data_1N6U
# 
_entry.id   1N6U 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1N6U         
RCSB  RCSB017591   
WWPDB D_1000017591 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1N6U 
_pdbx_database_status.recvd_initial_deposition_date   2002-11-12 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chill, J.H.'   1 
'Quadt, S.R.'   2 
'Levy, R.'      3 
'Schreiber, G.' 4 
'Anglister, J.' 5 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The human type I interferon receptor. NMR structure reveals the molecular basis of ligand binding.' Structure    11 791  
802  2003 STRUE6 UK 0969-2126 2005 ? 12842042 '10.1016/S0969-2126(03)00120-5' 
1       
'The human interferon receptor: NMR-based modeling, mapping of the IFN-alpha2 binding site, and observed ligand-induced tightening' 
Biochemistry 41 3575 3585 2002 BICHAW US 0006-2960 0033 ? ?        10.1021/bi011778f               
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chill, J.H.'   1  
primary 'Quadt, S.R.'   2  
primary 'Levy, R.'      3  
primary 'Schreiber, G.' 4  
primary 'Anglister, J.' 5  
1       'Chill, J.H.'   6  
1       'Nivasch, R.'   7  
1       'Levy, R.'      8  
1       'Albeck, S.'    9  
1       'Schreiber, G.' 10 
1       'Anglister, J.' 11 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'Interferon-alpha/beta receptor beta chain' 
_entity.formula_weight             24323.438 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IFN-alpha-REC, Type I interferon receptor, IFN-R, Interferon alpha/beta receptor- 2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYV
TVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKG
NMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESEFS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYV
TVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKG
NMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESEFS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   TYR n 
1 3   ASP n 
1 4   SER n 
1 5   PRO n 
1 6   ASP n 
1 7   TYR n 
1 8   THR n 
1 9   ASP n 
1 10  GLU n 
1 11  SER n 
1 12  CYS n 
1 13  THR n 
1 14  PHE n 
1 15  LYS n 
1 16  ILE n 
1 17  SER n 
1 18  LEU n 
1 19  ARG n 
1 20  ASN n 
1 21  PHE n 
1 22  ARG n 
1 23  SER n 
1 24  ILE n 
1 25  LEU n 
1 26  SER n 
1 27  TRP n 
1 28  GLU n 
1 29  LEU n 
1 30  LYS n 
1 31  ASN n 
1 32  HIS n 
1 33  SER n 
1 34  ILE n 
1 35  VAL n 
1 36  PRO n 
1 37  THR n 
1 38  HIS n 
1 39  TYR n 
1 40  THR n 
1 41  LEU n 
1 42  LEU n 
1 43  TYR n 
1 44  THR n 
1 45  ILE n 
1 46  MET n 
1 47  SER n 
1 48  LYS n 
1 49  PRO n 
1 50  GLU n 
1 51  ASP n 
1 52  LEU n 
1 53  LYS n 
1 54  VAL n 
1 55  VAL n 
1 56  LYS n 
1 57  ASN n 
1 58  CYS n 
1 59  ALA n 
1 60  ASN n 
1 61  THR n 
1 62  THR n 
1 63  ARG n 
1 64  SER n 
1 65  PHE n 
1 66  CYS n 
1 67  ASP n 
1 68  LEU n 
1 69  THR n 
1 70  ASP n 
1 71  GLU n 
1 72  TRP n 
1 73  ARG n 
1 74  SER n 
1 75  THR n 
1 76  HIS n 
1 77  GLU n 
1 78  ALA n 
1 79  TYR n 
1 80  VAL n 
1 81  THR n 
1 82  VAL n 
1 83  LEU n 
1 84  GLU n 
1 85  GLY n 
1 86  PHE n 
1 87  SER n 
1 88  GLY n 
1 89  ASN n 
1 90  THR n 
1 91  THR n 
1 92  LEU n 
1 93  PHE n 
1 94  SER n 
1 95  CYS n 
1 96  SER n 
1 97  HIS n 
1 98  ASN n 
1 99  PHE n 
1 100 TRP n 
1 101 LEU n 
1 102 ALA n 
1 103 ILE n 
1 104 ASP n 
1 105 MET n 
1 106 SER n 
1 107 PHE n 
1 108 GLU n 
1 109 PRO n 
1 110 PRO n 
1 111 GLU n 
1 112 PHE n 
1 113 GLU n 
1 114 ILE n 
1 115 VAL n 
1 116 GLY n 
1 117 PHE n 
1 118 THR n 
1 119 ASN n 
1 120 HIS n 
1 121 ILE n 
1 122 ASN n 
1 123 VAL n 
1 124 MET n 
1 125 VAL n 
1 126 LYS n 
1 127 PHE n 
1 128 PRO n 
1 129 SER n 
1 130 ILE n 
1 131 VAL n 
1 132 GLU n 
1 133 GLU n 
1 134 GLU n 
1 135 LEU n 
1 136 GLN n 
1 137 PHE n 
1 138 ASP n 
1 139 LEU n 
1 140 SER n 
1 141 LEU n 
1 142 VAL n 
1 143 ILE n 
1 144 GLU n 
1 145 GLU n 
1 146 GLN n 
1 147 SER n 
1 148 GLU n 
1 149 GLY n 
1 150 ILE n 
1 151 VAL n 
1 152 LYS n 
1 153 LYS n 
1 154 HIS n 
1 155 LYS n 
1 156 PRO n 
1 157 GLU n 
1 158 ILE n 
1 159 LYS n 
1 160 GLY n 
1 161 ASN n 
1 162 MET n 
1 163 SER n 
1 164 GLY n 
1 165 ASN n 
1 166 PHE n 
1 167 THR n 
1 168 TYR n 
1 169 ILE n 
1 170 ILE n 
1 171 ASP n 
1 172 LYS n 
1 173 LEU n 
1 174 ILE n 
1 175 PRO n 
1 176 ASN n 
1 177 THR n 
1 178 ASN n 
1 179 TYR n 
1 180 CYS n 
1 181 VAL n 
1 182 SER n 
1 183 VAL n 
1 184 TYR n 
1 185 LEU n 
1 186 GLU n 
1 187 HIS n 
1 188 SER n 
1 189 ASP n 
1 190 GLU n 
1 191 GLN n 
1 192 ALA n 
1 193 VAL n 
1 194 ILE n 
1 195 LYS n 
1 196 SER n 
1 197 PRO n 
1 198 LEU n 
1 199 LYS n 
1 200 CYS n 
1 201 THR n 
1 202 LEU n 
1 203 LEU n 
1 204 PRO n 
1 205 PRO n 
1 206 GLY n 
1 207 GLN n 
1 208 GLU n 
1 209 SER n 
1 210 GLU n 
1 211 PHE n 
1 212 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'IFNAR2 OR IFNARB' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               TG1 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    INAR2_HUMAN 
_struct_ref.pdbx_db_accession          P48551 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SYDSPDYTDESCTFKISLRNFRSILSWELKNHSIVPTHYTLLYTIMSKPEDLKVVKNCANTTRSFCDLTDEWRSTHEAYV
TVLEGFSGNTTLFSCSHNFWLAIDMSFEPPEFEIVGFTNHINVMVKFPSIVEEELQFDLSLVIEEQSEGIVKKHKPEIKG
NMSGNFTYIIDKLIPNTNYCVSVYLEHSDEQAVIKSPLKCTLLPPGQESE
;
_struct_ref.pdbx_align_begin           28 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1N6U 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 210 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P48551 
_struct_ref_seq.db_align_beg                  28 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  237 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       210 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1N6U PHE A 211 ? UNP P48551 ? ? 'CLONING ARTIFACT' 211 1 
1 1N6U SER A 212 ? UNP P48551 ? ? 'CLONING ARTIFACT' 212 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 3D_15N-separated_NOESY 
2 1 1 HNHA                   
3 2 2 HNCA                   
4 2 2 HNCACB                 
5 2 2 CBCACONH               
6 3 3 3D_13C-separated_NOESY 
# 
loop_
_pdbx_nmr_exptl_sample_conditions.conditions_id 
_pdbx_nmr_exptl_sample_conditions.temperature 
_pdbx_nmr_exptl_sample_conditions.pressure 
_pdbx_nmr_exptl_sample_conditions.pH 
_pdbx_nmr_exptl_sample_conditions.ionic_strength 
_pdbx_nmr_exptl_sample_conditions.pressure_units 
_pdbx_nmr_exptl_sample_conditions.temperature_units 
1 308 ambient 8 '20mM Tris' ? K 
2 308 ambient 8 '20mM Tris' ? K 
3 305 ambient 8 '20mM Tris' ? K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '0.5mM IFNAR2-EC U-15N; 20mM d-Tris pH 8, 0.02% NaN3;'      '95% H2O/5% D2O' 
2 '0.35mM IFNAR2-EC U-15N,13C; 20mM d-Tris pH 8, 0.02% NaN3;' '95% H2O/5% D2O' 
3 '0.35mM IFNAR2-EC U-15N,13C; 20mM d-Tris pH 8, 0.02% NaN3;' '99% D2O'        
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.type 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.field_strength 
1 ? Bruker DRX 800 
2 ? Bruker DMX 500 
# 
_pdbx_nmr_refine.entry_id           1N6U 
_pdbx_nmr_refine.method             'distance geometry, simulated annealing' 
_pdbx_nmr_refine.details            
;the structures are based on a total of 1947 inter-residual 
NOE-derived distance restraints (of which 1066 are long range), 
172 dihedral angle restraints (88 experimental and 84 TALOS-derived), 
138 distance restraints from hydrogen bonds, and 109 residual 
dipolar coupling restraints.
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1N6U 
_pdbx_nmr_details.text       'Experiments all performed in Shigemi tubed equipped with inserts' 
# 
_pdbx_nmr_ensemble.entry_id                                      1N6U 
_pdbx_nmr_ensemble.conformers_calculated_total_number            35 
_pdbx_nmr_ensemble.conformers_submitted_total_number             22 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1N6U 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
XWINNMR 3.0 processing           Neidig   1 
CNS     1.1 'structure solution' Brunger  2 
NMRPipe 2.1 'data analysis'      Delaglio 3 
CNS     1.1 refinement           Brunger  4 
# 
_exptl.entry_id          1N6U 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1N6U 
_struct.title                     'NMR structure of the interferon-binding ectodomain of the human interferon receptor' 
_struct.pdbx_descriptor           'Interferon-alpha/beta receptor beta chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1N6U 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'immunoglobulin fold, fibronectin fold, two-domain structure, IMMUNE SYSTEM' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LYS A 56  ? ALA A 59  ? LYS A 56  ALA A 59  5 ? 4 
HELX_P HELX_P2 2 TRP A 100 ? MET A 105 ? TRP A 100 MET A 105 1 ? 6 
HELX_P HELX_P3 3 VAL A 131 ? LEU A 135 ? VAL A 131 LEU A 135 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 12  SG ? ? ? 1_555 A CYS 95  SG ? ? A CYS 12  A CYS 95  1_555 ? ? ? ? ? ? ? 2.033 ? 
disulf2 disulf ? ? A CYS 58  SG ? ? ? 1_555 A CYS 66  SG ? ? A CYS 58  A CYS 66  1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf3 disulf ? ? A CYS 180 SG ? ? ? 1_555 A CYS 200 SG ? ? A CYS 180 A CYS 200 1_555 ? ? ? ? ? ? ? 2.037 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 3 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 16  ? ARG A 19  ? ILE A 16  ARG A 19  
A 2 ARG A 22  ? LEU A 25  ? ARG A 22  LEU A 25  
A 3 CYS A 66  ? LEU A 68  ? CYS A 66  LEU A 68  
B 1 LYS A 48  ? VAL A 54  ? LYS A 48  VAL A 54  
B 2 TYR A 39  ? ILE A 45  ? TYR A 39  ILE A 45  
B 3 TYR A 79  ? GLY A 85  ? TYR A 79  GLY A 85  
B 4 CYS A 95  ? PHE A 99  ? CYS A 95  PHE A 99  
C 1 GLU A 111 ? GLY A 116 ? GLU A 111 GLY A 116 
C 2 ILE A 121 ? LYS A 126 ? ILE A 121 LYS A 126 
C 3 ASN A 165 ? TYR A 168 ? ASN A 165 TYR A 168 
D 1 SER A 140 ? SER A 147 ? SER A 140 SER A 147 
D 2 TYR A 179 ? GLU A 186 ? TYR A 179 GLU A 186 
D 3 CYS A 200 ? THR A 201 ? CYS A 200 THR A 201 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 17  ? N SER A 17  O ILE A 24  ? O ILE A 24  
A 2 3 N SER A 23  ? N SER A 23  O LEU A 68  ? O LEU A 68  
B 1 2 O LYS A 48  ? O LYS A 48  N ILE A 45  ? N ILE A 45  
B 2 3 N LEU A 42  ? N LEU A 42  O VAL A 82  ? O VAL A 82  
B 3 4 N THR A 81  ? N THR A 81  O HIS A 97  ? O HIS A 97  
C 1 2 N VAL A 115 ? N VAL A 115 O ASN A 122 ? O ASN A 122 
C 2 3 N VAL A 123 ? N VAL A 123 O TYR A 168 ? O TYR A 168 
D 1 2 N VAL A 142 ? N VAL A 142 O TYR A 184 ? O TYR A 184 
D 2 3 N TYR A 179 ? N TYR A 179 O THR A 201 ? O THR A 201 
# 
_database_PDB_matrix.entry_id          1N6U 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1N6U 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . SER A 1 1   ? -11.305 -35.585 1.309   1.00 0.00 ? 1   SER A N    1  
ATOM 2     C CA   . SER A 1 1   ? -10.540 -35.212 2.527   1.00 0.00 ? 1   SER A CA   1  
ATOM 3     C C    . SER A 1 1   ? -11.146 -33.987 3.205   1.00 0.00 ? 1   SER A C    1  
ATOM 4     O O    . SER A 1 1   ? -11.794 -33.164 2.558   1.00 0.00 ? 1   SER A O    1  
ATOM 5     C CB   . SER A 1 1   ? -9.091  -34.930 2.125   1.00 0.00 ? 1   SER A CB   1  
ATOM 6     O OG   . SER A 1 1   ? -8.273  -34.740 3.266   1.00 0.00 ? 1   SER A OG   1  
ATOM 7     H H1   . SER A 1 1   ? -11.046 -34.919 0.555   1.00 0.00 ? 1   SER A H1   1  
ATOM 8     H H2   . SER A 1 1   ? -12.318 -35.518 1.538   1.00 0.00 ? 1   SER A H2   1  
ATOM 9     H H3   . SER A 1 1   ? -11.042 -36.558 1.055   1.00 0.00 ? 1   SER A H3   1  
ATOM 10    H HA   . SER A 1 1   ? -10.563 -36.043 3.216   1.00 0.00 ? 1   SER A HA   1  
ATOM 11    H HB2  . SER A 1 1   ? -8.708  -35.765 1.558   1.00 0.00 ? 1   SER A HB2  1  
ATOM 12    H HB3  . SER A 1 1   ? -9.056  -34.036 1.519   1.00 0.00 ? 1   SER A HB3  1  
ATOM 13    H HG   . SER A 1 1   ? -8.184  -35.571 3.739   1.00 0.00 ? 1   SER A HG   1  
ATOM 14    N N    . TYR A 1 2   ? -10.932 -33.873 4.511   1.00 0.00 ? 2   TYR A N    1  
ATOM 15    C CA   . TYR A 1 2   ? -11.457 -32.748 5.277   1.00 0.00 ? 2   TYR A CA   1  
ATOM 16    C C    . TYR A 1 2   ? -12.980 -32.708 5.210   1.00 0.00 ? 2   TYR A C    1  
ATOM 17    O O    . TYR A 1 2   ? -13.594 -33.388 4.387   1.00 0.00 ? 2   TYR A O    1  
ATOM 18    C CB   . TYR A 1 2   ? -10.876 -31.433 4.753   1.00 0.00 ? 2   TYR A CB   1  
ATOM 19    C CG   . TYR A 1 2   ? -9.634  -30.983 5.489   1.00 0.00 ? 2   TYR A CG   1  
ATOM 20    C CD1  . TYR A 1 2   ? -8.373  -31.403 5.083   1.00 0.00 ? 2   TYR A CD1  1  
ATOM 21    C CD2  . TYR A 1 2   ? -9.722  -30.139 6.589   1.00 0.00 ? 2   TYR A CD2  1  
ATOM 22    C CE1  . TYR A 1 2   ? -7.236  -30.994 5.753   1.00 0.00 ? 2   TYR A CE1  1  
ATOM 23    C CE2  . TYR A 1 2   ? -8.589  -29.726 7.264   1.00 0.00 ? 2   TYR A CE2  1  
ATOM 24    C CZ   . TYR A 1 2   ? -7.349  -30.156 6.842   1.00 0.00 ? 2   TYR A CZ   1  
ATOM 25    O OH   . TYR A 1 2   ? -6.218  -29.746 7.512   1.00 0.00 ? 2   TYR A OH   1  
ATOM 26    H H    . TYR A 1 2   ? -10.408 -34.561 4.972   1.00 0.00 ? 2   TYR A H    1  
ATOM 27    H HA   . TYR A 1 2   ? -11.157 -32.879 6.306   1.00 0.00 ? 2   TYR A HA   1  
ATOM 28    H HB2  . TYR A 1 2   ? -10.619 -31.550 3.711   1.00 0.00 ? 2   TYR A HB2  1  
ATOM 29    H HB3  . TYR A 1 2   ? -11.620 -30.655 4.850   1.00 0.00 ? 2   TYR A HB3  1  
ATOM 30    H HD1  . TYR A 1 2   ? -8.288  -32.059 4.230   1.00 0.00 ? 2   TYR A HD1  1  
ATOM 31    H HD2  . TYR A 1 2   ? -10.695 -29.804 6.917   1.00 0.00 ? 2   TYR A HD2  1  
ATOM 32    H HE1  . TYR A 1 2   ? -6.264  -31.331 5.423   1.00 0.00 ? 2   TYR A HE1  1  
ATOM 33    H HE2  . TYR A 1 2   ? -8.678  -29.069 8.117   1.00 0.00 ? 2   TYR A HE2  1  
ATOM 34    H HH   . TYR A 1 2   ? -5.940  -28.891 7.177   1.00 0.00 ? 2   TYR A HH   1  
ATOM 35    N N    . ASP A 1 3   ? -13.585 -31.906 6.081   1.00 0.00 ? 3   ASP A N    1  
ATOM 36    C CA   . ASP A 1 3   ? -15.037 -31.776 6.121   1.00 0.00 ? 3   ASP A CA   1  
ATOM 37    C C    . ASP A 1 3   ? -15.452 -30.310 6.065   1.00 0.00 ? 3   ASP A C    1  
ATOM 38    O O    . ASP A 1 3   ? -15.634 -29.666 7.098   1.00 0.00 ? 3   ASP A O    1  
ATOM 39    C CB   . ASP A 1 3   ? -15.593 -32.428 7.388   1.00 0.00 ? 3   ASP A CB   1  
ATOM 40    C CG   . ASP A 1 3   ? -14.989 -31.847 8.651   1.00 0.00 ? 3   ASP A CG   1  
ATOM 41    O OD1  . ASP A 1 3   ? -13.844 -32.215 8.985   1.00 0.00 ? 3   ASP A OD1  1  
ATOM 42    O OD2  . ASP A 1 3   ? -15.662 -31.023 9.306   1.00 0.00 ? 3   ASP A OD2  1  
ATOM 43    H H    . ASP A 1 3   ? -13.041 -31.390 6.712   1.00 0.00 ? 3   ASP A H    1  
ATOM 44    H HA   . ASP A 1 3   ? -15.439 -32.285 5.258   1.00 0.00 ? 3   ASP A HA   1  
ATOM 45    H HB2  . ASP A 1 3   ? -16.662 -32.280 7.422   1.00 0.00 ? 3   ASP A HB2  1  
ATOM 46    H HB3  . ASP A 1 3   ? -15.381 -33.487 7.363   1.00 0.00 ? 3   ASP A HB3  1  
ATOM 47    N N    . SER A 1 4   ? -15.600 -29.788 4.851   1.00 0.00 ? 4   SER A N    1  
ATOM 48    C CA   . SER A 1 4   ? -15.994 -28.397 4.660   1.00 0.00 ? 4   SER A CA   1  
ATOM 49    C C    . SER A 1 4   ? -16.176 -28.081 3.177   1.00 0.00 ? 4   SER A C    1  
ATOM 50    O O    . SER A 1 4   ? -15.218 -27.729 2.489   1.00 0.00 ? 4   SER A O    1  
ATOM 51    C CB   . SER A 1 4   ? -14.945 -27.462 5.266   1.00 0.00 ? 4   SER A CB   1  
ATOM 52    O OG   . SER A 1 4   ? -15.509 -26.201 5.584   1.00 0.00 ? 4   SER A OG   1  
ATOM 53    H H    . SER A 1 4   ? -15.440 -30.352 4.066   1.00 0.00 ? 4   SER A H    1  
ATOM 54    H HA   . SER A 1 4   ? -16.934 -28.246 5.169   1.00 0.00 ? 4   SER A HA   1  
ATOM 55    H HB2  . SER A 1 4   ? -14.551 -27.904 6.170   1.00 0.00 ? 4   SER A HB2  1  
ATOM 56    H HB3  . SER A 1 4   ? -14.144 -27.316 4.558   1.00 0.00 ? 4   SER A HB3  1  
ATOM 57    H HG   . SER A 1 4   ? -15.024 -25.510 5.128   1.00 0.00 ? 4   SER A HG   1  
ATOM 58    N N    . PRO A 1 5   ? -17.412 -28.203 2.662   1.00 0.00 ? 5   PRO A N    1  
ATOM 59    C CA   . PRO A 1 5   ? -17.709 -27.927 1.252   1.00 0.00 ? 5   PRO A CA   1  
ATOM 60    C C    . PRO A 1 5   ? -17.560 -26.448 0.909   1.00 0.00 ? 5   PRO A C    1  
ATOM 61    O O    . PRO A 1 5   ? -17.155 -26.096 -0.198  1.00 0.00 ? 5   PRO A O    1  
ATOM 62    C CB   . PRO A 1 5   ? -19.167 -28.367 1.098   1.00 0.00 ? 5   PRO A CB   1  
ATOM 63    C CG   . PRO A 1 5   ? -19.739 -28.279 2.470   1.00 0.00 ? 5   PRO A CG   1  
ATOM 64    C CD   . PRO A 1 5   ? -18.615 -28.616 3.409   1.00 0.00 ? 5   PRO A CD   1  
ATOM 65    H HA   . PRO A 1 5   ? -17.082 -28.511 0.595   1.00 0.00 ? 5   PRO A HA   1  
ATOM 66    H HB2  . PRO A 1 5   ? -19.676 -27.703 0.414   1.00 0.00 ? 5   PRO A HB2  1  
ATOM 67    H HB3  . PRO A 1 5   ? -19.203 -29.378 0.721   1.00 0.00 ? 5   PRO A HB3  1  
ATOM 68    H HG2  . PRO A 1 5   ? -20.095 -27.277 2.656   1.00 0.00 ? 5   PRO A HG2  1  
ATOM 69    H HG3  . PRO A 1 5   ? -20.544 -28.991 2.579   1.00 0.00 ? 5   PRO A HG3  1  
ATOM 70    H HD2  . PRO A 1 5   ? -18.710 -28.056 4.328   1.00 0.00 ? 5   PRO A HD2  1  
ATOM 71    H HD3  . PRO A 1 5   ? -18.597 -29.677 3.612   1.00 0.00 ? 5   PRO A HD3  1  
ATOM 72    N N    . ASP A 1 6   ? -17.889 -25.588 1.867   1.00 0.00 ? 6   ASP A N    1  
ATOM 73    C CA   . ASP A 1 6   ? -17.791 -24.147 1.666   1.00 0.00 ? 6   ASP A CA   1  
ATOM 74    C C    . ASP A 1 6   ? -16.539 -23.588 2.334   1.00 0.00 ? 6   ASP A C    1  
ATOM 75    O O    . ASP A 1 6   ? -16.460 -23.511 3.560   1.00 0.00 ? 6   ASP A O    1  
ATOM 76    C CB   . ASP A 1 6   ? -19.034 -23.448 2.220   1.00 0.00 ? 6   ASP A CB   1  
ATOM 77    C CG   . ASP A 1 6   ? -20.267 -23.706 1.377   1.00 0.00 ? 6   ASP A CG   1  
ATOM 78    O OD1  . ASP A 1 6   ? -20.686 -24.879 1.280   1.00 0.00 ? 6   ASP A OD1  1  
ATOM 79    O OD2  . ASP A 1 6   ? -20.814 -22.736 0.812   1.00 0.00 ? 6   ASP A OD2  1  
ATOM 80    H H    . ASP A 1 6   ? -18.205 -25.930 2.729   1.00 0.00 ? 6   ASP A H    1  
ATOM 81    H HA   . ASP A 1 6   ? -17.730 -23.964 0.604   1.00 0.00 ? 6   ASP A HA   1  
ATOM 82    H HB2  . ASP A 1 6   ? -19.225 -23.806 3.221   1.00 0.00 ? 6   ASP A HB2  1  
ATOM 83    H HB3  . ASP A 1 6   ? -18.857 -22.383 2.251   1.00 0.00 ? 6   ASP A HB3  1  
ATOM 84    N N    . TYR A 1 7   ? -15.563 -23.200 1.520   1.00 0.00 ? 7   TYR A N    1  
ATOM 85    C CA   . TYR A 1 7   ? -14.315 -22.647 2.033   1.00 0.00 ? 7   TYR A CA   1  
ATOM 86    C C    . TYR A 1 7   ? -14.288 -21.130 1.876   1.00 0.00 ? 7   TYR A C    1  
ATOM 87    O O    . TYR A 1 7   ? -13.803 -20.414 2.752   1.00 0.00 ? 7   TYR A O    1  
ATOM 88    C CB   . TYR A 1 7   ? -13.120 -23.269 1.307   1.00 0.00 ? 7   TYR A CB   1  
ATOM 89    C CG   . TYR A 1 7   ? -13.256 -23.270 -0.199  1.00 0.00 ? 7   TYR A CG   1  
ATOM 90    C CD1  . TYR A 1 7   ? -13.907 -24.307 -0.856  1.00 0.00 ? 7   TYR A CD1  1  
ATOM 91    C CD2  . TYR A 1 7   ? -12.734 -22.235 -0.964  1.00 0.00 ? 7   TYR A CD2  1  
ATOM 92    C CE1  . TYR A 1 7   ? -14.033 -24.312 -2.233  1.00 0.00 ? 7   TYR A CE1  1  
ATOM 93    C CE2  . TYR A 1 7   ? -12.857 -22.232 -2.340  1.00 0.00 ? 7   TYR A CE2  1  
ATOM 94    C CZ   . TYR A 1 7   ? -13.506 -23.273 -2.970  1.00 0.00 ? 7   TYR A CZ   1  
ATOM 95    O OH   . TYR A 1 7   ? -13.630 -23.273 -4.340  1.00 0.00 ? 7   TYR A OH   1  
ATOM 96    H H    . TYR A 1 7   ? -15.686 -23.286 0.552   1.00 0.00 ? 7   TYR A H    1  
ATOM 97    H HA   . TYR A 1 7   ? -14.252 -22.889 3.083   1.00 0.00 ? 7   TYR A HA   1  
ATOM 98    H HB2  . TYR A 1 7   ? -12.227 -22.716 1.557   1.00 0.00 ? 7   TYR A HB2  1  
ATOM 99    H HB3  . TYR A 1 7   ? -13.005 -24.293 1.631   1.00 0.00 ? 7   TYR A HB3  1  
ATOM 100   H HD1  . TYR A 1 7   ? -14.318 -25.120 -0.276  1.00 0.00 ? 7   TYR A HD1  1  
ATOM 101   H HD2  . TYR A 1 7   ? -12.225 -21.421 -0.468  1.00 0.00 ? 7   TYR A HD2  1  
ATOM 102   H HE1  . TYR A 1 7   ? -14.542 -25.127 -2.725  1.00 0.00 ? 7   TYR A HE1  1  
ATOM 103   H HE2  . TYR A 1 7   ? -12.444 -21.418 -2.917  1.00 0.00 ? 7   TYR A HE2  1  
ATOM 104   H HH   . TYR A 1 7   ? -13.290 -24.099 -4.692  1.00 0.00 ? 7   TYR A HH   1  
ATOM 105   N N    . THR A 1 8   ? -14.815 -20.648 0.755   1.00 0.00 ? 8   THR A N    1  
ATOM 106   C CA   . THR A 1 8   ? -14.856 -19.216 0.482   1.00 0.00 ? 8   THR A CA   1  
ATOM 107   C C    . THR A 1 8   ? -16.186 -18.827 -0.154  1.00 0.00 ? 8   THR A C    1  
ATOM 108   O O    . THR A 1 8   ? -16.839 -19.647 -0.798  1.00 0.00 ? 8   THR A O    1  
ATOM 109   C CB   . THR A 1 8   ? -13.701 -18.816 -0.436  1.00 0.00 ? 8   THR A CB   1  
ATOM 110   O OG1  . THR A 1 8   ? -13.605 -19.702 -1.537  1.00 0.00 ? 8   THR A OG1  1  
ATOM 111   C CG2  . THR A 1 8   ? -12.358 -18.803 0.261   1.00 0.00 ? 8   THR A CG2  1  
ATOM 112   H H    . THR A 1 8   ? -15.187 -21.270 0.096   1.00 0.00 ? 8   THR A H    1  
ATOM 113   H HA   . THR A 1 8   ? -14.754 -18.696 1.423   1.00 0.00 ? 8   THR A HA   1  
ATOM 114   H HB   . THR A 1 8   ? -13.885 -17.821 -0.817  1.00 0.00 ? 8   THR A HB   1  
ATOM 115   H HG1  . THR A 1 8   ? -14.479 -19.850 -1.906  1.00 0.00 ? 8   THR A HG1  1  
ATOM 116   H HG21 . THR A 1 8   ? -12.374 -18.077 1.061   1.00 0.00 ? 8   THR A HG21 1  
ATOM 117   H HG22 . THR A 1 8   ? -11.586 -18.541 -0.448  1.00 0.00 ? 8   THR A HG22 1  
ATOM 118   H HG23 . THR A 1 8   ? -12.155 -19.782 0.669   1.00 0.00 ? 8   THR A HG23 1  
ATOM 119   N N    . ASP A 1 9   ? -16.583 -17.572 0.030   1.00 0.00 ? 9   ASP A N    1  
ATOM 120   C CA   . ASP A 1 9   ? -17.838 -17.084 -0.529  1.00 0.00 ? 9   ASP A CA   1  
ATOM 121   C C    . ASP A 1 9   ? -17.866 -15.560 -0.577  1.00 0.00 ? 9   ASP A C    1  
ATOM 122   O O    . ASP A 1 9   ? -18.057 -14.898 0.443   1.00 0.00 ? 9   ASP A O    1  
ATOM 123   C CB   . ASP A 1 9   ? -19.021 -17.600 0.293   1.00 0.00 ? 9   ASP A CB   1  
ATOM 124   C CG   . ASP A 1 9   ? -20.345 -17.420 -0.424  1.00 0.00 ? 9   ASP A CG   1  
ATOM 125   O OD1  . ASP A 1 9   ? -20.358 -17.488 -1.671  1.00 0.00 ? 9   ASP A OD1  1  
ATOM 126   O OD2  . ASP A 1 9   ? -21.368 -17.213 0.262   1.00 0.00 ? 9   ASP A OD2  1  
ATOM 127   H H    . ASP A 1 9   ? -16.022 -16.963 0.554   1.00 0.00 ? 9   ASP A H    1  
ATOM 128   H HA   . ASP A 1 9   ? -17.921 -17.465 -1.535  1.00 0.00 ? 9   ASP A HA   1  
ATOM 129   H HB2  . ASP A 1 9   ? -18.881 -18.651 0.494   1.00 0.00 ? 9   ASP A HB2  1  
ATOM 130   H HB3  . ASP A 1 9   ? -19.063 -17.061 1.229   1.00 0.00 ? 9   ASP A HB3  1  
ATOM 131   N N    . GLU A 1 10  ? -17.684 -15.011 -1.774  1.00 0.00 ? 10  GLU A N    1  
ATOM 132   C CA   . GLU A 1 10  ? -17.698 -13.565 -1.966  1.00 0.00 ? 10  GLU A CA   1  
ATOM 133   C C    . GLU A 1 10  ? -16.582 -12.884 -1.178  1.00 0.00 ? 10  GLU A C    1  
ATOM 134   O O    . GLU A 1 10  ? -16.743 -12.579 0.003   1.00 0.00 ? 10  GLU A O    1  
ATOM 135   C CB   . GLU A 1 10  ? -19.052 -12.989 -1.547  1.00 0.00 ? 10  GLU A CB   1  
ATOM 136   C CG   . GLU A 1 10  ? -20.101 -13.038 -2.646  1.00 0.00 ? 10  GLU A CG   1  
ATOM 137   C CD   . GLU A 1 10  ? -21.169 -11.974 -2.479  1.00 0.00 ? 10  GLU A CD   1  
ATOM 138   O OE1  . GLU A 1 10  ? -22.091 -12.181 -1.663  1.00 0.00 ? 10  GLU A OE1  1  
ATOM 139   O OE2  . GLU A 1 10  ? -21.083 -10.934 -3.166  1.00 0.00 ? 10  GLU A OE2  1  
ATOM 140   H H    . GLU A 1 10  ? -17.544 -15.593 -2.549  1.00 0.00 ? 10  GLU A H    1  
ATOM 141   H HA   . GLU A 1 10  ? -17.549 -13.371 -3.017  1.00 0.00 ? 10  GLU A HA   1  
ATOM 142   H HB2  . GLU A 1 10  ? -19.422 -13.549 -0.701  1.00 0.00 ? 10  GLU A HB2  1  
ATOM 143   H HB3  . GLU A 1 10  ? -18.917 -11.958 -1.254  1.00 0.00 ? 10  GLU A HB3  1  
ATOM 144   H HG2  . GLU A 1 10  ? -19.614 -12.891 -3.598  1.00 0.00 ? 10  GLU A HG2  1  
ATOM 145   H HG3  . GLU A 1 10  ? -20.575 -14.008 -2.631  1.00 0.00 ? 10  GLU A HG3  1  
ATOM 146   N N    . SER A 1 11  ? -15.457 -12.631 -1.843  1.00 0.00 ? 11  SER A N    1  
ATOM 147   C CA   . SER A 1 11  ? -14.327 -11.968 -1.202  1.00 0.00 ? 11  SER A CA   1  
ATOM 148   C C    . SER A 1 11  ? -14.675 -10.522 -0.860  1.00 0.00 ? 11  SER A C    1  
ATOM 149   O O    . SER A 1 11  ? -14.008 -9.887  -0.043  1.00 0.00 ? 11  SER A O    1  
ATOM 150   C CB   . SER A 1 11  ? -13.094 -12.016 -2.108  1.00 0.00 ? 11  SER A CB   1  
ATOM 151   O OG   . SER A 1 11  ? -12.195 -13.030 -1.693  1.00 0.00 ? 11  SER A OG   1  
ATOM 152   H H    . SER A 1 11  ? -15.390 -12.886 -2.786  1.00 0.00 ? 11  SER A H    1  
ATOM 153   H HA   . SER A 1 11  ? -14.115 -12.495 -0.289  1.00 0.00 ? 11  SER A HA   1  
ATOM 154   H HB2  . SER A 1 11  ? -13.402 -12.221 -3.122  1.00 0.00 ? 11  SER A HB2  1  
ATOM 155   H HB3  . SER A 1 11  ? -12.585 -11.064 -2.072  1.00 0.00 ? 11  SER A HB3  1  
ATOM 156   H HG   . SER A 1 11  ? -12.098 -13.001 -0.738  1.00 0.00 ? 11  SER A HG   1  
ATOM 157   N N    . CYS A 1 12  ? -15.743 -10.026 -1.478  1.00 0.00 ? 12  CYS A N    1  
ATOM 158   C CA   . CYS A 1 12  ? -16.232 -8.666  -1.246  1.00 0.00 ? 12  CYS A CA   1  
ATOM 159   C C    . CYS A 1 12  ? -15.094 -7.665  -1.050  1.00 0.00 ? 12  CYS A C    1  
ATOM 160   O O    . CYS A 1 12  ? -15.200 -6.723  -0.264  1.00 0.00 ? 12  CYS A O    1  
ATOM 161   C CB   . CYS A 1 12  ? -17.111 -8.655  -0.014  1.00 0.00 ? 12  CYS A CB   1  
ATOM 162   S SG   . CYS A 1 12  ? -18.891 -8.449  -0.350  1.00 0.00 ? 12  CYS A SG   1  
ATOM 163   H H    . CYS A 1 12  ? -16.235 -10.602 -2.094  1.00 0.00 ? 12  CYS A H    1  
ATOM 164   H HA   . CYS A 1 12  ? -16.819 -8.377  -2.105  1.00 0.00 ? 12  CYS A HA   1  
ATOM 165   H HB2  . CYS A 1 12  ? -16.975 -9.587  0.505   1.00 0.00 ? 12  CYS A HB2  1  
ATOM 166   H HB3  . CYS A 1 12  ? -16.794 -7.847  0.621   1.00 0.00 ? 12  CYS A HB3  1  
ATOM 167   N N    . THR A 1 13  ? -14.017 -7.884  -1.763  1.00 0.00 ? 13  THR A N    1  
ATOM 168   C CA   . THR A 1 13  ? -12.844 -7.013  -1.675  1.00 0.00 ? 13  THR A CA   1  
ATOM 169   C C    . THR A 1 13  ? -12.802 -6.012  -2.826  1.00 0.00 ? 13  THR A C    1  
ATOM 170   O O    . THR A 1 13  ? -12.736 -6.394  -3.991  1.00 0.00 ? 13  THR A O    1  
ATOM 171   C CB   . THR A 1 13  ? -11.564 -7.846  -1.680  1.00 0.00 ? 13  THR A CB   1  
ATOM 172   O OG1  . THR A 1 13  ? -11.740 -9.046  -0.949  1.00 0.00 ? 13  THR A OG1  1  
ATOM 173   C CG2  . THR A 1 13  ? -10.374 -7.117  -1.092  1.00 0.00 ? 13  THR A CG2  1  
ATOM 174   H H    . THR A 1 13  ? -14.011 -8.650  -2.360  1.00 0.00 ? 13  THR A H    1  
ATOM 175   H HA   . THR A 1 13  ? -12.904 -6.470  -0.744  1.00 0.00 ? 13  THR A HA   1  
ATOM 176   H HB   . THR A 1 13  ? -11.322 -8.100  -2.700  1.00 0.00 ? 13  THR A HB   1  
ATOM 177   H HG1  . THR A 1 13  ? -11.873 -8.840  -0.021  1.00 0.00 ? 13  THR A HG1  1  
ATOM 178   H HG21 . THR A 1 13  ? -10.712 -6.434  -0.328  1.00 0.00 ? 13  THR A HG21 1  
ATOM 179   H HG22 . THR A 1 13  ? -9.870  -6.565  -1.872  1.00 0.00 ? 13  THR A HG22 1  
ATOM 180   H HG23 . THR A 1 13  ? -9.691  -7.833  -0.659  1.00 0.00 ? 13  THR A HG23 1  
ATOM 181   N N    . PHE A 1 14  ? -12.824 -4.727  -2.489  1.00 0.00 ? 14  PHE A N    1  
ATOM 182   C CA   . PHE A 1 14  ? -12.778 -3.668  -3.495  1.00 0.00 ? 14  PHE A CA   1  
ATOM 183   C C    . PHE A 1 14  ? -11.343 -3.191  -3.712  1.00 0.00 ? 14  PHE A C    1  
ATOM 184   O O    . PHE A 1 14  ? -10.707 -2.677  -2.792  1.00 0.00 ? 14  PHE A O    1  
ATOM 185   C CB   . PHE A 1 14  ? -13.659 -2.490  -3.079  1.00 0.00 ? 14  PHE A CB   1  
ATOM 186   C CG   . PHE A 1 14  ? -14.920 -2.921  -2.401  1.00 0.00 ? 14  PHE A CG   1  
ATOM 187   C CD1  . PHE A 1 14  ? -15.817 -3.763  -3.041  1.00 0.00 ? 14  PHE A CD1  1  
ATOM 188   C CD2  . PHE A 1 14  ? -15.193 -2.515  -1.107  1.00 0.00 ? 14  PHE A CD2  1  
ATOM 189   C CE1  . PHE A 1 14  ? -16.952 -4.183  -2.407  1.00 0.00 ? 14  PHE A CE1  1  
ATOM 190   C CE2  . PHE A 1 14  ? -16.341 -2.931  -0.468  1.00 0.00 ? 14  PHE A CE2  1  
ATOM 191   C CZ   . PHE A 1 14  ? -17.222 -3.767  -1.120  1.00 0.00 ? 14  PHE A CZ   1  
ATOM 192   H H    . PHE A 1 14  ? -12.862 -4.485  -1.542  1.00 0.00 ? 14  PHE A H    1  
ATOM 193   H HA   . PHE A 1 14  ? -13.164 -4.074  -4.418  1.00 0.00 ? 14  PHE A HA   1  
ATOM 194   H HB2  . PHE A 1 14  ? -13.110 -1.860  -2.396  1.00 0.00 ? 14  PHE A HB2  1  
ATOM 195   H HB3  . PHE A 1 14  ? -13.928 -1.920  -3.956  1.00 0.00 ? 14  PHE A HB3  1  
ATOM 196   H HD1  . PHE A 1 14  ? -15.634 -4.083  -4.056  1.00 0.00 ? 14  PHE A HD1  1  
ATOM 197   H HD2  . PHE A 1 14  ? -14.502 -1.860  -0.600  1.00 0.00 ? 14  PHE A HD2  1  
ATOM 198   H HE1  . PHE A 1 14  ? -17.624 -4.844  -2.919  1.00 0.00 ? 14  PHE A HE1  1  
ATOM 199   H HE2  . PHE A 1 14  ? -16.549 -2.604  0.539   1.00 0.00 ? 14  PHE A HE2  1  
ATOM 200   H HZ   . PHE A 1 14  ? -18.117 -4.095  -0.626  1.00 0.00 ? 14  PHE A HZ   1  
ATOM 201   N N    . LYS A 1 15  ? -10.837 -3.363  -4.929  1.00 0.00 ? 15  LYS A N    1  
ATOM 202   C CA   . LYS A 1 15  ? -9.475  -2.947  -5.258  1.00 0.00 ? 15  LYS A CA   1  
ATOM 203   C C    . LYS A 1 15  ? -9.485  -1.612  -5.982  1.00 0.00 ? 15  LYS A C    1  
ATOM 204   O O    . LYS A 1 15  ? -10.060 -1.489  -7.056  1.00 0.00 ? 15  LYS A O    1  
ATOM 205   C CB   . LYS A 1 15  ? -8.802  -3.997  -6.141  1.00 0.00 ? 15  LYS A CB   1  
ATOM 206   C CG   . LYS A 1 15  ? -7.446  -3.560  -6.700  1.00 0.00 ? 15  LYS A CG   1  
ATOM 207   C CD   . LYS A 1 15  ? -6.303  -4.315  -6.041  1.00 0.00 ? 15  LYS A CD   1  
ATOM 208   C CE   . LYS A 1 15  ? -6.073  -3.843  -4.614  1.00 0.00 ? 15  LYS A CE   1  
ATOM 209   N NZ   . LYS A 1 15  ? -4.978  -2.837  -4.532  1.00 0.00 ? 15  LYS A NZ   1  
ATOM 210   H H    . LYS A 1 15  ? -11.389 -3.778  -5.624  1.00 0.00 ? 15  LYS A H    1  
ATOM 211   H HA   . LYS A 1 15  ? -8.921  -2.848  -4.338  1.00 0.00 ? 15  LYS A HA   1  
ATOM 212   H HB2  . LYS A 1 15  ? -8.661  -4.898  -5.561  1.00 0.00 ? 15  LYS A HB2  1  
ATOM 213   H HB3  . LYS A 1 15  ? -9.459  -4.215  -6.971  1.00 0.00 ? 15  LYS A HB3  1  
ATOM 214   H HG2  . LYS A 1 15  ? -7.426  -3.756  -7.761  1.00 0.00 ? 15  LYS A HG2  1  
ATOM 215   H HG3  . LYS A 1 15  ? -7.310  -2.497  -6.528  1.00 0.00 ? 15  LYS A HG3  1  
ATOM 216   H HD2  . LYS A 1 15  ? -6.541  -5.368  -6.027  1.00 0.00 ? 15  LYS A HD2  1  
ATOM 217   H HD3  . LYS A 1 15  ? -5.401  -4.156  -6.614  1.00 0.00 ? 15  LYS A HD3  1  
ATOM 218   H HE2  . LYS A 1 15  ? -6.985  -3.401  -4.243  1.00 0.00 ? 15  LYS A HE2  1  
ATOM 219   H HE3  . LYS A 1 15  ? -5.813  -4.696  -4.004  1.00 0.00 ? 15  LYS A HE3  1  
ATOM 220   H HZ1  . LYS A 1 15  ? -4.997  -2.363  -3.606  1.00 0.00 ? 15  LYS A HZ1  1  
ATOM 221   H HZ2  . LYS A 1 15  ? -5.094  -2.121  -5.277  1.00 0.00 ? 15  LYS A HZ2  1  
ATOM 222   H HZ3  . LYS A 1 15  ? -4.056  -3.301  -4.654  1.00 0.00 ? 15  LYS A HZ3  1  
ATOM 223   N N    . ILE A 1 16  ? -8.809  -0.624  -5.421  1.00 0.00 ? 16  ILE A N    1  
ATOM 224   C CA   . ILE A 1 16  ? -8.741  0.678   -6.061  1.00 0.00 ? 16  ILE A CA   1  
ATOM 225   C C    . ILE A 1 16  ? -7.365  0.947   -6.630  1.00 0.00 ? 16  ILE A C    1  
ATOM 226   O O    . ILE A 1 16  ? -6.350  0.774   -5.955  1.00 0.00 ? 16  ILE A O    1  
ATOM 227   C CB   . ILE A 1 16  ? -9.137  1.824   -5.120  1.00 0.00 ? 16  ILE A CB   1  
ATOM 228   C CG1  . ILE A 1 16  ? -9.653  2.995   -5.954  1.00 0.00 ? 16  ILE A CG1  1  
ATOM 229   C CG2  . ILE A 1 16  ? -7.971  2.250   -4.236  1.00 0.00 ? 16  ILE A CG2  1  
ATOM 230   C CD1  . ILE A 1 16  ? -10.338 4.063   -5.141  1.00 0.00 ? 16  ILE A CD1  1  
ATOM 231   H H    . ILE A 1 16  ? -8.320  -0.790  -4.589  1.00 0.00 ? 16  ILE A H    1  
ATOM 232   H HA   . ILE A 1 16  ? -9.448  0.672   -6.878  1.00 0.00 ? 16  ILE A HA   1  
ATOM 233   H HB   . ILE A 1 16  ? -9.926  1.473   -4.485  1.00 0.00 ? 16  ILE A HB   1  
ATOM 234   H HG12 . ILE A 1 16  ? -8.827  3.450   -6.474  1.00 0.00 ? 16  ILE A HG12 1  
ATOM 235   H HG13 . ILE A 1 16  ? -10.364 2.623   -6.677  1.00 0.00 ? 16  ILE A HG13 1  
ATOM 236   H HG21 . ILE A 1 16  ? -7.394  3.010   -4.742  1.00 0.00 ? 16  ILE A HG21 1  
ATOM 237   H HG22 . ILE A 1 16  ? -7.341  1.396   -4.034  1.00 0.00 ? 16  ILE A HG22 1  
ATOM 238   H HG23 . ILE A 1 16  ? -8.350  2.646   -3.305  1.00 0.00 ? 16  ILE A HG23 1  
ATOM 239   H HD11 . ILE A 1 16  ? -11.205 3.637   -4.652  1.00 0.00 ? 16  ILE A HD11 1  
ATOM 240   H HD12 . ILE A 1 16  ? -10.644 4.870   -5.795  1.00 0.00 ? 16  ILE A HD12 1  
ATOM 241   H HD13 . ILE A 1 16  ? -9.655  4.442   -4.398  1.00 0.00 ? 16  ILE A HD13 1  
ATOM 242   N N    . SER A 1 17  ? -7.343  1.373   -7.879  1.00 0.00 ? 17  SER A N    1  
ATOM 243   C CA   . SER A 1 17  ? -6.095  1.673   -8.556  1.00 0.00 ? 17  SER A CA   1  
ATOM 244   C C    . SER A 1 17  ? -5.982  3.172   -8.831  1.00 0.00 ? 17  SER A C    1  
ATOM 245   O O    . SER A 1 17  ? -6.848  3.956   -8.426  1.00 0.00 ? 17  SER A O    1  
ATOM 246   C CB   . SER A 1 17  ? -5.998  0.889   -9.866  1.00 0.00 ? 17  SER A CB   1  
ATOM 247   O OG   . SER A 1 17  ? -5.237  -0.295  -9.697  1.00 0.00 ? 17  SER A OG   1  
ATOM 248   H H    . SER A 1 17  ? -8.186  1.488   -8.361  1.00 0.00 ? 17  SER A H    1  
ATOM 249   H HA   . SER A 1 17  ? -5.290  1.368   -7.900  1.00 0.00 ? 17  SER A HA   1  
ATOM 250   H HB2  . SER A 1 17  ? -6.990  0.619   -10.195 1.00 0.00 ? 17  SER A HB2  1  
ATOM 251   H HB3  . SER A 1 17  ? -5.524  1.503   -10.617 1.00 0.00 ? 17  SER A HB3  1  
ATOM 252   H HG   . SER A 1 17  ? -5.824  -1.054  -9.680  1.00 0.00 ? 17  SER A HG   1  
ATOM 253   N N    . LEU A 1 18  ? -4.930  3.559   -9.553  1.00 0.00 ? 18  LEU A N    1  
ATOM 254   C CA   . LEU A 1 18  ? -4.717  4.960   -9.903  1.00 0.00 ? 18  LEU A CA   1  
ATOM 255   C C    . LEU A 1 18  ? -3.926  5.086   -11.204 1.00 0.00 ? 18  LEU A C    1  
ATOM 256   O O    . LEU A 1 18  ? -2.695  5.096   -11.196 1.00 0.00 ? 18  LEU A O    1  
ATOM 257   C CB   . LEU A 1 18  ? -3.988  5.686   -8.766  1.00 0.00 ? 18  LEU A CB   1  
ATOM 258   C CG   . LEU A 1 18  ? -4.392  7.150   -8.523  1.00 0.00 ? 18  LEU A CG   1  
ATOM 259   C CD1  . LEU A 1 18  ? -5.901  7.335   -8.604  1.00 0.00 ? 18  LEU A CD1  1  
ATOM 260   C CD2  . LEU A 1 18  ? -3.893  7.602   -7.166  1.00 0.00 ? 18  LEU A CD2  1  
ATOM 261   H H    . LEU A 1 18  ? -4.306  2.878   -9.882  1.00 0.00 ? 18  LEU A H    1  
ATOM 262   H HA   . LEU A 1 18  ? -5.683  5.409   -10.043 1.00 0.00 ? 18  LEU A HA   1  
ATOM 263   H HB2  . LEU A 1 18  ? -4.164  5.137   -7.853  1.00 0.00 ? 18  LEU A HB2  1  
ATOM 264   H HB3  . LEU A 1 18  ? -2.929  5.662   -8.978  1.00 0.00 ? 18  LEU A HB3  1  
ATOM 265   H HG   . LEU A 1 18  ? -3.932  7.781   -9.276  1.00 0.00 ? 18  LEU A HG   1  
ATOM 266   H HD11 . LEU A 1 18  ? -6.255  7.810   -7.700  1.00 0.00 ? 18  LEU A HD11 1  
ATOM 267   H HD12 . LEU A 1 18  ? -6.380  6.375   -8.714  1.00 0.00 ? 18  LEU A HD12 1  
ATOM 268   H HD13 . LEU A 1 18  ? -6.138  7.958   -9.451  1.00 0.00 ? 18  LEU A HD13 1  
ATOM 269   H HD21 . LEU A 1 18  ? -2.983  7.075   -6.921  1.00 0.00 ? 18  LEU A HD21 1  
ATOM 270   H HD22 . LEU A 1 18  ? -4.646  7.388   -6.420  1.00 0.00 ? 18  LEU A HD22 1  
ATOM 271   H HD23 . LEU A 1 18  ? -3.701  8.664   -7.189  1.00 0.00 ? 18  LEU A HD23 1  
ATOM 272   N N    . ARG A 1 19  ? -4.646  5.190   -12.318 1.00 0.00 ? 19  ARG A N    1  
ATOM 273   C CA   . ARG A 1 19  ? -4.017  5.325   -13.632 1.00 0.00 ? 19  ARG A CA   1  
ATOM 274   C C    . ARG A 1 19  ? -3.910  6.795   -14.016 1.00 0.00 ? 19  ARG A C    1  
ATOM 275   O O    . ARG A 1 19  ? -4.919  7.491   -14.092 1.00 0.00 ? 19  ARG A O    1  
ATOM 276   C CB   . ARG A 1 19  ? -4.824  4.568   -14.692 1.00 0.00 ? 19  ARG A CB   1  
ATOM 277   C CG   . ARG A 1 19  ? -6.234  5.101   -14.879 1.00 0.00 ? 19  ARG A CG   1  
ATOM 278   C CD   . ARG A 1 19  ? -6.329  6.009   -16.094 1.00 0.00 ? 19  ARG A CD   1  
ATOM 279   N NE   . ARG A 1 19  ? -6.876  5.310   -17.256 1.00 0.00 ? 19  ARG A NE   1  
ATOM 280   C CZ   . ARG A 1 19  ? -6.423  5.459   -18.501 1.00 0.00 ? 19  ARG A CZ   1  
ATOM 281   N NH1  . ARG A 1 19  ? -5.420  6.289   -18.762 1.00 0.00 ? 19  ARG A NH1  1  
ATOM 282   N NH2  . ARG A 1 19  ? -6.980  4.776   -19.492 1.00 0.00 ? 19  ARG A NH2  1  
ATOM 283   H H    . ARG A 1 19  ? -5.625  5.182   -12.253 1.00 0.00 ? 19  ARG A H    1  
ATOM 284   H HA   . ARG A 1 19  ? -3.025  4.904   -13.572 1.00 0.00 ? 19  ARG A HA   1  
ATOM 285   H HB2  . ARG A 1 19  ? -4.307  4.637   -15.638 1.00 0.00 ? 19  ARG A HB2  1  
ATOM 286   H HB3  . ARG A 1 19  ? -4.892  3.530   -14.405 1.00 0.00 ? 19  ARG A HB3  1  
ATOM 287   H HG2  . ARG A 1 19  ? -6.909  4.268   -15.012 1.00 0.00 ? 19  ARG A HG2  1  
ATOM 288   H HG3  . ARG A 1 19  ? -6.517  5.659   -13.999 1.00 0.00 ? 19  ARG A HG3  1  
ATOM 289   H HD2  . ARG A 1 19  ? -6.970  6.844   -15.854 1.00 0.00 ? 19  ARG A HD2  1  
ATOM 290   H HD3  . ARG A 1 19  ? -5.341  6.370   -16.332 1.00 0.00 ? 19  ARG A HD3  1  
ATOM 291   H HE   . ARG A 1 19  ? -7.621  4.693   -17.101 1.00 0.00 ? 19  ARG A HE   1  
ATOM 292   H HH11 . ARG A 1 19  ? -4.995  6.812   -18.024 1.00 0.00 ? 19  ARG A HH11 1  
ATOM 293   H HH12 . ARG A 1 19  ? -5.088  6.391   -19.700 1.00 0.00 ? 19  ARG A HH12 1  
ATOM 294   H HH21 . ARG A 1 19  ? -7.737  4.151   -19.304 1.00 0.00 ? 19  ARG A HH21 1  
ATOM 295   H HH22 . ARG A 1 19  ? -6.642  4.886   -20.427 1.00 0.00 ? 19  ARG A HH22 1  
ATOM 296   N N    . ASN A 1 20  ? -2.686  7.276   -14.241 1.00 0.00 ? 20  ASN A N    1  
ATOM 297   C CA   . ASN A 1 20  ? -2.486  8.681   -14.594 1.00 0.00 ? 20  ASN A CA   1  
ATOM 298   C C    . ASN A 1 20  ? -3.244  9.551   -13.591 1.00 0.00 ? 20  ASN A C    1  
ATOM 299   O O    . ASN A 1 20  ? -4.033  10.421  -13.960 1.00 0.00 ? 20  ASN A O    1  
ATOM 300   C CB   . ASN A 1 20  ? -2.988  8.949   -16.016 1.00 0.00 ? 20  ASN A CB   1  
ATOM 301   C CG   . ASN A 1 20  ? -1.962  8.603   -17.085 1.00 0.00 ? 20  ASN A CG   1  
ATOM 302   O OD1  . ASN A 1 20  ? -1.929  9.223   -18.148 1.00 0.00 ? 20  ASN A OD1  1  
ATOM 303   N ND2  . ASN A 1 20  ? -1.123  7.607   -16.817 1.00 0.00 ? 20  ASN A ND2  1  
ATOM 304   H H    . ASN A 1 20  ? -1.909  6.684   -14.154 1.00 0.00 ? 20  ASN A H    1  
ATOM 305   H HA   . ASN A 1 20  ? -1.422  8.903   -14.535 1.00 0.00 ? 20  ASN A HA   1  
ATOM 306   H HB2  . ASN A 1 20  ? -3.874  8.358   -16.194 1.00 0.00 ? 20  ASN A HB2  1  
ATOM 307   H HB3  . ASN A 1 20  ? -3.237  9.996   -16.110 1.00 0.00 ? 20  ASN A HB3  1  
ATOM 308   H HD21 . ASN A 1 20  ? -1.203  7.149   -15.956 1.00 0.00 ? 20  ASN A HD21 1  
ATOM 309   H HD22 . ASN A 1 20  ? -0.455  7.372   -17.494 1.00 0.00 ? 20  ASN A HD22 1  
ATOM 310   N N    . PHE A 1 21  ? -3.018  9.252   -12.317 1.00 0.00 ? 21  PHE A N    1  
ATOM 311   C CA   . PHE A 1 21  ? -3.677  9.926   -11.203 1.00 0.00 ? 21  PHE A CA   1  
ATOM 312   C C    . PHE A 1 21  ? -5.190  9.956   -11.388 1.00 0.00 ? 21  PHE A C    1  
ATOM 313   O O    . PHE A 1 21  ? -5.861  10.916  -11.012 1.00 0.00 ? 21  PHE A O    1  
ATOM 314   C CB   . PHE A 1 21  ? -3.126  11.338  -10.983 1.00 0.00 ? 21  PHE A CB   1  
ATOM 315   C CG   . PHE A 1 21  ? -3.441  12.318  -12.079 1.00 0.00 ? 21  PHE A CG   1  
ATOM 316   C CD1  . PHE A 1 21  ? -4.607  13.068  -12.048 1.00 0.00 ? 21  PHE A CD1  1  
ATOM 317   C CD2  . PHE A 1 21  ? -2.566  12.496  -13.136 1.00 0.00 ? 21  PHE A CD2  1  
ATOM 318   C CE1  . PHE A 1 21  ? -4.894  13.974  -13.052 1.00 0.00 ? 21  PHE A CE1  1  
ATOM 319   C CE2  . PHE A 1 21  ? -2.847  13.400  -14.144 1.00 0.00 ? 21  PHE A CE2  1  
ATOM 320   C CZ   . PHE A 1 21  ? -4.013  14.139  -14.101 1.00 0.00 ? 21  PHE A CZ   1  
ATOM 321   H H    . PHE A 1 21  ? -2.398  8.520   -12.118 1.00 0.00 ? 21  PHE A H    1  
ATOM 322   H HA   . PHE A 1 21  ? -3.467  9.343   -10.319 1.00 0.00 ? 21  PHE A HA   1  
ATOM 323   H HB2  . PHE A 1 21  ? -3.536  11.731  -10.065 1.00 0.00 ? 21  PHE A HB2  1  
ATOM 324   H HB3  . PHE A 1 21  ? -2.054  11.273  -10.888 1.00 0.00 ? 21  PHE A HB3  1  
ATOM 325   H HD1  . PHE A 1 21  ? -5.297  12.942  -11.227 1.00 0.00 ? 21  PHE A HD1  1  
ATOM 326   H HD2  . PHE A 1 21  ? -1.655  11.919  -13.167 1.00 0.00 ? 21  PHE A HD2  1  
ATOM 327   H HE1  . PHE A 1 21  ? -5.806  14.551  -13.015 1.00 0.00 ? 21  PHE A HE1  1  
ATOM 328   H HE2  . PHE A 1 21  ? -2.157  13.529  -14.964 1.00 0.00 ? 21  PHE A HE2  1  
ATOM 329   H HZ   . PHE A 1 21  ? -4.234  14.846  -14.887 1.00 0.00 ? 21  PHE A HZ   1  
ATOM 330   N N    . ARG A 1 22  ? -5.722  8.861   -11.915 1.00 0.00 ? 22  ARG A N    1  
ATOM 331   C CA   . ARG A 1 22  ? -7.156  8.705   -12.101 1.00 0.00 ? 22  ARG A CA   1  
ATOM 332   C C    . ARG A 1 22  ? -7.593  7.541   -11.230 1.00 0.00 ? 22  ARG A C    1  
ATOM 333   O O    . ARG A 1 22  ? -6.901  6.528   -11.172 1.00 0.00 ? 22  ARG A O    1  
ATOM 334   C CB   . ARG A 1 22  ? -7.498  8.442   -13.570 1.00 0.00 ? 22  ARG A CB   1  
ATOM 335   C CG   . ARG A 1 22  ? -6.963  9.504   -14.519 1.00 0.00 ? 22  ARG A CG   1  
ATOM 336   C CD   . ARG A 1 22  ? -7.604  9.396   -15.894 1.00 0.00 ? 22  ARG A CD   1  
ATOM 337   N NE   . ARG A 1 22  ? -7.677  10.690  -16.567 1.00 0.00 ? 22  ARG A NE   1  
ATOM 338   C CZ   . ARG A 1 22  ? -8.499  10.955  -17.580 1.00 0.00 ? 22  ARG A CZ   1  
ATOM 339   N NH1  . ARG A 1 22  ? -9.320  10.018  -18.039 1.00 0.00 ? 22  ARG A NH1  1  
ATOM 340   N NH2  . ARG A 1 22  ? -8.501  12.159  -18.134 1.00 0.00 ? 22  ARG A NH2  1  
ATOM 341   H H    . ARG A 1 22  ? -5.140  8.112   -12.160 1.00 0.00 ? 22  ARG A H    1  
ATOM 342   H HA   . ARG A 1 22  ? -7.646  9.608   -11.765 1.00 0.00 ? 22  ARG A HA   1  
ATOM 343   H HB2  . ARG A 1 22  ? -7.084  7.489   -13.859 1.00 0.00 ? 22  ARG A HB2  1  
ATOM 344   H HB3  . ARG A 1 22  ? -8.571  8.404   -13.676 1.00 0.00 ? 22  ARG A HB3  1  
ATOM 345   H HG2  . ARG A 1 22  ? -7.175  10.480  -14.110 1.00 0.00 ? 22  ARG A HG2  1  
ATOM 346   H HG3  . ARG A 1 22  ? -5.895  9.379   -14.620 1.00 0.00 ? 22  ARG A HG3  1  
ATOM 347   H HD2  . ARG A 1 22  ? -7.019  8.719   -16.498 1.00 0.00 ? 22  ARG A HD2  1  
ATOM 348   H HD3  . ARG A 1 22  ? -8.604  9.003   -15.780 1.00 0.00 ? 22  ARG A HD3  1  
ATOM 349   H HE   . ARG A 1 22  ? -7.081  11.400  -16.248 1.00 0.00 ? 22  ARG A HE   1  
ATOM 350   H HH11 . ARG A 1 22  ? -9.324  9.108   -17.626 1.00 0.00 ? 22  ARG A HH11 1  
ATOM 351   H HH12 . ARG A 1 22  ? -9.936  10.224  -18.800 1.00 0.00 ? 22  ARG A HH12 1  
ATOM 352   H HH21 . ARG A 1 22  ? -7.885  12.869  -17.792 1.00 0.00 ? 22  ARG A HH21 1  
ATOM 353   H HH22 . ARG A 1 22  ? -9.119  12.358  -18.895 1.00 0.00 ? 22  ARG A HH22 1  
ATOM 354   N N    . SER A 1 23  ? -8.693  7.686   -10.512 1.00 0.00 ? 23  SER A N    1  
ATOM 355   C CA   . SER A 1 23  ? -9.122  6.634   -9.611  1.00 0.00 ? 23  SER A CA   1  
ATOM 356   C C    . SER A 1 23  ? -10.027 5.624   -10.290 1.00 0.00 ? 23  SER A C    1  
ATOM 357   O O    . SER A 1 23  ? -10.904 5.979   -11.068 1.00 0.00 ? 23  SER A O    1  
ATOM 358   C CB   . SER A 1 23  ? -9.846  7.251   -8.419  1.00 0.00 ? 23  SER A CB   1  
ATOM 359   O OG   . SER A 1 23  ? -9.644  6.487   -7.242  1.00 0.00 ? 23  SER A OG   1  
ATOM 360   H H    . SER A 1 23  ? -9.206  8.523   -10.553 1.00 0.00 ? 23  SER A H    1  
ATOM 361   H HA   . SER A 1 23  ? -8.239  6.124   -9.251  1.00 0.00 ? 23  SER A HA   1  
ATOM 362   H HB2  . SER A 1 23  ? -9.474  8.249   -8.256  1.00 0.00 ? 23  SER A HB2  1  
ATOM 363   H HB3  . SER A 1 23  ? -10.901 7.295   -8.630  1.00 0.00 ? 23  SER A HB3  1  
ATOM 364   H HG   . SER A 1 23  ? -8.738  6.594   -6.942  1.00 0.00 ? 23  SER A HG   1  
ATOM 365   N N    . ILE A 1 24  ? -9.817  4.361   -9.951  1.00 0.00 ? 24  ILE A N    1  
ATOM 366   C CA   . ILE A 1 24  ? -10.630 3.270   -10.475 1.00 0.00 ? 24  ILE A CA   1  
ATOM 367   C C    . ILE A 1 24  ? -10.732 2.198   -9.414  1.00 0.00 ? 24  ILE A C    1  
ATOM 368   O O    . ILE A 1 24  ? -9.749  1.528   -9.107  1.00 0.00 ? 24  ILE A O    1  
ATOM 369   C CB   . ILE A 1 24  ? -10.053 2.640   -11.750 1.00 0.00 ? 24  ILE A CB   1  
ATOM 370   C CG1  . ILE A 1 24  ? -10.007 3.667   -12.882 1.00 0.00 ? 24  ILE A CG1  1  
ATOM 371   C CG2  . ILE A 1 24  ? -10.867 1.408   -12.163 1.00 0.00 ? 24  ILE A CG2  1  
ATOM 372   C CD1  . ILE A 1 24  ? -9.443  3.118   -14.175 1.00 0.00 ? 24  ILE A CD1  1  
ATOM 373   H H    . ILE A 1 24  ? -9.106  4.155   -9.300  1.00 0.00 ? 24  ILE A H    1  
ATOM 374   H HA   . ILE A 1 24  ? -11.615 3.658   -10.695 1.00 0.00 ? 24  ILE A HA   1  
ATOM 375   H HB   . ILE A 1 24  ? -9.059  2.319   -11.527 1.00 0.00 ? 24  ILE A HB   1  
ATOM 376   H HG12 . ILE A 1 24  ? -11.007 4.019   -13.081 1.00 0.00 ? 24  ILE A HG12 1  
ATOM 377   H HG13 . ILE A 1 24  ? -9.390  4.501   -12.579 1.00 0.00 ? 24  ILE A HG13 1  
ATOM 378   H HG21 . ILE A 1 24  ? -10.873 0.683   -11.355 1.00 0.00 ? 24  ILE A HG21 1  
ATOM 379   H HG22 . ILE A 1 24  ? -10.426 0.960   -13.040 1.00 0.00 ? 24  ILE A HG22 1  
ATOM 380   H HG23 . ILE A 1 24  ? -11.882 1.703   -12.384 1.00 0.00 ? 24  ILE A HG23 1  
ATOM 381   H HD11 . ILE A 1 24  ? -8.478  2.673   -13.986 1.00 0.00 ? 24  ILE A HD11 1  
ATOM 382   H HD12 . ILE A 1 24  ? -9.337  3.919   -14.891 1.00 0.00 ? 24  ILE A HD12 1  
ATOM 383   H HD13 . ILE A 1 24  ? -10.113 2.369   -14.570 1.00 0.00 ? 24  ILE A HD13 1  
ATOM 384   N N    . LEU A 1 25  ? -11.909 2.035   -8.849  1.00 0.00 ? 25  LEU A N    1  
ATOM 385   C CA   . LEU A 1 25  ? -12.094 1.044   -7.822  1.00 0.00 ? 25  LEU A CA   1  
ATOM 386   C C    . LEU A 1 25  ? -12.822 -0.162  -8.372  1.00 0.00 ? 25  LEU A C    1  
ATOM 387   O O    . LEU A 1 25  ? -13.720 -0.049  -9.206  1.00 0.00 ? 25  LEU A O    1  
ATOM 388   C CB   . LEU A 1 25  ? -12.793 1.645   -6.605  1.00 0.00 ? 25  LEU A CB   1  
ATOM 389   C CG   . LEU A 1 25  ? -14.302 1.879   -6.723  1.00 0.00 ? 25  LEU A CG   1  
ATOM 390   C CD1  . LEU A 1 25  ? -15.056 0.814   -5.945  1.00 0.00 ? 25  LEU A CD1  1  
ATOM 391   C CD2  . LEU A 1 25  ? -14.675 3.274   -6.215  1.00 0.00 ? 25  LEU A CD2  1  
ATOM 392   H H    . LEU A 1 25  ? -12.660 2.584   -9.128  1.00 0.00 ? 25  LEU A H    1  
ATOM 393   H HA   . LEU A 1 25  ? -11.110 0.724   -7.517  1.00 0.00 ? 25  LEU A HA   1  
ATOM 394   H HB2  . LEU A 1 25  ? -12.614 0.993   -5.766  1.00 0.00 ? 25  LEU A HB2  1  
ATOM 395   H HB3  . LEU A 1 25  ? -12.323 2.589   -6.403  1.00 0.00 ? 25  LEU A HB3  1  
ATOM 396   H HG   . LEU A 1 25  ? -14.594 1.808   -7.761  1.00 0.00 ? 25  LEU A HG   1  
ATOM 397   H HD11 . LEU A 1 25  ? -15.142 -0.078  -6.547  1.00 0.00 ? 25  LEU A HD11 1  
ATOM 398   H HD12 . LEU A 1 25  ? -16.041 1.180   -5.697  1.00 0.00 ? 25  LEU A HD12 1  
ATOM 399   H HD13 . LEU A 1 25  ? -14.518 0.585   -5.037  1.00 0.00 ? 25  LEU A HD13 1  
ATOM 400   H HD21 . LEU A 1 25  ? -13.778 3.841   -6.014  1.00 0.00 ? 25  LEU A HD21 1  
ATOM 401   H HD22 . LEU A 1 25  ? -15.251 3.187   -5.306  1.00 0.00 ? 25  LEU A HD22 1  
ATOM 402   H HD23 . LEU A 1 25  ? -15.264 3.787   -6.961  1.00 0.00 ? 25  LEU A HD23 1  
ATOM 403   N N    . SER A 1 26  ? -12.396 -1.316  -7.910  1.00 0.00 ? 26  SER A N    1  
ATOM 404   C CA   . SER A 1 26  ? -12.954 -2.577  -8.348  1.00 0.00 ? 26  SER A CA   1  
ATOM 405   C C    . SER A 1 26  ? -13.412 -3.390  -7.161  1.00 0.00 ? 26  SER A C    1  
ATOM 406   O O    . SER A 1 26  ? -13.337 -2.938  -6.023  1.00 0.00 ? 26  SER A O    1  
ATOM 407   C CB   . SER A 1 26  ? -11.920 -3.368  -9.145  1.00 0.00 ? 26  SER A CB   1  
ATOM 408   O OG   . SER A 1 26  ? -11.195 -4.260  -8.316  1.00 0.00 ? 26  SER A OG   1  
ATOM 409   H H    . SER A 1 26  ? -11.675 -1.317  -7.253  1.00 0.00 ? 26  SER A H    1  
ATOM 410   H HA   . SER A 1 26  ? -13.801 -2.366  -8.984  1.00 0.00 ? 26  SER A HA   1  
ATOM 411   H HB2  . SER A 1 26  ? -12.419 -3.935  -9.908  1.00 0.00 ? 26  SER A HB2  1  
ATOM 412   H HB3  . SER A 1 26  ? -11.232 -2.686  -9.604  1.00 0.00 ? 26  SER A HB3  1  
ATOM 413   H HG   . SER A 1 26  ? -11.142 -5.120  -8.740  1.00 0.00 ? 26  SER A HG   1  
ATOM 414   N N    . TRP A 1 27  ? -13.891 -4.586  -7.440  1.00 0.00 ? 27  TRP A N    1  
ATOM 415   C CA   . TRP A 1 27  ? -14.367 -5.472  -6.392  1.00 0.00 ? 27  TRP A CA   1  
ATOM 416   C C    . TRP A 1 27  ? -14.027 -6.927  -6.662  1.00 0.00 ? 27  TRP A C    1  
ATOM 417   O O    . TRP A 1 27  ? -13.733 -7.319  -7.791  1.00 0.00 ? 27  TRP A O    1  
ATOM 418   C CB   . TRP A 1 27  ? -15.854 -5.304  -6.221  1.00 0.00 ? 27  TRP A CB   1  
ATOM 419   C CG   . TRP A 1 27  ? -16.630 -5.611  -7.459  1.00 0.00 ? 27  TRP A CG   1  
ATOM 420   C CD1  . TRP A 1 27  ? -16.758 -6.811  -8.095  1.00 0.00 ? 27  TRP A CD1  1  
ATOM 421   C CD2  . TRP A 1 27  ? -17.386 -4.678  -8.214  1.00 0.00 ? 27  TRP A CD2  1  
ATOM 422   N NE1  . TRP A 1 27  ? -17.570 -6.677  -9.188  1.00 0.00 ? 27  TRP A NE1  1  
ATOM 423   C CE2  . TRP A 1 27  ? -17.964 -5.373  -9.281  1.00 0.00 ? 27  TRP A CE2  1  
ATOM 424   C CE3  . TRP A 1 27  ? -17.633 -3.321  -8.080  1.00 0.00 ? 27  TRP A CE3  1  
ATOM 425   C CZ2  . TRP A 1 27  ? -18.775 -4.754  -10.211 1.00 0.00 ? 27  TRP A CZ2  1  
ATOM 426   C CZ3  . TRP A 1 27  ? -18.441 -2.697  -9.009  1.00 0.00 ? 27  TRP A CZ3  1  
ATOM 427   C CH2  . TRP A 1 27  ? -19.007 -3.417  -10.066 1.00 0.00 ? 27  TRP A CH2  1  
ATOM 428   H H    . TRP A 1 27  ? -13.918 -4.879  -8.376  1.00 0.00 ? 27  TRP A H    1  
ATOM 429   H HA   . TRP A 1 27  ? -13.892 -5.185  -5.469  1.00 0.00 ? 27  TRP A HA   1  
ATOM 430   H HB2  . TRP A 1 27  ? -16.186 -5.948  -5.430  1.00 0.00 ? 27  TRP A HB2  1  
ATOM 431   H HB3  . TRP A 1 27  ? -16.057 -4.278  -5.950  1.00 0.00 ? 27  TRP A HB3  1  
ATOM 432   H HD1  . TRP A 1 27  ? -16.296 -7.722  -7.772  1.00 0.00 ? 27  TRP A HD1  1  
ATOM 433   H HE1  . TRP A 1 27  ? -17.823 -7.397  -9.803  1.00 0.00 ? 27  TRP A HE1  1  
ATOM 434   H HE3  . TRP A 1 27  ? -17.198 -2.763  -7.270  1.00 0.00 ? 27  TRP A HE3  1  
ATOM 435   H HZ2  . TRP A 1 27  ? -19.205 -5.301  -11.023 1.00 0.00 ? 27  TRP A HZ2  1  
ATOM 436   H HZ3  . TRP A 1 27  ? -18.642 -1.643  -8.925  1.00 0.00 ? 27  TRP A HZ3  1  
ATOM 437   H HH2  . TRP A 1 27  ? -19.633 -2.895  -10.774 1.00 0.00 ? 27  TRP A HH2  1  
ATOM 438   N N    . GLU A 1 28  ? -14.068 -7.716  -5.600  1.00 0.00 ? 28  GLU A N    1  
ATOM 439   C CA   . GLU A 1 28  ? -13.766 -9.132  -5.670  1.00 0.00 ? 28  GLU A CA   1  
ATOM 440   C C    . GLU A 1 28  ? -14.792 -9.931  -4.904  1.00 0.00 ? 28  GLU A C    1  
ATOM 441   O O    . GLU A 1 28  ? -14.531 -10.409 -3.799  1.00 0.00 ? 28  GLU A O    1  
ATOM 442   C CB   . GLU A 1 28  ? -12.362 -9.386  -5.122  1.00 0.00 ? 28  GLU A CB   1  
ATOM 443   C CG   . GLU A 1 28  ? -11.406 -9.982  -6.142  1.00 0.00 ? 28  GLU A CG   1  
ATOM 444   C CD   . GLU A 1 28  ? -11.846 -11.351 -6.623  1.00 0.00 ? 28  GLU A CD   1  
ATOM 445   O OE1  . GLU A 1 28  ? -12.924 -11.443 -7.248  1.00 0.00 ? 28  GLU A OE1  1  
ATOM 446   O OE2  . GLU A 1 28  ? -11.113 -12.332 -6.374  1.00 0.00 ? 28  GLU A OE2  1  
ATOM 447   H H    . GLU A 1 28  ? -14.295 -7.325  -4.730  1.00 0.00 ? 28  GLU A H    1  
ATOM 448   H HA   . GLU A 1 28  ? -13.810 -9.450  -6.697  1.00 0.00 ? 28  GLU A HA   1  
ATOM 449   H HB2  . GLU A 1 28  ? -11.951 -8.443  -4.785  1.00 0.00 ? 28  GLU A HB2  1  
ATOM 450   H HB3  . GLU A 1 28  ? -12.426 -10.061 -4.282  1.00 0.00 ? 28  GLU A HB3  1  
ATOM 451   H HG2  . GLU A 1 28  ? -11.349 -9.320  -6.993  1.00 0.00 ? 28  GLU A HG2  1  
ATOM 452   H HG3  . GLU A 1 28  ? -10.429 -10.072 -5.690  1.00 0.00 ? 28  GLU A HG3  1  
ATOM 453   N N    . LEU A 1 29  ? -15.953 -10.113 -5.519  1.00 0.00 ? 29  LEU A N    1  
ATOM 454   C CA   . LEU A 1 29  ? -16.987 -10.905 -4.903  1.00 0.00 ? 29  LEU A CA   1  
ATOM 455   C C    . LEU A 1 29  ? -17.239 -12.137 -5.756  1.00 0.00 ? 29  LEU A C    1  
ATOM 456   O O    . LEU A 1 29  ? -17.851 -12.067 -6.821  1.00 0.00 ? 29  LEU A O    1  
ATOM 457   C CB   . LEU A 1 29  ? -18.293 -10.113 -4.725  1.00 0.00 ? 29  LEU A CB   1  
ATOM 458   C CG   . LEU A 1 29  ? -18.558 -8.965  -5.711  1.00 0.00 ? 29  LEU A CG   1  
ATOM 459   C CD1  . LEU A 1 29  ? -17.597 -7.816  -5.488  1.00 0.00 ? 29  LEU A CD1  1  
ATOM 460   C CD2  . LEU A 1 29  ? -18.515 -9.438  -7.158  1.00 0.00 ? 29  LEU A CD2  1  
ATOM 461   H H    . LEU A 1 29  ? -16.093 -9.745  -6.414  1.00 0.00 ? 29  LEU A H    1  
ATOM 462   H HA   . LEU A 1 29  ? -16.630 -11.214 -3.929  1.00 0.00 ? 29  LEU A HA   1  
ATOM 463   H HB2  . LEU A 1 29  ? -19.115 -10.809 -4.801  1.00 0.00 ? 29  LEU A HB2  1  
ATOM 464   H HB3  . LEU A 1 29  ? -18.295 -9.700  -3.727  1.00 0.00 ? 29  LEU A HB3  1  
ATOM 465   H HG   . LEU A 1 29  ? -19.547 -8.585  -5.526  1.00 0.00 ? 29  LEU A HG   1  
ATOM 466   H HD11 . LEU A 1 29  ? -17.494 -7.631  -4.430  1.00 0.00 ? 29  LEU A HD11 1  
ATOM 467   H HD12 . LEU A 1 29  ? -17.985 -6.935  -5.972  1.00 0.00 ? 29  LEU A HD12 1  
ATOM 468   H HD13 . LEU A 1 29  ? -16.635 -8.057  -5.908  1.00 0.00 ? 29  LEU A HD13 1  
ATOM 469   H HD21 . LEU A 1 29  ? -18.584 -8.581  -7.819  1.00 0.00 ? 29  LEU A HD21 1  
ATOM 470   H HD22 . LEU A 1 29  ? -19.348 -10.100 -7.342  1.00 0.00 ? 29  LEU A HD22 1  
ATOM 471   H HD23 . LEU A 1 29  ? -17.591 -9.961  -7.343  1.00 0.00 ? 29  LEU A HD23 1  
ATOM 472   N N    . LYS A 1 30  ? -16.760 -13.263 -5.266  1.00 0.00 ? 30  LYS A N    1  
ATOM 473   C CA   . LYS A 1 30  ? -16.918 -14.536 -5.957  1.00 0.00 ? 30  LYS A CA   1  
ATOM 474   C C    . LYS A 1 30  ? -18.313 -15.108 -5.723  1.00 0.00 ? 30  LYS A C    1  
ATOM 475   O O    . LYS A 1 30  ? -19.005 -14.717 -4.783  1.00 0.00 ? 30  LYS A O    1  
ATOM 476   C CB   . LYS A 1 30  ? -15.855 -15.532 -5.485  1.00 0.00 ? 30  LYS A CB   1  
ATOM 477   C CG   . LYS A 1 30  ? -14.868 -15.927 -6.571  1.00 0.00 ? 30  LYS A CG   1  
ATOM 478   C CD   . LYS A 1 30  ? -13.507 -16.274 -5.988  1.00 0.00 ? 30  LYS A CD   1  
ATOM 479   C CE   . LYS A 1 30  ? -12.809 -17.352 -6.802  1.00 0.00 ? 30  LYS A CE   1  
ATOM 480   N NZ   . LYS A 1 30  ? -11.376 -17.025 -7.043  1.00 0.00 ? 30  LYS A NZ   1  
ATOM 481   H H    . LYS A 1 30  ? -16.269 -13.229 -4.423  1.00 0.00 ? 30  LYS A H    1  
ATOM 482   H HA   . LYS A 1 30  ? -16.788 -14.358 -7.014  1.00 0.00 ? 30  LYS A HA   1  
ATOM 483   H HB2  . LYS A 1 30  ? -15.301 -15.089 -4.670  1.00 0.00 ? 30  LYS A HB2  1  
ATOM 484   H HB3  . LYS A 1 30  ? -16.344 -16.427 -5.130  1.00 0.00 ? 30  LYS A HB3  1  
ATOM 485   H HG2  . LYS A 1 30  ? -15.252 -16.788 -7.098  1.00 0.00 ? 30  LYS A HG2  1  
ATOM 486   H HG3  . LYS A 1 30  ? -14.755 -15.102 -7.259  1.00 0.00 ? 30  LYS A HG3  1  
ATOM 487   H HD2  . LYS A 1 30  ? -12.892 -15.387 -5.982  1.00 0.00 ? 30  LYS A HD2  1  
ATOM 488   H HD3  . LYS A 1 30  ? -13.640 -16.629 -4.976  1.00 0.00 ? 30  LYS A HD3  1  
ATOM 489   H HE2  . LYS A 1 30  ? -12.869 -18.287 -6.265  1.00 0.00 ? 30  LYS A HE2  1  
ATOM 490   H HE3  . LYS A 1 30  ? -13.312 -17.451 -7.753  1.00 0.00 ? 30  LYS A HE3  1  
ATOM 491   H HZ1  . LYS A 1 30  ? -10.798 -17.889 -6.988  1.00 0.00 ? 30  LYS A HZ1  1  
ATOM 492   H HZ2  . LYS A 1 30  ? -11.037 -16.349 -6.329  1.00 0.00 ? 30  LYS A HZ2  1  
ATOM 493   H HZ3  . LYS A 1 30  ? -11.259 -16.603 -7.987  1.00 0.00 ? 30  LYS A HZ3  1  
ATOM 494   N N    . ASN A 1 31  ? -18.722 -16.033 -6.585  1.00 0.00 ? 31  ASN A N    1  
ATOM 495   C CA   . ASN A 1 31  ? -20.036 -16.656 -6.471  1.00 0.00 ? 31  ASN A CA   1  
ATOM 496   C C    . ASN A 1 31  ? -19.911 -18.164 -6.281  1.00 0.00 ? 31  ASN A C    1  
ATOM 497   O O    . ASN A 1 31  ? -19.164 -18.830 -6.997  1.00 0.00 ? 31  ASN A O    1  
ATOM 498   C CB   . ASN A 1 31  ? -20.875 -16.354 -7.714  1.00 0.00 ? 31  ASN A CB   1  
ATOM 499   C CG   . ASN A 1 31  ? -20.119 -16.620 -9.000  1.00 0.00 ? 31  ASN A CG   1  
ATOM 500   O OD1  . ASN A 1 31  ? -20.275 -17.673 -9.619  1.00 0.00 ? 31  ASN A OD1  1  
ATOM 501   N ND2  . ASN A 1 31  ? -19.292 -15.665 -9.410  1.00 0.00 ? 31  ASN A ND2  1  
ATOM 502   H H    . ASN A 1 31  ? -18.126 -16.303 -7.315  1.00 0.00 ? 31  ASN A H    1  
ATOM 503   H HA   . ASN A 1 31  ? -20.527 -16.236 -5.606  1.00 0.00 ? 31  ASN A HA   1  
ATOM 504   H HB2  . ASN A 1 31  ? -21.759 -16.973 -7.703  1.00 0.00 ? 31  ASN A HB2  1  
ATOM 505   H HB3  . ASN A 1 31  ? -21.168 -15.314 -7.699  1.00 0.00 ? 31  ASN A HB3  1  
ATOM 506   H HD21 . ASN A 1 31  ? -19.217 -14.853 -8.866  1.00 0.00 ? 31  ASN A HD21 1  
ATOM 507   H HD22 . ASN A 1 31  ? -18.790 -15.811 -10.239 1.00 0.00 ? 31  ASN A HD22 1  
ATOM 508   N N    . HIS A 1 32  ? -20.650 -18.696 -5.313  1.00 0.00 ? 32  HIS A N    1  
ATOM 509   C CA   . HIS A 1 32  ? -20.626 -20.126 -5.029  1.00 0.00 ? 32  HIS A CA   1  
ATOM 510   C C    . HIS A 1 32  ? -21.927 -20.789 -5.470  1.00 0.00 ? 32  HIS A C    1  
ATOM 511   O O    . HIS A 1 32  ? -21.944 -21.583 -6.410  1.00 0.00 ? 32  HIS A O    1  
ATOM 512   C CB   . HIS A 1 32  ? -20.395 -20.369 -3.536  1.00 0.00 ? 32  HIS A CB   1  
ATOM 513   C CG   . HIS A 1 32  ? -19.489 -21.527 -3.252  1.00 0.00 ? 32  HIS A CG   1  
ATOM 514   N ND1  . HIS A 1 32  ? -19.891 -22.842 -3.360  1.00 0.00 ? 32  HIS A ND1  1  
ATOM 515   C CD2  . HIS A 1 32  ? -18.192 -21.564 -2.863  1.00 0.00 ? 32  HIS A CD2  1  
ATOM 516   C CE1  . HIS A 1 32  ? -18.882 -23.636 -3.050  1.00 0.00 ? 32  HIS A CE1  1  
ATOM 517   N NE2  . HIS A 1 32  ? -17.840 -22.886 -2.745  1.00 0.00 ? 32  HIS A NE2  1  
ATOM 518   H H    . HIS A 1 32  ? -21.227 -18.113 -4.777  1.00 0.00 ? 32  HIS A H    1  
ATOM 519   H HA   . HIS A 1 32  ? -19.809 -20.561 -5.586  1.00 0.00 ? 32  HIS A HA   1  
ATOM 520   H HB2  . HIS A 1 32  ? -19.951 -19.487 -3.099  1.00 0.00 ? 32  HIS A HB2  1  
ATOM 521   H HB3  . HIS A 1 32  ? -21.344 -20.563 -3.059  1.00 0.00 ? 32  HIS A HB3  1  
ATOM 522   H HD1  . HIS A 1 32  ? -20.784 -23.148 -3.625  1.00 0.00 ? 32  HIS A HD1  1  
ATOM 523   H HD2  . HIS A 1 32  ? -17.553 -20.711 -2.680  1.00 0.00 ? 32  HIS A HD2  1  
ATOM 524   H HE1  . HIS A 1 32  ? -18.905 -24.716 -3.047  1.00 0.00 ? 32  HIS A HE1  1  
ATOM 525   H HE2  . HIS A 1 32  ? -16.987 -23.218 -2.396  1.00 0.00 ? 32  HIS A HE2  1  
ATOM 526   N N    . SER A 1 33  ? -23.017 -20.453 -4.787  1.00 0.00 ? 33  SER A N    1  
ATOM 527   C CA   . SER A 1 33  ? -24.325 -21.013 -5.110  1.00 0.00 ? 33  SER A CA   1  
ATOM 528   C C    . SER A 1 33  ? -25.015 -20.185 -6.189  1.00 0.00 ? 33  SER A C    1  
ATOM 529   O O    . SER A 1 33  ? -25.151 -20.624 -7.331  1.00 0.00 ? 33  SER A O    1  
ATOM 530   C CB   . SER A 1 33  ? -25.201 -21.078 -3.857  1.00 0.00 ? 33  SER A CB   1  
ATOM 531   O OG   . SER A 1 33  ? -24.420 -20.962 -2.680  1.00 0.00 ? 33  SER A OG   1  
ATOM 532   H H    . SER A 1 33  ? -22.941 -19.813 -4.049  1.00 0.00 ? 33  SER A H    1  
ATOM 533   H HA   . SER A 1 33  ? -24.173 -22.015 -5.484  1.00 0.00 ? 33  SER A HA   1  
ATOM 534   H HB2  . SER A 1 33  ? -25.918 -20.271 -3.878  1.00 0.00 ? 33  SER A HB2  1  
ATOM 535   H HB3  . SER A 1 33  ? -25.725 -22.023 -3.835  1.00 0.00 ? 33  SER A HB3  1  
ATOM 536   H HG   . SER A 1 33  ? -24.985 -21.059 -1.909  1.00 0.00 ? 33  SER A HG   1  
ATOM 537   N N    . ILE A 1 34  ? -25.447 -18.983 -5.821  1.00 0.00 ? 34  ILE A N    1  
ATOM 538   C CA   . ILE A 1 34  ? -26.121 -18.092 -6.760  1.00 0.00 ? 34  ILE A CA   1  
ATOM 539   C C    . ILE A 1 34  ? -25.145 -17.565 -7.809  1.00 0.00 ? 34  ILE A C    1  
ATOM 540   O O    . ILE A 1 34  ? -23.952 -17.418 -7.542  1.00 0.00 ? 34  ILE A O    1  
ATOM 541   C CB   . ILE A 1 34  ? -26.799 -16.903 -6.039  1.00 0.00 ? 34  ILE A CB   1  
ATOM 542   C CG1  . ILE A 1 34  ? -25.762 -15.882 -5.550  1.00 0.00 ? 34  ILE A CG1  1  
ATOM 543   C CG2  . ILE A 1 34  ? -27.646 -17.400 -4.877  1.00 0.00 ? 34  ILE A CG2  1  
ATOM 544   C CD1  . ILE A 1 34  ? -24.873 -16.394 -4.437  1.00 0.00 ? 34  ILE A CD1  1  
ATOM 545   H H    . ILE A 1 34  ? -25.308 -18.689 -4.898  1.00 0.00 ? 34  ILE A H    1  
ATOM 546   H HA   . ILE A 1 34  ? -26.889 -18.665 -7.260  1.00 0.00 ? 34  ILE A HA   1  
ATOM 547   H HB   . ILE A 1 34  ? -27.459 -16.420 -6.745  1.00 0.00 ? 34  ILE A HB   1  
ATOM 548   H HG12 . ILE A 1 34  ? -25.126 -15.599 -6.375  1.00 0.00 ? 34  ILE A HG12 1  
ATOM 549   H HG13 . ILE A 1 34  ? -26.278 -15.007 -5.185  1.00 0.00 ? 34  ILE A HG13 1  
ATOM 550   H HG21 . ILE A 1 34  ? -27.723 -16.625 -4.130  1.00 0.00 ? 34  ILE A HG21 1  
ATOM 551   H HG22 . ILE A 1 34  ? -27.185 -18.275 -4.442  1.00 0.00 ? 34  ILE A HG22 1  
ATOM 552   H HG23 . ILE A 1 34  ? -28.633 -17.654 -5.234  1.00 0.00 ? 34  ILE A HG23 1  
ATOM 553   H HD11 . ILE A 1 34  ? -25.476 -16.905 -3.700  1.00 0.00 ? 34  ILE A HD11 1  
ATOM 554   H HD12 . ILE A 1 34  ? -24.364 -15.563 -3.972  1.00 0.00 ? 34  ILE A HD12 1  
ATOM 555   H HD13 . ILE A 1 34  ? -24.145 -17.080 -4.844  1.00 0.00 ? 34  ILE A HD13 1  
ATOM 556   N N    . VAL A 1 35  ? -25.657 -17.286 -9.003  1.00 0.00 ? 35  VAL A N    1  
ATOM 557   C CA   . VAL A 1 35  ? -24.825 -16.781 -10.089 1.00 0.00 ? 35  VAL A CA   1  
ATOM 558   C C    . VAL A 1 35  ? -25.129 -15.316 -10.394 1.00 0.00 ? 35  VAL A C    1  
ATOM 559   O O    . VAL A 1 35  ? -25.982 -15.011 -11.228 1.00 0.00 ? 35  VAL A O    1  
ATOM 560   C CB   . VAL A 1 35  ? -25.018 -17.610 -11.373 1.00 0.00 ? 35  VAL A CB   1  
ATOM 561   C CG1  . VAL A 1 35  ? -24.326 -18.958 -11.249 1.00 0.00 ? 35  VAL A CG1  1  
ATOM 562   C CG2  . VAL A 1 35  ? -26.498 -17.788 -11.676 1.00 0.00 ? 35  VAL A CG2  1  
ATOM 563   H H    . VAL A 1 35  ? -26.614 -17.426 -9.159  1.00 0.00 ? 35  VAL A H    1  
ATOM 564   H HA   . VAL A 1 35  ? -23.792 -16.867 -9.784  1.00 0.00 ? 35  VAL A HA   1  
ATOM 565   H HB   . VAL A 1 35  ? -24.566 -17.073 -12.195 1.00 0.00 ? 35  VAL A HB   1  
ATOM 566   H HG11 . VAL A 1 35  ? -24.927 -19.617 -10.639 1.00 0.00 ? 35  VAL A HG11 1  
ATOM 567   H HG12 . VAL A 1 35  ? -23.358 -18.825 -10.788 1.00 0.00 ? 35  VAL A HG12 1  
ATOM 568   H HG13 . VAL A 1 35  ? -24.201 -19.391 -12.230 1.00 0.00 ? 35  VAL A HG13 1  
ATOM 569   H HG21 . VAL A 1 35  ? -26.825 -18.753 -11.319 1.00 0.00 ? 35  VAL A HG21 1  
ATOM 570   H HG22 . VAL A 1 35  ? -26.657 -17.725 -12.742 1.00 0.00 ? 35  VAL A HG22 1  
ATOM 571   H HG23 . VAL A 1 35  ? -27.063 -17.011 -11.181 1.00 0.00 ? 35  VAL A HG23 1  
ATOM 572   N N    . PRO A 1 36  ? -24.427 -14.384 -9.724  1.00 0.00 ? 36  PRO A N    1  
ATOM 573   C CA   . PRO A 1 36  ? -24.618 -12.949 -9.932  1.00 0.00 ? 36  PRO A CA   1  
ATOM 574   C C    . PRO A 1 36  ? -23.874 -12.449 -11.166 1.00 0.00 ? 36  PRO A C    1  
ATOM 575   O O    . PRO A 1 36  ? -22.866 -13.030 -11.568 1.00 0.00 ? 36  PRO A O    1  
ATOM 576   C CB   . PRO A 1 36  ? -24.021 -12.342 -8.666  1.00 0.00 ? 36  PRO A CB   1  
ATOM 577   C CG   . PRO A 1 36  ? -22.935 -13.286 -8.277  1.00 0.00 ? 36  PRO A CG   1  
ATOM 578   C CD   . PRO A 1 36  ? -23.385 -14.658 -8.715  1.00 0.00 ? 36  PRO A CD   1  
ATOM 579   H HA   . PRO A 1 36  ? -25.664 -12.691 -10.004 1.00 0.00 ? 36  PRO A HA   1  
ATOM 580   H HB2  . PRO A 1 36  ? -23.632 -11.357 -8.883  1.00 0.00 ? 36  PRO A HB2  1  
ATOM 581   H HB3  . PRO A 1 36  ? -24.779 -12.277 -7.900  1.00 0.00 ? 36  PRO A HB3  1  
ATOM 582   H HG2  . PRO A 1 36  ? -22.018 -13.016 -8.780  1.00 0.00 ? 36  PRO A HG2  1  
ATOM 583   H HG3  . PRO A 1 36  ? -22.796 -13.263 -7.206  1.00 0.00 ? 36  PRO A HG3  1  
ATOM 584   H HD2  . PRO A 1 36  ? -22.561 -15.201 -9.153  1.00 0.00 ? 36  PRO A HD2  1  
ATOM 585   H HD3  . PRO A 1 36  ? -23.795 -15.204 -7.878  1.00 0.00 ? 36  PRO A HD3  1  
ATOM 586   N N    . THR A 1 37  ? -24.371 -11.373 -11.768 1.00 0.00 ? 37  THR A N    1  
ATOM 587   C CA   . THR A 1 37  ? -23.737 -10.812 -12.957 1.00 0.00 ? 37  THR A CA   1  
ATOM 588   C C    . THR A 1 37  ? -23.569 -9.300  -12.839 1.00 0.00 ? 37  THR A C    1  
ATOM 589   O O    . THR A 1 37  ? -22.455 -8.784  -12.928 1.00 0.00 ? 37  THR A O    1  
ATOM 590   C CB   . THR A 1 37  ? -24.539 -11.168 -14.214 1.00 0.00 ? 37  THR A CB   1  
ATOM 591   O OG1  . THR A 1 37  ? -23.840 -10.779 -15.382 1.00 0.00 ? 37  THR A OG1  1  
ATOM 592   C CG2  . THR A 1 37  ? -25.913 -10.536 -14.275 1.00 0.00 ? 37  THR A CG2  1  
ATOM 593   H H    . THR A 1 37  ? -25.177 -10.949 -11.406 1.00 0.00 ? 37  THR A H    1  
ATOM 594   H HA   . THR A 1 37  ? -22.756 -11.256 -13.038 1.00 0.00 ? 37  THR A HA   1  
ATOM 595   H HB   . THR A 1 37  ? -24.673 -12.236 -14.242 1.00 0.00 ? 37  THR A HB   1  
ATOM 596   H HG1  . THR A 1 37  ? -24.342 -11.039 -16.158 1.00 0.00 ? 37  THR A HG1  1  
ATOM 597   H HG21 . THR A 1 37  ? -26.412 -10.666 -13.326 1.00 0.00 ? 37  THR A HG21 1  
ATOM 598   H HG22 . THR A 1 37  ? -26.492 -11.010 -15.053 1.00 0.00 ? 37  THR A HG22 1  
ATOM 599   H HG23 . THR A 1 37  ? -25.816 -9.482  -14.490 1.00 0.00 ? 37  THR A HG23 1  
ATOM 600   N N    . HIS A 1 38  ? -24.674 -8.592  -12.638 1.00 0.00 ? 38  HIS A N    1  
ATOM 601   C CA   . HIS A 1 38  ? -24.630 -7.140  -12.509 1.00 0.00 ? 38  HIS A CA   1  
ATOM 602   C C    . HIS A 1 38  ? -24.454 -6.706  -11.058 1.00 0.00 ? 38  HIS A C    1  
ATOM 603   O O    . HIS A 1 38  ? -24.923 -7.365  -10.132 1.00 0.00 ? 38  HIS A O    1  
ATOM 604   C CB   . HIS A 1 38  ? -25.867 -6.499  -13.119 1.00 0.00 ? 38  HIS A CB   1  
ATOM 605   C CG   . HIS A 1 38  ? -27.120 -6.701  -12.335 1.00 0.00 ? 38  HIS A CG   1  
ATOM 606   N ND1  . HIS A 1 38  ? -27.293 -7.721  -11.426 1.00 0.00 ? 38  HIS A ND1  1  
ATOM 607   C CD2  . HIS A 1 38  ? -28.275 -6.006  -12.344 1.00 0.00 ? 38  HIS A CD2  1  
ATOM 608   C CE1  . HIS A 1 38  ? -28.505 -7.644  -10.911 1.00 0.00 ? 38  HIS A CE1  1  
ATOM 609   N NE2  . HIS A 1 38  ? -29.122 -6.610  -11.450 1.00 0.00 ? 38  HIS A NE2  1  
ATOM 610   H H    . HIS A 1 38  ? -25.532 -9.055  -12.572 1.00 0.00 ? 38  HIS A H    1  
ATOM 611   H HA   . HIS A 1 38  ? -23.782 -6.792  -13.064 1.00 0.00 ? 38  HIS A HA   1  
ATOM 612   H HB2  . HIS A 1 38  ? -25.695 -5.439  -13.207 1.00 0.00 ? 38  HIS A HB2  1  
ATOM 613   H HB3  . HIS A 1 38  ? -26.020 -6.907  -14.102 1.00 0.00 ? 38  HIS A HB3  1  
ATOM 614   H HD1  . HIS A 1 38  ? -26.625 -8.397  -11.189 1.00 0.00 ? 38  HIS A HD1  1  
ATOM 615   H HD2  . HIS A 1 38  ? -28.487 -5.136  -12.945 1.00 0.00 ? 38  HIS A HD2  1  
ATOM 616   H HE1  . HIS A 1 38  ? -28.921 -8.313  -10.172 1.00 0.00 ? 38  HIS A HE1  1  
ATOM 617   H HE2  . HIS A 1 38  ? -29.991 -6.258  -11.162 1.00 0.00 ? 38  HIS A HE2  1  
ATOM 618   N N    . TYR A 1 39  ? -23.770 -5.585  -10.882 1.00 0.00 ? 39  TYR A N    1  
ATOM 619   C CA   . TYR A 1 39  ? -23.512 -5.026  -9.556  1.00 0.00 ? 39  TYR A CA   1  
ATOM 620   C C    . TYR A 1 39  ? -23.797 -3.531  -9.543  1.00 0.00 ? 39  TYR A C    1  
ATOM 621   O O    . TYR A 1 39  ? -24.085 -2.941  -10.582 1.00 0.00 ? 39  TYR A O    1  
ATOM 622   C CB   . TYR A 1 39  ? -22.048 -5.234  -9.154  1.00 0.00 ? 39  TYR A CB   1  
ATOM 623   C CG   . TYR A 1 39  ? -21.508 -6.636  -9.348  1.00 0.00 ? 39  TYR A CG   1  
ATOM 624   C CD1  . TYR A 1 39  ? -21.719 -7.624  -8.400  1.00 0.00 ? 39  TYR A CD1  1  
ATOM 625   C CD2  . TYR A 1 39  ? -20.749 -6.954  -10.465 1.00 0.00 ? 39  TYR A CD2  1  
ATOM 626   C CE1  . TYR A 1 39  ? -21.190 -8.891  -8.558  1.00 0.00 ? 39  TYR A CE1  1  
ATOM 627   C CE2  . TYR A 1 39  ? -20.218 -8.217  -10.636 1.00 0.00 ? 39  TYR A CE2  1  
ATOM 628   C CZ   . TYR A 1 39  ? -20.439 -9.183  -9.678  1.00 0.00 ? 39  TYR A CZ   1  
ATOM 629   O OH   . TYR A 1 39  ? -19.911 -10.443 -9.839  1.00 0.00 ? 39  TYR A OH   1  
ATOM 630   H H    . TYR A 1 39  ? -23.434 -5.118  -11.673 1.00 0.00 ? 39  TYR A H    1  
ATOM 631   H HA   . TYR A 1 39  ? -24.164 -5.518  -8.838  1.00 0.00 ? 39  TYR A HA   1  
ATOM 632   H HB2  . TYR A 1 39  ? -21.427 -4.570  -9.736  1.00 0.00 ? 39  TYR A HB2  1  
ATOM 633   H HB3  . TYR A 1 39  ? -21.937 -4.977  -8.119  1.00 0.00 ? 39  TYR A HB3  1  
ATOM 634   H HD1  . TYR A 1 39  ? -22.307 -7.394  -7.527  1.00 0.00 ? 39  TYR A HD1  1  
ATOM 635   H HD2  . TYR A 1 39  ? -20.583 -6.198  -11.216 1.00 0.00 ? 39  TYR A HD2  1  
ATOM 636   H HE1  . TYR A 1 39  ? -21.364 -9.646  -7.806  1.00 0.00 ? 39  TYR A HE1  1  
ATOM 637   H HE2  . TYR A 1 39  ? -19.619 -8.437  -11.511 1.00 0.00 ? 39  TYR A HE2  1  
ATOM 638   H HH   . TYR A 1 39  ? -20.584 -11.100 -9.646  1.00 0.00 ? 39  TYR A HH   1  
ATOM 639   N N    . THR A 1 40  ? -23.679 -2.914  -8.369  1.00 0.00 ? 40  THR A N    1  
ATOM 640   C CA   . THR A 1 40  ? -23.890 -1.479  -8.234  1.00 0.00 ? 40  THR A CA   1  
ATOM 641   C C    . THR A 1 40  ? -22.876 -0.883  -7.277  1.00 0.00 ? 40  THR A C    1  
ATOM 642   O O    . THR A 1 40  ? -23.051 -0.929  -6.059  1.00 0.00 ? 40  THR A O    1  
ATOM 643   C CB   . THR A 1 40  ? -25.302 -1.170  -7.752  1.00 0.00 ? 40  THR A CB   1  
ATOM 644   O OG1  . THR A 1 40  ? -26.240 -1.349  -8.801  1.00 0.00 ? 40  THR A OG1  1  
ATOM 645   C CG2  . THR A 1 40  ? -25.462 0.244   -7.222  1.00 0.00 ? 40  THR A CG2  1  
ATOM 646   H H    . THR A 1 40  ? -23.413 -3.418  -7.572  1.00 0.00 ? 40  THR A H    1  
ATOM 647   H HA   . THR A 1 40  ? -23.747 -1.031  -9.194  1.00 0.00 ? 40  THR A HA   1  
ATOM 648   H HB   . THR A 1 40  ? -25.545 -1.847  -6.960  1.00 0.00 ? 40  THR A HB   1  
ATOM 649   H HG1  . THR A 1 40  ? -27.082 -0.960  -8.552  1.00 0.00 ? 40  THR A HG1  1  
ATOM 650   H HG21 . THR A 1 40  ? -25.221 0.950   -8.002  1.00 0.00 ? 40  THR A HG21 1  
ATOM 651   H HG22 . THR A 1 40  ? -24.793 0.396   -6.381  1.00 0.00 ? 40  THR A HG22 1  
ATOM 652   H HG23 . THR A 1 40  ? -26.481 0.394   -6.901  1.00 0.00 ? 40  THR A HG23 1  
ATOM 653   N N    . LEU A 1 41  ? -21.825 -0.311  -7.833  1.00 0.00 ? 41  LEU A N    1  
ATOM 654   C CA   . LEU A 1 41  ? -20.800 0.309   -7.020  1.00 0.00 ? 41  LEU A CA   1  
ATOM 655   C C    . LEU A 1 41  ? -21.328 1.596   -6.419  1.00 0.00 ? 41  LEU A C    1  
ATOM 656   O O    . LEU A 1 41  ? -21.519 2.593   -7.122  1.00 0.00 ? 41  LEU A O    1  
ATOM 657   C CB   . LEU A 1 41  ? -19.546 0.604   -7.842  1.00 0.00 ? 41  LEU A CB   1  
ATOM 658   C CG   . LEU A 1 41  ? -18.276 0.830   -7.016  1.00 0.00 ? 41  LEU A CG   1  
ATOM 659   C CD1  . LEU A 1 41  ? -17.576 -0.491  -6.731  1.00 0.00 ? 41  LEU A CD1  1  
ATOM 660   C CD2  . LEU A 1 41  ? -17.342 1.790   -7.734  1.00 0.00 ? 41  LEU A CD2  1  
ATOM 661   H H    . LEU A 1 41  ? -21.748 -0.295  -8.808  1.00 0.00 ? 41  LEU A H    1  
ATOM 662   H HA   . LEU A 1 41  ? -20.548 -0.374  -6.223  1.00 0.00 ? 41  LEU A HA   1  
ATOM 663   H HB2  . LEU A 1 41  ? -19.377 -0.222  -8.512  1.00 0.00 ? 41  LEU A HB2  1  
ATOM 664   H HB3  . LEU A 1 41  ? -19.727 1.491   -8.430  1.00 0.00 ? 41  LEU A HB3  1  
ATOM 665   H HG   . LEU A 1 41  ? -18.547 1.273   -6.068  1.00 0.00 ? 41  LEU A HG   1  
ATOM 666   H HD11 . LEU A 1 41  ? -18.289 -1.294  -6.796  1.00 0.00 ? 41  LEU A HD11 1  
ATOM 667   H HD12 . LEU A 1 41  ? -17.148 -0.471  -5.739  1.00 0.00 ? 41  LEU A HD12 1  
ATOM 668   H HD13 . LEU A 1 41  ? -16.790 -0.648  -7.457  1.00 0.00 ? 41  LEU A HD13 1  
ATOM 669   H HD21 . LEU A 1 41  ? -17.915 2.415   -8.402  1.00 0.00 ? 41  LEU A HD21 1  
ATOM 670   H HD22 . LEU A 1 41  ? -16.613 1.229   -8.299  1.00 0.00 ? 41  LEU A HD22 1  
ATOM 671   H HD23 . LEU A 1 41  ? -16.837 2.409   -7.009  1.00 0.00 ? 41  LEU A HD23 1  
ATOM 672   N N    . LEU A 1 42  ? -21.536 1.587   -5.113  1.00 0.00 ? 42  LEU A N    1  
ATOM 673   C CA   . LEU A 1 42  ? -22.009 2.784   -4.428  1.00 0.00 ? 42  LEU A CA   1  
ATOM 674   C C    . LEU A 1 42  ? -20.853 3.390   -3.652  1.00 0.00 ? 42  LEU A C    1  
ATOM 675   O O    . LEU A 1 42  ? -20.061 2.657   -3.070  1.00 0.00 ? 42  LEU A O    1  
ATOM 676   C CB   . LEU A 1 42  ? -23.155 2.462   -3.477  1.00 0.00 ? 42  LEU A CB   1  
ATOM 677   C CG   . LEU A 1 42  ? -24.160 1.434   -3.994  1.00 0.00 ? 42  LEU A CG   1  
ATOM 678   C CD1  . LEU A 1 42  ? -24.532 0.436   -2.907  1.00 0.00 ? 42  LEU A CD1  1  
ATOM 679   C CD2  . LEU A 1 42  ? -25.400 2.135   -4.509  1.00 0.00 ? 42  LEU A CD2  1  
ATOM 680   H H    . LEU A 1 42  ? -21.331 0.769   -4.586  1.00 0.00 ? 42  LEU A H    1  
ATOM 681   H HA   . LEU A 1 42  ? -22.354 3.487   -5.178  1.00 0.00 ? 42  LEU A HA   1  
ATOM 682   H HB2  . LEU A 1 42  ? -22.734 2.106   -2.553  1.00 0.00 ? 42  LEU A HB2  1  
ATOM 683   H HB3  . LEU A 1 42  ? -23.687 3.377   -3.279  1.00 0.00 ? 42  LEU A HB3  1  
ATOM 684   H HG   . LEU A 1 42  ? -23.720 0.892   -4.817  1.00 0.00 ? 42  LEU A HG   1  
ATOM 685   H HD11 . LEU A 1 42  ? -23.902 -0.436  -2.985  1.00 0.00 ? 42  LEU A HD11 1  
ATOM 686   H HD12 . LEU A 1 42  ? -25.565 0.143   -3.027  1.00 0.00 ? 42  LEU A HD12 1  
ATOM 687   H HD13 . LEU A 1 42  ? -24.397 0.892   -1.937  1.00 0.00 ? 42  LEU A HD13 1  
ATOM 688   H HD21 . LEU A 1 42  ? -26.079 2.315   -3.690  1.00 0.00 ? 42  LEU A HD21 1  
ATOM 689   H HD22 . LEU A 1 42  ? -25.882 1.515   -5.248  1.00 0.00 ? 42  LEU A HD22 1  
ATOM 690   H HD23 . LEU A 1 42  ? -25.114 3.076   -4.954  1.00 0.00 ? 42  LEU A HD23 1  
ATOM 691   N N    . TYR A 1 43  ? -20.712 4.712   -3.670  1.00 0.00 ? 43  TYR A N    1  
ATOM 692   C CA   . TYR A 1 43  ? -19.583 5.326   -2.974  1.00 0.00 ? 43  TYR A CA   1  
ATOM 693   C C    . TYR A 1 43  ? -19.915 6.655   -2.284  1.00 0.00 ? 43  TYR A C    1  
ATOM 694   O O    . TYR A 1 43  ? -20.797 7.394   -2.716  1.00 0.00 ? 43  TYR A O    1  
ATOM 695   C CB   . TYR A 1 43  ? -18.456 5.565   -3.966  1.00 0.00 ? 43  TYR A CB   1  
ATOM 696   C CG   . TYR A 1 43  ? -18.665 6.776   -4.843  1.00 0.00 ? 43  TYR A CG   1  
ATOM 697   C CD1  . TYR A 1 43  ? -18.384 8.036   -4.351  1.00 0.00 ? 43  TYR A CD1  1  
ATOM 698   C CD2  . TYR A 1 43  ? -19.126 6.668   -6.149  1.00 0.00 ? 43  TYR A CD2  1  
ATOM 699   C CE1  . TYR A 1 43  ? -18.553 9.160   -5.122  1.00 0.00 ? 43  TYR A CE1  1  
ATOM 700   C CE2  . TYR A 1 43  ? -19.301 7.795   -6.934  1.00 0.00 ? 43  TYR A CE2  1  
ATOM 701   C CZ   . TYR A 1 43  ? -19.012 9.039   -6.415  1.00 0.00 ? 43  TYR A CZ   1  
ATOM 702   O OH   . TYR A 1 43  ? -19.182 10.163  -7.190  1.00 0.00 ? 43  TYR A OH   1  
ATOM 703   H H    . TYR A 1 43  ? -21.339 5.264   -4.186  1.00 0.00 ? 43  TYR A H    1  
ATOM 704   H HA   . TYR A 1 43  ? -19.235 4.616   -2.239  1.00 0.00 ? 43  TYR A HA   1  
ATOM 705   H HB2  . TYR A 1 43  ? -17.539 5.717   -3.416  1.00 0.00 ? 43  TYR A HB2  1  
ATOM 706   H HB3  . TYR A 1 43  ? -18.353 4.697   -4.596  1.00 0.00 ? 43  TYR A HB3  1  
ATOM 707   H HD1  . TYR A 1 43  ? -18.024 8.132   -3.337  1.00 0.00 ? 43  TYR A HD1  1  
ATOM 708   H HD2  . TYR A 1 43  ? -19.352 5.691   -6.550  1.00 0.00 ? 43  TYR A HD2  1  
ATOM 709   H HE1  . TYR A 1 43  ? -18.317 10.128  -4.707  1.00 0.00 ? 43  TYR A HE1  1  
ATOM 710   H HE2  . TYR A 1 43  ? -19.659 7.699   -7.947  1.00 0.00 ? 43  TYR A HE2  1  
ATOM 711   H HH   . TYR A 1 43  ? -18.325 10.493  -7.469  1.00 0.00 ? 43  TYR A HH   1  
ATOM 712   N N    . THR A 1 44  ? -19.149 6.959   -1.229  1.00 0.00 ? 44  THR A N    1  
ATOM 713   C CA   . THR A 1 44  ? -19.289 8.206   -0.475  1.00 0.00 ? 44  THR A CA   1  
ATOM 714   C C    . THR A 1 44  ? -17.956 8.587   0.190   1.00 0.00 ? 44  THR A C    1  
ATOM 715   O O    . THR A 1 44  ? -16.934 7.933   -0.023  1.00 0.00 ? 44  THR A O    1  
ATOM 716   C CB   . THR A 1 44  ? -20.383 8.085   0.588   1.00 0.00 ? 44  THR A CB   1  
ATOM 717   O OG1  . THR A 1 44  ? -20.487 9.281   1.334   1.00 0.00 ? 44  THR A OG1  1  
ATOM 718   C CG2  . THR A 1 44  ? -20.154 6.955   1.566   1.00 0.00 ? 44  THR A CG2  1  
ATOM 719   H H    . THR A 1 44  ? -18.453 6.332   -0.961  1.00 0.00 ? 44  THR A H    1  
ATOM 720   H HA   . THR A 1 44  ? -19.561 8.984   -1.173  1.00 0.00 ? 44  THR A HA   1  
ATOM 721   H HB   . THR A 1 44  ? -21.328 7.913   0.099   1.00 0.00 ? 44  THR A HB   1  
ATOM 722   H HG1  . THR A 1 44  ? -20.799 9.989   0.764   1.00 0.00 ? 44  THR A HG1  1  
ATOM 723   H HG21 . THR A 1 44  ? -21.088 6.448   1.754   1.00 0.00 ? 44  THR A HG21 1  
ATOM 724   H HG22 . THR A 1 44  ? -19.773 7.355   2.491   1.00 0.00 ? 44  THR A HG22 1  
ATOM 725   H HG23 . THR A 1 44  ? -19.443 6.256   1.152   1.00 0.00 ? 44  THR A HG23 1  
ATOM 726   N N    . ILE A 1 45  ? -17.982 9.642   1.002   1.00 0.00 ? 45  ILE A N    1  
ATOM 727   C CA   . ILE A 1 45  ? -16.782 10.119  1.711   1.00 0.00 ? 45  ILE A CA   1  
ATOM 728   C C    . ILE A 1 45  ? -16.986 10.076  3.225   1.00 0.00 ? 45  ILE A C    1  
ATOM 729   O O    . ILE A 1 45  ? -18.022 10.494  3.734   1.00 0.00 ? 45  ILE A O    1  
ATOM 730   C CB   . ILE A 1 45  ? -16.389 11.553  1.292   1.00 0.00 ? 45  ILE A CB   1  
ATOM 731   C CG1  . ILE A 1 45  ? -17.574 12.283  0.652   1.00 0.00 ? 45  ILE A CG1  1  
ATOM 732   C CG2  . ILE A 1 45  ? -15.204 11.508  0.334   1.00 0.00 ? 45  ILE A CG2  1  
ATOM 733   C CD1  . ILE A 1 45  ? -17.389 13.783  0.575   1.00 0.00 ? 45  ILE A CD1  1  
ATOM 734   H H    . ILE A 1 45  ? -18.833 10.112  1.134   1.00 0.00 ? 45  ILE A H    1  
ATOM 735   H HA   . ILE A 1 45  ? -15.952 9.467   1.459   1.00 0.00 ? 45  ILE A HA   1  
ATOM 736   H HB   . ILE A 1 45  ? -16.080 12.091  2.177   1.00 0.00 ? 45  ILE A HB   1  
ATOM 737   H HG12 . ILE A 1 45  ? -17.715 11.915  -0.354  1.00 0.00 ? 45  ILE A HG12 1  
ATOM 738   H HG13 . ILE A 1 45  ? -18.465 12.087  1.231   1.00 0.00 ? 45  ILE A HG13 1  
ATOM 739   H HG21 . ILE A 1 45  ? -14.785 12.498  0.231   1.00 0.00 ? 45  ILE A HG21 1  
ATOM 740   H HG22 . ILE A 1 45  ? -15.536 11.155  -0.633  1.00 0.00 ? 45  ILE A HG22 1  
ATOM 741   H HG23 . ILE A 1 45  ? -14.449 10.835  0.724   1.00 0.00 ? 45  ILE A HG23 1  
ATOM 742   H HD11 . ILE A 1 45  ? -18.354 14.261  0.497   1.00 0.00 ? 45  ILE A HD11 1  
ATOM 743   H HD12 . ILE A 1 45  ? -16.794 14.029  -0.292  1.00 0.00 ? 45  ILE A HD12 1  
ATOM 744   H HD13 . ILE A 1 45  ? -16.887 14.130  1.466   1.00 0.00 ? 45  ILE A HD13 1  
ATOM 745   N N    . MET A 1 46  ? -16.003 9.512   3.922   1.00 0.00 ? 46  MET A N    1  
ATOM 746   C CA   . MET A 1 46  ? -16.063 9.342   5.379   1.00 0.00 ? 46  MET A CA   1  
ATOM 747   C C    . MET A 1 46  ? -16.709 10.537  6.088   1.00 0.00 ? 46  MET A C    1  
ATOM 748   O O    . MET A 1 46  ? -17.578 10.351  6.937   1.00 0.00 ? 46  MET A O    1  
ATOM 749   C CB   . MET A 1 46  ? -14.661 9.094   5.941   1.00 0.00 ? 46  MET A CB   1  
ATOM 750   C CG   . MET A 1 46  ? -13.569 9.846   5.205   1.00 0.00 ? 46  MET A CG   1  
ATOM 751   S SD   . MET A 1 46  ? -12.156 10.231  6.258   1.00 0.00 ? 46  MET A SD   1  
ATOM 752   C CE   . MET A 1 46  ? -11.900 8.656   7.071   1.00 0.00 ? 46  MET A CE   1  
ATOM 753   H H    . MET A 1 46  ? -15.244 9.142   3.425   1.00 0.00 ? 46  MET A H    1  
ATOM 754   H HA   . MET A 1 46  ? -16.666 8.468   5.574   1.00 0.00 ? 46  MET A HA   1  
ATOM 755   H HB2  . MET A 1 46  ? -14.637 9.395   6.975   1.00 0.00 ? 46  MET A HB2  1  
ATOM 756   H HB3  . MET A 1 46  ? -14.443 8.038   5.878   1.00 0.00 ? 46  MET A HB3  1  
