947   18.421  39.893  1.00 16.40 ? 195 TYR A O   1 
ATOM   1480 C  CB  . TYR A 1 195 ? 4.155   21.141  40.602  1.00 13.37 ? 195 TYR A CB  1 
ATOM   1481 C  CG  . TYR A 1 195 ? 5.385   21.908  40.996  1.00 15.28 ? 195 TYR A CG  1 
ATOM   1482 C  CD1 . TYR A 1 195 ? 6.650   21.475  40.607  1.00 11.23 ? 195 TYR A CD1 1 
ATOM   1483 C  CD2 . TYR A 1 195 ? 5.290   23.062  41.772  1.00 13.07 ? 195 TYR A CD2 1 
ATOM   1484 C  CE1 . TYR A 1 195 ? 7.790   22.172  40.975  1.00 14.20 ? 195 TYR A CE1 1 
ATOM   1485 C  CE2 . TYR A 1 195 ? 6.428   23.767  42.148  1.00 16.19 ? 195 TYR A CE2 1 
ATOM   1486 C  CZ  . TYR A 1 195 ? 7.673   23.317  41.744  1.00 13.24 ? 195 TYR A CZ  1 
ATOM   1487 O  OH  . TYR A 1 195 ? 8.801   24.017  42.093  1.00 20.31 ? 195 TYR A OH  1 
ATOM   1488 N  N   . GLU A 1 196 ? 1.509   19.293  41.393  1.00 13.97 ? 196 GLU A N   1 
ATOM   1489 C  CA  . GLU A 1 196 ? 0.372   18.562  40.864  1.00 14.68 ? 196 GLU A CA  1 
ATOM   1490 C  C   . GLU A 1 196 ? -0.848  19.440  40.668  1.00 17.52 ? 196 GLU A C   1 
ATOM   1491 O  O   . GLU A 1 196 ? -1.121  20.334  41.464  1.00 15.00 ? 196 GLU A O   1 
ATOM   1492 C  CB  . GLU A 1 196 ? -0.013  17.427  41.803  1.00 17.45 ? 196 GLU A CB  1 
ATOM   1493 C  CG  . GLU A 1 196 ? 1.050   16.378  42.014  1.00 28.41 ? 196 GLU A CG  1 
ATOM   1494 C  CD  . GLU A 1 196 ? 0.616   15.332  43.018  1.00 29.95 ? 196 GLU A CD  1 
ATOM   1495 O  OE1 . GLU A 1 196 ? -0.466  14.742  42.828  1.00 37.94 ? 196 GLU A OE1 1 
ATOM   1496 O  OE2 . GLU A 1 196 ? 1.354   15.097  43.994  1.00 38.31 ? 196 GLU A OE2 1 
ATOM   1497 N  N   . VAL A 1 197 ? -1.577  19.171  39.592  1.00 16.79 ? 197 VAL A N   1 
ATOM   1498 C  CA  . VAL A 1 197 ? -2.804  19.885  39.298  1.00 15.43 ? 197 VAL A CA  1 
ATOM   1499 C  C   . VAL A 1 197 ? -3.624  18.969  38.407  1.00 17.41 ? 197 VAL A C   1 
ATOM   1500 O  O   . VAL A 1 197 ? -3.084  18.257  37.558  1.00 18.51 ? 197 VAL A O   1 
ATOM   1501 C  CB  . VAL A 1 197 ? -2.541  21.222  38.577  1.00 18.96 ? 197 VAL A CB  1 
ATOM   1502 C  CG1 . VAL A 1 197 ? -1.946  20.973  37.202  1.00 13.41 ? 197 VAL A CG1 1 
ATOM   1503 C  CG2 . VAL A 1 197 ? -3.844  22.016  38.477  1.00 19.91 ? 197 VAL A CG2 1 
ATOM   1504 N  N   . SER A 1 198 ? -4.930  18.959  38.614  1.00 17.27 ? 198 SER A N   1 
ATOM   1505 C  CA  . SER A 1 198 ? -5.787  18.110  37.808  1.00 18.73 ? 198 SER A CA  1 
ATOM   1506 C  C   . SER A 1 198 ? -7.132  18.766  37.650  1.00 19.12 ? 198 SER A C   1 
ATOM   1507 O  O   . SER A 1 198 ? -7.483  19.682  38.392  1.00 19.16 ? 198 SER A O   1 
ATOM   1508 C  CB  . SER A 1 198 ? -5.949  16.740  38.456  1.00 16.63 ? 198 SER A CB  1 
ATOM   1509 O  OG  . SER A 1 198 ? -6.506  16.868  39.743  1.00 24.28 ? 198 SER A OG  1 
ATOM   1510 N  N   . TYR A 1 199 ? -7.887  18.290  36.674  1.00 18.99 ? 199 TYR A N   1 
ATOM   1511 C  CA  . TYR A 1 199 ? -9.189  18.846  36.399  1.00 18.43 ? 199 TYR A CA  1 
ATOM   1512 C  C   . TYR A 1 199 ? -10.012 17.824  35.643  1.00 19.55 ? 199 TYR A C   1 
ATOM   1513 O  O   . TYR A 1 199 ? -9.486  17.059  34.826  1.00 15.71 ? 199 TYR A O   1 
ATOM   1514 C  CB  . TYR A 1 199 ? -9.012  20.132  35.591  1.00 21.34 ? 199 TYR A CB  1 
ATOM   1515 C  CG  . TYR A 1 199 ? -10.283 20.852  35.218  1.00 23.80 ? 199 TYR A CG  1 
ATOM   1516 C  CD1 . TYR A 1 199 ? -10.909 20.612  34.000  1.00 28.93 ? 199 TYR A CD1 1 
ATOM   1517 C  CD2 . TYR A 1 199 ? -10.839 21.806  36.069  1.00 28.23 ? 199 TYR A CD2 1 
ATOM   1518 C  CE1 . TYR A 1 199 ? -12.054 21.311  33.629  1.00 32.84 ? 199 TYR A CE1 1 
ATOM   1519 C  CE2 . TYR A 1 199 ? -11.988 22.511  35.710  1.00 28.64 ? 199 TYR A CE2 1 
ATOM   1520 C  CZ  . TYR A 1 199 ? -12.584 22.259  34.488  1.00 30.51 ? 199 TYR A CZ  1 
ATOM   1521 O  OH  . TYR A 1 199 ? -13.702 22.964  34.110  1.00 38.30 ? 199 TYR A OH  1 
ATOM   1522 N  N   . GLU A 1 200 ? -11.305 17.801  35.932  1.00 18.06 ? 200 GLU A N   1 
ATOM   1523 C  CA  . GLU A 1 200 ? -12.200 16.865  35.282  1.00 23.72 ? 200 GLU A CA  1 
ATOM   1524 C  C   . GLU A 1 200 ? -12.743 17.513  34.017  1.00 25.62 ? 200 GLU A C   1 
ATOM   1525 O  O   . GLU A 1 200 ? -13.320 18.597  34.072  1.00 26.97 ? 200 GLU A O   1 
ATOM   1526 C  CB  . GLU A 1 200 ? -13.344 16.506  36.224  1.00 25.59 ? 200 GLU A CB  1 
ATOM   1527 C  CG  . GLU A 1 200 ? -14.286 15.462  35.671  1.00 32.95 ? 200 GLU A CG  1 
ATOM   1528 C  CD  . GLU A 1 200 ? -15.450 15.189  36.599  1.00 35.43 ? 200 GLU A CD  1 
ATOM   1529 O  OE1 . GLU A 1 200 ? -15.210 14.842  37.774  1.00 36.75 ? 200 GLU A OE1 1 
ATOM   1530 O  OE2 . GLU A 1 200 ? -16.607 15.319  36.148  1.00 41.84 ? 200 GLU A OE2 1 
ATOM   1531 N  N   . VAL A 1 201 ? -12.543 16.860  32.876  1.00 24.98 ? 201 VAL A N   1 
ATOM   1532 C  CA  . VAL A 1 201 ? -13.024 17.400  31.612  1.00 23.63 ? 201 VAL A CA  1 
ATOM   1533 C  C   . VAL A 1 201 ? -13.436 16.305  30.636  1.00 26.37 ? 201 VAL A C   1 
ATOM   1534 O  O   . VAL A 1 201 ? -12.748 15.295  30.486  1.00 25.70 ? 201 VAL A O   1 
ATOM   1535 C  CB  . VAL A 1 201 ? -11.952 18.277  30.935  1.00 23.32 ? 201 VAL A CB  1 
ATOM   1536 C  CG1 . VAL A 1 201 ? -10.711 17.454  30.638  1.00 22.07 ? 201 VAL A CG1 1 
ATOM   1537 C  CG2 . VAL A 1 201 ? -12.504 18.872  29.656  1.00 21.03 ? 201 VAL A CG2 1 
ATOM   1538 N  N   . ASP A 1 202 ? -14.574 16.509  29.981  1.00 25.98 ? 202 ASP A N   1 
ATOM   1539 C  CA  . ASP A 1 202 ? -15.067 15.556  29.000  1.00 25.61 ? 202 ASP A CA  1 
ATOM   1540 C  C   . ASP A 1 202 ? -14.489 15.989  27.659  1.00 24.60 ? 202 ASP A C   1 
ATOM   1541 O  O   . ASP A 1 202 ? -15.014 16.889  27.004  1.00 22.30 ? 202 ASP A O   1 
ATOM   1542 C  CB  . ASP A 1 202 ? -16.595 15.581  28.962  1.00 30.52 ? 202 ASP A CB  1 
ATOM   1543 C  CG  . ASP A 1 202 ? -17.174 14.595  27.967  1.00 34.32 ? 202 ASP A CG  1 
ATOM   1544 O  OD1 . ASP A 1 202 ? -18.412 14.479  27.910  1.00 39.94 ? 202 ASP A OD1 1 
ATOM   1545 O  OD2 . ASP A 1 202 ? -16.401 13.939  27.236  1.00 38.81 ? 202 ASP A OD2 1 
ATOM   1546 N  N   . VAL A 1 203 ? -13.393 15.353  27.261  1.00 23.20 ? 203 VAL A N   1 
ATOM   1547 C  CA  . VAL A 1 203 ? -12.729 15.699  26.012  1.00 21.03 ? 203 VAL A CA  1 
ATOM   1548 C  C   . VAL A 1 203 ? -13.640 15.613  24.800  1.00 21.01 ? 203 VAL A C   1 
ATOM   1549 O  O   . VAL A 1 203 ? -13.397 16.278  23.803  1.00 21.90 ? 203 VAL A O   1 
ATOM   1550 C  CB  . VAL A 1 203 ? -11.501 14.804  25.774  1.00 23.32 ? 203 VAL A CB  1 
ATOM   1551 C  CG1 . VAL A 1 203 ? -10.492 15.008  26.895  1.00 21.27 ? 203 VAL A CG1 1 
ATOM   1552 C  CG2 . VAL A 1 203 ? -11.926 13.348  25.704  1.00 19.39 ? 203 VAL A CG2 1 
ATOM   1553 N  N   . ARG A 1 204 ? -14.689 14.804  24.885  1.00 22.45 ? 204 ARG A N   1 
ATOM   1554 C  CA  . ARG A 1 204 ? -15.613 14.649  23.765  1.00 26.84 ? 204 ARG A CA  1 
ATOM   1555 C  C   . ARG A 1 204 ? -16.353 15.927  23.400  1.00 27.08 ? 204 ARG A C   1 
ATOM   1556 O  O   . ARG A 1 204 ? -16.621 16.176  22.223  1.00 27.34 ? 204 ARG A O   1 
ATOM   1557 C  CB  . ARG A 1 204 ? -16.642 13.562  24.064  1.00 29.25 ? 204 ARG A CB  1 
ATOM   1558 C  CG  . ARG A 1 204 ? -16.059 12.184  24.243  1.00 33.95 ? 204 ARG A CG  1 
ATOM   1559 C  CD  . ARG A 1 204 ? -17.152 11.241  24.671  1.00 37.43 ? 204 ARG A CD  1 
ATOM   1560 N  NE  . ARG A 1 204 ? -17.856 11.789  25.822  1.00 45.29 ? 204 ARG A NE  1 
ATOM   1561 C  CZ  . ARG A 1 204 ? -18.851 11.179  26.450  1.00 49.03 ? 204 ARG A CZ  1 
ATOM   1562 N  NH1 . ARG A 1 204 ? -19.265 9.989   26.038  1.00 51.92 ? 204 ARG A NH1 1 
ATOM   1563 N  NH2 . ARG A 1 204 ? -19.441 11.767  27.481  1.00 51.07 ? 204 ARG A NH2 1 
ATOM   1564 N  N   . SER A 1 205 ? -16.691 16.735  24.401  1.00 27.67 ? 205 SER A N   1 
ATOM   1565 C  CA  . SER A 1 205 ? -17.416 17.974  24.141  1.00 31.62 ? 205 SER A CA  1 
ATOM   1566 C  C   . SER A 1 205 ? -16.488 19.147  23.855  1.00 30.97 ? 205 SER A C   1 
ATOM   1567 O  O   . SER A 1 205 ? -16.945 20.263  23.618  1.00 32.84 ? 205 SER A O   1 
ATOM   1568 C  CB  . SER A 1 205 ? -18.333 18.316  25.321  1.00 35.18 ? 205 SER A CB  1 
ATOM   1569 O  OG  . SER A 1 205 ? -17.590 18.529  26.509  1.00 39.29 ? 205 SER A OG  1 
ATOM   1570 N  N   . VAL A 1 206 ? -15.184 18.892  23.867  1.00 29.62 ? 206 VAL A N   1 
ATOM   1571 C  CA  . VAL A 1 206 ? -14.209 19.944  23.611  1.00 25.83 ? 206 VAL A CA  1 
ATOM   1572 C  C   . VAL A 1 206 ? -13.481 19.791  22.283  1.00 24.24 ? 206 VAL A C   1 
ATOM   1573 O  O   . VAL A 1 206 ? -13.300 20.763  21.556  1.00 23.52 ? 206 VAL A O   1 
ATOM   1574 C  CB  . VAL A 1 206 ? -13.141 19.999  24.722  1.00 27.44 ? 206 VAL A CB  1 
ATOM   1575 C  CG1 . VAL A 1 206 ? -12.054 20.998  24.352  1.00 30.02 ? 206 VAL A CG1 1 
ATOM   1576 C  CG2 . VAL A 1 206 ? -13.779 20.398  26.031  1.00 26.78 ? 206 VAL A CG2 1 
ATOM   1577 N  N   . LEU A 1 207 ? -13.067 18.569  21.972  1.00 22.24 ? 207 LEU A N   1 
ATOM   1578 C  CA  . LEU A 1 207 ? -12.315 18.299  20.756  1.00 17.56 ? 207 LEU A CA  1 
ATOM   1579 C  C   . LEU A 1 207 ? -12.983 17.313  19.812  1.00 18.89 ? 207 LEU A C   1 
ATOM   1580 O  O   . LEU A 1 207 ? -13.820 16.507  20.218  1.00 21.30 ? 207 LEU A O   1 
ATOM   1581 C  CB  . LEU A 1 207 ? -10.939 17.747  21.126  1.00 17.34 ? 207 LEU A CB  1 
ATOM   1582 C  CG  . LEU A 1 207 ? -10.007 18.634  21.954  1.00 18.12 ? 207 LEU A CG  1 
ATOM   1583 C  CD1 . LEU A 1 207 ? -8.839  17.807  22.453  1.00 17.54 ? 207 LEU A CD1 1 
ATOM   1584 C  CD2 . LEU A 1 207 ? -9.527  19.815  21.112  1.00 17.45 ? 207 LEU A CD2 1 
ATOM   1585 N  N   . PRO A 1 208 ? -12.621 17.375  18.526  1.00 17.65 ? 208 PRO A N   1 
ATOM   1586 C  CA  . PRO A 1 208 ? -13.178 16.473  17.523  1.00 19.55 ? 208 PRO A CA  1 
ATOM   1587 C  C   . PRO A 1 208 ? -12.639 15.079  17.835  1.00 20.23 ? 208 PRO A C   1 
ATOM   1588 O  O   . PRO A 1 208 ? -11.811 14.927  18.736  1.00 20.19 ? 208 PRO A O   1 
ATOM   1589 C  CB  . PRO A 1 208 ? -12.618 17.043  16.221  1.00 18.39 ? 208 PRO A CB  1 
ATOM   1590 C  CG  . PRO A 1 208 ? -11.258 17.549  16.674  1.00 18.50 ? 208 PRO A CG  1 
ATOM   1591 C  CD  . PRO A 1 208 ? -11.696 18.328  17.888  1.00 16.71 ? 208 PRO A CD  1 
ATOM   1592 N  N   . GLU A 1 209 ? -13.102 14.074  17.095  1.00 18.33 ? 209 GLU A N   1 
ATOM   1593 C  CA  . GLU A 1 209 ? -12.673 12.698  17.305  1.00 18.07 ? 209 GLU A CA  1 
ATOM   1594 C  C   . GLU A 1 209 ? -11.194 12.492  17.019  1.00 16.07 ? 209 GLU A C   1 
ATOM   1595 O  O   . GLU A 1 209 ? -10.527 11.733  17.723  1.00 14.79 ? 209 GLU A O   1 
ATOM   1596 C  CB  . GLU A 1 209 ? -13.487 11.753  16.426  1.00 22.98 ? 209 GLU A CB  1 
ATOM   1597 C  CG  . GLU A 1 209 ? -14.980 11.858  16.642  1.00 26.84 ? 209 GLU A CG  1 
ATOM   1598 C  CD  . GLU A 1 209 ? -15.743 10.853  15.816  1.00 32.10 ? 209 GLU A CD  1 
ATOM   1599 O  OE1 . GLU A 1 209 ? -15.638 9.642   16.108  1.00 29.14 ? 209 GLU A OE1 1 
ATOM   1600 O  OE2 . GLU A 1 209 ? -16.436 11.277  14.867  1.00 36.16 ? 209 GLU A OE2 1 
ATOM   1601 N  N   . TRP A 1 210 ? -10.694 13.150  15.976  1.00 11.66 ? 210 TRP A N   1 
ATOM   1602 C  CA  . TRP A 1 210 ? -9.290  13.039  15.609  1.00 13.37 ? 210 TRP A CA  1 
ATOM   1603 C  C   . TRP A 1 210 ? -8.567  14.350  15.880  1.00 16.70 ? 210 TRP A C   1 
ATOM   1604 O  O   . TRP A 1 210 ? -9.033  15.425  15.497  1.00 14.23 ? 210 TRP A O   1 
ATOM   1605 C  CB  . TRP A 1 210 ? -9.123  12.659  14.131  1.00 16.43 ? 210 TRP A CB  1 
ATOM   1606 C  CG  . TRP A 1 210 ? -9.610  11.273  13.767  1.00 19.29 ? 210 TRP A CG  1 
ATOM   1607 C  CD1 . TRP A 1 210 ? -10.894 10.897  13.474  1.00 18.76 ? 210 TRP A CD1 1 
ATOM   1608 C  CD2 . TRP A 1 210 ? -8.810  10.085  13.654  1.00 18.69 ? 210 TRP A CD2 1 
ATOM   1609 N  NE1 . TRP A 1 210 ? -10.940 9.555   13.180  1.00 18.43 ? 210 TRP A NE1 1 
ATOM   1610 C  CE2 . TRP A 1 210 ? -9.676  9.032   13.282  1.00 20.81 ? 210 TRP A CE2 1 
ATOM   1611 C  CE3 . TRP A 1 210 ? -7.445  9.810   13.828  1.00 20.11 ? 210 TRP A CE3 1 
ATOM   1612 C  CZ2 . TRP A 1 210 ? -9.221  7.721   13.081  1.00 21.79 ? 210 TRP A CZ2 1 
ATOM   1613 C  CZ3 . TRP A 1 210 ? -6.991  8.506   13.626  1.00 19.39 ? 210 TRP A CZ3 1 
ATOM   1614 C  CH2 . TRP A 1 210 ? -7.879  7.478   13.256  1.00 20.45 ? 210 TRP A CH2 1 
ATOM   1615 N  N   . VAL A 1 211 ? -7.408  14.256  16.518  1.00 14.90 ? 211 VAL A N   1 
ATOM   1616 C  CA  . VAL A 1 211 ? -6.652  15.449  16.866  1.00 15.70 ? 211 VAL A CA  1 
ATOM   1617 C  C   . VAL A 1 211 ? -5.161  15.278  16.620  1.00 15.11 ? 211 VAL A C   1 
ATOM   1618 O  O   . VAL A 1 211 ? -4.707  14.254  16.122  1.00 17.50 ? 211 VAL A O   1 
ATOM   1619 C  CB  . VAL A 1 211 ? -6.833  15.773  18.369  1.00 14.67 ? 211 VAL A CB  1 
ATOM   1620 C  CG1 . VAL A 1 211 ? -8.300  15.995  18.699  1.00 14.43 ? 211 VAL A CG1 1 
ATOM   1621 C  CG2 . VAL A 1 211 ? -6.296  14.618  19.201  1.00 11.65 ? 211 VAL A CG2 1 
ATOM   1622 N  N   . ARG A 1 212 ? -4.411  16.313  16.967  1.00 16.88 ? 212 ARG A N   1 
ATOM   1623 C  CA  . ARG A 1 212 ? -2.960  16.292  16.882  1.00 16.79 ? 212 ARG A CA  1 
ATOM   1624 C  C   . ARG A 1 212 ? -2.436  16.866  18.181  1.00 17.38 ? 212 ARG A C   1 
ATOM   1625 O  O   . ARG A 1 212 ? -3.017  17.795  18.742  1.00 16.53 ? 212 ARG A O   1 
ATOM   1626 C  CB  . ARG A 1 212 ? -2.444  17.101  15.696  1.00 18.58 ? 212 ARG A CB  1 
ATOM   1627 C  CG  . ARG A 1 212 ? -2.346  16.268  14.446  1.00 18.22 ? 212 ARG A CG  1 
ATOM   1628 C  CD  . ARG A 1 212 ? -1.841  17.052  13.271  1.00 18.47 ? 212 ARG A CD  1 
ATOM   1629 N  NE  . ARG A 1 212 ? -1.625  16.150  12.148  1.00 26.89 ? 212 ARG A NE  1 
ATOM   1630 C  CZ  . ARG A 1 212 ? -1.709  16.511  10.874  1.00 25.71 ? 212 ARG A CZ  1 
ATOM   1631 N  NH1 . ARG A 1 212 ? -2.009  17.763  10.563  1.00 23.98 ? 212 ARG A NH1 1 
ATOM   1632 N  NH2 . ARG A 1 212 ? -1.502  15.617  9.918   1.00 23.99 ? 212 ARG A NH2 1 
ATOM   1633 N  N   . VAL A 1 213 ? -1.346  16.289  18.666  1.00 15.72 ? 213 VAL A N   1 
ATOM   1634 C  CA  . VAL A 1 213 ? -0.737  16.719  19.908  1.00 13.12 ? 213 VAL A CA  1 
ATOM   1635 C  C   . VAL A 1 213 ? 0.611   17.365  19.624  1.00 14.60 ? 213 VAL A C   1 
ATOM   1636 O  O   . VAL A 1 213 ? 1.260   17.049  18.625  1.00 14.34 ? 213 VAL A O   1 
ATOM   1637 C  CB  . VAL A 1 213 ? -0.551  15.520  20.838  1.00 15.35 ? 213 VAL A CB  1 
ATOM   1638 C  CG1 . VAL A 1 213 ? -1.915  14.971  21.248  1.00 12.30 ? 213 VAL A CG1 1 
ATOM   1639 C  CG2 . VAL A 1 213 ? 0.247   14.433  20.113  1.00 12.72 ? 213 VAL A CG2 1 
ATOM   1640 N  N   . GLY A 1 214 ? 1.027   18.274  20.498  1.00 9.51  ? 214 GLY A N   1 
ATOM   1641 C  CA  . GLY A 1 214 ? 2.296   18.938  20.293  1.00 15.11 ? 214 GLY A CA  1 
ATOM   1642 C  C   . GLY A 1 214 ? 2.657   19.915  21.391  1.00 15.09 ? 214 GLY A C   1 
ATOM   1643 O  O   . GLY A 1 214 ? 2.145   19.835  22.503  1.00 12.94 ? 214 GLY A O   1 
ATOM   1644 N  N   . PHE A 1 215 ? 3.557   20.838  21.078  1.00 14.20 ? 215 PHE A N   1 
ATOM   1645 C  CA  . PHE A 1 215 ? 3.987   21.835  22.049  1.00 15.14 ? 215 PHE A CA  1 
ATOM   1646 C  C   . PHE A 1 215 ? 4.039   23.197  21.399  1.00 15.33 ? 215 PHE A C   1 
ATOM   1647 O  O   . PHE A 1 215 ? 4.188   23.312  20.187  1.00 15.03 ? 215 PHE A O   1 
ATOM   1648 C  CB  . PHE A 1 215 ? 5.380   21.505  22.597  1.00 12.97 ? 215 PHE A CB  1 
ATOM   1649 C  CG  . PHE A 1 215 ? 5.459   20.182  23.286  1.00 14.75 ? 215 PHE A CG  1 
ATOM   1650 C  CD1 . PHE A 1 215 ? 5.428   18.999  22.555  1.00 13.56 ? 215 PHE A CD1 1 
ATOM   1651 C  CD2 . PHE A 1 215 ? 5.527   20.115  24.676  1.00 14.95 ? 215 PHE A CD2 1 
ATOM   1652 C  CE1 . PHE A 1 215 ? 5.462   17.761  23.199  1.00 15.25 ? 215 PHE A CE1 1 
ATOM   1653 C  CE2 . PHE A 1 215 ? 5.562   18.882  25.331  1.00 17.05 ? 215 PHE A CE2 1 
ATOM   1654 C  CZ  . PHE A 1 215 ? 5.530   17.703  24.589  1.00 14.09 ? 215 PHE A CZ  1 
ATOM   1655 N  N   . SER A 1 216 ? 3.915   24.228  22.218  1.00 17.01 ? 216 SER A N   1 
ATOM   1656 C  CA  . SER A 1 216 ? 3.977   25.590  21.735  1.00 17.58 ? 216 SER A CA  1 
ATOM   1657 C  C   . SER A 1 216 ? 4.726   26.416  22.766  1.00 16.62 ? 216 SER A C   1 
ATOM   1658 O  O   . SER A 1 216 ? 4.694   26.116  23.954  1.00 16.70 ? 216 SER A O   1 
ATOM   1659 C  CB  . SER A 1 216 ? 2.571   26.150  21.540  1.00 20.04 ? 216 SER A CB  1 
ATOM   1660 O  OG  . SER A 1 216 ? 2.628   27.422  20.919  1.00 23.91 ? 216 SER A OG  1 
ATOM   1661 N  N   . ALA A 1 217 ? 5.422   27.439  22.304  1.00 15.57 ? 217 ALA A N   1 
ATOM   1662 C  CA  . ALA A 1 217 ? 6.162   28.312  23.195  1.00 17.12 ? 217 ALA A CA  1 
ATOM   1663 C  C   . ALA A 1 217 ? 6.205   29.665  22.524  1.00 20.10 ? 217 ALA A C   1 
ATOM   1664 O  O   . ALA A 1 217 ? 6.043   29.763  21.305  1.00 20.52 ? 217 ALA A O   1 
ATOM   1665 C  CB  . ALA A 1 217 ? 7.570   27.791  23.413  1.00 16.27 ? 217 ALA A CB  1 
ATOM   1666 N  N   . ALA A 1 218 ? 6.417   30.708  23.316  1.00 18.72 ? 218 ALA A N   1 
ATOM   1667 C  CA  . ALA A 1 218 ? 6.477   32.054  22.778  1.00 18.35 ? 218 ALA A CA  1 
ATOM   1668 C  C   . ALA A 1 218 ? 7.191   32.981  23.739  1.00 20.13 ? 218 ALA A C   1 
ATOM   1669 O  O   . ALA A 1 218 ? 7.300   32.698  24.934  1.00 21.24 ? 218 ALA A O   1 
ATOM   1670 C  CB  . ALA A 1 218 ? 5.067   32.571  22.508  1.00 16.93 ? 218 ALA A CB  1 
ATOM   1671 N  N   . SER A 1 219 ? 7.686   34.086  23.196  1.00 19.75 ? 219 SER A N   1 
ATOM   1672 C  CA  . SER A 1 219 ? 8.372   35.106  23.971  1.00 20.63 ? 219 SER A CA  1 
ATOM   1673 C  C   . SER A 1 219 ? 7.962   36.456  23.403  1.00 23.09 ? 219 SER A C   1 
ATOM   1674 O  O   . SER A 1 219 ? 8.049   36.673  22.194  1.00 24.26 ? 219 SER A O   1 
ATOM   1675 C  CB  . SER A 1 219 ? 9.889   34.950  23.864  1.00 19.05 ? 219 SER A CB  1 
ATOM   1676 O  OG  . SER A 1 219 ? 10.347  33.781  24.516  1.00 23.26 ? 219 SER A OG  1 
ATOM   1677 N  N   . GLY A 1 220 ? 7.491   37.348  24.269  1.00 22.86 ? 220 GLY A N   1 
ATOM   1678 C  CA  . GLY A 1 220 ? 7.094   38.672  23.826  1.00 22.87 ? 220 GLY A CA  1 
ATOM   1679 C  C   . GLY A 1 220 ? 8.299   39.580  23.970  1.00 24.91 ? 220 GLY A C   1 
ATOM   1680 O  O   . GLY A 1 220 ? 9.334   39.329  23.347  1.00 24.31 ? 220 GLY A O   1 
ATOM   1681 N  N   . GLU A 1 221 ? 8.184   40.626  24.786  1.00 25.83 ? 221 GLU A N   1 
ATOM   1682 C  CA  . GLU A 1 221 ? 9.312   41.523  24.993  1.00 25.57 ? 221 GLU A CA  1 
ATOM   1683 C  C   . GLU A 1 221 ? 10.319  40.905  25.944  1.00 24.75 ? 221 GLU A C   1 
ATOM   1684 O  O   . GLU A 1 221 ? 11.501  41.243  25.900  1.00 23.97 ? 221 GLU A O   1 
ATOM   1685 C  CB  . GLU A 1 221 ? 8.854   42.885  25.504  1.00 32.93 ? 221 GLU A CB  1 
ATOM   1686 C  CG  . GLU A 1 221 ? 8.182   43.723  24.429  1.00 39.87 ? 221 GLU A CG  1 
ATOM   1687 C  CD  . GLU A 1 221 ? 7.981   45.159  24.856  1.00 48.17 ? 221 GLU A CD  1 
ATOM   1688 O  OE1 . GLU A 1 221 ? 8.990   45.831  25.175  1.00 48.23 ? 221 GLU A OE1 1 
ATOM   1689 O  OE2 . GLU A 1 221 ? 6.817   45.613  24.871  1.00 54.04 ? 221 GLU A OE2 1 
ATOM   1690 N  N   . GLN A 1 222 ? 9.849   40.015  26.815  1.00 22.83 ? 222 GLN A N   1 
ATOM   1691 C  CA  . GLN A 1 222 ? 10.746  39.298  27.717  1.00 23.74 ? 222 GLN A CA  1 
ATOM   1692 C  C   . GLN A 1 222 ? 10.935  37.935  27.073  1.00 23.91 ? 222 GLN A C   1 
ATOM   1693 O  O   . GLN A 1 222 ? 10.024  37.423  26.418  1.00 23.88 ? 222 GLN A O   1 
ATOM   1694 C  CB  . GLN A 1 222 ? 10.172  39.177  29.130  1.00 23.70 ? 222 GLN A CB  1 
ATOM   1695 C  CG  . GLN A 1 222 ? 10.618  40.329  30.013  1.00 31.00 ? 222 GLN A CG  1 
ATOM   1696 C  CD  . GLN A 1 222 ? 10.127  41.653  29.496  1.00 32.09 ? 222 GLN A CD  1 
ATOM   1697 O  OE1 . GLN A 1 222 ? 10.726  42.695  29.743  1.00 33.41 ? 222 GLN A OE1 1 
ATOM   1698 N  NE2 . GLN A 1 222 ? 9.012   41.621  28.787  1.00 34.94 ? 222 GLN A NE2 1 
ATOM   1699 N  N   . TYR A 1 223 ? 12.111  37.350  27.258  1.00 22.74 ? 223 TYR A N   1 
ATOM   1700 C  CA  . TYR A 1 223 ? 12.432  36.092  26.606  1.00 21.73 ? 223 TYR A CA  1 
ATOM   1701 C  C   . TYR A 1 223 ? 13.185  35.065  27.430  1.00 21.83 ? 223 TYR A C   1 
ATOM   1702 O  O   . TYR A 1 223 ? 13.711  35.355  28.501  1.00 22.03 ? 223 TYR A O   1 
ATOM   1703 C  CB  . TYR A 1 223 ? 13.246  36.389  25.346  1.00 23.47 ? 223 TYR A CB  1 
ATOM   1704 C  CG  . TYR A 1 223 ? 14.270  37.486  25.569  1.00 27.55 ? 223 TYR A CG  1 
ATOM   1705 C  CD1 . TYR A 1 223 ? 13.912  38.831  25.463  1.00 28.90 ? 223 TYR A CD1 1 
ATOM   1706 C  CD2 . TYR A 1 223 ? 15.571  37.184  25.970  1.00 28.50 ? 223 TYR A CD2 1 
ATOM   1707 C  CE1 . TYR A 1 223 ? 14.821  39.845  25.755  1.00 30.74 ? 223 TYR A CE1 1 
ATOM   1708 C  CE2 . TYR A 1 223 ? 16.488  38.192  26.265  1.00 30.86 ? 223 TYR A CE2 1 
ATOM   1709 C  CZ  . TYR A 1 223 ? 16.105  39.520  26.157  1.00 32.54 ? 223 TYR A CZ  1 
ATOM   1710 O  OH  . TYR A 1 223 ? 16.998  40.521  26.466  1.00 36.04 ? 223 TYR A OH  1 
ATOM   1711 N  N   . GLN A 1 224 ? 13.238  33.859  26.879  1.00 19.94 ? 224 GLN A N   1 
ATOM   1712 C  CA  . GLN A 1 224 ? 13.913  32.720  27.480  1.00 19.36 ? 224 GLN A CA  1 
ATOM   1713 C  C   . GLN A 1 224 ? 13.812  31.630  26.431  1.00 18.56 ? 224 GLN A C   1 
ATOM   1714 O  O   . GLN A 1 224 ? 12.947  31.686  25.556  1.00 18.15 ? 224 GLN A O   1 
ATOM   1715 C  CB  . GLN A 1 224 ? 13.184  32.270  28.753  1.00 18.02 ? 224 GLN A CB  1 
ATOM   1716 C  CG  . GLN A 1 224 ? 11.743  31.814  28.500  1.00 19.77 ? 224 GLN A CG  1 
ATOM   1717 C  CD  . GLN A 1 224 ? 10.953  31.532  29.779  1.00 17.49 ? 224 GLN A CD  1 
ATOM   1718 O  OE1 . GLN A 1 224 ? 9.777   31.167  29.725  1.00 20.38 ? 224 GLN A OE1 1 
ATOM   1719 N  NE2 . GLN A 1 224 ? 11.590  31.706  30.924  1.00 14.46 ? 224 GLN A NE2 1 
ATOM   1720 N  N   . THR A 1 225 ? 14.699  30.649  26.502  1.00 15.33 ? 225 THR A N   1 
ATOM   1721 C  CA  . THR A 1 225 ? 14.641  29.544  25.562  1.00 18.91 ? 225 THR A CA  1 
ATOM   1722 C  C   . THR A 1 225 ? 13.600  28.561  26.091  1.00 21.53 ? 225 THR A C   1 
ATOM   1723 O  O   . THR A 1 225 ? 13.423  28.436  27.310  1.00 22.40 ? 225 THR A O   1 
ATOM   1724 C  CB  . THR A 1 225 ? 15.990  28.805  25.480  1.00 19.19 ? 225 THR A CB  1 
ATOM   1725 O  OG1 . THR A 1 225 ? 16.368  28.369  26.793  1.00 21.12 ? 225 THR A OG1 1 
ATOM   1726 C  CG2 . THR A 1 225 ? 17.068  29.715  24.921  1.00 24.50 ? 225 THR A CG2 1 
ATOM   1727 N  N   . HIS A 1 226 ? 12.897  27.885  25.186  1.00 17.64 ? 226 HIS A N   1 
ATOM   1728 C  CA  . HIS A 1 226 ? 11.917  26.879  25.586  1.00 17.79 ? 226 HIS A CA  1 
ATOM   1729 C  C   . HIS A 1 226 ? 12.382  25.599  24.906  1.00 17.55 ? 226 HIS A C   1 
ATOM   1730 O  O   . HIS A 1 226 ? 11.975  25.279  23.795  1.00 19.29 ? 226 HIS A O   1 
ATOM   1731 C  CB  . HIS A 1 226 ? 10.515  27.268  25.134  1.00 18.02 ? 226 HIS A CB  1 
ATOM   1732 C  CG  . HIS A 1 226 ? 10.069  28.604  25.641  1.00 21.34 ? 226 HIS A CG  1 
ATOM   1733 N  ND1 . HIS A 1 226 ? 10.460  29.791  25.059  1.00 22.79 ? 226 HIS A ND1 1 
ATOM   1734 C  CD2 . HIS A 1 226 ? 9.292   28.942  26.697  1.00 21.93 ? 226 HIS A CD2 1 
ATOM   1735 C  CE1 . HIS A 1 226 ? 9.939   30.802  25.732  1.00 21.96 ? 226 HIS A CE1 1 
ATOM   1736 N  NE2 . HIS A 1 226 ? 9.227   30.314  26.732  1.00 23.94 ? 226 HIS A NE2 1 
ATOM   1737 N  N   . THR A 1 227 ? 13.244  24.872  25.604  1.00 16.23 ? 227 THR A N   1 
ATOM   1738 C  CA  . THR A 1 227 ? 13.856  23.665  25.080  1.00 15.18 ? 227 THR A CA  1 
ATOM   1739 C  C   . THR A 1 227 ? 13.193  22.338  25.443  1.00 15.95 ? 227 THR A C   1 
ATOM   1740 O  O   . THR A 1 227 ? 13.262  21.899  26.590  1.00 18.40 ? 227 THR A O   1 
ATOM   1741 C  CB  . THR A 1 227 ? 15.336  23.633  25.519  1.00 15.04 ? 227 THR A CB  1 
ATOM   1742 O  OG1 . THR A 1 227 ? 15.947  24.879  25.157  1.00 18.02 ? 227 THR A OG1 1 
ATOM   1743 C  CG2 . THR A 1 227 ? 16.097  22.486  24.836  1.00 12.02 ? 227 THR A CG2 1 
ATOM   1744 N  N   . LEU A 1 228 ? 12.557  21.705  24.457  1.00 13.24 ? 228 LEU A N   1 
ATOM   1745 C  CA  . LEU A 1 228 ? 11.911  20.406  24.652  1.00 12.59 ? 228 LEU A CA  1 
ATOM   1746 C  C   . LEU A 1 228 ? 13.030  19.375  24.474  1.00 13.49 ? 228 LEU A C   1 
ATOM   1747 O  O   . LEU A 1 228 ? 13.639  19.292  23.406  1.00 12.85 ? 228 LEU A O   1 
ATOM   1748 C  CB  . LEU A 1 228 ? 10.830  20.177  23.590  1.00 15.98 ? 228 LEU A CB  1 
ATOM   1749 C  CG  . LEU A 1 228 ? 9.979   18.912  23.759  1.00 16.46 ? 228 LEU A CG  1 
ATOM   1750 C  CD1 . LEU A 1 228 ? 9.145   19.040  25.023  1.00 14.09 ? 228 LEU A CD1 1 
ATOM   1751 C  CD2 . LEU A 1 228 ? 9.068   18.728  22.553  1.00 16.10 ? 228 LEU A CD2 1 
ATOM   1752 N  N   . GLU A 1 229 ? 13.288  18.587  25.511  1.00 13.13 ? 229 GLU A N   1 
ATOM   1753 C  CA  . GLU A 1 229 ? 14.370  17.607  25.485  1.00 15.98 ? 229 GLU A CA  1 
ATOM   1754 C  C   . GLU A 1 229 ? 13.993  16.171  25.138  1.00 16.77 ? 229 GLU A C   1 
ATOM   1755 O  O   . GLU A 1 229 ? 14.771  15.470  24.502  1.00 18.71 ? 229 GLU A O   1 
ATOM   1756 C  CB  . GLU A 1 229 ? 15.085  17.637  26.834  1.00 14.56 ? 229 GLU A CB  1 
ATOM   1757 C  CG  . GLU A 1 229 ? 15.718  18.978  27.128  1.00 21.18 ? 229 GLU A CG  1 
ATOM   1758 C  CD  . GLU A 1 229 ? 15.982  19.193  28.603  1.00 25.94 ? 229 GLU A CD  1 
ATOM   1759 O  OE1 . GLU A 1 229 ? 16.629  20.202  28.945  1.00 32.82 ? 229 GLU A OE1 1 
ATOM   1760 O  OE2 . GLU A 1 229 ? 15.529  18.364  29.420  1.00 28.67 ? 229 GLU A OE2 1 
ATOM   1761 N  N   . SER A 1 230 ? 12.814  15.730  25.562  1.00 16.93 ? 230 SER A N   1 
ATOM   1762 C  CA  . SER A 1 230 ? 12.363  14.371  25.284  1.00 17.36 ? 230 SER A CA  1 
ATOM   1763 C  C   . SER A 1 230 ? 10.839  14.342  25.331  1.00 18.75 ? 230 SER A C   1 
ATOM   1764 O  O   . SER A 1 230 ? 10.212  15.213  25.935  1.00 18.93 ? 230 SER A O   1 
ATOM   1765 C  CB  . SER A 1 230 ? 12.931  13.404  26.314  1.00 15.06 ? 230 SER A CB  1 
ATOM   1766 O  OG  . SER A 1 230 ? 12.458  13.734  27.609  1.00 20.65 ? 230 SER A OG  1 
ATOM   1767 N  N   . TRP A 1 231 ? 10.247  13.332  24.708  1.00 15.34 ? 231 TRP A N   1 
ATOM   1768 C  CA  . TRP A 1 231 ? 8.797   13.233  24.659  1.00 12.61 ? 231 TRP A CA  1 
ATOM   1769 C  C   . TRP A 1 231 ? 8.323   11.846  24.250  1.00 12.58 ? 231 TRP A C   1 
ATOM   1770 O  O   . TRP A 1 231 ? 8.779   11.297  23.249  1.00 11.99 ? 231 TRP A O   1 
ATOM   1771 C  CB  . TRP A 1 231 ? 8.270   14.288  23.670  1.00 12.80 ? 231 TRP A CB  1 
ATOM   1772 C  CG  . TRP A 1 231 ? 6.781   14.286  23.406  1.00 9.23  ? 231 TRP A CG  1 
ATOM   1773 C  CD1 . TRP A 1 231 ? 5.782   14.070  24.315  1.00 12.15 ? 231 TRP A CD1 1 
ATOM   1774 C  CD2 . TRP A 1 231 ? 6.128   14.640  22.176  1.00 12.20 ? 231 TRP A CD2 1 
ATOM   1775 N  NE1 . TRP A 1 231 ? 4.551   14.271  23.731  1.00 6.06  ? 231 TRP A NE1 1 
ATOM   1776 C  CE2 . TRP A 1 231 ? 4.734   14.621  22.420  1.00 8.20  ? 231 TRP A CE2 1 
ATOM   1777 C  CE3 . TRP A 1 231 ? 6.586   14.974  20.892  1.00 11.55 ? 231 TRP A CE3 1 
ATOM   1778 C  CZ2 . TRP A 1 231 ? 3.795   14.922  21.428  1.00 13.01 ? 231 TRP A CZ2 1 
ATOM   1779 C  CZ3 . TRP A 1 231 ? 5.652   15.275  19.905  1.00 11.69 ? 231 TRP A CZ3 1 
ATOM   1780 C  CH2 . TRP A 1 231 ? 4.272   15.246  20.179  1.00 14.85 ? 231 TRP A CH2 1 
ATOM   1781 N  N   . SER A 1 232 ? 7.426   11.271  25.045  1.00 12.39 ? 232 SER A N   1 
ATOM   1782 C  CA  . SER A 1 232 ? 6.848   9.971   24.725  1.00 12.76 ? 232 SER A CA  1 
ATOM   1783 C  C   . SER A 1 232 ? 5.345   10.182  24.833  1.00 14.96 ? 232 SER A C   1 
ATOM   1784 O  O   . SER A 1 232 ? 4.880   10.981  25.645  1.00 14.97 ? 232 SER A O   1 
ATOM   1785 C  CB  . SER A 1 232 ? 7.290   8.898   25.712  1.00 11.16 ? 232 SER A CB  1 
ATOM   1786 O  OG  . SER A 1 232 ? 6.772   9.177   26.995  1.00 26.73 ? 232 SER A OG  1 
ATOM   1787 N  N   . PHE A 1 233 ? 4.587   9.476   24.008  1.00 15.09 ? 233 PHE A N   1 
ATOM   1788 C  CA  . PHE A 1 233 ? 3.144   9.620   24.006  1.00 14.41 ? 233 PHE A CA  1 
ATOM   1789 C  C   . PHE A 1 233 ? 2.495   8.299   23.673  1.00 15.61 ? 233 PHE A C   1 
ATOM   1790 O  O   . PHE A 1 233 ? 2.956   7.565   22.802  1.00 16.24 ? 233 PHE A O   1 
ATOM   1791 C  CB  . PHE A 1 233 ? 2.731   10.687  22.985  1.00 12.87 ? 233 PHE A CB  1 
ATOM   1792 C  CG  . PHE A 1 233 ? 1.245   10.900  22.885  1.00 15.89 ? 233 PHE A CG  1 
ATOM   1793 C  CD1 . PHE A 1 233 ? 0.458   10.075  22.081  1.00 15.31 ? 233 PHE A CD1 1 
ATOM   1794 C  CD2 . PHE A 1 233 ? 0.627   11.925  23.606  1.00 16.45 ? 233 PHE A CD2 1 
ATOM   1795 C  CE1 . PHE A 1 233 ? -0.926  10.269  21.992  1.00 18.95 ? 233 PHE A CE1 1 
ATOM   1796 C  CE2 . PHE A 1 233 ? -0.756  12.129  23.528  1.00 17.18 ? 233 PHE A CE2 1 
ATOM   1797 C  CZ  . PHE A 1 233 ? -1.535  11.299  22.718  1.00 19.58 ? 233 PHE A CZ  1 
ATOM   1798 N  N   . THR A 1 234 ? 1.423   7.992   24.379  1.00 12.77 ? 234 THR A N   1 
ATOM   1799 C  CA  . THR A 1 234 ? 0.715   6.760   24.137  1.00 17.91 ? 234 THR A CA  1 
ATOM   1800 C  C   . THR A 1 234 ? -0.769  7.032   24.294  1.00 18.43 ? 234 THR A C   1 
ATOM   1801 O  O   . THR A 1 234 ? -1.185  7.813   25.153  1.00 18.92 ? 234 THR A O   1 
ATOM   1802 C  CB  . THR A 1 234 ? 1.180   5.658   25.114  1.00 18.92 ? 234 THR A CB  1 
ATOM   1803 O  OG1 . THR A 1 234 ? 0.432   4.460   24.874  1.00 25.49 ? 234 THR A OG1 1 
ATOM   1804 C  CG2 . THR A 1 234 ? 0.982   6.099   26.550  1.00 23.28 ? 234 THR A CG2 1 
ATOM   1805 N  N   . SER A 1 235 ? -1.565  6.403   23.444  1.00 16.81 ? 235 SER A N   1 
ATOM   1806 C  CA  . SER A 1 235 ? -3.005  6.581   23.489  1.00 16.84 ? 235 SER A CA  1 
ATOM   1807 C  C   . SER A 1 235 ? -3.713  5.285   23.120  1.00 17.68 ? 235 SER A C   1 
ATOM   1808 O  O   . SER A 1 235 ? -3.300  4.588   22.191  1.00 18.28 ? 235 SER A O   1 
ATOM   1809 C  CB  . SER A 1 235 ? -3.420  7.687   22.529  1.00 17.51 ? 235 SER A CB  1 
ATOM   1810 O  OG  . SER A 1 235 ? -4.817  7.845   22.555  1.00 21.02 ? 235 SER A OG  1 
ATOM   1811 N  N   . THR A 1 236 ? -4.775  4.966   23.852  1.00 14.65 ? 236 THR A N   1 
ATOM   1812 C  CA  . THR A 1 236 ? -5.534  3.746   23.606  1.00 16.35 ? 236 THR A CA  1 
ATOM   1813 C  C   . THR A 1 236 ? -7.024  4.008   23.790  1.00 16.27 ? 236 THR A C   1 
ATOM   1814 O  O   . THR A 1 236 ? -7.437  4.498   24.842  1.00 18.07 ? 236 THR A O   1 
ATOM   1815 C  CB  . THR A 1 236 ? -5.157  2.628   24.604  1.00 16.58 ? 236 THR A CB  1 
ATOM   1816 O  OG1 . THR A 1 236 ? -3.737  2.457   24.640  1.00 22.05 ? 236 THR A OG1 1 
ATOM   1817 C  CG2 . THR A 1 236 ? -5.800  1.320   24.185  1.00 18.27 ? 236 THR A CG2 1 
ATOM   1818 N  N   . LEU A 1 237 ? -7.827  3.688   22.779  1.00 14.08 ? 237 LEU A N   1 
ATOM   1819 C  CA  . LEU A 1 237 ? -9.275  3.857   22.882  1.00 15.47 ? 237 LEU A CA  1 
ATOM   1820 C  C   . LEU A 1 237 ? -9.847  2.814   23.844  1.00 19.17 ? 237 LEU A C   1 
ATOM   1821 O  O   . LEU A 1 237 ? -9.500  1.638   23.767  1.00 19.94 ? 237 LEU A O   1 
ATOM   1822 C  CB  . LEU A 1 237 ? -9.933  3.700   21.513  1.00 14.14 ? 237 LEU A CB  1 
ATOM   1823 C  CG  . LEU A 1 237 ? -9.897  4.913   20.586  1.00 18.19 ? 237 LEU A CG  1 
ATOM   1824 C  CD1 . LEU A 1 237 ? -10.510 4.563   19.239  1.00 14.95 ? 237 LEU A CD1 1 
ATOM   1825 C  CD2 . LEU A 1 237 ? -10.676 6.056   21.241  1.00 16.77 ? 237 LEU A CD2 1 
ATOM   1826 N  N   . LEU A 1 238 ? -10.727 3.243   24.743  1.00 21.71 ? 238 LEU A N   1 
ATOM   1827 C  CA  . LEU A 1 238 ? -11.325 2.333   25.717  1.00 25.62 ? 238 LEU A CA  1 
ATOM   1828 C  C   . LEU A 1 238 ? -12.827 2.511   25.939  1.00 28.06 ? 238 LEU A C   1 
ATOM   1829 O  O   . LEU A 1 238 ? -13.361 3.612   25.819  1.00 24.33 ? 238 LEU A O   1 
ATOM   1830 C  CB  . LEU A 1 238 ? -10.623 2.482   27.072  1.00 25.37 ? 238 LEU A CB  1 
ATOM   1831 C  CG  . LEU A 1 238 ? -9.149  2.095   27.189  1.00 25.11 ? 238 LEU A CG  1 
ATOM   1832 C  CD1 . LEU A 1 238 ? -8.643  2.446   28.580  1.00 25.53 ? 238 LEU A CD1 1 
ATOM   1833 C  CD2 . LEU A 1 238 ? -8.987  0.610   26.917  1.00 21.26 ? 238 LEU A CD2 1 
ATOM   1834 N  N   . TYR A 1 239 ? -13.497 1.404   26.253  1.00 33.93 ? 239 TYR A N   1 
ATOM   1835 C  CA  . TYR A 1 239 ? -14.923 1.405   26.566  1.00 40.37 ? 239 TYR A CA  1 
ATOM   1836 C  C   . TYR A 1 239 ? -14.910 1.692   28.060  1.00 42.22 ? 239 TYR A C   1 
ATOM   1837 O  O   . TYR A 1 239 ? -14.275 0.965   28.823  1.00 44.29 ? 239 TYR A O   1 
ATOM   1838 C  CB  . TYR A 1 239 ? -15.541 0.020   26.333  1.00 45.25 ? 239 TYR A CB  1 
ATOM   1839 C  CG  . TYR A 1 239 ? -15.654 -0.407  24.884  1.00 52.85 ? 239 TYR A CG  1 
ATOM   1840 C  CD1 . TYR A 1 239 ? -16.687 0.067   24.070  1.00 54.65 ? 239 TYR A CD1 1 
ATOM   1841 C  CD2 . TYR A 1 239 ? -14.718 -1.274  24.321  1.00 54.69 ? 239 TYR A CD2 1 
ATOM   1842 C  CE1 . TYR A 1 239 ? -16.781 -0.316  22.727  1.00 54.84 ? 239 TYR A CE1 1 
ATOM   1843 C  CE2 . TYR A 1 239 ? -14.801 -1.660  22.984  1.00 57.26 ? 239 TYR A CE2 1 
ATOM   1844 C  CZ  . TYR A 1 239 ? -15.832 -1.179  22.193  1.00 56.53 ? 239 TYR A CZ  1 