ATOM 757   H HG2  . MET A 1 46  ? -13.233 9.238   4.382   1.00 0.00 ? 46  MET A HG2  1  
ATOM 758   H HG3  . MET A 1 46  ? -13.979 10.768  4.824   1.00 0.00 ? 46  MET A HG3  1  
ATOM 759   H HE1  . MET A 1 46  ? -12.146 8.748   8.119   1.00 0.00 ? 46  MET A HE1  1  
ATOM 760   H HE2  . MET A 1 46  ? -10.866 8.361   6.968   1.00 0.00 ? 46  MET A HE2  1  
ATOM 761   H HE3  . MET A 1 46  ? -12.534 7.909   6.618   1.00 0.00 ? 46  MET A HE3  1  
ATOM 762   N N    . SER A 1 47  ? -16.281 11.754  5.763   1.00 0.00 ? 47  SER A N    1  
ATOM 763   C CA   . SER A 1 47  ? -16.836 12.949  6.403   1.00 0.00 ? 47  SER A CA   1  
ATOM 764   C C    . SER A 1 47  ? -18.320 13.128  6.068   1.00 0.00 ? 47  SER A C    1  
ATOM 765   O O    . SER A 1 47  ? -19.052 13.807  6.789   1.00 0.00 ? 47  SER A O    1  
ATOM 766   C CB   . SER A 1 47  ? -16.054 14.190  5.969   1.00 0.00 ? 47  SER A CB   1  
ATOM 767   O OG   . SER A 1 47  ? -15.937 15.118  7.034   1.00 0.00 ? 47  SER A OG   1  
ATOM 768   H H    . SER A 1 47  ? -15.565 11.858  5.103   1.00 0.00 ? 47  SER A H    1  
ATOM 769   H HA   . SER A 1 47  ? -16.734 12.828  7.471   1.00 0.00 ? 47  SER A HA   1  
ATOM 770   H HB2  . SER A 1 47  ? -15.063 13.897  5.654   1.00 0.00 ? 47  SER A HB2  1  
ATOM 771   H HB3  . SER A 1 47  ? -16.566 14.667  5.147   1.00 0.00 ? 47  SER A HB3  1  
ATOM 772   H HG   . SER A 1 47  ? -16.807 15.305  7.393   1.00 0.00 ? 47  SER A HG   1  
ATOM 773   N N    . LYS A 1 48  ? -18.753 12.510  4.976   1.00 0.00 ? 48  LYS A N    1  
ATOM 774   C CA   . LYS A 1 48  ? -20.145 12.590  4.541   1.00 0.00 ? 48  LYS A CA   1  
ATOM 775   C C    . LYS A 1 48  ? -20.635 11.228  4.055   1.00 0.00 ? 48  LYS A C    1  
ATOM 776   O O    . LYS A 1 48  ? -20.945 11.054  2.878   1.00 0.00 ? 48  LYS A O    1  
ATOM 777   C CB   . LYS A 1 48  ? -20.299 13.631  3.429   1.00 0.00 ? 48  LYS A CB   1  
ATOM 778   C CG   . LYS A 1 48  ? -20.004 15.052  3.884   1.00 0.00 ? 48  LYS A CG   1  
ATOM 779   C CD   . LYS A 1 48  ? -19.662 15.955  2.709   1.00 0.00 ? 48  LYS A CD   1  
ATOM 780   C CE   . LYS A 1 48  ? -18.842 17.158  3.150   1.00 0.00 ? 48  LYS A CE   1  
ATOM 781   N NZ   . LYS A 1 48  ? -19.421 18.437  2.654   1.00 0.00 ? 48  LYS A NZ   1  
ATOM 782   H H    . LYS A 1 48  ? -18.115 11.985  4.455   1.00 0.00 ? 48  LYS A H    1  
ATOM 783   H HA   . LYS A 1 48  ? -20.740 12.891  5.390   1.00 0.00 ? 48  LYS A HA   1  
ATOM 784   H HB2  . LYS A 1 48  ? -19.624 13.385  2.624   1.00 0.00 ? 48  LYS A HB2  1  
ATOM 785   H HB3  . LYS A 1 48  ? -21.313 13.598  3.059   1.00 0.00 ? 48  LYS A HB3  1  
ATOM 786   H HG2  . LYS A 1 48  ? -20.874 15.447  4.387   1.00 0.00 ? 48  LYS A HG2  1  
ATOM 787   H HG3  . LYS A 1 48  ? -19.168 15.034  4.568   1.00 0.00 ? 48  LYS A HG3  1  
ATOM 788   H HD2  . LYS A 1 48  ? -19.093 15.390  1.986   1.00 0.00 ? 48  LYS A HD2  1  
ATOM 789   H HD3  . LYS A 1 48  ? -20.580 16.303  2.257   1.00 0.00 ? 48  LYS A HD3  1  
ATOM 790   H HE2  . LYS A 1 48  ? -18.812 17.183  4.229   1.00 0.00 ? 48  LYS A HE2  1  
ATOM 791   H HE3  . LYS A 1 48  ? -17.839 17.054  2.765   1.00 0.00 ? 48  LYS A HE3  1  
ATOM 792   H HZ1  . LYS A 1 48  ? -20.349 18.605  3.094   1.00 0.00 ? 48  LYS A HZ1  1  
ATOM 793   H HZ2  . LYS A 1 48  ? -19.542 18.399  1.622   1.00 0.00 ? 48  LYS A HZ2  1  
ATOM 794   H HZ3  . LYS A 1 48  ? -18.790 19.230  2.888   1.00 0.00 ? 48  LYS A HZ3  1  
ATOM 795   N N    . PRO A 1 49  ? -20.704 10.240  4.965   1.00 0.00 ? 49  PRO A N    1  
ATOM 796   C CA   . PRO A 1 49  ? -21.148 8.880   4.634   1.00 0.00 ? 49  PRO A CA   1  
ATOM 797   C C    . PRO A 1 49  ? -22.597 8.824   4.175   1.00 0.00 ? 49  PRO A C    1  
ATOM 798   O O    . PRO A 1 49  ? -23.052 7.818   3.631   1.00 0.00 ? 49  PRO A O    1  
ATOM 799   C CB   . PRO A 1 49  ? -20.971 8.101   5.944   1.00 0.00 ? 49  PRO A CB   1  
ATOM 800   C CG   . PRO A 1 49  ? -20.084 8.948   6.793   1.00 0.00 ? 49  PRO A CG   1  
ATOM 801   C CD   . PRO A 1 49  ? -20.348 10.368  6.383   1.00 0.00 ? 49  PRO A CD   1  
ATOM 802   H HA   . PRO A 1 49  ? -20.532 8.453   3.874   1.00 0.00 ? 49  PRO A HA   1  
ATOM 803   H HB2  . PRO A 1 49  ? -21.935 7.952   6.409   1.00 0.00 ? 49  PRO A HB2  1  
ATOM 804   H HB3  . PRO A 1 49  ? -20.517 7.143   5.736   1.00 0.00 ? 49  PRO A HB3  1  
ATOM 805   H HG2  . PRO A 1 49  ? -20.330 8.808   7.835   1.00 0.00 ? 49  PRO A HG2  1  
ATOM 806   H HG3  . PRO A 1 49  ? -19.050 8.692   6.613   1.00 0.00 ? 49  PRO A HG3  1  
ATOM 807   H HD2  . PRO A 1 49  ? -21.165 10.782  6.948   1.00 0.00 ? 49  PRO A HD2  1  
ATOM 808   H HD3  . PRO A 1 49  ? -19.463 10.969  6.504   1.00 0.00 ? 49  PRO A HD3  1  
ATOM 809   N N    . GLU A 1 50  ? -23.310 9.909   4.397   1.00 0.00 ? 50  GLU A N    1  
ATOM 810   C CA   . GLU A 1 50  ? -24.712 10.002  4.010   1.00 0.00 ? 50  GLU A CA   1  
ATOM 811   C C    . GLU A 1 50  ? -24.855 10.405  2.543   1.00 0.00 ? 50  GLU A C    1  
ATOM 812   O O    . GLU A 1 50  ? -25.967 10.513  2.027   1.00 0.00 ? 50  GLU A O    1  
ATOM 813   C CB   . GLU A 1 50  ? -25.435 11.015  4.898   1.00 0.00 ? 50  GLU A CB   1  
ATOM 814   C CG   . GLU A 1 50  ? -26.494 10.393  5.794   1.00 0.00 ? 50  GLU A CG   1  
ATOM 815   C CD   . GLU A 1 50  ? -27.753 10.022  5.036   1.00 0.00 ? 50  GLU A CD   1  
ATOM 816   O OE1  . GLU A 1 50  ? -27.816 8.893   4.505   1.00 0.00 ? 50  GLU A OE1  1  
ATOM 817   O OE2  . GLU A 1 50  ? -28.678 10.860  4.973   1.00 0.00 ? 50  GLU A OE2  1  
ATOM 818   H H    . GLU A 1 50  ? -22.882 10.668  4.832   1.00 0.00 ? 50  GLU A H    1  
ATOM 819   H HA   . GLU A 1 50  ? -25.161 9.030   4.149   1.00 0.00 ? 50  GLU A HA   1  
ATOM 820   H HB2  . GLU A 1 50  ? -24.706 11.506  5.525   1.00 0.00 ? 50  GLU A HB2  1  
ATOM 821   H HB3  . GLU A 1 50  ? -25.912 11.752  4.270   1.00 0.00 ? 50  GLU A HB3  1  
ATOM 822   H HG2  . GLU A 1 50  ? -26.087 9.500   6.245   1.00 0.00 ? 50  GLU A HG2  1  
ATOM 823   H HG3  . GLU A 1 50  ? -26.752 11.101  6.568   1.00 0.00 ? 50  GLU A HG3  1  
ATOM 824   N N    . ASP A 1 51  ? -23.726 10.636  1.879   1.00 0.00 ? 51  ASP A N    1  
ATOM 825   C CA   . ASP A 1 51  ? -23.733 11.036  0.477   1.00 0.00 ? 51  ASP A CA   1  
ATOM 826   C C    . ASP A 1 51  ? -23.181 9.928   -0.420  1.00 0.00 ? 51  ASP A C    1  
ATOM 827   O O    . ASP A 1 51  ? -22.181 10.118  -1.113  1.00 0.00 ? 51  ASP A O    1  
ATOM 828   C CB   . ASP A 1 51  ? -22.912 12.315  0.295   1.00 0.00 ? 51  ASP A CB   1  
ATOM 829   C CG   . ASP A 1 51  ? -23.539 13.269  -0.703  1.00 0.00 ? 51  ASP A CG   1  
ATOM 830   O OD1  . ASP A 1 51  ? -23.326 13.080  -1.919  1.00 0.00 ? 51  ASP A OD1  1  
ATOM 831   O OD2  . ASP A 1 51  ? -24.242 14.205  -0.268  1.00 0.00 ? 51  ASP A OD2  1  
ATOM 832   H H    . ASP A 1 51  ? -22.868 10.542  2.340   1.00 0.00 ? 51  ASP A H    1  
ATOM 833   H HA   . ASP A 1 51  ? -24.756 11.234  0.195   1.00 0.00 ? 51  ASP A HA   1  
ATOM 834   H HB2  . ASP A 1 51  ? -22.829 12.822  1.246   1.00 0.00 ? 51  ASP A HB2  1  
ATOM 835   H HB3  . ASP A 1 51  ? -21.923 12.055  -0.054  1.00 0.00 ? 51  ASP A HB3  1  
ATOM 836   N N    . LEU A 1 52  ? -23.842 8.772   -0.414  1.00 0.00 ? 52  LEU A N    1  
ATOM 837   C CA   . LEU A 1 52  ? -23.413 7.647   -1.241  1.00 0.00 ? 52  LEU A CA   1  
ATOM 838   C C    . LEU A 1 52  ? -24.069 7.716   -2.614  1.00 0.00 ? 52  LEU A C    1  
ATOM 839   O O    . LEU A 1 52  ? -25.239 8.081   -2.733  1.00 0.00 ? 52  LEU A O    1  
ATOM 840   C CB   . LEU A 1 52  ? -23.740 6.317   -0.556  1.00 0.00 ? 52  LEU A CB   1  
ATOM 841   C CG   . LEU A 1 52  ? -22.521 5.462   -0.195  1.00 0.00 ? 52  LEU A CG   1  
ATOM 842   C CD1  . LEU A 1 52  ? -22.731 4.762   1.138   1.00 0.00 ? 52  LEU A CD1  1  
ATOM 843   C CD2  . LEU A 1 52  ? -22.241 4.443   -1.289  1.00 0.00 ? 52  LEU A CD2  1  
ATOM 844   H H    . LEU A 1 52  ? -24.637 8.676   0.150   1.00 0.00 ? 52  LEU A H    1  
ATOM 845   H HA   . LEU A 1 52  ? -22.347 7.723   -1.367  1.00 0.00 ? 52  LEU A HA   1  
ATOM 846   H HB2  . LEU A 1 52  ? -24.288 6.528   0.351   1.00 0.00 ? 52  LEU A HB2  1  
ATOM 847   H HB3  . LEU A 1 52  ? -24.374 5.740   -1.213  1.00 0.00 ? 52  LEU A HB3  1  
ATOM 848   H HG   . LEU A 1 52  ? -21.655 6.103   -0.105  1.00 0.00 ? 52  LEU A HG   1  
ATOM 849   H HD11 . LEU A 1 52  ? -21.794 4.343   1.475   1.00 0.00 ? 52  LEU A HD11 1  
ATOM 850   H HD12 . LEU A 1 52  ? -23.457 3.971   1.020   1.00 0.00 ? 52  LEU A HD12 1  
ATOM 851   H HD13 . LEU A 1 52  ? -23.089 5.474   1.867   1.00 0.00 ? 52  LEU A HD13 1  
ATOM 852   H HD21 . LEU A 1 52  ? -22.553 4.842   -2.242  1.00 0.00 ? 52  LEU A HD21 1  
ATOM 853   H HD22 . LEU A 1 52  ? -22.786 3.534   -1.083  1.00 0.00 ? 52  LEU A HD22 1  
ATOM 854   H HD23 . LEU A 1 52  ? -21.181 4.228   -1.318  1.00 0.00 ? 52  LEU A HD23 1  
ATOM 855   N N    . LYS A 1 53  ? -23.310 7.381   -3.655  1.00 0.00 ? 53  LYS A N    1  
ATOM 856   C CA   . LYS A 1 53  ? -23.834 7.430   -5.015  1.00 0.00 ? 53  LYS A CA   1  
ATOM 857   C C    . LYS A 1 53  ? -23.651 6.125   -5.760  1.00 0.00 ? 53  LYS A C    1  
ATOM 858   O O    . LYS A 1 53  ? -22.531 5.642   -5.926  1.00 0.00 ? 53  LYS A O    1  
ATOM 859   C CB   . LYS A 1 53  ? -23.143 8.529   -5.829  1.00 0.00 ? 53  LYS A CB   1  
ATOM 860   C CG   . LYS A 1 53  ? -24.106 9.410   -6.606  1.00 0.00 ? 53  LYS A CG   1  
ATOM 861   C CD   . LYS A 1 53  ? -23.701 10.874  -6.541  1.00 0.00 ? 53  LYS A CD   1  
ATOM 862   C CE   . LYS A 1 53  ? -24.172 11.637  -7.769  1.00 0.00 ? 53  LYS A CE   1  
ATOM 863   N NZ   . LYS A 1 53  ? -25.628 11.449  -8.014  1.00 0.00 ? 53  LYS A NZ   1  
ATOM 864   H H    . LYS A 1 53  ? -22.380 7.109   -3.506  1.00 0.00 ? 53  LYS A H    1  
ATOM 865   H HA   . LYS A 1 53  ? -24.887 7.649   -4.957  1.00 0.00 ? 53  LYS A HA   1  
ATOM 866   H HB2  . LYS A 1 53  ? -22.564 9.150   -5.167  1.00 0.00 ? 53  LYS A HB2  1  
ATOM 867   H HB3  . LYS A 1 53  ? -22.473 8.062   -6.543  1.00 0.00 ? 53  LYS A HB3  1  
ATOM 868   H HG2  . LYS A 1 53  ? -24.111 9.092   -7.640  1.00 0.00 ? 53  LYS A HG2  1  
ATOM 869   H HG3  . LYS A 1 53  ? -25.097 9.300   -6.188  1.00 0.00 ? 53  LYS A HG3  1  
ATOM 870   H HD2  . LYS A 1 53  ? -24.139 11.321  -5.662  1.00 0.00 ? 53  LYS A HD2  1  
ATOM 871   H HD3  . LYS A 1 53  ? -22.624 10.936  -6.481  1.00 0.00 ? 53  LYS A HD3  1  
ATOM 872   H HE2  . LYS A 1 53  ? -23.973 12.688  -7.622  1.00 0.00 ? 53  LYS A HE2  1  
ATOM 873   H HE3  . LYS A 1 53  ? -23.622 11.284  -8.629  1.00 0.00 ? 53  LYS A HE3  1  
ATOM 874   H HZ1  . LYS A 1 53  ? -26.108 11.179  -7.131  1.00 0.00 ? 53  LYS A HZ1  1  
ATOM 875   H HZ2  . LYS A 1 53  ? -25.779 10.700  -8.719  1.00 0.00 ? 53  LYS A HZ2  1  
ATOM 876   H HZ3  . LYS A 1 53  ? -26.048 12.333  -8.368  1.00 0.00 ? 53  LYS A HZ3  1  
ATOM 877   N N    . VAL A 1 54  ? -24.747 5.611   -6.288  1.00 0.00 ? 54  VAL A N    1  
ATOM 878   C CA   . VAL A 1 54  ? -24.681 4.424   -7.108  1.00 0.00 ? 54  VAL A CA   1  
ATOM 879   C C    . VAL A 1 54  ? -24.294 4.912   -8.495  1.00 0.00 ? 54  VAL A C    1  
ATOM 880   O O    . VAL A 1 54  ? -25.136 5.344   -9.281  1.00 0.00 ? 54  VAL A O    1  
ATOM 881   C CB   . VAL A 1 54  ? -26.014 3.614   -7.120  1.00 0.00 ? 54  VAL A CB   1  
ATOM 882   C CG1  . VAL A 1 54  ? -26.992 4.146   -6.081  1.00 0.00 ? 54  VAL A CG1  1  
ATOM 883   C CG2  . VAL A 1 54  ? -26.676 3.576   -8.494  1.00 0.00 ? 54  VAL A CG2  1  
ATOM 884   H H    . VAL A 1 54  ? -25.600 6.080   -6.181  1.00 0.00 ? 54  VAL A H    1  
ATOM 885   H HA   . VAL A 1 54  ? -23.889 3.790   -6.720  1.00 0.00 ? 54  VAL A HA   1  
ATOM 886   H HB   . VAL A 1 54  ? -25.767 2.602   -6.847  1.00 0.00 ? 54  VAL A HB   1  
ATOM 887   H HG11 . VAL A 1 54  ? -27.665 3.357   -5.783  1.00 0.00 ? 54  VAL A HG11 1  
ATOM 888   H HG12 . VAL A 1 54  ? -27.558 4.962   -6.504  1.00 0.00 ? 54  VAL A HG12 1  
ATOM 889   H HG13 . VAL A 1 54  ? -26.445 4.498   -5.217  1.00 0.00 ? 54  VAL A HG13 1  
ATOM 890   H HG21 . VAL A 1 54  ? -25.948 3.292   -9.239  1.00 0.00 ? 54  VAL A HG21 1  
ATOM 891   H HG22 . VAL A 1 54  ? -27.074 4.552   -8.730  1.00 0.00 ? 54  VAL A HG22 1  
ATOM 892   H HG23 . VAL A 1 54  ? -27.480 2.855   -8.484  1.00 0.00 ? 54  VAL A HG23 1  
ATOM 893   N N    . VAL A 1 55  ? -22.999 4.918   -8.766  1.00 0.00 ? 55  VAL A N    1  
ATOM 894   C CA   . VAL A 1 55  ? -22.503 5.431   -10.032 1.00 0.00 ? 55  VAL A CA   1  
ATOM 895   C C    . VAL A 1 55  ? -23.268 4.835   -11.211 1.00 0.00 ? 55  VAL A C    1  
ATOM 896   O O    . VAL A 1 55  ? -23.298 3.619   -11.395 1.00 0.00 ? 55  VAL A O    1  
ATOM 897   C CB   . VAL A 1 55  ? -20.996 5.167   -10.196 1.00 0.00 ? 55  VAL A CB   1  
ATOM 898   C CG1  . VAL A 1 55  ? -20.445 5.942   -11.382 1.00 0.00 ? 55  VAL A CG1  1  
ATOM 899   C CG2  . VAL A 1 55  ? -20.254 5.533   -8.917  1.00 0.00 ? 55  VAL A CG2  1  
ATOM 900   H H    . VAL A 1 55  ? -22.357 4.606   -8.089  1.00 0.00 ? 55  VAL A H    1  
ATOM 901   H HA   . VAL A 1 55  ? -22.657 6.505   -10.020 1.00 0.00 ? 55  VAL A HA   1  
ATOM 902   H HB   . VAL A 1 55  ? -20.852 4.114   -10.382 1.00 0.00 ? 55  VAL A HB   1  
ATOM 903   H HG11 . VAL A 1 55  ? -19.459 5.573   -11.626 1.00 0.00 ? 55  VAL A HG11 1  
ATOM 904   H HG12 . VAL A 1 55  ? -20.384 6.990   -11.130 1.00 0.00 ? 55  VAL A HG12 1  
ATOM 905   H HG13 . VAL A 1 55  ? -21.098 5.813   -12.232 1.00 0.00 ? 55  VAL A HG13 1  
ATOM 906   H HG21 . VAL A 1 55  ? -20.028 4.635   -8.362  1.00 0.00 ? 55  VAL A HG21 1  
ATOM 907   H HG22 . VAL A 1 55  ? -20.874 6.184   -8.312  1.00 0.00 ? 55  VAL A HG22 1  
ATOM 908   H HG23 . VAL A 1 55  ? -19.335 6.043   -9.166  1.00 0.00 ? 55  VAL A HG23 1  
ATOM 909   N N    . LYS A 1 56  ? -23.898 5.704   -11.999 1.00 0.00 ? 56  LYS A N    1  
ATOM 910   C CA   . LYS A 1 56  ? -24.679 5.275   -13.157 1.00 0.00 ? 56  LYS A CA   1  
ATOM 911   C C    . LYS A 1 56  ? -23.901 4.287   -14.021 1.00 0.00 ? 56  LYS A C    1  
ATOM 912   O O    . LYS A 1 56  ? -24.456 3.304   -14.511 1.00 0.00 ? 56  LYS A O    1  
ATOM 913   C CB   . LYS A 1 56  ? -25.089 6.487   -13.995 1.00 0.00 ? 56  LYS A CB   1  
ATOM 914   C CG   . LYS A 1 56  ? -26.418 6.310   -14.712 1.00 0.00 ? 56  LYS A CG   1  
ATOM 915   C CD   . LYS A 1 56  ? -26.265 6.443   -16.220 1.00 0.00 ? 56  LYS A CD   1  
ATOM 916   C CE   . LYS A 1 56  ? -27.416 7.228   -16.830 1.00 0.00 ? 56  LYS A CE   1  
ATOM 917   N NZ   . LYS A 1 56  ? -27.886 6.623   -18.107 1.00 0.00 ? 56  LYS A NZ   1  
ATOM 918   H H    . LYS A 1 56  ? -23.843 6.660   -11.791 1.00 0.00 ? 56  LYS A H    1  
ATOM 919   H HA   . LYS A 1 56  ? -25.570 4.787   -12.791 1.00 0.00 ? 56  LYS A HA   1  
ATOM 920   H HB2  . LYS A 1 56  ? -25.165 7.348   -13.348 1.00 0.00 ? 56  LYS A HB2  1  
ATOM 921   H HB3  . LYS A 1 56  ? -24.325 6.672   -14.736 1.00 0.00 ? 56  LYS A HB3  1  
ATOM 922   H HG2  . LYS A 1 56  ? -26.810 5.329   -14.487 1.00 0.00 ? 56  LYS A HG2  1  
ATOM 923   H HG3  . LYS A 1 56  ? -27.108 7.064   -14.361 1.00 0.00 ? 56  LYS A HG3  1  
ATOM 924   H HD2  . LYS A 1 56  ? -25.340 6.957   -16.434 1.00 0.00 ? 56  LYS A HD2  1  
ATOM 925   H HD3  . LYS A 1 56  ? -26.241 5.456   -16.658 1.00 0.00 ? 56  LYS A HD3  1  
ATOM 926   H HE2  . LYS A 1 56  ? -28.236 7.246   -16.128 1.00 0.00 ? 56  LYS A HE2  1  
ATOM 927   H HE3  . LYS A 1 56  ? -27.084 8.238   -17.021 1.00 0.00 ? 56  LYS A HE3  1  
ATOM 928   H HZ1  . LYS A 1 56  ? -27.126 6.056   -18.535 1.00 0.00 ? 56  LYS A HZ1  1  
ATOM 929   H HZ2  . LYS A 1 56  ? -28.165 7.369   -18.776 1.00 0.00 ? 56  LYS A HZ2  1  
ATOM 930   H HZ3  . LYS A 1 56  ? -28.706 6.008   -17.930 1.00 0.00 ? 56  LYS A HZ3  1  
ATOM 931   N N    . ASN A 1 57  ? -22.614 4.557   -14.207 1.00 0.00 ? 57  ASN A N    1  
ATOM 932   C CA   . ASN A 1 57  ? -21.762 3.693   -15.015 1.00 0.00 ? 57  ASN A CA   1  
ATOM 933   C C    . ASN A 1 57  ? -21.247 2.501   -14.210 1.00 0.00 ? 57  ASN A C    1  
ATOM 934   O O    . ASN A 1 57  ? -20.459 1.700   -14.713 1.00 0.00 ? 57  ASN A O    1  
ATOM 935   C CB   . ASN A 1 57  ? -20.580 4.490   -15.570 1.00 0.00 ? 57  ASN A CB   1  
ATOM 936   C CG   . ASN A 1 57  ? -19.965 3.839   -16.794 1.00 0.00 ? 57  ASN A CG   1  
ATOM 937   O OD1  . ASN A 1 57  ? -19.419 2.739   -16.719 1.00 0.00 ? 57  ASN A OD1  1  
ATOM 938   N ND2  . ASN A 1 57  ? -20.051 4.519   -17.931 1.00 0.00 ? 57  ASN A ND2  1  
ATOM 939   H H    . ASN A 1 57  ? -22.229 5.357   -13.793 1.00 0.00 ? 57  ASN A H    1  
ATOM 940   H HA   . ASN A 1 57  ? -22.352 3.325   -15.841 1.00 0.00 ? 57  ASN A HA   1  
ATOM 941   H HB2  . ASN A 1 57  ? -20.916 5.479   -15.842 1.00 0.00 ? 57  ASN A HB2  1  
ATOM 942   H HB3  . ASN A 1 57  ? -19.820 4.569   -14.806 1.00 0.00 ? 57  ASN A HB3  1  
ATOM 943   H HD21 . ASN A 1 57  ? -20.500 5.391   -17.917 1.00 0.00 ? 57  ASN A HD21 1  
ATOM 944   H HD22 . ASN A 1 57  ? -19.662 4.122   -18.739 1.00 0.00 ? 57  ASN A HD22 1  
ATOM 945   N N    . CYS A 1 58  ? -21.688 2.383   -12.959 1.00 0.00 ? 58  CYS A N    1  
ATOM 946   C CA   . CYS A 1 58  ? -21.255 1.283   -12.105 1.00 0.00 ? 58  CYS A CA   1  
ATOM 947   C C    . CYS A 1 58  ? -22.428 0.673   -11.329 1.00 0.00 ? 58  CYS A C    1  
ATOM 948   O O    . CYS A 1 58  ? -22.225 -0.100  -10.394 1.00 0.00 ? 58  CYS A O    1  
ATOM 949   C CB   . CYS A 1 58  ? -20.148 1.754   -11.152 1.00 0.00 ? 58  CYS A CB   1  
ATOM 950   S SG   . CYS A 1 58  ? -18.988 2.946   -11.908 1.00 0.00 ? 58  CYS A SG   1  
ATOM 951   H H    . CYS A 1 58  ? -22.311 3.047   -12.603 1.00 0.00 ? 58  CYS A H    1  
ATOM 952   H HA   . CYS A 1 58  ? -20.848 0.518   -12.752 1.00 0.00 ? 58  CYS A HA   1  
ATOM 953   H HB2  . CYS A 1 58  ? -20.598 2.227   -10.293 1.00 0.00 ? 58  CYS A HB2  1  
ATOM 954   H HB3  . CYS A 1 58  ? -19.575 0.898   -10.826 1.00 0.00 ? 58  CYS A HB3  1  
ATOM 955   N N    . ALA A 1 59  ? -23.652 0.980   -11.766 1.00 0.00 ? 59  ALA A N    1  
ATOM 956   C CA   . ALA A 1 59  ? -24.862 0.417   -11.164 1.00 0.00 ? 59  ALA A CA   1  
ATOM 957   C C    . ALA A 1 59  ? -25.274 -0.778  -12.004 1.00 0.00 ? 59  ALA A C    1  
ATOM 958   O O    . ALA A 1 59  ? -24.887 -0.847  -13.169 1.00 0.00 ? 59  ALA A O    1  
ATOM 959   C CB   . ALA A 1 59  ? -25.980 1.450   -11.125 1.00 0.00 ? 59  ALA A CB   1  
ATOM 960   H H    . ALA A 1 59  ? -23.747 1.561   -12.549 1.00 0.00 ? 59  ALA A H    1  
ATOM 961   H HA   . ALA A 1 59  ? -24.644 0.096   -10.151 1.00 0.00 ? 59  ALA A HA   1  
ATOM 962   H HB1  . ALA A 1 59  ? -26.795 1.122   -11.755 1.00 0.00 ? 59  ALA A HB1  1  
ATOM 963   H HB2  . ALA A 1 59  ? -25.607 2.398   -11.484 1.00 0.00 ? 59  ALA A HB2  1  
ATOM 964   H HB3  . ALA A 1 59  ? -26.332 1.561   -10.111 1.00 0.00 ? 59  ALA A HB3  1  
ATOM 965   N N    . ASN A 1 60  ? -26.022 -1.733  -11.434 1.00 0.00 ? 60  ASN A N    1  
ATOM 966   C CA   . ASN A 1 60  ? -26.413 -2.930  -12.199 1.00 0.00 ? 60  ASN A CA   1  
ATOM 967   C C    . ASN A 1 60  ? -25.615 -2.962  -13.485 1.00 0.00 ? 60  ASN A C    1  
ATOM 968   O O    . ASN A 1 60  ? -26.096 -2.622  -14.565 1.00 0.00 ? 60  ASN A O    1  
ATOM 969   C CB   . ASN A 1 60  ? -27.915 -2.906  -12.503 1.00 0.00 ? 60  ASN A CB   1  
ATOM 970   C CG   . ASN A 1 60  ? -28.520 -1.517  -12.398 1.00 0.00 ? 60  ASN A CG   1  
ATOM 971   O OD1  . ASN A 1 60  ? -28.627 -0.954  -11.308 1.00 0.00 ? 60  ASN A OD1  1  
ATOM 972   N ND2  . ASN A 1 60  ? -28.919 -0.957  -13.535 1.00 0.00 ? 60  ASN A ND2  1  
ATOM 973   H H    . ASN A 1 60  ? -26.276 -1.643  -10.492 1.00 0.00 ? 60  ASN A H    1  
ATOM 974   H HA   . ASN A 1 60  ? -26.165 -3.830  -11.631 1.00 0.00 ? 60  ASN A HA   1  
ATOM 975   H HB2  . ASN A 1 60  ? -28.076 -3.266  -13.507 1.00 0.00 ? 60  ASN A HB2  1  
ATOM 976   H HB3  . ASN A 1 60  ? -28.427 -3.553  -11.806 1.00 0.00 ? 60  ASN A HB3  1  
ATOM 977   H HD21 . ASN A 1 60  ? -28.803 -1.464  -14.366 1.00 0.00 ? 60  ASN A HD21 1  
ATOM 978   H HD22 . ASN A 1 60  ? -29.313 -0.061  -13.496 1.00 0.00 ? 60  ASN A HD22 1  
ATOM 979   N N    . THR A 1 61  ? -24.371 -3.372  -13.318 1.00 0.00 ? 61  THR A N    1  
ATOM 980   C CA   . THR A 1 61  ? -23.420 -3.471  -14.386 1.00 0.00 ? 61  THR A CA   1  
ATOM 981   C C    . THR A 1 61  ? -22.901 -4.881  -14.412 1.00 0.00 ? 61  THR A C    1  
ATOM 982   O O    . THR A 1 61  ? -22.541 -5.422  -13.368 1.00 0.00 ? 61  THR A O    1  
ATOM 983   C CB   . THR A 1 61  ? -22.260 -2.508  -14.123 1.00 0.00 ? 61  THR A CB   1  
ATOM 984   O OG1  . THR A 1 61  ? -21.246 -2.664  -15.099 1.00 0.00 ? 61  THR A OG1  1  
ATOM 985   C CG2  . THR A 1 61  ? -21.622 -2.707  -12.755 1.00 0.00 ? 61  THR A CG2  1  
ATOM 986   H H    . THR A 1 61  ? -24.072 -3.617  -12.423 1.00 0.00 ? 61  THR A H    1  
ATOM 987   H HA   . THR A 1 61  ? -23.900 -3.232  -15.320 1.00 0.00 ? 61  THR A HA   1  
ATOM 988   H HB   . THR A 1 61  ? -22.626 -1.491  -14.171 1.00 0.00 ? 61  THR A HB   1  
ATOM 989   H HG1  . THR A 1 61  ? -21.444 -2.111  -15.859 1.00 0.00 ? 61  THR A HG1  1  
ATOM 990   H HG21 . THR A 1 61  ? -21.689 -1.789  -12.189 1.00 0.00 ? 61  THR A HG21 1  
ATOM 991   H HG22 . THR A 1 61  ? -20.584 -2.977  -12.877 1.00 0.00 ? 61  THR A HG22 1  
ATOM 992   H HG23 . THR A 1 61  ? -22.137 -3.496  -12.219 1.00 0.00 ? 61  THR A HG23 1  
ATOM 993   N N    . THR A 1 62  ? -22.829 -5.479  -15.582 1.00 0.00 ? 62  THR A N    1  
ATOM 994   C CA   . THR A 1 62  ? -22.320 -6.826  -15.655 1.00 0.00 ? 62  THR A CA   1  
ATOM 995   C C    . THR A 1 62  ? -20.860 -6.756  -16.036 1.00 0.00 ? 62  THR A C    1  
ATOM 996   O O    . THR A 1 62  ? -20.390 -7.254  -17.059 1.00 0.00 ? 62  THR A O    1  
ATOM 997   C CB   . THR A 1 62  ? -23.147 -7.700  -16.580 1.00 0.00 ? 62  THR A CB   1  
ATOM 998   O OG1  . THR A 1 62  ? -22.405 -8.140  -17.703 1.00 0.00 ? 62  THR A OG1  1  
ATOM 999   C CG2  . THR A 1 62  ? -24.414 -7.038  -17.086 1.00 0.00 ? 62  THR A CG2  1  
ATOM 1000  H H    . THR A 1 62  ? -23.104 -5.005  -16.394 1.00 0.00 ? 62  THR A H    1  
ATOM 1001  H HA   . THR A 1 62  ? -22.384 -7.234  -14.650 1.00 0.00 ? 62  THR A HA   1  
ATOM 1002  H HB   . THR A 1 62  ? -23.437 -8.556  -16.002 1.00 0.00 ? 62  THR A HB   1  
ATOM 1003  H HG1  . THR A 1 62  ? -22.902 -8.815  -18.171 1.00 0.00 ? 62  THR A HG1  1  
ATOM 1004  H HG21 . THR A 1 62  ? -24.955 -7.729  -17.716 1.00 0.00 ? 62  THR A HG21 1  
ATOM 1005  H HG22 . THR A 1 62  ? -24.157 -6.157  -17.655 1.00 0.00 ? 62  THR A HG22 1  
ATOM 1006  H HG23 . THR A 1 62  ? -25.035 -6.756  -16.246 1.00 0.00 ? 62  THR A HG23 1  
ATOM 1007  N N    . ARG A 1 63  ? -20.184 -6.089  -15.132 1.00 0.00 ? 63  ARG A N    1  
ATOM 1008  C CA   . ARG A 1 63  ? -18.762 -5.818  -15.171 1.00 0.00 ? 63  ARG A CA   1  
ATOM 1009  C C    . ARG A 1 63  ? -18.268 -5.858  -13.736 1.00 0.00 ? 63  ARG A C    1  
ATOM 1010  O O    . ARG A 1 63  ? -19.079 -6.041  -12.832 1.00 0.00 ? 63  ARG A O    1  
ATOM 1011  C CB   . ARG A 1 63  ? -18.527 -4.432  -15.769 1.00 0.00 ? 63  ARG A CB   1  
ATOM 1012  C CG   . ARG A 1 63  ? -18.108 -4.458  -17.232 1.00 0.00 ? 63  ARG A CG   1  
ATOM 1013  C CD   . ARG A 1 63  ? -16.762 -3.782  -17.444 1.00 0.00 ? 63  ARG A CD   1  
ATOM 1014  N NE   . ARG A 1 63  ? -15.879 -4.574  -18.297 1.00 0.00 ? 63  ARG A NE   1  
ATOM 1015  C CZ   . ARG A 1 63  ? -15.961 -4.605  -19.625 1.00 0.00 ? 63  ARG A CZ   1  
ATOM 1016  N NH1  . ARG A 1 63  ? -16.884 -3.891  -20.256 1.00 0.00 ? 63  ARG A NH1  1  
ATOM 1017  N NH2  . ARG A 1 63  ? -15.118 -5.352  -20.324 1.00 0.00 ? 63  ARG A NH2  1  
ATOM 1018  H H    . ARG A 1 63  ? -20.691 -5.752  -14.369 1.00 0.00 ? 63  ARG A H    1  
ATOM 1019  H HA   . ARG A 1 63  ? -18.268 -6.576  -15.761 1.00 0.00 ? 63  ARG A HA   1  
ATOM 1020  H HB2  . ARG A 1 63  ? -19.448 -3.864  -15.686 1.00 0.00 ? 63  ARG A HB2  1  
ATOM 1021  H HB3  . ARG A 1 63  ? -17.757 -3.933  -15.200 1.00 0.00 ? 63  ARG A HB3  1  
ATOM 1022  H HG2  . ARG A 1 63  ? -18.038 -5.485  -17.557 1.00 0.00 ? 63  ARG A HG2  1  
ATOM 1023  H HG3  . ARG A 1 63  ? -18.856 -3.944  -17.818 1.00 0.00 ? 63  ARG A HG3  1  
ATOM 1024  H HD2  . ARG A 1 63  ? -16.926 -2.821  -17.908 1.00 0.00 ? 63  ARG A HD2  1  
ATOM 1025  H HD3  . ARG A 1 63  ? -16.288 -3.640  -16.484 1.00 0.00 ? 63  ARG A HD3  1  
ATOM 1026  H HE   . ARG A 1 63  ? -15.188 -5.112  -17.856 1.00 0.00 ? 63  ARG A HE   1  
ATOM 1027  H HH11 . ARG A 1 63  ? -17.524 -3.326  -19.736 1.00 0.00 ? 63  ARG A HH11 1  
ATOM 1028  H HH12 . ARG A 1 63  ? -16.940 -3.918  -21.254 1.00 0.00 ? 63  ARG A HH12 1  
ATOM 1029  H HH21 . ARG A 1 63  ? -14.420 -5.892  -19.853 1.00 0.00 ? 63  ARG A HH21 1  
ATOM 1030  H HH22 . ARG A 1 63  ? -15.179 -5.375  -21.321 1.00 0.00 ? 63  ARG A HH22 1  
ATOM 1031  N N    . SER A 1 64  ? -16.975 -5.680  -13.491 1.00 0.00 ? 64  SER A N    1  
ATOM 1032  C CA   . SER A 1 64  ? -16.498 -5.694  -12.114 1.00 0.00 ? 64  SER A CA   1  
ATOM 1033  C C    . SER A 1 64  ? -15.881 -4.355  -11.692 1.00 0.00 ? 64  SER A C    1  
ATOM 1034  O O    . SER A 1 64  ? -16.474 -3.607  -10.918 1.00 0.00 ? 64  SER A O    1  
ATOM 1035  C CB   . SER A 1 64  ? -15.534 -6.849  -11.874 1.00 0.00 ? 64  SER A CB   1  
ATOM 1036  O OG   . SER A 1 64  ? -14.271 -6.608  -12.471 1.00 0.00 ? 64  SER A OG   1  
ATOM 1037  H H    . SER A 1 64  ? -16.337 -5.512  -14.216 1.00 0.00 ? 64  SER A H    1  
ATOM 1038  H HA   . SER A 1 64  ? -17.362 -5.859  -11.497 1.00 0.00 ? 64  SER A HA   1  
ATOM 1039  H HB2  . SER A 1 64  ? -15.405 -6.983  -10.812 1.00 0.00 ? 64  SER A HB2  1  
ATOM 1040  H HB3  . SER A 1 64  ? -15.956 -7.748  -12.290 1.00 0.00 ? 64  SER A HB3  1  
ATOM 1041  H HG   . SER A 1 64  ? -13.610 -6.489  -11.786 1.00 0.00 ? 64  SER A HG   1  
ATOM 1042  N N    . PHE A 1 65  ? -14.672 -4.073  -12.170 1.00 0.00 ? 65  PHE A N    1  
ATOM 1043  C CA   . PHE A 1 65  ? -13.971 -2.842  -11.798 1.00 0.00 ? 65  PHE A CA   1  
ATOM 1044  C C    . PHE A 1 65  ? -14.568 -1.585  -12.427 1.00 0.00 ? 65  PHE A C    1  
ATOM 1045  O O    . PHE A 1 65  ? -14.592 -1.429  -13.648 1.00 0.00 ? 65  PHE A O    1  
ATOM 1046  C CB   . PHE A 1 65  ? -12.492 -2.941  -12.167 1.00 0.00 ? 65  PHE A CB   1  
ATOM 1047  C CG   . PHE A 1 65  ? -12.246 -3.147  -13.635 1.00 0.00 ? 65  PHE A CG   1  
ATOM 1048  C CD1  . PHE A 1 65  ? -12.200 -4.424  -14.171 1.00 0.00 ? 65  PHE A CD1  1  
ATOM 1049  C CD2  . PHE A 1 65  ? -12.060 -2.063  -14.478 1.00 0.00 ? 65  PHE A CD2  1  
ATOM 1050  C CE1  . PHE A 1 65  ? -11.973 -4.616  -15.520 1.00 0.00 ? 65  PHE A CE1  1  
ATOM 1051  C CE2  . PHE A 1 65  ? -11.833 -2.249  -15.828 1.00 0.00 ? 65  PHE A CE2  1  
ATOM 1052  C CZ   . PHE A 1 65  ? -11.789 -3.527  -16.350 1.00 0.00 ? 65  PHE A CZ   1  
ATOM 1053  H H    . PHE A 1 65  ? -14.224 -4.717  -12.756 1.00 0.00 ? 65  PHE A H    1  
ATOM 1054  H HA   . PHE A 1 65  ? -14.041 -2.743  -10.729 1.00 0.00 ? 65  PHE A HA   1  
ATOM 1055  H HB2  . PHE A 1 65  ? -11.996 -2.029  -11.871 1.00 0.00 ? 65  PHE A HB2  1  
ATOM 1056  H HB3  . PHE A 1 65  ? -12.054 -3.769  -11.635 1.00 0.00 ? 65  PHE A HB3  1  
ATOM 1057  H HD1  . PHE A 1 65  ? -12.344 -5.276  -13.523 1.00 0.00 ? 65  PHE A HD1  1  
ATOM 1058  H HD2  . PHE A 1 65  ? -12.095 -1.063  -14.071 1.00 0.00 ? 65  PHE A HD2  1  
ATOM 1059  H HE1  . PHE A 1 65  ? -11.938 -5.616  -15.926 1.00 0.00 ? 65  PHE A HE1  1  
ATOM 1060  H HE2  . PHE A 1 65  ? -11.689 -1.396  -16.475 1.00 0.00 ? 65  PHE A HE2  1  
ATOM 1061  H HZ   . PHE A 1 65  ? -11.611 -3.675  -17.405 1.00 0.00 ? 65  PHE A HZ   1  
ATOM 1062  N N    . CYS A 1 66  ? -15.030 -0.684  -11.562 1.00 0.00 ? 66  CYS A N    1  
ATOM 1063  C CA   . CYS A 1 66  ? -15.614 0.584   -11.990 1.00 0.00 ? 66  CYS A CA   1  
ATOM 1064  C C    . CYS A 1 66  ? -14.563 1.693   -11.870 1.00 0.00 ? 66  CYS A C    1  
ATOM 1065  O O    . CYS A 1 66  ? -13.691 1.640   -11.001 1.00 0.00 ? 66  CYS A O    1  
ATOM 1066  C CB   . CYS A 1 66  ? -16.861 0.896   -11.142 1.00 0.00 ? 66  CYS A CB   1  
ATOM 1067  S SG   . CYS A 1 66  ? -17.233 2.671   -10.922 1.00 0.00 ? 66  CYS A SG   1  
ATOM 1068  H H    . CYS A 1 66  ? -14.978 -0.889  -10.605 1.00 0.00 ? 66  CYS A H    1  
ATOM 1069  H HA   . CYS A 1 66  ? -15.903 0.485   -13.026 1.00 0.00 ? 66  CYS A HA   1  
ATOM 1070  H HB2  . CYS A 1 66  ? -17.722 0.444   -11.610 1.00 0.00 ? 66  CYS A HB2  1  
ATOM 1071  H HB3  . CYS A 1 66  ? -16.730 0.466   -10.160 1.00 0.00 ? 66  CYS A HB3  1  
ATOM 1072  N N    . ASP A 1 67  ? -14.633 2.683   -12.757 1.00 0.00 ? 67  ASP A N    1  
ATOM 1073  C CA   . ASP A 1 67  ? -13.662 3.777   -12.750 1.00 0.00 ? 67  ASP A CA   1  
ATOM 1074  C C    . ASP A 1 67  ? -14.206 5.030   -12.069 1.00 0.00 ? 67  ASP A C    1  
ATOM 1075  O O    . ASP A 1 67  ? -15.404 5.148   -11.812 1.00 0.00 ? 67  ASP A O    1  
ATOM 1076  C CB   . ASP A 1 67  ? -13.223 4.110   -14.173 1.00 0.00 ? 67  ASP A CB   1  
ATOM 1077  C CG   . ASP A 1 67  ? -14.364 4.626   -15.028 1.00 0.00 ? 67  ASP A CG   1  
ATOM 1078  O OD1  . ASP A 1 67  ? -15.139 3.796   -15.548 1.00 0.00 ? 67  ASP A OD1  1  
ATOM 1079  O OD2  . ASP A 1 67  ? -14.482 5.861   -15.179 1.00 0.00 ? 67  ASP A OD2  1  
ATOM 1080  H H    . ASP A 1 67  ? -15.340 2.671   -13.435 1.00 0.00 ? 67  ASP A H    1  
ATOM 1081  H HA   . ASP A 1 67  ? -12.797 3.438   -12.197 1.00 0.00 ? 67  ASP A HA   1  
ATOM 1082  H HB2  . ASP A 1 67  ? -12.455 4.868   -14.133 1.00 0.00 ? 67  ASP A HB2  1  
ATOM 1083  H HB3  . ASP A 1 67  ? -12.822 3.221   -14.635 1.00 0.00 ? 67  ASP A HB3  1  
ATOM 1084  N N    . LEU A 1 68  ? -13.297 5.957   -11.774 1.00 0.00 ? 68  LEU A N    1  
ATOM 1085  C CA   . LEU A 1 68  ? -13.642 7.211   -11.111 1.00 0.00 ? 68  LEU A CA   1  
ATOM 1086  C C    . LEU A 1 68  ? -12.452 8.171   -11.108 1.00 0.00 ? 68  LEU A C    1  
ATOM 1087  O O    . LEU A 1 68  ? -11.659 8.190   -10.167 1.00 0.00 ? 68  LEU A O    1  
ATOM 1088  C CB   . LEU A 1 68  ? -14.069 6.936   -9.670  1.00 0.00 ? 68  LEU A CB   1  
ATOM 1089  C CG   . LEU A 1 68  ? -13.194 5.915   -8.945  1.00 0.00 ? 68  LEU A CG   1  
ATOM 1090  C CD1  . LEU A 1 68  ? -13.141 6.196   -7.453  1.00 0.00 ? 68  LEU A CD1  1  
ATOM 1091  C CD2  . LEU A 1 68  ? -13.698 4.511   -9.212  1.00 0.00 ? 68  LEU A CD2  1  
ATOM 1092  H H    . LEU A 1 68  ? -12.362 5.787   -12.005 1.00 0.00 ? 68  LEU A H    1  
ATOM 1093  H HA   . LEU A 1 68  ? -14.463 7.664   -11.646 1.00 0.00 ? 68  LEU A HA   1  
ATOM 1094  H HB2  . LEU A 1 68  ? -14.040 7.866   -9.121  1.00 0.00 ? 68  LEU A HB2  1  
ATOM 1095  H HB3  . LEU A 1 68  ? -15.084 6.569   -9.678  1.00 0.00 ? 68  LEU A HB3  1  
ATOM 1096  H HG   . LEU A 1 68  ? -12.190 5.982   -9.327  1.00 0.00 ? 68  LEU A HG   1  
ATOM 1097  H HD11 . LEU A 1 68  ? -12.587 7.106   -7.280  1.00 0.00 ? 68  LEU A HD11 1  
ATOM 1098  H HD12 . LEU A 1 68  ? -12.649 5.377   -6.949  1.00 0.00 ? 68  LEU A HD12 1  
ATOM 1099  H HD13 . LEU A 1 68  ? -14.143 6.305   -7.069  1.00 0.00 ? 68  LEU A HD13 1  
ATOM 1100  H HD21 . LEU A 1 68  ? -14.745 4.546   -9.474  1.00 0.00 ? 68  LEU A HD21 1  
ATOM 1101  H HD22 . LEU A 1 68  ? -13.567 3.909   -8.328  1.00 0.00 ? 68  LEU A HD22 1  
ATOM 1102  H HD23 . LEU A 1 68  ? -13.136 4.079   -10.030 1.00 0.00 ? 68  LEU A HD23 1  
ATOM 1103  N N    . THR A 1 69  ? -12.310 8.963   -12.153 1.00 0.00 ? 69  THR A N    1  
ATOM 1104  C CA   . THR A 1 69  ? -11.201 9.901   -12.214 1.00 0.00 ? 69  THR A CA   1  
ATOM 1105  C C    . THR A 1 69  ? -11.558 11.196  -11.495 1.00 0.00 ? 69  THR A C    1  
ATOM 1106  O O    . THR A 1 69  ? -10.791 11.696  -10.673 1.00 0.00 ? 69  THR A O    1  
ATOM 1107  C CB   . THR A 1 69  ? -10.815 10.190  -13.664 1.00 0.00 ? 69  THR A CB   1  
ATOM 1108  O OG1  . THR A 1 69  ? -10.577 8.986   -14.371 1.00 0.00 ? 69  THR A OG1  1  
ATOM 1109  C CG2  . THR A 1 69  ? -9.579  11.053  -13.793 1.00 0.00 ? 69  THR A CG2  1  
ATOM 1110  H H    . THR A 1 69  ? -12.953 8.920   -12.892 1.00 0.00 ? 69  THR A H    1  
ATOM 1111  H HA   . THR A 1 69  ? -10.362 9.442   -11.700 1.00 0.00 ? 69  THR A HA   1  
ATOM 1112  H HB   . THR A 1 69  ? -11.631 10.709  -14.146 1.00 0.00 ? 69  THR A HB   1  
ATOM 1113  H HG1  . THR A 1 69  ? -11.288 8.365   -14.194 1.00 0.00 ? 69  THR A HG1  1  
ATOM 1114  H HG21 . THR A 1 69  ? -8.837  10.726  -13.080 1.00 0.00 ? 69  THR A HG21 1  
ATOM 1115  H HG22 . THR A 1 69  ? -9.838  12.083  -13.596 1.00 0.00 ? 69  THR A HG22 1  
ATOM 1116  H HG23 . THR A 1 69  ? -9.181  10.966  -14.792 1.00 0.00 ? 69  THR A HG23 1  
ATOM 1117  N N    . ASP A 1 70  ? -12.735 11.728  -11.806 1.00 0.00 ? 70  ASP A N    1  
ATOM 1118  C CA   . ASP A 1 70  ? -13.206 12.959  -11.184 1.00 0.00 ? 70  ASP A CA   1  
ATOM 1119  C C    . ASP A 1 70  ? -14.371 12.677  -10.236 1.00 0.00 ? 70  ASP A C    1  
ATOM 1120  O O    . ASP A 1 70  ? -15.041 13.599  -9.772  1.00 0.00 ? 70  ASP A O    1  
ATOM 1121  C CB   . ASP A 1 70  ? -13.635 13.964  -12.255 1.00 0.00 ? 70  ASP A CB   1  
ATOM 1122  C CG   . ASP A 1 70  ? -12.559 14.992  -12.546 1.00 0.00 ? 70  ASP A CG   1  
ATOM 1123  O OD1  . ASP A 1 70  ? -11.365 14.628  -12.512 1.00 0.00 ? 70  ASP A OD1  1  
ATOM 1124  O OD2  . ASP A 1 70  ? -12.911 16.162  -12.809 1.00 0.00 ? 70  ASP A OD2  1  
ATOM 1125  H H    . ASP A 1 70  ? -13.305 11.277  -12.463 1.00 0.00 ? 70  ASP A H    1  
ATOM 1126  H HA   . ASP A 1 70  ? -12.389 13.378  -10.616 1.00 0.00 ? 70  ASP A HA   1  
ATOM 1127  H HB2  . ASP A 1 70  ? -13.857 13.434  -13.169 1.00 0.00 ? 70  ASP A HB2  1  
ATOM 1128  H HB3  . ASP A 1 70  ? -14.522 14.483  -11.920 1.00 0.00 ? 70  ASP A HB3  1  
ATOM 1129  N N    . GLU A 1 71  ? -14.607 11.397  -9.952  1.00 0.00 ? 71  GLU A N    1  
ATOM 1130  C CA   . GLU A 1 71  ? -15.689 11.000  -9.061  1.00 0.00 ? 71  GLU A CA   1  
ATOM 1131  C C    . GLU A 1 71  ? -15.206 10.911  -7.616  1.00 0.00 ? 71  GLU A C    1  
ATOM 1132  O O    . GLU A 1 71  ? -16.005 10.995  -6.683  1.00 0.00 ? 71  GLU A O    1  
ATOM 1133  C CB   . GLU A 1 71  ? -16.276 9.656   -9.501  1.00 0.00 ? 71  GLU A CB   1  
ATOM 1134  C CG   . GLU A 1 71  ? -17.586 9.784   -10.260 1.00 0.00 ? 71  GLU A CG   1  
ATOM 1135  C CD   . GLU A 1 71  ? -17.450 10.619  -11.519 1.00 0.00 ? 71  GLU A CD   1  
ATOM 1136  O OE1  . GLU A 1 71  ? -17.048 10.061  -12.561 1.00 0.00 ? 71  GLU A OE1  1  
ATOM 1137  O OE2  . GLU A 1 71  ? -17.747 11.831  -11.462 1.00 0.00 ? 71  GLU A OE2  1  
ATOM 1138  H H    . GLU A 1 71  ? -14.041 10.704  -10.350 1.00 0.00 ? 71  GLU A H    1  
ATOM 1139  H HA   . GLU A 1 71  ? -16.460 11.754  -9.122  1.00 0.00 ? 71  GLU A HA   1  
ATOM 1140  H HB2  . GLU A 1 71  ? -15.563 9.156   -10.138 1.00 0.00 ? 71  GLU A HB2  1  
ATOM 1141  H HB3  . GLU A 1 71  ? -16.451 9.048   -8.625  1.00 0.00 ? 71  GLU A HB3  1  
ATOM 1142  H HG2  . GLU A 1 71  ? -17.925 8.797   -10.537 1.00 0.00 ? 71  GLU A HG2  1  
ATOM 1143  H HG3  . GLU A 1 71  ? -18.318 10.248  -9.615  1.00 0.00 ? 71  GLU A HG3  1  
ATOM 1144  N N    . TRP A 1 72  ? -13.895 10.762  -7.432  1.00 0.00 ? 72  TRP A N    1  
ATOM 1145  C CA   . TRP A 1 72  ? -13.312 10.683  -6.098  1.00 0.00 ? 72  TRP A CA   1  
ATOM 1146  C C    . TRP A 1 72  ? -12.266 11.784  -5.924  1.00 0.00 ? 72  TRP A C    1  
ATOM 1147  O O    . TRP A 1 72  ? -11.121 11.519  -5.558  1.00 0.00 ? 72  TRP A O    1  
ATOM 1148  C CB   . TRP A 1 72  ? -12.682 9.305   -5.860  1.00 0.00 ? 72  TRP A CB   1  
ATOM 1149  C CG   . TRP A 1 72  ? -13.666 8.247   -5.432  1.00 0.00 ? 72  TRP A CG   1  
ATOM 1150  C CD1  . TRP A 1 72  ? -15.001 8.189   -5.727  1.00 0.00 ? 72  TRP A CD1  1  
ATOM 1151  C CD2  . TRP A 1 72  ? -13.388 7.081   -4.642  1.00 0.00 ? 72  TRP A CD2  1  
ATOM 1152  N NE1  . TRP A 1 72  ? -15.561 7.065   -5.165  1.00 0.00 ? 72  TRP A NE1  1  
ATOM 1153  C CE2  . TRP A 1 72  ? -14.595 6.373   -4.499  1.00 0.00 ? 72  TRP A CE2  1  
ATOM 1154  C CE3  . TRP A 1 72  ? -12.238 6.565   -4.041  1.00 0.00 ? 72  TRP A CE3  1  
ATOM 1155  C CZ2  . TRP A 1 72  ? -14.686 5.185   -3.787  1.00 0.00 ? 72  TRP A CZ2  1  
ATOM 1156  C CZ3  . TRP A 1 72  ? -12.330 5.381   -3.330  1.00 0.00 ? 72  TRP A CZ3  1  
ATOM 1157  C CH2  . TRP A 1 72  ? -13.552 4.701   -3.210  1.00 0.00 ? 72  TRP A CH2  1  
ATOM 1158  H H    . TRP A 1 72  ? -13.295 10.727  -8.206  1.00 0.00 ? 72  TRP A H    1  
ATOM 1159  H HA   . TRP A 1 72  ? -14.099 10.836  -5.382  1.00 0.00 ? 72  TRP A HA   1  
ATOM 1160  H HB2  . TRP A 1 72  ? -12.213 8.971   -6.772  1.00 0.00 ? 72  TRP A HB2  1  
ATOM 1161  H HB3  . TRP A 1 72  ? -11.931 9.392   -5.088  1.00 0.00 ? 72  TRP A HB3  1  
ATOM 1162  H HD1  . TRP A 1 72  ? -15.527 8.924   -6.313  1.00 0.00 ? 72  TRP A HD1  1  
ATOM 1163  H HE1  . TRP A 1 72  ? -16.501 6.799   -5.231  1.00 0.00 ? 72  TRP A HE1  1  
ATOM 1164  H HE3  . TRP A 1 72  ? -11.293 7.074   -4.123  1.00 0.00 ? 72  TRP A HE3  1  
ATOM 1165  H HZ2  . TRP A 1 72  ? -15.616 4.653   -3.687  1.00 0.00 ? 72  TRP A HZ2  1  
ATOM 1166  H HZ3  . TRP A 1 72  ? -11.451 4.970   -2.858  1.00 0.00 ? 72  TRP A HZ3  1  
ATOM 1167  H HH2  . TRP A 1 72  ? -13.587 3.779   -2.647  1.00 0.00 ? 72  TRP A HH2  1  
ATOM 1168  N N    . ARG A 1 73  ? -12.674 13.025  -6.201  1.00 0.00 ? 73  ARG A N    1  
ATOM 1169  C CA   . ARG A 1 73  ? -11.783 14.183  -6.090  1.00 0.00 ? 73  ARG A CA   1  
ATOM 1170  C C    . ARG A 1 73  ? -11.441 14.502  -4.633  1.00 0.00 ? 73  ARG A C    1  
ATOM 1171  O O    . ARG A 1 73  ? -10.645 15.399  -4.357  1.00 0.00 ? 73  ARG A O    1  
ATOM 1172  C CB   . ARG A 1 73  ? -12.425 15.405  -6.749  1.00 0.00 ? 73  ARG A CB   1  
ATOM 1173  C CG   . ARG A 1 73  ? -13.698 15.870  -6.058  1.00 0.00 ? 73  ARG A CG   1  
ATOM 1174  C CD   . ARG A 1 73  ? -14.806 16.156  -7.060  1.00 0.00 ? 73  ARG A CD   1  
ATOM 1175  N NE   . ARG A 1 73  ? -15.992 16.718  -6.419  1.00 0.00 ? 73  ARG A NE   1  
ATOM 1176  C CZ   . ARG A 1 73  ? -17.195 16.754  -6.987  1.00 0.00 ? 73  ARG A CZ   1  
ATOM 1177  N NH1  . ARG A 1 73  ? -17.376 16.260  -8.206  1.00 0.00 ? 73  ARG A NH1  1  
ATOM 1178  N NH2  . ARG A 1 73  ? -18.221 17.284  -6.335  1.00 0.00 ? 73  ARG A NH2  1  
ATOM 1179  H H    . ARG A 1 73  ? -13.598 13.165  -6.494  1.00 0.00 ? 73  ARG A H    1  
ATOM 1180  H HA   . ARG A 1 73  ? -10.870 13.946  -6.615  1.00 0.00 ? 73  ARG A HA   1  
ATOM 1181  H HB2  . ARG A 1 73  ? -11.716 16.220  -6.736  1.00 0.00 ? 73  ARG A HB2  1  
ATOM 1182  H HB3  . ARG A 1 73  ? -12.664 15.163  -7.774  1.00 0.00 ? 73  ARG A HB3  1  
ATOM 1183  H HG2  . ARG A 1 73  ? -14.031 15.098  -5.381  1.00 0.00 ? 73  ARG A HG2  1  
ATOM 1184  H HG3  . ARG A 1 73  ? -13.485 16.772  -5.503  1.00 0.00 ? 73  ARG A HG3  1  
ATOM 1185  H HD2  . ARG A 1 73  ? -14.438 16.858  -7.793  1.00 0.00 ? 73  ARG A HD2  1  
ATOM 1186  H HD3  . ARG A 1 73  ? -15.077 15.232  -7.551  1.00 0.00 ? 73  ARG A HD3  1  
ATOM 1187  H HE   . ARG A 1 73  ? -15.887 17.089  -5.518  1.00 0.00 ? 73  ARG A HE   1  
ATOM 1188  H HH11 . ARG A 1 73  ? -16.606 15.858  -8.703  1.00 0.00 ? 73  ARG A HH11 1  
ATOM 1189  H HH12 . ARG A 1 73  ? -18.282 16.289  -8.628  1.00 0.00 ? 73  ARG A HH12 1  
ATOM 1190  H HH21 . ARG A 1 73  ? -18.091 17.657  -5.416  1.00 0.00 ? 73  ARG A HH21 1  
ATOM 1191  H HH22 . ARG A 1 73  ? -19.125 17.311  -6.762  1.00 0.00 ? 73  ARG A HH22 1  
ATOM 1192  N N    . SER A 1 74  ? -12.030 13.752  -3.710  1.00 0.00 ? 74  SER A N    1  
ATOM 1193  C CA   . SER A 1 74  ? -11.768 13.947  -2.289  1.00 0.00 ? 74  SER A CA   1  
ATOM 1194  C C    . SER A 1 74  ? -10.592 13.081  -1.847  1.00 0.00 ? 74  SER A C    1  
ATOM 1195  O O    . SER A 1 74  ? -10.681 12.345  -0.864  1.00 0.00 ? 74  SER A O    1  
ATOM 1196  C CB   . SER A 1 74  ? -13.011 13.619  -1.454  1.00 0.00 ? 74  SER A CB   1  
ATOM 1197  O OG   . SER A 1 74  ? -14.181 13.625  -2.254  1.00 0.00 ? 74  SER A OG   1  
ATOM 1198  H H    . SER A 1 74  ? -12.635 13.047  -4.001  1.00 0.00 ? 74  SER A H    1  
ATOM 1199  H HA   . SER A 1 74  ? -11.509 14.985  -2.140  1.00 0.00 ? 74  SER A HA   1  
ATOM 1200  H HB2  . SER A 1 74  ? -12.898 12.642  -1.010  1.00 0.00 ? 74  SER A HB2  1  
ATOM 1201  H HB3  . SER A 1 74  ? -13.121 14.356  -0.672  1.00 0.00 ? 74  SER A HB3  1  
ATOM 1202  H HG   . SER A 1 74  ? -14.799 12.970  -1.923  1.00 0.00 ? 74  SER A HG   1  
ATOM 1203  N N    . THR A 1 75  ? -9.488  13.174  -2.587  1.00 0.00 ? 75  THR A N    1  
ATOM 1204  C CA   . THR A 1 75  ? -8.287  12.402  -2.281  1.00 0.00 ? 75  THR A CA   1  
ATOM 1205  C C    . THR A 1 75  ? -7.900  12.561  -0.816  1.00 0.00 ? 75  THR A C    1  
ATOM 1206  O O    . THR A 1 75  ? -7.521  11.595  -0.155  1.00 0.00 ? 75  THR A O    1  
ATOM 1207  C CB   . THR A 1 75  ? -7.129  12.842  -3.178  1.00 0.00 ? 75  THR A CB   1  
ATOM 1208  O OG1  . THR A 1 75  ? -7.045  14.255  -3.230  1.00 0.00 ? 75  THR A OG1  1  
ATOM 1209  C CG2  . THR A 1 75  ? -7.248  12.337  -4.600  1.00 0.00 ? 75  THR A CG2  1  
ATOM 1210  H H    . THR A 1 75  ? -9.480  13.778  -3.358  1.00 0.00 ? 75  THR A H    1  
ATOM 1211  H HA   . THR A 1 75  ? -8.505  11.362  -2.473  1.00 0.00 ? 75  THR A HA   1  
ATOM 1212  H HB   . THR A 1 75  ? -6.205  12.462  -2.768  1.00 0.00 ? 75  THR A HB   1  
ATOM 1213  H HG1  . THR A 1 75  ? -6.174  14.513  -3.543  1.00 0.00 ? 75  THR A HG1  1  
ATOM 1214  H HG21 . THR A 1 75  ? -7.679  13.108  -5.221  1.00 0.00 ? 75  THR A HG21 1  
ATOM 1215  H HG22 . THR A 1 75  ? -7.882  11.462  -4.619  1.00 0.00 ? 75  THR A HG22 1  
ATOM 1216  H HG23 . THR A 1 75  ? -6.268  12.079  -4.973  1.00 0.00 ? 75  THR A HG23 1  
ATOM 1217  N N    . HIS A 1 76  ? -8.007  13.786  -0.315  1.00 0.00 ? 76  HIS A N    1  
ATOM 1218  C CA   . HIS A 1 76  ? -7.677  14.073  1.075   1.00 0.00 ? 76  HIS A CA   1  
ATOM 1219  C C    . HIS A 1 76  ? -8.618  13.329  2.021   1.00 0.00 ? 76  HIS A C    1  
ATOM 1220  O O    . HIS A 1 76  ? -8.339  13.202  3.213   1.00 0.00 ? 76  HIS A O    1  
ATOM 1221  C CB   . HIS A 1 76  ? -7.751  15.579  1.338   1.00 0.00 ? 76  HIS A CB   1  
ATOM 1222  C CG   . HIS A 1 76  ? -6.440  16.179  1.743   1.00 0.00 ? 76  HIS A CG   1  
ATOM 1223  N ND1  . HIS A 1 76  ? -5.755  17.087  0.963   1.00 0.00 ? 76  HIS A ND1  1  
ATOM 1224  C CD2  . HIS A 1 76  ? -5.688  15.998  2.854   1.00 0.00 ? 76  HIS A CD2  1  
ATOM 1225  C CE1  . HIS A 1 76  ? -4.638  17.437  1.577   1.00 0.00 ? 76  HIS A CE1  1  
ATOM 1226  N NE2  . HIS A 1 76  ? -4.575  16.791  2.726   1.00 0.00 ? 76  HIS A NE2  1  
ATOM 1227  H H    . HIS A 1 76  ? -8.321  14.513  -0.891  1.00 0.00 ? 76  HIS A H    1  
ATOM 1228  H HA   . HIS A 1 76  ? -6.668  13.735  1.253   1.00 0.00 ? 76  HIS A HA   1  
ATOM 1229  H HB2  . HIS A 1 76  ? -8.080  16.078  0.439   1.00 0.00 ? 76  HIS A HB2  1  
ATOM 1230  H HB3  . HIS A 1 76  ? -8.462  15.768  2.129   1.00 0.00 ? 76  HIS A HB3  1  
ATOM 1231  H HD1  . HIS A 1 76  ? -6.043  17.424  0.089   1.00 0.00 ? 76  HIS A HD1  1  
ATOM 1232  H HD2  . HIS A 1 76  ? -5.921  15.350  3.688   1.00 0.00 ? 76  HIS A HD2  1  
ATOM 1233  H HE1  . HIS A 1 76  ? -3.903  18.135  1.202   1.00 0.00 ? 76  HIS A HE1  1  
ATOM 1234  H HE2  . HIS A 1 76  ? -3.882  16.915  3.407   1.00 0.00 ? 76  HIS A HE2  1  
ATOM 1235  N N    . GLU A 1 77  ? -9.734  12.839  1.485   1.00 0.00 ? 77  GLU A N    1  
ATOM 1236  C CA   . GLU A 1 77  ? -10.707 12.113  2.279   1.00 0.00 ? 77  GLU A CA   1  
ATOM 1237  C C    . GLU A 1 77  ? -10.577 10.624  2.067   1.00 0.00 ? 77  GLU A C    1  
ATOM 1238  O O    . GLU A 1 77  ? -9.859  10.155  1.184   1.00 0.00 ? 77  GLU A O    1  
ATOM 1239  C CB   . GLU A 1 77  ? -12.138 12.538  1.912   1.00 0.00 ? 77  GLU A CB   1  
ATOM 1240  C CG   . GLU A 1 77  ? -12.538 13.897  2.459   1.00 0.00 ? 77  GLU A CG   1  
ATOM 1241  C CD   . GLU A 1 77  ? -12.241 14.046  3.939   1.00 0.00 ? 77  GLU A CD   1  
ATOM 1242  O OE1  . GLU A 1 77  ? -12.433 13.062  4.684   1.00 0.00 ? 77  GLU A OE1  1  
ATOM 1243  O OE2  . GLU A 1 77  ? -11.816 15.145  4.352   1.00 0.00 ? 77  GLU A OE2  1  
ATOM 1244  H H    . GLU A 1 77  ? -9.908  12.966  0.535   1.00 0.00 ? 77  GLU A H    1  
ATOM 1245  H HA   . GLU A 1 77  ? -10.521 12.332  3.318   1.00 0.00 ? 77  GLU A HA   1  
ATOM 1246  H HB2  . GLU A 1 77  ? -12.221 12.573  0.836   1.00 0.00 ? 77  GLU A HB2  1  
ATOM 1247  H HB3  . GLU A 1 77  ? -12.841 11.797  2.288   1.00 0.00 ? 77  GLU A HB3  1  
ATOM 1248  H HG2  . GLU A 1 77  ? -11.996 14.659  1.920   1.00 0.00 ? 77  GLU A HG2  1  
ATOM 1249  H HG3  . GLU A 1 77  ? -13.598 14.034  2.303   1.00 0.00 ? 77  GLU A HG3  1  
ATOM 1250  N N    . ALA A 1 78  ? -11.319 9.896   2.870   1.00 0.00 ? 78  ALA A N    1  
ATOM 1251  C CA   . ALA A 1 78  ? -11.358 8.455   2.785   1.00 0.00 ? 78  ALA A CA   1  
ATOM 1252  C C    . ALA A 1 78  ? -12.652 8.055   2.108   1.00 0.00 ? 78  ALA A C    1  
ATOM 1253  O O    . ALA A 1 78  ? -13.693 7.927   2.752   1.00 0.00 ? 78  ALA A O    1  
ATOM 1254  C CB   . ALA A 1 78  ? -11.236 7.835   4.169   1.00 0.00 ? 78  ALA A CB   1  
ATOM 1255  H H    . ALA A 1 78  ? -11.885 10.351  3.522   1.00 0.00 ? 78  ALA A H    1  
ATOM 1256  H HA   . ALA A 1 78  ? -10.528 8.134   2.180   1.00 0.00 ? 78  ALA A HA   1  
ATOM 1257  H HB1  . ALA A 1 78  ? -12.221 7.644   4.569   1.00 0.00 ? 78  ALA A HB1  1  
ATOM 1258  H HB2  . ALA A 1 78  ? -10.710 8.520   4.819   1.00 0.00 ? 78  ALA A HB2  1  
ATOM 1259  H HB3  . ALA A 1 78  ? -10.686 6.908   4.102   1.00 0.00 ? 78  ALA A HB3  1  
ATOM 1260  N N    . TYR A 1 79  ? -12.596 7.901   0.793   1.00 0.00 ? 79  TYR A N    1  
ATOM 1261  C CA   . TYR A 1 79  ? -13.782 7.569   0.030   1.00 0.00 ? 79  TYR A CA   1  
ATOM 1262  C C    . TYR A 1 79  ? -14.408 6.272   0.486   1.00 0.00 ? 79  TYR A C    1  
ATOM 1263  O O    . TYR A 1 79  ? -14.093 5.200   -0.028  1.00 0.00 ? 79  TYR A O    1  
ATOM 1264  C CB   . TYR A 1 79  ? -13.489 7.509   -1.472  1.00 0.00 ? 79  TYR A CB   1  
ATOM 1265  C CG   . TYR A 1 79  ? -14.058 8.691   -2.213  1.00 0.00 ? 79  TYR A CG   1  
ATOM 1266  C CD1  . TYR A 1 79  ? -13.316 9.848   -2.380  1.00 0.00 ? 79  TYR A CD1  1  
ATOM 1267  C CD2  . TYR A 1 79  ? -15.348 8.663   -2.722  1.00 0.00 ? 79  TYR A CD2  1  
ATOM 1268  C CE1  . TYR A 1 79  ? -13.842 10.940  -3.026  1.00 0.00 ? 79  TYR A CE1  1  
ATOM 1269  C CE2  . TYR A 1 79  ? -15.874 9.743   -3.373  1.00 0.00 ? 79  TYR A CE2  1  
ATOM 1270  C CZ   . TYR A 1 79  ? -15.125 10.885  -3.524  1.00 0.00 ? 79  TYR A CZ   1  
ATOM 1271  O OH   . TYR A 1 79  ? -15.658 11.976  -4.173  1.00 0.00 ? 79  TYR A OH   1  
ATOM 1272  H H    . TYR A 1 79  ? -11.748 8.035   0.323   1.00 0.00 ? 79  TYR A H    1  
ATOM 1273  H HA   . TYR A 1 79  ? -14.497 8.360   0.202   1.00 0.00 ? 79  TYR A HA   1  
ATOM 1274  H HB2  . TYR A 1 79  ? -12.423 7.488   -1.640  1.00 0.00 ? 79  TYR A HB2  1  
ATOM 1275  H HB3  . TYR A 1 79  ? -13.934 6.617   -1.883  1.00 0.00 ? 79  TYR A HB3  1  
ATOM 1276  H HD1  . TYR A 1 79  ? -12.312 9.888   -1.998  1.00 0.00 ? 79  TYR A HD1  1  
ATOM 1277  H HD2  . TYR A 1 79  ? -15.946 7.775   -2.614  1.00 0.00 ? 79  TYR A HD2  1  
ATOM 1278  H HE1  . TYR A 1 79  ? -13.246 11.824  -3.147  1.00 0.00 ? 79  TYR A HE1  1  
ATOM 1279  H HE2  . TYR A 1 79  ? -16.868 9.686   -3.760  1.00 0.00 ? 79  TYR A HE2  1  
ATOM 1280  H HH   . TYR A 1 79  ? -14.960 12.456  -4.624  1.00 0.00 ? 79  TYR A HH   1  
ATOM 1281  N N    . VAL A 1 80  ? -15.337 6.375   1.423   1.00 0.00 ? 80  VAL A N    1  
ATOM 1282  C CA   . VAL A 1 80  ? -16.033 5.198   1.892   1.00 0.00 ? 80  VAL A CA   1  
ATOM 1283  C C    . VAL A 1 80  ? -16.902 4.716   0.755   1.00 0.00 ? 80  VAL A C    1  
ATOM 1284  O O    . VAL A 1 80  ? -17.493 5.518   0.051   1.00 0.00 ? 80  VAL A O    1  
ATOM 1285  C CB   . VAL A 1 80  ? -16.902 5.465   3.136   1.00 0.00 ? 80  VAL A CB   1  
ATOM 1286  C CG1  . VAL A 1 80  ? -16.107 5.208   4.407   1.00 0.00 ? 80  VAL A CG1  1  
ATOM 1287  C CG2  . VAL A 1 80  ? -17.448 6.880   3.134   1.00 0.00 ? 80  VAL A CG2  1  
ATOM 1288  H H    . VAL A 1 80  ? -15.574 7.257   1.777   1.00 0.00 ? 80  VAL A H    1  
ATOM 1289  H HA   . VAL A 1 80  ? -15.299 4.439   2.128   1.00 0.00 ? 80  VAL A HA   1  
ATOM 1290  H HB   . VAL A 1 80  ? -17.738 4.782   3.109   1.00 0.00 ? 80  VAL A HB   1  
ATOM 1291  H HG11 . VAL A 1 80  ? -15.637 4.238   4.349   1.00 0.00 ? 80  VAL A HG11 1  
ATOM 1292  H HG12 . VAL A 1 80  ? -16.771 5.236   5.259   1.00 0.00 ? 80  VAL A HG12 1  
ATOM 1293  H HG13 . VAL A 1 80  ? -15.347 5.972   4.517   1.00 0.00 ? 80  VAL A HG13 1  
ATOM 1294  H HG21 . VAL A 1 80  ? -17.731 7.155   2.132   1.00 0.00 ? 80  VAL A HG21 1  
ATOM 1295  H HG22 . VAL A 1 80  ? -16.686 7.553   3.490   1.00 0.00 ? 80  VAL A HG22 1  
ATOM 1296  H HG23 . VAL A 1 80  ? -18.309 6.935   3.783   1.00 0.00 ? 80  VAL A HG23 1  
ATOM 1297  N N    . THR A 1 81  ? -16.936 3.422   0.539   1.00 0.00 ? 81  THR A N    1  
ATOM 1298  C CA   . THR A 1 81  ? -17.696 2.876   -0.572  1.00 0.00 ? 81  THR A CA   1  
ATOM 1299  C C    . THR A 1 81  ? -18.523 1.676   -0.140  1.00 0.00 ? 81  THR A C    1  
ATOM 1300  O O    . THR A 1 81  ? -18.104 0.898   0.711   1.00 0.00 ? 81  THR A O    1  
ATOM 1301  C CB   . THR A 1 81  ? -16.732 2.470   -1.686  1.00 0.00 ? 81  THR A CB   1  
ATOM 1302  O OG1  . THR A 1 81  ? -15.431 2.961   -1.429  1.00 0.00 ? 81  THR A OG1  1  
ATOM 1303  C CG2  . THR A 1 81  ? -17.131 2.963   -3.049  1.00 0.00 ? 81  THR A CG2  1  
ATOM 1304  H H    . THR A 1 81  ? -16.415 2.828   1.118   1.00 0.00 ? 81  THR A H    1  
ATOM 1305  H HA   . THR A 1 81  ? -18.353 3.649   -0.951  1.00 0.00 ? 81  THR A HA   1  
ATOM 1306  H HB   . THR A 1 81  ? -16.687 1.406   -1.731  1.00 0.00 ? 81  THR A HB   1  
ATOM 1307  H HG1  . THR A 1 81  ? -15.182 2.746   -0.529  1.00 0.00 ? 81  THR A HG1  1  
ATOM 1308  H HG21 . THR A 1 81  ? -18.016 2.446   -3.378  1.00 0.00 ? 81  THR A HG21 1  
ATOM 1309  H HG22 . THR A 1 81  ? -16.325 2.776   -3.745  1.00 0.00 ? 81  THR A HG22 1  
ATOM 1310  H HG23 . THR A 1 81  ? -17.324 4.018   -2.998  1.00 0.00 ? 81  THR A HG23 1  
ATOM 1311  N N    . VAL A 1 82  ? -19.682 1.523   -0.762  1.00 0.00 ? 82  VAL A N    1  
ATOM 1312  C CA   . VAL A 1 82  ? -20.572 0.406   -0.492  1.00 0.00 ? 82  VAL A CA   1  
ATOM 1313  C C    . VAL A 1 82  ? -20.970 -0.229  -1.810  1.00 0.00 ? 82  VAL A C    1  
ATOM 1314  O O    . VAL A 1 82  ? -21.894 0.237   -2.468  1.00 0.00 ? 82  VAL A O    1  
ATOM 1315  C CB   . VAL A 1 82  ? -21.855 0.845   0.247   1.00 0.00 ? 82  VAL A CB   1  
ATOM 1316  C CG1  . VAL A 1 82  ? -22.841 -0.318  0.366   1.00 0.00 ? 82  VAL A CG1  1  
ATOM 1317  C CG2  . VAL A 1 82  ? -21.520 1.414   1.617   1.00 0.00 ? 82  VAL A CG2  1  
ATOM 1318  H H    . VAL A 1 82  ? -19.939 2.165   -1.449  1.00 0.00 ? 82  VAL A H    1  
ATOM 1319  H HA   . VAL A 1 82  ? -20.046 -0.317  0.114   1.00 0.00 ? 82  VAL A HA   1  
ATOM 1320  H HB   . VAL A 1 82  ? -22.327 1.624   -0.336  1.00 0.00 ? 82  VAL A HB   1  
ATOM 1321  H HG11 . VAL A 1 82  ? -23.663 -0.029  1.004   1.00 0.00 ? 82  VAL A HG11 1  
ATOM 1322  H HG12 . VAL A 1 82  ? -22.341 -1.175  0.792   1.00 0.00 ? 82  VAL A HG12 1  
ATOM 1323  H HG13 . VAL A 1 82  ? -23.222 -0.575  -0.615  1.00 0.00 ? 82  VAL A HG13 1  
ATOM 1324  H HG21 . VAL A 1 82  ? -21.994 2.378   1.732   1.00 0.00 ? 82  VAL A HG21 1  
ATOM 1325  H HG22 . VAL A 1 82  ? -20.450 1.527   1.709   1.00 0.00 ? 82  VAL A HG22 1  
ATOM 1326  H HG23 . VAL A 1 82  ? -21.878 0.744   2.384   1.00 0.00 ? 82  VAL A HG23 1  
ATOM 1327  N N    . LEU A 1 83  ? -20.282 -1.286  -2.208  1.00 0.00 ? 83  LEU A N    1  
ATOM 1328  C CA   . LEU A 1 83  ? -20.618 -1.931  -3.461  1.00 0.00 ? 83  LEU A CA   1  
ATOM 1329  C C    . LEU A 1 83  ? -21.699 -2.973  -3.229  1.00 0.00 ? 83  LEU A C    1  
ATOM 1330  O O    . LEU A 1 83  ? -21.443 -4.051  -2.692  1.00 0.00 ? 83  LEU A O    1  
ATOM 1331  C CB   . LEU A 1 83  ? -19.384 -2.558  -4.132  1.00 0.00 ? 83  LEU A CB   1  
ATOM 1332  C CG   . LEU A 1 83  ? -19.686 -3.781  -5.004  1.00 0.00 ? 83  LEU A CG   1  
ATOM 1333  C CD1  . LEU A 1 83  ? -20.105 -3.394  -6.409  1.00 0.00 ? 83  LEU A CD1  1  
ATOM 1334  C CD2  . LEU A 1 83  ? -18.512 -4.726  -5.070  1.00 0.00 ? 83  LEU A CD2  1  
ATOM 1335  H H    . LEU A 1 83  ? -19.552 -1.636  -1.654  1.00 0.00 ? 83  LEU A H    1  
ATOM 1336  H HA   . LEU A 1 83  ? -21.018 -1.171  -4.117  1.00 0.00 ? 83  LEU A HA   1  
ATOM 1337  H HB2  . LEU A 1 83  ? -18.913 -1.806  -4.749  1.00 0.00 ? 83  LEU A HB2  1  
ATOM 1338  H HB3  . LEU A 1 83  ? -18.693 -2.854  -3.361  1.00 0.00 ? 83  LEU A HB3  1  
ATOM 1339  H HG   . LEU A 1 83  ? -20.496 -4.304  -4.562  1.00 0.00 ? 83  LEU A HG   1  
ATOM 1340  H HD11 . LEU A 1 83  ? -21.182 -3.361  -6.466  1.00 0.00 ? 83  LEU A HD11 1  
ATOM 1341  H HD12 . LEU A 1 83  ? -19.729 -4.136  -7.105  1.00 0.00 ? 83  LEU A HD12 1  
ATOM 1342  H HD13 . LEU A 1 83  ? -19.697 -2.429  -6.654  1.00 0.00 ? 83  LEU A HD13 1  
ATOM 1343  H HD21 . LEU A 1 83  ? -18.676 -5.549  -4.391  1.00 0.00 ? 83  LEU A HD21 1  
ATOM 1344  H HD22 . LEU A 1 83  ? -17.608 -4.203  -4.803  1.00 0.00 ? 83  LEU A HD22 1  
ATOM 1345  H HD23 . LEU A 1 83  ? -18.430 -5.104  -6.076  1.00 0.00 ? 83  LEU A HD23 1  
ATOM 1346  N N    . GLU A 1 84  ? -22.906 -2.642  -3.650  1.00 0.00 ? 84  GLU A N    1  
ATOM 1347  C CA   . GLU A 1 84  ? -24.033 -3.542  -3.512  1.00 0.00 ? 84  GLU A CA   1  
ATOM 1348  C C    . GLU A 1 84  ? -24.215 -4.309  -4.809  1.00 0.00 ? 84  GLU A C    1  
ATOM 1349  O O    . GLU A 1 84  ? -24.604 -3.741  -5.829  1.00 0.00 ? 84  GLU A O    1  
ATOM 1350  C CB   . GLU A 1 84  ? -25.294 -2.754  -3.168  1.00 0.00 ? 84  GLU A CB   1  
ATOM 1351  C CG   . GLU A 1 84  ? -25.524 -2.582  -1.681  1.00 0.00 ? 84  GLU A CG   1  
ATOM 1352  C CD   . GLU A 1 84  ? -26.436 -1.415  -1.359  1.00 0.00 ? 84  GLU A CD   1  
ATOM 1353  O OE1  . GLU A 1 84  ? -27.475 -1.269  -2.036  1.00 0.00 ? 84  GLU A OE1  1  
ATOM 1354  O OE2  . GLU A 1 84  ? -26.110 -0.646  -0.430  1.00 0.00 ? 84  GLU A OE2  1  
ATOM 1355  H H    . GLU A 1 84  ? -23.040 -1.771  -4.078  1.00 0.00 ? 84  GLU A H    1  
ATOM 1356  H HA   . GLU A 1 84  ? -23.815 -4.239  -2.716  1.00 0.00 ? 84  GLU A HA   1  
ATOM 1357  H HB2  . GLU A 1 84  ? -25.220 -1.784  -3.609  1.00 0.00 ? 84  GLU A HB2  1  
ATOM 1358  H HB3  . GLU A 1 84  ? -26.144 -3.255  -3.581  1.00 0.00 ? 84  GLU A HB3  1  
ATOM 1359  H HG2  . GLU A 1 84  ? -25.974 -3.484  -1.296  1.00 0.00 ? 84  GLU A HG2  1  
ATOM 1360  H HG3  . GLU A 1 84  ? -24.571 -2.420  -1.199  1.00 0.00 ? 84  GLU A HG3  1  
ATOM 1361  N N    . GLY A 1 85  ? -23.904 -5.595  -4.775  1.00 0.00 ? 85  GLY A N    1  
ATOM 1362  C CA   . GLY A 1 85  ? -24.017 -6.406  -5.965  1.00 0.00 ? 85  GLY A CA   1  
ATOM 1363  C C    . GLY A 1 85  ? -25.317 -7.166  -6.027  1.00 0.00 ? 85  GLY A C    1  
ATOM 1364  O O    . GLY A 1 85  ? -25.703 -7.843  -5.074  1.00 0.00 ? 85  GLY A O    1  
ATOM 1365  H H    . GLY A 1 85  ? -23.583 -5.991  -3.940  1.00 0.00 ? 85  GLY A H    1  
ATOM 1366  H HA2  . GLY A 1 85  ? -23.953 -5.761  -6.826  1.00 0.00 ? 85  GLY A HA2  1  
ATOM 1367  H HA3  . GLY A 1 85  ? -23.204 -7.099  -5.994  1.00 0.00 ? 85  GLY A HA3  1  
ATOM 1368  N N    . PHE A 1 86  ? -26.005 -7.030  -7.149  1.00 0.00 ? 86  PHE A N    1  
ATOM 1369  C CA   . PHE A 1 86  ? -27.288 -7.680  -7.346  1.00 0.00 ? 86  PHE A CA   1  
ATOM 1370  C C    . PHE A 1 86  ? -27.120 -8.947  -8.171  1.00 0.00 ? 86  PHE A C    1  
ATOM 1371  O O    . PHE A 1 86  ? -26.573 -8.916  -9.271  1.00 0.00 ? 86  PHE A O    1  
ATOM 1372  C CB   . PHE A 1 86  ? -28.268 -6.708  -8.025  1.00 0.00 ? 86  PHE A CB   1  
ATOM 1373  C CG   . PHE A 1 86  ? -28.120 -5.257  -7.614  1.00 0.00 ? 86  PHE A CG   1  
ATOM 1374  C CD1  . PHE A 1 86  ? -27.401 -4.894  -6.485  1.00 0.00 ? 86  PHE A CD1  1  
ATOM 1375  C CD2  . PHE A 1 86  ? -28.706 -4.251  -8.369  1.00 0.00 ? 86  PHE A CD2  1  
ATOM 1376  C CE1  . PHE A 1 86  ? -27.271 -3.573  -6.119  1.00 0.00 ? 86  PHE A CE1  1  
ATOM 1377  C CE2  . PHE A 1 86  ? -28.577 -2.922  -8.002  1.00 0.00 ? 86  PHE A CE2  1  
ATOM 1378  C CZ   . PHE A 1 86  ? -27.856 -2.586  -6.872  1.00 0.00 ? 86  PHE A CZ   1  
ATOM 1379  H H    . PHE A 1 86  ? -25.646 -6.461  -7.861  1.00 0.00 ? 86  PHE A H    1  
ATOM 1380  H HA   . PHE A 1 86  ? -27.679 -7.957  -6.382  1.00 0.00 ? 86  PHE A HA   1  
ATOM 1381  H HB2  . PHE A 1 86  ? -28.117 -6.754  -9.086  1.00 0.00 ? 86  PHE A HB2  1  
ATOM 1382  H HB3  . PHE A 1 86  ? -29.279 -7.015  -7.798  1.00 0.00 ? 86  PHE A HB3  1  
ATOM 1383  H HD1  . PHE A 1 86  ? -26.937 -5.656  -5.887  1.00 0.00 ? 86  PHE A HD1  1  
ATOM 1384  H HD2  . PHE A 1 86  ? -29.267 -4.513  -9.252  1.00 0.00 ? 86  PHE A HD2  1  
ATOM 1385  H HE1  . PHE A 1 86  ? -26.709 -3.312  -5.241  1.00 0.00 ? 86  PHE A HE1  1  
ATOM 1386  H HE2  . PHE A 1 86  ? -29.040 -2.149  -8.598  1.00 0.00 ? 86  PHE A HE2  1  
ATOM 1387  H HZ   . PHE A 1 86  ? -27.747 -1.552  -6.575  1.00 0.00 ? 86  PHE A HZ   1  
ATOM 1388  N N    . SER A 1 87  ? -27.595 -10.064 -7.633  1.00 0.00 ? 87  SER A N    1  
ATOM 1389  C CA   . SER A 1 87  ? -27.492 -11.331 -8.327  1.00 0.00 ? 87  SER A CA   1  
ATOM 1390  C C    . SER A 1 87  ? -28.590 -11.430 -9.381  1.00 0.00 ? 87  SER A C    1  
ATOM 1391  O O    . SER A 1 87  ? -29.752 -11.684 -9.057  1.00 0.00 ? 87  SER A O    1  
ATOM 1392  C CB   . SER A 1 87  ? -27.606 -12.496 -7.341  1.00 0.00 ? 87  SER A CB   1  
ATOM 1393  O OG   . SER A 1 87  ? -27.491 -13.742 -8.007  1.00 0.00 ? 87  SER A OG   1  
ATOM 1394  H H    . SER A 1 87  ? -28.031 -10.032 -6.752  1.00 0.00 ? 87  SER A H    1  
ATOM 1395  H HA   . SER A 1 87  ? -26.520 -11.363 -8.804  1.00 0.00 ? 87  SER A HA   1  
ATOM 1396  H HB2  . SER A 1 87  ? -26.819 -12.422 -6.607  1.00 0.00 ? 87  SER A HB2  1  
ATOM 1397  H HB3  . SER A 1 87  ? -28.566 -12.453 -6.846  1.00 0.00 ? 87  SER A HB3  1  
ATOM 1398  H HG   . SER A 1 87  ? -28.133 -13.785 -8.719  1.00 0.00 ? 87  SER A HG   1  
ATOM 1399  N N    . GLY A 1 88  ? -28.226 -11.209 -10.638 1.00 0.00 ? 88  GLY A N    1  
ATOM 1400  C CA   . GLY A 1 88  ? -29.204 -11.263 -11.707 1.00 0.00 ? 88  GLY A CA   1  
ATOM 1401  C C    . GLY A 1 88  ? -30.113 -10.048 -11.717 1.00 0.00 ? 88  GLY A C    1  
ATOM 1402  O O    . GLY A 1 88  ? -29.861 -9.085  -12.439 1.00 0.00 ? 88  GLY A O    1  
ATOM 1403  H H    . GLY A 1 88  ? -27.291 -10.996 -10.839 1.00 0.00 ? 88  GLY A H    1  
ATOM 1404  H HA2  . GLY A 1 88  ? -28.686 -11.321 -12.653 1.00 0.00 ? 88  GLY A HA2  1  
ATOM 1405  H HA3  . GLY A 1 88  ? -29.808 -12.150 -11.584 1.00 0.00 ? 88  GLY A HA3  1  
ATOM 1406  N N    . ASN A 1 89  ? -31.180 -10.098 -10.923 1.00 0.00 ? 89  ASN A N    1  
ATOM 1407  C CA   . ASN A 1 89  ? -32.130 -8.989  -10.844 1.00 0.00 ? 89  ASN A CA   1  
ATOM 1408  C C    . ASN A 1 89  ? -32.274 -8.449  -9.415  1.00 0.00 ? 89  ASN A C    1  
ATOM 1409  O O    . ASN A 1 89  ? -32.811 -7.360  -9.210  1.00 0.00 ? 89  ASN A O    1  
ATOM 1410  C CB   . ASN A 1 89  ? -33.498 -9.433  -11.367 1.00 0.00 ? 89  ASN A CB   1  
ATOM 1411  C CG   . ASN A 1 89  ? -33.435 -9.941  -12.793 1.00 0.00 ? 89  ASN A CG   1  
ATOM 1412  O OD1  . ASN A 1 89  ? -32.408 -9.823  -13.462 1.00 0.00 ? 89  ASN A OD1  1  
ATOM 1413  N ND2  . ASN A 1 89  ? -34.536 -10.512 -13.267 1.00 0.00 ? 89  ASN A ND2  1  
ATOM 1414  H H    . ASN A 1 89  ? -31.333 -10.898 -10.380 1.00 0.00 ? 89  ASN A H    1  
ATOM 1415  H HA   . ASN A 1 89  ? -31.760 -8.196  -11.476 1.00 0.00 ? 89  ASN A HA   1  
ATOM 1416  H HB2  . ASN A 1 89  ? -33.876 -10.225 -10.738 1.00 0.00 ? 89  ASN A HB2  1  
ATOM 1417  H HB3  . ASN A 1 89  ? -34.178 -8.595  -11.332 1.00 0.00 ? 89  ASN A HB3  1  
ATOM 1418  H HD21 . ASN A 1 89  ? -35.317 -10.572 -12.677 1.00 0.00 ? 89  ASN A HD21 1  
ATOM 1419  H HD22 . ASN A 1 89  ? -34.524 -10.850 -14.186 1.00 0.00 ? 89  ASN A HD22 1  
ATOM 1420  N N    . THR A 1 90  ? -31.841 -9.235  -8.430  1.00 0.00 ? 90  THR A N    1  
ATOM 1421  C CA   . THR A 1 90  ? -31.973 -8.855  -7.019  1.00 0.00 ? 90  THR A CA   1  
ATOM 1422  C C    . THR A 1 90  ? -30.643 -8.531  -6.352  1.00 0.00 ? 90  THR A C    1  
ATOM 1423  O O    . THR A 1 90  ? -29.618 -9.110  -6.686  1.00 0.00 ? 90  THR A O    1  
ATOM 1424  C CB   . THR A 1 90  ? -32.613 -10.003 -6.244  1.00 0.00 ? 90  THR A CB   1  
ATOM 1425  O OG1  . THR A 1 90  ? -33.983 -10.141 -6.577  1.00 0.00 ? 90  THR A OG1  1  
ATOM 1426  C CG2  . THR A 1 90  ? -32.511 -9.842  -4.740  1.00 0.00 ? 90  THR A CG2  1  
ATOM 1427  H H    . THR A 1 90  ? -31.453 -10.109 -8.651  1.00 0.00 ? 90  THR A H    1  
ATOM 1428  H HA   . THR A 1 90  ? -32.618 -7.994  -6.960  1.00 0.00 ? 90  THR A HA   1  
ATOM 1429  H HB   . THR A 1 90  ? -32.100 -10.919 -6.509  1.00 0.00 ? 90  THR A HB   1  
ATOM 1430  H HG1  . THR A 1 90  ? -34.063 -10.536 -7.448  1.00 0.00 ? 90  THR A HG1  1  
ATOM 1431  H HG21 . THR A 1 90  ? -31.472 -9.710  -4.463  1.00 0.00 ? 90  THR A HG21 1  
ATOM 1432  H HG22 . THR A 1 90  ? -32.905 -10.722 -4.255  1.00 0.00 ? 90  THR A HG22 1  
ATOM 1433  H HG23 . THR A 1 90  ? -33.077 -8.976  -4.431  1.00 0.00 ? 90  THR A HG23 1  
ATOM 1434  N N    . THR A 1 91  ? -30.688 -7.656  -5.347  1.00 0.00 ? 91  THR A N    1  
ATOM 1435  C CA   . THR A 1 91  ? -29.492 -7.338  -4.582  1.00 0.00 ? 91  THR A CA   1  
ATOM 1436  C C    . THR A 1 91  ? -29.140 -8.540  -3.730  1.00 0.00 ? 91  THR A C    1  
ATOM 1437  O O    . THR A 1 91  ? -29.881 -8.925  -2.826  1.00 0.00 ? 91  THR A O    1  
ATOM 1438  C CB   . THR A 1 91  ? -29.686 -6.110  -3.698  1.00 0.00 ? 91  THR A CB   1  
ATOM 1439  O OG1  . THR A 1 91  ? -30.965 -6.119  -3.090  1.00 0.00 ? 91  THR A OG1  1  
ATOM 1440  C CG2  . THR A 1 91  ? -29.535 -4.802  -4.439  1.00 0.00 ? 91  THR A CG2  1  
ATOM 1441  H H    . THR A 1 91  ? -31.548 -7.267  -5.083  1.00 0.00 ? 91  THR A H    1  
ATOM 1442  H HA   . THR A 1 91  ? -28.682 -7.166  -5.271  1.00 0.00 ? 91  THR A HA   1  
ATOM 1443  H HB   . THR A 1 91  ? -28.937 -6.131  -2.921  1.00 0.00 ? 91  THR A HB   1  
ATOM 1444  H HG1  . THR A 1 91  ? -30.865 -6.117  -2.135  1.00 0.00 ? 91  THR A HG1  1  
ATOM 1445  H HG21 . THR A 1 91  ? -29.664 -4.971  -5.498  1.00 0.00 ? 91  THR A HG21 1  
ATOM 1446  H HG22 . THR A 1 91  ? -28.549 -4.400  -4.254  1.00 0.00 ? 91  THR A HG22 1  
ATOM 1447  H HG23 . THR A 1 91  ? -30.280 -4.102  -4.092  1.00 0.00 ? 91  THR A HG23 1  
ATOM 1448  N N    . LEU A 1 92  ? -28.025 -9.148  -4.063  1.00 0.00 ? 92  LEU A N    1  
ATOM 1449  C CA   . LEU A 1 92  ? -27.559 -10.339 -3.390  1.00 0.00 ? 92  LEU A CA   1  
ATOM 1450  C C    . LEU A 1 92  ? -26.622 -10.001 -2.236  1.00 0.00 ? 92  LEU A C    1  
ATOM 1451  O O    . LEU A 1 92  ? -26.436 -10.807 -1.324  1.00 0.00 ? 92  LEU A O    1  
ATOM 1452  C CB   . LEU A 1 92  ? -26.869 -11.215 -4.433  1.00 0.00 ? 92  LEU A CB   1  
ATOM 1453  C CG   . LEU A 1 92  ? -25.756 -12.143 -3.929  1.00 0.00 ? 92  LEU A CG   1  
ATOM 1454  C CD1  . LEU A 1 92  ? -26.351 -13.395 -3.305  1.00 0.00 ? 92  LEU A CD1  1  
ATOM 1455  C CD2  . LEU A 1 92  ? -24.809 -12.507 -5.067  1.00 0.00 ? 92  LEU A CD2  1  
ATOM 1456  H H    . LEU A 1 92  ? -27.505 -8.798  -4.812  1.00 0.00 ? 92  LEU A H    1  
ATOM 1457  H HA   . LEU A 1 92  ? -28.419 -10.865 -3.004  1.00 0.00 ? 92  LEU A HA   1  
ATOM 1458  H HB2  . LEU A 1 92  ? -27.625 -11.827 -4.905  1.00 0.00 ? 92  LEU A HB2  1  
ATOM 1459  H HB3  . LEU A 1 92  ? -26.454 -10.551 -5.182  1.00 0.00 ? 92  LEU A HB3  1  
ATOM 1460  H HG   . LEU A 1 92  ? -25.183 -11.635 -3.168  1.00 0.00 ? 92  LEU A HG   1  
ATOM 1461  H HD11 . LEU A 1 92  ? -25.597 -14.167 -3.259  1.00 0.00 ? 92  LEU A HD11 1  
ATOM 1462  H HD12 . LEU A 1 92  ? -27.180 -13.738 -3.907  1.00 0.00 ? 92  LEU A HD12 1  
ATOM 1463  H HD13 . LEU A 1 92  ? -26.698 -13.171 -2.308  1.00 0.00 ? 92  LEU A HD13 1  
ATOM 1464  H HD21 . LEU A 1 92  ? -25.039 -11.907 -5.936  1.00 0.00 ? 92  LEU A HD21 1  
ATOM 1465  H HD22 . LEU A 1 92  ? -24.925 -13.552 -5.312  1.00 0.00 ? 92  LEU A HD22 1  
ATOM 1466  H HD23 . LEU A 1 92  ? -23.791 -12.320 -4.761  1.00 0.00 ? 92  LEU A HD23 1  
ATOM 1467  N N    . PHE A 1 93  ? -26.026 -8.815  -2.278  1.00 0.00 ? 93  PHE A N    1  
ATOM 1468  C CA   . PHE A 1 93  ? -25.109 -8.410  -1.225  1.00 0.00 ? 93  PHE A CA   1  
ATOM 1469  C C    . PHE A 1 93  ? -24.859 -6.903  -1.222  1.00 0.00 ? 93  PHE A C    1  
ATOM 1470  O O    . PHE A 1 93  ? -25.233 -6.186  -2.150  1.00 0.00 ? 93  PHE A O    1  
ATOM 1471  C CB   . PHE A 1 93  ? -23.785 -9.159  -1.373  1.00 0.00 ? 93  PHE A CB   1  
ATOM 1472  C CG   . PHE A 1 93  ? -23.107 -8.921  -2.691  1.00 0.00 ? 93  PHE A CG   1  
ATOM 1473  C CD1  . PHE A 1 93  ? -23.634 -9.440  -3.865  1.00 0.00 ? 93  PHE A CD1  1  
ATOM 1474  C CD2  . PHE A 1 93  ? -21.944 -8.177  -2.754  1.00 0.00 ? 93  PHE A CD2  1  
ATOM 1475  C CE1  . PHE A 1 93  ? -23.013 -9.220  -5.079  1.00 0.00 ? 93  PHE A CE1  1  
ATOM 1476  C CE2  . PHE A 1 93  ? -21.316 -7.951  -3.959  1.00 0.00 ? 93  PHE A CE2  1  
ATOM 1477  C CZ   . PHE A 1 93  ? -21.846 -8.470  -5.123  1.00 0.00 ? 93  PHE A CZ   1  
ATOM 1478  H H    . PHE A 1 93  ? -26.202 -8.212  -3.030  1.00 0.00 ? 93  PHE A H    1  
ATOM 1479  H HA   . PHE A 1 93  ? -25.555 -8.684  -0.281  1.00 0.00 ? 93  PHE A HA   1  
ATOM 1480  H HB2  . PHE A 1 93  ? -23.111 -8.844  -0.591  1.00 0.00 ? 93  PHE A HB2  1  
ATOM 1481  H HB3  . PHE A 1 93  ? -23.968 -10.220 -1.279  1.00 0.00 ? 93  PHE A HB3  1  
ATOM 1482  H HD1  . PHE A 1 93  ? -24.541 -10.019 -3.827  1.00 0.00 ? 93  PHE A HD1  1  
ATOM 1483  H HD2  . PHE A 1 93  ? -21.525 -7.769  -1.847  1.00 0.00 ? 93  PHE A HD2  1  
ATOM 1484  H HE1  . PHE A 1 93  ? -23.441 -9.632  -5.992  1.00 0.00 ? 93  PHE A HE1  1  
ATOM 1485  H HE2  . PHE A 1 93  ? -20.409 -7.367  -3.991  1.00 0.00 ? 93  PHE A HE2  1  
ATOM 1486  H HZ   . PHE A 1 93  ? -21.351 -8.283  -6.066  1.00 0.00 ? 93  PHE A HZ   1  
ATOM 1487  N N    . SER A 1 94  ? -24.215 -6.449  -0.154  1.00 0.00 ? 94  SER A N    1  
ATOM 1488  C CA   . SER A 1 94  ? -23.872 -5.047  0.050   1.00 0.00 ? 94  SER A CA   1  
ATOM 1489  C C    . SER A 1 94  ? -22.629 -4.995  0.930   1.00 0.00 ? 94  SER A C    1  
ATOM 1490  O O    . SER A 1 94  ? -22.703 -5.291  2.123   1.00 0.00 ? 94  SER A O    1  
ATOM 1491  C CB   . SER A 1 94  ? -25.016 -4.317  0.757   1.00 0.00 ? 94  SER A CB   1  
ATOM 1492  O OG   . SER A 1 94  ? -26.272 -4.868  0.402   1.00 0.00 ? 94  SER A OG   1  
ATOM 1493  H H    . SER A 1 94  ? -23.949 -7.084  0.540   1.00 0.00 ? 94  SER A H    1  
ATOM 1494  H HA   . SER A 1 94  ? -23.673 -4.577  -0.913  1.00 0.00 ? 94  SER A HA   1  
ATOM 1495  H HB2  . SER A 1 94  ? -24.888 -4.404  1.825   1.00 0.00 ? 94  SER A HB2  1  
ATOM 1496  H HB3  . SER A 1 94  ? -25.001 -3.275  0.483   1.00 0.00 ? 94  SER A HB3  1  
ATOM 1497  H HG   . SER A 1 94  ? -26.974 -4.285  0.701   1.00 0.00 ? 94  SER A HG   1  
ATOM 1498  N N    . CYS A 1 95  ? -21.490 -4.630  0.361   1.00 0.00 ? 95  CYS A N    1  
ATOM 1499  C CA   . CYS A 1 95  ? -20.256 -4.563  1.132   1.00 0.00 ? 95  CYS A CA   1  
ATOM 1500  C C    . CYS A 1 95  ? -19.666 -3.165  1.053   1.00 0.00 ? 95  CYS A C    1  
ATOM 1501  O O    . CYS A 1 95  ? -19.757 -2.508  0.017   1.00 0.00 ? 95  CYS A O    1  
ATOM 1502  C CB   . CYS A 1 95  ? -19.249 -5.597  0.619   1.00 0.00 ? 95  CYS A CB   1  
ATOM 1503  S SG   . CYS A 1 95  ? -19.554 -7.300  1.190   1.00 0.00 ? 95  CYS A SG   1  
ATOM 1504  H H    . CYS A 1 95  ? -21.468 -4.392  -0.590  1.00 0.00 ? 95  CYS A H    1  
ATOM 1505  H HA   . CYS A 1 95  ? -20.493 -4.779  2.159   1.00 0.00 ? 95  CYS A HA   1  
ATOM 1506  H HB2  . CYS A 1 95  ? -19.277 -5.608  -0.460  1.00 0.00 ? 95  CYS A HB2  1  
ATOM 1507  H HB3  . CYS A 1 95  ? -18.258 -5.314  0.944   1.00 0.00 ? 95  CYS A HB3  1  
ATOM 1508  N N    . SER A 1 96  ? -19.070 -2.701  2.148   1.00 0.00 ? 96  SER A N    1  
ATOM 1509  C CA   . SER A 1 96  ? -18.487 -1.369  2.174   1.00 0.00 ? 96  SER A CA   1  
ATOM 1510  C C    . SER A 1 96  ? -17.040 -1.402  2.652   1.00 0.00 ? 96  SER A C    1  
ATOM 1511  O O    . SER A 1 96  ? -16.562 -2.418  3.158   1.00 0.00 ? 96  SER A O    1  
ATOM 1512  C CB   . SER A 1 96  ? -19.310 -0.453  3.081   1.00 0.00 ? 96  SER A CB   1  
ATOM 1513  O OG   . SER A 1 96  ? -18.803 0.870   3.069   1.00 0.00 ? 96  SER A OG   1  
ATOM 1514  H H    . SER A 1 96  ? -19.020 -3.249  2.958   1.00 0.00 ? 96  SER A H    1  
ATOM 1515  H HA   . SER A 1 96  ? -18.512 -0.982  1.170   1.00 0.00 ? 96  SER A HA   1  
ATOM 1516  H HB2  . SER A 1 96  ? -20.333 -0.437  2.738   1.00 0.00 ? 96  SER A HB2  1  
ATOM 1517  H HB3  . SER A 1 96  ? -19.277 -0.829  4.093   1.00 0.00 ? 96  SER A HB3  1  
ATOM 1518  H HG   . SER A 1 96  ? -18.848 1.238   3.955   1.00 0.00 ? 96  SER A HG   1  
ATOM 1519  N N    . HIS A 1 97  ? -16.351 -0.278  2.488   1.00 0.00 ? 97  HIS A N    1  
ATOM 1520  C CA   . HIS A 1 97  ? -14.958 -0.160  2.899   1.00 0.00 ? 97  HIS A CA   1  
ATOM 1521  C C    . HIS A 1 97  ? -14.497 1.292   2.819   1.00 0.00 ? 97  HIS A C    1  
ATOM 1522  O O    . HIS A 1 97  ? -14.828 2.005   1.872   1.00 0.00 ? 97  HIS A O    1  
ATOM 1523  C CB   . HIS A 1 97  ? -14.067 -1.040  2.020   1.00 0.00 ? 97  HIS A CB   1  
ATOM 1524  C CG   . HIS A 1 97  ? -12.614 -0.971  2.378   1.00 0.00 ? 97  HIS A CG   1  
ATOM 1525  N ND1  . HIS A 1 97  ? -12.146 -1.144  3.664   1.00 0.00 ? 97  HIS A ND1  1  
ATOM 1526  C CD2  . HIS A 1 97  ? -11.521 -0.747  1.610   1.00 0.00 ? 97  HIS A CD2  1  
ATOM 1527  C CE1  . HIS A 1 97  ? -10.830 -1.027  3.671   1.00 0.00 ? 97  HIS A CE1  1  
ATOM 1528  N NE2  . HIS A 1 97  ? -10.427 -0.787  2.437   1.00 0.00 ? 97  HIS A NE2  1  
ATOM 1529  H H    . HIS A 1 97  ? -16.793 0.495   2.079   1.00 0.00 ? 97  HIS A H    1  
ATOM 1530  H HA   . HIS A 1 97  ? -14.884 -0.494  3.923   1.00 0.00 ? 97  HIS A HA   1  
ATOM 1531  H HB2  . HIS A 1 97  ? -14.383 -2.068  2.115   1.00 0.00 ? 97  HIS A HB2  1  
ATOM 1532  H HB3  . HIS A 1 97  ? -14.171 -0.730  0.991   1.00 0.00 ? 97  HIS A HB3  1  
ATOM 1533  H HD1  . HIS A 1 97  ? -12.697 -1.324  4.454   1.00 0.00 ? 97  HIS A HD1  1  
ATOM 1534  H HD2  . HIS A 1 97  ? -11.513 -0.569  0.543   1.00 0.00 ? 97  HIS A HD2  1  
ATOM 1535  H HE1  . HIS A 1 97  ? -10.193 -1.115  4.539   1.00 0.00 ? 97  HIS A HE1  1  
ATOM 1536  H HE2  . HIS A 1 97  ? -9.509  -0.563  2.177   1.00 0.00 ? 97  HIS A HE2  1  
ATOM 1537  N N    . ASN A 1 98  ? -13.734 1.725   3.816   1.00 0.00 ? 98  ASN A N    1  
ATOM 1538  C CA   . ASN A 1 98  ? -13.230 3.093   3.851   1.00 0.00 ? 98  ASN A CA   1  
ATOM 1539  C C    . ASN A 1 98  ? -11.948 3.216   3.035   1.00 0.00 ? 98  ASN A C    1  
ATOM 1540  O O    . ASN A 1 98  ? -10.870 2.840   3.495   1.00 0.00 ? 98  ASN A O    1  
ATOM 1541  C CB   . ASN A 1 98  ? -12.974 3.531   5.295   1.00 0.00 ? 98  ASN A CB   1  
ATOM 1542  C CG   . ASN A 1 98  ? -12.129 2.532   6.062   1.00 0.00 ? 98  ASN A CG   1  
ATOM 1543  O OD1  . ASN A 1 98  ? -10.902 2.534   5.964   1.00 0.00 ? 98  ASN A OD1  1  
ATOM 1544  N ND2  . ASN A 1 98  ? -12.784 1.671   6.832   1.00 0.00 ? 98  ASN A ND2  1  
ATOM 1545  H H    . ASN A 1 98  ? -13.503 1.111   4.544   1.00 0.00 ? 98  ASN A H    1  
ATOM 1546  H HA   . ASN A 1 98  ? -13.981 3.734   3.417   1.00 0.00 ? 98  ASN A HA   1  
ATOM 1547  H HB2  . ASN A 1 98  ? -12.459 4.480   5.291   1.00 0.00 ? 98  ASN A HB2  1  
ATOM 1548  H HB3  . ASN A 1 98  ? -13.920 3.641   5.804   1.00 0.00 ? 98  ASN A HB3  1  
ATOM 1549  H HD21 . ASN A 1 98  ? -13.762 1.728   6.862   1.00 0.00 ? 98  ASN A HD21 1  
ATOM 1550  H HD22 . ASN A 1 98  ? -12.263 1.014   7.340   1.00 0.00 ? 98  ASN A HD22 1  
ATOM 1551  N N    . PHE A 1 99  ? -12.070 3.743   1.820   1.00 0.00 ? 99  PHE A N    1  
ATOM 1552  C CA   . PHE A 1 99  ? -10.912 3.908   0.947   1.00 0.00 ? 99  PHE A CA   1  
ATOM 1553  C C    . PHE A 1 99  ? -10.066 5.093   1.377   1.00 0.00 ? 99  PHE A C    1  
ATOM 1554  O O    . PHE A 1 99  ? -10.499 6.243   1.278   1.00 0.00 ? 99  PHE A O    1  
ATOM 1555  C CB   . PHE A 1 99  ? -11.334 4.138   -0.500  1.00 0.00 ? 99  PHE A CB   1  
ATOM 1556  C CG   . PHE A 1 99  ? -11.905 2.943   -1.201  1.00 0.00 ? 99  PHE A CG   1  
ATOM 1557  C CD1  . PHE A 1 99  ? -12.931 2.204   -0.640  1.00 0.00 ? 99  PHE A CD1  1  
ATOM 1558  C CD2  . PHE A 1 99  ? -11.437 2.589   -2.452  1.00 0.00 ? 99  PHE A CD2  1  
ATOM 1559  C CE1  . PHE A 1 99  ? -13.475 1.129   -1.317  1.00 0.00 ? 99  PHE A CE1  1  
ATOM 1560  C CE2  . PHE A 1 99  ? -11.983 1.524   -3.136  1.00 0.00 ? 99  PHE A CE2  1  
ATOM 1561  C CZ   . PHE A 1 99  ? -13.000 0.795   -2.569  1.00 0.00 ? 99  PHE A CZ   1  
ATOM 1562  H H    . PHE A 1 99  ? -12.956 4.024   1.505   1.00 0.00 ? 99  PHE A H    1  
ATOM 1563  H HA   . PHE A 1 99  ? -10.317 3.009   1.004   1.00 0.00 ? 99  PHE A HA   1  
ATOM 1564  H HB2  . PHE A 1 99  ? -12.078 4.917   -0.526  1.00 0.00 ? 99  PHE A HB2  1  
ATOM 1565  H HB3  . PHE A 1 99  ? -10.470 4.466   -1.062  1.00 0.00 ? 99  PHE A HB3  1  
ATOM 1566  H HD1  . PHE A 1 99  ? -13.303 2.467   0.337   1.00 0.00 ? 99  PHE A HD1  1  
ATOM 1567  H HD2  . PHE A 1 99  ? -10.634 3.157   -2.895  1.00 0.00 ? 99  PHE A HD2  1  
ATOM 1568  H HE1  . PHE A 1 99  ? -14.275 0.557   -0.870  1.00 0.00 ? 99  PHE A HE1  1  
ATOM 1569  H HE2  . PHE A 1 99  ? -11.611 1.260   -4.112  1.00 0.00 ? 99  PHE A HE2  1  
ATOM 1570  H HZ   . PHE A 1 99  ? -13.431 -0.027  -3.110  1.00 0.00 ? 99  PHE A HZ   1  
ATOM 1571  N N    . TRP A 1 100 ? -8.848  4.813   1.811   1.00 0.00 ? 100 TRP A N    1  
ATOM 1572  C CA   . TRP A 1 100 ? -7.927  5.862   2.211   1.00 0.00 ? 100 TRP A CA   1  
ATOM 1573  C C    . TRP A 1 100 ? -7.058  6.245   1.023   1.00 0.00 ? 100 TRP A C    1  
ATOM 1574  O O    . TRP A 1 100 ? -5.947  5.755   0.887   1.00 0.00 ? 100 TRP A O    1  
ATOM 1575  C CB   . TRP A 1 100 ? -7.049  5.391   3.374   1.00 0.00 ? 100 TRP A CB   1  
ATOM 1576  C CG   . TRP A 1 100 ? -7.063  6.316   4.553   1.00 0.00 ? 100 TRP A CG   1  
ATOM 1577  C CD1  . TRP A 1 100 ? -6.902  5.969   5.863   1.00 0.00 ? 100 TRP A CD1  1  
ATOM 1578  C CD2  . TRP A 1 100 ? -7.246  7.738   4.534   1.00 0.00 ? 100 TRP A CD2  1  
ATOM 1579  N NE1  . TRP A 1 100 ? -6.972  7.085   6.659   1.00 0.00 ? 100 TRP A NE1  1  
ATOM 1580  C CE2  . TRP A 1 100 ? -7.183  8.183   5.868   1.00 0.00 ? 100 TRP A CE2  1  
ATOM 1581  C CE3  . TRP A 1 100 ? -7.455  8.680   3.521   1.00 0.00 ? 100 TRP A CE3  1  
ATOM 1582  C CZ2  . TRP A 1 100 ? -7.323  9.525   6.214   1.00 0.00 ? 100 TRP A CZ2  1  
ATOM 1583  C CZ3  . TRP A 1 100 ? -7.593  10.011  3.866   1.00 0.00 ? 100 TRP A CZ3  1  
ATOM 1584  C CH2  . TRP A 1 100 ? -7.526  10.422  5.203   1.00 0.00 ? 100 TRP A CH2  1  
ATOM 1585  H H    . TRP A 1 100 ? -8.551  3.880   1.837   1.00 0.00 ? 100 TRP A H    1  
ATOM 1586  H HA   . TRP A 1 100 ? -8.501  6.719   2.522   1.00 0.00 ? 100 TRP A HA   1  
ATOM 1587  H HB2  . TRP A 1 100 ? -7.394  4.425   3.706   1.00 0.00 ? 100 TRP A HB2  1  
ATOM 1588  H HB3  . TRP A 1 100 ? -6.028  5.302   3.033   1.00 0.00 ? 100 TRP A HB3  1  
ATOM 1589  H HD1  . TRP A 1 100 ? -6.742  4.958   6.209   1.00 0.00 ? 100 TRP A HD1  1  
ATOM 1590  H HE1  . TRP A 1 100 ? -6.885  7.093   7.634   1.00 0.00 ? 100 TRP A HE1  1  
ATOM 1591  H HE3  . TRP A 1 100 ? -7.509  8.383   2.484   1.00 0.00 ? 100 TRP A HE3  1  
ATOM 1592  H HZ2  . TRP A 1 100 ? -7.273  9.858   7.240   1.00 0.00 ? 100 TRP A HZ2  1  
ATOM 1593  H HZ3  . TRP A 1 100 ? -7.756  10.752  3.097   1.00 0.00 ? 100 TRP A HZ3  1  
ATOM 1594  H HH2  . TRP A 1 100 ? -7.641  11.473  5.427   1.00 0.00 ? 100 TRP A HH2  1  
ATOM 1595  N N    . LEU A 1 101 ? -7.569  7.116   0.157   1.00 0.00 ? 101 LEU A N    1  
ATOM 1596  C CA   . LEU A 1 101 ? -6.813  7.539   -1.017  1.00 0.00 ? 101 LEU A CA   1  
ATOM 1597  C C    . LEU A 1 101 ? -5.594  8.338   -0.599  1.00 0.00 ? 101 LEU A C    1  
ATOM 1598  O O    . LEU A 1 101 ? -4.457  7.930   -0.838  1.00 0.00 ? 101 LEU A O    1  
ATOM 1599  C CB   . LEU A 1 101 ? -7.688  8.375   -1.951  1.00 0.00 ? 101 LEU A CB   1  
ATOM 1600  C CG   . LEU A 1 101 ? -8.984  7.697   -2.390  1.00 0.00 ? 101 LEU A CG   1  
ATOM 1601  C CD1  . LEU A 1 101 ? -10.186 8.555   -2.027  1.00 0.00 ? 101 LEU A CD1  1  
ATOM 1602  C CD2  . LEU A 1 101 ? -8.958  7.416   -3.883  1.00 0.00 ? 101 LEU A CD2  1  
ATOM 1603  H H    . LEU A 1 101 ? -8.464  7.483   0.309   1.00 0.00 ? 101 LEU A H    1  
ATOM 1604  H HA   . LEU A 1 101 ? -6.487  6.652   -1.540  1.00 0.00 ? 101 LEU A HA   1  
ATOM 1605  H HB2  . LEU A 1 101 ? -7.936  9.298   -1.447  1.00 0.00 ? 101 LEU A HB2  1  
ATOM 1606  H HB3  . LEU A 1 101 ? -7.113  8.609   -2.835  1.00 0.00 ? 101 LEU A HB3  1  
ATOM 1607  H HG   . LEU A 1 101 ? -9.078  6.754   -1.873  1.00 0.00 ? 101 LEU A HG   1  
ATOM 1608  H HD11 . LEU A 1 101 ? -9.870  9.579   -1.894  1.00 0.00 ? 101 LEU A HD11 1  
ATOM 1609  H HD12 . LEU A 1 101 ? -10.621 8.191   -1.111  1.00 0.00 ? 101 LEU A HD12 1  
ATOM 1610  H HD13 . LEU A 1 101 ? -10.918 8.504   -2.819  1.00 0.00 ? 101 LEU A HD13 1  
ATOM 1611  H HD21 . LEU A 1 101 ? -9.404  6.451   -4.075  1.00 0.00 ? 101 LEU A HD21 1  
ATOM 1612  H HD22 . LEU A 1 101 ? -7.936  7.416   -4.232  1.00 0.00 ? 101 LEU A HD22 1  
ATOM 1613  H HD23 . LEU A 1 101 ? -9.519  8.182   -4.402  1.00 0.00 ? 101 LEU A HD23 1  
ATOM 1614  N N    . ALA A 1 102 ? -5.840  9.480   0.034   1.00 0.00 ? 102 ALA A N    1  
ATOM 1615  C CA   . ALA A 1 102 ? -4.771  10.352  0.501   1.00 0.00 ? 102 ALA A CA   1  
ATOM 1616  C C    . ALA A 1 102 ? -3.640  9.554   1.152   1.00 0.00 ? 102 ALA A C    1  
ATOM 1617  O O    . ALA A 1 102 ? -2.487  9.983   1.153   1.00 0.00 ? 102 ALA A O    1  
ATOM 1618  C CB   . ALA A 1 102 ? -5.334  11.378  1.481   1.00 0.00 ? 102 ALA A CB   1  
ATOM 1619  H H    . ALA A 1 102 ? -6.769  9.749   0.192   1.00 0.00 ? 102 ALA A H    1  
ATOM 1620  H HA   . ALA A 1 102 ? -4.378  10.884  -0.352  1.00 0.00 ? 102 ALA A HA   1  
ATOM 1621  H HB1  . ALA A 1 102 ? -4.772  11.344  2.403   1.00 0.00 ? 102 ALA A HB1  1  
ATOM 1622  H HB2  . ALA A 1 102 ? -6.374  11.154  1.687   1.00 0.00 ? 102 ALA A HB2  1  
ATOM 1623  H HB3  . ALA A 1 102 ? -5.259  12.365  1.051   1.00 0.00 ? 102 ALA A HB3  1  
ATOM 1624  N N    . ILE A 1 103 ? -3.984  8.403   1.726   1.00 0.00 ? 103 ILE A N    1  
ATOM 1625  C CA   . ILE A 1 103 ? -3.004  7.563   2.403   1.00 0.00 ? 103 ILE A CA   1  
ATOM 1626  C C    . ILE A 1 103 ? -2.643  6.305   1.600   1.00 0.00 ? 103 ILE A C    1  
ATOM 1627  O O    . ILE A 1 103 ? -1.603  5.694   1.845   1.00 0.00 ? 103 ILE A O    1  
ATOM 1628  C CB   . ILE A 1 103 ? -3.527  7.149   3.802   1.00 0.00 ? 103 ILE A CB   1  
ATOM 1629  C CG1  . ILE A 1 103 ? -3.437  8.331   4.770   1.00 0.00 ? 103 ILE A CG1  1  
ATOM 1630  C CG2  . ILE A 1 103 ? -2.747  5.959   4.351   1.00 0.00 ? 103 ILE A CG2  1  
ATOM 1631  C CD1  . ILE A 1 103 ? -4.395  9.456   4.446   1.00 0.00 ? 103 ILE A CD1  1  
ATOM 1632  H H    . ILE A 1 103 ? -4.923  8.124   1.720   1.00 0.00 ? 103 ILE A H    1  
ATOM 1633  H HA   . ILE A 1 103 ? -2.110  8.151   2.545   1.00 0.00 ? 103 ILE A HA   1  
ATOM 1634  H HB   . ILE A 1 103 ? -4.565  6.855   3.702   1.00 0.00 ? 103 ILE A HB   1  
ATOM 1635  H HG12 . ILE A 1 103 ? -3.659  7.986   5.769   1.00 0.00 ? 103 ILE A HG12 1  
ATOM 1636  H HG13 . ILE A 1 103 ? -2.434  8.731   4.747   1.00 0.00 ? 103 ILE A HG13 1  
ATOM 1637  H HG21 . ILE A 1 103 ? -3.039  5.779   5.375   1.00 0.00 ? 103 ILE A HG21 1  
ATOM 1638  H HG22 . ILE A 1 103 ? -1.689  6.172   4.311   1.00 0.00 ? 103 ILE A HG22 1  
ATOM 1639  H HG23 . ILE A 1 103 ? -2.961  5.083   3.756   1.00 0.00 ? 103 ILE A HG23 1  
ATOM 1640  H HD11 . ILE A 1 103 ? -4.994  9.681   5.316   1.00 0.00 ? 103 ILE A HD11 1  
ATOM 1641  H HD12 . ILE A 1 103 ? -5.039  9.158   3.633   1.00 0.00 ? 103 ILE A HD12 1  
ATOM 1642  H HD13 . ILE A 1 103 ? -3.835  10.334  4.158   1.00 0.00 ? 103 ILE A HD13 1  
ATOM 1643  N N    . ASP A 1 104 ? -3.505  5.895   0.669   1.00 0.00 ? 104 ASP A N    1  
ATOM 1644  C CA   . ASP A 1 104 ? -3.244  4.682   -0.110  1.00 0.00 ? 104 ASP A CA   1  
ATOM 1645  C C    . ASP A 1 104 ? -2.735  4.978   -1.519  1.00 0.00 ? 104 ASP A C    1  
ATOM 1646  O O    . ASP A 1 104 ? -1.707  4.438   -1.925  1.00 0.00 ? 104 ASP A O    1  
ATOM 1647  C CB   . ASP A 1 104 ? -4.514  3.833   -0.203  1.00 0.00 ? 104 ASP A CB   1  
ATOM 1648  C CG   . ASP A 1 104 ? -4.240  2.437   -0.725  1.00 0.00 ? 104 ASP A CG   1  
ATOM 1649  O OD1  . ASP A 1 104 ? -4.181  2.266   -1.961  1.00 0.00 ? 104 ASP A OD1  1  
ATOM 1650  O OD2  . ASP A 1 104 ? -4.084  1.514   0.102   1.00 0.00 ? 104 ASP A OD2  1  
ATOM 1651  H H    . ASP A 1 104 ? -4.336  6.394   0.526   1.00 0.00 ? 104 ASP A H    1  
ATOM 1652  H HA   . ASP A 1 104 ? -2.491  4.114   0.413   1.00 0.00 ? 104 ASP A HA   1  
ATOM 1653  H HB2  . ASP A 1 104 ? -4.957  3.750   0.778   1.00 0.00 ? 104 ASP A HB2  1  
ATOM 1654  H HB3  . ASP A 1 104 ? -5.215  4.317   -0.871  1.00 0.00 ? 104 ASP A HB3  1  
ATOM 1655  N N    . MET A 1 105 ? -3.452  5.831   -2.260  1.00 0.00 ? 105 MET A N    1  
ATOM 1656  C CA   . MET A 1 105 ? -3.065  6.191   -3.634  1.00 0.00 ? 105 MET A CA   1  
ATOM 1657  C C    . MET A 1 105 ? -2.274  5.063   -4.312  1.00 0.00 ? 105 MET A C    1  
ATOM 1658  O O    . MET A 1 105 ? -1.052  4.994   -4.179  1.00 0.00 ? 105 MET A O    1  
ATOM 1659  C CB   . MET A 1 105 ? -2.233  7.478   -3.618  1.00 0.00 ? 105 MET A CB   1  
ATOM 1660  C CG   . MET A 1 105 ? -2.951  8.690   -4.198  1.00 0.00 ? 105 MET A CG   1  
ATOM 1661  S SD   . MET A 1 105 ? -4.638  8.873   -3.589  1.00 0.00 ? 105 MET A SD   1  
ATOM 1662  C CE   . MET A 1 105 ? -5.504  9.291   -5.101  1.00 0.00 ? 105 MET A CE   1  
ATOM 1663  H H    . MET A 1 105 ? -4.264  6.226   -1.877  1.00 0.00 ? 105 MET A H    1  
ATOM 1664  H HA   . MET A 1 105 ? -3.970  6.365   -4.197  1.00 0.00 ? 105 MET A HA   1  
ATOM 1665  H HB2  . MET A 1 105 ? -1.964  7.704   -2.597  1.00 0.00 ? 105 MET A HB2  1  
ATOM 1666  H HB3  . MET A 1 105 ? -1.330  7.316   -4.189  1.00 0.00 ? 105 MET A HB3  1  
ATOM 1667  H HG2  . MET A 1 105 ? -2.397  9.577   -3.936  1.00 0.00 ? 105 MET A HG2  1  
ATOM 1668  H HG3  . MET A 1 105 ? -2.978  8.595   -5.271  1.00 0.00 ? 105 MET A HG3  1  
ATOM 1669  H HE1  . MET A 1 105 ? -4.792  9.616   -5.846  1.00 0.00 ? 105 MET A HE1  1  
ATOM 1670  H HE2  . MET A 1 105 ? -6.207  10.086  -4.905  1.00 0.00 ? 105 MET A HE2  1  
ATOM 1671  H HE3  . MET A 1 105 ? -6.034  8.423   -5.465  1.00 0.00 ? 105 MET A HE3  1  
ATOM 1672  N N    . SER A 1 106 ? -2.969  4.173   -5.024  1.00 0.00 ? 106 SER A N    1  
ATOM 1673  C CA   . SER A 1 106 ? -2.308  3.053   -5.689  1.00 0.00 ? 106 SER A CA   1  
ATOM 1674  C C    . SER A 1 106 ? -2.013  3.361   -7.153  1.00 0.00 ? 106 SER A C    1  
ATOM 1675  O O    . SER A 1 106 ? -2.908  3.329   -7.996  1.00 0.00 ? 106 SER A O    1  
ATOM 1676  C CB   . SER A 1 106 ? -3.171  1.791   -5.586  1.00 0.00 ? 106 SER A CB   1  
ATOM 1677  O OG   . SER A 1 106 ? -4.448  2.086   -5.047  1.00 0.00 ? 106 SER A OG   1  
ATOM 1678  H H    . SER A 1 106 ? -3.944  4.262   -5.097  1.00 0.00 ? 106 SER A H    1  
ATOM 1679  H HA   . SER A 1 106 ? -1.374  2.875   -5.180  1.00 0.00 ? 106 SER A HA   1  
ATOM 1680  H HB2  . SER A 1 106 ? -3.301  1.363   -6.569  1.00 0.00 ? 106 SER A HB2  1  
ATOM 1681  H HB3  . SER A 1 106 ? -2.680  1.075   -4.944  1.00 0.00 ? 106 SER A HB3  1  
ATOM 1682  H HG   . SER A 1 106 ? -5.027  2.396   -5.746  1.00 0.00 ? 106 SER A HG   1  
ATOM 1683  N N    . PHE A 1 107 ? -0.747  3.638   -7.453  1.00 0.00 ? 107 PHE A N    1  
ATOM 1684  C CA   . PHE A 1 107 ? -0.330  3.931   -8.819  1.00 0.00 ? 107 PHE A CA   1  
ATOM 1685  C C    . PHE A 1 107 ? 0.332   2.707   -9.447  1.00 0.00 ? 107 PHE A C    1  
ATOM 1686  O O    . PHE A 1 107 ? 0.899   1.871   -8.746  1.00 0.00 ? 107 PHE A O    1  
ATOM 1687  C CB   . PHE A 1 107 ? 0.650   5.107   -8.833  1.00 0.00 ? 107 PHE A CB   1  
ATOM 1688  C CG   . PHE A 1 107 ? -0.003  6.448   -9.012  1.00 0.00 ? 107 PHE A CG   1  
ATOM 1689  C CD1  . PHE A 1 107 ? -0.598  7.097   -7.941  1.00 0.00 ? 107 PHE A CD1  1  
ATOM 1690  C CD2  . PHE A 1 107 ? -0.014  7.064   -10.251 1.00 0.00 ? 107 PHE A CD2  1  
ATOM 1691  C CE1  . PHE A 1 107 ? -1.190  8.334   -8.105  1.00 0.00 ? 107 PHE A CE1  1  
ATOM 1692  C CE2  . PHE A 1 107 ? -0.606  8.300   -10.422 1.00 0.00 ? 107 PHE A CE2  1  
ATOM 1693  C CZ   . PHE A 1 107 ? -1.195  8.936   -9.348  1.00 0.00 ? 107 PHE A CZ   1  
ATOM 1694  H H    . PHE A 1 107 ? -0.071  3.631   -6.744  1.00 0.00 ? 107 PHE A H    1  
ATOM 1695  H HA   . PHE A 1 107 ? -1.207  4.192   -9.391  1.00 0.00 ? 107 PHE A HA   1  
ATOM 1696  H HB2  . PHE A 1 107 ? 1.188   5.124   -7.900  1.00 0.00 ? 107 PHE A HB2  1  
ATOM 1697  H HB3  . PHE A 1 107 ? 1.352   4.969   -9.643  1.00 0.00 ? 107 PHE A HB3  1  
ATOM 1698  H HD1  . PHE A 1 107 ? -0.596  6.628   -6.968  1.00 0.00 ? 107 PHE A HD1  1  
ATOM 1699  H HD2  . PHE A 1 107 ? 0.445   6.569   -11.092 1.00 0.00 ? 107 PHE A HD2  1  
ATOM 1700  H HE1  . PHE A 1 107 ? -1.651  8.829   -7.263  1.00 0.00 ? 107 PHE A HE1  1  
ATOM 1701  H HE2  . PHE A 1 107 ? -0.607  8.769   -11.395 1.00 0.00 ? 107 PHE A HE2  1  
ATOM 1702  H HZ   . PHE A 1 107 ? -1.658  9.903   -9.479  1.00 0.00 ? 107 PHE A HZ   1  
ATOM 1703  N N    . GLU A 1 108 ? 0.262   2.612   -10.770 1.00 0.00 ? 108 GLU A N    1  
ATOM 1704  C CA   . GLU A 1 108 ? 0.864   1.490   -11.489 1.00 0.00 ? 108 GLU A CA   1  
ATOM 1705  C C    . GLU A 1 108 ? 0.679   1.626   -13.004 1.00 0.00 ? 108 GLU A C    1  
ATOM 1706  O O    . GLU A 1 108 ? 1.639   1.493   -13.763 1.00 0.00 ? 108 GLU A O    1  
ATOM 1707  C CB   . GLU A 1 108 ? 0.277   0.160   -11.002 1.00 0.00 ? 108 GLU A CB   1  
ATOM 1708  C CG   . GLU A 1 108 ? 0.837   -1.056  -11.723 1.00 0.00 ? 108 GLU A CG   1  
ATOM 1709  C CD   . GLU A 1 108 ? -0.242  -2.036  -12.140 1.00 0.00 ? 108 GLU A CD   1  
ATOM 1710  O OE1  . GLU A 1 108 ? -1.221  -1.602  -12.784 1.00 0.00 ? 108 GLU A OE1  1  
ATOM 1711  O OE2  . GLU A 1 108 ? -0.110  -3.236  -11.822 1.00 0.00 ? 108 GLU A OE2  1  
ATOM 1712  H H    . GLU A 1 108 ? -0.198  3.314   -11.273 1.00 0.00 ? 108 GLU A H    1  
ATOM 1713  H HA   . GLU A 1 108 ? 1.923   1.498   -11.274 1.00 0.00 ? 108 GLU A HA   1  
ATOM 1714  H HB2  . GLU A 1 108 ? 0.488   0.053   -9.949  1.00 0.00 ? 108 GLU A HB2  1  
ATOM 1715  H HB3  . GLU A 1 108 ? -0.791  0.175   -11.144 1.00 0.00 ? 108 GLU A HB3  1  
ATOM 1716  H HG2  . GLU A 1 108 ? 1.362   -0.726  -12.607 1.00 0.00 ? 108 GLU A HG2  1  
ATOM 1717  H HG3  . GLU A 1 108 ? 1.528   -1.562  -11.064 1.00 0.00 ? 108 GLU A HG3  1  
ATOM 1718  N N    . PRO A 1 109 ? -0.558  1.889   -13.470 1.00 0.00 ? 109 PRO A N    1  
ATOM 1719  C CA   . PRO A 1 109 ? -0.851  2.036   -14.901 1.00 0.00 ? 109 PRO A CA   1  
ATOM 1720  C C    . PRO A 1 109 ? 0.182   2.879   -15.656 1.00 0.00 ? 109 PRO A C    1  
ATOM 1721  O O    . PRO A 1 109 ? 0.615   2.492   -16.742 1.00 0.00 ? 109 PRO A O    1  
ATOM 1722  C CB   . PRO A 1 109 ? -2.217  2.715   -14.903 1.00 0.00 ? 109 PRO A CB   1  
ATOM 1723  C CG   . PRO A 1 109 ? -2.871  2.221   -13.660 1.00 0.00 ? 109 PRO A CG   1  
ATOM 1724  C CD   . PRO A 1 109 ? -1.773  2.057   -12.646 1.00 0.00 ? 109 PRO A CD   1  
ATOM 1725  H HA   . PRO A 1 109 ? -0.932  1.071   -15.380 1.00 0.00 ? 109 PRO A HA   1  
ATOM 1726  H HB2  . PRO A 1 109 ? -2.092  3.787   -14.891 1.00 0.00 ? 109 PRO A HB2  1  
ATOM 1727  H HB3  . PRO A 1 109 ? -2.769  2.420   -15.783 1.00 0.00 ? 109 PRO A HB3  1  
ATOM 1728  H HG2  . PRO A 1 109 ? -3.592  2.942   -13.310 1.00 0.00 ? 109 PRO A HG2  1  
ATOM 1729  H HG3  . PRO A 1 109 ? -3.350  1.272   -13.849 1.00 0.00 ? 109 PRO A HG3  1  
ATOM 1730  H HD2  . PRO A 1 109 ? -1.704  2.938   -12.027 1.00 0.00 ? 109 PRO A HD2  1  
ATOM 1731  H HD3  . PRO A 1 109 ? -1.953  1.183   -12.040 1.00 0.00 ? 109 PRO A HD3  1  
ATOM 1732  N N    . PRO A 1 110 ? 0.595   4.044   -15.106 1.00 0.00 ? 110 PRO A N    1  
ATOM 1733  C CA   . PRO A 1 110 ? 1.580   4.920   -15.753 1.00 0.00 ? 110 PRO A CA   1  
ATOM 1734  C C    . PRO A 1 110 ? 2.703   4.148   -16.437 1.00 0.00 ? 110 PRO A C    1  
ATOM 1735  O O    . PRO A 1 110 ? 2.938   2.978   -16.134 1.00 0.00 ? 110 PRO A O    1  
ATOM 1736  C CB   . PRO A 1 110 ? 2.129   5.720   -14.577 1.00 0.00 ? 110 PRO A CB   1  
ATOM 1737  C CG   . PRO A 1 110 ? 0.962   5.869   -13.666 1.00 0.00 ? 110 PRO A CG   1  
ATOM 1738  C CD   . PRO A 1 110 ? 0.141   4.609   -13.816 1.00 0.00 ? 110 PRO A CD   1  
ATOM 1739  H HA   . PRO A 1 110 ? 1.116   5.589   -16.462 1.00 0.00 ? 110 PRO A HA   1  
ATOM 1740  H HB2  . PRO A 1 110 ? 2.931   5.168   -14.107 1.00 0.00 ? 110 PRO A HB2  1  
ATOM 1741  H HB3  . PRO A 1 110 ? 2.493   6.679   -14.917 1.00 0.00 ? 110 PRO A HB3  1  
ATOM 1742  H HG2  . PRO A 1 110 ? 1.306   5.970   -12.648 1.00 0.00 ? 110 PRO A HG2  1  
ATOM 1743  H HG3  . PRO A 1 110 ? 0.379   6.731   -13.953 1.00 0.00 ? 110 PRO A HG3  1  
ATOM 1744  H HD2  . PRO A 1 110 ? 0.349   3.934   -13.005 1.00 0.00 ? 110 PRO A HD2  1  
ATOM 1745  H HD3  . PRO A 1 110 ? -0.911  4.848   -13.849 1.00 0.00 ? 110 PRO A HD3  1  
ATOM 1746  N N    . GLU A 1 111 ? 3.403   4.811   -17.351 1.00 0.00 ? 111 GLU A N    1  
ATOM 1747  C CA   . GLU A 1 111 ? 4.507   4.177   -18.060 1.00 0.00 ? 111 GLU A CA   1  
ATOM 1748  C C    . GLU A 1 111 ? 5.826   4.529   -17.387 1.00 0.00 ? 111 GLU A C    1  
ATOM 1749  O O    . GLU A 1 111 ? 5.973   5.617   -16.834 1.00 0.00 ? 111 GLU A O    1  
ATOM 1750  C CB   . GLU A 1 111 ? 4.530   4.615   -19.533 1.00 0.00 ? 111 GLU A CB   1  
ATOM 1751  C CG   . GLU A 1 111 ? 5.725   4.088   -20.313 1.00 0.00 ? 111 GLU A CG   1  
ATOM 1752  C CD   . GLU A 1 111 ? 5.323   3.394   -21.600 1.00 0.00 ? 111 GLU A CD   1  
ATOM 1753  O OE1  . GLU A 1 111 ? 5.016   4.099   -22.584 1.00 0.00 ? 111 GLU A OE1  1  
ATOM 1754  O OE2  . GLU A 1 111 ? 5.315   2.145   -21.624 1.00 0.00 ? 111 GLU A OE2  1  
ATOM 1755  H H    . GLU A 1 111 ? 3.180   5.750   -17.544 1.00 0.00 ? 111 GLU A H    1  
ATOM 1756  H HA   . GLU A 1 111 ? 4.365   3.108   -18.010 1.00 0.00 ? 111 GLU A HA   1  
ATOM 1757  H HB2  . GLU A 1 111 ? 3.635   4.264   -20.015 1.00 0.00 ? 111 GLU A HB2  1  
ATOM 1758  H HB3  . GLU A 1 111 ? 4.544   5.689   -19.580 1.00 0.00 ? 111 GLU A HB3  1  
ATOM 1759  H HG2  . GLU A 1 111 ? 6.373   4.917   -20.557 1.00 0.00 ? 111 GLU A HG2  1  
ATOM 1760  H HG3  . GLU A 1 111 ? 6.261   3.384   -19.695 1.00 0.00 ? 111 GLU A HG3  1  
ATOM 1761  N N    . PHE A 1 112 ? 6.786   3.615   -17.435 1.00 0.00 ? 112 PHE A N    1  
ATOM 1762  C CA   . PHE A 1 112 ? 8.086   3.864   -16.829 1.00 0.00 ? 112 PHE A CA   1  
ATOM 1763  C C    . PHE A 1 112 ? 9.112   2.827   -17.248 1.00 0.00 ? 112 PHE A C    1  
ATOM 1764  O O    . PHE A 1 112 ? 8.838   1.628   -17.297 1.00 0.00 ? 112 PHE A O    1  
ATOM 1765  C CB   . PHE A 1 112 ? 7.983   3.918   -15.298 1.00 0.00 ? 112 PHE A CB   1  
ATOM 1766  C CG   . PHE A 1 112 ? 8.370   2.639   -14.595 1.00 0.00 ? 112 PHE A CG   1  
ATOM 1767  C CD1  . PHE A 1 112 ? 9.706   2.268   -14.460 1.00 0.00 ? 112 PHE A CD1  1  
ATOM 1768  C CD2  . PHE A 1 112 ? 7.394   1.811   -14.065 1.00 0.00 ? 112 PHE A CD2  1  
ATOM 1769  C CE1  . PHE A 1 112 ? 10.049  1.098   -13.812 1.00 0.00 ? 112 PHE A CE1  1  
ATOM 1770  C CE2  . PHE A 1 112 ? 7.736   0.640   -13.417 1.00 0.00 ? 112 PHE A CE2  1  
ATOM 1771  C CZ   . PHE A 1 112 ? 9.064   0.283   -13.290 1.00 0.00 ? 112 PHE A CZ   1  
ATOM 1772  H H    . PHE A 1 112 ? 6.621   2.763   -17.890 1.00 0.00 ? 112 PHE A H    1  
ATOM 1773  H HA   . PHE A 1 112 ? 8.428   4.829   -17.180 1.00 0.00 ? 112 PHE A HA   1  
ATOM 1774  H HB2  . PHE A 1 112 ? 8.630   4.700   -14.932 1.00 0.00 ? 112 PHE A HB2  1  
ATOM 1775  H HB3  . PHE A 1 112 ? 6.966   4.150   -15.028 1.00 0.00 ? 112 PHE A HB3  1  
ATOM 1776  H HD1  . PHE A 1 112 ? 10.485  2.901   -14.870 1.00 0.00 ? 112 PHE A HD1  1  
ATOM 1777  H HD2  . PHE A 1 112 ? 6.355   2.088   -14.163 1.00 0.00 ? 112 PHE A HD2  1  
ATOM 1778  H HE1  . PHE A 1 112 ? 11.087  0.820   -13.713 1.00 0.00 ? 112 PHE A HE1  1  
ATOM 1779  H HE2  . PHE A 1 112 ? 6.965   0.003   -13.009 1.00 0.00 ? 112 PHE A HE2  1  
ATOM 1780  H HZ   . PHE A 1 112 ? 9.333   -0.631  -12.784 1.00 0.00 ? 112 PHE A HZ   1  
ATOM 1781  N N    . GLU A 1 113 ? 10.303  3.319   -17.508 1.00 0.00 ? 113 GLU A N    1  
ATOM 1782  C CA   . GLU A 1 113 ? 11.430  2.492   -17.884 1.00 0.00 ? 113 GLU A CA   1  
ATOM 1783  C C    . GLU A 1 113 ? 12.687  3.170   -17.404 1.00 0.00 ? 113 GLU A C    1  
ATOM 1784  O O    . GLU A 1 113 ? 12.619  4.228   -16.778 1.00 0.00 ? 113 GLU A O    1  
ATOM 1785  C CB   . GLU A 1 113 ? 11.465  2.251   -19.392 1.00 0.00 ? 113 GLU A CB   1  
ATOM 1786  C CG   . GLU A 1 113 ? 11.820  3.484   -20.182 1.00 0.00 ? 113 GLU A CG   1  
ATOM 1787  C CD   . GLU A 1 113 ? 11.237  3.477   -21.581 1.00 0.00 ? 113 GLU A CD   1  
ATOM 1788  O OE1  . GLU A 1 113 ? 11.362  2.444   -22.272 1.00 0.00 ? 113 GLU A OE1  1  
ATOM 1789  O OE2  . GLU A 1 113 ? 10.656  4.505   -21.988 1.00 0.00 ? 113 GLU A OE2  1  
ATOM 1790  H H    . GLU A 1 113 ? 10.440  4.287   -17.415 1.00 0.00 ? 113 GLU A H    1  
ATOM 1791  H HA   . GLU A 1 113 ? 11.346  1.545   -17.368 1.00 0.00 ? 113 GLU A HA   1  
ATOM 1792  H HB2  . GLU A 1 113 ? 12.200  1.491   -19.606 1.00 0.00 ? 113 GLU A HB2  1  
ATOM 1793  H HB3  . GLU A 1 113 ? 10.494  1.906   -19.716 1.00 0.00 ? 113 GLU A HB3  1  
ATOM 1794  H HG2  . GLU A 1 113 ? 11.445  4.347   -19.652 1.00 0.00 ? 113 GLU A HG2  1  
ATOM 1795  H HG3  . GLU A 1 113 ? 12.894  3.538   -20.251 1.00 0.00 ? 113 GLU A HG3  1  
ATOM 1796  N N    . ILE A 1 114 ? 13.826  2.565   -17.652 1.00 0.00 ? 114 ILE A N    1  
ATOM 1797  C CA   . ILE A 1 114 ? 15.062  3.140   -17.180 1.00 0.00 ? 114 ILE A CA   1  
ATOM 1798  C C    . ILE A 1 114 ? 16.256  2.764   -18.051 1.00 0.00 ? 114 ILE A C    1  
ATOM 1799  O O    . ILE A 1 114 ? 16.446  1.599   -18.401 1.00 0.00 ? 114 ILE A O    1  
ATOM 1800  C CB   . ILE A 1 114 ? 15.293  2.699   -15.724 1.00 0.00 ? 114 ILE A CB   1  
ATOM 1801  C CG1  . ILE A 1 114 ? 14.869  1.245   -15.543 1.00 0.00 ? 114 ILE A CG1  1  
ATOM 1802  C CG2  . ILE A 1 114 ? 14.484  3.566   -14.776 1.00 0.00 ? 114 ILE A CG2  1  
ATOM 1803  C CD1  . ILE A 1 114 ? 15.829  0.423   -14.725 1.00 0.00 ? 114 ILE A CD1  1  
ATOM 1804  H H    . ILE A 1 114 ? 13.835  1.717   -18.141 1.00 0.00 ? 114 ILE A H    1  
ATOM 1805  H HA   . ILE A 1 114 ? 14.950  4.213   -17.187 1.00 0.00 ? 114 ILE A HA   1  
ATOM 1806  H HB   . ILE A 1 114 ? 16.336  2.812   -15.485 1.00 0.00 ? 114 ILE A HB   1  
ATOM 1807  H HG12 . ILE A 1 114 ? 13.913  1.230   -15.038 1.00 0.00 ? 114 ILE A HG12 1  
ATOM 1808  H HG13 . ILE A 1 114 ? 14.761  0.773   -16.514 1.00 0.00 ? 114 ILE A HG13 1  
ATOM 1809  H HG21 . ILE A 1 114 ? 13.629  3.005   -14.419 1.00 0.00 ? 114 ILE A HG21 1  
ATOM 1810  H HG22 . ILE A 1 114 ? 14.143  4.445   -15.295 1.00 0.00 ? 114 ILE A HG22 1  
ATOM 1811  H HG23 . ILE A 1 114 ? 15.099  3.853   -13.939 1.00 0.00 ? 114 ILE A HG23 1  
ATOM 1812  H HD11 . ILE A 1 114 ? 15.567  0.498   -13.680 1.00 0.00 ? 114 ILE A HD11 1  
ATOM 1813  H HD12 . ILE A 1 114 ? 16.831  0.788   -14.872 1.00 0.00 ? 114 ILE A HD12 1  
ATOM 1814  H HD13 . ILE A 1 114 ? 15.769  -0.606  -15.037 1.00 0.00 ? 114 ILE A HD13 1  
ATOM 1815  N N    . VAL A 1 115 ? 17.079  3.759   -18.361 1.00 0.00 ? 115 VAL A N    1  
ATOM 1816  C CA   . VAL A 1 115 ? 18.285  3.547   -19.149 1.00 0.00 ? 115 VAL A CA   1  
ATOM 1817  C C    . VAL A 1 115 ? 19.494  3.702   -18.249 1.00 0.00 ? 115 VAL A C    1  
ATOM 1818  O O    . VAL A 1 115 ? 19.609  4.686   -17.528 1.00 0.00 ? 115 VAL A O    1  
ATOM 1819  C CB   . VAL A 1 115 ? 18.402  4.540   -20.318 1.00 0.00 ? 115 VAL A CB   1  
ATOM 1820  C CG1  . VAL A 1 115 ? 19.583  4.179   -21.206 1.00 0.00 ? 115 VAL A CG1  1  
ATOM 1821  C CG2  . VAL A 1 115 ? 17.113  4.566   -21.119 1.00 0.00 ? 115 VAL A CG2  1  
ATOM 1822  H H    . VAL A 1 115 ? 16.887  4.655   -18.020 1.00 0.00 ? 115 VAL A H    1  
ATOM 1823  H HA   . VAL A 1 115 ? 18.261  2.541   -19.545 1.00 0.00 ? 115 VAL A HA   1  
ATOM 1824  H HB   . VAL A 1 115 ? 18.574  5.527   -19.912 1.00 0.00 ? 115 VAL A HB   1  
ATOM 1825  H HG11 . VAL A 1 115 ? 19.746  3.112   -21.172 1.00 0.00 ? 115 VAL A HG11 1  
ATOM 1826  H HG12 . VAL A 1 115 ? 20.467  4.690   -20.854 1.00 0.00 ? 115 VAL A HG12 1  
ATOM 1827  H HG13 . VAL A 1 115 ? 19.374  4.479   -22.222 1.00 0.00 ? 115 VAL A HG13 1  
ATOM 1828  H HG21 . VAL A 1 115 ? 16.749  3.556   -21.241 1.00 0.00 ? 115 VAL A HG21 1  
ATOM 1829  H HG22 . VAL A 1 115 ? 17.300  5.002   -22.089 1.00 0.00 ? 115 VAL A HG22 1  
ATOM 1830  H HG23 . VAL A 1 115 ? 16.375  5.154   -20.595 1.00 0.00 ? 115 VAL A HG23 1  
ATOM 1831  N N    . GLY A 1 116 ? 20.385  2.731   -18.269 1.00 0.00 ? 116 GLY A N    1  
ATOM 1832  C CA   . GLY A 1 116 ? 21.549  2.809   -17.412 1.00 0.00 ? 116 GLY A CA   1  
ATOM 1833  C C    . GLY A 1 116 ? 22.832  3.103   -18.153 1.00 0.00 ? 116 GLY A C    1  
ATOM 1834  O O    . GLY A 1 116 ? 23.178  2.417   -19.115 1.00 0.00 ? 116 GLY A O    1  
ATOM 1835  H H    . GLY A 1 116 ? 20.245  1.956   -18.854 1.00 0.00 ? 116 GLY A H    1  
ATOM 1836  H HA2  . GLY A 1 116 ? 21.389  3.594   -16.688 1.00 0.00 ? 116 GLY A HA2  1  
ATOM 1837  H HA3  . GLY A 1 116 ? 21.657  1.872   -16.881 1.00 0.00 ? 116 GLY A HA3  1  
ATOM 1838  N N    . PHE A 1 117 ? 23.560  4.104   -17.671 1.00 0.00 ? 117 PHE A N    1  
ATOM 1839  C CA   . PHE A 1 117 ? 24.837  4.466   -18.255 1.00 0.00 ? 117 PHE A CA   1  
ATOM 1840  C C    . PHE A 1 117 ? 25.913  3.656   -17.553 1.00 0.00 ? 117 PHE A C    1  
ATOM 1841  O O    . PHE A 1 117 ? 25.731  3.268   -16.399 1.00 0.00 ? 117 PHE A O    1  
ATOM 1842  C CB   . PHE A 1 117 ? 25.093  5.966   -18.111 1.00 0.00 ? 117 PHE A CB   1  
ATOM 1843  C CG   . PHE A 1 117 ? 24.489  6.783   -19.220 1.00 0.00 ? 117 PHE A CG   1  
ATOM 1844  C CD1  . PHE A 1 117 ? 23.119  6.770   -19.451 1.00 0.00 ? 117 PHE A CD1  1  
ATOM 1845  C CD2  . PHE A 1 117 ? 25.292  7.565   -20.036 1.00 0.00 ? 117 PHE A CD2  1  
ATOM 1846  C CE1  . PHE A 1 117 ? 22.568  7.521   -20.472 1.00 0.00 ? 117 PHE A CE1  1  
ATOM 1847  C CE2  . PHE A 1 117 ? 24.745  8.317   -21.058 1.00 0.00 ? 117 PHE A CE2  1  
ATOM 1848  C CZ   . PHE A 1 117 ? 23.381  8.295   -21.276 1.00 0.00 ? 117 PHE A CZ   1  
ATOM 1849  H H    . PHE A 1 117 ? 23.247  4.589   -16.879 1.00 0.00 ? 117 PHE A H    1  
ATOM 1850  H HA   . PHE A 1 117 ? 24.818  4.200   -19.302 1.00 0.00 ? 117 PHE A HA   1  
ATOM 1851  H HB2  . PHE A 1 117 ? 24.670  6.307   -17.178 1.00 0.00 ? 117 PHE A HB2  1  
ATOM 1852  H HB3  . PHE A 1 117 ? 26.158  6.144   -18.106 1.00 0.00 ? 117 PHE A HB3  1  
ATOM 1853  H HD1  . PHE A 1 117 ? 22.478  6.165   -18.823 1.00 0.00 ? 117 PHE A HD1  1  
ATOM 1854  H HD2  . PHE A 1 117 ? 26.359  7.584   -19.867 1.00 0.00 ? 117 PHE A HD2  1  
ATOM 1855  H HE1  . PHE A 1 117 ? 21.501  7.502   -20.642 1.00 0.00 ? 117 PHE A HE1  1  
ATOM 1856  H HE2  . PHE A 1 117 ? 25.383  8.922   -21.685 1.00 0.00 ? 117 PHE A HE2  1  
ATOM 1857  H HZ   . PHE A 1 117 ? 22.952  8.882   -22.074 1.00 0.00 ? 117 PHE A HZ   1  
ATOM 1858  N N    . THR A 1 118 ? 27.006  3.359   -18.250 1.00 0.00 ? 118 THR A N    1  
ATOM 1859  C CA   . THR A 1 118 ? 28.062  2.520   -17.683 1.00 0.00 ? 118 THR A CA   1  
ATOM 1860  C C    . THR A 1 118 ? 28.285  2.797   -16.190 1.00 0.00 ? 118 THR A C    1  
ATOM 1861  O O    . THR A 1 118 ? 28.632  1.891   -15.435 1.00 0.00 ? 118 THR A O    1  
ATOM 1862  C CB   . THR A 1 118 ? 29.390  2.706   -18.454 1.00 0.00 ? 118 THR A CB   1  
ATOM 1863  O OG1  . THR A 1 118 ? 29.764  1.503   -19.094 1.00 0.00 ? 118 THR A OG1  1  
ATOM 1864  C CG2  . THR A 1 118 ? 30.577  3.119   -17.599 1.00 0.00 ? 118 THR A CG2  1  
ATOM 1865  H H    . THR A 1 118 ? 27.083  3.666   -19.177 1.00 0.00 ? 118 THR A H    1  
ATOM 1866  H HA   . THR A 1 118 ? 27.727  1.490   -17.816 1.00 0.00 ? 118 THR A HA   1  
ATOM 1867  H HB   . THR A 1 118 ? 29.247  3.460   -19.215 1.00 0.00 ? 118 THR A HB   1  
ATOM 1868  H HG1  . THR A 1 118 ? 30.548  1.654   -19.626 1.00 0.00 ? 118 THR A HG1  1  
ATOM 1869  H HG21 . THR A 1 118 ? 30.286  3.917   -16.933 1.00 0.00 ? 118 THR A HG21 1  
ATOM 1870  H HG22 . THR A 1 118 ? 31.378  3.458   -18.239 1.00 0.00 ? 118 THR A HG22 1  
ATOM 1871  H HG23 . THR A 1 118 ? 30.917  2.268   -17.020 1.00 0.00 ? 118 THR A HG23 1  
ATOM 1872  N N    . ASN A 1 119 ? 28.107  4.050   -15.773 1.00 0.00 ? 119 ASN A N    1  
ATOM 1873  C CA   . ASN A 1 119 ? 28.316  4.417   -14.372 1.00 0.00 ? 119 ASN A CA   1  
ATOM 1874  C C    . ASN A 1 119 ? 27.067  5.014   -13.713 1.00 0.00 ? 119 ASN A C    1  
ATOM 1875  O O    . ASN A 1 119 ? 26.968  5.038   -12.486 1.00 0.00 ? 119 ASN A O    1  
ATOM 1876  C CB   . ASN A 1 119 ? 29.477  5.410   -14.265 1.00 0.00 ? 119 ASN A CB   1  
ATOM 1877  C CG   . ASN A 1 119 ? 30.711  4.793   -13.635 1.00 0.00 ? 119 ASN A CG   1  
ATOM 1878  O OD1  . ASN A 1 119 ? 31.669  4.448   -14.327 1.00 0.00 ? 119 ASN A OD1  1  
ATOM 1879  N ND2  . ASN A 1 119 ? 30.694  4.651   -12.315 1.00 0.00 ? 119 ASN A ND2  1  
ATOM 1880  H H    . ASN A 1 119 ? 27.846  4.740   -16.418 1.00 0.00 ? 119 ASN A H    1  
ATOM 1881  H HA   . ASN A 1 119 ? 28.585  3.520   -13.837 1.00 0.00 ? 119 ASN A HA   1  
ATOM 1882  H HB2  . ASN A 1 119 ? 29.738  5.757   -15.253 1.00 0.00 ? 119 ASN A HB2  1  
ATOM 1883  H HB3  . ASN A 1 119 ? 29.171  6.253   -13.662 1.00 0.00 ? 119 ASN A HB3  1  
ATOM 1884  H HD21 . ASN A 1 119 ? 29.897  4.948   -11.827 1.00 0.00 ? 119 ASN A HD21 1  
ATOM 1885  H HD22 . ASN A 1 119 ? 31.479  4.256   -11.881 1.00 0.00 ? 119 ASN A HD22 1  
ATOM 1886  N N    . HIS A 1 120 ? 26.138  5.535   -14.512 1.00 0.00 ? 120 HIS A N    1  
ATOM 1887  C CA   . HIS A 1 120 ? 24.938  6.168   -13.949 1.00 0.00 ? 120 HIS A CA   1  
ATOM 1888  C C    . HIS A 1 120 ? 23.646  5.499   -14.398 1.00 0.00 ? 120 HIS A C    1  
ATOM 1889  O O    . HIS A 1 120 ? 23.655  4.510   -15.130 1.00 0.00 ? 120 HIS A O    1  
ATOM 1890  C CB   . HIS A 1 120 ? 24.905  7.665   -14.281 1.00 0.00 ? 120 HIS A CB   1  
ATOM 1891  C CG   . HIS A 1 120 ? 25.538  8.027   -15.591 1.00 0.00 ? 120 HIS A CG   1  
ATOM 1892  N ND1  . HIS A 1 120 ? 26.851  7.737   -15.898 1.00 0.00 ? 120 HIS A ND1  1  
ATOM 1893  C CD2  . HIS A 1 120 ? 25.037  8.679   -16.667 1.00 0.00 ? 120 HIS A CD2  1  
ATOM 1894  C CE1  . HIS A 1 120 ? 27.130  8.196   -17.105 1.00 0.00 ? 120 HIS A CE1  1  
ATOM 1895  N NE2  . HIS A 1 120 ? 26.046  8.772   -17.593 1.00 0.00 ? 120 HIS A NE2  1  
ATOM 1896  H H    . HIS A 1 120 ? 26.280  5.524   -15.485 1.00 0.00 ? 120 HIS A H    1  
ATOM 1897  H HA   . HIS A 1 120 ? 24.996  6.075   -12.876 1.00 0.00 ? 120 HIS A HA   1  
ATOM 1898  H HB2  . HIS A 1 120 ? 23.880  7.997   -14.305 1.00 0.00 ? 120 HIS A HB2  1  
ATOM 1899  H HB3  . HIS A 1 120 ? 25.428  8.203   -13.504 1.00 0.00 ? 120 HIS A HB3  1  
ATOM 1900  H HD1  . HIS A 1 120 ? 27.484  7.266   -15.318 1.00 0.00 ? 120 HIS A HD1  1  
ATOM 1901  H HD2  . HIS A 1 120 ? 24.029  9.055   -16.777 1.00 0.00 ? 120 HIS A HD2  1  
ATOM 1902  H HE1  . HIS A 1 120 ? 28.082  8.114   -17.607 1.00 0.00 ? 120 HIS A HE1  1  
ATOM 1903  H HE2  . HIS A 1 120 ? 26.016  9.309   -18.412 1.00 0.00 ? 120 HIS A HE2  1  
ATOM 1904  N N    . ILE A 1 121 ? 22.533  6.057   -13.928 1.00 0.00 ? 121 ILE A N    1  
ATOM 1905  C CA   . ILE A 1 121 ? 21.205  5.545   -14.240 1.00 0.00 ? 121 ILE A CA   1  
ATOM 1906  C C    . ILE A 1 121 ? 20.305  6.659   -14.762 1.00 0.00 ? 121 ILE A C    1  
ATOM 1907  O O    . ILE A 1 121 ? 20.416  7.806   -14.343 1.00 0.00 ? 121 ILE A O    1  
ATOM 1908  C CB   . ILE A 1 121 ? 20.540  4.934   -12.991 1.00 0.00 ? 121 ILE A CB   1  
ATOM 1909  C CG1  . ILE A 1 121 ? 21.444  3.856   -12.375 1.00 0.00 ? 121 ILE A CG1  1  
ATOM 1910  C CG2  . ILE A 1 121 ? 19.164  4.379   -13.340 1.00 0.00 ? 121 ILE A CG2  1  
ATOM 1911  C CD1  . ILE A 1 121 ? 20.771  3.014   -11.305 1.00 0.00 ? 121 ILE A CD1  1  
ATOM 1912  H H    . ILE A 1 121 ? 22.609  6.841   -13.346 1.00 0.00 ? 121 ILE A H    1  
ATOM 1913  H HA   . ILE A 1 121 ? 21.298  4.773   -14.993 1.00 0.00 ? 121 ILE A HA   1  
ATOM 1914  H HB   . ILE A 1 121 ? 20.402  5.726   -12.273 1.00 0.00 ? 121 ILE A HB   1  
ATOM 1915  H HG12 . ILE A 1 121 ? 21.782  3.195   -13.156 1.00 0.00 ? 121 ILE A HG12 1  
ATOM 1916  H HG13 . ILE A 1 121 ? 22.303  4.334   -11.927 1.00 0.00 ? 121 ILE A HG13 1  
ATOM 1917  H HG21 . ILE A 1 121 ? 18.831  3.714   -12.558 1.00 0.00 ? 121 ILE A HG21 1  
ATOM 1918  H HG22 . ILE A 1 121 ? 19.218  3.841   -14.273 1.00 0.00 ? 121 ILE A HG22 1  
ATOM 1919  H HG23 . ILE A 1 121 ? 18.463  5.194   -13.439 1.00 0.00 ? 121 ILE A HG23 1  
ATOM 1920  H HD11 . ILE A 1 121 ? 19.825  2.651   -11.675 1.00 0.00 ? 121 ILE A HD11 1  
ATOM 1921  H HD12 . ILE A 1 121 ? 20.605  3.612   -10.420 1.00 0.00 ? 121 ILE A HD12 1  
ATOM 1922  H HD13 . ILE A 1 121 ? 21.403  2.174   -11.056 1.00 0.00 ? 121 ILE A HD13 1  
ATOM 1923  N N    . ASN A 1 122 ? 19.399  6.303   -15.657 1.00 0.00 ? 122 ASN A N    1  
ATOM 1924  C CA   . ASN A 1 122 ? 18.458  7.260   -16.220 1.00 0.00 ? 122 ASN A CA   1  
ATOM 1925  C C    . ASN A 1 122 ? 17.040  6.735   -16.050 1.00 0.00 ? 122 ASN A C    1  
ATOM 1926  O O    . ASN A 1 122 ? 16.585  5.879   -16.805 1.00 0.00 ? 122 ASN A O    1  
ATOM 1927  C CB   . ASN A 1 122 ? 18.761  7.521   -17.697 1.00 0.00 ? 122 ASN A CB   1  
ATOM 1928  C CG   . ASN A 1 122 ? 19.666  8.720   -17.900 1.00 0.00 ? 122 ASN A CG   1  
ATOM 1929  O OD1  . ASN A 1 122 ? 19.290  9.692   -18.554 1.00 0.00 ? 122 ASN A OD1  1  
ATOM 1930  N ND2  . ASN A 1 122 ? 20.867  8.656   -17.337 1.00 0.00 ? 122 ASN A ND2  1  
ATOM 1931  H H    . ASN A 1 122 ? 19.348  5.366   -15.934 1.00 0.00 ? 122 ASN A H    1  
ATOM 1932  H HA   . ASN A 1 122 ? 18.555  8.185   -15.668 1.00 0.00 ? 122 ASN A HA   1  
ATOM 1933  H HB2  . ASN A 1 122 ? 19.247  6.657   -18.117 1.00 0.00 ? 122 ASN A HB2  1  
ATOM 1934  H HB3  . ASN A 1 122 ? 17.836  7.700   -18.221 1.00 0.00 ? 122 ASN A HB3  1  
ATOM 1935  H HD21 . ASN A 1 122 ? 21.099  7.849   -16.830 1.00 0.00 ? 122 ASN A HD21 1  
ATOM 1936  H HD22 . ASN A 1 122 ? 21.473  9.417   -17.452 1.00 0.00 ? 122 ASN A HD22 1  
ATOM 1937  N N    . VAL A 1 123 ? 16.356  7.243   -15.038 1.00 0.00 ? 123 VAL A N    1  
ATOM 1938  C CA   . VAL A 1 123 ? 14.999  6.815   -14.747 1.00 0.00 ? 123 VAL A CA   1  
ATOM 1939  C C    . VAL A 1 123 ? 13.966  7.792   -15.281 1.00 0.00 ? 123 VAL A C    1  
ATOM 1940  O O    . VAL A 1 123 ? 13.896  8.938   -14.844 1.00 0.00 ? 123 VAL A O    1  
ATOM 1941  C CB   . VAL A 1 123 ? 14.777  6.650   -13.235 1.00 0.00 ? 123 VAL A CB   1  
ATOM 1942  C CG1  . VAL A 1 123 ? 13.392  6.086   -12.947 1.00 0.00 ? 123 VAL A CG1  1  
ATOM 1943  C CG2  . VAL A 1 123 ? 15.857  5.770   -12.641 1.00 0.00 ? 123 VAL A CG2  1  
ATOM 1944  H H    . VAL A 1 123 ? 16.786  7.915   -14.474 1.00 0.00 ? 123 VAL A H    1  
ATOM 1945  H HA   . VAL A 1 123 ? 14.854  5.855   -15.216 1.00 0.00 ? 123 VAL A HA   1  
ATOM 1946  H HB   . VAL A 1 123 ? 14.845  7.625   -12.774 1.00 0.00 ? 123 VAL A HB   1  
ATOM 1947  H HG11 . VAL A 1 123 ? 13.147  5.337   -13.686 1.00 0.00 ? 123 VAL A HG11 1  
ATOM 1948  H HG12 . VAL A 1 123 ? 12.664  6.882   -12.987 1.00 0.00 ? 123 VAL A HG12 1  
ATOM 1949  H HG13 . VAL A 1 123 ? 13.383  5.639   -11.965 1.00 0.00 ? 123 VAL A HG13 1  
ATOM 1950  H HG21 . VAL A 1 123 ? 16.379  5.258   -13.437 1.00 0.00 ? 123 VAL A HG21 1  
ATOM 1951  H HG22 . VAL A 1 123 ? 15.409  5.044   -11.979 1.00 0.00 ? 123 VAL A HG22 1  
ATOM 1952  H HG23 . VAL A 1 123 ? 16.553  6.381   -12.089 1.00 0.00 ? 123 VAL A HG23 1  
ATOM 1953  N N    . MET A 1 124 ? 13.146  7.322   -16.209 1.00 0.00 ? 124 MET A N    1  
ATOM 1954  C CA   . MET A 1 124 ? 12.096  8.153   -16.781 1.00 0.00 ? 124 MET A CA   1  
ATOM 1955  C C    . MET A 1 124 ? 10.725  7.601   -16.423 1.00 0.00 ? 124 MET A C    1  
ATOM 1956  O O    . MET A 1 124 ? 10.306  6.565   -16.942 1.00 0.00 ? 124 MET A O    1  
ATOM 1957  C CB   . MET A 1 124 ? 12.230  8.249   -18.301 1.00 0.00 ? 124 MET A CB   1  
ATOM 1958  C CG   . MET A 1 124 ? 11.942  9.635   -18.844 1.00 0.00 ? 124 MET A CG   1  
ATOM 1959  S SD   . MET A 1 124 ? 13.432  10.622  -19.039 1.00 0.00 ? 124 MET A SD   1  
ATOM 1960  C CE   . MET A 1 124 ? 14.438  9.992   -17.699 1.00 0.00 ? 124 MET A CE   1  
ATOM 1961  H H    . MET A 1 124 ? 13.240  6.391   -16.501 1.00 0.00 ? 124 MET A H    1  
ATOM 1962  H HA   . MET A 1 124 ? 12.196  9.143   -16.361 1.00 0.00 ? 124 MET A HA   1  
ATOM 1963  H HB2  . MET A 1 124 ? 13.238  7.986   -18.577 1.00 0.00 ? 124 MET A HB2  1  
ATOM 1964  H HB3  . MET A 1 124 ? 11.542  7.558   -18.761 1.00 0.00 ? 124 MET A HB3  1  
ATOM 1965  H HG2  . MET A 1 124 ? 11.478  9.542   -19.800 1.00 0.00 ? 124 MET A HG2  1  
ATOM 1966  H HG3  . MET A 1 124 ? 11.265  10.139  -18.175 1.00 0.00 ? 124 MET A HG3  1  
ATOM 1967  H HE1  . MET A 1 124 ? 13.845  9.951   -16.799 1.00 0.00 ? 124 MET A HE1  1  
ATOM 1968  H HE2  . MET A 1 124 ? 15.285  10.642  -17.545 1.00 0.00 ? 124 MET A HE2  1  
ATOM 1969  H HE3  . MET A 1 124 ? 14.785  9.000   -17.946 1.00 0.00 ? 124 MET A HE3  1  
ATOM 1970  N N    . VAL A 1 125 ? 10.024  8.302   -15.543 1.00 0.00 ? 125 VAL A N    1  
ATOM 1971  C CA   . VAL A 1 125 ? 8.693   7.883   -15.132 1.00 0.00 ? 125 VAL A CA   1  
ATOM 1972  C C    . VAL A 1 125 ? 7.658   8.673   -15.899 1.00 0.00 ? 125 VAL A C    1  
ATOM 1973  O O    . VAL A 1 125 ? 7.580   9.890   -15.789 1.00 0.00 ? 125 VAL A O    1  
ATOM 1974  C CB   . VAL A 1 125 ? 8.474   8.087   -13.628 1.00 0.00 ? 125 VAL A CB   1  
ATOM 1975  C CG1  . VAL A 1 125 ? 7.122   7.531   -13.208 1.00 0.00 ? 125 VAL A CG1  1  
ATOM 1976  C CG2  . VAL A 1 125 ? 9.609   7.442   -12.848 1.00 0.00 ? 125 VAL A CG2  1  
ATOM 1977  H H    . VAL A 1 125 ? 10.406  9.123   -15.170 1.00 0.00 ? 125 VAL A H    1  
ATOM 1978  H HA   . VAL A 1 125 ? 8.581   6.833   -15.365 1.00 0.00 ? 125 VAL A HA   1  
ATOM 1979  H HB   . VAL A 1 125 ? 8.481   9.146   -13.422 1.00 0.00 ? 125 VAL A HB   1  
ATOM 1980  H HG11 . VAL A 1 125 ? 7.027   7.588   -12.134 1.00 0.00 ? 125 VAL A HG11 1  
ATOM 1981  H HG12 . VAL A 1 125 ? 7.043   6.502   -13.524 1.00 0.00 ? 125 VAL A HG12 1  
ATOM 1982  H HG13 . VAL A 1 125 ? 6.334   8.109   -13.670 1.00 0.00 ? 125 VAL A HG13 1  
ATOM 1983  H HG21 . VAL A 1 125 ? 9.782   6.445   -13.228 1.00 0.00 ? 125 VAL A HG21 1  
ATOM 1984  H HG22 . VAL A 1 125 ? 9.348   7.392   -11.803 1.00 0.00 ? 125 VAL A HG22 1  
ATOM 1985  H HG23 . VAL A 1 125 ? 10.507  8.032   -12.966 1.00 0.00 ? 125 VAL A HG23 1  
ATOM 1986  N N    . LYS A 1 126 ? 6.916   7.981   -16.732 1.00 0.00 ? 126 LYS A N    1  
ATOM 1987  C CA   . LYS A 1 126 ? 5.944   8.627   -17.589 1.00 0.00 ? 126 LYS A CA   1  
ATOM 1988  C C    . LYS A 1 126 ? 4.579   8.868   -16.944 1.00 0.00 ? 126 LYS A C    1  
ATOM 1989  O O    . LYS A 1 126 ? 3.644   8.081   -17.126 1.00 0.00 ? 126 LYS A O    1  
ATOM 1990  C CB   . LYS A 1 126 ? 5.791   7.798   -18.855 1.00 0.00 ? 126 LYS A CB   1  
ATOM 1991  C CG   . LYS A 1 126 ? 7.093   7.631   -19.625 1.00 0.00 ? 126 LYS A CG   1  
ATOM 1992  C CD   . LYS A 1 126 ? 7.906   6.452   -19.117 1.00 0.00 ? 126 LYS A CD   1  
ATOM 1993  C CE   . LYS A 1 126 ? 8.924   5.993   -20.149 1.00 0.00 ? 126 LYS A CE   1  
ATOM 1994  N NZ   . LYS A 1 126 ? 9.758   7.121   -20.651 1.00 0.00 ? 126 LYS A NZ   1  
ATOM 1995  H H    . LYS A 1 126 ? 7.067   7.017   -16.830 1.00 0.00 ? 126 LYS A H    1  
ATOM 1996  H HA   . LYS A 1 126 ? 6.355   9.584   -17.869 1.00 0.00 ? 126 LYS A HA   1  
ATOM 1997  H HB2  . LYS A 1 126 ? 5.431   6.822   -18.580 1.00 0.00 ? 126 LYS A HB2  1  
ATOM 1998  H HB3  . LYS A 1 126 ? 5.069   8.274   -19.502 1.00 0.00 ? 126 LYS A HB3  1  
ATOM 1999  H HG2  . LYS A 1 126 ? 6.860   7.466   -20.665 1.00 0.00 ? 126 LYS A HG2  1  
ATOM 2000  H HG3  . LYS A 1 126 ? 7.685   8.533   -19.516 1.00 0.00 ? 126 LYS A HG3  1  
ATOM 2001  H HD2  . LYS A 1 126 ? 8.430   6.748   -18.219 1.00 0.00 ? 126 LYS A HD2  1  
ATOM 2002  H HD3  . LYS A 1 126 ? 7.239   5.636   -18.897 1.00 0.00 ? 126 LYS A HD3  1  
ATOM 2003  H HE2  . LYS A 1 126 ? 9.570   5.256   -19.695 1.00 0.00 ? 126 LYS A HE2  1  
ATOM 2004  H HE3  . LYS A 1 126 ? 8.399   5.547   -20.980 1.00 0.00 ? 126 LYS A HE3  1  
ATOM 2005  H HZ1  . LYS A 1 126 ? 10.766  6.922   -20.486 1.00 0.00 ? 126 LYS A HZ1  1  
ATOM 2006  H HZ2  . LYS A 1 126 ? 9.506   8.002   -20.160 1.00 0.00 ? 126 LYS A HZ2  1  
ATOM 2007  H HZ3  . LYS A 1 126 ? 9.605   7.251   -21.672 1.00 0.00 ? 126 LYS A HZ3  1  
ATOM 2008  N N    . PHE A 1 127 ? 4.466   9.996   -16.240 1.00 0.00 ? 127 PHE A N    1  
ATOM 2009  C CA   . PHE A 1 127 ? 3.215   10.418  -15.612 1.00 0.00 ? 127 PHE A CA   1  
ATOM 2010  C C    . PHE A 1 127 ? 2.430   11.244  -16.628 1.00 0.00 ? 127 PHE A C    1  
ATOM 2011  O O    . PHE A 1 127 ? 3.025   11.894  -17.487 1.00 0.00 ? 127 PHE A O    1  
ATOM 2012  C CB   . PHE A 1 127 ? 3.497   11.327  -14.414 1.00 0.00 ? 127 PHE A CB   1  
ATOM 2013  C CG   . PHE A 1 127 ? 3.692   10.648  -13.091 1.00 0.00 ? 127 PHE A CG   1  
ATOM 2014  C CD1  . PHE A 1 127 ? 2.620   10.096  -12.407 1.00 0.00 ? 127 PHE A CD1  1  
ATOM 2015  C CD2  . PHE A 1 127 ? 4.945   10.618  -12.502 1.00 0.00 ? 127 PHE A CD2  1  
ATOM 2016  C CE1  . PHE A 1 127 ? 2.799   9.520   -11.163 1.00 0.00 ? 127 PHE A CE1  1  
ATOM 2017  C CE2  . PHE A 1 127 ? 5.128   10.055  -11.256 1.00 0.00 ? 127 PHE A CE2  1  
ATOM 2018  C CZ   . PHE A 1 127 ? 4.054   9.504   -10.586 1.00 0.00 ? 127 PHE A CZ   1  
ATOM 2019  H H    . PHE A 1 127 ? 5.242   10.586  -16.151 1.00 0.00 ? 127 PHE A H    1  
ATOM 2020  H HA   . PHE A 1 127 ? 2.638   9.552   -15.306 1.00 0.00 ? 127 PHE A HA   1  
ATOM 2021  H HB2  . PHE A 1 127 ? 4.390   11.891  -14.617 1.00 0.00 ? 127 PHE A HB2  1  
ATOM 2022  H HB3  . PHE A 1 127 ? 2.671   12.018  -14.307 1.00 0.00 ? 127 PHE A HB3  1  
ATOM 2023  H HD1  . PHE A 1 127 ? 1.639   10.109  -12.857 1.00 0.00 ? 127 PHE A HD1  1  
ATOM 2024  H HD2  . PHE A 1 127 ? 5.787   11.046  -13.027 1.00 0.00 ? 127 PHE A HD2  1  
ATOM 2025  H HE1  . PHE A 1 127 ? 1.958   9.090   -10.639 1.00 0.00 ? 127 PHE A HE1  1  
ATOM 2026  H HE2  . PHE A 1 127 ? 6.112   10.039  -10.811 1.00 0.00 ? 127 PHE A HE2  1  
ATOM 2027  H HZ   . PHE A 1 127 ? 4.194   9.073   -9.606  1.00 0.00 ? 127 PHE A HZ   1  
ATOM 2028  N N    . PRO A 1 128 ? 1.098   11.264  -16.528 1.00 0.00 ? 128 PRO A N    1  
ATOM 2029  C CA   . PRO A 1 128 ? 0.245   12.041  -17.437 1.00 0.00 ? 128 PRO A CA   1  
ATOM 2030  C C    . PRO A 1 128 ? 0.664   13.503  -17.521 1.00 0.00 ? 128 PRO A C    1  
ATOM 2031  O O    . PRO A 1 128 ? 1.286   14.034  -16.601 1.00 0.00 ? 128 PRO A O    1  
ATOM 2032  C CB   . PRO A 1 128 ? -1.148  11.935  -16.803 1.00 0.00 ? 128 PRO A CB   1  
ATOM 2033  C CG   . PRO A 1 128 ? -0.902  11.445  -15.417 1.00 0.00 ? 128 PRO A CG   1  
ATOM 2034  C CD   . PRO A 1 128 ? 0.308   10.569  -15.511 1.00 0.00 ? 128 PRO A CD   1  
ATOM 2035  H HA   . PRO A 1 128 ? 0.227   11.613  -18.428 1.00 0.00 ? 128 PRO A HA   1  
ATOM 2036  H HB2  . PRO A 1 128 ? -1.618  12.909  -16.800 1.00 0.00 ? 128 PRO A HB2  1  
ATOM 2037  H HB3  . PRO A 1 128 ? -1.752  11.241  -17.365 1.00 0.00 ? 128 PRO A HB3  1  
ATOM 2038  H HG2  . PRO A 1 128 ? -0.705  12.282  -14.764 1.00 0.00 ? 128 PRO A HG2  1  
ATOM 2039  H HG3  . PRO A 1 128 ? -1.751  10.884  -15.067 1.00 0.00 ? 128 PRO A HG3  1  
ATOM 2040  H HD2  . PRO A 1 128 ? 0.833   10.537  -14.567 1.00 0.00 ? 128 PRO A HD2  1  
ATOM 2041  H HD3  . PRO A 1 128 ? 0.040   9.576   -15.839 1.00 0.00 ? 128 PRO A HD3  1  
ATOM 2042  N N    . SER A 1 129 ? 0.301   14.155  -18.620 1.00 0.00 ? 129 SER A N    1  
ATOM 2043  C CA   . SER A 1 129 ? 0.622   15.562  -18.810 1.00 0.00 ? 129 SER A CA   1  
ATOM 2044  C C    . SER A 1 129 ? -0.353  16.424  -18.008 1.00 0.00 ? 129 SER A C    1  
ATOM 2045  O O    . SER A 1 129 ? -1.484  16.656  -18.433 1.00 0.00 ? 129 SER A O    1  
ATOM 2046  C CB   . SER A 1 129 ? 0.549   15.931  -20.293 1.00 0.00 ? 129 SER A CB   1  
ATOM 2047  O OG   . SER A 1 129 ? -0.673  15.501  -20.866 1.00 0.00 ? 129 SER A OG   1  
ATOM 2048  H H    . SER A 1 129 ? -0.206  13.681  -19.312 1.00 0.00 ? 129 SER A H    1  
ATOM 2049  H HA   . SER A 1 129 ? 1.631   15.728  -18.449 1.00 0.00 ? 129 SER A HA   1  
ATOM 2050  H HB2  . SER A 1 129 ? 0.625   17.003  -20.399 1.00 0.00 ? 129 SER A HB2  1  
ATOM 2051  H HB3  . SER A 1 129 ? 1.366   15.459  -20.819 1.00 0.00 ? 129 SER A HB3  1  
ATOM 2052  H HG   . SER A 1 129 ? -1.404  15.950  -20.436 1.00 0.00 ? 129 SER A HG   1  
ATOM 2053  N N    . ILE A 1 130 ? 0.088   16.882  -16.842 1.00 0.00 ? 130 ILE A N    1  
ATOM 2054  C CA   . ILE A 1 130 ? -0.751  17.703  -15.974 1.00 0.00 ? 130 ILE A CA   1  
ATOM 2055  C C    . ILE A 1 130 ? 0.026   18.884  -15.402 1.00 0.00 ? 130 ILE A C    1  
ATOM 2056  O O    . ILE A 1 130 ? 1.189   18.752  -15.024 1.00 0.00 ? 130 ILE A O    1  
ATOM 2057  C CB   . ILE A 1 130 ? -1.331  16.865  -14.812 1.00 0.00 ? 130 ILE A CB   1  
ATOM 2058  C CG1  . ILE A 1 130 ? -2.059  17.763  -13.796 1.00 0.00 ? 130 ILE A CG1  1  
ATOM 2059  C CG2  . ILE A 1 130 ? -0.230  16.057  -14.139 1.00 0.00 ? 130 ILE A CG2  1  
ATOM 2060  C CD1  . ILE A 1 130 ? -1.163  18.335  -12.712 1.00 0.00 ? 130 ILE A CD1  1  
ATOM 2061  H H    . ILE A 1 130 ? 0.996   16.657  -16.560 1.00 0.00 ? 130 ILE A H    1  
ATOM 2062  H HA   . ILE A 1 130 ? -1.574  18.078  -16.564 1.00 0.00 ? 130 ILE A HA   1  
ATOM 2063  H HB   . ILE A 1 130 ? -2.041  16.167  -15.231 1.00 0.00 ? 130 ILE A HB   1  
ATOM 2064  H HG12 . ILE A 1 130 ? -2.509  18.592  -14.320 1.00 0.00 ? 130 ILE A HG12 1  
ATOM 2065  H HG13 . ILE A 1 130 ? -2.836  17.187  -13.314 1.00 0.00 ? 130 ILE A HG13 1  
ATOM 2066  H HG21 . ILE A 1 130 ? 0.555   16.722  -13.810 1.00 0.00 ? 130 ILE A HG21 1  
ATOM 2067  H HG22 . ILE A 1 130 ? 0.174   15.343  -14.842 1.00 0.00 ? 130 ILE A HG22 1  
ATOM 2068  H HG23 . ILE A 1 130 ? -0.637  15.532  -13.287 1.00 0.00 ? 130 ILE A HG23 1  
ATOM 2069  H HD11 . ILE A 1 130 ? -0.133  18.305  -13.037 1.00 0.00 ? 130 ILE A HD11 1  
ATOM 2070  H HD12 . ILE A 1 130 ? -1.271  17.751  -11.810 1.00 0.00 ? 130 ILE A HD12 1  
ATOM 2071  H HD13 . ILE A 1 130 ? -1.447  19.358  -12.513 1.00 0.00 ? 130 ILE A HD13 1  
ATOM 2072  N N    . VAL A 1 131 ? -0.631  20.038  -15.334 1.00 0.00 ? 131 VAL A N    1  
ATOM 2073  C CA   . VAL A 1 131 ? -0.004  21.237  -14.799 1.00 0.00 ? 131 VAL A CA   1  
ATOM 2074  C C    . VAL A 1 131 ? -0.198  21.327  -13.289 1.00 0.00 ? 131 VAL A C    1  
ATOM 2075  O O    . VAL A 1 131 ? -1.260  21.720  -12.814 1.00 0.00 ? 131 VAL A O    1  
ATOM 2076  C CB   . VAL A 1 131 ? -0.572  22.510  -15.454 1.00 0.00 ? 131 VAL A CB   1  
ATOM 2077  C CG1  . VAL A 1 131 ? 0.225   23.733  -15.027 1.00 0.00 ? 131 VAL A CG1  1  
ATOM 2078  C CG2  . VAL A 1 131 ? -0.580  22.372  -16.968 1.00 0.00 ? 131 VAL A CG2  1  
ATOM 2079  H H    . VAL A 1 131 ? -1.559  20.080  -15.646 1.00 0.00 ? 131 VAL A H    1  
ATOM 2080  H HA   . VAL A 1 131 ? 1.054   21.187  -15.014 1.00 0.00 ? 131 VAL A HA   1  
ATOM 2081  H HB   . VAL A 1 131 ? -1.591  22.638  -15.120 1.00 0.00 ? 131 VAL A HB   1  
ATOM 2082  H HG11 . VAL A 1 131 ? 0.938   23.986  -15.797 1.00 0.00 ? 131 VAL A HG11 1  
ATOM 2083  H HG12 . VAL A 1 131 ? 0.750   23.518  -14.107 1.00 0.00 ? 131 VAL A HG12 1  
ATOM 2084  H HG13 . VAL A 1 131 ? -0.447  24.565  -14.872 1.00 0.00 ? 131 VAL A HG13 1  
ATOM 2085  H HG21 . VAL A 1 131 ? -0.652  23.351  -17.419 1.00 0.00 ? 131 VAL A HG21 1  
ATOM 2086  H HG22 . VAL A 1 131 ? -1.427  21.774  -17.270 1.00 0.00 ? 131 VAL A HG22 1  
ATOM 2087  H HG23 . VAL A 1 131 ? 0.332   21.893  -17.291 1.00 0.00 ? 131 VAL A HG23 1  
ATOM 2088  N N    . GLU A 1 132 ? 0.835   20.931  -12.548 1.00 0.00 ? 132 GLU A N    1  
ATOM 2089  C CA   . GLU A 1 132 ? 0.804   20.930  -11.081 1.00 0.00 ? 132 GLU A CA   1  
ATOM 2090  C C    . GLU A 1 132 ? 0.084   22.154  -10.515 1.00 0.00 ? 132 GLU A C    1  
ATOM 2091  O O    . GLU A 1 132 ? -0.512  22.095  -9.440  1.00 0.00 ? 132 GLU A O    1  
ATOM 2092  C CB   . GLU A 1 132 ? 2.221   20.875  -10.534 1.00 0.00 ? 132 GLU A CB   1  
ATOM 2093  C CG   . GLU A 1 132 ? 3.053   22.090  -10.896 1.00 0.00 ? 132 GLU A CG   1  
ATOM 2094  C CD   . GLU A 1 132 ? 4.307   22.213  -10.053 1.00 0.00 ? 132 GLU A CD   1  
ATOM 2095  O OE1  . GLU A 1 132 ? 4.237   21.923  -8.840  1.00 0.00 ? 132 GLU A OE1  1  
ATOM 2096  O OE2  . GLU A 1 132 ? 5.358   22.599  -10.606 1.00 0.00 ? 132 GLU A OE2  1  
ATOM 2097  H H    . GLU A 1 132 ? 1.630   20.593  -13.011 1.00 0.00 ? 132 GLU A H    1  
ATOM 2098  H HA   . GLU A 1 132 ? 0.279   20.045  -10.767 1.00 0.00 ? 132 GLU A HA   1  
ATOM 2099  H HB2  . GLU A 1 132 ? 2.179   20.798  -9.459  1.00 0.00 ? 132 GLU A HB2  1  
ATOM 2100  H HB3  . GLU A 1 132 ? 2.705   20.003  -10.932 1.00 0.00 ? 132 GLU A HB3  1  
ATOM 2101  H HG2  . GLU A 1 132 ? 3.339   22.015  -11.934 1.00 0.00 ? 132 GLU A HG2  1  
ATOM 2102  H HG3  . GLU A 1 132 ? 2.450   22.975  -10.752 1.00 0.00 ? 132 GLU A HG3  1  
ATOM 2103  N N    . GLU A 1 133 ? 0.128   23.251  -11.257 1.00 0.00 ? 133 GLU A N    1  
ATOM 2104  C CA   . GLU A 1 133 ? -0.537  24.489  -10.849 1.00 0.00 ? 133 GLU A CA   1  
ATOM 2105  C C    . GLU A 1 133 ? -2.038  24.269  -10.606 1.00 0.00 ? 133 GLU A C    1  
ATOM 2106  O O    . GLU A 1 133 ? -2.724  25.144  -10.078 1.00 0.00 ? 133 GLU A O    1  
ATOM 2107  C CB   . GLU A 1 133 ? -0.337  25.572  -11.911 1.00 0.00 ? 133 GLU A CB   1  
ATOM 2108  C CG   . GLU A 1 133 ? 1.124   25.864  -12.214 1.00 0.00 ? 133 GLU A CG   1  
ATOM 2109  C CD   . GLU A 1 133 ? 1.299   26.776  -13.413 1.00 0.00 ? 133 GLU A CD   1  
ATOM 2110  O OE1  . GLU A 1 133 ? 0.901   27.956  -13.324 1.00 0.00 ? 133 GLU A OE1  1  
ATOM 2111  O OE2  . GLU A 1 133 ? 1.835   26.310  -14.440 1.00 0.00 ? 133 GLU A OE2  1  
ATOM 2112  H H    . GLU A 1 133 ? 0.607   23.223  -12.110 1.00 0.00 ? 133 GLU A H    1  
ATOM 2113  H HA   . GLU A 1 133 ? -0.082  24.818  -9.926  1.00 0.00 ? 133 GLU A HA   1  
ATOM 2114  H HB2  . GLU A 1 133 ? -0.815  25.254  -12.826 1.00 0.00 ? 133 GLU A HB2  1  
ATOM 2115  H HB3  . GLU A 1 133 ? -0.801  26.485  -11.571 1.00 0.00 ? 133 GLU A HB3  1  
ATOM 2116  H HG2  . GLU A 1 133 ? 1.569   26.339  -11.353 1.00 0.00 ? 133 GLU A HG2  1  
ATOM 2117  H HG3  . GLU A 1 133 ? 1.631   24.931  -12.413 1.00 0.00 ? 133 GLU A HG3  1  
ATOM 2118  N N    . GLU A 1 134 ? -2.534  23.094  -10.991 1.00 0.00 ? 134 GLU A N    1  
ATOM 2119  C CA   . GLU A 1 134 ? -3.942  22.754  -10.813 1.00 0.00 ? 134 GLU A CA   1  
ATOM 2120  C C    . GLU A 1 134 ? -4.116  21.263  -10.538 1.00 0.00 ? 134 GLU A C    1  
ATOM 2121  O O    . GLU A 1 134 ? -5.149  20.679  -10.866 1.00 0.00 ? 134 GLU A O    1  
ATOM 2122  C CB   . GLU A 1 134 ? -4.746  23.154  -12.051 1.00 0.00 ? 134 GLU A CB   1  
ATOM 2123  C CG   . GLU A 1 134 ? -5.193  24.607  -12.040 1.00 0.00 ? 134 GLU A CG   1  
ATOM 2124  C CD   . GLU A 1 134 ? -6.631  24.778  -12.490 1.00 0.00 ? 134 GLU A CD   1  
ATOM 2125  O OE1  . GLU A 1 134 ? -7.537  24.663  -11.639 1.00 0.00 ? 134 GLU A OE1  1  
ATOM 2126  O OE2  . GLU A 1 134 ? -6.850  25.027  -13.694 1.00 0.00 ? 134 GLU A OE2  1  
ATOM 2127  H H    . GLU A 1 134 ? -1.929  22.442  -11.386 1.00 0.00 ? 134 GLU A H    1  
ATOM 2128  H HA   . GLU A 1 134 ? -4.310  23.309  -9.963  1.00 0.00 ? 134 GLU A HA   1  
ATOM 2129  H HB2  . GLU A 1 134 ? -4.137  22.993  -12.929 1.00 0.00 ? 134 GLU A HB2  1  
ATOM 2130  H HB3  . GLU A 1 134 ? -5.624  22.529  -12.113 1.00 0.00 ? 134 GLU A HB3  1  
ATOM 2131  H HG2  . GLU A 1 134 ? -5.099  24.992  -11.036 1.00 0.00 ? 134 GLU A HG2  1  
ATOM 2132  H HG3  . GLU A 1 134 ? -4.554  25.172  -12.703 1.00 0.00 ? 134 GLU A HG3  1  
ATOM 2133  N N    . LEU A 1 135 ? -3.101  20.650  -9.934  1.00 0.00 ? 135 LEU A N    1  
ATOM 2134  C CA   . LEU A 1 135 ? -3.149  19.225  -9.619  1.00 0.00 ? 135 LEU A CA   1  
ATOM 2135  C C    . LEU A 1 135 ? -4.126  18.949  -8.479  1.00 0.00 ? 135 LEU A C    1  
ATOM 2136  O O    . LEU A 1 135 ? -4.497  19.853  -7.730  1.00 0.00 ? 135 LEU A O    1  
ATOM 2137  C CB   . LEU A 1 135 ? -1.748  18.704  -9.267  1.00 0.00 ? 135 LEU A CB   1  
ATOM 2138  C CG   . LEU A 1 135 ? -1.346  18.812  -7.793  1.00 0.00 ? 135 LEU A CG   1  
ATOM 2139  C CD1  . LEU A 1 135 ? -0.061  18.042  -7.541  1.00 0.00 ? 135 LEU A CD1  1  
ATOM 2140  C CD2  . LEU A 1 135 ? -1.186  20.268  -7.386  1.00 0.00 ? 135 LEU A CD2  1  
ATOM 2141  H H    . LEU A 1 135 ? -2.303  21.166  -9.698  1.00 0.00 ? 135 LEU A H    1  
ATOM 2142  H HA   . LEU A 1 135 ? -3.498  18.709  -10.501 1.00 0.00 ? 135 LEU A HA   1  
ATOM 2143  H HB2  . LEU A 1 135 ? -1.695  17.665  -9.554  1.00 0.00 ? 135 LEU A HB2  1  
ATOM 2144  H HB3  . LEU A 1 135 ? -1.028  19.254  -9.851  1.00 0.00 ? 135 LEU A HB3  1  
ATOM 2145  H HG   . LEU A 1 135 ? -2.121  18.374  -7.180  1.00 0.00 ? 135 LEU A HG   1  
ATOM 2146  H HD11 . LEU A 1 135 ? 0.072   17.902  -6.479  1.00 0.00 ? 135 LEU A HD11 1  
ATOM 2147  H HD12 . LEU A 1 135 ? 0.776   18.598  -7.939  1.00 0.00 ? 135 LEU A HD12 1  
ATOM 2148  H HD13 . LEU A 1 135 ? -0.119  17.078  -8.027  1.00 0.00 ? 135 LEU A HD13 1  
ATOM 2149  H HD21 . LEU A 1 135 ? -1.182  20.342  -6.308  1.00 0.00 ? 135 LEU A HD21 1  
ATOM 2150  H HD22 . LEU A 1 135 ? -2.006  20.846  -7.783  1.00 0.00 ? 135 LEU A HD22 1  
ATOM 2151  H HD23 . LEU A 1 135 ? -0.253  20.650  -7.775  1.00 0.00 ? 135 LEU A HD23 1  
ATOM 2152  N N    . GLN A 1 136 ? -4.543  17.693  -8.360  1.00 0.00 ? 136 GLN A N    1  
ATOM 2153  C CA   . GLN A 1 136 ? -5.483  17.291  -7.319  1.00 0.00 ? 136 GLN A CA   1  
ATOM 2154  C C    . GLN A 1 136 ? -4.771  16.561  -6.182  1.00 0.00 ? 136 GLN A C    1  
ATOM 2155  O O    . GLN A 1 136 ? -5.214  16.594  -5.035  1.00 0.00 ? 136 GLN A O    1  
ATOM 2156  C CB   . GLN A 1 136 ? -6.573  16.399  -7.919  1.00 0.00 ? 136 GLN A CB   1  
ATOM 2157  C CG   . GLN A 1 136 ? -6.170  14.939  -8.071  1.00 0.00 ? 136 GLN A CG   1  
ATOM 2158  C CD   . GLN A 1 136 ? -7.270  14.091  -8.680  1.00 0.00 ? 136 GLN A CD   1  
ATOM 2159  O OE1  . GLN A 1 136 ? -8.038  14.559  -9.519  1.00 0.00 ? 136 GLN A OE1  1  
ATOM 2160  N NE2  . GLN A 1 136 ? -7.351  12.834  -8.257  1.00 0.00 ? 136 GLN A NE2  1  
ATOM 2161  H H    . GLN A 1 136 ? -4.214  17.019  -8.991  1.00 0.00 ? 136 GLN A H    1  
ATOM 2162  H HA   . GLN A 1 136 ? -5.941  18.185  -6.924  1.00 0.00 ? 136 GLN A HA   1  
ATOM 2163  H HB2  . GLN A 1 136 ? -7.448  16.444  -7.288  1.00 0.00 ? 136 GLN A HB2  1  
ATOM 2164  H HB3  . GLN A 1 136 ? -6.826  16.779  -8.895  1.00 0.00 ? 136 GLN A HB3  1  
ATOM 2165  H HG2  . GLN A 1 136 ? -5.300  14.883  -8.709  1.00 0.00 ? 136 GLN A HG2  1  
ATOM 2166  H HG3  . GLN A 1 136 ? -5.926  14.542  -7.097  1.00 0.00 ? 136 GLN A HG3  1  
ATOM 2167  H HE21 . GLN A 1 136 ? -6.705  12.529  -7.585  1.00 0.00 ? 136 GLN A HE21 1  
ATOM 2168  H HE22 . GLN A 1 136 ? -8.052  12.264  -8.633  1.00 0.00 ? 136 GLN A HE22 1  
ATOM 2169  N N    . PHE A 1 137 ? -3.670  15.897  -6.514  1.00 0.00 ? 137 PHE A N    1  
ATOM 2170  C CA   . PHE A 1 137 ? -2.900  15.151  -5.518  1.00 0.00 ? 137 PHE A CA   1  
ATOM 2171  C C    . PHE A 1 137 ? -1.486  15.695  -5.353  1.00 0.00 ? 137 PHE A C    1  
ATOM 2172  O O    . PHE A 1 137 ? -0.728  15.795  -6.314  1.00 0.00 ? 137 PHE A O    1  
ATOM 2173  C CB   . PHE A 1 137 ? -2.832  13.655  -5.878  1.00 0.00 ? 137 PHE A CB   1  
ATOM 2174  C CG   . PHE A 1 137 ? -1.956  13.310  -7.061  1.00 0.00 ? 137 PHE A CG   1  
ATOM 2175  C CD1  . PHE A 1 137 ? -1.774  14.193  -8.118  1.00 0.00 ? 137 PHE A CD1  1  
ATOM 2176  C CD2  . PHE A 1 137 ? -1.317  12.081  -7.113  1.00 0.00 ? 137 PHE A CD2  1  
ATOM 2177  C CE1  . PHE A 1 137 ? -0.974  13.857  -9.193  1.00 0.00 ? 137 PHE A CE1  1  
ATOM 2178  C CE2  . PHE A 1 137 ? -0.518  11.740  -8.187  1.00 0.00 ? 137 PHE A CE2  1  
ATOM 2179  C CZ   . PHE A 1 137 ? -0.347  12.629  -9.228  1.00 0.00 ? 137 PHE A CZ   1  
ATOM 2180  H H    . PHE A 1 137 ? -3.374  15.909  -7.444  1.00 0.00 ? 137 PHE A H    1  
ATOM 2181  H HA   . PHE A 1 137 ? -3.413  15.250  -4.574  1.00 0.00 ? 137 PHE A HA   1  
ATOM 2182  H HB2  . PHE A 1 137 ? -2.447  13.115  -5.027  1.00 0.00 ? 137 PHE A HB2  1  
ATOM 2183  H HB3  . PHE A 1 137 ? -3.823  13.299  -6.090  1.00 0.00 ? 137 PHE A HB3  1  
ATOM 2184  H HD1  . PHE A 1 137 ? -2.257  15.153  -8.097  1.00 0.00 ? 137 PHE A HD1  1  
ATOM 2185  H HD2  . PHE A 1 137 ? -1.449  11.383  -6.301  1.00 0.00 ? 137 PHE A HD2  1  
ATOM 2186  H HE1  . PHE A 1 137 ? -0.842  14.555  -10.007 1.00 0.00 ? 137 PHE A HE1  1  
ATOM 2187  H HE2  . PHE A 1 137 ? -0.026  10.780  -8.211  1.00 0.00 ? 137 PHE A HE2  1  
ATOM 2188  H HZ   . PHE A 1 137 ? 0.278   12.365  -10.069 1.00 0.00 ? 137 PHE A HZ   1  
ATOM 2189  N N    . ASP A 1 138 ? -1.121  16.002  -4.111  1.00 0.00 ? 138 ASP A N    1  
ATOM 2190  C CA   . ASP A 1 138 ? 0.221   16.487  -3.810  1.00 0.00 ? 138 ASP A CA   1  
ATOM 2191  C C    . ASP A 1 138 ? 1.197   15.310  -3.800  1.00 0.00 ? 138 ASP A C    1  
ATOM 2192  O O    . ASP A 1 138 ? 2.411   15.488  -3.694  1.00 0.00 ? 138 ASP A O    1  
ATOM 2193  C CB   . ASP A 1 138 ? 0.242   17.203  -2.458  1.00 0.00 ? 138 ASP A CB   1  
ATOM 2194  C CG   . ASP A 1 138 ? 1.147   18.419  -2.460  1.00 0.00 ? 138 ASP A CG   1  
ATOM 2195  O OD1  . ASP A 1 138 ? 1.169   19.141  -3.479  1.00 0.00 ? 138 ASP A OD1  1  
ATOM 2196  O OD2  . ASP A 1 138 ? 1.834   18.650  -1.442  1.00 0.00 ? 138 ASP A OD2  1  
ATOM 2197  H H    . ASP A 1 138 ? -1.758  15.869  -3.378  1.00 0.00 ? 138 ASP A H    1  
ATOM 2198  H HA   . ASP A 1 138 ? 0.511   17.179  -4.587  1.00 0.00 ? 138 ASP A HA   1  
ATOM 2199  H HB2  . ASP A 1 138 ? -0.760  17.524  -2.212  1.00 0.00 ? 138 ASP A HB2  1  
ATOM 2200  H HB3  . ASP A 1 138 ? 0.591   16.517  -1.700  1.00 0.00 ? 138 ASP A HB3  1  
ATOM 2201  N N    . LEU A 1 139 ? 0.631   14.105  -3.917  1.00 0.00 ? 139 LEU A N    1  
ATOM 2202  C CA   . LEU A 1 139 ? 1.381   12.852  -3.937  1.00 0.00 ? 139 LEU A CA   1  
ATOM 2203  C C    . LEU A 1 139 ? 2.767   13.002  -4.546  1.00 0.00 ? 139 LEU A C    1  
ATOM 2204  O O    . LEU A 1 139 ? 2.938   13.651  -5.578  1.00 0.00 ? 139 LEU A O    1  
ATOM 2205  C CB   . LEU A 1 139 ? 0.596   11.828  -4.752  1.00 0.00 ? 139 LEU A CB   1  
ATOM 2206  C CG   . LEU A 1 139 ? 0.544   10.418  -4.178  1.00 0.00 ? 139 LEU A CG   1  
ATOM 2207  C CD1  . LEU A 1 139 ? -0.374  10.375  -2.968  1.00 0.00 ? 139 LEU A CD1  1  
ATOM 2208  C CD2  . LEU A 1 139 ? 0.071   9.444   -5.247  1.00 0.00 ? 139 LEU A CD2  1  
ATOM 2209  H H    . LEU A 1 139 ? -0.341  14.055  -3.997  1.00 0.00 ? 139 LEU A H    1  
ATOM 2210  H HA   . LEU A 1 139 ? 1.474   12.496  -2.924  1.00 0.00 ? 139 LEU A HA   1  
ATOM 2211  H HB2  . LEU A 1 139 ? -0.414  12.187  -4.847  1.00 0.00 ? 139 LEU A HB2  1  
ATOM 2212  H HB3  . LEU A 1 139 ? 1.032   11.774  -5.738  1.00 0.00 ? 139 LEU A HB3  1  
ATOM 2213  H HG   . LEU A 1 139 ? 1.534   10.122  -3.864  1.00 0.00 ? 139 LEU A HG   1  
ATOM 2214  H HD11 . LEU A 1 139 ? -0.697  9.358   -2.799  1.00 0.00 ? 139 LEU A HD11 1  
ATOM 2215  H HD12 . LEU A 1 139 ? -1.236  11.002  -3.150  1.00 0.00 ? 139 LEU A HD12 1  
ATOM 2216  H HD13 . LEU A 1 139 ? 0.158   10.734  -2.099  1.00 0.00 ? 139 LEU A HD13 1  
ATOM 2217  H HD21 . LEU A 1 139 ? 0.121   8.436   -4.865  1.00 0.00 ? 139 LEU A HD21 1  
ATOM 2218  H HD22 . LEU A 1 139 ? 0.705   9.531   -6.120  1.00 0.00 ? 139 LEU A HD22 1  
ATOM 2219  H HD23 . LEU A 1 139 ? -0.950  9.679   -5.519  1.00 0.00 ? 139 LEU A HD23 1  
ATOM 2220  N N    . SER A 1 140 ? 3.747   12.369  -3.918  1.00 0.00 ? 140 SER A N    1  
ATOM 2221  C CA   . SER A 1 140 ? 5.109   12.407  -4.421  1.00 0.00 ? 140 SER A CA   1  
ATOM 2222  C C    . SER A 1 140 ? 5.431   11.112  -5.144  1.00 0.00 ? 140 SER A C    1  
ATOM 2223  O O    . SER A 1 140 ? 4.679   10.140  -5.066  1.00 0.00 ? 140 SER A O    1  
ATOM 2224  C CB   . SER A 1 140 ? 6.122   12.608  -3.295  1.00 0.00 ? 140 SER A CB   1  
ATOM 2225  O OG   . SER A 1 140 ? 6.068   13.929  -2.784  1.00 0.00 ? 140 SER A OG   1  
ATOM 2226  H H    . SER A 1 140 ? 3.547   11.851  -3.110  1.00 0.00 ? 140 SER A H    1  
ATOM 2227  H HA   . SER A 1 140 ? 5.182   13.228  -5.115  1.00 0.00 ? 140 SER A HA   1  
ATOM 2228  H HB2  . SER A 1 140 ? 5.911   11.914  -2.495  1.00 0.00 ? 140 SER A HB2  1  
ATOM 2229  H HB3  . SER A 1 140 ? 7.120   12.421  -3.680  1.00 0.00 ? 140 SER A HB3  1  
ATOM 2230  H HG   . SER A 1 140 ? 5.151   14.196  -2.681  1.00 0.00 ? 140 SER A HG   1  
ATOM 2231  N N    . LEU A 1 141 ? 6.571   11.092  -5.809  1.00 0.00 ? 141 LEU A N    1  
ATOM 2232  C CA   . LEU A 1 141 ? 7.018   9.905   -6.508  1.00 0.00 ? 141 LEU A CA   1  
ATOM 2233  C C    . LEU A 1 141 ? 8.257   9.375   -5.832  1.00 0.00 ? 141 LEU A C    1  
ATOM 2234  O O    . LEU A 1 141 ? 9.152   10.132  -5.467  1.00 0.00 ? 141 LEU A O    1  
ATOM 2235  C CB   . LEU A 1 141 ? 7.316   10.179  -7.982  1.00 0.00 ? 141 LEU A CB   1  
ATOM 2236  C CG   . LEU A 1 141 ? 7.702   8.943   -8.794  1.00 0.00 ? 141 LEU A CG   1  
ATOM 2237  C CD1  . LEU A 1 141 ? 6.480   8.084   -9.080  1.00 0.00 ? 141 LEU A CD1  1  
ATOM 2238  C CD2  . LEU A 1 141 ? 8.392   9.355   -10.086 1.00 0.00 ? 141 LEU A CD2  1  
ATOM 2239  H H    . LEU A 1 141 ? 7.142   11.882  -5.800  1.00 0.00 ? 141 LEU A H    1  
ATOM 2240  H HA   . LEU A 1 141 ? 6.236   9.162   -6.436  1.00 0.00 ? 141 LEU A HA   1  
ATOM 2241  H HB2  . LEU A 1 141 ? 6.444   10.626  -8.432  1.00 0.00 ? 141 LEU A HB2  1  
ATOM 2242  H HB3  . LEU A 1 141 ? 8.131   10.877  -8.040  1.00 0.00 ? 141 LEU A HB3  1  
ATOM 2243  H HG   . LEU A 1 141 ? 8.397   8.348   -8.219  1.00 0.00 ? 141 LEU A HG   1  
ATOM 2244  H HD11 . LEU A 1 141 ? 6.694   7.058   -8.820  1.00 0.00 ? 141 LEU A HD11 1  
ATOM 2245  H HD12 . LEU A 1 141 ? 6.232   8.146   -10.129 1.00 0.00 ? 141 LEU A HD12 1  
ATOM 2246  H HD13 . LEU A 1 141 ? 5.646   8.437   -8.491  1.00 0.00 ? 141 LEU A HD13 1  
ATOM 2247  H HD21 . LEU A 1 141 ? 8.144   8.652   -10.867 1.00 0.00 ? 141 LEU A HD21 1  
ATOM 2248  H HD22 . LEU A 1 141 ? 9.462   9.364   -9.934  1.00 0.00 ? 141 LEU A HD22 1  
ATOM 2249  H HD23 . LEU A 1 141 ? 8.061   10.342  -10.371 1.00 0.00 ? 141 LEU A HD23 1  
ATOM 2250  N N    . VAL A 1 142 ? 8.301   8.076   -5.672  1.00 0.00 ? 142 VAL A N    1  
ATOM 2251  C CA   . VAL A 1 142 ? 9.434   7.429   -5.040  1.00 0.00 ? 142 VAL A CA   1  
ATOM 2252  C C    . VAL A 1 142 ? 10.155  6.528   -6.023  1.00 0.00 ? 142 VAL A C    1  
ATOM 2253  O O    . VAL A 1 142 ? 9.669   5.449   -6.369  1.00 0.00 ? 142 VAL A O    1  
ATOM 2254  C CB   . VAL A 1 142 ? 9.027   6.596   -3.810  1.00 0.00 ? 142 VAL A CB   1  
ATOM 2255  C CG1  . VAL A 1 142 ? 10.265  6.087   -3.083  1.00 0.00 ? 142 VAL A CG1  1  
ATOM 2256  C CG2  . VAL A 1 142 ? 8.144   7.412   -2.877  1.00 0.00 ? 142 VAL A CG2  1  
ATOM 2257  H H    . VAL A 1 142 ? 7.556   7.543   -5.998  1.00 0.00 ? 142 VAL A H    1  
ATOM 2258  H HA   . VAL A 1 142 ? 10.110  8.206   -4.713  1.00 0.00 ? 142 VAL A HA   1  
ATOM 2259  H HB   . VAL A 1 142 ? 8.463   5.740   -4.151  1.00 0.00 ? 142 VAL A HB   1  
ATOM 2260  H HG11 . VAL A 1 142 ? 10.644  6.862   -2.432  1.00 0.00 ? 142 VAL A HG11 1  
ATOM 2261  H HG12 . VAL A 1 142 ? 11.024  5.820   -3.805  1.00 0.00 ? 142 VAL A HG12 1  
ATOM 2262  H HG13 . VAL A 1 142 ? 10.011  5.221   -2.498  1.00 0.00 ? 142 VAL A HG13 1  
ATOM 2263  H HG21 . VAL A 1 142 ? 7.186   6.924   -2.771  1.00 0.00 ? 142 VAL A HG21 1  
ATOM 2264  H HG22 . VAL A 1 142 ? 8.001   8.400   -3.288  1.00 0.00 ? 142 VAL A HG22 1  
ATOM 2265  H HG23 . VAL A 1 142 ? 8.617   7.490   -1.909  1.00 0.00 ? 142 VAL A HG23 1  
ATOM 2266  N N    . ILE A 1 143 ? 11.318  6.974   -6.463  1.00 0.00 ? 143 ILE A N    1  
ATOM 2267  C CA   . ILE A 1 143 ? 12.116  6.204   -7.403  1.00 0.00 ? 143 ILE A CA   1  
ATOM 2268  C C    . ILE A 1 143 ? 12.995  5.216   -6.640  1.00 0.00 ? 143 ILE A C    1  
ATOM 2269  O O    . ILE A 1 143 ? 14.036  5.583   -6.102  1.00 0.00 ? 143 ILE A O    1  
ATOM 2270  C CB   . ILE A 1 143 ? 13.018  7.095   -8.301  1.00 0.00 ? 143 ILE A CB   1  
ATOM 2271  C CG1  . ILE A 1 143 ? 12.698  8.601   -8.154  1.00 0.00 ? 143 ILE A CG1  1  
ATOM 2272  C CG2  . ILE A 1 143 ? 12.898  6.661   -9.750  1.00 0.00 ? 143 ILE A CG2  1  
ATOM 2273  C CD1  . ILE A 1 143 ? 11.227  8.959   -8.256  1.00 0.00 ? 143 ILE A CD1  1  
ATOM 2274  H H    . ILE A 1 143 ? 11.650  7.839   -6.142  1.00 0.00 ? 143 ILE A H    1  
ATOM 2275  H HA   . ILE A 1 143 ? 11.430  5.648   -8.041  1.00 0.00 ? 143 ILE A HA   1  
ATOM 2276  H HB   . ILE A 1 143 ? 14.043  6.931   -8.000  1.00 0.00 ? 143 ILE A HB   1  
ATOM 2277  H HG12 . ILE A 1 143 ? 13.054  8.940   -7.199  1.00 0.00 ? 143 ILE A HG12 1  
ATOM 2278  H HG13 . ILE A 1 143 ? 13.216  9.148   -8.925  1.00 0.00 ? 143 ILE A HG13 1  
ATOM 2279  H HG21 . ILE A 1 143 ? 13.578  7.241   -10.355 1.00 0.00 ? 143 ILE A HG21 1  
ATOM 2280  H HG22 . ILE A 1 143 ? 11.885  6.819   -10.090 1.00 0.00 ? 143 ILE A HG22 1  
ATOM 2281  H HG23 . ILE A 1 143 ? 13.148  5.611   -9.832  1.00 0.00 ? 143 ILE A HG23 1  
ATOM 2282  H HD11 . ILE A 1 143 ? 10.828  9.146   -7.265  1.00 0.00 ? 143 ILE A HD11 1  
ATOM 2283  H HD12 . ILE A 1 143 ? 10.686  8.149   -8.718  1.00 0.00 ? 143 ILE A HD12 1  
ATOM 2284  H HD13 . ILE A 1 143 ? 11.121  9.854   -8.855  1.00 0.00 ? 143 ILE A HD13 1  
ATOM 2285  N N    . GLU A 1 144 ? 12.572  3.962   -6.591  1.00 0.00 ? 144 GLU A N    1  
ATOM 2286  C CA   . GLU A 1 144 ? 13.328  2.934   -5.882  1.00 0.00 ? 144 GLU A CA   1  
ATOM 2287  C C    . GLU A 1 144 ? 14.416  2.355   -6.784  1.00 0.00 ? 144 GLU A C    1  
ATOM 2288  O O    . GLU A 1 144 ? 14.194  2.140   -7.972  1.00 0.00 ? 144 GLU A O    1  
ATOM 2289  C CB   . GLU A 1 144 ? 12.369  1.853   -5.385  1.00 0.00 ? 144 GLU A CB   1  
ATOM 2290  C CG   . GLU A 1 144 ? 11.985  1.995   -3.926  1.00 0.00 ? 144 GLU A CG   1  
ATOM 2291  C CD   . GLU A 1 144 ? 11.735  0.657   -3.258  1.00 0.00 ? 144 GLU A CD   1  
ATOM 2292  O OE1  . GLU A 1 144 ? 10.870  -0.099  -3.749  1.00 0.00 ? 144 GLU A OE1  1  
ATOM 2293  O OE2  . GLU A 1 144 ? 12.404  0.365   -2.245  1.00 0.00 ? 144 GLU A OE2  1  
ATOM 2294  H H    . GLU A 1 144 ? 11.738  3.718   -7.047  1.00 0.00 ? 144 GLU A H    1  
ATOM 2295  H HA   . GLU A 1 144 ? 13.802  3.399   -5.033  1.00 0.00 ? 144 GLU A HA   1  
ATOM 2296  H HB2  . GLU A 1 144 ? 11.469  1.906   -5.967  1.00 0.00 ? 144 GLU A HB2  1  
ATOM 2297  H HB3  . GLU A 1 144 ? 12.816  0.890   -5.519  1.00 0.00 ? 144 GLU A HB3  1  
ATOM 2298  H HG2  . GLU A 1 144 ? 12.778  2.497   -3.403  1.00 0.00 ? 144 GLU A HG2  1  
ATOM 2299  H HG3  . GLU A 1 144 ? 11.088  2.587   -3.866  1.00 0.00 ? 144 GLU A HG3  1  
ATOM 2300  N N    . GLU A 1 145 ? 15.607  2.143   -6.219  1.00 0.00 ? 145 GLU A N    1  
ATOM 2301  C CA   . GLU A 1 145 ? 16.743  1.631   -6.987  1.00 0.00 ? 145 GLU A CA   1  
ATOM 2302  C C    . GLU A 1 145 ? 17.292  0.321   -6.413  1.00 0.00 ? 145 GLU A C    1  
ATOM 2303  O O    . GLU A 1 145 ? 17.790  0.284   -5.288  1.00 0.00 ? 145 GLU A O    1  
ATOM 2304  C CB   . GLU A 1 145 ? 17.851  2.686   -7.018  1.00 0.00 ? 145 GLU A CB   1  
ATOM 2305  C CG   . GLU A 1 145 ? 18.707  2.642   -8.266  1.00 0.00 ? 145 GLU A CG   1  
ATOM 2306  C CD   . GLU A 1 145 ? 19.964  1.827   -8.066  1.00 0.00 ? 145 GLU A CD   1  
ATOM 2307  O OE1  . GLU A 1 145 ? 19.943  0.900   -7.228  1.00 0.00 ? 145 GLU A OE1  1  
ATOM 2308  O OE2  . GLU A 1 145 ? 20.972  2.116   -8.743  1.00 0.00 ? 145 GLU A OE2  1  
ATOM 2309  H H    . GLU A 1 145 ? 15.731  2.363   -5.272  1.00 0.00 ? 145 GLU A H    1  
ATOM 2310  H HA   . GLU A 1 145 ? 16.406  1.454   -7.997  1.00 0.00 ? 145 GLU A HA   1  
ATOM 2311  H HB2  . GLU A 1 145 ? 17.403  3.665   -6.951  1.00 0.00 ? 145 GLU A HB2  1  
ATOM 2312  H HB3  . GLU A 1 145 ? 18.497  2.538   -6.168  1.00 0.00 ? 145 GLU A HB3  1  
ATOM 2313  H HG2  . GLU A 1 145 ? 18.133  2.208   -9.070  1.00 0.00 ? 145 GLU A HG2  1  
ATOM 2314  H HG3  . GLU A 1 145 ? 18.990  3.650   -8.525  1.00 0.00 ? 145 GLU A HG3  1  
ATOM 2315  N N    . GLN A 1 146 ? 17.198  -0.752  -7.200  1.00 0.00 ? 146 GLN A N    1  
ATOM 2316  C CA   . GLN A 1 146 ? 17.686  -2.068  -6.779  1.00 0.00 ? 146 GLN A CA   1  
ATOM 2317  C C    . GLN A 1 146 ? 18.857  -2.531  -7.648  1.00 0.00 ? 146 GLN A C    1  
ATOM 2318  O O    . GLN A 1 146 ? 18.726  -3.471  -8.429  1.00 0.00 ? 146 GLN A O    1  
ATOM 2319  C CB   . GLN A 1 146 ? 16.550  -3.079  -6.858  1.00 0.00 ? 146 GLN A CB   1  
ATOM 2320  C CG   . GLN A 1 146 ? 16.349  -3.872  -5.582  1.00 0.00 ? 146 GLN A CG   1  
ATOM 2321  C CD   . GLN A 1 146 ? 17.036  -5.223  -5.619  1.00 0.00 ? 146 GLN A CD   1  
ATOM 2322  O OE1  . GLN A 1 146 ? 16.420  -6.236  -5.953  1.00 0.00 ? 146 GLN A OE1  1  
ATOM 2323  N NE2  . GLN A 1 146 ? 18.318  -5.245  -5.276  1.00 0.00 ? 146 GLN A NE2  1  
ATOM 2324  H H    . GLN A 1 146 ? 16.784  -0.653  -8.085  1.00 0.00 ? 146 GLN A H    1  
ATOM 2325  H HA   . GLN A 1 146 ? 18.013  -1.989  -5.758  1.00 0.00 ? 146 GLN A HA   1  
ATOM 2326  H HB2  . GLN A 1 146 ? 15.643  -2.545  -7.070  1.00 0.00 ? 146 GLN A HB2  1  
ATOM 2327  H HB3  . GLN A 1 146 ? 16.746  -3.772  -7.661  1.00 0.00 ? 146 GLN A HB3  1  
ATOM 2328  H HG2  . GLN A 1 146 ? 16.751  -3.303  -4.757  1.00 0.00 ? 146 GLN A HG2  1  
ATOM 2329  H HG3  . GLN A 1 146 ? 15.290  -4.025  -5.435  1.00 0.00 ? 146 GLN A HG3  1  
ATOM 2330  H HE21 . GLN A 1 146 ? 18.744  -4.400  -5.021  1.00 0.00 ? 146 GLN A HE21 1  
ATOM 2331  H HE22 . GLN A 1 146 ? 18.787  -6.106  -5.292  1.00 0.00 ? 146 GLN A HE22 1  
ATOM 2332  N N    . SER A 1 147 ? 19.985  -1.838  -7.531  1.00 0.00 ? 147 SER A N    1  
ATOM 2333  C CA   . SER A 1 147 ? 21.171  -2.143  -8.347  1.00 0.00 ? 147 SER A CA   1  
ATOM 2334  C C    . SER A 1 147 ? 22.098  -3.179  -7.731  1.00 0.00 ? 147 SER A C    1  
ATOM 2335  O O    . SER A 1 147 ? 22.475  -3.091  -6.572  1.00 0.00 ? 147 SER A O    1  
ATOM 2336  C CB   . SER A 1 147 ? 21.965  -0.863  -8.640  1.00 0.00 ? 147 SER A CB   1  
ATOM 2337  O OG   . SER A 1 147 ? 22.948  -0.620  -7.647  1.00 0.00 ? 147 SER A OG   1  
ATOM 2338  H H    . SER A 1 147 ? 20.005  -1.077  -6.920  1.00 0.00 ? 147 SER A H    1  
ATOM 2339  H HA   . SER A 1 147 ? 20.825  -2.535  -9.279  1.00 0.00 ? 147 SER A HA   1  
ATOM 2340  H HB2  . SER A 1 147 ? 22.455  -0.956  -9.600  1.00 0.00 ? 147 SER A HB2  1  
ATOM 2341  H HB3  . SER A 1 147 ? 21.291  -0.026  -8.670  1.00 0.00 ? 147 SER A HB3  1  
ATOM 2342  H HG   . SER A 1 147 ? 23.624  -1.298  -7.690  1.00 0.00 ? 147 SER A HG   1  
ATOM 2343  N N    . GLU A 1 148 ? 22.487  -4.138  -8.567  1.00 0.00 ? 148 GLU A N    1  
ATOM 2344  C CA   . GLU A 1 148 ? 23.412  -5.207  -8.196  1.00 0.00 ? 148 GLU A CA   1  
ATOM 2345  C C    . GLU A 1 148 ? 23.228  -5.705  -6.757  1.00 0.00 ? 148 GLU A C    1  
ATOM 2346  O O    . GLU A 1 148 ? 24.204  -5.879  -6.027  1.00 0.00 ? 148 GLU A O    1  
ATOM 2347  C CB   . GLU A 1 148 ? 24.851  -4.727  -8.410  1.00 0.00 ? 148 GLU A CB   1  
ATOM 2348  C CG   . GLU A 1 148 ? 25.839  -5.853  -8.664  1.00 0.00 ? 148 GLU A CG   1  
ATOM 2349  C CD   . GLU A 1 148 ? 26.631  -6.224  -7.426  1.00 0.00 ? 148 GLU A CD   1  
ATOM 2350  O OE1  . GLU A 1 148 ? 26.847  -5.339  -6.571  1.00 0.00 ? 148 GLU A OE1  1  
ATOM 2351  O OE2  . GLU A 1 148 ? 27.036  -7.400  -7.310  1.00 0.00 ? 148 GLU A OE2  1  
ATOM 2352  H H    . GLU A 1 148 ? 22.158  -4.108  -9.490  1.00 0.00 ? 148 GLU A H    1  
ATOM 2353  H HA   . GLU A 1 148 ? 23.230  -6.034  -8.863  1.00 0.00 ? 148 GLU A HA   1  
ATOM 2354  H HB2  . GLU A 1 148 ? 24.873  -4.062  -9.266  1.00 0.00 ? 148 GLU A HB2  1  
ATOM 2355  H HB3  . GLU A 1 148 ? 25.173  -4.184  -7.534  1.00 0.00 ? 148 GLU A HB3  1  
ATOM 2356  H HG2  . GLU A 1 148 ? 25.295  -6.724  -8.999  1.00 0.00 ? 148 GLU A HG2  1  
ATOM 2357  H HG3  . GLU A 1 148 ? 26.528  -5.542  -9.436  1.00 0.00 ? 148 GLU A HG3  1  
ATOM 2358  N N    . GLY A 1 149 ? 21.983  -5.965  -6.360  1.00 0.00 ? 149 GLY A N    1  
ATOM 2359  C CA   . GLY A 1 149 ? 21.725  -6.476  -5.020  1.00 0.00 ? 149 GLY A CA   1  
ATOM 2360  C C    . GLY A 1 149 ? 21.445  -5.397  -3.987  1.00 0.00 ? 149 GLY A C    1  
ATOM 2361  O O    . GLY A 1 149 ? 21.073  -5.704  -2.855  1.00 0.00 ? 149 GLY A O    1  
ATOM 2362  H H    . GLY A 1 149 ? 21.237  -5.831  -6.981  1.00 0.00 ? 149 GLY A H    1  
ATOM 2363  H HA2  . GLY A 1 149 ? 20.873  -7.137  -5.063  1.00 0.00 ? 149 GLY A HA2  1  
ATOM 2364  H HA3  . GLY A 1 149 ? 22.586  -7.046  -4.700  1.00 0.00 ? 149 GLY A HA3  1  
ATOM 2365  N N    . ILE A 1 150 ? 21.620  -4.139  -4.367  1.00 0.00 ? 150 ILE A N    1  
ATOM 2366  C CA   . ILE A 1 150 ? 21.378  -3.029  -3.452  1.00 0.00 ? 150 ILE A CA   1  
ATOM 2367  C C    . ILE A 1 150 ? 20.028  -2.389  -3.738  1.00 0.00 ? 150 ILE A C    1  
ATOM 2368  O O    . ILE A 1 150 ? 19.765  -1.961  -4.859  1.00 0.00 ? 150 ILE A O    1  
ATOM 2369  C CB   . ILE A 1 150 ? 22.468  -1.937  -3.547  1.00 0.00 ? 150 ILE A CB   1  
ATOM 2370  C CG1  . ILE A 1 150 ? 23.825  -2.530  -3.948  1.00 0.00 ? 150 ILE A CG1  1  
ATOM 2371  C CG2  . ILE A 1 150 ? 22.582  -1.196  -2.223  1.00 0.00 ? 150 ILE A CG2  1  
ATOM 2372  C CD1  . ILE A 1 150 ? 24.345  -1.997  -5.266  1.00 0.00 ? 150 ILE A CD1  1  
ATOM 2373  H H    . ILE A 1 150 ? 21.913  -3.951  -5.276  1.00 0.00 ? 150 ILE A H    1  
ATOM 2374  H HA   . ILE A 1 150 ? 21.374  -3.421  -2.445  1.00 0.00 ? 150 ILE A HA   1  
ATOM 2375  H HB   . ILE A 1 150 ? 22.160  -1.225  -4.298  1.00 0.00 ? 150 ILE A HB   1  
ATOM 2376  H HG12 . ILE A 1 150 ? 24.554  -2.295  -3.187  1.00 0.00 ? 150 ILE A HG12 1  
ATOM 2377  H HG13 . ILE A 1 150 ? 23.737  -3.602  -4.034  1.00 0.00 ? 150 ILE A HG13 1  
ATOM 2378  H HG21 . ILE A 1 150 ? 21.659  -1.298  -1.672  1.00 0.00 ? 150 ILE A HG21 1  
ATOM 2379  H HG22 . ILE A 1 150 ? 22.775  -0.150  -2.411  1.00 0.00 ? 150 ILE A HG22 1  
ATOM 2380  H HG23 . ILE A 1 150 ? 23.394  -1.614  -1.645  1.00 0.00 ? 150 ILE A HG23 1  
ATOM 2381  H HD11 . ILE A 1 150 ? 23.582  -1.390  -5.733  1.00 0.00 ? 150 ILE A HD11 1  
ATOM 2382  H HD12 . ILE A 1 150 ? 24.591  -2.823  -5.918  1.00 0.00 ? 150 ILE A HD12 1  
ATOM 2383  H HD13 . ILE A 1 150 ? 25.226  -1.399  -5.092  1.00 0.00 ? 150 ILE A HD13 1  
ATOM 2384  N N    . VAL A 1 151 ? 19.183  -2.314  -2.716  1.00 0.00 ? 151 VAL A N    1  
ATOM 2385  C CA   . VAL A 1 151 ? 17.862  -1.712  -2.855  1.00 0.00 ? 151 VAL A CA   1  
ATOM 2386  C C    . VAL A 1 151 ? 17.861  -0.300  -2.282  1.00 0.00 ? 151 VAL A C    1  
ATOM 2387  O O    . VAL A 1 151 ? 18.597  -0.006  -1.341  1.00 0.00 ? 151 VAL A O    1  
ATOM 2388  C CB   . VAL A 1 151 ? 16.782  -2.543  -2.135  1.00 0.00 ? 151 VAL A CB   1  
ATOM 2389  C CG1  . VAL A 1 151 ? 15.392  -2.105  -2.571  1.00 0.00 ? 151 VAL A CG1  1  
ATOM 2390  C CG2  . VAL A 1 151 ? 16.986  -4.031  -2.392  1.00 0.00 ? 151 VAL A CG2  1  
ATOM 2391  H H    . VAL A 1 151 ? 19.460  -2.656  -1.842  1.00 0.00 ? 151 VAL A H    1  
ATOM 2392  H HA   . VAL A 1 151 ? 17.616  -1.669  -3.910  1.00 0.00 ? 151 VAL A HA   1  
ATOM 2393  H HB   . VAL A 1 151 ? 16.872  -2.368  -1.073  1.00 0.00 ? 151 VAL A HB   1  
ATOM 2394  H HG11 . VAL A 1 151 ? 15.185  -1.120  -2.179  1.00 0.00 ? 151 VAL A HG11 1  
ATOM 2395  H HG12 . VAL A 1 151 ? 14.660  -2.804  -2.194  1.00 0.00 ? 151 VAL A HG12 1  
ATOM 2396  H HG13 . VAL A 1 151 ? 15.344  -2.081  -3.650  1.00 0.00 ? 151 VAL A HG13 1  
ATOM 2397  H HG21 . VAL A 1 151 ? 17.665  -4.164  -3.221  1.00 0.00 ? 151 VAL A HG21 1  
ATOM 2398  H HG22 . VAL A 1 151 ? 16.038  -4.491  -2.626  1.00 0.00 ? 151 VAL A HG22 1  
ATOM 2399  H HG23 . VAL A 1 151 ? 17.402  -4.494  -1.509  1.00 0.00 ? 151 VAL A HG23 1  
ATOM 2400  N N    . LYS A 1 152 ? 17.039  0.575   -2.850  1.00 0.00 ? 152 LYS A N    1  
ATOM 2401  C CA   . LYS A 1 152 ? 16.964  1.951   -2.381  1.00 0.00 ? 152 LYS A CA   1  
ATOM 2402  C C    . LYS A 1 152 ? 15.642  2.593   -2.779  1.00 0.00 ? 152 LYS A C    1  
ATOM 2403  O O    . LYS A 1 152 ? 14.916  2.072   -3.626  1.00 0.00 ? 152 LYS A O    1  
ATOM 2404  C CB   . LYS A 1 152 ? 18.130  2.767   -2.943  1.00 0.00 ? 152 LYS A CB   1  
ATOM 2405  C CG   . LYS A 1 152 ? 18.707  3.769   -1.954  1.00 0.00 ? 152 LYS A CG   1  
ATOM 2406  C CD   . LYS A 1 152 ? 19.344  3.073   -0.761  1.00 0.00 ? 152 LYS A CD   1  
ATOM 2407  C CE   . LYS A 1 152 ? 19.143  3.866   0.521   1.00 0.00 ? 152 LYS A CE   1  
ATOM 2408  N NZ   . LYS A 1 152 ? 20.413  4.481   0.998   1.00 0.00 ? 152 LYS A NZ   1  
ATOM 2409  H H    . LYS A 1 152 ? 16.474  0.292   -3.600  1.00 0.00 ? 152 LYS A H    1  
ATOM 2410  H HA   . LYS A 1 152 ? 17.032  1.938   -1.304  1.00 0.00 ? 152 LYS A HA   1  
ATOM 2411  H HB2  . LYS A 1 152 ? 18.919  2.091   -3.237  1.00 0.00 ? 152 LYS A HB2  1  
ATOM 2412  H HB3  . LYS A 1 152 ? 17.790  3.309   -3.813  1.00 0.00 ? 152 LYS A HB3  1  
ATOM 2413  H HG2  . LYS A 1 152 ? 19.459  4.361   -2.455  1.00 0.00 ? 152 LYS A HG2  1  
ATOM 2414  H HG3  . LYS A 1 152 ? 17.914  4.412   -1.604  1.00 0.00 ? 152 LYS A HG3  1  
ATOM 2415  H HD2  . LYS A 1 152 ? 18.894  2.099   -0.643  1.00 0.00 ? 152 LYS A HD2  1  
ATOM 2416  H HD3  . LYS A 1 152 ? 20.403  2.963   -0.944  1.00 0.00 ? 152 LYS A HD3  1  
ATOM 2417  H HE2  . LYS A 1 152 ? 18.422  4.649   0.337   1.00 0.00 ? 152 LYS A HE2  1  
ATOM 2418  H HE3  . LYS A 1 152 ? 18.766  3.202   1.284   1.00 0.00 ? 152 LYS A HE3  1  
ATOM 2419  H HZ1  . LYS A 1 152 ? 20.226  5.424   1.397   1.00 0.00 ? 152 LYS A HZ1  1  
ATOM 2420  H HZ2  . LYS A 1 152 ? 21.083  4.578   0.209   1.00 0.00 ? 152 LYS A HZ2  1  
ATOM 2421  H HZ3  . LYS A 1 152 ? 20.845  3.885   1.733   1.00 0.00 ? 152 LYS A HZ3  1  
ATOM 2422  N N    . LYS A 1 153 ? 15.343  3.729   -2.165  1.00 0.00 ? 153 LYS A N    1  
ATOM 2423  C CA   . LYS A 1 153 ? 14.116  4.458   -2.449  1.00 0.00 ? 153 LYS A CA   1  
ATOM 2424  C C    . LYS A 1 153 ? 14.410  5.947   -2.610  1.00 0.00 ? 153 LYS A C    1  
ATOM 2425  O O    . LYS A 1 153 ? 14.990  6.576   -1.725  1.00 0.00 ? 153 LYS A O    1  
ATOM 2426  C CB   . LYS A 1 153 ? 13.099  4.245   -1.325  1.00 0.00 ? 153 LYS A CB   1  
ATOM 2427  C CG   . LYS A 1 153 ? 13.669  4.481   0.064   1.00 0.00 ? 153 LYS A CG   1  
ATOM 2428  C CD   . LYS A 1 153 ? 12.885  3.722   1.123   1.00 0.00 ? 153 LYS A CD   1  
ATOM 2429  C CE   . LYS A 1 153 ? 13.032  2.218   0.958   1.00 0.00 ? 153 LYS A CE   1  
ATOM 2430  N NZ   . LYS A 1 153 ? 11.714  1.525   0.984   1.00 0.00 ? 153 LYS A NZ   1  
ATOM 2431  H H    . LYS A 1 153 ? 15.971  4.092   -1.505  1.00 0.00 ? 153 LYS A H    1  
ATOM 2432  H HA   . LYS A 1 153 ? 13.703  4.076   -3.376  1.00 0.00 ? 153 LYS A HA   1  
ATOM 2433  H HB2  . LYS A 1 153 ? 12.271  4.923   -1.471  1.00 0.00 ? 153 LYS A HB2  1  
ATOM 2434  H HB3  . LYS A 1 153 ? 12.735  3.230   -1.374  1.00 0.00 ? 153 LYS A HB3  1  
ATOM 2435  H HG2  . LYS A 1 153 ? 14.695  4.147   0.083   1.00 0.00 ? 153 LYS A HG2  1  
ATOM 2436  H HG3  . LYS A 1 153 ? 13.627  5.537   0.285   1.00 0.00 ? 153 LYS A HG3  1  
ATOM 2437  H HD2  . LYS A 1 153 ? 13.251  4.004   2.099   1.00 0.00 ? 153 LYS A HD2  1  
ATOM 2438  H HD3  . LYS A 1 153 ? 11.840  3.984   1.039   1.00 0.00 ? 153 LYS A HD3  1  
ATOM 2439  H HE2  . LYS A 1 153 ? 13.516  2.016   0.014   1.00 0.00 ? 153 LYS A HE2  1  
ATOM 2440  H HE3  . LYS A 1 153 ? 13.644  1.839   1.763   1.00 0.00 ? 153 LYS A HE3  1  
ATOM 2441  H HZ1  . LYS A 1 153 ? 11.373  1.369   0.013   1.00 0.00 ? 153 LYS A HZ1  1  
ATOM 2442  H HZ2  . LYS A 1 153 ? 11.017  2.101   1.496   1.00 0.00 ? 153 LYS A HZ2  1  
ATOM 2443  H HZ3  . LYS A 1 153 ? 11.804  0.604   1.460   1.00 0.00 ? 153 LYS A HZ3  1  
ATOM 2444  N N    . HIS A 1 154 ? 13.998  6.502   -3.739  1.00 0.00 ? 154 HIS A N    1  
ATOM 2445  C CA   . HIS A 1 154 ? 14.202  7.917   -4.022  1.00 0.00 ? 154 HIS A CA   1  
ATOM 2446  C C    . HIS A 1 154 ? 12.876  8.652   -3.941  1.00 0.00 ? 154 HIS A C    1  
ATOM 2447  O O    . HIS A 1 154 ? 11.828  8.024   -3.877  1.00 0.00 ? 154 HIS A O    1  
ATOM 2448  C CB   . HIS A 1 154 ? 14.824  8.099   -5.411  1.00 0.00 ? 154 HIS A CB   1  
ATOM 2449  C CG   . HIS A 1 154 ? 16.196  7.511   -5.527  1.00 0.00 ? 154 HIS A CG   1  
ATOM 2450  N ND1  . HIS A 1 154 ? 17.276  7.975   -4.807  1.00 0.00 ? 154 HIS A ND1  1  
ATOM 2451  C CD2  . HIS A 1 154 ? 16.662  6.484   -6.279  1.00 0.00 ? 154 HIS A CD2  1  
ATOM 2452  C CE1  . HIS A 1 154 ? 18.345  7.262   -5.110  1.00 0.00 ? 154 HIS A CE1  1  
ATOM 2453  N NE2  . HIS A 1 154 ? 18.001  6.350   -6.000  1.00 0.00 ? 154 HIS A NE2  1  
ATOM 2454  H H    . HIS A 1 154 ? 13.531  5.946   -4.395  1.00 0.00 ? 154 HIS A H    1  
ATOM 2455  H HA   . HIS A 1 154 ? 14.873  8.315   -3.276  1.00 0.00 ? 154 HIS A HA   1  
ATOM 2456  H HB2  . HIS A 1 154 ? 14.194  7.625   -6.145  1.00 0.00 ? 154 HIS A HB2  1  
ATOM 2457  H HB3  . HIS A 1 154 ? 14.892  9.152   -5.636  1.00 0.00 ? 154 HIS A HB3  1  
ATOM 2458  H HD1  . HIS A 1 154 ? 17.260  8.719   -4.168  1.00 0.00 ? 154 HIS A HD1  1  
ATOM 2459  H HD2  . HIS A 1 154 ? 16.088  5.880   -6.969  1.00 0.00 ? 154 HIS A HD2  1  
ATOM 2460  H HE1  . HIS A 1 154 ? 19.334  7.401   -4.698  1.00 0.00 ? 154 HIS A HE1  1  
ATOM 2461  H HE2  . HIS A 1 154 ? 18.569  5.607   -6.291  1.00 0.00 ? 154 HIS A HE2  1  
ATOM 2462  N N    . LYS A 1 155 ? 12.916  9.975   -3.945  1.00 0.00 ? 155 LYS A N    1  
ATOM 2463  C CA   . LYS A 1 155 ? 11.691  10.761  -3.875  1.00 0.00 ? 155 LYS A CA   1  
ATOM 2464  C C    . LYS A 1 155 ? 11.928  12.179  -4.380  1.00 0.00 ? 155 LYS A C    1  
ATOM 2465  O O    . LYS A 1 155 ? 11.968  13.133  -3.604  1.00 0.00 ? 155 LYS A O    1  
ATOM 2466  C CB   . LYS A 1 155 ? 11.144  10.779  -2.448  1.00 0.00 ? 155 LYS A CB   1  
ATOM 2467  C CG   . LYS A 1 155 ? 12.208  11.013  -1.389  1.00 0.00 ? 155 LYS A CG   1  
ATOM 2468  C CD   . LYS A 1 155 ? 11.958  12.299  -0.616  1.00 0.00 ? 155 LYS A CD   1  
ATOM 2469  C CE   . LYS A 1 155 ? 13.214  12.775  0.094   1.00 0.00 ? 155 LYS A CE   1  
ATOM 2470  N NZ   . LYS A 1 155 ? 13.393  12.109  1.414   1.00 0.00 ? 155 LYS A NZ   1  
ATOM 2471  H H    . LYS A 1 155 ? 13.781  10.432  -3.999  1.00 0.00 ? 155 LYS A H    1  
ATOM 2472  H HA   . LYS A 1 155 ? 10.968  10.286  -4.517  1.00 0.00 ? 155 LYS A HA   1  
ATOM 2473  H HB2  . LYS A 1 155 ? 10.404  11.559  -2.371  1.00 0.00 ? 155 LYS A HB2  1  
ATOM 2474  H HB3  . LYS A 1 155 ? 10.671  9.829   -2.246  1.00 0.00 ? 155 LYS A HB3  1  
ATOM 2475  H HG2  . LYS A 1 155 ? 12.200  10.182  -0.699  1.00 0.00 ? 155 LYS A HG2  1  
ATOM 2476  H HG3  . LYS A 1 155 ? 13.173  11.074  -1.870  1.00 0.00 ? 155 LYS A HG3  1  
ATOM 2477  H HD2  . LYS A 1 155 ? 11.634  13.064  -1.305  1.00 0.00 ? 155 LYS A HD2  1  
ATOM 2478  H HD3  . LYS A 1 155 ? 11.185  12.121  0.118   1.00 0.00 ? 155 LYS A HD3  1  
ATOM 2479  H HE2  . LYS A 1 155 ? 14.069  12.556  -0.528  1.00 0.00 ? 155 LYS A HE2  1  
ATOM 2480  H HE3  . LYS A 1 155 ? 13.144  13.843  0.246   1.00 0.00 ? 155 LYS A HE3  1  
ATOM 2481  H HZ1  . LYS A 1 155 ? 14.372  12.229  1.745   1.00 0.00 ? 155 LYS A HZ1  1  
ATOM 2482  H HZ2  . LYS A 1 155 ? 13.188  11.093  1.332   1.00 0.00 ? 155 LYS A HZ2  1  
ATOM 2483  H HZ3  . LYS A 1 155 ? 12.748  12.526  2.115   1.00 0.00 ? 155 LYS A HZ3  1  
ATOM 2484  N N    . PRO A 1 156 ? 12.106  12.320  -5.702  1.00 0.00 ? 156 PRO A N    1  
ATOM 2485  C CA   . PRO A 1 156 ? 12.363  13.609  -6.350  1.00 0.00 ? 156 PRO A CA   1  
ATOM 2486  C C    . PRO A 1 156 ? 11.196  14.578  -6.223  1.00 0.00 ? 156 PRO A C    1  
ATOM 2487  O O    . PRO A 1 156 ? 10.041  14.164  -6.122  1.00 0.00 ? 156 PRO A O    1  
ATOM 2488  C CB   . PRO A 1 156 ? 12.585  13.232  -7.820  1.00 0.00 ? 156 PRO A CB   1  
ATOM 2489  C CG   . PRO A 1 156 ? 12.924  11.786  -7.781  1.00 0.00 ? 156 PRO A CG   1  
ATOM 2490  C CD   . PRO A 1 156 ? 12.094  11.226  -6.677  1.00 0.00 ? 156 PRO A CD   1  
ATOM 2491  H HA   . PRO A 1 156 ? 13.255  14.064  -5.964  1.00 0.00 ? 156 PRO A HA   1  
ATOM 2492  H HB2  . PRO A 1 156 ? 11.681  13.414  -8.383  1.00 0.00 ? 156 PRO A HB2  1  
ATOM 2493  H HB3  . PRO A 1 156 ? 13.396  13.818  -8.227  1.00 0.00 ? 156 PRO A HB3  1  
ATOM 2494  H HG2  . PRO A 1 156 ? 12.675  11.318  -8.721  1.00 0.00 ? 156 PRO A HG2  1  
ATOM 2495  H HG3  . PRO A 1 156 ? 13.971  11.662  -7.557  1.00 0.00 ? 156 PRO A HG3  1  
ATOM 2496  H HD2  . PRO A 1 156 ? 11.097  11.019  -7.026  1.00 0.00 ? 156 PRO A HD2  1  
ATOM 2497  H HD3  . PRO A 1 156 ? 12.547  10.340  -6.267  1.00 0.00 ? 156 PRO A HD3  1  
ATOM 2498  N N    . GLU A 1 157 ? 11.502  15.872  -6.241  1.00 0.00 ? 157 GLU A N    1  
ATOM 2499  C CA   . GLU A 1 157 ? 10.473  16.897  -6.141  1.00 0.00 ? 157 GLU A CA   1  
ATOM 2500  C C    . GLU A 1 157 ? 9.490   16.766  -7.297  1.00 0.00 ? 157 GLU A C    1  
ATOM 2501  O O    . GLU A 1 157 ? 9.844   16.993  -8.453  1.00 0.00 ? 157 GLU A O    1  
ATOM 2502  C CB   . GLU A 1 157 ? 11.104  18.291  -6.146  1.00 0.00 ? 157 GLU A CB   1  
ATOM 2503  C CG   . GLU A 1 157 ? 11.931  18.589  -4.906  1.00 0.00 ? 157 GLU A CG   1  
ATOM 2504  C CD   . GLU A 1 157 ? 13.419  18.420  -5.144  1.00 0.00 ? 157 GLU A CD   1  