ATOM   1845 O  OH  . TYR A 1 239 ? -15.898 -1.556  20.870  1.00 58.73 ? 239 TYR A OH  1 
ATOM   1846 N  N   . THR A 1 240 ? -15.594 2.744   28.485  1.00 45.06 ? 240 THR A N   1 
ATOM   1847 C  CA  . THR A 1 240 ? -15.601 3.084   29.900  1.00 50.02 ? 240 THR A CA  1 
ATOM   1848 C  C   . THR A 1 240 ? -16.909 2.738   30.611  1.00 52.02 ? 240 THR A C   1 
ATOM   1849 O  O   . THR A 1 240 ? -17.935 2.505   29.971  1.00 50.39 ? 240 THR A O   1 
ATOM   1850 C  CB  . THR A 1 240 ? -15.300 4.580   30.094  1.00 51.77 ? 240 THR A CB  1 
ATOM   1851 O  OG1 . THR A 1 240 ? -15.340 4.896   31.490  1.00 58.19 ? 240 THR A OG1 1 
ATOM   1852 C  CG2 . THR A 1 240 ? -16.315 5.432   29.339  1.00 51.91 ? 240 THR A CG2 1 
ATOM   1853 N  N   . ALA A 1 241 ? -16.853 2.705   31.941  1.00 54.72 ? 241 ALA A N   1 
ATOM   1854 C  CA  . ALA A 1 241 ? -18.008 2.394   32.782  1.00 56.74 ? 241 ALA A CA  1 
ATOM   1855 C  C   . ALA A 1 241 ? -19.335 2.782   32.134  1.00 57.81 ? 241 ALA A C   1 
ATOM   1856 O  O   . ALA A 1 241 ? -19.480 3.978   31.800  1.00 60.26 ? 241 ALA A O   1 
ATOM   1857 C  CB  . ALA A 1 241 ? -17.865 3.093   34.130  1.00 57.12 ? 241 ALA A CB  1 
ATOM   1858 N  N   . GLN B 1 1   ? 11.034  9.573   15.777  1.00 16.20 ? 1   GLN B N   1 
ATOM   1859 C  CA  . GLN B 1 1   ? 10.966  8.814   17.063  1.00 16.07 ? 1   GLN B CA  1 
ATOM   1860 C  C   . GLN B 1 1   ? 11.755  7.521   16.996  1.00 18.19 ? 1   GLN B C   1 
ATOM   1861 O  O   . GLN B 1 1   ? 11.774  6.852   15.966  1.00 18.95 ? 1   GLN B O   1 
ATOM   1862 C  CB  . GLN B 1 1   ? 9.501   8.522   17.336  1.00 17.10 ? 1   GLN B CB  1 
ATOM   1863 C  CG  . GLN B 1 1   ? 8.799   8.688   16.035  1.00 16.48 ? 1   GLN B CG  1 
ATOM   1864 C  CD  . GLN B 1 1   ? 9.663   9.572   15.168  1.00 16.90 ? 1   GLN B CD  1 
ATOM   1865 O  OE1 . GLN B 1 1   ? 9.284   9.937   14.063  1.00 19.71 ? 1   GLN B OE1 1 
ATOM   1866 N  N   . ASP B 1 2   ? 12.409  7.177   18.101  1.00 16.03 ? 2   ASP B N   1 
ATOM   1867 C  CA  . ASP B 1 2   ? 13.183  5.949   18.178  1.00 16.63 ? 2   ASP B CA  1 
ATOM   1868 C  C   . ASP B 1 2   ? 12.247  4.756   18.205  1.00 18.18 ? 2   ASP B C   1 
ATOM   1869 O  O   . ASP B 1 2   ? 12.573  3.684   17.692  1.00 18.60 ? 2   ASP B O   1 
ATOM   1870 C  CB  . ASP B 1 2   ? 14.044  5.946   19.437  1.00 15.48 ? 2   ASP B CB  1 
ATOM   1871 C  CG  . ASP B 1 2   ? 15.205  6.908   19.347  1.00 16.19 ? 2   ASP B CG  1 
ATOM   1872 O  OD1 . ASP B 1 2   ? 15.251  7.707   18.392  1.00 16.30 ? 2   ASP B OD1 1 
ATOM   1873 O  OD2 . ASP B 1 2   ? 16.072  6.864   20.238  1.00 18.40 ? 2   ASP B OD2 1 
ATOM   1874 N  N   . SER B 1 3   ? 11.086  4.946   18.822  1.00 16.27 ? 3   SER B N   1 
ATOM   1875 C  CA  . SER B 1 3   ? 10.090  3.890   18.920  1.00 17.15 ? 3   SER B CA  1 
ATOM   1876 C  C   . SER B 1 3   ? 8.733   4.358   18.393  1.00 15.94 ? 3   SER B C   1 
ATOM   1877 O  O   . SER B 1 3   ? 8.330   5.504   18.584  1.00 12.62 ? 3   SER B O   1 
ATOM   1878 C  CB  . SER B 1 3   ? 9.966   3.421   20.370  1.00 16.33 ? 3   SER B CB  1 
ATOM   1879 O  OG  . SER B 1 3   ? 9.681   4.507   21.227  1.00 23.91 ? 3   SER B OG  1 
ATOM   1880 N  N   . LEU B 1 4   ? 8.036   3.459   17.711  1.00 17.29 ? 4   LEU B N   1 
ATOM   1881 C  CA  . LEU B 1 4   ? 6.738   3.774   17.140  1.00 15.48 ? 4   LEU B CA  1 
ATOM   1882 C  C   . LEU B 1 4   ? 5.882   2.533   17.212  1.00 16.74 ? 4   LEU B C   1 
ATOM   1883 O  O   . LEU B 1 4   ? 6.365   1.424   17.001  1.00 20.24 ? 4   LEU B O   1 
ATOM   1884 C  CB  . LEU B 1 4   ? 6.889   4.197   15.681  1.00 16.21 ? 4   LEU B CB  1 
ATOM   1885 C  CG  . LEU B 1 4   ? 5.598   4.487   14.913  1.00 19.31 ? 4   LEU B CG  1 
ATOM   1886 C  CD1 . LEU B 1 4   ? 4.847   5.637   15.557  1.00 18.88 ? 4   LEU B CD1 1 
ATOM   1887 C  CD2 . LEU B 1 4   ? 5.943   4.832   13.479  1.00 24.12 ? 4   LEU B CD2 1 
ATOM   1888 N  N   . SER B 1 5   ? 4.606   2.717   17.506  1.00 15.69 ? 5   SER B N   1 
ATOM   1889 C  CA  . SER B 1 5   ? 3.700   1.590   17.598  1.00 16.80 ? 5   SER B CA  1 
ATOM   1890 C  C   . SER B 1 5   ? 2.266   2.000   17.319  1.00 14.85 ? 5   SER B C   1 
ATOM   1891 O  O   . SER B 1 5   ? 1.858   3.118   17.627  1.00 12.87 ? 5   SER B O   1 
ATOM   1892 C  CB  . SER B 1 5   ? 3.792   0.967   18.990  1.00 18.14 ? 5   SER B CB  1 
ATOM   1893 O  OG  . SER B 1 5   ? 2.867   -0.091  19.118  1.00 30.26 ? 5   SER B OG  1 
ATOM   1894 N  N   . PHE B 1 6   ? 1.504   1.090   16.727  1.00 13.22 ? 6   PHE B N   1 
ATOM   1895 C  CA  . PHE B 1 6   ? 0.102   1.347   16.436  1.00 12.15 ? 6   PHE B CA  1 
ATOM   1896 C  C   . PHE B 1 6   ? -0.610  0.027   16.223  1.00 12.51 ? 6   PHE B C   1 
ATOM   1897 O  O   . PHE B 1 6   ? 0.006   -0.965  15.835  1.00 10.28 ? 6   PHE B O   1 
ATOM   1898 C  CB  . PHE B 1 6   ? -0.047  2.265   15.213  1.00 10.47 ? 6   PHE B CB  1 
ATOM   1899 C  CG  . PHE B 1 6   ? 0.584   1.730   13.951  1.00 12.79 ? 6   PHE B CG  1 
ATOM   1900 C  CD1 . PHE B 1 6   ? -0.010  0.696   13.234  1.00 13.10 ? 6   PHE B CD1 1 
ATOM   1901 C  CD2 . PHE B 1 6   ? 1.773   2.273   13.476  1.00 15.35 ? 6   PHE B CD2 1 
ATOM   1902 C  CE1 . PHE B 1 6   ? 0.571   0.213   12.058  1.00 13.66 ? 6   PHE B CE1 1 
ATOM   1903 C  CE2 . PHE B 1 6   ? 2.364   1.795   12.300  1.00 14.84 ? 6   PHE B CE2 1 
ATOM   1904 C  CZ  . PHE B 1 6   ? 1.759   0.765   11.592  1.00 13.51 ? 6   PHE B CZ  1 
ATOM   1905 N  N   . GLY B 1 7   ? -1.906  0.013   16.507  1.00 12.23 ? 7   GLY B N   1 
ATOM   1906 C  CA  . GLY B 1 7   ? -2.668  -1.205  16.340  1.00 13.79 ? 7   GLY B CA  1 
ATOM   1907 C  C   . GLY B 1 7   ? -4.041  -0.966  15.751  1.00 15.17 ? 7   GLY B C   1 
ATOM   1908 O  O   . GLY B 1 7   ? -4.734  -0.019  16.129  1.00 13.33 ? 7   GLY B O   1 
ATOM   1909 N  N   . PHE B 1 8   ? -4.417  -1.816  14.799  1.00 14.75 ? 8   PHE B N   1 
ATOM   1910 C  CA  . PHE B 1 8   ? -5.726  -1.747  14.166  1.00 14.01 ? 8   PHE B CA  1 
ATOM   1911 C  C   . PHE B 1 8   ? -6.466  -3.053  14.445  1.00 16.46 ? 8   PHE B C   1 
ATOM   1912 O  O   . PHE B 1 8   ? -6.355  -4.001  13.669  1.00 18.36 ? 8   PHE B O   1 
ATOM   1913 C  CB  . PHE B 1 8   ? -5.636  -1.603  12.639  1.00 12.76 ? 8   PHE B CB  1 
ATOM   1914 C  CG  . PHE B 1 8   ? -5.060  -0.303  12.161  1.00 15.96 ? 8   PHE B CG  1 
ATOM   1915 C  CD1 . PHE B 1 8   ? -3.687  -0.139  12.025  1.00 13.02 ? 8   PHE B CD1 1 
ATOM   1916 C  CD2 . PHE B 1 8   ? -5.901  0.743   11.796  1.00 13.54 ? 8   PHE B CD2 1 
ATOM   1917 C  CE1 . PHE B 1 8   ? -3.159  1.048   11.524  1.00 14.00 ? 8   PHE B CE1 1 
ATOM   1918 C  CE2 . PHE B 1 8   ? -5.385  1.932   11.297  1.00 13.52 ? 8   PHE B CE2 1 
ATOM   1919 C  CZ  . PHE B 1 8   ? -4.010  2.084   11.160  1.00 13.74 ? 8   PHE B CZ  1 
ATOM   1920 N  N   . PRO B 1 9   ? -7.205  -3.139  15.562  1.00 15.37 ? 9   PRO B N   1 
ATOM   1921 C  CA  . PRO B 1 9   ? -7.918  -4.395  15.809  1.00 15.31 ? 9   PRO B CA  1 
ATOM   1922 C  C   . PRO B 1 9   ? -8.896  -4.624  14.656  1.00 15.12 ? 9   PRO B C   1 
ATOM   1923 O  O   . PRO B 1 9   ? -9.189  -5.758  14.292  1.00 15.13 ? 9   PRO B O   1 
ATOM   1924 C  CB  . PRO B 1 9   ? -8.611  -4.128  17.145  1.00 15.80 ? 9   PRO B CB  1 
ATOM   1925 C  CG  . PRO B 1 9   ? -7.637  -3.167  17.817  1.00 15.14 ? 9   PRO B CG  1 
ATOM   1926 C  CD  . PRO B 1 9   ? -7.440  -2.201  16.668  1.00 14.60 ? 9   PRO B CD  1 
ATOM   1927 N  N   . THR B 1 10  ? -9.394  -3.525  14.094  1.00 14.33 ? 10  THR B N   1 
ATOM   1928 C  CA  . THR B 1 10  ? -10.300 -3.553  12.947  1.00 15.28 ? 10  THR B CA  1 
ATOM   1929 C  C   . THR B 1 10  ? -10.006 -2.282  12.166  1.00 15.03 ? 10  THR B C   1 
ATOM   1930 O  O   . THR B 1 10  ? -9.207  -1.456  12.604  1.00 14.34 ? 10  THR B O   1 
ATOM   1931 C  CB  . THR B 1 10  ? -11.798 -3.534  13.337  1.00 17.38 ? 10  THR B CB  1 
ATOM   1932 O  OG1 . THR B 1 10  ? -12.123 -2.277  13.930  1.00 21.73 ? 10  THR B OG1 1 
ATOM   1933 C  CG2 . THR B 1 10  ? -12.121 -4.653  14.309  1.00 18.29 ? 10  THR B CG2 1 
ATOM   1934 N  N   . PHE B 1 11  ? -10.648 -2.127  11.012  1.00 17.62 ? 11  PHE B N   1 
ATOM   1935 C  CA  . PHE B 1 11  ? -10.444 -0.960  10.167  1.00 17.64 ? 11  PHE B CA  1 
ATOM   1936 C  C   . PHE B 1 11  ? -11.724 -0.182  9.878   1.00 22.86 ? 11  PHE B C   1 
ATOM   1937 O  O   . PHE B 1 11  ? -12.357 -0.380  8.837   1.00 21.65 ? 11  PHE B O   1 
ATOM   1938 C  CB  . PHE B 1 11  ? -9.814  -1.381  8.838   1.00 17.11 ? 11  PHE B CB  1 
ATOM   1939 C  CG  . PHE B 1 11  ? -8.375  -1.796  8.949   1.00 15.23 ? 11  PHE B CG  1 
ATOM   1940 C  CD1 . PHE B 1 11  ? -7.367  -0.839  9.020   1.00 11.43 ? 11  PHE B CD1 1 
ATOM   1941 C  CD2 . PHE B 1 11  ? -8.024  -3.144  8.982   1.00 14.42 ? 11  PHE B CD2 1 
ATOM   1942 C  CE1 . PHE B 1 11  ? -6.031  -1.215  9.117   1.00 10.83 ? 11  PHE B CE1 1 
ATOM   1943 C  CE2 . PHE B 1 11  ? -6.685  -3.535  9.082   1.00 11.98 ? 11  PHE B CE2 1 
ATOM   1944 C  CZ  . PHE B 1 11  ? -5.687  -2.566  9.149   1.00 11.67 ? 11  PHE B CZ  1 
ATOM   1945 N  N   . PRO B 1 12  ? -12.130 0.705   10.800  1.00 21.93 ? 12  PRO B N   1 
ATOM   1946 C  CA  . PRO B 1 12  ? -13.340 1.503   10.593  1.00 23.73 ? 12  PRO B CA  1 
ATOM   1947 C  C   . PRO B 1 12  ? -13.098 2.352   9.347   1.00 26.54 ? 12  PRO B C   1 
ATOM   1948 O  O   . PRO B 1 12  ? -11.956 2.685   9.041   1.00 28.07 ? 12  PRO B O   1 
ATOM   1949 C  CB  . PRO B 1 12  ? -13.404 2.341   11.867  1.00 24.12 ? 12  PRO B CB  1 
ATOM   1950 C  CG  . PRO B 1 12  ? -12.760 1.411   12.891  1.00 24.94 ? 12  PRO B CG  1 
ATOM   1951 C  CD  . PRO B 1 12  ? -11.528 1.036   12.101  1.00 23.75 ? 12  PRO B CD  1 
ATOM   1952 N  N   . SER B 1 13  ? -14.158 2.705   8.629   1.00 28.28 ? 13  SER B N   1 
ATOM   1953 C  CA  . SER B 1 13  ? -14.007 3.495   7.409   1.00 30.57 ? 13  SER B CA  1 
ATOM   1954 C  C   . SER B 1 13  ? -13.414 4.880   7.650   1.00 31.02 ? 13  SER B C   1 
ATOM   1955 O  O   . SER B 1 13  ? -12.821 5.478   6.754   1.00 34.37 ? 13  SER B O   1 
ATOM   1956 C  CB  . SER B 1 13  ? -15.357 3.640   6.712   1.00 30.60 ? 13  SER B CB  1 
ATOM   1957 O  OG  . SER B 1 13  ? -16.283 4.293   7.558   1.00 36.71 ? 13  SER B OG  1 
ATOM   1958 N  N   . ASP B 1 14  ? -13.571 5.388   8.862   1.00 30.26 ? 14  ASP B N   1 
ATOM   1959 C  CA  . ASP B 1 14  ? -13.057 6.706   9.199   1.00 32.88 ? 14  ASP B CA  1 
ATOM   1960 C  C   . ASP B 1 14  ? -11.556 6.634   9.492   1.00 32.33 ? 14  ASP B C   1 
ATOM   1961 O  O   . ASP B 1 14  ? -11.144 6.573   10.647  1.00 37.60 ? 14  ASP B O   1 
ATOM   1962 C  CB  . ASP B 1 14  ? -13.831 7.241   10.409  1.00 35.80 ? 14  ASP B CB  1 
ATOM   1963 C  CG  . ASP B 1 14  ? -13.453 8.660   10.768  1.00 41.57 ? 14  ASP B CG  1 
ATOM   1964 O  OD1 . ASP B 1 14  ? -13.444 9.521   9.861   1.00 42.13 ? 14  ASP B OD1 1 
ATOM   1965 O  OD2 . ASP B 1 14  ? -13.184 8.915   11.964  1.00 42.79 ? 14  ASP B OD2 1 
ATOM   1966 N  N   . GLN B 1 15  ? -10.744 6.635   8.437   1.00 29.20 ? 15  GLN B N   1 
ATOM   1967 C  CA  . GLN B 1 15  ? -9.288  6.552   8.576   1.00 24.48 ? 15  GLN B CA  1 
ATOM   1968 C  C   . GLN B 1 15  ? -8.564  7.858   8.284   1.00 21.25 ? 15  GLN B C   1 
ATOM   1969 O  O   . GLN B 1 15  ? -8.949  8.602   7.386   1.00 22.20 ? 15  GLN B O   1 
ATOM   1970 C  CB  . GLN B 1 15  ? -8.730  5.466   7.655   1.00 24.97 ? 15  GLN B CB  1 
ATOM   1971 C  CG  . GLN B 1 15  ? -9.098  4.057   8.055   1.00 24.95 ? 15  GLN B CG  1 
ATOM   1972 C  CD  . GLN B 1 15  ? -8.704  3.764   9.480   1.00 25.83 ? 15  GLN B CD  1 
ATOM   1973 O  OE1 . GLN B 1 15  ? -7.588  4.060   9.896   1.00 30.90 ? 15  GLN B OE1 1 
ATOM   1974 N  NE2 . GLN B 1 15  ? -9.611  3.169   10.236  1.00 27.88 ? 15  GLN B NE2 1 
ATOM   1975 N  N   . LYS B 1 16  ? -7.497  8.123   9.031   1.00 18.27 ? 16  LYS B N   1 
ATOM   1976 C  CA  . LYS B 1 16  ? -6.729  9.349   8.843   1.00 17.16 ? 16  LYS B CA  1 
ATOM   1977 C  C   . LYS B 1 16  ? -5.241  9.111   8.615   1.00 17.25 ? 16  LYS B C   1 
ATOM   1978 O  O   . LYS B 1 16  ? -4.591  9.896   7.935   1.00 16.53 ? 16  LYS B O   1 
ATOM   1979 C  CB  . LYS B 1 16  ? -6.885  10.270  10.060  1.00 19.81 ? 16  LYS B CB  1 
ATOM   1980 C  CG  . LYS B 1 16  ? -8.303  10.741  10.346  1.00 24.65 ? 16  LYS B CG  1 
ATOM   1981 C  CD  . LYS B 1 16  ? -8.843  11.647  9.255   1.00 22.79 ? 16  LYS B CD  1 
ATOM   1982 C  CE  . LYS B 1 16  ? -10.266 12.087  9.584   1.00 31.72 ? 16  LYS B CE  1 
ATOM   1983 N  NZ  . LYS B 1 16  ? -10.849 12.983  8.542   1.00 36.81 ? 16  LYS B NZ  1 
ATOM   1984 N  N   . ASN B 1 17  ? -4.699  8.034   9.175   1.00 15.87 ? 17  ASN B N   1 
ATOM   1985 C  CA  . ASN B 1 17  ? -3.271  7.775   9.040   1.00 16.19 ? 17  ASN B CA  1 
ATOM   1986 C  C   . ASN B 1 17  ? -2.860  6.724   8.023   1.00 17.43 ? 17  ASN B C   1 
ATOM   1987 O  O   . ASN B 1 17  ? -1.720  6.262   8.038   1.00 19.49 ? 17  ASN B O   1 
ATOM   1988 C  CB  . ASN B 1 17  ? -2.671  7.421   10.406  1.00 17.29 ? 17  ASN B CB  1 
ATOM   1989 C  CG  . ASN B 1 17  ? -2.824  8.546   11.415  1.00 19.03 ? 17  ASN B CG  1 
ATOM   1990 O  OD1 . ASN B 1 17  ? -2.478  9.695   11.133  1.00 13.84 ? 17  ASN B OD1 1 
ATOM   1991 N  ND2 . ASN B 1 17  ? -3.331  8.221   12.598  1.00 16.06 ? 17  ASN B ND2 1 
ATOM   1992 N  N   . LEU B 1 18  ? -3.778  6.341   7.143   1.00 14.97 ? 18  LEU B N   1 
ATOM   1993 C  CA  . LEU B 1 18  ? -3.457  5.362   6.115   1.00 14.72 ? 18  LEU B CA  1 
ATOM   1994 C  C   . LEU B 1 18  ? -3.326  6.033   4.763   1.00 13.90 ? 18  LEU B C   1 
ATOM   1995 O  O   . LEU B 1 18  ? -4.074  6.951   4.441   1.00 15.82 ? 18  LEU B O   1 
ATOM   1996 C  CB  . LEU B 1 18  ? -4.535  4.282   6.019   1.00 10.94 ? 18  LEU B CB  1 
ATOM   1997 C  CG  . LEU B 1 18  ? -4.657  3.310   7.186   1.00 16.72 ? 18  LEU B CG  1 
ATOM   1998 C  CD1 . LEU B 1 18  ? -5.803  2.349   6.925   1.00 13.82 ? 18  LEU B CD1 1 
ATOM   1999 C  CD2 . LEU B 1 18  ? -3.345  2.548   7.353   1.00 15.54 ? 18  LEU B CD2 1 
ATOM   2000 N  N   . ILE B 1 19  ? -2.350  5.582   3.986   1.00 15.78 ? 19  ILE B N   1 
ATOM   2001 C  CA  . ILE B 1 19  ? -2.141  6.093   2.641   1.00 16.24 ? 19  ILE B CA  1 
ATOM   2002 C  C   . ILE B 1 19  ? -2.687  4.995   1.737   1.00 17.62 ? 19  ILE B C   1 
ATOM   2003 O  O   . ILE B 1 19  ? -2.177  3.875   1.727   1.00 19.30 ? 19  ILE B O   1 
ATOM   2004 C  CB  . ILE B 1 19  ? -0.641  6.311   2.325   1.00 17.51 ? 19  ILE B CB  1 
ATOM   2005 C  CG1 . ILE B 1 19  ? -0.060  7.380   3.252   1.00 17.30 ? 19  ILE B CG1 1 
ATOM   2006 C  CG2 . ILE B 1 19  ? -0.467  6.723   0.857   1.00 15.92 ? 19  ILE B CG2 1 
ATOM   2007 C  CD1 . ILE B 1 19  ? 1.431   7.607   3.070   1.00 13.90 ? 19  ILE B CD1 1 
ATOM   2008 N  N   . PHE B 1 20  ? -3.741  5.310   0.999   1.00 19.91 ? 20  PHE B N   1 
ATOM   2009 C  CA  . PHE B 1 20  ? -4.357  4.348   0.099   1.00 17.19 ? 20  PHE B CA  1 
ATOM   2010 C  C   . PHE B 1 20  ? -3.817  4.550   -1.302  1.00 19.31 ? 20  PHE B C   1 
ATOM   2011 O  O   . PHE B 1 20  ? -3.730  5.682   -1.777  1.00 20.03 ? 20  PHE B O   1 
ATOM   2012 C  CB  . PHE B 1 20  ? -5.870  4.546   0.087   1.00 18.16 ? 20  PHE B CB  1 
ATOM   2013 C  CG  . PHE B 1 20  ? -6.537  4.225   1.392   1.00 19.95 ? 20  PHE B CG  1 
ATOM   2014 C  CD1 . PHE B 1 20  ? -6.867  2.914   1.717   1.00 18.08 ? 20  PHE B CD1 1 
ATOM   2015 C  CD2 . PHE B 1 20  ? -6.817  5.233   2.308   1.00 18.92 ? 20  PHE B CD2 1 
ATOM   2016 C  CE1 . PHE B 1 20  ? -7.468  2.610   2.932   1.00 15.99 ? 20  PHE B CE1 1 
ATOM   2017 C  CE2 . PHE B 1 20  ? -7.416  4.939   3.526   1.00 20.09 ? 20  PHE B CE2 1 
ATOM   2018 C  CZ  . PHE B 1 20  ? -7.744  3.620   3.839   1.00 16.42 ? 20  PHE B CZ  1 
ATOM   2019 N  N   . GLN B 1 21  ? -3.442  3.459   -1.961  1.00 14.35 ? 21  GLN B N   1 
ATOM   2020 C  CA  . GLN B 1 21  ? -2.943  3.549   -3.323  1.00 16.10 ? 21  GLN B CA  1 
ATOM   2021 C  C   . GLN B 1 21  ? -3.692  2.531   -4.170  1.00 15.36 ? 21  GLN B C   1 
ATOM   2022 O  O   . GLN B 1 21  ? -4.138  1.506   -3.661  1.00 16.29 ? 21  GLN B O   1 
ATOM   2023 C  CB  . GLN B 1 21  ? -1.441  3.276   -3.365  1.00 13.77 ? 21  GLN B CB  1 
ATOM   2024 C  CG  . GLN B 1 21  ? -0.646  4.181   -2.448  1.00 11.00 ? 21  GLN B CG  1 
ATOM   2025 C  CD  . GLN B 1 21  ? 0.847   3.969   -2.566  1.00 15.29 ? 21  GLN B CD  1 
ATOM   2026 O  OE1 . GLN B 1 21  ? 1.329   2.836   -2.548  1.00 16.33 ? 21  GLN B OE1 1 
ATOM   2027 N  NE2 . GLN B 1 21  ? 1.594   5.066   -2.668  1.00 18.64 ? 21  GLN B NE2 1 
ATOM   2028 N  N   . GLY B 1 22  ? -3.845  2.817   -5.457  1.00 16.07 ? 22  GLY B N   1 
ATOM   2029 C  CA  . GLY B 1 22  ? -4.546  1.885   -6.320  1.00 15.15 ? 22  GLY B CA  1 
ATOM   2030 C  C   . GLY B 1 22  ? -6.011  1.744   -5.955  1.00 15.14 ? 22  GLY B C   1 
ATOM   2031 O  O   . GLY B 1 22  ? -6.686  2.734   -5.672  1.00 18.77 ? 22  GLY B O   1 
ATOM   2032 N  N   . ASP B 1 23  ? -6.505  0.510   -5.937  1.00 14.76 ? 23  ASP B N   1 
ATOM   2033 C  CA  . ASP B 1 23  ? -7.908  0.269   -5.639  1.00 15.82 ? 23  ASP B CA  1 
ATOM   2034 C  C   . ASP B 1 23  ? -8.234  0.016   -4.176  1.00 19.55 ? 23  ASP B C   1 
ATOM   2035 O  O   . ASP B 1 23  ? -9.403  -0.132  -3.817  1.00 20.46 ? 23  ASP B O   1 
ATOM   2036 C  CB  . ASP B 1 23  ? -8.421  -0.900  -6.480  1.00 16.92 ? 23  ASP B CB  1 
ATOM   2037 C  CG  . ASP B 1 23  ? -8.265  -0.655  -7.971  1.00 18.80 ? 23  ASP B CG  1 
ATOM   2038 O  OD1 . ASP B 1 23  ? -8.647  0.437   -8.438  1.00 24.00 ? 23  ASP B OD1 1 
ATOM   2039 O  OD2 . ASP B 1 23  ? -7.778  -1.555  -8.681  1.00 17.75 ? 23  ASP B OD2 1 
ATOM   2040 N  N   . ALA B 1 24  ? -7.212  -0.023  -3.329  1.00 16.84 ? 24  ALA B N   1 
ATOM   2041 C  CA  . ALA B 1 24  ? -7.426  -0.276  -1.908  1.00 19.99 ? 24  ALA B CA  1 
ATOM   2042 C  C   . ALA B 1 24  ? -8.460  0.654   -1.278  1.00 17.87 ? 24  ALA B C   1 
ATOM   2043 O  O   . ALA B 1 24  ? -8.471  1.854   -1.535  1.00 18.92 ? 24  ALA B O   1 
ATOM   2044 C  CB  . ALA B 1 24  ? -6.097  -0.159  -1.154  1.00 16.47 ? 24  ALA B CB  1 
ATOM   2045 N  N   . GLN B 1 25  ? -9.344  0.089   -0.468  1.00 19.89 ? 25  GLN B N   1 
ATOM   2046 C  CA  . GLN B 1 25  ? -10.338 0.889   0.232   1.00 24.90 ? 25  GLN B CA  1 
ATOM   2047 C  C   . GLN B 1 25  ? -10.989 0.092   1.350   1.00 25.27 ? 25  GLN B C   1 
ATOM   2048 O  O   . GLN B 1 25  ? -10.950 -1.135  1.352   1.00 26.85 ? 25  GLN B O   1 
ATOM   2049 C  CB  . GLN B 1 25  ? -11.393 1.434   -0.728  1.00 27.19 ? 25  GLN B CB  1 
ATOM   2050 C  CG  . GLN B 1 25  ? -12.275 0.415   -1.389  1.00 35.56 ? 25  GLN B CG  1 
ATOM   2051 C  CD  . GLN B 1 25  ? -13.213 1.068   -2.389  1.00 39.70 ? 25  GLN B CD  1 
ATOM   2052 O  OE1 . GLN B 1 25  ? -12.773 1.637   -3.394  1.00 39.21 ? 25  GLN B OE1 1 
ATOM   2053 N  NE2 . GLN B 1 25  ? -14.511 1.006   -2.112  1.00 41.67 ? 25  GLN B NE2 1 
ATOM   2054 N  N   . ILE B 1 26  ? -11.570 0.801   2.311   1.00 25.37 ? 26  ILE B N   1 
ATOM   2055 C  CA  . ILE B 1 26  ? -12.205 0.169   3.458   1.00 24.24 ? 26  ILE B CA  1 
ATOM   2056 C  C   . ILE B 1 26  ? -13.645 -0.252  3.194   1.00 23.61 ? 26  ILE B C   1 
ATOM   2057 O  O   . ILE B 1 26  ? -14.455 0.528   2.697   1.00 24.03 ? 26  ILE B O   1 
ATOM   2058 C  CB  . ILE B 1 26  ? -12.208 1.120   4.675   1.00 27.14 ? 26  ILE B CB  1 
ATOM   2059 C  CG1 . ILE B 1 26  ? -10.782 1.583   4.994   1.00 27.08 ? 26  ILE B CG1 1 
ATOM   2060 C  CG2 . ILE B 1 26  ? -12.825 0.421   5.876   1.00 26.61 ? 26  ILE B CG2 1 
ATOM   2061 C  CD1 . ILE B 1 26  ? -9.852  0.483   5.393   1.00 29.66 ? 26  ILE B CD1 1 
ATOM   2062 N  N   . LYS B 1 27  ? -13.952 -1.499  3.533   1.00 23.99 ? 27  LYS B N   1 
ATOM   2063 C  CA  . LYS B 1 27  ? -15.294 -2.045  3.379   1.00 27.46 ? 27  LYS B CA  1 
ATOM   2064 C  C   . LYS B 1 27  ? -15.520 -3.058  4.485   1.00 28.65 ? 27  LYS B C   1 
ATOM   2065 O  O   . LYS B 1 27  ? -14.739 -3.998  4.643   1.00 27.14 ? 27  LYS B O   1 
ATOM   2066 C  CB  . LYS B 1 27  ? -15.468 -2.748  2.030   1.00 33.15 ? 27  LYS B CB  1 
ATOM   2067 C  CG  . LYS B 1 27  ? -15.406 -1.848  0.809   1.00 41.08 ? 27  LYS B CG  1 
ATOM   2068 C  CD  . LYS B 1 27  ? -15.577 -2.676  -0.460  1.00 48.42 ? 27  LYS B CD  1 
ATOM   2069 C  CE  . LYS B 1 27  ? -15.454 -1.831  -1.719  1.00 51.89 ? 27  LYS B CE  1 
ATOM   2070 N  NZ  . LYS B 1 27  ? -16.503 -0.777  -1.796  1.00 55.98 ? 27  LYS B NZ  1 
ATOM   2071 N  N   . ASN B 1 28  ? -16.583 -2.858  5.255   1.00 28.78 ? 28  ASN B N   1 
ATOM   2072 C  CA  . ASN B 1 28  ? -16.922 -3.766  6.344   1.00 31.23 ? 28  ASN B CA  1 
ATOM   2073 C  C   . ASN B 1 28  ? -15.824 -3.887  7.394   1.00 29.19 ? 28  ASN B C   1 
ATOM   2074 O  O   . ASN B 1 28  ? -15.403 -4.990  7.741   1.00 28.22 ? 28  ASN B O   1 
ATOM   2075 C  CB  . ASN B 1 28  ? -17.244 -5.152  5.787   1.00 36.15 ? 28  ASN B CB  1 
ATOM   2076 C  CG  . ASN B 1 28  ? -18.360 -5.121  4.770   1.00 44.02 ? 28  ASN B CG  1 
ATOM   2077 O  OD1 . ASN B 1 28  ? -19.474 -4.685  5.070   1.00 47.45 ? 28  ASN B OD1 1 
ATOM   2078 N  ND2 . ASN B 1 28  ? -18.070 -5.582  3.554   1.00 47.15 ? 28  ASN B ND2 1 
ATOM   2079 N  N   . ASN B 1 29  ? -15.360 -2.749  7.892   1.00 26.69 ? 29  ASN B N   1 
ATOM   2080 C  CA  . ASN B 1 29  ? -14.334 -2.724  8.922   1.00 27.56 ? 29  ASN B CA  1 
ATOM   2081 C  C   . ASN B 1 29  ? -13.090 -3.525  8.564   1.00 25.47 ? 29  ASN B C   1 
ATOM   2082 O  O   . ASN B 1 29  ? -12.372 -3.998  9.447   1.00 24.01 ? 29  ASN B O   1 
ATOM   2083 C  CB  . ASN B 1 29  ? -14.915 -3.231  10.243  1.00 31.06 ? 29  ASN B CB  1 
ATOM   2084 C  CG  . ASN B 1 29  ? -16.114 -2.421  10.691  1.00 37.53 ? 29  ASN B CG  1 
ATOM   2085 O  OD1 . ASN B 1 29  ? -16.031 -1.201  10.842  1.00 40.95 ? 29  ASN B OD1 1 
ATOM   2086 N  ND2 . ASN B 1 29  ? -17.239 -3.095  10.906  1.00 37.52 ? 29  ASN B ND2 1 
ATOM   2087 N  N   . ALA B 1 30  ? -12.848 -3.682  7.268   1.00 21.71 ? 30  ALA B N   1 
ATOM   2088 C  CA  . ALA B 1 30  ? -11.673 -4.393  6.789   1.00 21.77 ? 30  ALA B CA  1 
ATOM   2089 C  C   . ALA B 1 30  ? -11.122 -3.666  5.567   1.00 21.34 ? 30  ALA B C   1 
ATOM   2090 O  O   . ALA B 1 30  ? -11.834 -2.908  4.911   1.00 22.83 ? 30  ALA B O   1 
ATOM   2091 C  CB  . ALA B 1 30  ? -12.027 -5.824  6.433   1.00 18.55 ? 30  ALA B CB  1 
ATOM   2092 N  N   . VAL B 1 31  ? -9.847  -3.881  5.272   1.00 20.02 ? 31  VAL B N   1 
ATOM   2093 C  CA  . VAL B 1 31  ? -9.234  -3.250  4.111   1.00 18.82 ? 31  VAL B CA  1 
ATOM   2094 C  C   . VAL B 1 31  ? -9.320  -4.190  2.916   1.00 18.48 ? 31  VAL B C   1 
ATOM   2095 O  O   . VAL B 1 31  ? -8.789  -5.302  2.955   1.00 19.45 ? 31  VAL B O   1 
ATOM   2096 C  CB  . VAL B 1 31  ? -7.740  -2.933  4.353   1.00 20.38 ? 31  VAL B CB  1 
ATOM   2097 C  CG1 . VAL B 1 31  ? -7.118  -2.371  3.079   1.00 19.37 ? 31  VAL B CG1 1 
ATOM   2098 C  CG2 . VAL B 1 31  ? -7.589  -1.946  5.497   1.00 18.17 ? 31  VAL B CG2 1 
ATOM   2099 N  N   . GLN B 1 32  ? -10.015 -3.767  1.867   1.00 16.67 ? 32  GLN B N   1 
ATOM   2100 C  CA  . GLN B 1 32  ? -10.099 -4.575  0.660   1.00 16.01 ? 32  GLN B CA  1 
ATOM   2101 C  C   . GLN B 1 32  ? -8.984  -4.021  -0.213  1.00 14.89 ? 32  GLN B C   1 
ATOM   2102 O  O   . GLN B 1 32  ? -9.129  -2.950  -0.793  1.00 18.12 ? 32  GLN B O   1 
ATOM   2103 C  CB  . GLN B 1 32  ? -11.444 -4.391  -0.049  1.00 16.40 ? 32  GLN B CB  1 
ATOM   2104 C  CG  . GLN B 1 32  ? -12.664 -4.848  0.734   1.00 22.14 ? 32  GLN B CG  1 
ATOM   2105 C  CD  . GLN B 1 32  ? -12.534 -6.269  1.264   1.00 23.90 ? 32  GLN B CD  1 
ATOM   2106 O  OE1 . GLN B 1 32  ? -12.074 -7.172  0.563   1.00 20.95 ? 32  GLN B OE1 1 
ATOM   2107 N  NE2 . GLN B 1 32  ? -12.961 -6.475  2.506   1.00 24.59 ? 32  GLN B NE2 1 
ATOM   2108 N  N   . LEU B 1 33  ? -7.861  -4.729  -0.280  1.00 16.23 ? 33  LEU B N   1 
ATOM   2109 C  CA  . LEU B 1 33  ? -6.729  -4.271  -1.078  1.00 13.74 ? 33  LEU B CA  1 
ATOM   2110 C  C   . LEU B 1 33  ? -7.054  -4.274  -2.566  1.00 16.55 ? 33  LEU B C   1 
ATOM   2111 O  O   . LEU B 1 33  ? -6.725  -3.329  -3.275  1.00 15.85 ? 33  LEU B O   1 
ATOM   2112 C  CB  . LEU B 1 33  ? -5.496  -5.135  -0.801  1.00 13.45 ? 33  LEU B CB  1 
ATOM   2113 C  CG  . LEU B 1 33  ? -4.922  -4.995  0.615   1.00 15.37 ? 33  LEU B CG  1 
ATOM   2114 C  CD1 . LEU B 1 33  ? -3.811  -6.002  0.830   1.00 12.48 ? 33  LEU B CD1 1 
ATOM   2115 C  CD2 . LEU B 1 33  ? -4.409  -3.576  0.815   1.00 13.60 ? 33  LEU B CD2 1 
ATOM   2116 N  N   . THR B 1 34  ? -7.704  -5.333  -3.036  1.00 17.15 ? 34  THR B N   1 
ATOM   2117 C  CA  . THR B 1 34  ? -8.066  -5.414  -4.443  1.00 20.23 ? 34  THR B CA  1 
ATOM   2118 C  C   . THR B 1 34  ? -9.533  -5.070  -4.625  1.00 20.20 ? 34  THR B C   1 
ATOM   2119 O  O   . THR B 1 34  ? -10.348 -5.259  -3.716  1.00 21.28 ? 34  THR B O   1 
ATOM   2120 C  CB  . THR B 1 34  ? -7.764  -6.815  -5.035  1.00 18.55 ? 34  THR B CB  1 
ATOM   2121 O  OG1 . THR B 1 34  ? -8.282  -7.833  -4.169  1.00 18.69 ? 34  THR B OG1 1 
ATOM   2122 C  CG2 . THR B 1 34  ? -6.255  -7.002  -5.207  1.00 17.70 ? 34  THR B CG2 1 
ATOM   2123 N  N   . LYS B 1 35  ? -9.852  -4.553  -5.807  1.00 20.74 ? 35  LYS B N   1 
ATOM   2124 C  CA  . LYS B 1 35  ? -11.203 -4.133  -6.152  1.00 22.40 ? 35  LYS B CA  1 
ATOM   2125 C  C   . LYS B 1 35  ? -12.233 -5.260  -6.158  1.00 24.92 ? 35  LYS B C   1 
ATOM   2126 O  O   . LYS B 1 35  ? -11.953 -6.383  -6.584  1.00 20.94 ? 35  LYS B O   1 
ATOM   2127 C  CB  . LYS B 1 35  ? -11.185 -3.445  -7.519  1.00 20.69 ? 35  LYS B CB  1 
ATOM   2128 C  CG  . LYS B 1 35  ? -12.534 -2.927  -7.982  1.00 22.50 ? 35  LYS B CG  1 
ATOM   2129 C  CD  . LYS B 1 35  ? -12.411 -2.203  -9.315  1.00 25.42 ? 35  LYS B CD  1 
ATOM   2130 N  N   . THR B 1 36  ? -13.429 -4.937  -5.679  1.00 26.49 ? 36  THR B N   1 
ATOM   2131 C  CA  . THR B 1 36  ? -14.541 -5.881  -5.624  1.00 29.84 ? 36  THR B CA  1 
ATOM   2132 C  C   . THR B 1 36  ? -15.766 -5.142  -6.150  1.00 32.35 ? 36  THR B C   1 
ATOM   2133 O  O   . THR B 1 36  ? -15.885 -3.934  -5.938  1.00 33.85 ? 36  THR B O   1 
ATOM   2134 C  CB  . THR B 1 36  ? -14.822 -6.321  -4.179  1.00 28.99 ? 36  THR B CB  1 
ATOM   2135 O  OG1 . THR B 1 36  ? -15.206 -5.180  -3.400  1.00 29.80 ? 36  THR B OG1 1 
ATOM   2136 C  CG2 . THR B 1 36  ? -13.588 -6.944  -3.567  1.00 24.05 ? 36  THR B CG2 1 
ATOM   2137 N  N   . ASP B 1 37  ? -16.669 -5.848  -6.832  1.00 33.89 ? 37  ASP B N   1 
ATOM   2138 C  CA  . ASP B 1 37  ? -17.870 -5.199  -7.367  1.00 34.70 ? 37  ASP B CA  1 
ATOM   2139 C  C   . ASP B 1 37  ? -18.928 -4.921  -6.302  1.00 35.63 ? 37  ASP B C   1 
ATOM   2140 O  O   . ASP B 1 37  ? -18.687 -5.102  -5.107  1.00 34.04 ? 37  ASP B O   1 
ATOM   2141 C  CB  . ASP B 1 37  ? -18.509 -6.024  -8.495  1.00 32.58 ? 37  ASP B CB  1 
ATOM   2142 C  CG  . ASP B 1 37  ? -18.937 -7.406  -8.047  1.00 30.01 ? 37  ASP B CG  1 
ATOM   2143 O  OD1 . ASP B 1 37  ? -19.457 -7.546  -6.921  1.00 30.24 ? 37  ASP B OD1 1 
ATOM   2144 O  OD2 . ASP B 1 37  ? -18.777 -8.356  -8.839  1.00 35.45 ? 37  ASP B OD2 1 
ATOM   2145 N  N   . SER B 1 38  ? -20.103 -4.489  -6.756  1.00 38.65 ? 38  SER B N   1 
ATOM   2146 C  CA  . SER B 1 38  ? -21.222 -4.155  -5.875  1.00 41.88 ? 38  SER B CA  1 
ATOM   2147 C  C   . SER B 1 38  ? -21.609 -5.275  -4.916  1.00 41.62 ? 38  SER B C   1 
ATOM   2148 O  O   . SER B 1 38  ? -21.979 -5.013  -3.771  1.00 40.01 ? 38  SER B O   1 
ATOM   2149 C  CB  . SER B 1 38  ? -22.446 -3.769  -6.707  1.00 44.58 ? 38  SER B CB  1 
ATOM   2150 O  OG  . SER B 1 38  ? -22.151 -2.688  -7.576  1.00 50.78 ? 38  SER B OG  1 
ATOM   2151 N  N   . ASN B 1 39  ? -21.532 -6.517  -5.387  1.00 42.42 ? 39  ASN B N   1 
ATOM   2152 C  CA  . ASN B 1 39  ? -21.878 -7.678  -4.568  1.00 43.15 ? 39  ASN B CA  1 
ATOM   2153 C  C   . ASN B 1 39  ? -20.726 -8.121  -3.669  1.00 42.45 ? 39  ASN B C   1 
ATOM   2154 O  O   . ASN B 1 39  ? -20.887 -9.016  -2.838  1.00 42.26 ? 39  ASN B O   1 
ATOM   2155 C  CB  . ASN B 1 39  ? -22.294 -8.850  -5.459  1.00 46.45 ? 39  ASN B CB  1 
ATOM   2156 C  CG  . ASN B 1 39  ? -23.531 -8.552  -6.279  1.00 50.71 ? 39  ASN B CG  1 
ATOM   2157 O  OD1 . ASN B 1 39  ? -24.601 -8.278  -5.731  1.00 52.64 ? 39  ASN B OD1 1 
ATOM   2158 N  ND2 . ASN B 1 39  ? -23.393 -8.605  -7.601  1.00 50.43 ? 39  ASN B ND2 1 
ATOM   2159 N  N   . GLY B 1 40  ? -19.561 -7.505  -3.840  1.00 40.69 ? 40  GLY B N   1 
ATOM   2160 C  CA  . GLY B 1 40  ? -18.416 -7.871  -3.027  1.00 37.38 ? 40  GLY B CA  1 
ATOM   2161 C  C   . GLY B 1 40  ? -17.578 -8.984  -3.633  1.00 32.95 ? 40  GLY B C   1 
ATOM   2162 O  O   . GLY B 1 40  ? -16.721 -9.558  -2.962  1.00 32.50 ? 40  GLY B O   1 
ATOM   2163 N  N   . ASN B 1 41  ? -17.826 -9.302  -4.898  1.00 30.70 ? 41  ASN B N   1 
ATOM   2164 C  CA  . ASN B 1 41  ? -17.062 -10.349 -5.565  1.00 30.04 ? 41  ASN B CA  1 
ATOM   2165 C  C   . ASN B 1 41  ? -15.806 -9.733  -6.152  1.00 27.15 ? 41  ASN B C   1 
ATOM   2166 O  O   . ASN B 1 41  ? -15.818 -8.584  -6.592  1.00 25.98 ? 41  ASN B O   1 
ATOM   2167 C  CB  . ASN B 1 41  ? -17.872 -10.992 -6.687  1.00 31.27 ? 41  ASN B CB  1 
ATOM   2168 C  CG  . ASN B 1 41  ? -19.206 -11.513 -6.211  1.00 38.99 ? 41  ASN B CG  1 
ATOM   2169 O  OD1 . ASN B 1 41  ? -20.113 -10.739 -5.917  1.00 43.00 ? 41  ASN B OD1 1 
ATOM   2170 N  ND2 . ASN B 1 41  ? -19.329 -12.832 -6.115  1.00 42.79 ? 41  ASN B ND2 1 
ATOM   2171 N  N   . PRO B 1 42  ? -14.700 -10.486 -6.155  1.00 24.13 ? 42  PRO B N   1 
ATOM   2172 C  CA  . PRO B 1 42  ? -13.430 -9.997  -6.696  1.00 22.44 ? 42  PRO B CA  1 
ATOM   2173 C  C   . PRO B 1 42  ? -13.500 -9.848  -8.207  1.00 24.01 ? 42  PRO B C   1 
ATOM   2174 O  O   . PRO B 1 42  ? -14.249 -10.565 -8.875  1.00 23.90 ? 42  PRO B O   1 
ATOM   2175 C  CB  . PRO B 1 42  ? -12.451 -11.083 -6.270  1.00 23.23 ? 42  PRO B CB  1 
ATOM   2176 C  CG  . PRO B 1 42  ? -13.317 -12.326 -6.395  1.00 24.37 ? 42  PRO B CG  1 
ATOM   2177 C  CD  . PRO B 1 42  ? -14.531 -11.848 -5.620  1.00 22.47 ? 42  PRO B CD  1 
ATOM   2178 N  N   . VAL B 1 43  ? -12.725 -8.911  -8.741  1.00 23.00 ? 43  VAL B N   1 
ATOM   2179 C  CA  . VAL B 1 43  ? -12.680 -8.679  -10.179 1.00 23.41 ? 43  VAL B CA  1 
ATOM   2180 C  C   . VAL B 1 43  ? -11.235 -8.777  -10.633 1.00 23.61 ? 43  VAL B C   1 
ATOM   2181 O  O   . VAL B 1 43  ? -10.314 -8.721  -9.816  1.00 23.99 ? 43  VAL B O   1 
ATOM   2182 C  CB  . VAL B 1 43  ? -13.225 -7.284  -10.550 1.00 24.62 ? 43  VAL B CB  1 
ATOM   2183 C  CG1 . VAL B 1 43  ? -14.685 -7.177  -10.162 1.00 25.92 ? 43  VAL B CG1 1 
ATOM   2184 C  CG2 . VAL B 1 43  ? -12.418 -6.209  -9.847  1.00 28.10 ? 43  VAL B CG2 1 
ATOM   2185 N  N   . ALA B 1 44  ? -11.035 -8.914  -11.936 1.00 23.48 ? 44  ALA B N   1 
ATOM   2186 C  CA  . ALA B 1 44  ? -9.691  -9.028  -12.485 1.00 22.79 ? 44  ALA B CA  1 
ATOM   2187 C  C   . ALA B 1 44  ? -9.049  -7.661  -12.694 1.00 22.45 ? 44  ALA B C   1 
ATOM   2188 O  O   . ALA B 1 44  ? -9.718  -6.635  -12.608 1.00 22.72 ? 44  ALA B O   1 
ATOM   2189 C  CB  . ALA B 1 44  ? -9.736  -9.791  -13.804 1.00 22.55 ? 44  ALA B CB  1 
ATOM   2190 N  N   . SER B 1 45  ? -7.744  -7.661  -12.955 1.00 21.31 ? 45  SER B N   1 
ATOM   2191 C  CA  . SER B 1 45  ? -6.995  -6.431  -13.207 1.00 23.19 ? 45  SER B CA  1 
ATOM   2192 C  C   . SER B 1 45  ? -7.152  -5.373  -12.135 1.00 24.30 ? 45  SER B C   1 
ATOM   2193 O  O   . SER B 1 45  ? -7.732  -4.311  -12.379 1.00 26.68 ? 45  SER B O   1 
ATOM   2194 C  CB  . SER B 1 45  ? -7.411  -5.822  -14.546 1.00 22.83 ? 45  SER B CB  1 
ATOM   2195 O  OG  . SER B 1 45  ? -7.181  -6.729  -15.600 1.00 28.44 ? 45  SER B OG  1 
ATOM   2196 N  N   . THR B 1 46  ? -6.625  -5.653  -10.951 1.00 24.38 ? 46  THR B N   1 
ATOM   2197 C  CA  . THR B 1 46  ? -6.707  -4.706  -9.854  1.00 21.37 ? 46  THR B CA  1 
ATOM   2198 C  C   . THR B 1 46  ? -5.485  -4.814  -8.954  1.00 20.84 ? 46  THR B C   1 
ATOM   2199 O  O   . THR B 1 46  ? -4.991  -5.907  -8.686  1.00 23.38 ? 46  THR B O   1 
ATOM   2200 C  CB  . THR B 1 46  ? -8.001  -4.931  -9.028  1.00 20.53 ? 46  THR B CB  1 
ATOM   2201 O  OG1 . THR B 1 46  ? -7.957  -4.137  -7.837  1.00 18.67 ? 46  THR B OG1 1 
ATOM   2202 C  CG2 . THR B 1 46  ? -8.165  -6.393  -8.669  1.00 19.25 ? 46  THR B CG2 1 
ATOM   2203 N  N   . VAL B 1 47  ? -4.986  -3.663  -8.518  1.00 18.26 ? 47  VAL B N   1 
ATOM   2204 C  CA  . VAL B 1 47  ? -3.830  -3.590  -7.636  1.00 13.52 ? 47  VAL B CA  1 
ATOM   2205 C  C   . VAL B 1 47  ? -4.171  -2.572  -6.568  1.00 15.42 ? 47  VAL B C   1 
ATOM   2206 O  O   . VAL B 1 47  ? -4.848  -1.580  -6.843  1.00 18.38 ? 47  VAL B O   1 
ATOM   2207 C  CB  . VAL B 1 47  ? -2.559  -3.105  -8.375  1.00 16.13 ? 47  VAL B CB  1 
ATOM   2208 C  CG1 . VAL B 1 47  ? -1.382  -3.049  -7.413  1.00 12.85 ? 47  VAL B CG1 1 
ATOM   2209 C  CG2 . VAL B 1 47  ? -2.237  -4.033  -9.520  1.00 18.77 ? 47  VAL B CG2 1 
ATOM   2210 N  N   . GLY B 1 48  ? -3.714  -2.817  -5.346  1.00 15.25 ? 48  GLY B N   1 