ATOM 2505  O OE1  . GLU A 1 157 ? 14.016  19.291  -5.811  1.00 0.00 ? 157 GLU A OE1  1  
ATOM 2506  O OE2  . GLU A 1 157 ? 13.988  17.418  -4.663  1.00 0.00 ? 157 GLU A OE2  1  
ATOM 2507  H H    . GLU A 1 157 ? 12.440  16.141  -6.333  1.00 0.00 ? 157 GLU A H    1  
ATOM 2508  H HA   . GLU A 1 157 ? 9.944   16.751  -5.211  1.00 0.00 ? 157 GLU A HA   1  
ATOM 2509  H HB2  . GLU A 1 157 ? 11.746  18.380  -7.010  1.00 0.00 ? 157 GLU A HB2  1  
ATOM 2510  H HB3  . GLU A 1 157 ? 10.319  19.029  -6.214  1.00 0.00 ? 157 GLU A HB3  1  
ATOM 2511  H HG2  . GLU A 1 157 ? 11.745  19.607  -4.600  1.00 0.00 ? 157 GLU A HG2  1  
ATOM 2512  H HG3  . GLU A 1 157 ? 11.629  17.916  -4.117  1.00 0.00 ? 157 GLU A HG3  1  
ATOM 2513  N N    . ILE A 1 158 ? 8.257   16.386  -6.981  1.00 0.00 ? 158 ILE A N    1  
ATOM 2514  C CA   . ILE A 1 158 ? 7.234   16.212  -8.004  1.00 0.00 ? 158 ILE A CA   1  
ATOM 2515  C C    . ILE A 1 158 ? 6.495   17.517  -8.293  1.00 0.00 ? 158 ILE A C    1  
ATOM 2516  O O    . ILE A 1 158 ? 5.480   17.518  -8.989  1.00 0.00 ? 158 ILE A O    1  
ATOM 2517  C CB   . ILE A 1 158 ? 6.208   15.128  -7.612  1.00 0.00 ? 158 ILE A CB   1  
ATOM 2518  C CG1  . ILE A 1 158 ? 6.886   13.990  -6.846  1.00 0.00 ? 158 ILE A CG1  1  
ATOM 2519  C CG2  . ILE A 1 158 ? 5.510   14.583  -8.850  1.00 0.00 ? 158 ILE A CG2  1  
ATOM 2520  C CD1  . ILE A 1 158 ? 7.828   13.164  -7.694  1.00 0.00 ? 158 ILE A CD1  1  
ATOM 2521  H H    . ILE A 1 158 ? 8.034   16.211  -6.043  1.00 0.00 ? 158 ILE A H    1  
ATOM 2522  H HA   . ILE A 1 158 ? 7.729   15.890  -8.909  1.00 0.00 ? 158 ILE A HA   1  
ATOM 2523  H HB   . ILE A 1 158 ? 5.461   15.583  -6.979  1.00 0.00 ? 158 ILE A HB   1  
ATOM 2524  H HG12 . ILE A 1 158 ? 7.451   14.398  -6.023  1.00 0.00 ? 158 ILE A HG12 1  
ATOM 2525  H HG13 . ILE A 1 158 ? 6.126   13.330  -6.464  1.00 0.00 ? 158 ILE A HG13 1  
ATOM 2526  H HG21 . ILE A 1 158 ? 4.443   14.700  -8.741  1.00 0.00 ? 158 ILE A HG21 1  
ATOM 2527  H HG22 . ILE A 1 158 ? 5.747   13.532  -8.966  1.00 0.00 ? 158 ILE A HG22 1  
ATOM 2528  H HG23 . ILE A 1 158 ? 5.844   15.124  -9.723  1.00 0.00 ? 158 ILE A HG23 1  
ATOM 2529  H HD11 . ILE A 1 158 ? 8.397   12.490  -7.059  1.00 0.00 ? 158 ILE A HD11 1  
ATOM 2530  H HD12 . ILE A 1 158 ? 8.499   13.820  -8.225  1.00 0.00 ? 158 ILE A HD12 1  
ATOM 2531  H HD13 . ILE A 1 158 ? 7.254   12.586  -8.403  1.00 0.00 ? 158 ILE A HD13 1  
ATOM 2532  N N    . LYS A 1 159 ? 7.014   18.630  -7.774  1.00 0.00 ? 159 LYS A N    1  
ATOM 2533  C CA   . LYS A 1 159 ? 6.401   19.932  -8.007  1.00 0.00 ? 159 LYS A CA   1  
ATOM 2534  C C    . LYS A 1 159 ? 6.532   20.300  -9.478  1.00 0.00 ? 159 LYS A C    1  
ATOM 2535  O O    . LYS A 1 159 ? 7.384   21.104  -9.857  1.00 0.00 ? 159 LYS A O    1  
ATOM 2536  C CB   . LYS A 1 159 ? 7.062   21.001  -7.135  1.00 0.00 ? 159 LYS A CB   1  
ATOM 2537  C CG   . LYS A 1 159 ? 6.448   21.120  -5.749  1.00 0.00 ? 159 LYS A CG   1  
ATOM 2538  C CD   . LYS A 1 159 ? 7.465   20.823  -4.659  1.00 0.00 ? 159 LYS A CD   1  
ATOM 2539  C CE   . LYS A 1 159 ? 6.791   20.592  -3.317  1.00 0.00 ? 159 LYS A CE   1  
ATOM 2540  N NZ   . LYS A 1 159 ? 6.381   21.871  -2.673  1.00 0.00 ? 159 LYS A NZ   1  
ATOM 2541  H H    . LYS A 1 159 ? 7.831   18.576  -7.238  1.00 0.00 ? 159 LYS A H    1  
ATOM 2542  H HA   . LYS A 1 159 ? 5.353   19.860  -7.753  1.00 0.00 ? 159 LYS A HA   1  
ATOM 2543  H HB2  . LYS A 1 159 ? 8.109   20.761  -7.024  1.00 0.00 ? 159 LYS A HB2  1  
ATOM 2544  H HB3  . LYS A 1 159 ? 6.971   21.957  -7.629  1.00 0.00 ? 159 LYS A HB3  1  
ATOM 2545  H HG2  . LYS A 1 159 ? 6.076   22.125  -5.616  1.00 0.00 ? 159 LYS A HG2  1  
ATOM 2546  H HG3  . LYS A 1 159 ? 5.630   20.418  -5.667  1.00 0.00 ? 159 LYS A HG3  1  
ATOM 2547  H HD2  . LYS A 1 159 ? 8.020   19.938  -4.929  1.00 0.00 ? 159 LYS A HD2  1  
ATOM 2548  H HD3  . LYS A 1 159 ? 8.141   21.662  -4.573  1.00 0.00 ? 159 LYS A HD3  1  
ATOM 2549  H HE2  . LYS A 1 159 ? 5.915   19.979  -3.469  1.00 0.00 ? 159 LYS A HE2  1  
ATOM 2550  H HE3  . LYS A 1 159 ? 7.481   20.076  -2.666  1.00 0.00 ? 159 LYS A HE3  1  
ATOM 2551  H HZ1  . LYS A 1 159 ? 5.478   21.746  -2.173  1.00 0.00 ? 159 LYS A HZ1  1  
ATOM 2552  H HZ2  . LYS A 1 159 ? 6.267   22.613  -3.392  1.00 0.00 ? 159 LYS A HZ2  1  
ATOM 2553  H HZ3  . LYS A 1 159 ? 7.104   22.174  -1.990  1.00 0.00 ? 159 LYS A HZ3  1  
ATOM 2554  N N    . GLY A 1 160 ? 5.700   19.681  -10.305 1.00 0.00 ? 160 GLY A N    1  
ATOM 2555  C CA   . GLY A 1 160 ? 5.751   19.922  -11.733 1.00 0.00 ? 160 GLY A CA   1  
ATOM 2556  C C    . GLY A 1 160 ? 6.518   18.828  -12.454 1.00 0.00 ? 160 GLY A C    1  
ATOM 2557  O O    . GLY A 1 160 ? 6.882   18.977  -13.621 1.00 0.00 ? 160 GLY A O    1  
ATOM 2558  H H    . GLY A 1 160 ? 5.059   19.034  -9.944  1.00 0.00 ? 160 GLY A H    1  
ATOM 2559  H HA2  . GLY A 1 160 ? 4.743   19.962  -12.120 1.00 0.00 ? 160 GLY A HA2  1  
ATOM 2560  H HA3  . GLY A 1 160 ? 6.237   20.869  -11.913 1.00 0.00 ? 160 GLY A HA3  1  
ATOM 2561  N N    . ASN A 1 161 ? 6.763   17.723  -11.748 1.00 0.00 ? 161 ASN A N    1  
ATOM 2562  C CA   . ASN A 1 161 ? 7.489   16.591  -12.308 1.00 0.00 ? 161 ASN A CA   1  
ATOM 2563  C C    . ASN A 1 161 ? 6.528   15.487  -12.744 1.00 0.00 ? 161 ASN A C    1  
ATOM 2564  O O    . ASN A 1 161 ? 6.852   14.673  -13.609 1.00 0.00 ? 161 ASN A O    1  
ATOM 2565  C CB   . ASN A 1 161 ? 8.486   16.052  -11.285 1.00 0.00 ? 161 ASN A CB   1  
ATOM 2566  C CG   . ASN A 1 161 ? 9.765   15.560  -11.934 1.00 0.00 ? 161 ASN A CG   1  
ATOM 2567  O OD1  . ASN A 1 161 ? 9.732   14.757  -12.866 1.00 0.00 ? 161 ASN A OD1  1  
ATOM 2568  N ND2  . ASN A 1 161 ? 10.901  16.039  -11.442 1.00 0.00 ? 161 ASN A ND2  1  
ATOM 2569  H H    . ASN A 1 161 ? 6.444   17.668  -10.824 1.00 0.00 ? 161 ASN A H    1  
ATOM 2570  H HA   . ASN A 1 161 ? 8.031   16.937  -13.170 1.00 0.00 ? 161 ASN A HA   1  
ATOM 2571  H HB2  . ASN A 1 161 ? 8.738   16.838  -10.589 1.00 0.00 ? 161 ASN A HB2  1  
ATOM 2572  H HB3  . ASN A 1 161 ? 8.035   15.234  -10.748 1.00 0.00 ? 161 ASN A HB3  1  
ATOM 2573  H HD21 . ASN A 1 161 ? 10.852  16.675  -10.698 1.00 0.00 ? 161 ASN A HD21 1  
ATOM 2574  H HD22 . ASN A 1 161 ? 11.743  15.739  -11.843 1.00 0.00 ? 161 ASN A HD22 1  
ATOM 2575  N N    . MET A 1 162 ? 5.340   15.475  -12.146 1.00 0.00 ? 162 MET A N    1  
ATOM 2576  C CA   . MET A 1 162 ? 4.319   14.486  -12.474 1.00 0.00 ? 162 MET A CA   1  
ATOM 2577  C C    . MET A 1 162 ? 3.448   14.993  -13.628 1.00 0.00 ? 162 MET A C    1  
ATOM 2578  O O    . MET A 1 162 ? 2.219   14.973  -13.547 1.00 0.00 ? 162 MET A O    1  
ATOM 2579  C CB   . MET A 1 162 ? 3.445   14.216  -11.241 1.00 0.00 ? 162 MET A CB   1  
ATOM 2580  C CG   . MET A 1 162 ? 3.705   12.874  -10.577 1.00 0.00 ? 162 MET A CG   1  
ATOM 2581  S SD   . MET A 1 162 ? 2.784   12.674  -9.038  1.00 0.00 ? 162 MET A SD   1  
ATOM 2582  C CE   . MET A 1 162 ? 4.065   12.083  -7.935  1.00 0.00 ? 162 MET A CE   1  
ATOM 2583  H H    . MET A 1 162 ? 5.139   16.156  -11.471 1.00 0.00 ? 162 MET A H    1  
ATOM 2584  H HA   . MET A 1 162 ? 4.815   13.573  -12.769 1.00 0.00 ? 162 MET A HA   1  
ATOM 2585  H HB2  . MET A 1 162 ? 3.628   14.992  -10.513 1.00 0.00 ? 162 MET A HB2  1  
ATOM 2586  H HB3  . MET A 1 162 ? 2.406   14.251  -11.533 1.00 0.00 ? 162 MET A HB3  1  
ATOM 2587  H HG2  . MET A 1 162 ? 3.410   12.094  -11.254 1.00 0.00 ? 162 MET A HG2  1  
ATOM 2588  H HG3  . MET A 1 162 ? 4.759   12.786  -10.367 1.00 0.00 ? 162 MET A HG3  1  
ATOM 2589  H HE1  . MET A 1 162 ? 3.688   11.250  -7.360  1.00 0.00 ? 162 MET A HE1  1  
ATOM 2590  H HE2  . MET A 1 162 ? 4.359   12.878  -7.266  1.00 0.00 ? 162 MET A HE2  1  
ATOM 2591  H HE3  . MET A 1 162 ? 4.920   11.766  -8.514  1.00 0.00 ? 162 MET A HE3  1  
ATOM 2592  N N    . SER A 1 163 ? 4.089   15.486  -14.687 1.00 0.00 ? 163 SER A N    1  
ATOM 2593  C CA   . SER A 1 163 ? 3.361   16.038  -15.828 1.00 0.00 ? 163 SER A CA   1  
ATOM 2594  C C    . SER A 1 163 ? 3.839   15.486  -17.173 1.00 0.00 ? 163 SER A C    1  
ATOM 2595  O O    . SER A 1 163 ? 3.796   16.196  -18.179 1.00 0.00 ? 163 SER A O    1  
ATOM 2596  C CB   . SER A 1 163 ? 3.482   17.563  -15.832 1.00 0.00 ? 163 SER A CB   1  
ATOM 2597  O OG   . SER A 1 163 ? 4.752   17.973  -16.309 1.00 0.00 ? 163 SER A OG   1  
ATOM 2598  H H    . SER A 1 163 ? 5.068   15.504  -14.688 1.00 0.00 ? 163 SER A H    1  
ATOM 2599  H HA   . SER A 1 163 ? 2.324   15.779  -15.703 1.00 0.00 ? 163 SER A HA   1  
ATOM 2600  H HB2  . SER A 1 163 ? 2.719   17.981  -16.471 1.00 0.00 ? 163 SER A HB2  1  
ATOM 2601  H HB3  . SER A 1 163 ? 3.353   17.934  -14.826 1.00 0.00 ? 163 SER A HB3  1  
ATOM 2602  H HG   . SER A 1 163 ? 5.440   17.487  -15.850 1.00 0.00 ? 163 SER A HG   1  
ATOM 2603  N N    . GLY A 1 164 ? 4.296   14.238  -17.208 1.00 0.00 ? 164 GLY A N    1  
ATOM 2604  C CA   . GLY A 1 164 ? 4.764   13.678  -18.463 1.00 0.00 ? 164 GLY A CA   1  
ATOM 2605  C C    . GLY A 1 164 ? 5.879   12.665  -18.276 1.00 0.00 ? 164 GLY A C    1  
ATOM 2606  O O    . GLY A 1 164 ? 5.730   11.708  -17.522 1.00 0.00 ? 164 GLY A O    1  
ATOM 2607  H H    . GLY A 1 164 ? 4.312   13.696  -16.391 1.00 0.00 ? 164 GLY A H    1  
ATOM 2608  H HA2  . GLY A 1 164 ? 3.934   13.195  -18.958 1.00 0.00 ? 164 GLY A HA2  1  
ATOM 2609  H HA3  . GLY A 1 164 ? 5.117   14.483  -19.088 1.00 0.00 ? 164 GLY A HA3  1  
ATOM 2610  N N    . ASN A 1 165 ? 6.999   12.867  -18.965 1.00 0.00 ? 165 ASN A N    1  
ATOM 2611  C CA   . ASN A 1 165 ? 8.129   11.942  -18.858 1.00 0.00 ? 165 ASN A CA   1  
ATOM 2612  C C    . ASN A 1 165 ? 9.087   12.349  -17.747 1.00 0.00 ? 165 ASN A C    1  
ATOM 2613  O O    . ASN A 1 165 ? 10.136  12.939  -18.005 1.00 0.00 ? 165 ASN A O    1  
ATOM 2614  C CB   . ASN A 1 165 ? 8.899   11.814  -20.185 1.00 0.00 ? 165 ASN A CB   1  
ATOM 2615  C CG   . ASN A 1 165 ? 8.488   12.840  -21.226 1.00 0.00 ? 165 ASN A CG   1  
ATOM 2616  O OD1  . ASN A 1 165 ? 8.348   14.025  -20.926 1.00 0.00 ? 165 ASN A OD1  1  
ATOM 2617  N ND2  . ASN A 1 165 ? 8.289   12.384  -22.458 1.00 0.00 ? 165 ASN A ND2  1  
ATOM 2618  H H    . ASN A 1 165 ? 7.066   13.647  -19.553 1.00 0.00 ? 165 ASN A H    1  
ATOM 2619  H HA   . ASN A 1 165 ? 7.729   10.971  -18.606 1.00 0.00 ? 165 ASN A HA   1  
ATOM 2620  H HB2  . ASN A 1 165 ? 9.956   11.934  -19.992 1.00 0.00 ? 165 ASN A HB2  1  
ATOM 2621  H HB3  . ASN A 1 165 ? 8.730   10.827  -20.592 1.00 0.00 ? 165 ASN A HB3  1  
ATOM 2622  H HD21 . ASN A 1 165 ? 8.418   11.427  -22.624 1.00 0.00 ? 165 ASN A HD21 1  
ATOM 2623  H HD22 . ASN A 1 165 ? 8.023   13.024  -23.151 1.00 0.00 ? 165 ASN A HD22 1  
ATOM 2624  N N    . PHE A 1 166 ? 8.733   11.993  -16.512 1.00 0.00 ? 166 PHE A N    1  
ATOM 2625  C CA   . PHE A 1 166 ? 9.576   12.277  -15.353 1.00 0.00 ? 166 PHE A CA   1  
ATOM 2626  C C    . PHE A 1 166 ? 11.021  11.970  -15.709 1.00 0.00 ? 166 PHE A C    1  
ATOM 2627  O O    . PHE A 1 166 ? 11.302  10.942  -16.313 1.00 0.00 ? 166 PHE A O    1  
ATOM 2628  C CB   . PHE A 1 166 ? 9.131   11.413  -14.173 1.00 0.00 ? 166 PHE A CB   1  
ATOM 2629  C CG   . PHE A 1 166 ? 9.356   12.020  -12.824 1.00 0.00 ? 166 PHE A CG   1  
ATOM 2630  C CD1  . PHE A 1 166 ? 10.636  12.220  -12.336 1.00 0.00 ? 166 PHE A CD1  1  
ATOM 2631  C CD2  . PHE A 1 166 ? 8.276   12.371  -12.035 1.00 0.00 ? 166 PHE A CD2  1  
ATOM 2632  C CE1  . PHE A 1 166 ? 10.833  12.762  -11.080 1.00 0.00 ? 166 PHE A CE1  1  
ATOM 2633  C CE2  . PHE A 1 166 ? 8.463   12.914  -10.784 1.00 0.00 ? 166 PHE A CE2  1  
ATOM 2634  C CZ   . PHE A 1 166 ? 9.745   13.110  -10.303 1.00 0.00 ? 166 PHE A CZ   1  
ATOM 2635  H H    . PHE A 1 166 ? 7.896   11.503  -16.382 1.00 0.00 ? 166 PHE A H    1  
ATOM 2636  H HA   . PHE A 1 166 ? 9.477   13.322  -15.100 1.00 0.00 ? 166 PHE A HA   1  
ATOM 2637  H HB2  . PHE A 1 166 ? 8.078   11.223  -14.264 1.00 0.00 ? 166 PHE A HB2  1  
ATOM 2638  H HB3  . PHE A 1 166 ? 9.663   10.476  -14.206 1.00 0.00 ? 166 PHE A HB3  1  
ATOM 2639  H HD1  . PHE A 1 166 ? 11.485  11.950  -12.945 1.00 0.00 ? 166 PHE A HD1  1  
ATOM 2640  H HD2  . PHE A 1 166 ? 7.275   12.218  -12.410 1.00 0.00 ? 166 PHE A HD2  1  
ATOM 2641  H HE1  . PHE A 1 166 ? 11.835  12.913  -10.708 1.00 0.00 ? 166 PHE A HE1  1  
ATOM 2642  H HE2  . PHE A 1 166 ? 7.608   13.185  -10.182 1.00 0.00 ? 166 PHE A HE2  1  
ATOM 2643  H HZ   . PHE A 1 166 ? 9.896   13.531  -9.323  1.00 0.00 ? 166 PHE A HZ   1  
ATOM 2644  N N    . THR A 1 167 ? 11.929  12.863  -15.369 1.00 0.00 ? 167 THR A N    1  
ATOM 2645  C CA   . THR A 1 167 ? 13.334  12.664  -15.707 1.00 0.00 ? 167 THR A CA   1  
ATOM 2646  C C    . THR A 1 167 ? 14.217  12.594  -14.456 1.00 0.00 ? 167 THR A C    1  
ATOM 2647  O O    . THR A 1 167 ? 14.545  13.623  -13.866 1.00 0.00 ? 167 THR A O    1  
ATOM 2648  C CB   . THR A 1 167 ? 13.817  13.812  -16.599 1.00 0.00 ? 167 THR A CB   1  
ATOM 2649  O OG1  . THR A 1 167 ? 12.790  14.768  -16.794 1.00 0.00 ? 167 THR A OG1  1  
ATOM 2650  C CG2  . THR A 1 167 ? 14.276  13.353  -17.960 1.00 0.00 ? 167 THR A CG2  1  
ATOM 2651  H H    . THR A 1 167 ? 11.653  13.677  -14.899 1.00 0.00 ? 167 THR A H    1  
ATOM 2652  H HA   . THR A 1 167 ? 13.409  11.727  -16.268 1.00 0.00 ? 167 THR A HA   1  
ATOM 2653  H HB   . THR A 1 167 ? 14.651  14.304  -16.118 1.00 0.00 ? 167 THR A HB   1  
ATOM 2654  H HG1  . THR A 1 167 ? 13.117  15.482  -17.347 1.00 0.00 ? 167 THR A HG1  1  
ATOM 2655  H HG21 . THR A 1 167 ? 14.856  12.449  -17.854 1.00 0.00 ? 167 THR A HG21 1  
ATOM 2656  H HG22 . THR A 1 167 ? 14.883  14.121  -18.415 1.00 0.00 ? 167 THR A HG22 1  
ATOM 2657  H HG23 . THR A 1 167 ? 13.414  13.157  -18.581 1.00 0.00 ? 167 THR A HG23 1  
ATOM 2658  N N    . TYR A 1 168 ? 14.609  11.386  -14.062 1.00 0.00 ? 168 TYR A N    1  
ATOM 2659  C CA   . TYR A 1 168 ? 15.466  11.206  -12.889 1.00 0.00 ? 168 TYR A CA   1  
ATOM 2660  C C    . TYR A 1 168 ? 16.732  10.435  -13.260 1.00 0.00 ? 168 TYR A C    1  
ATOM 2661  O O    . TYR A 1 168 ? 16.711  9.601   -14.158 1.00 0.00 ? 168 TYR A O    1  
ATOM 2662  C CB   . TYR A 1 168 ? 14.712  10.467  -11.775 1.00 0.00 ? 168 TYR A CB   1  
ATOM 2663  C CG   . TYR A 1 168 ? 15.553  10.209  -10.542 1.00 0.00 ? 168 TYR A CG   1  
ATOM 2664  C CD1  . TYR A 1 168 ? 16.562  9.251   -10.542 1.00 0.00 ? 168 TYR A CD1  1  
ATOM 2665  C CD2  . TYR A 1 168 ? 15.342  10.932  -9.379  1.00 0.00 ? 168 TYR A CD2  1  
ATOM 2666  C CE1  . TYR A 1 168 ? 17.333  9.028   -9.415  1.00 0.00 ? 168 TYR A CE1  1  
ATOM 2667  C CE2  . TYR A 1 168 ? 16.106  10.713  -8.249  1.00 0.00 ? 168 TYR A CE2  1  
ATOM 2668  C CZ   . TYR A 1 168 ? 17.100  9.760   -8.273  1.00 0.00 ? 168 TYR A CZ   1  
ATOM 2669  O OH   . TYR A 1 168 ? 17.866  9.541   -7.150  1.00 0.00 ? 168 TYR A OH   1  
ATOM 2670  H H    . TYR A 1 168 ? 14.325  10.601  -14.569 1.00 0.00 ? 168 TYR A H    1  
ATOM 2671  H HA   . TYR A 1 168 ? 15.748  12.185  -12.532 1.00 0.00 ? 168 TYR A HA   1  
ATOM 2672  H HB2  . TYR A 1 168 ? 13.861  11.060  -11.475 1.00 0.00 ? 168 TYR A HB2  1  
ATOM 2673  H HB3  . TYR A 1 168 ? 14.365  9.514   -12.147 1.00 0.00 ? 168 TYR A HB3  1  
ATOM 2674  H HD1  . TYR A 1 168 ? 16.740  8.675   -11.439 1.00 0.00 ? 168 TYR A HD1  1  
ATOM 2675  H HD2  . TYR A 1 168 ? 14.561  11.675  -9.362  1.00 0.00 ? 168 TYR A HD2  1  
ATOM 2676  H HE1  . TYR A 1 168 ? 18.113  8.283   -9.433  1.00 0.00 ? 168 TYR A HE1  1  
ATOM 2677  H HE2  . TYR A 1 168 ? 15.921  11.287  -7.354  1.00 0.00 ? 168 TYR A HE2  1  
ATOM 2678  H HH   . TYR A 1 168 ? 17.341  9.713   -6.365  1.00 0.00 ? 168 TYR A HH   1  
ATOM 2679  N N    . ILE A 1 169 ? 17.834  10.726  -12.571 1.00 0.00 ? 169 ILE A N    1  
ATOM 2680  C CA   . ILE A 1 169 ? 19.102  10.050  -12.844 1.00 0.00 ? 169 ILE A CA   1  
ATOM 2681  C C    . ILE A 1 169 ? 19.732  9.494   -11.575 1.00 0.00 ? 169 ILE A C    1  
ATOM 2682  O O    . ILE A 1 169 ? 20.152  10.247  -10.697 1.00 0.00 ? 169 ILE A O    1  
ATOM 2683  C CB   . ILE A 1 169 ? 20.127  10.989  -13.513 1.00 0.00 ? 169 ILE A CB   1  
ATOM 2684  C CG1  . ILE A 1 169 ? 19.491  11.711  -14.703 1.00 0.00 ? 169 ILE A CG1  1  
ATOM 2685  C CG2  . ILE A 1 169 ? 21.368  10.207  -13.952 1.00 0.00 ? 169 ILE A CG2  1  
ATOM 2686  C CD1  . ILE A 1 169 ? 19.087  10.784  -15.827 1.00 0.00 ? 169 ILE A CD1  1  
ATOM 2687  H H    . ILE A 1 169 ? 17.793  11.413  -11.873 1.00 0.00 ? 169 ILE A H    1  
ATOM 2688  H HA   . ILE A 1 169 ? 18.902  9.233   -13.521 1.00 0.00 ? 169 ILE A HA   1  
ATOM 2689  H HB   . ILE A 1 169 ? 20.437  11.721  -12.783 1.00 0.00 ? 169 ILE A HB   1  
ATOM 2690  H HG12 . ILE A 1 169 ? 18.605  12.229  -14.369 1.00 0.00 ? 169 ILE A HG12 1  
ATOM 2691  H HG13 . ILE A 1 169 ? 20.194  12.428  -15.099 1.00 0.00 ? 169 ILE A HG13 1  
ATOM 2692  H HG21 . ILE A 1 169 ? 22.223  10.866  -13.972 1.00 0.00 ? 169 ILE A HG21 1  
ATOM 2693  H HG22 . ILE A 1 169 ? 21.206  9.798   -14.940 1.00 0.00 ? 169 ILE A HG22 1  
ATOM 2694  H HG23 . ILE A 1 169 ? 21.557  9.396   -13.256 1.00 0.00 ? 169 ILE A HG23 1  
ATOM 2695  H HD11 . ILE A 1 169 ? 18.019  10.624  -15.796 1.00 0.00 ? 169 ILE A HD11 1  
ATOM 2696  H HD12 . ILE A 1 169 ? 19.597  9.840   -15.713 1.00 0.00 ? 169 ILE A HD12 1  
ATOM 2697  H HD13 . ILE A 1 169 ? 19.357  11.228  -16.774 1.00 0.00 ? 169 ILE A HD13 1  
ATOM 2698  N N    . ILE A 1 170 ? 19.835  8.172   -11.503 1.00 0.00 ? 170 ILE A N    1  
ATOM 2699  C CA   . ILE A 1 170 ? 20.464  7.527   -10.359 1.00 0.00 ? 170 ILE A CA   1  
ATOM 2700  C C    . ILE A 1 170 ? 21.936  7.322   -10.658 1.00 0.00 ? 170 ILE A C    1  
ATOM 2701  O O    . ILE A 1 170 ? 22.315  6.422   -11.403 1.00 0.00 ? 170 ILE A O    1  
ATOM 2702  C CB   . ILE A 1 170 ? 19.830  6.173   -9.996  1.00 0.00 ? 170 ILE A CB   1  
ATOM 2703  C CG1  . ILE A 1 170 ? 18.472  5.998   -10.668 1.00 0.00 ? 170 ILE A CG1  1  
ATOM 2704  C CG2  . ILE A 1 170 ? 19.693  6.040   -8.486  1.00 0.00 ? 170 ILE A CG2  1  
ATOM 2705  C CD1  . ILE A 1 170 ? 17.879  4.640   -10.425 1.00 0.00 ? 170 ILE A CD1  1  
ATOM 2706  H H    . ILE A 1 170 ? 19.513  7.625   -12.248 1.00 0.00 ? 170 ILE A H    1  
ATOM 2707  H HA   . ILE A 1 170 ? 20.370  8.185   -9.510  1.00 0.00 ? 170 ILE A HA   1  
ATOM 2708  H HB   . ILE A 1 170 ? 20.492  5.395   -10.337 1.00 0.00 ? 170 ILE A HB   1  
ATOM 2709  H HG12 . ILE A 1 170 ? 17.784  6.734   -10.284 1.00 0.00 ? 170 ILE A HG12 1  
ATOM 2710  H HG13 . ILE A 1 170 ? 18.579  6.129   -11.732 1.00 0.00 ? 170 ILE A HG13 1  
ATOM 2711  H HG21 . ILE A 1 170 ? 18.755  5.558   -8.250  1.00 0.00 ? 170 ILE A HG21 1  
ATOM 2712  H HG22 . ILE A 1 170 ? 19.717  7.020   -8.034  1.00 0.00 ? 170 ILE A HG22 1  
ATOM 2713  H HG23 . ILE A 1 170 ? 20.509  5.446   -8.102  1.00 0.00 ? 170 ILE A HG23 1  
ATOM 2714  H HD11 . ILE A 1 170 ? 17.195  4.396   -11.220 1.00 0.00 ? 170 ILE A HD11 1  
ATOM 2715  H HD12 . ILE A 1 170 ? 17.355  4.644   -9.483  1.00 0.00 ? 170 ILE A HD12 1  
ATOM 2716  H HD13 . ILE A 1 170 ? 18.672  3.911   -10.394 1.00 0.00 ? 170 ILE A HD13 1  
ATOM 2717  N N    . ASP A 1 171 ? 22.754  8.187   -10.097 1.00 0.00 ? 171 ASP A N    1  
ATOM 2718  C CA   . ASP A 1 171 ? 24.192  8.136   -10.323 1.00 0.00 ? 171 ASP A CA   1  
ATOM 2719  C C    . ASP A 1 171 ? 24.942  7.715   -9.062  1.00 0.00 ? 171 ASP A C    1  
ATOM 2720  O O    . ASP A 1 171 ? 24.340  7.256   -8.091  1.00 0.00 ? 171 ASP A O    1  
ATOM 2721  C CB   . ASP A 1 171 ? 24.687  9.501   -10.817 1.00 0.00 ? 171 ASP A CB   1  
ATOM 2722  C CG   . ASP A 1 171 ? 24.865  10.508  -9.694  1.00 0.00 ? 171 ASP A CG   1  
ATOM 2723  O OD1  . ASP A 1 171 ? 23.847  10.922  -9.101  1.00 0.00 ? 171 ASP A OD1  1  
ATOM 2724  O OD2  . ASP A 1 171 ? 26.023  10.881  -9.410  1.00 0.00 ? 171 ASP A OD2  1  
ATOM 2725  H H    . ASP A 1 171 ? 22.377  8.888   -9.532  1.00 0.00 ? 171 ASP A H    1  
ATOM 2726  H HA   . ASP A 1 171 ? 24.376  7.403   -11.096 1.00 0.00 ? 171 ASP A HA   1  
ATOM 2727  H HB2  . ASP A 1 171 ? 25.634  9.375   -11.317 1.00 0.00 ? 171 ASP A HB2  1  
ATOM 2728  H HB3  . ASP A 1 171 ? 23.969  9.900   -11.519 1.00 0.00 ? 171 ASP A HB3  1  
ATOM 2729  N N    . LYS A 1 172 ? 26.263  7.876   -9.088  1.00 0.00 ? 172 LYS A N    1  
ATOM 2730  C CA   . LYS A 1 172 ? 27.105  7.515   -7.951  1.00 0.00 ? 172 LYS A CA   1  
ATOM 2731  C C    . LYS A 1 172 ? 27.141  6.002   -7.761  1.00 0.00 ? 172 LYS A C    1  
ATOM 2732  O O    . LYS A 1 172 ? 27.058  5.503   -6.639  1.00 0.00 ? 172 LYS A O    1  
ATOM 2733  C CB   . LYS A 1 172 ? 26.601  8.192   -6.673  1.00 0.00 ? 172 LYS A CB   1  
ATOM 2734  C CG   . LYS A 1 172 ? 27.598  8.148   -5.526  1.00 0.00 ? 172 LYS A CG   1  
ATOM 2735  C CD   . LYS A 1 172 ? 27.043  8.817   -4.278  1.00 0.00 ? 172 LYS A CD   1  
ATOM 2736  C CE   . LYS A 1 172 ? 27.650  10.196  -4.064  1.00 0.00 ? 172 LYS A CE   1  
ATOM 2737  N NZ   . LYS A 1 172 ? 28.211  10.350  -2.693  1.00 0.00 ? 172 LYS A NZ   1  
ATOM 2738  H H    . LYS A 1 172 ? 26.681  8.246   -9.894  1.00 0.00 ? 172 LYS A H    1  
ATOM 2739  H HA   . LYS A 1 172 ? 28.107  7.862   -8.159  1.00 0.00 ? 172 LYS A HA   1  
ATOM 2740  H HB2  . LYS A 1 172 ? 26.380  9.226   -6.890  1.00 0.00 ? 172 LYS A HB2  1  
ATOM 2741  H HB3  . LYS A 1 172 ? 25.695  7.699   -6.353  1.00 0.00 ? 172 LYS A HB3  1  
ATOM 2742  H HG2  . LYS A 1 172 ? 27.824  7.117   -5.298  1.00 0.00 ? 172 LYS A HG2  1  
ATOM 2743  H HG3  . LYS A 1 172 ? 28.501  8.658   -5.827  1.00 0.00 ? 172 LYS A HG3  1  
ATOM 2744  H HD2  . LYS A 1 172 ? 25.973  8.919   -4.380  1.00 0.00 ? 172 LYS A HD2  1  
ATOM 2745  H HD3  . LYS A 1 172 ? 27.267  8.199   -3.421  1.00 0.00 ? 172 LYS A HD3  1  
ATOM 2746  H HE2  . LYS A 1 172 ? 28.440  10.345  -4.784  1.00 0.00 ? 172 LYS A HE2  1  
ATOM 2747  H HE3  . LYS A 1 172 ? 26.882  10.940  -4.215  1.00 0.00 ? 172 LYS A HE3  1  
ATOM 2748  H HZ1  . LYS A 1 172 ? 29.197  10.019  -2.671  1.00 0.00 ? 172 LYS A HZ1  1  
ATOM 2749  H HZ2  . LYS A 1 172 ? 27.655  9.791   -2.014  1.00 0.00 ? 172 LYS A HZ2  1  
ATOM 2750  H HZ3  . LYS A 1 172 ? 28.184  11.349  -2.406  1.00 0.00 ? 172 LYS A HZ3  1  
ATOM 2751  N N    . LEU A 1 173 ? 27.268  5.277   -8.868  1.00 0.00 ? 173 LEU A N    1  
ATOM 2752  C CA   . LEU A 1 173 ? 27.318  3.820   -8.824  1.00 0.00 ? 173 LEU A CA   1  
ATOM 2753  C C    . LEU A 1 173 ? 28.498  3.291   -9.633  1.00 0.00 ? 173 LEU A C    1  
ATOM 2754  O O    . LEU A 1 173 ? 28.894  3.889   -10.633 1.00 0.00 ? 173 LEU A O    1  
ATOM 2755  C CB   . LEU A 1 173 ? 26.011  3.226   -9.354  1.00 0.00 ? 173 LEU A CB   1  
ATOM 2756  C CG   . LEU A 1 173 ? 24.746  3.989   -8.952  1.00 0.00 ? 173 LEU A CG   1  
ATOM 2757  C CD1  . LEU A 1 173 ? 24.308  4.921   -10.070 1.00 0.00 ? 173 LEU A CD1  1  
ATOM 2758  C CD2  . LEU A 1 173 ? 23.628  3.021   -8.596  1.00 0.00 ? 173 LEU A CD2  1  
ATOM 2759  H H    . LEU A 1 173 ? 27.336  5.734   -9.732  1.00 0.00 ? 173 LEU A H    1  
ATOM 2760  H HA   . LEU A 1 173 ? 27.445  3.525   -7.794  1.00 0.00 ? 173 LEU A HA   1  
ATOM 2761  H HB2  . LEU A 1 173 ? 26.065  3.198   -10.433 1.00 0.00 ? 173 LEU A HB2  1  
ATOM 2762  H HB3  . LEU A 1 173 ? 25.927  2.214   -8.988  1.00 0.00 ? 173 LEU A HB3  1  
ATOM 2763  H HG   . LEU A 1 173 ? 24.959  4.591   -8.081  1.00 0.00 ? 173 LEU A HG   1  
ATOM 2764  H HD11 . LEU A 1 173 ? 24.014  4.338   -10.930 1.00 0.00 ? 173 LEU A HD11 1  
ATOM 2765  H HD12 . LEU A 1 173 ? 25.128  5.571   -10.339 1.00 0.00 ? 173 LEU A HD12 1  
ATOM 2766  H HD13 . LEU A 1 173 ? 23.472  5.516   -9.735  1.00 0.00 ? 173 LEU A HD13 1  
ATOM 2767  H HD21 . LEU A 1 173 ? 23.760  2.677   -7.581  1.00 0.00 ? 173 LEU A HD21 1  
ATOM 2768  H HD22 . LEU A 1 173 ? 23.654  2.177   -9.269  1.00 0.00 ? 173 LEU A HD22 1  
ATOM 2769  H HD23 . LEU A 1 173 ? 22.677  3.524   -8.685  1.00 0.00 ? 173 LEU A HD23 1  
ATOM 2770  N N    . ILE A 1 174 ? 29.048  2.163   -9.199  1.00 0.00 ? 174 ILE A N    1  
ATOM 2771  C CA   . ILE A 1 174 ? 30.175  1.550   -9.891  1.00 0.00 ? 174 ILE A CA   1  
ATOM 2772  C C    . ILE A 1 174 ? 29.694  0.763   -11.106 1.00 0.00 ? 174 ILE A C    1  
ATOM 2773  O O    . ILE A 1 174 ? 28.579  0.246   -11.114 1.00 0.00 ? 174 ILE A O    1  
ATOM 2774  C CB   . ILE A 1 174 ? 30.976  0.609   -8.967  1.00 0.00 ? 174 ILE A CB   1  
ATOM 2775  C CG1  . ILE A 1 174 ? 30.075  -0.515  -8.428  1.00 0.00 ? 174 ILE A CG1  1  
ATOM 2776  C CG2  . ILE A 1 174 ? 31.623  1.397   -7.835  1.00 0.00 ? 174 ILE A CG2  1  
ATOM 2777  C CD1  . ILE A 1 174 ? 29.426  -0.220  -7.088  1.00 0.00 ? 174 ILE A CD1  1  
ATOM 2778  H H    . ILE A 1 174 ? 28.683  1.730   -8.402  1.00 0.00 ? 174 ILE A H    1  
ATOM 2779  H HA   . ILE A 1 174 ? 30.832  2.341   -10.224 1.00 0.00 ? 174 ILE A HA   1  
ATOM 2780  H HB   . ILE A 1 174 ? 31.768  0.167   -9.554  1.00 0.00 ? 174 ILE A HB   1  
ATOM 2781  H HG12 . ILE A 1 174 ? 29.284  -0.701  -9.139  1.00 0.00 ? 174 ILE A HG12 1  
ATOM 2782  H HG13 . ILE A 1 174 ? 30.665  -1.413  -8.318  1.00 0.00 ? 174 ILE A HG13 1  
ATOM 2783  H HG21 . ILE A 1 174 ? 31.721  0.763   -6.966  1.00 0.00 ? 174 ILE A HG21 1  
ATOM 2784  H HG22 . ILE A 1 174 ? 31.007  2.249   -7.592  1.00 0.00 ? 174 ILE A HG22 1  
ATOM 2785  H HG23 . ILE A 1 174 ? 32.600  1.736   -8.146  1.00 0.00 ? 174 ILE A HG23 1  
ATOM 2786  H HD11 . ILE A 1 174 ? 28.398  -0.549  -7.106  1.00 0.00 ? 174 ILE A HD11 1  
ATOM 2787  H HD12 . ILE A 1 174 ? 29.460  0.842   -6.894  1.00 0.00 ? 174 ILE A HD12 1  
ATOM 2788  H HD13 . ILE A 1 174 ? 29.958  -0.745  -6.309  1.00 0.00 ? 174 ILE A HD13 1  
ATOM 2789  N N    . PRO A 1 175 ? 30.527  0.662   -12.154 1.00 0.00 ? 175 PRO A N    1  
ATOM 2790  C CA   . PRO A 1 175 ? 30.171  -0.067  -13.376 1.00 0.00 ? 175 PRO A CA   1  
ATOM 2791  C C    . PRO A 1 175 ? 29.553  -1.432  -13.079 1.00 0.00 ? 175 PRO A C    1  
ATOM 2792  O O    . PRO A 1 175 ? 29.786  -2.008  -12.016 1.00 0.00 ? 175 PRO A O    1  
ATOM 2793  C CB   . PRO A 1 175 ? 31.513  -0.220  -14.092 1.00 0.00 ? 175 PRO A CB   1  
ATOM 2794  C CG   . PRO A 1 175 ? 32.323  0.945   -13.636 1.00 0.00 ? 175 PRO A CG   1  
ATOM 2795  C CD   . PRO A 1 175 ? 31.880  1.247   -12.229 1.00 0.00 ? 175 PRO A CD   1  
ATOM 2796  H HA   . PRO A 1 175 ? 29.494  0.505   -13.992 1.00 0.00 ? 175 PRO A HA   1  
ATOM 2797  H HB2  . PRO A 1 175 ? 31.971  -1.157  -13.811 1.00 0.00 ? 175 PRO A HB2  1  
ATOM 2798  H HB3  . PRO A 1 175 ? 31.357  -0.194  -15.159 1.00 0.00 ? 175 PRO A HB3  1  
ATOM 2799  H HG2  . PRO A 1 175 ? 33.372  0.689   -13.650 1.00 0.00 ? 175 PRO A HG2  1  
ATOM 2800  H HG3  . PRO A 1 175 ? 32.136  1.794   -14.277 1.00 0.00 ? 175 PRO A HG3  1  
ATOM 2801  H HD2  . PRO A 1 175 ? 32.541  0.777   -11.517 1.00 0.00 ? 175 PRO A HD2  1  
ATOM 2802  H HD3  . PRO A 1 175 ? 31.846  2.314   -12.066 1.00 0.00 ? 175 PRO A HD3  1  
ATOM 2803  N N    . ASN A 1 176 ? 28.756  -1.943  -14.019 1.00 0.00 ? 176 ASN A N    1  
ATOM 2804  C CA   . ASN A 1 176 ? 28.103  -3.238  -13.843 1.00 0.00 ? 176 ASN A CA   1  
ATOM 2805  C C    . ASN A 1 176 ? 27.151  -3.190  -12.644 1.00 0.00 ? 176 ASN A C    1  
ATOM 2806  O O    . ASN A 1 176 ? 27.474  -3.663  -11.555 1.00 0.00 ? 176 ASN A O    1  
ATOM 2807  C CB   . ASN A 1 176 ? 29.167  -4.331  -13.665 1.00 0.00 ? 176 ASN A CB   1  
ATOM 2808  C CG   . ASN A 1 176 ? 28.647  -5.578  -12.970 1.00 0.00 ? 176 ASN A CG   1  
ATOM 2809  O OD1  . ASN A 1 176 ? 28.863  -5.771  -11.774 1.00 0.00 ? 176 ASN A OD1  1  
ATOM 2810  N ND2  . ASN A 1 176 ? 27.959  -6.430  -13.720 1.00 0.00 ? 176 ASN A ND2  1  
ATOM 2811  H H    . ASN A 1 176 ? 28.603  -1.436  -14.843 1.00 0.00 ? 176 ASN A H    1  
ATOM 2812  H HA   . ASN A 1 176 ? 27.527  -3.445  -14.737 1.00 0.00 ? 176 ASN A HA   1  
ATOM 2813  H HB2  . ASN A 1 176 ? 29.539  -4.619  -14.632 1.00 0.00 ? 176 ASN A HB2  1  
ATOM 2814  H HB3  . ASN A 1 176 ? 29.981  -3.929  -13.090 1.00 0.00 ? 176 ASN A HB3  1  
ATOM 2815  H HD21 . ASN A 1 176 ? 27.826  -6.212  -14.666 1.00 0.00 ? 176 ASN A HD21 1  
ATOM 2816  H HD22 . ASN A 1 176 ? 27.612  -7.243  -13.297 1.00 0.00 ? 176 ASN A HD22 1  
ATOM 2817  N N    . THR A 1 177 ? 25.989  -2.580  -12.854 1.00 0.00 ? 177 THR A N    1  
ATOM 2818  C CA   . THR A 1 177 ? 24.993  -2.424  -11.804 1.00 0.00 ? 177 THR A CA   1  
ATOM 2819  C C    . THR A 1 177 ? 23.580  -2.646  -12.334 1.00 0.00 ? 177 THR A C    1  
ATOM 2820  O O    . THR A 1 177 ? 22.911  -1.695  -12.737 1.00 0.00 ? 177 THR A O    1  
ATOM 2821  C CB   . THR A 1 177 ? 25.080  -1.012  -11.237 1.00 0.00 ? 177 THR A CB   1  
ATOM 2822  O OG1  . THR A 1 177 ? 26.333  -0.427  -11.538 1.00 0.00 ? 177 THR A OG1  1  
ATOM 2823  C CG2  . THR A 1 177 ? 24.891  -0.949  -9.740  1.00 0.00 ? 177 THR A CG2  1  
ATOM 2824  H H    . THR A 1 177 ? 25.808  -2.198  -13.729 1.00 0.00 ? 177 THR A H    1  
ATOM 2825  H HA   . THR A 1 177 ? 25.201  -3.136  -11.022 1.00 0.00 ? 177 THR A HA   1  
ATOM 2826  H HB   . THR A 1 177 ? 24.307  -0.412  -11.701 1.00 0.00 ? 177 THR A HB   1  
ATOM 2827  H HG1  . THR A 1 177 ? 26.202  0.476   -11.836 1.00 0.00 ? 177 THR A HG1  1  
ATOM 2828  H HG21 . THR A 1 177 ? 24.424  -1.861  -9.398  1.00 0.00 ? 177 THR A HG21 1  
ATOM 2829  H HG22 . THR A 1 177 ? 24.263  -0.107  -9.491  1.00 0.00 ? 177 THR A HG22 1  
ATOM 2830  H HG23 . THR A 1 177 ? 25.852  -0.836  -9.260  1.00 0.00 ? 177 THR A HG23 1  
ATOM 2831  N N    . ASN A 1 178 ? 23.114  -3.887  -12.332 1.00 0.00 ? 178 ASN A N    1  
ATOM 2832  C CA   . ASN A 1 178 ? 21.768  -4.170  -12.809 1.00 0.00 ? 178 ASN A CA   1  
ATOM 2833  C C    . ASN A 1 178 ? 20.770  -3.784  -11.723 1.00 0.00 ? 178 ASN A C    1  
ATOM 2834  O O    . ASN A 1 178 ? 20.722  -4.418  -10.669 1.00 0.00 ? 178 ASN A O    1  
ATOM 2835  C CB   . ASN A 1 178 ? 21.624  -5.642  -13.185 1.00 0.00 ? 178 ASN A CB   1  
ATOM 2836  C CG   . ASN A 1 178 ? 21.775  -6.570  -11.995 1.00 0.00 ? 178 ASN A CG   1  
ATOM 2837  O OD1  . ASN A 1 178 ? 20.799  -6.891  -11.316 1.00 0.00 ? 178 ASN A OD1  1  
ATOM 2838  N ND2  . ASN A 1 178 ? 23.002  -7.006  -11.736 1.00 0.00 ? 178 ASN A ND2  1  
ATOM 2839  H H    . ASN A 1 178 ? 23.676  -4.617  -11.997 1.00 0.00 ? 178 ASN A H    1  
ATOM 2840  H HA   . ASN A 1 178 ? 21.594  -3.567  -13.685 1.00 0.00 ? 178 ASN A HA   1  
ATOM 2841  H HB2  . ASN A 1 178 ? 20.650  -5.796  -13.622 1.00 0.00 ? 178 ASN A HB2  1  
ATOM 2842  H HB3  . ASN A 1 178 ? 22.381  -5.890  -13.914 1.00 0.00 ? 178 ASN A HB3  1  
ATOM 2843  H HD21 . ASN A 1 178 ? 23.732  -6.708  -12.319 1.00 0.00 ? 178 ASN A HD21 1  
ATOM 2844  H HD22 . ASN A 1 178 ? 23.128  -7.608  -10.973 1.00 0.00 ? 178 ASN A HD22 1  
ATOM 2845  N N    . TYR A 1 179 ? 20.005  -2.717  -11.953 1.00 0.00 ? 179 TYR A N    1  
ATOM 2846  C CA   . TYR A 1 179 ? 19.061  -2.250  -10.939 1.00 0.00 ? 179 TYR A CA   1  
ATOM 2847  C C    . TYR A 1 179 ? 17.613  -2.368  -11.347 1.00 0.00 ? 179 TYR A C    1  
ATOM 2848  O O    . TYR A 1 179 ? 17.231  -2.015  -12.461 1.00 0.00 ? 179 TYR A O    1  
ATOM 2849  C CB   . TYR A 1 179 ? 19.317  -0.797  -10.588 1.00 0.00 ? 179 TYR A CB   1  
ATOM 2850  C CG   . TYR A 1 179 ? 19.602  0.042   -11.788 1.00 0.00 ? 179 TYR A CG   1  
ATOM 2851  C CD1  . TYR A 1 179 ? 20.895  0.171   -12.245 1.00 0.00 ? 179 TYR A CD1  1  
ATOM 2852  C CD2  . TYR A 1 179 ? 18.583  0.695   -12.465 1.00 0.00 ? 179 TYR A CD2  1  
ATOM 2853  C CE1  . TYR A 1 179 ? 21.182  0.929   -13.348 1.00 0.00 ? 179 TYR A CE1  1  
ATOM 2854  C CE2  . TYR A 1 179 ? 18.854  1.459   -13.573 1.00 0.00 ? 179 TYR A CE2  1  
ATOM 2855  C CZ   . TYR A 1 179 ? 20.159  1.575   -14.015 1.00 0.00 ? 179 TYR A CZ   1  
ATOM 2856  O OH   . TYR A 1 179 ? 20.441  2.338   -15.120 1.00 0.00 ? 179 TYR A OH   1  
ATOM 2857  H H    . TYR A 1 179 ? 20.102  -2.220  -12.795 1.00 0.00 ? 179 TYR A H    1  
ATOM 2858  H HA   . TYR A 1 179 ? 19.218  -2.834  -10.061 1.00 0.00 ? 179 TYR A HA   1  
ATOM 2859  H HB2  . TYR A 1 179 ? 18.447  -0.390  -10.095 1.00 0.00 ? 179 TYR A HB2  1  
ATOM 2860  H HB3  . TYR A 1 179 ? 20.159  -0.732  -9.932  1.00 0.00 ? 179 TYR A HB3  1  
ATOM 2861  H HD1  . TYR A 1 179 ? 21.689  -0.333  -11.718 1.00 0.00 ? 179 TYR A HD1  1  
ATOM 2862  H HD2  . TYR A 1 179 ? 17.566  0.597   -12.114 1.00 0.00 ? 179 TYR A HD2  1  
ATOM 2863  H HE1  . TYR A 1 179 ? 22.204  1.014   -13.681 1.00 0.00 ? 179 TYR A HE1  1  
ATOM 2864  H HE2  . TYR A 1 179 ? 18.048  1.964   -14.087 1.00 0.00 ? 179 TYR A HE2  1  
ATOM 2865  H HH   . TYR A 1 179 ? 19.703  2.302   -15.733 1.00 0.00 ? 179 TYR A HH   1  
ATOM 2866  N N    . CYS A 1 180 ? 16.808  -2.790  -10.386 1.00 0.00 ? 180 CYS A N    1  
ATOM 2867  C CA   . CYS A 1 180 ? 15.377  -2.890  -10.557 1.00 0.00 ? 180 CYS A CA   1  
ATOM 2868  C C    . CYS A 1 180 ? 14.764  -1.609  -10.006 1.00 0.00 ? 180 CYS A C    1  
ATOM 2869  O O    . CYS A 1 180 ? 14.666  -1.428  -8.792  1.00 0.00 ? 180 CYS A O    1  
ATOM 2870  C CB   . CYS A 1 180 ? 14.850  -4.125  -9.828  1.00 0.00 ? 180 CYS A CB   1  
ATOM 2871  S SG   . CYS A 1 180 ? 15.599  -5.690  -10.407 1.00 0.00 ? 180 CYS A SG   1  
ATOM 2872  H H    . CYS A 1 180 ? 17.190  -2.988  -9.505  1.00 0.00 ? 180 CYS A H    1  
ATOM 2873  H HA   . CYS A 1 180 ? 15.156  -2.971  -11.609 1.00 0.00 ? 180 CYS A HA   1  
ATOM 2874  H HB2  . CYS A 1 180 ? 15.063  -4.026  -8.775  1.00 0.00 ? 180 CYS A HB2  1  
ATOM 2875  H HB3  . CYS A 1 180 ? 13.785  -4.194  -9.965  1.00 0.00 ? 180 CYS A HB3  1  
ATOM 2876  N N    . VAL A 1 181 ? 14.409  -0.695  -10.904 1.00 0.00 ? 181 VAL A N    1  
ATOM 2877  C CA   . VAL A 1 181 ? 13.859  0.594   -10.508 1.00 0.00 ? 181 VAL A CA   1  
ATOM 2878  C C    . VAL A 1 181 ? 12.337  0.567   -10.449 1.00 0.00 ? 181 VAL A C    1  
ATOM 2879  O O    . VAL A 1 181 ? 11.667  0.463   -11.477 1.00 0.00 ? 181 VAL A O    1  
ATOM 2880  C CB   . VAL A 1 181 ? 14.328  1.719   -11.464 1.00 0.00 ? 181 VAL A CB   1  
ATOM 2881  C CG1  . VAL A 1 181 ? 13.465  2.966   -11.319 1.00 0.00 ? 181 VAL A CG1  1  
ATOM 2882  C CG2  . VAL A 1 181 ? 15.789  2.052   -11.205 1.00 0.00 ? 181 VAL A CG2  1  
ATOM 2883  H H    . VAL A 1 181 ? 14.548  -0.882  -11.855 1.00 0.00 ? 181 VAL A H    1  
ATOM 2884  H HA   . VAL A 1 181 ? 14.234  0.822   -9.524  1.00 0.00 ? 181 VAL A HA   1  
ATOM 2885  H HB   . VAL A 1 181 ? 14.242  1.366   -12.482 1.00 0.00 ? 181 VAL A HB   1  
ATOM 2886  H HG11 . VAL A 1 181 ? 13.881  3.762   -11.918 1.00 0.00 ? 181 VAL A HG11 1  
ATOM 2887  H HG12 . VAL A 1 181 ? 13.442  3.270   -10.283 1.00 0.00 ? 181 VAL A HG12 1  
ATOM 2888  H HG13 . VAL A 1 181 ? 12.461  2.751   -11.654 1.00 0.00 ? 181 VAL A HG13 1  
ATOM 2889  H HG21 . VAL A 1 181 ? 15.852  2.921   -10.566 1.00 0.00 ? 181 VAL A HG21 1  
ATOM 2890  H HG22 . VAL A 1 181 ? 16.284  2.258   -12.143 1.00 0.00 ? 181 VAL A HG22 1  
ATOM 2891  H HG23 . VAL A 1 181 ? 16.269  1.215   -10.721 1.00 0.00 ? 181 VAL A HG23 1  
ATOM 2892  N N    . SER A 1 182 ? 11.799  0.690   -9.238  1.00 0.00 ? 182 SER A N    1  
ATOM 2893  C CA   . SER A 1 182 ? 10.358  0.712   -9.050  1.00 0.00 ? 182 SER A CA   1  
ATOM 2894  C C    . SER A 1 182 ? 9.864   2.147   -9.078  1.00 0.00 ? 182 SER A C    1  
ATOM 2895  O O    . SER A 1 182 ? 10.657  3.089   -9.031  1.00 0.00 ? 182 SER A O    1  
ATOM 2896  C CB   . SER A 1 182 ? 9.948   0.047   -7.733  1.00 0.00 ? 182 SER A CB   1  
ATOM 2897  O OG   . SER A 1 182 ? 8.538   0.006   -7.603  1.00 0.00 ? 182 SER A OG   1  
ATOM 2898  H H    . SER A 1 182 ? 12.387  0.790   -8.460  1.00 0.00 ? 182 SER A H    1  
ATOM 2899  H HA   . SER A 1 182 ? 9.909   0.174   -9.872  1.00 0.00 ? 182 SER A HA   1  
ATOM 2900  H HB2  . SER A 1 182 ? 10.325  -0.961  -7.706  1.00 0.00 ? 182 SER A HB2  1  
ATOM 2901  H HB3  . SER A 1 182 ? 10.354  0.607   -6.906  1.00 0.00 ? 182 SER A HB3  1  
ATOM 2902  H HG   . SER A 1 182 ? 8.244   0.743   -7.064  1.00 0.00 ? 182 SER A HG   1  
ATOM 2903  N N    . VAL A 1 183 ? 8.559   2.307   -9.169  1.00 0.00 ? 183 VAL A N    1  
ATOM 2904  C CA   . VAL A 1 183 ? 7.959   3.628   -9.226  1.00 0.00 ? 183 VAL A CA   1  
ATOM 2905  C C    . VAL A 1 183 ? 6.731   3.706   -8.332  1.00 0.00 ? 183 VAL A C    1  
ATOM 2906  O O    . VAL A 1 183 ? 5.602   3.576   -8.808  1.00 0.00 ? 183 VAL A O    1  
ATOM 2907  C CB   . VAL A 1 183 ? 7.512   3.939   -10.656 1.00 0.00 ? 183 VAL A CB   1  
ATOM 2908  C CG1  . VAL A 1 183 ? 7.027   5.372   -10.780 1.00 0.00 ? 183 VAL A CG1  1  
ATOM 2909  C CG2  . VAL A 1 183 ? 8.624   3.643   -11.655 1.00 0.00 ? 183 VAL A CG2  1  
ATOM 2910  H H    . VAL A 1 183 ? 7.982   1.517   -9.213  1.00 0.00 ? 183 VAL A H    1  
ATOM 2911  H HA   . VAL A 1 183 ? 8.695   4.363   -8.916  1.00 0.00 ? 183 VAL A HA   1  
ATOM 2912  H HB   . VAL A 1 183 ? 6.682   3.288   -10.870 1.00 0.00 ? 183 VAL A HB   1  
ATOM 2913  H HG11 . VAL A 1 183 ? 6.175   5.521   -10.134 1.00 0.00 ? 183 VAL A HG11 1  
ATOM 2914  H HG12 . VAL A 1 183 ? 6.740   5.565   -11.803 1.00 0.00 ? 183 VAL A HG12 1  
ATOM 2915  H HG13 . VAL A 1 183 ? 7.819   6.046   -10.493 1.00 0.00 ? 183 VAL A HG13 1  
ATOM 2916  H HG21 . VAL A 1 183 ? 8.403   4.131   -12.594 1.00 0.00 ? 183 VAL A HG21 1  
ATOM 2917  H HG22 . VAL A 1 183 ? 8.692   2.576   -11.812 1.00 0.00 ? 183 VAL A HG22 1  
ATOM 2918  H HG23 . VAL A 1 183 ? 9.564   4.010   -11.270 1.00 0.00 ? 183 VAL A HG23 1  
ATOM 2919  N N    . TYR A 1 184 ? 6.936   3.911   -7.043  1.00 0.00 ? 184 TYR A N    1  
ATOM 2920  C CA   . TYR A 1 184 ? 5.816   3.996   -6.115  1.00 0.00 ? 184 TYR A CA   1  
ATOM 2921  C C    . TYR A 1 184 ? 5.717   5.386   -5.491  1.00 0.00 ? 184 TYR A C    1  
ATOM 2922  O O    . TYR A 1 184 ? 6.713   6.095   -5.370  1.00 0.00 ? 184 TYR A O    1  
ATOM 2923  C CB   . TYR A 1 184 ? 5.915   2.902   -5.045  1.00 0.00 ? 184 TYR A CB   1  
ATOM 2924  C CG   . TYR A 1 184 ? 6.899   3.155   -3.922  1.00 0.00 ? 184 TYR A CG   1  
ATOM 2925  C CD1  . TYR A 1 184 ? 6.625   4.098   -2.944  1.00 0.00 ? 184 TYR A CD1  1  
ATOM 2926  C CD2  . TYR A 1 184 ? 8.078   2.417   -3.811  1.00 0.00 ? 184 TYR A CD2  1  
ATOM 2927  C CE1  . TYR A 1 184 ? 7.494   4.313   -1.893  1.00 0.00 ? 184 TYR A CE1  1  
ATOM 2928  C CE2  . TYR A 1 184 ? 8.945   2.621   -2.758  1.00 0.00 ? 184 TYR A CE2  1  
ATOM 2929  C CZ   . TYR A 1 184 ? 8.650   3.570   -1.803  1.00 0.00 ? 184 TYR A CZ   1  
ATOM 2930  O OH   . TYR A 1 184 ? 9.515   3.775   -0.752  1.00 0.00 ? 184 TYR A OH   1  
ATOM 2931  H H    . TYR A 1 184 ? 7.845   4.005   -6.699  1.00 0.00 ? 184 TYR A H    1  
ATOM 2932  H HA   . TYR A 1 184 ? 4.916   3.824   -6.690  1.00 0.00 ? 184 TYR A HA   1  
ATOM 2933  H HB2  . TYR A 1 184 ? 4.945   2.775   -4.594  1.00 0.00 ? 184 TYR A HB2  1  
ATOM 2934  H HB3  . TYR A 1 184 ? 6.196   1.981   -5.525  1.00 0.00 ? 184 TYR A HB3  1  
ATOM 2935  H HD1  . TYR A 1 184 ? 5.720   4.677   -3.018  1.00 0.00 ? 184 TYR A HD1  1  
ATOM 2936  H HD2  . TYR A 1 184 ? 8.319   1.677   -4.565  1.00 0.00 ? 184 TYR A HD2  1  
ATOM 2937  H HE1  . TYR A 1 184 ? 7.263   5.056   -1.145  1.00 0.00 ? 184 TYR A HE1  1  
ATOM 2938  H HE2  . TYR A 1 184 ? 9.851   2.039   -2.686  1.00 0.00 ? 184 TYR A HE2  1  
ATOM 2939  H HH   . TYR A 1 184 ? 10.409  3.868   -1.087  1.00 0.00 ? 184 TYR A HH   1  
ATOM 2940  N N    . LEU A 1 185 ? 4.499   5.778   -5.124  1.00 0.00 ? 185 LEU A N    1  
ATOM 2941  C CA   . LEU A 1 185 ? 4.258   7.099   -4.541  1.00 0.00 ? 185 LEU A CA   1  
ATOM 2942  C C    . LEU A 1 185 ? 4.362   7.070   -3.021  1.00 0.00 ? 185 LEU A C    1  
ATOM 2943  O O    . LEU A 1 185 ? 4.288   6.013   -2.398  1.00 0.00 ? 185 LEU A O    1  
ATOM 2944  C CB   . LEU A 1 185 ? 2.880   7.654   -4.949  1.00 0.00 ? 185 LEU A CB   1  
ATOM 2945  C CG   . LEU A 1 185 ? 2.135   6.897   -6.057  1.00 0.00 ? 185 LEU A CG   1  
ATOM 2946  C CD1  . LEU A 1 185 ? 3.057   6.606   -7.234  1.00 0.00 ? 185 LEU A CD1  1  
ATOM 2947  C CD2  . LEU A 1 185 ? 1.522   5.613   -5.510  1.00 0.00 ? 185 LEU A CD2  1  
ATOM 2948  H H    . LEU A 1 185 ? 3.746   5.173   -5.264  1.00 0.00 ? 185 LEU A H    1  
ATOM 2949  H HA   . LEU A 1 185 ? 5.020   7.762   -4.921  1.00 0.00 ? 185 LEU A HA   1  
ATOM 2950  H HB2  . LEU A 1 185 ? 2.249   7.663   -4.072  1.00 0.00 ? 185 LEU A HB2  1  
ATOM 2951  H HB3  . LEU A 1 185 ? 3.016   8.674   -5.276  1.00 0.00 ? 185 LEU A HB3  1  
ATOM 2952  H HG   . LEU A 1 185 ? 1.330   7.519   -6.419  1.00 0.00 ? 185 LEU A HG   1  
ATOM 2953  H HD11 . LEU A 1 185 ? 3.326   5.560   -7.231  1.00 0.00 ? 185 LEU A HD11 1  
ATOM 2954  H HD12 . LEU A 1 185 ? 3.951   7.207   -7.148  1.00 0.00 ? 185 LEU A HD12 1  
ATOM 2955  H HD13 . LEU A 1 185 ? 2.550   6.846   -8.156  1.00 0.00 ? 185 LEU A HD13 1  
ATOM 2956  H HD21 . LEU A 1 185 ? 0.458   5.617   -5.690  1.00 0.00 ? 185 LEU A HD21 1  
ATOM 2957  H HD22 . LEU A 1 185 ? 1.705   5.549   -4.447  1.00 0.00 ? 185 LEU A HD22 1  
ATOM 2958  H HD23 . LEU A 1 185 ? 1.967   4.761   -6.003  1.00 0.00 ? 185 LEU A HD23 1  
ATOM 2959  N N    . GLU A 1 186 ? 4.523   8.250   -2.433  1.00 0.00 ? 186 GLU A N    1  
ATOM 2960  C CA   . GLU A 1 186 ? 4.633   8.374   -0.985  1.00 0.00 ? 186 GLU A CA   1  
ATOM 2961  C C    . GLU A 1 186 ? 3.989   9.666   -0.494  1.00 0.00 ? 186 GLU A C    1  
ATOM 2962  O O    . GLU A 1 186 ? 3.440   10.440  -1.279  1.00 0.00 ? 186 GLU A O    1  
ATOM 2963  C CB   . GLU A 1 186 ? 6.101   8.331   -0.557  1.00 0.00 ? 186 GLU A CB   1  
ATOM 2964  C CG   . GLU A 1 186 ? 6.908   9.534   -1.022  1.00 0.00 ? 186 GLU A CG   1  
ATOM 2965  C CD   . GLU A 1 186 ? 6.911   10.660  -0.007  1.00 0.00 ? 186 GLU A CD   1  
ATOM 2966  O OE1  . GLU A 1 186 ? 7.081   10.375  1.197   1.00 0.00 ? 186 GLU A OE1  1  
ATOM 2967  O OE2  . GLU A 1 186 ? 6.743   11.828  -0.416  1.00 0.00 ? 186 GLU A OE2  1  
ATOM 2968  H H    . GLU A 1 186 ? 4.562   9.057   -2.987  1.00 0.00 ? 186 GLU A H    1  
ATOM 2969  H HA   . GLU A 1 186 ? 4.114   7.537   -0.542  1.00 0.00 ? 186 GLU A HA   1  
ATOM 2970  H HB2  . GLU A 1 186 ? 6.148   8.290   0.521   1.00 0.00 ? 186 GLU A HB2  1  
ATOM 2971  H HB3  . GLU A 1 186 ? 6.557   7.441   -0.962  1.00 0.00 ? 186 GLU A HB3  1  
ATOM 2972  H HG2  . GLU A 1 186 ? 7.928   9.223   -1.193  1.00 0.00 ? 186 GLU A HG2  1  
ATOM 2973  H HG3  . GLU A 1 186 ? 6.484   9.901   -1.945  1.00 0.00 ? 186 GLU A HG3  1  
ATOM 2974  N N    . HIS A 1 187 ? 4.066   9.888   0.812   1.00 0.00 ? 187 HIS A N    1  
ATOM 2975  C CA   . HIS A 1 187 ? 3.500   11.080  1.429   1.00 0.00 ? 187 HIS A CA   1  
ATOM 2976  C C    . HIS A 1 187 ? 3.754   11.064  2.933   1.00 0.00 ? 187 HIS A C    1  
ATOM 2977  O O    . HIS A 1 187 ? 2.818   11.066  3.733   1.00 0.00 ? 187 HIS A O    1  
ATOM 2978  C CB   . HIS A 1 187 ? 1.998   11.167  1.148   1.00 0.00 ? 187 HIS A CB   1  
ATOM 2979  C CG   . HIS A 1 187 ? 1.263   9.891   1.417   1.00 0.00 ? 187 HIS A CG   1  
ATOM 2980  N ND1  . HIS A 1 187 ? 0.852   9.034   0.418   1.00 0.00 ? 187 HIS A ND1  1  
ATOM 2981  C CD2  . HIS A 1 187 ? 0.864   9.326   2.582   1.00 0.00 ? 187 HIS A CD2  1  
ATOM 2982  C CE1  . HIS A 1 187 ? 0.231   7.999   0.956   1.00 0.00 ? 187 HIS A CE1  1  
ATOM 2983  N NE2  . HIS A 1 187 ? 0.226   8.152   2.267   1.00 0.00 ? 187 HIS A NE2  1  
ATOM 2984  H H    . HIS A 1 187 ? 4.520   9.230   1.379   1.00 0.00 ? 187 HIS A H    1  
ATOM 2985  H HA   . HIS A 1 187 ? 3.991   11.942  1.001   1.00 0.00 ? 187 HIS A HA   1  
ATOM 2986  H HB2  . HIS A 1 187 ? 1.566   11.936  1.771   1.00 0.00 ? 187 HIS A HB2  1  
ATOM 2987  H HB3  . HIS A 1 187 ? 1.848   11.426  0.110   1.00 0.00 ? 187 HIS A HB3  1  
ATOM 2988  H HD1  . HIS A 1 187 ? 0.992   9.166   -0.543  1.00 0.00 ? 187 HIS A HD1  1  
ATOM 2989  H HD2  . HIS A 1 187 ? 1.020   9.725   3.574   1.00 0.00 ? 187 HIS A HD2  1  
ATOM 2990  H HE1  . HIS A 1 187 ? -0.198  7.168   0.415   1.00 0.00 ? 187 HIS A HE1  1  
ATOM 2991  H HE2  . HIS A 1 187 ? -0.107  7.494   2.912   1.00 0.00 ? 187 HIS A HE2  1  
ATOM 2992  N N    . SER A 1 188 ? 5.029   11.035  3.308   1.00 0.00 ? 188 SER A N    1  
ATOM 2993  C CA   . SER A 1 188 ? 5.416   11.004  4.714   1.00 0.00 ? 188 SER A CA   1  
ATOM 2994  C C    . SER A 1 188 ? 4.983   9.690   5.357   1.00 0.00 ? 188 SER A C    1  
ATOM 2995  O O    . SER A 1 188 ? 4.612   9.652   6.530   1.00 0.00 ? 188 SER A O    1  
ATOM 2996  C CB   . SER A 1 188 ? 4.804   12.190  5.466   1.00 0.00 ? 188 SER A CB   1  
ATOM 2997  O OG   . SER A 1 188 ? 5.751   13.230  5.636   1.00 0.00 ? 188 SER A OG   1  
ATOM 2998  H H    . SER A 1 188 ? 5.728   11.026  2.621   1.00 0.00 ? 188 SER A H    1  
ATOM 2999  H HA   . SER A 1 188 ? 6.493   11.076  4.762   1.00 0.00 ? 188 SER A HA   1  
ATOM 3000  H HB2  . SER A 1 188 ? 3.965   12.575  4.906   1.00 0.00 ? 188 SER A HB2  1  
ATOM 3001  H HB3  . SER A 1 188 ? 4.467   11.864  6.439   1.00 0.00 ? 188 SER A HB3  1  
ATOM 3002  H HG   . SER A 1 188 ? 5.637   13.884  4.943   1.00 0.00 ? 188 SER A HG   1  
ATOM 3003  N N    . ASP A 1 189 ? 5.030   8.614   4.576   1.00 0.00 ? 189 ASP A N    1  
ATOM 3004  C CA   . ASP A 1 189 ? 4.639   7.297   5.064   1.00 0.00 ? 189 ASP A CA   1  
ATOM 3005  C C    . ASP A 1 189 ? 5.380   6.190   4.317   1.00 0.00 ? 189 ASP A C    1  
ATOM 3006  O O    . ASP A 1 189 ? 5.580   6.270   3.105   1.00 0.00 ? 189 ASP A O    1  
ATOM 3007  C CB   . ASP A 1 189 ? 3.129   7.105   4.914   1.00 0.00 ? 189 ASP A CB   1  
ATOM 3008  C CG   . ASP A 1 189 ? 2.370   7.488   6.169   1.00 0.00 ? 189 ASP A CG   1  
ATOM 3009  O OD1  . ASP A 1 189 ? 2.102   8.694   6.356   1.00 0.00 ? 189 ASP A OD1  1  
ATOM 3010  O OD2  . ASP A 1 189 ? 2.043   6.583   6.965   1.00 0.00 ? 189 ASP A OD2  1  
ATOM 3011  H H    . ASP A 1 189 ? 5.332   8.710   3.649   1.00 0.00 ? 189 ASP A H    1  
ATOM 3012  H HA   . ASP A 1 189 ? 4.896   7.241   6.110   1.00 0.00 ? 189 ASP A HA   1  
ATOM 3013  H HB2  . ASP A 1 189 ? 2.773   7.718   4.100   1.00 0.00 ? 189 ASP A HB2  1  
ATOM 3014  H HB3  . ASP A 1 189 ? 2.924   6.067   4.694   1.00 0.00 ? 189 ASP A HB3  1  
ATOM 3015  N N    . GLU A 1 190 ? 5.773   5.152   5.050   1.00 0.00 ? 190 GLU A N    1  
ATOM 3016  C CA   . GLU A 1 190 ? 6.480   4.018   4.462   1.00 0.00 ? 190 GLU A CA   1  
ATOM 3017  C C    . GLU A 1 190 ? 5.559   2.808   4.368   1.00 0.00 ? 190 GLU A C    1  
ATOM 3018  O O    . GLU A 1 190 ? 6.015   1.665   4.340   1.00 0.00 ? 190 GLU A O    1  
ATOM 3019  C CB   . GLU A 1 190 ? 7.720   3.674   5.290   1.00 0.00 ? 190 GLU A CB   1  
ATOM 3020  C CG   . GLU A 1 190 ? 9.002   4.282   4.744   1.00 0.00 ? 190 GLU A CG   1  
ATOM 3021  C CD   . GLU A 1 190 ? 9.623   5.288   5.694   1.00 0.00 ? 190 GLU A CD   1  
ATOM 3022  O OE1  . GLU A 1 190 ? 10.027  4.885   6.805   1.00 0.00 ? 190 GLU A OE1  1  
ATOM 3023  O OE2  . GLU A 1 190 ? 9.706   6.479   5.326   1.00 0.00 ? 190 GLU A OE2  1  
ATOM 3024  H H    . GLU A 1 190 ? 5.574   5.144   6.010   1.00 0.00 ? 190 GLU A H    1  
ATOM 3025  H HA   . GLU A 1 190 ? 6.786   4.295   3.464   1.00 0.00 ? 190 GLU A HA   1  
ATOM 3026  H HB2  . GLU A 1 190 ? 7.577   4.033   6.298   1.00 0.00 ? 190 GLU A HB2  1  
ATOM 3027  H HB3  . GLU A 1 190 ? 7.838   2.601   5.312   1.00 0.00 ? 190 GLU A HB3  1  
ATOM 3028  H HG2  . GLU A 1 190 ? 9.715   3.491   4.568   1.00 0.00 ? 190 GLU A HG2  1  
ATOM 3029  H HG3  . GLU A 1 190 ? 8.780   4.780   3.811   1.00 0.00 ? 190 GLU A HG3  1  
ATOM 3030  N N    . GLN A 1 191 ? 4.259   3.073   4.310   1.00 0.00 ? 191 GLN A N    1  
ATOM 3031  C CA   . GLN A 1 191 ? 3.263   2.016   4.208   1.00 0.00 ? 191 GLN A CA   1  
ATOM 3032  C C    . GLN A 1 191 ? 2.517   2.106   2.880   1.00 0.00 ? 191 GLN A C    1  
ATOM 3033  O O    . GLN A 1 191 ? 1.895   1.138   2.442   1.00 0.00 ? 191 GLN A O    1  
ATOM 3034  C CB   . GLN A 1 191 ? 2.273   2.106   5.371   1.00 0.00 ? 191 GLN A CB   1  
ATOM 3035  C CG   . GLN A 1 191 ? 1.611   0.781   5.710   1.00 0.00 ? 191 GLN A CG   1  
ATOM 3036  C CD   . GLN A 1 191 ? 0.372   0.951   6.568   1.00 0.00 ? 191 GLN A CD   1  
ATOM 3037  O OE1  . GLN A 1 191 ? -0.727  1.166   6.057   1.00 0.00 ? 191 GLN A OE1  1  
ATOM 3038  N NE2  . GLN A 1 191 ? 0.544   0.857   7.882   1.00 0.00 ? 191 GLN A NE2  1  
ATOM 3039  H H    . GLN A 1 191 ? 3.961   4.005   4.329   1.00 0.00 ? 191 GLN A H    1  
ATOM 3040  H HA   . GLN A 1 191 ? 3.778   1.068   4.256   1.00 0.00 ? 191 GLN A HA   1  
ATOM 3041  H HB2  . GLN A 1 191 ? 2.796   2.458   6.248   1.00 0.00 ? 191 GLN A HB2  1  
ATOM 3042  H HB3  . GLN A 1 191 ? 1.499   2.815   5.115   1.00 0.00 ? 191 GLN A HB3  1  
ATOM 3043  H HG2  . GLN A 1 191 ? 1.328   0.288   4.792   1.00 0.00 ? 191 GLN A HG2  1  
ATOM 3044  H HG3  . GLN A 1 191 ? 2.319   0.166   6.245   1.00 0.00 ? 191 GLN A HG3  1  
ATOM 3045  H HE21 . GLN A 1 191 ? 1.448   0.685   8.219   1.00 0.00 ? 191 GLN A HE21 1  
ATOM 3046  H HE22 . GLN A 1 191 ? -0.240  0.964   8.460   1.00 0.00 ? 191 GLN A HE22 1  
ATOM 3047  N N    . ALA A 1 192 ? 2.614   3.260   2.221   1.00 0.00 ? 192 ALA A N    1  
ATOM 3048  C CA   . ALA A 1 192 ? 1.987   3.464   0.924   1.00 0.00 ? 192 ALA A CA   1  
ATOM 3049  C C    . ALA A 1 192 ? 2.970   3.128   -0.193  1.00 0.00 ? 192 ALA A C    1  
ATOM 3050  O O    . ALA A 1 192 ? 3.168   3.925   -1.112  1.00 0.00 ? 192 ALA A O    1  
ATOM 3051  C CB   . ALA A 1 192 ? 1.503   4.904   0.798   1.00 0.00 ? 192 ALA A CB   1  
ATOM 3052  H H    . ALA A 1 192 ? 3.167   3.984   2.579   1.00 0.00 ? 192 ALA A H    1  
ATOM 3053  H HA   . ALA A 1 192 ? 1.132   2.808   0.854   1.00 0.00 ? 192 ALA A HA   1  
ATOM 3054  H HB1  . ALA A 1 192 ? 2.137   5.441   0.107   1.00 0.00 ? 192 ALA A HB1  1  
ATOM 3055  H HB2  . ALA A 1 192 ? 1.543   5.382   1.767   1.00 0.00 ? 192 ALA A HB2  1  
ATOM 3056  H HB3  . ALA A 1 192 ? 0.486   4.912   0.435   1.00 0.00 ? 192 ALA A HB3  1  
ATOM 3057  N N    . VAL A 1 193 ? 3.616   1.969   -0.103  1.00 0.00 ? 193 VAL A N    1  
ATOM 3058  C CA   . VAL A 1 193 ? 4.603   1.592   -1.110  1.00 0.00 ? 193 VAL A CA   1  
ATOM 3059  C C    . VAL A 1 193 ? 4.002   0.833   -2.279  1.00 0.00 ? 193 VAL A C    1  
ATOM 3060  O O    . VAL A 1 193 ? 4.076   -0.395  -2.351  1.00 0.00 ? 193 VAL A O    1  
ATOM 3061  C CB   . VAL A 1 193 ? 5.758   0.744   -0.552  1.00 0.00 ? 193 VAL A CB   1  
ATOM 3062  C CG1  . VAL A 1 193 ? 6.958   1.612   -0.213  1.00 0.00 ? 193 VAL A CG1  1  
ATOM 3063  C CG2  . VAL A 1 193 ? 5.324   -0.080  0.648   1.00 0.00 ? 193 VAL A CG2  1  
ATOM 3064  H H    . VAL A 1 193 ? 3.445   1.379   0.659   1.00 0.00 ? 193 VAL A H    1  
ATOM 3065  H HA   . VAL A 1 193 ? 5.030   2.508   -1.493  1.00 0.00 ? 193 VAL A HA   1  
ATOM 3066  H HB   . VAL A 1 193 ? 6.057   0.065   -1.334  1.00 0.00 ? 193 VAL A HB   1  
ATOM 3067  H HG11 . VAL A 1 193 ? 7.312   1.368   0.778   1.00 0.00 ? 193 VAL A HG11 1  
ATOM 3068  H HG12 . VAL A 1 193 ? 6.671   2.653   -0.247  1.00 0.00 ? 193 VAL A HG12 1  
ATOM 3069  H HG13 . VAL A 1 193 ? 7.744   1.429   -0.931  1.00 0.00 ? 193 VAL A HG13 1  
ATOM 3070  H HG21 . VAL A 1 193 ? 4.294   -0.380  0.525   1.00 0.00 ? 193 VAL A HG21 1  
ATOM 3071  H HG22 . VAL A 1 193 ? 5.425   0.514   1.547   1.00 0.00 ? 193 VAL A HG22 1  
ATOM 3072  H HG23 . VAL A 1 193 ? 5.948   -0.958  0.722   1.00 0.00 ? 193 VAL A HG23 1  
ATOM 3073  N N    . ILE A 1 194 ? 3.454   1.580   -3.213  1.00 0.00 ? 194 ILE A N    1  
ATOM 3074  C CA   . ILE A 1 194 ? 2.888   0.997   -4.417  1.00 0.00 ? 194 ILE A CA   1  
ATOM 3075  C C    . ILE A 1 194 ? 4.026   0.691   -5.380  1.00 0.00 ? 194 ILE A C    1  
ATOM 3076  O O    . ILE A 1 194 ? 4.103   1.244   -6.477  1.00 0.00 ? 194 ILE A O    1  
ATOM 3077  C CB   . ILE A 1 194 ? 1.872   1.932   -5.102  1.00 0.00 ? 194 ILE A CB   1  
ATOM 3078  C CG1  . ILE A 1 194 ? 1.004   2.643   -4.060  1.00 0.00 ? 194 ILE A CG1  1  
ATOM 3079  C CG2  . ILE A 1 194 ? 1.006   1.141   -6.072  1.00 0.00 ? 194 ILE A CG2  1  
ATOM 3080  C CD1  . ILE A 1 194 ? 0.083   1.714   -3.301  1.00 0.00 ? 194 ILE A CD1  1  
ATOM 3081  H H    . ILE A 1 194 ? 3.462   2.546   -3.090  1.00 0.00 ? 194 ILE A H    1  
ATOM 3082  H HA   . ILE A 1 194 ? 2.391   0.074   -4.148  1.00 0.00 ? 194 ILE A HA   1  
ATOM 3083  H HB   . ILE A 1 194 ? 2.421   2.669   -5.669  1.00 0.00 ? 194 ILE A HB   1  
ATOM 3084  H HG12 . ILE A 1 194 ? 1.643   3.134   -3.342  1.00 0.00 ? 194 ILE A HG12 1  
ATOM 3085  H HG13 . ILE A 1 194 ? 0.396   3.383   -4.556  1.00 0.00 ? 194 ILE A HG13 1  
ATOM 3086  H HG21 . ILE A 1 194 ? 0.188   1.757   -6.412  1.00 0.00 ? 194 ILE A HG21 1  
ATOM 3087  H HG22 . ILE A 1 194 ? 0.614   0.267   -5.573  1.00 0.00 ? 194 ILE A HG22 1  
ATOM 3088  H HG23 . ILE A 1 194 ? 1.603   0.834   -6.918  1.00 0.00 ? 194 ILE A HG23 1  
ATOM 3089  H HD11 . ILE A 1 194 ? 0.420   1.629   -2.278  1.00 0.00 ? 194 ILE A HD11 1  
ATOM 3090  H HD12 . ILE A 1 194 ? 0.092   0.739   -3.765  1.00 0.00 ? 194 ILE A HD12 1  
ATOM 3091  H HD13 . ILE A 1 194 ? -0.921  2.111   -3.316  1.00 0.00 ? 194 ILE A HD13 1  
ATOM 3092  N N    . LYS A 1 195 ? 4.925   -0.179  -4.935  1.00 0.00 ? 195 LYS A N    1  
ATOM 3093  C CA   . LYS A 1 195 ? 6.089   -0.558  -5.717  1.00 0.00 ? 195 LYS A CA   1  
ATOM 3094  C C    . LYS A 1 195 ? 5.679   -1.394  -6.922  1.00 0.00 ? 195 LYS A C    1  
ATOM 3095  O O    . LYS A 1 195 ? 5.449   -2.599  -6.814  1.00 0.00 ? 195 LYS A O    1  
ATOM 3096  C CB   . LYS A 1 195 ? 7.087   -1.300  -4.818  1.00 0.00 ? 195 LYS A CB   1  
ATOM 3097  C CG   . LYS A 1 195 ? 8.246   -1.940  -5.564  1.00 0.00 ? 195 LYS A CG   1  
ATOM 3098  C CD   . LYS A 1 195 ? 8.693   -3.229  -4.895  1.00 0.00 ? 195 LYS A CD   1  
ATOM 3099  C CE   . LYS A 1 195 ? 9.305   -2.963  -3.529  1.00 0.00 ? 195 LYS A CE   1  
ATOM 3100  N NZ   . LYS A 1 195 ? 9.599   -4.224  -2.793  1.00 0.00 ? 195 LYS A NZ   1  
ATOM 3101  H H    . LYS A 1 195 ? 4.802   -0.574  -4.048  1.00 0.00 ? 195 LYS A H    1  
ATOM 3102  H HA   . LYS A 1 195 ? 6.553   0.346   -6.075  1.00 0.00 ? 195 LYS A HA   1  
ATOM 3103  H HB2  . LYS A 1 195 ? 7.496   -0.595  -4.109  1.00 0.00 ? 195 LYS A HB2  1  
ATOM 3104  H HB3  . LYS A 1 195 ? 6.562   -2.070  -4.271  1.00 0.00 ? 195 LYS A HB3  1  
ATOM 3105  H HG2  . LYS A 1 195 ? 7.939   -2.157  -6.575  1.00 0.00 ? 195 LYS A HG2  1  
ATOM 3106  H HG3  . LYS A 1 195 ? 9.075   -1.248  -5.580  1.00 0.00 ? 195 LYS A HG3  1  
ATOM 3107  H HD2  . LYS A 1 195 ? 7.838   -3.877  -4.776  1.00 0.00 ? 195 LYS A HD2  1  
ATOM 3108  H HD3  . LYS A 1 195 ? 9.429   -3.712  -5.522  1.00 0.00 ? 195 LYS A HD3  1  
ATOM 3109  H HE2  . LYS A 1 195 ? 10.223  -2.412  -3.661  1.00 0.00 ? 195 LYS A HE2  1  
ATOM 3110  H HE3  . LYS A 1 195 ? 8.612   -2.371  -2.948  1.00 0.00 ? 195 LYS A HE3  1  
ATOM 3111  H HZ1  . LYS A 1 195 ? 8.930   -4.344  -2.006  1.00 0.00 ? 195 LYS A HZ1  1  
ATOM 3112  H HZ2  . LYS A 1 195 ? 10.565  -4.197  -2.410  1.00 0.00 ? 195 LYS A HZ2  1  
ATOM 3113  H HZ3  . LYS A 1 195 ? 9.515   -5.040  -3.433  1.00 0.00 ? 195 LYS A HZ3  1  
ATOM 3114  N N    . SER A 1 196 ? 5.582   -0.729  -8.071  1.00 0.00 ? 196 SER A N    1  
ATOM 3115  C CA   . SER A 1 196 ? 5.188   -1.387  -9.312  1.00 0.00 ? 196 SER A CA   1  
ATOM 3116  C C    . SER A 1 196 ? 6.321   -2.249  -9.851  1.00 0.00 ? 196 SER A C    1  
ATOM 3117  O O    . SER A 1 196 ? 7.471   -2.098  -9.439  1.00 0.00 ? 196 SER A O    1  
ATOM 3118  C CB   . SER A 1 196 ? 4.787   -0.343  -10.356 1.00 0.00 ? 196 SER A CB   1  
ATOM 3119  O OG   . SER A 1 196 ? 5.718   0.725   -10.393 1.00 0.00 ? 196 SER A OG   1  
ATOM 3120  H H    . SER A 1 196 ? 5.775   0.237   -8.079  1.00 0.00 ? 196 SER A H    1  
ATOM 3121  H HA   . SER A 1 196 ? 4.338   -2.017  -9.100  1.00 0.00 ? 196 SER A HA   1  
ATOM 3122  H HB2  . SER A 1 196 ? 4.752   -0.805  -11.331 1.00 0.00 ? 196 SER A HB2  1  
ATOM 3123  H HB3  . SER A 1 196 ? 3.814   0.054   -10.111 1.00 0.00 ? 196 SER A HB3  1  
ATOM 3124  H HG   . SER A 1 196 ? 5.797   1.052   -11.292 1.00 0.00 ? 196 SER A HG   1  
ATOM 3125  N N    . PRO A 1 197 ? 6.021   -3.162  -10.792 1.00 0.00 ? 197 PRO A N    1  
ATOM 3126  C CA   . PRO A 1 197 ? 7.039   -4.029  -11.381 1.00 0.00 ? 197 PRO A CA   1  
ATOM 3127  C C    . PRO A 1 197 ? 8.229   -3.223  -11.867 1.00 0.00 ? 197 PRO A C    1  
ATOM 3128  O O    . PRO A 1 197 ? 8.173   -2.565  -12.906 1.00 0.00 ? 197 PRO A O    1  
ATOM 3129  C CB   . PRO A 1 197 ? 6.321   -4.691  -12.548 1.00 0.00 ? 197 PRO A CB   1  
ATOM 3130  C CG   . PRO A 1 197 ? 4.880   -4.668  -12.167 1.00 0.00 ? 197 PRO A CG   1  
ATOM 3131  C CD   . PRO A 1 197 ? 4.683   -3.411  -11.360 1.00 0.00 ? 197 PRO A CD   1  
ATOM 3132  H HA   . PRO A 1 197 ? 7.374   -4.781  -10.680 1.00 0.00 ? 197 PRO A HA   1  
ATOM 3133  H HB2  . PRO A 1 197 ? 6.507   -4.128  -13.449 1.00 0.00 ? 197 PRO A HB2  1  
ATOM 3134  H HB3  . PRO A 1 197 ? 6.685   -5.700  -12.663 1.00 0.00 ? 197 PRO A HB3  1  
ATOM 3135  H HG2  . PRO A 1 197 ? 4.266   -4.643  -13.056 1.00 0.00 ? 197 PRO A HG2  1  
ATOM 3136  H HG3  . PRO A 1 197 ? 4.643   -5.537  -11.571 1.00 0.00 ? 197 PRO A HG3  1  
ATOM 3137  H HD2  . PRO A 1 197 ? 4.378   -2.597  -12.001 1.00 0.00 ? 197 PRO A HD2  1  
ATOM 3138  H HD3  . PRO A 1 197 ? 3.955   -3.572  -10.579 1.00 0.00 ? 197 PRO A HD3  1  
ATOM 3139  N N    . LEU A 1 198 ? 9.289   -3.255  -11.083 1.00 0.00 ? 198 LEU A N    1  
ATOM 3140  C CA   . LEU A 1 198 ? 10.500  -2.505  -11.387 1.00 0.00 ? 198 LEU A CA   1  
ATOM 3141  C C    . LEU A 1 198 ? 11.000  -2.734  -12.792 1.00 0.00 ? 198 LEU A C    1  
ATOM 3142  O O    . LEU A 1 198 ? 10.443  -3.498  -13.581 1.00 0.00 ? 198 LEU A O    1  
ATOM 3143  C CB   . LEU A 1 198 ? 11.642  -2.885  -10.440 1.00 0.00 ? 198 LEU A CB   1  
ATOM 3144  C CG   . LEU A 1 198 ? 11.257  -3.050  -8.988  1.00 0.00 ? 198 LEU A CG   1  
ATOM 3145  C CD1  . LEU A 1 198 ? 11.156  -4.525  -8.642  1.00 0.00 ? 198 LEU A CD1  1  
ATOM 3146  C CD2  . LEU A 1 198 ? 12.264  -2.361  -8.082  1.00 0.00 ? 198 LEU A CD2  1  
ATOM 3147  H H    . LEU A 1 198 ? 9.250   -3.779  -10.260 1.00 0.00 ? 198 LEU A H    1  
ATOM 3148  H HA   . LEU A 1 198 ? 10.282  -1.457  -11.259 1.00 0.00 ? 198 LEU A HA   1  
ATOM 3149  H HB2  . LEU A 1 198 ? 12.066  -3.817  -10.786 1.00 0.00 ? 198 LEU A HB2  1  
ATOM 3150  H HB3  . LEU A 1 198 ? 12.405  -2.123  -10.502 1.00 0.00 ? 198 LEU A HB3  1  
ATOM 3151  H HG   . LEU A 1 198 ? 10.299  -2.591  -8.843  1.00 0.00 ? 198 LEU A HG   1  
ATOM 3152  H HD11 . LEU A 1 198 ? 11.951  -5.060  -9.145  1.00 0.00 ? 198 LEU A HD11 1  
ATOM 3153  H HD12 . LEU A 1 198 ? 10.201  -4.909  -8.965  1.00 0.00 ? 198 LEU A HD12 1  
ATOM 3154  H HD13 . LEU A 1 198 ? 11.256  -4.653  -7.575  1.00 0.00 ? 198 LEU A HD13 1  
ATOM 3155  H HD21 . LEU A 1 198 ? 13.178  -2.937  -8.058  1.00 0.00 ? 198 LEU A HD21 1  
ATOM 3156  H HD22 . LEU A 1 198 ? 11.859  -2.286  -7.084  1.00 0.00 ? 198 LEU A HD22 1  
ATOM 3157  H HD23 . LEU A 1 198 ? 12.472  -1.373  -8.462  1.00 0.00 ? 198 LEU A HD23 1  
ATOM 3158  N N    . LYS A 1 199 ? 12.117  -2.087  -13.035 1.00 0.00 ? 199 LYS A N    1  
ATOM 3159  C CA   . LYS A 1 199 ? 12.848  -2.187  -14.281 1.00 0.00 ? 199 LYS A CA   1  
ATOM 3160  C C    . LYS A 1 199 ? 14.275  -2.545  -13.914 1.00 0.00 ? 199 LYS A C    1  
ATOM 3161  O O    . LYS A 1 199 ? 14.988  -1.726  -13.340 1.00 0.00 ? 199 LYS A O    1  
ATOM 3162  C CB   . LYS A 1 199 ? 12.834  -0.863  -15.047 1.00 0.00 ? 199 LYS A CB   1  
ATOM 3163  C CG   . LYS A 1 199 ? 11.732  -0.734  -16.087 1.00 0.00 ? 199 LYS A CG   1  
ATOM 3164  C CD   . LYS A 1 199 ? 12.303  -0.602  -17.496 1.00 0.00 ? 199 LYS A CD   1  
ATOM 3165  C CE   . LYS A 1 199 ? 11.212  -0.624  -18.554 1.00 0.00 ? 199 LYS A CE   1  
ATOM 3166  N NZ   . LYS A 1 199 ? 10.707  -2.002  -18.806 1.00 0.00 ? 199 LYS A NZ   1  
ATOM 3167  H H    . LYS A 1 199 ? 12.495  -1.544  -12.306 1.00 0.00 ? 199 LYS A H    1  
ATOM 3168  H HA   . LYS A 1 199 ? 12.414  -2.973  -14.882 1.00 0.00 ? 199 LYS A HA   1  
ATOM 3169  H HB2  . LYS A 1 199 ? 12.721  -0.058  -14.339 1.00 0.00 ? 199 LYS A HB2  1  
ATOM 3170  H HB3  . LYS A 1 199 ? 13.782  -0.755  -15.550 1.00 0.00 ? 199 LYS A HB3  1  
ATOM 3171  H HG2  . LYS A 1 199 ? 11.100  -1.608  -16.043 1.00 0.00 ? 199 LYS A HG2  1  
ATOM 3172  H HG3  . LYS A 1 199 ? 11.150  0.149   -15.862 1.00 0.00 ? 199 LYS A HG3  1  
ATOM 3173  H HD2  . LYS A 1 199 ? 12.835  0.337   -17.572 1.00 0.00 ? 199 LYS A HD2  1  
ATOM 3174  H HD3  . LYS A 1 199 ? 12.985  -1.419  -17.677 1.00 0.00 ? 199 LYS A HD3  1  
ATOM 3175  H HE2  . LYS A 1 199 ? 10.393  -0.003  -18.221 1.00 0.00 ? 199 LYS A HE2  1  
ATOM 3176  H HE3  . LYS A 1 199 ? 11.614  -0.222  -19.473 1.00 0.00 ? 199 LYS A HE3  1  
ATOM 3177  H HZ1  . LYS A 1 199 ? 11.422  -2.555  -19.322 1.00 0.00 ? 199 LYS A HZ1  1  
ATOM 3178  H HZ2  . LYS A 1 199 ? 9.837   -1.966  -19.374 1.00 0.00 ? 199 LYS A HZ2  1  
ATOM 3179  H HZ3  . LYS A 1 199 ? 10.500  -2.478  -17.904 1.00 0.00 ? 199 LYS A HZ3  1  
ATOM 3180  N N    . CYS A 1 200 ? 14.694  -3.760  -14.217 1.00 0.00 ? 200 CYS A N    1  
ATOM 3181  C CA   . CYS A 1 200 ? 16.041  -4.178  -13.875 1.00 0.00 ? 200 CYS A CA   1  
ATOM 3182  C C    . CYS A 1 200 ? 16.990  -3.930  -15.043 1.00 0.00 ? 200 CYS A C    1  
ATOM 3183  O O    . CYS A 1 200 ? 17.421  -4.862  -15.722 1.00 0.00 ? 200 CYS A O    1  
ATOM 3184  C CB   . CYS A 1 200 ? 16.041  -5.645  -13.443 1.00 0.00 ? 200 CYS A CB   1  
ATOM 3185  S SG   . CYS A 1 200 ? 14.739  -6.041  -12.220 1.00 0.00 ? 200 CYS A SG   1  
ATOM 3186  H H    . CYS A 1 200 ? 14.097  -4.383  -14.679 1.00 0.00 ? 200 CYS A H    1  
ATOM 3187  H HA   . CYS A 1 200 ? 16.359  -3.578  -13.040 1.00 0.00 ? 200 CYS A HA   1  
ATOM 3188  H HB2  . CYS A 1 200 ? 15.882  -6.270  -14.310 1.00 0.00 ? 200 CYS A HB2  1  
ATOM 3189  H HB3  . CYS A 1 200 ? 16.996  -5.885  -12.999 1.00 0.00 ? 200 CYS A HB3  1  
ATOM 3190  N N    . THR A 1 201 ? 17.293  -2.650  -15.277 1.00 0.00 ? 201 THR A N    1  
ATOM 3191  C CA   . THR A 1 201 ? 18.172  -2.253  -16.371 1.00 0.00 ? 201 THR A CA   1  
ATOM 3192  C C    . THR A 1 201 ? 19.631  -2.148  -15.914 1.00 0.00 ? 201 THR A C    1  
ATOM 3193  O O    . THR A 1 201 ? 19.958  -1.396  -14.995 1.00 0.00 ? 201 THR A O    1  
ATOM 3194  C CB   . THR A 1 201 ? 17.694  -0.927  -16.996 1.00 0.00 ? 201 THR A CB   1  
ATOM 3195  O OG1  . THR A 1 201 ? 17.789  -0.984  -18.408 1.00 0.00 ? 201 THR A OG1  1  
ATOM 3196  C CG2  . THR A 1 201 ? 18.461  0.301   -16.542 1.00 0.00 ? 201 THR A CG2  1  
ATOM 3197  H H    . THR A 1 201 ? 16.904  -1.959  -14.704 1.00 0.00 ? 201 THR A H    1  
ATOM 3198  H HA   . THR A 1 201 ? 18.102  -3.018  -17.123 1.00 0.00 ? 201 THR A HA   1  
ATOM 3199  H HB   . THR A 1 201 ? 16.655  -0.780  -16.739 1.00 0.00 ? 201 THR A HB   1  
ATOM 3200  H HG1  . THR A 1 201 ? 18.714  -0.996  -18.666 1.00 0.00 ? 201 THR A HG1  1  
ATOM 3201  H HG21 . THR A 1 201 ? 19.374  0.389   -17.112 1.00 0.00 ? 201 THR A HG21 1  
ATOM 3202  H HG22 . THR A 1 201 ? 18.697  0.209   -15.497 1.00 0.00 ? 201 THR A HG22 1  
ATOM 3203  H HG23 . THR A 1 201 ? 17.855  1.183   -16.696 1.00 0.00 ? 201 THR A HG23 1  
ATOM 3204  N N    . LEU A 1 202 ? 20.498  -2.920  -16.560 1.00 0.00 ? 202 LEU A N    1  
ATOM 3205  C CA   . LEU A 1 202 ? 21.921  -2.927  -16.232 1.00 0.00 ? 202 LEU A CA   1  
ATOM 3206  C C    . LEU A 1 202 ? 22.655  -1.857  -17.048 1.00 0.00 ? 202 LEU A C    1  
ATOM 3207  O O    . LEU A 1 202 ? 22.125  -1.359  -18.041 1.00 0.00 ? 202 LEU A O    1  
ATOM 3208  C CB   . LEU A 1 202 ? 22.500  -4.320  -16.505 1.00 0.00 ? 202 LEU A CB   1  
ATOM 3209  C CG   . LEU A 1 202 ? 23.975  -4.547  -16.135 1.00 0.00 ? 202 LEU A CG   1  
ATOM 3210  C CD1  . LEU A 1 202 ? 24.345  -3.896  -14.814 1.00 0.00 ? 202 LEU A CD1  1  
ATOM 3211  C CD2  . LEU A 1 202 ? 24.258  -6.032  -16.058 1.00 0.00 ? 202 LEU A CD2  1  
ATOM 3212  H H    . LEU A 1 202 ? 20.166  -3.512  -17.267 1.00 0.00 ? 202 LEU A H    1  
ATOM 3213  H HA   . LEU A 1 202 ? 22.018  -2.704  -15.182 1.00 0.00 ? 202 LEU A HA   1  
ATOM 3214  H HB2  . LEU A 1 202 ? 21.908  -5.038  -15.958 1.00 0.00 ? 202 LEU A HB2  1  
ATOM 3215  H HB3  . LEU A 1 202 ? 22.386  -4.524  -17.558 1.00 0.00 ? 202 LEU A HB3  1  
ATOM 3216  H HG   . LEU A 1 202 ? 24.608  -4.127  -16.902 1.00 0.00 ? 202 LEU A HG   1  
ATOM 3217  H HD11 . LEU A 1 202 ? 25.320  -3.447  -14.905 1.00 0.00 ? 202 LEU A HD11 1  
ATOM 3218  H HD12 . LEU A 1 202 ? 24.369  -4.646  -14.038 1.00 0.00 ? 202 LEU A HD12 1  
ATOM 3219  H HD13 . LEU A 1 202 ? 23.622  -3.139  -14.558 1.00 0.00 ? 202 LEU A HD13 1  
ATOM 3220  H HD21 . LEU A 1 202 ? 23.562  -6.486  -15.367 1.00 0.00 ? 202 LEU A HD21 1  
ATOM 3221  H HD22 . LEU A 1 202 ? 25.267  -6.186  -15.706 1.00 0.00 ? 202 LEU A HD22 1  
ATOM 3222  H HD23 . LEU A 1 202 ? 24.141  -6.475  -17.035 1.00 0.00 ? 202 LEU A HD23 1  
ATOM 3223  N N    . LEU A 1 203 ? 23.874  -1.511  -16.637 1.00 0.00 ? 203 LEU A N    1  
ATOM 3224  C CA   . LEU A 1 203 ? 24.668  -0.512  -17.340 1.00 0.00 ? 203 LEU A CA   1  
ATOM 3225  C C    . LEU A 1 203 ? 25.881  -1.190  -17.928 1.00 0.00 ? 203 LEU A C    1  
ATOM 3226  O O    . LEU A 1 203 ? 26.295  -2.231  -17.427 1.00 0.00 ? 203 LEU A O    1  
ATOM 3227  C CB   . LEU A 1 203 ? 25.092  0.635   -16.410 1.00 0.00 ? 203 LEU A CB   1  
ATOM 3228  C CG   . LEU A 1 203 ? 25.252  0.282   -14.925 1.00 0.00 ? 203 LEU A CG   1  
ATOM 3229  C CD1  . LEU A 1 203 ? 26.722  0.156   -14.561 1.00 0.00 ? 203 LEU A CD1  1  
ATOM 3230  C CD2  . LEU A 1 203 ? 24.583  1.336   -14.054 1.00 0.00 ? 203 LEU A CD2  1  
ATOM 3231  H H    . LEU A 1 203 ? 24.261  -1.942  -15.849 1.00 0.00 ? 203 LEU A H    1  
ATOM 3232  H HA   . LEU A 1 203 ? 24.072  -0.112  -18.146 1.00 0.00 ? 203 LEU A HA   1  
ATOM 3233  H HB2  . LEU A 1 203 ? 26.036  1.022   -16.766 1.00 0.00 ? 203 LEU A HB2  1  
ATOM 3234  H HB3  . LEU A 1 203 ? 24.354  1.420   -16.491 1.00 0.00 ? 203 LEU A HB3  1  
ATOM 3235  H HG   . LEU A 1 203 ? 24.777  -0.665  -14.727 1.00 0.00 ? 203 LEU A HG   1  
ATOM 3236  H HD11 . LEU A 1 203 ? 26.849  -0.640  -13.845 1.00 0.00 ? 203 LEU A HD11 1  
ATOM 3237  H HD12 . LEU A 1 203 ? 27.065  1.084   -14.129 1.00 0.00 ? 203 LEU A HD12 1  
ATOM 3238  H HD13 . LEU A 1 203 ? 27.296  -0.062  -15.449 1.00 0.00 ? 203 LEU A HD13 1  
ATOM 3239  H HD21 . LEU A 1 203 ? 23.827  1.850   -14.627 1.00 0.00 ? 203 LEU A HD21 1  
ATOM 3240  H HD22 . LEU A 1 203 ? 25.324  2.046   -13.716 1.00 0.00 ? 203 LEU A HD22 1  
ATOM 3241  H HD23 . LEU A 1 203 ? 24.126  0.859   -13.200 1.00 0.00 ? 203 LEU A HD23 1  
ATOM 3242  N N    . PRO A 1 204 ? 26.486  -0.627  -18.985 1.00 0.00 ? 204 PRO A N    1  
ATOM 3243  C CA   . PRO A 1 204 ? 27.661  -1.230  -19.589 1.00 0.00 ? 204 PRO A CA   1  
ATOM 3244  C C    . PRO A 1 204 ? 28.646  -1.592  -18.491 1.00 0.00 ? 204 PRO A C    1  
ATOM 3245  O O    . PRO A 1 204 ? 29.334  -0.727  -17.947 1.00 0.00 ? 204 PRO A O    1  
ATOM 3246  C CB   . PRO A 1 204 ? 28.210  -0.158  -20.537 1.00 0.00 ? 204 PRO A CB   1  
ATOM 3247  C CG   . PRO A 1 204 ? 27.355  1.059   -20.342 1.00 0.00 ? 204 PRO A CG   1  
ATOM 3248  C CD   . PRO A 1 204 ? 26.101  0.628   -19.632 1.00 0.00 ? 204 PRO A CD   1  
ATOM 3249  H HA   . PRO A 1 204 ? 27.402  -2.119  -20.148 1.00 0.00 ? 204 PRO A HA   1  
ATOM 3250  H HB2  . PRO A 1 204 ? 29.241  0.040   -20.295 1.00 0.00 ? 204 PRO A HB2  1  
ATOM 3251  H HB3  . PRO A 1 204 ? 28.146  -0.517  -21.554 1.00 0.00 ? 204 PRO A HB3  1  
ATOM 3252  H HG2  . PRO A 1 204 ? 27.878  1.779   -19.754 1.00 0.00 ? 204 PRO A HG2  1  
ATOM 3253  H HG3  . PRO A 1 204 ? 27.109  1.485   -21.294 1.00 0.00 ? 204 PRO A HG3  1  
ATOM 3254  H HD2  . PRO A 1 204 ? 25.814  1.364   -18.897 1.00 0.00 ? 204 PRO A HD2  1  
ATOM 3255  H HD3  . PRO A 1 204 ? 25.310  0.472   -20.332 1.00 0.00 ? 204 PRO A HD3  1  
ATOM 3256  N N    . PRO A 1 205 ? 28.687  -2.879  -18.112 1.00 0.00 ? 205 PRO A N    1  
ATOM 3257  C CA   . PRO A 1 205 ? 29.547  -3.349  -17.030 1.00 0.00 ? 205 PRO A CA   1  
ATOM 3258  C C    . PRO A 1 205 ? 31.020  -3.215  -17.359 1.00 0.00 ? 205 PRO A C    1  
ATOM 3259  O O    . PRO A 1 205 ? 31.548  -3.869  -18.258 1.00 0.00 ? 205 PRO A O    1  
ATOM 3260  C CB   . PRO A 1 205 ? 29.111  -4.796  -16.847 1.00 0.00 ? 205 PRO A CB   1  
ATOM 3261  C CG   . PRO A 1 205 ? 28.576  -5.198  -18.172 1.00 0.00 ? 205 PRO A CG   1  
ATOM 3262  C CD   . PRO A 1 205 ? 27.880  -3.977  -18.689 1.00 0.00 ? 205 PRO A CD   1  
ATOM 3263  H HA   . PRO A 1 205 ? 29.351  -2.807  -16.110 1.00 0.00 ? 205 PRO A HA   1  
ATOM 3264  H HB2  . PRO A 1 205 ? 29.950  -5.403  -16.547 1.00 0.00 ? 205 PRO A HB2  1  
ATOM 3265  H HB3  . PRO A 1 205 ? 28.338  -4.820  -16.090 1.00 0.00 ? 205 PRO A HB3  1  
ATOM 3266  H HG2  . PRO A 1 205 ? 29.386  -5.481  -18.828 1.00 0.00 ? 205 PRO A HG2  1  
ATOM 3267  H HG3  . PRO A 1 205 ? 27.875  -6.012  -18.059 1.00 0.00 ? 205 PRO A HG3  1  
ATOM 3268  H HD2  . PRO A 1 205 ? 27.909  -3.956  -19.769 1.00 0.00 ? 205 PRO A HD2  1  
ATOM 3269  H HD3  . PRO A 1 205 ? 26.863  -3.943  -18.334 1.00 0.00 ? 205 PRO A HD3  1  
ATOM 3270  N N    . GLY A 1 206 ? 31.659  -2.329  -16.615 1.00 0.00 ? 206 GLY A N    1  
ATOM 3271  C CA   . GLY A 1 206 ? 33.069  -2.050  -16.801 1.00 0.00 ? 206 GLY A CA   1  
ATOM 3272  C C    . GLY A 1 206 ? 33.929  -3.296  -16.711 1.00 0.00 ? 206 GLY A C    1  
ATOM 3273  O O    . GLY A 1 206 ? 34.445  -3.776  -17.720 1.00 0.00 ? 206 GLY A O    1  
ATOM 3274  H H    . GLY A 1 206 ? 31.151  -1.849  -15.930 1.00 0.00 ? 206 GLY A H    1  
ATOM 3275  H HA2  . GLY A 1 206 ? 33.206  -1.594  -17.772 1.00 0.00 ? 206 GLY A HA2  1  
ATOM 3276  H HA3  . GLY A 1 206 ? 33.386  -1.348  -16.043 1.00 0.00 ? 206 GLY A HA3  1  
ATOM 3277  N N    . GLN A 1 207 ? 34.080  -3.821  -15.500 1.00 0.00 ? 207 GLN A N    1  
ATOM 3278  C CA   . GLN A 1 207 ? 34.881  -5.021  -15.280 1.00 0.00 ? 207 GLN A CA   1  
ATOM 3279  C C    . GLN A 1 207 ? 36.329  -4.799  -15.704 1.00 0.00 ? 207 GLN A C    1  
ATOM 3280  O O    . GLN A 1 207 ? 36.994  -5.719  -16.179 1.00 0.00 ? 207 GLN A O    1  
ATOM 3281  C CB   . GLN A 1 207 ? 34.288  -6.202  -16.050 1.00 0.00 ? 207 GLN A CB   1  
ATOM 3282  C CG   . GLN A 1 207 ? 33.131  -6.878  -15.331 1.00 0.00 ? 207 GLN A CG   1  
ATOM 3283  C CD   . GLN A 1 207 ? 33.245  -8.390  -15.336 1.00 0.00 ? 207 GLN A CD   1  
ATOM 3284  O OE1  . GLN A 1 207 ? 34.024  -8.968  -14.578 1.00 0.00 ? 207 GLN A OE1  1  
ATOM 3285  N NE2  . GLN A 1 207 ? 32.465  -9.039  -16.194 1.00 0.00 ? 207 GLN A NE2  1  
ATOM 3286  H H    . GLN A 1 207 ? 33.641  -3.393  -14.735 1.00 0.00 ? 207 GLN A H    1  
ATOM 3287  H HA   . GLN A 1 207 ? 34.858  -5.244  -14.224 1.00 0.00 ? 207 GLN A HA   1  
ATOM 3288  H HB2  . GLN A 1 207 ? 33.932  -5.851  -17.008 1.00 0.00 ? 207 GLN A HB2  1  
ATOM 3289  H HB3  . GLN A 1 207 ? 35.063  -6.937  -16.212 1.00 0.00 ? 207 GLN A HB3  1  
ATOM 3290  H HG2  . GLN A 1 207 ? 33.113  -6.538  -14.307 1.00 0.00 ? 207 GLN A HG2  1  
ATOM 3291  H HG3  . GLN A 1 207 ? 32.209  -6.599  -15.819 1.00 0.00 ? 207 GLN A HG3  1  
ATOM 3292  H HE21 . GLN A 1 207 ? 31.869  -8.513  -16.767 1.00 0.00 ? 207 GLN A HE21 1  
ATOM 3293  H HE22 . GLN A 1 207 ? 32.518  -10.017 -16.218 1.00 0.00 ? 207 GLN A HE22 1  
ATOM 3294  N N    . GLU A 1 208 ? 36.812  -3.572  -15.526 1.00 0.00 ? 208 GLU A N    1  
ATOM 3295  C CA   . GLU A 1 208 ? 38.184  -3.228  -15.889 1.00 0.00 ? 208 GLU A CA   1  
ATOM 3296  C C    . GLU A 1 208 ? 38.389  -3.319  -17.399 1.00 0.00 ? 208 GLU A C    1  
ATOM 3297  O O    . GLU A 1 208 ? 38.450  -2.302  -18.089 1.00 0.00 ? 208 GLU A O    1  
ATOM 3298  C CB   . GLU A 1 208 ? 39.174  -4.146  -15.167 1.00 0.00 ? 208 GLU A CB   1  
ATOM 3299  C CG   . GLU A 1 208 ? 40.183  -3.399  -14.309 1.00 0.00 ? 208 GLU A CG   1  
ATOM 3300  C CD   . GLU A 1 208 ? 41.514  -3.209  -15.009 1.00 0.00 ? 208 GLU A CD   1  
ATOM 3301  O OE1  . GLU A 1 208 ? 41.853  -4.040  -15.877 1.00 0.00 ? 208 GLU A OE1  1  
ATOM 3302  O OE2  . GLU A 1 208 ? 42.218  -2.228  -14.689 1.00 0.00 ? 208 GLU A OE2  1  
ATOM 3303  H H    . GLU A 1 208 ? 36.233  -2.882  -15.141 1.00 0.00 ? 208 GLU A H    1  
ATOM 3304  H HA   . GLU A 1 208 ? 38.361  -2.209  -15.577 1.00 0.00 ? 208 GLU A HA   1  
ATOM 3305  H HB2  . GLU A 1 208 ? 38.622  -4.821  -14.529 1.00 0.00 ? 208 GLU A HB2  1  
ATOM 3306  H HB3  . GLU A 1 208 ? 39.717  -4.724  -15.901 1.00 0.00 ? 208 GLU A HB3  1  
ATOM 3307  H HG2  . GLU A 1 208 ? 39.780  -2.428  -14.066 1.00 0.00 ? 208 GLU A HG2  1  
ATOM 3308  H HG3  . GLU A 1 208 ? 40.347  -3.959  -13.400 1.00 0.00 ? 208 GLU A HG3  1  
ATOM 3309  N N    . SER A 1 209 ? 38.494  -4.545  -17.904 1.00 0.00 ? 209 SER A N    1  
ATOM 3310  C CA   . SER A 1 209 ? 38.693  -4.770  -19.331 1.00 0.00 ? 209 SER A CA   1  
ATOM 3311  C C    . SER A 1 209 ? 40.016  -4.172  -19.798 1.00 0.00 ? 209 SER A C    1  
ATOM 3312  O O    . SER A 1 209 ? 40.140  -3.726  -20.939 1.00 0.00 ? 209 SER A O    1  
ATOM 3313  C CB   . SER A 1 209 ? 37.536  -4.167  -20.130 1.00 0.00 ? 209 SER A CB   1  
ATOM 3314  O OG   . SER A 1 209 ? 37.192  -4.990  -21.232 1.00 0.00 ? 209 SER A OG   1  
ATOM 3315  H H    . SER A 1 209 ? 38.437  -5.316  -17.302 1.00 0.00 ? 209 SER A H    1  
ATOM 3316  H HA   . SER A 1 209 ? 38.716  -5.836  -19.498 1.00 0.00 ? 209 SER A HA   1  
ATOM 3317  H HB2  . SER A 1 209 ? 36.672  -4.067  -19.490 1.00 0.00 ? 209 SER A HB2  1  
ATOM 3318  H HB3  . SER A 1 209 ? 37.824  -3.193  -20.499 1.00 0.00 ? 209 SER A HB3  1  
ATOM 3319  H HG   . SER A 1 209 ? 37.980  -5.184  -21.745 1.00 0.00 ? 209 SER A HG   1  
ATOM 3320  N N    . GLU A 1 210 ? 41.003  -4.166  -18.907 1.00 0.00 ? 210 GLU A N    1  
ATOM 3321  C CA   . GLU A 1 210 ? 42.318  -3.624  -19.228 1.00 0.00 ? 210 GLU A CA   1  
ATOM 3322  C C    . GLU A 1 210 ? 42.222  -2.146  -19.597 1.00 0.00 ? 210 GLU A C    1  
ATOM 3323  O O    . GLU A 1 210 ? 42.654  -1.734  -20.674 1.00 0.00 ? 210 GLU A O    1  
ATOM 3324  C CB   . GLU A 1 210 ? 42.950  -4.413  -20.377 1.00 0.00 ? 210 GLU A CB   1  
ATOM 3325  C CG   . GLU A 1 210 ? 44.395  -4.030  -20.655 1.00 0.00 ? 210 GLU A CG   1  
ATOM 3326  C CD   . GLU A 1 210 ? 44.700  -3.945  -22.137 1.00 0.00 ? 210 GLU A CD   1  
ATOM 3327  O OE1  . GLU A 1 210 ? 44.324  -4.880  -22.876 1.00 0.00 ? 210 GLU A OE1  1  
ATOM 3328  O OE2  . GLU A 1 210 ? 45.315  -2.944  -22.561 1.00 0.00 ? 210 GLU A OE2  1  
ATOM 3329  H H    . GLU A 1 210 ? 40.843  -4.536  -18.014 1.00 0.00 ? 210 GLU A H    1  
ATOM 3330  H HA   . GLU A 1 210 ? 42.939  -3.723  -18.350 1.00 0.00 ? 210 GLU A HA   1  
ATOM 3331  H HB2  . GLU A 1 210 ? 42.919  -5.465  -20.135 1.00 0.00 ? 210 GLU A HB2  1  
ATOM 3332  H HB3  . GLU A 1 210 ? 42.375  -4.241  -21.275 1.00 0.00 ? 210 GLU A HB3  1  
ATOM 3333  H HG2  . GLU A 1 210 ? 44.591  -3.068  -20.207 1.00 0.00 ? 210 GLU A HG2  1  
ATOM 3334  H HG3  . GLU A 1 210 ? 45.042  -4.772  -20.210 1.00 0.00 ? 210 GLU A HG3  1  
ATOM 3335  N N    . PHE A 1 211 ? 41.652  -1.353  -18.696 1.00 0.00 ? 211 PHE A N    1  
ATOM 3336  C CA   . PHE A 1 211 ? 41.499  0.079   -18.926 1.00 0.00 ? 211 PHE A CA   1  
ATOM 3337  C C    . PHE A 1 211 ? 42.233  0.884   -17.858 1.00 0.00 ? 211 PHE A C    1  
ATOM 3338  O O    . PHE A 1 211 ? 43.099  1.702   -18.168 1.00 0.00 ? 211 PHE A O    1  
ATOM 3339  C CB   . PHE A 1 211 ? 40.017  0.459   -18.938 1.00 0.00 ? 211 PHE A CB   1  
ATOM 3340  C CG   . PHE A 1 211 ? 39.679  1.524   -19.942 1.00 0.00 ? 211 PHE A CG   1  
ATOM 3341  C CD1  . PHE A 1 211 ? 39.445  1.196   -21.268 1.00 0.00 ? 211 PHE A CD1  1  
ATOM 3342  C CD2  . PHE A 1 211 ? 39.594  2.854   -19.559 1.00 0.00 ? 211 PHE A CD2  1  
ATOM 3343  C CE1  . PHE A 1 211 ? 39.133  2.174   -22.193 1.00 0.00 ? 211 PHE A CE1  1  
ATOM 3344  C CE2  . PHE A 1 211 ? 39.283  3.836   -20.481 1.00 0.00 ? 211 PHE A CE2  1  
ATOM 3345  C CZ   . PHE A 1 211 ? 39.052  3.495   -21.799 1.00 0.00 ? 211 PHE A CZ   1  
ATOM 3346  H H    . PHE A 1 211 ? 41.327  -1.740  -17.856 1.00 0.00 ? 211 PHE A H    1  
ATOM 3347  H HA   . PHE A 1 211 ? 41.928  0.308   -19.890 1.00 0.00 ? 211 PHE A HA   1  
ATOM 3348  H HB2  . PHE A 1 211 ? 39.430  -0.416  -19.173 1.00 0.00 ? 211 PHE A HB2  1  
ATOM 3349  H HB3  . PHE A 1 211 ? 39.737  0.822   -17.960 1.00 0.00 ? 211 PHE A HB3  1  
ATOM 3350  H HD1  . PHE A 1 211 ? 39.508  0.163   -21.577 1.00 0.00 ? 211 PHE A HD1  1  
ATOM 3351  H HD2  . PHE A 1 211 ? 39.774  3.121   -18.529 1.00 0.00 ? 211 PHE A HD2  1  
ATOM 3352  H HE1  . PHE A 1 211 ? 38.954  1.905   -23.224 1.00 0.00 ? 211 PHE A HE1  1  
ATOM 3353  H HE2  . PHE A 1 211 ? 39.220  4.868   -20.170 1.00 0.00 ? 211 PHE A HE2  1  
ATOM 3354  H HZ   . PHE A 1 211 ? 38.808  4.261   -22.521 1.00 0.00 ? 211 PHE A HZ   1  
ATOM 3355  N N    . SER A 1 212 ? 41.880  0.646   -16.598 1.00 0.00 ? 212 SER A N    1  
ATOM 3356  C CA   . SER A 1 212 ? 42.506  1.348   -15.484 1.00 0.00 ? 212 SER A CA   1  
ATOM 3357  C C    . SER A 1 212 ? 42.282  2.853   -15.595 1.00 0.00 ? 212 SER A C    1  
ATOM 3358  O O    . SER A 1 212 ? 41.282  3.345   -15.031 1.00 0.00 ? 212 SER A O    1  
ATOM 3359  C CB   . SER A 1 212 ? 44.004  1.046   -15.439 1.00 0.00 ? 212 SER A CB   1  
ATOM 3360  O OG   . SER A 1 212 ? 44.280  -0.246  -15.952 1.00 0.00 ? 212 SER A OG   1  
ATOM 3361  O OXT  . SER A 1 212 ? 43.109  3.527   -16.245 1.00 0.00 ? 212 SER A OXT  1  
ATOM 3362  H H    . SER A 1 212 ? 41.183  -0.018  -16.414 1.00 0.00 ? 212 SER A H    1  
ATOM 3363  H HA   . SER A 1 212 ? 42.048  0.995   -14.572 1.00 0.00 ? 212 SER A HA   1  
ATOM 3364  H HB2  . SER A 1 212 ? 44.535  1.775   -16.031 1.00 0.00 ? 212 SER A HB2  1  
ATOM 3365  H HB3  . SER A 1 212 ? 44.348  1.094   -14.416 1.00 0.00 ? 212 SER A HB3  1  
ATOM 3366  H HG   . SER A 1 212 ? 43.655  -0.876  -15.587 1.00 0.00 ? 212 SER A HG   1  
ATOM 3367  N N    . SER A 1 1   ? 0.301   -20.900 1.676   1.00 0.00 ? 1   SER A N    2  
ATOM 3368  C CA   . SER A 1 1   ? 1.075   -21.775 2.595   1.00 0.00 ? 1   SER A CA   2  
ATOM 3369  C C    . SER A 1 1   ? 0.404   -21.870 3.961   1.00 0.00 ? 1   SER A C    2  
ATOM 3370  O O    . SER A 1 1   ? 0.203   -22.962 4.491   1.00 0.00 ? 1   SER A O    2  
ATOM 3371  C CB   . SER A 1 1   ? 2.489   -21.205 2.735   1.00 0.00 ? 1   SER A CB   2  
ATOM 3372  O OG   . SER A 1 1   ? 3.431   -21.995 2.030   1.00 0.00 ? 1   SER A OG   2  
ATOM 3373  H H1   . SER A 1 1   ? -0.698  -21.183 1.736   1.00 0.00 ? 1   SER A H1   2  
ATOM 3374  H H2   . SER A 1 1   ? 0.675   -21.040 0.715   1.00 0.00 ? 1   SER A H2   2  
ATOM 3375  H H3   . SER A 1 1   ? 0.430   -19.918 1.990   1.00 0.00 ? 1   SER A H3   2  
ATOM 3376  H HA   . SER A 1 1   ? 1.132   -22.763 2.161   1.00 0.00 ? 1   SER A HA   2  
ATOM 3377  H HB2  . SER A 1 1   ? 2.511   -20.202 2.336   1.00 0.00 ? 1   SER A HB2  2  
ATOM 3378  H HB3  . SER A 1 1   ? 2.765   -21.182 3.779   1.00 0.00 ? 1   SER A HB3  2  