ATOM   2211 C  CA  . GLY B 1 48  ? -3.992  -1.891  -4.268  1.00 16.38 ? 48  GLY B CA  1 
ATOM   2212 C  C   . GLY B 1 48  ? -2.986  -2.040  -3.148  1.00 16.96 ? 48  GLY B C   1 
ATOM   2213 O  O   . GLY B 1 48  ? -2.453  -3.127  -2.935  1.00 19.30 ? 48  GLY B O   1 
ATOM   2214 N  N   . ARG B 1 49  ? -2.711  -0.951  -2.439  1.00 17.91 ? 49  ARG B N   1 
ATOM   2215 C  CA  . ARG B 1 49  ? -1.769  -0.991  -1.326  1.00 18.13 ? 49  ARG B CA  1 
ATOM   2216 C  C   . ARG B 1 49  ? -2.170  0.062   -0.298  1.00 20.20 ? 49  ARG B C   1 
ATOM   2217 O  O   . ARG B 1 49  ? -2.916  0.992   -0.607  1.00 20.04 ? 49  ARG B O   1 
ATOM   2218 C  CB  . ARG B 1 49  ? -0.339  -0.685  -1.808  1.00 13.80 ? 49  ARG B CB  1 
ATOM   2219 C  CG  . ARG B 1 49  ? 0.004   -1.239  -3.191  1.00 16.01 ? 49  ARG B CG  1 
ATOM   2220 C  CD  . ARG B 1 49  ? 1.500   -1.246  -3.500  1.00 17.48 ? 49  ARG B CD  1 
ATOM   2221 N  NE  . ARG B 1 49  ? 2.152   0.051   -3.346  1.00 17.15 ? 49  ARG B NE  1 
ATOM   2222 C  CZ  . ARG B 1 49  ? 3.438   0.267   -3.612  1.00 21.81 ? 49  ARG B CZ  1 
ATOM   2223 N  NH1 . ARG B 1 49  ? 4.204   -0.724  -4.047  1.00 22.23 ? 49  ARG B NH1 1 
ATOM   2224 N  NH2 . ARG B 1 49  ? 3.973   1.467   -3.418  1.00 19.45 ? 49  ARG B NH2 1 
ATOM   2225 N  N   . ILE B 1 50  ? -1.705  -0.116  0.933   1.00 18.88 ? 50  ILE B N   1 
ATOM   2226 C  CA  . ILE B 1 50  ? -1.937  0.860   1.992   1.00 17.43 ? 50  ILE B CA  1 
ATOM   2227 C  C   . ILE B 1 50  ? -0.594  1.008   2.693   1.00 16.23 ? 50  ILE B C   1 
ATOM   2228 O  O   . ILE B 1 50  ? 0.229   0.088   2.694   1.00 14.34 ? 50  ILE B O   1 
ATOM   2229 C  CB  . ILE B 1 50  ? -3.001  0.428   3.056   1.00 17.13 ? 50  ILE B CB  1 
ATOM   2230 C  CG1 . ILE B 1 50  ? -2.600  -0.893  3.709   1.00 16.81 ? 50  ILE B CG1 1 
ATOM   2231 C  CG2 . ILE B 1 50  ? -4.382  0.347   2.426   1.00 15.48 ? 50  ILE B CG2 1 
ATOM   2232 C  CD1 . ILE B 1 50  ? -3.465  -1.248  4.908   1.00 17.66 ? 50  ILE B CD1 1 
ATOM   2233 N  N   . LEU B 1 51  ? -0.371  2.175   3.273   1.00 18.79 ? 51  LEU B N   1 
ATOM   2234 C  CA  . LEU B 1 51  ? 0.866   2.455   3.984   1.00 19.34 ? 51  LEU B CA  1 
ATOM   2235 C  C   . LEU B 1 51  ? 0.485   3.287   5.193   1.00 18.18 ? 51  LEU B C   1 
ATOM   2236 O  O   . LEU B 1 51  ? -0.434  4.102   5.111   1.00 15.86 ? 51  LEU B O   1 
ATOM   2237 C  CB  . LEU B 1 51  ? 1.804   3.268   3.097   1.00 16.81 ? 51  LEU B CB  1 
ATOM   2238 C  CG  . LEU B 1 51  ? 2.277   2.679   1.763   1.00 20.22 ? 51  LEU B CG  1 
ATOM   2239 C  CD1 . LEU B 1 51  ? 2.705   3.809   0.855   1.00 21.08 ? 51  LEU B CD1 1 
ATOM   2240 C  CD2 . LEU B 1 51  ? 3.408   1.688   1.984   1.00 14.25 ? 51  LEU B CD2 1 
ATOM   2241 N  N   . PHE B 1 52  ? 1.159   3.073   6.318   1.00 17.09 ? 52  PHE B N   1 
ATOM   2242 C  CA  . PHE B 1 52  ? 0.874   3.885   7.489   1.00 15.64 ? 52  PHE B CA  1 
ATOM   2243 C  C   . PHE B 1 52  ? 1.567   5.196   7.119   1.00 15.33 ? 52  PHE B C   1 
ATOM   2244 O  O   . PHE B 1 52  ? 2.656   5.179   6.539   1.00 12.62 ? 52  PHE B O   1 
ATOM   2245 C  CB  . PHE B 1 52  ? 1.499   3.282   8.752   1.00 18.47 ? 52  PHE B CB  1 
ATOM   2246 C  CG  . PHE B 1 52  ? 1.049   3.954   10.022  1.00 22.54 ? 52  PHE B CG  1 
ATOM   2247 C  CD1 . PHE B 1 52  ? -0.279  3.860   10.437  1.00 19.36 ? 52  PHE B CD1 1 
ATOM   2248 C  CD2 . PHE B 1 52  ? 1.932   4.722   10.775  1.00 21.64 ? 52  PHE B CD2 1 
ATOM   2249 C  CE1 . PHE B 1 52  ? -0.721  4.521   11.573  1.00 18.39 ? 52  PHE B CE1 1 
ATOM   2250 C  CE2 . PHE B 1 52  ? 1.497   5.390   11.917  1.00 22.23 ? 52  PHE B CE2 1 
ATOM   2251 C  CZ  . PHE B 1 52  ? 0.167   5.290   12.316  1.00 21.52 ? 52  PHE B CZ  1 
ATOM   2252 N  N   . SER B 1 53  ? 0.946   6.327   7.434   1.00 14.37 ? 53  SER B N   1 
ATOM   2253 C  CA  . SER B 1 53  ? 1.528   7.616   7.072   1.00 18.52 ? 53  SER B CA  1 
ATOM   2254 C  C   . SER B 1 53  ? 2.834   7.956   7.779   1.00 17.79 ? 53  SER B C   1 
ATOM   2255 O  O   . SER B 1 53  ? 3.732   8.526   7.167   1.00 20.61 ? 53  SER B O   1 
ATOM   2256 C  CB  . SER B 1 53  ? 0.518   8.741   7.308   1.00 17.31 ? 53  SER B CB  1 
ATOM   2257 O  OG  . SER B 1 53  ? 0.156   8.809   8.676   1.00 24.50 ? 53  SER B OG  1 
ATOM   2258 N  N   . ALA B 1 54  ? 2.946   7.616   9.060   1.00 16.42 ? 54  ALA B N   1 
ATOM   2259 C  CA  . ALA B 1 54  ? 4.166   7.922   9.810   1.00 18.27 ? 54  ALA B CA  1 
ATOM   2260 C  C   . ALA B 1 54  ? 5.349   7.063   9.371   1.00 18.47 ? 54  ALA B C   1 
ATOM   2261 O  O   . ALA B 1 54  ? 5.242   5.845   9.241   1.00 18.82 ? 54  ALA B O   1 
ATOM   2262 C  CB  . ALA B 1 54  ? 3.924   7.749   11.307  1.00 14.65 ? 54  ALA B CB  1 
ATOM   2263 N  N   . GLN B 1 55  ? 6.484   7.705   9.140   1.00 17.51 ? 55  GLN B N   1 
ATOM   2264 C  CA  . GLN B 1 55  ? 7.659   6.974   8.720   1.00 16.68 ? 55  GLN B CA  1 
ATOM   2265 C  C   . GLN B 1 55  ? 8.281   6.274   9.906   1.00 17.02 ? 55  GLN B C   1 
ATOM   2266 O  O   . GLN B 1 55  ? 8.325   6.817   11.010  1.00 13.53 ? 55  GLN B O   1 
ATOM   2267 C  CB  . GLN B 1 55  ? 8.659   7.920   8.050   1.00 16.65 ? 55  GLN B CB  1 
ATOM   2268 C  CG  . GLN B 1 55  ? 8.134   8.456   6.729   1.00 20.24 ? 55  GLN B CG  1 
ATOM   2269 C  CD  . GLN B 1 55  ? 9.093   9.404   6.043   1.00 19.50 ? 55  GLN B CD  1 
ATOM   2270 O  OE1 . GLN B 1 55  ? 10.279  9.107   5.880   1.00 19.46 ? 55  GLN B OE1 1 
ATOM   2271 N  NE2 . GLN B 1 55  ? 8.580   10.544  5.618   1.00 16.85 ? 55  GLN B NE2 1 
ATOM   2272 N  N   . VAL B 1 56  ? 8.726   5.043   9.675   1.00 17.65 ? 56  VAL B N   1 
ATOM   2273 C  CA  . VAL B 1 56  ? 9.360   4.238   10.712  1.00 17.81 ? 56  VAL B CA  1 
ATOM   2274 C  C   . VAL B 1 56  ? 10.860  4.443   10.594  1.00 17.30 ? 56  VAL B C   1 
ATOM   2275 O  O   . VAL B 1 56  ? 11.399  4.452   9.491   1.00 18.73 ? 56  VAL B O   1 
ATOM   2276 C  CB  . VAL B 1 56  ? 9.050   2.736   10.513  1.00 16.45 ? 56  VAL B CB  1 
ATOM   2277 C  CG1 . VAL B 1 56  ? 9.805   1.902   11.537  1.00 16.13 ? 56  VAL B CG1 1 
ATOM   2278 C  CG2 . VAL B 1 56  ? 7.560   2.502   10.622  1.00 16.27 ? 56  VAL B CG2 1 
ATOM   2279 N  N   . HIS B 1 57  ? 11.538  4.615   11.720  1.00 18.28 ? 57  HIS B N   1 
ATOM   2280 C  CA  . HIS B 1 57  ? 12.983  4.807   11.679  1.00 18.13 ? 57  HIS B CA  1 
ATOM   2281 C  C   . HIS B 1 57  ? 13.580  3.411   11.811  1.00 16.53 ? 57  HIS B C   1 
ATOM   2282 O  O   . HIS B 1 57  ? 13.732  2.898   12.917  1.00 16.65 ? 57  HIS B O   1 
ATOM   2283 C  CB  . HIS B 1 57  ? 13.430  5.713   12.831  1.00 21.10 ? 57  HIS B CB  1 
ATOM   2284 C  CG  . HIS B 1 57  ? 14.768  6.350   12.616  1.00 22.00 ? 57  HIS B CG  1 
ATOM   2285 N  ND1 . HIS B 1 57  ? 15.318  7.244   13.509  1.00 19.30 ? 57  HIS B ND1 1 
ATOM   2286 C  CD2 . HIS B 1 57  ? 15.658  6.239   11.601  1.00 25.67 ? 57  HIS B CD2 1 
ATOM   2287 C  CE1 . HIS B 1 57  ? 16.487  7.656   13.054  1.00 23.18 ? 57  HIS B CE1 1 
ATOM   2288 N  NE2 . HIS B 1 57  ? 16.718  7.061   11.898  1.00 25.32 ? 57  HIS B NE2 1 
ATOM   2289 N  N   . LEU B 1 58  ? 13.898  2.804   10.669  1.00 16.76 ? 58  LEU B N   1 
ATOM   2290 C  CA  . LEU B 1 58  ? 14.437  1.445   10.606  1.00 18.76 ? 58  LEU B CA  1 
ATOM   2291 C  C   . LEU B 1 58  ? 15.853  1.331   11.169  1.00 18.69 ? 58  LEU B C   1 
ATOM   2292 O  O   . LEU B 1 58  ? 16.163  0.392   11.900  1.00 18.42 ? 58  LEU B O   1 
ATOM   2293 C  CB  . LEU B 1 58  ? 14.400  0.944   9.158   1.00 16.04 ? 58  LEU B CB  1 
ATOM   2294 C  CG  . LEU B 1 58  ? 14.604  -0.554  8.939   1.00 19.50 ? 58  LEU B CG  1 
ATOM   2295 C  CD1 . LEU B 1 58  ? 13.471  -1.328  9.609   1.00 17.22 ? 58  LEU B CD1 1 
ATOM   2296 C  CD2 . LEU B 1 58  ? 14.627  -0.853  7.450   1.00 20.16 ? 58  LEU B CD2 1 
ATOM   2297 N  N   . TRP B 1 59  ? 16.723  2.266   10.809  1.00 19.40 ? 59  TRP B N   1 
ATOM   2298 C  CA  . TRP B 1 59  ? 18.082  2.263   11.345  1.00 22.81 ? 59  TRP B CA  1 
ATOM   2299 C  C   . TRP B 1 59  ? 18.681  3.664   11.316  1.00 23.83 ? 59  TRP B C   1 
ATOM   2300 O  O   . TRP B 1 59  ? 18.236  4.526   10.560  1.00 25.60 ? 59  TRP B O   1 
ATOM   2301 C  CB  . TRP B 1 59  ? 18.999  1.272   10.611  1.00 17.37 ? 59  TRP B CB  1 
ATOM   2302 C  CG  . TRP B 1 59  ? 19.164  1.496   9.143   1.00 21.96 ? 59  TRP B CG  1 
ATOM   2303 C  CD1 . TRP B 1 59  ? 18.276  1.178   8.154   1.00 19.56 ? 59  TRP B CD1 1 
ATOM   2304 C  CD2 . TRP B 1 59  ? 20.304  2.072   8.490   1.00 21.14 ? 59  TRP B CD2 1 
ATOM   2305 N  NE1 . TRP B 1 59  ? 18.796  1.518   6.924   1.00 21.69 ? 59  TRP B NE1 1 
ATOM   2306 C  CE2 . TRP B 1 59  ? 20.038  2.068   7.102   1.00 19.51 ? 59  TRP B CE2 1 
ATOM   2307 C  CE3 . TRP B 1 59  ? 21.525  2.590   8.944   1.00 23.34 ? 59  TRP B CE3 1 
ATOM   2308 C  CZ2 . TRP B 1 59  ? 20.950  2.564   6.160   1.00 22.64 ? 59  TRP B CZ2 1 
ATOM   2309 C  CZ3 . TRP B 1 59  ? 22.435  3.084   8.007   1.00 25.86 ? 59  TRP B CZ3 1 
ATOM   2310 C  CH2 . TRP B 1 59  ? 22.139  3.065   6.630   1.00 24.48 ? 59  TRP B CH2 1 
ATOM   2311 N  N   . GLU B 1 60  ? 19.689  3.883   12.149  1.00 27.52 ? 60  GLU B N   1 
ATOM   2312 C  CA  . GLU B 1 60  ? 20.324  5.190   12.254  1.00 32.09 ? 60  GLU B CA  1 
ATOM   2313 C  C   . GLU B 1 60  ? 21.833  5.054   12.120  1.00 33.49 ? 60  GLU B C   1 
ATOM   2314 O  O   . GLU B 1 60  ? 22.497  4.531   13.014  1.00 35.52 ? 60  GLU B O   1 
ATOM   2315 C  CB  . GLU B 1 60  ? 19.955  5.810   13.606  1.00 30.37 ? 60  GLU B CB  1 
ATOM   2316 C  CG  . GLU B 1 60  ? 20.431  7.229   13.822  1.00 35.01 ? 60  GLU B CG  1 
ATOM   2317 C  CD  . GLU B 1 60  ? 19.905  7.812   15.123  1.00 34.91 ? 60  GLU B CD  1 
ATOM   2318 O  OE1 . GLU B 1 60  ? 20.262  7.294   16.198  1.00 34.37 ? 60  GLU B OE1 1 
ATOM   2319 O  OE2 . GLU B 1 60  ? 19.121  8.781   15.070  1.00 35.47 ? 60  GLU B OE2 1 
ATOM   2320 N  N   . LYS B 1 61  ? 22.367  5.531   11.000  1.00 38.95 ? 61  LYS B N   1 
ATOM   2321 C  CA  . LYS B 1 61  ? 23.800  5.453   10.726  1.00 41.87 ? 61  LYS B CA  1 
ATOM   2322 C  C   . LYS B 1 61  ? 24.679  6.010   11.840  1.00 41.46 ? 61  LYS B C   1 
ATOM   2323 O  O   . LYS B 1 61  ? 25.600  5.345   12.306  1.00 41.17 ? 61  LYS B O   1 
ATOM   2324 C  CB  . LYS B 1 61  ? 24.127  6.181   9.421   1.00 46.84 ? 61  LYS B CB  1 
ATOM   2325 C  CG  . LYS B 1 61  ? 25.608  6.167   9.080   1.00 55.16 ? 61  LYS B CG  1 
ATOM   2326 C  CD  . LYS B 1 61  ? 25.915  6.932   7.802   1.00 58.61 ? 61  LYS B CD  1 
ATOM   2327 C  CE  . LYS B 1 61  ? 27.416  6.950   7.535   1.00 61.50 ? 61  LYS B CE  1 
ATOM   2328 N  NZ  . LYS B 1 61  ? 27.762  7.698   6.294   1.00 64.94 ? 61  LYS B NZ  1 
ATOM   2329 N  N   . SER B 1 62  ? 24.390  7.231   12.267  1.00 42.21 ? 62  SER B N   1 
ATOM   2330 C  CA  . SER B 1 62  ? 25.171  7.876   13.314  1.00 42.99 ? 62  SER B CA  1 
ATOM   2331 C  C   . SER B 1 62  ? 25.310  7.052   14.595  1.00 43.16 ? 62  SER B C   1 
ATOM   2332 O  O   . SER B 1 62  ? 26.419  6.708   15.000  1.00 44.44 ? 62  SER B O   1 
ATOM   2333 C  CB  . SER B 1 62  ? 24.562  9.238   13.647  1.00 42.35 ? 62  SER B CB  1 
ATOM   2334 O  OG  . SER B 1 62  ? 23.236  9.092   14.121  1.00 46.36 ? 62  SER B OG  1 
ATOM   2335 N  N   . SER B 1 63  ? 24.185  6.737   15.227  1.00 41.41 ? 63  SER B N   1 
ATOM   2336 C  CA  . SER B 1 63  ? 24.194  5.979   16.473  1.00 36.66 ? 63  SER B CA  1 
ATOM   2337 C  C   . SER B 1 63  ? 24.454  4.492   16.268  1.00 35.69 ? 63  SER B C   1 
ATOM   2338 O  O   . SER B 1 63  ? 24.527  3.731   17.238  1.00 37.56 ? 63  SER B O   1 
ATOM   2339 C  CB  . SER B 1 63  ? 22.863  6.156   17.207  1.00 37.60 ? 63  SER B CB  1 
ATOM   2340 O  OG  . SER B 1 63  ? 21.799  5.559   16.485  1.00 36.74 ? 63  SER B OG  1 
ATOM   2341 N  N   . SER B 1 64  ? 24.584  4.074   15.016  1.00 34.25 ? 64  SER B N   1 
ATOM   2342 C  CA  . SER B 1 64  ? 24.834  2.669   14.717  1.00 32.61 ? 64  SER B CA  1 
ATOM   2343 C  C   . SER B 1 64  ? 23.733  1.753   15.275  1.00 30.45 ? 64  SER B C   1 
ATOM   2344 O  O   . SER B 1 64  ? 24.005  0.640   15.726  1.00 29.79 ? 64  SER B O   1 
ATOM   2345 C  CB  . SER B 1 64  ? 26.193  2.261   15.292  1.00 33.33 ? 64  SER B CB  1 
ATOM   2346 O  OG  . SER B 1 64  ? 26.475  0.897   15.040  1.00 42.25 ? 64  SER B OG  1 
ATOM   2347 N  N   . ARG B 1 65  ? 22.489  2.222   15.253  1.00 27.62 ? 65  ARG B N   1 
ATOM   2348 C  CA  . ARG B 1 65  ? 21.384  1.414   15.757  1.00 23.43 ? 65  ARG B CA  1 
ATOM   2349 C  C   . ARG B 1 65  ? 20.502  0.865   14.643  1.00 21.86 ? 65  ARG B C   1 
ATOM   2350 O  O   . ARG B 1 65  ? 20.423  1.437   13.553  1.00 19.70 ? 65  ARG B O   1 
ATOM   2351 C  CB  . ARG B 1 65  ? 20.521  2.222   16.728  1.00 24.98 ? 65  ARG B CB  1 
ATOM   2352 C  CG  . ARG B 1 65  ? 21.203  2.569   18.034  1.00 25.89 ? 65  ARG B CG  1 
ATOM   2353 C  CD  . ARG B 1 65  ? 20.257  3.327   18.941  1.00 23.77 ? 65  ARG B CD  1 
ATOM   2354 N  NE  . ARG B 1 65  ? 19.895  4.619   18.374  1.00 23.78 ? 65  ARG B NE  1 
ATOM   2355 C  CZ  . ARG B 1 65  ? 18.943  5.403   18.865  1.00 24.26 ? 65  ARG B CZ  1 
ATOM   2356 N  NH1 . ARG B 1 65  ? 18.258  5.021   19.932  1.00 22.02 ? 65  ARG B NH1 1 
ATOM   2357 N  NH2 . ARG B 1 65  ? 18.669  6.564   18.284  1.00 22.19 ? 65  ARG B NH2 1 
ATOM   2358 N  N   . VAL B 1 66  ? 19.850  -0.257  14.930  1.00 20.70 ? 66  VAL B N   1 
ATOM   2359 C  CA  . VAL B 1 66  ? 18.950  -0.896  13.979  1.00 20.52 ? 66  VAL B CA  1 
ATOM   2360 C  C   . VAL B 1 66  ? 17.691  -1.293  14.731  1.00 20.39 ? 66  VAL B C   1 
ATOM   2361 O  O   . VAL B 1 66  ? 17.754  -1.843  15.831  1.00 19.49 ? 66  VAL B O   1 
ATOM   2362 C  CB  . VAL B 1 66  ? 19.576  -2.148  13.341  1.00 18.69 ? 66  VAL B CB  1 
ATOM   2363 C  CG1 . VAL B 1 66  ? 18.583  -2.790  12.376  1.00 19.21 ? 66  VAL B CG1 1 
ATOM   2364 C  CG2 . VAL B 1 66  ? 20.845  -1.766  12.600  1.00 19.53 ? 66  VAL B CG2 1 
ATOM   2365 N  N   . ALA B 1 67  ? 16.547  -1.016  14.125  1.00 17.73 ? 67  ALA B N   1 
ATOM   2366 C  CA  . ALA B 1 67  ? 15.274  -1.298  14.753  1.00 17.15 ? 67  ALA B CA  1 
ATOM   2367 C  C   . ALA B 1 67  ? 14.912  -2.756  14.901  1.00 18.19 ? 67  ALA B C   1 
ATOM   2368 O  O   . ALA B 1 67  ? 15.235  -3.596  14.067  1.00 19.35 ? 67  ALA B O   1 
ATOM   2369 C  CB  . ALA B 1 67  ? 14.165  -0.583  14.004  1.00 16.52 ? 67  ALA B CB  1 
ATOM   2370 N  N   . ASN B 1 68  ? 14.231  -3.031  16.000  1.00 18.60 ? 68  ASN B N   1 
ATOM   2371 C  CA  . ASN B 1 68  ? 13.709  -4.341  16.316  1.00 19.70 ? 68  ASN B CA  1 
ATOM   2372 C  C   . ASN B 1 68  ? 12.230  -4.074  16.041  1.00 20.14 ? 68  ASN B C   1 
ATOM   2373 O  O   . ASN B 1 68  ? 11.664  -3.143  16.611  1.00 22.50 ? 68  ASN B O   1 
ATOM   2374 C  CB  . ASN B 1 68  ? 13.909  -4.638  17.805  1.00 24.97 ? 68  ASN B CB  1 
ATOM   2375 C  CG  . ASN B 1 68  ? 13.351  -5.988  18.219  1.00 30.40 ? 68  ASN B CG  1 
ATOM   2376 O  OD1 . ASN B 1 68  ? 12.183  -6.296  17.976  1.00 34.00 ? 68  ASN B OD1 1 
ATOM   2377 N  ND2 . ASN B 1 68  ? 14.184  -6.796  18.866  1.00 36.44 ? 68  ASN B ND2 1 
ATOM   2378 N  N   . PHE B 1 69  ? 11.604  -4.838  15.155  1.00 17.57 ? 69  PHE B N   1 
ATOM   2379 C  CA  . PHE B 1 69  ? 10.187  -4.600  14.901  1.00 20.23 ? 69  PHE B CA  1 
ATOM   2380 C  C   . PHE B 1 69  ? 9.386   -5.884  14.784  1.00 19.01 ? 69  PHE B C   1 
ATOM   2381 O  O   . PHE B 1 69  ? 9.936   -6.955  14.516  1.00 17.98 ? 69  PHE B O   1 
ATOM   2382 C  CB  . PHE B 1 69  ? 9.987   -3.735  13.645  1.00 16.99 ? 69  PHE B CB  1 
ATOM   2383 C  CG  . PHE B 1 69  ? 10.367  -4.414  12.360  1.00 21.52 ? 69  PHE B CG  1 
ATOM   2384 C  CD1 . PHE B 1 69  ? 9.550   -5.392  11.802  1.00 21.72 ? 69  PHE B CD1 1 
ATOM   2385 C  CD2 . PHE B 1 69  ? 11.547  -4.074  11.703  1.00 22.65 ? 69  PHE B CD2 1 
ATOM   2386 C  CE1 . PHE B 1 69  ? 9.905   -6.022  10.606  1.00 23.80 ? 69  PHE B CE1 1 
ATOM   2387 C  CE2 . PHE B 1 69  ? 11.909  -4.701  10.509  1.00 22.33 ? 69  PHE B CE2 1 
ATOM   2388 C  CZ  . PHE B 1 69  ? 11.086  -5.676  9.961   1.00 19.76 ? 69  PHE B CZ  1 
ATOM   2389 N  N   . GLN B 1 70  ? 8.082   -5.753  15.005  1.00 18.27 ? 70  GLN B N   1 
ATOM   2390 C  CA  . GLN B 1 70  ? 7.148   -6.867  14.932  1.00 16.91 ? 70  GLN B CA  1 
ATOM   2391 C  C   . GLN B 1 70  ? 5.883   -6.395  14.237  1.00 16.06 ? 70  GLN B C   1 
ATOM   2392 O  O   . GLN B 1 70  ? 5.381   -5.304  14.516  1.00 16.97 ? 70  GLN B O   1 
ATOM   2393 C  CB  . GLN B 1 70  ? 6.762   -7.346  16.327  1.00 16.89 ? 70  GLN B CB  1 
ATOM   2394 C  CG  . GLN B 1 70  ? 7.897   -7.839  17.176  1.00 25.83 ? 70  GLN B CG  1 
ATOM   2395 C  CD  . GLN B 1 70  ? 7.440   -8.119  18.586  1.00 35.67 ? 70  GLN B CD  1 
ATOM   2396 O  OE1 . GLN B 1 70  ? 6.563   -8.958  18.812  1.00 38.29 ? 70  GLN B OE1 1 
ATOM   2397 N  NE2 . GLN B 1 70  ? 8.019   -7.405  19.549  1.00 39.14 ? 70  GLN B NE2 1 
ATOM   2398 N  N   . SER B 1 71  ? 5.373   -7.212  13.327  1.00 11.33 ? 71  SER B N   1 
ATOM   2399 C  CA  . SER B 1 71  ? 4.144   -6.878  12.631  1.00 11.43 ? 71  SER B CA  1 
ATOM   2400 C  C   . SER B 1 71  ? 3.249   -8.106  12.744  1.00 13.55 ? 71  SER B C   1 
ATOM   2401 O  O   . SER B 1 71  ? 3.612   -9.195  12.298  1.00 13.61 ? 71  SER B O   1 
ATOM   2402 C  CB  . SER B 1 71  ? 4.422   -6.555  11.168  1.00 12.28 ? 71  SER B CB  1 
ATOM   2403 O  OG  . SER B 1 71  ? 3.240   -6.147  10.498  1.00 19.10 ? 71  SER B OG  1 
ATOM   2404 N  N   . GLN B 1 72  ? 2.097   -7.928  13.379  1.00 11.12 ? 72  GLN B N   1 
ATOM   2405 C  CA  . GLN B 1 72  ? 1.142   -9.008  13.567  1.00 12.79 ? 72  GLN B CA  1 
ATOM   2406 C  C   . GLN B 1 72  ? -0.066  -8.615  12.741  1.00 13.65 ? 72  GLN B C   1 
ATOM   2407 O  O   . GLN B 1 72  ? -0.567  -7.493  12.858  1.00 13.97 ? 72  GLN B O   1 
ATOM   2408 C  CB  . GLN B 1 72  ? 0.761   -9.110  15.044  1.00 14.21 ? 72  GLN B CB  1 
ATOM   2409 C  CG  . GLN B 1 72  ? 0.109   -10.420 15.468  1.00 19.16 ? 72  GLN B CG  1 
ATOM   2410 C  CD  . GLN B 1 72  ? -1.226  -10.673 14.805  1.00 25.18 ? 72  GLN B CD  1 
ATOM   2411 O  OE1 . GLN B 1 72  ? -2.103  -9.810  14.802  1.00 27.03 ? 72  GLN B OE1 1 
ATOM   2412 N  NE2 . GLN B 1 72  ? -1.398  -11.873 14.257  1.00 27.07 ? 72  GLN B NE2 1 
ATOM   2413 N  N   . PHE B 1 73  ? -0.533  -9.515  11.886  1.00 11.52 ? 73  PHE B N   1 
ATOM   2414 C  CA  . PHE B 1 73  ? -1.684  -9.181  11.064  1.00 13.10 ? 73  PHE B CA  1 
ATOM   2415 C  C   . PHE B 1 73  ? -2.437  -10.420 10.630  1.00 14.33 ? 73  PHE B C   1 
ATOM   2416 O  O   . PHE B 1 73  ? -1.924  -11.535 10.721  1.00 11.95 ? 73  PHE B O   1 
ATOM   2417 C  CB  . PHE B 1 73  ? -1.234  -8.356  9.843   1.00 9.02  ? 73  PHE B CB  1 
ATOM   2418 C  CG  . PHE B 1 73  ? -0.240  -9.059  8.951   1.00 11.03 ? 73  PHE B CG  1 
ATOM   2419 C  CD1 . PHE B 1 73  ? -0.669  -9.876  7.911   1.00 11.29 ? 73  PHE B CD1 1 
ATOM   2420 C  CD2 . PHE B 1 73  ? 1.134   -8.906  9.156   1.00 13.87 ? 73  PHE B CD2 1 
ATOM   2421 C  CE1 . PHE B 1 73  ? 0.255   -10.534 7.081   1.00 9.60  ? 73  PHE B CE1 1 
ATOM   2422 C  CE2 . PHE B 1 73  ? 2.065   -9.559  8.334   1.00 11.66 ? 73  PHE B CE2 1 
ATOM   2423 C  CZ  . PHE B 1 73  ? 1.621   -10.374 7.295   1.00 7.72  ? 73  PHE B CZ  1 
ATOM   2424 N  N   . SER B 1 74  ? -3.663  -10.223 10.166  1.00 11.81 ? 74  SER B N   1 
ATOM   2425 C  CA  . SER B 1 74  ? -4.461  -11.342 9.714   1.00 13.59 ? 74  SER B CA  1 
ATOM   2426 C  C   . SER B 1 74  ? -5.229  -10.929 8.475   1.00 12.95 ? 74  SER B C   1 
ATOM   2427 O  O   . SER B 1 74  ? -5.684  -9.788  8.363   1.00 13.96 ? 74  SER B O   1 
ATOM   2428 C  CB  . SER B 1 74  ? -5.448  -11.768 10.796  1.00 11.94 ? 74  SER B CB  1 
ATOM   2429 O  OG  . SER B 1 74  ? -6.421  -10.760 10.972  1.00 15.44 ? 74  SER B OG  1 
ATOM   2430 N  N   . PHE B 1 75  ? -5.371  -11.864 7.545   1.00 11.05 ? 75  PHE B N   1 
ATOM   2431 C  CA  . PHE B 1 75  ? -6.105  -11.598 6.324   1.00 8.46  ? 75  PHE B CA  1 
ATOM   2432 C  C   . PHE B 1 75  ? -6.819  -12.862 5.891   1.00 10.82 ? 75  PHE B C   1 
ATOM   2433 O  O   . PHE B 1 75  ? -6.605  -13.936 6.448   1.00 8.26  ? 75  PHE B O   1 
ATOM   2434 C  CB  . PHE B 1 75  ? -5.172  -11.153 5.196   1.00 11.37 ? 75  PHE B CB  1 
ATOM   2435 C  CG  . PHE B 1 75  ? -4.180  -12.204 4.774   1.00 13.25 ? 75  PHE B CG  1 
ATOM   2436 C  CD1 . PHE B 1 75  ? -2.937  -12.306 5.399   1.00 16.64 ? 75  PHE B CD1 1 
ATOM   2437 C  CD2 . PHE B 1 75  ? -4.507  -13.124 3.779   1.00 9.38  ? 75  PHE B CD2 1 
ATOM   2438 C  CE1 . PHE B 1 75  ? -2.029  -13.318 5.036   1.00 19.16 ? 75  PHE B CE1 1 
ATOM   2439 C  CE2 . PHE B 1 75  ? -3.615  -14.137 3.409   1.00 14.95 ? 75  PHE B CE2 1 
ATOM   2440 C  CZ  . PHE B 1 75  ? -2.371  -14.236 4.038   1.00 16.39 ? 75  PHE B CZ  1 
ATOM   2441 N  N   . SER B 1 76  ? -7.670  -12.718 4.886   1.00 10.59 ? 76  SER B N   1 
ATOM   2442 C  CA  . SER B 1 76  ? -8.401  -13.837 4.336   1.00 13.26 ? 76  SER B CA  1 
ATOM   2443 C  C   . SER B 1 76  ? -8.502  -13.604 2.844   1.00 12.80 ? 76  SER B C   1 
ATOM   2444 O  O   . SER B 1 76  ? -8.531  -12.461 2.388   1.00 11.65 ? 76  SER B O   1 
ATOM   2445 C  CB  . SER B 1 76  ? -9.796  -13.937 4.969   1.00 15.17 ? 76  SER B CB  1 
ATOM   2446 O  OG  . SER B 1 76  ? -10.510 -12.722 4.835   1.00 21.23 ? 76  SER B OG  1 
ATOM   2447 N  N   . LEU B 1 77  ? -8.537  -14.690 2.086   1.00 14.09 ? 77  LEU B N   1 
ATOM   2448 C  CA  . LEU B 1 77  ? -8.633  -14.608 0.635   1.00 14.68 ? 77  LEU B CA  1 
ATOM   2449 C  C   . LEU B 1 77  ? -9.884  -15.385 0.235   1.00 15.36 ? 77  LEU B C   1 
ATOM   2450 O  O   . LEU B 1 77  ? -10.227 -16.384 0.861   1.00 14.39 ? 77  LEU B O   1 
ATOM   2451 C  CB  . LEU B 1 77  ? -7.396  -15.238 -0.012  1.00 12.29 ? 77  LEU B CB  1 
ATOM   2452 C  CG  . LEU B 1 77  ? -6.023  -14.781 0.507   1.00 16.31 ? 77  LEU B CG  1 
ATOM   2453 C  CD1 . LEU B 1 77  ? -4.932  -15.643 -0.123  1.00 14.74 ? 77  LEU B CD1 1 
ATOM   2454 C  CD2 . LEU B 1 77  ? -5.798  -13.300 0.209   1.00 10.98 ? 77  LEU B CD2 1 
ATOM   2455 N  N   . LYS B 1 78  ? -10.577 -14.929 -0.797  1.00 14.70 ? 78  LYS B N   1 
ATOM   2456 C  CA  . LYS B 1 78  ? -11.772 -15.631 -1.212  1.00 16.94 ? 78  LYS B CA  1 
ATOM   2457 C  C   . LYS B 1 78  ? -11.986 -15.502 -2.710  1.00 18.59 ? 78  LYS B C   1 
ATOM   2458 O  O   . LYS B 1 78  ? -11.793 -14.432 -3.293  1.00 18.95 ? 78  LYS B O   1 
ATOM   2459 C  CB  . LYS B 1 78  ? -12.973 -15.091 -0.430  1.00 21.20 ? 78  LYS B CB  1 
ATOM   2460 C  CG  . LYS B 1 78  ? -14.250 -15.884 -0.604  1.00 28.44 ? 78  LYS B CG  1 
ATOM   2461 C  CD  . LYS B 1 78  ? -15.178 -15.706 0.601   1.00 32.82 ? 78  LYS B CD  1 
ATOM   2462 C  CE  . LYS B 1 78  ? -15.505 -14.244 0.861   1.00 35.51 ? 78  LYS B CE  1 
ATOM   2463 N  N   . SER B 1 79  ? -12.365 -16.607 -3.337  1.00 17.51 ? 79  SER B N   1 
ATOM   2464 C  CA  . SER B 1 79  ? -12.604 -16.604 -4.770  1.00 17.97 ? 79  SER B CA  1 
ATOM   2465 C  C   . SER B 1 79  ? -13.402 -17.810 -5.214  1.00 16.29 ? 79  SER B C   1 
ATOM   2466 O  O   . SER B 1 79  ? -13.165 -18.924 -4.751  1.00 16.99 ? 79  SER B O   1 
ATOM   2467 C  CB  . SER B 1 79  ? -11.282 -16.584 -5.538  1.00 14.49 ? 79  SER B CB  1 
ATOM   2468 O  OG  . SER B 1 79  ? -11.524 -16.684 -6.929  1.00 15.08 ? 79  SER B OG  1 
ATOM   2469 N  N   . PRO B 1 80  ? -14.379 -17.593 -6.106  1.00 16.94 ? 80  PRO B N   1 
ATOM   2470 C  CA  . PRO B 1 80  ? -15.226 -18.660 -6.635  1.00 19.19 ? 80  PRO B CA  1 
ATOM   2471 C  C   . PRO B 1 80  ? -14.437 -19.504 -7.631  1.00 18.36 ? 80  PRO B C   1 
ATOM   2472 O  O   . PRO B 1 80  ? -14.885 -20.572 -8.038  1.00 22.68 ? 80  PRO B O   1 
ATOM   2473 C  CB  . PRO B 1 80  ? -16.356 -17.881 -7.297  1.00 18.66 ? 80  PRO B CB  1 
ATOM   2474 C  CG  . PRO B 1 80  ? -15.600 -16.706 -7.866  1.00 21.51 ? 80  PRO B CG  1 
ATOM   2475 C  CD  . PRO B 1 80  ? -14.827 -16.290 -6.631  1.00 17.50 ? 80  PRO B CD  1 
ATOM   2476 N  N   . LEU B 1 81  ? -13.262 -19.014 -8.019  1.00 19.73 ? 81  LEU B N   1 
ATOM   2477 C  CA  . LEU B 1 81  ? -12.394 -19.721 -8.969  1.00 19.77 ? 81  LEU B CA  1 
ATOM   2478 C  C   . LEU B 1 81  ? -11.557 -20.757 -8.236  1.00 19.35 ? 81  LEU B C   1 
ATOM   2479 O  O   . LEU B 1 81  ? -11.367 -20.664 -7.025  1.00 19.58 ? 81  LEU B O   1 
ATOM   2480 C  CB  . LEU B 1 81  ? -11.428 -18.754 -9.657  1.00 15.57 ? 81  LEU B CB  1 
ATOM   2481 C  CG  . LEU B 1 81  ? -11.986 -17.533 -10.374 1.00 19.98 ? 81  LEU B CG  1 
ATOM   2482 C  CD1 . LEU B 1 81  ? -10.823 -16.707 -10.907 1.00 16.07 ? 81  LEU B CD1 1 
ATOM   2483 C  CD2 . LEU B 1 81  ? -12.916 -17.969 -11.498 1.00 19.54 ? 81  LEU B CD2 1 
ATOM   2484 N  N   . SER B 1 82  ? -11.044 -21.732 -8.978  1.00 16.89 ? 82  SER B N   1 
ATOM   2485 C  CA  . SER B 1 82  ? -10.206 -22.767 -8.391  1.00 18.43 ? 82  SER B CA  1 
ATOM   2486 C  C   . SER B 1 82  ? -8.757  -22.270 -8.290  1.00 18.36 ? 82  SER B C   1 
ATOM   2487 O  O   . SER B 1 82  ? -7.944  -22.850 -7.576  1.00 17.75 ? 82  SER B O   1 
ATOM   2488 C  CB  . SER B 1 82  ? -10.261 -24.031 -9.251  1.00 18.67 ? 82  SER B CB  1 
ATOM   2489 O  OG  . SER B 1 82  ? -9.792  -23.760 -10.561 1.00 18.20 ? 82  SER B OG  1 
ATOM   2490 N  N   . ASN B 1 83  ? -8.443  -21.194 -9.007  1.00 19.97 ? 83  ASN B N   1 
ATOM   2491 C  CA  . ASN B 1 83  ? -7.092  -20.631 -9.003  1.00 21.94 ? 83  ASN B CA  1 
ATOM   2492 C  C   . ASN B 1 83  ? -7.039  -19.146 -8.655  1.00 18.17 ? 83  ASN B C   1 
ATOM   2493 O  O   . ASN B 1 83  ? -6.531  -18.347 -9.440  1.00 19.72 ? 83  ASN B O   1 
ATOM   2494 C  CB  . ASN B 1 83  ? -6.422  -20.819 -10.372 1.00 31.48 ? 83  ASN B CB  1 
ATOM   2495 C  CG  . ASN B 1 83  ? -6.210  -22.277 -10.735 1.00 39.71 ? 83  ASN B CG  1 
ATOM   2496 O  OD1 . ASN B 1 83  ? -5.639  -22.586 -11.783 1.00 46.66 ? 83  ASN B OD1 1 
ATOM   2497 N  ND2 . ASN B 1 83  ? -6.669  -23.181 -9.877  1.00 44.68 ? 83  ASN B ND2 1 
ATOM   2498 N  N   . GLY B 1 84  ? -7.555  -18.772 -7.492  1.00 16.87 ? 84  GLY B N   1 
ATOM   2499 C  CA  . GLY B 1 84  ? -7.518  -17.376 -7.096  1.00 14.57 ? 84  GLY B CA  1 
ATOM   2500 C  C   . GLY B 1 84  ? -6.099  -16.832 -7.156  1.00 16.22 ? 84  GLY B C   1 
ATOM   2501 O  O   . GLY B 1 84  ? -5.142  -17.519 -6.788  1.00 14.11 ? 84  GLY B O   1 
ATOM   2502 N  N   . ALA B 1 85  ? -5.966  -15.594 -7.621  1.00 13.16 ? 85  ALA B N   1 
ATOM   2503 C  CA  . ALA B 1 85  ? -4.670  -14.943 -7.753  1.00 13.21 ? 85  ALA B CA  1 
ATOM   2504 C  C   . ALA B 1 85  ? -4.822  -13.477 -7.357  1.00 12.62 ? 85  ALA B C   1 
ATOM   2505 O  O   . ALA B 1 85  ? -5.942  -12.965 -7.318  1.00 14.09 ? 85  ALA B O   1 
ATOM   2506 C  CB  . ALA B 1 85  ? -4.191  -15.054 -9.194  1.00 9.48  ? 85  ALA B CB  1 
ATOM   2507 N  N   . ASP B 1 86  ? -3.715  -12.779 -7.097  1.00 12.81 ? 86  ASP B N   1 
ATOM   2508 C  CA  . ASP B 1 86  ? -2.363  -13.319 -7.169  1.00 12.52 ? 86  ASP B CA  1 
ATOM   2509 C  C   . ASP B 1 86  ? -1.652  -13.450 -5.834  1.00 15.39 ? 86  ASP B C   1 
ATOM   2510 O  O   . ASP B 1 86  ? -0.631  -14.133 -5.739  1.00 12.42 ? 86  ASP B O   1 
ATOM   2511 C  CB  . ASP B 1 86  ? -1.526  -12.446 -8.095  1.00 11.83 ? 86  ASP B CB  1 
ATOM   2512 C  CG  . ASP B 1 86  ? -1.721  -12.800 -9.547  1.00 10.70 ? 86  ASP B CG  1 
ATOM   2513 O  OD1 . ASP B 1 86  ? -1.111  -13.794 -9.986  1.00 16.02 ? 86  ASP B OD1 1 
ATOM   2514 O  OD2 . ASP B 1 86  ? -2.495  -12.106 -10.238 1.00 17.82 ? 86  ASP B OD2 1 
ATOM   2515 N  N   . GLY B 1 87  ? -2.174  -12.787 -4.809  1.00 14.37 ? 87  GLY B N   1 
ATOM   2516 C  CA  . GLY B 1 87  ? -1.546  -12.865 -3.503  1.00 17.12 ? 87  GLY B CA  1 
ATOM   2517 C  C   . GLY B 1 87  ? -1.467  -11.525 -2.795  1.00 16.81 ? 87  GLY B C   1 
ATOM   2518 O  O   . GLY B 1 87  ? -1.725  -10.477 -3.390  1.00 18.33 ? 87  GLY B O   1 
ATOM   2519 N  N   . ILE B 1 88  ? -1.109  -11.566 -1.517  1.00 13.03 ? 88  ILE B N   1 
ATOM   2520 C  CA  . ILE B 1 88  ? -0.995  -10.361 -0.709  1.00 11.47 ? 88  ILE B CA  1 
ATOM   2521 C  C   . ILE B 1 88  ? 0.404   -10.311 -0.102  1.00 12.73 ? 88  ILE B C   1 
ATOM   2522 O  O   . ILE B 1 88  ? 1.040   -11.343 0.085   1.00 11.67 ? 88  ILE B O   1 
ATOM   2523 C  CB  . ILE B 1 88  ? -2.045  -10.363 0.429   1.00 10.89 ? 88  ILE B CB  1 
ATOM   2524 C  CG1 . ILE B 1 88  ? -1.887  -9.109  1.290   1.00 10.77 ? 88  ILE B CG1 1 
ATOM   2525 C  CG2 . ILE B 1 88  ? -1.897  -11.626 1.280   1.00 9.58  ? 88  ILE B CG2 1 
ATOM   2526 C  CD1 . ILE B 1 88  ? -2.850  -9.044  2.460   1.00 10.77 ? 88  ILE B CD1 1 
ATOM   2527 N  N   . ALA B 1 89  ? 0.890   -9.116  0.202   1.00 13.23 ? 89  ALA B N   1 
ATOM   2528 C  CA  . ALA B 1 89  ? 2.214   -9.002  0.790   1.00 13.89 ? 89  ALA B CA  1 
ATOM   2529 C  C   . ALA B 1 89  ? 2.328   -7.852  1.768   1.00 14.53 ? 89  ALA B C   1 
ATOM   2530 O  O   . ALA B 1 89  ? 1.726   -6.796  1.571   1.00 14.69 ? 89  ALA B O   1 
ATOM   2531 C  CB  . ALA B 1 89  ? 3.269   -8.837  -0.311  1.00 9.93  ? 89  ALA B CB  1 
ATOM   2532 N  N   . PHE B 1 90  ? 3.085   -8.087  2.836   1.00 11.10 ? 90  PHE B N   1 
ATOM   2533 C  CA  . PHE B 1 90  ? 3.383   -7.070  3.831   1.00 10.55 ? 90  PHE B CA  1 
ATOM   2534 C  C   . PHE B 1 90  ? 4.743   -6.620  3.322   1.00 11.00 ? 90  PHE B C   1 
ATOM   2535 O  O   . PHE B 1 90  ? 5.587   -7.462  3.015   1.00 9.82  ? 90  PHE B O   1 
ATOM   2536 C  CB  . PHE B 1 90  ? 3.536   -7.694  5.226   1.00 12.25 ? 90  PHE B CB  1 
ATOM   2537 C  CG  . PHE B 1 90  ? 4.238   -6.800  6.219   1.00 14.21 ? 90  PHE B CG  1 
ATOM   2538 C  CD1 . PHE B 1 90  ? 3.667   -5.596  6.625   1.00 16.37 ? 90  PHE B CD1 1 
ATOM   2539 C  CD2 . PHE B 1 90  ? 5.496   -7.139  6.706   1.00 13.04 ? 90  PHE B CD2 1 
ATOM   2540 C  CE1 . PHE B 1 90  ? 4.340   -4.744  7.497   1.00 17.91 ? 90  PHE B CE1 1 
ATOM   2541 C  CE2 . PHE B 1 90  ? 6.175   -6.297  7.575   1.00 15.15 ? 90  PHE B CE2 1 
ATOM   2542 C  CZ  . PHE B 1 90  ? 5.595   -5.093  7.972   1.00 15.53 ? 90  PHE B CZ  1 
ATOM   2543 N  N   . PHE B 1 91  ? 4.968   -5.319  3.194   1.00 10.24 ? 91  PHE B N   1 
ATOM   2544 C  CA  . PHE B 1 91  ? 6.267   -4.872  2.698   1.00 10.51 ? 91  PHE B CA  1 
ATOM   2545 C  C   . PHE B 1 91  ? 6.823   -3.648  3.396   1.00 12.18 ? 91  PHE B C   1 
ATOM   2546 O  O   . PHE B 1 91  ? 6.122   -2.946  4.133   1.00 12.79 ? 91  PHE B O   1 
ATOM   2547 C  CB  . PHE B 1 91  ? 6.228   -4.609  1.180   1.00 9.50  ? 91  PHE B CB  1 
ATOM   2548 C  CG  . PHE B 1 91  ? 5.408   -3.414  0.780   1.00 10.26 ? 91  PHE B CG  1 
ATOM   2549 C  CD1 . PHE B 1 91  ? 4.026   -3.415  0.916   1.00 12.36 ? 91  PHE B CD1 1 
ATOM   2550 C  CD2 . PHE B 1 91  ? 6.026   -2.284  0.250   1.00 13.05 ? 91  PHE B CD2 1 
ATOM   2551 C  CE1 . PHE B 1 91  ? 3.266   -2.309  0.527   1.00 13.33 ? 91  PHE B CE1 1 
ATOM   2552 C  CE2 . PHE B 1 91  ? 5.278   -1.171  -0.141  1.00 16.42 ? 91  PHE B CE2 1 
ATOM   2553 C  CZ  . PHE B 1 91  ? 3.895   -1.186  -0.002  1.00 17.25 ? 91  PHE B CZ  1 
ATOM   2554 N  N   . ILE B 1 92  ? 8.102   -3.407  3.149   1.00 14.16 ? 92  ILE B N   1 
ATOM   2555 C  CA  . ILE B 1 92  ? 8.819   -2.285  3.727   1.00 14.85 ? 92  ILE B CA  1 
ATOM   2556 C  C   . ILE B 1 92  ? 9.592   -1.673  2.572   1.00 17.42 ? 92  ILE B C   1 
ATOM   2557 O  O   . ILE B 1 92  ? 10.376  -2.358  1.915   1.00 20.05 ? 92  ILE B O   1 
ATOM   2558 C  CB  . ILE B 1 92  ? 9.808   -2.774  4.780   1.00 13.61 ? 92  ILE B CB  1 
ATOM   2559 C  CG1 . ILE B 1 92  ? 9.086   -3.689  5.766   1.00 11.87 ? 92  ILE B CG1 1 
ATOM   2560 C  CG2 . ILE B 1 92  ? 10.424  -1.590  5.505   1.00 14.87 ? 92  ILE B CG2 1 
ATOM   2561 C  CD1 . ILE B 1 92  ? 10.001  -4.333  6.772   1.00 15.63 ? 92  ILE B CD1 1 
ATOM   2562 N  N   . ALA B 1 93  ? 9.372   -0.391  2.319   1.00 16.80 ? 93  ALA B N   1 
ATOM   2563 C  CA  . ALA B 1 93  ? 10.045  0.279   1.216   1.00 16.46 ? 93  ALA B CA  1 
ATOM   2564 C  C   . ALA B 1 93  ? 10.317  1.740   1.560   1.00 18.67 ? 93  ALA B C   1 
ATOM   2565 O  O   . ALA B 1 93  ? 9.910   2.215   2.621   1.00 15.45 ? 93  ALA B O   1 
ATOM   2566 C  CB  . ALA B 1 93  ? 9.173   0.190   -0.033  1.00 15.99 ? 93  ALA B CB  1 
ATOM   2567 N  N   . PRO B 1 94  ? 11.034  2.464   0.674   1.00 17.79 ? 94  PRO B N   1 
ATOM   2568 C  CA  . PRO B 1 94  ? 11.341  3.876   0.902   1.00 17.73 ? 94  PRO B CA  1 
ATOM   2569 C  C   . PRO B 1 94  ? 10.023  4.629   1.075   1.00 17.63 ? 94  PRO B C   1 
ATOM   2570 O  O   . PRO B 1 94  ? 9.009   4.242   0.509   1.00 17.37 ? 94  PRO B O   1 
ATOM   2571 C  CB  . PRO B 1 94  ? 12.085  4.265   -0.375  1.00 18.59 ? 94  PRO B CB  1 
ATOM   2572 C  CG  . PRO B 1 94  ? 12.794  2.972   -0.726  1.00 19.52 ? 94  PRO B CG  1 
ATOM   2573 C  CD  . PRO B 1 94  ? 11.624  2.027   -0.604  1.00 16.82 ? 94  PRO B CD  1 
ATOM   2574 N  N   . PRO B 1 95  ? 10.034  5.730   1.838   1.00 17.60 ? 95  PRO B N   1 
ATOM   2575 C  CA  . PRO B 1 95  ? 8.852   6.551   2.111   1.00 19.00 ? 95  PRO B CA  1 
ATOM   2576 C  C   . PRO B 1 95  ? 8.019   7.005   0.921   1.00 18.93 ? 95  PRO B C   1 
ATOM   2577 O  O   . PRO B 1 95  ? 6.799   7.099   1.023   1.00 20.06 ? 95  PRO B O   1 
ATOM   2578 C  CB  . PRO B 1 95  ? 9.441   7.728   2.889   1.00 18.46 ? 95  PRO B CB  1 
ATOM   2579 C  CG  . PRO B 1 95  ? 10.572  7.071   3.636   1.00 20.62 ? 95  PRO B CG  1 
ATOM   2580 C  CD  . PRO B 1 95  ? 11.211  6.339   2.478   1.00 19.13 ? 95  PRO B CD  1 
ATOM   2581 N  N   . ASP B 1 96  ? 8.667   7.293   -0.201  1.00 19.07 ? 96  ASP B N   1 
ATOM   2582 C  CA  . ASP B 1 96  ? 7.950   7.771   -1.376  1.00 20.93 ? 96  ASP B CA  1 
ATOM   2583 C  C   . ASP B 1 96  ? 7.489   6.683   -2.338  1.00 21.48 ? 96  ASP B C   1 
ATOM   2584 O  O   . ASP B 1 96  ? 7.126   6.981   -3.472  1.00 21.93 ? 96  ASP B O   1 
ATOM   2585 C  CB  . ASP B 1 96  ? 8.811   8.775   -2.149  1.00 24.73 ? 96  ASP B CB  1 
ATOM   2586 C  CG  . ASP B 1 96  ? 10.143  8.191   -2.590  1.00 32.51 ? 96  ASP B CG  1 
ATOM   2587 O  OD1 . ASP B 1 96  ? 10.822  8.830   -3.422  1.00 39.56 ? 96  ASP B OD1 1 
ATOM   2588 O  OD2 . ASP B 1 96  ? 10.523  7.105   -2.100  1.00 33.02 ? 96  ASP B OD2 1 
ATOM   2589 N  N   . THR B 1 97  ? 7.489   5.431   -1.891  1.00 20.23 ? 97  THR B N   1 
ATOM   2590 C  CA  . THR B 1 97  ? 7.081   4.324   -2.750  1.00 19.02 ? 97  THR B CA  1 
ATOM   2591 C  C   . THR B 1 97  ? 5.655   4.460   -3.282  1.00 18.96 ? 97  THR B C   1 
ATOM   2592 O  O   . THR B 1 97  ? 4.740   4.845   -2.552  1.00 18.64 ? 97  THR B O   1 
ATOM   2593 C  CB  . THR B 1 97  ? 7.196   2.970   -2.007  1.00 20.78 ? 97  THR B CB  1 
ATOM   2594 O  OG1 . THR B 1 97  ? 6.847   1.906   -2.899  1.00 19.38 ? 97  THR B OG1 1 
ATOM   2595 C  CG2 . THR B 1 97  ? 6.261   2.934   -0.799  1.00 16.55 ? 97  THR B CG2 1 
ATOM   2596 N  N   . THR B 1 98  ? 5.484   4.159   -4.567  1.00 20.02 ? 98  THR B N   1 
ATOM   2597 C  CA  . THR B 1 98  ? 4.176   4.196   -5.225  1.00 19.73 ? 98  THR B CA  1 
ATOM   2598 C  C   . THR B 1 98  ? 4.067   2.931   -6.066  1.00 18.67 ? 98  THR B C   1 
ATOM   2599 O  O   . THR B 1 98  ? 5.061   2.238   -6.280  1.00 20.20 ? 98  THR B O   1 
ATOM   2600 C  CB  . THR B 1 98  ? 4.011   5.417   -6.166  1.00 20.27 ? 98  THR B CB  1 
ATOM   2601 O  OG1 . THR B 1 98  ? 5.068   5.427   -7.130  1.00 21.20 ? 98  THR B OG1 1 
ATOM   2602 C  CG2 . THR B 1 98  ? 4.028   6.710   -5.382  1.00 22.46 ? 98  THR B CG2 1 
ATOM   2603 N  N   . ILE B 1 99  ? 2.862   2.621   -6.531  1.00 17.41 ? 99  ILE B N   1 
ATOM   2604 C  CA  . ILE B 1 99  ? 2.655   1.431   -7.344  1.00 18.59 ? 99  ILE B CA  1 
ATOM   2605 C  C   . ILE B 1 99  ? 3.391   1.570   -8.674  1.00 19.13 ? 99  ILE B C   1 
ATOM   2606 O  O   . ILE B 1 99  ? 3.116   2.487   -9.443  1.00 19.46 ? 99  ILE B O   1 
ATOM   2607 C  CB  . ILE B 1 99  ? 1.165   1.211   -7.652  1.00 16.97 ? 99  ILE B CB  1 
ATOM   2608 C  CG1 . ILE B 1 99  ? 0.382   0.997   -6.353  1.00 16.89 ? 99  ILE B CG1 1 
ATOM   2609 C  CG2 . ILE B 1 99  ? 1.010   0.027   -8.589  1.00 14.11 ? 99  ILE B CG2 1 
ATOM   2610 C  CD1 . ILE B 1 99  ? -1.122  0.866   -6.554  1.00 14.15 ? 99  ILE B CD1 1 
ATOM   2611 N  N   . PRO B 1 100 ? 4.338   0.659   -8.958  1.00 21.40 ? 100 PRO B N   1 
ATOM   2612 C  CA  . PRO B 1 100 ? 5.121   0.668   -10.199 1.00 20.69 ? 100 PRO B CA  1 
ATOM   2613 C  C   . PRO B 1 100 ? 4.227   0.472   -11.423 1.00 22.63 ? 100 PRO B C   1 
ATOM   2614 O  O   . PRO B 1 100 ? 3.219   -0.232  -11.359 1.00 19.24 ? 100 PRO B O   1 
ATOM   2615 C  CB  . PRO B 1 100 ? 6.077   -0.510  -10.002 1.00 19.17 ? 100 PRO B CB  1 
ATOM   2616 C  CG  . PRO B 1 100 ? 6.228   -0.567  -8.484  1.00 24.83 ? 100 PRO B CG  1 
ATOM   2617 C  CD  . PRO B 1 100 ? 4.764   -0.471  -8.115  1.00 24.00 ? 100 PRO B CD  1 
ATOM   2618 N  N   . SER B 1 101 ? 4.594   1.092   -12.538 1.00 26.12 ? 101 SER B N   1 
ATOM   2619 C  CA  . SER B 1 101 ? 3.802   0.947   -13.753 1.00 26.80 ? 101 SER B CA  1 
ATOM   2620 C  C   . SER B 1 101 ? 3.902   -0.497  -14.232 1.00 25.02 ? 101 SER B C   1 
ATOM   2621 O  O   . SER B 1 101 ? 5.000   -1.033  -14.367 1.00 28.65 ? 101 SER B O   1 
ATOM   2622 C  CB  . SER B 1 101 ? 4.316   1.892   -14.837 1.00 30.22 ? 101 SER B CB  1 
ATOM   2623 O  OG  . SER B 1 101 ? 3.540   1.768   -16.014 1.00 37.68 ? 101 SER B OG  1 
ATOM   2624 N  N   . GLY B 1 102 ? 2.753   -1.125  -14.467 1.00 23.31 ? 102 GLY B N   1 
ATOM   2625 C  CA  . GLY B 1 102 ? 2.726   -2.501  -14.932 1.00 22.14 ? 102 GLY B CA  1 
ATOM   2626 C  C   . GLY B 1 102 ? 3.089   -3.536  -13.882 1.00 22.92 ? 102 GLY B C   1 
ATOM   2627 O  O   . GLY B 1 102 ? 3.579   -4.615  -14.213 1.00 23.67 ? 102 GLY B O   1 
ATOM   2628 N  N   . SER B 1 103 ? 2.836   -3.221  -12.617 1.00 22.54 ? 103 SER B N   1 
ATOM   2629 C  CA  . SER B 1 103 ? 3.162   -4.130  -11.521 1.00 21.50 ? 103 SER B CA  1 
ATOM   2630 C  C   . SER B 1 103 ? 2.012   -5.049  -11.119 1.00 20.39 ? 103 SER B C   1 
ATOM   2631 O  O   . SER B 1 103 ? 2.042   -5.654  -10.048 1.00 19.45 ? 103 SER B O   1 
ATOM   2632 C  CB  . SER B 1 103 ? 3.603   -3.327  -10.297 1.00 20.03 ? 103 SER B CB  1 
ATOM   2633 O  OG  . SER B 1 103 ? 2.567   -2.459  -9.873  1.00 19.35 ? 103 SER B OG  1 
ATOM   2634 N  N   . GLY B 1 104 ? 1.003   -5.157  -11.975 1.00 18.31 ? 104 GLY B N   1 
ATOM   2635 C  CA  . GLY B 1 104 ? -0.136  -5.995  -11.654 1.00 16.41 ? 104 GLY B CA  1 
ATOM   2636 C  C   . GLY B 1 104 ? 0.140   -7.486  -11.595 1.00 18.17 ? 104 GLY B C   1 
ATOM   2637 O  O   . GLY B 1 104 ? 1.286   -7.937  -11.723 1.00 18.38 ? 104 GLY B O   1 
ATOM   2638 N  N   . GLY B 1 105 ? -0.927  -8.252  -11.386 1.00 15.71 ? 105 GLY B N   1 
ATOM   2639 C  CA  . GLY B 1 105 ? -0.827  -9.701  -11.325 1.00 15.20 ? 105 GLY B CA  1 
ATOM   2640 C  C   . GLY B 1 105 ? 0.299   -10.277 -10.487 1.00 15.51 ? 105 GLY B C   1 
ATOM   2641 O  O   . GLY B 1 105 ? 0.475   -9.912  -9.323  1.00 12.89 ? 105 GLY B O   1 
ATOM   2642 N  N   . GLY B 1 106 ? 1.061   -11.185 -11.093 1.00 15.94 ? 106 GLY B N   1 
ATOM   2643 C  CA  . GLY B 1 106 ? 2.166   -11.836 -10.411 1.00 13.14 ? 106 GLY B CA  1 
ATOM   2644 C  C   . GLY B 1 106 ? 3.223   -10.931 -9.802  1.00 14.28 ? 106 GLY B C   1 
ATOM   2645 O  O   . GLY B 1 106 ? 4.019   -11.384 -8.977  1.00 14.22 ? 106 GLY B O   1 
ATOM   2646 N  N   . LEU B 1 107 ? 3.254   -9.662  -10.194 1.00 14.14 ? 107 LEU B N   1 
ATOM   2647 C  CA  . LEU B 1 107 ? 4.246   -8.754  -9.630  1.00 16.77 ? 107 LEU B CA  1 
ATOM   2648 C  C   . LEU B 1 107 ? 3.760   -8.161  -8.312  1.00 18.70 ? 107 LEU B C   1 
ATOM   2649 O  O   . LEU B 1 107 ? 4.460   -7.374  -7.673  1.00 18.54 ? 107 LEU B O   1 
ATOM   2650 C  CB  . LEU B 1 107 ? 4.610   -7.653  -10.634 1.00 17.48 ? 107 LEU B CB  1 
ATOM   2651 C  CG  . LEU B 1 107 ? 5.268   -8.181  -11.920 1.00 18.30 ? 107 LEU B CG  1 
ATOM   2652 C  CD1 . LEU B 1 107 ? 5.727   -7.016  -12.773 1.00 17.54 ? 107 LEU B CD1 1 
ATOM   2653 C  CD2 . LEU B 1 107 ? 6.457   -9.073  -11.571 1.00 16.97 ? 107 LEU B CD2 1 
ATOM   2654 N  N   . LEU B 1 108 ? 2.549   -8.548  -7.920  1.00 18.02 ? 108 LEU B N   1 
ATOM   2655 C  CA  . LEU B 1 108 ? 1.958   -8.132  -6.655  1.00 17.25 ? 108 LEU B CA  1 
ATOM   2656 C  C   . LEU B 1 108 ? 1.910   -6.633  -6.380  1.00 20.15 ? 108 LEU B C   1 
ATOM   2657 O  O   . LEU B 1 108 ? 1.730   -6.218  -5.235  1.00 20.41 ? 108 LEU B O   1 
ATOM   2658 C  CB  . LEU B 1 108 ? 2.699   -8.834  -5.513  1.00 15.59 ? 108 LEU B CB  1 
ATOM   2659 C  CG  . LEU B 1 108 ? 2.647   -10.364 -5.550  1.00 20.57 ? 108 LEU B CG  1 
ATOM   2660 C  CD1 . LEU B 1 108 ? 3.457   -10.950 -4.408  1.00 15.84 ? 108 LEU B CD1 1 
ATOM   2661 C  CD2 . LEU B 1 108 ? 1.196   -10.817 -5.455  1.00 19.68 ? 108 LEU B CD2 1 
ATOM   2662 N  N   . GLY B 1 109 ? 2.068   -5.820  -7.417  1.00 18.15 ? 109 GLY B N   1 
ATOM   2663 C  CA  . GLY B 1 109 ? 2.033   -4.382  -7.221  1.00 17.85 ? 109 GLY B CA  1 
ATOM   2664 C  C   . GLY B 1 109 ? 3.270   -3.883  -6.494  1.00 19.21 ? 109 GLY B C   1 
ATOM   2665 O  O   . GLY B 1 109 ? 3.281   -2.779  -5.952  1.00 19.34 ? 109 GLY B O   1 
ATOM   2666 N  N   . LEU B 1 110 ? 4.317   -4.700  -6.484  1.00 17.05 ? 110 LEU B N   1 
ATOM   2667 C  CA  . LEU B 1 110 ? 5.564   -4.345  -5.822  1.00 17.12 ? 110 LEU B CA  1 
ATOM   2668 C  C   . LEU B 1 110 ? 6.716   -4.073  -6.798  1.00 20.12 ? 110 LEU B C   1 
ATOM   2669 O  O   . LEU B 1 110 ? 7.577   -3.230  -6.531  1.00 17.69 ? 110 LEU B O   1 
ATOM   2670 C  CB  . LEU B 1 110 ? 5.977   -5.459  -4.857  1.00 13.78 ? 110 LEU B CB  1 
ATOM   2671 C  CG  . LEU B 1 110 ? 5.088   -5.700  -3.633  1.00 16.62 ? 110 LEU B CG  1 
ATOM   2672 C  CD1 . LEU B 1 110 ? 5.543   -6.949  -2.897  1.00 9.72  ? 110 LEU B CD1 1 
ATOM   2673 C  CD2 . LEU B 1 110 ? 5.143   -4.479  -2.720  1.00 11.80 ? 110 LEU B CD2 1 
ATOM   2674 N  N   . PHE B 1 111 ? 6.742   -4.782  -7.924  1.00 19.99 ? 111 PHE B N   1 
ATOM   2675 C  CA  . PHE B 1 111 ? 7.823   -4.587  -8.884  1.00 20.01 ? 111 PHE B CA  1 
ATOM   2676 C  C   . PHE B 1 111 ? 7.366   -4.252  -10.293 1.00 22.81 ? 111 PHE B C   1 
ATOM   2677 O  O   . PHE B 1 111 ? 6.271   -4.630  -10.716 1.00 22.06 ? 111 PHE B O   1 
ATOM   2678 C  CB  . PHE B 1 111 ? 8.710   -5.830  -8.975  1.00 19.40 ? 111 PHE B CB  1 
ATOM   2679 C  CG  . PHE B 1 111 ? 9.245   -6.303  -7.658  1.00 20.37 ? 111 PHE B CG  1 
ATOM   2680 C  CD1 . PHE B 1 111 ? 8.490   -7.140  -6.848  1.00 16.94 ? 111 PHE B CD1 1 
ATOM   2681 C  CD2 . PHE B 1 111 ? 10.508  -5.910  -7.224  1.00 19.52 ? 111 PHE B CD2 1 
ATOM   2682 C  CE1 . PHE B 1 111 ? 8.986   -7.579  -5.631  1.00 16.58 ? 111 PHE B CE1 1 
ATOM   2683 C  CE2 . PHE B 1 111 ? 11.010  -6.345  -6.005  1.00 14.17 ? 111 PHE B CE2 1 
ATOM   2684 C  CZ  . PHE B 1 111 ? 10.248  -7.180  -5.209  1.00 19.00 ? 111 PHE B CZ  1 
ATOM   2685 N  N   . ALA B 1 112 ? 8.237   -3.544  -11.009 1.00 23.18 ? 112 ALA B N   1 
ATOM   2686 C  CA  . ALA B 1 112 ? 8.008   -3.161  -12.394 1.00 22.39 ? 112 ALA B CA  1 
ATOM   2687 C  C   . ALA B 1 112 ? 8.524   -4.339  -13.207 1.00 23.04 ? 112 ALA B C   1 
ATOM   2688 O  O   . ALA B 1 112 ? 9.563   -4.909  -12.884 1.00 22.18 ? 112 ALA B O   1 
ATOM   2689 C  CB  . ALA B 1 112 ? 8.798   -1.912  -12.726 1.00 23.76 ? 112 ALA B CB  1 
ATOM   2690 N  N   . PRO B 1 113 ? 7.821   -4.704  -14.288 1.00 24.19 ? 113 PRO B N   1 
ATOM   2691 C  CA  . PRO B 1 113 ? 8.220   -5.830  -15.135 1.00 25.82 ? 113 PRO B CA  1 
ATOM   2692 C  C   . PRO B 1 113 ? 9.689   -5.858  -15.543 1.00 27.00 ? 113 PRO B C   1 
ATOM   2693 O  O   . PRO B 1 113 ? 10.346  -6.895  -15.455 1.00 29.15 ? 113 PRO B O   1 
ATOM   2694 C  CB  . PRO B 1 113 ? 7.284   -5.687  -16.330 1.00 25.58 ? 113 PRO B CB  1 
ATOM   2695 C  CG  . PRO B 1 113 ? 6.034   -5.179  -15.675 1.00 28.20 ? 113 PRO B CG  1 
ATOM   2696 C  CD  . PRO B 1 113 ? 6.629   -4.053  -14.856 1.00 24.16 ? 113 PRO B CD  1 
ATOM   2697 N  N   . GLY B 1 114 ? 10.203  -4.715  -15.981 1.00 29.03 ? 114 GLY B N   1 
ATOM   2698 C  CA  . GLY B 1 114 ? 11.584  -4.647  -16.424 1.00 29.55 ? 114 GLY B CA  1 
ATOM   2699 C  C   . GLY B 1 114 ? 12.664  -5.011  -15.423 1.00 31.15 ? 114 GLY B C   1 
ATOM   2700 O  O   . GLY B 1 114 ? 13.704  -5.552  -15.796 1.00 34.47 ? 114 GLY B O   1 
ATOM   2701 N  N   . THR B 1 115 ? 12.430  -4.730  -14.149 1.00 31.49 ? 115 THR B N   1 
ATOM   2702 C  CA  . THR B 1 115 ? 13.435  -5.015  -13.137 1.00 30.39 ? 115 THR B CA  1 
ATOM   2703 C  C   . THR B 1 115 ? 12.941  -5.885  -11.983 1.00 29.35 ? 115 THR B C   1 
ATOM   2704 O  O   . THR B 1 115 ? 13.579  -5.947  -10.932 1.00 28.67 ? 115 THR B O   1 
ATOM   2705 C  CB  . THR B 1 115 ? 13.983  -3.697  -12.579 1.00 32.85 ? 115 THR B CB  1 
ATOM   2706 O  OG1 . THR B 1 115 ? 12.889  -2.888  -12.125 1.00 34.64 ? 115 THR B OG1 1 
ATOM   2707 C  CG2 . THR B 1 115 ? 14.748  -2.936  -13.665 1.00 31.58 ? 115 THR B CG2 1 
ATOM   2708 N  N   . ALA B 1 116 ? 11.816  -6.565  -12.193 1.00 27.50 ? 116 ALA B N   1 
ATOM   2709 C  CA  . ALA B 1 116 ? 11.221  -7.423  -11.170 1.00 24.35 ? 116 ALA B CA  1 
ATOM   2710 C  C   . ALA B 1 116 ? 12.202  -8.412  -10.556 1.00 24.49 ? 116 ALA B C   1 
ATOM   2711 O  O   . ALA B 1 116 ? 12.009  -8.859  -9.424  1.00 25.11 ? 116 ALA B O   1 
ATOM   2712 C  CB  . ALA B 1 116 ? 10.025  -8.168  -11.745 1.00 18.64 ? 116 ALA B CB  1 
ATOM   2713 N  N   . GLN B 1 117 ? 13.254  -8.760  -11.292 1.00 22.84 ? 117 GLN B N   1 
ATOM   2714 C  CA  . GLN B 1 117 ? 14.237  -9.696  -10.771 1.00 22.56 ? 117 GLN B CA  1 
ATOM   2715 C  C   . GLN B 1 117 ? 15.653  -9.135  -10.703 1.00 24.67 ? 117 GLN B C   1 
ATOM   2716 O  O   . GLN B 1 117 ? 16.612  -9.893  -10.559 1.00 25.37 ? 117 GLN B O   1 
ATOM   2717 C  CB  . GLN B 1 117 ? 14.232  -10.995 -11.584 1.00 23.11 ? 117 GLN B CB  1 
ATOM   2718 C  CG  . GLN B 1 117 ? 12.939  -11.794 -11.471 1.00 22.94 ? 117 GLN B CG  1 
ATOM   2719 C  CD  . GLN B 1 117 ? 13.024  -13.156 -12.142 1.00 25.97 ? 117 GLN B CD  1 
ATOM   2720 O  OE1 . GLN B 1 117 ? 13.821  -14.009 -11.746 1.00 29.13 ? 117 GLN B OE1 1 
ATOM   2721 N  NE2 . GLN B 1 117 ? 12.200  -13.368 -13.159 1.00 26.10 ? 117 GLN B NE2 1 
ATOM   2722 N  N   . ASN B 1 118 ? 15.786  -7.814  -10.800 1.00 23.02 ? 118 ASN B N   1 
ATOM   2723 C  CA  . ASN B 1 118 ? 17.096  -7.171  -10.724 1.00 24.43 ? 118 ASN B CA  1 
ATOM   2724 C  C   . ASN B 1 118 ? 17.242  -6.624  -9.302  1.00 23.98 ? 118 ASN B C   1 
ATOM   2725 O  O   . ASN B 1 118 ? 16.763  -5.529  -8.998  1.00 24.41 ? 118 ASN B O   1 
ATOM   2726 C  CB  . ASN B 1 118 ? 17.190  -6.022  -11.732 1.00 29.70 ? 118 ASN B CB  1 
ATOM   2727 C  CG  . ASN B 1 118 ? 18.597  -5.442  -11.833 1.00 32.99 ? 118 ASN B CG  1 
ATOM   2728 O  OD1 . ASN B 1 118 ? 19.233  -5.132  -10.823 1.00 31.66 ? 118 ASN B OD1 1 
ATOM   2729 N  ND2 . ASN B 1 118 ? 19.080  -5.280  -13.059 1.00 39.22 ? 118 ASN B ND2 1 
ATOM   2730 N  N   . THR B 1 119 ? 17.906  -7.384  -8.437  1.00 23.89 ? 119 THR B N   1 
ATOM   2731 C  CA  . THR B 1 119 ? 18.071  -6.986  -7.043  1.00 27.95 ? 119 THR B CA  1 
ATOM   2732 C  C   . THR B 1 119 ? 18.793  -5.666  -6.822  1.00 30.33 ? 119 THR B C   1 
ATOM   2733 O  O   . THR B 1 119 ? 18.770  -5.123  -5.717  1.00 33.42 ? 119 THR B O   1 
ATOM   2734 C  CB  . THR B 1 119 ? 18.791  -8.076  -6.220  1.00 26.00 ? 119 THR B CB  1 
ATOM   2735 O  OG1 . THR B 1 119 ? 20.103  -8.296  -6.745  1.00 27.21 ? 119 THR B OG1 1 
ATOM   2736 C  CG2 . THR B 1 119 ? 18.007  -9.373  -6.268  1.00 26.08 ? 119 THR B CG2 1 
ATOM   2737 N  N   . SER B 1 120 ? 19.426  -5.141  -7.865  1.00 30.83 ? 120 SER B N   1 
ATOM   2738 C  CA  . SER B 1 120 ? 20.134  -3.873  -7.743  1.00 31.34 ? 120 SER B CA  1 
ATOM   2739 C  C   . SER B 1 120 ? 19.251  -2.692  -8.126  1.00 31.96 ? 120 SER B C   1 
ATOM   2740 O  O   . SER B 1 120 ? 19.604  -1.541  -7.887  1.00 35.44 ? 120 SER B O   1 
ATOM   2741 C  CB  . SER B 1 120 ? 21.390  -3.879  -8.618  1.00 32.49 ? 120 SER B CB  1 
ATOM   2742 O  OG  . SER B 1 120 ? 22.297  -4.878  -8.187  1.00 36.50 ? 120 SER B OG  1 
ATOM   2743 N  N   . ALA B 1 121 ? 18.094  -2.969  -8.712  1.00 31.13 ? 121 ALA B N   1 
ATOM   2744 C  CA  . ALA B 1 121 ? 17.204  -1.893  -9.119  1.00 30.68 ? 121 ALA B CA  1 
ATOM   2745 C  C   . ALA B 1 121 ? 16.086  -1.647  -8.115  1.00 29.24 ? 121 ALA B C   1 
ATOM   2746 O  O   . ALA B 1 121 ? 15.322  -0.694  -8.253  1.00 29.85 ? 121 ALA B O   1 
ATOM   2747 C  CB  . ALA B 1 121 ? 16.609  -2.204  -10.489 1.00 30.64 ? 121 ALA B CB  1 
ATOM   2748 N  N   . ASN B 1 122 ? 16.000  -2.494  -7.096  1.00 27.69 ? 122 ASN B N   1 
ATOM   2749 C  CA  . ASN B 1 122 ? 14.937  -2.360  -6.108  1.00 28.13 ? 122 ASN B CA  1 
ATOM   2750 C  C   . ASN B 1 122 ? 15.382  -2.162  -4.666  1.00 27.58 ? 122 ASN B C   1 
ATOM   2751 O  O   . ASN B 1 122 ? 16.515  -2.461  -4.292  1.00 27.05 ? 122 ASN B O   1 
ATOM   2752 C  CB  . ASN B 1 122 ? 14.027  -3.588  -6.169  1.00 27.07 ? 122 ASN B CB  1 
ATOM   2753 C  CG  . ASN B 1 122 ? 13.403  -3.778  -7.530  1.00 26.72 ? 122 ASN B CG  1 
ATOM   2754 O  OD1 . ASN B 1 122 ? 12.603  -2.958  -7.975  1.00 31.01 ? 122 ASN B OD1 1 
ATOM   2755 N  ND2 . ASN B 1 122 ? 13.773  -4.862  -8.206  1.00 25.21 ? 122 ASN B ND2 1 
ATOM   2756 N  N   . GLN B 1 123 ? 14.455  -1.646  -3.868  1.00 25.61 ? 123 GLN B N   1 
ATOM   2757 C  CA  . GLN B 1 123 ? 14.662  -1.419  -2.449  1.00 26.13 ? 123 GLN B CA  1 
ATOM   2758 C  C   . GLN B 1 123 ? 13.370  -1.792  -1.760  1.00 23.08 ? 123 GLN B C   1 
ATOM   2759 O  O   . GLN B 1 123 ? 12.516  -0.945  -1.521  1.00 26.60 ? 123 GLN B O   1 
ATOM   2760 C  CB  . GLN B 1 123 ? 14.978  0.041   -2.157  1.00 25.44 ? 123 GLN B CB  1 
ATOM   2761 C  CG  . GLN B 1 123 ? 16.346  0.477   -2.591  1.00 29.93 ? 123 GLN B CG  1 
ATOM   2762 C  CD  . GLN B 1 123 ? 16.657  1.867   -2.105  1.00 32.51 ? 123 GLN B CD  1 
ATOM   2763 O  OE1 . GLN B 1 123 ? 16.084  2.847   -2.583  1.00 35.48 ? 123 GLN B OE1 1 
ATOM   2764 N  NE2 . GLN B 1 123 ? 17.547  1.962   -1.125  1.00 31.91 ? 123 GLN B NE2 1 
ATOM   2765 N  N   . VAL B 1 124 ? 13.218  -3.068  -1.447  1.00 22.29 ? 124 VAL B N   1 
ATOM   2766 C  CA  . VAL B 1 124 ? 12.003  -3.514  -0.796  1.00 20.42 ? 124 VAL B CA  1 
ATOM   2767 C  C   . VAL B 1 124 ? 12.166  -4.890  -0.186  1.00 16.93 ? 124 VAL B C   1 
ATOM   2768 O  O   . VAL B 1 124 ? 12.848  -5.749  -0.738  1.00 18.51 ? 124 VAL B O   1 
ATOM   2769 C  CB  . VAL B 1 124 ? 10.823  -3.543  -1.804  1.00 18.85 ? 124 VAL B CB  1 
ATOM   2770 C  CG1 . VAL B 1 124 ? 11.199  -4.379  -3.011  1.00 22.79 ? 124 VAL B CG1 1 
ATOM   2771 C  CG2 . VAL B 1 124 ? 9.577   -4.117  -1.149  1.00 19.09 ? 124 VAL B CG2 1 
ATOM   2772 N  N   . ILE B 1 125 ? 11.570  -5.068  0.988   1.00 14.90 ? 125 ILE B N   1 
ATOM   2773 C  CA  . ILE B 1 125 ? 11.566  -6.347  1.669   1.00 14.12 ? 125 ILE B CA  1 
ATOM   2774 C  C   . ILE B 1 125 ? 10.085  -6.647  1.860   1.00 16.05 ? 125 ILE B C   1 
ATOM   2775 O  O   . ILE B 1 125 ? 9.319   -5.798  2.321   1.00 13.74 ? 125 ILE B O   1 
ATOM   2776 C  CB  . ILE B 1 125 ? 12.270  -6.296  3.043   1.00 16.26 ? 125 ILE B CB  1 
ATOM   2777 C  CG1 . ILE B 1 125 ? 13.774  -6.102  2.848   1.00 18.35 ? 125 ILE B CG1 1 
ATOM   2778 C  CG2 . ILE B 1 125 ? 12.004  -7.586  3.814   1.00 13.69 ? 125 ILE B CG2 1 
ATOM   2779 C  CD1 . ILE B 1 125 ? 14.560  -6.144  4.139   1.00 18.25 ? 125 ILE B CD1 1 
ATOM   2780 N  N   . ALA B 1 126 ? 9.672   -7.846  1.485   1.00 14.78 ? 126 ALA B N   1 
ATOM   2781 C  CA  . ALA B 1 126 ? 8.276   -8.201  1.617   1.00 11.29 ? 126 ALA B CA  1 
ATOM   2782 C  C   . ALA B 1 126 ? 8.101   -9.662  1.939   1.00 11.90 ? 126 ALA B C   1 
ATOM   2783 O  O   . ALA B 1 126 ? 8.932   -10.498 1.583   1.00 10.47 ? 126 ALA B O   1 
ATOM   2784 C  CB  . ALA B 1 126 ? 7.526   -7.865  0.324   1.00 11.84 ? 126 ALA B CB  1 
ATOM   2785 N  N   . VAL B 1 127 ? 7.023   -9.956  2.653   1.00 13.33 ? 127 VAL B N   1 
ATOM   2786 C  CA  . VAL B 1 127 ? 6.676   -11.324 2.983   1.00 13.58 ? 127 VAL B CA  1 
ATOM   2787 C  C   . VAL B 1 127 ? 5.426   -11.522 2.140   1.00 15.07 ? 127 VAL B C   1 
ATOM   2788 O  O   . VAL B 1 127 ? 4.409   -10.858 2.354   1.00 13.22 ? 127 VAL B O   1 
ATOM   2789 C  CB  . VAL B 1 127 ? 6.328   -11.505 4.477   1.00 13.35 ? 127 VAL B CB  1 
ATOM   2790 C  CG1 . VAL B 1 127 ? 5.919   -12.945 4.737   1.00 11.74 ? 127 VAL B CG1 1 
ATOM   2791 C  CG2 . VAL B 1 127 ? 7.528   -11.150 5.347   1.00 12.72 ? 127 VAL B CG2 1 
ATOM   2792 N  N   . GLU B 1 128 ? 5.515   -12.411 1.158   1.00 12.30 ? 128 GLU B N   1 
ATOM   2793 C  CA  . GLU B 1 128 ? 4.387   -12.662 0.279   1.00 13.89 ? 128 GLU B CA  1 
ATOM   2794 C  C   . GLU B 1 128 ? 3.643   -13.956 0.552   1.00 13.67 ? 128 GLU B C   1 
ATOM   2795 O  O   . GLU B 1 128 ? 4.222   -14.948 0.990   1.00 13.29 ? 128 GLU B O   1 
ATOM   2796 C  CB  . GLU B 1 128 ? 4.842   -12.675 -1.183  1.00 10.49 ? 128 GLU B CB  1 
ATOM   2797 C  CG  . GLU B 1 128 ? 5.989   -13.634 -1.459  1.00 11.45 ? 128 GLU B CG  1 
ATOM   2798 C  CD  . GLU B 1 128 ? 6.161   -13.943 -2.940  1.00 13.38 ? 128 GLU B CD  1 
ATOM   2799 O  OE1 . GLU B 1 128 ? 5.769   -15.051 -3.356  1.00 14.81 ? 128 GLU B OE1 1 
ATOM   2800 O  OE2 . GLU B 1 128 ? 6.668   -13.081 -3.686  1.00 8.47  ? 128 GLU B OE2 1 
ATOM   2801 N  N   . PHE B 1 129 ? 2.344   -13.917 0.284   1.00 12.32 ? 129 PHE B N   1 
ATOM   2802 C  CA  . PHE B 1 129 ? 1.464   -15.067 0.418   1.00 12.14 ? 129 PHE B CA  1 
ATOM   2803 C  C   . PHE B 1 129 ? 0.934   -15.197 -0.998  1.00 12.25 ? 129 PHE B C   1 
ATOM   2804 O  O   . PHE B 1 129 ? -0.081  -14.613 -1.382  1.00 12.06 ? 129 PHE B O   1 
ATOM   2805 C  CB  . PHE B 1 129 ? 0.379   -14.783 1.445   1.00 7.15  ? 129 PHE B CB  1 
ATOM   2806 C  CG  . PHE B 1 129 ? 0.930   -14.580 2.825   1.00 11.50 ? 129 PHE B CG  1 
ATOM   2807 C  CD1 . PHE B 1 129 ? 1.557   -13.388 3.167   1.00 9.40  ? 129 PHE B CD1 1 
ATOM   2808 C  CD2 . PHE B 1 129 ? 0.923   -15.620 3.746   1.00 8.44  ? 129 PHE B CD2 1 
ATOM   2809 C  CE1 . PHE B 1 129 ? 2.175   -13.235 4.405   1.00 11.30 ? 129 PHE B CE1 1 
ATOM   2810 C  CE2 . PHE B 1 129 ? 1.540   -15.477 4.985   1.00 14.97 ? 129 PHE B CE2 1 
ATOM   2811 C  CZ  . PHE B 1 129 ? 2.169   -14.284 5.316   1.00 7.83  ? 129 PHE B CZ  1 
ATOM   2812 N  N   . ASP B 1 130 ? 1.691   -15.964 -1.770  1.00 12.64 ? 130 ASP B N   1 
ATOM   2813 C  CA  . ASP B 1 130 ? 1.467   -16.162 -3.186  1.00 12.00 ? 130 ASP B CA  1 
ATOM   2814 C  C   . ASP B 1 130 ? 0.635   -17.400 -3.516  1.00 13.03 ? 130 ASP B C   1 
ATOM   2815 O  O   . ASP B 1 130 ? 1.045   -18.528 -3.236  1.00 13.95 ? 130 ASP B O   1 
ATOM   2816 C  CB  . ASP B 1 130 ? 2.853   -16.209 -3.826  1.00 11.31 ? 130 ASP B CB  1 
ATOM   2817 C  CG  . ASP B 1 130 ? 2.817   -16.097 -5.317  1.00 12.40 ? 130 ASP B CG  1 
ATOM   2818 O  OD1 . ASP B 1 130 ? 3.910   -15.953 -5.893  1.00 10.46 ? 130 ASP B OD1 1 
ATOM   2819 O  OD2 . ASP B 1 130 ? 1.717   -16.153 -5.908  1.00 13.40 ? 130 ASP B OD2 1 
ATOM   2820 N  N   . THR B 1 131 ? -0.531  -17.181 -4.123  1.00 11.45 ? 131 THR B N   1 
ATOM   2821 C  CA  . THR B 1 131 ? -1.438  -18.275 -4.462  1.00 14.66 ? 131 THR B CA  1 
ATOM   2822 C  C   . THR B 1 131 ? -1.468  -18.683 -5.938  1.00 15.56 ? 131 THR B C   1 
ATOM   2823 O  O   . THR B 1 131 ? -2.136  -19.649 -6.285  1.00 15.84 ? 131 THR B O   1 
ATOM   2824 C  CB  . THR B 1 131 ? -2.889  -17.939 -4.061  1.00 14.93 ? 131 THR B CB  1 
ATOM   2825 O  OG1 . THR B 1 131 ? -3.351  -16.836 -4.851  1.00 14.12 ? 131 THR B OG1 1 
ATOM   2826 C  CG2 . THR B 1 131 ? -2.973  -17.566 -2.577  1.00 13.29 ? 131 THR B CG2 1 
ATOM   2827 N  N   . PHE B 1 132 ? -0.767  -17.957 -6.806  1.00 17.58 ? 132 PHE B N   1 
ATOM   2828 C  CA  . PHE B 1 132 ? -0.763  -18.286 -8.234  1.00 18.05 ? 132 PHE B CA  1 
ATOM   2829 C  C   . PHE B 1 132 ? 0.679   -18.549 -8.658  1.00 19.10 ? 132 PHE B C   1 
ATOM   2830 O  O   . PHE B 1 132 ? 1.531   -17.671 -8.547  1.00 16.74 ? 132 PHE B O   1 
ATOM   2831 C  CB  . PHE B 1 132 ? -1.335  -17.124 -9.050  1.00 19.04 ? 132 PHE B CB  1 
ATOM   2832 C  CG  . PHE B 1 132 ? -1.631  -17.477 -10.482 1.00 22.01 ? 132 PHE B CG  1 
ATOM   2833 C  CD1 . PHE B 1 132 ? -2.755  -18.231 -10.807 1.00 19.99 ? 132 PHE B CD1 1 
ATOM   2834 C  CD2 . PHE B 1 132 ? -0.773  -17.080 -11.503 1.00 23.01 ? 132 PHE B CD2 1 
ATOM   2835 C  CE1 . PHE B 1 132 ? -3.020  -18.584 -12.128 1.00 22.04 ? 132 PHE B CE1 1 
ATOM   2836 C  CE2 . PHE B 1 132 ? -1.030  -17.431 -12.830 1.00 22.00 ? 132 PHE B CE2 1 
ATOM   2837 C  CZ  . PHE B 1 132 ? -2.156  -18.183 -13.140 1.00 19.05 ? 132 PHE B CZ  1 
ATOM   2838 N  N   . TYR B 1 133 ? 0.937   -19.748 -9.171  1.00 19.52 ? 133 TYR B N   1 
ATOM   2839 C  CA  . TYR B 1 133 ? 2.283   -20.156 -9.563  1.00 18.96 ? 133 TYR B CA  1 
ATOM   2840 C  C   . TYR B 1 133 ? 2.430   -20.770 -10.964 1.00 21.29 ? 133 TYR B C   1 
ATOM   2841 O  O   . TYR B 1 133 ? 3.451   -21.387 -11.256 1.00 19.32 ? 133 TYR B O   1 
ATOM   2842 C  CB  . TYR B 1 133 ? 2.800   -21.152 -8.527  1.00 20.51 ? 133 TYR B CB  1 
ATOM   2843 C  CG  . TYR B 1 133 ? 1.746   -22.171 -8.160  1.00 22.49 ? 133 TYR B CG  1 
ATOM   2844 C  CD1 . TYR B 1 133 ? 0.663   -21.815 -7.358  1.00 25.55 ? 133 TYR B CD1 1 
ATOM   2845 C  CD2 . TYR B 1 133 ? 1.776   -23.461 -8.687  1.00 25.15 ? 133 TYR B CD2 1 
ATOM   2846 C  CE1 . TYR B 1 133 ? -0.366  -22.711 -7.093  1.00 29.36 ? 133 TYR B CE1 1 
ATOM   2847 C  CE2 . TYR B 1 133 ? 0.748   -24.371 -8.429  1.00 28.35 ? 133 TYR B CE2 1 
ATOM   2848 C  CZ  . TYR B 1 133 ? -0.323  -23.986 -7.631  1.00 30.32 ? 133 TYR B CZ  1 
ATOM   2849 O  OH  . TYR B 1 133 ? -1.355  -24.863 -7.375  1.00 29.96 ? 133 TYR B OH  1 
ATOM   2850 N  N   . ALA B 1 134 ? 1.424   -20.612 -11.820 1.00 20.82 ? 134 ALA B N   1 
ATOM   2851 C  CA  . ALA B 1 134 ? 1.480   -21.158 -13.174 1.00 21.85 ? 134 ALA B CA  1 
ATOM   2852 C  C   . ALA B 1 134 ? 2.881   -20.965 -13.749 1.00 22.13 ? 134 ALA B C   1 
ATOM   2853 O  O   . ALA B 1 134 ? 3.330   -19.841 -13.957 1.00 22.62 ? 134 ALA B O   1 
ATOM   2854 C  CB  . ALA B 1 134 ? 0.445   -20.473 -14.056 1.00 23.31 ? 134 ALA B CB  1 
ATOM   2855 N  N   . GLN B 1 135 ? 3.563   -22.075 -14.004 1.00 27.12 ? 135 GLN B N   1 
ATOM   2856 C  CA  . GLN B 1 135 ? 4.929   -22.053 -14.514 1.00 29.90 ? 135 GLN B CA  1 
ATOM   2857 C  C   . GLN B 1 135 ? 5.147   -21.372 -15.863 1.00 30.59 ? 135 GLN B C   1 
ATOM   2858 O  O   . GLN B 1 135 ? 6.288   -21.185 -16.275 1.00 31.11 ? 135 GLN B O   1 
ATOM   2859 C  CB  . GLN B 1 135 ? 5.480   -23.478 -14.558 1.00 29.98 ? 135 GLN B CB  1 
ATOM   2860 C  CG  . GLN B 1 135 ? 5.545   -24.151 -13.192 1.00 32.70 ? 135 GLN B CG  1 
ATOM   2861 C  CD  . GLN B 1 135 ? 6.539   -23.490 -12.251 1.00 34.63 ? 135 GLN B CD  1 
ATOM   2862 O  OE1 . GLN B 1 135 ? 7.740   -23.468 -12.515 1.00 34.16 ? 135 GLN B OE1 1 
ATOM   2863 N  NE2 . GLN B 1 135 ? 6.041   -22.948 -11.144 1.00 35.55 ? 135 GLN B NE2 1 
ATOM   2864 N  N   . ASP B 1 136 ? 4.072   -20.993 -16.547 1.00 32.40 ? 136 ASP B N   1 
ATOM   2865 C  CA  . ASP B 1 136 ? 4.215   -20.326 -17.837 1.00 33.93 ? 136 ASP B CA  1 
ATOM   2866 C  C   . ASP B 1 136 ? 4.215   -18.802 -17.714 1.00 33.07 ? 136 ASP B C   1 
ATOM   2867 O  O   . ASP B 1 136 ? 4.766   -18.110 -18.568 1.00 31.85 ? 136 ASP B O   1 
ATOM   2868 C  CB  . ASP B 1 136 ? 3.111   -20.779 -18.801 1.00 38.34 ? 136 ASP B CB  1 
ATOM   2869 C  CG  . ASP B 1 136 ? 1.724   -20.619 -18.216 1.00 42.70 ? 136 ASP B CG  1 
ATOM   2870 O  OD1 . ASP B 1 136 ? 1.442   -21.257 -17.179 1.00 43.73 ? 136 ASP B OD1 1 
ATOM   2871 O  OD2 . ASP B 1 136 ? 0.917   -19.858 -18.790 1.00 43.51 ? 136 ASP B OD2 1 
ATOM   2872 N  N   . SER B 1 137 ? 3.599   -18.275 -16.658 1.00 30.38 ? 137 SER B N   1 
ATOM   2873 C  CA  . SER B 1 137 ? 3.570   -16.829 -16.454 1.00 30.23 ? 137 SER B CA  1 
ATOM   2874 C  C   . SER B 1 137 ? 4.460   -16.428 -15.281 1.00 29.01 ? 137 SER B C   1 
ATOM   2875 O  O   . SER B 1 137 ? 5.332   -15.575 -15.427 1.00 31.43 ? 137 SER B O   1 
ATOM   2876 C  CB  . SER B 1 137 ? 2.137   -16.332 -16.226 1.00 32.93 ? 137 SER B CB  1 
ATOM   2877 O  OG  . SER B 1 137 ? 1.547   -16.925 -15.085 1.00 38.52 ? 137 SER B OG  1 
ATOM   2878 N  N   . ASN B 1 138 ? 4.246   -17.037 -14.118 1.00 27.12 ? 138 ASN B N   1 
ATOM   2879 C  CA  . ASN B 1 138 ? 5.076   -16.727 -12.958 1.00 24.07 ? 138 ASN B CA  1 
ATOM   2880 C  C   . ASN B 1 138 ? 6.255   -17.698 -12.957 1.00 23.60 ? 138 ASN B C   1 
ATOM   2881 O  O   . ASN B 1 138 ? 6.396   -18.533 -12.060 1.00 21.06 ? 138 ASN B O   1 
ATOM   2882 C  CB  . ASN B 1 138 ? 4.277   -16.866 -11.657 1.00 23.48 ? 138 ASN B CB  1 
ATOM   2883 C  CG  . ASN B 1 138 ? 3.104   -15.900 -11.575 1.00 21.84 ? 138 ASN B CG  1 
ATOM   2884 O  OD1 . ASN B 1 138 ? 2.665   -15.548 -10.482 1.00 19.66 ? 138 ASN B OD1 1 
ATOM   2885 N  ND2 . ASN B 1 138 ? 2.575   -15.489 -12.726 1.00 17.48 ? 138 ASN B ND2 1 
ATOM   2886 N  N   . THR B 1 139 ? 7.097   -17.576 -13.980 1.00 22.85 ? 139 THR B N   1 
ATOM   2887 C  CA  . THR B 1 139 ? 8.257   -18.443 -14.162 1.00 22.38 ? 139 THR B CA  1 
ATOM   2888 C  C   . THR B 1 139 ? 9.205   -18.479 -12.970 1.00 22.53 ? 139 THR B C   1 
ATOM   2889 O  O   . THR B 1 139 ? 9.951   -19.439 -12.791 1.00 24.99 ? 139 THR B O   1 
ATOM   2890 C  CB  . THR B 1 139 ? 9.059   -18.023 -15.419 1.00 23.45 ? 139 THR B CB  1 
ATOM   2891 O  OG1 . THR B 1 139 ? 9.537   -16.682 -15.263 1.00 24.55 ? 139 THR B OG1 1 
ATOM   2892 C  CG2 . THR B 1 139 ? 8.179   -18.070 -16.644 1.00 18.87 ? 139 THR B CG2 1 
ATOM   2893 N  N   . TRP B 1 140 ? 9.158   -17.436 -12.150 1.00 22.48 ? 140 TRP B N   1 
ATOM   2894 C  CA  . TRP B 1 140 ? 10.022  -17.311 -10.982 1.00 19.63 ? 140 TRP B CA  1 
ATOM   2895 C  C   . TRP B 1 140 ? 9.546   -18.057 -9.732  1.00 20.26 ? 140 TRP B C   1 
ATOM   2896 O  O   . TRP B 1 140 ? 10.314  -18.238 -8.790  1.00 21.96 ? 140 TRP B O   1 
ATOM   2897 C  CB  . TRP B 1 140 ? 10.193  -15.827 -10.666 1.00 19.86 ? 140 TRP B CB  1 
ATOM   2898 C  CG  . TRP B 1 140 ? 8.881   -15.144 -10.456 1.00 19.23 ? 140 TRP B CG  1 
ATOM   2899 C  CD1 . TRP B 1 140 ? 8.093   -15.206 -9.344  1.00 20.44 ? 140 TRP B CD1 1 
ATOM   2900 C  CD2 . TRP B 1 140 ? 8.144   -14.393 -11.426 1.00 20.85 ? 140 TRP B CD2 1 
ATOM   2901 N  NE1 . TRP B 1 140 ? 6.908   -14.545 -9.562  1.00 21.13 ? 140 TRP B NE1 1 
ATOM   2902 C  CE2 . TRP B 1 140 ? 6.912   -14.037 -10.833 1.00 21.48 ? 140 TRP B CE2 1 
ATOM   2903 C  CE3 . TRP B 1 140 ? 8.403   -13.991 -12.741 1.00 21.29 ? 140 TRP B CE3 1 
ATOM   2904 C  CZ2 . TRP B 1 140 ? 5.940   -13.296 -11.510 1.00 22.82 ? 140 TRP B CZ2 1 
ATOM   2905 C  CZ3 . TRP B 1 140 ? 7.435   -13.254 -13.417 1.00 24.82 ? 140 TRP B CZ3 1 
ATOM   2906 C  CH2 . TRP B 1 140 ? 6.218   -12.915 -12.798 1.00 25.05 ? 140 TRP B CH2 1 
ATOM   2907 N  N   . ASP B 1 141 ? 8.292   -18.495 -9.719  1.00 18.96 ? 141 ASP B N   1 
ATOM   2908 C  CA  . ASP B 1 141 ? 7.753   -19.207 -8.560  1.00 18.52 ? 141 ASP B CA  1 
ATOM   2909 C  C   . ASP B 1 141 ? 7.940   -20.706 -8.539  1.00 18.86 ? 141 ASP B C   1 
ATOM   2910 O  O   . ASP B 1 141 ? 8.104   -21.340 -9.577  1.00 17.86 ? 141 ASP B O   1 
ATOM   2911 C  CB  . ASP B 1 141 ? 6.241   -18.988 -8.416  1.00 15.70 ? 141 ASP B CB  1 
ATOM   2912 C  CG  . ASP B 1 141 ? 5.889   -17.595 -7.999  1.00 14.06 ? 141 ASP B CG  1 
ATOM   2913 O  OD1 . ASP B 1 141 ? 6.655   -17.012 -7.215  1.00 13.16 ? 141 ASP B OD1 1 
ATOM   2914 O  OD2 . ASP B 1 141 ? 4.831   -17.099 -8.426  1.00 14.52 ? 141 ASP B OD2 1 
ATOM   2915 N  N   . PRO B 1 142 ? 7.943   -21.289 -7.334  1.00 21.16 ? 142 PRO B N   1 
ATOM   2916 C  CA  . PRO B 1 142 ? 8.078   -22.734 -7.173  1.00 21.98 ? 142 PRO B CA  1 
ATOM   2917 C  C   . PRO B 1 142 ? 6.694   -23.196 -7.637  1.00 24.65 ? 142 PRO B C   1 
ATOM   2918 O  O   . PRO B 1 142 ? 5.768   -22.384 -7.682  1.00 25.69 ? 142 PRO B O   1 
ATOM   2919 C  CB  . PRO B 1 142 ? 8.270   -22.882 -5.667  1.00 23.89 ? 142 PRO B CB  1 
ATOM   2920 C  CG  . PRO B 1 142 ? 7.392   -21.771 -5.136  1.00 24.03 ? 142 PRO B CG  1 
ATOM   2921 C  CD  . PRO B 1 142 ? 7.901   -20.639 -6.011  1.00 24.04 ? 142 PRO B CD  1 
ATOM   2922 N  N   . ASN B 1 143 ? 6.526   -24.472 -7.963  1.00 28.08 ? 143 ASN B N   1 
ATOM   2923 C  CA  . ASN B 1 143 ? 5.235   -24.936 -8.467  1.00 29.32 ? 143 ASN B CA  1 
ATOM   2924 C  C   . ASN B 1 143 ? 4.184   -25.342 -7.425  1.00 30.39 ? 143 ASN B C   1 
ATOM   2925 O  O   . ASN B 1 143 ? 3.733   -26.489 -7.399  1.00 30.00 ? 143 ASN B O   1 
ATOM   2926 C  CB  . ASN B 1 143 ? 5.466   -26.080 -9.463  1.00 30.99 ? 143 ASN B CB  1 
ATOM   2927 C  CG  . ASN B 1 143 ? 4.197   -26.500 -10.175 1.00 34.20 ? 143 ASN B CG  1 
ATOM   2928 O  OD1 . ASN B 1 143 ? 3.484   -25.668 -10.734 1.00 38.18 ? 143 ASN B OD1 1 
ATOM   2929 N  ND2 . ASN B 1 143 ? 3.916   -27.798 -10.173 1.00 39.34 ? 143 ASN B ND2 1 
ATOM   2930 N  N   . TYR B 1 144 ? 3.792   -24.386 -6.582  1.00 28.61 ? 144 TYR B N   1 
ATOM   2931 C  CA  . TYR B 1 144 ? 2.777   -24.598 -5.547  1.00 26.69 ? 144 TYR B CA  1 
ATOM   2932 C  C   . TYR B 1 144 ? 2.567   -23.332 -4.722  1.00 23.42 ? 144 TYR B C   1 
ATOM   2933 O  O   . TYR B 1 144 ? 3.435   -22.464 -4.689  1.00 21.84 ? 144 TYR B O   1 
ATOM   2934 C  CB  . TYR B 1 144 ? 3.171   -25.772 -4.634  1.00 26.77 ? 144 TYR B CB  1 
ATOM   2935 C  CG  . TYR B 1 144 ? 4.581   -25.711 -4.096  1.00 23.29 ? 144 TYR B CG  1 
ATOM   2936 C  CD1 . TYR B 1 144 ? 4.965   -24.727 -3.187  1.00 25.12 ? 144 TYR B CD1 1 
ATOM   2937 C  CD2 . TYR B 1 144 ? 5.543   -26.622 -4.525  1.00 27.32 ? 144 TYR B CD2 1 
ATOM   2938 C  CE1 . TYR B 1 144 ? 6.273   -24.651 -2.719  1.00 25.38 ? 144 TYR B CE1 1 
ATOM   2939 C  CE2 . TYR B 1 144 ? 6.854   -26.556 -4.064  1.00 29.15 ? 144 TYR B CE2 1 
ATOM   2940 C  CZ  . TYR B 1 144 ? 7.211   -25.568 -3.163  1.00 28.14 ? 144 TYR B CZ  1 
ATOM   2941 O  OH  . TYR B 1 144 ? 8.509   -25.499 -2.713  1.00 32.57 ? 144 TYR B OH  1 