ATOM 3379  H HG   . SER A 1 1   ? 3.565   -22.824 2.495   1.00 0.00 ? 1   SER A HG   2  
ATOM 3380  N N    . TYR A 1 2   ? 0.060   -20.717 4.526   1.00 0.00 ? 2   TYR A N    2  
ATOM 3381  C CA   . TYR A 1 2   ? -0.590  -20.670 5.831   1.00 0.00 ? 2   TYR A CA   2  
ATOM 3382  C C    . TYR A 1 2   ? -1.995  -20.088 5.717   1.00 0.00 ? 2   TYR A C    2  
ATOM 3383  O O    . TYR A 1 2   ? -2.490  -19.446 6.644   1.00 0.00 ? 2   TYR A O    2  
ATOM 3384  C CB   . TYR A 1 2   ? 0.242   -19.839 6.809   1.00 0.00 ? 2   TYR A CB   2  
ATOM 3385  C CG   . TYR A 1 2   ? 0.496   -18.424 6.341   1.00 0.00 ? 2   TYR A CG   2  
ATOM 3386  C CD1  . TYR A 1 2   ? -0.397  -17.402 6.638   1.00 0.00 ? 2   TYR A CD1  2  
ATOM 3387  C CD2  . TYR A 1 2   ? 1.630   -18.110 5.603   1.00 0.00 ? 2   TYR A CD2  2  
ATOM 3388  C CE1  . TYR A 1 2   ? -0.168  -16.108 6.212   1.00 0.00 ? 2   TYR A CE1  2  
ATOM 3389  C CE2  . TYR A 1 2   ? 1.867   -16.818 5.173   1.00 0.00 ? 2   TYR A CE2  2  
ATOM 3390  C CZ   . TYR A 1 2   ? 0.965   -15.821 5.480   1.00 0.00 ? 2   TYR A CZ   2  
ATOM 3391  O OH   . TYR A 1 2   ? 1.198   -14.533 5.054   1.00 0.00 ? 2   TYR A OH   2  
ATOM 3392  H H    . TYR A 1 2   ? 0.246   -19.878 4.055   1.00 0.00 ? 2   TYR A H    2  
ATOM 3393  H HA   . TYR A 1 2   ? -0.661  -21.681 6.203   1.00 0.00 ? 2   TYR A HA   2  
ATOM 3394  H HB2  . TYR A 1 2   ? -0.275  -19.786 7.756   1.00 0.00 ? 2   TYR A HB2  2  
ATOM 3395  H HB3  . TYR A 1 2   ? 1.199   -20.318 6.954   1.00 0.00 ? 2   TYR A HB3  2  
ATOM 3396  H HD1  . TYR A 1 2   ? -1.284  -17.630 7.211   1.00 0.00 ? 2   TYR A HD1  2  
ATOM 3397  H HD2  . TYR A 1 2   ? 2.334   -18.893 5.364   1.00 0.00 ? 2   TYR A HD2  2  
ATOM 3398  H HE1  . TYR A 1 2   ? -0.874  -15.327 6.452   1.00 0.00 ? 2   TYR A HE1  2  
ATOM 3399  H HE2  . TYR A 1 2   ? 2.754   -16.594 4.600   1.00 0.00 ? 2   TYR A HE2  2  
ATOM 3400  H HH   . TYR A 1 2   ? 1.029   -13.922 5.775   1.00 0.00 ? 2   TYR A HH   2  
ATOM 3401  N N    . ASP A 1 3   ? -2.633  -20.317 4.574   1.00 0.00 ? 3   ASP A N    2  
ATOM 3402  C CA   . ASP A 1 3   ? -3.982  -19.817 4.337   1.00 0.00 ? 3   ASP A CA   2  
ATOM 3403  C C    . ASP A 1 3   ? -5.026  -20.817 4.823   1.00 0.00 ? 3   ASP A C    2  
ATOM 3404  O O    . ASP A 1 3   ? -5.042  -21.970 4.392   1.00 0.00 ? 3   ASP A O    2  
ATOM 3405  C CB   . ASP A 1 3   ? -4.187  -19.532 2.848   1.00 0.00 ? 3   ASP A CB   2  
ATOM 3406  C CG   . ASP A 1 3   ? -3.624  -18.186 2.434   1.00 0.00 ? 3   ASP A CG   2  
ATOM 3407  O OD1  . ASP A 1 3   ? -3.641  -17.254 3.265   1.00 0.00 ? 3   ASP A OD1  2  
ATOM 3408  O OD2  . ASP A 1 3   ? -3.166  -18.065 1.279   1.00 0.00 ? 3   ASP A OD2  2  
ATOM 3409  H H    . ASP A 1 3   ? -2.186  -20.836 3.873   1.00 0.00 ? 3   ASP A H    2  
ATOM 3410  H HA   . ASP A 1 3   ? -4.097  -18.897 4.890   1.00 0.00 ? 3   ASP A HA   2  
ATOM 3411  H HB2  . ASP A 1 3   ? -3.696  -20.300 2.270   1.00 0.00 ? 3   ASP A HB2  2  
ATOM 3412  H HB3  . ASP A 1 3   ? -5.244  -19.543 2.628   1.00 0.00 ? 3   ASP A HB3  2  
ATOM 3413  N N    . SER A 1 4   ? -5.896  -20.367 5.721   1.00 0.00 ? 4   SER A N    2  
ATOM 3414  C CA   . SER A 1 4   ? -6.944  -21.224 6.264   1.00 0.00 ? 4   SER A CA   2  
ATOM 3415  C C    . SER A 1 4   ? -8.277  -20.963 5.563   1.00 0.00 ? 4   SER A C    2  
ATOM 3416  O O    . SER A 1 4   ? -8.689  -19.814 5.410   1.00 0.00 ? 4   SER A O    2  
ATOM 3417  C CB   . SER A 1 4   ? -7.092  -20.990 7.769   1.00 0.00 ? 4   SER A CB   2  
ATOM 3418  O OG   . SER A 1 4   ? -6.718  -19.670 8.121   1.00 0.00 ? 4   SER A OG   2  
ATOM 3419  H H    . SER A 1 4   ? -5.832  -19.438 6.025   1.00 0.00 ? 4   SER A H    2  
ATOM 3420  H HA   . SER A 1 4   ? -6.652  -22.248 6.096   1.00 0.00 ? 4   SER A HA   2  
ATOM 3421  H HB2  . SER A 1 4   ? -8.121  -21.147 8.056   1.00 0.00 ? 4   SER A HB2  2  
ATOM 3422  H HB3  . SER A 1 4   ? -6.460  -21.685 8.303   1.00 0.00 ? 4   SER A HB3  2  
ATOM 3423  H HG   . SER A 1 4   ? -6.063  -19.699 8.823   1.00 0.00 ? 4   SER A HG   2  
ATOM 3424  N N    . PRO A 1 5   ? -8.973  -22.030 5.126   1.00 0.00 ? 5   PRO A N    2  
ATOM 3425  C CA   . PRO A 1 5   ? -10.264 -21.899 4.441   1.00 0.00 ? 5   PRO A CA   2  
ATOM 3426  C C    . PRO A 1 5   ? -11.264 -21.074 5.243   1.00 0.00 ? 5   PRO A C    2  
ATOM 3427  O O    . PRO A 1 5   ? -11.032 -20.764 6.412   1.00 0.00 ? 5   PRO A O    2  
ATOM 3428  C CB   . PRO A 1 5   ? -10.749 -23.344 4.309   1.00 0.00 ? 5   PRO A CB   2  
ATOM 3429  C CG   . PRO A 1 5   ? -9.510  -24.168 4.352   1.00 0.00 ? 5   PRO A CG   2  
ATOM 3430  C CD   . PRO A 1 5   ? -8.562  -23.440 5.263   1.00 0.00 ? 5   PRO A CD   2  
ATOM 3431  H HA   . PRO A 1 5   ? -10.147 -21.464 3.459   1.00 0.00 ? 5   PRO A HA   2  
ATOM 3432  H HB2  . PRO A 1 5   ? -11.410 -23.581 5.130   1.00 0.00 ? 5   PRO A HB2  2  
ATOM 3433  H HB3  . PRO A 1 5   ? -11.272 -23.468 3.372   1.00 0.00 ? 5   PRO A HB3  2  
ATOM 3434  H HG2  . PRO A 1 5   ? -9.733  -25.148 4.748   1.00 0.00 ? 5   PRO A HG2  2  
ATOM 3435  H HG3  . PRO A 1 5   ? -9.088  -24.249 3.361   1.00 0.00 ? 5   PRO A HG3  2  
ATOM 3436  H HD2  . PRO A 1 5   ? -8.681  -23.779 6.282   1.00 0.00 ? 5   PRO A HD2  2  
ATOM 3437  H HD3  . PRO A 1 5   ? -7.542  -23.577 4.934   1.00 0.00 ? 5   PRO A HD3  2  
ATOM 3438  N N    . ASP A 1 6   ? -12.377 -20.721 4.608   1.00 0.00 ? 6   ASP A N    2  
ATOM 3439  C CA   . ASP A 1 6   ? -13.414 -19.932 5.263   1.00 0.00 ? 6   ASP A CA   2  
ATOM 3440  C C    . ASP A 1 6   ? -14.784 -20.233 4.665   1.00 0.00 ? 6   ASP A C    2  
ATOM 3441  O O    . ASP A 1 6   ? -14.889 -20.868 3.615   1.00 0.00 ? 6   ASP A O    2  
ATOM 3442  C CB   . ASP A 1 6   ? -13.103 -18.439 5.137   1.00 0.00 ? 6   ASP A CB   2  
ATOM 3443  C CG   . ASP A 1 6   ? -12.543 -17.854 6.419   1.00 0.00 ? 6   ASP A CG   2  
ATOM 3444  O OD1  . ASP A 1 6   ? -11.534 -18.388 6.925   1.00 0.00 ? 6   ASP A OD1  2  
ATOM 3445  O OD2  . ASP A 1 6   ? -13.114 -16.861 6.917   1.00 0.00 ? 6   ASP A OD2  2  
ATOM 3446  H H    . ASP A 1 6   ? -12.504 -20.999 3.677   1.00 0.00 ? 6   ASP A H    2  
ATOM 3447  H HA   . ASP A 1 6   ? -13.424 -20.201 6.309   1.00 0.00 ? 6   ASP A HA   2  
ATOM 3448  H HB2  . ASP A 1 6   ? -12.376 -18.294 4.351   1.00 0.00 ? 6   ASP A HB2  2  
ATOM 3449  H HB3  . ASP A 1 6   ? -14.009 -17.907 4.886   1.00 0.00 ? 6   ASP A HB3  2  
ATOM 3450  N N    . TYR A 1 7   ? -15.833 -19.774 5.340   1.00 0.00 ? 7   TYR A N    2  
ATOM 3451  C CA   . TYR A 1 7   ? -17.197 -19.994 4.875   1.00 0.00 ? 7   TYR A CA   2  
ATOM 3452  C C    . TYR A 1 7   ? -17.672 -18.831 4.010   1.00 0.00 ? 7   TYR A C    2  
ATOM 3453  O O    . TYR A 1 7   ? -18.331 -17.912 4.496   1.00 0.00 ? 7   TYR A O    2  
ATOM 3454  C CB   . TYR A 1 7   ? -18.141 -20.178 6.065   1.00 0.00 ? 7   TYR A CB   2  
ATOM 3455  C CG   . TYR A 1 7   ? -17.957 -21.494 6.786   1.00 0.00 ? 7   TYR A CG   2  
ATOM 3456  C CD1  . TYR A 1 7   ? -18.674 -22.622 6.406   1.00 0.00 ? 7   TYR A CD1  2  
ATOM 3457  C CD2  . TYR A 1 7   ? -17.066 -21.609 7.845   1.00 0.00 ? 7   TYR A CD2  2  
ATOM 3458  C CE1  . TYR A 1 7   ? -18.509 -23.827 7.062   1.00 0.00 ? 7   TYR A CE1  2  
ATOM 3459  C CE2  . TYR A 1 7   ? -16.894 -22.811 8.506   1.00 0.00 ? 7   TYR A CE2  2  
ATOM 3460  C CZ   . TYR A 1 7   ? -17.618 -23.916 8.111   1.00 0.00 ? 7   TYR A CZ   2  
ATOM 3461  O OH   . TYR A 1 7   ? -17.450 -25.114 8.766   1.00 0.00 ? 7   TYR A OH   2  
ATOM 3462  H H    . TYR A 1 7   ? -15.686 -19.275 6.171   1.00 0.00 ? 7   TYR A H    2  
ATOM 3463  H HA   . TYR A 1 7   ? -17.203 -20.895 4.280   1.00 0.00 ? 7   TYR A HA   2  
ATOM 3464  H HB2  . TYR A 1 7   ? -17.970 -19.384 6.777   1.00 0.00 ? 7   TYR A HB2  2  
ATOM 3465  H HB3  . TYR A 1 7   ? -19.162 -20.129 5.716   1.00 0.00 ? 7   TYR A HB3  2  
ATOM 3466  H HD1  . TYR A 1 7   ? -19.371 -22.549 5.585   1.00 0.00 ? 7   TYR A HD1  2  
ATOM 3467  H HD2  . TYR A 1 7   ? -16.501 -20.742 8.153   1.00 0.00 ? 7   TYR A HD2  2  
ATOM 3468  H HE1  . TYR A 1 7   ? -19.075 -24.692 6.752   1.00 0.00 ? 7   TYR A HE1  2  
ATOM 3469  H HE2  . TYR A 1 7   ? -16.197 -22.880 9.327   1.00 0.00 ? 7   TYR A HE2  2  
ATOM 3470  H HH   . TYR A 1 7   ? -17.354 -24.954 9.708   1.00 0.00 ? 7   TYR A HH   2  
ATOM 3471  N N    . THR A 1 8   ? -17.332 -18.878 2.727   1.00 0.00 ? 8   THR A N    2  
ATOM 3472  C CA   . THR A 1 8   ? -17.723 -17.828 1.794   1.00 0.00 ? 8   THR A CA   2  
ATOM 3473  C C    . THR A 1 8   ? -17.483 -18.265 0.352   1.00 0.00 ? 8   THR A C    2  
ATOM 3474  O O    . THR A 1 8   ? -16.877 -19.306 0.101   1.00 0.00 ? 8   THR A O    2  
ATOM 3475  C CB   . THR A 1 8   ? -16.947 -16.542 2.085   1.00 0.00 ? 8   THR A CB   2  
ATOM 3476  O OG1  . THR A 1 8   ? -17.294 -15.527 1.160   1.00 0.00 ? 8   THR A OG1  2  
ATOM 3477  C CG2  . THR A 1 8   ? -15.446 -16.723 2.027   1.00 0.00 ? 8   THR A CG2  2  
ATOM 3478  H H    . THR A 1 8   ? -16.805 -19.636 2.399   1.00 0.00 ? 8   THR A H    2  
ATOM 3479  H HA   . THR A 1 8   ? -18.778 -17.640 1.930   1.00 0.00 ? 8   THR A HA   2  
ATOM 3480  H HB   . THR A 1 8   ? -17.201 -16.198 3.078   1.00 0.00 ? 8   THR A HB   2  
ATOM 3481  H HG1  . THR A 1 8   ? -17.656 -14.774 1.632   1.00 0.00 ? 8   THR A HG1  2  
ATOM 3482  H HG21 . THR A 1 8   ? -15.179 -17.664 2.485   1.00 0.00 ? 8   THR A HG21 2  
ATOM 3483  H HG22 . THR A 1 8   ? -14.965 -15.914 2.557   1.00 0.00 ? 8   THR A HG22 2  
ATOM 3484  H HG23 . THR A 1 8   ? -15.123 -16.720 0.996   1.00 0.00 ? 8   THR A HG23 2  
ATOM 3485  N N    . ASP A 1 9   ? -17.963 -17.462 -0.592  1.00 0.00 ? 9   ASP A N    2  
ATOM 3486  C CA   . ASP A 1 9   ? -17.800 -17.766 -2.008  1.00 0.00 ? 9   ASP A CA   2  
ATOM 3487  C C    . ASP A 1 9   ? -17.741 -16.485 -2.835  1.00 0.00 ? 9   ASP A C    2  
ATOM 3488  O O    . ASP A 1 9   ? -18.182 -16.456 -3.984  1.00 0.00 ? 9   ASP A O    2  
ATOM 3489  C CB   . ASP A 1 9   ? -18.949 -18.649 -2.498  1.00 0.00 ? 9   ASP A CB   2  
ATOM 3490  C CG   . ASP A 1 9   ? -19.055 -19.945 -1.719  1.00 0.00 ? 9   ASP A CG   2  
ATOM 3491  O OD1  . ASP A 1 9   ? -18.166 -20.808 -1.878  1.00 0.00 ? 9   ASP A OD1  2  
ATOM 3492  O OD2  . ASP A 1 9   ? -20.028 -20.099 -0.951  1.00 0.00 ? 9   ASP A OD2  2  
ATOM 3493  H H    . ASP A 1 9   ? -18.437 -16.645 -0.329  1.00 0.00 ? 9   ASP A H    2  
ATOM 3494  H HA   . ASP A 1 9   ? -16.870 -18.301 -2.128  1.00 0.00 ? 9   ASP A HA   2  
ATOM 3495  H HB2  . ASP A 1 9   ? -19.879 -18.110 -2.392  1.00 0.00 ? 9   ASP A HB2  2  
ATOM 3496  H HB3  . ASP A 1 9   ? -18.793 -18.887 -3.540  1.00 0.00 ? 9   ASP A HB3  2  
ATOM 3497  N N    . GLU A 1 10  ? -17.193 -15.429 -2.243  1.00 0.00 ? 10  GLU A N    2  
ATOM 3498  C CA   . GLU A 1 10  ? -17.078 -14.146 -2.927  1.00 0.00 ? 10  GLU A CA   2  
ATOM 3499  C C    . GLU A 1 10  ? -15.976 -13.292 -2.309  1.00 0.00 ? 10  GLU A C    2  
ATOM 3500  O O    . GLU A 1 10  ? -16.120 -12.783 -1.197  1.00 0.00 ? 10  GLU A O    2  
ATOM 3501  C CB   . GLU A 1 10  ? -18.409 -13.395 -2.873  1.00 0.00 ? 10  GLU A CB   2  
ATOM 3502  C CG   . GLU A 1 10  ? -19.536 -14.098 -3.613  1.00 0.00 ? 10  GLU A CG   2  
ATOM 3503  C CD   . GLU A 1 10  ? -20.790 -13.251 -3.705  1.00 0.00 ? 10  GLU A CD   2  
ATOM 3504  O OE1  . GLU A 1 10  ? -21.609 -13.299 -2.764  1.00 0.00 ? 10  GLU A OE1  2  
ATOM 3505  O OE2  . GLU A 1 10  ? -20.952 -12.539 -4.719  1.00 0.00 ? 10  GLU A OE2  2  
ATOM 3506  H H    . GLU A 1 10  ? -16.859 -15.514 -1.326  1.00 0.00 ? 10  GLU A H    2  
ATOM 3507  H HA   . GLU A 1 10  ? -16.828 -14.343 -3.959  1.00 0.00 ? 10  GLU A HA   2  
ATOM 3508  H HB2  . GLU A 1 10  ? -18.703 -13.279 -1.840  1.00 0.00 ? 10  GLU A HB2  2  
ATOM 3509  H HB3  . GLU A 1 10  ? -18.275 -12.417 -3.312  1.00 0.00 ? 10  GLU A HB3  2  
ATOM 3510  H HG2  . GLU A 1 10  ? -19.203 -14.331 -4.613  1.00 0.00 ? 10  GLU A HG2  2  
ATOM 3511  H HG3  . GLU A 1 10  ? -19.775 -15.014 -3.091  1.00 0.00 ? 10  GLU A HG3  2  
ATOM 3512  N N    . SER A 1 11  ? -14.874 -13.139 -3.039  1.00 0.00 ? 11  SER A N    2  
ATOM 3513  C CA   . SER A 1 11  ? -13.743 -12.345 -2.570  1.00 0.00 ? 11  SER A CA   2  
ATOM 3514  C C    . SER A 1 11  ? -14.187 -10.962 -2.111  1.00 0.00 ? 11  SER A C    2  
ATOM 3515  O O    . SER A 1 11  ? -13.547 -10.342 -1.261  1.00 0.00 ? 11  SER A O    2  
ATOM 3516  C CB   . SER A 1 11  ? -12.695 -12.215 -3.676  1.00 0.00 ? 11  SER A CB   2  
ATOM 3517  O OG   . SER A 1 11  ? -11.657 -13.167 -3.512  1.00 0.00 ? 11  SER A OG   2  
ATOM 3518  H H    . SER A 1 11  ? -14.820 -13.571 -3.915  1.00 0.00 ? 11  SER A H    2  
ATOM 3519  H HA   . SER A 1 11  ? -13.309 -12.858 -1.735  1.00 0.00 ? 11  SER A HA   2  
ATOM 3520  H HB2  . SER A 1 11  ? -13.166 -12.376 -4.635  1.00 0.00 ? 11  SER A HB2  2  
ATOM 3521  H HB3  . SER A 1 11  ? -12.266 -11.224 -3.650  1.00 0.00 ? 11  SER A HB3  2  
ATOM 3522  H HG   . SER A 1 11  ? -11.395 -13.200 -2.589  1.00 0.00 ? 11  SER A HG   2  
ATOM 3523  N N    . CYS A 1 12  ? -15.299 -10.499 -2.670  1.00 0.00 ? 12  CYS A N    2  
ATOM 3524  C CA   . CYS A 1 12  ? -15.871 -9.194  -2.326  1.00 0.00 ? 12  CYS A CA   2  
ATOM 3525  C C    . CYS A 1 12  ? -14.790 -8.147  -2.062  1.00 0.00 ? 12  CYS A C    2  
ATOM 3526  O O    . CYS A 1 12  ? -14.946 -7.266  -1.216  1.00 0.00 ? 12  CYS A O    2  
ATOM 3527  C CB   . CYS A 1 12  ? -16.731 -9.329  -1.087  1.00 0.00 ? 12  CYS A CB   2  
ATOM 3528  S SG   . CYS A 1 12  ? -18.529 -9.280  -1.391  1.00 0.00 ? 12  CYS A SG   2  
ATOM 3529  H H    . CYS A 1 12  ? -15.761 -11.063 -3.319  1.00 0.00 ? 12  CYS A H    2  
ATOM 3530  H HA   . CYS A 1 12  ? -16.487 -8.873  -3.154  1.00 0.00 ? 12  CYS A HA   2  
ATOM 3531  H HB2  . CYS A 1 12  ? -16.499 -10.268 -0.616  1.00 0.00 ? 12  CYS A HB2  2  
ATOM 3532  H HB3  . CYS A 1 12  ? -16.484 -8.527  -0.415  1.00 0.00 ? 12  CYS A HB3  2  
ATOM 3533  N N    . THR A 1 13  ? -13.703 -8.261  -2.786  1.00 0.00 ? 13  THR A N    2  
ATOM 3534  C CA   . THR A 1 13  ? -12.578 -7.339  -2.643  1.00 0.00 ? 13  THR A CA   2  
ATOM 3535  C C    . THR A 1 13  ? -12.599 -6.274  -3.731  1.00 0.00 ? 13  THR A C    2  
ATOM 3536  O O    . THR A 1 13  ? -12.519 -6.579  -4.916  1.00 0.00 ? 13  THR A O    2  
ATOM 3537  C CB   . THR A 1 13  ? -11.255 -8.099  -2.700  1.00 0.00 ? 13  THR A CB   2  
ATOM 3538  O OG1  . THR A 1 13  ? -11.353 -9.335  -2.017  1.00 0.00 ? 13  THR A OG1  2  
ATOM 3539  C CG2  . THR A 1 13  ? -10.097 -7.330  -2.101  1.00 0.00 ? 13  THR A CG2  2  
ATOM 3540  H H    . THR A 1 13  ? -13.659 -8.981  -3.434  1.00 0.00 ? 13  THR A H    2  
ATOM 3541  H HA   . THR A 1 13  ? -12.665 -6.857  -1.681  1.00 0.00 ? 13  THR A HA   2  
ATOM 3542  H HB   . THR A 1 13  ? -11.017 -8.298  -3.733  1.00 0.00 ? 13  THR A HB   2  
ATOM 3543  H HG1  . THR A 1 13  ? -11.630 -9.180  -1.111  1.00 0.00 ? 13  THR A HG1  2  
ATOM 3544  H HG21 . THR A 1 13  ? -10.457 -6.703  -1.298  1.00 0.00 ? 13  THR A HG21 2  
ATOM 3545  H HG22 . THR A 1 13  ? -9.643  -6.713  -2.863  1.00 0.00 ? 13  THR A HG22 2  
ATOM 3546  H HG23 . THR A 1 13  ? -9.365  -8.024  -1.716  1.00 0.00 ? 13  THR A HG23 2  
ATOM 3547  N N    . PHE A 1 14  ? -12.694 -5.021  -3.316  1.00 0.00 ? 14  PHE A N    2  
ATOM 3548  C CA   . PHE A 1 14  ? -12.718 -3.901  -4.250  1.00 0.00 ? 14  PHE A CA   2  
ATOM 3549  C C    . PHE A 1 14  ? -11.304 -3.353  -4.459  1.00 0.00 ? 14  PHE A C    2  
ATOM 3550  O O    . PHE A 1 14  ? -10.666 -2.892  -3.513  1.00 0.00 ? 14  PHE A O    2  
ATOM 3551  C CB   . PHE A 1 14  ? -13.653 -2.810  -3.727  1.00 0.00 ? 14  PHE A CB   2  
ATOM 3552  C CG   . PHE A 1 14  ? -14.873 -3.380  -3.070  1.00 0.00 ? 14  PHE A CG   2  
ATOM 3553  C CD1  . PHE A 1 14  ? -15.703 -4.250  -3.761  1.00 0.00 ? 14  PHE A CD1  2  
ATOM 3554  C CD2  . PHE A 1 14  ? -15.172 -3.081  -1.753  1.00 0.00 ? 14  PHE A CD2  2  
ATOM 3555  C CE1  . PHE A 1 14  ? -16.796 -4.803  -3.157  1.00 0.00 ? 14  PHE A CE1  2  
ATOM 3556  C CE2  . PHE A 1 14  ? -16.274 -3.639  -1.138  1.00 0.00 ? 14  PHE A CE2  2  
ATOM 3557  C CZ   . PHE A 1 14  ? -17.087 -4.504  -1.841  1.00 0.00 ? 14  PHE A CZ   2  
ATOM 3558  H H    . PHE A 1 14  ? -12.739 -4.842  -2.355  1.00 0.00 ? 14  PHE A H    2  
ATOM 3559  H HA   . PHE A 1 14  ? -13.109 -4.265  -5.191  1.00 0.00 ? 14  PHE A HA   2  
ATOM 3560  H HB2  . PHE A 1 14  ? -13.127 -2.209  -3.000  1.00 0.00 ? 14  PHE A HB2  2  
ATOM 3561  H HB3  . PHE A 1 14  ? -13.972 -2.186  -4.548  1.00 0.00 ? 14  PHE A HB3  2  
ATOM 3562  H HD1  . PHE A 1 14  ? -15.502 -4.484  -4.794  1.00 0.00 ? 14  PHE A HD1  2  
ATOM 3563  H HD2  . PHE A 1 14  ? -14.534 -2.404  -1.204  1.00 0.00 ? 14  PHE A HD2  2  
ATOM 3564  H HE1  . PHE A 1 14  ? -17.413 -5.485  -3.712  1.00 0.00 ? 14  PHE A HE1  2  
ATOM 3565  H HE2  . PHE A 1 14  ? -16.499 -3.401  -0.110  1.00 0.00 ? 14  PHE A HE2  2  
ATOM 3566  H HZ   . PHE A 1 14  ? -17.949 -4.939  -1.365  1.00 0.00 ? 14  PHE A HZ   2  
ATOM 3567  N N    . LYS A 1 15  ? -10.814 -3.417  -5.696  1.00 0.00 ? 15  LYS A N    2  
ATOM 3568  C CA   . LYS A 1 15  ? -9.466  -2.939  -6.015  1.00 0.00 ? 15  LYS A CA   2  
ATOM 3569  C C    . LYS A 1 15  ? -9.517  -1.548  -6.623  1.00 0.00 ? 15  LYS A C    2  
ATOM 3570  O O    . LYS A 1 15  ? -10.116 -1.346  -7.669  1.00 0.00 ? 15  LYS A O    2  
ATOM 3571  C CB   . LYS A 1 15  ? -8.786  -3.892  -6.998  1.00 0.00 ? 15  LYS A CB   2  
ATOM 3572  C CG   . LYS A 1 15  ? -7.437  -3.391  -7.515  1.00 0.00 ? 15  LYS A CG   2  
ATOM 3573  C CD   . LYS A 1 15  ? -6.281  -4.132  -6.862  1.00 0.00 ? 15  LYS A CD   2  
ATOM 3574  C CE   . LYS A 1 15  ? -6.120  -3.737  -5.403  1.00 0.00 ? 15  LYS A CE   2  
ATOM 3575  N NZ   . LYS A 1 15  ? -5.536  -2.376  -5.259  1.00 0.00 ? 15  LYS A NZ   2  
ATOM 3576  H H    . LYS A 1 15  ? -11.364 -3.804  -6.409  1.00 0.00 ? 15  LYS A H    2  
ATOM 3577  H HA   . LYS A 1 15  ? -8.895  -2.905  -5.100  1.00 0.00 ? 15  LYS A HA   2  
ATOM 3578  H HB2  . LYS A 1 15  ? -8.632  -4.843  -6.508  1.00 0.00 ? 15  LYS A HB2  2  
ATOM 3579  H HB3  . LYS A 1 15  ? -9.442  -4.037  -7.846  1.00 0.00 ? 15  LYS A HB3  2  
ATOM 3580  H HG2  . LYS A 1 15  ? -7.391  -3.545  -8.582  1.00 0.00 ? 15  LYS A HG2  2  
ATOM 3581  H HG3  . LYS A 1 15  ? -7.340  -2.331  -7.301  1.00 0.00 ? 15  LYS A HG3  2  
ATOM 3582  H HD2  . LYS A 1 15  ? -6.470  -5.194  -6.918  1.00 0.00 ? 15  LYS A HD2  2  
ATOM 3583  H HD3  . LYS A 1 15  ? -5.370  -3.897  -7.392  1.00 0.00 ? 15  LYS A HD3  2  
ATOM 3584  H HE2  . LYS A 1 15  ? -7.091  -3.755  -4.930  1.00 0.00 ? 15  LYS A HE2  2  
ATOM 3585  H HE3  . LYS A 1 15  ? -5.471  -4.452  -4.920  1.00 0.00 ? 15  LYS A HE3  2  
ATOM 3586  H HZ1  . LYS A 1 15  ? -4.511  -2.407  -5.429  1.00 0.00 ? 15  LYS A HZ1  2  
ATOM 3587  H HZ2  . LYS A 1 15  ? -5.706  -2.014  -4.299  1.00 0.00 ? 15  LYS A HZ2  2  
ATOM 3588  H HZ3  . LYS A 1 15  ? -5.971  -1.725  -5.944  1.00 0.00 ? 15  LYS A HZ3  2  
ATOM 3589  N N    . ILE A 1 16  ? -8.849  -0.597  -5.991  1.00 0.00 ? 16  ILE A N    2  
ATOM 3590  C CA   . ILE A 1 16  ? -8.826  0.756   -6.517  1.00 0.00 ? 16  ILE A CA   2  
ATOM 3591  C C    . ILE A 1 16  ? -7.485  1.106   -7.125  1.00 0.00 ? 16  ILE A C    2  
ATOM 3592  O O    . ILE A 1 16  ? -6.435  0.914   -6.514  1.00 0.00 ? 16  ILE A O    2  
ATOM 3593  C CB   . ILE A 1 16  ? -9.200  1.805   -5.462  1.00 0.00 ? 16  ILE A CB   2  
ATOM 3594  C CG1  . ILE A 1 16  ? -9.812  3.015   -6.160  1.00 0.00 ? 16  ILE A CG1  2  
ATOM 3595  C CG2  . ILE A 1 16  ? -7.994  2.208   -4.619  1.00 0.00 ? 16  ILE A CG2  2  
ATOM 3596  C CD1  . ILE A 1 16  ? -10.516 3.959   -5.224  1.00 0.00 ? 16  ILE A CD1  2  
ATOM 3597  H H    . ILE A 1 16  ? -8.341  -0.823  -5.184  1.00 0.00 ? 16  ILE A H    2  
ATOM 3598  H HA   . ILE A 1 16  ? -9.567  0.807   -7.298  1.00 0.00 ? 16  ILE A HA   2  
ATOM 3599  H HB   . ILE A 1 16  ? -9.932  1.372   -4.810  1.00 0.00 ? 16  ILE A HB   2  
ATOM 3600  H HG12 . ILE A 1 16  ? -9.036  3.563   -6.666  1.00 0.00 ? 16  ILE A HG12 2  
ATOM 3601  H HG13 . ILE A 1 16  ? -10.533 2.672   -6.887  1.00 0.00 ? 16  ILE A HG13 2  
ATOM 3602  H HG21 . ILE A 1 16  ? -7.349  1.353   -4.481  1.00 0.00 ? 16  ILE A HG21 2  
ATOM 3603  H HG22 . ILE A 1 16  ? -8.331  2.564   -3.656  1.00 0.00 ? 16  ILE A HG22 2  
ATOM 3604  H HG23 . ILE A 1 16  ? -7.449  2.993   -5.122  1.00 0.00 ? 16  ILE A HG23 2  
ATOM 3605  H HD11 . ILE A 1 16  ? -9.816  4.322   -4.488  1.00 0.00 ? 16  ILE A HD11 2  
ATOM 3606  H HD12 . ILE A 1 16  ? -11.322 3.433   -4.730  1.00 0.00 ? 16  ILE A HD12 2  
ATOM 3607  H HD13 . ILE A 1 16  ? -10.912 4.793   -5.789  1.00 0.00 ? 16  ILE A HD13 2  
ATOM 3608  N N    . SER A 1 17  ? -7.537  1.627   -8.338  1.00 0.00 ? 17  SER A N    2  
ATOM 3609  C CA   . SER A 1 17  ? -6.335  2.017   -9.052  1.00 0.00 ? 17  SER A CA   2  
ATOM 3610  C C    . SER A 1 17  ? -6.244  3.541   -9.158  1.00 0.00 ? 17  SER A C    2  
ATOM 3611  O O    . SER A 1 17  ? -7.089  4.263   -8.619  1.00 0.00 ? 17  SER A O    2  
ATOM 3612  C CB   . SER A 1 17  ? -6.320  1.394   -10.449 1.00 0.00 ? 17  SER A CB   2  
ATOM 3613  O OG   . SER A 1 17  ? -5.539  0.212   -10.472 1.00 0.00 ? 17  SER A OG   2  
ATOM 3614  H H    . SER A 1 17  ? -8.407  1.753   -8.771  1.00 0.00 ? 17  SER A H    2  
ATOM 3615  H HA   . SER A 1 17  ? -5.489  1.645   -8.491  1.00 0.00 ? 17  SER A HA   2  
ATOM 3616  H HB2  . SER A 1 17  ? -7.330  1.148   -10.742 1.00 0.00 ? 17  SER A HB2  2  
ATOM 3617  H HB3  . SER A 1 17  ? -5.904  2.100   -11.153 1.00 0.00 ? 17  SER A HB3  2  
ATOM 3618  H HG   . SER A 1 17  ? -4.720  0.360   -9.994  1.00 0.00 ? 17  SER A HG   2  
ATOM 3619  N N    . LEU A 1 18  ? -5.236  4.019   -9.888  1.00 0.00 ? 18  LEU A N    2  
ATOM 3620  C CA   . LEU A 1 18  ? -5.044  5.454   -10.091 1.00 0.00 ? 18  LEU A CA   2  
ATOM 3621  C C    . LEU A 1 18  ? -4.317  5.731   -11.407 1.00 0.00 ? 18  LEU A C    2  
ATOM 3622  O O    . LEU A 1 18  ? -3.089  5.776   -11.449 1.00 0.00 ? 18  LEU A O    2  
ATOM 3623  C CB   . LEU A 1 18  ? -4.259  6.064   -8.922  1.00 0.00 ? 18  LEU A CB   2  
ATOM 3624  C CG   . LEU A 1 18  ? -4.721  7.453   -8.449  1.00 0.00 ? 18  LEU A CG   2  
ATOM 3625  C CD1  . LEU A 1 18  ? -6.238  7.522   -8.326  1.00 0.00 ? 18  LEU A CD1  2  
ATOM 3626  C CD2  . LEU A 1 18  ? -4.086  7.782   -7.112  1.00 0.00 ? 18  LEU A CD2  2  
ATOM 3627  H H    . LEU A 1 18  ? -4.629  3.386   -10.325 1.00 0.00 ? 18  LEU A H    2  
ATOM 3628  H HA   . LEU A 1 18  ? -6.017  5.909   -10.133 1.00 0.00 ? 18  LEU A HA   2  
ATOM 3629  H HB2  . LEU A 1 18  ? -4.325  5.387   -8.085  1.00 0.00 ? 18  LEU A HB2  2  
ATOM 3630  H HB3  . LEU A 1 18  ? -3.223  6.139   -9.217  1.00 0.00 ? 18  LEU A HB3  2  
ATOM 3631  H HG   . LEU A 1 18  ? -4.402  8.205   -9.166  1.00 0.00 ? 18  LEU A HG   2  
ATOM 3632  H HD11 . LEU A 1 18  ? -6.665  6.557   -8.553  1.00 0.00 ? 18  LEU A HD11 2  
ATOM 3633  H HD12 . LEU A 1 18  ? -6.620  8.258   -9.015  1.00 0.00 ? 18  LEU A HD12 2  
ATOM 3634  H HD13 . LEU A 1 18  ? -6.506  7.804   -7.316  1.00 0.00 ? 18  LEU A HD13 2  
ATOM 3635  H HD21 . LEU A 1 18  ? -3.922  8.847   -7.043  1.00 0.00 ? 18  LEU A HD21 2  
ATOM 3636  H HD22 . LEU A 1 18  ? -3.144  7.263   -7.022  1.00 0.00 ? 18  LEU A HD22 2  
ATOM 3637  H HD23 . LEU A 1 18  ? -4.750  7.468   -6.320  1.00 0.00 ? 18  LEU A HD23 2  
ATOM 3638  N N    . ARG A 1 19  ? -5.084  5.924   -12.476 1.00 0.00 ? 19  ARG A N    2  
ATOM 3639  C CA   . ARG A 1 19  ? -4.507  6.210   -13.791 1.00 0.00 ? 19  ARG A CA   2  
ATOM 3640  C C    . ARG A 1 19  ? -4.417  7.715   -14.009 1.00 0.00 ? 19  ARG A C    2  
ATOM 3641  O O    . ARG A 1 19  ? -5.425  8.415   -13.924 1.00 0.00 ? 19  ARG A O    2  
ATOM 3642  C CB   . ARG A 1 19  ? -5.348  5.572   -14.902 1.00 0.00 ? 19  ARG A CB   2  
ATOM 3643  C CG   . ARG A 1 19  ? -6.841  5.834   -14.768 1.00 0.00 ? 19  ARG A CG   2  
ATOM 3644  C CD   . ARG A 1 19  ? -7.415  6.458   -16.030 1.00 0.00 ? 19  ARG A CD   2  
ATOM 3645  N NE   . ARG A 1 19  ? -7.149  5.644   -17.213 1.00 0.00 ? 19  ARG A NE   2  
ATOM 3646  C CZ   . ARG A 1 19  ? -7.821  5.756   -18.357 1.00 0.00 ? 19  ARG A CZ   2  
ATOM 3647  N NH1  . ARG A 1 19  ? -8.800  6.645   -18.475 1.00 0.00 ? 19  ARG A NH1  2  
ATOM 3648  N NH2  . ARG A 1 19  ? -7.514  4.978   -19.385 1.00 0.00 ? 19  ARG A NH2  2  
ATOM 3649  H H    . ARG A 1 19  ? -6.060  5.884   -12.377 1.00 0.00 ? 19  ARG A H    2  
ATOM 3650  H HA   . ARG A 1 19  ? -3.512  5.793   -13.815 1.00 0.00 ? 19  ARG A HA   2  
ATOM 3651  H HB2  . ARG A 1 19  ? -5.020  5.963   -15.854 1.00 0.00 ? 19  ARG A HB2  2  
ATOM 3652  H HB3  . ARG A 1 19  ? -5.191  4.504   -14.891 1.00 0.00 ? 19  ARG A HB3  2  
ATOM 3653  H HG2  . ARG A 1 19  ? -7.345  4.899   -14.580 1.00 0.00 ? 19  ARG A HG2  2  
ATOM 3654  H HG3  . ARG A 1 19  ? -7.005  6.506   -13.939 1.00 0.00 ? 19  ARG A HG3  2  
ATOM 3655  H HD2  . ARG A 1 19  ? -8.483  6.563   -15.910 1.00 0.00 ? 19  ARG A HD2  2  
ATOM 3656  H HD3  . ARG A 1 19  ? -6.972  7.434   -16.168 1.00 0.00 ? 19  ARG A HD3  2  
ATOM 3657  H HE   . ARG A 1 19  ? -6.431  4.979   -17.153 1.00 0.00 ? 19  ARG A HE   2  
ATOM 3658  H HH11 . ARG A 1 19  ? -9.036  7.236   -17.703 1.00 0.00 ? 19  ARG A HH11 2  
ATOM 3659  H HH12 . ARG A 1 19  ? -9.301  6.725   -19.336 1.00 0.00 ? 19  ARG A HH12 2  
ATOM 3660  H HH21 . ARG A 1 19  ? -6.777  4.307   -19.301 1.00 0.00 ? 19  ARG A HH21 2  
ATOM 3661  H HH22 . ARG A 1 19  ? -8.019  5.062   -20.244 1.00 0.00 ? 19  ARG A HH22 2  
ATOM 3662  N N    . ASN A 1 20  ? -3.208  8.222   -14.268 1.00 0.00 ? 20  ASN A N    2  
ATOM 3663  C CA   . ASN A 1 20  ? -3.022  9.660   -14.463 1.00 0.00 ? 20  ASN A CA   2  
ATOM 3664  C C    . ASN A 1 20  ? -3.736  10.402  -13.335 1.00 0.00 ? 20  ASN A C    2  
ATOM 3665  O O    . ASN A 1 20  ? -4.541  11.303  -13.567 1.00 0.00 ? 20  ASN A O    2  
ATOM 3666  C CB   . ASN A 1 20  ? -3.581  10.091  -15.822 1.00 0.00 ? 20  ASN A CB   2  
ATOM 3667  C CG   . ASN A 1 20  ? -2.822  9.477   -16.982 1.00 0.00 ? 20  ASN A CG   2  
ATOM 3668  O OD1  . ASN A 1 20  ? -1.889  10.077  -17.516 1.00 0.00 ? 20  ASN A OD1  2  
ATOM 3669  N ND2  . ASN A 1 20  ? -3.222  8.275   -17.380 1.00 0.00 ? 20  ASN A ND2  2  
ATOM 3670  H H    . ASN A 1 20  ? -2.432  7.625   -14.309 1.00 0.00 ? 20  ASN A H    2  
ATOM 3671  H HA   . ASN A 1 20  ? -1.957  9.876   -14.423 1.00 0.00 ? 20  ASN A HA   2  
ATOM 3672  H HB2  . ASN A 1 20  ? -4.615  9.786   -15.891 1.00 0.00 ? 20  ASN A HB2  2  
ATOM 3673  H HB3  . ASN A 1 20  ? -3.522  11.166  -15.904 1.00 0.00 ? 20  ASN A HB3  2  
ATOM 3674  H HD21 . ASN A 1 20  ? -3.973  7.858   -16.909 1.00 0.00 ? 20  ASN A HD21 2  
ATOM 3675  H HD22 . ASN A 1 20  ? -2.749  7.854   -18.127 1.00 0.00 ? 20  ASN A HD22 2  
ATOM 3676  N N    . PHE A 1 21  ? -3.452  9.958   -12.116 1.00 0.00 ? 21  PHE A N    2  
ATOM 3677  C CA   . PHE A 1 21  ? -4.061  10.495  -10.902 1.00 0.00 ? 21  PHE A CA   2  
ATOM 3678  C C    . PHE A 1 21  ? -5.581  10.520  -11.003 1.00 0.00 ? 21  PHE A C    2  
ATOM 3679  O O    . PHE A 1 21  ? -6.238  11.427  -10.497 1.00 0.00 ? 21  PHE A O    2  
ATOM 3680  C CB   . PHE A 1 21  ? -3.517  11.881  -10.556 1.00 0.00 ? 21  PHE A CB   2  
ATOM 3681  C CG   . PHE A 1 21  ? -3.831  12.946  -11.567 1.00 0.00 ? 21  PHE A CG   2  
ATOM 3682  C CD1  . PHE A 1 21  ? -5.001  13.686  -11.475 1.00 0.00 ? 21  PHE A CD1  2  
ATOM 3683  C CD2  . PHE A 1 21  ? -2.957  13.210  -12.607 1.00 0.00 ? 21  PHE A CD2  2  
ATOM 3684  C CE1  . PHE A 1 21  ? -5.291  14.667  -12.403 1.00 0.00 ? 21  PHE A CE1  2  
ATOM 3685  C CE2  . PHE A 1 21  ? -3.242  14.190  -13.538 1.00 0.00 ? 21  PHE A CE2  2  
ATOM 3686  C CZ   . PHE A 1 21  ? -4.411  14.919  -13.436 1.00 0.00 ? 21  PHE A CZ   2  
ATOM 3687  H H    . PHE A 1 21  ? -2.822  9.214   -12.032 1.00 0.00 ? 21  PHE A H    2  
ATOM 3688  H HA   . PHE A 1 21  ? -3.798  9.822   -10.099 1.00 0.00 ? 21  PHE A HA   2  
ATOM 3689  H HB2  . PHE A 1 21  ? -3.935  12.192  -9.611  1.00 0.00 ? 21  PHE A HB2  2  
ATOM 3690  H HB3  . PHE A 1 21  ? -2.445  11.812  -10.460 1.00 0.00 ? 21  PHE A HB3  2  
ATOM 3691  H HD1  . PHE A 1 21  ? -5.689  13.492  -10.667 1.00 0.00 ? 21  PHE A HD1  2  
ATOM 3692  H HD2  . PHE A 1 21  ? -2.044  12.640  -12.687 1.00 0.00 ? 21  PHE A HD2  2  
ATOM 3693  H HE1  . PHE A 1 21  ? -6.205  15.236  -12.321 1.00 0.00 ? 21  PHE A HE1  2  
ATOM 3694  H HE2  . PHE A 1 21  ? -2.553  14.387  -14.343 1.00 0.00 ? 21  PHE A HE2  2  
ATOM 3695  H HZ   . PHE A 1 21  ? -4.635  15.686  -14.163 1.00 0.00 ? 21  PHE A HZ   2  
ATOM 3696  N N    . ARG A 1 22  ? -6.130  9.477   -11.614 1.00 0.00 ? 22  ARG A N    2  
ATOM 3697  C CA   . ARG A 1 22  ? -7.571  9.319   -11.740 1.00 0.00 ? 22  ARG A CA   2  
ATOM 3698  C C    . ARG A 1 22  ? -7.952  8.056   -10.990 1.00 0.00 ? 22  ARG A C    2  
ATOM 3699  O O    . ARG A 1 22  ? -7.234  7.064   -11.060 1.00 0.00 ? 22  ARG A O    2  
ATOM 3700  C CB   . ARG A 1 22  ? -7.994  9.222   -13.208 1.00 0.00 ? 22  ARG A CB   2  
ATOM 3701  C CG   . ARG A 1 22  ? -7.522  10.390  -14.058 1.00 0.00 ? 22  ARG A CG   2  
ATOM 3702  C CD   . ARG A 1 22  ? -8.047  10.292  -15.481 1.00 0.00 ? 22  ARG A CD   2  
ATOM 3703  N NE   . ARG A 1 22  ? -7.326  11.175  -16.394 1.00 0.00 ? 22  ARG A NE   2  
ATOM 3704  C CZ   . ARG A 1 22  ? -7.567  12.480  -16.509 1.00 0.00 ? 22  ARG A CZ   2  
ATOM 3705  N NH1  . ARG A 1 22  ? -8.505  13.056  -15.768 1.00 0.00 ? 22  ARG A NH1  2  
ATOM 3706  N NH2  . ARG A 1 22  ? -6.868  13.210  -17.367 1.00 0.00 ? 22  ARG A NH2  2  
ATOM 3707  H H    . ARG A 1 22  ? -5.553  8.767   -11.965 1.00 0.00 ? 22  ARG A H    2  
ATOM 3708  H HA   . ARG A 1 22  ? -8.050  10.170  -11.276 1.00 0.00 ? 22  ARG A HA   2  
ATOM 3709  H HB2  . ARG A 1 22  ? -7.592  8.313   -13.627 1.00 0.00 ? 22  ARG A HB2  2  
ATOM 3710  H HB3  . ARG A 1 22  ? -9.071  9.183   -13.257 1.00 0.00 ? 22  ARG A HB3  2  
ATOM 3711  H HG2  . ARG A 1 22  ? -7.875  11.310  -13.618 1.00 0.00 ? 22  ARG A HG2  2  
ATOM 3712  H HG3  . ARG A 1 22  ? -6.443  10.391  -14.083 1.00 0.00 ? 22  ARG A HG3  2  
ATOM 3713  H HD2  . ARG A 1 22  ? -7.939  9.273   -15.822 1.00 0.00 ? 22  ARG A HD2  2  
ATOM 3714  H HD3  . ARG A 1 22  ? -9.092  10.562  -15.484 1.00 0.00 ? 22  ARG A HD3  2  
ATOM 3715  H HE   . ARG A 1 22  ? -6.626  10.776  -16.952 1.00 0.00 ? 22  ARG A HE   2  
ATOM 3716  H HH11 . ARG A 1 22  ? -9.035  12.512  -15.118 1.00 0.00 ? 22  ARG A HH11 2  
ATOM 3717  H HH12 . ARG A 1 22  ? -8.681  14.036  -15.859 1.00 0.00 ? 22  ARG A HH12 2  
ATOM 3718  H HH21 . ARG A 1 22  ? -6.159  12.781  -17.927 1.00 0.00 ? 22  ARG A HH21 2  
ATOM 3719  H HH22 . ARG A 1 22  ? -7.049  14.189  -17.454 1.00 0.00 ? 22  ARG A HH22 2  
ATOM 3720  N N    . SER A 1 23  ? -9.042  8.087   -10.241 1.00 0.00 ? 23  SER A N    2  
ATOM 3721  C CA   . SER A 1 23  ? -9.425  6.929   -9.457  1.00 0.00 ? 23  SER A CA   2  
ATOM 3722  C C    . SER A 1 23  ? -10.318 5.978   -10.237 1.00 0.00 ? 23  SER A C    2  
ATOM 3723  O O    . SER A 1 23  ? -11.200 6.400   -10.977 1.00 0.00 ? 23  SER A O    2  
ATOM 3724  C CB   . SER A 1 23  ? -10.150 7.391   -8.197  1.00 0.00 ? 23  SER A CB   2  
ATOM 3725  O OG   . SER A 1 23  ? -9.891  6.523   -7.107  1.00 0.00 ? 23  SER A OG   2  
ATOM 3726  H H    . SER A 1 23  ? -9.581  8.907   -10.185 1.00 0.00 ? 23  SER A H    2  
ATOM 3727  H HA   . SER A 1 23  ? -8.522  6.408   -9.164  1.00 0.00 ? 23  SER A HA   2  
ATOM 3728  H HB2  . SER A 1 23  ? -9.817  8.385   -7.941  1.00 0.00 ? 23  SER A HB2  2  
ATOM 3729  H HB3  . SER A 1 23  ? -11.210 7.409   -8.387  1.00 0.00 ? 23  SER A HB3  2  
ATOM 3730  H HG   . SER A 1 23  ? -10.120 6.964   -6.286  1.00 0.00 ? 23  SER A HG   2  
ATOM 3731  N N    . ILE A 1 24  ? -10.095 4.689   -10.028 1.00 0.00 ? 24  ILE A N    2  
ATOM 3732  C CA   . ILE A 1 24  ? -10.897 3.645   -10.662 1.00 0.00 ? 24  ILE A CA   2  
ATOM 3733  C C    . ILE A 1 24  ? -10.935 2.443   -9.743  1.00 0.00 ? 24  ILE A C    2  
ATOM 3734  O O    . ILE A 1 24  ? -9.949  1.721   -9.613  1.00 0.00 ? 24  ILE A O    2  
ATOM 3735  C CB   . ILE A 1 24  ? -10.350 3.200   -12.025 1.00 0.00 ? 24  ILE A CB   2  
ATOM 3736  C CG1  . ILE A 1 24  ? -10.397 4.357   -13.024 1.00 0.00 ? 24  ILE A CG1  2  
ATOM 3737  C CG2  . ILE A 1 24  ? -11.134 1.993   -12.552 1.00 0.00 ? 24  ILE A CG2  2  
ATOM 3738  C CD1  . ILE A 1 24  ? -9.868  3.994   -14.395 1.00 0.00 ? 24  ILE A CD1  2  
ATOM 3739  H H    . ILE A 1 24  ? -9.382  4.426   -9.400  1.00 0.00 ? 24  ILE A H    2  
ATOM 3740  H HA   . ILE A 1 24  ? -11.900 4.026   -10.802 1.00 0.00 ? 24  ILE A HA   2  
ATOM 3741  H HB   . ILE A 1 24  ? -9.336  2.900   -11.880 1.00 0.00 ? 24  ILE A HB   2  
ATOM 3742  H HG12 . ILE A 1 24  ? -11.420 4.683   -13.140 1.00 0.00 ? 24  ILE A HG12 2  
ATOM 3743  H HG13 . ILE A 1 24  ? -9.804  5.176   -12.645 1.00 0.00 ? 24  ILE A HG13 2  
ATOM 3744  H HG21 . ILE A 1 24  ? -11.097 1.184   -11.829 1.00 0.00 ? 24  ILE A HG21 2  
ATOM 3745  H HG22 . ILE A 1 24  ? -10.700 1.660   -13.482 1.00 0.00 ? 24  ILE A HG22 2  
ATOM 3746  H HG23 . ILE A 1 24  ? -12.163 2.275   -12.718 1.00 0.00 ? 24  ILE A HG23 2  
ATOM 3747  H HD11 . ILE A 1 24  ? -9.425  4.867   -14.852 1.00 0.00 ? 24  ILE A HD11 2  
ATOM 3748  H HD12 . ILE A 1 24  ? -10.680 3.638   -15.012 1.00 0.00 ? 24  ILE A HD12 2  
ATOM 3749  H HD13 . ILE A 1 24  ? -9.122  3.220   -14.299 1.00 0.00 ? 24  ILE A HD13 2  
ATOM 3750  N N    . LEU A 1 25  ? -12.062 2.237   -9.099  1.00 0.00 ? 25  LEU A N    2  
ATOM 3751  C CA   . LEU A 1 25  ? -12.202 1.135   -8.184  1.00 0.00 ? 25  LEU A CA   2  
ATOM 3752  C C    . LEU A 1 25  ? -12.896 -0.038  -8.847  1.00 0.00 ? 25  LEU A C    2  
ATOM 3753  O O    . LEU A 1 25  ? -13.788 0.127   -9.678  1.00 0.00 ? 25  LEU A O    2  
ATOM 3754  C CB   . LEU A 1 25  ? -12.932 1.581   -6.924  1.00 0.00 ? 25  LEU A CB   2  
ATOM 3755  C CG   . LEU A 1 25  ? -14.440 1.780   -7.068  1.00 0.00 ? 25  LEU A CG   2  
ATOM 3756  C CD1  . LEU A 1 25  ? -15.173 0.510   -6.677  1.00 0.00 ? 25  LEU A CD1  2  
ATOM 3757  C CD2  . LEU A 1 25  ? -14.909 2.960   -6.222  1.00 0.00 ? 25  LEU A CD2  2  
ATOM 3758  H H    . LEU A 1 25  ? -12.809 2.840   -9.235  1.00 0.00 ? 25  LEU A H    2  
ATOM 3759  H HA   . LEU A 1 25  ? -11.209 0.824   -7.908  1.00 0.00 ? 25  LEU A HA   2  
ATOM 3760  H HB2  . LEU A 1 25  ? -12.754 0.846   -6.155  1.00 0.00 ? 25  LEU A HB2  2  
ATOM 3761  H HB3  . LEU A 1 25  ? -12.499 2.513   -6.609  1.00 0.00 ? 25  LEU A HB3  2  
ATOM 3762  H HG   . LEU A 1 25  ? -14.671 1.994   -8.101  1.00 0.00 ? 25  LEU A HG   2  
ATOM 3763  H HD11 . LEU A 1 25  ? -15.916 0.736   -5.927  1.00 0.00 ? 25  LEU A HD11 2  
ATOM 3764  H HD12 . LEU A 1 25  ? -14.469 -0.207  -6.279  1.00 0.00 ? 25  LEU A HD12 2  
ATOM 3765  H HD13 . LEU A 1 25  ? -15.655 0.095   -7.548  1.00 0.00 ? 25  LEU A HD13 2  
ATOM 3766  H HD21 . LEU A 1 25  ? -15.426 2.595   -5.347  1.00 0.00 ? 25  LEU A HD21 2  
ATOM 3767  H HD22 . LEU A 1 25  ? -15.578 3.578   -6.802  1.00 0.00 ? 25  LEU A HD22 2  
ATOM 3768  H HD23 . LEU A 1 25  ? -14.055 3.547   -5.915  1.00 0.00 ? 25  LEU A HD23 2  
ATOM 3769  N N    . SER A 1 26  ? -12.453 -1.220  -8.475  1.00 0.00 ? 26  SER A N    2  
ATOM 3770  C CA   . SER A 1 26  ? -12.981 -2.454  -9.019  1.00 0.00 ? 26  SER A CA   2  
ATOM 3771  C C    . SER A 1 26  ? -13.390 -3.387  -7.900  1.00 0.00 ? 26  SER A C    2  
ATOM 3772  O O    . SER A 1 26  ? -13.314 -3.031  -6.728  1.00 0.00 ? 26  SER A O    2  
ATOM 3773  C CB   . SER A 1 26  ? -11.935 -3.137  -9.900  1.00 0.00 ? 26  SER A CB   2  
ATOM 3774  O OG   . SER A 1 26  ? -11.258 -4.169  -9.201  1.00 0.00 ? 26  SER A OG   2  
ATOM 3775  H H    . SER A 1 26  ? -11.735 -1.261  -7.816  1.00 0.00 ? 26  SER A H    2  
ATOM 3776  H HA   . SER A 1 26  ? -13.844 -2.213  -9.621  1.00 0.00 ? 26  SER A HA   2  
ATOM 3777  H HB2  . SER A 1 26  ? -12.417 -3.562  -10.760 1.00 0.00 ? 26  SER A HB2  2  
ATOM 3778  H HB3  . SER A 1 26  ? -11.216 -2.410  -10.220 1.00 0.00 ? 26  SER A HB3  2  
ATOM 3779  H HG   . SER A 1 26  ? -11.541 -5.023  -9.538  1.00 0.00 ? 26  SER A HG   2  
ATOM 3780  N N    . TRP A 1 27  ? -13.817 -4.581  -8.270  1.00 0.00 ? 27  TRP A N    2  
ATOM 3781  C CA   . TRP A 1 27  ? -14.231 -5.576  -7.291  1.00 0.00 ? 27  TRP A CA   2  
ATOM 3782  C C    . TRP A 1 27  ? -13.822 -6.986  -7.685  1.00 0.00 ? 27  TRP A C    2  
ATOM 3783  O O    . TRP A 1 27  ? -13.641 -7.300  -8.862  1.00 0.00 ? 27  TRP A O    2  
ATOM 3784  C CB   . TRP A 1 27  ? -15.725 -5.502  -7.061  1.00 0.00 ? 27  TRP A CB   2  
ATOM 3785  C CG   . TRP A 1 27  ? -16.535 -5.624  -8.312  1.00 0.00 ? 27  TRP A CG   2  
ATOM 3786  C CD1  . TRP A 1 27  ? -16.685 -6.716  -9.113  1.00 0.00 ? 27  TRP A CD1  2  
ATOM 3787  C CD2  . TRP A 1 27  ? -17.310 -4.589  -8.900  1.00 0.00 ? 27  TRP A CD2  2  
ATOM 3788  N NE1  . TRP A 1 27  ? -17.518 -6.418  -10.161 1.00 0.00 ? 27  TRP A NE1  2  
ATOM 3789  C CE2  . TRP A 1 27  ? -17.913 -5.114  -10.050 1.00 0.00 ? 27  TRP A CE2  2  
ATOM 3790  C CE3  . TRP A 1 27  ? -17.551 -3.268  -8.557  1.00 0.00 ? 27  TRP A CE3  2  
ATOM 3791  C CZ2  . TRP A 1 27  ? -18.745 -4.357  -10.860 1.00 0.00 ? 27  TRP A CZ2  2  
ATOM 3792  C CZ3  . TRP A 1 27  ? -18.378 -2.511  -9.361  1.00 0.00 ? 27  TRP A CZ3  2  
ATOM 3793  C CH2  . TRP A 1 27  ? -18.968 -3.060  -10.505 1.00 0.00 ? 27  TRP A CH2  2  
ATOM 3794  H H    . TRP A 1 27  ? -13.843 -4.799  -9.226  1.00 0.00 ? 27  TRP A H    2  
ATOM 3795  H HA   . TRP A 1 27  ? -13.744 -5.347  -6.356  1.00 0.00 ? 27  TRP A HA   2  
ATOM 3796  H HB2  . TRP A 1 27  ? -16.009 -6.285  -6.384  1.00 0.00 ? 27  TRP A HB2  2  
ATOM 3797  H HB3  . TRP A 1 27  ? -15.956 -4.548  -6.612  1.00 0.00 ? 27  TRP A HB3  2  
ATOM 3798  H HD1  . TRP A 1 27  ? -16.218 -7.664  -8.939  1.00 0.00 ? 27  TRP A HD1  2  
ATOM 3799  H HE1  . TRP A 1 27  ? -17.784 -7.037  -10.872 1.00 0.00 ? 27  TRP A HE1  2  
ATOM 3800  H HE3  . TRP A 1 27  ? -17.102 -2.840  -7.678  1.00 0.00 ? 27  TRP A HE3  2  
ATOM 3801  H HZ2  . TRP A 1 27  ? -19.196 -4.766  -11.745 1.00 0.00 ? 27  TRP A HZ2  2  
ATOM 3802  H HZ3  . TRP A 1 27  ? -18.574 -1.482  -9.111  1.00 0.00 ? 27  TRP A HZ3  2  
ATOM 3803  H HH2  . TRP A 1 27  ? -19.604 -2.438  -11.112 1.00 0.00 ? 27  TRP A HH2  2  
ATOM 3804  N N    . GLU A 1 28  ? -13.693 -7.826  -6.672  1.00 0.00 ? 28  GLU A N    2  
ATOM 3805  C CA   . GLU A 1 28  ? -13.321 -9.218  -6.839  1.00 0.00 ? 28  GLU A CA   2  
ATOM 3806  C C    . GLU A 1 28  ? -14.375 -10.085 -6.220  1.00 0.00 ? 28  GLU A C    2  
ATOM 3807  O O    . GLU A 1 28  ? -14.281 -10.485 -5.060  1.00 0.00 ? 28  GLU A O    2  
ATOM 3808  C CB   . GLU A 1 28  ? -11.956 -9.471  -6.204  1.00 0.00 ? 28  GLU A CB   2  
ATOM 3809  C CG   . GLU A 1 28  ? -10.937 -10.062 -7.165  1.00 0.00 ? 28  GLU A CG   2  
ATOM 3810  C CD   . GLU A 1 28  ? -11.419 -11.348 -7.807  1.00 0.00 ? 28  GLU A CD   2  
ATOM 3811  O OE1  . GLU A 1 28  ? -12.265 -11.274 -8.723  1.00 0.00 ? 28  GLU A OE1  2  
ATOM 3812  O OE2  . GLU A 1 28  ? -10.951 -12.430 -7.393  1.00 0.00 ? 28  GLU A OE2  2  
ATOM 3813  H H    . GLU A 1 28  ? -13.859 -7.494  -5.765  1.00 0.00 ? 28  GLU A H    2  
ATOM 3814  H HA   . GLU A 1 28  ? -13.286 -9.454  -7.885  1.00 0.00 ? 28  GLU A HA   2  
ATOM 3815  H HB2  . GLU A 1 28  ? -11.571 -8.528  -5.838  1.00 0.00 ? 28  GLU A HB2  2  
ATOM 3816  H HB3  . GLU A 1 28  ? -12.074 -10.150 -5.372  1.00 0.00 ? 28  GLU A HB3  2  
ATOM 3817  H HG2  . GLU A 1 28  ? -10.737 -9.343  -7.945  1.00 0.00 ? 28  GLU A HG2  2  
ATOM 3818  H HG3  . GLU A 1 28  ? -10.025 -10.267 -6.623  1.00 0.00 ? 28  GLU A HG3  2  
ATOM 3819  N N    . LEU A 1 29  ? -15.388 -10.372 -7.013  1.00 0.00 ? 29  LEU A N    2  
ATOM 3820  C CA   . LEU A 1 29  ? -16.472 -11.193 -6.557  1.00 0.00 ? 29  LEU A CA   2  
ATOM 3821  C C    . LEU A 1 29  ? -16.359 -12.562 -7.188  1.00 0.00 ? 29  LEU A C    2  
ATOM 3822  O O    . LEU A 1 29  ? -16.630 -12.757 -8.373  1.00 0.00 ? 29  LEU A O    2  
ATOM 3823  C CB   . LEU A 1 29  ? -17.815 -10.552 -6.913  1.00 0.00 ? 29  LEU A CB   2  
ATOM 3824  C CG   . LEU A 1 29  ? -17.718 -9.178  -7.581  1.00 0.00 ? 29  LEU A CG   2  
ATOM 3825  C CD1  . LEU A 1 29  ? -18.459 -9.170  -8.902  1.00 0.00 ? 29  LEU A CD1  2  
ATOM 3826  C CD2  . LEU A 1 29  ? -18.242 -8.099  -6.657  1.00 0.00 ? 29  LEU A CD2  2  
ATOM 3827  H H    . LEU A 1 29  ? -15.400 -10.028 -7.930  1.00 0.00 ? 29  LEU A H    2  
ATOM 3828  H HA   . LEU A 1 29  ? -16.397 -11.285 -5.480  1.00 0.00 ? 29  LEU A HA   2  
ATOM 3829  H HB2  . LEU A 1 29  ? -18.345 -11.219 -7.579  1.00 0.00 ? 29  LEU A HB2  2  
ATOM 3830  H HB3  . LEU A 1 29  ? -18.391 -10.447 -6.006  1.00 0.00 ? 29  LEU A HB3  2  
ATOM 3831  H HG   . LEU A 1 29  ? -16.686 -8.957  -7.788  1.00 0.00 ? 29  LEU A HG   2  
ATOM 3832  H HD11 . LEU A 1 29  ? -19.253 -9.900  -8.871  1.00 0.00 ? 29  LEU A HD11 2  
ATOM 3833  H HD12 . LEU A 1 29  ? -17.770 -9.420  -9.696  1.00 0.00 ? 29  LEU A HD12 2  
ATOM 3834  H HD13 . LEU A 1 29  ? -18.873 -8.189  -9.078  1.00 0.00 ? 29  LEU A HD13 2  
ATOM 3835  H HD21 . LEU A 1 29  ? -19.246 -7.833  -6.946  1.00 0.00 ? 29  LEU A HD21 2  
ATOM 3836  H HD22 . LEU A 1 29  ? -17.603 -7.231  -6.726  1.00 0.00 ? 29  LEU A HD22 2  
ATOM 3837  H HD23 . LEU A 1 29  ? -18.241 -8.469  -5.641  1.00 0.00 ? 29  LEU A HD23 2  
ATOM 3838  N N    . LYS A 1 30  ? -15.955 -13.493 -6.367  1.00 0.00 ? 30  LYS A N    2  
ATOM 3839  C CA   . LYS A 1 30  ? -15.782 -14.880 -6.779  1.00 0.00 ? 30  LYS A CA   2  
ATOM 3840  C C    . LYS A 1 30  ? -17.134 -15.547 -7.014  1.00 0.00 ? 30  LYS A C    2  
ATOM 3841  O O    . LYS A 1 30  ? -18.131 -15.188 -6.388  1.00 0.00 ? 30  LYS A O    2  
ATOM 3842  C CB   . LYS A 1 30  ? -14.995 -15.654 -5.721  1.00 0.00 ? 30  LYS A CB   2  
ATOM 3843  C CG   . LYS A 1 30  ? -14.315 -16.903 -6.261  1.00 0.00 ? 30  LYS A CG   2  
ATOM 3844  C CD   . LYS A 1 30  ? -12.800 -16.794 -6.183  1.00 0.00 ? 30  LYS A CD   2  
ATOM 3845  C CE   . LYS A 1 30  ? -12.265 -17.392 -4.892  1.00 0.00 ? 30  LYS A CE   2  
ATOM 3846  N NZ   . LYS A 1 30  ? -10.806 -17.679 -4.976  1.00 0.00 ? 30  LYS A NZ   2  
ATOM 3847  H H    . LYS A 1 30  ? -15.750 -13.226 -5.453  1.00 0.00 ? 30  LYS A H    2  
ATOM 3848  H HA   . LYS A 1 30  ? -15.226 -14.884 -7.705  1.00 0.00 ? 30  LYS A HA   2  
ATOM 3849  H HB2  . LYS A 1 30  ? -14.237 -15.006 -5.307  1.00 0.00 ? 30  LYS A HB2  2  
ATOM 3850  H HB3  . LYS A 1 30  ? -15.671 -15.951 -4.933  1.00 0.00 ? 30  LYS A HB3  2  
ATOM 3851  H HG2  . LYS A 1 30  ? -14.634 -17.755 -5.680  1.00 0.00 ? 30  LYS A HG2  2  
ATOM 3852  H HG3  . LYS A 1 30  ? -14.605 -17.040 -7.293  1.00 0.00 ? 30  LYS A HG3  2  
ATOM 3853  H HD2  . LYS A 1 30  ? -12.368 -17.323 -7.019  1.00 0.00 ? 30  LYS A HD2  2  
ATOM 3854  H HD3  . LYS A 1 30  ? -12.521 -15.752 -6.230  1.00 0.00 ? 30  LYS A HD3  2  
ATOM 3855  H HE2  . LYS A 1 30  ? -12.440 -16.694 -4.087  1.00 0.00 ? 30  LYS A HE2  2  
ATOM 3856  H HE3  . LYS A 1 30  ? -12.793 -18.313 -4.691  1.00 0.00 ? 30  LYS A HE3  2  
ATOM 3857  H HZ1  . LYS A 1 30  ? -10.263 -16.795 -4.895  1.00 0.00 ? 30  LYS A HZ1  2  
ATOM 3858  H HZ2  . LYS A 1 30  ? -10.581 -18.128 -5.886  1.00 0.00 ? 30  LYS A HZ2  2  
ATOM 3859  H HZ3  . LYS A 1 30  ? -10.523 -18.319 -4.207  1.00 0.00 ? 30  LYS A HZ3  2  
ATOM 3860  N N    . ASN A 1 31  ? -17.161 -16.517 -7.922  1.00 0.00 ? 31  ASN A N    2  
ATOM 3861  C CA   . ASN A 1 31  ? -18.393 -17.231 -8.239  1.00 0.00 ? 31  ASN A CA   2  
ATOM 3862  C C    . ASN A 1 31  ? -18.177 -18.740 -8.193  1.00 0.00 ? 31  ASN A C    2  
ATOM 3863  O O    . ASN A 1 31  ? -17.757 -19.347 -9.178  1.00 0.00 ? 31  ASN A O    2  
ATOM 3864  C CB   . ASN A 1 31  ? -18.905 -16.818 -9.621  1.00 0.00 ? 31  ASN A CB   2  
ATOM 3865  C CG   . ASN A 1 31  ? -18.888 -15.315 -9.820  1.00 0.00 ? 31  ASN A CG   2  
ATOM 3866  O OD1  . ASN A 1 31  ? -18.533 -14.823 -10.891 1.00 0.00 ? 31  ASN A OD1  2  
ATOM 3867  N ND2  . ASN A 1 31  ? -19.271 -14.576 -8.784  1.00 0.00 ? 31  ASN A ND2  2  
ATOM 3868  H H    . ASN A 1 31  ? -16.335 -16.758 -8.390  1.00 0.00 ? 31  ASN A H    2  
ATOM 3869  H HA   . ASN A 1 31  ? -19.131 -16.963 -7.498  1.00 0.00 ? 31  ASN A HA   2  
ATOM 3870  H HB2  . ASN A 1 31  ? -18.282 -17.270 -10.378 1.00 0.00 ? 31  ASN A HB2  2  
ATOM 3871  H HB3  . ASN A 1 31  ? -19.920 -17.168 -9.740  1.00 0.00 ? 31  ASN A HB3  2  
ATOM 3872  H HD21 . ASN A 1 31  ? -19.539 -15.036 -7.962  1.00 0.00 ? 31  ASN A HD21 2  
ATOM 3873  H HD22 . ASN A 1 31  ? -19.269 -13.602 -8.885  1.00 0.00 ? 31  ASN A HD22 2  
ATOM 3874  N N    . HIS A 1 32  ? -18.470 -19.340 -7.044  1.00 0.00 ? 32  HIS A N    2  
ATOM 3875  C CA   . HIS A 1 32  ? -18.311 -20.779 -6.871  1.00 0.00 ? 32  HIS A CA   2  
ATOM 3876  C C    . HIS A 1 32  ? -19.422 -21.538 -7.590  1.00 0.00 ? 32  HIS A C    2  
ATOM 3877  O O    . HIS A 1 32  ? -19.183 -22.201 -8.599  1.00 0.00 ? 32  HIS A O    2  
ATOM 3878  C CB   . HIS A 1 32  ? -18.311 -21.139 -5.385  1.00 0.00 ? 32  HIS A CB   2  
ATOM 3879  C CG   . HIS A 1 32  ? -16.999 -20.887 -4.708  1.00 0.00 ? 32  HIS A CG   2  
ATOM 3880  N ND1  . HIS A 1 32  ? -16.422 -19.638 -4.625  1.00 0.00 ? 32  HIS A ND1  2  
ATOM 3881  C CD2  . HIS A 1 32  ? -16.150 -21.734 -4.079  1.00 0.00 ? 32  HIS A CD2  2  
ATOM 3882  C CE1  . HIS A 1 32  ? -15.275 -19.727 -3.975  1.00 0.00 ? 32  HIS A CE1  2  
ATOM 3883  N NE2  . HIS A 1 32  ? -15.087 -20.988 -3.632  1.00 0.00 ? 32  HIS A NE2  2  
ATOM 3884  H H    . HIS A 1 32  ? -18.803 -18.803 -6.295  1.00 0.00 ? 32  HIS A H    2  
ATOM 3885  H HA   . HIS A 1 32  ? -17.362 -21.062 -7.302  1.00 0.00 ? 32  HIS A HA   2  
ATOM 3886  H HB2  . HIS A 1 32  ? -19.063 -20.552 -4.879  1.00 0.00 ? 32  HIS A HB2  2  
ATOM 3887  H HB3  . HIS A 1 32  ? -18.546 -22.188 -5.276  1.00 0.00 ? 32  HIS A HB3  2  
ATOM 3888  H HD1  . HIS A 1 32  ? -16.796 -18.809 -4.989  1.00 0.00 ? 32  HIS A HD1  2  
ATOM 3889  H HD2  . HIS A 1 32  ? -16.284 -22.799 -3.951  1.00 0.00 ? 32  HIS A HD2  2  
ATOM 3890  H HE1  . HIS A 1 32  ? -14.605 -18.907 -3.759  1.00 0.00 ? 32  HIS A HE1  2  
ATOM 3891  H HE2  . HIS A 1 32  ? -14.361 -21.316 -3.062  1.00 0.00 ? 32  HIS A HE2  2  
ATOM 3892  N N    . SER A 1 33  ? -20.639 -21.432 -7.065  1.00 0.00 ? 33  SER A N    2  
ATOM 3893  C CA   . SER A 1 33  ? -21.788 -22.105 -7.658  1.00 0.00 ? 33  SER A CA   2  
ATOM 3894  C C    . SER A 1 33  ? -22.513 -21.181 -8.630  1.00 0.00 ? 33  SER A C    2  
ATOM 3895  O O    . SER A 1 33  ? -22.446 -21.366 -9.846  1.00 0.00 ? 33  SER A O    2  
ATOM 3896  C CB   . SER A 1 33  ? -22.752 -22.573 -6.565  1.00 0.00 ? 33  SER A CB   2  
ATOM 3897  O OG   . SER A 1 33  ? -23.901 -23.183 -7.126  1.00 0.00 ? 33  SER A OG   2  
ATOM 3898  H H    . SER A 1 33  ? -20.767 -20.887 -6.260  1.00 0.00 ? 33  SER A H    2  
ATOM 3899  H HA   . SER A 1 33  ? -21.426 -22.966 -8.199  1.00 0.00 ? 33  SER A HA   2  
ATOM 3900  H HB2  . SER A 1 33  ? -22.253 -23.291 -5.931  1.00 0.00 ? 33  SER A HB2  2  
ATOM 3901  H HB3  . SER A 1 33  ? -23.061 -21.725 -5.974  1.00 0.00 ? 33  SER A HB3  2  
ATOM 3902  H HG   . SER A 1 33  ? -23.636 -23.787 -7.824  1.00 0.00 ? 33  SER A HG   2  
ATOM 3903  N N    . ILE A 1 34  ? -23.203 -20.182 -8.087  1.00 0.00 ? 34  ILE A N    2  
ATOM 3904  C CA   . ILE A 1 34  ? -23.937 -19.225 -8.906  1.00 0.00 ? 34  ILE A CA   2  
ATOM 3905  C C    . ILE A 1 34  ? -23.012 -18.127 -9.420  1.00 0.00 ? 34  ILE A C    2  
ATOM 3906  O O    . ILE A 1 34  ? -22.025 -17.780 -8.772  1.00 0.00 ? 34  ILE A O    2  
ATOM 3907  C CB   . ILE A 1 34  ? -25.094 -18.582 -8.119  1.00 0.00 ? 34  ILE A CB   2  
ATOM 3908  C CG1  . ILE A 1 34  ? -24.580 -17.990 -6.806  1.00 0.00 ? 34  ILE A CG1  2  
ATOM 3909  C CG2  . ILE A 1 34  ? -26.188 -19.605 -7.854  1.00 0.00 ? 34  ILE A CG2  2  
ATOM 3910  C CD1  . ILE A 1 34  ? -25.523 -16.978 -6.191  1.00 0.00 ? 34  ILE A CD1  2  
ATOM 3911  H H    . ILE A 1 34  ? -23.215 -20.086 -7.112  1.00 0.00 ? 34  ILE A H    2  
ATOM 3912  H HA   . ILE A 1 34  ? -24.353 -19.757 -9.749  1.00 0.00 ? 34  ILE A HA   2  
ATOM 3913  H HB   . ILE A 1 34  ? -25.513 -17.791 -8.722  1.00 0.00 ? 34  ILE A HB   2  
ATOM 3914  H HG12 . ILE A 1 34  ? -24.438 -18.787 -6.091  1.00 0.00 ? 34  ILE A HG12 2  
ATOM 3915  H HG13 . ILE A 1 34  ? -23.635 -17.499 -6.985  1.00 0.00 ? 34  ILE A HG13 2  
ATOM 3916  H HG21 . ILE A 1 34  ? -26.903 -19.585 -8.663  1.00 0.00 ? 34  ILE A HG21 2  
ATOM 3917  H HG22 . ILE A 1 34  ? -26.687 -19.365 -6.926  1.00 0.00 ? 34  ILE A HG22 2  
ATOM 3918  H HG23 . ILE A 1 34  ? -25.751 -20.590 -7.784  1.00 0.00 ? 34  ILE A HG23 2  
ATOM 3919  H HD11 . ILE A 1 34  ? -25.246 -15.986 -6.514  1.00 0.00 ? 34  ILE A HD11 2  
ATOM 3920  H HD12 . ILE A 1 34  ? -25.461 -17.037 -5.114  1.00 0.00 ? 34  ILE A HD12 2  
ATOM 3921  H HD13 . ILE A 1 34  ? -26.534 -17.190 -6.506  1.00 0.00 ? 34  ILE A HD13 2  
ATOM 3922  N N    . VAL A 1 35  ? -23.334 -17.586 -10.591 1.00 0.00 ? 35  VAL A N    2  
ATOM 3923  C CA   . VAL A 1 35  ? -22.525 -16.531 -11.191 1.00 0.00 ? 35  VAL A CA   2  
ATOM 3924  C C    . VAL A 1 35  ? -23.375 -15.313 -11.555 1.00 0.00 ? 35  VAL A C    2  
ATOM 3925  O O    . VAL A 1 35  ? -24.177 -15.366 -12.487 1.00 0.00 ? 35  VAL A O    2  
ATOM 3926  C CB   . VAL A 1 35  ? -21.805 -17.033 -12.456 1.00 0.00 ? 35  VAL A CB   2  
ATOM 3927  C CG1  . VAL A 1 35  ? -20.817 -15.990 -12.959 1.00 0.00 ? 35  VAL A CG1  2  
ATOM 3928  C CG2  . VAL A 1 35  ? -21.103 -18.354 -12.182 1.00 0.00 ? 35  VAL A CG2  2  
ATOM 3929  H H    . VAL A 1 35  ? -24.131 -17.906 -11.064 1.00 0.00 ? 35  VAL A H    2  
ATOM 3930  H HA   . VAL A 1 35  ? -21.776 -16.237 -10.471 1.00 0.00 ? 35  VAL A HA   2  
ATOM 3931  H HB   . VAL A 1 35  ? -22.544 -17.195 -13.226 1.00 0.00 ? 35  VAL A HB   2  
ATOM 3932  H HG11 . VAL A 1 35  ? -20.200 -16.423 -13.732 1.00 0.00 ? 35  VAL A HG11 2  
ATOM 3933  H HG12 . VAL A 1 35  ? -20.193 -15.662 -12.141 1.00 0.00 ? 35  VAL A HG12 2  
ATOM 3934  H HG13 . VAL A 1 35  ? -21.358 -15.146 -13.360 1.00 0.00 ? 35  VAL A HG13 2  
ATOM 3935  H HG21 . VAL A 1 35  ? -21.775 -19.171 -12.401 1.00 0.00 ? 35  VAL A HG21 2  
ATOM 3936  H HG22 . VAL A 1 35  ? -20.810 -18.398 -11.143 1.00 0.00 ? 35  VAL A HG22 2  
ATOM 3937  H HG23 . VAL A 1 35  ? -20.226 -18.432 -12.807 1.00 0.00 ? 35  VAL A HG23 2  
ATOM 3938  N N    . PRO A 1 36  ? -23.206 -14.192 -10.828 1.00 0.00 ? 36  PRO A N    2  
ATOM 3939  C CA   . PRO A 1 36  ? -23.960 -12.961 -11.092 1.00 0.00 ? 36  PRO A CA   2  
ATOM 3940  C C    . PRO A 1 36  ? -23.503 -12.279 -12.377 1.00 0.00 ? 36  PRO A C    2  
ATOM 3941  O O    . PRO A 1 36  ? -22.546 -12.720 -13.013 1.00 0.00 ? 36  PRO A O    2  
ATOM 3942  C CB   . PRO A 1 36  ? -23.641 -12.086 -9.878  1.00 0.00 ? 36  PRO A CB   2  
ATOM 3943  C CG   . PRO A 1 36  ? -22.304 -12.554 -9.421  1.00 0.00 ? 36  PRO A CG   2  
ATOM 3944  C CD   . PRO A 1 36  ? -22.266 -14.031 -9.702  1.00 0.00 ? 36  PRO A CD   2  
ATOM 3945  H HA   . PRO A 1 36  ? -25.022 -13.149 -11.141 1.00 0.00 ? 36  PRO A HA   2  
ATOM 3946  H HB2  . PRO A 1 36  ? -23.618 -11.048 -10.175 1.00 0.00 ? 36  PRO A HB2  2  
ATOM 3947  H HB3  . PRO A 1 36  ? -24.391 -12.234 -9.116  1.00 0.00 ? 36  PRO A HB3  2  
ATOM 3948  H HG2  . PRO A 1 36  ? -21.528 -12.046 -9.975  1.00 0.00 ? 36  PRO A HG2  2  
ATOM 3949  H HG3  . PRO A 1 36  ? -22.193 -12.371 -8.363  1.00 0.00 ? 36  PRO A HG3  2  
ATOM 3950  H HD2  . PRO A 1 36  ? -21.269 -14.336 -9.986  1.00 0.00 ? 36  PRO A HD2  2  
ATOM 3951  H HD3  . PRO A 1 36  ? -22.600 -14.588 -8.839  1.00 0.00 ? 36  PRO A HD3  2  
ATOM 3952  N N    . THR A 1 37  ? -24.186 -11.202 -12.760 1.00 0.00 ? 37  THR A N    2  
ATOM 3953  C CA   . THR A 1 37  ? -23.827 -10.478 -13.973 1.00 0.00 ? 37  THR A CA   2  
ATOM 3954  C C    . THR A 1 37  ? -23.719 -8.976  -13.720 1.00 0.00 ? 37  THR A C    2  
ATOM 3955  O O    . THR A 1 37  ? -22.658 -8.388  -13.921 1.00 0.00 ? 37  THR A O    2  
ATOM 3956  C CB   . THR A 1 37  ? -24.831 -10.768 -15.096 1.00 0.00 ? 37  THR A CB   2  
ATOM 3957  O OG1  . THR A 1 37  ? -24.385 -10.215 -16.321 1.00 0.00 ? 37  THR A OG1  2  
ATOM 3958  C CG2  . THR A 1 37  ? -26.226 -10.241 -14.840 1.00 0.00 ? 37  THR A CG2  2  
ATOM 3959  H H    . THR A 1 37  ? -24.940 -10.891 -12.217 1.00 0.00 ? 37  THR A H    2  
ATOM 3960  H HA   . THR A 1 37  ? -22.856 -10.835 -14.284 1.00 0.00 ? 37  THR A HA   2  
ATOM 3961  H HB   . THR A 1 37  ? -24.905 -11.836 -15.218 1.00 0.00 ? 37  THR A HB   2  
ATOM 3962  H HG1  . THR A 1 37  ? -24.352 -10.903 -16.990 1.00 0.00 ? 37  THR A HG1  2  
ATOM 3963  H HG21 . THR A 1 37  ? -26.526 -10.487 -13.832 1.00 0.00 ? 37  THR A HG21 2  
ATOM 3964  H HG22 . THR A 1 37  ? -26.914 -10.692 -15.540 1.00 0.00 ? 37  THR A HG22 2  
ATOM 3965  H HG23 . THR A 1 37  ? -26.236 -9.168  -14.969 1.00 0.00 ? 37  THR A HG23 2  
ATOM 3966  N N    . HIS A 1 38  ? -24.810 -8.359  -13.277 1.00 0.00 ? 38  HIS A N    2  
ATOM 3967  C CA   . HIS A 1 38  ? -24.816 -6.925  -13.002 1.00 0.00 ? 38  HIS A CA   2  
ATOM 3968  C C    . HIS A 1 38  ? -24.428 -6.631  -11.559 1.00 0.00 ? 38  HIS A C    2  
ATOM 3969  O O    . HIS A 1 38  ? -24.689 -7.423  -10.654 1.00 0.00 ? 38  HIS A O    2  
ATOM 3970  C CB   . HIS A 1 38  ? -26.179 -6.317  -13.312 1.00 0.00 ? 38  HIS A CB   2  
ATOM 3971  C CG   . HIS A 1 38  ? -27.183 -6.491  -12.221 1.00 0.00 ? 38  HIS A CG   2  
ATOM 3972  N ND1  . HIS A 1 38  ? -28.225 -7.392  -12.274 1.00 0.00 ? 38  HIS A ND1  2  
ATOM 3973  C CD2  . HIS A 1 38  ? -27.288 -5.867  -11.035 1.00 0.00 ? 38  HIS A CD2  2  
ATOM 3974  C CE1  . HIS A 1 38  ? -28.928 -7.307  -11.158 1.00 0.00 ? 38  HIS A CE1  2  
ATOM 3975  N NE2  . HIS A 1 38  ? -28.381 -6.385  -10.391 1.00 0.00 ? 38  HIS A NE2  2  
ATOM 3976  H H    . HIS A 1 38  ? -25.624 -8.878  -13.127 1.00 0.00 ? 38  HIS A H    2  
ATOM 3977  H HA   . HIS A 1 38  ? -24.092 -6.459  -13.649 1.00 0.00 ? 38  HIS A HA   2  
ATOM 3978  H HB2  . HIS A 1 38  ? -26.052 -5.260  -13.482 1.00 0.00 ? 38  HIS A HB2  2  
ATOM 3979  H HB3  . HIS A 1 38  ? -26.568 -6.766  -14.201 1.00 0.00 ? 38  HIS A HB3  2  
ATOM 3980  H HD1  . HIS A 1 38  ? -28.421 -8.000  -13.018 1.00 0.00 ? 38  HIS A HD1  2  
ATOM 3981  H HD2  . HIS A 1 38  ? -26.618 -5.115  -10.660 1.00 0.00 ? 38  HIS A HD2  2  
ATOM 3982  H HE1  . HIS A 1 38  ? -29.787 -7.909  -10.902 1.00 0.00 ? 38  HIS A HE1  2  
ATOM 3983  H HE2  . HIS A 1 38  ? -28.798 -6.003  -9.592  1.00 0.00 ? 38  HIS A HE2  2  
ATOM 3984  N N    . TYR A 1 39  ? -23.806 -5.480  -11.362 1.00 0.00 ? 39  TYR A N    2  
ATOM 3985  C CA   . TYR A 1 39  ? -23.371 -5.044  -10.039 1.00 0.00 ? 39  TYR A CA   2  
ATOM 3986  C C    . TYR A 1 39  ? -23.685 -3.569  -9.838  1.00 0.00 ? 39  TYR A C    2  
ATOM 3987  O O    . TYR A 1 39  ? -24.064 -2.881  -10.783 1.00 0.00 ? 39  TYR A O    2  
ATOM 3988  C CB   . TYR A 1 39  ? -21.872 -5.284  -9.875  1.00 0.00 ? 39  TYR A CB   2  
ATOM 3989  C CG   . TYR A 1 39  ? -21.458 -6.693  -10.216 1.00 0.00 ? 39  TYR A CG   2  
ATOM 3990  C CD1  . TYR A 1 39  ? -21.982 -7.774  -9.528  1.00 0.00 ? 39  TYR A CD1  2  
ATOM 3991  C CD2  . TYR A 1 39  ? -20.546 -6.940  -11.230 1.00 0.00 ? 39  TYR A CD2  2  
ATOM 3992  C CE1  . TYR A 1 39  ? -21.607 -9.065  -9.838  1.00 0.00 ? 39  TYR A CE1  2  
ATOM 3993  C CE2  . TYR A 1 39  ? -20.162 -8.223  -11.552 1.00 0.00 ? 39  TYR A CE2  2  
ATOM 3994  C CZ   . TYR A 1 39  ? -20.695 -9.287  -10.851 1.00 0.00 ? 39  TYR A CZ   2  
ATOM 3995  O OH   . TYR A 1 39  ? -20.318 -10.572 -11.165 1.00 0.00 ? 39  TYR A OH   2  
ATOM 3996  H H    . TYR A 1 39  ? -23.631 -4.901  -12.130 1.00 0.00 ? 39  TYR A H    2  
ATOM 3997  H HA   . TYR A 1 39  ? -23.906 -5.624  -9.301  1.00 0.00 ? 39  TYR A HA   2  
ATOM 3998  H HB2  . TYR A 1 39  ? -21.327 -4.611  -10.519 1.00 0.00 ? 39  TYR A HB2  2  
ATOM 3999  H HB3  . TYR A 1 39  ? -21.594 -5.089  -8.856  1.00 0.00 ? 39  TYR A HB3  2  
ATOM 4000  H HD1  . TYR A 1 39  ? -22.693 -7.597  -8.735  1.00 0.00 ? 39  TYR A HD1  2  
ATOM 4001  H HD2  . TYR A 1 39  ? -20.138 -6.111  -11.775 1.00 0.00 ? 39  TYR A HD2  2  
ATOM 4002  H HE1  . TYR A 1 39  ? -22.030 -9.892  -9.288  1.00 0.00 ? 39  TYR A HE1  2  
ATOM 4003  H HE2  . TYR A 1 39  ? -19.445 -8.386  -12.346 1.00 0.00 ? 39  TYR A HE2  2  
ATOM 4004  H HH   . TYR A 1 39  ? -20.250 -10.662 -12.118 1.00 0.00 ? 39  TYR A HH   2  
ATOM 4005  N N    . THR A 1 40  ? -23.515 -3.074  -8.614  1.00 0.00 ? 40  THR A N    2  
ATOM 4006  C CA   . THR A 1 40  ? -23.777 -1.671  -8.327  1.00 0.00 ? 40  THR A CA   2  
ATOM 4007  C C    . THR A 1 40  ? -22.717 -1.098  -7.401  1.00 0.00 ? 40  THR A C    2  
ATOM 4008  O O    . THR A 1 40  ? -22.774 -1.278  -6.184  1.00 0.00 ? 40  THR A O    2  
ATOM 4009  C CB   . THR A 1 40  ? -25.160 -1.492  -7.705  1.00 0.00 ? 40  THR A CB   2  
ATOM 4010  O OG1  . THR A 1 40  ? -26.176 -1.828  -8.632  1.00 0.00 ? 40  THR A OG1  2  
ATOM 4011  C CG2  . THR A 1 40  ? -25.422 -0.081  -7.222  1.00 0.00 ? 40  THR A CG2  2  
ATOM 4012  H H    . THR A 1 40  ? -23.195 -3.645  -7.884  1.00 0.00 ? 40  THR A H    2  
ATOM 4013  H HA   . THR A 1 40  ? -23.744 -1.134  -9.254  1.00 0.00 ? 40  THR A HA   2  
ATOM 4014  H HB   . THR A 1 40  ? -25.244 -2.149  -6.860  1.00 0.00 ? 40  THR A HB   2  
ATOM 4015  H HG1  . THR A 1 40  ? -26.238 -2.783  -8.706  1.00 0.00 ? 40  THR A HG1  2  
ATOM 4016  H HG21 . THR A 1 40  ? -25.379 0.600   -8.058  1.00 0.00 ? 40  THR A HG21 2  
ATOM 4017  H HG22 . THR A 1 40  ? -24.671 0.196   -6.492  1.00 0.00 ? 40  THR A HG22 2  
ATOM 4018  H HG23 . THR A 1 40  ? -26.400 -0.034  -6.767  1.00 0.00 ? 40  THR A HG23 2  
ATOM 4019  N N    . LEU A 1 41  ? -21.758 -0.396  -7.986  1.00 0.00 ? 41  LEU A N    2  
ATOM 4020  C CA   . LEU A 1 41  ? -20.694 0.219   -7.213  1.00 0.00 ? 41  LEU A CA   2  
ATOM 4021  C C    . LEU A 1 41  ? -21.232 1.426   -6.463  1.00 0.00 ? 41  LEU A C    2  
ATOM 4022  O O    . LEU A 1 41  ? -21.477 2.484   -7.054  1.00 0.00 ? 41  LEU A O    2  
ATOM 4023  C CB   . LEU A 1 41  ? -19.538 0.643   -8.125  1.00 0.00 ? 41  LEU A CB   2  
ATOM 4024  C CG   . LEU A 1 41  ? -18.147 0.656   -7.471  1.00 0.00 ? 41  LEU A CG   2  
ATOM 4025  C CD1  . LEU A 1 41  ? -18.003 1.859   -6.550  1.00 0.00 ? 41  LEU A CD1  2  
ATOM 4026  C CD2  . LEU A 1 41  ? -17.886 -0.640  -6.708  1.00 0.00 ? 41  LEU A CD2  2  
ATOM 4027  H H    . LEU A 1 41  ? -21.776 -0.280  -8.957  1.00 0.00 ? 41  LEU A H    2  
ATOM 4028  H HA   . LEU A 1 41  ? -20.339 -0.506  -6.498  1.00 0.00 ? 41  LEU A HA   2  
ATOM 4029  H HB2  . LEU A 1 41  ? -19.511 -0.026  -8.970  1.00 0.00 ? 41  LEU A HB2  2  
ATOM 4030  H HB3  . LEU A 1 41  ? -19.745 1.639   -8.487  1.00 0.00 ? 41  LEU A HB3  2  
ATOM 4031  H HG   . LEU A 1 41  ? -17.399 0.743   -8.246  1.00 0.00 ? 41  LEU A HG   2  
ATOM 4032  H HD11 . LEU A 1 41  ? -17.249 2.523   -6.944  1.00 0.00 ? 41  LEU A HD11 2  
ATOM 4033  H HD12 . LEU A 1 41  ? -17.711 1.527   -5.565  1.00 0.00 ? 41  LEU A HD12 2  
ATOM 4034  H HD13 . LEU A 1 41  ? -18.945 2.383   -6.488  1.00 0.00 ? 41  LEU A HD13 2  
ATOM 4035  H HD21 . LEU A 1 41  ? -16.966 -1.090  -7.054  1.00 0.00 ? 41  LEU A HD21 2  
ATOM 4036  H HD22 . LEU A 1 41  ? -18.699 -1.323  -6.873  1.00 0.00 ? 41  LEU A HD22 2  
ATOM 4037  H HD23 . LEU A 1 41  ? -17.804 -0.429  -5.652  1.00 0.00 ? 41  LEU A HD23 2  
ATOM 4038  N N    . LEU A 1 42  ? -21.395 1.277   -5.156  1.00 0.00 ? 42  LEU A N    2  
ATOM 4039  C CA   . LEU A 1 42  ? -21.884 2.384   -4.333  1.00 0.00 ? 42  LEU A CA   2  
ATOM 4040  C C    . LEU A 1 42  ? -20.758 2.903   -3.454  1.00 0.00 ? 42  LEU A C    2  
ATOM 4041  O O    . LEU A 1 42  ? -19.991 2.113   -2.923  1.00 0.00 ? 42  LEU A O    2  
ATOM 4042  C CB   . LEU A 1 42  ? -23.048 1.940   -3.457  1.00 0.00 ? 42  LEU A CB   2  
ATOM 4043  C CG   . LEU A 1 42  ? -24.062 1.020   -4.137  1.00 0.00 ? 42  LEU A CG   2  
ATOM 4044  C CD1  . LEU A 1 42  ? -24.437 -0.145  -3.231  1.00 0.00 ? 42  LEU A CD1  2  
ATOM 4045  C CD2  . LEU A 1 42  ? -25.299 1.807   -4.529  1.00 0.00 ? 42  LEU A CD2  2  
ATOM 4046  H H    . LEU A 1 42  ? -21.154 0.410   -4.724  1.00 0.00 ? 42  LEU A H    2  
ATOM 4047  H HA   . LEU A 1 42  ? -22.217 3.173   -4.995  1.00 0.00 ? 42  LEU A HA   2  
ATOM 4048  H HB2  . LEU A 1 42  ? -22.644 1.435   -2.595  1.00 0.00 ? 42  LEU A HB2  2  
ATOM 4049  H HB3  . LEU A 1 42  ? -23.567 2.822   -3.123  1.00 0.00 ? 42  LEU A HB3  2  
ATOM 4050  H HG   . LEU A 1 42  ? -23.623 0.619   -5.038  1.00 0.00 ? 42  LEU A HG   2  
ATOM 4051  H HD11 . LEU A 1 42  ? -23.658 -0.890  -3.260  1.00 0.00 ? 42  LEU A HD11 2  
ATOM 4052  H HD12 . LEU A 1 42  ? -25.365 -0.584  -3.572  1.00 0.00 ? 42  LEU A HD12 2  
ATOM 4053  H HD13 . LEU A 1 42  ? -24.559 0.210   -2.219  1.00 0.00 ? 42  LEU A HD13 2  
ATOM 4054  H HD21 . LEU A 1 42  ? -25.793 1.318   -5.353  1.00 0.00 ? 42  LEU A HD21 2  
ATOM 4055  H HD22 . LEU A 1 42  ? -25.007 2.802   -4.823  1.00 0.00 ? 42  LEU A HD22 2  
ATOM 4056  H HD23 . LEU A 1 42  ? -25.972 1.863   -3.687  1.00 0.00 ? 42  LEU A HD23 2  
ATOM 4057  N N    . TYR A 1 43  ? -20.630 4.222   -3.316  1.00 0.00 ? 43  TYR A N    2  
ATOM 4058  C CA   . TYR A 1 43  ? -19.541 4.770   -2.504  1.00 0.00 ? 43  TYR A CA   2  
ATOM 4059  C C    . TYR A 1 43  ? -19.945 5.968   -1.639  1.00 0.00 ? 43  TYR A C    2  
ATOM 4060  O O    . TYR A 1 43  ? -20.869 6.706   -1.967  1.00 0.00 ? 43  TYR A O    2  
ATOM 4061  C CB   . TYR A 1 43  ? -18.399 5.220   -3.404  1.00 0.00 ? 43  TYR A CB   2  
ATOM 4062  C CG   . TYR A 1 43  ? -18.635 6.570   -4.046  1.00 0.00 ? 43  TYR A CG   2  
ATOM 4063  C CD1  . TYR A 1 43  ? -18.384 7.735   -3.337  1.00 0.00 ? 43  TYR A CD1  2  
ATOM 4064  C CD2  . TYR A 1 43  ? -19.109 6.682   -5.344  1.00 0.00 ? 43  TYR A CD2  2  
ATOM 4065  C CE1  . TYR A 1 43  ? -18.599 8.974   -3.899  1.00 0.00 ? 43  TYR A CE1  2  
ATOM 4066  C CE2  . TYR A 1 43  ? -19.325 7.923   -5.919  1.00 0.00 ? 43  TYR A CE2  2  
ATOM 4067  C CZ   . TYR A 1 43  ? -19.069 9.065   -5.191  1.00 0.00 ? 43  TYR A CZ   2  
ATOM 4068  O OH   . TYR A 1 43  ? -19.285 10.301  -5.755  1.00 0.00 ? 43  TYR A OH   2  
ATOM 4069  H H    . TYR A 1 43  ? -21.250 4.823   -3.785  1.00 0.00 ? 43  TYR A H    2  
ATOM 4070  H HA   . TYR A 1 43  ? -19.179 3.971   -1.874  1.00 0.00 ? 43  TYR A HA   2  
ATOM 4071  H HB2  . TYR A 1 43  ? -17.499 5.294   -2.811  1.00 0.00 ? 43  TYR A HB2  2  
ATOM 4072  H HB3  . TYR A 1 43  ? -18.255 4.488   -4.179  1.00 0.00 ? 43  TYR A HB3  2  
ATOM 4073  H HD1  . TYR A 1 43  ? -18.014 7.663   -2.325  1.00 0.00 ? 43  TYR A HD1  2  
ATOM 4074  H HD2  . TYR A 1 43  ? -19.308 5.784   -5.907  1.00 0.00 ? 43  TYR A HD2  2  
ATOM 4075  H HE1  . TYR A 1 43  ? -18.389 9.865   -3.326  1.00 0.00 ? 43  TYR A HE1  2  
ATOM 4076  H HE2  . TYR A 1 43  ? -19.691 7.995   -6.931  1.00 0.00 ? 43  TYR A HE2  2  
ATOM 4077  H HH   . TYR A 1 43  ? -19.011 10.285  -6.675  1.00 0.00 ? 43  TYR A HH   2  
ATOM 4078  N N    . THR A 1 44  ? -19.185 6.176   -0.562  1.00 0.00 ? 44  THR A N    2  
ATOM 4079  C CA   . THR A 1 44  ? -19.387 7.304   0.344   1.00 0.00 ? 44  THR A CA   2  
ATOM 4080  C C    . THR A 1 44  ? -18.048 7.735   0.953   1.00 0.00 ? 44  THR A C    2  
ATOM 4081  O O    . THR A 1 44  ? -17.016 7.110   0.713   1.00 0.00 ? 44  THR A O    2  
ATOM 4082  C CB   . THR A 1 44  ? -20.371 6.946   1.461   1.00 0.00 ? 44  THR A CB   2  
ATOM 4083  O OG1  . THR A 1 44  ? -20.427 7.978   2.429   1.00 0.00 ? 44  THR A OG1  2  
ATOM 4084  C CG2  . THR A 1 44  ? -20.029 5.657   2.180   1.00 0.00 ? 44  THR A CG2  2  
ATOM 4085  H H    . THR A 1 44  ? -18.447 5.565   -0.384  1.00 0.00 ? 44  THR A H    2  
ATOM 4086  H HA   . THR A 1 44  ? -19.788 8.125   -0.232  1.00 0.00 ? 44  THR A HA   2  
ATOM 4087  H HB   . THR A 1 44  ? -21.355 6.836   1.036   1.00 0.00 ? 44  THR A HB   2  
ATOM 4088  H HG1  . THR A 1 44  ? -19.728 7.855   3.076   1.00 0.00 ? 44  THR A HG1  2  
ATOM 4089  H HG21 . THR A 1 44  ? -20.919 5.058   2.288   1.00 0.00 ? 44  THR A HG21 2  
ATOM 4090  H HG22 . THR A 1 44  ? -19.631 5.885   3.157   1.00 0.00 ? 44  THR A HG22 2  
ATOM 4091  H HG23 . THR A 1 44  ? -19.294 5.108   1.609   1.00 0.00 ? 44  THR A HG23 2  
ATOM 4092  N N    . ILE A 1 45  ? -18.080 8.791   1.759   1.00 0.00 ? 45  ILE A N    2  
ATOM 4093  C CA   . ILE A 1 45  ? -16.874 9.297   2.433   1.00 0.00 ? 45  ILE A CA   2  
ATOM 4094  C C    . ILE A 1 45  ? -16.915 8.914   3.907   1.00 0.00 ? 45  ILE A C    2  
ATOM 4095  O O    . ILE A 1 45  ? -17.898 9.169   4.596   1.00 0.00 ? 45  ILE A O    2  
ATOM 4096  C CB   . ILE A 1 45  ? -16.716 10.829  2.303   1.00 0.00 ? 45  ILE A CB   2  
ATOM 4097  C CG1  . ILE A 1 45  ? -17.872 11.439  1.502   1.00 0.00 ? 45  ILE A CG1  2  
ATOM 4098  C CG2  . ILE A 1 45  ? -15.380 11.155  1.645   1.00 0.00 ? 45  ILE A CG2  2  
ATOM 4099  C CD1  . ILE A 1 45  ? -17.765 12.938  1.331   1.00 0.00 ? 45  ILE A CD1  2  
ATOM 4100  H H    . ILE A 1 45  ? -18.941 9.230   1.922   1.00 0.00 ? 45  ILE A H    2  
ATOM 4101  H HA   . ILE A 1 45  ? -16.001 8.832   1.979   1.00 0.00 ? 45  ILE A HA   2  
ATOM 4102  H HB   . ILE A 1 45  ? -16.711 11.255  3.296   1.00 0.00 ? 45  ILE A HB   2  
ATOM 4103  H HG12 . ILE A 1 45  ? -17.893 10.994  0.519   1.00 0.00 ? 45  ILE A HG12 2  
ATOM 4104  H HG13 . ILE A 1 45  ? -18.803 11.227  2.009   1.00 0.00 ? 45  ILE A HG13 2  
ATOM 4105  H HG21 . ILE A 1 45  ? -14.645 10.410  1.927   1.00 0.00 ? 45  ILE A HG21 2  
ATOM 4106  H HG22 . ILE A 1 45  ? -15.047 12.129  1.969   1.00 0.00 ? 45  ILE A HG22 2  
ATOM 4107  H HG23 . ILE A 1 45  ? -15.499 11.153  0.571   1.00 0.00 ? 45  ILE A HG23 2  
ATOM 4108  H HD11 . ILE A 1 45  ? -18.090 13.428  2.237   1.00 0.00 ? 45  ILE A HD11 2  
ATOM 4109  H HD12 . ILE A 1 45  ? -18.389 13.252  0.508   1.00 0.00 ? 45  ILE A HD12 2  
ATOM 4110  H HD13 . ILE A 1 45  ? -16.738 13.205  1.127   1.00 0.00 ? 45  ILE A HD13 2  
ATOM 4111  N N    . MET A 1 46  ? -15.866 8.238   4.359   1.00 0.00 ? 46  MET A N    2  
ATOM 4112  C CA   . MET A 1 46  ? -15.790 7.741   5.734   1.00 0.00 ? 46  MET A CA   2  
ATOM 4113  C C    . MET A 1 46  ? -16.379 8.726   6.750   1.00 0.00 ? 46  MET A C    2  
ATOM 4114  O O    . MET A 1 46  ? -17.150 8.322   7.619   1.00 0.00 ? 46  MET A O    2  
ATOM 4115  C CB   . MET A 1 46  ? -14.339 7.388   6.072   1.00 0.00 ? 46  MET A CB   2  
ATOM 4116  C CG   . MET A 1 46  ? -14.026 7.352   7.561   1.00 0.00 ? 46  MET A CG   2  
ATOM 4117  S SD   . MET A 1 46  ? -15.190 6.340   8.496   1.00 0.00 ? 46  MET A SD   2  
ATOM 4118  C CE   . MET A 1 46  ? -14.066 5.338   9.465   1.00 0.00 ? 46  MET A CE   2  
ATOM 4119  H H    . MET A 1 46  ? -15.156 8.008   3.725   1.00 0.00 ? 46  MET A H    2  
ATOM 4120  H HA   . MET A 1 46  ? -16.374 6.834   5.774   1.00 0.00 ? 46  MET A HA   2  
ATOM 4121  H HB2  . MET A 1 46  ? -14.119 6.414   5.663   1.00 0.00 ? 46  MET A HB2  2  
ATOM 4122  H HB3  . MET A 1 46  ? -13.695 8.111   5.604   1.00 0.00 ? 46  MET A HB3  2  
ATOM 4123  H HG2  . MET A 1 46  ? -13.035 6.945   7.693   1.00 0.00 ? 46  MET A HG2  2  
ATOM 4124  H HG3  . MET A 1 46  ? -14.055 8.360   7.946   1.00 0.00 ? 46  MET A HG3  2  
ATOM 4125  H HE1  . MET A 1 46  ? -13.794 4.457   8.903   1.00 0.00 ? 46  MET A HE1  2  
ATOM 4126  H HE2  . MET A 1 46  ? -14.548 5.045   10.386  1.00 0.00 ? 46  MET A HE2  2  
ATOM 4127  H HE3  . MET A 1 46  ? -13.177 5.910   9.690   1.00 0.00 ? 46  MET A HE3  2  
ATOM 4128  N N    . SER A 1 47  ? -16.028 10.005  6.656   1.00 0.00 ? 47  SER A N    2  
ATOM 4129  C CA   . SER A 1 47  ? -16.556 10.994  7.597   1.00 0.00 ? 47  SER A CA   2  
ATOM 4130  C C    . SER A 1 47  ? -18.072 11.128  7.444   1.00 0.00 ? 47  SER A C    2  
ATOM 4131  O O    . SER A 1 47  ? -18.783 11.412  8.409   1.00 0.00 ? 47  SER A O    2  
ATOM 4132  C CB   . SER A 1 47  ? -15.886 12.351  7.372   1.00 0.00 ? 47  SER A CB   2  
ATOM 4133  O OG   . SER A 1 47  ? -16.450 13.021  6.258   1.00 0.00 ? 47  SER A OG   2  
ATOM 4134  H H    . SER A 1 47  ? -15.395 10.293  5.964   1.00 0.00 ? 47  SER A H    2  
ATOM 4135  H HA   . SER A 1 47  ? -16.334 10.652  8.597   1.00 0.00 ? 47  SER A HA   2  
ATOM 4136  H HB2  . SER A 1 47  ? -16.019 12.966  8.250   1.00 0.00 ? 47  SER A HB2  2  
ATOM 4137  H HB3  . SER A 1 47  ? -14.831 12.204  7.192   1.00 0.00 ? 47  SER A HB3  2  
ATOM 4138  H HG   . SER A 1 47  ? -15.762 13.211  5.616   1.00 0.00 ? 47  SER A HG   2  
ATOM 4139  N N    . LYS A 1 48  ? -18.556 10.904  6.227   1.00 0.00 ? 48  LYS A N    2  
ATOM 4140  C CA   . LYS A 1 48  ? -19.984 10.979  5.934   1.00 0.00 ? 48  LYS A CA   2  
ATOM 4141  C C    . LYS A 1 48  ? -20.457 9.688   5.272   1.00 0.00 ? 48  LYS A C    2  
ATOM 4142  O O    . LYS A 1 48  ? -20.690 9.651   4.066   1.00 0.00 ? 48  LYS A O    2  
ATOM 4143  C CB   . LYS A 1 48  ? -20.290 12.171  5.023   1.00 0.00 ? 48  LYS A CB   2  
ATOM 4144  C CG   . LYS A 1 48  ? -20.129 13.518  5.709   1.00 0.00 ? 48  LYS A CG   2  
ATOM 4145  C CD   . LYS A 1 48  ? -20.372 14.668  4.743   1.00 0.00 ? 48  LYS A CD   2  
ATOM 4146  C CE   . LYS A 1 48  ? -21.262 15.735  5.359   1.00 0.00 ? 48  LYS A CE   2  
ATOM 4147  N NZ   . LYS A 1 48  ? -20.742 16.203  6.673   1.00 0.00 ? 48  LYS A NZ   2  
ATOM 4148  H H    . LYS A 1 48  ? -17.928 10.677  5.512   1.00 0.00 ? 48  LYS A H    2  
ATOM 4149  H HA   . LYS A 1 48  ? -20.509 11.103  6.869   1.00 0.00 ? 48  LYS A HA   2  
ATOM 4150  H HB2  . LYS A 1 48  ? -19.624 12.141  4.173   1.00 0.00 ? 48  LYS A HB2  2  
ATOM 4151  H HB3  . LYS A 1 48  ? -21.308 12.089  4.672   1.00 0.00 ? 48  LYS A HB3  2  
ATOM 4152  H HG2  . LYS A 1 48  ? -20.839 13.585  6.519   1.00 0.00 ? 48  LYS A HG2  2  
ATOM 4153  H HG3  . LYS A 1 48  ? -19.125 13.594  6.100   1.00 0.00 ? 48  LYS A HG3  2  
ATOM 4154  H HD2  . LYS A 1 48  ? -19.423 15.112  4.482   1.00 0.00 ? 48  LYS A HD2  2  
ATOM 4155  H HD3  . LYS A 1 48  ? -20.849 14.284  3.853   1.00 0.00 ? 48  LYS A HD3  2  
ATOM 4156  H HE2  . LYS A 1 48  ? -21.315 16.576  4.683   1.00 0.00 ? 48  LYS A HE2  2  
ATOM 4157  H HE3  . LYS A 1 48  ? -22.252 15.324  5.498   1.00 0.00 ? 48  LYS A HE3  2  
ATOM 4158  H HZ1  . LYS A 1 48  ? -21.411 16.872  7.106   1.00 0.00 ? 48  LYS A HZ1  2  
ATOM 4159  H HZ2  . LYS A 1 48  ? -19.827 16.680  6.546   1.00 0.00 ? 48  LYS A HZ2  2  
ATOM 4160  H HZ3  . LYS A 1 48  ? -20.612 15.394  7.315   1.00 0.00 ? 48  LYS A HZ3  2  
ATOM 4161  N N    . PRO A 1 49  ? -20.596 8.607   6.059   1.00 0.00 ? 49  PRO A N    2  
ATOM 4162  C CA   . PRO A 1 49  ? -21.031 7.301   5.546   1.00 0.00 ? 49  PRO A CA   2  
ATOM 4163  C C    . PRO A 1 49  ? -22.490 7.284   5.118   1.00 0.00 ? 49  PRO A C    2  
ATOM 4164  O O    . PRO A 1 49  ? -22.963 6.320   4.514   1.00 0.00 ? 49  PRO A O    2  
ATOM 4165  C CB   . PRO A 1 49  ? -20.805 6.359   6.730   1.00 0.00 ? 49  PRO A CB   2  
ATOM 4166  C CG   . PRO A 1 49  ? -20.877 7.236   7.933   1.00 0.00 ? 49  PRO A CG   2  
ATOM 4167  C CD   . PRO A 1 49  ? -20.332 8.572   7.508   1.00 0.00 ? 49  PRO A CD   2  
ATOM 4168  H HA   . PRO A 1 49  ? -20.425 6.994   4.719   1.00 0.00 ? 49  PRO A HA   2  
ATOM 4169  H HB2  . PRO A 1 49  ? -21.576 5.603   6.744   1.00 0.00 ? 49  PRO A HB2  2  
ATOM 4170  H HB3  . PRO A 1 49  ? -19.836 5.891   6.641   1.00 0.00 ? 49  PRO A HB3  2  
ATOM 4171  H HG2  . PRO A 1 49  ? -21.903 7.334   8.254   1.00 0.00 ? 49  PRO A HG2  2  
ATOM 4172  H HG3  . PRO A 1 49  ? -20.273 6.821   8.726   1.00 0.00 ? 49  PRO A HG3  2  
ATOM 4173  H HD2  . PRO A 1 49  ? -20.855 9.371   8.012   1.00 0.00 ? 49  PRO A HD2  2  
ATOM 4174  H HD3  . PRO A 1 49  ? -19.275 8.631   7.707   1.00 0.00 ? 49  PRO A HD3  2  
ATOM 4175  N N    . GLU A 1 50  ? -23.193 8.354   5.431   1.00 0.00 ? 50  GLU A N    2  
ATOM 4176  C CA   . GLU A 1 50  ? -24.602 8.478   5.081   1.00 0.00 ? 50  GLU A CA   2  
ATOM 4177  C C    . GLU A 1 50  ? -24.774 9.080   3.688   1.00 0.00 ? 50  GLU A C    2  
ATOM 4178  O O    . GLU A 1 50  ? -25.897 9.255   3.214   1.00 0.00 ? 50  GLU A O    2  
ATOM 4179  C CB   . GLU A 1 50  ? -25.319 9.350   6.111   1.00 0.00 ? 50  GLU A CB   2  
ATOM 4180  C CG   . GLU A 1 50  ? -26.354 8.597   6.932   1.00 0.00 ? 50  GLU A CG   2  
ATOM 4181  C CD   . GLU A 1 50  ? -26.689 9.300   8.233   1.00 0.00 ? 50  GLU A CD   2  
ATOM 4182  O OE1  . GLU A 1 50  ? -27.357 10.354  8.183   1.00 0.00 ? 50  GLU A OE1  2  
ATOM 4183  O OE2  . GLU A 1 50  ? -26.283 8.796   9.302   1.00 0.00 ? 50  GLU A OE2  2  
ATOM 4184  H H    . GLU A 1 50  ? -22.753 9.080   5.910   1.00 0.00 ? 50  GLU A H    2  
ATOM 4185  H HA   . GLU A 1 50  ? -25.037 7.491   5.092   1.00 0.00 ? 50  GLU A HA   2  
ATOM 4186  H HB2  . GLU A 1 50  ? -24.584 9.762   6.786   1.00 0.00 ? 50  GLU A HB2  2  
ATOM 4187  H HB3  . GLU A 1 50  ? -25.816 10.159  5.598   1.00 0.00 ? 50  GLU A HB3  2  
ATOM 4188  H HG2  . GLU A 1 50  ? -27.258 8.503   6.349   1.00 0.00 ? 50  GLU A HG2  2  
ATOM 4189  H HG3  . GLU A 1 50  ? -25.968 7.614   7.159   1.00 0.00 ? 50  GLU A HG3  2  
ATOM 4190  N N    . ASP A 1 51  ? -23.660 9.403   3.040   1.00 0.00 ? 51  ASP A N    2  
ATOM 4191  C CA   . ASP A 1 51  ? -23.693 9.993   1.708   1.00 0.00 ? 51  ASP A CA   2  
ATOM 4192  C C    . ASP A 1 51  ? -23.156 9.025   0.653   1.00 0.00 ? 51  ASP A C    2  
ATOM 4193  O O    . ASP A 1 51  ? -22.188 9.330   -0.044  1.00 0.00 ? 51  ASP A O    2  
ATOM 4194  C CB   . ASP A 1 51  ? -22.876 11.289  1.692   1.00 0.00 ? 51  ASP A CB   2  
ATOM 4195  C CG   . ASP A 1 51  ? -23.489 12.349  0.799   1.00 0.00 ? 51  ASP A CG   2  
ATOM 4196  O OD1  . ASP A 1 51  ? -24.583 12.849  1.135   1.00 0.00 ? 51  ASP A OD1  2  
ATOM 4197  O OD2  . ASP A 1 51  ? -22.876 12.678  -0.238  1.00 0.00 ? 51  ASP A OD2  2  
ATOM 4198  H H    . ASP A 1 51  ? -22.793 9.248   3.467   1.00 0.00 ? 51  ASP A H    2  
ATOM 4199  H HA   . ASP A 1 51  ? -24.721 10.226  1.475   1.00 0.00 ? 51  ASP A HA   2  
ATOM 4200  H HB2  . ASP A 1 51  ? -22.815 11.682  2.697   1.00 0.00 ? 51  ASP A HB2  2  
ATOM 4201  H HB3  . ASP A 1 51  ? -21.880 11.074  1.335   1.00 0.00 ? 51  ASP A HB3  2  
ATOM 4202  N N    . LEU A 1 52  ? -23.791 7.860   0.531   1.00 0.00 ? 52  LEU A N    2  
ATOM 4203  C CA   . LEU A 1 52  ? -23.367 6.865   -0.452  1.00 0.00 ? 52  LEU A CA   2  
ATOM 4204  C C    . LEU A 1 52  ? -24.030 7.129   -1.800  1.00 0.00 ? 52  LEU A C    2  
ATOM 4205  O O    . LEU A 1 52  ? -25.172 7.584   -1.859  1.00 0.00 ? 52  LEU A O    2  
ATOM 4206  C CB   . LEU A 1 52  ? -23.692 5.448   0.033   1.00 0.00 ? 52  LEU A CB   2  
ATOM 4207  C CG   . LEU A 1 52  ? -22.473 4.544   0.245   1.00 0.00 ? 52  LEU A CG   2  
ATOM 4208  C CD1  . LEU A 1 52  ? -22.683 3.634   1.444   1.00 0.00 ? 52  LEU A CD1  2  
ATOM 4209  C CD2  . LEU A 1 52  ? -22.190 3.720   -1.002  1.00 0.00 ? 52  LEU A CD2  2  
ATOM 4210  H H    . LEU A 1 52  ? -24.560 7.670   1.108   1.00 0.00 ? 52  LEU A H    2  
ATOM 4211  H HA   . LEU A 1 52  ? -22.301 6.959   -0.569  1.00 0.00 ? 52  LEU A HA   2  
ATOM 4212  H HB2  . LEU A 1 52  ? -24.226 5.524   0.969   1.00 0.00 ? 52  LEU A HB2  2  
ATOM 4213  H HB3  . LEU A 1 52  ? -24.338 4.977   -0.693  1.00 0.00 ? 52  LEU A HB3  2  
ATOM 4214  H HG   . LEU A 1 52  ? -21.607 5.162   0.439   1.00 0.00 ? 52  LEU A HG   2  
ATOM 4215  H HD11 . LEU A 1 52  ? -23.281 2.784   1.151   1.00 0.00 ? 52  LEU A HD11 2  
ATOM 4216  H HD12 . LEU A 1 52  ? -23.191 4.179   2.226   1.00 0.00 ? 52  LEU A HD12 2  
ATOM 4217  H HD13 . LEU A 1 52  ? -21.725 3.291   1.807   1.00 0.00 ? 52  LEU A HD13 2  
ATOM 4218  H HD21 . LEU A 1 52  ? -22.764 2.805   -0.967  1.00 0.00 ? 52  LEU A HD21 2  
ATOM 4219  H HD22 . LEU A 1 52  ? -21.135 3.481   -1.047  1.00 0.00 ? 52  LEU A HD22 2  
ATOM 4220  H HD23 . LEU A 1 52  ? -22.468 4.285   -1.879  1.00 0.00 ? 52  LEU A HD23 2  
ATOM 4221  N N    . LYS A 1 53  ? -23.306 6.856   -2.884  1.00 0.00 ? 53  LYS A N    2  
ATOM 4222  C CA   . LYS A 1 53  ? -23.834 7.086   -4.223  1.00 0.00 ? 53  LYS A CA   2  
ATOM 4223  C C    . LYS A 1 53  ? -23.578 5.917   -5.154  1.00 0.00 ? 53  LYS A C    2  
ATOM 4224  O O    . LYS A 1 53  ? -22.437 5.494   -5.337  1.00 0.00 ? 53  LYS A O    2  
ATOM 4225  C CB   . LYS A 1 53  ? -23.191 8.325   -4.856  1.00 0.00 ? 53  LYS A CB   2  
ATOM 4226  C CG   . LYS A 1 53  ? -24.184 9.235   -5.559  1.00 0.00 ? 53  LYS A CG   2  
ATOM 4227  C CD   . LYS A 1 53  ? -23.893 10.702  -5.282  1.00 0.00 ? 53  LYS A CD   2  
ATOM 4228  C CE   . LYS A 1 53  ? -23.182 11.363  -6.453  1.00 0.00 ? 53  LYS A CE   2  
ATOM 4229  N NZ   . LYS A 1 53  ? -21.880 11.961  -6.046  1.00 0.00 ? 53  LYS A NZ   2  
ATOM 4230  H H    . LYS A 1 53  ? -22.398 6.507   -2.784  1.00 0.00 ? 53  LYS A H    2  
ATOM 4231  H HA   . LYS A 1 53  ? -24.897 7.246   -4.142  1.00 0.00 ? 53  LYS A HA   2  
ATOM 4232  H HB2  . LYS A 1 53  ? -22.684 8.889   -4.093  1.00 0.00 ? 53  LYS A HB2  2  
ATOM 4233  H HB3  . LYS A 1 53  ? -22.463 8.000   -5.590  1.00 0.00 ? 53  LYS A HB3  2  
ATOM 4234  H HG2  . LYS A 1 53  ? -24.121 9.060   -6.625  1.00 0.00 ? 53  LYS A HG2  2  
ATOM 4235  H HG3  . LYS A 1 53  ? -25.180 9.002   -5.212  1.00 0.00 ? 53  LYS A HG3  2  
ATOM 4236  H HD2  . LYS A 1 53  ? -24.825 11.217  -5.104  1.00 0.00 ? 53  LYS A HD2  2  
ATOM 4237  H HD3  . LYS A 1 53  ? -23.267 10.775  -4.405  1.00 0.00 ? 53  LYS A HD3  2  
ATOM 4238  H HE2  . LYS A 1 53  ? -23.003 10.621  -7.217  1.00 0.00 ? 53  LYS A HE2  2  
ATOM 4239  H HE3  . LYS A 1 53  ? -23.817 12.141  -6.850  1.00 0.00 ? 53  LYS A HE3  2  
ATOM 4240  H HZ1  . LYS A 1 53  ? -21.181 11.848  -6.808  1.00 0.00 ? 53  LYS A HZ1  2  
ATOM 4241  H HZ2  . LYS A 1 53  ? -21.523 11.492  -5.190  1.00 0.00 ? 53  LYS A HZ2  2  
ATOM 4242  H HZ3  . LYS A 1 53  ? -21.999 12.975  -5.848  1.00 0.00 ? 53  LYS A HZ3  2  
ATOM 4243  N N    . VAL A 1 54  ? -24.630 5.459   -5.811  1.00 0.00 ? 54  VAL A N    2  
ATOM 4244  C CA   . VAL A 1 54  ? -24.482 4.415   -6.802  1.00 0.00 ? 54  VAL A CA   2  
ATOM 4245  C C    . VAL A 1 54  ? -24.035 5.128   -8.071  1.00 0.00 ? 54  VAL A C    2  
ATOM 4246  O O    . VAL A 1 54  ? -24.841 5.706   -8.799  1.00 0.00 ? 54  VAL A O    2  
ATOM 4247  C CB   . VAL A 1 54  ? -25.785 3.582   -7.012  1.00 0.00 ? 54  VAL A CB   2  
ATOM 4248  C CG1  . VAL A 1 54  ? -26.845 3.947   -5.980  1.00 0.00 ? 54  VAL A CG1  2  
ATOM 4249  C CG2  . VAL A 1 54  ? -26.353 3.724   -8.421  1.00 0.00 ? 54  VAL A CG2  2  
ATOM 4250  H H    . VAL A 1 54  ? -25.504 5.883   -5.678  1.00 0.00 ? 54  VAL A H    2  
ATOM 4251  H HA   . VAL A 1 54  ? -23.689 3.750   -6.471  1.00 0.00 ? 54  VAL A HA   2  
ATOM 4252  H HB   . VAL A 1 54  ? -25.528 2.543   -6.863  1.00 0.00 ? 54  VAL A HB   2  