ATOM   2942 N  N   . PRO B 1 145 ? 1.394   -23.189 -4.078  1.00 22.18 ? 145 PRO B N   1 
ATOM   2943 C  CA  . PRO B 1 145 ? 1.158   -21.987 -3.272  1.00 20.85 ? 145 PRO B CA  1 
ATOM   2944 C  C   . PRO B 1 145 ? 2.248   -21.904 -2.205  1.00 20.18 ? 145 PRO B C   1 
ATOM   2945 O  O   . PRO B 1 145 ? 2.699   -22.926 -1.688  1.00 18.56 ? 145 PRO B O   1 
ATOM   2946 C  CB  . PRO B 1 145 ? -0.252  -22.223 -2.718  1.00 21.49 ? 145 PRO B CB  1 
ATOM   2947 C  CG  . PRO B 1 145 ? -0.338  -23.737 -2.677  1.00 22.80 ? 145 PRO B CG  1 
ATOM   2948 C  CD  . PRO B 1 145 ? 0.208   -24.058 -4.039  1.00 20.41 ? 145 PRO B CD  1 
ATOM   2949 N  N   . HIS B 1 146 ? 2.676   -20.693 -1.873  1.00 18.12 ? 146 HIS B N   1 
ATOM   2950 C  CA  . HIS B 1 146 ? 3.763   -20.558 -0.918  1.00 14.09 ? 146 HIS B CA  1 
ATOM   2951 C  C   . HIS B 1 146 ? 3.852   -19.220 -0.207  1.00 13.22 ? 146 HIS B C   1 
ATOM   2952 O  O   . HIS B 1 146 ? 3.235   -18.235 -0.606  1.00 15.20 ? 146 HIS B O   1 
ATOM   2953 C  CB  . HIS B 1 146 ? 5.075   -20.755 -1.657  1.00 14.77 ? 146 HIS B CB  1 
ATOM   2954 C  CG  . HIS B 1 146 ? 5.244   -19.810 -2.806  1.00 14.89 ? 146 HIS B CG  1 
ATOM   2955 N  ND1 . HIS B 1 146 ? 4.558   -19.955 -3.994  1.00 15.13 ? 146 HIS B ND1 1 
ATOM   2956 C  CD2 . HIS B 1 146 ? 5.943   -18.656 -2.917  1.00 15.57 ? 146 HIS B CD2 1 
ATOM   2957 C  CE1 . HIS B 1 146 ? 4.829   -18.933 -4.785  1.00 14.78 ? 146 HIS B CE1 1 
ATOM   2958 N  NE2 . HIS B 1 146 ? 5.667   -18.130 -4.156  1.00 12.27 ? 146 HIS B NE2 1 
ATOM   2959 N  N   . ILE B 1 147 ? 4.655   -19.207 0.850   1.00 11.55 ? 147 ILE B N   1 
ATOM   2960 C  CA  . ILE B 1 147 ? 4.932   -17.998 1.604   1.00 11.61 ? 147 ILE B CA  1 
ATOM   2961 C  C   . ILE B 1 147 ? 6.364   -17.721 1.194   1.00 14.01 ? 147 ILE B C   1 
ATOM   2962 O  O   . ILE B 1 147 ? 7.190   -18.634 1.186   1.00 13.28 ? 147 ILE B O   1 
ATOM   2963 C  CB  . ILE B 1 147 ? 4.914   -18.231 3.125   1.00 10.17 ? 147 ILE B CB  1 
ATOM   2964 C  CG1 . ILE B 1 147 ? 3.497   -18.555 3.595   1.00 13.70 ? 147 ILE B CG1 1 
ATOM   2965 C  CG2 . ILE B 1 147 ? 5.468   -17.011 3.828   1.00 10.48 ? 147 ILE B CG2 1 
ATOM   2966 C  CD1 . ILE B 1 147 ? 3.403   -18.885 5.075   1.00 10.68 ? 147 ILE B CD1 1 
ATOM   2967 N  N   . GLY B 1 148 ? 6.672   -16.481 0.843   1.00 14.85 ? 148 GLY B N   1 
ATOM   2968 C  CA  . GLY B 1 148 ? 8.036   -16.193 0.441   1.00 14.92 ? 148 GLY B CA  1 
ATOM   2969 C  C   . GLY B 1 148 ? 8.602   -14.910 1.010   1.00 14.98 ? 148 GLY B C   1 
ATOM   2970 O  O   . GLY B 1 148 ? 7.860   -13.978 1.329   1.00 12.78 ? 148 GLY B O   1 
ATOM   2971 N  N   . ILE B 1 149 ? 9.922   -14.874 1.159   1.00 15.44 ? 149 ILE B N   1 
ATOM   2972 C  CA  . ILE B 1 149 ? 10.602  -13.682 1.647   1.00 13.08 ? 149 ILE B CA  1 
ATOM   2973 C  C   . ILE B 1 149 ? 11.208  -13.065 0.404   1.00 15.98 ? 149 ILE B C   1 
ATOM   2974 O  O   . ILE B 1 149 ? 11.995  -13.704 -0.295  1.00 14.63 ? 149 ILE B O   1 
ATOM   2975 C  CB  . ILE B 1 149 ? 11.739  -14.005 2.631   1.00 14.46 ? 149 ILE B CB  1 
ATOM   2976 C  CG1 . ILE B 1 149 ? 11.194  -14.739 3.855   1.00 12.45 ? 149 ILE B CG1 1 
ATOM   2977 C  CG2 . ILE B 1 149 ? 12.406  -12.712 3.082   1.00 12.75 ? 149 ILE B CG2 1 
ATOM   2978 C  CD1 . ILE B 1 149 ? 10.218  -13.933 4.640   1.00 21.78 ? 149 ILE B CD1 1 
ATOM   2979 N  N   . ASP B 1 150 ? 10.822  -11.829 0.118   1.00 15.76 ? 150 ASP B N   1 
ATOM   2980 C  CA  . ASP B 1 150 ? 11.321  -11.131 -1.050  1.00 16.67 ? 150 ASP B CA  1 
ATOM   2981 C  C   . ASP B 1 150 ? 12.278  -10.008 -0.656  1.00 18.19 ? 150 ASP B C   1 
ATOM   2982 O  O   . ASP B 1 150 ? 11.904  -9.112  0.101   1.00 18.29 ? 150 ASP B O   1 
ATOM   2983 C  CB  . ASP B 1 150 ? 10.150  -10.536 -1.833  1.00 16.16 ? 150 ASP B CB  1 
ATOM   2984 C  CG  . ASP B 1 150 ? 9.159   -11.586 -2.296  1.00 19.72 ? 150 ASP B CG  1 
ATOM   2985 O  OD1 . ASP B 1 150 ? 8.095   -11.200 -2.834  1.00 16.78 ? 150 ASP B OD1 1 
ATOM   2986 O  OD2 . ASP B 1 150 ? 9.444   -12.792 -2.132  1.00 18.55 ? 150 ASP B OD2 1 
ATOM   2987 N  N   . VAL B 1 151 ? 13.505  -10.062 -1.168  1.00 16.57 ? 151 VAL B N   1 
ATOM   2988 C  CA  . VAL B 1 151 ? 14.496  -9.025  -0.895  1.00 15.82 ? 151 VAL B CA  1 
ATOM   2989 C  C   . VAL B 1 151 ? 14.947  -8.441  -2.227  1.00 18.25 ? 151 VAL B C   1 
ATOM   2990 O  O   . VAL B 1 151 ? 15.841  -8.976  -2.873  1.00 22.74 ? 151 VAL B O   1 
ATOM   2991 C  CB  . VAL B 1 151 ? 15.727  -9.581  -0.141  1.00 13.19 ? 151 VAL B CB  1 
ATOM   2992 C  CG1 . VAL B 1 151 ? 16.736  -8.473  0.082   1.00 14.99 ? 151 VAL B CG1 1 
ATOM   2993 C  CG2 . VAL B 1 151 ? 15.306  -10.156 1.204   1.00 10.22 ? 151 VAL B CG2 1 
ATOM   2994 N  N   . ASN B 1 152 ? 14.302  -7.349  -2.629  1.00 18.57 ? 152 ASN B N   1 
ATOM   2995 C  CA  . ASN B 1 152 ? 14.586  -6.640  -3.880  1.00 21.42 ? 152 ASN B CA  1 
ATOM   2996 C  C   . ASN B 1 152 ? 14.252  -7.389  -5.164  1.00 21.94 ? 152 ASN B C   1 
ATOM   2997 O  O   . ASN B 1 152 ? 14.656  -6.962  -6.246  1.00 21.35 ? 152 ASN B O   1 
ATOM   2998 C  CB  . ASN B 1 152 ? 16.051  -6.193  -3.953  1.00 20.93 ? 152 ASN B CB  1 
ATOM   2999 C  CG  . ASN B 1 152 ? 16.410  -5.202  -2.876  1.00 24.45 ? 152 ASN B CG  1 
ATOM   3000 O  OD1 . ASN B 1 152 ? 15.631  -4.300  -2.561  1.00 23.96 ? 152 ASN B OD1 1 
ATOM   3001 N  ND2 . ASN B 1 152 ? 17.604  -5.341  -2.322  1.00 23.82 ? 152 ASN B ND2 1 
ATOM   3002 N  N   . SER B 1 153 ? 13.513  -8.488  -5.054  1.00 20.85 ? 153 SER B N   1 
ATOM   3003 C  CA  . SER B 1 153 ? 13.148  -9.273  -6.231  1.00 19.92 ? 153 SER B CA  1 
ATOM   3004 C  C   . SER B 1 153 ? 11.867  -10.081 -6.044  1.00 18.22 ? 153 SER B C   1 
ATOM   3005 O  O   . SER B 1 153 ? 11.569  -10.533 -4.941  1.00 18.80 ? 153 SER B O   1 
ATOM   3006 C  CB  . SER B 1 153 ? 14.285  -10.230 -6.590  1.00 18.31 ? 153 SER B CB  1 
ATOM   3007 O  OG  . SER B 1 153 ? 13.893  -11.098 -7.640  1.00 21.45 ? 153 SER B OG  1 
ATOM   3008 N  N   . ILE B 1 154 ? 11.123  -10.273 -7.131  1.00 18.19 ? 154 ILE B N   1 
ATOM   3009 C  CA  . ILE B 1 154 ? 9.885   -11.043 -7.083  1.00 17.79 ? 154 ILE B CA  1 
ATOM   3010 C  C   . ILE B 1 154 ? 10.244  -12.527 -6.930  1.00 18.89 ? 154 ILE B C   1 
ATOM   3011 O  O   . ILE B 1 154 ? 9.405   -13.340 -6.545  1.00 17.43 ? 154 ILE B O   1 
ATOM   3012 C  CB  . ILE B 1 154 ? 9.026   -10.829 -8.367  1.00 19.43 ? 154 ILE B CB  1 
ATOM   3013 C  CG1 . ILE B 1 154 ? 7.621   -11.408 -8.165  1.00 17.53 ? 154 ILE B CG1 1 
ATOM   3014 C  CG2 . ILE B 1 154 ? 9.685   -11.505 -9.572  1.00 21.16 ? 154 ILE B CG2 1 
ATOM   3015 C  CD1 . ILE B 1 154 ? 6.823   -10.721 -7.065  1.00 16.46 ? 154 ILE B CD1 1 
ATOM   3016 N  N   . ARG B 1 155 ? 11.491  -12.878 -7.239  1.00 17.93 ? 155 ARG B N   1 
ATOM   3017 C  CA  . ARG B 1 155 ? 11.940  -14.258 -7.085  1.00 17.19 ? 155 ARG B CA  1 
ATOM   3018 C  C   . ARG B 1 155 ? 12.404  -14.344 -5.646  1.00 18.72 ? 155 ARG B C   1 
ATOM   3019 O  O   . ARG B 1 155 ? 13.483  -13.871 -5.302  1.00 18.68 ? 155 ARG B O   1 
ATOM   3020 C  CB  . ARG B 1 155 ? 13.111  -14.588 -8.017  1.00 18.40 ? 155 ARG B CB  1 
ATOM   3021 C  CG  . ARG B 1 155 ? 13.682  -16.002 -7.807  1.00 23.01 ? 155 ARG B CG  1 
ATOM   3022 C  CD  . ARG B 1 155 ? 14.938  -16.247 -8.643  1.00 28.69 ? 155 ARG B CD  1 
ATOM   3023 N  NE  . ARG B 1 155 ? 14.670  -16.292 -10.081 1.00 35.02 ? 155 ARG B NE  1 
ATOM   3024 C  CZ  . ARG B 1 155 ? 14.088  -17.316 -10.704 1.00 36.40 ? 155 ARG B CZ  1 
ATOM   3025 N  NH1 . ARG B 1 155 ? 13.882  -17.266 -12.013 1.00 32.13 ? 155 ARG B NH1 1 
ATOM   3026 N  NH2 . ARG B 1 155 ? 13.732  -18.398 -10.024 1.00 40.14 ? 155 ARG B NH2 1 
ATOM   3027 N  N   . SER B 1 156 ? 11.566  -14.937 -4.809  1.00 18.77 ? 156 SER B N   1 
ATOM   3028 C  CA  . SER B 1 156 ? 11.841  -15.079 -3.390  1.00 18.89 ? 156 SER B CA  1 
ATOM   3029 C  C   . SER B 1 156 ? 13.206  -15.677 -3.069  1.00 19.00 ? 156 SER B C   1 
ATOM   3030 O  O   . SER B 1 156 ? 13.661  -16.602 -3.737  1.00 23.35 ? 156 SER B O   1 
ATOM   3031 C  CB  . SER B 1 156 ? 10.745  -15.933 -2.758  1.00 14.19 ? 156 SER B CB  1 
ATOM   3032 O  OG  . SER B 1 156 ? 9.470   -15.367 -3.011  1.00 18.44 ? 156 SER B OG  1 
ATOM   3033 N  N   . VAL B 1 157 ? 13.860  -15.142 -2.042  1.00 17.19 ? 157 VAL B N   1 
ATOM   3034 C  CA  . VAL B 1 157 ? 15.157  -15.659 -1.632  1.00 17.67 ? 157 VAL B CA  1 
ATOM   3035 C  C   . VAL B 1 157 ? 14.896  -16.912 -0.815  1.00 19.95 ? 157 VAL B C   1 
ATOM   3036 O  O   . VAL B 1 157 ? 15.792  -17.722 -0.586  1.00 22.22 ? 157 VAL B O   1 
ATOM   3037 C  CB  . VAL B 1 157 ? 15.938  -14.649 -0.753  1.00 14.79 ? 157 VAL B CB  1 
ATOM   3038 C  CG1 . VAL B 1 157 ? 16.153  -13.354 -1.524  1.00 17.43 ? 157 VAL B CG1 1 
ATOM   3039 C  CG2 . VAL B 1 157 ? 15.190  -14.381 0.549   1.00 9.60  ? 157 VAL B CG2 1 
ATOM   3040 N  N   . LYS B 1 158 ? 13.648  -17.075 -0.396  1.00 19.74 ? 158 LYS B N   1 
ATOM   3041 C  CA  . LYS B 1 158 ? 13.267  -18.217 0.416   1.00 23.02 ? 158 LYS B CA  1 
ATOM   3042 C  C   . LYS B 1 158 ? 11.751  -18.445 0.315   1.00 22.35 ? 158 LYS B C   1 
ATOM   3043 O  O   . LYS B 1 158 ? 10.978  -17.491 0.364   1.00 21.00 ? 158 LYS B O   1 
ATOM   3044 C  CB  . LYS B 1 158 ? 13.661  -17.926 1.874   1.00 26.81 ? 158 LYS B CB  1 
ATOM   3045 C  CG  . LYS B 1 158 ? 13.367  -19.033 2.863   1.00 32.37 ? 158 LYS B CG  1 
ATOM   3046 C  CD  . LYS B 1 158 ? 14.313  -20.202 2.692   1.00 33.82 ? 158 LYS B CD  1 
ATOM   3047 C  CE  . LYS B 1 158 ? 15.700  -19.894 3.239   1.00 33.24 ? 158 LYS B CE  1 
ATOM   3048 N  NZ  . LYS B 1 158 ? 15.708  -19.854 4.724   1.00 22.81 ? 158 LYS B NZ  1 
ATOM   3049 N  N   . THR B 1 159 ? 11.330  -19.697 0.147   1.00 20.06 ? 159 THR B N   1 
ATOM   3050 C  CA  . THR B 1 159 ? 9.900   -20.019 0.101   1.00 18.53 ? 159 THR B CA  1 
ATOM   3051 C  C   . THR B 1 159 ? 9.632   -21.315 0.854   1.00 21.11 ? 159 THR B C   1 
ATOM   3052 O  O   . THR B 1 159 ? 10.518  -22.160 0.992   1.00 22.08 ? 159 THR B O   1 
ATOM   3053 C  CB  . THR B 1 159 ? 9.352   -20.215 -1.340  1.00 17.47 ? 159 THR B CB  1 
ATOM   3054 O  OG1 . THR B 1 159 ? 9.987   -21.340 -1.951  1.00 19.19 ? 159 THR B OG1 1 
ATOM   3055 C  CG2 . THR B 1 159 ? 9.586   -18.982 -2.186  1.00 17.66 ? 159 THR B CG2 1 
ATOM   3056 N  N   . VAL B 1 160 ? 8.411   -21.452 1.358   1.00 18.96 ? 160 VAL B N   1 
ATOM   3057 C  CA  . VAL B 1 160 ? 7.992   -22.658 2.058   1.00 18.39 ? 160 VAL B CA  1 
ATOM   3058 C  C   . VAL B 1 160 ? 6.585   -22.954 1.580   1.00 19.57 ? 160 VAL B C   1 
ATOM   3059 O  O   . VAL B 1 160 ? 5.819   -22.033 1.300   1.00 18.80 ? 160 VAL B O   1 
ATOM   3060 C  CB  . VAL B 1 160 ? 7.987   -22.478 3.590   1.00 16.79 ? 160 VAL B CB  1 
ATOM   3061 C  CG1 . VAL B 1 160 ? 9.403   -22.252 4.083   1.00 17.31 ? 160 VAL B CG1 1 
ATOM   3062 C  CG2 . VAL B 1 160 ? 7.094   -21.308 3.977   1.00 17.10 ? 160 VAL B CG2 1 
ATOM   3063 N  N   . LYS B 1 161 ? 6.248   -24.234 1.470   1.00 22.35 ? 161 LYS B N   1 
ATOM   3064 C  CA  . LYS B 1 161 ? 4.926   -24.618 1.005   1.00 24.51 ? 161 LYS B CA  1 
ATOM   3065 C  C   . LYS B 1 161 ? 3.842   -24.082 1.930   1.00 23.45 ? 161 LYS B C   1 
ATOM   3066 O  O   . LYS B 1 161 ? 3.963   -24.121 3.157   1.00 23.30 ? 161 LYS B O   1 
ATOM   3067 C  CB  . LYS B 1 161 ? 4.801   -26.137 0.892   1.00 30.54 ? 161 LYS B CB  1 
ATOM   3068 C  CG  . LYS B 1 161 ? 3.484   -26.566 0.257   1.00 42.24 ? 161 LYS B CG  1 
ATOM   3069 C  CD  . LYS B 1 161 ? 3.332   -28.076 0.169   1.00 46.29 ? 161 LYS B CD  1 
ATOM   3070 C  CE  . LYS B 1 161 ? 1.985   -28.434 -0.444  1.00 51.43 ? 161 LYS B CE  1 
ATOM   3071 N  NZ  . LYS B 1 161 ? 0.856   -27.827 0.324   1.00 50.18 ? 161 LYS B NZ  1 
ATOM   3072 N  N   . TRP B 1 162 ? 2.775   -23.587 1.324   1.00 20.22 ? 162 TRP B N   1 
ATOM   3073 C  CA  . TRP B 1 162 ? 1.668   -23.013 2.072   1.00 20.34 ? 162 TRP B CA  1 
ATOM   3074 C  C   . TRP B 1 162 ? 0.355   -23.524 1.504   1.00 20.62 ? 162 TRP B C   1 
ATOM   3075 O  O   . TRP B 1 162 ? 0.271   -23.870 0.325   1.00 24.75 ? 162 TRP B O   1 
ATOM   3076 C  CB  . TRP B 1 162 ? 1.737   -21.487 1.966   1.00 15.17 ? 162 TRP B CB  1 
ATOM   3077 C  CG  . TRP B 1 162 ? 0.601   -20.756 2.591   1.00 13.47 ? 162 TRP B CG  1 
ATOM   3078 C  CD1 . TRP B 1 162 ? 0.152   -20.871 3.878   1.00 10.58 ? 162 TRP B CD1 1 
ATOM   3079 C  CD2 . TRP B 1 162 ? -0.221  -19.764 1.965   1.00 11.46 ? 162 TRP B CD2 1 
ATOM   3080 N  NE1 . TRP B 1 162 ? -0.902  -20.013 4.089   1.00 12.30 ? 162 TRP B NE1 1 
ATOM   3081 C  CE2 . TRP B 1 162 ? -1.152  -19.321 2.931   1.00 11.45 ? 162 TRP B CE2 1 
ATOM   3082 C  CE3 . TRP B 1 162 ? -0.262  -19.206 0.678   1.00 12.55 ? 162 TRP B CE3 1 
ATOM   3083 C  CZ2 . TRP B 1 162 ? -2.116  -18.343 2.651   1.00 11.66 ? 162 TRP B CZ2 1 
ATOM   3084 C  CZ3 . TRP B 1 162 ? -1.223  -18.230 0.398   1.00 13.74 ? 162 TRP B CZ3 1 
ATOM   3085 C  CH2 . TRP B 1 162 ? -2.135  -17.811 1.381   1.00 9.34  ? 162 TRP B CH2 1 
ATOM   3086 N  N   . ASP B 1 163 ? -0.667  -23.575 2.348   1.00 18.48 ? 163 ASP B N   1 
ATOM   3087 C  CA  . ASP B 1 163 ? -1.976  -24.028 1.916   1.00 20.26 ? 163 ASP B CA  1 
ATOM   3088 C  C   . ASP B 1 163 ? -2.924  -22.843 1.886   1.00 19.93 ? 163 ASP B C   1 
ATOM   3089 O  O   . ASP B 1 163 ? -3.061  -22.127 2.881   1.00 15.74 ? 163 ASP B O   1 
ATOM   3090 C  CB  . ASP B 1 163 ? -2.525  -25.073 2.887   1.00 23.57 ? 163 ASP B CB  1 
ATOM   3091 C  CG  . ASP B 1 163 ? -1.589  -26.238 3.068   1.00 30.60 ? 163 ASP B CG  1 
ATOM   3092 O  OD1 . ASP B 1 163 ? -1.319  -26.937 2.068   1.00 34.66 ? 163 ASP B OD1 1 
ATOM   3093 O  OD2 . ASP B 1 163 ? -1.114  -26.452 4.207   1.00 36.30 ? 163 ASP B OD2 1 
ATOM   3094 N  N   . ARG B 1 164 ? -3.555  -22.624 0.737   1.00 18.27 ? 164 ARG B N   1 
ATOM   3095 C  CA  . ARG B 1 164 ? -4.533  -21.555 0.596   1.00 16.91 ? 164 ARG B CA  1 
ATOM   3096 C  C   . ARG B 1 164 ? -5.856  -22.145 1.089   1.00 17.95 ? 164 ARG B C   1 
ATOM   3097 O  O   . ARG B 1 164 ? -6.212  -23.264 0.724   1.00 17.84 ? 164 ARG B O   1 
ATOM   3098 C  CB  . ARG B 1 164 ? -4.678  -21.143 -0.873  1.00 14.45 ? 164 ARG B CB  1 
ATOM   3099 C  CG  . ARG B 1 164 ? -5.741  -20.070 -1.119  1.00 14.24 ? 164 ARG B CG  1 
ATOM   3100 C  CD  . ARG B 1 164 ? -5.897  -19.743 -2.612  1.00 11.25 ? 164 ARG B CD  1 
ATOM   3101 N  NE  . ARG B 1 164 ? -6.829  -18.642 -2.835  1.00 11.66 ? 164 ARG B NE  1 
ATOM   3102 C  CZ  . ARG B 1 164 ? -8.130  -18.681 -2.547  1.00 16.23 ? 164 ARG B CZ  1 
ATOM   3103 N  NH1 . ARG B 1 164 ? -8.895  -17.621 -2.787  1.00 9.34  ? 164 ARG B NH1 1 
ATOM   3104 N  NH2 . ARG B 1 164 ? -8.677  -19.780 -2.036  1.00 8.81  ? 164 ARG B NH2 1 
ATOM   3105 N  N   . ARG B 1 165 ? -6.567  -21.412 1.937   1.00 18.20 ? 165 ARG B N   1 
ATOM   3106 C  CA  . ARG B 1 165 ? -7.855  -21.877 2.453   1.00 18.84 ? 165 ARG B CA  1 
ATOM   3107 C  C   . ARG B 1 165 ? -8.868  -20.761 2.266   1.00 18.49 ? 165 ARG B C   1 
ATOM   3108 O  O   . ARG B 1 165 ? -8.825  -19.743 2.958   1.00 18.94 ? 165 ARG B O   1 
ATOM   3109 C  CB  . ARG B 1 165 ? -7.749  -22.248 3.933   1.00 16.65 ? 165 ARG B CB  1 
ATOM   3110 C  CG  . ARG B 1 165 ? -6.852  -23.440 4.212   1.00 16.83 ? 165 ARG B CG  1 
ATOM   3111 C  CD  . ARG B 1 165 ? -6.881  -23.788 5.687   1.00 16.72 ? 165 ARG B CD  1 
ATOM   3112 N  NE  . ARG B 1 165 ? -6.062  -24.950 6.008   1.00 17.83 ? 165 ARG B NE  1 
ATOM   3113 C  CZ  . ARG B 1 165 ? -5.933  -25.447 7.235   1.00 21.59 ? 165 ARG B CZ  1 
ATOM   3114 N  NH1 . ARG B 1 165 ? -5.167  -26.509 7.449   1.00 20.00 ? 165 ARG B NH1 1 
ATOM   3115 N  NH2 . ARG B 1 165 ? -6.573  -24.880 8.249   1.00 19.89 ? 165 ARG B NH2 1 
ATOM   3116 N  N   . ASP B 1 166 ? -9.783  -20.968 1.325   1.00 20.93 ? 166 ASP B N   1 
ATOM   3117 C  CA  . ASP B 1 166 ? -10.789 -19.968 0.993   1.00 19.15 ? 166 ASP B CA  1 
ATOM   3118 C  C   . ASP B 1 166 ? -11.615 -19.520 2.193   1.00 19.24 ? 166 ASP B C   1 
ATOM   3119 O  O   . ASP B 1 166 ? -12.170 -20.341 2.923   1.00 19.65 ? 166 ASP B O   1 
ATOM   3120 C  CB  . ASP B 1 166 ? -11.725 -20.501 -0.089  1.00 16.40 ? 166 ASP B CB  1 
ATOM   3121 C  CG  . ASP B 1 166 ? -12.306 -19.396 -0.944  1.00 14.76 ? 166 ASP B CG  1 
ATOM   3122 O  OD1 . ASP B 1 166 ? -11.585 -18.885 -1.826  1.00 14.51 ? 166 ASP B OD1 1 
ATOM   3123 O  OD2 . ASP B 1 166 ? -13.471 -19.019 -0.723  1.00 14.24 ? 166 ASP B OD2 1 
ATOM   3124 N  N   . GLY B 1 167 ? -11.677 -18.206 2.389   1.00 17.50 ? 167 GLY B N   1 
ATOM   3125 C  CA  . GLY B 1 167 ? -12.452 -17.640 3.477   1.00 18.95 ? 167 GLY B CA  1 
ATOM   3126 C  C   . GLY B 1 167 ? -11.968 -17.879 4.895   1.00 19.22 ? 167 GLY B C   1 
ATOM   3127 O  O   . GLY B 1 167 ? -12.708 -17.620 5.838   1.00 24.37 ? 167 GLY B O   1 
ATOM   3128 N  N   . GLN B 1 168 ? -10.750 -18.377 5.067   1.00 16.85 ? 168 GLN B N   1 
ATOM   3129 C  CA  . GLN B 1 168 ? -10.239 -18.606 6.414   1.00 18.82 ? 168 GLN B CA  1 
ATOM   3130 C  C   . GLN B 1 168 ? -9.109  -17.636 6.727   1.00 17.72 ? 168 GLN B C   1 
ATOM   3131 O  O   . GLN B 1 168 ? -8.197  -17.451 5.922   1.00 18.59 ? 168 GLN B O   1 
ATOM   3132 C  CB  . GLN B 1 168 ? -9.756  -20.046 6.572   1.00 21.68 ? 168 GLN B CB  1 
ATOM   3133 C  CG  . GLN B 1 168 ? -10.869 -21.082 6.575   1.00 31.42 ? 168 GLN B CG  1 
ATOM   3134 C  CD  . GLN B 1 168 ? -10.343 -22.492 6.793   1.00 40.09 ? 168 GLN B CD  1 
ATOM   3135 O  OE1 . GLN B 1 168 ? -9.615  -22.752 7.753   1.00 45.88 ? 168 GLN B OE1 1 
ATOM   3136 N  NE2 . GLN B 1 168 ? -10.716 -23.412 5.909   1.00 43.51 ? 168 GLN B NE2 1 
ATOM   3137 N  N   . SER B 1 169 ? -9.181  -17.010 7.895   1.00 11.53 ? 169 SER B N   1 
ATOM   3138 C  CA  . SER B 1 169 ? -8.177  -16.039 8.303   1.00 12.88 ? 169 SER B CA  1 
ATOM   3139 C  C   . SER B 1 169 ? -6.855  -16.670 8.670   1.00 12.93 ? 169 SER B C   1 
ATOM   3140 O  O   . SER B 1 169 ? -6.799  -17.681 9.372   1.00 13.82 ? 169 SER B O   1 
ATOM   3141 C  CB  . SER B 1 169 ? -8.668  -15.217 9.501   1.00 13.31 ? 169 SER B CB  1 
ATOM   3142 O  OG  . SER B 1 169 ? -9.812  -14.460 9.163   1.00 22.84 ? 169 SER B OG  1 
ATOM   3143 N  N   . LEU B 1 170 ? -5.786  -16.059 8.187   1.00 10.49 ? 170 LEU B N   1 
ATOM   3144 C  CA  . LEU B 1 170 ? -4.450  -16.526 8.495   1.00 11.42 ? 170 LEU B CA  1 
ATOM   3145 C  C   . LEU B 1 170 ? -3.866  -15.473 9.428   1.00 10.35 ? 170 LEU B C   1 
ATOM   3146 O  O   . LEU B 1 170 ? -3.933  -14.288 9.132   1.00 9.69  ? 170 LEU B O   1 
ATOM   3147 C  CB  . LEU B 1 170 ? -3.605  -16.604 7.226   1.00 10.66 ? 170 LEU B CB  1 
ATOM   3148 C  CG  . LEU B 1 170 ? -2.206  -17.206 7.379   1.00 14.43 ? 170 LEU B CG  1 
ATOM   3149 C  CD1 . LEU B 1 170 ? -2.328  -18.698 7.646   1.00 10.70 ? 170 LEU B CD1 1 
ATOM   3150 C  CD2 . LEU B 1 170 ? -1.399  -16.970 6.112   1.00 11.26 ? 170 LEU B CD2 1 
ATOM   3151 N  N   . ASN B 1 171 ? -3.336  -15.894 10.572  1.00 11.44 ? 171 ASN B N   1 
ATOM   3152 C  CA  . ASN B 1 171 ? -2.707  -14.951 11.491  1.00 12.72 ? 171 ASN B CA  1 
ATOM   3153 C  C   . ASN B 1 171 ? -1.211  -15.036 11.263  1.00 13.26 ? 171 ASN B C   1 
ATOM   3154 O  O   . ASN B 1 171 ? -0.628  -16.122 11.285  1.00 16.71 ? 171 ASN B O   1 
ATOM   3155 C  CB  . ASN B 1 171 ? -3.056  -15.275 12.942  1.00 16.86 ? 171 ASN B CB  1 
ATOM   3156 C  CG  . ASN B 1 171 ? -4.360  -14.634 13.373  1.00 23.94 ? 171 ASN B CG  1 
ATOM   3157 O  OD1 . ASN B 1 171 ? -4.437  -13.413 13.540  1.00 21.50 ? 171 ASN B OD1 1 
ATOM   3158 N  ND2 . ASN B 1 171 ? -5.398  -15.447 13.533  1.00 24.24 ? 171 ASN B ND2 1 
ATOM   3159 N  N   . VAL B 1 172 ? -0.597  -13.882 11.038  1.00 12.34 ? 172 VAL B N   1 
ATOM   3160 C  CA  . VAL B 1 172 ? 0.825   -13.814 10.746  1.00 12.57 ? 172 VAL B CA  1 
ATOM   3161 C  C   . VAL B 1 172 ? 1.608   -12.932 11.704  1.00 12.91 ? 172 VAL B C   1 
ATOM   3162 O  O   . VAL B 1 172 ? 1.150   -11.858 12.089  1.00 14.10 ? 172 VAL B O   1 
ATOM   3163 C  CB  . VAL B 1 172 ? 1.044   -13.256 9.328   1.00 13.40 ? 172 VAL B CB  1 
ATOM   3164 C  CG1 . VAL B 1 172 ? 2.510   -13.342 8.958   1.00 13.73 ? 172 VAL B CG1 1 
ATOM   3165 C  CG2 . VAL B 1 172 ? 0.162   -14.006 8.328   1.00 7.39  ? 172 VAL B CG2 1 
ATOM   3166 N  N   . LEU B 1 173 ? 2.790   -13.397 12.092  1.00 12.01 ? 173 LEU B N   1 
ATOM   3167 C  CA  . LEU B 1 173 ? 3.662   -12.618 12.959  1.00 12.35 ? 173 LEU B CA  1 
ATOM   3168 C  C   . LEU B 1 173 ? 4.995   -12.492 12.230  1.00 13.19 ? 173 LEU B C   1 
ATOM   3169 O  O   . LEU B 1 173 ? 5.650   -13.497 11.942  1.00 11.86 ? 173 LEU B O   1 
ATOM   3170 C  CB  . LEU B 1 173 ? 3.881   -13.305 14.308  1.00 14.15 ? 173 LEU B CB  1 
ATOM   3171 C  CG  . LEU B 1 173 ? 4.852   -12.547 15.227  1.00 17.13 ? 173 LEU B CG  1 
ATOM   3172 C  CD1 . LEU B 1 173 ? 4.252   -11.212 15.617  1.00 18.45 ? 173 LEU B CD1 1 
ATOM   3173 C  CD2 . LEU B 1 173 ? 5.150   -13.357 16.466  1.00 12.08 ? 173 LEU B CD2 1 
ATOM   3174 N  N   . VAL B 1 174 ? 5.379   -11.261 11.908  1.00 9.28  ? 174 VAL B N   1 
ATOM   3175 C  CA  . VAL B 1 174 ? 6.641   -11.009 11.221  1.00 11.33 ? 174 VAL B CA  1 
ATOM   3176 C  C   . VAL B 1 174 ? 7.509   -10.204 12.176  1.00 14.02 ? 174 VAL B C   1 
ATOM   3177 O  O   . VAL B 1 174 ? 7.127   -9.109  12.583  1.00 17.79 ? 174 VAL B O   1 
ATOM   3178 C  CB  . VAL B 1 174 ? 6.441   -10.181 9.917   1.00 9.19  ? 174 VAL B CB  1 
ATOM   3179 C  CG1 . VAL B 1 174 ? 7.779   -9.967  9.232   1.00 10.13 ? 174 VAL B CG1 1 
ATOM   3180 C  CG2 . VAL B 1 174 ? 5.476   -10.893 8.973   1.00 11.55 ? 174 VAL B CG2 1 
ATOM   3181 N  N   . THR B 1 175 ? 8.670   -10.741 12.537  1.00 14.39 ? 175 THR B N   1 
ATOM   3182 C  CA  . THR B 1 175 ? 9.566   -10.049 13.451  1.00 16.98 ? 175 THR B CA  1 
ATOM   3183 C  C   . THR B 1 175 ? 10.984  -9.980  12.907  1.00 18.34 ? 175 THR B C   1 
ATOM   3184 O  O   . THR B 1 175 ? 11.409  -10.845 12.143  1.00 20.08 ? 175 THR B O   1 
ATOM   3185 C  CB  . THR B 1 175 ? 9.626   -10.757 14.817  1.00 18.32 ? 175 THR B CB  1 
ATOM   3186 O  OG1 . THR B 1 175 ? 10.240  -12.040 14.658  1.00 23.92 ? 175 THR B OG1 1 
ATOM   3187 C  CG2 . THR B 1 175 ? 8.227   -10.956 15.380  1.00 16.96 ? 175 THR B CG2 1 
ATOM   3188 N  N   . PHE B 1 176 ? 11.708  -8.938  13.302  1.00 18.49 ? 176 PHE B N   1 
ATOM   3189 C  CA  . PHE B 1 176 ? 13.094  -8.761  12.894  1.00 16.71 ? 176 PHE B CA  1 
ATOM   3190 C  C   . PHE B 1 176 ? 13.893  -8.477  14.152  1.00 18.68 ? 176 PHE B C   1 
ATOM   3191 O  O   . PHE B 1 176 ? 13.536  -7.608  14.947  1.00 19.35 ? 176 PHE B O   1 
ATOM   3192 C  CB  . PHE B 1 176 ? 13.259  -7.592  11.921  1.00 15.78 ? 176 PHE B CB  1 
ATOM   3193 C  CG  . PHE B 1 176 ? 14.691  -7.349  11.504  1.00 20.91 ? 176 PHE B CG  1 
ATOM   3194 C  CD1 . PHE B 1 176 ? 15.372  -8.275  10.719  1.00 18.17 ? 176 PHE B CD1 1 
ATOM   3195 C  CD2 . PHE B 1 176 ? 15.366  -6.201  11.913  1.00 16.84 ? 176 PHE B CD2 1 
ATOM   3196 C  CE1 . PHE B 1 176 ? 16.704  -8.057  10.347  1.00 21.85 ? 176 PHE B CE1 1 
ATOM   3197 C  CE2 . PHE B 1 176 ? 16.697  -5.975  11.547  1.00 16.17 ? 176 PHE B CE2 1 
ATOM   3198 C  CZ  . PHE B 1 176 ? 17.366  -6.902  10.765  1.00 16.12 ? 176 PHE B CZ  1 
ATOM   3199 N  N   . ASN B 1 177 ? 14.964  -9.234  14.338  1.00 18.01 ? 177 ASN B N   1 
ATOM   3200 C  CA  . ASN B 1 177 ? 15.827  -9.072  15.489  1.00 19.27 ? 177 ASN B CA  1 
ATOM   3201 C  C   . ASN B 1 177 ? 17.156  -8.558  14.945  1.00 20.60 ? 177 ASN B C   1 
ATOM   3202 O  O   . ASN B 1 177 ? 17.850  -9.275  14.230  1.00 20.48 ? 177 ASN B O   1 
ATOM   3203 C  CB  . ASN B 1 177 ? 16.040  -10.419 16.174  1.00 24.71 ? 177 ASN B CB  1 
ATOM   3204 C  CG  . ASN B 1 177 ? 16.886  -10.304 17.417  1.00 28.46 ? 177 ASN B CG  1 
ATOM   3205 O  OD1 . ASN B 1 177 ? 17.900  -9.606  17.422  1.00 32.75 ? 177 ASN B OD1 1 
ATOM   3206 N  ND2 . ASN B 1 177 ? 16.490  -10.999 18.475  1.00 28.74 ? 177 ASN B ND2 1 
ATOM   3207 N  N   . PRO B 1 178 ? 17.514  -7.305  15.263  1.00 19.03 ? 178 PRO B N   1 
ATOM   3208 C  CA  . PRO B 1 178 ? 18.756  -6.669  14.812  1.00 19.86 ? 178 PRO B CA  1 
ATOM   3209 C  C   . PRO B 1 178 ? 20.050  -7.333  15.284  1.00 23.45 ? 178 PRO B C   1 
ATOM   3210 O  O   . PRO B 1 178 ? 21.083  -7.217  14.625  1.00 22.51 ? 178 PRO B O   1 
ATOM   3211 C  CB  . PRO B 1 178 ? 18.613  -5.247  15.341  1.00 20.90 ? 178 PRO B CB  1 
ATOM   3212 C  CG  . PRO B 1 178 ? 17.830  -5.473  16.632  1.00 20.76 ? 178 PRO B CG  1 
ATOM   3213 C  CD  . PRO B 1 178 ? 16.733  -6.357  16.075  1.00 18.74 ? 178 PRO B CD  1 
ATOM   3214 N  N   . SER B 1 179 ? 20.003  -8.027  16.416  1.00 24.82 ? 179 SER B N   1 
ATOM   3215 C  CA  . SER B 1 179 ? 21.208  -8.671  16.922  1.00 27.49 ? 179 SER B CA  1 
ATOM   3216 C  C   . SER B 1 179 ? 21.598  -9.890  16.087  1.00 28.59 ? 179 SER B C   1 
ATOM   3217 O  O   . SER B 1 179 ? 22.782  -10.113 15.828  1.00 28.42 ? 179 SER B O   1 
ATOM   3218 C  CB  . SER B 1 179 ? 21.040  -9.064  18.394  1.00 28.71 ? 179 SER B CB  1 
ATOM   3219 O  OG  . SER B 1 179 ? 20.020  -10.024 18.569  1.00 37.93 ? 179 SER B OG  1 
ATOM   3220 N  N   . THR B 1 180 ? 20.608  -10.665 15.656  1.00 26.25 ? 180 THR B N   1 
ATOM   3221 C  CA  . THR B 1 180 ? 20.871  -11.852 14.848  1.00 23.63 ? 180 THR B CA  1 
ATOM   3222 C  C   . THR B 1 180 ? 20.575  -11.584 13.375  1.00 23.62 ? 180 THR B C   1 
ATOM   3223 O  O   . THR B 1 180 ? 20.950  -12.371 12.507  1.00 23.29 ? 180 THR B O   1 
ATOM   3224 C  CB  . THR B 1 180 ? 20.001  -13.044 15.298  1.00 24.19 ? 180 THR B CB  1 
ATOM   3225 O  OG1 . THR B 1 180 ? 18.625  -12.781 14.992  1.00 25.13 ? 180 THR B OG1 1 
ATOM   3226 C  CG2 . THR B 1 180 ? 20.137  -13.259 16.802  1.00 18.93 ? 180 THR B CG2 1 
ATOM   3227 N  N   . ARG B 1 181 ? 19.911  -10.466 13.100  1.00 19.91 ? 181 ARG B N   1 
ATOM   3228 C  CA  . ARG B 1 181 ? 19.542  -10.101 11.739  1.00 20.41 ? 181 ARG B CA  1 
ATOM   3229 C  C   . ARG B 1 181 ? 18.596  -11.127 11.133  1.00 18.57 ? 181 ARG B C   1 
ATOM   3230 O  O   . ARG B 1 181 ? 18.530  -11.285 9.916   1.00 20.48 ? 181 ARG B O   1 
ATOM   3231 C  CB  . ARG B 1 181 ? 20.781  -9.966  10.863  1.00 24.13 ? 181 ARG B CB  1 
ATOM   3232 C  CG  . ARG B 1 181 ? 21.693  -8.836  11.286  1.00 31.95 ? 181 ARG B CG  1 
ATOM   3233 C  CD  . ARG B 1 181 ? 22.948  -8.784  10.444  1.00 37.47 ? 181 ARG B CD  1 
ATOM   3234 N  NE  . ARG B 1 181 ? 23.801  -7.676  10.855  1.00 47.26 ? 181 ARG B NE  1 
ATOM   3235 C  CZ  . ARG B 1 181 ? 24.996  -7.420  10.336  1.00 49.34 ? 181 ARG B CZ  1 
ATOM   3236 N  NH1 . ARG B 1 181 ? 25.487  -8.197  9.379   1.00 48.19 ? 181 ARG B NH1 1 
ATOM   3237 N  NH2 . ARG B 1 181 ? 25.697  -6.381  10.774  1.00 51.09 ? 181 ARG B NH2 1 
ATOM   3238 N  N   . ASN B 1 182 ? 17.864  -11.826 11.989  1.00 15.80 ? 182 ASN B N   1 
ATOM   3239 C  CA  . ASN B 1 182 ? 16.908  -12.818 11.525  1.00 17.74 ? 182 ASN B CA  1 
ATOM   3240 C  C   . ASN B 1 182 ? 15.514  -12.235 11.309  1.00 17.92 ? 182 ASN B C   1 
ATOM   3241 O  O   . ASN B 1 182 ? 14.936  -11.613 12.204  1.00 18.86 ? 182 ASN B O   1 
ATOM   3242 C  CB  . ASN B 1 182 ? 16.819  -13.974 12.520  1.00 21.45 ? 182 ASN B CB  1 
ATOM   3243 C  CG  . ASN B 1 182 ? 18.002  -14.915 12.432  1.00 27.67 ? 182 ASN B CG  1 
ATOM   3244 O  OD1 . ASN B 1 182 ? 19.158  -14.490 12.435  1.00 35.31 ? 182 ASN B OD1 1 
ATOM   3245 N  ND2 . ASN B 1 182 ? 17.717  -16.207 12.369  1.00 31.65 ? 182 ASN B ND2 1 
ATOM   3246 N  N   . LEU B 1 183 ? 14.990  -12.422 10.106  1.00 16.47 ? 183 LEU B N   1 
ATOM   3247 C  CA  . LEU B 1 183 ? 13.642  -11.976 9.778   1.00 16.61 ? 183 LEU B CA  1 
ATOM   3248 C  C   . LEU B 1 183 ? 12.823  -13.263 9.878   1.00 18.40 ? 183 LEU B C   1 
ATOM   3249 O  O   . LEU B 1 183 ? 12.986  -14.178 9.061   1.00 18.00 ? 183 LEU B O   1 
ATOM   3250 C  CB  . LEU B 1 183 ? 13.588  -11.424 8.353   1.00 17.29 ? 183 LEU B CB  1 
ATOM   3251 C  CG  . LEU B 1 183 ? 12.238  -10.933 7.830   1.00 19.53 ? 183 LEU B CG  1 
ATOM   3252 C  CD1 . LEU B 1 183 ? 11.768  -9.739  8.647   1.00 20.58 ? 183 LEU B CD1 1 
ATOM   3253 C  CD2 . LEU B 1 183 ? 12.376  -10.544 6.368   1.00 21.54 ? 183 LEU B CD2 1 
ATOM   3254 N  N   . ASP B 1 184 ? 11.970  -13.348 10.893  1.00 16.20 ? 184 ASP B N   1 
ATOM   3255 C  CA  . ASP B 1 184 ? 11.164  -14.542 11.098  1.00 17.03 ? 184 ASP B CA  1 
ATOM   3256 C  C   . ASP B 1 184 ? 9.702   -14.358 10.743  1.00 17.37 ? 184 ASP B C   1 
ATOM   3257 O  O   . ASP B 1 184 ? 9.109   -13.323 11.027  1.00 19.17 ? 184 ASP B O   1 
ATOM   3258 C  CB  . ASP B 1 184 ? 11.252  -15.011 12.553  1.00 19.96 ? 184 ASP B CB  1 
ATOM   3259 C  CG  . ASP B 1 184 ? 12.649  -15.436 12.947  1.00 27.67 ? 184 ASP B CG  1 
ATOM   3260 O  OD1 . ASP B 1 184 ? 13.204  -16.340 12.291  1.00 35.53 ? 184 ASP B OD1 1 
ATOM   3261 O  OD2 . ASP B 1 184 ? 13.193  -14.873 13.917  1.00 33.35 ? 184 ASP B OD2 1 
ATOM   3262 N  N   . VAL B 1 185 ? 9.126   -15.384 10.128  1.00 15.35 ? 185 VAL B N   1 
ATOM   3263 C  CA  . VAL B 1 185 ? 7.725   -15.362 9.758   1.00 13.54 ? 185 VAL B CA  1 
ATOM   3264 C  C   . VAL B 1 185 ? 7.035   -16.585 10.337  1.00 14.99 ? 185 VAL B C   1 
ATOM   3265 O  O   . VAL B 1 185 ? 7.491   -17.707 10.148  1.00 15.11 ? 185 VAL B O   1 
ATOM   3266 C  CB  . VAL B 1 185 ? 7.544   -15.382 8.228   1.00 14.30 ? 185 VAL B CB  1 
ATOM   3267 C  CG1 . VAL B 1 185 ? 6.058   -15.381 7.883   1.00 9.13  ? 185 VAL B CG1 1 
ATOM   3268 C  CG2 . VAL B 1 185 ? 8.231   -14.175 7.607   1.00 14.02 ? 185 VAL B CG2 1 
ATOM   3269 N  N   . VAL B 1 186 ? 5.949   -16.360 11.068  1.00 14.09 ? 186 VAL B N   1 
ATOM   3270 C  CA  . VAL B 1 186 ? 5.169   -17.451 11.638  1.00 13.85 ? 186 VAL B CA  1 
ATOM   3271 C  C   . VAL B 1 186 ? 3.721   -17.150 11.264  1.00 13.41 ? 186 VAL B C   1 
ATOM   3272 O  O   . VAL B 1 186 ? 3.228   -16.052 11.509  1.00 13.60 ? 186 VAL B O   1 
ATOM   3273 C  CB  . VAL B 1 186 ? 5.287   -17.521 13.178  1.00 17.06 ? 186 VAL B CB  1 
ATOM   3274 C  CG1 . VAL B 1 186 ? 4.464   -18.693 13.705  1.00 11.60 ? 186 VAL B CG1 1 
ATOM   3275 C  CG2 . VAL B 1 186 ? 6.750   -17.677 13.591  1.00 18.16 ? 186 VAL B CG2 1 
ATOM   3276 N  N   . ALA B 1 187 ? 3.051   -18.118 10.653  1.00 10.68 ? 187 ALA B N   1 
ATOM   3277 C  CA  . ALA B 1 187 ? 1.669   -17.941 10.235  1.00 12.55 ? 187 ALA B CA  1 
ATOM   3278 C  C   . ALA B 1 187 ? 0.853   -19.141 10.681  1.00 12.33 ? 187 ALA B C   1 
ATOM   3279 O  O   . ALA B 1 187 ? 1.326   -20.274 10.617  1.00 10.16 ? 187 ALA B O   1 
ATOM   3280 C  CB  . ALA B 1 187 ? 1.598   -17.786 8.710   1.00 10.73 ? 187 ALA B CB  1 
ATOM   3281 N  N   . THR B 1 188 ? -0.374  -18.897 11.124  1.00 13.30 ? 188 THR B N   1 
ATOM   3282 C  CA  . THR B 1 188 ? -1.223  -19.986 11.582  1.00 12.06 ? 188 THR B CA  1 
ATOM   3283 C  C   . THR B 1 188 ? -2.684  -19.829 11.193  1.00 15.50 ? 188 THR B C   1 
ATOM   3284 O  O   . THR B 1 188 ? -3.182  -18.716 11.026  1.00 13.25 ? 188 THR B O   1 
ATOM   3285 C  CB  . THR B 1 188 ? -1.190  -20.117 13.125  1.00 15.54 ? 188 THR B CB  1 
ATOM   3286 O  OG1 . THR B 1 188 ? -1.630  -18.886 13.715  1.00 16.94 ? 188 THR B OG1 1 
ATOM   3287 C  CG2 . THR B 1 188 ? 0.211   -20.438 13.618  1.00 14.65 ? 188 THR B CG2 1 
ATOM   3288 N  N   . TYR B 1 189 ? -3.359  -20.963 11.036  1.00 15.98 ? 189 TYR B N   1 
ATOM   3289 C  CA  . TYR B 1 189 ? -4.784  -20.974 10.753  1.00 14.70 ? 189 TYR B CA  1 
ATOM   3290 C  C   . TYR B 1 189 ? -5.414  -21.302 12.102  1.00 16.35 ? 189 TYR B C   1 
ATOM   3291 O  O   . TYR B 1 189 ? -4.726  -21.792 12.994  1.00 17.23 ? 189 TYR B O   1 
ATOM   3292 C  CB  . TYR B 1 189 ? -5.134  -22.035 9.711   1.00 15.16 ? 189 TYR B CB  1 
ATOM   3293 C  CG  . TYR B 1 189 ? -4.880  -21.582 8.289   1.00 12.27 ? 189 TYR B CG  1 
ATOM   3294 C  CD1 . TYR B 1 189 ? -3.949  -22.229 7.481   1.00 7.85  ? 189 TYR B CD1 1 
ATOM   3295 C  CD2 . TYR B 1 189 ? -5.592  -20.515 7.751   1.00 7.52  ? 189 TYR B CD2 1 
ATOM   3296 C  CE1 . TYR B 1 189 ? -3.736  -21.828 6.171   1.00 7.87  ? 189 TYR B CE1 1 
ATOM   3297 C  CE2 . TYR B 1 189 ? -5.385  -20.104 6.435   1.00 11.84 ? 189 TYR B CE2 1 
ATOM   3298 C  CZ  . TYR B 1 189 ? -4.458  -20.770 5.655   1.00 7.87  ? 189 TYR B CZ  1 
ATOM   3299 O  OH  . TYR B 1 189 ? -4.275  -20.393 4.351   1.00 13.46 ? 189 TYR B OH  1 
ATOM   3300 N  N   . SER B 1 190 ? -6.705  -21.034 12.255  1.00 16.79 ? 190 SER B N   1 
ATOM   3301 C  CA  . SER B 1 190 ? -7.399  -21.260 13.525  1.00 18.95 ? 190 SER B CA  1 
ATOM   3302 C  C   . SER B 1 190 ? -7.398  -22.702 14.039  1.00 19.97 ? 190 SER B C   1 
ATOM   3303 O  O   . SER B 1 190 ? -7.736  -22.949 15.195  1.00 20.08 ? 190 SER B O   1 
ATOM   3304 C  CB  . SER B 1 190 ? -8.848  -20.776 13.418  1.00 19.00 ? 190 SER B CB  1 
ATOM   3305 O  OG  . SER B 1 190 ? -9.589  -21.606 12.537  1.00 25.11 ? 190 SER B OG  1 
ATOM   3306 N  N   . ASP B 1 191 ? -7.028  -23.654 13.190  1.00 17.19 ? 191 ASP B N   1 
ATOM   3307 C  CA  . ASP B 1 191 ? -7.006  -25.053 13.604  1.00 17.01 ? 191 ASP B CA  1 
ATOM   3308 C  C   . ASP B 1 191 ? -5.618  -25.466 14.099  1.00 18.39 ? 191 ASP B C   1 
ATOM   3309 O  O   . ASP B 1 191 ? -5.368  -26.640 14.376  1.00 19.38 ? 191 ASP B O   1 
ATOM   3310 C  CB  . ASP B 1 191 ? -7.430  -25.941 12.433  1.00 18.13 ? 191 ASP B CB  1 
ATOM   3311 C  CG  . ASP B 1 191 ? -6.401  -25.965 11.313  1.00 19.31 ? 191 ASP B CG  1 
ATOM   3312 O  OD1 . ASP B 1 191 ? -5.602  -25.011 11.204  1.00 20.60 ? 191 ASP B OD1 1 
ATOM   3313 O  OD2 . ASP B 1 191 ? -6.405  -26.930 10.525  1.00 24.11 ? 191 ASP B OD2 1 
ATOM   3314 N  N   . GLY B 1 192 ? -4.712  -24.498 14.200  1.00 19.76 ? 192 GLY B N   1 
ATOM   3315 C  CA  . GLY B 1 192 ? -3.370  -24.797 14.669  1.00 18.81 ? 192 GLY B CA  1 
ATOM   3316 C  C   . GLY B 1 192 ? -2.336  -25.071 13.586  1.00 19.25 ? 192 GLY B C   1 
ATOM   3317 O  O   . GLY B 1 192 ? -1.147  -25.181 13.890  1.00 20.47 ? 192 GLY B O   1 
ATOM   3318 N  N   . THR B 1 193 ? -2.767  -25.189 12.331  1.00 17.56 ? 193 THR B N   1 
ATOM   3319 C  CA  . THR B 1 193 ? -1.820  -25.445 11.244  1.00 16.82 ? 193 THR B CA  1 
ATOM   3320 C  C   . THR B 1 193 ? -0.823  -24.293 11.224  1.00 18.44 ? 193 THR B C   1 
ATOM   3321 O  O   . THR B 1 193 ? -1.199  -23.121 11.103  1.00 17.22 ? 193 THR B O   1 
ATOM   3322 C  CB  . THR B 1 193 ? -2.539  -25.549 9.903   1.00 16.88 ? 193 THR B CB  1 
ATOM   3323 O  OG1 . THR B 1 193 ? -3.510  -26.603 9.976   1.00 13.12 ? 193 THR B OG1 1 
ATOM   3324 C  CG2 . THR B 1 193 ? -1.542  -25.851 8.792   1.00 12.57 ? 193 THR B CG2 1 
ATOM   3325 N  N   . ARG B 1 194 ? 0.452   -24.638 11.326  1.00 18.65 ? 194 ARG B N   1 
ATOM   3326 C  CA  . ARG B 1 194 ? 1.515   -23.644 11.430  1.00 18.34 ? 194 ARG B CA  1 
ATOM   3327 C  C   . ARG B 1 194 ? 2.526   -23.656 10.287  1.00 17.73 ? 194 ARG B C   1 
ATOM   3328 O  O   . ARG B 1 194 ? 2.883   -24.717 9.787   1.00 18.64 ? 194 ARG B O   1 
ATOM   3329 C  CB  . ARG B 1 194 ? 2.232   -23.902 12.761  1.00 20.25 ? 194 ARG B CB  1 
ATOM   3330 C  CG  . ARG B 1 194 ? 3.246   -22.884 13.228  1.00 25.67 ? 194 ARG B CG  1 
ATOM   3331 C  CD  . ARG B 1 194 ? 3.977   -23.457 14.440  1.00 29.85 ? 194 ARG B CD  1 
ATOM   3332 N  NE  . ARG B 1 194 ? 4.849   -22.490 15.098  1.00 35.63 ? 194 ARG B NE  1 
ATOM   3333 C  CZ  . ARG B 1 194 ? 4.416   -21.502 15.877  1.00 40.91 ? 194 ARG B CZ  1 
ATOM   3334 N  NH1 . ARG B 1 194 ? 3.116   -21.349 16.099  1.00 40.04 ? 194 ARG B NH1 1 
ATOM   3335 N  NH2 . ARG B 1 194 ? 5.282   -20.669 16.438  1.00 43.33 ? 194 ARG B NH2 1 
ATOM   3336 N  N   . TYR B 1 195 ? 2.981   -22.469 9.882   1.00 15.94 ? 195 TYR B N   1 
ATOM   3337 C  CA  . TYR B 1 195 ? 3.995   -22.338 8.831   1.00 14.35 ? 195 TYR B CA  1 
ATOM   3338 C  C   . TYR B 1 195 ? 5.054   -21.361 9.325   1.00 18.32 ? 195 TYR B C   1 
ATOM   3339 O  O   . TYR B 1 195 ? 4.734   -20.319 9.907   1.00 19.28 ? 195 TYR B O   1 
ATOM   3340 C  CB  . TYR B 1 195 ? 3.421   -21.772 7.523   1.00 12.25 ? 195 TYR B CB  1 
ATOM   3341 C  CG  . TYR B 1 195 ? 2.177   -22.457 7.011   1.00 15.10 ? 195 TYR B CG  1 
ATOM   3342 C  CD1 . TYR B 1 195 ? 0.928   -22.160 7.552   1.00 16.67 ? 195 TYR B CD1 1 
ATOM   3343 C  CD2 . TYR B 1 195 ? 2.247   -23.421 6.009   1.00 13.82 ? 195 TYR B CD2 1 
ATOM   3344 C  CE1 . TYR B 1 195 ? -0.223  -22.804 7.109   1.00 17.81 ? 195 TYR B CE1 1 
ATOM   3345 C  CE2 . TYR B 1 195 ? 1.099   -24.074 5.558   1.00 16.40 ? 195 TYR B CE2 1 
ATOM   3346 C  CZ  . TYR B 1 195 ? -0.131  -23.758 6.115   1.00 14.90 ? 195 TYR B CZ  1 
ATOM   3347 O  OH  . TYR B 1 195 ? -1.266  -24.395 5.690   1.00 17.62 ? 195 TYR B OH  1 
ATOM   3348 N  N   . GLU B 1 196 ? 6.320   -21.685 9.113   1.00 17.15 ? 196 GLU B N   1 
ATOM   3349 C  CA  . GLU B 1 196 ? 7.361   -20.765 9.528   1.00 21.86 ? 196 GLU B CA  1 
ATOM   3350 C  C   . GLU B 1 196 ? 8.564   -20.808 8.603   1.00 20.82 ? 196 GLU B C   1 
ATOM   3351 O  O   . GLU B 1 196 ? 8.986   -21.867 8.145   1.00 22.95 ? 196 GLU B O   1 
ATOM   3352 C  CB  . GLU B 1 196 ? 7.768   -21.016 10.991  1.00 22.83 ? 196 GLU B CB  1 
ATOM   3353 C  CG  . GLU B 1 196 ? 8.218   -22.422 11.320  1.00 32.55 ? 196 GLU B CG  1 
ATOM   3354 C  CD  . GLU B 1 196 ? 8.481   -22.603 12.809  1.00 38.49 ? 196 GLU B CD  1 
ATOM   3355 O  OE1 . GLU B 1 196 ? 7.522   -22.503 13.609  1.00 37.79 ? 196 GLU B OE1 1 
ATOM   3356 O  OE2 . GLU B 1 196 ? 9.649   -22.838 13.183  1.00 43.21 ? 196 GLU B OE2 1 
ATOM   3357 N  N   . VAL B 1 197 ? 9.082   -19.627 8.301   1.00 16.96 ? 197 VAL B N   1 
ATOM   3358 C  CA  . VAL B 1 197 ? 10.238  -19.490 7.443   1.00 17.02 ? 197 VAL B CA  1 
ATOM   3359 C  C   . VAL B 1 197 ? 11.068  -18.359 8.031   1.00 19.81 ? 197 VAL B C   1 
ATOM   3360 O  O   . VAL B 1 197 ? 10.529  -17.392 8.570   1.00 19.86 ? 197 VAL B O   1 
ATOM   3361 C  CB  . VAL B 1 197 ? 9.828   -19.161 5.982   1.00 18.20 ? 197 VAL B CB  1 
ATOM   3362 C  CG1 . VAL B 1 197 ? 9.036   -17.872 5.931   1.00 19.25 ? 197 VAL B CG1 1 
ATOM   3363 C  CG2 . VAL B 1 197 ? 11.067  -19.057 5.106   1.00 17.03 ? 197 VAL B CG2 1 
ATOM   3364 N  N   . SER B 1 198 ? 12.383  -18.492 7.951   1.00 18.78 ? 198 SER B N   1 
ATOM   3365 C  CA  . SER B 1 198 ? 13.270  -17.480 8.498   1.00 19.62 ? 198 SER B CA  1 
ATOM   3366 C  C   . SER B 1 198 ? 14.389  -17.164 7.520   1.00 18.61 ? 198 SER B C   1 
ATOM   3367 O  O   . SER B 1 198 ? 14.757  -17.995 6.693   1.00 19.94 ? 198 SER B O   1 
ATOM   3368 C  CB  . SER B 1 198 ? 13.850  -17.971 9.828   1.00 16.33 ? 198 SER B CB  1 
ATOM   3369 O  OG  . SER B 1 198 ? 14.813  -17.060 10.327  1.00 28.01 ? 198 SER B OG  1 
ATOM   3370 N  N   . TYR B 1 199 ? 14.934  -15.962 7.619   1.00 18.76 ? 199 TYR B N   1 
ATOM   3371 C  CA  . TYR B 1 199 ? 16.007  -15.562 6.729   1.00 16.20 ? 199 TYR B CA  1 
ATOM   3372 C  C   . TYR B 1 199 ? 16.867  -14.480 7.369   1.00 18.30 ? 199 TYR B C   1 
ATOM   3373 O  O   . TYR B 1 199 ? 16.351  -13.558 8.002   1.00 18.47 ? 199 TYR B O   1 
ATOM   3374 C  CB  . TYR B 1 199 ? 15.411  -15.069 5.413   1.00 15.19 ? 199 TYR B CB  1 
ATOM   3375 C  CG  . TYR B 1 199 ? 16.424  -14.644 4.381   1.00 14.30 ? 199 TYR B CG  1 
ATOM   3376 C  CD1 . TYR B 1 199 ? 16.670  -13.294 4.127   1.00 16.08 ? 199 TYR B CD1 1 
ATOM   3377 C  CD2 . TYR B 1 199 ? 17.100  -15.593 3.616   1.00 15.98 ? 199 TYR B CD2 1 
ATOM   3378 C  CE1 . TYR B 1 199 ? 17.562  -12.900 3.122   1.00 18.52 ? 199 TYR B CE1 1 
ATOM   3379 C  CE2 . TYR B 1 199 ? 17.992  -15.213 2.611   1.00 16.51 ? 199 TYR B CE2 1 
ATOM   3380 C  CZ  . TYR B 1 199 ? 18.215  -13.868 2.368   1.00 17.35 ? 199 TYR B CZ  1 
ATOM   3381 O  OH  . TYR B 1 199 ? 19.079  -13.497 1.360   1.00 16.67 ? 199 TYR B OH  1 
ATOM   3382 N  N   . GLU B 1 200 ? 18.179  -14.609 7.210   1.00 17.16 ? 200 GLU B N   1 
ATOM   3383 C  CA  . GLU B 1 200 ? 19.114  -13.649 7.774   1.00 21.08 ? 200 GLU B CA  1 
ATOM   3384 C  C   . GLU B 1 200 ? 19.358  -12.535 6.771   1.00 22.13 ? 200 GLU B C   1 
ATOM   3385 O  O   . GLU B 1 200 ? 19.801  -12.790 5.652   1.00 20.20 ? 200 GLU B O   1 
ATOM   3386 C  CB  . GLU B 1 200 ? 20.444  -14.332 8.109   1.00 27.03 ? 200 GLU B CB  1 
ATOM   3387 C  CG  . GLU B 1 200 ? 21.447  -13.431 8.826   1.00 33.35 ? 200 GLU B CG  1 
ATOM   3388 C  CD  . GLU B 1 200 ? 22.767  -14.132 9.125   1.00 34.55 ? 200 GLU B CD  1 
ATOM   3389 O  OE1 . GLU B 1 200 ? 22.750  -15.210 9.752   1.00 36.48 ? 200 GLU B OE1 1 
ATOM   3390 O  OE2 . GLU B 1 200 ? 23.825  -13.598 8.740   1.00 41.60 ? 200 GLU B OE2 1 
ATOM   3391 N  N   . VAL B 1 201 ? 19.061  -11.302 7.167   1.00 20.27 ? 201 VAL B N   1 
ATOM   3392 C  CA  . VAL B 1 201 ? 19.270  -10.166 6.283   1.00 20.94 ? 201 VAL B CA  1 
ATOM   3393 C  C   . VAL B 1 201 ? 19.583  -8.885  7.054   1.00 23.07 ? 201 VAL B C   1 
ATOM   3394 O  O   . VAL B 1 201 ? 18.918  -8.558  8.038   1.00 22.54 ? 201 VAL B O   1 
ATOM   3395 C  CB  . VAL B 1 201 ? 18.033  -9.923  5.377   1.00 20.56 ? 201 VAL B CB  1 
ATOM   3396 C  CG1 . VAL B 1 201 ? 16.798  -9.686  6.230   1.00 20.31 ? 201 VAL B CG1 1 
ATOM   3397 C  CG2 . VAL B 1 201 ? 18.276  -8.732  4.464   1.00 18.00 ? 201 VAL B CG2 1 
ATOM   3398 N  N   . ASP B 1 202 ? 20.609  -8.174  6.599   1.00 21.00 ? 202 ASP B N   1 
ATOM   3399 C  CA  . ASP B 1 202 ? 21.011  -6.914  7.208   1.00 22.38 ? 202 ASP B CA  1 
ATOM   3400 C  C   . ASP B 1 202 ? 20.167  -5.868  6.490   1.00 19.45 ? 202 ASP B C   1 
ATOM   3401 O  O   . ASP B 1 202 ? 20.413  -5.565  5.329   1.00 18.63 ? 202 ASP B O   1 
ATOM   3402 C  CB  . ASP B 1 202 ? 22.491  -6.646  6.940   1.00 23.94 ? 202 ASP B CB  1 
ATOM   3403 C  CG  . ASP B 1 202 ? 23.018  -5.459  7.720   1.00 29.99 ? 202 ASP B CG  1 
ATOM   3404 O  OD1 . ASP B 1 202 ? 22.379  -4.386  7.688   1.00 34.53 ? 202 ASP B OD1 1 
ATOM   3405 O  OD2 . ASP B 1 202 ? 24.080  -5.596  8.360   1.00 34.42 ? 202 ASP B OD2 1 
ATOM   3406 N  N   . VAL B 1 203 ? 19.175  -5.314  7.173   1.00 17.90 ? 203 VAL B N   1 
ATOM   3407 C  CA  . VAL B 1 203 ? 18.299  -4.344  6.534   1.00 20.63 ? 203 VAL B CA  1 
ATOM   3408 C  C   . VAL B 1 203 ? 18.984  -3.047  6.114   1.00 21.79 ? 203 VAL B C   1 
ATOM   3409 O  O   . VAL B 1 203 ? 18.474  -2.331  5.254   1.00 21.96 ? 203 VAL B O   1 
ATOM   3410 C  CB  . VAL B 1 203 ? 17.090  -4.012  7.435   1.00 20.51 ? 203 VAL B CB  1 
ATOM   3411 C  CG1 . VAL B 1 203 ? 16.296  -5.274  7.698   1.00 19.04 ? 203 VAL B CG1 1 
ATOM   3412 C  CG2 . VAL B 1 203 ? 17.557  -3.394  8.744   1.00 16.67 ? 203 VAL B CG2 1 
ATOM   3413 N  N   . ARG B 1 204 ? 20.140  -2.755  6.699   1.00 19.00 ? 204 ARG B N   1 
ATOM   3414 C  CA  . ARG B 1 204 ? 20.862  -1.527  6.375   1.00 22.47 ? 204 ARG B CA  1 
ATOM   3415 C  C   . ARG B 1 204 ? 21.436  -1.498  4.961   1.00 23.67 ? 204 ARG B C   1 
ATOM   3416 O  O   . ARG B 1 204 ? 21.639  -0.426  4.392   1.00 25.45 ? 204 ARG B O   1 
ATOM   3417 C  CB  . ARG B 1 204 ? 21.990  -1.300  7.383   1.00 24.45 ? 204 ARG B CB  1 
ATOM   3418 C  CG  . ARG B 1 204 ? 21.516  -1.204  8.814   1.00 27.83 ? 204 ARG B CG  1 
ATOM   3419 C  CD  . ARG B 1 204 ? 22.688  -1.191  9.761   1.00 31.67 ? 204 ARG B CD  1 
ATOM   3420 N  NE  . ARG B 1 204 ? 23.545  -2.350  9.551   1.00 41.00 ? 204 ARG B NE  1 
ATOM   3421 C  CZ  . ARG B 1 204 ? 24.581  -2.664  10.320  1.00 48.09 ? 204 ARG B CZ  1 
ATOM   3422 N  NH1 . ARG B 1 204 ? 24.893  -1.902  11.363  1.00 54.40 ? 204 ARG B NH1 1 
ATOM   3423 N  NH2 . ARG B 1 204 ? 25.310  -3.739  10.047  1.00 50.41 ? 204 ARG B NH2 1 
ATOM   3424 N  N   . SER B 1 205 ? 21.705  -2.665  4.389   1.00 22.34 ? 205 SER B N   1 
ATOM   3425 C  CA  . SER B 1 205 ? 22.251  -2.708  3.041   1.00 24.39 ? 205 SER B CA  1 
ATOM   3426 C  C   . SER B 1 205 ? 21.141  -2.762  2.003   1.00 26.94 ? 205 SER B C   1 
ATOM   3427 O  O   . SER B 1 205 ? 21.407  -2.687  0.805   1.00 29.28 ? 205 SER B O   1 
ATOM   3428 C  CB  . SER B 1 205 ? 23.142  -3.932  2.869   1.00 26.61 ? 205 SER B CB  1 
ATOM   3429 O  OG  . SER B 1 205 ? 22.363  -5.112  2.908   1.00 34.80 ? 205 SER B OG  1 
ATOM   3430 N  N   . VAL B 1 206 ? 19.898  -2.882  2.462   1.00 26.51 ? 206 VAL B N   1 
ATOM   3431 C  CA  . VAL B 1 206 ? 18.754  -2.973  1.557   1.00 24.69 ? 206 VAL B CA  1 
ATOM   3432 C  C   . VAL B 1 206 ? 17.824  -1.763  1.558   1.00 22.96 ? 206 VAL B C   1 
ATOM   3433 O  O   . VAL B 1 206 ? 17.385  -1.305  0.501   1.00 21.48 ? 206 VAL B O   1 
ATOM   3434 C  CB  . VAL B 1 206 ? 17.888  -4.209  1.887   1.00 24.68 ? 206 VAL B CB  1 
ATOM   3435 C  CG1 . VAL B 1 206 ? 16.718  -4.289  0.922   1.00 26.62 ? 206 VAL B CG1 1 
ATOM   3436 C  CG2 . VAL B 1 206 ? 18.732  -5.473  1.823   1.00 24.69 ? 206 VAL B CG2 1 
ATOM   3437 N  N   . LEU B 1 207 ? 17.517  -1.255  2.746   1.00 21.48 ? 207 LEU B N   1 
ATOM   3438 C  CA  . LEU B 1 207 ? 16.609  -0.127  2.874   1.00 20.39 ? 207 LEU B CA  1 
ATOM   3439 C  C   . LEU B 1 207 ? 17.242  1.109   3.508   1.00 22.83 ? 207 LEU B C   1 
ATOM   3440 O  O   . LEU B 1 207 ? 18.216  1.010   4.257   1.00 22.85 ? 207 LEU B O   1 
ATOM   3441 C  CB  . LEU B 1 207 ? 15.400  -0.549  3.714   1.00 20.84 ? 207 LEU B CB  1 
ATOM   3442 C  CG  . LEU B 1 207 ? 14.539  -1.707  3.199   1.00 17.62 ? 207 LEU B CG  1 
ATOM   3443 C  CD1 . LEU B 1 207 ? 13.558  -2.123  4.269   1.00 19.06 ? 207 LEU B CD1 1 
ATOM   3444 C  CD2 . LEU B 1 207 ? 13.807  -1.288  1.945   1.00 18.53 ? 207 LEU B CD2 1 
ATOM   3445 N  N   . PRO B 1 208 ? 16.701  2.297   3.192   1.00 21.15 ? 208 PRO B N   1 
ATOM   3446 C  CA  . PRO B 1 208 ? 17.194  3.565   3.734   1.00 22.25 ? 208 PRO B CA  1 
ATOM   3447 C  C   . PRO B 1 208 ? 16.859  3.629   5.231   1.00 23.83 ? 208 PRO B C   1 
ATOM   3448 O  O   . PRO B 1 208 ? 16.150  2.757   5.742   1.00 19.59 ? 208 PRO B O   1 
ATOM   3449 C  CB  . PRO B 1 208 ? 16.420  4.595   2.916   1.00 22.31 ? 208 PRO B CB  1 
ATOM   3450 C  CG  . PRO B 1 208 ? 15.092  3.885   2.708   1.00 24.63 ? 208 PRO B CG  1 
ATOM   3451 C  CD  . PRO B 1 208 ? 15.613  2.549   2.231   1.00 21.53 ? 208 PRO B CD  1 
ATOM   3452 N  N   . GLU B 1 209 ? 17.369  4.649   5.922   1.00 23.72 ? 209 GLU B N   1 
ATOM   3453 C  CA  . GLU B 1 209 ? 17.123  4.818   7.356   1.00 24.38 ? 209 GLU B CA  1 
ATOM   3454 C  C   . GLU B 1 209 ? 15.648  4.950   7.706   1.00 19.99 ? 209 GLU B C   1 
ATOM   3455 O  O   . GLU B 1 209 ? 15.189  4.367   8.684   1.00 19.49 ? 209 GLU B O   1 
ATOM   3456 C  CB  . GLU B 1 209 ? 17.859  6.046   7.900   1.00 23.79 ? 209 GLU B CB  1 
ATOM   3457 C  CG  . GLU B 1 209 ? 19.361  5.915   7.967   1.00 30.37 ? 209 GLU B CG  1 
ATOM   3458 C  CD  . GLU B 1 209 ? 20.008  7.135   8.599   1.00 37.41 ? 209 GLU B CD  1 
ATOM   3459 O  OE1 . GLU B 1 209 ? 19.723  7.419   9.785   1.00 40.82 ? 209 GLU B OE1 1 
ATOM   3460 O  OE2 . GLU B 1 209 ? 20.794  7.816   7.906   1.00 39.88 ? 209 GLU B OE2 1 
ATOM   3461 N  N   . TRP B 1 210 ? 14.916  5.740   6.927   1.00 17.40 ? 210 TRP B N   1 
ATOM   3462 C  CA  . TRP B 1 210 ? 13.492  5.919   7.175   1.00 18.82 ? 210 TRP B CA  1 
ATOM   3463 C  C   . TRP B 1 210 ? 12.670  5.217   6.105   1.00 17.27 ? 210 TRP B C   1 
ATOM   3464 O  O   . TRP B 1 210 ? 12.917  5.379   4.912   1.00 14.99 ? 210 TRP B O   1 
ATOM   3465 C  CB  . TRP B 1 210 ? 13.117  7.402   7.219   1.00 21.26 ? 210 TRP B CB  1 
ATOM   3466 C  CG  . TRP B 1 210 ? 13.703  8.153   8.379   1.00 22.67 ? 210 TRP B CG  1 
ATOM   3467 C  CD1 . TRP B 1 210 ? 14.961  8.670   8.475   1.00 21.71 ? 210 TRP B CD1 1 
ATOM   3468 C  CD2 . TRP B 1 210 ? 13.056  8.441   9.624   1.00 20.88 ? 210 TRP B CD2 1 
ATOM   3469 N  NE1 . TRP B 1 210 ? 15.139  9.264   9.701   1.00 19.30 ? 210 TRP B NE1 1 
ATOM   3470 C  CE2 . TRP B 1 210 ? 13.985  9.137   10.427  1.00 20.90 ? 210 TRP B CE2 1 
ATOM   3471 C  CE3 . TRP B 1 210 ? 11.780  8.177   10.139  1.00 18.64 ? 210 TRP B CE3 1 
ATOM   3472 C  CZ2 . TRP B 1 210 ? 13.679  9.576   11.720  1.00 20.86 ? 210 TRP B CZ2 1 
ATOM   3473 C  CZ3 . TRP B 1 210 ? 11.474  8.614   11.428  1.00 21.68 ? 210 TRP B CZ3 1 
ATOM   3474 C  CH2 . TRP B 1 210 ? 12.423  9.306   12.201  1.00 19.39 ? 210 TRP B CH2 1 
ATOM   3475 N  N   . VAL B 1 211 ? 11.683  4.442   6.536   1.00 16.48 ? 211 VAL B N   1 
ATOM   3476 C  CA  . VAL B 1 211 ? 10.848  3.705   5.599   1.00 16.10 ? 211 VAL B CA  1 
ATOM   3477 C  C   . VAL B 1 211 ? 9.386   3.754   5.985   1.00 18.09 ? 211 VAL B C   1 
ATOM   3478 O  O   . VAL B 1 211 ? 9.026   4.224   7.064   1.00 19.11 ? 211 VAL B O   1 
ATOM   3479 C  CB  . VAL B 1 211 ? 11.230  2.220   5.569   1.00 14.25 ? 211 VAL B CB  1 
ATOM   3480 C  CG1 . VAL B 1 211 ? 12.689  2.055   5.197   1.00 15.97 ? 211 VAL B CG1 1 
ATOM   3481 C  CG2 . VAL B 1 211 ? 10.959  1.601   6.927   1.00 11.98 ? 211 VAL B CG2 1 
ATOM   3482 N  N   . ARG B 1 212 ? 8.547   3.267   5.079   1.00 17.35 ? 212 ARG B N   1 
ATOM   3483 C  CA  . ARG B 1 212 ? 7.122   3.169   5.334   1.00 13.74 ? 212 ARG B CA  1 
ATOM   3484 C  C   . ARG B 1 212 ? 6.768   1.695   5.234   1.00 12.15 ? 212 ARG B C   1 
ATOM   3485 O  O   . ARG B 1 212 ? 7.398   0.938   4.487   1.00 8.72  ? 212 ARG B O   1 
ATOM   3486 C  CB  . ARG B 1 212 ? 6.297   3.981   4.333   1.00 15.12 ? 212 ARG B CB  1 
ATOM   3487 C  CG  . ARG B 1 212 ? 6.188   5.468   4.673   1.00 15.00 ? 212 ARG B CG  1 
ATOM   3488 C  CD  . ARG B 1 212 ? 4.861   6.007   4.159   1.00 19.47 ? 212 ARG B CD  1 
ATOM   3489 N  NE  . ARG B 1 212 ? 4.529   7.349   4.636   1.00 20.80 ? 212 ARG B NE  1 
ATOM   3490 C  CZ  . ARG B 1 212 ? 4.990   8.478   4.109   1.00 24.11 ? 212 ARG B CZ  1 
ATOM   3491 N  NH1 . ARG B 1 212 ? 5.813   8.441   3.072   1.00 25.96 ? 212 ARG B NH1 1 
ATOM   3492 N  NH2 . ARG B 1 212 ? 4.611   9.648   4.609   1.00 19.19 ? 212 ARG B NH2 1 
ATOM   3493 N  N   . VAL B 1 213 ? 5.773   1.281   6.005   1.00 10.81 ? 213 VAL B N   1 
ATOM   3494 C  CA  . VAL B 1 213 ? 5.355   -0.107  6.006   1.00 7.93  ? 213 VAL B CA  1 
ATOM   3495 C  C   . VAL B 1 213 ? 3.904   -0.210  5.588   1.00 9.77  ? 213 VAL B C   1 
ATOM   3496 O  O   . VAL B 1 213 ? 3.108   0.694   5.842   1.00 9.87  ? 213 VAL B O   1 
ATOM   3497 C  CB  . VAL B 1 213 ? 5.524   -0.732  7.403   1.00 11.12 ? 213 VAL B CB  1 
ATOM   3498 C  CG1 . VAL B 1 213 ? 6.998   -0.746  7.797   1.00 10.20 ? 213 VAL B CG1 1 
ATOM   3499 C  CG2 . VAL B 1 213 ? 4.729   0.063   8.421   1.00 9.36  ? 213 VAL B CG2 1 
ATOM   3500 N  N   . GLY B 1 214 ? 3.568   -1.314  4.935   1.00 9.31  ? 214 GLY B N   1 
ATOM   3501 C  CA  . GLY B 1 214 ? 2.206   -1.512  4.500   1.00 11.75 ? 214 GLY B CA  1 
ATOM   3502 C  C   . GLY B 1 214 ? 1.949   -2.855  3.849   1.00 12.78 ? 214 GLY B C   1 
ATOM   3503 O  O   . GLY B 1 214 ? 2.688   -3.827  4.047   1.00 10.66 ? 214 GLY B O   1 
ATOM   3504 N  N   . PHE B 1 215 ? 0.878   -2.905  3.069   1.00 11.51 ? 215 PHE B N   1 
ATOM   3505 C  CA  . PHE B 1 215 ? 0.501   -4.126  2.381   1.00 13.73 ? 215 PHE B CA  1 
ATOM   3506 C  C   . PHE B 1 215 ? 0.193   -3.856  0.928   1.00 12.80 ? 215 PHE B C   1 
ATOM   3507 O  O   . PHE B 1 215 ? -0.179  -2.750  0.549   1.00 11.18 ? 215 PHE B O   1 
ATOM   3508 C  CB  . PHE B 1 215 ? -0.721  -4.770  3.036   1.00 11.36 ? 215 PHE B CB  1 
ATOM   3509 C  CG  . PHE B 1 215 ? -0.496  -5.195  4.449   1.00 12.72 ? 215 PHE B CG  1 
ATOM   3510 C  CD1 . PHE B 1 215 ? -0.553  -4.270  5.486   1.00 13.07 ? 215 PHE B CD1 1 
ATOM   3511 C  CD2 . PHE B 1 215 ? -0.197  -6.524  4.744   1.00 10.12 ? 215 PHE B CD2 1 
ATOM   3512 C  CE1 . PHE B 1 215 ? -0.318  -4.663  6.804   1.00 12.74 ? 215 PHE B CE1 1 
ATOM   3513 C  CE2 . PHE B 1 215 ? 0.041   -6.928  6.057   1.00 12.79 ? 215 PHE B CE2 1 
ATOM   3514 C  CZ  . PHE B 1 215 ? -0.020  -5.996  7.088   1.00 11.10 ? 215 PHE B CZ  1 
ATOM   3515 N  N   . SER B 1 216 ? 0.352   -4.888  0.118   1.00 13.19 ? 216 SER B N   1 
ATOM   3516 C  CA  . SER B 1 216 ? 0.084   -4.781  -1.296  1.00 13.66 ? 216 SER B CA  1 
ATOM   3517 C  C   . SER B 1 216 ? -0.560  -6.082  -1.732  1.00 12.30 ? 216 SER B C   1 
ATOM   3518 O  O   . SER B 1 216 ? -0.333  -7.129  -1.130  1.00 14.52 ? 216 SER B O   1 
ATOM   3519 C  CB  . SER B 1 216 ? 1.391   -4.552  -2.057  1.00 17.10 ? 216 SER B CB  1 
ATOM   3520 O  OG  . SER B 1 216 ? 1.151   -4.355  -3.437  1.00 22.12 ? 216 SER B OG  1 
ATOM   3521 N  N   . ALA B 1 217 ? -1.379  -6.010  -2.769  1.00 13.49 ? 217 ALA B N   1 
ATOM   3522 C  CA  . ALA B 1 217 ? -2.040  -7.190  -3.301  1.00 14.33 ? 217 ALA B CA  1 
ATOM   3523 C  C   . ALA B 1 217 ? -2.446  -6.873  -4.727  1.00 14.39 ? 217 ALA B C   1 
ATOM   3524 O  O   . ALA B 1 217 ? -2.560  -5.706  -5.102  1.00 15.18 ? 217 ALA B O   1 
ATOM   3525 C  CB  . ALA B 1 217 ? -3.275  -7.546  -2.464  1.00 10.41 ? 217 ALA B CB  1 
ATOM   3526 N  N   . ALA B 1 218 ? -2.662  -7.911  -5.523  1.00 13.74 ? 218 ALA B N   1 
ATOM   3527 C  CA  . ALA B 1 218 ? -3.051  -7.706  -6.903  1.00 15.96 ? 218 ALA B CA  1 
ATOM   3528 C  C   . ALA B 1 218 ? -3.677  -8.954  -7.502  1.00 15.30 ? 218 ALA B C   1 
ATOM   3529 O  O   . ALA B 1 218 ? -3.484  -10.064 -7.007  1.00 15.32 ? 218 ALA B O   1 
ATOM   3530 C  CB  . ALA B 1 218 ? -1.836  -7.286  -7.722  1.00 11.81 ? 218 ALA B CB  1 
ATOM   3531 N  N   . SER B 1 219 ? -4.444  -8.746  -8.562  1.00 13.60 ? 219 SER B N   1 
ATOM   3532 C  CA  . SER B 1 219 ? -5.087  -9.825  -9.297  1.00 15.78 ? 219 SER B CA  1 
ATOM   3533 C  C   . SER B 1 219 ? -4.925  -9.496  -10.780 1.00 16.38 ? 219 SER B C   1 
ATOM   3534 O  O   . SER B 1 219 ? -5.127  -8.353  -11.188 1.00 15.30 ? 219 SER B O   1 
ATOM   3535 C  CB  . SER B 1 219 ? -6.578  -9.917  -8.952  1.00 15.30 ? 219 SER B CB  1 
ATOM   3536 O  OG  . SER B 1 219 ? -6.785  -10.297 -7.599  1.00 17.84 ? 219 SER B OG  1 
ATOM   3537 N  N   . GLY B 1 220 ? -4.530  -10.490 -11.570 1.00 17.09 ? 220 GLY B N   1 
ATOM   3538 C  CA  . GLY B 1 220 ? -4.377  -10.287 -12.999 1.00 17.27 ? 220 GLY B CA  1 
ATOM   3539 C  C   . GLY B 1 220 ? -5.598  -10.869 -13.686 1.00 20.62 ? 220 GLY B C   1 
ATOM   3540 O  O   . GLY B 1 220 ? -6.711  -10.388 -13.473 1.00 22.07 ? 220 GLY B O   1 
ATOM   3541 N  N   . GLU B 1 221 ? -5.408  -11.903 -14.501 1.00 20.93 ? 221 GLU B N   1 
ATOM   3542 C  CA  . GLU B 1 221 ? -6.533  -12.538 -15.186 1.00 24.78 ? 221 GLU B CA  1 
ATOM   3543 C  C   . GLU B 1 221 ? -7.346  -13.360 -14.188 1.00 21.51 ? 221 GLU B C   1 
ATOM   3544 O  O   . GLU B 1 221 ? -8.558  -13.479 -14.315 1.00 23.56 ? 221 GLU B O   1 
ATOM   3545 C  CB  . GLU B 1 221 ? -6.044  -13.433 -16.330 1.00 29.98 ? 221 GLU B CB  1 
ATOM   3546 C  CG  . GLU B 1 221 ? -5.424  -12.676 -17.494 1.00 43.35 ? 221 GLU B CG  1 
ATOM   3547 C  CD  . GLU B 1 221 ? -6.390  -11.680 -18.118 1.00 50.88 ? 221 GLU B CD  1 
ATOM   3548 O  OE1 . GLU B 1 221 ? -7.477  -12.104 -18.569 1.00 54.95 ? 221 GLU B OE1 1 
ATOM   3549 O  OE2 . GLU B 1 221 ? -6.063  -10.474 -18.158 1.00 53.60 ? 221 GLU B OE2 1 
ATOM   3550 N  N   . GLN B 1 222 ? -6.665  -13.945 -13.210 1.00 20.10 ? 222 GLN B N   1 
ATOM   3551 C  CA  . GLN B 1 222 ? -7.336  -14.709 -12.161 1.00 20.84 ? 222 GLN B CA  1 
ATOM   3552 C  C   . GLN B 1 222 ? -7.485  -13.742 -10.991 1.00 19.51 ? 222 GLN B C   1 
ATOM   3553 O  O   . GLN B 1 222 ? -6.700  -12.800 -10.852 1.00 18.59 ? 222 GLN B O   1 
ATOM   3554 C  CB  . GLN B 1 222 ? -6.505  -15.929 -11.758 1.00 23.07 ? 222 GLN B CB  1 
ATOM   3555 C  CG  . GLN B 1 222 ? -6.804  -17.198 -12.556 1.00 29.44 ? 222 GLN B CG  1 
ATOM   3556 C  CD  . GLN B 1 222 ? -6.854  -16.973 -14.050 1.00 35.50 ? 222 GLN B CD  1 
ATOM   3557 O  OE1 . GLN B 1 222 ? -7.794  -16.372 -14.571 1.00 40.45 ? 222 GLN B OE1 1 
ATOM   3558 N  NE2 . GLN B 1 222 ? -5.835  -17.447 -14.751 1.00 41.19 ? 222 GLN B NE2 1 
ATOM   3559 N  N   . TYR B 1 223 ? -8.482  -13.971 -10.145 1.00 17.30 ? 223 TYR B N   1 
ATOM   3560 C  CA  . TYR B 1 223 ? -8.737  -13.058 -9.041  1.00 15.55 ? 223 TYR B CA  1 
ATOM   3561 C  C   . TYR B 1 223 ? -9.251  -13.686 -7.768  1.00 14.90 ? 223 TYR B C   1 
ATOM   3562 O  O   . TYR B 1 223 ? -9.656  -14.850 -7.740  1.00 14.57 ? 223 TYR B O   1 
ATOM   3563 C  CB  . TYR B 1 223 ? -9.745  -11.995 -9.478  1.00 17.12 ? 223 TYR B CB  1 
ATOM   3564 C  CG  . TYR B 1 223 ? -10.909 -12.571 -10.262 1.00 21.88 ? 223 TYR B CG  1 
ATOM   3565 C  CD1 . TYR B 1 223 ? -10.828 -12.738 -11.648 1.00 22.76 ? 223 TYR B CD1 1 
ATOM   3566 C  CD2 . TYR B 1 223 ? -12.069 -12.996 -9.619  1.00 23.26 ? 223 TYR B CD2 1 
ATOM   3567 C  CE1 . TYR B 1 223 ? -11.872 -13.311 -12.370 1.00 23.91 ? 223 TYR B CE1 1 
ATOM   3568 C  CE2 . TYR B 1 223 ? -13.118 -13.574 -10.334 1.00 24.10 ? 223 TYR B CE2 1 
ATOM   3569 C  CZ  . TYR B 1 223 ? -13.011 -13.727 -11.706 1.00 23.72 ? 223 TYR B CZ  1 
ATOM   3570 O  OH  . TYR B 1 223 ? -14.039 -14.304 -12.413 1.00 30.31 ? 223 TYR B OH  1 
ATOM   3571 N  N   . GLN B 1 224 ? -9.256  -12.865 -6.724  1.00 11.67 ? 224 GLN B N   1 
ATOM   3572 C  CA  . GLN B 1 224 ? -9.717  -13.244 -5.399  1.00 13.54 ? 224 GLN B CA  1 
ATOM   3573 C  C   . GLN B 1 224 ? -9.647  -11.968 -4.573  1.00 15.38 ? 224 GLN B C   1 
ATOM   3574 O  O   . GLN B 1 224 ? -8.894  -11.050 -4.903  1.00 14.51 ? 224 GLN B O   1 
ATOM   3575 C  CB  . GLN B 1 224 ? -8.780  -14.289 -4.784  1.00 9.87  ? 224 GLN B CB  1 
ATOM   3576 C  CG  . GLN B 1 224 ? -7.368  -13.757 -4.571  1.00 10.96 ? 224 GLN B CG  1 
ATOM   3577 C  CD  . GLN B 1 224 ? -6.355  -14.829 -4.193  1.00 12.91 ? 224 GLN B CD  1 
ATOM   3578 O  OE1 . GLN B 1 224 ? -5.153  -14.562 -4.145  1.00 15.91 ? 224 GLN B OE1 1 
ATOM   3579 N  NE2 . GLN B 1 224 ? -6.831  -16.038 -3.920  1.00 9.67  ? 224 GLN B NE2 1 
ATOM   3580 N  N   . THR B 1 225 ? -10.432 -11.895 -3.507  1.00 13.49 ? 225 THR B N   1 
ATOM   3581 C  CA  . THR B 1 225 ? -10.376 -10.721 -2.653  1.00 15.00 ? 225 THR B CA  1 
ATOM   3582 C  C   . THR B 1 225 ? -9.154  -10.888 -1.741  1.00 16.50 ? 225 THR B C   1 
ATOM   3583 O  O   . THR B 1 225 ? -8.738  -12.015 -1.453  1.00 13.69 ? 225 THR B O   1 
ATOM   3584 C  CB  . THR B 1 225 ? -11.631 -10.607 -1.773  1.00 11.55 ? 225 THR B CB  1 
ATOM   3585 O  OG1 . THR B 1 225 ? -11.758 -11.791 -0.981  1.00 13.85 ? 225 THR B OG1 1 
ATOM   3586 C  CG2 . THR B 1 225 ? -12.873 -10.444 -2.627  1.00 17.76 ? 225 THR B CG2 1 
ATOM   3587 N  N   . HIS B 1 226 ? -8.567  -9.771  -1.318  1.00 15.19 ? 226 HIS B N   1 
ATOM   3588 C  CA  . HIS B 1 226 ? -7.423  -9.798  -0.409  1.00 12.92 ? 226 HIS B CA  1 
ATOM   3589 C  C   . HIS B 1 226 ? -7.820  -8.872  0.723   1.00 13.34 ? 226 HIS B C   1 
ATOM   3590 O  O   . HIS B 1 226 ? -7.604  -7.664  0.662   1.00 14.28 ? 226 HIS B O   1 
ATOM   3591 C  CB  . HIS B 1 226 ? -6.154  -9.289  -1.091  1.00 12.41 ? 226 HIS B CB  1 
ATOM   3592 C  CG  . HIS B 1 226 ? -5.778  -10.056 -2.318  1.00 12.11 ? 226 HIS B CG  1 
ATOM   3593 N  ND1 . HIS B 1 226 ? -6.336  -9.807  -3.552  1.00 11.72 ? 226 HIS B ND1 1 
ATOM   3594 C  CD2 . HIS B 1 226 ? -4.915  -11.083 -2.496  1.00 13.53 ? 226 HIS B CD2 1 
ATOM   3595 C  CE1 . HIS B 1 226 ? -5.831  -10.644 -4.439  1.00 9.61  ? 226 HIS B CE1 1 
ATOM   3596 N  NE2 . HIS B 1 226 ? -4.967  -11.431 -3.824  1.00 13.37 ? 226 HIS B NE2 1 
ATOM   3597 N  N   . THR B 1 227 ? -8.406  -9.458  1.759   1.00 14.12 ? 227 THR B N   1 
ATOM   3598 C  CA  . THR B 1 227 ? -8.907  -8.701  2.894   1.00 14.70 ? 227 THR B CA  1 
ATOM   3599 C  C   . THR B 1 227 ? -7.994  -8.680  4.112   1.00 13.74 ? 227 THR B C   1 
ATOM   3600 O  O   . THR B 1 227 ? -7.776  -9.710  4.756   1.00 15.48 ? 227 THR B O   1 
ATOM   3601 C  CB  . THR B 1 227 ? -10.282 -9.262  3.312   1.00 15.49 ? 227 THR B CB  1 
ATOM   3602 O  OG1 . THR B 1 227 ? -11.130 -9.316  2.158   1.00 13.94 ? 227 THR B OG1 1 
ATOM   3603 C  CG2 . THR B 1 227 ? -10.932 -8.384  4.382   1.00 13.70 ? 227 THR B CG2 1 
ATOM   3604 N  N   . LEU B 1 228 ? -7.462  -7.501  4.419   1.00 12.50 ? 228 LEU B N   1 
ATOM   3605 C  CA  . LEU B 1 228 ? -6.602  -7.323  5.583   1.00 12.34 ? 228 LEU B CA  1 
ATOM   3606 C  C   . LEU B 1 228 ? -7.581  -7.035  6.708   1.00 13.41 ? 228 LEU B C   1 
ATOM   3607 O  O   . LEU B 1 228 ? -8.278  -6.021  6.674   1.00 14.91 ? 228 LEU B O   1 
ATOM   3608 C  CB  . LEU B 1 228 ? -5.671  -6.130  5.380   1.00 14.94 ? 228 LEU B CB  1 
ATOM   3609 C  CG  . LEU B 1 228 ? -4.738  -5.792  6.543   1.00 13.20 ? 228 LEU B CG  1 
ATOM   3610 C  CD1 . LEU B 1 228 ? -3.759  -6.940  6.789   1.00 16.15 ? 228 LEU B CD1 1 
ATOM   3611 C  CD2 . LEU B 1 228 ? -3.990  -4.521  6.211   1.00 16.07 ? 228 LEU B CD2 1 
ATOM   3612 N  N   . GLU B 1 229 ? -7.635  -7.928  7.695   1.00 13.61 ? 229 GLU B N   1 
ATOM   3613 C  CA  . GLU B 1 229 ? -8.577  -7.819  8.812   1.00 15.09 ? 229 GLU B CA  1 
ATOM   3614 C  C   . GLU B 1 229 ? -8.102  -7.036  10.036  1.00 16.64 ? 229 GLU B C   1 
ATOM   3615 O  O   . GLU B 1 229 ? -8.883  -6.318  10.662  1.00 18.91 ? 229 GLU B O   1 
ATOM   3616 C  CB  . GLU B 1 229 ? -9.009  -9.232  9.215   1.00 13.15 ? 229 GLU B CB  1 
ATOM   3617 C  CG  . GLU B 1 229 ? -9.756  -9.938  8.083   1.00 17.97 ? 229 GLU B CG  1 
ATOM   3618 C  CD  . GLU B 1 229 ? -9.881  -11.436 8.276   1.00 23.26 ? 229 GLU B CD  1 
ATOM   3619 O  OE1 . GLU B 1 229 ? -10.588 -12.075 7.472   1.00 25.54 ? 229 GLU B OE1 1 
ATOM   3620 O  OE2 . GLU B 1 229 ? -9.263  -11.982 9.211   1.00 28.08 ? 229 GLU B OE2 1 
ATOM   3621 N  N   . SER B 1 230 ? -6.835  -7.182  10.393  1.00 16.45 ? 230 SER B N   1 
ATOM   3622 C  CA  . SER B 1 230 ? -6.288  -6.458  11.536  1.00 15.47 ? 230 SER B CA  1 
ATOM   3623 C  C   . SER B 1 230 ? -4.790  -6.307  11.351  1.00 14.78 ? 230 SER B C   1 
ATOM   3624 O  O   . SER B 1 230 ? -4.183  -7.017  10.551  1.00 15.55 ? 230 SER B O   1 
ATOM   3625 C  CB  . SER B 1 230 ? -6.571  -7.209  12.834  1.00 11.69 ? 230 SER B CB  1 
ATOM   3626 O  OG  . SER B 1 230 ? -6.015  -8.503  12.773  1.00 12.26 ? 230 SER B OG  1 
ATOM   3627 N  N   . TRP B 1 231 ? -4.194  -5.384  12.093  1.00 13.30 ? 231 TRP B N   1 
ATOM   3628 C  CA  . TRP B 1 231 ? -2.763  -5.153  11.991  1.00 10.25 ? 231 TRP B CA  1 
ATOM   3629 C  C   . TRP B 1 231 ? -2.228  -4.343  13.156  1.00 9.81  ? 231 TRP B C   1 
ATOM   3630 O  O   . TRP B 1 231 ? -2.781  -3.302  13.492  1.00 11.36 ? 231 TRP B O   1 
ATOM   3631 C  CB  . TRP B 1 231 ? -2.464  -4.438  10.669  1.00 9.34  ? 231 TRP B CB  1 
ATOM   3632 C  CG  . TRP B 1 231 ? -1.026  -4.028  10.442  1.00 13.11 ? 231 TRP B CG  1 
ATOM   3633 C  CD1 . TRP B 1 231 ? 0.101   -4.738  10.773  1.00 15.88 ? 231 TRP B CD1 1 
ATOM   3634 C  CD2 . TRP B 1 231 ? -0.573  -2.888  9.701   1.00 11.33 ? 231 TRP B CD2 1 
ATOM   3635 N  NE1 . TRP B 1 231 ? 1.223   -4.110  10.278  1.00 10.98 ? 231 TRP B NE1 1 
ATOM   3636 C  CE2 . TRP B 1 231 ? 0.837   -2.974  9.615   1.00 13.60 ? 231 TRP B CE2 1 
ATOM   3637 C  CE3 . TRP B 1 231 ? -1.222  -1.802  9.096   1.00 10.86 ? 231 TRP B CE3 1 
ATOM   3638 C  CZ2 . TRP B 1 231 ? 1.607   -2.015  8.948   1.00 14.66 ? 231 TRP B CZ2 1 
ATOM   3639 C  CZ3 . TRP B 1 231 ? -0.452  -0.845  8.429   1.00 10.39 ? 231 TRP B CZ3 1 
ATOM   3640 C  CH2 . TRP B 1 231 ? 0.946   -0.961  8.362   1.00 11.92 ? 231 TRP B CH2 1 
ATOM   3641 N  N   . SER B 1 232 ? -1.167  -4.838  13.785  1.00 9.90  ? 232 SER B N   1 
ATOM   3642 C  CA  . SER B 1 232 ? -0.521  -4.114  14.880  1.00 14.05 ? 232 SER B CA  1 
ATOM   3643 C  C   . SER B 1 232 ? 0.950   -4.081  14.506  1.00 13.34 ? 232 SER B C   1 
ATOM   3644 O  O   . SER B 1 232 ? 1.487   -5.053  13.973  1.00 13.21 ? 232 SER B O   1 
ATOM   3645 C  CB  . SER B 1 232 ? -0.697  -4.824  16.228  1.00 11.84 ? 232 SER B CB  1 
ATOM   3646 O  OG  . SER B 1 232 ? 0.020   -6.042  16.256  1.00 26.55 ? 232 SER B OG  1 
ATOM   3647 N  N   . PHE B 1 233 ? 1.604   -2.965  14.779  1.00 15.56 ? 233 PHE B N   1 
ATOM   3648 C  CA  . PHE B 1 233 ? 3.010   -2.826  14.439  1.00 15.02 ? 233 PHE B CA  1 
ATOM   3649 C  C   . PHE B 1 233 ? 3.760   -2.082  15.536  1.00 16.14 ? 233 PHE B C   1 
ATOM   3650 O  O   . PHE B 1 233 ? 3.211   -1.203  16.200  1.00 17.01 ? 233 PHE B O   1 
ATOM   3651 C  CB  . PHE B 1 233 ? 3.130   -2.099  13.090  1.00 12.67 ? 233 PHE B CB  1 
ATOM   3652 C  CG  . PHE B 1 233 ? 4.539   -1.840  12.652  1.00 11.50 ? 233 PHE B CG  1 
ATOM   3653 C  CD1 . PHE B 1 233 ? 5.246   -0.744  13.137  1.00 15.78 ? 233 PHE B CD1 1 
ATOM   3654 C  CD2 . PHE B 1 233 ? 5.172   -2.704  11.764  1.00 17.07 ? 233 PHE B CD2 1 
ATOM   3655 C  CE1 . PHE B 1 233 ? 6.565   -0.509  12.740  1.00 19.69 ? 233 PHE B CE1 1 
ATOM   3656 C  CE2 . PHE B 1 233 ? 6.489   -2.481  11.361  1.00 14.71 ? 233 PHE B CE2 1 
ATOM   3657 C  CZ  . PHE B 1 233 ? 7.187   -1.380  11.851  1.00 17.46 ? 233 PHE B CZ  1 
ATOM   3658 N  N   . THR B 1 234 ? 5.014   -2.462  15.737  1.00 15.03 ? 234 THR B N   1 
ATOM   3659 C  CA  . THR B 1 234 ? 5.851   -1.824  16.736  1.00 16.83 ? 234 THR B CA  1 
ATOM   3660 C  C   . THR B 1 234 ? 7.316   -1.968  16.334  1.00 16.90 ? 234 THR B C   1 
ATOM   3661 O  O   . THR B 1 234 ? 7.713   -2.981  15.751  1.00 15.76 ? 234 THR B O   1 
ATOM   3662 C  CB  . THR B 1 234 ? 5.632   -2.446  18.143  1.00 15.71 ? 234 THR B CB  1 
ATOM   3663 O  OG1 . THR B 1 234 ? 6.465   -1.773  19.089  1.00 22.27 ? 234 THR B OG1 1 
ATOM   3664 C  CG2 . THR B 1 234 ? 5.989   -3.916  18.154  1.00 18.38 ? 234 THR B CG2 1 
ATOM   3665 N  N   . SER B 1 235 ? 8.104   -0.936  16.616  1.00 15.59 ? 235 SER B N   1 
ATOM   3666 C  CA  . SER B 1 235 ? 9.527   -0.954  16.312  1.00 19.21 ? 235 SER B CA  1 
ATOM   3667 C  C   . SER B 1 235 ? 10.266  -0.006  17.251  1.00 21.13 ? 235 SER B C   1 
ATOM   3668 O  O   . SER B 1 235 ? 9.774   1.080   17.579  1.00 18.67 ? 235 SER B O   1 
ATOM   3669 C  CB  . SER B 1 235 ? 9.791   -0.560  14.850  1.00 20.27 ? 235 SER B CB  1 
ATOM   3670 O  OG  . SER B 1 235 ? 9.429   0.781   14.592  1.00 26.73 ? 235 SER B OG  1 
ATOM   3671 N  N   . THR B 1 236 ? 11.446  -0.439  17.683  1.00 19.95 ? 236 THR B N   1 
ATOM   3672 C  CA  . THR B 1 236 ? 12.289  0.325   18.590  1.00 23.09 ? 236 THR B CA  1 
ATOM   3673 C  C   . THR B 1 236 ? 13.739  0.229   18.147  1.00 22.66 ? 236 THR B C   1 