ATOM 4253  H HG11 . VAL A 1 54  ? -27.510 3.108   -5.836  1.00 0.00 ? 54  VAL A HG11 2  
ATOM 4254  H HG12 . VAL A 1 54  ? -27.410 4.798   -6.330  1.00 0.00 ? 54  VAL A HG12 2  
ATOM 4255  H HG13 . VAL A 1 54  ? -26.367 4.193   -5.043  1.00 0.00 ? 54  VAL A HG13 2  
ATOM 4256  H HG21 . VAL A 1 54  ? -27.147 3.006   -8.561  1.00 0.00 ? 54  VAL A HG21 2  
ATOM 4257  H HG22 . VAL A 1 54  ? -25.572 3.544   -9.145  1.00 0.00 ? 54  VAL A HG22 2  
ATOM 4258  H HG23 . VAL A 1 54  ? -26.744 4.722   -8.552  1.00 0.00 ? 54  VAL A HG23 2  
ATOM 4259  N N    . VAL A 1 55  ? -22.728 5.163   -8.283  1.00 0.00 ? 55  VAL A N    2  
ATOM 4260  C CA   . VAL A 1 55  ? -22.166 5.887   -9.413  1.00 0.00 ? 55  VAL A CA   2  
ATOM 4261  C C    . VAL A 1 55  ? -22.832 5.517   -10.734 1.00 0.00 ? 55  VAL A C    2  
ATOM 4262  O O    . VAL A 1 55  ? -23.078 4.344   -11.014 1.00 0.00 ? 55  VAL A O    2  
ATOM 4263  C CB   . VAL A 1 55  ? -20.649 5.663   -9.519  1.00 0.00 ? 55  VAL A CB   2  
ATOM 4264  C CG1  . VAL A 1 55  ? -20.047 6.561   -10.590 1.00 0.00 ? 55  VAL A CG1  2  
ATOM 4265  C CG2  . VAL A 1 55  ? -19.989 5.910   -8.170  1.00 0.00 ? 55  VAL A CG2  2  
ATOM 4266  H H    . VAL A 1 55  ? -22.121 4.729   -7.642  1.00 0.00 ? 55  VAL A H    2  
ATOM 4267  H HA   . VAL A 1 55  ? -22.332 6.942   -9.225  1.00 0.00 ? 55  VAL A HA   2  
ATOM 4268  H HB   . VAL A 1 55  ? -20.473 4.636   -9.800  1.00 0.00 ? 55  VAL A HB   2  
ATOM 4269  H HG11 . VAL A 1 55  ? -20.117 7.592   -10.275 1.00 0.00 ? 55  VAL A HG11 2  
ATOM 4270  H HG12 . VAL A 1 55  ? -20.588 6.430   -11.515 1.00 0.00 ? 55  VAL A HG12 2  
ATOM 4271  H HG13 . VAL A 1 55  ? -19.010 6.300   -10.738 1.00 0.00 ? 55  VAL A HG13 2  
ATOM 4272  H HG21 . VAL A 1 55  ? -20.695 6.391   -7.503  1.00 0.00 ? 55  VAL A HG21 2  
ATOM 4273  H HG22 . VAL A 1 55  ? -19.126 6.546   -8.301  1.00 0.00 ? 55  VAL A HG22 2  
ATOM 4274  H HG23 . VAL A 1 55  ? -19.679 4.967   -7.744  1.00 0.00 ? 55  VAL A HG23 2  
ATOM 4275  N N    . LYS A 1 56  ? -23.115 6.536   -11.544 1.00 0.00 ? 56  LYS A N    2  
ATOM 4276  C CA   . LYS A 1 56  ? -23.748 6.335   -12.842 1.00 0.00 ? 56  LYS A CA   2  
ATOM 4277  C C    . LYS A 1 56  ? -22.921 5.385   -13.699 1.00 0.00 ? 56  LYS A C    2  
ATOM 4278  O O    . LYS A 1 56  ? -21.701 5.521   -13.793 1.00 0.00 ? 56  LYS A O    2  
ATOM 4279  C CB   . LYS A 1 56  ? -23.923 7.673   -13.562 1.00 0.00 ? 56  LYS A CB   2  
ATOM 4280  C CG   . LYS A 1 56  ? -25.274 8.324   -13.317 1.00 0.00 ? 56  LYS A CG   2  
ATOM 4281  C CD   . LYS A 1 56  ? -25.192 9.837   -13.435 1.00 0.00 ? 56  LYS A CD   2  
ATOM 4282  C CE   . LYS A 1 56  ? -24.986 10.274  -14.877 1.00 0.00 ? 56  LYS A CE   2  
ATOM 4283  N NZ   . LYS A 1 56  ? -23.583 10.701  -15.132 1.00 0.00 ? 56  LYS A NZ   2  
ATOM 4284  H H    . LYS A 1 56  ? -22.889 7.447   -11.261 1.00 0.00 ? 56  LYS A H    2  
ATOM 4285  H HA   . LYS A 1 56  ? -24.720 5.896   -12.673 1.00 0.00 ? 56  LYS A HA   2  
ATOM 4286  H HB2  . LYS A 1 56  ? -23.153 8.353   -13.227 1.00 0.00 ? 56  LYS A HB2  2  
ATOM 4287  H HB3  . LYS A 1 56  ? -23.812 7.514   -14.625 1.00 0.00 ? 56  LYS A HB3  2  
ATOM 4288  H HG2  . LYS A 1 56  ? -25.979 7.953   -14.046 1.00 0.00 ? 56  LYS A HG2  2  
ATOM 4289  H HG3  . LYS A 1 56  ? -25.611 8.066   -12.323 1.00 0.00 ? 56  LYS A HG3  2  
ATOM 4290  H HD2  . LYS A 1 56  ? -26.112 10.267  -13.068 1.00 0.00 ? 56  LYS A HD2  2  
ATOM 4291  H HD3  . LYS A 1 56  ? -24.364 10.190  -12.839 1.00 0.00 ? 56  LYS A HD3  2  
ATOM 4292  H HE2  . LYS A 1 56  ? -25.225 9.447   -15.529 1.00 0.00 ? 56  LYS A HE2  2  
ATOM 4293  H HE3  . LYS A 1 56  ? -25.649 11.100  -15.087 1.00 0.00 ? 56  LYS A HE3  2  
ATOM 4294  H HZ1  . LYS A 1 56  ? -23.568 11.503  -15.794 1.00 0.00 ? 56  LYS A HZ1  2  
ATOM 4295  H HZ2  . LYS A 1 56  ? -23.039 9.916   -15.544 1.00 0.00 ? 56  LYS A HZ2  2  
ATOM 4296  H HZ3  . LYS A 1 56  ? -23.130 10.992  -14.242 1.00 0.00 ? 56  LYS A HZ3  2  
ATOM 4297  N N    . ASN A 1 57  ? -23.594 4.415   -14.312 1.00 0.00 ? 57  ASN A N    2  
ATOM 4298  C CA   . ASN A 1 57  ? -22.929 3.425   -15.156 1.00 0.00 ? 57  ASN A CA   2  
ATOM 4299  C C    . ASN A 1 57  ? -22.255 2.343   -14.312 1.00 0.00 ? 57  ASN A C    2  
ATOM 4300  O O    . ASN A 1 57  ? -21.756 1.353   -14.847 1.00 0.00 ? 57  ASN A O    2  
ATOM 4301  C CB   . ASN A 1 57  ? -21.898 4.091   -16.072 1.00 0.00 ? 57  ASN A CB   2  
ATOM 4302  C CG   . ASN A 1 57  ? -21.797 3.407   -17.422 1.00 0.00 ? 57  ASN A CG   2  
ATOM 4303  O OD1  . ASN A 1 57  ? -21.998 4.031   -18.464 1.00 0.00 ? 57  ASN A OD1  2  
ATOM 4304  N ND2  . ASN A 1 57  ? -21.484 2.117   -17.409 1.00 0.00 ? 57  ASN A ND2  2  
ATOM 4305  H H    . ASN A 1 57  ? -24.564 4.358   -14.188 1.00 0.00 ? 57  ASN A H    2  
ATOM 4306  H HA   . ASN A 1 57  ? -23.686 2.958   -15.769 1.00 0.00 ? 57  ASN A HA   2  
ATOM 4307  H HB2  . ASN A 1 57  ? -22.179 5.121   -16.232 1.00 0.00 ? 57  ASN A HB2  2  
ATOM 4308  H HB3  . ASN A 1 57  ? -20.928 4.057   -15.598 1.00 0.00 ? 57  ASN A HB3  2  
ATOM 4309  H HD21 . ASN A 1 57  ? -21.337 1.684   -16.542 1.00 0.00 ? 57  ASN A HD21 2  
ATOM 4310  H HD22 . ASN A 1 57  ? -21.413 1.649   -18.267 1.00 0.00 ? 57  ASN A HD22 2  
ATOM 4311  N N    . CYS A 1 58  ? -22.248 2.528   -12.990 1.00 0.00 ? 58  CYS A N    2  
ATOM 4312  C CA   . CYS A 1 58  ? -21.642 1.555   -12.091 1.00 0.00 ? 58  CYS A CA   2  
ATOM 4313  C C    . CYS A 1 58  ? -22.711 0.833   -11.267 1.00 0.00 ? 58  CYS A C    2  
ATOM 4314  O O    . CYS A 1 58  ? -22.399 -0.072  -10.495 1.00 0.00 ? 58  CYS A O    2  
ATOM 4315  C CB   . CYS A 1 58  ? -20.606 2.230   -11.188 1.00 0.00 ? 58  CYS A CB   2  
ATOM 4316  S SG   . CYS A 1 58  ? -19.313 3.130   -12.114 1.00 0.00 ? 58  CYS A SG   2  
ATOM 4317  H H    . CYS A 1 58  ? -22.664 3.327   -12.613 1.00 0.00 ? 58  CYS A H    2  
ATOM 4318  H HA   . CYS A 1 58  ? -21.140 0.821   -12.705 1.00 0.00 ? 58  CYS A HA   2  
ATOM 4319  H HB2  . CYS A 1 58  ? -21.105 2.937   -10.544 1.00 0.00 ? 58  CYS A HB2  2  
ATOM 4320  H HB3  . CYS A 1 58  ? -20.118 1.479   -10.585 1.00 0.00 ? 58  CYS A HB3  2  
ATOM 4321  N N    . ALA A 1 59  ? -23.979 1.191   -11.495 1.00 0.00 ? 59  ALA A N    2  
ATOM 4322  C CA   . ALA A 1 59  ? -25.104 0.530   -10.839 1.00 0.00 ? 59  ALA A CA   2  
ATOM 4323  C C    . ALA A 1 59  ? -25.535 -0.599  -11.753 1.00 0.00 ? 59  ALA A C    2  
ATOM 4324  O O    . ALA A 1 59  ? -25.241 -0.539  -12.946 1.00 0.00 ? 59  ALA A O    2  
ATOM 4325  C CB   . ALA A 1 59  ? -26.252 1.502   -10.610 1.00 0.00 ? 59  ALA A CB   2  
ATOM 4326  H H    . ALA A 1 59  ? -24.168 1.874   -12.171 1.00 0.00 ? 59  ALA A H    2  
ATOM 4327  H HA   . ALA A 1 59  ? -24.780 0.129   -9.885  1.00 0.00 ? 59  ALA A HA   2  
ATOM 4328  H HB1  . ALA A 1 59  ? -25.922 2.507   -10.824 1.00 0.00 ? 59  ALA A HB1  2  
ATOM 4329  H HB2  . ALA A 1 59  ? -26.575 1.439   -9.582  1.00 0.00 ? 59  ALA A HB2  2  
ATOM 4330  H HB3  . ALA A 1 59  ? -27.076 1.246   -11.262 1.00 0.00 ? 59  ALA A HB3  2  
ATOM 4331  N N    . ASN A 1 60  ? -26.188 -1.638  -11.224 1.00 0.00 ? 60  ASN A N    2  
ATOM 4332  C CA   . ASN A 1 60  ? -26.581 -2.776  -12.069 1.00 0.00 ? 60  ASN A CA   2  
ATOM 4333  C C    . ASN A 1 60  ? -25.903 -2.642  -13.411 1.00 0.00 ? 60  ASN A C    2  
ATOM 4334  O O    . ASN A 1 60  ? -26.500 -2.262  -14.418 1.00 0.00 ? 60  ASN A O    2  
ATOM 4335  C CB   . ASN A 1 60  ? -28.105 -2.841  -12.239 1.00 0.00 ? 60  ASN A CB   2  
ATOM 4336  C CG   . ASN A 1 60  ? -28.802 -1.557  -11.829 1.00 0.00 ? 60  ASN A CG   2  
ATOM 4337  O OD1  . ASN A 1 60  ? -29.379 -1.469  -10.745 1.00 0.00 ? 60  ASN A OD1  2  
ATOM 4338  N ND2  . ASN A 1 60  ? -28.752 -0.552  -12.696 1.00 0.00 ? 60  ASN A ND2  2  
ATOM 4339  H H    . ASN A 1 60  ? -26.372 -1.653  -10.263 1.00 0.00 ? 60  ASN A H    2  
ATOM 4340  H HA   . ASN A 1 60  ? -26.221 -3.700  -11.620 1.00 0.00 ? 60  ASN A HA   2  
ATOM 4341  H HB2  . ASN A 1 60  ? -28.335 -3.032  -13.275 1.00 0.00 ? 60  ASN A HB2  2  
ATOM 4342  H HB3  . ASN A 1 60  ? -28.492 -3.648  -11.635 1.00 0.00 ? 60  ASN A HB3  2  
ATOM 4343  H HD21 . ASN A 1 60  ? -28.274 -0.693  -13.540 1.00 0.00 ? 60  ASN A HD21 2  
ATOM 4344  H HD22 . ASN A 1 60  ? -29.194 0.289   -12.456 1.00 0.00 ? 60  ASN A HD22 2  
ATOM 4345  N N    . THR A 1 61  ? -24.631 -2.980  -13.378 1.00 0.00 ? 61  THR A N    2  
ATOM 4346  C CA   . THR A 1 61  ? -23.773 -2.946  -14.518 1.00 0.00 ? 61  THR A CA   2  
ATOM 4347  C C    . THR A 1 61  ? -23.174 -4.317  -14.638 1.00 0.00 ? 61  THR A C    2  
ATOM 4348  O O    . THR A 1 61  ? -22.681 -4.863  -13.650 1.00 0.00 ? 61  THR A O    2  
ATOM 4349  C CB   . THR A 1 61  ? -22.668 -1.904  -14.310 1.00 0.00 ? 61  THR A CB   2  
ATOM 4350  O OG1  . THR A 1 61  ? -21.805 -1.845  -15.434 1.00 0.00 ? 61  THR A OG1  2  
ATOM 4351  C CG2  . THR A 1 61  ? -21.814 -2.177  -13.082 1.00 0.00 ? 61  THR A CG2  2  
ATOM 4352  H H    . THR A 1 61  ? -24.244 -3.277  -12.533 1.00 0.00 ? 61  THR A H    2  
ATOM 4353  H HA   . THR A 1 61  ? -24.353 -2.712  -15.397 1.00 0.00 ? 61  THR A HA   2  
ATOM 4354  H HB   . THR A 1 61  ? -23.123 -0.931  -14.183 1.00 0.00 ? 61  THR A HB   2  
ATOM 4355  H HG1  . THR A 1 61  ? -21.733 -2.715  -15.832 1.00 0.00 ? 61  THR A HG1  2  
ATOM 4356  H HG21 . THR A 1 61  ? -22.280 -2.944  -12.474 1.00 0.00 ? 61  THR A HG21 2  
ATOM 4357  H HG22 . THR A 1 61  ? -21.717 -1.271  -12.502 1.00 0.00 ? 61  THR A HG22 2  
ATOM 4358  H HG23 . THR A 1 61  ? -20.835 -2.511  -13.392 1.00 0.00 ? 61  THR A HG23 2  
ATOM 4359  N N    . THR A 1 62  ? -23.205 -4.886  -15.817 1.00 0.00 ? 62  THR A N    2  
ATOM 4360  C CA   . THR A 1 62  ? -22.649 -6.203  -15.972 1.00 0.00 ? 62  THR A CA   2  
ATOM 4361  C C    . THR A 1 62  ? -21.246 -6.080  -16.514 1.00 0.00 ? 62  THR A C    2  
ATOM 4362  O O    . THR A 1 62  ? -20.873 -6.589  -17.572 1.00 0.00 ? 62  THR A O    2  
ATOM 4363  C CB   . THR A 1 62  ? -23.538 -7.084  -16.811 1.00 0.00 ? 62  THR A CB   2  
ATOM 4364  O OG1  . THR A 1 62  ? -23.334 -6.864  -18.196 1.00 0.00 ? 62  THR A OG1  2  
ATOM 4365  C CG2  . THR A 1 62  ? -25.012 -6.892  -16.504 1.00 0.00 ? 62  THR A CG2  2  
ATOM 4366  H H    . THR A 1 62  ? -23.608 -4.416  -16.577 1.00 0.00 ? 62  THR A H    2  
ATOM 4367  H HA   . THR A 1 62  ? -22.583 -6.630  -14.978 1.00 0.00 ? 62  THR A HA   2  
ATOM 4368  H HB   . THR A 1 62  ? -23.287 -8.098  -16.576 1.00 0.00 ? 62  THR A HB   2  
ATOM 4369  H HG1  . THR A 1 62  ? -22.647 -7.452  -18.516 1.00 0.00 ? 62  THR A HG1  2  
ATOM 4370  H HG21 . THR A 1 62  ? -25.519 -7.843  -16.556 1.00 0.00 ? 62  THR A HG21 2  
ATOM 4371  H HG22 . THR A 1 62  ? -25.445 -6.212  -17.223 1.00 0.00 ? 62  THR A HG22 2  
ATOM 4372  H HG23 . THR A 1 62  ? -25.123 -6.479  -15.506 1.00 0.00 ? 62  THR A HG23 2  
ATOM 4373  N N    . ARG A 1 63  ? -20.501 -5.377  -15.691 1.00 0.00 ? 63  ARG A N    2  
ATOM 4374  C CA   . ARG A 1 63  ? -19.100 -5.062  -15.862 1.00 0.00 ? 63  ARG A CA   2  
ATOM 4375  C C    . ARG A 1 63  ? -18.476 -5.217  -14.487 1.00 0.00 ? 63  ARG A C    2  
ATOM 4376  O O    . ARG A 1 63  ? -19.200 -5.526  -13.546 1.00 0.00 ? 63  ARG A O    2  
ATOM 4377  C CB   . ARG A 1 63  ? -18.956 -3.623  -16.351 1.00 0.00 ? 63  ARG A CB   2  
ATOM 4378  C CG   . ARG A 1 63  ? -18.867 -3.497  -17.865 1.00 0.00 ? 63  ARG A CG   2  
ATOM 4379  C CD   . ARG A 1 63  ? -19.760 -2.382  -18.391 1.00 0.00 ? 63  ARG A CD   2  
ATOM 4380  N NE   . ARG A 1 63  ? -19.006 -1.394  -19.158 1.00 0.00 ? 63  ARG A NE   2  
ATOM 4381  C CZ   . ARG A 1 63  ? -18.625 -1.570  -20.422 1.00 0.00 ? 63  ARG A CZ   2  
ATOM 4382  N NH1  . ARG A 1 63  ? -18.925 -2.694  -21.062 1.00 0.00 ? 63  ARG A NH1  2  
ATOM 4383  N NH2  . ARG A 1 63  ? -17.943 -0.621  -21.047 1.00 0.00 ? 63  ARG A NH2  2  
ATOM 4384  H H    . ARG A 1 63  ? -20.937 -5.056  -14.881 1.00 0.00 ? 63  ARG A H    2  
ATOM 4385  H HA   . ARG A 1 63  ? -18.655 -5.754  -16.561 1.00 0.00 ? 63  ARG A HA   2  
ATOM 4386  H HB2  . ARG A 1 63  ? -19.818 -3.058  -16.009 1.00 0.00 ? 63  ARG A HB2  2  
ATOM 4387  H HB3  . ARG A 1 63  ? -18.064 -3.195  -15.920 1.00 0.00 ? 63  ARG A HB3  2  
ATOM 4388  H HG2  . ARG A 1 63  ? -17.845 -3.284  -18.139 1.00 0.00 ? 63  ARG A HG2  2  
ATOM 4389  H HG3  . ARG A 1 63  ? -19.174 -4.432  -18.311 1.00 0.00 ? 63  ARG A HG3  2  
ATOM 4390  H HD2  . ARG A 1 63  ? -20.517 -2.816  -19.027 1.00 0.00 ? 63  ARG A HD2  2  
ATOM 4391  H HD3  . ARG A 1 63  ? -20.233 -1.890  -17.554 1.00 0.00 ? 63  ARG A HD3  2  
ATOM 4392  H HE   . ARG A 1 63  ? -18.772 -0.555  -18.710 1.00 0.00 ? 63  ARG A HE   2  
ATOM 4393  H HH11 . ARG A 1 63  ? -19.439 -3.414  -20.596 1.00 0.00 ? 63  ARG A HH11 2  
ATOM 4394  H HH12 . ARG A 1 63  ? -18.636 -2.820  -22.010 1.00 0.00 ? 63  ARG A HH12 2  
ATOM 4395  H HH21 . ARG A 1 63  ? -17.714 0.228   -20.569 1.00 0.00 ? 63  ARG A HH21 2  
ATOM 4396  H HH22 . ARG A 1 63  ? -17.656 -0.753  -21.995 1.00 0.00 ? 63  ARG A HH22 2  
ATOM 4397  N N    . SER A 1 64  ? -17.177 -5.006  -14.319 1.00 0.00 ? 64  SER A N    2  
ATOM 4398  C CA   . SER A 1 64  ? -16.606 -5.139  -12.984 1.00 0.00 ? 64  SER A CA   2  
ATOM 4399  C C    . SER A 1 64  ? -15.998 -3.835  -12.460 1.00 0.00 ? 64  SER A C    2  
ATOM 4400  O O    . SER A 1 64  ? -16.577 -3.170  -11.607 1.00 0.00 ? 64  SER A O    2  
ATOM 4401  C CB   . SER A 1 64  ? -15.604 -6.285  -12.926 1.00 0.00 ? 64  SER A CB   2  
ATOM 4402  O OG   . SER A 1 64  ? -14.385 -5.948  -13.565 1.00 0.00 ? 64  SER A OG   2  
ATOM 4403  H H    . SER A 1 64  ? -16.598 -4.736  -15.062 1.00 0.00 ? 64  SER A H    2  
ATOM 4404  H HA   . SER A 1 64  ? -17.424 -5.391  -12.331 1.00 0.00 ? 64  SER A HA   2  
ATOM 4405  H HB2  . SER A 1 64  ? -15.409 -6.529  -11.893 1.00 0.00 ? 64  SER A HB2  2  
ATOM 4406  H HB3  . SER A 1 64  ? -16.033 -7.144  -13.412 1.00 0.00 ? 64  SER A HB3  2  
ATOM 4407  H HG   . SER A 1 64  ? -13.655 -6.099  -12.961 1.00 0.00 ? 64  SER A HG   2  
ATOM 4408  N N    . PHE A 1 65  ? -14.809 -3.490  -12.937 1.00 0.00 ? 65  PHE A N    2  
ATOM 4409  C CA   . PHE A 1 65  ? -14.127 -2.288  -12.463 1.00 0.00 ? 65  PHE A CA   2  
ATOM 4410  C C    . PHE A 1 65  ? -14.799 -0.994  -12.914 1.00 0.00 ? 65  PHE A C    2  
ATOM 4411  O O    . PHE A 1 65  ? -14.902 -0.706  -14.107 1.00 0.00 ? 65  PHE A O    2  
ATOM 4412  C CB   . PHE A 1 65  ? -12.667 -2.296  -12.908 1.00 0.00 ? 65  PHE A CB   2  
ATOM 4413  C CG   . PHE A 1 65  ? -12.490 -2.289  -14.399 1.00 0.00 ? 65  PHE A CG   2  
ATOM 4414  C CD1  . PHE A 1 65  ? -12.452 -3.477  -15.112 1.00 0.00 ? 65  PHE A CD1  2  
ATOM 4415  C CD2  . PHE A 1 65  ? -12.360 -1.094  -15.088 1.00 0.00 ? 65  PHE A CD2  2  
ATOM 4416  C CE1  . PHE A 1 65  ? -12.288 -3.473  -16.484 1.00 0.00 ? 65  PHE A CE1  2  
ATOM 4417  C CE2  . PHE A 1 65  ? -12.196 -1.084  -16.461 1.00 0.00 ? 65  PHE A CE2  2  
ATOM 4418  C CZ   . PHE A 1 65  ? -12.160 -2.275  -17.159 1.00 0.00 ? 65  PHE A CZ   2  
ATOM 4419  H H    . PHE A 1 65  ? -14.362 -4.068  -13.589 1.00 0.00 ? 65  PHE A H    2  
ATOM 4420  H HA   . PHE A 1 65  ? -14.148 -2.314  -11.388 1.00 0.00 ? 65  PHE A HA   2  
ATOM 4421  H HB2  . PHE A 1 65  ? -12.175 -1.422  -12.509 1.00 0.00 ? 65  PHE A HB2  2  
ATOM 4422  H HB3  . PHE A 1 65  ? -12.188 -3.180  -12.517 1.00 0.00 ? 65  PHE A HB3  2  
ATOM 4423  H HD1  . PHE A 1 65  ? -12.552 -4.414  -14.585 1.00 0.00 ? 65  PHE A HD1  2  
ATOM 4424  H HD2  . PHE A 1 65  ? -12.388 -0.162  -14.543 1.00 0.00 ? 65  PHE A HD2  2  
ATOM 4425  H HE1  . PHE A 1 65  ? -12.260 -4.406  -17.028 1.00 0.00 ? 65  PHE A HE1  2  
ATOM 4426  H HE2  . PHE A 1 65  ? -12.097 -0.146  -16.986 1.00 0.00 ? 65  PHE A HE2  2  
ATOM 4427  H HZ   . PHE A 1 65  ? -12.032 -2.269  -18.232 1.00 0.00 ? 65  PHE A HZ   2  
ATOM 4428  N N    . CYS A 1 66  ? -15.237 -0.212  -11.928 1.00 0.00 ? 66  CYS A N    2  
ATOM 4429  C CA   . CYS A 1 66  ? -15.887 1.072   -12.174 1.00 0.00 ? 66  CYS A CA   2  
ATOM 4430  C C    . CYS A 1 66  ? -14.863 2.194   -11.994 1.00 0.00 ? 66  CYS A C    2  
ATOM 4431  O O    . CYS A 1 66  ? -13.982 2.109   -11.136 1.00 0.00 ? 66  CYS A O    2  
ATOM 4432  C CB   . CYS A 1 66  ? -17.082 1.246   -11.219 1.00 0.00 ? 66  CYS A CB   2  
ATOM 4433  S SG   . CYS A 1 66  ? -17.641 2.967   -10.969 1.00 0.00 ? 66  CYS A SG   2  
ATOM 4434  H H    . CYS A 1 66  ? -15.118 -0.519  -11.005 1.00 0.00 ? 66  CYS A H    2  
ATOM 4435  H HA   . CYS A 1 66  ? -16.240 1.078   -13.195 1.00 0.00 ? 66  CYS A HA   2  
ATOM 4436  H HB2  . CYS A 1 66  ? -17.921 0.689   -11.606 1.00 0.00 ? 66  CYS A HB2  2  
ATOM 4437  H HB3  . CYS A 1 66  ? -16.814 0.846   -10.252 1.00 0.00 ? 66  CYS A HB3  2  
ATOM 4438  N N    . ASP A 1 67  ? -14.967 3.235   -12.815 1.00 0.00 ? 67  ASP A N    2  
ATOM 4439  C CA   . ASP A 1 67  ? -14.025 4.347   -12.744 1.00 0.00 ? 67  ASP A CA   2  
ATOM 4440  C C    . ASP A 1 67  ? -14.543 5.481   -11.868 1.00 0.00 ? 67  ASP A C    2  
ATOM 4441  O O    . ASP A 1 67  ? -15.718 5.520   -11.503 1.00 0.00 ? 67  ASP A O    2  
ATOM 4442  C CB   . ASP A 1 67  ? -13.701 4.870   -14.140 1.00 0.00 ? 67  ASP A CB   2  
ATOM 4443  C CG   . ASP A 1 67  ? -14.903 5.493   -14.824 1.00 0.00 ? 67  ASP A CG   2  
ATOM 4444  O OD1  . ASP A 1 67  ? -15.745 4.736   -15.350 1.00 0.00 ? 67  ASP A OD1  2  
ATOM 4445  O OD2  . ASP A 1 67  ? -15.002 6.738   -14.832 1.00 0.00 ? 67  ASP A OD2  2  
ATOM 4446  H H    . ASP A 1 67  ? -15.684 3.249   -13.483 1.00 0.00 ? 67  ASP A H    2  
ATOM 4447  H HA   . ASP A 1 67  ? -13.113 3.968   -12.304 1.00 0.00 ? 67  ASP A HA   2  
ATOM 4448  H HB2  . ASP A 1 67  ? -12.925 5.617   -14.060 1.00 0.00 ? 67  ASP A HB2  2  
ATOM 4449  H HB3  . ASP A 1 67  ? -13.344 4.053   -14.748 1.00 0.00 ? 67  ASP A HB3  2  
ATOM 4450  N N    . LEU A 1 68  ? -13.638 6.391   -11.523 1.00 0.00 ? 68  LEU A N    2  
ATOM 4451  C CA   . LEU A 1 68  ? -13.962 7.528   -10.669 1.00 0.00 ? 68  LEU A CA   2  
ATOM 4452  C C    . LEU A 1 68  ? -12.809 8.529   -10.640 1.00 0.00 ? 68  LEU A C    2  
ATOM 4453  O O    . LEU A 1 68  ? -12.011 8.551   -9.704  1.00 0.00 ? 68  LEU A O    2  
ATOM 4454  C CB   . LEU A 1 68  ? -14.253 7.046   -9.245  1.00 0.00 ? 68  LEU A CB   2  
ATOM 4455  C CG   . LEU A 1 68  ? -13.421 5.840   -8.804  1.00 0.00 ? 68  LEU A CG   2  
ATOM 4456  C CD1  . LEU A 1 68  ? -13.164 5.863   -7.307  1.00 0.00 ? 68  LEU A CD1  2  
ATOM 4457  C CD2  . LEU A 1 68  ? -14.108 4.550   -9.210  1.00 0.00 ? 68  LEU A CD2  2  
ATOM 4458  H H    . LEU A 1 68  ? -12.719 6.286   -11.842 1.00 0.00 ? 68  LEU A H    2  
ATOM 4459  H HA   . LEU A 1 68  ? -14.841 8.011   -11.068 1.00 0.00 ? 68  LEU A HA   2  
ATOM 4460  H HB2  . LEU A 1 68  ? -14.061 7.862   -8.563  1.00 0.00 ? 68  LEU A HB2  2  
ATOM 4461  H HB3  . LEU A 1 68  ? -15.297 6.780   -9.181  1.00 0.00 ? 68  LEU A HB3  2  
ATOM 4462  H HG   . LEU A 1 68  ? -12.468 5.875   -9.299  1.00 0.00 ? 68  LEU A HG   2  
ATOM 4463  H HD11 . LEU A 1 68  ? -14.101 5.773   -6.781  1.00 0.00 ? 68  LEU A HD11 2  
ATOM 4464  H HD12 . LEU A 1 68  ? -12.686 6.793   -7.035  1.00 0.00 ? 68  LEU A HD12 2  
ATOM 4465  H HD13 . LEU A 1 68  ? -12.520 5.038   -7.039  1.00 0.00 ? 68  LEU A HD13 2  
ATOM 4466  H HD21 . LEU A 1 68  ? -14.091 3.858   -8.383  1.00 0.00 ? 68  LEU A HD21 2  
ATOM 4467  H HD22 . LEU A 1 68  ? -13.584 4.118   -10.054 1.00 0.00 ? 68  LEU A HD22 2  
ATOM 4468  H HD23 . LEU A 1 68  ? -15.131 4.756   -9.488  1.00 0.00 ? 68  LEU A HD23 2  
ATOM 4469  N N    . THR A 1 69  ? -12.715 9.362   -11.657 1.00 0.00 ? 69  THR A N    2  
ATOM 4470  C CA   . THR A 1 69  ? -11.652 10.350  -11.698 1.00 0.00 ? 69  THR A CA   2  
ATOM 4471  C C    . THR A 1 69  ? -12.079 11.588  -10.923 1.00 0.00 ? 69  THR A C    2  
ATOM 4472  O O    . THR A 1 69  ? -11.336 12.108  -10.091 1.00 0.00 ? 69  THR A O    2  
ATOM 4473  C CB   . THR A 1 69  ? -11.304 10.716  -13.143 1.00 0.00 ? 69  THR A CB   2  
ATOM 4474  O OG1  . THR A 1 69  ? -12.180 11.717  -13.632 1.00 0.00 ? 69  THR A OG1  2  
ATOM 4475  C CG2  . THR A 1 69  ? -11.374 9.542   -14.096 1.00 0.00 ? 69  THR A CG2  2  
ATOM 4476  H H    . THR A 1 69  ? -13.370 9.319   -12.386 1.00 0.00 ? 69  THR A H    2  
ATOM 4477  H HA   . THR A 1 69  ? -10.785 9.914   -11.211 1.00 0.00 ? 69  THR A HA   2  
ATOM 4478  H HB   . THR A 1 69  ? -10.297 11.105  -13.170 1.00 0.00 ? 69  THR A HB   2  
ATOM 4479  H HG1  . THR A 1 69  ? -13.065 11.355  -13.714 1.00 0.00 ? 69  THR A HG1  2  
ATOM 4480  H HG21 . THR A 1 69  ? -12.406 9.340   -14.342 1.00 0.00 ? 69  THR A HG21 2  
ATOM 4481  H HG22 . THR A 1 69  ? -10.939 8.671   -13.629 1.00 0.00 ? 69  THR A HG22 2  
ATOM 4482  H HG23 . THR A 1 69  ? -10.829 9.776   -14.998 1.00 0.00 ? 69  THR A HG23 2  
ATOM 4483  N N    . ASP A 1 70  ? -13.297 12.035  -11.194 1.00 0.00 ? 70  ASP A N    2  
ATOM 4484  C CA   . ASP A 1 70  ? -13.862 13.194  -10.519 1.00 0.00 ? 70  ASP A CA   2  
ATOM 4485  C C    . ASP A 1 70  ? -15.043 12.779  -9.641  1.00 0.00 ? 70  ASP A C    2  
ATOM 4486  O O    . ASP A 1 70  ? -15.719 13.623  -9.053  1.00 0.00 ? 70  ASP A O    2  
ATOM 4487  C CB   . ASP A 1 70  ? -14.313 14.240  -11.541 1.00 0.00 ? 70  ASP A CB   2  
ATOM 4488  C CG   . ASP A 1 70  ? -13.171 15.120  -12.009 1.00 0.00 ? 70  ASP A CG   2  
ATOM 4489  O OD1  . ASP A 1 70  ? -12.668 15.923  -11.195 1.00 0.00 ? 70  ASP A OD1  2  
ATOM 4490  O OD2  . ASP A 1 70  ? -12.779 15.006  -13.190 1.00 0.00 ? 70  ASP A OD2  2  
ATOM 4491  H H    . ASP A 1 70  ? -13.840 11.560  -11.858 1.00 0.00 ? 70  ASP A H    2  
ATOM 4492  H HA   . ASP A 1 70  ? -13.094 13.622  -9.891  1.00 0.00 ? 70  ASP A HA   2  
ATOM 4493  H HB2  . ASP A 1 70  ? -14.730 13.737  -12.400 1.00 0.00 ? 70  ASP A HB2  2  
ATOM 4494  H HB3  . ASP A 1 70  ? -15.069 14.868  -11.094 1.00 0.00 ? 70  ASP A HB3  2  
ATOM 4495  N N    . GLU A 1 71  ? -15.287 11.469  -9.556  1.00 0.00 ? 71  GLU A N    2  
ATOM 4496  C CA   . GLU A 1 71  ? -16.383 10.942  -8.752  1.00 0.00 ? 71  GLU A CA   2  
ATOM 4497  C C    . GLU A 1 71  ? -15.939 10.703  -7.313  1.00 0.00 ? 71  GLU A C    2  
ATOM 4498  O O    . GLU A 1 71  ? -16.758 10.716  -6.394  1.00 0.00 ? 71  GLU A O    2  
ATOM 4499  C CB   . GLU A 1 71  ? -16.913 9.640   -9.356  1.00 0.00 ? 71  GLU A CB   2  
ATOM 4500  C CG   . GLU A 1 71  ? -18.055 9.845   -10.338 1.00 0.00 ? 71  GLU A CG   2  
ATOM 4501  C CD   . GLU A 1 71  ? -17.638 10.636  -11.562 1.00 0.00 ? 71  GLU A CD   2  
ATOM 4502  O OE1  . GLU A 1 71  ? -16.962 10.059  -12.440 1.00 0.00 ? 71  GLU A OE1  2  
ATOM 4503  O OE2  . GLU A 1 71  ? -17.987 11.832  -11.643 1.00 0.00 ? 71  GLU A OE2  2  
ATOM 4504  H H    . GLU A 1 71  ? -14.715 10.842  -10.046 1.00 0.00 ? 71  GLU A H    2  
ATOM 4505  H HA   . GLU A 1 71  ? -17.175 11.676  -8.753  1.00 0.00 ? 71  GLU A HA   2  
ATOM 4506  H HB2  . GLU A 1 71  ? -16.107 9.141   -9.874  1.00 0.00 ? 71  GLU A HB2  2  
ATOM 4507  H HB3  . GLU A 1 71  ? -17.264 9.003   -8.558  1.00 0.00 ? 71  GLU A HB3  2  
ATOM 4508  H HG2  . GLU A 1 71  ? -18.416 8.879   -10.658 1.00 0.00 ? 71  GLU A HG2  2  
ATOM 4509  H HG3  . GLU A 1 71  ? -18.851 10.377  -9.837  1.00 0.00 ? 71  GLU A HG3  2  
ATOM 4510  N N    . TRP A 1 72  ? -14.638 10.502  -7.116  1.00 0.00 ? 72  TRP A N    2  
ATOM 4511  C CA   . TRP A 1 72  ? -14.100 10.281  -5.779  1.00 0.00 ? 72  TRP A CA   2  
ATOM 4512  C C    . TRP A 1 72  ? -13.227 11.459  -5.360  1.00 0.00 ? 72  TRP A C    2  
ATOM 4513  O O    . TRP A 1 72  ? -12.044 11.294  -5.058  1.00 0.00 ? 72  TRP A O    2  
ATOM 4514  C CB   . TRP A 1 72  ? -13.294 8.983   -5.716  1.00 0.00 ? 72  TRP A CB   2  
ATOM 4515  C CG   . TRP A 1 72  ? -14.120 7.795   -5.329  1.00 0.00 ? 72  TRP A CG   2  
ATOM 4516  C CD1  . TRP A 1 72  ? -15.434 7.574   -5.636  1.00 0.00 ? 72  TRP A CD1  2  
ATOM 4517  C CD2  . TRP A 1 72  ? -13.691 6.663   -4.563  1.00 0.00 ? 72  TRP A CD2  2  
ATOM 4518  N NE1  . TRP A 1 72  ? -15.844 6.374   -5.106  1.00 0.00 ? 72  TRP A NE1  2  
ATOM 4519  C CE2  . TRP A 1 72  ? -14.794 5.800   -4.448  1.00 0.00 ? 72  TRP A CE2  2  
ATOM 4520  C CE3  . TRP A 1 72  ? -12.485 6.291   -3.964  1.00 0.00 ? 72  TRP A CE3  2  
ATOM 4521  C CZ2  . TRP A 1 72  ? -14.730 4.599   -3.765  1.00 0.00 ? 72  TRP A CZ2  2  
ATOM 4522  C CZ3  . TRP A 1 72  ? -12.425 5.089   -3.281  1.00 0.00 ? 72  TRP A CZ3  2  
ATOM 4523  C CH2  . TRP A 1 72  ? -13.547 4.256   -3.190  1.00 0.00 ? 72  TRP A CH2  2  
ATOM 4524  H H    . TRP A 1 72  ? -14.023 10.518  -7.878  1.00 0.00 ? 72  TRP A H    2  
ATOM 4525  H HA   . TRP A 1 72  ? -14.935 10.203  -5.102  1.00 0.00 ? 72  TRP A HA   2  
ATOM 4526  H HB2  . TRP A 1 72  ? -12.855 8.787   -6.681  1.00 0.00 ? 72  TRP A HB2  2  
ATOM 4527  H HB3  . TRP A 1 72  ? -12.506 9.093   -4.985  1.00 0.00 ? 72  TRP A HB3  2  
ATOM 4528  H HD1  . TRP A 1 72  ? -16.048 8.252   -6.210  1.00 0.00 ? 72  TRP A HD1  2  
ATOM 4529  H HE1  . TRP A 1 72  ? -16.742 5.987   -5.186  1.00 0.00 ? 72  TRP A HE1  2  
ATOM 4530  H HE3  . TRP A 1 72  ? -11.613 6.921   -4.027  1.00 0.00 ? 72  TRP A HE3  2  
ATOM 4531  H HZ2  . TRP A 1 72  ? -15.578 3.949   -3.689  1.00 0.00 ? 72  TRP A HZ2  2  
ATOM 4532  H HZ3  . TRP A 1 72  ? -11.502 4.781   -2.813  1.00 0.00 ? 72  TRP A HZ3  2  
ATOM 4533  H HH2  . TRP A 1 72  ? -13.467 3.327   -2.649  1.00 0.00 ? 72  TRP A HH2  2  
ATOM 4534  N N    . ARG A 1 73  ? -13.819 12.649  -5.354  1.00 0.00 ? 73  ARG A N    2  
ATOM 4535  C CA   . ARG A 1 73  ? -13.103 13.865  -4.982  1.00 0.00 ? 73  ARG A CA   2  
ATOM 4536  C C    . ARG A 1 73  ? -12.542 13.755  -3.563  1.00 0.00 ? 73  ARG A C    2  
ATOM 4537  O O    . ARG A 1 73  ? -12.275 12.657  -3.082  1.00 0.00 ? 73  ARG A O    2  
ATOM 4538  C CB   . ARG A 1 73  ? -14.034 15.075  -5.103  1.00 0.00 ? 73  ARG A CB   2  
ATOM 4539  C CG   . ARG A 1 73  ? -13.375 16.287  -5.741  1.00 0.00 ? 73  ARG A CG   2  
ATOM 4540  C CD   . ARG A 1 73  ? -14.359 17.433  -5.913  1.00 0.00 ? 73  ARG A CD   2  
ATOM 4541  N NE   . ARG A 1 73  ? -13.794 18.709  -5.480  1.00 0.00 ? 73  ARG A NE   2  
ATOM 4542  C CZ   . ARG A 1 73  ? -12.791 19.324  -6.102  1.00 0.00 ? 73  ARG A CZ   2  
ATOM 4543  N NH1  . ARG A 1 73  ? -12.241 18.786  -7.184  1.00 0.00 ? 73  ARG A NH1  2  
ATOM 4544  N NH2  . ARG A 1 73  ? -12.337 20.482  -5.641  1.00 0.00 ? 73  ARG A NH2  2  
ATOM 4545  H H    . ARG A 1 73  ? -14.762 12.713  -5.613  1.00 0.00 ? 73  ARG A H    2  
ATOM 4546  H HA   . ARG A 1 73  ? -12.281 13.986  -5.671  1.00 0.00 ? 73  ARG A HA   2  
ATOM 4547  H HB2  . ARG A 1 73  ? -14.889 14.799  -5.703  1.00 0.00 ? 73  ARG A HB2  2  
ATOM 4548  H HB3  . ARG A 1 73  ? -14.374 15.355  -4.116  1.00 0.00 ? 73  ARG A HB3  2  
ATOM 4549  H HG2  . ARG A 1 73  ? -12.562 16.616  -5.112  1.00 0.00 ? 73  ARG A HG2  2  
ATOM 4550  H HG3  . ARG A 1 73  ? -12.991 16.006  -6.711  1.00 0.00 ? 73  ARG A HG3  2  
ATOM 4551  H HD2  . ARG A 1 73  ? -14.629 17.505  -6.956  1.00 0.00 ? 73  ARG A HD2  2  
ATOM 4552  H HD3  . ARG A 1 73  ? -15.242 17.224  -5.328  1.00 0.00 ? 73  ARG A HD3  2  
ATOM 4553  H HE   . ARG A 1 73  ? -14.182 19.128  -4.684  1.00 0.00 ? 73  ARG A HE   2  
ATOM 4554  H HH11 . ARG A 1 73  ? -12.579 17.914  -7.536  1.00 0.00 ? 73  ARG A HH11 2  
ATOM 4555  H HH12 . ARG A 1 73  ? -11.488 19.254  -7.646  1.00 0.00 ? 73  ARG A HH12 2  
ATOM 4556  H HH21 . ARG A 1 73  ? -12.747 20.891  -4.827  1.00 0.00 ? 73  ARG A HH21 2  
ATOM 4557  H HH22 . ARG A 1 73  ? -11.583 20.944  -6.108  1.00 0.00 ? 73  ARG A HH22 2  
ATOM 4558  N N    . SER A 1 74  ? -12.363 14.898  -2.897  1.00 0.00 ? 74  SER A N    2  
ATOM 4559  C CA   . SER A 1 74  ? -11.832 14.923  -1.534  1.00 0.00 ? 74  SER A CA   2  
ATOM 4560  C C    . SER A 1 74  ? -10.703 13.909  -1.361  1.00 0.00 ? 74  SER A C    2  
ATOM 4561  O O    . SER A 1 74  ? -10.783 13.009  -0.524  1.00 0.00 ? 74  SER A O    2  
ATOM 4562  C CB   . SER A 1 74  ? -12.948 14.636  -0.525  1.00 0.00 ? 74  SER A CB   2  
ATOM 4563  O OG   . SER A 1 74  ? -13.992 15.588  -0.631  1.00 0.00 ? 74  SER A OG   2  
ATOM 4564  H H    . SER A 1 74  ? -12.594 15.743  -3.335  1.00 0.00 ? 74  SER A H    2  
ATOM 4565  H HA   . SER A 1 74  ? -11.441 15.912  -1.350  1.00 0.00 ? 74  SER A HA   2  
ATOM 4566  H HB2  . SER A 1 74  ? -13.354 13.653  -0.710  1.00 0.00 ? 74  SER A HB2  2  
ATOM 4567  H HB3  . SER A 1 74  ? -12.543 14.673  0.476   1.00 0.00 ? 74  SER A HB3  2  
ATOM 4568  H HG   . SER A 1 74  ? -14.498 15.602  0.185   1.00 0.00 ? 74  SER A HG   2  
ATOM 4569  N N    . THR A 1 75  ? -9.653  14.057  -2.164  1.00 0.00 ? 75  THR A N    2  
ATOM 4570  C CA   . THR A 1 75  ? -8.508  13.152  -2.105  1.00 0.00 ? 75  THR A CA   2  
ATOM 4571  C C    . THR A 1 75  ? -8.011  12.975  -0.673  1.00 0.00 ? 75  THR A C    2  
ATOM 4572  O O    . THR A 1 75  ? -7.376  11.973  -0.349  1.00 0.00 ? 75  THR A O    2  
ATOM 4573  C CB   . THR A 1 75  ? -7.372  13.668  -2.988  1.00 0.00 ? 75  THR A CB   2  
ATOM 4574  O OG1  . THR A 1 75  ? -7.153  15.051  -2.769  1.00 0.00 ? 75  THR A OG1  2  
ATOM 4575  C CG2  . THR A 1 75  ? -7.625  13.469  -4.467  1.00 0.00 ? 75  THR A CG2  2  
ATOM 4576  H H    . THR A 1 75  ? -9.648  14.790  -2.814  1.00 0.00 ? 75  THR A H    2  
ATOM 4577  H HA   . THR A 1 75  ? -8.830  12.191  -2.479  1.00 0.00 ? 75  THR A HA   2  
ATOM 4578  H HB   . THR A 1 75  ? -6.466  13.137  -2.734  1.00 0.00 ? 75  THR A HB   2  
ATOM 4579  H HG1  . THR A 1 75  ? -7.860  15.558  -3.175  1.00 0.00 ? 75  THR A HG1  2  
ATOM 4580  H HG21 . THR A 1 75  ? -7.966  12.459  -4.641  1.00 0.00 ? 75  THR A HG21 2  
ATOM 4581  H HG22 . THR A 1 75  ? -6.710  13.640  -5.015  1.00 0.00 ? 75  THR A HG22 2  
ATOM 4582  H HG23 . THR A 1 75  ? -8.380  14.166  -4.801  1.00 0.00 ? 75  THR A HG23 2  
ATOM 4583  N N    . HIS A 1 76  ? -8.300  13.954  0.181   1.00 0.00 ? 76  HIS A N    2  
ATOM 4584  C CA   . HIS A 1 76  ? -7.876  13.900  1.575   1.00 0.00 ? 76  HIS A CA   2  
ATOM 4585  C C    . HIS A 1 76  ? -8.898  13.172  2.449   1.00 0.00 ? 76  HIS A C    2  
ATOM 4586  O O    . HIS A 1 76  ? -8.883  13.309  3.672   1.00 0.00 ? 76  HIS A O    2  
ATOM 4587  C CB   . HIS A 1 76  ? -7.649  15.314  2.113   1.00 0.00 ? 76  HIS A CB   2  
ATOM 4588  C CG   . HIS A 1 76  ? -6.450  15.993  1.525   1.00 0.00 ? 76  HIS A CG   2  
ATOM 4589  N ND1  . HIS A 1 76  ? -5.601  15.379  0.628   1.00 0.00 ? 76  HIS A ND1  2  
ATOM 4590  C CD2  . HIS A 1 76  ? -5.960  17.242  1.709   1.00 0.00 ? 76  HIS A CD2  2  
ATOM 4591  C CE1  . HIS A 1 76  ? -4.641  16.220  0.287   1.00 0.00 ? 76  HIS A CE1  2  
ATOM 4592  N NE2  . HIS A 1 76  ? -4.836  17.357  0.929   1.00 0.00 ? 76  HIS A NE2  2  
ATOM 4593  H H    . HIS A 1 76  ? -8.805  14.732  -0.133  1.00 0.00 ? 76  HIS A H    2  
ATOM 4594  H HA   . HIS A 1 76  ? -6.942  13.360  1.614   1.00 0.00 ? 76  HIS A HA   2  
ATOM 4595  H HB2  . HIS A 1 76  ? -8.515  15.920  1.891   1.00 0.00 ? 76  HIS A HB2  2  
ATOM 4596  H HB3  . HIS A 1 76  ? -7.513  15.267  3.184   1.00 0.00 ? 76  HIS A HB3  2  
ATOM 4597  H HD1  . HIS A 1 76  ? -5.689  14.462  0.293   1.00 0.00 ? 76  HIS A HD1  2  
ATOM 4598  H HD2  . HIS A 1 76  ? -6.376  18.006  2.351   1.00 0.00 ? 76  HIS A HD2  2  
ATOM 4599  H HE1  . HIS A 1 76  ? -3.834  16.012  -0.400  1.00 0.00 ? 76  HIS A HE1  2  
ATOM 4600  H HE2  . HIS A 1 76  ? -4.227  18.124  0.917   1.00 0.00 ? 76  HIS A HE2  2  
ATOM 4601  N N    . GLU A 1 77  ? -9.779  12.389  1.825   1.00 0.00 ? 77  GLU A N    2  
ATOM 4602  C CA   . GLU A 1 77  ? -10.785 11.643  2.565   1.00 0.00 ? 77  GLU A CA   2  
ATOM 4603  C C    . GLU A 1 77  ? -10.634 10.159  2.323   1.00 0.00 ? 77  GLU A C    2  
ATOM 4604  O O    . GLU A 1 77  ? -9.941  9.724   1.404   1.00 0.00 ? 77  GLU A O    2  
ATOM 4605  C CB   . GLU A 1 77  ? -12.208 12.077  2.172   1.00 0.00 ? 77  GLU A CB   2  
ATOM 4606  C CG   . GLU A 1 77  ? -12.721 13.269  2.962   1.00 0.00 ? 77  GLU A CG   2  
ATOM 4607  C CD   . GLU A 1 77  ? -12.626 13.061  4.461   1.00 0.00 ? 77  GLU A CD   2  
ATOM 4608  O OE1  . GLU A 1 77  ? -12.788 11.907  4.912   1.00 0.00 ? 77  GLU A OE1  2  
ATOM 4609  O OE2  . GLU A 1 77  ? -12.390 14.051  5.185   1.00 0.00 ? 77  GLU A OE2  2  
ATOM 4610  H H    . GLU A 1 77  ? -9.748  12.303  0.856   1.00 0.00 ? 77  GLU A H    2  
ATOM 4611  H HA   . GLU A 1 77  ? -10.631 11.832  3.615   1.00 0.00 ? 77  GLU A HA   2  
ATOM 4612  H HB2  . GLU A 1 77  ? -12.214 12.339  1.124   1.00 0.00 ? 77  GLU A HB2  2  
ATOM 4613  H HB3  . GLU A 1 77  ? -12.894 11.243  2.328   1.00 0.00 ? 77  GLU A HB3  2  
ATOM 4614  H HG2  . GLU A 1 77  ? -12.138 14.138  2.697   1.00 0.00 ? 77  GLU A HG2  2  
ATOM 4615  H HG3  . GLU A 1 77  ? -13.755 13.439  2.702   1.00 0.00 ? 77  GLU A HG3  2  
ATOM 4616  N N    . ALA A 1 78  ? -11.316 9.395   3.146   1.00 0.00 ? 78  ALA A N    2  
ATOM 4617  C CA   . ALA A 1 78  ? -11.307 7.955   3.038   1.00 0.00 ? 78  ALA A CA   2  
ATOM 4618  C C    . ALA A 1 78  ? -12.606 7.505   2.402   1.00 0.00 ? 78  ALA A C    2  
ATOM 4619  O O    . ALA A 1 78  ? -13.635 7.402   3.069   1.00 0.00 ? 78  ALA A O    2  
ATOM 4620  C CB   . ALA A 1 78  ? -11.108 7.330   4.405   1.00 0.00 ? 78  ALA A CB   2  
ATOM 4621  H H    . ALA A 1 78  ? -11.864 9.818   3.836   1.00 0.00 ? 78  ALA A H    2  
ATOM 4622  H HA   . ALA A 1 78  ? -10.486 7.672   2.402   1.00 0.00 ? 78  ALA A HA   2  
ATOM 4623  H HB1  . ALA A 1 78  ? -11.481 8.005   5.163   1.00 0.00 ? 78  ALA A HB1  2  
ATOM 4624  H HB2  . ALA A 1 78  ? -10.055 7.155   4.567   1.00 0.00 ? 78  ALA A HB2  2  
ATOM 4625  H HB3  . ALA A 1 78  ? -11.644 6.394   4.458   1.00 0.00 ? 78  ALA A HB3  2  
ATOM 4626  N N    . TYR A 1 79  ? -12.564 7.284   1.097   1.00 0.00 ? 79  TYR A N    2  
ATOM 4627  C CA   . TYR A 1 79  ? -13.754 6.902   0.363   1.00 0.00 ? 79  TYR A CA   2  
ATOM 4628  C C    . TYR A 1 79  ? -14.273 5.535   0.747   1.00 0.00 ? 79  TYR A C    2  
ATOM 4629  O O    . TYR A 1 79  ? -13.939 4.532   0.119   1.00 0.00 ? 79  TYR A O    2  
ATOM 4630  C CB   . TYR A 1 79  ? -13.518 6.955   -1.146  1.00 0.00 ? 79  TYR A CB   2  
ATOM 4631  C CG   . TYR A 1 79  ? -14.052 8.218   -1.762  1.00 0.00 ? 79  TYR A CG   2  
ATOM 4632  C CD1  . TYR A 1 79  ? -13.456 9.441   -1.505  1.00 0.00 ? 79  TYR A CD1  2  
ATOM 4633  C CD2  . TYR A 1 79  ? -15.161 8.189   -2.587  1.00 0.00 ? 79  TYR A CD2  2  
ATOM 4634  C CE1  . TYR A 1 79  ? -13.954 10.600  -2.057  1.00 0.00 ? 79  TYR A CE1  2  
ATOM 4635  C CE2  . TYR A 1 79  ? -15.660 9.329   -3.144  1.00 0.00 ? 79  TYR A CE2  2  
ATOM 4636  C CZ   . TYR A 1 79  ? -15.057 10.542  -2.880  1.00 0.00 ? 79  TYR A CZ   2  
ATOM 4637  O OH   . TYR A 1 79  ? -15.561 11.695  -3.437  1.00 0.00 ? 79  TYR A OH   2  
ATOM 4638  H H    . TYR A 1 79  ? -11.726 7.411   0.609   1.00 0.00 ? 79  TYR A H    2  
ATOM 4639  H HA   . TYR A 1 79  ? -14.517 7.625   0.606   1.00 0.00 ? 79  TYR A HA   2  
ATOM 4640  H HB2  . TYR A 1 79  ? -12.461 6.896   -1.361  1.00 0.00 ? 79  TYR A HB2  2  
ATOM 4641  H HB3  . TYR A 1 79  ? -14.022 6.122   -1.613  1.00 0.00 ? 79  TYR A HB3  2  
ATOM 4642  H HD1  . TYR A 1 79  ? -12.589 9.480   -0.864  1.00 0.00 ? 79  TYR A HD1  2  
ATOM 4643  H HD2  . TYR A 1 79  ? -15.640 7.252   -2.796  1.00 0.00 ? 79  TYR A HD2  2  
ATOM 4644  H HE1  . TYR A 1 79  ? -13.477 11.541  -1.848  1.00 0.00 ? 79  TYR A HE1  2  
ATOM 4645  H HE2  . TYR A 1 79  ? -16.513 9.264   -3.792  1.00 0.00 ? 79  TYR A HE2  2  
ATOM 4646  H HH   . TYR A 1 79  ? -15.528 12.404  -2.790  1.00 0.00 ? 79  TYR A HH   2  
ATOM 4647  N N    . VAL A 1 80  ? -15.149 5.506   1.737   1.00 0.00 ? 80  VAL A N    2  
ATOM 4648  C CA   . VAL A 1 80  ? -15.763 4.256   2.131   1.00 0.00 ? 80  VAL A CA   2  
ATOM 4649  C C    . VAL A 1 80  ? -16.670 3.848   0.988   1.00 0.00 ? 80  VAL A C    2  
ATOM 4650  O O    . VAL A 1 80  ? -17.239 4.704   0.325   1.00 0.00 ? 80  VAL A O    2  
ATOM 4651  C CB   . VAL A 1 80  ? -16.576 4.376   3.438   1.00 0.00 ? 80  VAL A CB   2  
ATOM 4652  C CG1  . VAL A 1 80  ? -15.702 4.068   4.643   1.00 0.00 ? 80  VAL A CG1  2  
ATOM 4653  C CG2  . VAL A 1 80  ? -17.183 5.758   3.576   1.00 0.00 ? 80  VAL A CG2  2  
ATOM 4654  H H    . VAL A 1 80  ? -15.414 6.340   2.174   1.00 0.00 ? 80  VAL A H    2  
ATOM 4655  H HA   . VAL A 1 80  ? -14.986 3.514   2.258   1.00 0.00 ? 80  VAL A HA   2  
ATOM 4656  H HB   . VAL A 1 80  ? -17.381 3.656   3.402   1.00 0.00 ? 80  VAL A HB   2  
ATOM 4657  H HG11 . VAL A 1 80  ? -15.107 4.939   4.887   1.00 0.00 ? 80  VAL A HG11 2  
ATOM 4658  H HG12 . VAL A 1 80  ? -15.050 3.239   4.413   1.00 0.00 ? 80  VAL A HG12 2  
ATOM 4659  H HG13 . VAL A 1 80  ? -16.326 3.812   5.485   1.00 0.00 ? 80  VAL A HG13 2  
ATOM 4660  H HG21 . VAL A 1 80  ? -17.930 5.750   4.355   1.00 0.00 ? 80  VAL A HG21 2  
ATOM 4661  H HG22 . VAL A 1 80  ? -17.634 6.048   2.642   1.00 0.00 ? 80  VAL A HG22 2  
ATOM 4662  H HG23 . VAL A 1 80  ? -16.405 6.457   3.831   1.00 0.00 ? 80  VAL A HG23 2  
ATOM 4663  N N    . THR A 1 81  ? -16.761 2.568   0.708   1.00 0.00 ? 81  THR A N    2  
ATOM 4664  C CA   . THR A 1 81  ? -17.563 2.122   -0.421  1.00 0.00 ? 81  THR A CA   2  
ATOM 4665  C C    . THR A 1 81  ? -18.340 0.852   -0.102  1.00 0.00 ? 81  THR A C    2  
ATOM 4666  O O    . THR A 1 81  ? -17.929 0.053   0.734   1.00 0.00 ? 81  THR A O    2  
ATOM 4667  C CB   . THR A 1 81  ? -16.643 1.889   -1.615  1.00 0.00 ? 81  THR A CB   2  
ATOM 4668  O OG1  . THR A 1 81  ? -15.371 2.459   -1.384  1.00 0.00 ? 81  THR A OG1  2  
ATOM 4669  C CG2  . THR A 1 81  ? -17.157 2.461   -2.910  1.00 0.00 ? 81  THR A CG2  2  
ATOM 4670  H H    . THR A 1 81  ? -16.254 1.921   1.243   1.00 0.00 ? 81  THR A H    2  
ATOM 4671  H HA   . THR A 1 81  ? -18.259 2.912   -0.678  1.00 0.00 ? 81  THR A HA   2  
ATOM 4672  H HB   . THR A 1 81  ? -16.517 0.839   -1.753  1.00 0.00 ? 81  THR A HB   2  
ATOM 4673  H HG1  . THR A 1 81  ? -14.855 2.416   -2.189  1.00 0.00 ? 81  THR A HG1  2  
ATOM 4674  H HG21 . THR A 1 81  ? -17.215 3.532   -2.826  1.00 0.00 ? 81  THR A HG21 2  
ATOM 4675  H HG22 . THR A 1 81  ? -18.131 2.060   -3.121  1.00 0.00 ? 81  THR A HG22 2  
ATOM 4676  H HG23 . THR A 1 81  ? -16.479 2.199   -3.710  1.00 0.00 ? 81  THR A HG23 2  
ATOM 4677  N N    . VAL A 1 82  ? -19.450 0.673   -0.803  1.00 0.00 ? 82  VAL A N    2  
ATOM 4678  C CA   . VAL A 1 82  ? -20.299 -0.499  -0.651  1.00 0.00 ? 82  VAL A CA   2  
ATOM 4679  C C    . VAL A 1 82  ? -20.728 -0.988  -2.022  1.00 0.00 ? 82  VAL A C    2  
ATOM 4680  O O    . VAL A 1 82  ? -21.626 -0.412  -2.632  1.00 0.00 ? 82  VAL A O    2  
ATOM 4681  C CB   . VAL A 1 82  ? -21.570 -0.193  0.168   1.00 0.00 ? 82  VAL A CB   2  
ATOM 4682  C CG1  . VAL A 1 82  ? -22.436 -1.445  0.310   1.00 0.00 ? 82  VAL A CG1  2  
ATOM 4683  C CG2  . VAL A 1 82  ? -21.212 0.379   1.532   1.00 0.00 ? 82  VAL A CG2  2  
ATOM 4684  H H    . VAL A 1 82  ? -19.700 1.341   -1.466  1.00 0.00 ? 82  VAL A H    2  
ATOM 4685  H HA   . VAL A 1 82  ? -19.735 -1.272  -0.150  1.00 0.00 ? 82  VAL A HA   2  
ATOM 4686  H HB   . VAL A 1 82  ? -22.143 0.549   -0.371  1.00 0.00 ? 82  VAL A HB   2  
ATOM 4687  H HG11 . VAL A 1 82  ? -23.141 -1.306  1.116   1.00 0.00 ? 82  VAL A HG11 2  
ATOM 4688  H HG12 . VAL A 1 82  ? -21.807 -2.296  0.526   1.00 0.00 ? 82  VAL A HG12 2  
ATOM 4689  H HG13 . VAL A 1 82  ? -22.975 -1.622  -0.613  1.00 0.00 ? 82  VAL A HG13 2  
ATOM 4690  H HG21 . VAL A 1 82  ? -21.497 -0.321  2.304   1.00 0.00 ? 82  VAL A HG21 2  
ATOM 4691  H HG22 . VAL A 1 82  ? -21.739 1.310   1.681   1.00 0.00 ? 82  VAL A HG22 2  
ATOM 4692  H HG23 . VAL A 1 82  ? -20.148 0.556   1.583   1.00 0.00 ? 82  VAL A HG23 2  
ATOM 4693  N N    . LEU A 1 83  ? -20.108 -2.050  -2.510  1.00 0.00 ? 83  LEU A N    2  
ATOM 4694  C CA   . LEU A 1 83  ? -20.483 -2.575  -3.809  1.00 0.00 ? 83  LEU A CA   2  
ATOM 4695  C C    . LEU A 1 83  ? -21.509 -3.680  -3.620  1.00 0.00 ? 83  LEU A C    2  
ATOM 4696  O O    . LEU A 1 83  ? -21.178 -4.802  -3.235  1.00 0.00 ? 83  LEU A O    2  
ATOM 4697  C CB   . LEU A 1 83  ? -19.266 -3.074  -4.602  1.00 0.00 ? 83  LEU A CB   2  
ATOM 4698  C CG   . LEU A 1 83  ? -19.585 -4.155  -5.637  1.00 0.00 ? 83  LEU A CG   2  
ATOM 4699  C CD1  . LEU A 1 83  ? -19.981 -3.571  -6.979  1.00 0.00 ? 83  LEU A CD1  2  
ATOM 4700  C CD2  . LEU A 1 83  ? -18.432 -5.116  -5.818  1.00 0.00 ? 83  LEU A CD2  2  
ATOM 4701  H H    . LEU A 1 83  ? -19.408 -2.496  -1.985  1.00 0.00 ? 83  LEU A H    2  
ATOM 4702  H HA   . LEU A 1 83  ? -20.951 -1.770  -4.360  1.00 0.00 ? 83  LEU A HA   2  
ATOM 4703  H HB2  . LEU A 1 83  ? -18.822 -2.232  -5.110  1.00 0.00 ? 83  LEU A HB2  2  
ATOM 4704  H HB3  . LEU A 1 83  ? -18.549 -3.473  -3.906  1.00 0.00 ? 83  LEU A HB3  2  
ATOM 4705  H HG   . LEU A 1 83  ? -20.412 -4.708  -5.277  1.00 0.00 ? 83  LEU A HG   2  
ATOM 4706  H HD11 . LEU A 1 83  ? -21.047 -3.405  -6.999  1.00 0.00 ? 83  LEU A HD11 2  
ATOM 4707  H HD12 . LEU A 1 83  ? -19.708 -4.270  -7.763  1.00 0.00 ? 83  LEU A HD12 2  
ATOM 4708  H HD13 . LEU A 1 83  ? -19.466 -2.641  -7.134  1.00 0.00 ? 83  LEU A HD13 2  
ATOM 4709  H HD21 . LEU A 1 83  ? -18.397 -5.430  -6.851  1.00 0.00 ? 83  LEU A HD21 2  
ATOM 4710  H HD22 . LEU A 1 83  ? -18.582 -5.979  -5.186  1.00 0.00 ? 83  LEU A HD22 2  
ATOM 4711  H HD23 . LEU A 1 83  ? -17.508 -4.627  -5.555  1.00 0.00 ? 83  LEU A HD23 2  
ATOM 4712  N N    . GLU A 1 84  ? -22.756 -3.341  -3.883  1.00 0.00 ? 84  GLU A N    2  
ATOM 4713  C CA   . GLU A 1 84  ? -23.855 -4.276  -3.742  1.00 0.00 ? 84  GLU A CA   2  
ATOM 4714  C C    . GLU A 1 84  ? -24.159 -4.938  -5.076  1.00 0.00 ? 84  GLU A C    2  
ATOM 4715  O O    . GLU A 1 84  ? -24.476 -4.264  -6.057  1.00 0.00 ? 84  GLU A O    2  
ATOM 4716  C CB   . GLU A 1 84  ? -25.079 -3.528  -3.230  1.00 0.00 ? 84  GLU A CB   2  
ATOM 4717  C CG   . GLU A 1 84  ? -25.265 -3.587  -1.729  1.00 0.00 ? 84  GLU A CG   2  
ATOM 4718  C CD   . GLU A 1 84  ? -25.598 -2.236  -1.126  1.00 0.00 ? 84  GLU A CD   2  
ATOM 4719  O OE1  . GLU A 1 84  ? -26.346 -1.468  -1.766  1.00 0.00 ? 84  GLU A OE1  2  
ATOM 4720  O OE2  . GLU A 1 84  ? -25.113 -1.947  -0.012  1.00 0.00 ? 84  GLU A OE2  2  
ATOM 4721  H H    . GLU A 1 84  ? -22.946 -2.426  -4.178  1.00 0.00 ? 84  GLU A H    2  
ATOM 4722  H HA   . GLU A 1 84  ? -23.571 -5.033  -3.025  1.00 0.00 ? 84  GLU A HA   2  
ATOM 4723  H HB2  . GLU A 1 84  ? -24.975 -2.504  -3.503  1.00 0.00 ? 84  GLU A HB2  2  
ATOM 4724  H HB3  . GLU A 1 84  ? -25.958 -3.925  -3.698  1.00 0.00 ? 84  GLU A HB3  2  
ATOM 4725  H HG2  . GLU A 1 84  ? -26.071 -4.268  -1.508  1.00 0.00 ? 84  GLU A HG2  2  
ATOM 4726  H HG3  . GLU A 1 84  ? -24.351 -3.949  -1.281  1.00 0.00 ? 84  GLU A HG3  2  
ATOM 4727  N N    . GLY A 1 85  ? -24.046 -6.256  -5.112  1.00 0.00 ? 85  GLY A N    2  
ATOM 4728  C CA   . GLY A 1 85  ? -24.301 -6.981  -6.336  1.00 0.00 ? 85  GLY A CA   2  
ATOM 4729  C C    . GLY A 1 85  ? -25.548 -7.832  -6.270  1.00 0.00 ? 85  GLY A C    2  
ATOM 4730  O O    . GLY A 1 85  ? -26.050 -8.147  -5.191  1.00 0.00 ? 85  GLY A O    2  
ATOM 4731  H H    . GLY A 1 85  ? -23.781 -6.740  -4.302  1.00 0.00 ? 85  GLY A H    2  
ATOM 4732  H HA2  . GLY A 1 85  ? -24.404 -6.277  -7.147  1.00 0.00 ? 85  GLY A HA2  2  
ATOM 4733  H HA3  . GLY A 1 85  ? -23.461 -7.615  -6.543  1.00 0.00 ? 85  GLY A HA3  2  
ATOM 4734  N N    . PHE A 1 86  ? -26.038 -8.201  -7.440  1.00 0.00 ? 86  PHE A N    2  
ATOM 4735  C CA   . PHE A 1 86  ? -27.229 -9.024  -7.568  1.00 0.00 ? 86  PHE A CA   2  
ATOM 4736  C C    . PHE A 1 86  ? -27.012 -10.023 -8.689  1.00 0.00 ? 86  PHE A C    2  
ATOM 4737  O O    . PHE A 1 86  ? -26.628 -9.647  -9.796  1.00 0.00 ? 86  PHE A O    2  
ATOM 4738  C CB   . PHE A 1 86  ? -28.448 -8.138  -7.840  1.00 0.00 ? 86  PHE A CB   2  
ATOM 4739  C CG   . PHE A 1 86  ? -28.397 -6.818  -7.118  1.00 0.00 ? 86  PHE A CG   2  
ATOM 4740  C CD1  . PHE A 1 86  ? -27.511 -5.828  -7.517  1.00 0.00 ? 86  PHE A CD1  2  
ATOM 4741  C CD2  . PHE A 1 86  ? -29.225 -6.571  -6.034  1.00 0.00 ? 86  PHE A CD2  2  
ATOM 4742  C CE1  . PHE A 1 86  ? -27.452 -4.619  -6.850  1.00 0.00 ? 86  PHE A CE1  2  
ATOM 4743  C CE2  . PHE A 1 86  ? -29.171 -5.362  -5.364  1.00 0.00 ? 86  PHE A CE2  2  
ATOM 4744  C CZ   . PHE A 1 86  ? -28.283 -4.385  -5.773  1.00 0.00 ? 86  PHE A CZ   2  
ATOM 4745  H H    . PHE A 1 86  ? -25.578 -7.911  -8.256  1.00 0.00 ? 86  PHE A H    2  
ATOM 4746  H HA   . PHE A 1 86  ? -27.381 -9.563  -6.648  1.00 0.00 ? 86  PHE A HA   2  
ATOM 4747  H HB2  . PHE A 1 86  ? -28.510 -7.941  -8.894  1.00 0.00 ? 86  PHE A HB2  2  
ATOM 4748  H HB3  . PHE A 1 86  ? -29.340 -8.653  -7.524  1.00 0.00 ? 86  PHE A HB3  2  
ATOM 4749  H HD1  . PHE A 1 86  ? -26.861 -6.008  -8.361  1.00 0.00 ? 86  PHE A HD1  2  
ATOM 4750  H HD2  . PHE A 1 86  ? -29.918 -7.336  -5.708  1.00 0.00 ? 86  PHE A HD2  2  
ATOM 4751  H HE1  . PHE A 1 86  ? -26.757 -3.858  -7.170  1.00 0.00 ? 86  PHE A HE1  2  
ATOM 4752  H HE2  . PHE A 1 86  ? -29.822 -5.181  -4.522  1.00 0.00 ? 86  PHE A HE2  2  
ATOM 4753  H HZ   . PHE A 1 86  ? -28.236 -3.441  -5.249  1.00 0.00 ? 86  PHE A HZ   2  
ATOM 4754  N N    . SER A 1 87  ? -27.237 -11.298 -8.403  1.00 0.00 ? 87  SER A N    2  
ATOM 4755  C CA   . SER A 1 87  ? -27.034 -12.323 -9.405  1.00 0.00 ? 87  SER A CA   2  
ATOM 4756  C C    . SER A 1 87  ? -28.222 -12.351 -10.359 1.00 0.00 ? 87  SER A C    2  
ATOM 4757  O O    . SER A 1 87  ? -29.276 -12.902 -10.037 1.00 0.00 ? 87  SER A O    2  
ATOM 4758  C CB   . SER A 1 87  ? -26.851 -13.692 -8.744  1.00 0.00 ? 87  SER A CB   2  
ATOM 4759  O OG   . SER A 1 87  ? -25.554 -14.207 -8.990  1.00 0.00 ? 87  SER A OG   2  
ATOM 4760  H H    . SER A 1 87  ? -27.534 -11.552 -7.502  1.00 0.00 ? 87  SER A H    2  
ATOM 4761  H HA   . SER A 1 87  ? -26.132 -12.066 -9.948  1.00 0.00 ? 87  SER A HA   2  
ATOM 4762  H HB2  . SER A 1 87  ? -26.990 -13.595 -7.678  1.00 0.00 ? 87  SER A HB2  2  
ATOM 4763  H HB3  . SER A 1 87  ? -27.581 -14.383 -9.141  1.00 0.00 ? 87  SER A HB3  2  
ATOM 4764  H HG   . SER A 1 87  ? -25.529 -15.137 -8.754  1.00 0.00 ? 87  SER A HG   2  
ATOM 4765  N N    . GLY A 1 88  ? -28.056 -11.731 -11.521 1.00 0.00 ? 88  GLY A N    2  
ATOM 4766  C CA   . GLY A 1 88  ? -29.136 -11.677 -12.487 1.00 0.00 ? 88  GLY A CA   2  
ATOM 4767  C C    . GLY A 1 88  ? -30.171 -10.636 -12.107 1.00 0.00 ? 88  GLY A C    2  
ATOM 4768  O O    . GLY A 1 88  ? -30.028 -9.460  -12.439 1.00 0.00 ? 88  GLY A O    2  
ATOM 4769  H H    . GLY A 1 88  ? -27.202 -11.292 -11.716 1.00 0.00 ? 88  GLY A H    2  
ATOM 4770  H HA2  . GLY A 1 88  ? -28.728 -11.432 -13.457 1.00 0.00 ? 88  GLY A HA2  2  
ATOM 4771  H HA3  . GLY A 1 88  ? -29.612 -12.644 -12.538 1.00 0.00 ? 88  GLY A HA3  2  
ATOM 4772  N N    . ASN A 1 89  ? -31.211 -11.068 -11.401 1.00 0.00 ? 89  ASN A N    2  
ATOM 4773  C CA   . ASN A 1 89  ? -32.270 -10.164 -10.962 1.00 0.00 ? 89  ASN A CA   2  
ATOM 4774  C C    . ASN A 1 89  ? -32.403 -10.157 -9.436  1.00 0.00 ? 89  ASN A C    2  
ATOM 4775  O O    . ASN A 1 89  ? -33.179 -9.382  -8.877  1.00 0.00 ? 89  ASN A O    2  
ATOM 4776  C CB   . ASN A 1 89  ? -33.604 -10.564 -11.597 1.00 0.00 ? 89  ASN A CB   2  
ATOM 4777  C CG   . ASN A 1 89  ? -33.889 -12.046 -11.458 1.00 0.00 ? 89  ASN A CG   2  
ATOM 4778  O OD1  . ASN A 1 89  ? -33.728 -12.813 -12.407 1.00 0.00 ? 89  ASN A OD1  2  
ATOM 4779  N ND2  . ASN A 1 89  ? -34.318 -12.457 -10.270 1.00 0.00 ? 89  ASN A ND2  2  
ATOM 4780  H H    . ASN A 1 89  ? -31.264 -12.017 -11.162 1.00 0.00 ? 89  ASN A H    2  
ATOM 4781  H HA   . ASN A 1 89  ? -32.012 -9.169  -11.291 1.00 0.00 ? 89  ASN A HA   2  
ATOM 4782  H HB2  . ASN A 1 89  ? -34.402 -10.016 -11.118 1.00 0.00 ? 89  ASN A HB2  2  
ATOM 4783  H HB3  . ASN A 1 89  ? -33.583 -10.316 -12.648 1.00 0.00 ? 89  ASN A HB3  2  
ATOM 4784  H HD21 . ASN A 1 89  ? -34.424 -11.791 -9.560  1.00 0.00 ? 89  ASN A HD21 2  
ATOM 4785  H HD22 . ASN A 1 89  ? -34.510 -13.411 -10.153 1.00 0.00 ? 89  ASN A HD22 2  
ATOM 4786  N N    . THR A 1 90  ? -31.656 -11.036 -8.768  1.00 0.00 ? 90  THR A N    2  
ATOM 4787  C CA   . THR A 1 90  ? -31.705 -11.142 -7.311  1.00 0.00 ? 90  THR A CA   2  
ATOM 4788  C C    . THR A 1 90  ? -30.420 -10.642 -6.666  1.00 0.00 ? 90  THR A C    2  
ATOM 4789  O O    . THR A 1 90  ? -29.344 -10.769 -7.238  1.00 0.00 ? 90  THR A O    2  
ATOM 4790  C CB   . THR A 1 90  ? -31.917 -12.602 -6.907  1.00 0.00 ? 90  THR A CB   2  
ATOM 4791  O OG1  . THR A 1 90  ? -33.272 -12.982 -7.072  1.00 0.00 ? 90  THR A OG1  2  
ATOM 4792  C CG2  . THR A 1 90  ? -31.525 -12.894 -5.471  1.00 0.00 ? 90  THR A CG2  2  
ATOM 4793  H H    . THR A 1 90  ? -31.065 -11.637 -9.266  1.00 0.00 ? 90  THR A H    2  
ATOM 4794  H HA   . THR A 1 90  ? -32.536 -10.552 -6.955  1.00 0.00 ? 90  THR A HA   2  
ATOM 4795  H HB   . THR A 1 90  ? -31.305 -13.225 -7.545  1.00 0.00 ? 90  THR A HB   2  
ATOM 4796  H HG1  . THR A 1 90  ? -33.843 -12.296 -6.718  1.00 0.00 ? 90  THR A HG1  2  
ATOM 4797  H HG21 . THR A 1 90  ? -30.483 -12.632 -5.323  1.00 0.00 ? 90  THR A HG21 2  
ATOM 4798  H HG22 . THR A 1 90  ? -31.665 -13.944 -5.265  1.00 0.00 ? 90  THR A HG22 2  
ATOM 4799  H HG23 . THR A 1 90  ? -32.140 -12.310 -4.803  1.00 0.00 ? 90  THR A HG23 2  
ATOM 4800  N N    . THR A 1 91  ? -30.532 -10.122 -5.446  1.00 0.00 ? 91  THR A N    2  
ATOM 4801  C CA   . THR A 1 91  ? -29.356 -9.668  -4.720  1.00 0.00 ? 91  THR A CA   2  
ATOM 4802  C C    . THR A 1 91  ? -28.626 -10.865 -4.155  1.00 0.00 ? 91  THR A C    2  
ATOM 4803  O O    . THR A 1 91  ? -29.206 -11.723 -3.490  1.00 0.00 ? 91  THR A O    2  
ATOM 4804  C CB   . THR A 1 91  ? -29.717 -8.713  -3.592  1.00 0.00 ? 91  THR A CB   2  
ATOM 4805  O OG1  . THR A 1 91  ? -30.962 -8.083  -3.832  1.00 0.00 ? 91  THR A OG1  2  
ATOM 4806  C CG2  . THR A 1 91  ? -28.683 -7.632  -3.360  1.00 0.00 ? 91  THR A CG2  2  
ATOM 4807  H H    . THR A 1 91  ? -31.412 -10.080 -5.017  1.00 0.00 ? 91  THR A H    2  
ATOM 4808  H HA   . THR A 1 91  ? -28.695 -9.173  -5.418  1.00 0.00 ? 91  THR A HA   2  
ATOM 4809  H HB   . THR A 1 91  ? -29.790 -9.285  -2.688  1.00 0.00 ? 91  THR A HB   2  
ATOM 4810  H HG1  . THR A 1 91  ? -31.191 -7.530  -3.081  1.00 0.00 ? 91  THR A HG1  2  
ATOM 4811  H HG21 . THR A 1 91  ? -29.174 -6.674  -3.283  1.00 0.00 ? 91  THR A HG21 2  
ATOM 4812  H HG22 . THR A 1 91  ? -27.986 -7.617  -4.185  1.00 0.00 ? 91  THR A HG22 2  
ATOM 4813  H HG23 . THR A 1 91  ? -28.149 -7.837  -2.443  1.00 0.00 ? 91  THR A HG23 2  
ATOM 4814  N N    . LEU A 1 92  ? -27.360 -10.921 -4.473  1.00 0.00 ? 92  LEU A N    2  
ATOM 4815  C CA   . LEU A 1 92  ? -26.507 -12.014 -4.065  1.00 0.00 ? 92  LEU A CA   2  
ATOM 4816  C C    . LEU A 1 92  ? -25.483 -11.568 -3.030  1.00 0.00 ? 92  LEU A C    2  
ATOM 4817  O O    . LEU A 1 92  ? -25.006 -12.379 -2.235  1.00 0.00 ? 92  LEU A O    2  
ATOM 4818  C CB   . LEU A 1 92  ? -25.824 -12.575 -5.310  1.00 0.00 ? 92  LEU A CB   2  
ATOM 4819  C CG   . LEU A 1 92  ? -24.503 -13.320 -5.082  1.00 0.00 ? 92  LEU A CG   2  
ATOM 4820  C CD1  . LEU A 1 92  ? -24.761 -14.674 -4.440  1.00 0.00 ? 92  LEU A CD1  2  
ATOM 4821  C CD2  . LEU A 1 92  ? -23.754 -13.485 -6.395  1.00 0.00 ? 92  LEU A CD2  2  
ATOM 4822  H H    . LEU A 1 92  ? -26.998 -10.211 -5.030  1.00 0.00 ? 92  LEU A H    2  
ATOM 4823  H HA   . LEU A 1 92  ? -27.130 -12.781 -3.633  1.00 0.00 ? 92  LEU A HA   2  
ATOM 4824  H HB2  . LEU A 1 92  ? -26.514 -13.255 -5.789  1.00 0.00 ? 92  LEU A HB2  2  
ATOM 4825  H HB3  . LEU A 1 92  ? -25.645 -11.745 -5.981  1.00 0.00 ? 92  LEU A HB3  2  
ATOM 4826  H HG   . LEU A 1 92  ? -23.881 -12.748 -4.410  1.00 0.00 ? 92  LEU A HG   2  
ATOM 4827  H HD11 . LEU A 1 92  ? -25.758 -15.006 -4.688  1.00 0.00 ? 92  LEU A HD11 2  
ATOM 4828  H HD12 . LEU A 1 92  ? -24.666 -14.588 -3.368  1.00 0.00 ? 92  LEU A HD12 2  
ATOM 4829  H HD13 . LEU A 1 92  ? -24.041 -15.390 -4.809  1.00 0.00 ? 92  LEU A HD13 2  
ATOM 4830  H HD21 . LEU A 1 92  ? -22.837 -14.028 -6.221  1.00 0.00 ? 92  LEU A HD21 2  
ATOM 4831  H HD22 . LEU A 1 92  ? -23.523 -12.512 -6.803  1.00 0.00 ? 92  LEU A HD22 2  
ATOM 4832  H HD23 . LEU A 1 92  ? -24.369 -14.032 -7.095  1.00 0.00 ? 92  LEU A HD23 2  
ATOM 4833  N N    . PHE A 1 93  ? -25.134 -10.285 -3.042  1.00 0.00 ? 93  PHE A N    2  
ATOM 4834  C CA   . PHE A 1 93  ? -24.155 -9.784  -2.093  1.00 0.00 ? 93  PHE A CA   2  
ATOM 4835  C C    . PHE A 1 93  ? -24.214 -8.264  -1.926  1.00 0.00 ? 93  PHE A C    2  
ATOM 4836  O O    . PHE A 1 93  ? -24.881 -7.554  -2.678  1.00 0.00 ? 93  PHE A O    2  
ATOM 4837  C CB   . PHE A 1 93  ? -22.752 -10.219 -2.513  1.00 0.00 ? 93  PHE A CB   2  
ATOM 4838  C CG   . PHE A 1 93  ? -22.344 -9.726  -3.871  1.00 0.00 ? 93  PHE A CG   2  
ATOM 4839  C CD1  . PHE A 1 93  ? -22.933 -10.233 -5.022  1.00 0.00 ? 93  PHE A CD1  2  
ATOM 4840  C CD2  . PHE A 1 93  ? -21.364 -8.760  -3.991  1.00 0.00 ? 93  PHE A CD2  2  
ATOM 4841  C CE1  . PHE A 1 93  ? -22.547 -9.782  -6.273  1.00 0.00 ? 93  PHE A CE1  2  
ATOM 4842  C CE2  . PHE A 1 93  ? -20.973 -8.302  -5.229  1.00 0.00 ? 93  PHE A CE2  2  
ATOM 4843  C CZ   . PHE A 1 93  ? -21.560 -8.809  -6.374  1.00 0.00 ? 93  PHE A CZ   2  
ATOM 4844  H H    . PHE A 1 93  ? -25.534 -9.676  -3.696  1.00 0.00 ? 93  PHE A H    2  
ATOM 4845  H HA   . PHE A 1 93  ? -24.376 -10.235 -1.138  1.00 0.00 ? 93  PHE A HA   2  
ATOM 4846  H HB2  . PHE A 1 93  ? -22.037 -9.842  -1.797  1.00 0.00 ? 93  PHE A HB2  2  
ATOM 4847  H HB3  . PHE A 1 93  ? -22.707 -11.298 -2.524  1.00 0.00 ? 93  PHE A HB3  2  
ATOM 4848  H HD1  . PHE A 1 93  ? -23.700 -10.985 -4.937  1.00 0.00 ? 93  PHE A HD1  2  
ATOM 4849  H HD2  . PHE A 1 93  ? -20.902 -8.361  -3.100  1.00 0.00 ? 93  PHE A HD2  2  
ATOM 4850  H HE1  . PHE A 1 93  ? -23.022 -10.187 -7.169  1.00 0.00 ? 93  PHE A HE1  2  
ATOM 4851  H HE2  . PHE A 1 93  ? -20.210 -7.544  -5.302  1.00 0.00 ? 93  PHE A HE2  2  
ATOM 4852  H HZ   . PHE A 1 93  ? -21.249 -8.445  -7.341  1.00 0.00 ? 93  PHE A HZ   2  
ATOM 4853  N N    . SER A 1 94  ? -23.510 -7.802  -0.899  1.00 0.00 ? 94  SER A N    2  
ATOM 4854  C CA   . SER A 1 94  ? -23.427 -6.394  -0.518  1.00 0.00 ? 94  SER A CA   2  
ATOM 4855  C C    . SER A 1 94  ? -22.202 -6.239  0.379   1.00 0.00 ? 94  SER A C    2  
ATOM 4856  O O    . SER A 1 94  ? -22.282 -6.513  1.577   1.00 0.00 ? 94  SER A O    2  
ATOM 4857  C CB   . SER A 1 94  ? -24.679 -5.998  0.274   1.00 0.00 ? 94  SER A CB   2  
ATOM 4858  O OG   . SER A 1 94  ? -25.534 -7.112  0.471   1.00 0.00 ? 94  SER A OG   2  
ATOM 4859  H H    . SER A 1 94  ? -23.026 -8.443  -0.345  1.00 0.00 ? 94  SER A H    2  
ATOM 4860  H HA   . SER A 1 94  ? -23.333 -5.768  -1.408  1.00 0.00 ? 94  SER A HA   2  
ATOM 4861  H HB2  . SER A 1 94  ? -24.386 -5.614  1.240   1.00 0.00 ? 94  SER A HB2  2  
ATOM 4862  H HB3  . SER A 1 94  ? -25.218 -5.240  -0.258  1.00 0.00 ? 94  SER A HB3  2  
ATOM 4863  H HG   . SER A 1 94  ? -25.064 -7.795  0.955   1.00 0.00 ? 94  SER A HG   2  
ATOM 4864  N N    . CYS A 1 95  ? -21.069 -5.825  -0.176  1.00 0.00 ? 95  CYS A N    2  
ATOM 4865  C CA   . CYS A 1 95  ? -19.859 -5.679  0.628   1.00 0.00 ? 95  CYS A CA   2  
ATOM 4866  C C    . CYS A 1 95  ? -19.328 -4.256  0.565   1.00 0.00 ? 95  CYS A C    2  
ATOM 4867  O O    . CYS A 1 95  ? -19.506 -3.560  -0.435  1.00 0.00 ? 95  CYS A O    2  
ATOM 4868  C CB   . CYS A 1 95  ? -18.775 -6.675  0.177   1.00 0.00 ? 95  CYS A CB   2  
ATOM 4869  S SG   . CYS A 1 95  ? -18.963 -7.299  -1.531  1.00 0.00 ? 95  CYS A SG   2  
ATOM 4870  H H    . CYS A 1 95  ? -21.027 -5.611  -1.132  1.00 0.00 ? 95  CYS A H    2  
ATOM 4871  H HA   . CYS A 1 95  ? -20.121 -5.895  1.649   1.00 0.00 ? 95  CYS A HA   2  
ATOM 4872  H HB2  . CYS A 1 95  ? -17.811 -6.194  0.240   1.00 0.00 ? 95  CYS A HB2  2  
ATOM 4873  H HB3  . CYS A 1 95  ? -18.786 -7.527  0.840   1.00 0.00 ? 95  CYS A HB3  2  
ATOM 4874  N N    . SER A 1 96  ? -18.681 -3.824  1.643   1.00 0.00 ? 96  SER A N    2  
ATOM 4875  C CA   . SER A 1 96  ? -18.133 -2.480  1.712   1.00 0.00 ? 96  SER A CA   2  
ATOM 4876  C C    . SER A 1 96  ? -16.682 -2.508  2.179   1.00 0.00 ? 96  SER A C    2  
ATOM 4877  O O    . SER A 1 96  ? -16.199 -3.523  2.680   1.00 0.00 ? 96  SER A O    2  
ATOM 4878  C CB   . SER A 1 96  ? -18.968 -1.622  2.664   1.00 0.00 ? 96  SER A CB   2  
ATOM 4879  O OG   . SER A 1 96  ? -18.945 -2.151  3.979   1.00 0.00 ? 96  SER A OG   2  
ATOM 4880  H H    . SER A 1 96  ? -18.570 -4.415  2.416   1.00 0.00 ? 96  SER A H    2  
ATOM 4881  H HA   . SER A 1 96  ? -18.174 -2.054  0.723   1.00 0.00 ? 96  SER A HA   2  
ATOM 4882  H HB2  . SER A 1 96  ? -18.571 -0.619  2.688   1.00 0.00 ? 96  SER A HB2  2  
ATOM 4883  H HB3  . SER A 1 96  ? -19.990 -1.598  2.318   1.00 0.00 ? 96  SER A HB3  2  
ATOM 4884  H HG   . SER A 1 96  ? -18.035 -2.257  4.265   1.00 0.00 ? 96  SER A HG   2  
ATOM 4885  N N    . HIS A 1 97  ? -15.995 -1.385  2.012   1.00 0.00 ? 97  HIS A N    2  
ATOM 4886  C CA   . HIS A 1 97  ? -14.600 -1.275  2.416   1.00 0.00 ? 97  HIS A CA   2  
ATOM 4887  C C    . HIS A 1 97  ? -14.166 0.184   2.465   1.00 0.00 ? 97  HIS A C    2  
ATOM 4888  O O    . HIS A 1 97  ? -14.582 0.993   1.636   1.00 0.00 ? 97  HIS A O    2  
ATOM 4889  C CB   . HIS A 1 97  ? -13.704 -2.055  1.453   1.00 0.00 ? 97  HIS A CB   2  
ATOM 4890  C CG   . HIS A 1 97  ? -12.256 -2.035  1.834   1.00 0.00 ? 97  HIS A CG   2  
ATOM 4891  N ND1  . HIS A 1 97  ? -11.791 -2.500  3.046   1.00 0.00 ? 97  HIS A ND1  2  
ATOM 4892  C CD2  . HIS A 1 97  ? -11.167 -1.603  1.156   1.00 0.00 ? 97  HIS A CD2  2  
ATOM 4893  C CE1  . HIS A 1 97  ? -10.478 -2.354  3.097   1.00 0.00 ? 97  HIS A CE1  2  
ATOM 4894  N NE2  . HIS A 1 97  ? -10.076 -1.813  1.963   1.00 0.00 ? 97  HIS A NE2  2  
ATOM 4895  H H    . HIS A 1 97  ? -16.437 -0.609  1.607   1.00 0.00 ? 97  HIS A H    2  
ATOM 4896  H HA   . HIS A 1 97  ? -14.507 -1.700  3.405   1.00 0.00 ? 97  HIS A HA   2  
ATOM 4897  H HB2  . HIS A 1 97  ? -14.026 -3.085  1.425   1.00 0.00 ? 97  HIS A HB2  2  
ATOM 4898  H HB3  . HIS A 1 97  ? -13.794 -1.628  0.464   1.00 0.00 ? 97  HIS A HB3  2  
ATOM 4899  H HD1  . HIS A 1 97  ? -12.340 -2.881  3.762   1.00 0.00 ? 97  HIS A HD1  2  
ATOM 4900  H HD2  . HIS A 1 97  ? -11.158 -1.173  0.164   1.00 0.00 ? 97  HIS A HD2  2  
ATOM 4901  H HE1  . HIS A 1 97  ? -9.844  -2.631  3.926   1.00 0.00 ? 97  HIS A HE1  2  
ATOM 4902  H HE2  . HIS A 1 97  ? -9.141  -1.674  1.703   1.00 0.00 ? 97  HIS A HE2  2  
ATOM 4903  N N    . ASN A 1 98  ? -13.329 0.514   3.440   1.00 0.00 ? 98  ASN A N    2  
ATOM 4904  C CA   . ASN A 1 98  ? -12.839 1.879   3.594   1.00 0.00 ? 98  ASN A CA   2  
ATOM 4905  C C    . ASN A 1 98  ? -11.626 2.123   2.707   1.00 0.00 ? 98  ASN A C    2  
ATOM 4906  O O    . ASN A 1 98  ? -10.600 1.458   2.846   1.00 0.00 ? 98  ASN A O    2  
ATOM 4907  C CB   . ASN A 1 98  ? -12.480 2.166   5.054   1.00 0.00 ? 98  ASN A CB   2  
ATOM 4908  C CG   . ASN A 1 98  ? -11.726 1.024   5.709   1.00 0.00 ? 98  ASN A CG   2  
ATOM 4909  O OD1  . ASN A 1 98  ? -11.338 0.061   5.048   1.00 0.00 ? 98  ASN A OD1  2  
ATOM 4910  N ND2  . ASN A 1 98  ? -11.514 1.127   7.016   1.00 0.00 ? 98  ASN A ND2  2  
ATOM 4911  H H    . ASN A 1 98  ? -13.033 -0.176  4.070   1.00 0.00 ? 98  ASN A H    2  
ATOM 4912  H HA   . ASN A 1 98  ? -13.629 2.549   3.290   1.00 0.00 ? 98  ASN A HA   2  
ATOM 4913  H HB2  . ASN A 1 98  ? -11.860 3.047   5.095   1.00 0.00 ? 98  ASN A HB2  2  
ATOM 4914  H HB3  . ASN A 1 98  ? -13.386 2.344   5.614   1.00 0.00 ? 98  ASN A HB3  2  
ATOM 4915  H HD21 . ASN A 1 98  ? -11.851 1.923   7.478   1.00 0.00 ? 98  ASN A HD21 2  
ATOM 4916  H HD22 . ASN A 1 98  ? -11.029 0.403   7.465   1.00 0.00 ? 98  ASN A HD22 2  
ATOM 4917  N N    . PHE A 1 99  ? -11.748 3.082   1.794   1.00 0.00 ? 99  PHE A N    2  
ATOM 4918  C CA   . PHE A 1 99  ? -10.654 3.407   0.888   1.00 0.00 ? 99  PHE A CA   2  
ATOM 4919  C C    . PHE A 1 99  ? -9.864  4.610   1.383   1.00 0.00 ? 99  PHE A C    2  
ATOM 4920  O O    . PHE A 1 99  ? -10.373 5.729   1.409   1.00 0.00 ? 99  PHE A O    2  
ATOM 4921  C CB   . PHE A 1 99  ? -11.172 3.728   -0.512  1.00 0.00 ? 99  PHE A CB   2  
ATOM 4922  C CG   . PHE A 1 99  ? -11.763 2.568   -1.259  1.00 0.00 ? 99  PHE A CG   2  
ATOM 4923  C CD1  . PHE A 1 99  ? -12.770 1.792   -0.706  1.00 0.00 ? 99  PHE A CD1  2  
ATOM 4924  C CD2  . PHE A 1 99  ? -11.331 2.281   -2.544  1.00 0.00 ? 99  PHE A CD2  2  
ATOM 4925  C CE1  . PHE A 1 99  ? -13.327 0.748   -1.420  1.00 0.00 ? 99  PHE A CE1  2  
ATOM 4926  C CE2  . PHE A 1 99  ? -11.892 1.246   -3.263  1.00 0.00 ? 99  PHE A CE2  2  
ATOM 4927  C CZ   . PHE A 1 99  ? -12.888 0.480   -2.701  1.00 0.00 ? 99  PHE A CZ   2  
ATOM 4928  H H    . PHE A 1 99  ? -12.590 3.580   1.729   1.00 0.00 ? 99  PHE A H    2  
ATOM 4929  H HA   . PHE A 1 99  ? -9.997  2.552   0.834   1.00 0.00 ? 99  PHE A HA   2  
ATOM 4930  H HB2  . PHE A 1 99  ? -11.931 4.488   -0.436  1.00 0.00 ? 99  PHE A HB2  2  
ATOM 4931  H HB3  . PHE A 1 99  ? -10.352 4.114   -1.101  1.00 0.00 ? 99  PHE A HB3  2  
ATOM 4932  H HD1  . PHE A 1 99  ? -13.117 2.002   0.293   1.00 0.00 ? 99  PHE A HD1  2  
ATOM 4933  H HD2  . PHE A 1 99  ? -10.547 2.878   -2.984  1.00 0.00 ? 99  PHE A HD2  2  
ATOM 4934  H HE1  . PHE A 1 99  ? -14.109 0.147   -0.980  1.00 0.00 ? 99  PHE A HE1  2  
ATOM 4935  H HE2  . PHE A 1 99  ? -11.550 1.033   -4.263  1.00 0.00 ? 99  PHE A HE2  2  
ATOM 4936  H HZ   . PHE A 1 99  ? -13.331 -0.319  -3.269  1.00 0.00 ? 99  PHE A HZ   2  
ATOM 4937  N N    . TRP A 1 100 ? -8.610  4.381   1.730   1.00 0.00 ? 100 TRP A N    2  
ATOM 4938  C CA   . TRP A 1 100 ? -7.734  5.454   2.171   1.00 0.00 ? 100 TRP A CA   2  
ATOM 4939  C C    . TRP A 1 100 ? -7.005  6.009   0.954   1.00 0.00 ? 100 TRP A C    2  
ATOM 4940  O O    . TRP A 1 100 ? -5.871  5.639   0.695   1.00 0.00 ? 100 TRP A O    2  
ATOM 4941  C CB   . TRP A 1 100 ? -6.727  4.928   3.201   1.00 0.00 ? 100 TRP A CB   2  
ATOM 4942  C CG   . TRP A 1 100 ? -6.950  5.443   4.593   1.00 0.00 ? 100 TRP A CG   2  
ATOM 4943  C CD1  . TRP A 1 100 ? -6.029  6.058   5.392   1.00 0.00 ? 100 TRP A CD1  2  
ATOM 4944  C CD2  . TRP A 1 100 ? -8.163  5.382   5.356   1.00 0.00 ? 100 TRP A CD2  2  
ATOM 4945  N NE1  . TRP A 1 100 ? -6.593  6.386   6.600   1.00 0.00 ? 100 TRP A NE1  2  
ATOM 4946  C CE2  . TRP A 1 100 ? -7.901  5.983   6.603   1.00 0.00 ? 100 TRP A CE2  2  
ATOM 4947  C CE3  . TRP A 1 100 ? -9.444  4.881   5.108   1.00 0.00 ? 100 TRP A CE3  2  
ATOM 4948  C CZ2  . TRP A 1 100 ? -8.871  6.095   7.596   1.00 0.00 ? 100 TRP A CZ2  2  
ATOM 4949  C CZ3  . TRP A 1 100 ? -10.406 4.994   6.097   1.00 0.00 ? 100 TRP A CZ3  2  
ATOM 4950  C CH2  . TRP A 1 100 ? -10.114 5.597   7.326   1.00 0.00 ? 100 TRP A CH2  2  
ATOM 4951  H H    . TRP A 1 100 ? -8.251  3.472   1.655   1.00 0.00 ? 100 TRP A H    2  
ATOM 4952  H HA   . TRP A 1 100 ? -8.332  6.233   2.616   1.00 0.00 ? 100 TRP A HA   2  
ATOM 4953  H HB2  . TRP A 1 100 ? -6.789  3.851   3.233   1.00 0.00 ? 100 TRP A HB2  2  
ATOM 4954  H HB3  . TRP A 1 100 ? -5.733  5.215   2.896   1.00 0.00 ? 100 TRP A HB3  2  
ATOM 4955  H HD1  . TRP A 1 100 ? -5.008  6.253   5.105   1.00 0.00 ? 100 TRP A HD1  2  
ATOM 4956  H HE1  . TRP A 1 100 ? -6.134  6.837   7.339   1.00 0.00 ? 100 TRP A HE1  2  
ATOM 4957  H HE3  . TRP A 1 100 ? -9.689  4.414   4.166   1.00 0.00 ? 100 TRP A HE3  2  
ATOM 4958  H HZ2  . TRP A 1 100 ? -8.662  6.558   8.549   1.00 0.00 ? 100 TRP A HZ2  2  
ATOM 4959  H HZ3  . TRP A 1 100 ? -11.401 4.616   5.924   1.00 0.00 ? 100 TRP A HZ3  2  
ATOM 4960  H HH2  . TRP A 1 100 ? -10.896 5.663   8.068   1.00 0.00 ? 100 TRP A HH2  2  
ATOM 4961  N N    . LEU A 1 101 ? -7.664  6.885   0.195   1.00 0.00 ? 101 LEU A N    2  
ATOM 4962  C CA   . LEU A 1 101 ? -7.052  7.457   -1.005  1.00 0.00 ? 101 LEU A CA   2  
ATOM 4963  C C    . LEU A 1 101 ? -5.829  8.280   -0.649  1.00 0.00 ? 101 LEU A C    2  
ATOM 4964  O O    . LEU A 1 101 ? -4.702  7.910   -0.976  1.00 0.00 ? 101 LEU A O    2  
ATOM 4965  C CB   . LEU A 1 101 ? -8.053  8.330   -1.767  1.00 0.00 ? 101 LEU A CB   2  
ATOM 4966  C CG   . LEU A 1 101 ? -9.309  7.605   -2.242  1.00 0.00 ? 101 LEU A CG   2  
ATOM 4967  C CD1  . LEU A 1 101 ? -10.553 8.416   -1.914  1.00 0.00 ? 101 LEU A CD1  2  
ATOM 4968  C CD2  . LEU A 1 101 ? -9.234  7.334   -3.736  1.00 0.00 ? 101 LEU A CD2  2  
ATOM 4969  H H    . LEU A 1 101 ? -8.574  7.152   0.441   1.00 0.00 ? 101 LEU A H    2  
ATOM 4970  H HA   . LEU A 1 101 ? -6.746  6.639   -1.640  1.00 0.00 ? 101 LEU A HA   2  
ATOM 4971  H HB2  . LEU A 1 101 ? -8.350  9.147   -1.125  1.00 0.00 ? 101 LEU A HB2  2  
ATOM 4972  H HB3  . LEU A 1 101 ? -7.555  8.741   -2.633  1.00 0.00 ? 101 LEU A HB3  2  
ATOM 4973  H HG   . LEU A 1 101 ? -9.377  6.656   -1.732  1.00 0.00 ? 101 LEU A HG   2  
ATOM 4974  H HD11 . LEU A 1 101 ? -11.286 8.287   -2.698  1.00 0.00 ? 101 LEU A HD11 2  
ATOM 4975  H HD12 . LEU A 1 101 ? -10.290 9.461   -1.836  1.00 0.00 ? 101 LEU A HD12 2  
ATOM 4976  H HD13 . LEU A 1 101 ? -10.964 8.079   -0.976  1.00 0.00 ? 101 LEU A HD13 2  
ATOM 4977  H HD21 . LEU A 1 101 ? -9.820  8.074   -4.263  1.00 0.00 ? 101 LEU A HD21 2  
ATOM 4978  H HD22 . LEU A 1 101 ? -9.628  6.350   -3.942  1.00 0.00 ? 101 LEU A HD22 2  
ATOM 4979  H HD23 . LEU A 1 101 ? -8.206  7.387   -4.061  1.00 0.00 ? 101 LEU A HD23 2  
ATOM 4980  N N    . ALA A 1 102 ? -6.061  9.402   0.024   1.00 0.00 ? 102 ALA A N    2  
ATOM 4981  C CA   . ALA A 1 102 ? -4.987  10.298  0.436   1.00 0.00 ? 102 ALA A CA   2  
ATOM 4982  C C    . ALA A 1 102 ? -3.776  9.531   0.970   1.00 0.00 ? 102 ALA A C    2  
ATOM 4983  O O    . ALA A 1 102 ? -2.652  10.033  0.943   1.00 0.00 ? 102 ALA A O    2  
ATOM 4984  C CB   . ALA A 1 102 ? -5.506  11.271  1.491   1.00 0.00 ? 102 ALA A CB   2  
ATOM 4985  H H    . ALA A 1 102 ? -6.984  9.642   0.250   1.00 0.00 ? 102 ALA A H    2  
ATOM 4986  H HA   . ALA A 1 102 ? -4.684  10.872  -0.426  1.00 0.00 ? 102 ALA A HA   2  
ATOM 4987  H HB1  . ALA A 1 102 ? -5.010  11.082  2.432   1.00 0.00 ? 102 ALA A HB1  2  
ATOM 4988  H HB2  . ALA A 1 102 ? -6.574  11.137  1.615   1.00 0.00 ? 102 ALA A HB2  2  
ATOM 4989  H HB3  . ALA A 1 102 ? -5.306  12.284  1.176   1.00 0.00 ? 102 ALA A HB3  2  
ATOM 4990  N N    . ILE A 1 103 ? -4.015  8.326   1.481   1.00 0.00 ? 103 ILE A N    2  
ATOM 4991  C CA   . ILE A 1 103 ? -2.949  7.511   2.049   1.00 0.00 ? 103 ILE A CA   2  
ATOM 4992  C C    . ILE A 1 103 ? -2.594  6.294   1.184   1.00 0.00 ? 103 ILE A C    2  
ATOM 4993  O O    . ILE A 1 103 ? -1.532  5.699   1.367   1.00 0.00 ? 103 ILE A O    2  
ATOM 4994  C CB   . ILE A 1 103 ? -3.352  7.021   3.454   1.00 0.00 ? 103 ILE A CB   2  
ATOM 4995  C CG1  . ILE A 1 103 ? -3.612  8.214   4.375   1.00 0.00 ? 103 ILE A CG1  2  
ATOM 4996  C CG2  . ILE A 1 103 ? -2.277  6.116   4.043   1.00 0.00 ? 103 ILE A CG2  2  
ATOM 4997  C CD1  . ILE A 1 103 ? -5.043  8.704   4.339   1.00 0.00 ? 103 ILE A CD1  2  
ATOM 4998  H H    . ILE A 1 103 ? -4.933  7.987   1.504   1.00 0.00 ? 103 ILE A H    2  
ATOM 4999  H HA   . ILE A 1 103 ? -2.073  8.134   2.151   1.00 0.00 ? 103 ILE A HA   2  
ATOM 5000  H HB   . ILE A 1 103 ? -4.264  6.446   3.358   1.00 0.00 ? 103 ILE A HB   2  
ATOM 5001  H HG12 . ILE A 1 103 ? -3.385  7.931   5.392   1.00 0.00 ? 103 ILE A HG12 2  
ATOM 5002  H HG13 . ILE A 1 103 ? -2.972  9.033   4.082   1.00 0.00 ? 103 ILE A HG13 2  
ATOM 5003  H HG21 . ILE A 1 103 ? -2.521  5.084   3.835   1.00 0.00 ? 103 ILE A HG21 2  
ATOM 5004  H HG22 . ILE A 1 103 ? -2.226  6.265   5.111   1.00 0.00 ? 103 ILE A HG22 2  
ATOM 5005  H HG23 . ILE A 1 103 ? -1.321  6.356   3.601   1.00 0.00 ? 103 ILE A HG23 2  
ATOM 5006  H HD11 . ILE A 1 103 ? -5.621  8.077   3.676   1.00 0.00 ? 103 ILE A HD11 2  
ATOM 5007  H HD12 . ILE A 1 103 ? -5.065  9.723   3.981   1.00 0.00 ? 103 ILE A HD12 2  
ATOM 5008  H HD13 . ILE A 1 103 ? -5.464  8.662   5.332   1.00 0.00 ? 103 ILE A HD13 2  
ATOM 5009  N N    . ASP A 1 104 ? -3.483  5.896   0.276   1.00 0.00 ? 104 ASP A N    2  
ATOM 5010  C CA   . ASP A 1 104 ? -3.226  4.715   -0.552  1.00 0.00 ? 104 ASP A CA   2  
ATOM 5011  C C    . ASP A 1 104 ? -2.884  5.058   -1.998  1.00 0.00 ? 104 ASP A C    2  
ATOM 5012  O O    . ASP A 1 104 ? -1.876  4.580   -2.515  1.00 0.00 ? 104 ASP A O    2  
ATOM 5013  C CB   . ASP A 1 104 ? -4.441  3.786   -0.535  1.00 0.00 ? 104 ASP A CB   2  
ATOM 5014  C CG   . ASP A 1 104 ? -4.100  2.377   -0.978  1.00 0.00 ? 104 ASP A CG   2  
ATOM 5015  O OD1  . ASP A 1 104 ? -3.060  2.201   -1.647  1.00 0.00 ? 104 ASP A OD1  2  
ATOM 5016  O OD2  . ASP A 1 104 ? -4.872  1.450   -0.655  1.00 0.00 ? 104 ASP A OD2  2  
ATOM 5017  H H    . ASP A 1 104 ? -4.331  6.377   0.184   1.00 0.00 ? 104 ASP A H    2  
ATOM 5018  H HA   . ASP A 1 104 ? -2.389  4.189   -0.118  1.00 0.00 ? 104 ASP A HA   2  
ATOM 5019  H HB2  . ASP A 1 104 ? -4.839  3.742   0.467   1.00 0.00 ? 104 ASP A HB2  2  
ATOM 5020  H HB3  . ASP A 1 104 ? -5.197  4.181   -1.201  1.00 0.00 ? 104 ASP A HB3  2  
ATOM 5021  N N    . MET A 1 105 ? -3.724  5.871   -2.651  1.00 0.00 ? 105 MET A N    2  
ATOM 5022  C CA   . MET A 1 105 ? -3.504  6.256   -4.056  1.00 0.00 ? 105 MET A CA   2  
ATOM 5023  C C    . MET A 1 105 ? -2.598  5.254   -4.779  1.00 0.00 ? 105 MET A C    2  
ATOM 5024  O O    . MET A 1 105 ? -1.374  5.368   -4.731  1.00 0.00 ? 105 MET A O    2  
ATOM 5025  C CB   . MET A 1 105 ? -2.895  7.662   -4.140  1.00 0.00 ? 105 MET A CB   2  
ATOM 5026  C CG   . MET A 1 105 ? -3.831  8.793   -3.716  1.00 0.00 ? 105 MET A CG   2  
ATOM 5027  S SD   . MET A 1 105 ? -5.571  8.469   -4.078  1.00 0.00 ? 105 MET A SD   2  
ATOM 5028  C CE   . MET A 1 105 ? -5.950  9.785   -5.231  1.00 0.00 ? 105 MET A CE   2  
ATOM 5029  H H    . MET A 1 105 ? -4.520  6.211   -2.183  1.00 0.00 ? 105 MET A H    2  
ATOM 5030  H HA   . MET A 1 105 ? -4.463  6.259   -4.548  1.00 0.00 ? 105 MET A HA   2  
ATOM 5031  H HB2  . MET A 1 105 ? -2.023  7.697   -3.505  1.00 0.00 ? 105 MET A HB2  2  
ATOM 5032  H HB3  . MET A 1 105 ? -2.587  7.844   -5.159  1.00 0.00 ? 105 MET A HB3  2  
ATOM 5033  H HG2  . MET A 1 105 ? -3.726  8.945   -2.654  1.00 0.00 ? 105 MET A HG2  2  
ATOM 5034  H HG3  . MET A 1 105 ? -3.534  9.694   -4.233  1.00 0.00 ? 105 MET A HG3  2  
ATOM 5035  H HE1  . MET A 1 105 ? -5.475  10.698  -4.905  1.00 0.00 ? 105 MET A HE1  2  
ATOM 5036  H HE2  . MET A 1 105 ? -7.019  9.931   -5.271  1.00 0.00 ? 105 MET A HE2  2  
ATOM 5037  H HE3  . MET A 1 105 ? -5.587  9.520   -6.214  1.00 0.00 ? 105 MET A HE3  2  
ATOM 5038  N N    . SER A 1 106 ? -3.202  4.266   -5.434  1.00 0.00 ? 106 SER A N    2  
ATOM 5039  C CA   . SER A 1 106 ? -2.435  3.247   -6.142  1.00 0.00 ? 106 SER A CA   2  
ATOM 5040  C C    . SER A 1 106 ? -2.083  3.696   -7.554  1.00 0.00 ? 106 SER A C    2  
ATOM 5041  O O    . SER A 1 106 ? -2.947  3.760   -8.426  1.00 0.00 ? 106 SER A O    2  
ATOM 5042  C CB   . SER A 1 106 ? -3.223  1.937   -6.195  1.00 0.00 ? 106 SER A CB   2  
ATOM 5043  O OG   . SER A 1 106 ? -2.369  0.838   -6.461  1.00 0.00 ? 106 SER A OG   2  
ATOM 5044  H H    . SER A 1 106 ? -4.181  4.215   -5.435  1.00 0.00 ? 106 SER A H    2  
ATOM 5045  H HA   . SER A 1 106 ? -1.523  3.082   -5.593  1.00 0.00 ? 106 SER A HA   2  
ATOM 5046  H HB2  . SER A 1 106 ? -3.712  1.775   -5.247  1.00 0.00 ? 106 SER A HB2  2  
ATOM 5047  H HB3  . SER A 1 106 ? -3.965  1.998   -6.977  1.00 0.00 ? 106 SER A HB3  2  
ATOM 5048  H HG   . SER A 1 106 ? -2.162  0.812   -7.399  1.00 0.00 ? 106 SER A HG   2  
ATOM 5049  N N    . PHE A 1 107 ? -0.804  3.979   -7.785  1.00 0.00 ? 107 PHE A N    2  
ATOM 5050  C CA   . PHE A 1 107 ? -0.346  4.394   -9.104  1.00 0.00 ? 107 PHE A CA   2  
ATOM 5051  C C    . PHE A 1 107 ? 0.170   3.182   -9.877  1.00 0.00 ? 107 PHE A C    2  
ATOM 5052  O O    . PHE A 1 107 ? 0.766   2.276   -9.295  1.00 0.00 ? 107 PHE A O    2  
ATOM 5053  C CB   . PHE A 1 107 ? 0.763   5.451   -8.984  1.00 0.00 ? 107 PHE A CB   2  
ATOM 5054  C CG   . PHE A 1 107 ? 0.274   6.879   -9.008  1.00 0.00 ? 107 PHE A CG   2  
ATOM 5055  C CD1  . PHE A 1 107 ? -0.846  7.238   -9.742  1.00 0.00 ? 107 PHE A CD1  2  
ATOM 5056  C CD2  . PHE A 1 107 ? 0.944   7.866   -8.297  1.00 0.00 ? 107 PHE A CD2  2  
ATOM 5057  C CE1  . PHE A 1 107 ? -1.288  8.546   -9.765  1.00 0.00 ? 107 PHE A CE1  2  
ATOM 5058  C CE2  . PHE A 1 107 ? 0.505   9.176   -8.319  1.00 0.00 ? 107 PHE A CE2  2  
ATOM 5059  C CZ   . PHE A 1 107 ? -0.613  9.516   -9.053  1.00 0.00 ? 107 PHE A CZ   2  
ATOM 5060  H H    . PHE A 1 107 ? -0.144  3.886   -7.067  1.00 0.00 ? 107 PHE A H    2  
ATOM 5061  H HA   . PHE A 1 107 ? -1.188  4.813   -9.631  1.00 0.00 ? 107 PHE A HA   2  
ATOM 5062  H HB2  . PHE A 1 107 ? 1.289   5.301   -8.053  1.00 0.00 ? 107 PHE A HB2  2  
ATOM 5063  H HB3  . PHE A 1 107 ? 1.456   5.325   -9.803  1.00 0.00 ? 107 PHE A HB3  2  
ATOM 5064  H HD1  . PHE A 1 107 ? -1.377  6.485   -10.302 1.00 0.00 ? 107 PHE A HD1  2  
ATOM 5065  H HD2  . PHE A 1 107 ? 1.817   7.607   -7.719  1.00 0.00 ? 107 PHE A HD2  2  
ATOM 5066  H HE1  . PHE A 1 107 ? -2.162  8.809   -10.338 1.00 0.00 ? 107 PHE A HE1  2  
ATOM 5067  H HE2  . PHE A 1 107 ? 1.036   9.933   -7.763  1.00 0.00 ? 107 PHE A HE2  2  
ATOM 5068  H HZ   . PHE A 1 107 ? -0.957  10.539  -9.071  1.00 0.00 ? 107 PHE A HZ   2  
ATOM 5069  N N    . GLU A 1 108 ? -0.065  3.163   -11.183 1.00 0.00 ? 108 GLU A N    2  
ATOM 5070  C CA   . GLU A 1 108 ? 0.378   2.048   -12.016 1.00 0.00 ? 108 GLU A CA   2  
ATOM 5071  C C    . GLU A 1 108 ? 0.150   2.328   -13.502 1.00 0.00 ? 108 GLU A C    2  
ATOM 5072  O O    . GLU A 1 108 ? 1.079   2.243   -14.305 1.00 0.00 ? 108 GLU A O    2  
ATOM 5073  C CB   . GLU A 1 108 ? -0.352  0.765   -11.609 1.00 0.00 ? 108 GLU A CB   2  
ATOM 5074  C CG   . GLU A 1 108 ? 0.580   -0.366  -11.208 1.00 0.00 ? 108 GLU A CG   2  
ATOM 5075  C CD   . GLU A 1 108 ? -0.072  -1.729  -11.331 1.00 0.00 ? 108 GLU A CD   2  
ATOM 5076  O OE1  . GLU A 1 108 ? -0.432  -2.114  -12.463 1.00 0.00 ? 108 GLU A OE1  2  
ATOM 5077  O OE2  . GLU A 1 108 ? -0.221  -2.412  -10.296 1.00 0.00 ? 108 GLU A OE2  2  
ATOM 5078  H H    . GLU A 1 108 ? -0.548  3.908   -11.593 1.00 0.00 ? 108 GLU A H    2  
ATOM 5079  H HA   . GLU A 1 108 ? 1.436   1.913   -11.849 1.00 0.00 ? 108 GLU A HA   2  
ATOM 5080  H HB2  . GLU A 1 108 ? -0.998  0.984   -10.772 1.00 0.00 ? 108 GLU A HB2  2  
ATOM 5081  H HB3  . GLU A 1 108 ? -0.956  0.427   -12.439 1.00 0.00 ? 108 GLU A HB3  2  
ATOM 5082  H HG2  . GLU A 1 108 ? 1.451   -0.341  -11.846 1.00 0.00 ? 108 GLU A HG2  2  
ATOM 5083  H HG3  . GLU A 1 108 ? 0.883   -0.219  -10.181 1.00 0.00 ? 108 GLU A HG3  2  
ATOM 5084  N N    . PRO A 1 109 ? -1.096  2.658   -13.891 1.00 0.00 ? 109 PRO A N    2  
ATOM 5085  C CA   . PRO A 1 109 ? -1.438  2.939   -15.289 1.00 0.00 ? 109 PRO A CA   2  
ATOM 5086  C C    . PRO A 1 109 ? -0.414  3.833   -15.991 1.00 0.00 ? 109 PRO A C    2  
ATOM 5087  O O    . PRO A 1 109 ? 0.002   3.532   -17.110 1.00 0.00 ? 109 PRO A O    2  
ATOM 5088  C CB   . PRO A 1 109 ? -2.792  3.634   -15.183 1.00 0.00 ? 109 PRO A CB   2  
ATOM 5089  C CG   . PRO A 1 109 ? -3.407  3.062   -13.951 1.00 0.00 ? 109 PRO A CG   2  
ATOM 5090  C CD   . PRO A 1 109 ? -2.272  2.773   -13.005 1.00 0.00 ? 109 PRO A CD   2  
ATOM 5091  H HA   . PRO A 1 109 ? -1.549  2.024   -15.852 1.00 0.00 ? 109 PRO A HA   2  
ATOM 5092  H HB2  . PRO A 1 109 ? -2.649  4.699   -15.102 1.00 0.00 ? 109 PRO A HB2  2  
ATOM 5093  H HB3  . PRO A 1 109 ? -3.383  3.410   -16.058 1.00 0.00 ? 109 PRO A HB3  2  
ATOM 5094  H HG2  . PRO A 1 109 ? -4.084  3.779   -13.512 1.00 0.00 ? 109 PRO A HG2  2  
ATOM 5095  H HG3  . PRO A 1 109 ? -3.932  2.150   -14.194 1.00 0.00 ? 109 PRO A HG3  2  
ATOM 5096  H HD2  . PRO A 1 109 ? -2.152  3.587   -12.308 1.00 0.00 ? 109 PRO A HD2  2  
ATOM 5097  H HD3  . PRO A 1 109 ? -2.448  1.847   -12.477 1.00 0.00 ? 109 PRO A HD3  2  
ATOM 5098  N N    . PRO A 1 110 ? 0.019   4.943   -15.352 1.00 0.00 ? 110 PRO A N    2  
ATOM 5099  C CA   . PRO A 1 110 ? 1.004   5.856   -15.940 1.00 0.00 ? 110 PRO A CA   2  
ATOM 5100  C C    . PRO A 1 110 ? 2.114   5.121   -16.681 1.00 0.00 ? 110 PRO A C    2  
ATOM 5101  O O    . PRO A 1 110 ? 2.361   3.940   -16.433 1.00 0.00 ? 110 PRO A O    2  
ATOM 5102  C CB   . PRO A 1 110 ? 1.564   6.571   -14.714 1.00 0.00 ? 110 PRO A CB   2  
ATOM 5103  C CG   . PRO A 1 110 ? 0.404   6.652   -13.783 1.00 0.00 ? 110 PRO A CG   2  
ATOM 5104  C CD   . PRO A 1 110 ? -0.406  5.398   -14.010 1.00 0.00 ? 110 PRO A CD   2  
ATOM 5105  H HA   . PRO A 1 110 ? 0.540   6.574   -16.601 1.00 0.00 ? 110 PRO A HA   2  
ATOM 5106  H HB2  . PRO A 1 110 ? 2.371   5.989   -14.293 1.00 0.00 ? 110 PRO A HB2  2  
ATOM 5107  H HB3  . PRO A 1 110 ? 1.923   7.551   -14.989 1.00 0.00 ? 110 PRO A HB3  2  
ATOM 5108  H HG2  . PRO A 1 110 ? 0.756   6.691   -12.763 1.00 0.00 ? 110 PRO A HG2  2  
ATOM 5109  H HG3  . PRO A 1 110 ? -0.188  7.526   -14.010 1.00 0.00 ? 110 PRO A HG3  2  
ATOM 5110  H HD2  . PRO A 1 110 ? -0.168  4.663   -13.261 1.00 0.00 ? 110 PRO A HD2  2  
ATOM 5111  H HD3  . PRO A 1 110 ? -1.460  5.626   -13.996 1.00 0.00 ? 110 PRO A HD3  2  
ATOM 5112  N N    . GLU A 1 111 ? 2.786   5.823   -17.585 1.00 0.00 ? 111 GLU A N    2  
ATOM 5113  C CA   . GLU A 1 111 ? 3.874   5.226   -18.348 1.00 0.00 ? 111 GLU A CA   2  
ATOM 5114  C C    . GLU A 1 111 ? 5.197   5.463   -17.630 1.00 0.00 ? 111 GLU A C    2  
ATOM 5115  O O    . GLU A 1 111 ? 5.367   6.475   -16.956 1.00 0.00 ? 111 GLU A O    2  
ATOM 5116  C CB   . GLU A 1 111 ? 3.911   5.813   -19.770 1.00 0.00 ? 111 GLU A CB   2  
ATOM 5117  C CG   . GLU A 1 111 ? 5.156   5.449   -20.567 1.00 0.00 ? 111 GLU A CG   2  
ATOM 5118  C CD   . GLU A 1 111 ? 4.828   4.876   -21.932 1.00 0.00 ? 111 GLU A CD   2  
ATOM 5119  O OE1  . GLU A 1 111 ? 4.594   3.652   -22.022 1.00 0.00 ? 111 GLU A OE1  2  
ATOM 5120  O OE2  . GLU A 1 111 ? 4.806   5.651   -22.911 1.00 0.00 ? 111 GLU A OE2  2  
ATOM 5121  H H    . GLU A 1 111 ? 2.552   6.766   -17.735 1.00 0.00 ? 111 GLU A H    2  
ATOM 5122  H HA   . GLU A 1 111 ? 3.694   4.163   -18.408 1.00 0.00 ? 111 GLU A HA   2  
ATOM 5123  H HB2  . GLU A 1 111 ? 3.055   5.456   -20.314 1.00 0.00 ? 111 GLU A HB2  2  
ATOM 5124  H HB3  . GLU A 1 111 ? 3.852   6.886   -19.708 1.00 0.00 ? 111 GLU A HB3  2  
ATOM 5125  H HG2  . GLU A 1 111 ? 5.752   6.338   -20.703 1.00 0.00 ? 111 GLU A HG2  2  
ATOM 5126  H HG3  . GLU A 1 111 ? 5.723   4.717   -20.012 1.00 0.00 ? 111 GLU A HG3  2  
ATOM 5127  N N    . PHE A 1 112 ? 6.133   4.531   -17.773 1.00 0.00 ? 112 PHE A N    2  
ATOM 5128  C CA   . PHE A 1 112 ? 7.437   4.666   -17.132 1.00 0.00 ? 112 PHE A CA   2  
ATOM 5129  C C    . PHE A 1 112 ? 8.454   3.717   -17.741 1.00 0.00 ? 112 PHE A C    2  
ATOM 5130  O O    . PHE A 1 112 ? 8.167   2.552   -18.015 1.00 0.00 ? 112 PHE A O    2  
ATOM 5131  C CB   . PHE A 1 112 ? 7.335   4.441   -15.616 1.00 0.00 ? 112 PHE A CB   2  
ATOM 5132  C CG   . PHE A 1 112 ? 7.759   3.069   -15.151 1.00 0.00 ? 112 PHE A CG   2  
ATOM 5133  C CD1  . PHE A 1 112 ? 9.104   2.723   -15.079 1.00 0.00 ? 112 PHE A CD1  2  
ATOM 5134  C CD2  . PHE A 1 112 ? 6.810   2.129   -14.783 1.00 0.00 ? 112 PHE A CD2  2  
ATOM 5135  C CE1  . PHE A 1 112 ? 9.486   1.466   -14.649 1.00 0.00 ? 112 PHE A CE1  2  
ATOM 5136  C CE2  . PHE A 1 112 ? 7.189   0.872   -14.354 1.00 0.00 ? 112 PHE A CE2  2  
ATOM 5137  C CZ   . PHE A 1 112 ? 8.528   0.540   -14.287 1.00 0.00 ? 112 PHE A CZ   2  
ATOM 5138  H H    . PHE A 1 112 ? 5.946   3.741   -18.321 1.00 0.00 ? 112 PHE A H    2  
ATOM 5139  H HA   . PHE A 1 112 ? 7.783   5.678   -17.304 1.00 0.00 ? 112 PHE A HA   2  
ATOM 5140  H HB2  . PHE A 1 112 ? 7.961   5.162   -15.113 1.00 0.00 ? 112 PHE A HB2  2  
ATOM 5141  H HB3  . PHE A 1 112 ? 6.313   4.593   -15.312 1.00 0.00 ? 112 PHE A HB3  2  
ATOM 5142  H HD1  . PHE A 1 112 ? 9.860   3.445   -15.364 1.00 0.00 ? 112 PHE A HD1  2  
ATOM 5143  H HD2  . PHE A 1 112 ? 5.762   2.387   -14.835 1.00 0.00 ? 112 PHE A HD2  2  
ATOM 5144  H HE1  . PHE A 1 112 ? 10.534  1.208   -14.598 1.00 0.00 ? 112 PHE A HE1  2  
ATOM 5145  H HE2  . PHE A 1 112 ? 6.438   0.148   -14.071 1.00 0.00 ? 112 PHE A HE2  2  
ATOM 5146  H HZ   . PHE A 1 112 ? 8.826   -0.442  -13.952 1.00 0.00 ? 112 PHE A HZ   2  
ATOM 5147  N N    . GLU A 1 113 ? 9.646   4.241   -17.924 1.00 0.00 ? 113 GLU A N    2  
ATOM 5148  C CA   . GLU A 1 113 ? 10.757  3.490   -18.474 1.00 0.00 ? 113 GLU A CA   2  
ATOM 5149  C C    . GLU A 1 113 ? 12.045  4.045   -17.909 1.00 0.00 ? 113 GLU A C    2  
ATOM 5150  O O    . GLU A 1 113 ? 12.027  5.026   -17.167 1.00 0.00 ? 113 GLU A O    2  
ATOM 5151  C CB   . GLU A 1 113 ? 10.748  3.558   -19.998 1.00 0.00 ? 113 GLU A CB   2  
ATOM 5152  C CG   . GLU A 1 113 ? 11.218  4.891   -20.529 1.00 0.00 ? 113 GLU A CG   2  
ATOM 5153  C CD   . GLU A 1 113 ? 10.880  5.095   -21.993 1.00 0.00 ? 113 GLU A CD   2  
ATOM 5154  O OE1  . GLU A 1 113 ? 9.972   4.399   -22.495 1.00 0.00 ? 113 GLU A OE1  2  
ATOM 5155  O OE2  . GLU A 1 113 ? 11.522  5.951   -22.637 1.00 0.00 ? 113 GLU A OE2  2  
ATOM 5156  H H    . GLU A 1 113 ? 9.792   5.174   -17.661 1.00 0.00 ? 113 GLU A H    2  
ATOM 5157  H HA   . GLU A 1 113 ? 10.667  2.460   -18.156 1.00 0.00 ? 113 GLU A HA   2  
ATOM 5158  H HB2  . GLU A 1 113 ? 11.394  2.788   -20.388 1.00 0.00 ? 113 GLU A HB2  2  
ATOM 5159  H HB3  . GLU A 1 113 ? 9.742   3.387   -20.351 1.00 0.00 ? 113 GLU A HB3  2  
ATOM 5160  H HG2  . GLU A 1 113 ? 10.749  5.673   -19.949 1.00 0.00 ? 113 GLU A HG2  2  
ATOM 5161  H HG3  . GLU A 1 113 ? 12.290  4.942   -20.407 1.00 0.00 ? 113 GLU A HG3  2  
ATOM 5162  N N    . ILE A 1 114 ? 13.153  3.409   -18.227 1.00 0.00 ? 114 ILE A N    2  
ATOM 5163  C CA   . ILE A 1 114 ? 14.426  3.846   -17.704 1.00 0.00 ? 114 ILE A CA   2  
ATOM 5164  C C    . ILE A 1 114 ? 15.582  3.506   -18.640 1.00 0.00 ? 114 ILE A C    2  
ATOM 5165  O O    . ILE A 1 114 ? 15.729  2.363   -19.074 1.00 0.00 ? 114 ILE A O    2  
ATOM 5166  C CB   . ILE A 1 114 ? 14.665  3.201   -16.323 1.00 0.00 ? 114 ILE A CB   2  
ATOM 5167  C CG1  . ILE A 1 114 ? 14.154  1.764   -16.316 1.00 0.00 ? 114 ILE A CG1  2  
ATOM 5168  C CG2  . ILE A 1 114 ? 13.953  3.975   -15.234 1.00 0.00 ? 114 ILE A CG2  2  
ATOM 5169  C CD1  . ILE A 1 114 ? 15.060  0.806   -15.583 1.00 0.00 ? 114 ILE A CD1  2  
ATOM 5170  H H    . ILE A 1 114 ? 13.113  2.625   -18.811 1.00 0.00 ? 114 ILE A H    2  
ATOM 5171  H HA   . ILE A 1 114 ? 14.384  4.918   -17.572 1.00 0.00 ? 114 ILE A HA   2  
ATOM 5172  H HB   . ILE A 1 114 ? 15.720  3.213   -16.114 1.00 0.00 ? 114 ILE A HB   2  
ATOM 5173  H HG12 . ILE A 1 114 ? 13.188  1.740   -15.826 1.00 0.00 ? 114 ILE A HG12 2  
ATOM 5174  H HG13 . ILE A 1 114 ? 14.041  1.419   -17.335 1.00 0.00 ? 114 ILE A HG13 2  
ATOM 5175  H HG21 . ILE A 1 114 ? 13.468  4.836   -15.659 1.00 0.00 ? 114 ILE A HG21 2  
ATOM 5176  H HG22 . ILE A 1 114 ? 14.669  4.290   -14.492 1.00 0.00 ? 114 ILE A HG22 2  
ATOM 5177  H HG23 . ILE A 1 114 ? 13.213  3.335   -14.774 1.00 0.00 ? 114 ILE A HG23 2  
ATOM 5178  H HD11 . ILE A 1 114 ? 14.920  -0.187  -15.975 1.00 0.00 ? 114 ILE A HD11 2  
ATOM 5179  H HD12 . ILE A 1 114 ? 14.816  0.816   -14.531 1.00 0.00 ? 114 ILE A HD12 2  
ATOM 5180  H HD13 . ILE A 1 114 ? 16.086  1.106   -15.718 1.00 0.00 ? 114 ILE A HD13 2  
ATOM 5181  N N    . VAL A 1 115 ? 16.421  4.498   -18.910 1.00 0.00 ? 115 VAL A N    2  
ATOM 5182  C CA   . VAL A 1 115 ? 17.596  4.309   -19.749 1.00 0.00 ? 115 VAL A CA   2  
ATOM 5183  C C    . VAL A 1 115 ? 18.831  4.338   -18.870 1.00 0.00 ? 115 VAL A C    2  
ATOM 5184  O O    . VAL A 1 115 ? 19.010  5.261   -18.086 1.00 0.00 ? 115 VAL A O    2  
ATOM 5185  C CB   . VAL A 1 115 ? 17.723  5.397   -20.829 1.00 0.00 ? 115 VAL A CB   2  
ATOM 5186  C CG1  . VAL A 1 115 ? 18.887  5.094   -21.761 1.00 0.00 ? 115 VAL A CG1  2  
ATOM 5187  C CG2  . VAL A 1 115 ? 16.426  5.517   -21.608 1.00 0.00 ? 115 VAL A CG2  2  
ATOM 5188  H H    . VAL A 1 115 ? 16.265  5.372   -18.505 1.00 0.00 ? 115 VAL A H    2  
ATOM 5189  H HA   . VAL A 1 115 ? 17.522  3.344   -20.230 1.00 0.00 ? 115 VAL A HA   2  
ATOM 5190  H HB   . VAL A 1 115 ? 17.918  6.342   -20.341 1.00 0.00 ? 115 VAL A HB   2  
ATOM 5191  H HG11 . VAL A 1 115 ? 18.647  5.432   -22.758 1.00 0.00 ? 115 VAL A HG11 2  
ATOM 5192  H HG12 . VAL A 1 115 ? 19.068  4.030   -21.776 1.00 0.00 ? 115 VAL A HG12 2  
ATOM 5193  H HG13 . VAL A 1 115 ? 19.771  5.605   -21.410 1.00 0.00 ? 115 VAL A HG13 2  
ATOM 5194  H HG21 . VAL A 1 115 ? 16.035  4.529   -21.802 1.00 0.00 ? 115 VAL A HG21 2  
ATOM 5195  H HG22 . VAL A 1 115 ? 16.613  6.021   -22.544 1.00 0.00 ? 115 VAL A HG22 2  
ATOM 5196  H HG23 . VAL A 1 115 ? 15.709  6.081   -21.031 1.00 0.00 ? 115 VAL A HG23 2  
ATOM 5197  N N    . GLY A 1 116 ? 19.668  3.324   -18.975 1.00 0.00 ? 116 GLY A N    2  
ATOM 5198  C CA   . GLY A 1 116 ? 20.852  3.281   -18.140 1.00 0.00 ? 116 GLY A CA   2  
ATOM 5199  C C    . GLY A 1 116 ? 22.126  3.638   -18.869 1.00 0.00 ? 116 GLY A C    2  
ATOM 5200  O O    . GLY A 1 116 ? 22.432  3.075   -19.920 1.00 0.00 ? 116 GLY A O    2  
ATOM 5201  H H    . GLY A 1 116 ? 19.477  2.601   -19.609 1.00 0.00 ? 116 GLY A H    2  
ATOM 5202  H HA2  . GLY A 1 116 ? 20.721  3.980   -17.326 1.00 0.00 ? 116 GLY A HA2  2  
ATOM 5203  H HA3  . GLY A 1 116 ? 20.951  2.288   -17.723 1.00 0.00 ? 116 GLY A HA3  2  
ATOM 5204  N N    . PHE A 1 117 ? 22.887  4.556   -18.284 1.00 0.00 ? 117 PHE A N    2  
ATOM 5205  C CA   . PHE A 1 117 ? 24.159  4.968   -18.851 1.00 0.00 ? 117 PHE A CA   2  
ATOM 5206  C C    . PHE A 1 117 ? 25.245  4.063   -18.294 1.00 0.00 ? 117 PHE A C    2  
ATOM 5207  O O    . PHE A 1 117 ? 25.115  3.566   -17.175 1.00 0.00 ? 117 PHE A O    2  
ATOM 5208  C CB   . PHE A 1 117 ? 24.443  6.434   -18.527 1.00 0.00 ? 117 PHE A CB   2  
ATOM 5209  C CG   . PHE A 1 117 ? 23.815  7.390   -19.504 1.00 0.00 ? 117 PHE A CG   2  
ATOM 5210  C CD1  . PHE A 1 117 ? 22.439  7.416   -19.688 1.00 0.00 ? 117 PHE A CD1  2  
ATOM 5211  C CD2  . PHE A 1 117 ? 24.602  8.261   -20.241 1.00 0.00 ? 117 PHE A CD2  2  
ATOM 5212  C CE1  . PHE A 1 117 ? 21.864  8.293   -20.587 1.00 0.00 ? 117 PHE A CE1  2  
ATOM 5213  C CE2  . PHE A 1 117 ? 24.030  9.140   -21.142 1.00 0.00 ? 117 PHE A CE2  2  
ATOM 5214  C CZ   . PHE A 1 117 ? 22.660  9.156   -21.314 1.00 0.00 ? 117 PHE A CZ   2  
ATOM 5215  H H    . PHE A 1 117 ? 22.600  4.945   -17.431 1.00 0.00 ? 117 PHE A H    2  
ATOM 5216  H HA   . PHE A 1 117 ? 24.107  4.839   -19.923 1.00 0.00 ? 117 PHE A HA   2  
ATOM 5217  H HB2  . PHE A 1 117 ? 24.056  6.660   -17.545 1.00 0.00 ? 117 PHE A HB2  2  
ATOM 5218  H HB3  . PHE A 1 117 ? 25.510  6.599   -18.537 1.00 0.00 ? 117 PHE A HB3  2  
ATOM 5219  H HD1  . PHE A 1 117 ? 21.813  6.741   -19.121 1.00 0.00 ? 117 PHE A HD1  2  
ATOM 5220  H HD2  . PHE A 1 117 ? 25.673  8.249   -20.108 1.00 0.00 ? 117 PHE A HD2  2  
ATOM 5221  H HE1  . PHE A 1 117 ? 20.792  8.305   -20.720 1.00 0.00 ? 117 PHE A HE1  2  
ATOM 5222  H HE2  . PHE A 1 117 ? 24.655  9.813   -21.710 1.00 0.00 ? 117 PHE A HE2  2  
ATOM 5223  H HZ   . PHE A 1 117 ? 22.212  9.843   -22.017 1.00 0.00 ? 117 PHE A HZ   2  
ATOM 5224  N N    . THR A 1 118 ? 26.288  3.813   -19.080 1.00 0.00 ? 118 THR A N    2  
ATOM 5225  C CA   . THR A 1 118 ? 27.353  2.899   -18.666 1.00 0.00 ? 118 THR A CA   2  
ATOM 5226  C C    . THR A 1 118 ? 27.677  3.024   -17.170 1.00 0.00 ? 118 THR A C    2  
ATOM 5227  O O    . THR A 1 118 ? 28.063  2.047   -16.534 1.00 0.00 ? 118 THR A O    2  
ATOM 5228  C CB   . THR A 1 118 ? 28.635  3.131   -19.500 1.00 0.00 ? 118 THR A CB   2  
ATOM 5229  O OG1  . THR A 1 118 ? 28.946  1.982   -20.261 1.00 0.00 ? 118 THR A OG1  2  
ATOM 5230  C CG2  . THR A 1 118 ? 29.877  3.453   -18.688 1.00 0.00 ? 118 THR A CG2  2  
ATOM 5231  H H    . THR A 1 118 ? 26.321  4.213   -19.975 1.00 0.00 ? 118 THR A H    2  
ATOM 5232  H HA   . THR A 1 118 ? 26.982  1.895   -18.876 1.00 0.00 ? 118 THR A HA   2  
ATOM 5233  H HB   . THR A 1 118 ? 28.461  3.950   -20.184 1.00 0.00 ? 118 THR A HB   2  
ATOM 5234  H HG1  . THR A 1 118 ? 29.671  2.179   -20.858 1.00 0.00 ? 118 THR A HG1  2  
ATOM 5235  H HG21 . THR A 1 118 ? 30.647  3.829   -19.345 1.00 0.00 ? 118 THR A HG21 2  
ATOM 5236  H HG22 . THR A 1 118 ? 30.233  2.551   -18.201 1.00 0.00 ? 118 THR A HG22 2  
ATOM 5237  H HG23 . THR A 1 118 ? 29.643  4.198   -17.943 1.00 0.00 ? 118 THR A HG23 2  
ATOM 5238  N N    . ASN A 1 119 ? 27.544  4.231   -16.621 1.00 0.00 ? 119 ASN A N    2  
ATOM 5239  C CA   . ASN A 1 119 ? 27.849  4.459   -15.208 1.00 0.00 ? 119 ASN A CA   2  
ATOM 5240  C C    . ASN A 1 119 ? 26.649  4.993   -14.421 1.00 0.00 ? 119 ASN A C    2  
ATOM 5241  O O    . ASN A 1 119 ? 26.612  4.881   -13.196 1.00 0.00 ? 119 ASN A O    2  
ATOM 5242  C CB   . ASN A 1 119 ? 29.023  5.436   -15.082 1.00 0.00 ? 119 ASN A CB   2  
ATOM 5243  C CG   . ASN A 1 119 ? 30.216  4.826   -14.371 1.00 0.00 ? 119 ASN A CG   2  
ATOM 5244  O OD1  . ASN A 1 119 ? 31.299  4.707   -14.943 1.00 0.00 ? 119 ASN A OD1  2  
ATOM 5245  N ND2  . ASN A 1 119 ? 30.023  4.435   -13.116 1.00 0.00 ? 119 ASN A ND2  2  
ATOM 5246  H H    . ASN A 1 119 ? 27.251  4.983   -17.177 1.00 0.00 ? 119 ASN A H    2  
ATOM 5247  H HA   . ASN A 1 119 ? 28.144  3.514   -14.780 1.00 0.00 ? 119 ASN A HA   2  
ATOM 5248  H HB2  . ASN A 1 119 ? 29.335  5.741   -16.069 1.00 0.00 ? 119 ASN A HB2  2  
ATOM 5249  H HB3  . ASN A 1 119 ? 28.703  6.306   -14.527 1.00 0.00 ? 119 ASN A HB3  2  
ATOM 5250  H HD21 . ASN A 1 119 ? 29.133  4.560   -12.723 1.00 0.00 ? 119 ASN A HD21 2  
ATOM 5251  H HD22 . ASN A 1 119 ? 30.778  4.039   -12.633 1.00 0.00 ? 119 ASN A HD22 2  
ATOM 5252  N N    . HIS A 1 120 ? 25.692  5.612   -15.109 1.00 0.00 ? 120 HIS A N    2  
ATOM 5253  C CA   . HIS A 1 120 ? 24.533  6.196   -14.424 1.00 0.00 ? 120 HIS A CA   2  
ATOM 5254  C C    . HIS A 1 120 ? 23.214  5.593   -14.883 1.00 0.00 ? 120 HIS A C    2  
ATOM 5255  O O    . HIS A 1 120 ? 23.178  4.680   -15.708 1.00 0.00 ? 120 HIS A O    2  
ATOM 5256  C CB   . HIS A 1 120 ? 24.504  7.719   -14.606 1.00 0.00 ? 120 HIS A CB   2  
ATOM 5257  C CG   . HIS A 1 120 ? 25.151  8.206   -15.867 1.00 0.00 ? 120 HIS A CG   2  
ATOM 5258  N ND1  . HIS A 1 120 ? 26.464  7.938   -16.194 1.00 0.00 ? 120 HIS A ND1  2  
ATOM 5259  C CD2  . HIS A 1 120 ? 24.662  8.964   -16.877 1.00 0.00 ? 120 HIS A CD2  2  
ATOM 5260  C CE1  . HIS A 1 120 ? 26.754  8.511   -17.348 1.00 0.00 ? 120 HIS A CE1  2  
ATOM 5261  N NE2  . HIS A 1 120 ? 25.678  9.140   -17.784 1.00 0.00 ? 120 HIS A NE2  2  
ATOM 5262  H H    . HIS A 1 120 ? 25.787  5.708   -16.082 1.00 0.00 ? 120 HIS A H    2  
ATOM 5263  H HA   . HIS A 1 120 ? 24.638  5.992   -13.370 1.00 0.00 ? 120 HIS A HA   2  
ATOM 5264  H HB2  . HIS A 1 120 ? 23.478  8.051   -14.612 1.00 0.00 ? 120 HIS A HB2  2  
ATOM 5265  H HB3  . HIS A 1 120 ? 25.016  8.178   -13.773 1.00 0.00 ? 120 HIS A HB3  2  
ATOM 5266  H HD1  . HIS A 1 120 ? 27.090  7.407   -15.658 1.00 0.00 ? 120 HIS A HD1  2  
ATOM 5267  H HD2  . HIS A 1 120 ? 23.658  9.358   -16.956 1.00 0.00 ? 120 HIS A HD2  2  
ATOM 5268  H HE1  . HIS A 1 120 ? 27.710  8.472   -17.850 1.00 0.00 ? 120 HIS A HE1  2  
ATOM 5269  H HE2  . HIS A 1 120 ? 25.657  9.754   -18.547 1.00 0.00 ? 120 HIS A HE2  2  
ATOM 5270  N N    . ILE A 1 121 ? 22.130  6.126   -14.329 1.00 0.00 ? 121 ILE A N    2  
ATOM 5271  C CA   . ILE A 1 121 ? 20.786  5.673   -14.650 1.00 0.00 ? 121 ILE A CA   2  
ATOM 5272  C C    . ILE A 1 121 ? 19.896  6.850   -15.012 1.00 0.00 ? 121 ILE A C    2  
ATOM 5273  O O    . ILE A 1 121 ? 19.959  7.905   -14.387 1.00 0.00 ? 121 ILE A O    2  
ATOM 5274  C CB   . ILE A 1 121 ? 20.141  4.934   -13.463 1.00 0.00 ? 121 ILE A CB   2  
ATOM 5275  C CG1  . ILE A 1 121 ? 21.013  3.748   -13.037 1.00 0.00 ? 121 ILE A CG1  2  
ATOM 5276  C CG2  . ILE A 1 121 ? 18.730  4.484   -13.825 1.00 0.00 ? 121 ILE A CG2  2  
ATOM 5277  C CD1  . ILE A 1 121 ? 20.357  2.838   -12.017 1.00 0.00 ? 121 ILE A CD1  2  
ATOM 5278  H H    . ILE A 1 121 ? 22.240  6.856   -13.684 1.00 0.00 ? 121 ILE A H    2  
ATOM 5279  H HA   . ILE A 1 121 ? 20.841  4.992   -15.490 1.00 0.00 ? 121 ILE A HA   2  
ATOM 5280  H HB   . ILE A 1 121 ? 20.066  5.627   -12.640 1.00 0.00 ? 121 ILE A HB   2  
ATOM 5281  H HG12 . ILE A 1 121 ? 21.251  3.159   -13.906 1.00 0.00 ? 121 ILE A HG12 2  
ATOM 5282  H HG13 . ILE A 1 121 ? 21.928  4.122   -12.607 1.00 0.00 ? 121 ILE A HG13 2  
ATOM 5283  H HG21 . ILE A 1 121 ? 18.722  4.095   -14.831 1.00 0.00 ? 121 ILE A HG21 2  
ATOM 5284  H HG22 . ILE A 1 121 ? 18.058  5.327   -13.764 1.00 0.00 ? 121 ILE A HG22 2  
ATOM 5285  H HG23 . ILE A 1 121 ? 18.406  3.717   -13.139 1.00 0.00 ? 121 ILE A HG23 2  
ATOM 5286  H HD11 . ILE A 1 121 ? 19.428  2.458   -12.419 1.00 0.00 ? 121 ILE A HD11 2  
ATOM 5287  H HD12 . ILE A 1 121 ? 20.157  3.393   -11.111 1.00 0.00 ? 121 ILE A HD12 2  
ATOM 5288  H HD13 . ILE A 1 121 ? 21.014  2.010   -11.795 1.00 0.00 ? 121 ILE A HD13 2  
ATOM 5289  N N    . ASN A 1 122 ? 19.050  6.650   -16.004 1.00 0.00 ? 122 ASN A N    2  
ATOM 5290  C CA   . ASN A 1 122 ? 18.121  7.680   -16.434 1.00 0.00 ? 122 ASN A CA   2  
ATOM 5291  C C    . ASN A 1 122 ? 16.696  7.165   -16.307 1.00 0.00 ? 122 ASN A C    2  
ATOM 5292  O O    . ASN A 1 122 ? 16.234  6.366   -17.115 1.00 0.00 ? 122 ASN A O    2  
ATOM 5293  C CB   . ASN A 1 122 ? 18.413  8.114   -17.872 1.00 0.00 ? 122 ASN A CB   2  
ATOM 5294  C CG   . ASN A 1 122 ? 19.310  9.334   -17.937 1.00 0.00 ? 122 ASN A CG   2  
ATOM 5295  O OD1  . ASN A 1 122 ? 20.415  9.335   -17.394 1.00 0.00 ? 122 ASN A OD1  2  
ATOM 5296  N ND2  . ASN A 1 122 ? 18.838  10.382  -18.601 1.00 0.00 ? 122 ASN A ND2  2  
ATOM 5297  H H    . ASN A 1 122 ? 19.033  5.778   -16.445 1.00 0.00 ? 122 ASN A H    2  
ATOM 5298  H HA   . ASN A 1 122 ? 18.242  8.530   -15.778 1.00 0.00 ? 122 ASN A HA   2  
ATOM 5299  H HB2  . ASN A 1 122 ? 18.900  7.308   -18.395 1.00 0.00 ? 122 ASN A HB2  2  
ATOM 5300  H HB3  . ASN A 1 122 ? 17.483  8.349   -18.366 1.00 0.00 ? 122 ASN A HB3  2  
ATOM 5301  H HD21 . ASN A 1 122 ? 17.948  10.310  -19.007 1.00 0.00 ? 122 ASN A HD21 2  
ATOM 5302  H HD22 . ASN A 1 122 ? 19.398  11.184  -18.659 1.00 0.00 ? 122 ASN A HD22 2  
ATOM 5303  N N    . VAL A 1 123 ? 16.013  7.625   -15.276 1.00 0.00 ? 123 VAL A N    2  
ATOM 5304  C CA   . VAL A 1 123 ? 14.644  7.211   -15.021 1.00 0.00 ? 123 VAL A CA   2  
ATOM 5305  C C    . VAL A 1 123 ? 13.659  8.255   -15.521 1.00 0.00 ? 123 VAL A C    2  
ATOM 5306  O O    . VAL A 1 123 ? 13.852  9.452   -15.318 1.00 0.00 ? 123 VAL A O    2  
ATOM 5307  C CB   . VAL A 1 123 ? 14.396  6.981   -13.517 1.00 0.00 ? 123 VAL A CB   2  
ATOM 5308  C CG1  . VAL A 1 123 ? 12.988  6.455   -13.276 1.00 0.00 ? 123 VAL A CG1  2  
ATOM 5309  C CG2  . VAL A 1 123 ? 15.436  6.033   -12.941 1.00 0.00 ? 123 VAL A CG2  2  
ATOM 5310  H H    . VAL A 1 123 ? 16.448  8.256   -14.674 1.00 0.00 ? 123 VAL A H    2  
ATOM 5311  H HA   . VAL A 1 123 ? 14.476  6.282   -15.543 1.00 0.00 ? 123 VAL A HA   2  
ATOM 5312  H HB   . VAL A 1 123 ? 14.490  7.930   -13.010 1.00 0.00 ? 123 VAL A HB   2  
ATOM 5313  H HG11 . VAL A 1 123 ? 12.726  5.754   -14.053 1.00 0.00 ? 123 VAL A HG11 2  
ATOM 5314  H HG12 . VAL A 1 123 ? 12.290  7.279   -13.286 1.00 0.00 ? 123 VAL A HG12 2  
ATOM 5315  H HG13 . VAL A 1 123 ? 12.947  5.961   -12.316 1.00 0.00 ? 123 VAL A HG13 2  
ATOM 5316  H HG21 . VAL A 1 123 ? 16.109  6.583   -12.301 1.00 0.00 ? 123 VAL A HG21 2  
ATOM 5317  H HG22 . VAL A 1 123 ? 15.996  5.579   -13.746 1.00 0.00 ? 123 VAL A HG22 2  
ATOM 5318  H HG23 . VAL A 1 123 ? 14.943  5.262   -12.366 1.00 0.00 ? 123 VAL A HG23 2  
ATOM 5319  N N    . MET A 1 124 ? 12.596  7.796   -16.167 1.00 0.00 ? 124 MET A N    2  
ATOM 5320  C CA   . MET A 1 124 ? 11.581  8.702   -16.677 1.00 0.00 ? 124 MET A CA   2  
ATOM 5321  C C    . MET A 1 124 ? 10.186  8.180   -16.381 1.00 0.00 ? 124 MET A C    2  
ATOM 5322  O O    . MET A 1 124 ? 9.732   7.210   -16.987 1.00 0.00 ? 124 MET A O    2  
ATOM 5323  C CB   . MET A 1 124 ? 11.737  8.919   -18.178 1.00 0.00 ? 124 MET A CB   2  
ATOM 5324  C CG   . MET A 1 124 ? 11.551  10.365  -18.589 1.00 0.00 ? 124 MET A CG   2  
ATOM 5325  S SD   . MET A 1 124 ? 13.095  11.270  -18.564 1.00 0.00 ? 124 MET A SD   2  
ATOM 5326  C CE   . MET A 1 124 ? 14.010  10.365  -19.804 1.00 0.00 ? 124 MET A CE   2  
ATOM 5327  H H    . MET A 1 124 ? 12.488  6.831   -16.294 1.00 0.00 ? 124 MET A H    2  
ATOM 5328  H HA   . MET A 1 124 ? 11.715  9.650   -16.177 1.00 0.00 ? 124 MET A HA   2  
ATOM 5329  H HB2  . MET A 1 124 ? 12.728  8.611   -18.473 1.00 0.00 ? 124 MET A HB2  2  
ATOM 5330  H HB3  . MET A 1 124 ? 11.007  8.322   -18.702 1.00 0.00 ? 124 MET A HB3  2  
ATOM 5331  H HG2  . MET A 1 124 ? 11.163  10.399  -19.583 1.00 0.00 ? 124 MET A HG2  2  
ATOM 5332  H HG3  . MET A 1 124 ? 10.851  10.835  -17.920 1.00 0.00 ? 124 MET A HG3  2  
ATOM 5333  H HE1  . MET A 1 124 ? 13.383  10.214  -20.671 1.00 0.00 ? 124 MET A HE1  2  
ATOM 5334  H HE2  . MET A 1 124 ? 14.306  9.406   -19.404 1.00 0.00 ? 124 MET A HE2  2  
ATOM 5335  H HE3  . MET A 1 124 ? 14.887  10.926  -20.087 1.00 0.00 ? 124 MET A HE3  2  
ATOM 5336  N N    . VAL A 1 125 ? 9.505   8.835   -15.457 1.00 0.00 ? 125 VAL A N    2  
ATOM 5337  C CA   . VAL A 1 125 ? 8.153   8.441   -15.094 1.00 0.00 ? 125 VAL A CA   2  
ATOM 5338  C C    . VAL A 1 125 ? 7.155   9.338   -15.796 1.00 0.00 ? 125 VAL A C    2  
ATOM 5339  O O    . VAL A 1 125 ? 7.118   10.541  -15.579 1.00 0.00 ? 125 VAL A O    2  
ATOM 5340  C CB   . VAL A 1 125 ? 7.932   8.520   -13.579 1.00 0.00 ? 125 VAL A CB   2  
ATOM 5341  C CG1  . VAL A 1 125 ? 6.634   7.828   -13.196 1.00 0.00 ? 125 VAL A CG1  2  
ATOM 5342  C CG2  . VAL A 1 125 ? 9.123   7.914   -12.850 1.00 0.00 ? 125 VAL A CG2  2  
ATOM 5343  H H    . VAL A 1 125 ? 9.916   9.606   -15.016 1.00 0.00 ? 125 VAL A H    2  
ATOM 5344  H HA   . VAL A 1 125 ? 8.000   7.420   -15.419 1.00 0.00 ? 125 VAL A HA   2  
ATOM 5345  H HB   . VAL A 1 125 ? 7.857   9.559   -13.299 1.00 0.00 ? 125 VAL A HB   2  
ATOM 5346  H HG11 . VAL A 1 125 ? 6.727   6.768   -13.370 1.00 0.00 ? 125 VAL A HG11 2  
ATOM 5347  H HG12 . VAL A 1 125 ? 5.824   8.221   -13.797 1.00 0.00 ? 125 VAL A HG12 2  
ATOM 5348  H HG13 . VAL A 1 125 ? 6.424   8.008   -12.152 1.00 0.00 ? 125 VAL A HG13 2  
ATOM 5349  H HG21 . VAL A 1 125 ? 10.016  8.473   -13.094 1.00 0.00 ? 125 VAL A HG21 2  
ATOM 5350  H HG22 . VAL A 1 125 ? 9.249   6.887   -13.163 1.00 0.00 ? 125 VAL A HG22 2  
ATOM 5351  H HG23 . VAL A 1 125 ? 8.956   7.952   -11.785 1.00 0.00 ? 125 VAL A HG23 2  
ATOM 5352  N N    . LYS A 1 126 ? 6.396   8.755   -16.693 1.00 0.00 ? 126 LYS A N    2  
ATOM 5353  C CA   . LYS A 1 126 ? 5.458   9.513   -17.496 1.00 0.00 ? 126 LYS A CA   2  
ATOM 5354  C C    . LYS A 1 126 ? 4.089   9.740   -16.847 1.00 0.00 ? 126 LYS A C    2  
ATOM 5355  O O    . LYS A 1 126 ? 3.139   8.993   -17.098 1.00 0.00 ? 126 LYS A O    2  
ATOM 5356  C CB   . LYS A 1 126 ? 5.294   8.808   -18.832 1.00 0.00 ? 126 LYS A CB   2  
ATOM 5357  C CG   . LYS A 1 126 ? 6.601   8.671   -19.599 1.00 0.00 ? 126 LYS A CG   2  
ATOM 5358  C CD   . LYS A 1 126 ? 7.375   7.431   -19.187 1.00 0.00 ? 126 LYS A CD   2  
ATOM 5359  C CE   . LYS A 1 126 ? 8.340   6.993   -20.277 1.00 0.00 ? 126 LYS A CE   2  
ATOM 5360  N NZ   . LYS A 1 126 ? 9.386   8.020   -20.539 1.00 0.00 ? 126 LYS A NZ   2  
ATOM 5361  H H    . LYS A 1 126 ? 6.514   7.800   -16.881 1.00 0.00 ? 126 LYS A H    2  
ATOM 5362  H HA   . LYS A 1 126 ? 5.904   10.475  -17.682 1.00 0.00 ? 126 LYS A HA   2  
ATOM 5363  H HB2  . LYS A 1 126 ? 4.904   7.821   -18.651 1.00 0.00 ? 126 LYS A HB2  2  
ATOM 5364  H HB3  . LYS A 1 126 ? 4.596   9.362   -19.441 1.00 0.00 ? 126 LYS A HB3  2  
ATOM 5365  H HG2  . LYS A 1 126 ? 6.378   8.605   -20.652 1.00 0.00 ? 126 LYS A HG2  2  
ATOM 5366  H HG3  . LYS A 1 126 ? 7.216   9.543   -19.405 1.00 0.00 ? 126 LYS A HG3  2  
ATOM 5367  H HD2  . LYS A 1 126 ? 7.935   7.648   -18.290 1.00 0.00 ? 126 LYS A HD2  2  
ATOM 5368  H HD3  . LYS A 1 126 ? 6.679   6.632   -18.995 1.00 0.00 ? 126 LYS A HD3  2  
ATOM 5369  H HE2  . LYS A 1 126 ? 8.818   6.075   -19.969 1.00 0.00 ? 126 LYS A HE2  2  
ATOM 5370  H HE3  . LYS A 1 126 ? 7.782   6.820   -21.185 1.00 0.00 ? 126 LYS A HE3  2  
ATOM 5371  H HZ1  . LYS A 1 126 ? 9.391   8.729   -19.778 1.00 0.00 ? 126 LYS A HZ1  2  
ATOM 5372  H HZ2  . LYS A 1 126 ? 9.197   8.500   -21.442 1.00 0.00 ? 126 LYS A HZ2  2  
ATOM 5373  H HZ3  . LYS A 1 126 ? 10.323  7.572   -20.588 1.00 0.00 ? 126 LYS A HZ3  2  
ATOM 5374  N N    . PHE A 1 127 ? 3.989   10.813  -16.056 1.00 0.00 ? 127 PHE A N    2  
ATOM 5375  C CA   . PHE A 1 127 ? 2.732   11.204  -15.415 1.00 0.00 ? 127 PHE A CA   2  
ATOM 5376  C C    . PHE A 1 127 ? 1.977   12.123  -16.369 1.00 0.00 ? 127 PHE A C    2  
ATOM 5377  O O    . PHE A 1 127 ? 2.600   12.815  -17.177 1.00 0.00 ? 127 PHE A O    2  
ATOM 5378  C CB   . PHE A 1 127 ? 2.997   11.991  -14.131 1.00 0.00 ? 127 PHE A CB   2  
ATOM 5379  C CG   . PHE A 1 127 ? 3.331   11.173  -12.920 1.00 0.00 ? 127 PHE A CG   2  
ATOM 5380  C CD1  . PHE A 1 127 ? 2.348   10.474  -12.237 1.00 0.00 ? 127 PHE A CD1  2  
ATOM 5381  C CD2  . PHE A 1 127 ? 4.627   11.145  -12.438 1.00 0.00 ? 127 PHE A CD2  2  
ATOM 5382  C CE1  . PHE A 1 127 ? 2.659   9.756   -11.097 1.00 0.00 ? 127 PHE A CE1  2  
ATOM 5383  C CE2  . PHE A 1 127 ? 4.942   10.437  -11.295 1.00 0.00 ? 127 PHE A CE2  2  
ATOM 5384  C CZ   . PHE A 1 127 ? 3.958   9.741   -10.624 1.00 0.00 ? 127 PHE A CZ   2  
ATOM 5385  H H    . PHE A 1 127 ? 4.775   11.379  -15.913 1.00 0.00 ? 127 PHE A H    2  
ATOM 5386  H HA   . PHE A 1 127 ? 2.136   10.323  -15.201 1.00 0.00 ? 127 PHE A HA   2  
ATOM 5387  H HB2  . PHE A 1 127 ? 3.823   12.662  -14.303 1.00 0.00 ? 127 PHE A HB2  2  
ATOM 5388  H HB3  . PHE A 1 127 ? 2.118   12.576  -13.899 1.00 0.00 ? 127 PHE A HB3  2  
ATOM 5389  H HD1  . PHE A 1 127 ? 1.334   10.486  -12.607 1.00 0.00 ? 127 PHE A HD1  2  
ATOM 5390  H HD2  . PHE A 1 127 ? 5.396   11.686  -12.965 1.00 0.00 ? 127 PHE A HD2  2  
ATOM 5391  H HE1  . PHE A 1 127 ? 1.887   9.212   -10.573 1.00 0.00 ? 127 PHE A HE1  2  
ATOM 5392  H HE2  . PHE A 1 127 ? 5.959   10.424  -10.931 1.00 0.00 ? 127 PHE A HE2  2  
ATOM 5393  H HZ   . PHE A 1 127 ? 4.202   9.196   -9.725  1.00 0.00 ? 127 PHE A HZ   2  
ATOM 5394  N N    . PRO A 1 128 ? 0.637   12.170  -16.272 1.00 0.00 ? 128 PRO A N    2  
ATOM 5395  C CA   . PRO A 1 128 ? -0.209  13.020  -17.117 1.00 0.00 ? 128 PRO A CA   2  
ATOM 5396  C C    . PRO A 1 128 ? 0.420   14.381  -17.410 1.00 0.00 ? 128 PRO A C    2  
ATOM 5397  O O    . PRO A 1 128 ? 1.299   14.837  -16.682 1.00 0.00 ? 128 PRO A O    2  
ATOM 5398  C CB   . PRO A 1 128 ? -1.495  13.183  -16.287 1.00 0.00 ? 128 PRO A CB   2  
ATOM 5399  C CG   . PRO A 1 128 ? -1.262  12.420  -15.016 1.00 0.00 ? 128 PRO A CG   2  
ATOM 5400  C CD   . PRO A 1 128 ? -0.176  11.428  -15.315 1.00 0.00 ? 128 PRO A CD   2  
ATOM 5401  H HA   . PRO A 1 128 ? -0.445  12.532  -18.051 1.00 0.00 ? 128 PRO A HA   2  
ATOM 5402  H HB2  . PRO A 1 128 ? -1.666  14.230  -16.089 1.00 0.00 ? 128 PRO A HB2  2  
ATOM 5403  H HB3  . PRO A 1 128 ? -2.331  12.778  -16.838 1.00 0.00 ? 128 PRO A HB3  2  
ATOM 5404  H HG2  . PRO A 1 128 ? -0.943  13.098  -14.238 1.00 0.00 ? 128 PRO A HG2  2  
ATOM 5405  H HG3  . PRO A 1 128 ? -2.166  11.912  -14.722 1.00 0.00 ? 128 PRO A HG3  2  
ATOM 5406  H HD2  . PRO A 1 128 ? 0.386   11.194  -14.421 1.00 0.00 ? 128 PRO A HD2  2  
ATOM 5407  H HD3  . PRO A 1 128 ? -0.584  10.534  -15.761 1.00 0.00 ? 128 PRO A HD3  2  
ATOM 5408  N N    . SER A 1 129 ? -0.035  15.019  -18.485 1.00 0.00 ? 129 SER A N    2  
ATOM 5409  C CA   . SER A 1 129 ? 0.487   16.324  -18.886 1.00 0.00 ? 129 SER A CA   2  
ATOM 5410  C C    . SER A 1 129 ? -0.247  17.469  -18.190 1.00 0.00 ? 129 SER A C    2  
ATOM 5411  O O    . SER A 1 129 ? -0.379  18.560  -18.744 1.00 0.00 ? 129 SER A O    2  
ATOM 5412  C CB   . SER A 1 129 ? 0.375   16.490  -20.400 1.00 0.00 ? 129 SER A CB   2  
ATOM 5413  O OG   . SER A 1 129 ? 0.769   15.307  -21.075 1.00 0.00 ? 129 SER A OG   2  
ATOM 5414  H H    . SER A 1 129 ? -0.735  14.600  -19.028 1.00 0.00 ? 129 SER A H    2  
ATOM 5415  H HA   . SER A 1 129 ? 1.530   16.361  -18.609 1.00 0.00 ? 129 SER A HA   2  
ATOM 5416  H HB2  . SER A 1 129 ? -0.650  16.711  -20.657 1.00 0.00 ? 129 SER A HB2  2  
ATOM 5417  H HB3  . SER A 1 129 ? 1.011   17.302  -20.721 1.00 0.00 ? 129 SER A HB3  2  
ATOM 5418  H HG   . SER A 1 129 ? 0.046   14.995  -21.624 1.00 0.00 ? 129 SER A HG   2  
ATOM 5419  N N    . ILE A 1 130 ? -0.734  17.212  -16.983 1.00 0.00 ? 130 ILE A N    2  
ATOM 5420  C CA   . ILE A 1 130 ? -1.467  18.217  -16.221 1.00 0.00 ? 130 ILE A CA   2  
ATOM 5421  C C    . ILE A 1 130 ? -0.518  19.215  -15.573 1.00 0.00 ? 130 ILE A C    2  
ATOM 5422  O O    . ILE A 1 130 ? 0.610   18.877  -15.219 1.00 0.00 ? 130 ILE A O    2  
ATOM 5423  C CB   . ILE A 1 130 ? -2.320  17.556  -15.113 1.00 0.00 ? 130 ILE A CB   2  
ATOM 5424  C CG1  . ILE A 1 130 ? -2.988  18.619  -14.222 1.00 0.00 ? 130 ILE A CG1  2  
ATOM 5425  C CG2  . ILE A 1 130 ? -1.461  16.613  -14.281 1.00 0.00 ? 130 ILE A CG2  2  
ATOM 5426  C CD1  . ILE A 1 130 ? -2.161  19.042  -13.017 1.00 0.00 ? 130 ILE A CD1  2  
ATOM 5427  H H    . ILE A 1 130 ? -0.621  16.319  -16.605 1.00 0.00 ? 130 ILE A H    2  
ATOM 5428  H HA   . ILE A 1 130 ? -2.128  18.740  -16.897 1.00 0.00 ? 130 ILE A HA   2  
ATOM 5429  H HB   . ILE A 1 130 ? -3.088  16.967  -15.592 1.00 0.00 ? 130 ILE A HB   2  
ATOM 5430  H HG12 . ILE A 1 130 ? -3.183  19.501  -14.812 1.00 0.00 ? 130 ILE A HG12 2  
ATOM 5431  H HG13 . ILE A 1 130 ? -3.927  18.228  -13.856 1.00 0.00 ? 130 ILE A HG13 2  
ATOM 5432  H HG21 . ILE A 1 130 ? -1.994  16.338  -13.383 1.00 0.00 ? 130 ILE A HG21 2  
ATOM 5433  H HG22 . ILE A 1 130 ? -0.538  17.107  -14.015 1.00 0.00 ? 130 ILE A HG22 2  
ATOM 5434  H HG23 . ILE A 1 130 ? -1.240  15.725  -14.855 1.00 0.00 ? 130 ILE A HG23 2  
ATOM 5435  H HD11 . ILE A 1 130 ? -1.109  18.999  -13.261 1.00 0.00 ? 130 ILE A HD11 2  
ATOM 5436  H HD12 . ILE A 1 130 ? -2.363  18.378  -12.190 1.00 0.00 ? 130 ILE A HD12 2  
ATOM 5437  H HD13 . ILE A 1 130 ? -2.422  20.052  -12.737 1.00 0.00 ? 130 ILE A HD13 2  
ATOM 5438  N N    . VAL A 1 131 ? -0.997  20.441  -15.400 1.00 0.00 ? 131 VAL A N    2  
ATOM 5439  C CA   . VAL A 1 131 ? -0.206  21.484  -14.770 1.00 0.00 ? 131 VAL A CA   2  
ATOM 5440  C C    . VAL A 1 131 ? -0.535  21.553  -13.284 1.00 0.00 ? 131 VAL A C    2  
ATOM 5441  O O    . VAL A 1 131 ? -1.558  22.113  -12.889 1.00 0.00 ? 131 VAL A O    2  
ATOM 5442  C CB   . VAL A 1 131 ? -0.456  22.859  -15.423 1.00 0.00 ? 131 VAL A CB   2  
ATOM 5443  C CG1  . VAL A 1 131 ? -1.921  23.258  -15.300 1.00 0.00 ? 131 VAL A CG1  2  
ATOM 5444  C CG2  . VAL A 1 131 ? 0.450   23.918  -14.811 1.00 0.00 ? 131 VAL A CG2  2  
ATOM 5445  H H    . VAL A 1 131 ? -1.913  20.643  -15.684 1.00 0.00 ? 131 VAL A H    2  
ATOM 5446  H HA   . VAL A 1 131 ? 0.839   21.231  -14.888 1.00 0.00 ? 131 VAL A HA   2  
ATOM 5447  H HB   . VAL A 1 131 ? -0.219  22.781  -16.474 1.00 0.00 ? 131 VAL A HB   2  
ATOM 5448  H HG11 . VAL A 1 131 ? -2.017  24.059  -14.582 1.00 0.00 ? 131 VAL A HG11 2  
ATOM 5449  H HG12 . VAL A 1 131 ? -2.500  22.408  -14.971 1.00 0.00 ? 131 VAL A HG12 2  
ATOM 5450  H HG13 . VAL A 1 131 ? -2.285  23.591  -16.261 1.00 0.00 ? 131 VAL A HG13 2  
ATOM 5451  H HG21 . VAL A 1 131 ? 0.842   23.557  -13.872 1.00 0.00 ? 131 VAL A HG21 2  
ATOM 5452  H HG22 . VAL A 1 131 ? -0.115  24.822  -14.641 1.00 0.00 ? 131 VAL A HG22 2  
ATOM 5453  H HG23 . VAL A 1 131 ? 1.267   24.126  -15.486 1.00 0.00 ? 131 VAL A HG23 2  
ATOM 5454  N N    . GLU A 1 132 ? 0.322   20.944  -12.469 1.00 0.00 ? 132 GLU A N    2  
ATOM 5455  C CA   . GLU A 1 132 ? 0.121   20.892  -11.020 1.00 0.00 ? 132 GLU A CA   2  
ATOM 5456  C C    . GLU A 1 132 ? -0.397  22.214  -10.448 1.00 0.00 ? 132 GLU A C    2  
ATOM 5457  O O    . GLU A 1 132 ? -1.034  22.230  -9.395  1.00 0.00 ? 132 GLU A O    2  
ATOM 5458  C CB   . GLU A 1 132 ? 1.407   20.486  -10.318 1.00 0.00 ? 132 GLU A CB   2  
ATOM 5459  C CG   . GLU A 1 132 ? 1.890   19.100  -10.699 1.00 0.00 ? 132 GLU A CG   2  
ATOM 5460  C CD   . GLU A 1 132 ? 2.760   18.469  -9.630  1.00 0.00 ? 132 GLU A CD   2  
ATOM 5461  O OE1  . GLU A 1 132 ? 2.277   18.308  -8.489  1.00 0.00 ? 132 GLU A OE1  2  
ATOM 5462  O OE2  . GLU A 1 132 ? 3.925   18.134  -9.933  1.00 0.00 ? 132 GLU A OE2  2  
ATOM 5463  H H    . GLU A 1 132 ? 1.094   20.483  -12.860 1.00 0.00 ? 132 GLU A H    2  
ATOM 5464  H HA   . GLU A 1 132 ? -0.620  20.134  -10.837 1.00 0.00 ? 132 GLU A HA   2  
ATOM 5465  H HB2  . GLU A 1 132 ? 2.172   21.189  -10.571 1.00 0.00 ? 132 GLU A HB2  2  
ATOM 5466  H HB3  . GLU A 1 132 ? 1.243   20.510  -9.254  1.00 0.00 ? 132 GLU A HB3  2  
ATOM 5467  H HG2  . GLU A 1 132 ? 1.031   18.467  -10.864 1.00 0.00 ? 132 GLU A HG2  2  
ATOM 5468  H HG3  . GLU A 1 132 ? 2.462   19.174  -11.612 1.00 0.00 ? 132 GLU A HG3  2  
ATOM 5469  N N    . GLU A 1 133 ? -0.149  23.315  -11.156 1.00 0.00 ? 133 GLU A N    2  
ATOM 5470  C CA   . GLU A 1 133 ? -0.625  24.636  -10.725 1.00 0.00 ? 133 GLU A CA   2  
ATOM 5471  C C    . GLU A 1 133 ? -2.130  24.605  -10.408 1.00 0.00 ? 133 GLU A C    2  
ATOM 5472  O O    . GLU A 1 133 ? -2.671  25.535  -9.809  1.00 0.00 ? 133 GLU A O    2  
ATOM 5473  C CB   . GLU A 1 133 ? -0.338  25.680  -11.808 1.00 0.00 ? 133 GLU A CB   2  
ATOM 5474  C CG   . GLU A 1 133 ? 0.683   26.727  -11.388 1.00 0.00 ? 133 GLU A CG   2  
ATOM 5475  C CD   . GLU A 1 133 ? 0.060   28.091  -11.162 1.00 0.00 ? 133 GLU A CD   2  
ATOM 5476  O OE1  . GLU A 1 133 ? -0.715  28.236  -10.194 1.00 0.00 ? 133 GLU A OE1  2  
ATOM 5477  O OE2  . GLU A 1 133 ? 0.349   29.014  -11.953 1.00 0.00 ? 133 GLU A OE2  2  
ATOM 5478  H H    . GLU A 1 133 ? 0.349   23.236  -11.993 1.00 0.00 ? 133 GLU A H    2  
ATOM 5479  H HA   . GLU A 1 133 ? -0.087  24.904  -9.828  1.00 0.00 ? 133 GLU A HA   2  
ATOM 5480  H HB2  . GLU A 1 133 ? 0.037   25.176  -12.686 1.00 0.00 ? 133 GLU A HB2  2  
ATOM 5481  H HB3  . GLU A 1 133 ? -1.258  26.187  -12.060 1.00 0.00 ? 133 GLU A HB3  2  
ATOM 5482  H HG2  . GLU A 1 133 ? 1.152   26.406  -10.470 1.00 0.00 ? 133 GLU A HG2  2  
ATOM 5483  H HG3  . GLU A 1 133 ? 1.431   26.812  -12.163 1.00 0.00 ? 133 GLU A HG3  2  
ATOM 5484  N N    . GLU A 1 134 ? -2.777  23.503  -10.780 1.00 0.00 ? 134 GLU A N    2  
ATOM 5485  C CA   . GLU A 1 134 ? -4.195  23.295  -10.511 1.00 0.00 ? 134 GLU A CA   2  
ATOM 5486  C C    . GLU A 1 134 ? -4.360  22.113  -9.562  1.00 0.00 ? 134 GLU A C    2  
ATOM 5487  O O    . GLU A 1 134 ? -5.291  22.055  -8.758  1.00 0.00 ? 134 GLU A O    2  
ATOM 5488  C CB   . GLU A 1 134 ? -4.963  23.046  -11.811 1.00 0.00 ? 134 GLU A CB   2  
ATOM 5489  C CG   . GLU A 1 134 ? -6.399  23.543  -11.774 1.00 0.00 ? 134 GLU A CG   2  
ATOM 5490  C CD   . GLU A 1 134 ? -7.006  23.672  -13.157 1.00 0.00 ? 134 GLU A CD   2  
ATOM 5491  O OE1  . GLU A 1 134 ? -7.404  22.635  -13.729 1.00 0.00 ? 134 GLU A OE1  2  
ATOM 5492  O OE2  . GLU A 1 134 ? -7.083  24.809  -13.669 1.00 0.00 ? 134 GLU A OE2  2  
ATOM 5493  H H    . GLU A 1 134 ? -2.263  22.796  -11.208 1.00 0.00 ? 134 GLU A H    2  
ATOM 5494  H HA   . GLU A 1 134 ? -4.574  24.177  -10.033 1.00 0.00 ? 134 GLU A HA   2  
ATOM 5495  H HB2  . GLU A 1 134 ? -4.451  23.547  -12.619 1.00 0.00 ? 134 GLU A HB2  2  
ATOM 5496  H HB3  . GLU A 1 134 ? -4.978  21.984  -12.009 1.00 0.00 ? 134 GLU A HB3  2  
ATOM 5497  H HG2  . GLU A 1 134 ? -6.993  22.848  -11.200 1.00 0.00 ? 134 GLU A HG2  2  
ATOM 5498  H HG3  . GLU A 1 134 ? -6.418  24.512  -11.297 1.00 0.00 ? 134 GLU A HG3  2  
ATOM 5499  N N    . LEU A 1 135 ? -3.432  21.176  -9.683  1.00 0.00 ? 135 LEU A N    2  
ATOM 5500  C CA   . LEU A 1 135 ? -3.404  19.962  -8.876  1.00 0.00 ? 135 LEU A CA   2  
ATOM 5501  C C    . LEU A 1 135 ? -3.509  20.274  -7.384  1.00 0.00 ? 135 LEU A C    2  
ATOM 5502  O O    . LEU A 1 135 ? -2.731  21.061  -6.844  1.00 0.00 ? 135 LEU A O    2  
ATOM 5503  C CB   . LEU A 1 135 ? -2.099  19.214  -9.169  1.00 0.00 ? 135 LEU A CB   2  
ATOM 5504  C CG   . LEU A 1 135 ? -1.775  18.034  -8.257  1.00 0.00 ? 135 LEU A CG   2  
ATOM 5505  C CD1  . LEU A 1 135 ? -1.057  16.946  -9.041  1.00 0.00 ? 135 LEU A CD1  2  
ATOM 5506  C CD2  . LEU A 1 135 ? -0.920  18.493  -7.085  1.00 0.00 ? 135 LEU A CD2  2  
ATOM 5507  H H    . LEU A 1 135 ? -2.742  21.299  -10.360 1.00 0.00 ? 135 LEU A H    2  
ATOM 5508  H HA   . LEU A 1 135 ? -4.238  19.343  -9.168  1.00 0.00 ? 135 LEU A HA   2  
ATOM 5509  H HB2  . LEU A 1 135 ? -2.142  18.852  -10.185 1.00 0.00 ? 135 LEU A HB2  2  
ATOM 5510  H HB3  . LEU A 1 135 ? -1.287  19.924  -9.095  1.00 0.00 ? 135 LEU A HB3  2  
ATOM 5511  H HG   . LEU A 1 135 ? -2.693  17.620  -7.868  1.00 0.00 ? 135 LEU A HG   2  
ATOM 5512  H HD11 . LEU A 1 135 ? -1.701  16.586  -9.830  1.00 0.00 ? 135 LEU A HD11 2  
ATOM 5513  H HD12 . LEU A 1 135 ? -0.808  16.128  -8.380  1.00 0.00 ? 135 LEU A HD12 2  
ATOM 5514  H HD13 . LEU A 1 135 ? -0.151  17.353  -9.472  1.00 0.00 ? 135 LEU A HD13 2  
ATOM 5515  H HD21 . LEU A 1 135 ? -0.577  17.633  -6.530  1.00 0.00 ? 135 LEU A HD21 2  
ATOM 5516  H HD22 . LEU A 1 135 ? -1.504  19.130  -6.439  1.00 0.00 ? 135 LEU A HD22 2  
ATOM 5517  H HD23 . LEU A 1 135 ? -0.067  19.044  -7.458  1.00 0.00 ? 135 LEU A HD23 2  
ATOM 5518  N N    . GLN A 1 136 ? -4.476  19.642  -6.725  1.00 0.00 ? 136 GLN A N    2  
ATOM 5519  C CA   . GLN A 1 136 ? -4.693  19.833  -5.294  1.00 0.00 ? 136 GLN A CA   2  
ATOM 5520  C C    . GLN A 1 136 ? -4.121  18.666  -4.494  1.00 0.00 ? 136 GLN A C    2  
ATOM 5521  O O    . GLN A 1 136 ? -4.419  18.500  -3.311  1.00 0.00 ? 136 GLN A O    2  
ATOM 5522  C CB   . GLN A 1 136 ? -6.184  19.964  -5.007  1.00 0.00 ? 136 GLN A CB   2  
ATOM 5523  C CG   . GLN A 1 136 ? -6.502  20.920  -3.872  1.00 0.00 ? 136 GLN A CG   2  
ATOM 5524  C CD   . GLN A 1 136 ? -7.937  21.408  -3.904  1.00 0.00 ? 136 GLN A CD   2  
ATOM 5525  O OE1  . GLN A 1 136 ? -8.209  22.547  -4.283  1.00 0.00 ? 136 GLN A OE1  2  
ATOM 5526  N NE2  . GLN A 1 136 ? -8.865  20.546  -3.505  1.00 0.00 ? 136 GLN A NE2  2  
ATOM 5527  H H    . GLN A 1 136 ? -5.058  19.024  -7.215  1.00 0.00 ? 136 GLN A H    2  
ATOM 5528  H HA   . GLN A 1 136 ? -4.194  20.743  -4.997  1.00 0.00 ? 136 GLN A HA   2  
ATOM 5529  H HB2  . GLN A 1 136 ? -6.677  20.316  -5.900  1.00 0.00 ? 136 GLN A HB2  2  
ATOM 5530  H HB3  . GLN A 1 136 ? -6.573  18.990  -4.752  1.00 0.00 ? 136 GLN A HB3  2  
ATOM 5531  H HG2  . GLN A 1 136 ? -6.331  20.413  -2.934  1.00 0.00 ? 136 GLN A HG2  2  
ATOM 5532  H HG3  . GLN A 1 136 ? -5.844  21.774  -3.943  1.00 0.00 ? 136 GLN A HG3  2  
ATOM 5533  H HE21 . GLN A 1 136 ? -8.576  19.655  -3.216  1.00 0.00 ? 136 GLN A HE21 2  
ATOM 5534  H HE22 . GLN A 1 136 ? -9.801  20.836  -3.516  1.00 0.00 ? 136 GLN A HE22 2  
ATOM 5535  N N    . PHE A 1 137 ? -3.300  17.864  -5.154  1.00 0.00 ? 137 PHE A N    2  
ATOM 5536  C CA   . PHE A 1 137 ? -2.673  16.706  -4.528  1.00 0.00 ? 137 PHE A CA   2  
ATOM 5537  C C    . PHE A 1 137 ? -1.631  17.137  -3.502  1.00 0.00 ? 137 PHE A C    2  
ATOM 5538  O O    . PHE A 1 137 ? -1.244  18.304  -3.436  1.00 0.00 ? 137 PHE A O    2  
ATOM 5539  C CB   . PHE A 1 137 ? -2.000  15.825  -5.591  1.00 0.00 ? 137 PHE A CB   2  
ATOM 5540  C CG   . PHE A 1 137 ? -2.517  14.418  -5.668  1.00 0.00 ? 137 PHE A CG   2  
ATOM 5541  C CD1  . PHE A 1 137 ? -2.985  13.761  -4.540  1.00 0.00 ? 137 PHE A CD1  2  
ATOM 5542  C CD2  . PHE A 1 137 ? -2.511  13.744  -6.876  1.00 0.00 ? 137 PHE A CD2  2  
ATOM 5543  C CE1  . PHE A 1 137 ? -3.439  12.460  -4.621  1.00 0.00 ? 137 PHE A CE1  2  
ATOM 5544  C CE2  . PHE A 1 137 ? -2.959  12.443  -6.963  1.00 0.00 ? 137 PHE A CE2  2  
ATOM 5545  C CZ   . PHE A 1 137 ? -3.425  11.799  -5.834  1.00 0.00 ? 137 PHE A CZ   2  
ATOM 5546  H H    . PHE A 1 137 ? -3.110  18.059  -6.090  1.00 0.00 ? 137 PHE A H    2  
ATOM 5547  H HA   . PHE A 1 137 ? -3.443  16.136  -4.031  1.00 0.00 ? 137 PHE A HA   2  
ATOM 5548  H HB2  . PHE A 1 137 ? -2.141  16.276  -6.560  1.00 0.00 ? 137 PHE A HB2  2  
ATOM 5549  H HB3  . PHE A 1 137 ? -0.940  15.767  -5.382  1.00 0.00 ? 137 PHE A HB3  2  
ATOM 5550  H HD1  . PHE A 1 137 ? -2.996  14.277  -3.591  1.00 0.00 ? 137 PHE A HD1  2  
ATOM 5551  H HD2  . PHE A 1 137 ? -2.148  14.246  -7.761  1.00 0.00 ? 137 PHE A HD2  2  
ATOM 5552  H HE1  . PHE A 1 137 ? -3.803  11.958  -3.736  1.00 0.00 ? 137 PHE A HE1  2  
ATOM 5553  H HE2  . PHE A 1 137 ? -2.948  11.932  -7.913  1.00 0.00 ? 137 PHE A HE2  2  
ATOM 5554  H HZ   . PHE A 1 137 ? -3.773  10.780  -5.899  1.00 0.00 ? 137 PHE A HZ   2  
ATOM 5555  N N    . ASP A 1 138 ? -1.170  16.171  -2.723  1.00 0.00 ? 138 ASP A N    2  
ATOM 5556  C CA   . ASP A 1 138 ? -0.155  16.403  -1.707  1.00 0.00 ? 138 ASP A CA   2  
ATOM 5557  C C    . ASP A 1 138 ? 0.664   15.134  -1.525  1.00 0.00 ? 138 ASP A C    2  
ATOM 5558  O O    . ASP A 1 138 ? 1.118   14.818  -0.425  1.00 0.00 ? 138 ASP A O    2  
ATOM 5559  C CB   . ASP A 1 138 ? -0.801  16.811  -0.382  1.00 0.00 ? 138 ASP A CB   2  
ATOM 5560  C CG   . ASP A 1 138 ? 0.198   17.412  0.587   1.00 0.00 ? 138 ASP A CG   2  
ATOM 5561  O OD1  . ASP A 1 138 ? 0.494   18.619  0.462   1.00 0.00 ? 138 ASP A OD1  2  
ATOM 5562  O OD2  . ASP A 1 138 ? 0.684   16.677  1.472   1.00 0.00 ? 138 ASP A OD2  2  
ATOM 5563  H H    . ASP A 1 138 ? -1.514  15.262  -2.846  1.00 0.00 ? 138 ASP A H    2  
ATOM 5564  H HA   . ASP A 1 138 ? 0.493   17.196  -2.051  1.00 0.00 ? 138 ASP A HA   2  
ATOM 5565  H HB2  . ASP A 1 138 ? -1.572  17.541  -0.574  1.00 0.00 ? 138 ASP A HB2  2  
ATOM 5566  H HB3  . ASP A 1 138 ? -1.242  15.939  0.079   1.00 0.00 ? 138 ASP A HB3  2  
ATOM 5567  N N    . LEU A 1 139 ? 0.822   14.399  -2.622  1.00 0.00 ? 139 LEU A N    2  
ATOM 5568  C CA   . LEU A 1 139 ? 1.555   13.144  -2.613  1.00 0.00 ? 139 LEU A CA   2  
ATOM 5569  C C    . LEU A 1 139 ? 2.848   13.244  -3.407  1.00 0.00 ? 139 LEU A C    2  
ATOM 5570  O O    . LEU A 1 139 ? 2.981   14.082  -4.298  1.00 0.00 ? 139 LEU A O    2  
ATOM 5571  C CB   . LEU A 1 139 ? 0.664   12.031  -3.189  1.00 0.00 ? 139 LEU A CB   2  
ATOM 5572  C CG   . LEU A 1 139 ? 0.963   11.580  -4.627  1.00 0.00 ? 139 LEU A CG   2  
ATOM 5573  C CD1  . LEU A 1 139 ? -0.092  10.596  -5.083  1.00 0.00 ? 139 LEU A CD1  2  
ATOM 5574  C CD2  . LEU A 1 139 ? 1.007   12.763  -5.584  1.00 0.00 ? 139 LEU A CD2  2  
ATOM 5575  H H    . LEU A 1 139 ? 0.418   14.704  -3.460  1.00 0.00 ? 139 LEU A H    2  
ATOM 5576  H HA   . LEU A 1 139 ? 1.792   12.904  -1.588  1.00 0.00 ? 139 LEU A HA   2  
ATOM 5577  H HB2  . LEU A 1 139 ? 0.746   11.169  -2.546  1.00 0.00 ? 139 LEU A HB2  2  
ATOM 5578  H HB3  . LEU A 1 139 ? -0.355  12.376  -3.163  1.00 0.00 ? 139 LEU A HB3  2  
ATOM 5579  H HG   . LEU A 1 139 ? 1.923   11.084  -4.654  1.00 0.00 ? 139 LEU A HG   2  
ATOM 5580  H HD11 . LEU A 1 139 ? -1.037  11.112  -5.183  1.00 0.00 ? 139 LEU A HD11 2  
ATOM 5581  H HD12 . LEU A 1 139 ? -0.185  9.806   -4.354  1.00 0.00 ? 139 LEU A HD12 2  
ATOM 5582  H HD13 . LEU A 1 139 ? 0.193   10.181  -6.036  1.00 0.00 ? 139 LEU A HD13 2  
ATOM 5583  H HD21 . LEU A 1 139 ? 0.466   12.514  -6.487  1.00 0.00 ? 139 LEU A HD21 2  
ATOM 5584  H HD22 . LEU A 1 139 ? 2.031   12.987  -5.833  1.00 0.00 ? 139 LEU A HD22 2  
ATOM 5585  H HD23 . LEU A 1 139 ? 0.552   13.623  -5.118  1.00 0.00 ? 139 LEU A HD23 2  
ATOM 5586  N N    . SER A 1 140 ? 3.793   12.375  -3.084  1.00 0.00 ? 140 SER A N    2  
ATOM 5587  C CA   . SER A 1 140 ? 5.065   12.353  -3.782  1.00 0.00 ? 140 SER A CA   2  
ATOM 5588  C C    . SER A 1 140 ? 5.194   11.069  -4.581  1.00 0.00 ? 140 SER A C    2  
ATOM 5589  O O    . SER A 1 140 ? 4.298   10.224  -4.571  1.00 0.00 ? 140 SER A O    2  
ATOM 5590  C CB   . SER A 1 140 ? 6.238   12.453  -2.804  1.00 0.00 ? 140 SER A CB   2  
ATOM 5591  O OG   . SER A 1 140 ? 6.328   13.750  -2.240  1.00 0.00 ? 140 SER A OG   2  
ATOM 5592  H H    . SER A 1 140 ? 3.634   11.732  -2.362  1.00 0.00 ? 140 SER A H    2  
ATOM 5593  H HA   . SER A 1 140 ? 5.090   13.195  -4.453  1.00 0.00 ? 140 SER A HA   2  
ATOM 5594  H HB2  . SER A 1 140 ? 6.101   11.735  -2.008  1.00 0.00 ? 140 SER A HB2  2  
ATOM 5595  H HB3  . SER A 1 140 ? 7.160   12.233  -3.331  1.00 0.00 ? 140 SER A HB3  2  
ATOM 5596  H HG   . SER A 1 140 ? 6.424   13.679  -1.288  1.00 0.00 ? 140 SER A HG   2  
ATOM 5597  N N    . LEU A 1 141 ? 6.328   10.911  -5.238  1.00 0.00 ? 141 LEU A N    2  
ATOM 5598  C CA   . LEU A 1 141 ? 6.598   9.714   -6.007  1.00 0.00 ? 141 LEU A CA   2  
ATOM 5599  C C    . LEU A 1 141 ? 7.882   9.092   -5.504  1.00 0.00 ? 141 LEU A C    2  
ATOM 5600  O O    . LEU A 1 141 ? 8.797   9.789   -5.065  1.00 0.00 ? 141 LEU A O    2  
ATOM 5601  C CB   . LEU A 1 141 ? 6.684   10.006  -7.511  1.00 0.00 ? 141 LEU A CB   2  
ATOM 5602  C CG   . LEU A 1 141 ? 6.475   8.793   -8.428  1.00 0.00 ? 141 LEU A CG   2  
ATOM 5603  C CD1  . LEU A 1 141 ? 7.748   7.963   -8.518  1.00 0.00 ? 141 LEU A CD1  2  
ATOM 5604  C CD2  . LEU A 1 141 ? 5.311   7.938   -7.941  1.00 0.00 ? 141 LEU A CD2  2  
ATOM 5605  H H    . LEU A 1 141 ? 7.015   11.604  -5.178  1.00 0.00 ? 141 LEU A H    2  
ATOM 5606  H HA   . LEU A 1 141 ? 5.788   9.022   -5.827  1.00 0.00 ? 141 LEU A HA   2  
ATOM 5607  H HB2  . LEU A 1 141 ? 5.938   10.747  -7.755  1.00 0.00 ? 141 LEU A HB2  2  
ATOM 5608  H HB3  . LEU A 1 141 ? 7.658   10.419  -7.722  1.00 0.00 ? 141 LEU A HB3  2  
ATOM 5609  H HG   . LEU A 1 141 ? 6.238   9.144   -9.423  1.00 0.00 ? 141 LEU A HG   2  
ATOM 5610  H HD11 . LEU A 1 141 ? 7.515   6.923   -8.342  1.00 0.00 ? 141 LEU A HD11 2  
ATOM 5611  H HD12 . LEU A 1 141 ? 8.455   8.303   -7.776  1.00 0.00 ? 141 LEU A HD12 2  
ATOM 5612  H HD13 . LEU A 1 141 ? 8.180   8.073   -9.502  1.00 0.00 ? 141 LEU A HD13 2  
ATOM 5613  H HD21 . LEU A 1 141 ? 4.604   8.560   -7.412  1.00 0.00 ? 141 LEU A HD21 2  
ATOM 5614  H HD22 . LEU A 1 141 ? 5.681   7.170   -7.279  1.00 0.00 ? 141 LEU A HD22 2  
ATOM 5615  H HD23 . LEU A 1 141 ? 4.823   7.479   -8.788  1.00 0.00 ? 141 LEU A HD23 2  
ATOM 5616  N N    . VAL A 1 142 ? 7.936   7.781   -5.551  1.00 0.00 ? 142 VAL A N    2  
ATOM 5617  C CA   . VAL A 1 142 ? 9.100   7.054   -5.080  1.00 0.00 ? 142 VAL A CA   2  
ATOM 5618  C C    . VAL A 1 142 ? 9.726   6.226   -6.191  1.00 0.00 ? 142 VAL A C    2  
ATOM 5619  O O    . VAL A 1 142 ? 9.165   5.219   -6.630  1.00 0.00 ? 142 VAL A O    2  
ATOM 5620  C CB   . VAL A 1 142 ? 8.758   6.131   -3.893  1.00 0.00 ? 142 VAL A CB   2  
ATOM 5621  C CG1  . VAL A 1 142 ? 10.018  5.495   -3.322  1.00 0.00 ? 142 VAL A CG1  2  
ATOM 5622  C CG2  . VAL A 1 142 ? 8.012   6.905   -2.817  1.00 0.00 ? 142 VAL A CG2  2  
ATOM 5623  H H    . VAL A 1 142 ? 7.172   7.295   -5.906  1.00 0.00 ? 142 VAL A H    2  
ATOM 5624  H HA   . VAL A 1 142 ? 9.819   7.785   -4.738  1.00 0.00 ? 142 VAL A HA   2  
ATOM 5625  H HB   . VAL A 1 142 ? 8.116   5.342   -4.250  1.00 0.00 ? 142 VAL A HB   2  
ATOM 5626  H HG11 . VAL A 1 142 ? 9.784   5.016   -2.384  1.00 0.00 ? 142 VAL A HG11 2  
ATOM 5627  H HG12 . VAL A 1 142 ? 10.764  6.256   -3.156  1.00 0.00 ? 142 VAL A HG12 2  
ATOM 5628  H HG13 . VAL A 1 142 ? 10.400  4.758   -4.017  1.00 0.00 ? 142 VAL A HG13 2  
ATOM 5629  H HG21 . VAL A 1 142 ? 7.360   7.630   -3.281  1.00 0.00 ? 142 VAL A HG21 2  
ATOM 5630  H HG22 . VAL A 1 142 ? 8.723   7.414   -2.182  1.00 0.00 ? 142 VAL A HG22 2  
ATOM 5631  H HG23 . VAL A 1 142 ? 7.425   6.220   -2.223  1.00 0.00 ? 142 VAL A HG23 2  
ATOM 5632  N N    . ILE A 1 143 ? 10.899  6.654   -6.626  1.00 0.00 ? 143 ILE A N    2  
ATOM 5633  C CA   . ILE A 1 143 ? 11.634  5.963   -7.672  1.00 0.00 ? 143 ILE A CA   2  
ATOM 5634  C C    . ILE A 1 143 ? 12.520  4.889   -7.048  1.00 0.00 ? 143 ILE A C    2  
ATOM 5635  O O    . ILE A 1 143 ? 13.567  5.195   -6.484  1.00 0.00 ? 143 ILE A O    2  
ATOM 5636  C CB   . ILE A 1 143 ? 12.536  6.925   -8.493  1.00 0.00 ? 143 ILE A CB   2  
ATOM 5637  C CG1  . ILE A 1 143 ? 12.290  8.408   -8.139  1.00 0.00 ? 143 ILE A CG1  2  
ATOM 5638  C CG2  . ILE A 1 143 ? 12.345  6.687   -9.978  1.00 0.00 ? 143 ILE A CG2  2  
ATOM 5639  C CD1  . ILE A 1 143 ? 10.840  8.852   -8.204  1.00 0.00 ? 143 ILE A CD1  2  
ATOM 5640  H H    . ILE A 1 143 ? 11.289  7.456   -6.219  1.00 0.00 ? 143 ILE A H    2  
ATOM 5641  H HA   . ILE A 1 143 ? 10.916  5.497   -8.341  1.00 0.00 ? 143 ILE A HA   2  
ATOM 5642  H HB   . ILE A 1 143 ? 13.564  6.684   -8.261  1.00 0.00 ? 143 ILE A HB   2  
ATOM 5643  H HG12 . ILE A 1 143 ? 12.645  8.589   -7.140  1.00 0.00 ? 143 ILE A HG12 2  
ATOM 5644  H HG13 . ILE A 1 143 ? 12.850  9.029   -8.821  1.00 0.00 ? 143 ILE A HG13 2  
ATOM 5645  H HG21 . ILE A 1 143 ? 12.526  5.643   -10.201 1.00 0.00 ? 143 ILE A HG21 2  
ATOM 5646  H HG22 . ILE A 1 143 ? 13.043  7.300   -10.528 1.00 0.00 ? 143 ILE A HG22 2  
ATOM 5647  H HG23 . ILE A 1 143 ? 11.336  6.947   -10.258 1.00 0.00 ? 143 ILE A HG23 2  
ATOM 5648  H HD11 . ILE A 1 143 ? 10.407  8.827   -7.212  1.00 0.00 ? 143 ILE A HD11 2  
ATOM 5649  H HD12 . ILE A 1 143 ? 10.287  8.193   -8.856  1.00 0.00 ? 143 ILE A HD12 2  
ATOM 5650  H HD13 . ILE A 1 143 ? 10.793  9.863   -8.585  1.00 0.00 ? 143 ILE A HD13 2  
ATOM 5651  N N    . GLU A 1 144 ? 12.110  3.633   -7.143  1.00 0.00 ? 144 GLU A N    2  
ATOM 5652  C CA   . GLU A 1 144 ? 12.901  2.552   -6.566  1.00 0.00 ? 144 GLU A CA   2  
ATOM 5653  C C    . GLU A 1 144 ? 13.942  2.052   -7.561  1.00 0.00 ? 144 GLU A C    2  
ATOM 5654  O O    . GLU A 1 144 ? 13.702  2.035   -8.766  1.00 0.00 ? 144 GLU A O    2  
ATOM 5655  C CB   . GLU A 1 144 ? 11.991  1.419   -6.092  1.00 0.00 ? 144 GLU A CB   2  
ATOM 5656  C CG   . GLU A 1 144 ? 12.053  1.177   -4.592  1.00 0.00 ? 144 GLU A CG   2  
ATOM 5657  C CD   . GLU A 1 144 ? 13.413  0.687   -4.133  1.00 0.00 ? 144 GLU A CD   2  
ATOM 5658  O OE1  . GLU A 1 144 ? 14.252  0.362   -4.999  1.00 0.00 ? 144 GLU A OE1  2  
ATOM 5659  O OE2  . GLU A 1 144 ? 13.638  0.627   -2.906  1.00 0.00 ? 144 GLU A OE2  2  
ATOM 5660  H H    . GLU A 1 144 ? 11.268  3.429   -7.608  1.00 0.00 ? 144 GLU A H    2  
ATOM 5661  H HA   . GLU A 1 144 ? 13.424  2.953   -5.714  1.00 0.00 ? 144 GLU A HA   2  
ATOM 5662  H HB2  . GLU A 1 144 ? 10.971  1.657   -6.355  1.00 0.00 ? 144 GLU A HB2  2  
ATOM 5663  H HB3  . GLU A 1 144 ? 12.277  0.516   -6.587  1.00 0.00 ? 144 GLU A HB3  2  
ATOM 5664  H HG2  . GLU A 1 144 ? 11.829  2.101   -4.081  1.00 0.00 ? 144 GLU A HG2  2  
ATOM 5665  H HG3  . GLU A 1 144 ? 11.314  0.434   -4.331  1.00 0.00 ? 144 GLU A HG3  2  
ATOM 5666  N N    . GLU A 1 145 ? 15.112  1.676   -7.046  1.00 0.00 ? 145 GLU A N    2  
ATOM 5667  C CA   . GLU A 1 145 ? 16.211  1.207   -7.886  1.00 0.00 ? 145 GLU A CA   2  
ATOM 5668  C C    . GLU A 1 145 ? 16.751  -0.144  -7.412  1.00 0.00 ? 145 GLU A C    2  
ATOM 5669  O O    . GLU A 1 145 ? 17.292  -0.255  -6.312  1.00 0.00 ? 145 GLU A O    2  
ATOM 5670  C CB   . GLU A 1 145 ? 17.338  2.244   -7.883  1.00 0.00 ? 145 GLU A CB   2  
ATOM 5671  C CG   . GLU A 1 145 ? 18.208  2.206   -9.124  1.00 0.00 ? 145 GLU A CG   2  
ATOM 5672  C CD   . GLU A 1 145 ? 19.305  1.167   -9.028  1.00 0.00 ? 145 GLU A CD   2  
ATOM 5673  O OE1  . GLU A 1 145 ? 19.301  0.389   -8.050  1.00 0.00 ? 145 GLU A OE1  2  
ATOM 5674  O OE2  . GLU A 1 145 ? 20.170  1.132   -9.927  1.00 0.00 ? 145 GLU A OE2  2  
ATOM 5675  H H    . GLU A 1 145 ? 15.246  1.735   -6.079  1.00 0.00 ? 145 GLU A H    2  
ATOM 5676  H HA   . GLU A 1 145 ? 15.838  1.103   -8.892  1.00 0.00 ? 145 GLU A HA   2  
ATOM 5677  H HB2  . GLU A 1 145 ? 16.906  3.230   -7.802  1.00 0.00 ? 145 GLU A HB2  2  
ATOM 5678  H HB3  . GLU A 1 145 ? 17.971  2.068   -7.027  1.00 0.00 ? 145 GLU A HB3  2  
ATOM 5679  H HG2  . GLU A 1 145 ? 17.588  1.980   -9.978  1.00 0.00 ? 145 GLU A HG2  2  
ATOM 5680  H HG3  . GLU A 1 145 ? 18.664  3.176   -9.256  1.00 0.00 ? 145 GLU A HG3  2  
ATOM 5681  N N    . GLN A 1 146 ? 16.600  -1.166  -8.252  1.00 0.00 ? 146 GLN A N    2  
ATOM 5682  C CA   . GLN A 1 146 ? 17.074  -2.512  -7.924  1.00 0.00 ? 146 GLN A CA   2  
ATOM 5683  C C    . GLN A 1 146 ? 18.184  -2.953  -8.875  1.00 0.00 ? 146 GLN A C    2  
ATOM 5684  O O    . GLN A 1 146 ? 17.975  -3.816  -9.726  1.00 0.00 ? 146 GLN A O    2  
ATOM 5685  C CB   . GLN A 1 146 ? 15.913  -3.494  -7.993  1.00 0.00 ? 146 GLN A CB   2  
ATOM 5686  C CG   . GLN A 1 146 ? 16.167  -4.801  -7.262  1.00 0.00 ? 146 GLN A CG   2  
ATOM 5687  C CD   . GLN A 1 146 ? 14.930  -5.329  -6.562  1.00 0.00 ? 146 GLN A CD   2  
ATOM 5688  O OE1  . GLN A 1 146 ? 14.557  -6.491  -6.727  1.00 0.00 ? 146 GLN A OE1  2  
ATOM 5689  N NE2  . GLN A 1 146 ? 14.284  -4.477  -5.774  1.00 0.00 ? 146 GLN A NE2  2  
ATOM 5690  H H    . GLN A 1 146 ? 16.153  -1.009  -9.112  1.00 0.00 ? 146 GLN A H    2  
ATOM 5691  H HA   . GLN A 1 146 ? 17.458  -2.493  -6.918  1.00 0.00 ? 146 GLN A HA   2  
ATOM 5692  H HB2  . GLN A 1 146 ? 15.052  -3.024  -7.560  1.00 0.00 ? 146 GLN A HB2  2  
ATOM 5693  H HB3  . GLN A 1 146 ? 15.707  -3.719  -9.029  1.00 0.00 ? 146 GLN A HB3  2  
ATOM 5694  H HG2  . GLN A 1 146 ? 16.498  -5.539  -7.977  1.00 0.00 ? 146 GLN A HG2  2  
ATOM 5695  H HG3  . GLN A 1 146 ? 16.940  -4.642  -6.525  1.00 0.00 ? 146 GLN A HG3  2  
ATOM 5696  H HE21 . GLN A 1 146 ? 14.638  -3.567  -5.689  1.00 0.00 ? 146 GLN A HE21 2  
ATOM 5697  H HE22 . GLN A 1 146 ? 13.481  -4.792  -5.310  1.00 0.00 ? 146 GLN A HE22 2  
ATOM 5698  N N    . SER A 1 147 ? 19.351  -2.328  -8.745  1.00 0.00 ? 147 SER A N    2  
ATOM 5699  C CA   . SER A 1 147 ? 20.491  -2.617  -9.628  1.00 0.00 ? 147 SER A CA   2  
ATOM 5700  C C    . SER A 1 147 ? 21.371  -3.756  -9.131  1.00 0.00 ? 147 SER A C    2  
ATOM 5701  O O    . SER A 1 147 ? 21.754  -3.807  -7.972  1.00 0.00 ? 147 SER A O    2  
ATOM 5702  C CB   . SER A 1 147 ? 21.372  -1.374  -9.796  1.00 0.00 ? 147 SER A CB   2  
ATOM 5703  O OG   . SER A 1 147 ? 21.377  -0.584  -8.622  1.00 0.00 ? 147 SER A OG   2  
ATOM 5704  H H    . SER A 1 147 ? 19.433  -1.622  -8.073  1.00 0.00 ? 147 SER A H    2  
ATOM 5705  H HA   . SER A 1 147 ? 20.100  -2.887  -10.591 1.00 0.00 ? 147 SER A HA   2  
ATOM 5706  H HB2  . SER A 1 147 ? 22.381  -1.686  -10.001 1.00 0.00 ? 147 SER A HB2  2  
ATOM 5707  H HB3  . SER A 1 147 ? 21.011  -0.776  -10.623 1.00 0.00 ? 147 SER A HB3  2  
ATOM 5708  H HG   . SER A 1 147 ? 22.192  -0.078  -8.579  1.00 0.00 ? 147 SER A HG   2  
ATOM 5709  N N    . GLU A 1 148 ? 21.713  -4.642  -10.061 1.00 0.00 ? 148 GLU A N    2  
ATOM 5710  C CA   . GLU A 1 148 ? 22.585  -5.789  -9.806  1.00 0.00 ? 148 GLU A CA   2  
ATOM 5711  C C    . GLU A 1 148 ? 22.455  -6.367  -8.388  1.00 0.00 ? 148 GLU A C    2  
ATOM 5712  O O    . GLU A 1 148 ? 23.458  -6.689  -7.752  1.00 0.00 ? 148 GLU A O    2  
ATOM 5713  C CB   . GLU A 1 148 ? 24.044  -5.407  -10.099 1.00 0.00 ? 148 GLU A CB   2  
ATOM 5714  C CG   . GLU A 1 148 ? 24.600  -4.321  -9.192  1.00 0.00 ? 148 GLU A CG   2  
ATOM 5715  C CD   . GLU A 1 148 ? 25.480  -4.874  -8.088  1.00 0.00 ? 148 GLU A CD   2  
ATOM 5716  O OE1  . GLU A 1 148 ? 26.637  -5.243  -8.380  1.00 0.00 ? 148 GLU A OE1  2  
ATOM 5717  O OE2  . GLU A 1 148 ? 25.013  -4.936  -6.931  1.00 0.00 ? 148 GLU A OE2  2  
ATOM 5718  H H    . GLU A 1 148 ? 21.386  -4.503  -10.974 1.00 0.00 ? 148 GLU A H    2  
ATOM 5719  H HA   . GLU A 1 148 ? 22.299  -6.561  -10.503 1.00 0.00 ? 148 GLU A HA   2  
ATOM 5720  H HB2  . GLU A 1 148 ? 24.662  -6.284  -9.987  1.00 0.00 ? 148 GLU A HB2  2  
ATOM 5721  H HB3  . GLU A 1 148 ? 24.113  -5.057  -11.123 1.00 0.00 ? 148 GLU A HB3  2  
ATOM 5722  H HG2  . GLU A 1 148 ? 25.188  -3.640  -9.790  1.00 0.00 ? 148 GLU A HG2  2  
ATOM 5723  H HG3  . GLU A 1 148 ? 23.779  -3.785  -8.744  1.00 0.00 ? 148 GLU A HG3  2  
ATOM 5724  N N    . GLY A 1 149 ? 21.219  -6.545  -7.917  1.00 0.00 ? 149 GLY A N    2  
ATOM 5725  C CA   . GLY A 1 149 ? 21.004  -7.140  -6.602  1.00 0.00 ? 149 GLY A CA   2  
ATOM 5726  C C    . GLY A 1 149 ? 20.819  -6.144  -5.466  1.00 0.00 ? 149 GLY A C    2  
ATOM 5727  O O    . GLY A 1 149 ? 20.476  -6.537  -4.351  1.00 0.00 ? 149 GLY A O    2  
ATOM 5728  H H    . GLY A 1 149 ? 20.451  -6.307  -8.478  1.00 0.00 ? 149 GLY A H    2  
ATOM 5729  H HA2  . GLY A 1 149 ? 20.125  -7.763  -6.650  1.00 0.00 ? 149 GLY A HA2  2  
ATOM 5730  H HA3  . GLY A 1 149 ? 21.853  -7.769  -6.371  1.00 0.00 ? 149 GLY A HA3  2  
ATOM 5731  N N    . ILE A 1 150 ? 21.043  -4.864  -5.729  1.00 0.00 ? 150 ILE A N    2  
ATOM 5732  C CA   . ILE A 1 150 ? 20.892  -3.842  -4.698  1.00 0.00 ? 150 ILE A CA   2  
ATOM 5733  C C    . ILE A 1 150 ? 19.604  -3.048  -4.892  1.00 0.00 ? 150 ILE A C    2  
ATOM 5734  O O    . ILE A 1 150 ? 19.301  -2.600  -5.995  1.00 0.00 ? 150 ILE A O    2  
ATOM 5735  C CB   . ILE A 1 150 ? 22.097  -2.873  -4.666  1.00 0.00 ? 150 ILE A CB   2  
ATOM 5736  C CG1  . ILE A 1 150 ? 22.130  -1.994  -5.933  1.00 0.00 ? 150 ILE A CG1  2  
ATOM 5737  C CG2  . ILE A 1 150 ? 23.393  -3.655  -4.492  1.00 0.00 ? 150 ILE A CG2  2  
ATOM 5738  C CD1  . ILE A 1 150 ? 23.387  -2.131  -6.773  1.00 0.00 ? 150 ILE A CD1  2  
ATOM 5739  H H    . ILE A 1 150 ? 21.311  -4.602  -6.625  1.00 0.00 ? 150 ILE A H    2  
ATOM 5740  H HA   . ILE A 1 150 ? 20.843  -4.347  -3.743  1.00 0.00 ? 150 ILE A HA   2  
ATOM 5741  H HB   . ILE A 1 150 ? 21.983  -2.235  -3.802  1.00 0.00 ? 150 ILE A HB   2  
ATOM 5742  H HG12 . ILE A 1 150 ? 21.292  -2.249  -6.560  1.00 0.00 ? 150 ILE A HG12 2  
ATOM 5743  H HG13 . ILE A 1 150 ? 22.043  -0.958  -5.638  1.00 0.00 ? 150 ILE A HG13 2  
ATOM 5744  H HG21 . ILE A 1 150 ? 24.218  -2.966  -4.387  1.00 0.00 ? 150 ILE A HG21 2  
ATOM 5745  H HG22 . ILE A 1 150 ? 23.555  -4.281  -5.357  1.00 0.00 ? 150 ILE A HG22 2  
ATOM 5746  H HG23 . ILE A 1 150 ? 23.325  -4.273  -3.609  1.00 0.00 ? 150 ILE A HG23 2  
ATOM 5747  H HD11 . ILE A 1 150 ? 24.202  -1.614  -6.289  1.00 0.00 ? 150 ILE A HD11 2  
ATOM 5748  H HD12 . ILE A 1 150 ? 23.214  -1.700  -7.749  1.00 0.00 ? 150 ILE A HD12 2  
ATOM 5749  H HD13 . ILE A 1 150 ? 23.636  -3.176  -6.883  1.00 0.00 ? 150 ILE A HD13 2  
ATOM 5750  N N    . VAL A 1 151 ? 18.853  -2.875  -3.809  1.00 0.00 ? 151 VAL A N    2  
ATOM 5751  C CA   . VAL A 1 151 ? 17.600  -2.130  -3.857  1.00 0.00 ? 151 VAL A CA   2  
ATOM 5752  C C    . VAL A 1 151 ? 17.753  -0.779  -3.168  1.00 0.00 ? 151 VAL A C    2  
ATOM 5753  O O    . VAL A 1 151 ? 18.602  -0.616  -2.292  1.00 0.00 ? 151 VAL A O    2  
ATOM 5754  C CB   . VAL A 1 151 ? 16.454  -2.909  -3.181  1.00 0.00 ? 151 VAL A CB   2  
ATOM 5755  C CG1  . VAL A 1 151 ? 15.114  -2.256  -3.483  1.00 0.00 ? 151 VAL A CG1  2  
ATOM 5756  C CG2  . VAL A 1 151 ? 16.459  -4.364  -3.626  1.00 0.00 ? 151 VAL A CG2  2  
ATOM 5757  H H    . VAL A 1 151 ? 19.151  -3.251  -2.955  1.00 0.00 ? 151 VAL A H    2  
ATOM 5758  H HA   . VAL A 1 151 ? 17.340  -1.973  -4.895  1.00 0.00 ? 151 VAL A HA   2  
ATOM 5759  H HB   . VAL A 1 151 ? 16.609  -2.881  -2.113  1.00 0.00 ? 151 VAL A HB   2  
ATOM 5760  H HG11 . VAL A 1 151 ? 14.849  -1.589  -2.675  1.00 0.00 ? 151 VAL A HG11 2  
ATOM 5761  H HG12 . VAL A 1 151 ? 14.356  -3.018  -3.583  1.00 0.00 ? 151 VAL A HG12 2  
ATOM 5762  H HG13 . VAL A 1 151 ? 15.185  -1.696  -4.403  1.00 0.00 ? 151 VAL A HG13 2  
ATOM 5763  H HG21 . VAL A 1 151 ? 16.986  -4.452  -4.564  1.00 0.00 ? 151 VAL A HG21 2  
ATOM 5764  H HG22 . VAL A 1 151 ? 15.443  -4.707  -3.751  1.00 0.00 ? 151 VAL A HG22 2  
ATOM 5765  H HG23 . VAL A 1 151 ? 16.953  -4.967  -2.878  1.00 0.00 ? 151 VAL A HG23 2  
ATOM 5766  N N    . LYS A 1 152 ? 16.932  0.188   -3.562  1.00 0.00 ? 152 LYS A N    2  
ATOM 5767  C CA   . LYS A 1 152 ? 16.991  1.518   -2.970  1.00 0.00 ? 152 LYS A CA   2  
ATOM 5768  C C    . LYS A 1 152 ? 15.866  2.396   -3.497  1.00 0.00 ? 152 LYS A C    2  
ATOM 5769  O O    . LYS A 1 152 ? 15.791  2.671   -4.694  1.00 0.00 ? 152 LYS A O    2  
ATOM 5770  C CB   . LYS A 1 152 ? 18.342  2.172   -3.267  1.00 0.00 ? 152 LYS A CB   2  
ATOM 5771  C CG   . LYS A 1 152 ? 18.688  3.308   -2.319  1.00 0.00 ? 152 LYS A CG   2  
ATOM 5772  C CD   . LYS A 1 152 ? 19.865  4.122   -2.830  1.00 0.00 ? 152 LYS A CD   2  
ATOM 5773  C CE   . LYS A 1 152 ? 19.959  5.467   -2.128  1.00 0.00 ? 152 LYS A CE   2  
ATOM 5774  N NZ   . LYS A 1 152 ? 21.371  5.861   -1.862  1.00 0.00 ? 152 LYS A NZ   2  
ATOM 5775  H H    . LYS A 1 152 ? 16.272  0.005   -4.266  1.00 0.00 ? 152 LYS A H    2  
ATOM 5776  H HA   . LYS A 1 152 ? 16.879  1.411   -1.902  1.00 0.00 ? 152 LYS A HA   2  
ATOM 5777  H HB2  . LYS A 1 152 ? 19.116  1.422   -3.193  1.00 0.00 ? 152 LYS A HB2  2  
ATOM 5778  H HB3  . LYS A 1 152 ? 18.326  2.564   -4.274  1.00 0.00 ? 152 LYS A HB3  2  
ATOM 5779  H HG2  . LYS A 1 152 ? 17.830  3.957   -2.222  1.00 0.00 ? 152 LYS A HG2  2  
ATOM 5780  H HG3  . LYS A 1 152 ? 18.940  2.894   -1.353  1.00 0.00 ? 152 LYS A HG3  2  
ATOM 5781  H HD2  . LYS A 1 152 ? 20.776  3.570   -2.652  1.00 0.00 ? 152 LYS A HD2  2  
ATOM 5782  H HD3  . LYS A 1 152 ? 19.743  4.287   -3.891  1.00 0.00 ? 152 LYS A HD3  2  
ATOM 5783  H HE2  . LYS A 1 152 ? 19.498  6.218   -2.752  1.00 0.00 ? 152 LYS A HE2  2  
ATOM 5784  H HE3  . LYS A 1 152 ? 19.428  5.406   -1.189  1.00 0.00 ? 152 LYS A HE3  2  
ATOM 5785  H HZ1  . LYS A 1 152 ? 22.015  5.087   -2.124  1.00 0.00 ? 152 LYS A HZ1  2  
ATOM 5786  H HZ2  . LYS A 1 152 ? 21.498  6.075   -0.852  1.00 0.00 ? 152 LYS A HZ2  2  
ATOM 5787  H HZ3  . LYS A 1 152 ? 21.618  6.705   -2.417  1.00 0.00 ? 152 LYS A HZ3  2  
ATOM 5788  N N    . LYS A 1 153 ? 14.979  2.816   -2.604  1.00 0.00 ? 153 LYS A N    2  
ATOM 5789  C CA   . LYS A 1 153 ? 13.845  3.639   -2.998  1.00 0.00 ? 153 LYS A CA   2  
ATOM 5790  C C    . LYS A 1 153 ? 14.209  5.121   -2.981  1.00 0.00 ? 153 LYS A C    2  
ATOM 5791  O O    . LYS A 1 153 ? 14.849  5.611   -2.050  1.00 0.00 ? 153 LYS A O    2  
ATOM 5792  C CB   . LYS A 1 153 ? 12.660  3.385   -2.065  1.00 0.00 ? 153 LYS A CB   2  
ATOM 5793  C CG   . LYS A 1 153 ? 12.918  3.794   -0.624  1.00 0.00 ? 153 LYS A CG   2  
ATOM 5794  C CD   . LYS A 1 153 ? 11.838  3.264   0.306   1.00 0.00 ? 153 LYS A CD   2  
ATOM 5795  C CE   . LYS A 1 153 ? 12.388  2.974   1.694   1.00 0.00 ? 153 LYS A CE   2  
ATOM 5796  N NZ   . LYS A 1 153 ? 11.991  4.018   2.679   1.00 0.00 ? 153 LYS A NZ   2  
ATOM 5797  H H    . LYS A 1 153 ? 15.069  2.537   -1.669  1.00 0.00 ? 153 LYS A H    2  
ATOM 5798  H HA   . LYS A 1 153 ? 13.564  3.354   -4.003  1.00 0.00 ? 153 LYS A HA   2  
ATOM 5799  H HB2  . LYS A 1 153 ? 11.807  3.940   -2.426  1.00 0.00 ? 153 LYS A HB2  2  
ATOM 5800  H HB3  . LYS A 1 153 ? 12.424  2.331   -2.081  1.00 0.00 ? 153 LYS A HB3  2  
ATOM 5801  H HG2  . LYS A 1 153 ? 13.873  3.397   -0.313  1.00 0.00 ? 153 LYS A HG2  2  
ATOM 5802  H HG3  . LYS A 1 153 ? 12.936  4.872   -0.564  1.00 0.00 ? 153 LYS A HG3  2  
ATOM 5803  H HD2  . LYS A 1 153 ? 11.054  4.002   0.389   1.00 0.00 ? 153 LYS A HD2  2  
ATOM 5804  H HD3  . LYS A 1 153 ? 11.434  2.352   -0.109  1.00 0.00 ? 153 LYS A HD3  2  
ATOM 5805  H HE2  . LYS A 1 153 ? 12.010  2.018   2.025   1.00 0.00 ? 153 LYS A HE2  2  
ATOM 5806  H HE3  . LYS A 1 153 ? 13.466  2.934   1.640   1.00 0.00 ? 153 LYS A HE3  2  
ATOM 5807  H HZ1  . LYS A 1 153 ? 11.879  4.935   2.202   1.00 0.00 ? 153 LYS A HZ1  2  
ATOM 5808  H HZ2  . LYS A 1 153 ? 12.718  4.109   3.416   1.00 0.00 ? 153 LYS A HZ2  2  
ATOM 5809  H HZ3  . LYS A 1 153 ? 11.088  3.760   3.128   1.00 0.00 ? 153 LYS A HZ3  2  
ATOM 5810  N N    . HIS A 1 154 ? 13.786  5.822   -4.027  1.00 0.00 ? 154 HIS A N    2  
ATOM 5811  C CA   . HIS A 1 154 ? 14.042  7.252   -4.171  1.00 0.00 ? 154 HIS A CA   2  
ATOM 5812  C C    . HIS A 1 154 ? 12.733  8.019   -4.069  1.00 0.00 ? 154 HIS A C    2  
ATOM 5813  O O    . HIS A 1 154 ? 11.699  7.519   -4.480  1.00 0.00 ? 154 HIS A O    2  
ATOM 5814  C CB   . HIS A 1 154 ? 14.707  7.529   -5.526  1.00 0.00 ? 154 HIS A CB   2  
ATOM 5815  C CG   . HIS A 1 154 ? 16.086  6.956   -5.642  1.00 0.00 ? 154 HIS A CG   2  
ATOM 5816  N ND1  . HIS A 1 154 ? 17.168  7.455   -4.948  1.00 0.00 ? 154 HIS A ND1  2  
ATOM 5817  C CD2  . HIS A 1 154 ? 16.559  5.915   -6.374  1.00 0.00 ? 154 HIS A CD2  2  
ATOM 5818  C CE1  . HIS A 1 154 ? 18.245  6.750   -5.247  1.00 0.00 ? 154 HIS A CE1  2  
ATOM 5819  N NE2  . HIS A 1 154 ? 17.902  5.810   -6.109  1.00 0.00 ? 154 HIS A NE2  2  
ATOM 5820  H H    . HIS A 1 154 ? 13.275  5.360   -4.723  1.00 0.00 ? 154 HIS A H    2  
ATOM 5821  H HA   . HIS A 1 154 ? 14.702  7.562   -3.375  1.00 0.00 ? 154 HIS A HA   2  
ATOM 5822  H HB2  . HIS A 1 154 ? 14.103  7.099   -6.308  1.00 0.00 ? 154 HIS A HB2  2  
ATOM 5823  H HB3  . HIS A 1 154 ? 14.772  8.594   -5.683  1.00 0.00 ? 154 HIS A HB3  2  
ATOM 5824  H HD1  . HIS A 1 154 ? 17.150  8.215   -4.329  1.00 0.00 ? 154 HIS A HD1  2  
ATOM 5825  H HD2  . HIS A 1 154 ? 15.985  5.284   -7.040  1.00 0.00 ? 154 HIS A HD2  2  
ATOM 5826  H HE1  . HIS A 1 154 ? 19.237  6.914   -4.853  1.00 0.00 ? 154 HIS A HE1  2  
ATOM 5827  H HE2  . HIS A 1 154 ? 18.489  5.091   -6.423  1.00 0.00 ? 154 HIS A HE2  2  
ATOM 5828  N N    . LYS A 1 155 ? 12.768  9.228   -3.524  1.00 0.00 ? 155 LYS A N    2  
ATOM 5829  C CA   . LYS A 1 155 ? 11.549  10.022  -3.396  1.00 0.00 ? 155 LYS A CA   2  
ATOM 5830  C C    . LYS A 1 155 ? 11.796  11.477  -3.786  1.00 0.00 ? 155 LYS A C    2  
ATOM 5831  O O    . LYS A 1 155 ? 11.835  12.367  -2.938  1.00 0.00 ? 155 LYS A O    2  
ATOM 5832  C CB   . LYS A 1 155 ? 10.995  9.931   -1.975  1.00 0.00 ? 155 LYS A CB   2  
ATOM 5833  C CG   . LYS A 1 155 ? 12.043  10.135  -0.894  1.00 0.00 ? 155 LYS A CG   2  
ATOM 5834  C CD   . LYS A 1 155 ? 11.999  11.547  -0.331  1.00 0.00 ? 155 LYS A CD   2  
ATOM 5835  C CE   . LYS A 1 155 ? 12.083  11.546  1.187   1.00 0.00 ? 155 LYS A CE   2  
ATOM 5836  N NZ   . LYS A 1 155 ? 11.206  12.586  1.792   1.00 0.00 ? 155 LYS A NZ   2  
ATOM 5837  H H    . LYS A 1 155 ? 13.620  9.592   -3.206  1.00 0.00 ? 155 LYS A H    2  
ATOM 5838  H HA   . LYS A 1 155 ? 10.820  9.607   -4.077  1.00 0.00 ? 155 LYS A HA   2  
ATOM 5839  H HB2  . LYS A 1 155 ? 10.228  10.678  -1.854  1.00 0.00 ? 155 LYS A HB2  2  
ATOM 5840  H HB3  . LYS A 1 155 ? 10.555  8.954   -1.837  1.00 0.00 ? 155 LYS A HB3  2  
ATOM 5841  H HG2  . LYS A 1 155 ? 11.859  9.433   -0.095  1.00 0.00 ? 155 LYS A HG2  2  
ATOM 5842  H HG3  . LYS A 1 155 ? 13.020  9.954   -1.317  1.00 0.00 ? 155 LYS A HG3  2  
ATOM 5843  H HD2  . LYS A 1 155 ? 12.833  12.108  -0.726  1.00 0.00 ? 155 LYS A HD2  2  
ATOM 5844  H HD3  . LYS A 1 155 ? 11.073  12.016  -0.631  1.00 0.00 ? 155 LYS A HD3  2  
ATOM 5845  H HE2  . LYS A 1 155 ? 11.778  10.576  1.551   1.00 0.00 ? 155 LYS A HE2  2  
ATOM 5846  H HE3  . LYS A 1 155 ? 13.105  11.735  1.479   1.00 0.00 ? 155 LYS A HE3  2  
ATOM 5847  H HZ1  . LYS A 1 155 ? 11.757  13.445  1.994   1.00 0.00 ? 155 LYS A HZ1  2  
ATOM 5848  H HZ2  . LYS A 1 155 ? 10.795  12.235  2.681   1.00 0.00 ? 155 LYS A HZ2  2  
ATOM 5849  H HZ3  . LYS A 1 155 ? 10.434  12.828  1.138   1.00 0.00 ? 155 LYS A HZ3  2  
ATOM 5850  N N    . PRO A 1 156 ? 11.978  11.722  -5.094  1.00 0.00 ? 156 PRO A N    2  
ATOM 5851  C CA   . PRO A 1 156 ? 12.238  13.060  -5.641  1.00 0.00 ? 156 PRO A CA   2  
ATOM 5852  C C    . PRO A 1 156 ? 11.116  14.050  -5.356  1.00 0.00 ? 156 PRO A C    2  
ATOM 5853  O O    . PRO A 1 156 ? 10.019  13.665  -4.950  1.00 0.00 ? 156 PRO A O    2  
ATOM 5854  C CB   . PRO A 1 156 ? 12.349  12.813  -7.148  1.00 0.00 ? 156 PRO A CB   2  
ATOM 5855  C CG   . PRO A 1 156 ? 12.701  11.375  -7.259  1.00 0.00 ? 156 PRO A CG   2  
ATOM 5856  C CD   . PRO A 1 156 ? 11.961  10.703  -6.150  1.00 0.00 ? 156 PRO A CD   2  
ATOM 5857  H HA   . PRO A 1 156 ? 13.168  13.453  -5.278  1.00 0.00 ? 156 PRO A HA   2  
ATOM 5858  H HB2  . PRO A 1 156 ? 11.403  13.029  -7.623  1.00 0.00 ? 156 PRO A HB2  2  
ATOM 5859  H HB3  . PRO A 1 156 ? 13.122  13.442  -7.564  1.00 0.00 ? 156 PRO A HB3  2  
ATOM 5860  H HG2  . PRO A 1 156 ? 12.387  10.987  -8.216  1.00 0.00 ? 156 PRO A HG2  2  
ATOM 5861  H HG3  . PRO A 1 156 ? 13.763  11.247  -7.127  1.00 0.00 ? 156 PRO A HG3  2  
ATOM 5862  H HD2  . PRO A 1 156 ? 10.954  10.474  -6.454  1.00 0.00 ? 156 PRO A HD2  2  
ATOM 5863  H HD3  . PRO A 1 156 ? 12.477  9.811   -5.830  1.00 0.00 ? 156 PRO A HD3  2  
ATOM 5864  N N    . GLU A 1 157 ? 11.395  15.329  -5.589  1.00 0.00 ? 157 GLU A N    2  
ATOM 5865  C CA   . GLU A 1 157 ? 10.407  16.378  -5.377  1.00 0.00 ? 157 GLU A CA   2  
ATOM 5866  C C    . GLU A 1 157 ? 9.404   16.387  -6.525  1.00 0.00 ? 157 GLU A C    2  
ATOM 5867  O O    . GLU A 1 157 ? 9.759   16.676  -7.668  1.00 0.00 ? 157 GLU A O    2  
ATOM 5868  C CB   . GLU A 1 157 ? 11.092  17.743  -5.265  1.00 0.00 ? 157 GLU A CB   2  
ATOM 5869  C CG   . GLU A 1 157 ? 11.308  18.200  -3.831  1.00 0.00 ? 157 GLU A CG   2  
ATOM 5870  C CD   . GLU A 1 157 ? 12.526  19.091  -3.681  1.00 0.00 ? 157 GLU A CD   2  
ATOM 5871  O OE1  . GLU A 1 157 ? 12.448  20.275  -4.072  1.00 0.00 ? 157 GLU A OE1  2  
ATOM 5872  O OE2  . GLU A 1 157 ? 13.558  18.605  -3.171  1.00 0.00 ? 157 GLU A OE2  2  
ATOM 5873  H H    . GLU A 1 157 ? 12.284  15.571  -5.924  1.00 0.00 ? 157 GLU A H    2  
ATOM 5874  H HA   . GLU A 1 157 ? 9.885   16.165  -4.456  1.00 0.00 ? 157 GLU A HA   2  
ATOM 5875  H HB2  . GLU A 1 157 ? 12.055  17.691  -5.752  1.00 0.00 ? 157 GLU A HB2  2  
ATOM 5876  H HB3  . GLU A 1 157 ? 10.484  18.482  -5.767  1.00 0.00 ? 157 GLU A HB3  2  
ATOM 5877  H HG2  . GLU A 1 157 ? 10.437  18.750  -3.507  1.00 0.00 ? 157 GLU A HG2  2  
ATOM 5878  H HG3  . GLU A 1 157 ? 11.438  17.329  -3.205  1.00 0.00 ? 157 GLU A HG3  2  
ATOM 5879  N N    . ILE A 1 158 ? 8.156   16.055  -6.220  1.00 0.00 ? 158 ILE A N    2  
ATOM 5880  C CA   . ILE A 1 158 ? 7.112   16.012  -7.238  1.00 0.00 ? 158 ILE A CA   2  
ATOM 5881  C C    . ILE A 1 158 ? 6.400   17.355  -7.380  1.00 0.00 ? 158 ILE A C    2  
ATOM 5882  O O    . ILE A 1 158 ? 5.347   17.439  -8.012  1.00 0.00 ? 158 ILE A O    2  
ATOM 5883  C CB   . ILE A 1 158 ? 6.060   14.926  -6.937  1.00 0.00 ? 158 ILE A CB   2  
ATOM 5884  C CG1  . ILE A 1 158 ? 6.692   13.735  -6.218  1.00 0.00 ? 158 ILE A CG1  2  
ATOM 5885  C CG2  . ILE A 1 158 ? 5.396   14.464  -8.224  1.00 0.00 ? 158 ILE A CG2  2  
ATOM 5886  C CD1  . ILE A 1 158 ? 7.758   13.043  -7.032  1.00 0.00 ? 158 ILE A CD1  2  
ATOM 5887  H H    . ILE A 1 158 ? 7.934   15.827  -5.293  1.00 0.00 ? 158 ILE A H    2  
ATOM 5888  H HA   . ILE A 1 158 ? 7.582   15.770  -8.180  1.00 0.00 ? 158 ILE A HA   2  
ATOM 5889  H HB   . ILE A 1 158 ? 5.300   15.357  -6.303  1.00 0.00 ? 158 ILE A HB   2  
ATOM 5890  H HG12 . ILE A 1 158 ? 7.139   14.068  -5.294  1.00 0.00 ? 158 ILE A HG12 2  
ATOM 5891  H HG13 . ILE A 1 158 ? 5.923   13.012  -6.003  1.00 0.00 ? 158 ILE A HG13 2  
ATOM 5892  H HG21 . ILE A 1 158 ? 5.656   15.137  -9.027  1.00 0.00 ? 158 ILE A HG21 2  
ATOM 5893  H HG22 . ILE A 1 158 ? 4.324   14.458  -8.093  1.00 0.00 ? 158 ILE A HG22 2  
ATOM 5894  H HG23 . ILE A 1 158 ? 5.735   13.465  -8.467  1.00 0.00 ? 158 ILE A HG23 2  
ATOM 5895  H HD11 . ILE A 1 158 ? 7.569   13.220  -8.079  1.00 0.00 ? 158 ILE A HD11 2  
ATOM 5896  H HD12 . ILE A 1 158 ? 7.735   11.979  -6.832  1.00 0.00 ? 158 ILE A HD12 2  
ATOM 5897  H HD13 . ILE A 1 158 ? 8.727   13.437  -6.770  1.00 0.00 ? 158 ILE A HD13 2  
ATOM 5898  N N    . LYS A 1 159 ? 6.975   18.406  -6.795  1.00 0.00 ? 159 LYS A N    2  
ATOM 5899  C CA   . LYS A 1 159 ? 6.384   19.741  -6.870  1.00 0.00 ? 159 LYS A CA   2  
ATOM 5900  C C    . LYS A 1 159 ? 5.949   20.066  -8.298  1.00 0.00 ? 159 LYS A C    2  
ATOM 5901  O O    . LYS A 1 159 ? 4.997   20.816  -8.515  1.00 0.00 ? 159 LYS A O    2  
ATOM 5902  C CB   . LYS A 1 159 ? 7.382   20.790  -6.374  1.00 0.00 ? 159 LYS A CB   2  
ATOM 5903  C CG   . LYS A 1 159 ? 7.019   21.383  -5.022  1.00 0.00 ? 159 LYS A CG   2  
ATOM 5904  C CD   . LYS A 1 159 ? 7.628   22.764  -4.839  1.00 0.00 ? 159 LYS A CD   2  
ATOM 5905  C CE   . LYS A 1 159 ? 7.070   23.460  -3.609  1.00 0.00 ? 159 LYS A CE   2  
ATOM 5906  N NZ   . LYS A 1 159 ? 7.023   24.938  -3.781  1.00 0.00 ? 159 LYS A NZ   2  
ATOM 5907  H H    . LYS A 1 159 ? 7.812   18.283  -6.303  1.00 0.00 ? 159 LYS A H    2  
ATOM 5908  H HA   . LYS A 1 159 ? 5.514   19.753  -6.230  1.00 0.00 ? 159 LYS A HA   2  
ATOM 5909  H HB2  . LYS A 1 159 ? 8.356   20.332  -6.291  1.00 0.00 ? 159 LYS A HB2  2  
ATOM 5910  H HB3  . LYS A 1 159 ? 7.432   21.594  -7.093  1.00 0.00 ? 159 LYS A HB3  2  
ATOM 5911  H HG2  . LYS A 1 159 ? 5.945   21.463  -4.952  1.00 0.00 ? 159 LYS A HG2  2  
ATOM 5912  H HG3  . LYS A 1 159 ? 7.386   20.731  -4.243  1.00 0.00 ? 159 LYS A HG3  2  
ATOM 5913  H HD2  . LYS A 1 159 ? 8.698   22.663  -4.730  1.00 0.00 ? 159 LYS A HD2  2  
ATOM 5914  H HD3  . LYS A 1 159 ? 7.409   23.362  -5.712  1.00 0.00 ? 159 LYS A HD3  2  
ATOM 5915  H HE2  . LYS A 1 159 ? 6.070   23.096  -3.428  1.00 0.00 ? 159 LYS A HE2  2  
ATOM 5916  H HE3  . LYS A 1 159 ? 7.698   23.224  -2.762  1.00 0.00 ? 159 LYS A HE3  2  
ATOM 5917  H HZ1  . LYS A 1 159 ? 6.179   25.325  -3.311  1.00 0.00 ? 159 LYS A HZ1  2  
ATOM 5918  H HZ2  . LYS A 1 159 ? 6.984   25.180  -4.791  1.00 0.00 ? 159 LYS A HZ2  2  
ATOM 5919  H HZ3  . LYS A 1 159 ? 7.870   25.374  -3.364  1.00 0.00 ? 159 LYS A HZ3  2  
ATOM 5920  N N    . GLY A 1 160 ? 6.651   19.486  -9.265  1.00 0.00 ? 160 GLY A N    2  
ATOM 5921  C CA   . GLY A 1 160 ? 6.330   19.710  -10.661 1.00 0.00 ? 160 GLY A CA   2  
ATOM 5922  C C    . GLY A 1 160 ? 6.889   18.619  -11.551 1.00 0.00 ? 160 GLY A C    2  
ATOM 5923  O O    . GLY A 1 160 ? 7.248   18.868  -12.702 1.00 0.00 ? 160 GLY A O    2  
ATOM 5924  H H    . GLY A 1 160 ? 7.396   18.895  -9.028  1.00 0.00 ? 160 GLY A H    2  
ATOM 5925  H HA2  . GLY A 1 160 ? 5.256   19.741  -10.773 1.00 0.00 ? 160 GLY A HA2  2  
ATOM 5926  H HA3  . GLY A 1 160 ? 6.744   20.659  -10.968 1.00 0.00 ? 160 GLY A HA3  2  
ATOM 5927  N N    . ASN A 1 161 ? 6.969   17.406  -11.011 1.00 0.00 ? 161 ASN A N    2  
ATOM 5928  C CA   . ASN A 1 161 ? 7.497   16.268  -11.754 1.00 0.00 ? 161 ASN A CA   2  
ATOM 5929  C C    . ASN A 1 161 ? 6.396   15.278  -12.133 1.00 0.00 ? 161 ASN A C    2  
ATOM 5930  O O    . ASN A 1 161 ? 6.609   14.391  -12.959 1.00 0.00 ? 161 ASN A O    2  
ATOM 5931  C CB   . ASN A 1 161 ? 8.575   15.561  -10.939 1.00 0.00 ? 161 ASN A CB   2  
ATOM 5932  C CG   . ASN A 1 161 ? 9.821   16.408  -10.768 1.00 0.00 ? 161 ASN A CG   2  
ATOM 5933  O OD1  . ASN A 1 161 ? 9.952   17.471  -11.377 1.00 0.00 ? 161 ASN A OD1  2  
ATOM 5934  N ND2  . ASN A 1 161 ? 10.746  15.940  -9.938  1.00 0.00 ? 161 ASN A ND2  2  
ATOM 5935  H H    . ASN A 1 161 ? 6.672   17.275  -10.086 1.00 0.00 ? 161 ASN A H    2  
ATOM 5936  H HA   . ASN A 1 161 ? 7.943   16.646  -12.657 1.00 0.00 ? 161 ASN A HA   2  
ATOM 5937  H HB2  . ASN A 1 161 ? 8.184   15.327  -9.961  1.00 0.00 ? 161 ASN A HB2  2  
ATOM 5938  H HB3  . ASN A 1 161 ? 8.849   14.647  -11.441 1.00 0.00 ? 161 ASN A HB3  2  
ATOM 5939  H HD21 . ASN A 1 161 ? 10.576  15.086  -9.488  1.00 0.00 ? 161 ASN A HD21 2  
ATOM 5940  H HD22 . ASN A 1 161 ? 11.562  16.467  -9.810  1.00 0.00 ? 161 ASN A HD22 2  
ATOM 5941  N N    . MET A 1 162 ? 5.219   15.434  -11.532 1.00 0.00 ? 162 MET A N    2  
ATOM 5942  C CA   . MET A 1 162 ? 4.093   14.551  -11.819 1.00 0.00 ? 162 MET A CA   2  
ATOM 5943  C C    . MET A 1 162 ? 3.205   15.154  -12.915 1.00 0.00 ? 162 MET A C    2  
ATOM 5944  O O    . MET A 1 162 ? 1.979   15.058  -12.854 1.00 0.00 ? 162 MET A O    2  
ATOM 5945  C CB   . MET A 1 162 ? 3.266   14.323  -10.548 1.00 0.00 ? 162 MET A CB   2  
ATOM 5946  C CG   . MET A 1 162 ? 3.403   12.925  -9.964  1.00 0.00 ? 162 MET A CG   2  
ATOM 5947  S SD   . MET A 1 162 ? 2.397   12.687  -8.485  1.00 0.00 ? 162 MET A SD   2  
ATOM 5948  C CE   . MET A 1 162 ? 3.555   11.842  -7.410  1.00 0.00 ? 162 MET A CE   2  
ATOM 5949  H H    . MET A 1 162 ? 5.103   16.160  -10.884 1.00 0.00 ? 162 MET A H    2  
ATOM 5950  H HA   . MET A 1 162 ? 4.494   13.605  -12.154 1.00 0.00 ? 162 MET A HA   2  
ATOM 5951  H HB2  . MET A 1 162 ? 3.579   15.034  -9.799  1.00 0.00 ? 162 MET A HB2  2  
ATOM 5952  H HB3  . MET A 1 162 ? 2.223   14.492  -10.773 1.00 0.00 ? 162 MET A HB3  2  
ATOM 5953  H HG2  . MET A 1 162 ? 3.094   12.210  -10.708 1.00 0.00 ? 162 MET A HG2  2  
ATOM 5954  H HG3  . MET A 1 162 ? 4.438   12.753  -9.712  1.00 0.00 ? 162 MET A HG3  2  
ATOM 5955  H HE1  . MET A 1 162 ? 4.362   12.512  -7.151  1.00 0.00 ? 162 MET A HE1  2  
ATOM 5956  H HE2  . MET A 1 162 ? 3.957   10.979  -7.921  1.00 0.00 ? 162 MET A HE2  2  
ATOM 5957  H HE3  . MET A 1 162 ? 3.044   11.527  -6.508  1.00 0.00 ? 162 MET A HE3  2  
ATOM 5958  N N    . SER A 1 163 ? 3.828   15.810  -13.894 1.00 0.00 ? 163 SER A N    2  
ATOM 5959  C CA   . SER A 1 163 ? 3.087   16.467  -14.974 1.00 0.00 ? 163 SER A CA   2  
ATOM 5960  C C    . SER A 1 163 ? 3.617   16.107  -16.365 1.00 0.00 ? 163 SER A C    2  
ATOM 5961  O O    . SER A 1 163 ? 3.566   16.934  -17.276 1.00 0.00 ? 163 SER A O    2  
ATOM 5962  C CB   . SER A 1 163 ? 3.134   17.984  -14.787 1.00 0.00 ? 163 SER A CB   2  
ATOM 5963  O OG   . SER A 1 163 ? 4.449   18.422  -14.494 1.00 0.00 ? 163 SER A OG   2  
ATOM 5964  H H    . SER A 1 163 ? 4.804   15.879  -13.876 1.00 0.00 ? 163 SER A H    2  
ATOM 5965  H HA   . SER A 1 163 ? 2.060   16.146  -14.905 1.00 0.00 ? 163 SER A HA   2  
ATOM 5966  H HB2  . SER A 1 163 ? 2.801   18.467  -15.694 1.00 0.00 ? 163 SER A HB2  2  
ATOM 5967  H HB3  . SER A 1 163 ? 2.484   18.265  -13.971 1.00 0.00 ? 163 SER A HB3  2  
ATOM 5968  H HG   . SER A 1 163 ? 4.867   18.740  -15.298 1.00 0.00 ? 163 SER A HG   2  
ATOM 5969  N N    . GLY A 1 164 ? 4.127   14.890  -16.539 1.00 0.00 ? 164 GLY A N    2  
ATOM 5970  C CA   . GLY A 1 164 ? 4.648   14.504  -17.838 1.00 0.00 ? 164 GLY A CA   2  
ATOM 5971  C C    . GLY A 1 164 ? 5.756   13.475  -17.748 1.00 0.00 ? 164 GLY A C    2  
ATOM 5972  O O    . GLY A 1 164 ? 5.652   12.507  -16.998 1.00 0.00 ? 164 GLY A O    2  
ATOM 5973  H H    . GLY A 1 164 ? 4.143   14.253  -15.796 1.00 0.00 ? 164 GLY A H    2  
ATOM 5974  H HA2  . GLY A 1 164 ? 3.842   14.098  -18.431 1.00 0.00 ? 164 GLY A HA2  2  
ATOM 5975  H HA3  . GLY A 1 164 ? 5.031   15.385  -18.333 1.00 0.00 ? 164 GLY A HA3  2  
ATOM 5976  N N    . ASN A 1 165 ? 6.819   13.682  -18.520 1.00 0.00 ? 165 ASN A N    2  
ATOM 5977  C CA   . ASN A 1 165 ? 7.947   12.753  -18.528 1.00 0.00 ? 165 ASN A CA   2  
ATOM 5978  C C    . ASN A 1 165 ? 8.899   13.008  -17.365 1.00 0.00 ? 165 ASN A C    2  
ATOM 5979  O O    . ASN A 1 165 ? 9.991   13.547  -17.554 1.00 0.00 ? 165 ASN A O    2  
ATOM 5980  C CB   . ASN A 1 165 ? 8.725   12.805  -19.856 1.00 0.00 ? 165 ASN A CB   2  
ATOM 5981  C CG   . ASN A 1 165 ? 8.374   14.002  -20.721 1.00 0.00 ? 165 ASN A CG   2  
ATOM 5982  O OD1  . ASN A 1 165 ? 8.218   15.117  -20.223 1.00 0.00 ? 165 ASN A OD1  2  
ATOM 5983  N ND2  . ASN A 1 165 ? 8.248   13.776  -22.024 1.00 0.00 ? 165 ASN A ND2  2  
ATOM 5984  H H    . ASN A 1 165 ? 6.840   14.472  -19.097 1.00 0.00 ? 165 ASN A H    2  
ATOM 5985  H HA   . ASN A 1 165 ? 7.544   11.758  -18.413 1.00 0.00 ? 165 ASN A HA   2  
ATOM 5986  H HB2  . ASN A 1 165 ? 9.783   12.843  -19.642 1.00 0.00 ? 165 ASN A HB2  2  
ATOM 5987  H HB3  . ASN A 1 165 ? 8.516   11.904  -20.417 1.00 0.00 ? 165 ASN A HB3  2  
ATOM 5988  H HD21 . ASN A 1 165 ? 8.386   12.863  -22.351 1.00 0.00 ? 165 ASN A HD21 2  
ATOM 5989  H HD22 . ASN A 1 165 ? 8.021   14.532  -22.605 1.00 0.00 ? 165 ASN A HD22 2  
ATOM 5990  N N    . PHE A 1 166 ? 8.494   12.580  -16.168 1.00 0.00 ? 166 PHE A N    2  
ATOM 5991  C CA   . PHE A 1 166 ? 9.326   12.713  -14.971 1.00 0.00 ? 166 PHE A CA   2  
ATOM 5992  C C    . PHE A 1 166 ? 10.763  12.387  -15.336 1.00 0.00 ? 166 PHE A C    2  
ATOM 5993  O O    . PHE A 1 166 ? 11.013  11.404  -16.022 1.00 0.00 ? 166 PHE A O    2  
ATOM 5994  C CB   . PHE A 1 166 ? 8.830   11.739  -13.906 1.00 0.00 ? 166 PHE A CB   2  
ATOM 5995  C CG   . PHE A 1 166 ? 9.012   12.173  -12.486 1.00 0.00 ? 166 PHE A CG   2  
ATOM 5996  C CD1  . PHE A 1 166 ? 10.253  12.542  -11.994 1.00 0.00 ? 166 PHE A CD1  2  
ATOM 5997  C CD2  . PHE A 1 166 ? 7.926   12.181  -11.634 1.00 0.00 ? 166 PHE A CD2  2  
ATOM 5998  C CE1  . PHE A 1 166 ? 10.399  12.916  -10.671 1.00 0.00 ? 166 PHE A CE1  2  
ATOM 5999  C CE2  . PHE A 1 166 ? 8.062   12.547  -10.321 1.00 0.00 ? 166 PHE A CE2  2  
ATOM 6000  C CZ   . PHE A 1 166 ? 9.300   12.917  -9.831  1.00 0.00 ? 166 PHE A CZ   2  