ATOM   3674 O  O   . THR B 1 236 ? 14.217  -0.861  17.833  1.00 23.81 ? 236 THR B O   1 
ATOM   3675 C  CB  . THR B 1 236 ? 12.227  -0.236  20.023  1.00 25.71 ? 236 THR B CB  1 
ATOM   3676 O  OG1 . THR B 1 236 ? 10.876  -0.216  20.492  1.00 33.18 ? 236 THR B OG1 1 
ATOM   3677 C  CG2 . THR B 1 236 ? 13.094  0.598   20.957  1.00 28.39 ? 236 THR B CG2 1 
ATOM   3678 N  N   . LEU B 1 237 ? 14.437  1.359   18.113  1.00 22.49 ? 237 LEU B N   1 
ATOM   3679 C  CA  . LEU B 1 237 ? 15.843  1.347   17.736  1.00 24.78 ? 237 LEU B CA  1 
ATOM   3680 C  C   . LEU B 1 237 ? 16.651  0.744   18.876  1.00 27.73 ? 237 LEU B C   1 
ATOM   3681 O  O   . LEU B 1 237 ? 16.415  1.057   20.041  1.00 25.93 ? 237 LEU B O   1 
ATOM   3682 C  CB  . LEU B 1 237 ? 16.347  2.761   17.446  1.00 22.05 ? 237 LEU B CB  1 
ATOM   3683 C  CG  . LEU B 1 237 ? 15.905  3.362   16.117  1.00 22.17 ? 237 LEU B CG  1 
ATOM   3684 C  CD1 . LEU B 1 237 ? 16.472  4.763   15.970  1.00 24.36 ? 237 LEU B CD1 1 
ATOM   3685 C  CD2 . LEU B 1 237 ? 16.401  2.473   14.986  1.00 22.75 ? 237 LEU B CD2 1 
ATOM   3686 N  N   . LEU B 1 238 ? 17.593  -0.130  18.534  1.00 31.37 ? 238 LEU B N   1 
ATOM   3687 C  CA  . LEU B 1 238 ? 18.447  -0.774  19.526  1.00 34.80 ? 238 LEU B CA  1 
ATOM   3688 C  C   . LEU B 1 238 ? 19.902  -0.773  19.073  1.00 37.88 ? 238 LEU B C   1 
ATOM   3689 O  O   . LEU B 1 238 ? 20.196  -0.668  17.882  1.00 37.22 ? 238 LEU B O   1 
ATOM   3690 C  CB  . LEU B 1 238 ? 17.999  -2.218  19.769  1.00 34.46 ? 238 LEU B CB  1 
ATOM   3691 C  CG  . LEU B 1 238 ? 16.586  -2.442  20.312  1.00 38.50 ? 238 LEU B CG  1 
ATOM   3692 C  CD1 . LEU B 1 238 ? 16.355  -3.936  20.490  1.00 37.31 ? 238 LEU B CD1 1 
ATOM   3693 C  CD2 . LEU B 1 238 ? 16.407  -1.706  21.639  1.00 34.75 ? 238 LEU B CD2 1 
ATOM   3694 N  N   . TYR B 1 239 ? 20.809  -0.888  20.035  1.00 45.01 ? 239 TYR B N   1 
ATOM   3695 C  CA  . TYR B 1 239 ? 22.237  -0.913  19.743  1.00 50.20 ? 239 TYR B CA  1 
ATOM   3696 C  C   . TYR B 1 239 ? 22.656  -2.291  19.249  1.00 51.61 ? 239 TYR B C   1 
ATOM   3697 O  O   . TYR B 1 239 ? 22.213  -3.312  19.774  1.00 49.91 ? 239 TYR B O   1 
ATOM   3698 C  CB  . TYR B 1 239 ? 23.039  -0.545  20.995  1.00 54.08 ? 239 TYR B CB  1 
ATOM   3699 C  CG  . TYR B 1 239 ? 22.869  0.894   21.434  1.00 59.73 ? 239 TYR B CG  1 
ATOM   3700 C  CD1 . TYR B 1 239 ? 23.383  1.944   20.668  1.00 60.78 ? 239 TYR B CD1 1 
ATOM   3701 C  CD2 . TYR B 1 239 ? 22.181  1.210   22.608  1.00 62.12 ? 239 TYR B CD2 1 
ATOM   3702 C  CE1 . TYR B 1 239 ? 23.215  3.274   21.061  1.00 63.44 ? 239 TYR B CE1 1 
ATOM   3703 C  CE2 . TYR B 1 239 ? 22.007  2.537   23.010  1.00 63.74 ? 239 TYR B CE2 1 
ATOM   3704 C  CZ  . TYR B 1 239 ? 22.525  3.562   22.232  1.00 63.84 ? 239 TYR B CZ  1 
ATOM   3705 O  OH  . TYR B 1 239 ? 22.348  4.871   22.621  1.00 65.55 ? 239 TYR B OH  1 
ATOM   3706 N  N   . THR B 1 240 ? 23.507  -2.305  18.229  1.00 56.11 ? 240 THR B N   1 
ATOM   3707 C  CA  . THR B 1 240 ? 24.011  -3.543  17.645  1.00 61.05 ? 240 THR B CA  1 
ATOM   3708 C  C   . THR B 1 240 ? 25.514  -3.410  17.420  1.00 65.03 ? 240 THR B C   1 
ATOM   3709 O  O   . THR B 1 240 ? 26.022  -2.305  17.219  1.00 66.35 ? 240 THR B O   1 
ATOM   3710 C  CB  . THR B 1 240 ? 23.321  -3.850  16.291  1.00 61.06 ? 240 THR B CB  1 
ATOM   3711 O  OG1 . THR B 1 240 ? 21.917  -4.045  16.502  1.00 61.36 ? 240 THR B OG1 1 
ATOM   3712 C  CG2 . THR B 1 240 ? 23.913  -5.103  15.654  1.00 60.00 ? 240 THR B CG2 1 
ATOM   3713 N  N   . ALA B 1 241 ? 26.222  -4.536  17.461  1.00 67.96 ? 241 ALA B N   1 
ATOM   3714 C  CA  . ALA B 1 241 ? 27.667  -4.540  17.260  1.00 69.83 ? 241 ALA B CA  1 
ATOM   3715 C  C   . ALA B 1 241 ? 28.033  -5.233  15.949  1.00 70.68 ? 241 ALA B C   1 
ATOM   3716 O  O   . ALA B 1 241 ? 27.282  -5.035  14.969  1.00 71.18 ? 241 ALA B O   1 
ATOM   3717 C  CB  . ALA B 1 241 ? 28.357  -5.236  18.434  1.00 69.63 ? 241 ALA B CB  1 
HETATM 3718 C  C1  . FRU C 2 .   ? 5.828   43.368  29.770  1.00 36.14 ? 1   FRU C C1  1 
HETATM 3719 C  C2  . FRU C 2 .   ? 4.770   44.235  28.987  1.00 37.44 ? 1   FRU C C2  1 
HETATM 3720 C  C3  . FRU C 2 .   ? 4.540   43.833  27.541  1.00 37.37 ? 1   FRU C C3  1 
HETATM 3721 C  C4  . FRU C 2 .   ? 3.985   45.109  26.876  1.00 41.29 ? 1   FRU C C4  1 
HETATM 3722 C  C5  . FRU C 2 .   ? 4.838   46.135  27.578  1.00 41.52 ? 1   FRU C C5  1 
HETATM 3723 C  C6  . FRU C 2 .   ? 3.904   47.287  27.972  1.00 45.71 ? 1   FRU C C6  1 
HETATM 3724 O  O1  . FRU C 2 .   ? 7.075   43.271  29.041  1.00 34.06 ? 1   FRU C O1  1 
HETATM 3725 O  O2  . FRU C 2 .   ? 3.630   44.250  29.825  1.00 36.53 ? 1   FRU C O2  1 
HETATM 3726 O  O3  . FRU C 2 .   ? 3.836   42.706  27.016  1.00 33.96 ? 1   FRU C O3  1 
HETATM 3727 O  O4  . FRU C 2 .   ? 4.308   44.970  25.507  1.00 42.48 ? 1   FRU C O4  1 
HETATM 3728 O  O5  . FRU C 2 .   ? 5.471   45.442  28.724  1.00 39.79 ? 1   FRU C O5  1 
HETATM 3729 O  O6  . FRU C 2 .   ? 4.731   48.340  28.264  1.00 49.65 ? 1   FRU C O6  1 
HETATM 3730 C  C1  . GLC C 2 .   ? 4.517   41.997  26.019  1.00 28.30 ? 2   GLC C C1  1 
HETATM 3731 C  C2  . GLC C 2 .   ? 3.498   41.117  25.290  1.00 27.04 ? 2   GLC C C2  1 
HETATM 3732 C  C3  . GLC C 2 .   ? 2.956   40.048  26.247  1.00 23.53 ? 2   GLC C C3  1 
HETATM 3733 C  C4  . GLC C 2 .   ? 4.093   39.248  26.883  1.00 22.32 ? 2   GLC C C4  1 
HETATM 3734 C  C5  . GLC C 2 .   ? 5.121   40.191  27.512  1.00 25.45 ? 2   GLC C C5  1 
HETATM 3735 C  C6  . GLC C 2 .   ? 6.353   39.466  28.029  1.00 25.63 ? 2   GLC C C6  1 
HETATM 3736 O  O2  . GLC C 2 .   ? 2.421   41.926  24.842  1.00 31.94 ? 2   GLC C O2  1 
HETATM 3737 O  O3  . GLC C 2 .   ? 2.095   39.170  25.543  1.00 29.00 ? 2   GLC C O3  1 
HETATM 3738 O  O4  . GLC C 2 .   ? 3.560   38.401  27.887  1.00 21.20 ? 2   GLC C O4  1 
HETATM 3739 O  O5  . GLC C 2 .   ? 5.561   41.176  26.545  1.00 26.39 ? 2   GLC C O5  1 
HETATM 3740 O  O6  . GLC C 2 .   ? 7.044   38.792  26.985  1.00 21.89 ? 2   GLC C O6  1 
HETATM 3741 C  C1  . BDF D 3 .   ? -2.883  -16.858 -16.449 1.00 37.69 ? 1   BDF D C1  1 
HETATM 3742 C  C2  . BDF D 3 .   ? -1.962  -16.425 -17.579 1.00 40.53 ? 1   BDF D C2  1 
HETATM 3743 C  C3  . BDF D 3 .   ? -1.942  -14.877 -17.738 1.00 37.30 ? 1   BDF D C3  1 
HETATM 3744 C  C4  . BDF D 3 .   ? -1.212  -14.499 -19.032 1.00 40.29 ? 1   BDF D C4  1 
HETATM 3745 C  C5  . BDF D 3 .   ? -1.765  -15.228 -20.254 1.00 40.83 ? 1   BDF D C5  1 
HETATM 3746 C  C6  . BDF D 3 .   ? -1.760  -16.721 -19.976 1.00 42.05 ? 1   BDF D C6  1 
HETATM 3747 O  O1  . BDF D 3 .   ? -4.221  -16.413 -16.631 1.00 39.75 ? 1   BDF D O1  1 
HETATM 3748 O  O2  . BDF D 3 .   ? -0.634  -16.918 -17.382 1.00 40.84 ? 1   BDF D O2  1 
HETATM 3749 O  O3  . BDF D 3 .   ? -1.250  -14.269 -16.633 1.00 32.94 ? 1   BDF D O3  1 
HETATM 3750 O  O4  . BDF D 3 .   ? -1.279  -13.085 -19.244 1.00 43.91 ? 1   BDF D O4  1 
HETATM 3751 O  O5  . BDF D 3 .   ? -3.115  -14.805 -20.534 1.00 46.81 ? 1   BDF D O5  1 
HETATM 3752 O  O6  . BDF D 3 .   ? -2.518  -17.003 -18.769 1.00 41.23 ? 1   BDF D O6  1 
HETATM 3753 C  C1  . GLC D 3 .   ? -1.889  -13.174 -16.028 1.00 26.78 ? 2   GLC D C1  1 
HETATM 3754 C  C2  . GLC D 3 .   ? -0.847  -12.142 -15.584 1.00 25.54 ? 2   GLC D C2  1 
HETATM 3755 C  C3  . GLC D 3 .   ? 0.036   -12.726 -14.474 1.00 27.30 ? 2   GLC D C3  1 
HETATM 3756 C  C4  . GLC D 3 .   ? -0.831  -13.231 -13.316 1.00 21.96 ? 2   GLC D C4  1 
HETATM 3757 C  C5  . GLC D 3 .   ? -1.903  -14.195 -13.841 1.00 25.42 ? 2   GLC D C5  1 
HETATM 3758 C  C6  . GLC D 3 .   ? -2.883  -14.623 -12.767 1.00 24.76 ? 2   GLC D C6  1 
HETATM 3759 O  O2  . GLC D 3 .   ? -0.040  -11.760 -16.686 1.00 27.71 ? 2   GLC D O2  1 
HETATM 3760 O  O3  . GLC D 3 .   ? 0.937   -11.734 -14.004 1.00 30.91 ? 2   GLC D O3  1 
HETATM 3761 O  O4  . GLC D 3 .   ? -0.012  -13.899 -12.369 1.00 19.78 ? 2   GLC D O4  1 
HETATM 3762 O  O5  . GLC D 3 .   ? -2.669  -13.568 -14.904 1.00 23.12 ? 2   GLC D O5  1 
HETATM 3763 O  O6  . GLC D 3 .   ? -3.616  -13.514 -12.276 1.00 18.59 ? 2   GLC D O6  1 
HETATM 3764 MN MN  . MN  E 4 .   ? -1.254  31.518  32.674  1.00 16.43 ? 271 MN  A MN  1 
HETATM 3765 CA CA  . CA  F 5 .   ? 1.396   34.490  31.152  1.00 15.90 ? 272 CA  A CA  1 
HETATM 3766 MN MN  . MN  G 4 .   ? 6.034   -16.159 -5.344  1.00 17.49 ? 273 MN  B MN  1 
HETATM 3767 CA CA  . CA  H 5 .   ? 2.903   -15.903 -8.047  1.00 12.04 ? 274 CA  B CA  1 
HETATM 3768 O  O   . HOH I 6 .   ? -0.233  33.563  29.538  1.00 15.66 ? 273 HOH A O   1 
HETATM 3769 O  O   . HOH I 6 .   ? 3.212   34.277  29.673  1.00 14.84 ? 274 HOH A O   1 
HETATM 3770 O  O   . HOH I 6 .   ? -2.268  31.681  30.571  1.00 15.42 ? 275 HOH A O   1 
HETATM 3771 O  O   . HOH I 6 .   ? -3.107  30.724  33.437  1.00 15.45 ? 276 HOH A O   1 
HETATM 3772 O  O   . HOH I 6 .   ? -5.328  32.213  34.550  1.00 17.47 ? 277 HOH A O   1 
HETATM 3773 O  O   . HOH I 6 .   ? -5.034  37.699  39.466  1.00 32.52 ? 278 HOH A O   1 
HETATM 3774 O  O   . HOH I 6 .   ? 5.575   38.392  35.475  1.00 26.71 ? 279 HOH A O   1 
HETATM 3775 O  O   . HOH I 6 .   ? -8.968  27.490  30.337  1.00 23.09 ? 280 HOH A O   1 
HETATM 3776 O  O   . HOH I 6 .   ? -8.687  38.609  35.915  1.00 39.71 ? 281 HOH A O   1 
HETATM 3777 O  O   . HOH I 6 .   ? -6.579  27.696  40.120  1.00 41.51 ? 282 HOH A O   1 
HETATM 3778 O  O   . HOH I 6 .   ? 1.591   39.914  22.537  1.00 42.86 ? 283 HOH A O   1 
HETATM 3779 O  O   . HOH I 6 .   ? -8.291  0.445   14.441  1.00 14.82 ? 284 HOH A O   1 
HETATM 3780 O  O   . HOH I 6 .   ? -10.559 16.066  13.185  1.00 21.73 ? 285 HOH A O   1 
HETATM 3781 O  O   . HOH I 6 .   ? -0.244  14.343  16.609  1.00 15.73 ? 286 HOH A O   1 
HETATM 3782 O  O   . HOH I 6 .   ? 14.173  31.228  22.569  1.00 22.59 ? 287 HOH A O   1 
HETATM 3783 O  O   . HOH I 6 .   ? -6.180  6.477   20.426  1.00 15.83 ? 288 HOH A O   1 
HETATM 3784 O  O   . HOH I 6 .   ? 13.970  25.286  33.384  1.00 15.62 ? 289 HOH A O   1 
HETATM 3785 O  O   . HOH I 6 .   ? 1.447   23.338  9.485   1.00 22.32 ? 290 HOH A O   1 
HETATM 3786 O  O   . HOH I 6 .   ? 10.478  12.204  13.051  1.00 22.76 ? 291 HOH A O   1 
HETATM 3787 O  O   . HOH I 6 .   ? -13.994 8.144   15.202  1.00 30.60 ? 292 HOH A O   1 
HETATM 3788 O  O   . HOH I 6 .   ? 9.858   16.131  10.668  1.00 27.68 ? 293 HOH A O   1 
HETATM 3789 O  O   . HOH I 6 .   ? 3.648   19.923  45.763  1.00 23.01 ? 294 HOH A O   1 
HETATM 3790 O  O   . HOH I 6 .   ? -1.766  21.356  11.607  1.00 33.30 ? 295 HOH A O   1 
HETATM 3791 O  O   . HOH I 6 .   ? -6.955  28.947  19.314  1.00 31.41 ? 296 HOH A O   1 
HETATM 3792 O  O   . HOH I 6 .   ? -14.932 9.714   29.280  1.00 33.48 ? 297 HOH A O   1 
HETATM 3793 O  O   . HOH I 6 .   ? 5.752   36.549  20.772  1.00 31.49 ? 298 HOH A O   1 
HETATM 3794 O  O   . HOH I 6 .   ? -6.904  31.152  36.333  1.00 32.14 ? 299 HOH A O   1 
HETATM 3795 O  O   . HOH I 6 .   ? 14.354  27.581  22.381  1.00 22.06 ? 300 HOH A O   1 
HETATM 3796 O  O   . HOH I 6 .   ? 13.098  33.511  23.346  1.00 23.23 ? 301 HOH A O   1 
HETATM 3797 O  O   . HOH I 6 .   ? 1.569   42.687  37.745  1.00 20.49 ? 302 HOH A O   1 
HETATM 3798 O  O   . HOH I 6 .   ? -2.757  28.654  41.846  1.00 28.10 ? 303 HOH A O   1 
HETATM 3799 O  O   . HOH I 6 .   ? 14.141  27.942  17.165  1.00 28.80 ? 304 HOH A O   1 
HETATM 3800 O  O   . HOH I 6 .   ? -17.947 36.837  22.385  1.00 42.76 ? 305 HOH A O   1 
HETATM 3801 O  O   . HOH I 6 .   ? -4.937  -1.765  19.670  1.00 19.29 ? 306 HOH A O   1 
HETATM 3802 O  O   . HOH I 6 .   ? -6.751  -2.205  21.447  1.00 46.59 ? 307 HOH A O   1 
HETATM 3803 O  O   . HOH I 6 .   ? -6.195  30.190  38.994  1.00 29.71 ? 308 HOH A O   1 
HETATM 3804 O  O   . HOH I 6 .   ? -9.918  3.715   15.674  1.00 27.67 ? 309 HOH A O   1 
HETATM 3805 O  O   . HOH I 6 .   ? -3.884  -3.922  18.724  1.00 21.09 ? 310 HOH A O   1 
HETATM 3806 O  O   . HOH I 6 .   ? 15.623  19.412  37.385  1.00 25.97 ? 311 HOH A O   1 
HETATM 3807 O  O   . HOH I 6 .   ? 11.881  26.097  34.960  1.00 21.33 ? 312 HOH A O   1 
HETATM 3808 O  O   . HOH I 6 .   ? 17.303  16.049  24.079  1.00 29.33 ? 313 HOH A O   1 
HETATM 3809 O  O   . HOH I 6 .   ? -5.079  6.626   17.850  1.00 25.00 ? 314 HOH A O   1 
HETATM 3810 O  O   . HOH I 6 .   ? 1.490   20.675  43.806  1.00 32.46 ? 315 HOH A O   1 
HETATM 3811 O  O   . HOH I 6 .   ? 1.081   27.733  11.911  1.00 26.53 ? 316 HOH A O   1 
HETATM 3812 O  O   . HOH I 6 .   ? 16.114  15.777  30.386  1.00 32.94 ? 317 HOH A O   1 
HETATM 3813 O  O   . HOH I 6 .   ? -5.718  37.341  15.303  1.00 41.54 ? 318 HOH A O   1 
HETATM 3814 O  O   . HOH I 6 .   ? -14.339 12.063  28.183  1.00 25.74 ? 319 HOH A O   1 
HETATM 3815 O  O   . HOH I 6 .   ? -0.054  43.966  39.938  1.00 30.72 ? 320 HOH A O   1 
HETATM 3816 O  O   . HOH I 6 .   ? 16.371  16.167  47.236  1.00 32.79 ? 321 HOH A O   1 
HETATM 3817 O  O   . HOH I 6 .   ? -0.128  12.291  35.246  1.00 23.87 ? 322 HOH A O   1 
HETATM 3818 O  O   . HOH I 6 .   ? -11.652 36.784  24.547  1.00 38.77 ? 323 HOH A O   1 
HETATM 3819 O  O   . HOH I 6 .   ? 6.091   22.313  45.102  1.00 25.98 ? 324 HOH A O   1 
HETATM 3820 O  O   . HOH I 6 .   ? -12.237 19.187  38.435  1.00 30.14 ? 325 HOH A O   1 
HETATM 3821 O  O   . HOH I 6 .   ? -13.162 13.981  39.230  1.00 49.99 ? 326 HOH A O   1 
HETATM 3822 O  O   . HOH I 6 .   ? 2.397   24.893  44.552  1.00 31.10 ? 327 HOH A O   1 
HETATM 3823 O  O   . HOH I 6 .   ? -8.273  26.758  18.575  1.00 43.09 ? 328 HOH A O   1 
HETATM 3824 O  O   . HOH I 6 .   ? 13.521  42.743  28.172  1.00 43.29 ? 329 HOH A O   1 
HETATM 3825 O  O   . HOH I 6 .   ? 14.979  21.561  12.713  1.00 32.08 ? 330 HOH A O   1 
HETATM 3826 O  O   . HOH I 6 .   ? -12.193 32.090  29.986  1.00 41.26 ? 331 HOH A O   1 
HETATM 3827 O  O   . HOH I 6 .   ? 15.004  14.967  32.672  1.00 43.22 ? 332 HOH A O   1 
HETATM 3828 O  O   . HOH I 6 .   ? -8.296  32.293  20.169  1.00 52.08 ? 333 HOH A O   1 
HETATM 3829 O  O   . HOH I 6 .   ? -14.326 23.341  21.944  1.00 42.51 ? 334 HOH A O   1 
HETATM 3830 O  O   . HOH I 6 .   ? 4.013   8.141   27.422  1.00 31.88 ? 335 HOH A O   1 
HETATM 3831 O  O   . HOH I 6 .   ? 19.320  26.995  38.320  1.00 39.19 ? 336 HOH A O   1 
HETATM 3832 O  O   . HOH I 6 .   ? 17.320  25.844  27.288  1.00 44.13 ? 337 HOH A O   1 
HETATM 3833 O  O   . HOH I 6 .   ? 7.178   41.208  21.752  1.00 48.51 ? 338 HOH A O   1 
HETATM 3834 O  O   . HOH I 6 .   ? -5.610  11.092  34.538  1.00 41.80 ? 339 HOH A O   1 
HETATM 3835 O  O   . HOH I 6 .   ? 13.072  42.799  23.841  1.00 53.40 ? 340 HOH A O   1 
HETATM 3836 O  O   . HOH I 6 .   ? 9.298   29.953  9.761   1.00 49.45 ? 341 HOH A O   1 
HETATM 3837 O  O   . HOH I 6 .   ? 10.006  30.836  40.174  1.00 35.76 ? 342 HOH A O   1 
HETATM 3838 O  O   . HOH I 6 .   ? -14.779 36.800  22.043  1.00 45.30 ? 343 HOH A O   1 
HETATM 3839 O  O   . HOH I 6 .   ? -0.250  38.216  21.728  1.00 47.96 ? 344 HOH A O   1 
HETATM 3840 O  O   . HOH I 6 .   ? 5.546   11.706  8.272   1.00 42.75 ? 345 HOH A O   1 
HETATM 3841 O  O   . HOH I 6 .   ? -5.204  41.392  36.256  1.00 49.48 ? 346 HOH A O   1 
HETATM 3842 O  O   . HOH I 6 .   ? 13.324  26.681  42.894  1.00 48.89 ? 347 HOH A O   1 
HETATM 3843 O  O   . HOH I 6 .   ? -1.356  12.650  44.415  1.00 42.92 ? 348 HOH A O   1 
HETATM 3844 O  O   . HOH I 6 .   ? -6.399  25.771  16.375  1.00 45.82 ? 349 HOH A O   1 
HETATM 3845 O  O   . HOH I 6 .   ? 21.876  14.723  15.355  1.00 43.48 ? 350 HOH A O   1 
HETATM 3846 O  O   . HOH I 6 .   ? 16.105  40.220  20.972  1.00 40.76 ? 351 HOH A O   1 
HETATM 3847 O  O   . HOH I 6 .   ? -15.187 15.047  14.832  1.00 40.93 ? 352 HOH A O   1 
HETATM 3848 O  O   . HOH I 6 .   ? 18.147  18.738  35.138  1.00 36.17 ? 353 HOH A O   1 
HETATM 3849 O  O   . HOH I 6 .   ? 21.457  31.477  32.157  1.00 39.63 ? 354 HOH A O   1 
HETATM 3850 O  O   . HOH I 6 .   ? -4.314  26.691  18.323  1.00 38.41 ? 355 HOH A O   1 
HETATM 3851 O  O   . HOH I 6 .   ? -5.040  33.708  12.547  1.00 37.54 ? 356 HOH A O   1 
HETATM 3852 O  O   . HOH I 6 .   ? -5.851  38.422  11.210  1.00 48.04 ? 357 HOH A O   1 
HETATM 3853 O  O   . HOH I 6 .   ? -4.681  40.130  24.755  1.00 38.72 ? 358 HOH A O   1 
HETATM 3854 O  O   . HOH I 6 .   ? -2.130  39.913  23.619  1.00 38.17 ? 359 HOH A O   1 
HETATM 3855 O  O   . HOH I 6 .   ? -1.734  27.149  43.990  1.00 29.00 ? 360 HOH A O   1 
HETATM 3856 O  O   . HOH I 6 .   ? -5.603  19.951  41.374  1.00 30.34 ? 361 HOH A O   1 
HETATM 3857 O  O   . HOH J 6 .   ? 8.154   -16.656 -4.886  1.00 13.95 ? 275 HOH B O   1 
HETATM 3858 O  O   . HOH J 6 .   ? 6.767   -14.188 -6.018  1.00 11.41 ? 276 HOH B O   1 
HETATM 3859 O  O   . HOH J 6 .   ? 4.310   -13.917 -8.083  1.00 14.60 ? 277 HOH B O   1 
HETATM 3860 O  O   . HOH J 6 .   ? 0.952   -14.467 -8.102  1.00 8.42  ? 278 HOH B O   1 
HETATM 3861 O  O   . HOH J 6 .   ? 10.224  -17.542 -6.245  1.00 20.68 ? 279 HOH B O   1 
HETATM 3862 O  O   . HOH J 6 .   ? 13.126  -21.613 -0.990  1.00 13.18 ? 280 HOH B O   1 
HETATM 3863 O  O   . HOH J 6 .   ? -3.051  -6.856  -11.786 1.00 28.37 ? 281 HOH B O   1 
HETATM 3864 O  O   . HOH J 6 .   ? 13.643  -12.069 -3.234  1.00 24.99 ? 282 HOH B O   1 
HETATM 3865 O  O   . HOH J 6 .   ? -1.064  -21.283 -10.060 1.00 35.86 ? 283 HOH B O   1 
HETATM 3866 O  O   . HOH J 6 .   ? -1.057  -19.666 -16.742 1.00 47.15 ? 284 HOH B O   1 
HETATM 3867 O  O   . HOH J 6 .   ? -9.560  -9.431  -7.357  1.00 14.74 ? 285 HOH B O   1 
HETATM 3868 O  O   . HOH J 6 .   ? 18.406  -17.881 -0.335  1.00 10.71 ? 286 HOH B O   1 
HETATM 3869 O  O   . HOH J 6 .   ? -10.678 -8.314  -5.021  1.00 12.64 ? 287 HOH B O   1 
HETATM 3870 O  O   . HOH J 6 .   ? -10.142 -7.331  -1.756  1.00 15.62 ? 288 HOH B O   1 
HETATM 3871 O  O   . HOH J 6 .   ? 11.756  2.748   15.089  1.00 15.66 ? 289 HOH B O   1 
HETATM 3872 O  O   . HOH J 6 .   ? -8.312  -19.846 9.993   1.00 13.90 ? 290 HOH B O   1 
HETATM 3873 O  O   . HOH J 6 .   ? 1.136   -16.327 13.636  1.00 18.35 ? 291 HOH B O   1 
HETATM 3874 O  O   . HOH J 6 .   ? -7.946  -17.184 3.323   1.00 11.45 ? 292 HOH B O   1 
HETATM 3875 O  O   . HOH J 6 .   ? 4.781   3.401   7.541   1.00 14.29 ? 293 HOH B O   1 
HETATM 3876 O  O   . HOH J 6 .   ? -6.253  6.167   10.584  1.00 19.51 ? 294 HOH B O   1 
HETATM 3877 O  O   . HOH J 6 .   ? 13.578  10.771  15.816  1.00 28.61 ? 295 HOH B O   1 
HETATM 3878 O  O   . HOH J 6 .   ? -8.580  -20.378 -5.412  1.00 27.14 ? 296 HOH B O   1 
HETATM 3879 O  O   . HOH J 6 .   ? -8.449  -22.508 -1.830  1.00 23.12 ? 297 HOH B O   1 
HETATM 3880 O  O   . HOH J 6 .   ? -11.681 -6.315  10.584  1.00 14.71 ? 298 HOH B O   1 
HETATM 3881 O  O   . HOH J 6 .   ? 19.433  -17.073 5.848   1.00 12.62 ? 299 HOH B O   1 
HETATM 3882 O  O   . HOH J 6 .   ? 13.340  -12.335 14.446  1.00 17.82 ? 300 HOH B O   1 
HETATM 3883 O  O   . HOH J 6 .   ? -11.248 -17.596 9.568   1.00 25.93 ? 301 HOH B O   1 
HETATM 3884 O  O   . HOH J 6 .   ? 19.091  6.847   4.308   1.00 34.66 ? 302 HOH B O   1 
HETATM 3885 O  O   . HOH J 6 .   ? 10.456  5.020   14.338  1.00 19.75 ? 303 HOH B O   1 
HETATM 3886 O  O   . HOH J 6 .   ? -6.134  7.612   6.030   1.00 18.73 ? 304 HOH B O   1 
HETATM 3887 O  O   . HOH J 6 .   ? -5.534  -18.510 2.299   1.00 18.98 ? 305 HOH B O   1 
HETATM 3888 O  O   . HOH J 6 .   ? -8.203  4.289   12.271  1.00 36.51 ? 306 HOH B O   1 
HETATM 3889 O  O   . HOH J 6 .   ? -6.227  -17.774 12.157  1.00 23.62 ? 307 HOH B O   1 
HETATM 3890 O  O   . HOH J 6 .   ? -0.112  -14.465 15.152  1.00 33.00 ? 308 HOH B O   1 
HETATM 3891 O  O   . HOH J 6 .   ? -10.010 -22.648 -4.225  1.00 20.84 ? 309 HOH B O   1 
HETATM 3892 O  O   . HOH J 6 .   ? 16.521  -12.543 -8.509  1.00 31.58 ? 310 HOH B O   1 
HETATM 3893 O  O   . HOH J 6 .   ? -3.620  -24.756 -1.372  1.00 23.43 ? 311 HOH B O   1 
HETATM 3894 O  O   . HOH J 6 .   ? 12.450  -21.097 -3.437  1.00 35.86 ? 312 HOH B O   1 
HETATM 3895 O  O   . HOH J 6 .   ? -11.645 3.715   2.040   1.00 26.04 ? 313 HOH B O   1 
HETATM 3896 O  O   . HOH J 6 .   ? -4.354  -18.578 13.913  1.00 27.02 ? 314 HOH B O   1 
HETATM 3897 O  O   . HOH J 6 .   ? 14.122  10.187  18.512  1.00 26.43 ? 315 HOH B O   1 
HETATM 3898 O  O   . HOH J 6 .   ? 20.909  -15.168 4.703   1.00 22.28 ? 316 HOH B O   1 
HETATM 3899 O  O   . HOH J 6 .   ? 0.899   4.424   -6.348  1.00 27.79 ? 317 HOH B O   1 
HETATM 3900 O  O   . HOH J 6 .   ? -10.342 -12.404 -16.086 1.00 27.24 ? 318 HOH B O   1 
HETATM 3901 O  O   . HOH J 6 .   ? 4.732   6.711   -0.454  1.00 31.70 ? 319 HOH B O   1 
HETATM 3902 O  O   . HOH J 6 .   ? 14.517  8.132   15.765  1.00 40.63 ? 320 HOH B O   1 
HETATM 3903 O  O   . HOH J 6 .   ? -3.397  -22.123 -12.868 1.00 36.92 ? 321 HOH B O   1 
HETATM 3904 O  O   . HOH J 6 .   ? -15.525 -18.253 -2.434  1.00 31.86 ? 322 HOH B O   1 
HETATM 3905 O  O   . HOH J 6 .   ? -11.942 -21.908 -11.915 1.00 26.48 ? 323 HOH B O   1 
HETATM 3906 O  O   . HOH J 6 .   ? 16.330  -13.499 16.252  1.00 47.30 ? 324 HOH B O   1 
HETATM 3907 O  O   . HOH J 6 .   ? 12.354  -18.486 -4.998  1.00 30.62 ? 325 HOH B O   1 
HETATM 3908 O  O   . HOH J 6 .   ? 5.336   -25.298 4.924   1.00 26.53 ? 326 HOH B O   1 
HETATM 3909 O  O   . HOH J 6 .   ? -9.336  -11.882 11.651  1.00 44.27 ? 327 HOH B O   1 
HETATM 3910 O  O   . HOH J 6 .   ? -4.557  -9.803  14.483  1.00 40.95 ? 328 HOH B O   1 
HETATM 3911 O  O   . HOH J 6 .   ? 11.456  -23.344 11.527  1.00 28.18 ? 329 HOH B O   1 
HETATM 3912 O  O   . HOH J 6 .   ? 27.461  -3.414  12.450  1.00 36.83 ? 330 HOH B O   1 
HETATM 3913 O  O   . HOH J 6 .   ? -11.940 -12.057 1.503   1.00 33.28 ? 331 HOH B O   1 
HETATM 3914 O  O   . HOH J 6 .   ? 7.104   -0.792  -5.032  1.00 29.57 ? 332 HOH B O   1 
HETATM 3915 O  O   . HOH J 6 .   ? 21.730  -5.491  12.679  1.00 34.56 ? 333 HOH B O   1 
HETATM 3916 O  O   . HOH J 6 .   ? -1.828  11.593  9.056   1.00 27.27 ? 334 HOH B O   1 
HETATM 3917 O  O   . HOH J 6 .   ? -9.312  -1.185  -11.369 1.00 41.24 ? 335 HOH B O   1 
HETATM 3918 O  O   . HOH J 6 .   ? -4.634  -16.460 15.902  1.00 39.90 ? 336 HOH B O   1 
HETATM 3919 O  O   . HOH J 6 .   ? -8.981  2.526   13.494  1.00 49.96 ? 337 HOH B O   1 
HETATM 3920 O  O   . HOH J 6 .   ? 0.131   0.469   19.855  1.00 40.11 ? 338 HOH B O   1 
HETATM 3921 O  O   . HOH J 6 .   ? 4.417   -9.663  -15.195 1.00 40.01 ? 339 HOH B O   1 
HETATM 3922 O  O   . HOH J 6 .   ? 19.034  -10.975 0.378   1.00 40.35 ? 340 HOH B O   1 
HETATM 3923 O  O   . HOH J 6 .   ? -15.798 -20.472 -10.623 1.00 42.74 ? 341 HOH B O   1 
HETATM 3924 O  O   . HOH J 6 .   ? 19.894  -15.846 -0.521  1.00 44.24 ? 342 HOH B O   1 
HETATM 3925 O  O   . HOH J 6 .   ? 20.324  -1.461  -1.670  1.00 43.90 ? 343 HOH B O   1 
HETATM 3926 O  O   . HOH J 6 .   ? -12.212 -23.199 3.732   1.00 28.32 ? 344 HOH B O   1 
HETATM 3927 O  O   . HOH J 6 .   ? -6.377  -22.467 -5.213  1.00 40.35 ? 345 HOH B O   1 
HETATM 3928 O  O   . HOH J 6 .   ? 18.681  -10.824 -2.616  1.00 38.40 ? 346 HOH B O   1 
HETATM 3929 O  O   . HOH J 6 .   ? -16.179 -14.515 -10.936 1.00 45.87 ? 347 HOH B O   1 
HETATM 3930 O  O   . HOH J 6 .   ? 7.887   -13.978 13.615  1.00 39.27 ? 348 HOH B O   1 
HETATM 3931 O  O   . HOH J 6 .   ? -8.471  -23.166 9.824   1.00 46.34 ? 349 HOH B O   1 
HETATM 3932 O  O   . HOH J 6 .   ? 0.019   -24.032 16.076  1.00 29.01 ? 350 HOH B O   1 
HETATM 3933 O  O   . HOH J 6 .   ? 9.282   -23.813 -1.024  1.00 52.06 ? 351 HOH B O   1 
HETATM 3934 O  O   . HOH J 6 .   ? -10.084 -25.864 7.220   1.00 41.13 ? 352 HOH B O   1 
HETATM 3935 O  O   . HOH J 6 .   ? 9.951   -1.965  -6.748  1.00 35.71 ? 353 HOH B O   1 
HETATM 3936 O  O   . HOH J 6 .   ? 9.772   -22.051 -13.984 1.00 44.10 ? 354 HOH B O   1 
HETATM 3937 O  O   . HOH J 6 .   ? 16.405  -14.124 -5.705  1.00 39.19 ? 355 HOH B O   1 
HETATM 3938 O  O   . HOH J 6 .   ? 1.100   -27.358 11.551  1.00 43.59 ? 356 HOH B O   1 
HETATM 3939 O  O   . HOH J 6 .   ? -16.183 -5.579  -0.758  1.00 37.05 ? 357 HOH B O   1 
HETATM 3940 O  O   . HOH J 6 .   ? -17.006 1.741   9.758   1.00 48.44 ? 358 HOH B O   1 
HETATM 3941 O  O   . HOH J 6 .   ? 20.555  0.947   2.272   1.00 34.36 ? 359 HOH B O   1 
HETATM 3942 O  O   . HOH J 6 .   ? 9.145   -14.505 -16.982 1.00 36.96 ? 360 HOH B O   1 
HETATM 3943 O  O   . HOH J 6 .   ? -11.201 -2.274  -3.029  1.00 34.47 ? 361 HOH B O   1 
HETATM 3944 O  O   . HOH J 6 .   ? 21.359  -16.271 11.844  1.00 46.80 ? 362 HOH B O   1 
HETATM 3945 O  O   . HOH J 6 .   ? 6.484   -13.025 -17.027 1.00 50.39 ? 363 HOH B O   1 
HETATM 3946 O  O   . HOH J 6 .   ? 19.148  10.633  13.343  1.00 47.10 ? 364 HOH B O   1 
HETATM 3947 O  O   . HOH J 6 .   ? 15.322  5.527   -1.264  1.00 32.87 ? 365 HOH B O   1 
HETATM 3948 O  O   . HOH J 6 .   ? 10.876  -3.286  -9.995  1.00 34.54 ? 366 HOH B O   1 
HETATM 3949 O  O   . HOH J 6 .   ? 21.923  8.728   11.107  1.00 36.49 ? 367 HOH B O   1 
HETATM 3950 O  O   . HOH J 6 .   ? 13.977  7.664   3.303   1.00 36.58 ? 368 HOH B O   1 
HETATM 3951 O  O   . HOH J 6 .   ? 2.761   -6.194  16.792  1.00 30.99 ? 369 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLN 1   1   1   GLN GLN A . n 
A 1 2   ASP 2   2   2   ASP ASP A . n 
A 1 3   SER 3   3   3   SER SER A . n 
A 1 4   LEU 4   4   4   LEU LEU A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   PHE 6   6   6   PHE PHE A . n 
A 1 7   GLY 7   7   7   GLY GLY A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   PRO 9   9   9   PRO PRO A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  PHE 11  11  11  PHE PHE A . n 
A 1 12  PRO 12  12  12  PRO PRO A . n 
A 1 13  SER 13  13  13  SER SER A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  GLN 15  15  15  GLN GLN A . n 
A 1 16  LYS 16  16  16  LYS LYS A . n 
A 1 17  ASN 17  17  17  ASN ASN A . n 
A 1 18  LEU 18  18  18  LEU LEU A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  PHE 20  20  20  PHE PHE A . n 
A 1 21  GLN 21  21  21  GLN GLN A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  ALA 24  24  24  ALA ALA A . n 
A 1 25  GLN 25  25  25  GLN GLN A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  ASN 28  28  28  ASN ASN A . n 
A 1 29  ASN 29  29  29  ASN ASN A . n 
A 1 30  ALA 30  30  30  ALA ALA A . n 
A 1 31  VAL 31  31  31  VAL VAL A . n 
A 1 32  GLN 32  32  32  GLN GLN A . n 
A 1 33  LEU 33  33  33  LEU LEU A . n 
A 1 34  THR 34  34  34  THR THR A . n 
A 1 35  LYS 35  35  35  LYS LYS A . n 
A 1 36  THR 36  36  36  THR THR A . n 
A 1 37  ASP 37  37  37  ASP ASP A . n 
A 1 38  SER 38  38  38  SER SER A . n 
A 1 39  ASN 39  39  39  ASN ASN A . n 
A 1 40  GLY 40  40  40  GLY GLY A . n 
A 1 41  ASN 41  41  41  ASN ASN A . n 
A 1 42  PRO 42  42  42  PRO PRO A . n 
A 1 43  VAL 43  43  43  VAL VAL A . n 
A 1 44  ALA 44  44  44  ALA ALA A . n 
A 1 45  SER 45  45  45  SER SER A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  GLY 48  48  48  GLY GLY A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  ALA 54  54  54  ALA ALA A . n 
A 1 55  GLN 55  55  55  GLN GLN A . n 
A 1 56  VAL 56  56  56  VAL VAL A . n 
A 1 57  HIS 57  57  57  HIS HIS A . n 
A 1 58  LEU 58  58  58  LEU LEU A . n 
A 1 59  TRP 59  59  59  TRP TRP A . n 
A 1 60  GLU 60  60  60  GLU GLU A . n 
A 1 61  LYS 61  61  61  LYS LYS A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  SER 63  63  63  SER SER A . n 
A 1 64  SER 64  64  64  SER SER A . n 
A 1 65  ARG 65  65  65  ARG ARG A . n 
A 1 66  VAL 66  66  66  VAL VAL A . n 
A 1 67  ALA 67  67  67  ALA ALA A . n 
A 1 68  ASN 68  68  68  ASN ASN A . n 
A 1 69  PHE 69  69  69  PHE PHE A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  SER 71  71  71  SER SER A . n 
A 1 72  GLN 72  72  72  GLN GLN A . n 
A 1 73  PHE 73  73  73  PHE PHE A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  SER 76  76  76  SER SER A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  LYS 78  78  78  LYS LYS A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  LEU 81  81  81  LEU LEU A . n 
A 1 82  SER 82  82  82  SER SER A . n 
A 1 83  ASN 83  83  83  ASN ASN A . n 
A 1 84  GLY 84  84  84  GLY GLY A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  ILE 88  88  88  ILE ILE A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  PHE 90  90  90  PHE PHE A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  PRO 94  94  94  PRO PRO A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  ASP 96  96  96  ASP ASP A . n 
A 1 97  THR 97  97  97  THR THR A . n 
A 1 98  THR 98  98  98  THR THR A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 PRO 100 100 100 PRO PRO A . n 
A 1 101 SER 101 101 101 SER SER A . n 
A 1 102 GLY 102 102 102 GLY GLY A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 GLY 105 105 105 GLY GLY A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 LEU 110 110 110 LEU LEU A . n 
A 1 111 PHE 111 111 111 PHE PHE A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 PRO 113 113 113 PRO PRO A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 THR 115 115 115 THR THR A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 GLN 117 117 117 GLN GLN A . n 
A 1 118 ASN 118 118 118 ASN ASN A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 SER 120 120 120 SER SER A . n 
A 1 121 ALA 121 121 121 ALA ALA A . n 
A 1 122 ASN 122 122 122 ASN ASN A . n 
A 1 123 GLN 123 123 123 GLN GLN A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 ILE 125 125 125 ILE ILE A . n 
A 1 126 ALA 126 126 126 ALA ALA A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 GLU 128 128 128 GLU GLU A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 TYR 133 133 133 TYR TYR A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 GLN 135 135 135 GLN GLN A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 ASN 138 138 138 ASN ASN A . n 
A 1 139 THR 139 139 139 THR THR A . n 
A 1 140 TRP 140 140 140 TRP TRP A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 PRO 142 142 142 PRO PRO A . n 
A 1 143 ASN 143 143 143 ASN ASN A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 PRO 145 145 145 PRO PRO A . n 
A 1 146 HIS 146 146 146 HIS HIS A . n 
A 1 147 ILE 147 147 147 ILE ILE A . n 
A 1 148 GLY 148 148 148 GLY GLY A . n 
A 1 149 ILE 149 149 149 ILE ILE A . n 
A 1 150 ASP 150 150 150 ASP ASP A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 ASN 152 152 152 ASN ASN A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 ILE 154 154 154 ILE ILE A . n 
A 1 155 ARG 155 155 155 ARG ARG A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 VAL 157 157 157 VAL VAL A . n 
A 1 158 LYS 158 158 158 LYS LYS A . n 
A 1 159 THR 159 159 159 THR THR A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 LYS 161 161 161 LYS LYS A . n 
A 1 162 TRP 162 162 162 TRP TRP A . n 
A 1 163 ASP 163 163 163 ASP ASP A . n 
A 1 164 ARG 164 164 164 ARG ARG A . n 
A 1 165 ARG 165 165 165 ARG ARG A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 GLY 167 167 167 GLY GLY A . n 
A 1 168 GLN 168 168 168 GLN GLN A . n 
A 1 169 SER 169 169 169 SER SER A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 ASN 171 171 171 ASN ASN A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 THR 175 175 175 THR THR A . n 
A 1 176 PHE 176 176 176 PHE PHE A . n 
A 1 177 ASN 177 177 177 ASN ASN A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 THR 180 180 180 THR THR A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 LEU 183 183 183 LEU LEU A . n 
A 1 184 ASP 184 184 184 ASP ASP A . n 
A 1 185 VAL 185 185 185 VAL VAL A . n 
A 1 186 VAL 186 186 186 VAL VAL A . n 
A 1 187 ALA 187 187 187 ALA ALA A . n 
A 1 188 THR 188 188 188 THR THR A . n 
A 1 189 TYR 189 189 189 TYR TYR A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 ASP 191 191 191 ASP ASP A . n 
A 1 192 GLY 192 192 192 GLY GLY A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 TYR 195 195 195 TYR TYR A . n 
A 1 196 GLU 196 196 196 GLU GLU A . n 
A 1 197 VAL 197 197 197 VAL VAL A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 TYR 199 199 199 TYR TYR A . n 
A 1 200 GLU 200 200 200 GLU GLU A . n 
A 1 201 VAL 201 201 201 VAL VAL A . n 
A 1 202 ASP 202 202 202 ASP ASP A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 ARG 204 204 204 ARG ARG A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 LEU 207 207 207 LEU LEU A . n 
A 1 208 PRO 208 208 208 PRO PRO A . n 
A 1 209 GLU 209 209 209 GLU GLU A . n 
A 1 210 TRP 210 210 210 TRP TRP A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 ARG 212 212 212 ARG ARG A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 PHE 215 215 215 PHE PHE A . n 
A 1 216 SER 216 216 216 SER SER A . n 
A 1 217 ALA 217 217 217 ALA ALA A . n 
A 1 218 ALA 218 218 218 ALA ALA A . n 
A 1 219 SER 219 219 219 SER SER A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 GLU 221 221 221 GLU GLU A . n 
A 1 222 GLN 222 222 222 GLN GLN A . n 
A 1 223 TYR 223 223 223 TYR TYR A . n 
A 1 224 GLN 224 224 224 GLN GLN A . n 
A 1 225 THR 225 225 225 THR THR A . n 
A 1 226 HIS 226 226 226 HIS HIS A . n 
A 1 227 THR 227 227 227 THR THR A . n 
A 1 228 LEU 228 228 228 LEU LEU A . n 
A 1 229 GLU 229 229 229 GLU GLU A . n 
A 1 230 SER 230 230 230 SER SER A . n 
A 1 231 TRP 231 231 231 TRP TRP A . n 
A 1 232 SER 232 232 232 SER SER A . n 
A 1 233 PHE 233 233 233 PHE PHE A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 THR 236 236 236 THR THR A . n 
A 1 237 LEU 237 237 237 LEU LEU A . n 
A 1 238 LEU 238 238 238 LEU LEU A . n 
A 1 239 TYR 239 239 239 TYR TYR A . n 
A 1 240 THR 240 240 240 THR THR A . n 
A 1 241 ALA 241 241 241 ALA ALA A . n 
A 1 242 GLN 242 242 ?   ?   ?   A . n 
A 1 243 LYS 243 243 ?   ?   ?   A . n 
A 1 244 LYS 244 244 ?   ?   ?   A . n 
A 1 245 GLY 245 245 ?   ?   ?   A . n 
A 1 246 GLU 246 246 ?   ?   ?   A . n 
A 1 247 ASN 247 247 ?   ?   ?   A . n 
A 1 248 LEU 248 248 ?   ?   ?   A . n 
A 1 249 ALA 249 249 ?   ?   ?   A . n 
A 1 250 LEU 250 250 ?   ?   ?   A . n 
A 1 251 GLU 251 251 ?   ?   ?   A . n 
A 1 252 MET 252 252 ?   ?   ?   A . n 
B 1 1   GLN 1   1   1   GLN GLN B . n 
B 1 2   ASP 2   2   2   ASP ASP B . n 
B 1 3   SER 3   3   3   SER SER B . n 
B 1 4   LEU 4   4   4   LEU LEU B . n 
B 1 5   SER 5   5   5   SER SER B . n 
B 1 6   PHE 6   6   6   PHE PHE B . n 
B 1 7   GLY 7   7   7   GLY GLY B . n 
B 1 8   PHE 8   8   8   PHE PHE B . n 
B 1 9   PRO 9   9   9   PRO PRO B . n 
B 1 10  THR 10  10  10  THR THR B . n 
B 1 11  PHE 11  11  11  PHE PHE B . n 
B 1 12  PRO 12  12  12  PRO PRO B . n 
B 1 13  SER 13  13  13  SER SER B . n 
B 1 14  ASP 14  14  14  ASP ASP B . n 
B 1 15  GLN 15  15  15  GLN GLN B . n 
B 1 16  LYS 16  16  16  LYS LYS B . n 
B 1 17  ASN 17  17  17  ASN ASN B . n 
B 1 18  LEU 18  18  18  LEU LEU B . n 
B 1 19  ILE 19  19  19  ILE ILE B . n 
B 1 20  PHE 20  20  20  PHE PHE B . n 
B 1 21  GLN 21  21  21  GLN GLN B . n 
B 1 22  GLY 22  22  22  GLY GLY B . n 
B 1 23  ASP 23  23  23  ASP ASP B . n 
B 1 24  ALA 24  24  24  ALA ALA B . n 
B 1 25  GLN 25  25  25  GLN GLN B . n 
B 1 26  ILE 26  26  26  ILE ILE B . n 
B 1 27  LYS 27  27  27  LYS LYS B . n 
B 1 28  ASN 28  28  28  ASN ASN B . n 
B 1 29  ASN 29  29  29  ASN ASN B . n 
B 1 30  ALA 30  30  30  ALA ALA B . n 
B 1 31  VAL 31  31  31  VAL VAL B . n 
B 1 32  GLN 32  32  32  GLN GLN B . n 
B 1 33  LEU 33  33  33  LEU LEU B . n 
B 1 34  THR 34  34  34  THR THR B . n 
B 1 35  LYS 35  35  35  LYS LYS B . n 
B 1 36  THR 36  36  36  THR THR B . n 
B 1 37  ASP 37  37  37  ASP ASP B . n 
B 1 38  SER 38  38  38  SER SER B . n 
B 1 39  ASN 39  39  39  ASN ASN B . n 
B 1 40  GLY 40  40  40  GLY GLY B . n 
B 1 41  ASN 41  41  41  ASN ASN B . n 
B 1 42  PRO 42  42  42  PRO PRO B . n 
B 1 43  VAL 43  43  43  VAL VAL B . n 
B 1 44  ALA 44  44  44  ALA ALA B . n 
B 1 45  SER 45  45  45  SER SER B . n 
B 1 46  THR 46  46  46  THR THR B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  GLY 48  48  48  GLY GLY B . n 
B 1 49  ARG 49  49  49  ARG ARG B . n 
B 1 50  ILE 50  50  50  ILE ILE B . n 
B 1 51  LEU 51  51  51  LEU LEU B . n 
B 1 52  PHE 52  52  52  PHE PHE B . n 
B 1 53  SER 53  53  53  SER SER B . n 
B 1 54  ALA 54  54  54  ALA ALA B . n 
B 1 55  GLN 55  55  55  GLN GLN B . n 
B 1 56  VAL 56  56  56  VAL VAL B . n 
B 1 57  HIS 57  57  57  HIS HIS B . n 
B 1 58  LEU 58  58  58  LEU LEU B . n 
B 1 59  TRP 59  59  59  TRP TRP B . n 
B 1 60  GLU 60  60  60  GLU GLU B . n 
B 1 61  LYS 61  61  61  LYS LYS B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  SER 63  63  63  SER SER B . n 
B 1 64  SER 64  64  64  SER SER B . n 
B 1 65  ARG 65  65  65  ARG ARG B . n 
B 1 66  VAL 66  66  66  VAL VAL B . n 
B 1 67  ALA 67  67  67  ALA ALA B . n 
B 1 68  ASN 68  68  68  ASN ASN B . n 
B 1 69  PHE 69  69  69  PHE PHE B . n 
B 1 70  GLN 70  70  70  GLN GLN B . n 
B 1 71  SER 71  71  71  SER SER B . n 
B 1 72  GLN 72  72  72  GLN GLN B . n 
B 1 73  PHE 73  73  73  PHE PHE B . n 
B 1 74  SER 74  74  74  SER SER B . n 
B 1 75  PHE 75  75  75  PHE PHE B . n 
B 1 76  SER 76  76  76  SER SER B . n 
B 1 77  LEU 77  77  77  LEU LEU B . n 
B 1 78  LYS 78  78  78  LYS LYS B . n 
B 1 79  SER 79  79  79  SER SER B . n 
B 1 80  PRO 80  80  80  PRO PRO B . n 
B 1 81  LEU 81  81  81  LEU LEU B . n 
B 1 82  SER 82  82  82  SER SER B . n 
B 1 83  ASN 83  83  83  ASN ASN B . n 
B 1 84  GLY 84  84  84  GLY GLY B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  ASP 86  86  86  ASP ASP B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  ILE 88  88  88  ILE ILE B . n 
B 1 89  ALA 89  89  89  ALA ALA B . n 
B 1 90  PHE 90  90  90  PHE PHE B . n 
B 1 91  PHE 91  91  91  PHE PHE B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  PRO 94  94  94  PRO PRO B . n 
B 1 95  PRO 95  95  95  PRO PRO B . n 
B 1 96  ASP 96  96  96  ASP ASP B . n 
B 1 97  THR 97  97  97  THR THR B . n 
B 1 98  THR 98  98  98  THR THR B . n 
B 1 99  ILE 99  99  99  ILE ILE B . n 
B 1 100 PRO 100 100 100 PRO PRO B . n 
B 1 101 SER 101 101 101 SER SER B . n 
B 1 102 GLY 102 102 102 GLY GLY B . n 
B 1 103 SER 103 103 103 SER SER B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 GLY 105 105 105 GLY GLY B . n 
B 1 106 GLY 106 106 106 GLY GLY B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 GLY 109 109 109 GLY GLY B . n 
B 1 110 LEU 110 110 110 LEU LEU B . n 
B 1 111 PHE 111 111 111 PHE PHE B . n 
B 1 112 ALA 112 112 112 ALA ALA B . n 
B 1 113 PRO 113 113 113 PRO PRO B . n 
B 1 114 GLY 114 114 114 GLY GLY B . n 
B 1 115 THR 115 115 115 THR THR B . n 
B 1 116 ALA 116 116 116 ALA ALA B . n 
B 1 117 GLN 117 117 117 GLN GLN B . n 
B 1 118 ASN 118 118 118 ASN ASN B . n 
B 1 119 THR 119 119 119 THR THR B . n 
B 1 120 SER 120 120 120 SER SER B . n 
B 1 121 ALA 121 121 121 ALA ALA B . n 
B 1 122 ASN 122 122 122 ASN ASN B . n 
B 1 123 GLN 123 123 123 GLN GLN B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
B 1 125 ILE 125 125 125 ILE ILE B . n 
B 1 126 ALA 126 126 126 ALA ALA B . n 
B 1 127 VAL 127 127 127 VAL VAL B . n 
B 1 128 GLU 128 128 128 GLU GLU B . n 
B 1 129 PHE 129 129 129 PHE PHE B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 THR 131 131 131 THR THR B . n 
B 1 132 PHE 132 132 132 PHE PHE B . n 
B 1 133 TYR 133 133 133 TYR TYR B . n 
B 1 134 ALA 134 134 134 ALA ALA B . n 
B 1 135 GLN 135 135 135 GLN GLN B . n 
B 1 136 ASP 136 136 136 ASP ASP B . n 
B 1 137 SER 137 137 137 SER SER B . n 
B 1 138 ASN 138 138 138 ASN ASN B . n 
B 1 139 THR 139 139 139 THR THR B . n 
B 1 140 TRP 140 140 140 TRP TRP B . n 
B 1 141 ASP 141 141 141 ASP ASP B . n 
B 1 142 PRO 142 142 142 PRO PRO B . n 
B 1 143 ASN 143 143 143 ASN ASN B . n 
B 1 144 TYR 144 144 144 TYR TYR B . n 
B 1 145 PRO 145 145 145 PRO PRO B . n 
B 1 146 HIS 146 146 146 HIS HIS B . n 
B 1 147 ILE 147 147 147 ILE ILE B . n 
B 1 148 GLY 148 148 148 GLY GLY B . n 
B 1 149 ILE 149 149 149 ILE ILE B . n 
B 1 150 ASP 150 150 150 ASP ASP B . n 
B 1 151 VAL 151 151 151 VAL VAL B . n 
B 1 152 ASN 152 152 152 ASN ASN B . n 
B 1 153 SER 153 153 153 SER SER B . n 
B 1 154 ILE 154 154 154 ILE ILE B . n 
B 1 155 ARG 155 155 155 ARG ARG B . n 
B 1 156 SER 156 156 156 SER SER B . n 
B 1 157 VAL 157 157 157 VAL VAL B . n 
B 1 158 LYS 158 158 158 LYS LYS B . n 
B 1 159 THR 159 159 159 THR THR B . n 
B 1 160 VAL 160 160 160 VAL VAL B . n 
B 1 161 LYS 161 161 161 LYS LYS B . n 
B 1 162 TRP 162 162 162 TRP TRP B . n 
B 1 163 ASP 163 163 163 ASP ASP B . n 
B 1 164 ARG 164 164 164 ARG ARG B . n 
B 1 165 ARG 165 165 165 ARG ARG B . n 
B 1 166 ASP 166 166 166 ASP ASP B . n 
B 1 167 GLY 167 167 167 GLY GLY B . n 
B 1 168 GLN 168 168 168 GLN GLN B . n 
B 1 169 SER 169 169 169 SER SER B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 ASN 171 171 171 ASN ASN B . n 
B 1 172 VAL 172 172 172 VAL VAL B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 VAL 174 174 174 VAL VAL B . n 
B 1 175 THR 175 175 175 THR THR B . n 
B 1 176 PHE 176 176 176 PHE PHE B . n 
B 1 177 ASN 177 177 177 ASN ASN B . n 
B 1 178 PRO 178 178 178 PRO PRO B . n 
B 1 179 SER 179 179 179 SER SER B . n 
B 1 180 THR 180 180 180 THR THR B . n 
B 1 181 ARG 181 181 181 ARG ARG B . n 
B 1 182 ASN 182 182 182 ASN ASN B . n 
B 1 183 LEU 183 183 183 LEU LEU B . n 
B 1 184 ASP 184 184 184 ASP ASP B . n 
B 1 185 VAL 185 185 185 VAL VAL B . n 
B 1 186 VAL 186 186 186 VAL VAL B . n 
B 1 187 ALA 187 187 187 ALA ALA B . n 
B 1 188 THR 188 188 188 THR THR B . n 
B 1 189 TYR 189 189 189 TYR TYR B . n 
B 1 190 SER 190 190 190 SER SER B . n 
B 1 191 ASP 191 191 191 ASP ASP B . n 
B 1 192 GLY 192 192 192 GLY GLY B . n 
B 1 193 THR 193 193 193 THR THR B . n 
B 1 194 ARG 194 194 194 ARG ARG B . n 
B 1 195 TYR 195 195 195 TYR TYR B . n 
B 1 196 GLU 196 196 196 GLU GLU B . n 
B 1 197 VAL 197 197 197 VAL VAL B . n 
B 1 198 SER 198 198 198 SER SER B . n 
B 1 199 TYR 199 199 199 TYR TYR B . n 
B 1 200 GLU 200 200 200 GLU GLU B . n 
B 1 201 VAL 201 201 201 VAL VAL B . n 
B 1 202 ASP 202 202 202 ASP ASP B . n 
B 1 203 VAL 203 203 203 VAL VAL B . n 
B 1 204 ARG 204 204 204 ARG ARG B . n 
B 1 205 SER 205 205 205 SER SER B . n 
B 1 206 VAL 206 206 206 VAL VAL B . n 
B 1 207 LEU 207 207 207 LEU LEU B . n 
B 1 208 PRO 208 208 208 PRO PRO B . n 
B 1 209 GLU 209 209 209 GLU GLU B . n 
B 1 210 TRP 210 210 210 TRP TRP B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 ARG 212 212 212 ARG ARG B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 GLY 214 214 214 GLY GLY B . n 
B 1 215 PHE 215 215 215 PHE PHE B . n 
B 1 216 SER 216 216 216 SER SER B . n 
B 1 217 ALA 217 217 217 ALA ALA B . n 
B 1 218 ALA 218 218 218 ALA ALA B . n 
B 1 219 SER 219 219 219 SER SER B . n 
B 1 220 GLY 220 220 220 GLY GLY B . n 
B 1 221 GLU 221 221 221 GLU GLU B . n 
B 1 222 GLN 222 222 222 GLN GLN B . n 
B 1 223 TYR 223 223 223 TYR TYR B . n 
B 1 224 GLN 224 224 224 GLN GLN B . n 
B 1 225 THR 225 225 225 THR THR B . n 
B 1 226 HIS 226 226 226 HIS HIS B . n 
B 1 227 THR 227 227 227 THR THR B . n 
B 1 228 LEU 228 228 228 LEU LEU B . n 
B 1 229 GLU 229 229 229 GLU GLU B . n 
B 1 230 SER 230 230 230 SER SER B . n 
B 1 231 TRP 231 231 231 TRP TRP B . n 
B 1 232 SER 232 232 232 SER SER B . n 
B 1 233 PHE 233 233 233 PHE PHE B . n 
B 1 234 THR 234 234 234 THR THR B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 THR 236 236 236 THR THR B . n 
B 1 237 LEU 237 237 237 LEU LEU B . n 
B 1 238 LEU 238 238 238 LEU LEU B . n 
B 1 239 TYR 239 239 239 TYR TYR B . n 
B 1 240 THR 240 240 240 THR THR B . n 
B 1 241 ALA 241 241 241 ALA ALA B . n 
B 1 242 GLN 242 242 ?   ?   ?   B . n 
B 1 243 LYS 243 243 ?   ?   ?   B . n 
B 1 244 LYS 244 244 ?   ?   ?   B . n 
B 1 245 GLY 245 245 ?   ?   ?   B . n 
B 1 246 GLU 246 246 ?   ?   ?   B . n 
B 1 247 ASN 247 247 ?   ?   ?   B . n 
B 1 248 LEU 248 248 ?   ?   ?   B . n 
B 1 249 ALA 249 249 ?   ?   ?   B . n 
B 1 250 LEU 250 250 ?   ?   ?   B . n 
B 1 251 GLU 251 251 ?   ?   ?   B . n 
B 1 252 MET 252 252 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 MN  1  271 271 MN  MNG A . 
F 5 CA  1  272 272 CA  CAL A . 
G 4 MN  1  273 273 MN  MNG B . 
H 5 CA  1  274 274 CA  CAL B . 
I 6 HOH 1  273 1   HOH WAT A . 
I 6 HOH 2  274 2   HOH WAT A . 
I 6 HOH 3  275 3   HOH WAT A . 
I 6 HOH 4  276 4   HOH WAT A . 
I 6 HOH 5  277 5   HOH WAT A . 
I 6 HOH 6  278 6   HOH WAT A . 
I 6 HOH 7  279 7   HOH WAT A . 
I 6 HOH 8  280 8   HOH WAT A . 
I 6 HOH 9  281 9   HOH WAT A . 
I 6 HOH 10 282 10  HOH WAT A . 
I 6 HOH 11 283 20  HOH WAT A . 
I 6 HOH 12 284 23  HOH WAT A . 
I 6 HOH 13 285 28  HOH WAT A . 
I 6 HOH 14 286 30  HOH WAT A . 
I 6 HOH 15 287 34  HOH WAT A . 
I 6 HOH 16 288 35  HOH WAT A . 
I 6 HOH 17 289 37  HOH WAT A . 
I 6 HOH 18 290 38  HOH WAT A . 
I 6 HOH 19 291 40  HOH WAT A . 
I 6 HOH 20 292 45  HOH WAT A . 
I 6 HOH 21 293 46  HOH WAT A . 
I 6 HOH 22 294 51  HOH WAT A . 
I 6 HOH 23 295 53  HOH WAT A . 
I 6 HOH 24 296 54  HOH WAT A . 
I 6 HOH 25 297 55  HOH WAT A . 
I 6 HOH 26 298 56  HOH WAT A . 
I 6 HOH 27 299 57  HOH WAT A . 
I 6 HOH 28 300 58  HOH WAT A . 
I 6 HOH 29 301 59  HOH WAT A . 
I 6 HOH 30 302 62  HOH WAT A . 
I 6 HOH 31 303 63  HOH WAT A . 
I 6 HOH 32 304 64  HOH WAT A . 
I 6 HOH 33 305 66  HOH WAT A . 
I 6 HOH 34 306 68  HOH WAT A . 
I 6 HOH 35 307 69  HOH WAT A . 
I 6 HOH 36 308 70  HOH WAT A . 
I 6 HOH 37 309 72  HOH WAT A . 
I 6 HOH 38 310 75  HOH WAT A . 
I 6 HOH 39 311 80  HOH WAT A . 
I 6 HOH 40 312 83  HOH WAT A . 
I 6 HOH 41 313 89  HOH WAT A . 
I 6 HOH 42 314 90  HOH WAT A . 
I 6 HOH 43 315 92  HOH WAT A . 
I 6 HOH 44 316 93  HOH WAT A . 
I 6 HOH 45 317 96  HOH WAT A . 
I 6 HOH 46 318 97  HOH WAT A . 
I 6 HOH 47 319 98  HOH WAT A . 
I 6 HOH 48 320 100 HOH WAT A . 
I 6 HOH 49 321 101 HOH WAT A . 
I 6 HOH 50 322 104 HOH WAT A . 
I 6 HOH 51 323 105 HOH WAT A . 
I 6 HOH 52 324 106 HOH WAT A . 
I 6 HOH 53 325 107 HOH WAT A . 
I 6 HOH 54 326 109 HOH WAT A . 
I 6 HOH 55 327 110 HOH WAT A . 
I 6 HOH 56 328 117 HOH WAT A . 
I 6 HOH 57 329 118 HOH WAT A . 
I 6 HOH 58 330 123 HOH WAT A . 
I 6 HOH 59 331 124 HOH WAT A . 
I 6 HOH 60 332 125 HOH WAT A . 
I 6 HOH 61 333 129 HOH WAT A . 
I 6 HOH 62 334 130 HOH WAT A . 
I 6 HOH 63 335 132 HOH WAT A . 
I 6 HOH 64 336 133 HOH WAT A . 
I 6 HOH 65 337 135 HOH WAT A . 
I 6 HOH 66 338 136 HOH WAT A . 
I 6 HOH 67 339 148 HOH WAT A . 
I 6 HOH 68 340 153 HOH WAT A . 
I 6 HOH 69 341 154 HOH WAT A . 
I 6 HOH 70 342 155 HOH WAT A . 
I 6 HOH 71 343 156 HOH WAT A . 
I 6 HOH 72 344 159 HOH WAT A . 
I 6 HOH 73 345 162 HOH WAT A . 
I 6 HOH 74 346 163 HOH WAT A . 
I 6 HOH 75 347 164 HOH WAT A . 
I 6 HOH 76 348 165 HOH WAT A . 
I 6 HOH 77 349 169 HOH WAT A . 
I 6 HOH 78 350 170 HOH WAT A . 
I 6 HOH 79 351 173 HOH WAT A . 
I 6 HOH 80 352 174 HOH WAT A . 
I 6 HOH 81 353 175 HOH WAT A . 
I 6 HOH 82 354 176 HOH WAT A . 
I 6 HOH 83 355 177 HOH WAT A . 
I 6 HOH 84 356 178 HOH WAT A . 
I 6 HOH 85 357 179 HOH WAT A . 
I 6 HOH 86 358 180 HOH WAT A . 
I 6 HOH 87 359 181 HOH WAT A . 
I 6 HOH 88 360 182 HOH WAT A . 
I 6 HOH 89 361 183 HOH WAT A . 
J 6 HOH 1  275 11  HOH WAT B . 
J 6 HOH 2  276 12  HOH WAT B . 
J 6 HOH 3  277 13  HOH WAT B . 
J 6 HOH 4  278 14  HOH WAT B . 
J 6 HOH 5  279 15  HOH WAT B . 
J 6 HOH 6  280 16  HOH WAT B . 
J 6 HOH 7  281 17  HOH WAT B . 
J 6 HOH 8  282 18  HOH WAT B . 
J 6 HOH 9  283 19  HOH WAT B . 
J 6 HOH 10 284 21  HOH WAT B . 
J 6 HOH 11 285 22  HOH WAT B . 
J 6 HOH 12 286 24  HOH WAT B . 
J 6 HOH 13 287 25  HOH WAT B . 
J 6 HOH 14 288 26  HOH WAT B . 
J 6 HOH 15 289 27  HOH WAT B . 
J 6 HOH 16 290 29  HOH WAT B . 
J 6 HOH 17 291 31  HOH WAT B . 
J 6 HOH 18 292 32  HOH WAT B . 
J 6 HOH 19 293 33  HOH WAT B . 
J 6 HOH 20 294 36  HOH WAT B . 
J 6 HOH 21 295 39  HOH WAT B . 
J 6 HOH 22 296 41  HOH WAT B . 
J 6 HOH 23 297 42  HOH WAT B . 
J 6 HOH 24 298 43  HOH WAT B . 
J 6 HOH 25 299 44  HOH WAT B . 
J 6 HOH 26 300 47  HOH WAT B . 
J 6 HOH 27 301 48  HOH WAT B . 
J 6 HOH 28 302 49  HOH WAT B . 
J 6 HOH 29 303 50  HOH WAT B . 
J 6 HOH 30 304 52  HOH WAT B . 
J 6 HOH 31 305 60  HOH WAT B . 
J 6 HOH 32 306 61  HOH WAT B . 
J 6 HOH 33 307 65  HOH WAT B . 
J 6 HOH 34 308 67  HOH WAT B . 
J 6 HOH 35 309 71  HOH WAT B . 
J 6 HOH 36 310 73  HOH WAT B . 
J 6 HOH 37 311 74  HOH WAT B . 
J 6 HOH 38 312 76  HOH WAT B . 
J 6 HOH 39 313 77  HOH WAT B . 
J 6 HOH 40 314 78  HOH WAT B . 
J 6 HOH 41 315 79  HOH WAT B . 
J 6 HOH 42 316 81  HOH WAT B . 
J 6 HOH 43 317 82  HOH WAT B . 
J 6 HOH 44 318 84  HOH WAT B . 
J 6 HOH 45 319 85  HOH WAT B . 
J 6 HOH 46 320 86  HOH WAT B . 
J 6 HOH 47 321 87  HOH WAT B . 
J 6 HOH 48 322 88  HOH WAT B . 
J 6 HOH 49 323 91  HOH WAT B . 
J 6 HOH 50 324 94  HOH WAT B . 
J 6 HOH 51 325 95  HOH WAT B . 
J 6 HOH 52 326 99  HOH WAT B . 
J 6 HOH 53 327 102 HOH WAT B . 
J 6 HOH 54 328 103 HOH WAT B . 
J 6 HOH 55 329 108 HOH WAT B . 
J 6 HOH 56 330 111 HOH WAT B . 
J 6 HOH 57 331 112 HOH WAT B . 
J 6 HOH 58 332 113 HOH WAT B . 
J 6 HOH 59 333 114 HOH WAT B . 
J 6 HOH 60 334 115 HOH WAT B . 
J 6 HOH 61 335 116 HOH WAT B . 
J 6 HOH 62 336 119 HOH WAT B . 
J 6 HOH 63 337 120 HOH WAT B . 
J 6 HOH 64 338 121 HOH WAT B . 
J 6 HOH 65 339 122 HOH WAT B . 
J 6 HOH 66 340 126 HOH WAT B . 
J 6 HOH 67 341 127 HOH WAT B . 
J 6 HOH 68 342 128 HOH WAT B . 
J 6 HOH 69 343 131 HOH WAT B . 
J 6 HOH 70 344 134 HOH WAT B . 
J 6 HOH 71 345 137 HOH WAT B . 
J 6 HOH 72 346 138 HOH WAT B . 
J 6 HOH 73 347 139 HOH WAT B . 
J 6 HOH 74 348 140 HOH WAT B . 
J 6 HOH 75 349 141 HOH WAT B . 
J 6 HOH 76 350 142 HOH WAT B . 
J 6 HOH 77 351 143 HOH WAT B . 
J 6 HOH 78 352 144 HOH WAT B . 
J 6 HOH 79 353 145 HOH WAT B . 
J 6 HOH 80 354 146 HOH WAT B . 
J 6 HOH 81 355 147 HOH WAT B . 
J 6 HOH 82 356 149 HOH WAT B . 
J 6 HOH 83 357 150 HOH WAT B . 
J 6 HOH 84 358 151 HOH WAT B . 
J 6 HOH 85 359 152 HOH WAT B . 
J 6 HOH 86 360 157 HOH WAT B . 
J 6 HOH 87 361 158 HOH WAT B . 
J 6 HOH 88 362 160 HOH WAT B . 
J 6 HOH 89 363 161 HOH WAT B . 
J 6 HOH 90 364 166 HOH WAT B . 
J 6 HOH 91 365 167 HOH WAT B . 
J 6 HOH 92 366 168 HOH WAT B . 
J 6 HOH 93 367 171 HOH WAT B . 
J 6 HOH 94 368 172 HOH WAT B . 
J 6 HOH 95 369 184 HOH WAT B . 
# 
_pdbx_molecule_features.prd_id    PRD_900047 
_pdbx_molecule_features.name      beta-turanose 
_pdbx_molecule_features.type      Oligosaccharide 
_pdbx_molecule_features.class     Nutrient 
_pdbx_molecule_features.details   oligosaccharide 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_900047 
_pdbx_molecule.asym_id       C 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 93.6  ? 
2  OE2 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 OD1 ? A ASP 141 ? A ASP 141 ? 1_555 173.6 ? 
3  OD2 ? A ASP 130 ? A ASP 130 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 OD1 ? A ASP 141 ? A ASP 141 ? 1_555 91.5  ? 
4  OE2 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 94.5  ? 
5  OD2 ? A ASP 130 ? A ASP 130 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 91.3  ? 
6  OD1 ? A ASP 141 ? A ASP 141 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 89.2  ? 
7  OE2 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 O   ? I HOH .   ? A HOH 275 ? 1_555 84.2  ? 
8  OD2 ? A ASP 130 ? A ASP 130 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 O   ? I HOH .   ? A HOH 275 ? 1_555 91.8  ? 
9  OD1 ? A ASP 141 ? A ASP 141 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 O   ? I HOH .   ? A HOH 275 ? 1_555 91.8  ? 
10 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 O   ? I HOH .   ? A HOH 275 ? 1_555 176.7 ? 
11 OE2 ? A GLU 128 ? A GLU 128 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 O   ? I HOH .   ? A HOH 276 ? 1_555 84.3  ? 
12 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 O   ? I HOH .   ? A HOH 276 ? 1_555 177.9 ? 
13 OD1 ? A ASP 141 ? A ASP 141 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 O   ? I HOH .   ? A HOH 276 ? 1_555 90.6  ? 
14 NE2 ? A HIS 146 ? A HIS 146 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 O   ? I HOH .   ? A HOH 276 ? 1_555 88.5  ? 
15 O   ? I HOH .   ? A HOH 275 ? 1_555 MN ? E MN . ? A MN 271 ? 1_555 O   ? I HOH .   ? A HOH 276 ? 1_555 88.4  ? 
16 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 53.7  ? 
17 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 O   ? A PHE 132 ? A PHE 132 ? 1_555 70.0  ? 
18 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 O   ? A PHE 132 ? A PHE 132 ? 1_555 109.3 ? 
19 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 148.6 ? 
20 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 157.4 ? 
21 O   ? A PHE 132 ? A PHE 132 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 89.0  ? 
22 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 109.0 ? 
23 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 77.5  ? 
24 O   ? A PHE 132 ? A PHE 132 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 85.0  ? 
25 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 91.5  ? 
26 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 O   ? I HOH .   ? A HOH 273 ? 1_555 111.8 ? 
27 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 O   ? I HOH .   ? A HOH 273 ? 1_555 70.8  ? 
28 O   ? A PHE 132 ? A PHE 132 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 O   ? I HOH .   ? A HOH 273 ? 1_555 177.0 ? 
29 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 O   ? I HOH .   ? A HOH 273 ? 1_555 90.2  ? 
30 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 O   ? I HOH .   ? A HOH 273 ? 1_555 92.1  ? 
31 OD1 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 O   ? I HOH .   ? A HOH 274 ? 1_555 71.5  ? 
32 OD2 ? A ASP 130 ? A ASP 130 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 O   ? I HOH .   ? A HOH 274 ? 1_555 107.2 ? 
33 O   ? A PHE 132 ? A PHE 132 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 O   ? I HOH .   ? A HOH 274 ? 1_555 89.1  ? 
34 OD1 ? A ASN 138 ? A ASN 138 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 O   ? I HOH .   ? A HOH 274 ? 1_555 85.5  ? 
35 OD2 ? A ASP 141 ? A ASP 141 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 O   ? I HOH .   ? A HOH 274 ? 1_555 173.5 ? 
36 O   ? I HOH .   ? A HOH 273 ? 1_555 CA ? F CA . ? A CA 272 ? 1_555 O   ? I HOH .   ? A HOH 274 ? 1_555 93.7  ? 
37 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 93.4  ? 
38 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 168.9 ? 
39 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 95.7  ? 
40 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 87.0  ? 
41 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 93.1  ? 
42 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 98.8  ? 
43 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 O   ? J HOH .   ? B HOH 275 ? 1_555 92.3  ? 
44 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 O   ? J HOH .   ? B HOH 275 ? 1_555 172.1 ? 
45 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 O   ? J HOH .   ? B HOH 275 ? 1_555 79.3  ? 
46 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 O   ? J HOH .   ? B HOH 275 ? 1_555 81.7  ? 
47 OE1 ? B GLU 128 ? B GLU 128 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 O   ? J HOH .   ? B HOH 276 ? 1_555 82.6  ? 
48 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 O   ? J HOH .   ? B HOH 276 ? 1_555 99.2  ? 
49 OD1 ? B ASP 141 ? B ASP 141 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 O   ? J HOH .   ? B HOH 276 ? 1_555 89.6  ? 
50 NE2 ? B HIS 146 ? B HIS 146 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 O   ? J HOH .   ? B HOH 276 ? 1_555 164.3 ? 
51 O   ? J HOH .   ? B HOH 275 ? 1_555 MN ? G MN . ? B MN 273 ? 1_555 O   ? J HOH .   ? B HOH 276 ? 1_555 86.9  ? 
52 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 54.1  ? 
53 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 O   ? B PHE 132 ? B PHE 132 ? 1_555 115.8 ? 
54 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 O   ? B PHE 132 ? B PHE 132 ? 1_555 79.8  ? 
55 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 159.4 ? 
56 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 145.6 ? 
57 O   ? B PHE 132 ? B PHE 132 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 80.7  ? 
58 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 77.5  ? 
59 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 119.7 ? 
60 O   ? B PHE 132 ? B PHE 132 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 93.7  ? 
61 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 89.6  ? 
62 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 O   ? J HOH .   ? B HOH 277 ? 1_555 77.6  ? 
63 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 O   ? J HOH .   ? B HOH 277 ? 1_555 112.0 ? 
64 O   ? B PHE 132 ? B PHE 132 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 O   ? J HOH .   ? B HOH 277 ? 1_555 166.3 ? 
65 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 O   ? J HOH .   ? B HOH 277 ? 1_555 85.6  ? 
66 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 O   ? J HOH .   ? B HOH 277 ? 1_555 86.4  ? 
67 OD1 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 O   ? J HOH .   ? B HOH 278 ? 1_555 112.0 ? 
68 OD2 ? B ASP 130 ? B ASP 130 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 O   ? J HOH .   ? B HOH 278 ? 1_555 72.0  ? 
69 O   ? B PHE 132 ? B PHE 132 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 O   ? J HOH .   ? B HOH 278 ? 1_555 88.3  ? 
70 OD1 ? B ASN 138 ? B ASN 138 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 O   ? J HOH .   ? B HOH 278 ? 1_555 79.3  ? 
71 OD2 ? B ASP 141 ? B ASP 141 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 O   ? J HOH .   ? B HOH 278 ? 1_555 168.3 ? 
72 O   ? J HOH .   ? B HOH 277 ? 1_555 CA ? H CA . ? B CA 274 ? 1_555 O   ? J HOH .   ? B HOH 278 ? 1_555 88.9  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2002-11-20 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Derived calculations'      
6 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' diffrn_source                 
4  4 'Structure model' entity                        
5  4 'Structure model' entity_name_com               
6  4 'Structure model' pdbx_branch_scheme            
7  4 'Structure model' pdbx_chem_comp_identifier     
8  4 'Structure model' pdbx_entity_branch            
9  4 'Structure model' pdbx_entity_branch_descriptor 
10 4 'Structure model' pdbx_entity_branch_link       
11 4 'Structure model' pdbx_entity_branch_list       
12 4 'Structure model' pdbx_entity_nonpoly           
13 4 'Structure model' pdbx_molecule_features        
14 4 'Structure model' pdbx_nonpoly_scheme           
15 4 'Structure model' pdbx_struct_assembly_gen      
16 4 'Structure model' pdbx_struct_conn_angle        
17 4 'Structure model' struct_asym                   
18 4 'Structure model' struct_conn                   
19 4 'Structure model' struct_conn_type              
20 4 'Structure model' struct_site                   
21 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  4 'Structure model' '_atom_site.Cartn_x'                          
3  4 'Structure model' '_atom_site.Cartn_y'                          
4  4 'Structure model' '_atom_site.Cartn_z'                          
5  4 'Structure model' '_atom_site.auth_asym_id'                     
6  4 'Structure model' '_atom_site.auth_atom_id'                     
7  4 'Structure model' '_atom_site.auth_comp_id'                     
8  4 'Structure model' '_atom_site.auth_seq_id'                      
9  4 'Structure model' '_atom_site.label_asym_id'                    
10 4 'Structure model' '_atom_site.label_atom_id'                    
11 4 'Structure model' '_atom_site.label_comp_id'                    
12 4 'Structure model' '_atom_site.label_entity_id'                  
13 4 'Structure model' '_atom_site.type_symbol'                      
14 4 'Structure model' '_chem_comp.name'                             
15 4 'Structure model' '_chem_comp.type'                             
16 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site'        
17 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_asym_id'  
19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
24 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
25 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_asym_id'  
26 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_comp_id'  
27 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id'   
28 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
29 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_atom_id' 
30 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_comp_id' 
31 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_asym_id'  
32 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
33 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
34 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
35 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
36 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
37 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
38 4 'Structure model' '_pdbx_struct_conn_angle.value'               
39 4 'Structure model' '_struct_conn.conn_type_id'                   
40 4 'Structure model' '_struct_conn.id'                             
41 4 'Structure model' '_struct_conn.pdbx_dist_value'                
42 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
43 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
44 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
45 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
46 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
47 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
48 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
49 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
50 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
51 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
52 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
53 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
54 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
55 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
56 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
57 4 'Structure model' '_struct_conn_type.id'                        
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
AMoRE     phasing          .   ? 3 
CNS       refinement       1.0 ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 45  ? ? 48.25   71.15  
2 1 ASN A 138 ? ? -114.63 57.63  
3 1 ASN A 152 ? ? 59.74   14.19  
4 1 LEU B 108 ? ? 53.33   17.38  
5 1 TYR B 144 ? ? 178.67  156.90 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 1  ? NE2 ? A GLN 1  NE2 
2  1 Y 1 A LYS 35 ? CE  ? A LYS 35 CE  
3  1 Y 1 A LYS 35 ? NZ  ? A LYS 35 NZ  
4  1 Y 1 A LYS 78 ? CG  ? A LYS 78 CG  
5  1 Y 1 A LYS 78 ? CD  ? A LYS 78 CD  
6  1 Y 1 A LYS 78 ? CE  ? A LYS 78 CE  
7  1 Y 1 A LYS 78 ? NZ  ? A LYS 78 NZ  
8  1 Y 1 B GLN 1  ? NE2 ? B GLN 1  NE2 
9  1 Y 1 B LYS 35 ? CE  ? B LYS 35 CE  
10 1 Y 1 B LYS 35 ? NZ  ? B LYS 35 NZ  
11 1 Y 1 B LYS 78 ? NZ  ? B LYS 78 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLN 242 ? A GLN 242 
2  1 Y 1 A LYS 243 ? A LYS 243 
3  1 Y 1 A LYS 244 ? A LYS 244 
4  1 Y 1 A GLY 245 ? A GLY 245 
5  1 Y 1 A GLU 246 ? A GLU 246 
6  1 Y 1 A ASN 247 ? A ASN 247 
7  1 Y 1 A LEU 248 ? A LEU 248 
8  1 Y 1 A ALA 249 ? A ALA 249 
9  1 Y 1 A LEU 250 ? A LEU 250 
10 1 Y 1 A GLU 251 ? A GLU 251 
11 1 Y 1 A MET 252 ? A MET 252 
12 1 Y 1 B GLN 242 ? B GLN 242 
13 1 Y 1 B LYS 243 ? B LYS 243 
14 1 Y 1 B LYS 244 ? B LYS 244 
15 1 Y 1 B GLY 245 ? B GLY 245 
16 1 Y 1 B GLU 246 ? B GLU 246 
17 1 Y 1 B ASN 247 ? B ASN 247 
18 1 Y 1 B LEU 248 ? B LEU 248 
19 1 Y 1 B ALA 249 ? B ALA 249 
20 1 Y 1 B LEU 250 ? B LEU 250 
21 1 Y 1 B GLU 251 ? B GLU 251 
22 1 Y 1 B MET 252 ? B MET 252 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 FRU 1 C FRU 1 S FRU 2   n 
C 2 GLC 2 C GLC 2 S GLC 1   n 
D 3 BDF 1 D BDF 1 S FBP 102 n 
D 3 GLC 2 D GLC 2 S GLC 101 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BDF 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DFrupb             
BDF 'COMMON NAME'                         GMML     1.0 b-D-fructopyranose 
BDF 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Frup           
BDF 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fru                
FRU 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DFrufb             
FRU 'COMMON NAME'                         GMML     1.0 b-D-fructofuranose 
FRU 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Fruf           
FRU 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fru                
GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpa             
GLC 'COMMON NAME'                         GMML     1.0 a-D-glucopyranose  
GLC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Glcp           
GLC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc                
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
2 oligosaccharide 
3 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 DGlcpa1-3DFrufb2-                                          'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,2,1/[ha122h-2b_2-5][a2122h-1a_1-5]/1-2/a3-b1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[][b-D-Fruf]{[(3+1)][a-D-Glcp]{}}'                        LINUCS                      PDB-CARE   ?     
4 3 DGlcpa1-3DFrupb2-                                          'Glycam Condensed Sequence' GMML       1.0   
5 3 'WURCS=2.0/2,2,1/[ha122h-2b_2-6][a2122h-1a_1-5]/1-2/a3-b1' WURCS                       PDB2Glycan 1.1.0 
6 3 '[][b-D-Frup]{[(3+1)][a-D-Glcp]{}}'                        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 GLC C1 O1 1 FRU O3 HO3 sing ? 
2 3 2 GLC C1 O1 1 BDF O3 HO3 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 FRU 1 n 
2 GLC 2 n 
3 BDF 1 n 
3 GLC 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MANGANESE (II) ION' MN  
5 'CALCIUM ION'        CA  
6 water                HOH 
#