ATOM 6001  H H    . PHE A 1 166 ? 7.626   12.135  -16.095 1.00 0.00 ? 166 PHE A H    2  
ATOM 6002  H HA   . PHE A 1 166 ? 9.259   13.727  -14.606 1.00 0.00 ? 166 PHE A HA   2  
ATOM 6003  H HB2  . PHE A 1 166 ? 7.780   11.585  -14.052 1.00 0.00 ? 166 PHE A HB2  2  
ATOM 6004  H HB3  . PHE A 1 166 ? 9.341   10.799  -14.028 1.00 0.00 ? 166 PHE A HB3  2  
ATOM 6005  H HD1  . PHE A 1 166 ? 11.108  12.540  -12.653 1.00 0.00 ? 166 PHE A HD1  2  
ATOM 6006  H HD2  . PHE A 1 166 ? 6.957   11.894  -12.009 1.00 0.00 ? 166 PHE A HD2  2  
ATOM 6007  H HE1  . PHE A 1 166 ? 11.369  13.204  -10.294 1.00 0.00 ? 166 PHE A HE1  2  
ATOM 6008  H HE2  . PHE A 1 166 ? 7.197   12.545  -9.677  1.00 0.00 ? 166 PHE A HE2  2  
ATOM 6009  H HZ   . PHE A 1 166 ? 9.407   13.205  -8.796  1.00 0.00 ? 166 PHE A HZ   2  
ATOM 6010  N N    . THR A 1 167 ? 11.699  13.212  -14.915 1.00 0.00 ? 167 THR A N    2  
ATOM 6011  C CA   . THR A 1 167 ? 13.097  12.981  -15.260 1.00 0.00 ? 167 THR A CA   2  
ATOM 6012  C C    . THR A 1 167 ? 13.978  12.828  -14.018 1.00 0.00 ? 167 THR A C    2  
ATOM 6013  O O    . THR A 1 167 ? 14.335  13.816  -13.376 1.00 0.00 ? 167 THR A O    2  
ATOM 6014  C CB   . THR A 1 167 ? 13.618  14.138  -16.114 1.00 0.00 ? 167 THR A CB   2  
ATOM 6015  O OG1  . THR A 1 167 ? 12.548  14.942  -16.581 1.00 0.00 ? 167 THR A OG1  2  
ATOM 6016  C CG2  . THR A 1 167 ? 14.401  13.675  -17.317 1.00 0.00 ? 167 THR A CG2  2  
ATOM 6017  H H    . THR A 1 167 ? 11.450  13.993  -14.381 1.00 0.00 ? 167 THR A H    2  
ATOM 6018  H HA   . THR A 1 167 ? 13.142  12.064  -15.854 1.00 0.00 ? 167 THR A HA   2  
ATOM 6019  H HB   . THR A 1 167 ? 14.269  14.755  -15.512 1.00 0.00 ? 167 THR A HB   2  
ATOM 6020  H HG1  . THR A 1 167 ? 12.548  15.779  -16.111 1.00 0.00 ? 167 THR A HG1  2  
ATOM 6021  H HG21 . THR A 1 167 ? 13.763  13.698  -18.190 1.00 0.00 ? 167 THR A HG21 2  
ATOM 6022  H HG22 . THR A 1 167 ? 14.744  12.663  -17.151 1.00 0.00 ? 167 THR A HG22 2  
ATOM 6023  H HG23 . THR A 1 167 ? 15.248  14.325  -17.471 1.00 0.00 ? 167 THR A HG23 2  
ATOM 6024  N N    . TYR A 1 168 ? 14.337  11.591  -13.695 1.00 0.00 ? 168 TYR A N    2  
ATOM 6025  C CA   . TYR A 1 168 ? 15.189  11.311  -12.543 1.00 0.00 ? 168 TYR A CA   2  
ATOM 6026  C C    . TYR A 1 168 ? 16.428  10.534  -12.982 1.00 0.00 ? 168 TYR A C    2  
ATOM 6027  O O    . TYR A 1 168 ? 16.363  9.749   -13.919 1.00 0.00 ? 168 TYR A O    2  
ATOM 6028  C CB   . TYR A 1 168 ? 14.412  10.510  -11.489 1.00 0.00 ? 168 TYR A CB   2  
ATOM 6029  C CG   . TYR A 1 168 ? 15.251  10.074  -10.307 1.00 0.00 ? 168 TYR A CG   2  
ATOM 6030  C CD1  . TYR A 1 168 ? 16.220  9.086   -10.437 1.00 0.00 ? 168 TYR A CD1  2  
ATOM 6031  C CD2  . TYR A 1 168 ? 15.071  10.653  -9.062  1.00 0.00 ? 168 TYR A CD2  2  
ATOM 6032  C CE1  . TYR A 1 168 ? 16.986  8.693   -9.355  1.00 0.00 ? 168 TYR A CE1  2  
ATOM 6033  C CE2  . TYR A 1 168 ? 15.833  10.267  -7.976  1.00 0.00 ? 168 TYR A CE2  2  
ATOM 6034  C CZ   . TYR A 1 168 ? 16.789  9.287   -8.127  1.00 0.00 ? 168 TYR A CZ   2  
ATOM 6035  O OH   . TYR A 1 168 ? 17.550  8.901   -7.046  1.00 0.00 ? 168 TYR A OH   2  
ATOM 6036  H H    . TYR A 1 168 ? 14.028  10.845  -14.249 1.00 0.00 ? 168 TYR A H    2  
ATOM 6037  H HA   . TYR A 1 168 ? 15.498  12.254  -12.116 1.00 0.00 ? 168 TYR A HA   2  
ATOM 6038  H HB2  . TYR A 1 168 ? 13.605  11.119  -11.111 1.00 0.00 ? 168 TYR A HB2  2  
ATOM 6039  H HB3  . TYR A 1 168 ? 13.999  9.624   -11.950 1.00 0.00 ? 168 TYR A HB3  2  
ATOM 6040  H HD1  . TYR A 1 168 ? 16.370  8.621   -11.401 1.00 0.00 ? 168 TYR A HD1  2  
ATOM 6041  H HD2  . TYR A 1 168 ? 14.322  11.420  -8.945  1.00 0.00 ? 168 TYR A HD2  2  
ATOM 6042  H HE1  . TYR A 1 168 ? 17.737  7.928   -9.474  1.00 0.00 ? 168 TYR A HE1  2  
ATOM 6043  H HE2  . TYR A 1 168 ? 15.675  10.730  -7.014  1.00 0.00 ? 168 TYR A HE2  2  
ATOM 6044  H HH   . TYR A 1 168 ? 18.110  8.161   -7.292  1.00 0.00 ? 168 TYR A HH   2  
ATOM 6045  N N    . ILE A 1 169 ? 17.557  10.759  -12.313 1.00 0.00 ? 169 ILE A N    2  
ATOM 6046  C CA   . ILE A 1 169 ? 18.795  10.062  -12.665 1.00 0.00 ? 169 ILE A CA   2  
ATOM 6047  C C    . ILE A 1 169 ? 19.405  9.348   -11.467 1.00 0.00 ? 169 ILE A C    2  
ATOM 6048  O O    . ILE A 1 169 ? 19.770  9.978   -10.474 1.00 0.00 ? 169 ILE A O    2  
ATOM 6049  C CB   . ILE A 1 169 ? 19.855  11.020  -13.250 1.00 0.00 ? 169 ILE A CB   2  
ATOM 6050  C CG1  . ILE A 1 169 ? 19.241  11.880  -14.357 1.00 0.00 ? 169 ILE A CG1  2  
ATOM 6051  C CG2  . ILE A 1 169 ? 21.057  10.234  -13.780 1.00 0.00 ? 169 ILE A CG2  2  
ATOM 6052  C CD1  . ILE A 1 169 ? 18.821  11.090  -15.575 1.00 0.00 ? 169 ILE A CD1  2  
ATOM 6053  H H    . ILE A 1 169 ? 17.558  11.409  -11.579 1.00 0.00 ? 169 ILE A H    2  
ATOM 6054  H HA   . ILE A 1 169 ? 18.554  9.328   -13.420 1.00 0.00 ? 169 ILE A HA   2  
ATOM 6055  H HB   . ILE A 1 169 ? 20.202  11.663  -12.456 1.00 0.00 ? 169 ILE A HB   2  
ATOM 6056  H HG12 . ILE A 1 169 ? 18.366  12.381  -13.970 1.00 0.00 ? 169 ILE A HG12 2  
ATOM 6057  H HG13 . ILE A 1 169 ? 19.963  12.619  -14.672 1.00 0.00 ? 169 ILE A HG13 2  
ATOM 6058  H HG21 . ILE A 1 169 ? 21.252  9.382   -13.138 1.00 0.00 ? 169 ILE A HG21 2  
ATOM 6059  H HG22 . ILE A 1 169 ? 21.928  10.872  -13.796 1.00 0.00 ? 169 ILE A HG22 2  
ATOM 6060  H HG23 . ILE A 1 169 ? 20.848  9.886   -14.782 1.00 0.00 ? 169 ILE A HG23 2  
ATOM 6061  H HD11 . ILE A 1 169 ? 19.057  11.650  -16.467 1.00 0.00 ? 169 ILE A HD11 2  
ATOM 6062  H HD12 . ILE A 1 169 ? 17.757  10.907  -15.537 1.00 0.00 ? 169 ILE A HD12 2  
ATOM 6063  H HD13 . ILE A 1 169 ? 19.347  10.148  -15.592 1.00 0.00 ? 169 ILE A HD13 2  
ATOM 6064  N N    . ILE A 1 170 ? 19.549  8.033   -11.584 1.00 0.00 ? 170 ILE A N    2  
ATOM 6065  C CA   . ILE A 1 170 ? 20.157  7.238   -10.526 1.00 0.00 ? 170 ILE A CA   2  
ATOM 6066  C C    . ILE A 1 170 ? 21.603  6.954   -10.882 1.00 0.00 ? 170 ILE A C    2  
ATOM 6067  O O    . ILE A 1 170 ? 21.914  5.988   -11.574 1.00 0.00 ? 170 ILE A O    2  
ATOM 6068  C CB   . ILE A 1 170 ? 19.429  5.907   -10.270 1.00 0.00 ? 170 ILE A CB   2  
ATOM 6069  C CG1  . ILE A 1 170 ? 18.105  5.845   -11.020 1.00 0.00 ? 170 ILE A CG1  2  
ATOM 6070  C CG2  . ILE A 1 170 ? 19.199  5.707   -8.779  1.00 0.00 ? 170 ILE A CG2  2  
ATOM 6071  C CD1  . ILE A 1 170 ? 17.480  4.482   -10.967 1.00 0.00 ? 170 ILE A CD1  2  
ATOM 6072  H H    . ILE A 1 170 ? 19.265  7.593   -12.412 1.00 0.00 ? 170 ILE A H    2  
ATOM 6073  H HA   . ILE A 1 170 ? 20.132  7.817   -9.618  1.00 0.00 ? 170 ILE A HA   2  
ATOM 6074  H HB   . ILE A 1 170 ? 20.065  5.109   -10.615 1.00 0.00 ? 170 ILE A HB   2  
ATOM 6075  H HG12 . ILE A 1 170 ? 17.411  6.546   -10.585 1.00 0.00 ? 170 ILE A HG12 2  
ATOM 6076  H HG13 . ILE A 1 170 ? 18.268  6.098   -12.053 1.00 0.00 ? 170 ILE A HG13 2  
ATOM 6077  H HG21 . ILE A 1 170 ? 18.356  5.048   -8.630  1.00 0.00 ? 170 ILE A HG21 2  
ATOM 6078  H HG22 . ILE A 1 170 ? 18.997  6.661   -8.315  1.00 0.00 ? 170 ILE A HG22 2  
ATOM 6079  H HG23 . ILE A 1 170 ? 20.081  5.271   -8.334  1.00 0.00 ? 170 ILE A HG23 2  
ATOM 6080  H HD11 . ILE A 1 170 ? 16.760  4.384   -11.761 1.00 0.00 ? 170 ILE A HD11 2  
ATOM 6081  H HD12 . ILE A 1 170 ? 16.995  4.351   -10.013 1.00 0.00 ? 170 ILE A HD12 2  
ATOM 6082  H HD13 . ILE A 1 170 ? 18.252  3.740   -11.085 1.00 0.00 ? 170 ILE A HD13 2  
ATOM 6083  N N    . ASP A 1 171 ? 22.473  7.827   -10.423 1.00 0.00 ? 171 ASP A N    2  
ATOM 6084  C CA   . ASP A 1 171 ? 23.899  7.715   -10.701 1.00 0.00 ? 171 ASP A CA   2  
ATOM 6085  C C    . ASP A 1 171 ? 24.661  7.168   -9.494  1.00 0.00 ? 171 ASP A C    2  
ATOM 6086  O O    . ASP A 1 171 ? 24.061  6.661   -8.546  1.00 0.00 ? 171 ASP A O    2  
ATOM 6087  C CB   . ASP A 1 171 ? 24.457  9.081   -11.111 1.00 0.00 ? 171 ASP A CB   2  
ATOM 6088  C CG   . ASP A 1 171 ? 24.599  10.035  -9.938  1.00 0.00 ? 171 ASP A CG   2  
ATOM 6089  O OD1  . ASP A 1 171 ? 23.697  10.050  -9.074  1.00 0.00 ? 171 ASP A OD1  2  
ATOM 6090  O OD2  . ASP A 1 171 ? 25.611  10.764  -9.885  1.00 0.00 ? 171 ASP A OD2  2  
ATOM 6091  H H    . ASP A 1 171 ? 22.142  8.576   -9.895  1.00 0.00 ? 171 ASP A H    2  
ATOM 6092  H HA   . ASP A 1 171 ? 24.019  7.029   -11.528 1.00 0.00 ? 171 ASP A HA   2  
ATOM 6093  H HB2  . ASP A 1 171 ? 25.428  8.947   -11.561 1.00 0.00 ? 171 ASP A HB2  2  
ATOM 6094  H HB3  . ASP A 1 171 ? 23.792  9.529   -11.835 1.00 0.00 ? 171 ASP A HB3  2  
ATOM 6095  N N    . LYS A 1 172 ? 25.987  7.274   -9.542  1.00 0.00 ? 172 LYS A N    2  
ATOM 6096  C CA   . LYS A 1 172 ? 26.840  6.792   -8.459  1.00 0.00 ? 172 LYS A CA   2  
ATOM 6097  C C    . LYS A 1 172 ? 26.835  5.267   -8.397  1.00 0.00 ? 172 LYS A C    2  
ATOM 6098  O O    . LYS A 1 172 ? 26.787  4.680   -7.316  1.00 0.00 ? 172 LYS A O    2  
ATOM 6099  C CB   . LYS A 1 172 ? 26.385  7.371   -7.117  1.00 0.00 ? 172 LYS A CB   2  
ATOM 6100  C CG   . LYS A 1 172 ? 27.399  7.187   -6.000  1.00 0.00 ? 172 LYS A CG   2  
ATOM 6101  C CD   . LYS A 1 172 ? 27.278  8.280   -4.951  1.00 0.00 ? 172 LYS A CD   2  
ATOM 6102  C CE   . LYS A 1 172 ? 26.252  7.922   -3.888  1.00 0.00 ? 172 LYS A CE   2  
ATOM 6103  N NZ   . LYS A 1 172 ? 24.972  8.659   -4.081  1.00 0.00 ? 172 LYS A NZ   2  
ATOM 6104  H H    . LYS A 1 172 ? 26.403  7.687   -10.327 1.00 0.00 ? 172 LYS A H    2  
ATOM 6105  H HA   . LYS A 1 172 ? 27.847  7.126   -8.660  1.00 0.00 ? 172 LYS A HA   2  
ATOM 6106  H HB2  . LYS A 1 172 ? 26.202  8.429   -7.237  1.00 0.00 ? 172 LYS A HB2  2  
ATOM 6107  H HB3  . LYS A 1 172 ? 25.465  6.887   -6.822  1.00 0.00 ? 172 LYS A HB3  2  
ATOM 6108  H HG2  . LYS A 1 172 ? 27.232  6.230   -5.529  1.00 0.00 ? 172 LYS A HG2  2  
ATOM 6109  H HG3  . LYS A 1 172 ? 28.393  7.214   -6.423  1.00 0.00 ? 172 LYS A HG3  2  
ATOM 6110  H HD2  . LYS A 1 172 ? 28.238  8.419   -4.477  1.00 0.00 ? 172 LYS A HD2  2  
ATOM 6111  H HD3  . LYS A 1 172 ? 26.978  9.198   -5.435  1.00 0.00 ? 172 LYS A HD3  2  
ATOM 6112  H HE2  . LYS A 1 172 ? 26.056  6.862   -3.936  1.00 0.00 ? 172 LYS A HE2  2  
ATOM 6113  H HE3  . LYS A 1 172 ? 26.657  8.169   -2.918  1.00 0.00 ? 172 LYS A HE3  2  
ATOM 6114  H HZ1  . LYS A 1 172 ? 24.869  8.941   -5.077  1.00 0.00 ? 172 LYS A HZ1  2  
ATOM 6115  H HZ2  . LYS A 1 172 ? 24.959  9.514   -3.489  1.00 0.00 ? 172 LYS A HZ2  2  
ATOM 6116  H HZ3  . LYS A 1 172 ? 24.168  8.055   -3.817  1.00 0.00 ? 172 LYS A HZ3  2  
ATOM 6117  N N    . LEU A 1 173 ? 26.891  4.631   -9.563  1.00 0.00 ? 173 LEU A N    2  
ATOM 6118  C CA   . LEU A 1 173 ? 26.899  3.174   -9.636  1.00 0.00 ? 173 LEU A CA   2  
ATOM 6119  C C    . LEU A 1 173 ? 28.026  2.677   -10.533 1.00 0.00 ? 173 LEU A C    2  
ATOM 6120  O O    . LEU A 1 173 ? 28.405  3.341   -11.496 1.00 0.00 ? 173 LEU A O    2  
ATOM 6121  C CB   . LEU A 1 173 ? 25.557  2.656   -10.155 1.00 0.00 ? 173 LEU A CB   2  
ATOM 6122  C CG   . LEU A 1 173 ? 24.327  3.345   -9.565  1.00 0.00 ? 173 LEU A CG   2  
ATOM 6123  C CD1  . LEU A 1 173 ? 23.862  4.468   -10.476 1.00 0.00 ? 173 LEU A CD1  2  
ATOM 6124  C CD2  . LEU A 1 173 ? 23.207  2.339   -9.346  1.00 0.00 ? 173 LEU A CD2  2  
ATOM 6125  H H    . LEU A 1 173 ? 26.936  5.153   -10.391 1.00 0.00 ? 173 LEU A H    2  
ATOM 6126  H HA   . LEU A 1 173 ? 27.058  2.795   -8.637  1.00 0.00 ? 173 LEU A HA   2  
ATOM 6127  H HB2  . LEU A 1 173 ? 25.537  2.784   -11.228 1.00 0.00 ? 173 LEU A HB2  2  
ATOM 6128  H HB3  . LEU A 1 173 ? 25.493  1.602   -9.934  1.00 0.00 ? 173 LEU A HB3  2  
ATOM 6129  H HG   . LEU A 1 173 ? 24.585  3.775   -8.609  1.00 0.00 ? 173 LEU A HG   2  
ATOM 6130  H HD11 . LEU A 1 173 ? 23.373  4.048   -11.341 1.00 0.00 ? 173 LEU A HD11 2  
ATOM 6131  H HD12 . LEU A 1 173 ? 24.714  5.051   -10.792 1.00 0.00 ? 173 LEU A HD12 2  
ATOM 6132  H HD13 . LEU A 1 173 ? 23.169  5.101   -9.942  1.00 0.00 ? 173 LEU A HD13 2  
ATOM 6133  H HD21 . LEU A 1 173 ? 23.625  1.347   -9.264  1.00 0.00 ? 173 LEU A HD21 2  
ATOM 6134  H HD22 . LEU A 1 173 ? 22.523  2.374   -10.181 1.00 0.00 ? 173 LEU A HD22 2  
ATOM 6135  H HD23 . LEU A 1 173 ? 22.677  2.583   -8.437  1.00 0.00 ? 173 LEU A HD23 2  
ATOM 6136  N N    . ILE A 1 174 ? 28.549  1.501   -10.213 1.00 0.00 ? 174 ILE A N    2  
ATOM 6137  C CA   . ILE A 1 174 ? 29.626  0.901   -10.990 1.00 0.00 ? 174 ILE A CA   2  
ATOM 6138  C C    . ILE A 1 174 ? 29.068  0.235   -12.246 1.00 0.00 ? 174 ILE A C    2  
ATOM 6139  O O    . ILE A 1 174 ? 28.027  -0.420  -12.190 1.00 0.00 ? 174 ILE A O    2  
ATOM 6140  C CB   . ILE A 1 174 ? 30.393  -0.146  -10.152 1.00 0.00 ? 174 ILE A CB   2  
ATOM 6141  C CG1  . ILE A 1 174 ? 31.565  -0.729  -10.945 1.00 0.00 ? 174 ILE A CG1  2  
ATOM 6142  C CG2  . ILE A 1 174 ? 29.454  -1.253  -9.697  1.00 0.00 ? 174 ILE A CG2  2  
ATOM 6143  C CD1  . ILE A 1 174 ? 32.837  0.082   -10.827 1.00 0.00 ? 174 ILE A CD1  2  
ATOM 6144  H H    . ILE A 1 174 ? 28.198  1.020   -9.437  1.00 0.00 ? 174 ILE A H    2  
ATOM 6145  H HA   . ILE A 1 174 ? 30.313  1.685   -11.275 1.00 0.00 ? 174 ILE A HA   2  
ATOM 6146  H HB   . ILE A 1 174 ? 30.776  0.347   -9.271  1.00 0.00 ? 174 ILE A HB   2  
ATOM 6147  H HG12 . ILE A 1 174 ? 31.774  -1.724  -10.582 1.00 0.00 ? 174 ILE A HG12 2  
ATOM 6148  H HG13 . ILE A 1 174 ? 31.297  -0.782  -11.989 1.00 0.00 ? 174 ILE A HG13 2  
ATOM 6149  H HG21 . ILE A 1 174 ? 30.025  -2.036  -9.221  1.00 0.00 ? 174 ILE A HG21 2  
ATOM 6150  H HG22 . ILE A 1 174 ? 28.933  -1.658  -10.552 1.00 0.00 ? 174 ILE A HG22 2  
ATOM 6151  H HG23 . ILE A 1 174 ? 28.738  -0.853  -8.995  1.00 0.00 ? 174 ILE A HG23 2  
ATOM 6152  H HD11 . ILE A 1 174 ? 33.515  -0.409  -10.145 1.00 0.00 ? 174 ILE A HD11 2  
ATOM 6153  H HD12 . ILE A 1 174 ? 32.602  1.068   -10.453 1.00 0.00 ? 174 ILE A HD12 2  
ATOM 6154  H HD13 . ILE A 1 174 ? 33.302  0.167   -11.798 1.00 0.00 ? 174 ILE A HD13 2  
ATOM 6155  N N    . PRO A 1 175 ? 29.747  0.395   -13.402 1.00 0.00 ? 175 PRO A N    2  
ATOM 6156  C CA   . PRO A 1 175 ? 29.304  -0.195  -14.668 1.00 0.00 ? 175 PRO A CA   2  
ATOM 6157  C C    . PRO A 1 175 ? 28.717  -1.593  -14.484 1.00 0.00 ? 175 PRO A C    2  
ATOM 6158  O O    . PRO A 1 175 ? 28.995  -2.262  -13.488 1.00 0.00 ? 175 PRO A O    2  
ATOM 6159  C CB   . PRO A 1 175 ? 30.592  -0.241  -15.483 1.00 0.00 ? 175 PRO A CB   2  
ATOM 6160  C CG   . PRO A 1 175 ? 31.385  0.929   -15.006 1.00 0.00 ? 175 PRO A CG   2  
ATOM 6161  C CD   . PRO A 1 175 ? 30.995  1.166   -13.567 1.00 0.00 ? 175 PRO A CD   2  
ATOM 6162  H HA   . PRO A 1 175 ? 28.581  0.434   -15.164 1.00 0.00 ? 175 PRO A HA   2  
ATOM 6163  H HB2  . PRO A 1 175 ? 31.107  -1.172  -15.299 1.00 0.00 ? 175 PRO A HB2  2  
ATOM 6164  H HB3  . PRO A 1 175 ? 30.358  -0.152  -16.532 1.00 0.00 ? 175 PRO A HB3  2  
ATOM 6165  H HG2  . PRO A 1 175 ? 32.439  0.707   -15.074 1.00 0.00 ? 175 PRO A HG2  2  
ATOM 6166  H HG3  . PRO A 1 175 ? 31.148  1.797   -15.604 1.00 0.00 ? 175 PRO A HG3  2  
ATOM 6167  H HD2  . PRO A 1 175 ? 31.764  0.800   -12.906 1.00 0.00 ? 175 PRO A HD2  2  
ATOM 6168  H HD3  . PRO A 1 175 ? 30.820  2.218   -13.395 1.00 0.00 ? 175 PRO A HD3  2  
ATOM 6169  N N    . ASN A 1 176 ? 27.886  -2.026  -15.431 1.00 0.00 ? 176 ASN A N    2  
ATOM 6170  C CA   . ASN A 1 176 ? 27.251  -3.336  -15.334 1.00 0.00 ? 176 ASN A CA   2  
ATOM 6171  C C    . ASN A 1 176 ? 26.340  -3.356  -14.104 1.00 0.00 ? 176 ASN A C    2  
ATOM 6172  O O    . ASN A 1 176 ? 26.666  -3.941  -13.070 1.00 0.00 ? 176 ASN A O    2  
ATOM 6173  C CB   . ASN A 1 176 ? 28.326  -4.434  -15.269 1.00 0.00 ? 176 ASN A CB   2  
ATOM 6174  C CG   . ASN A 1 176 ? 27.879  -5.687  -14.536 1.00 0.00 ? 176 ASN A CG   2  
ATOM 6175  O OD1  . ASN A 1 176 ? 26.994  -6.407  -14.997 1.00 0.00 ? 176 ASN A OD1  2  
ATOM 6176  N ND2  . ASN A 1 176 ? 28.491  -5.951  -13.387 1.00 0.00 ? 176 ASN A ND2  2  
ATOM 6177  H H    . ASN A 1 176 ? 27.684  -1.447  -16.196 1.00 0.00 ? 176 ASN A H    2  
ATOM 6178  H HA   . ASN A 1 176 ? 26.644  -3.480  -16.220 1.00 0.00 ? 176 ASN A HA   2  
ATOM 6179  H HB2  . ASN A 1 176 ? 28.599  -4.716  -16.270 1.00 0.00 ? 176 ASN A HB2  2  
ATOM 6180  H HB3  . ASN A 1 176 ? 29.196  -4.036  -14.774 1.00 0.00 ? 176 ASN A HB3  2  
ATOM 6181  H HD21 . ASN A 1 176 ? 29.187  -5.333  -13.081 1.00 0.00 ? 176 ASN A HD21 2  
ATOM 6182  H HD22 . ASN A 1 176 ? 28.222  -6.753  -12.893 1.00 0.00 ? 176 ASN A HD22 2  
ATOM 6183  N N    . THR A 1 177 ? 25.213  -2.664  -14.222 1.00 0.00 ? 177 THR A N    2  
ATOM 6184  C CA   . THR A 1 177 ? 24.253  -2.540  -13.137 1.00 0.00 ? 177 THR A CA   2  
ATOM 6185  C C    . THR A 1 177 ? 22.818  -2.655  -13.649 1.00 0.00 ? 177 THR A C    2  
ATOM 6186  O O    . THR A 1 177 ? 22.182  -1.645  -13.947 1.00 0.00 ? 177 THR A O    2  
ATOM 6187  C CB   . THR A 1 177 ? 24.434  -1.178  -12.474 1.00 0.00 ? 177 THR A CB   2  
ATOM 6188  O OG1  . THR A 1 177 ? 25.640  -0.567  -12.899 1.00 0.00 ? 177 THR A OG1  2  
ATOM 6189  C CG2  . THR A 1 177 ? 24.463  -1.235  -10.964 1.00 0.00 ? 177 THR A CG2  2  
ATOM 6190  H H    . THR A 1 177 ? 25.037  -2.196  -15.054 1.00 0.00 ? 177 THR A H    2  
ATOM 6191  H HA   . THR A 1 177 ? 24.445  -3.319  -12.416 1.00 0.00 ? 177 THR A HA   2  
ATOM 6192  H HB   . THR A 1 177 ? 23.609  -0.542  -12.773 1.00 0.00 ? 177 THR A HB   2  
ATOM 6193  H HG1  . THR A 1 177 ? 26.388  -1.074  -12.574 1.00 0.00 ? 177 THR A HG1  2  
ATOM 6194  H HG21 . THR A 1 177 ? 23.805  -0.479  -10.562 1.00 0.00 ? 177 THR A HG21 2  
ATOM 6195  H HG22 . THR A 1 177 ? 25.470  -1.057  -10.616 1.00 0.00 ? 177 THR A HG22 2  
ATOM 6196  H HG23 . THR A 1 177 ? 24.137  -2.210  -10.635 1.00 0.00 ? 177 THR A HG23 2  
ATOM 6197  N N    . ASN A 1 178 ? 22.303  -3.874  -13.753 1.00 0.00 ? 178 ASN A N    2  
ATOM 6198  C CA   . ASN A 1 178 ? 20.937  -4.066  -14.227 1.00 0.00 ? 178 ASN A CA   2  
ATOM 6199  C C    . ASN A 1 178 ? 19.962  -3.775  -13.092 1.00 0.00 ? 178 ASN A C    2  
ATOM 6200  O O    . ASN A 1 178 ? 19.920  -4.509  -12.105 1.00 0.00 ? 178 ASN A O    2  
ATOM 6201  C CB   . ASN A 1 178 ? 20.743  -5.483  -14.757 1.00 0.00 ? 178 ASN A CB   2  
ATOM 6202  C CG   . ASN A 1 178 ? 20.895  -6.538  -13.678 1.00 0.00 ? 178 ASN A CG   2  
ATOM 6203  O OD1  . ASN A 1 178 ? 19.945  -6.847  -12.958 1.00 0.00 ? 178 ASN A OD1  2  
ATOM 6204  N ND2  . ASN A 1 178 ? 22.094  -7.097  -13.561 1.00 0.00 ? 178 ASN A ND2  2  
ATOM 6205  H H    . ASN A 1 178 ? 22.845  -4.652  -13.505 1.00 0.00 ? 178 ASN A H    2  
ATOM 6206  H HA   . ASN A 1 178 ? 20.767  -3.368  -15.033 1.00 0.00 ? 178 ASN A HA   2  
ATOM 6207  H HB2  . ASN A 1 178 ? 19.755  -5.565  -15.182 1.00 0.00 ? 178 ASN A HB2  2  
ATOM 6208  H HB3  . ASN A 1 178 ? 21.476  -5.670  -15.527 1.00 0.00 ? 178 ASN A HB3  2  
ATOM 6209  H HD21 . ASN A 1 178 ? 22.803  -6.801  -14.169 1.00 0.00 ? 178 ASN A HD21 2  
ATOM 6210  H HD22 . ASN A 1 178 ? 22.219  -7.783  -12.872 1.00 0.00 ? 178 ASN A HD22 2  
ATOM 6211  N N    . TYR A 1 179 ? 19.206  -2.683  -13.205 1.00 0.00 ? 179 TYR A N    2  
ATOM 6212  C CA   . TYR A 1 179 ? 18.279  -2.305  -12.137 1.00 0.00 ? 179 TYR A CA   2  
ATOM 6213  C C    . TYR A 1 179 ? 16.828  -2.325  -12.551 1.00 0.00 ? 179 TYR A C    2  
ATOM 6214  O O    . TYR A 1 179 ? 16.464  -1.863  -13.631 1.00 0.00 ? 179 TYR A O    2  
ATOM 6215  C CB   . TYR A 1 179 ? 18.580  -0.907  -11.633 1.00 0.00 ? 179 TYR A CB   2  
ATOM 6216  C CG   . TYR A 1 179 ? 18.880  0.038   -12.748 1.00 0.00 ? 179 TYR A CG   2  
ATOM 6217  C CD1  . TYR A 1 179 ? 20.170  0.163   -13.217 1.00 0.00 ? 179 TYR A CD1  2  
ATOM 6218  C CD2  . TYR A 1 179 ? 17.874  0.783   -13.344 1.00 0.00 ? 179 TYR A CD2  2  
ATOM 6219  C CE1  . TYR A 1 179 ? 20.465  1.007   -14.254 1.00 0.00 ? 179 TYR A CE1  2  
ATOM 6220  C CE2  . TYR A 1 179 ? 18.153  1.638   -14.381 1.00 0.00 ? 179 TYR A CE2  2  
ATOM 6221  C CZ   . TYR A 1 179 ? 19.455  1.749   -14.838 1.00 0.00 ? 179 TYR A CZ   2  
ATOM 6222  O OH   . TYR A 1 179 ? 19.746  2.595   -15.879 1.00 0.00 ? 179 TYR A OH   2  
ATOM 6223  H H    . TYR A 1 179 ? 19.295  -2.109  -13.998 1.00 0.00 ? 179 TYR A H    2  
ATOM 6224  H HA   . TYR A 1 179 ? 18.417  -2.985  -11.329 1.00 0.00 ? 179 TYR A HA   2  
ATOM 6225  H HB2  . TYR A 1 179 ? 17.724  -0.529  -11.095 1.00 0.00 ? 179 TYR A HB2  2  
ATOM 6226  H HB3  . TYR A 1 179 ? 19.427  -0.935  -10.979 1.00 0.00 ? 179 TYR A HB3  2  
ATOM 6227  H HD1  . TYR A 1 179 ? 20.955  -0.412  -12.752 1.00 0.00 ? 179 TYR A HD1  2  
ATOM 6228  H HD2  . TYR A 1 179 ? 16.860  0.687   -12.985 1.00 0.00 ? 179 TYR A HD2  2  
ATOM 6229  H HE1  . TYR A 1 179 ? 21.482  1.087   -14.599 1.00 0.00 ? 179 TYR A HE1  2  
ATOM 6230  H HE2  . TYR A 1 179 ? 17.355  2.216   -14.829 1.00 0.00 ? 179 TYR A HE2  2  
ATOM 6231  H HH   . TYR A 1 179 ? 18.953  2.756   -16.396 1.00 0.00 ? 179 TYR A HH   2  
ATOM 6232  N N    . CYS A 1 180 ? 16.001  -2.782  -11.626 1.00 0.00 ? 180 CYS A N    2  
ATOM 6233  C CA   . CYS A 1 180 ? 14.570  -2.786  -11.814 1.00 0.00 ? 180 CYS A CA   2  
ATOM 6234  C C    . CYS A 1 180 ? 14.022  -1.536  -11.144 1.00 0.00 ? 180 CYS A C    2  
ATOM 6235  O O    . CYS A 1 180 ? 13.987  -1.445  -9.918  1.00 0.00 ? 180 CYS A O    2  
ATOM 6236  C CB   . CYS A 1 180 ? 13.946  -4.050  -11.227 1.00 0.00 ? 180 CYS A CB   2  
ATOM 6237  S SG   . CYS A 1 180 ? 13.564  -5.326  -12.476 1.00 0.00 ? 180 CYS A SG   2  
ATOM 6238  H H    . CYS A 1 180 ? 16.365  -3.064  -10.761 1.00 0.00 ? 180 CYS A H    2  
ATOM 6239  H HA   . CYS A 1 180 ? 14.363  -2.745  -12.868 1.00 0.00 ? 180 CYS A HA   2  
ATOM 6240  H HB2  . CYS A 1 180 ? 14.625  -4.480  -10.515 1.00 0.00 ? 180 CYS A HB2  2  
ATOM 6241  H HB3  . CYS A 1 180 ? 13.030  -3.791  -10.724 1.00 0.00 ? 180 CYS A HB3  2  
ATOM 6242  N N    . VAL A 1 181 ? 13.650  -0.551  -11.951 1.00 0.00 ? 181 VAL A N    2  
ATOM 6243  C CA   . VAL A 1 181 ? 13.150  0.710   -11.425 1.00 0.00 ? 181 VAL A CA   2  
ATOM 6244  C C    . VAL A 1 181 ? 11.633  0.703   -11.328 1.00 0.00 ? 181 VAL A C    2  
ATOM 6245  O O    . VAL A 1 181 ? 10.935  0.589   -12.337 1.00 0.00 ? 181 VAL A O    2  
ATOM 6246  C CB   . VAL A 1 181 ? 13.624  1.907   -12.286 1.00 0.00 ? 181 VAL A CB   2  
ATOM 6247  C CG1  . VAL A 1 181 ? 12.831  3.168   -11.963 1.00 0.00 ? 181 VAL A CG1  2  
ATOM 6248  C CG2  . VAL A 1 181 ? 15.113  2.144   -12.075 1.00 0.00 ? 181 VAL A CG2  2  
ATOM 6249  H H    . VAL A 1 181 ? 13.740  -0.664  -12.919 1.00 0.00 ? 181 VAL A H    2  
ATOM 6250  H HA   . VAL A 1 181 ? 13.555  0.836   -10.434 1.00 0.00 ? 181 VAL A HA   2  
ATOM 6251  H HB   . VAL A 1 181 ? 13.469  1.668   -13.328 1.00 0.00 ? 181 VAL A HB   2  
ATOM 6252  H HG11 . VAL A 1 181 ? 11.796  3.022   -12.235 1.00 0.00 ? 181 VAL A HG11 2  
ATOM 6253  H HG12 . VAL A 1 181 ? 13.235  4.000   -12.520 1.00 0.00 ? 181 VAL A HG12 2  
ATOM 6254  H HG13 . VAL A 1 181 ? 12.899  3.376   -10.905 1.00 0.00 ? 181 VAL A HG13 2  
ATOM 6255  H HG21 . VAL A 1 181 ? 15.557  1.269   -11.620 1.00 0.00 ? 181 VAL A HG21 2  
ATOM 6256  H HG22 . VAL A 1 181 ? 15.254  2.997   -11.428 1.00 0.00 ? 181 VAL A HG22 2  
ATOM 6257  H HG23 . VAL A 1 181 ? 15.586  2.333   -13.027 1.00 0.00 ? 181 VAL A HG23 2  
ATOM 6258  N N    . SER A 1 182 ? 11.130  0.839   -10.104 1.00 0.00 ? 182 SER A N    2  
ATOM 6259  C CA   . SER A 1 182 ? 9.695   0.870   -9.874  1.00 0.00 ? 182 SER A CA   2  
ATOM 6260  C C    . SER A 1 182 ? 9.229   2.305   -9.731  1.00 0.00 ? 182 SER A C    2  
ATOM 6261  O O    . SER A 1 182 ? 10.041  3.227   -9.625  1.00 0.00 ? 182 SER A O    2  
ATOM 6262  C CB   . SER A 1 182 ? 9.300   0.075   -8.630  1.00 0.00 ? 182 SER A CB   2  
ATOM 6263  O OG   . SER A 1 182 ? 7.894   0.079   -8.456  1.00 0.00 ? 182 SER A OG   2  
ATOM 6264  H H    . SER A 1 182 ? 11.740  0.936   -9.342  1.00 0.00 ? 182 SER A H    2  
ATOM 6265  H HA   . SER A 1 182 ? 9.214   0.434   -10.738 1.00 0.00 ? 182 SER A HA   2  
ATOM 6266  H HB2  . SER A 1 182 ? 9.632   -0.945  -8.733  1.00 0.00 ? 182 SER A HB2  2  
ATOM 6267  H HB3  . SER A 1 182 ? 9.757   0.518   -7.759  1.00 0.00 ? 182 SER A HB3  2  
ATOM 6268  H HG   . SER A 1 182 ? 7.516   -0.699  -8.872  1.00 0.00 ? 182 SER A HG   2  
ATOM 6269  N N    . VAL A 1 183 ? 7.923   2.490   -9.745  1.00 0.00 ? 183 VAL A N    2  
ATOM 6270  C CA   . VAL A 1 183 ? 7.346   3.816   -9.641  1.00 0.00 ? 183 VAL A CA   2  
ATOM 6271  C C    . VAL A 1 183 ? 6.157   3.833   -8.690  1.00 0.00 ? 183 VAL A C    2  
ATOM 6272  O O    . VAL A 1 183 ? 5.006   3.852   -9.128  1.00 0.00 ? 183 VAL A O    2  
ATOM 6273  C CB   . VAL A 1 183 ? 6.852   4.280   -11.011 1.00 0.00 ? 183 VAL A CB   2  
ATOM 6274  C CG1  . VAL A 1 183 ? 6.452   5.744   -10.975 1.00 0.00 ? 183 VAL A CG1  2  
ATOM 6275  C CG2  . VAL A 1 183 ? 7.899   4.016   -12.090 1.00 0.00 ? 183 VAL A CG2  2  
ATOM 6276  H H    . VAL A 1 183 ? 7.331   1.716   -9.843  1.00 0.00 ? 183 VAL A H    2  
ATOM 6277  H HA   . VAL A 1 183 ? 8.110   4.503   -9.292  1.00 0.00 ? 183 VAL A HA   2  
ATOM 6278  H HB   . VAL A 1 183 ? 5.975   3.698   -11.239 1.00 0.00 ? 183 VAL A HB   2  
ATOM 6279  H HG11 . VAL A 1 183 ? 5.774   5.952   -11.791 1.00 0.00 ? 183 VAL A HG11 2  
ATOM 6280  H HG12 . VAL A 1 183 ? 7.332   6.358   -11.072 1.00 0.00 ? 183 VAL A HG12 2  
ATOM 6281  H HG13 . VAL A 1 183 ? 5.963   5.961   -10.038 1.00 0.00 ? 183 VAL A HG13 2  
ATOM 6282  H HG21 . VAL A 1 183 ? 7.917   2.962   -12.324 1.00 0.00 ? 183 VAL A HG21 2  
ATOM 6283  H HG22 . VAL A 1 183 ? 8.872   4.320   -11.733 1.00 0.00 ? 183 VAL A HG22 2  
ATOM 6284  H HG23 . VAL A 1 183 ? 7.649   4.578   -12.979 1.00 0.00 ? 183 VAL A HG23 2  
ATOM 6285  N N    . TYR A 1 184 ? 6.425   3.831   -7.398  1.00 0.00 ? 184 TYR A N    2  
ATOM 6286  C CA   . TYR A 1 184 ? 5.356   3.853   -6.408  1.00 0.00 ? 184 TYR A CA   2  
ATOM 6287  C C    . TYR A 1 184 ? 5.363   5.176   -5.652  1.00 0.00 ? 184 TYR A C    2  
ATOM 6288  O O    . TYR A 1 184 ? 6.415   5.775   -5.458  1.00 0.00 ? 184 TYR A O    2  
ATOM 6289  C CB   . TYR A 1 184 ? 5.487   2.668   -5.449  1.00 0.00 ? 184 TYR A CB   2  
ATOM 6290  C CG   . TYR A 1 184 ? 6.647   2.742   -4.482  1.00 0.00 ? 184 TYR A CG   2  
ATOM 6291  C CD1  . TYR A 1 184 ? 6.609   3.592   -3.384  1.00 0.00 ? 184 TYR A CD1  2  
ATOM 6292  C CD2  . TYR A 1 184 ? 7.774   1.941   -4.653  1.00 0.00 ? 184 TYR A CD2  2  
ATOM 6293  C CE1  . TYR A 1 184 ? 7.659   3.647   -2.487  1.00 0.00 ? 184 TYR A CE1  2  
ATOM 6294  C CE2  . TYR A 1 184 ? 8.823   1.989   -3.758  1.00 0.00 ? 184 TYR A CE2  2  
ATOM 6295  C CZ   . TYR A 1 184 ? 8.762   2.843   -2.678  1.00 0.00 ? 184 TYR A CZ   2  
ATOM 6296  O OH   . TYR A 1 184 ? 9.807   2.891   -1.785  1.00 0.00 ? 184 TYR A OH   2  
ATOM 6297  H H    . TYR A 1 184 ? 7.351   3.819   -7.090  1.00 0.00 ? 184 TYR A H    2  
ATOM 6298  H HA   . TYR A 1 184 ? 4.419   3.766   -6.941  1.00 0.00 ? 184 TYR A HA   2  
ATOM 6299  H HB2  . TYR A 1 184 ? 4.584   2.583   -4.869  1.00 0.00 ? 184 TYR A HB2  2  
ATOM 6300  H HB3  . TYR A 1 184 ? 5.608   1.774   -6.031  1.00 0.00 ? 184 TYR A HB3  2  
ATOM 6301  H HD1  . TYR A 1 184 ? 5.743   4.220   -3.236  1.00 0.00 ? 184 TYR A HD1  2  
ATOM 6302  H HD2  . TYR A 1 184 ? 7.824   1.271   -5.503  1.00 0.00 ? 184 TYR A HD2  2  
ATOM 6303  H HE1  . TYR A 1 184 ? 7.611   4.316   -1.640  1.00 0.00 ? 184 TYR A HE1  2  
ATOM 6304  H HE2  . TYR A 1 184 ? 9.687   1.361   -3.907  1.00 0.00 ? 184 TYR A HE2  2  
ATOM 6305  H HH   . TYR A 1 184 ? 9.463   2.978   -0.893  1.00 0.00 ? 184 TYR A HH   2  
ATOM 6306  N N    . LEU A 1 185 ? 4.186   5.643   -5.249  1.00 0.00 ? 185 LEU A N    2  
ATOM 6307  C CA   . LEU A 1 185 ? 4.078   6.915   -4.543  1.00 0.00 ? 185 LEU A CA   2  
ATOM 6308  C C    . LEU A 1 185 ? 4.166   6.740   -3.033  1.00 0.00 ? 185 LEU A C    2  
ATOM 6309  O O    . LEU A 1 185 ? 4.206   5.622   -2.522  1.00 0.00 ? 185 LEU A O    2  
ATOM 6310  C CB   . LEU A 1 185 ? 2.770   7.616   -4.910  1.00 0.00 ? 185 LEU A CB   2  
ATOM 6311  C CG   . LEU A 1 185 ? 1.500   6.845   -4.554  1.00 0.00 ? 185 LEU A CG   2  
ATOM 6312  C CD1  . LEU A 1 185 ? 1.168   7.016   -3.079  1.00 0.00 ? 185 LEU A CD1  2  
ATOM 6313  C CD2  . LEU A 1 185 ? 0.341   7.307   -5.423  1.00 0.00 ? 185 LEU A CD2  2  
ATOM 6314  H H    . LEU A 1 185 ? 3.372   5.132   -5.445  1.00 0.00 ? 185 LEU A H    2  
ATOM 6315  H HA   . LEU A 1 185 ? 4.902   7.535   -4.864  1.00 0.00 ? 185 LEU A HA   2  
ATOM 6316  H HB2  . LEU A 1 185 ? 2.743   8.569   -4.402  1.00 0.00 ? 185 LEU A HB2  2  
ATOM 6317  H HB3  . LEU A 1 185 ? 2.769   7.794   -5.975  1.00 0.00 ? 185 LEU A HB3  2  
ATOM 6318  H HG   . LEU A 1 185 ? 1.660   5.793   -4.740  1.00 0.00 ? 185 LEU A HG   2  
ATOM 6319  H HD11 . LEU A 1 185 ? 1.581   6.190   -2.519  1.00 0.00 ? 185 LEU A HD11 2  
ATOM 6320  H HD12 . LEU A 1 185 ? 0.095   7.036   -2.951  1.00 0.00 ? 185 LEU A HD12 2  
ATOM 6321  H HD13 . LEU A 1 185 ? 1.591   7.942   -2.720  1.00 0.00 ? 185 LEU A HD13 2  
ATOM 6322  H HD21 . LEU A 1 185 ? 0.147   6.568   -6.186  1.00 0.00 ? 185 LEU A HD21 2  
ATOM 6323  H HD22 . LEU A 1 185 ? 0.594   8.246   -5.889  1.00 0.00 ? 185 LEU A HD22 2  
ATOM 6324  H HD23 . LEU A 1 185 ? -0.539  7.434   -4.812  1.00 0.00 ? 185 LEU A HD23 2  
ATOM 6325  N N    . GLU A 1 186 ? 4.194   7.867   -2.328  1.00 0.00 ? 186 GLU A N    2  
ATOM 6326  C CA   . GLU A 1 186 ? 4.279   7.865   -0.874  1.00 0.00 ? 186 GLU A CA   2  
ATOM 6327  C C    . GLU A 1 186 ? 3.503   9.040   -0.288  1.00 0.00 ? 186 GLU A C    2  
ATOM 6328  O O    . GLU A 1 186 ? 3.083   9.943   -1.012  1.00 0.00 ? 186 GLU A O    2  
ATOM 6329  C CB   . GLU A 1 186 ? 5.741   7.937   -0.430  1.00 0.00 ? 186 GLU A CB   2  
ATOM 6330  C CG   . GLU A 1 186 ? 6.459   9.188   -0.910  1.00 0.00 ? 186 GLU A CG   2  
ATOM 6331  C CD   . GLU A 1 186 ? 7.369   9.781   0.147   1.00 0.00 ? 186 GLU A CD   2  
ATOM 6332  O OE1  . GLU A 1 186 ? 6.879   10.063  1.261   1.00 0.00 ? 186 GLU A OE1  2  
ATOM 6333  O OE2  . GLU A 1 186 ? 8.571   9.963   -0.138  1.00 0.00 ? 186 GLU A OE2  2  
ATOM 6334  H H    . GLU A 1 186 ? 4.157   8.724   -2.801  1.00 0.00 ? 186 GLU A H    2  
ATOM 6335  H HA   . GLU A 1 186 ? 3.846   6.944   -0.515  1.00 0.00 ? 186 GLU A HA   2  
ATOM 6336  H HB2  . GLU A 1 186 ? 5.779   7.919   0.648   1.00 0.00 ? 186 GLU A HB2  2  
ATOM 6337  H HB3  . GLU A 1 186 ? 6.265   7.076   -0.816  1.00 0.00 ? 186 GLU A HB3  2  
ATOM 6338  H HG2  . GLU A 1 186 ? 7.054   8.936   -1.775  1.00 0.00 ? 186 GLU A HG2  2  
ATOM 6339  H HG3  . GLU A 1 186 ? 5.721   9.927   -1.186  1.00 0.00 ? 186 GLU A HG3  2  
ATOM 6340  N N    . HIS A 1 187 ? 3.320   9.023   1.026   1.00 0.00 ? 187 HIS A N    2  
ATOM 6341  C CA   . HIS A 1 187 ? 2.599   10.088  1.712   1.00 0.00 ? 187 HIS A CA   2  
ATOM 6342  C C    . HIS A 1 187 ? 3.191   10.335  3.095   1.00 0.00 ? 187 HIS A C    2  
ATOM 6343  O O    . HIS A 1 187 ? 3.491   11.472  3.460   1.00 0.00 ? 187 HIS A O    2  
ATOM 6344  C CB   . HIS A 1 187 ? 1.116   9.733   1.835   1.00 0.00 ? 187 HIS A CB   2  
ATOM 6345  C CG   . HIS A 1 187 ? 0.293   10.818  2.457   1.00 0.00 ? 187 HIS A CG   2  
ATOM 6346  N ND1  . HIS A 1 187 ? -0.513  10.614  3.558   1.00 0.00 ? 187 HIS A ND1  2  
ATOM 6347  C CD2  . HIS A 1 187 ? 0.153   12.124  2.128   1.00 0.00 ? 187 HIS A CD2  2  
ATOM 6348  C CE1  . HIS A 1 187 ? -1.111  11.748  3.878   1.00 0.00 ? 187 HIS A CE1  2  
ATOM 6349  N NE2  . HIS A 1 187 ? -0.724  12.679  3.027   1.00 0.00 ? 187 HIS A NE2  2  
ATOM 6350  H H    . HIS A 1 187 ? 3.681   8.276   1.549   1.00 0.00 ? 187 HIS A H    2  
ATOM 6351  H HA   . HIS A 1 187 ? 2.698   10.988  1.124   1.00 0.00 ? 187 HIS A HA   2  
ATOM 6352  H HB2  . HIS A 1 187 ? 0.717   9.536   0.851   1.00 0.00 ? 187 HIS A HB2  2  
ATOM 6353  H HB3  . HIS A 1 187 ? 1.014   8.846   2.443   1.00 0.00 ? 187 HIS A HB3  2  
ATOM 6354  H HD1  . HIS A 1 187 ? -0.628  9.765   4.033   1.00 0.00 ? 187 HIS A HD1  2  
ATOM 6355  H HD2  . HIS A 1 187 ? 0.642   12.634  1.309   1.00 0.00 ? 187 HIS A HD2  2  
ATOM 6356  H HE1  . HIS A 1 187 ? -1.800  11.889  4.698   1.00 0.00 ? 187 HIS A HE1  2  
ATOM 6357  H HE2  . HIS A 1 187 ? -0.939  13.632  3.097   1.00 0.00 ? 187 HIS A HE2  2  
ATOM 6358  N N    . SER A 1 188 ? 3.358   9.261   3.859   1.00 0.00 ? 188 SER A N    2  
ATOM 6359  C CA   . SER A 1 188 ? 3.917   9.353   5.203   1.00 0.00 ? 188 SER A CA   2  
ATOM 6360  C C    . SER A 1 188 ? 3.930   7.984   5.877   1.00 0.00 ? 188 SER A C    2  
ATOM 6361  O O    . SER A 1 188 ? 3.644   7.865   7.069   1.00 0.00 ? 188 SER A O    2  
ATOM 6362  C CB   . SER A 1 188 ? 3.114   10.345  6.049   1.00 0.00 ? 188 SER A CB   2  
ATOM 6363  O OG   . SER A 1 188 ? 3.665   11.648  5.968   1.00 0.00 ? 188 SER A OG   2  
ATOM 6364  H H    . SER A 1 188 ? 3.100   8.382   3.509   1.00 0.00 ? 188 SER A H    2  
ATOM 6365  H HA   . SER A 1 188 ? 4.933   9.707   5.116   1.00 0.00 ? 188 SER A HA   2  
ATOM 6366  H HB2  . SER A 1 188 ? 2.095   10.377  5.693   1.00 0.00 ? 188 SER A HB2  2  
ATOM 6367  H HB3  . SER A 1 188 ? 3.124   10.027  7.081   1.00 0.00 ? 188 SER A HB3  2  
ATOM 6368  H HG   . SER A 1 188 ? 3.893   11.844  5.056   1.00 0.00 ? 188 SER A HG   2  
ATOM 6369  N N    . ASP A 1 189 ? 4.260   6.952   5.107   1.00 0.00 ? 189 ASP A N    2  
ATOM 6370  C CA   . ASP A 1 189 ? 4.305   5.594   5.633   1.00 0.00 ? 189 ASP A CA   2  
ATOM 6371  C C    . ASP A 1 189 ? 5.029   4.653   4.676   1.00 0.00 ? 189 ASP A C    2  
ATOM 6372  O O    . ASP A 1 189 ? 5.123   4.920   3.478   1.00 0.00 ? 189 ASP A O    2  
ATOM 6373  C CB   . ASP A 1 189 ? 2.888   5.080   5.894   1.00 0.00 ? 189 ASP A CB   2  
ATOM 6374  C CG   . ASP A 1 189 ? 2.396   5.421   7.287   1.00 0.00 ? 189 ASP A CG   2  
ATOM 6375  O OD1  . ASP A 1 189 ? 3.074   5.042   8.265   1.00 0.00 ? 189 ASP A OD1  2  
ATOM 6376  O OD2  . ASP A 1 189 ? 1.333   6.066   7.399   1.00 0.00 ? 189 ASP A OD2  2  
ATOM 6377  H H    . ASP A 1 189 ? 4.476   7.108   4.164   1.00 0.00 ? 189 ASP A H    2  
ATOM 6378  H HA   . ASP A 1 189 ? 4.843   5.620   6.566   1.00 0.00 ? 189 ASP A HA   2  
ATOM 6379  H HB2  . ASP A 1 189 ? 2.214   5.523   5.176   1.00 0.00 ? 189 ASP A HB2  2  
ATOM 6380  H HB3  . ASP A 1 189 ? 2.875   4.006   5.779   1.00 0.00 ? 189 ASP A HB3  2  
ATOM 6381  N N    . GLU A 1 190 ? 5.528   3.544   5.214   1.00 0.00 ? 190 GLU A N    2  
ATOM 6382  C CA   . GLU A 1 190 ? 6.231   2.551   4.412   1.00 0.00 ? 190 GLU A CA   2  
ATOM 6383  C C    . GLU A 1 190 ? 5.305   1.391   4.075   1.00 0.00 ? 190 GLU A C    2  
ATOM 6384  O O    . GLU A 1 190 ? 5.746   0.253   3.909   1.00 0.00 ? 190 GLU A O    2  
ATOM 6385  C CB   . GLU A 1 190 ? 7.466   2.039   5.155   1.00 0.00 ? 190 GLU A CB   2  
ATOM 6386  C CG   . GLU A 1 190 ? 8.468   1.333   4.256   1.00 0.00 ? 190 GLU A CG   2  
ATOM 6387  C CD   . GLU A 1 190 ? 9.893   1.786   4.502   1.00 0.00 ? 190 GLU A CD   2  
ATOM 6388  O OE1  . GLU A 1 190 ? 10.113  3.009   4.633   1.00 0.00 ? 190 GLU A OE1  2  
ATOM 6389  O OE2  . GLU A 1 190 ? 10.790  0.919   4.564   1.00 0.00 ? 190 GLU A OE2  2  
ATOM 6390  H H    . GLU A 1 190 ? 5.410   3.385   6.174   1.00 0.00 ? 190 GLU A H    2  
ATOM 6391  H HA   . GLU A 1 190 ? 6.543   3.023   3.492   1.00 0.00 ? 190 GLU A HA   2  
ATOM 6392  H HB2  . GLU A 1 190 ? 7.962   2.876   5.624   1.00 0.00 ? 190 GLU A HB2  2  
ATOM 6393  H HB3  . GLU A 1 190 ? 7.150   1.344   5.920   1.00 0.00 ? 190 GLU A HB3  2  
ATOM 6394  H HG2  . GLU A 1 190 ? 8.409   0.270   4.436   1.00 0.00 ? 190 GLU A HG2  2  
ATOM 6395  H HG3  . GLU A 1 190 ? 8.213   1.536   3.226   1.00 0.00 ? 190 GLU A HG3  2  
ATOM 6396  N N    . GLN A 1 191 ? 4.017   1.694   3.969   1.00 0.00 ? 191 GLN A N    2  
ATOM 6397  C CA   . GLN A 1 191 ? 3.015   0.689   3.645   1.00 0.00 ? 191 GLN A CA   2  
ATOM 6398  C C    . GLN A 1 191 ? 2.242   1.078   2.386   1.00 0.00 ? 191 GLN A C    2  
ATOM 6399  O O    . GLN A 1 191 ? 1.504   0.266   1.829   1.00 0.00 ? 191 GLN A O    2  
ATOM 6400  C CB   . GLN A 1 191 ? 2.046   0.509   4.815   1.00 0.00 ? 191 GLN A CB   2  
ATOM 6401  C CG   . GLN A 1 191 ? 2.572   -0.412  5.904   1.00 0.00 ? 191 GLN A CG   2  
ATOM 6402  C CD   . GLN A 1 191 ? 2.205   -1.863  5.667   1.00 0.00 ? 191 GLN A CD   2  
ATOM 6403  O OE1  . GLN A 1 191 ? 1.081   -2.284  5.940   1.00 0.00 ? 191 GLN A OE1  2  
ATOM 6404  N NE2  . GLN A 1 191 ? 3.155   -2.637  5.155   1.00 0.00 ? 191 GLN A NE2  2  
ATOM 6405  H H    . GLN A 1 191 ? 3.732   2.621   4.106   1.00 0.00 ? 191 GLN A H    2  
ATOM 6406  H HA   . GLN A 1 191 ? 3.527   -0.244  3.466   1.00 0.00 ? 191 GLN A HA   2  
ATOM 6407  H HB2  . GLN A 1 191 ? 1.847   1.475   5.255   1.00 0.00 ? 191 GLN A HB2  2  
ATOM 6408  H HB3  . GLN A 1 191 ? 1.121   0.096   4.441   1.00 0.00 ? 191 GLN A HB3  2  
ATOM 6409  H HG2  . GLN A 1 191 ? 3.648   -0.329  5.939   1.00 0.00 ? 191 GLN A HG2  2  
ATOM 6410  H HG3  . GLN A 1 191 ? 2.157   -0.101  6.852   1.00 0.00 ? 191 GLN A HG3  2  
ATOM 6411  H HE21 . GLN A 1 191 ? 4.027   -2.233  4.961   1.00 0.00 ? 191 GLN A HE21 2  
ATOM 6412  H HE22 . GLN A 1 191 ? 2.945   -3.580  4.991   1.00 0.00 ? 191 GLN A HE22 2  
ATOM 6413  N N    . ALA A 1 192 ? 2.449   2.308   1.912   1.00 0.00 ? 192 ALA A N    2  
ATOM 6414  C CA   . ALA A 1 192 ? 1.811   2.783   0.693   1.00 0.00 ? 192 ALA A CA   2  
ATOM 6415  C C    . ALA A 1 192 ? 2.725   2.538   -0.503  1.00 0.00 ? 192 ALA A C    2  
ATOM 6416  O O    . ALA A 1 192 ? 2.900   3.419   -1.347  1.00 0.00 ? 192 ALA A O    2  
ATOM 6417  C CB   . ALA A 1 192 ? 1.479   4.265   0.816   1.00 0.00 ? 192 ALA A CB   2  
ATOM 6418  H H    . ALA A 1 192 ? 3.094   2.900   2.348   1.00 0.00 ? 192 ALA A H    2  
ATOM 6419  H HA   . ALA A 1 192 ? 0.890   2.235   0.556   1.00 0.00 ? 192 ALA A HA   2  
ATOM 6420  H HB1  . ALA A 1 192 ? 2.077   4.703   1.603   1.00 0.00 ? 192 ALA A HB1  2  
ATOM 6421  H HB2  . ALA A 1 192 ? 0.432   4.381   1.053   1.00 0.00 ? 192 ALA A HB2  2  
ATOM 6422  H HB3  . ALA A 1 192 ? 1.694   4.764   -0.119  1.00 0.00 ? 192 ALA A HB3  2  
ATOM 6423  N N    . VAL A 1 193 ? 3.344   1.363   -0.561  1.00 0.00 ? 193 VAL A N    2  
ATOM 6424  C CA   . VAL A 1 193 ? 4.271   1.069   -1.648  1.00 0.00 ? 193 VAL A CA   2  
ATOM 6425  C C    . VAL A 1 193 ? 3.596   0.445   -2.856  1.00 0.00 ? 193 VAL A C    2  
ATOM 6426  O O    . VAL A 1 193 ? 3.630   -0.770  -3.053  1.00 0.00 ? 193 VAL A O    2  
ATOM 6427  C CB   . VAL A 1 193 ? 5.431   0.152   -1.229  1.00 0.00 ? 193 VAL A CB   2  
ATOM 6428  C CG1  . VAL A 1 193 ? 6.664   0.969   -0.876  1.00 0.00 ? 193 VAL A CG1  2  
ATOM 6429  C CG2  . VAL A 1 193 ? 5.038   -0.766  -0.082  1.00 0.00 ? 193 VAL A CG2  2  
ATOM 6430  H H    . VAL A 1 193 ? 3.197   0.704   0.147   1.00 0.00 ? 193 VAL A H    2  
ATOM 6431  H HA   . VAL A 1 193 ? 4.700   2.011   -1.958  1.00 0.00 ? 193 VAL A HA   2  
ATOM 6432  H HB   . VAL A 1 193 ? 5.675   -0.460  -2.082  1.00 0.00 ? 193 VAL A HB   2  
ATOM 6433  H HG11 . VAL A 1 193 ? 7.367   0.927   -1.695  1.00 0.00 ? 193 VAL A HG11 2  
ATOM 6434  H HG12 . VAL A 1 193 ? 7.123   0.564   0.014   1.00 0.00 ? 193 VAL A HG12 2  
ATOM 6435  H HG13 . VAL A 1 193 ? 6.378   1.995   -0.699  1.00 0.00 ? 193 VAL A HG13 2  
ATOM 6436  H HG21 . VAL A 1 193 ? 5.151   -0.239  0.856   1.00 0.00 ? 193 VAL A HG21 2  
ATOM 6437  H HG22 . VAL A 1 193 ? 5.677   -1.637  -0.086  1.00 0.00 ? 193 VAL A HG22 2  
ATOM 6438  H HG23 . VAL A 1 193 ? 4.011   -1.073  -0.203  1.00 0.00 ? 193 VAL A HG23 2  
ATOM 6439  N N    . ILE A 1 194 ? 3.030   1.299   -3.681  1.00 0.00 ? 194 ILE A N    2  
ATOM 6440  C CA   . ILE A 1 194 ? 2.388   0.865   -4.912  1.00 0.00 ? 194 ILE A CA   2  
ATOM 6441  C C    . ILE A 1 194 ? 3.472   0.613   -5.952  1.00 0.00 ? 194 ILE A C    2  
ATOM 6442  O O    . ILE A 1 194 ? 3.519   1.260   -6.998  1.00 0.00 ? 194 ILE A O    2  
ATOM 6443  C CB   . ILE A 1 194 ? 1.391   1.913   -5.446  1.00 0.00 ? 194 ILE A CB   2  
ATOM 6444  C CG1  . ILE A 1 194 ? 0.568   2.508   -4.296  1.00 0.00 ? 194 ILE A CG1  2  
ATOM 6445  C CG2  . ILE A 1 194 ? 0.483   1.289   -6.497  1.00 0.00 ? 194 ILE A CG2  2  
ATOM 6446  C CD1  . ILE A 1 194 ? -0.479  1.565   -3.742  1.00 0.00 ? 194 ILE A CD1  2  
ATOM 6447  H H    . ILE A 1 194 ? 3.073   2.246   -3.458  1.00 0.00 ? 194 ILE A H    2  
ATOM 6448  H HA   . ILE A 1 194 ? 1.859   -0.057  -4.715  1.00 0.00 ? 194 ILE A HA   2  
ATOM 6449  H HB   . ILE A 1 194 ? 1.956   2.703   -5.920  1.00 0.00 ? 194 ILE A HB   2  
ATOM 6450  H HG12 . ILE A 1 194 ? 1.230   2.775   -3.488  1.00 0.00 ? 194 ILE A HG12 2  
ATOM 6451  H HG13 . ILE A 1 194 ? 0.064   3.396   -4.646  1.00 0.00 ? 194 ILE A HG13 2  
ATOM 6452  H HG21 . ILE A 1 194 ? -0.339  1.956   -6.705  1.00 0.00 ? 194 ILE A HG21 2  
ATOM 6453  H HG22 . ILE A 1 194 ? 0.100   0.349   -6.130  1.00 0.00 ? 194 ILE A HG22 2  
ATOM 6454  H HG23 . ILE A 1 194 ? 1.046   1.119   -7.403  1.00 0.00 ? 194 ILE A HG23 2  
ATOM 6455  H HD11 . ILE A 1 194 ? 0.007   0.740   -3.242  1.00 0.00 ? 194 ILE A HD11 2  
ATOM 6456  H HD12 . ILE A 1 194 ? -1.088  1.187   -4.550  1.00 0.00 ? 194 ILE A HD12 2  
ATOM 6457  H HD13 . ILE A 1 194 ? -1.104  2.094   -3.038  1.00 0.00 ? 194 ILE A HD13 2  
ATOM 6458  N N    . LYS A 1 195 ? 4.364   -0.317  -5.624  1.00 0.00 ? 195 LYS A N    2  
ATOM 6459  C CA   . LYS A 1 195 ? 5.489   -0.658  -6.482  1.00 0.00 ? 195 LYS A CA   2  
ATOM 6460  C C    . LYS A 1 195 ? 5.031   -1.383  -7.742  1.00 0.00 ? 195 LYS A C    2  
ATOM 6461  O O    . LYS A 1 195 ? 4.792   -2.591  -7.729  1.00 0.00 ? 195 LYS A O    2  
ATOM 6462  C CB   . LYS A 1 195 ? 6.494   -1.501  -5.687  1.00 0.00 ? 195 LYS A CB   2  
ATOM 6463  C CG   . LYS A 1 195 ? 7.603   -2.110  -6.528  1.00 0.00 ? 195 LYS A CG   2  
ATOM 6464  C CD   . LYS A 1 195 ? 8.404   -3.127  -5.734  1.00 0.00 ? 195 LYS A CD   2  
ATOM 6465  C CE   . LYS A 1 195 ? 9.089   -2.480  -4.541  1.00 0.00 ? 195 LYS A CE   2  
ATOM 6466  N NZ   . LYS A 1 195 ? 8.340   -2.710  -3.274  1.00 0.00 ? 195 LYS A NZ   2  
ATOM 6467  H H    . LYS A 1 195 ? 4.269   -0.780  -4.768  1.00 0.00 ? 195 LYS A H    2  
ATOM 6468  H HA   . LYS A 1 195 ? 5.968   0.259   -6.777  1.00 0.00 ? 195 LYS A HA   2  
ATOM 6469  H HB2  . LYS A 1 195 ? 6.952   -0.871  -4.938  1.00 0.00 ? 195 LYS A HB2  2  
ATOM 6470  H HB3  . LYS A 1 195 ? 5.964   -2.300  -5.188  1.00 0.00 ? 195 LYS A HB3  2  
ATOM 6471  H HG2  . LYS A 1 195 ? 7.168   -2.596  -7.386  1.00 0.00 ? 195 LYS A HG2  2  
ATOM 6472  H HG3  . LYS A 1 195 ? 8.265   -1.323  -6.855  1.00 0.00 ? 195 LYS A HG3  2  
ATOM 6473  H HD2  . LYS A 1 195 ? 7.738   -3.899  -5.379  1.00 0.00 ? 195 LYS A HD2  2  
ATOM 6474  H HD3  . LYS A 1 195 ? 9.155   -3.562  -6.377  1.00 0.00 ? 195 LYS A HD3  2  
ATOM 6475  H HE2  . LYS A 1 195 ? 10.081  -2.894  -4.442  1.00 0.00 ? 195 LYS A HE2  2  
ATOM 6476  H HE3  . LYS A 1 195 ? 9.162   -1.416  -4.717  1.00 0.00 ? 195 LYS A HE3  2  
ATOM 6477  H HZ1  . LYS A 1 195 ? 8.892   -3.319  -2.637  1.00 0.00 ? 195 LYS A HZ1  2  
ATOM 6478  H HZ2  . LYS A 1 195 ? 7.430   -3.172  -3.473  1.00 0.00 ? 195 LYS A HZ2  2  
ATOM 6479  H HZ3  . LYS A 1 195 ? 8.157   -1.804  -2.797  1.00 0.00 ? 195 LYS A HZ3  2  
ATOM 6480  N N    . SER A 1 196 ? 4.912   -0.627  -8.832  1.00 0.00 ? 196 SER A N    2  
ATOM 6481  C CA   . SER A 1 196 ? 4.484   -1.190  -10.107 1.00 0.00 ? 196 SER A CA   2  
ATOM 6482  C C    . SER A 1 196 ? 5.574   -2.082  -10.690 1.00 0.00 ? 196 SER A C    2  
ATOM 6483  O O    . SER A 1 196 ? 6.733   -1.997  -10.284 1.00 0.00 ? 196 SER A O    2  
ATOM 6484  C CB   . SER A 1 196 ? 4.142   -0.073  -11.095 1.00 0.00 ? 196 SER A CB   2  
ATOM 6485  O OG   . SER A 1 196 ? 5.105   0.965   -11.045 1.00 0.00 ? 196 SER A OG   2  
ATOM 6486  H H    . SER A 1 196 ? 5.119   0.336   -8.771  1.00 0.00 ? 196 SER A H    2  
ATOM 6487  H HA   . SER A 1 196 ? 3.602   -1.787  -9.929  1.00 0.00 ? 196 SER A HA   2  
ATOM 6488  H HB2  . SER A 1 196 ? 4.117   -0.476  -12.096 1.00 0.00 ? 196 SER A HB2  2  
ATOM 6489  H HB3  . SER A 1 196 ? 3.175   0.338   -10.849 1.00 0.00 ? 196 SER A HB3  2  
ATOM 6490  H HG   . SER A 1 196 ? 5.987   0.585   -11.055 1.00 0.00 ? 196 SER A HG   2  
ATOM 6491  N N    . PRO A 1 197 ? 5.226   -2.946  -11.659 1.00 0.00 ? 197 PRO A N    2  
ATOM 6492  C CA   . PRO A 1 197 ? 6.199   -3.838  -12.290 1.00 0.00 ? 197 PRO A CA   2  
ATOM 6493  C C    . PRO A 1 197 ? 7.424   -3.074  -12.762 1.00 0.00 ? 197 PRO A C    2  
ATOM 6494  O O    . PRO A 1 197 ? 7.375   -2.345  -13.753 1.00 0.00 ? 197 PRO A O    2  
ATOM 6495  C CB   . PRO A 1 197 ? 5.440   -4.421  -13.475 1.00 0.00 ? 197 PRO A CB   2  
ATOM 6496  C CG   . PRO A 1 197 ? 4.004   -4.343  -13.081 1.00 0.00 ? 197 PRO A CG   2  
ATOM 6497  C CD   . PRO A 1 197 ? 3.874   -3.114  -12.220 1.00 0.00 ? 197 PRO A CD   2  
ATOM 6498  H HA   . PRO A 1 197 ? 6.503   -4.632  -11.622 1.00 0.00 ? 197 PRO A HA   2  
ATOM 6499  H HB2  . PRO A 1 197 ? 5.645   -3.833  -14.357 1.00 0.00 ? 197 PRO A HB2  2  
ATOM 6500  H HB3  . PRO A 1 197 ? 5.754   -5.441  -13.632 1.00 0.00 ? 197 PRO A HB3  2  
ATOM 6501  H HG2  . PRO A 1 197 ? 3.387   -4.250  -13.962 1.00 0.00 ? 197 PRO A HG2  2  
ATOM 6502  H HG3  . PRO A 1 197 ? 3.729   -5.223  -12.520 1.00 0.00 ? 197 PRO A HG3  2  
ATOM 6503  H HD2  . PRO A 1 197 ? 3.598   -2.260  -12.821 1.00 0.00 ? 197 PRO A HD2  2  
ATOM 6504  H HD3  . PRO A 1 197 ? 3.149   -3.275  -11.436 1.00 0.00 ? 197 PRO A HD3  2  
ATOM 6505  N N    . LEU A 1 198 ? 8.510   -3.219  -12.023 1.00 0.00 ? 198 LEU A N    2  
ATOM 6506  C CA   . LEU A 1 198 ? 9.749   -2.517  -12.329 1.00 0.00 ? 198 LEU A CA   2  
ATOM 6507  C C    . LEU A 1 198 ? 10.168  -2.653  -13.771 1.00 0.00 ? 198 LEU A C    2  
ATOM 6508  O O    . LEU A 1 198 ? 9.586   -3.392  -14.566 1.00 0.00 ? 198 LEU A O    2  
ATOM 6509  C CB   . LEU A 1 198 ? 10.914  -3.032  -11.479 1.00 0.00 ? 198 LEU A CB   2  
ATOM 6510  C CG   . LEU A 1 198 ? 10.638  -3.129  -9.995  1.00 0.00 ? 198 LEU A CG   2  
ATOM 6511  C CD1  . LEU A 1 198 ? 10.734  -4.575  -9.545  1.00 0.00 ? 198 LEU A CD1  2  
ATOM 6512  C CD2  . LEU A 1 198 ? 11.606  -2.264  -9.206  1.00 0.00 ? 198 LEU A CD2  2  
ATOM 6513  H H    . LEU A 1 198 ? 8.473   -3.792  -11.231 1.00 0.00 ? 198 LEU A H    2  
ATOM 6514  H HA   . LEU A 1 198 ? 9.600   -1.473  -12.108 1.00 0.00 ? 198 LEU A HA   2  
ATOM 6515  H HB2  . LEU A 1 198 ? 11.189  -4.014  -11.838 1.00 0.00 ? 198 LEU A HB2  2  
ATOM 6516  H HB3  . LEU A 1 198 ? 11.759  -2.375  -11.622 1.00 0.00 ? 198 LEU A HB3  2  
ATOM 6517  H HG   . LEU A 1 198 ? 9.642   -2.771  -9.817  1.00 0.00 ? 198 LEU A HG   2  
ATOM 6518  H HD11 . LEU A 1 198 ? 9.818   -5.091  -9.786  1.00 0.00 ? 198 LEU A HD11 2  
ATOM 6519  H HD12 . LEU A 1 198 ? 10.902  -4.611  -8.479  1.00 0.00 ? 198 LEU A HD12 2  
ATOM 6520  H HD13 . LEU A 1 198 ? 11.563  -5.049  -10.058 1.00 0.00 ? 198 LEU A HD13 2  
ATOM 6521  H HD21 . LEU A 1 198 ? 12.528  -2.806  -9.053  1.00 0.00 ? 198 LEU A HD21 2  
ATOM 6522  H HD22 . LEU A 1 198 ? 11.172  -2.018  -8.248  1.00 0.00 ? 198 LEU A HD22 2  
ATOM 6523  H HD23 . LEU A 1 198 ? 11.807  -1.357  -9.755  1.00 0.00 ? 198 LEU A HD23 2  
ATOM 6524  N N    . LYS A 1 199 ? 11.246  -1.959  -14.044 1.00 0.00 ? 199 LYS A N    2  
ATOM 6525  C CA   . LYS A 1 199 ? 11.899  -1.973  -15.338 1.00 0.00 ? 199 LYS A CA   2  
ATOM 6526  C C    . LYS A 1 199 ? 13.364  -2.282  -15.079 1.00 0.00 ? 199 LYS A C    2  
ATOM 6527  O O    . LYS A 1 199 ? 14.068  -1.484  -14.464 1.00 0.00 ? 199 LYS A O    2  
ATOM 6528  C CB   . LYS A 1 199 ? 11.738  -0.632  -16.060 1.00 0.00 ? 199 LYS A CB   2  
ATOM 6529  C CG   . LYS A 1 199 ? 12.521  -0.555  -17.360 1.00 0.00 ? 199 LYS A CG   2  
ATOM 6530  C CD   . LYS A 1 199 ? 11.940  0.471   -18.319 1.00 0.00 ? 199 LYS A CD   2  
ATOM 6531  C CE   . LYS A 1 199 ? 12.562  0.366   -19.706 1.00 0.00 ? 199 LYS A CE   2  
ATOM 6532  N NZ   . LYS A 1 199 ? 13.978  -0.098  -19.656 1.00 0.00 ? 199 LYS A NZ   2  
ATOM 6533  H H    . LYS A 1 199 ? 11.653  -1.442  -13.309 1.00 0.00 ? 199 LYS A H    2  
ATOM 6534  H HA   . LYS A 1 199 ? 11.465  -2.766  -15.931 1.00 0.00 ? 199 LYS A HA   2  
ATOM 6535  H HB2  . LYS A 1 199 ? 10.693  -0.478  -16.283 1.00 0.00 ? 199 LYS A HB2  2  
ATOM 6536  H HB3  . LYS A 1 199 ? 12.081  0.159   -15.410 1.00 0.00 ? 199 LYS A HB3  2  
ATOM 6537  H HG2  . LYS A 1 199 ? 13.535  -0.279  -17.133 1.00 0.00 ? 199 LYS A HG2  2  
ATOM 6538  H HG3  . LYS A 1 199 ? 12.508  -1.525  -17.833 1.00 0.00 ? 199 LYS A HG3  2  
ATOM 6539  H HD2  . LYS A 1 199 ? 10.876  0.314   -18.402 1.00 0.00 ? 199 LYS A HD2  2  
ATOM 6540  H HD3  . LYS A 1 199 ? 12.128  1.459   -17.927 1.00 0.00 ? 199 LYS A HD3  2  
ATOM 6541  H HE2  . LYS A 1 199 ? 11.986  -0.334  -20.292 1.00 0.00 ? 199 LYS A HE2  2  
ATOM 6542  H HE3  . LYS A 1 199 ? 12.529  1.339   -20.175 1.00 0.00 ? 199 LYS A HE3  2  
ATOM 6543  H HZ1  . LYS A 1 199 ? 14.393  -0.081  -20.610 1.00 0.00 ? 199 LYS A HZ1  2  
ATOM 6544  H HZ2  . LYS A 1 199 ? 14.024  -1.069  -19.288 1.00 0.00 ? 199 LYS A HZ2  2  
ATOM 6545  H HZ3  . LYS A 1 199 ? 14.536  0.523   -19.036 1.00 0.00 ? 199 LYS A HZ3  2  
ATOM 6546  N N    . CYS A 1 200 ? 13.816  -3.450  -15.511 1.00 0.00 ? 200 CYS A N    2  
ATOM 6547  C CA   . CYS A 1 200 ? 15.192  -3.853  -15.267 1.00 0.00 ? 200 CYS A CA   2  
ATOM 6548  C C    . CYS A 1 200 ? 16.115  -3.456  -16.416 1.00 0.00 ? 200 CYS A C    2  
ATOM 6549  O O    . CYS A 1 200 ? 16.523  -4.298  -17.216 1.00 0.00 ? 200 CYS A O    2  
ATOM 6550  C CB   . CYS A 1 200 ? 15.261  -5.360  -15.019 1.00 0.00 ? 200 CYS A CB   2  
ATOM 6551  S SG   . CYS A 1 200 ? 15.380  -5.815  -13.253 1.00 0.00 ? 200 CYS A SG   2  
ATOM 6552  H H    . CYS A 1 200 ? 13.218  -4.058  -15.994 1.00 0.00 ? 200 CYS A H    2  
ATOM 6553  H HA   . CYS A 1 200 ? 15.517  -3.348  -14.373 1.00 0.00 ? 200 CYS A HA   2  
ATOM 6554  H HB2  . CYS A 1 200 ? 14.371  -5.824  -15.418 1.00 0.00 ? 200 CYS A HB2  2  
ATOM 6555  H HB3  . CYS A 1 200 ? 16.128  -5.763  -15.522 1.00 0.00 ? 200 CYS A HB3  2  
ATOM 6556  N N    . THR A 1 201 ? 16.441  -2.167  -16.494 1.00 0.00 ? 201 THR A N    2  
ATOM 6557  C CA   . THR A 1 201 ? 17.315  -1.668  -17.549 1.00 0.00 ? 201 THR A CA   2  
ATOM 6558  C C    . THR A 1 201 ? 18.781  -1.667  -17.103 1.00 0.00 ? 201 THR A C    2  
ATOM 6559  O O    . THR A 1 201 ? 19.146  -1.038  -16.107 1.00 0.00 ? 201 THR A O    2  
ATOM 6560  C CB   . THR A 1 201 ? 16.877  -0.264  -18.008 1.00 0.00 ? 201 THR A CB   2  
ATOM 6561  O OG1  . THR A 1 201 ? 16.891  -0.180  -19.422 1.00 0.00 ? 201 THR A OG1  2  
ATOM 6562  C CG2  . THR A 1 201 ? 17.740  0.870   -17.482 1.00 0.00 ? 201 THR A CG2  2  
ATOM 6563  H H    . THR A 1 201 ? 16.080  -1.543  -15.833 1.00 0.00 ? 201 THR A H    2  
ATOM 6564  H HA   . THR A 1 201 ? 17.213  -2.340  -18.385 1.00 0.00 ? 201 THR A HA   2  
ATOM 6565  H HB   . THR A 1 201 ? 15.865  -0.091  -17.675 1.00 0.00 ? 201 THR A HB   2  
ATOM 6566  H HG1  . THR A 1 201 ? 16.587  0.689   -19.695 1.00 0.00 ? 201 THR A HG1  2  
ATOM 6567  H HG21 . THR A 1 201 ? 18.641  0.943   -18.073 1.00 0.00 ? 201 THR A HG21 2  
ATOM 6568  H HG22 . THR A 1 201 ? 17.998  0.675   -16.458 1.00 0.00 ? 201 THR A HG22 2  
ATOM 6569  H HG23 . THR A 1 201 ? 17.194  1.800   -17.543 1.00 0.00 ? 201 THR A HG23 2  
ATOM 6570  N N    . LEU A 1 202 ? 19.610  -2.395  -17.842 1.00 0.00 ? 202 LEU A N    2  
ATOM 6571  C CA   . LEU A 1 202 ? 21.034  -2.492  -17.538 1.00 0.00 ? 202 LEU A CA   2  
ATOM 6572  C C    . LEU A 1 202 ? 21.802  -1.384  -18.268 1.00 0.00 ? 202 LEU A C    2  
ATOM 6573  O O    . LEU A 1 202 ? 21.292  -0.800  -19.224 1.00 0.00 ? 202 LEU A O    2  
ATOM 6574  C CB   . LEU A 1 202 ? 21.549  -3.878  -17.946 1.00 0.00 ? 202 LEU A CB   2  
ATOM 6575  C CG   . LEU A 1 202 ? 23.022  -4.190  -17.639 1.00 0.00 ? 202 LEU A CG   2  
ATOM 6576  C CD1  . LEU A 1 202 ? 23.445  -3.679  -16.272 1.00 0.00 ? 202 LEU A CD1  2  
ATOM 6577  C CD2  . LEU A 1 202 ? 23.253  -5.685  -17.711 1.00 0.00 ? 202 LEU A CD2  2  
ATOM 6578  H H    . LEU A 1 202 ? 19.246  -2.894  -18.603 1.00 0.00 ? 202 LEU A H    2  
ATOM 6579  H HA   . LEU A 1 202 ? 21.154  -2.370  -16.474 1.00 0.00 ? 202 LEU A HA   2  
ATOM 6580  H HB2  . LEU A 1 202 ? 20.942  -4.617  -17.445 1.00 0.00 ? 202 LEU A HB2  2  
ATOM 6581  H HB3  . LEU A 1 202 ? 21.400  -3.986  -19.008 1.00 0.00 ? 202 LEU A HB3  2  
ATOM 6582  H HG   . LEU A 1 202 ? 23.651  -3.720  -18.379 1.00 0.00 ? 202 LEU A HG   2  
ATOM 6583  H HD11 . LEU A 1 202 ? 23.482  -4.502  -15.575 1.00 0.00 ? 202 LEU A HD11 2  
ATOM 6584  H HD12 . LEU A 1 202 ? 22.743  -2.941  -15.918 1.00 0.00 ? 202 LEU A HD12 2  
ATOM 6585  H HD13 . LEU A 1 202 ? 24.423  -3.236  -16.350 1.00 0.00 ? 202 LEU A HD13 2  
ATOM 6586  H HD21 . LEU A 1 202 ? 22.560  -6.181  -17.046 1.00 0.00 ? 202 LEU A HD21 2  
ATOM 6587  H HD22 . LEU A 1 202 ? 24.265  -5.906  -17.407 1.00 0.00 ? 202 LEU A HD22 2  
ATOM 6588  H HD23 . LEU A 1 202 ? 23.093  -6.028  -18.722 1.00 0.00 ? 202 LEU A HD23 2  
ATOM 6589  N N    . LEU A 1 203 ? 23.026  -1.099  -17.825 1.00 0.00 ? 203 LEU A N    2  
ATOM 6590  C CA   . LEU A 1 203 ? 23.846  -0.068  -18.448 1.00 0.00 ? 203 LEU A CA   2  
ATOM 6591  C C    . LEU A 1 203 ? 25.005  -0.732  -19.151 1.00 0.00 ? 203 LEU A C    2  
ATOM 6592  O O    . LEU A 1 203 ? 25.392  -1.834  -18.775 1.00 0.00 ? 203 LEU A O    2  
ATOM 6593  C CB   . LEU A 1 203 ? 24.358  0.946   -17.414 1.00 0.00 ? 203 LEU A CB   2  
ATOM 6594  C CG   . LEU A 1 203 ? 24.625  0.393   -16.007 1.00 0.00 ? 203 LEU A CG   2  
ATOM 6595  C CD1  . LEU A 1 203 ? 26.113  0.402   -15.701 1.00 0.00 ? 203 LEU A CD1  2  
ATOM 6596  C CD2  . LEU A 1 203 ? 23.866  1.196   -14.959 1.00 0.00 ? 203 LEU A CD2  2  
ATOM 6597  H H    . LEU A 1 203 ? 23.398  -1.597  -17.068 1.00 0.00 ? 203 LEU A H    2  
ATOM 6598  H HA   . LEU A 1 203 ? 23.247  0.447   -19.181 1.00 0.00 ? 203 LEU A HA   2  
ATOM 6599  H HB2  . LEU A 1 203 ? 25.277  1.371   -17.790 1.00 0.00 ? 203 LEU A HB2  2  
ATOM 6600  H HB3  . LEU A 1 203 ? 23.628  1.737   -17.332 1.00 0.00 ? 203 LEU A HB3  2  
ATOM 6601  H HG   . LEU A 1 203 ? 24.285  -0.629  -15.955 1.00 0.00 ? 203 LEU A HG   2  
ATOM 6602  H HD11 . LEU A 1 203 ? 26.670  0.247   -16.613 1.00 0.00 ? 203 LEU A HD11 2  
ATOM 6603  H HD12 . LEU A 1 203 ? 26.341  -0.387  -15.001 1.00 0.00 ? 203 LEU A HD12 2  
ATOM 6604  H HD13 . LEU A 1 203 ? 26.385  1.355   -15.270 1.00 0.00 ? 203 LEU A HD13 2  
ATOM 6605  H HD21 . LEU A 1 203 ? 23.188  1.880   -15.447 1.00 0.00 ? 203 LEU A HD21 2  
ATOM 6606  H HD22 . LEU A 1 203 ? 24.565  1.754   -14.354 1.00 0.00 ? 203 LEU A HD22 2  
ATOM 6607  H HD23 . LEU A 1 203 ? 23.305  0.523   -14.329 1.00 0.00 ? 203 LEU A HD23 2  
ATOM 6608  N N    . PRO A 1 204 ? 25.595  -0.085  -20.168 1.00 0.00 ? 204 PRO A N    2  
ATOM 6609  C CA   . PRO A 1 204 ? 26.722  -0.667  -20.874 1.00 0.00 ? 204 PRO A CA   2  
ATOM 6610  C C    . PRO A 1 204 ? 27.735  -1.153  -19.852 1.00 0.00 ? 204 PRO A C    2  
ATOM 6611  O O    . PRO A 1 204 ? 28.462  -0.360  -19.254 1.00 0.00 ? 204 PRO A O    2  
ATOM 6612  C CB   . PRO A 1 204 ? 27.271  0.468   -21.746 1.00 0.00 ? 204 PRO A CB   2  
ATOM 6613  C CG   . PRO A 1 204 ? 26.470  1.690   -21.407 1.00 0.00 ? 204 PRO A CG   2  
ATOM 6614  C CD   . PRO A 1 204 ? 25.242  1.246   -20.663 1.00 0.00 ? 204 PRO A CD   2  
ATOM 6615  H HA   . PRO A 1 204 ? 26.411  -1.495  -21.497 1.00 0.00 ? 204 PRO A HA   2  
ATOM 6616  H HB2  . PRO A 1 204 ? 28.317  0.610   -21.531 1.00 0.00 ? 204 PRO A HB2  2  
ATOM 6617  H HB3  . PRO A 1 204 ? 27.154  0.204   -22.787 1.00 0.00 ? 204 PRO A HB3  2  
ATOM 6618  H HG2  . PRO A 1 204 ? 27.049  2.346   -20.796 1.00 0.00 ? 204 PRO A HG2  2  
ATOM 6619  H HG3  . PRO A 1 204 ? 26.189  2.199   -22.308 1.00 0.00 ? 204 PRO A HG3  2  
ATOM 6620  H HD2  . PRO A 1 204 ? 25.038  1.917   -19.841 1.00 0.00 ? 204 PRO A HD2  2  
ATOM 6621  H HD3  . PRO A 1 204 ? 24.402  1.199   -21.321 1.00 0.00 ? 204 PRO A HD3  2  
ATOM 6622  N N    . PRO A 1 205 ? 27.755  -2.470  -19.596 1.00 0.00 ? 205 PRO A N    2  
ATOM 6623  C CA   . PRO A 1 205 ? 28.638  -3.056  -18.592 1.00 0.00 ? 205 PRO A CA   2  
ATOM 6624  C C    . PRO A 1 205 ? 30.103  -2.949  -18.966 1.00 0.00 ? 205 PRO A C    2  
ATOM 6625  O O    . PRO A 1 205 ? 30.585  -3.578  -19.907 1.00 0.00 ? 205 PRO A O    2  
ATOM 6626  C CB   . PRO A 1 205 ? 28.150  -4.493  -18.503 1.00 0.00 ? 205 PRO A CB   2  
ATOM 6627  C CG   . PRO A 1 205 ? 27.564  -4.774  -19.838 1.00 0.00 ? 205 PRO A CG   2  
ATOM 6628  C CD   . PRO A 1 205 ? 26.901  -3.493  -20.241 1.00 0.00 ? 205 PRO A CD   2  
ATOM 6629  H HA   . PRO A 1 205 ? 28.498  -2.581  -17.626 1.00 0.00 ? 205 PRO A HA   2  
ATOM 6630  H HB2  . PRO A 1 205 ? 28.972  -5.152  -18.273 1.00 0.00 ? 205 PRO A HB2  2  
ATOM 6631  H HB3  . PRO A 1 205 ? 27.397  -4.543  -17.727 1.00 0.00 ? 205 PRO A HB3  2  
ATOM 6632  H HG2  . PRO A 1 205 ? 28.345  -5.035  -20.538 1.00 0.00 ? 205 PRO A HG2  2  
ATOM 6633  H HG3  . PRO A 1 205 ? 26.837  -5.568  -19.765 1.00 0.00 ? 205 PRO A HG3  2  
ATOM 6634  H HD2  . PRO A 1 205 ? 26.910  -3.385  -21.317 1.00 0.00 ? 205 PRO A HD2  2  
ATOM 6635  H HD3  . PRO A 1 205 ? 25.893  -3.454  -19.863 1.00 0.00 ? 205 PRO A HD3  2  
ATOM 6636  N N    . GLY A 1 206 ? 30.784  -2.110  -18.204 1.00 0.00 ? 206 GLY A N    2  
ATOM 6637  C CA   . GLY A 1 206 ? 32.195  -1.853  -18.415 1.00 0.00 ? 206 GLY A CA   2  
ATOM 6638  C C    . GLY A 1 206 ? 33.025  -3.122  -18.438 1.00 0.00 ? 206 GLY A C    2  
ATOM 6639  O O    . GLY A 1 206 ? 33.413  -3.599  -19.504 1.00 0.00 ? 206 GLY A O    2  
ATOM 6640  H H    . GLY A 1 206 ? 30.305  -1.650  -17.488 1.00 0.00 ? 206 GLY A H    2  
ATOM 6641  H HA2  . GLY A 1 206 ? 32.316  -1.333  -19.355 1.00 0.00 ? 206 GLY A HA2  2  
ATOM 6642  H HA3  . GLY A 1 206 ? 32.552  -1.214  -17.621 1.00 0.00 ? 206 GLY A HA3  2  
ATOM 6643  N N    . GLN A 1 207 ? 33.296  -3.669  -17.257 1.00 0.00 ? 207 GLN A N    2  
ATOM 6644  C CA   . GLN A 1 207 ? 34.085  -4.890  -17.142 1.00 0.00 ? 207 GLN A CA   2  
ATOM 6645  C C    . GLN A 1 207 ? 33.558  -5.772  -16.014 1.00 0.00 ? 207 GLN A C    2  
ATOM 6646  O O    . GLN A 1 207 ? 32.621  -5.399  -15.309 1.00 0.00 ? 207 GLN A O    2  
ATOM 6647  C CB   . GLN A 1 207 ? 35.556  -4.551  -16.897 1.00 0.00 ? 207 GLN A CB   2  
ATOM 6648  C CG   . GLN A 1 207 ? 36.096  -3.476  -17.827 1.00 0.00 ? 207 GLN A CG   2  
ATOM 6649  C CD   . GLN A 1 207 ? 37.564  -3.181  -17.589 1.00 0.00 ? 207 GLN A CD   2  
ATOM 6650  O OE1  . GLN A 1 207 ? 37.930  -2.561  -16.590 1.00 0.00 ? 207 GLN A OE1  2  
ATOM 6651  N NE2  . GLN A 1 207 ? 38.413  -3.625  -18.508 1.00 0.00 ? 207 GLN A NE2  2  
ATOM 6652  H H    . GLN A 1 207 ? 32.957  -3.241  -16.444 1.00 0.00 ? 207 GLN A H    2  
ATOM 6653  H HA   . GLN A 1 207 ? 33.999  -5.429  -18.074 1.00 0.00 ? 207 GLN A HA   2  
ATOM 6654  H HB2  . GLN A 1 207 ? 35.669  -4.206  -15.880 1.00 0.00 ? 207 GLN A HB2  2  
ATOM 6655  H HB3  . GLN A 1 207 ? 36.148  -5.444  -17.032 1.00 0.00 ? 207 GLN A HB3  2  
ATOM 6656  H HG2  . GLN A 1 207 ? 35.972  -3.807  -18.848 1.00 0.00 ? 207 GLN A HG2  2  
ATOM 6657  H HG3  . GLN A 1 207 ? 35.531  -2.569  -17.673 1.00 0.00 ? 207 GLN A HG3  2  
ATOM 6658  H HE21 . GLN A 1 207 ? 38.050  -4.110  -19.278 1.00 0.00 ? 207 GLN A HE21 2  
ATOM 6659  H HE22 . GLN A 1 207 ? 39.369  -3.449  -18.379 1.00 0.00 ? 207 GLN A HE22 2  
ATOM 6660  N N    . GLU A 1 208 ? 34.166  -6.942  -15.850 1.00 0.00 ? 208 GLU A N    2  
ATOM 6661  C CA   . GLU A 1 208 ? 33.757  -7.875  -14.808 1.00 0.00 ? 208 GLU A CA   2  
ATOM 6662  C C    . GLU A 1 208 ? 34.970  -8.431  -14.068 1.00 0.00 ? 208 GLU A C    2  
ATOM 6663  O O    . GLU A 1 208 ? 34.955  -9.568  -13.596 1.00 0.00 ? 208 GLU A O    2  
ATOM 6664  C CB   . GLU A 1 208 ? 32.941  -9.020  -15.413 1.00 0.00 ? 208 GLU A CB   2  
ATOM 6665  C CG   . GLU A 1 208 ? 31.439  -8.799  -15.344 1.00 0.00 ? 208 GLU A CG   2  
ATOM 6666  C CD   . GLU A 1 208 ? 30.665  -10.095 -15.207 1.00 0.00 ? 208 GLU A CD   2  
ATOM 6667  O OE1  . GLU A 1 208 ? 30.654  -10.886 -16.174 1.00 0.00 ? 208 GLU A OE1  2  
ATOM 6668  O OE2  . GLU A 1 208 ? 30.069  -10.321 -14.132 1.00 0.00 ? 208 GLU A OE2  2  
ATOM 6669  H H    . GLU A 1 208 ? 34.907  -7.183  -16.444 1.00 0.00 ? 208 GLU A H    2  
ATOM 6670  H HA   . GLU A 1 208 ? 33.138  -7.337  -14.106 1.00 0.00 ? 208 GLU A HA   2  
ATOM 6671  H HB2  . GLU A 1 208 ? 33.219  -9.136  -16.450 1.00 0.00 ? 208 GLU A HB2  2  
ATOM 6672  H HB3  . GLU A 1 208 ? 33.173  -9.932  -14.884 1.00 0.00 ? 208 GLU A HB3  2  
ATOM 6673  H HG2  . GLU A 1 208 ? 31.219  -8.175  -14.491 1.00 0.00 ? 208 GLU A HG2  2  
ATOM 6674  H HG3  . GLU A 1 208 ? 31.120  -8.300  -16.247 1.00 0.00 ? 208 GLU A HG3  2  
ATOM 6675  N N    . SER A 1 209 ? 36.020  -7.621  -13.971 1.00 0.00 ? 209 SER A N    2  
ATOM 6676  C CA   . SER A 1 209 ? 37.241  -8.031  -13.288 1.00 0.00 ? 209 SER A CA   2  
ATOM 6677  C C    . SER A 1 209 ? 37.162  -7.718  -11.797 1.00 0.00 ? 209 SER A C    2  
ATOM 6678  O O    . SER A 1 209 ? 37.328  -6.570  -11.384 1.00 0.00 ? 209 SER A O    2  
ATOM 6679  C CB   . SER A 1 209 ? 38.454  -7.332  -13.904 1.00 0.00 ? 209 SER A CB   2  
ATOM 6680  O OG   . SER A 1 209 ? 39.660  -7.798  -13.326 1.00 0.00 ? 209 SER A OG   2  
ATOM 6681  H H    . SER A 1 209 ? 35.971  -6.726  -14.367 1.00 0.00 ? 209 SER A H    2  
ATOM 6682  H HA   . SER A 1 209 ? 37.349  -9.098  -13.414 1.00 0.00 ? 209 SER A HA   2  
ATOM 6683  H HB2  . SER A 1 209 ? 38.479  -7.529  -14.966 1.00 0.00 ? 209 SER A HB2  2  
ATOM 6684  H HB3  . SER A 1 209 ? 38.376  -6.268  -13.738 1.00 0.00 ? 209 SER A HB3  2  
ATOM 6685  H HG   . SER A 1 209 ? 40.403  -7.326  -13.709 1.00 0.00 ? 209 SER A HG   2  
ATOM 6686  N N    . GLU A 1 210 ? 36.909  -8.747  -10.994 1.00 0.00 ? 210 GLU A N    2  
ATOM 6687  C CA   . GLU A 1 210 ? 36.809  -8.581  -9.549  1.00 0.00 ? 210 GLU A CA   2  
ATOM 6688  C C    . GLU A 1 210 ? 38.192  -8.562  -8.906  1.00 0.00 ? 210 GLU A C    2  
ATOM 6689  O O    . GLU A 1 210 ? 39.160  -9.063  -9.479  1.00 0.00 ? 210 GLU A O    2  
ATOM 6690  C CB   . GLU A 1 210 ? 35.968  -9.706  -8.943  1.00 0.00 ? 210 GLU A CB   2  
ATOM 6691  C CG   . GLU A 1 210 ? 34.481  -9.575  -9.227  1.00 0.00 ? 210 GLU A CG   2  
ATOM 6692  C CD   . GLU A 1 210 ? 34.102  -10.102 -10.598 1.00 0.00 ? 210 GLU A CD   2  
ATOM 6693  O OE1  . GLU A 1 210 ? 34.705  -11.105 -11.036 1.00 0.00 ? 210 GLU A OE1  2  
ATOM 6694  O OE2  . GLU A 1 210 ? 33.202  -9.513  -11.232 1.00 0.00 ? 210 GLU A OE2  2  
ATOM 6695  H H    . GLU A 1 210 ? 36.787  -9.638  -11.383 1.00 0.00 ? 210 GLU A H    2  
ATOM 6696  H HA   . GLU A 1 210 ? 36.322  -7.637  -9.356  1.00 0.00 ? 210 GLU A HA   2  
ATOM 6697  H HB2  . GLU A 1 210 ? 36.308  -10.650 -9.343  1.00 0.00 ? 210 GLU A HB2  2  
ATOM 6698  H HB3  . GLU A 1 210 ? 36.109  -9.708  -7.872  1.00 0.00 ? 210 GLU A HB3  2  
ATOM 6699  H HG2  . GLU A 1 210 ? 33.934  -10.132 -8.481  1.00 0.00 ? 210 GLU A HG2  2  
ATOM 6700  H HG3  . GLU A 1 210 ? 34.207  -8.532  -9.170  1.00 0.00 ? 210 GLU A HG3  2  
ATOM 6701  N N    . PHE A 1 211 ? 38.278  -7.982  -7.713  1.00 0.00 ? 211 PHE A N    2  
ATOM 6702  C CA   . PHE A 1 211 ? 39.543  -7.899  -6.993  1.00 0.00 ? 211 PHE A CA   2  
ATOM 6703  C C    . PHE A 1 211 ? 39.864  -9.221  -6.305  1.00 0.00 ? 211 PHE A C    2  
ATOM 6704  O O    . PHE A 1 211 ? 39.040  -10.135 -6.278  1.00 0.00 ? 211 PHE A O    2  
ATOM 6705  C CB   . PHE A 1 211 ? 39.492  -6.770  -5.961  1.00 0.00 ? 211 PHE A CB   2  
ATOM 6706  C CG   . PHE A 1 211 ? 40.186  -5.515  -6.409  1.00 0.00 ? 211 PHE A CG   2  
ATOM 6707  C CD1  . PHE A 1 211 ? 39.948  -4.988  -7.668  1.00 0.00 ? 211 PHE A CD1  2  
ATOM 6708  C CD2  . PHE A 1 211 ? 41.077  -4.864  -5.571  1.00 0.00 ? 211 PHE A CD2  2  
ATOM 6709  C CE1  . PHE A 1 211 ? 40.585  -3.835  -8.083  1.00 0.00 ? 211 PHE A CE1  2  
ATOM 6710  C CE2  . PHE A 1 211 ? 41.718  -3.710  -5.981  1.00 0.00 ? 211 PHE A CE2  2  
ATOM 6711  C CZ   . PHE A 1 211 ? 41.472  -3.195  -7.239  1.00 0.00 ? 211 PHE A CZ   2  
ATOM 6712  H H    . PHE A 1 211 ? 37.471  -7.601  -7.308  1.00 0.00 ? 211 PHE A H    2  
ATOM 6713  H HA   . PHE A 1 211 ? 40.319  -7.683  -7.712  1.00 0.00 ? 211 PHE A HA   2  
ATOM 6714  H HB2  . PHE A 1 211 ? 38.460  -6.523  -5.759  1.00 0.00 ? 211 PHE A HB2  2  
ATOM 6715  H HB3  . PHE A 1 211 ? 39.963  -7.103  -5.048  1.00 0.00 ? 211 PHE A HB3  2  
ATOM 6716  H HD1  . PHE A 1 211 ? 39.255  -5.488  -8.329  1.00 0.00 ? 211 PHE A HD1  2  
ATOM 6717  H HD2  . PHE A 1 211 ? 41.271  -5.267  -4.588  1.00 0.00 ? 211 PHE A HD2  2  
ATOM 6718  H HE1  . PHE A 1 211 ? 40.391  -3.434  -9.067  1.00 0.00 ? 211 PHE A HE1  2  
ATOM 6719  H HE2  . PHE A 1 211 ? 42.410  -3.212  -5.319  1.00 0.00 ? 211 PHE A HE2  2  
ATOM 6720  H HZ   . PHE A 1 211 ? 41.971  -2.293  -7.561  1.00 0.00 ? 211 PHE A HZ   2  
ATOM 6721  N N    . SER A 1 212 ? 41.068  -9.316  -5.750  1.00 0.00 ? 212 SER A N    2  
ATOM 6722  C CA   . SER A 1 212 ? 41.498  -10.527 -5.062  1.00 0.00 ? 212 SER A CA   2  
ATOM 6723  C C    . SER A 1 212 ? 40.958  -10.565 -3.636  1.00 0.00 ? 212 SER A C    2  
ATOM 6724  O O    . SER A 1 212 ? 40.030  -11.359 -3.377  1.00 0.00 ? 212 SER A O    2  
ATOM 6725  C CB   . SER A 1 212 ? 43.026  -10.613 -5.043  1.00 0.00 ? 212 SER A CB   2  
ATOM 6726  O OG   . SER A 1 212 ? 43.463  -11.960 -5.088  1.00 0.00 ? 212 SER A OG   2  
ATOM 6727  O OXT  . SER A 1 212 ? 41.468  -9.800  -2.790  1.00 0.00 ? 212 SER A OXT  2  
ATOM 6728  H H    . SER A 1 212 ? 41.681  -8.553  -5.804  1.00 0.00 ? 212 SER A H    2  
ATOM 6729  H HA   . SER A 1 212 ? 41.106  -11.374 -5.605  1.00 0.00 ? 212 SER A HA   2  
ATOM 6730  H HB2  . SER A 1 212 ? 43.425  -10.090 -5.899  1.00 0.00 ? 212 SER A HB2  2  
ATOM 6731  H HB3  . SER A 1 212 ? 43.398  -10.157 -4.137  1.00 0.00 ? 212 SER A HB3  2  
ATOM 6732  H HG   . SER A 1 212 ? 44.243  -12.063 -4.537  1.00 0.00 ? 212 SER A HG   2  
ATOM 6733  N N    . SER A 1 1   ? 4.420   -26.207 -22.323 1.00 0.00 ? 1   SER A N    3  
ATOM 6734  C CA   . SER A 1 1   ? 4.362   -25.116 -21.316 1.00 0.00 ? 1   SER A CA   3  
ATOM 6735  C C    . SER A 1 1   ? 4.191   -23.756 -21.984 1.00 0.00 ? 1   SER A C    3  
ATOM 6736  O O    . SER A 1 1   ? 5.168   -23.061 -22.262 1.00 0.00 ? 1   SER A O    3  
ATOM 6737  C CB   . SER A 1 1   ? 5.653   -25.141 -20.495 1.00 0.00 ? 1   SER A CB   3  
ATOM 6738  O OG   . SER A 1 1   ? 6.751   -25.565 -21.284 1.00 0.00 ? 1   SER A OG   3  
ATOM 6739  H H1   . SER A 1 1   ? 5.091   -25.919 -23.064 1.00 0.00 ? 1   SER A H1   3  
ATOM 6740  H H2   . SER A 1 1   ? 3.462   -26.331 -22.711 1.00 0.00 ? 1   SER A H2   3  
ATOM 6741  H H3   . SER A 1 1   ? 4.744   -27.068 -21.840 1.00 0.00 ? 1   SER A H3   3  
ATOM 6742  H HA   . SER A 1 1   ? 3.522   -25.296 -20.662 1.00 0.00 ? 1   SER A HA   3  
ATOM 6743  H HB2  . SER A 1 1   ? 5.858   -24.150 -20.119 1.00 0.00 ? 1   SER A HB2  3  
ATOM 6744  H HB3  . SER A 1 1   ? 5.536   -25.823 -19.666 1.00 0.00 ? 1   SER A HB3  3  
ATOM 6745  H HG   . SER A 1 1   ? 7.094   -26.392 -20.938 1.00 0.00 ? 1   SER A HG   3  
ATOM 6746  N N    . TYR A 1 2   ? 2.941   -23.382 -22.240 1.00 0.00 ? 2   TYR A N    3  
ATOM 6747  C CA   . TYR A 1 2   ? 2.641   -22.104 -22.876 1.00 0.00 ? 2   TYR A CA   3  
ATOM 6748  C C    . TYR A 1 2   ? 1.290   -21.570 -22.412 1.00 0.00 ? 2   TYR A C    3  
ATOM 6749  O O    . TYR A 1 2   ? 0.581   -20.904 -23.167 1.00 0.00 ? 2   TYR A O    3  
ATOM 6750  C CB   . TYR A 1 2   ? 2.648   -22.255 -24.399 1.00 0.00 ? 2   TYR A CB   3  
ATOM 6751  C CG   . TYR A 1 2   ? 3.307   -21.101 -25.119 1.00 0.00 ? 2   TYR A CG   3  
ATOM 6752  C CD1  . TYR A 1 2   ? 4.691   -21.006 -25.199 1.00 0.00 ? 2   TYR A CD1  3  
ATOM 6753  C CD2  . TYR A 1 2   ? 2.545   -20.105 -25.719 1.00 0.00 ? 2   TYR A CD2  3  
ATOM 6754  C CE1  . TYR A 1 2   ? 5.297   -19.952 -25.857 1.00 0.00 ? 2   TYR A CE1  3  
ATOM 6755  C CE2  . TYR A 1 2   ? 3.144   -19.049 -26.379 1.00 0.00 ? 2   TYR A CE2  3  
ATOM 6756  C CZ   . TYR A 1 2   ? 4.519   -18.977 -26.444 1.00 0.00 ? 2   TYR A CZ   3  
ATOM 6757  O OH   . TYR A 1 2   ? 5.119   -17.926 -27.100 1.00 0.00 ? 2   TYR A OH   3  
ATOM 6758  H H    . TYR A 1 2   ? 2.204   -23.979 -21.995 1.00 0.00 ? 2   TYR A H    3  
ATOM 6759  H HA   . TYR A 1 2   ? 3.410   -21.403 -22.590 1.00 0.00 ? 2   TYR A HA   3  
ATOM 6760  H HB2  . TYR A 1 2   ? 3.181   -23.157 -24.661 1.00 0.00 ? 2   TYR A HB2  3  
ATOM 6761  H HB3  . TYR A 1 2   ? 1.630   -22.330 -24.751 1.00 0.00 ? 2   TYR A HB3  3  
ATOM 6762  H HD1  . TYR A 1 2   ? 5.297   -21.772 -24.739 1.00 0.00 ? 2   TYR A HD1  3  
ATOM 6763  H HD2  . TYR A 1 2   ? 1.468   -20.165 -25.666 1.00 0.00 ? 2   TYR A HD2  3  
ATOM 6764  H HE1  . TYR A 1 2   ? 6.374   -19.896 -25.908 1.00 0.00 ? 2   TYR A HE1  3  
ATOM 6765  H HE2  . TYR A 1 2   ? 2.535   -18.285 -26.839 1.00 0.00 ? 2   TYR A HE2  3  
ATOM 6766  H HH   . TYR A 1 2   ? 5.335   -18.190 -27.998 1.00 0.00 ? 2   TYR A HH   3  
ATOM 6767  N N    . ASP A 1 3   ? 0.940   -21.865 -21.164 1.00 0.00 ? 3   ASP A N    3  
ATOM 6768  C CA   . ASP A 1 3   ? -0.326  -21.415 -20.598 1.00 0.00 ? 3   ASP A CA   3  
ATOM 6769  C C    . ASP A 1 3   ? -0.107  -20.267 -19.618 1.00 0.00 ? 3   ASP A C    3  
ATOM 6770  O O    . ASP A 1 3   ? -0.595  -19.156 -19.829 1.00 0.00 ? 3   ASP A O    3  
ATOM 6771  C CB   . ASP A 1 3   ? -1.035  -22.573 -19.894 1.00 0.00 ? 3   ASP A CB   3  
ATOM 6772  C CG   . ASP A 1 3   ? -1.360  -23.712 -20.840 1.00 0.00 ? 3   ASP A CG   3  
ATOM 6773  O OD1  . ASP A 1 3   ? -1.488  -23.457 -22.056 1.00 0.00 ? 3   ASP A OD1  3  
ATOM 6774  O OD2  . ASP A 1 3   ? -1.486  -24.861 -20.365 1.00 0.00 ? 3   ASP A OD2  3  
ATOM 6775  H H    . ASP A 1 3   ? 1.548   -22.399 -20.611 1.00 0.00 ? 3   ASP A H    3  
ATOM 6776  H HA   . ASP A 1 3   ? -0.946  -21.065 -21.410 1.00 0.00 ? 3   ASP A HA   3  
ATOM 6777  H HB2  . ASP A 1 3   ? -0.400  -22.952 -19.108 1.00 0.00 ? 3   ASP A HB2  3  
ATOM 6778  H HB3  . ASP A 1 3   ? -1.958  -22.213 -19.463 1.00 0.00 ? 3   ASP A HB3  3  
ATOM 6779  N N    . SER A 1 4   ? 0.630   -20.542 -18.547 1.00 0.00 ? 4   SER A N    3  
ATOM 6780  C CA   . SER A 1 4   ? 0.913   -19.531 -17.535 1.00 0.00 ? 4   SER A CA   3  
ATOM 6781  C C    . SER A 1 4   ? 2.142   -18.708 -17.916 1.00 0.00 ? 4   SER A C    3  
ATOM 6782  O O    . SER A 1 4   ? 3.097   -19.234 -18.489 1.00 0.00 ? 4   SER A O    3  
ATOM 6783  C CB   . SER A 1 4   ? 1.131   -20.192 -16.172 1.00 0.00 ? 4   SER A CB   3  
ATOM 6784  O OG   . SER A 1 4   ? 1.066   -19.237 -15.126 1.00 0.00 ? 4   SER A OG   3  
ATOM 6785  H H    . SER A 1 4   ? 0.992   -21.446 -18.434 1.00 0.00 ? 4   SER A H    3  
ATOM 6786  H HA   . SER A 1 4   ? 0.058   -18.876 -17.474 1.00 0.00 ? 4   SER A HA   3  
ATOM 6787  H HB2  . SER A 1 4   ? 0.367   -20.937 -16.009 1.00 0.00 ? 4   SER A HB2  3  
ATOM 6788  H HB3  . SER A 1 4   ? 2.103   -20.663 -16.154 1.00 0.00 ? 4   SER A HB3  3  
ATOM 6789  H HG   . SER A 1 4   ? 0.219   -18.787 -15.155 1.00 0.00 ? 4   SER A HG   3  
ATOM 6790  N N    . PRO A 1 5   ? 2.136   -17.400 -17.603 1.00 0.00 ? 5   PRO A N    3  
ATOM 6791  C CA   . PRO A 1 5   ? 3.257   -16.508 -17.919 1.00 0.00 ? 5   PRO A CA   3  
ATOM 6792  C C    . PRO A 1 5   ? 4.583   -17.031 -17.375 1.00 0.00 ? 5   PRO A C    3  
ATOM 6793  O O    . PRO A 1 5   ? 4.616   -17.999 -16.616 1.00 0.00 ? 5   PRO A O    3  
ATOM 6794  C CB   . PRO A 1 5   ? 2.879   -15.195 -17.229 1.00 0.00 ? 5   PRO A CB   3  
ATOM 6795  C CG   . PRO A 1 5   ? 1.395   -15.240 -17.111 1.00 0.00 ? 5   PRO A CG   3  
ATOM 6796  C CD   . PRO A 1 5   ? 1.039   -16.688 -16.920 1.00 0.00 ? 5   PRO A CD   3  
ATOM 6797  H HA   . PRO A 1 5   ? 3.346   -16.347 -18.983 1.00 0.00 ? 5   PRO A HA   3  
ATOM 6798  H HB2  . PRO A 1 5   ? 3.351   -15.147 -16.259 1.00 0.00 ? 5   PRO A HB2  3  
ATOM 6799  H HB3  . PRO A 1 5   ? 3.201   -14.361 -17.835 1.00 0.00 ? 5   PRO A HB3  3  
ATOM 6800  H HG2  . PRO A 1 5   ? 1.077   -14.660 -16.257 1.00 0.00 ? 5   PRO A HG2  3  
ATOM 6801  H HG3  . PRO A 1 5   ? 0.943   -14.859 -18.015 1.00 0.00 ? 5   PRO A HG3  3  
ATOM 6802  H HD2  . PRO A 1 5   ? 1.015   -16.935 -15.869 1.00 0.00 ? 5   PRO A HD2  3  
ATOM 6803  H HD3  . PRO A 1 5   ? 0.089   -16.907 -17.384 1.00 0.00 ? 5   PRO A HD3  3  
ATOM 6804  N N    . ASP A 1 6   ? 5.674   -16.381 -17.768 1.00 0.00 ? 6   ASP A N    3  
ATOM 6805  C CA   . ASP A 1 6   ? 7.004   -16.777 -17.319 1.00 0.00 ? 6   ASP A CA   3  
ATOM 6806  C C    . ASP A 1 6   ? 7.890   -15.553 -17.107 1.00 0.00 ? 6   ASP A C    3  
ATOM 6807  O O    . ASP A 1 6   ? 8.333   -14.922 -18.067 1.00 0.00 ? 6   ASP A O    3  
ATOM 6808  C CB   . ASP A 1 6   ? 7.648   -17.721 -18.338 1.00 0.00 ? 6   ASP A CB   3  
ATOM 6809  C CG   . ASP A 1 6   ? 8.158   -18.999 -17.699 1.00 0.00 ? 6   ASP A CG   3  
ATOM 6810  O OD1  . ASP A 1 6   ? 8.648   -18.934 -16.552 1.00 0.00 ? 6   ASP A OD1  3  
ATOM 6811  O OD2  . ASP A 1 6   ? 8.067   -20.063 -18.346 1.00 0.00 ? 6   ASP A OD2  3  
ATOM 6812  H H    . ASP A 1 6   ? 5.582   -15.616 -18.373 1.00 0.00 ? 6   ASP A H    3  
ATOM 6813  H HA   . ASP A 1 6   ? 6.896   -17.295 -16.378 1.00 0.00 ? 6   ASP A HA   3  
ATOM 6814  H HB2  . ASP A 1 6   ? 6.917   -17.984 -19.088 1.00 0.00 ? 6   ASP A HB2  3  
ATOM 6815  H HB3  . ASP A 1 6   ? 8.479   -17.220 -18.812 1.00 0.00 ? 6   ASP A HB3  3  
ATOM 6816  N N    . TYR A 1 7   ? 8.141   -15.221 -15.845 1.00 0.00 ? 7   TYR A N    3  
ATOM 6817  C CA   . TYR A 1 7   ? 8.971   -14.071 -15.508 1.00 0.00 ? 7   TYR A CA   3  
ATOM 6818  C C    . TYR A 1 7   ? 10.071  -14.459 -14.525 1.00 0.00 ? 7   TYR A C    3  
ATOM 6819  O O    . TYR A 1 7   ? 10.083  -15.572 -13.998 1.00 0.00 ? 7   TYR A O    3  
ATOM 6820  C CB   . TYR A 1 7   ? 8.109   -12.953 -14.915 1.00 0.00 ? 7   TYR A CB   3  
ATOM 6821  C CG   . TYR A 1 7   ? 8.037   -11.716 -15.782 1.00 0.00 ? 7   TYR A CG   3  
ATOM 6822  C CD1  . TYR A 1 7   ? 9.168   -11.224 -16.421 1.00 0.00 ? 7   TYR A CD1  3  
ATOM 6823  C CD2  . TYR A 1 7   ? 6.837   -11.040 -15.960 1.00 0.00 ? 7   TYR A CD2  3  
ATOM 6824  C CE1  . TYR A 1 7   ? 9.106   -10.094 -17.213 1.00 0.00 ? 7   TYR A CE1  3  
ATOM 6825  C CE2  . TYR A 1 7   ? 6.766   -9.909  -16.751 1.00 0.00 ? 7   TYR A CE2  3  
ATOM 6826  C CZ   . TYR A 1 7   ? 7.903   -9.440  -17.375 1.00 0.00 ? 7   TYR A CZ   3  
ATOM 6827  O OH   . TYR A 1 7   ? 7.836   -8.314  -18.163 1.00 0.00 ? 7   TYR A OH   3  
ATOM 6828  H H    . TYR A 1 7   ? 7.757   -15.762 -15.123 1.00 0.00 ? 7   TYR A H    3  
ATOM 6829  H HA   . TYR A 1 7   ? 9.429   -13.714 -16.419 1.00 0.00 ? 7   TYR A HA   3  
ATOM 6830  H HB2  . TYR A 1 7   ? 7.103   -13.319 -14.778 1.00 0.00 ? 7   TYR A HB2  3  
ATOM 6831  H HB3  . TYR A 1 7   ? 8.514   -12.663 -13.956 1.00 0.00 ? 7   TYR A HB3  3  
ATOM 6832  H HD1  . TYR A 1 7   ? 10.109  -11.739 -16.293 1.00 0.00 ? 7   TYR A HD1  3  
ATOM 6833  H HD2  . TYR A 1 7   ? 5.948   -11.409 -15.470 1.00 0.00 ? 7   TYR A HD2  3  
ATOM 6834  H HE1  . TYR A 1 7   ? 9.996   -9.727  -17.702 1.00 0.00 ? 7   TYR A HE1  3  
ATOM 6835  H HE2  . TYR A 1 7   ? 5.823   -9.397  -16.877 1.00 0.00 ? 7   TYR A HE2  3  
ATOM 6836  H HH   . TYR A 1 7   ? 8.395   -8.430  -18.935 1.00 0.00 ? 7   TYR A HH   3  
ATOM 6837  N N    . THR A 1 8   ? 10.990  -13.531 -14.281 1.00 0.00 ? 8   THR A N    3  
ATOM 6838  C CA   . THR A 1 8   ? 12.095  -13.769 -13.359 1.00 0.00 ? 8   THR A CA   3  
ATOM 6839  C C    . THR A 1 8   ? 12.380  -12.525 -12.523 1.00 0.00 ? 8   THR A C    3  
ATOM 6840  O O    . THR A 1 8   ? 13.508  -12.304 -12.085 1.00 0.00 ? 8   THR A O    3  
ATOM 6841  C CB   . THR A 1 8   ? 13.351  -14.180 -14.129 1.00 0.00 ? 8   THR A CB   3  
ATOM 6842  O OG1  . THR A 1 8   ? 13.391  -13.548 -15.396 1.00 0.00 ? 8   THR A OG1  3  
ATOM 6843  C CG2  . THR A 1 8   ? 13.452  -15.672 -14.357 1.00 0.00 ? 8   THR A CG2  3  
ATOM 6844  H H    . THR A 1 8   ? 10.923  -12.663 -14.731 1.00 0.00 ? 8   THR A H    3  
ATOM 6845  H HA   . THR A 1 8   ? 11.808  -14.574 -12.699 1.00 0.00 ? 8   THR A HA   3  
ATOM 6846  H HB   . THR A 1 8   ? 14.221  -13.871 -13.568 1.00 0.00 ? 8   THR A HB   3  
ATOM 6847  H HG1  . THR A 1 8   ? 13.217  -12.609 -15.291 1.00 0.00 ? 8   THR A HG1  3  
ATOM 6848  H HG21 . THR A 1 8   ? 14.131  -15.866 -15.174 1.00 0.00 ? 8   THR A HG21 3  
ATOM 6849  H HG22 . THR A 1 8   ? 12.476  -16.067 -14.598 1.00 0.00 ? 8   THR A HG22 3  
ATOM 6850  H HG23 . THR A 1 8   ? 13.822  -16.149 -13.461 1.00 0.00 ? 8   THR A HG23 3  
ATOM 6851  N N    . ASP A 1 9   ? 11.347  -11.715 -12.308 1.00 0.00 ? 9   ASP A N    3  
ATOM 6852  C CA   . ASP A 1 9   ? 11.483  -10.492 -11.526 1.00 0.00 ? 9   ASP A CA   3  
ATOM 6853  C C    . ASP A 1 9   ? 10.218  -10.226 -10.715 1.00 0.00 ? 9   ASP A C    3  
ATOM 6854  O O    . ASP A 1 9   ? 9.380   -11.113 -10.549 1.00 0.00 ? 9   ASP A O    3  
ATOM 6855  C CB   . ASP A 1 9   ? 11.777  -9.304  -12.446 1.00 0.00 ? 9   ASP A CB   3  
ATOM 6856  C CG   . ASP A 1 9   ? 12.866  -9.610  -13.456 1.00 0.00 ? 9   ASP A CG   3  
ATOM 6857  O OD1  . ASP A 1 9   ? 12.540  -10.143 -14.537 1.00 0.00 ? 9   ASP A OD1  3  
ATOM 6858  O OD2  . ASP A 1 9   ? 14.045  -9.314  -13.166 1.00 0.00 ? 9   ASP A OD2  3  
ATOM 6859  H H    . ASP A 1 9   ? 10.472  -11.945 -12.684 1.00 0.00 ? 9   ASP A H    3  
ATOM 6860  H HA   . ASP A 1 9   ? 12.312  -10.624 -10.846 1.00 0.00 ? 9   ASP A HA   3  
ATOM 6861  H HB2  . ASP A 1 9   ? 10.879  -9.040  -12.982 1.00 0.00 ? 9   ASP A HB2  3  
ATOM 6862  H HB3  . ASP A 1 9   ? 12.094  -8.463  -11.847 1.00 0.00 ? 9   ASP A HB3  3  
ATOM 6863  N N    . GLU A 1 10  ? 10.086  -9.004  -10.209 1.00 0.00 ? 10  GLU A N    3  
ATOM 6864  C CA   . GLU A 1 10  ? 8.923   -8.629  -9.414  1.00 0.00 ? 10  GLU A CA   3  
ATOM 6865  C C    . GLU A 1 10  ? 7.802   -8.089  -10.298 1.00 0.00 ? 10  GLU A C    3  
ATOM 6866  O O    . GLU A 1 10  ? 8.022   -7.215  -11.136 1.00 0.00 ? 10  GLU A O    3  
ATOM 6867  C CB   . GLU A 1 10  ? 9.310   -7.582  -8.368  1.00 0.00 ? 10  GLU A CB   3  
ATOM 6868  C CG   . GLU A 1 10  ? 9.993   -6.358  -8.956  1.00 0.00 ? 10  GLU A CG   3  
ATOM 6869  C CD   . GLU A 1 10  ? 11.505  -6.437  -8.872  1.00 0.00 ? 10  GLU A CD   3  
ATOM 6870  O OE1  . GLU A 1 10  ? 12.015  -7.148  -7.981  1.00 0.00 ? 10  GLU A OE1  3  
ATOM 6871  O OE2  . GLU A 1 10  ? 12.179  -5.788  -9.700  1.00 0.00 ? 10  GLU A OE2  3  
ATOM 6872  H H    . GLU A 1 10  ? 10.787  -8.339  -10.373 1.00 0.00 ? 10  GLU A H    3  
ATOM 6873  H HA   . GLU A 1 10  ? 8.569   -9.514  -8.908  1.00 0.00 ? 10  GLU A HA   3  
ATOM 6874  H HB2  . GLU A 1 10  ? 8.419   -7.258  -7.852  1.00 0.00 ? 10  GLU A HB2  3  
ATOM 6875  H HB3  . GLU A 1 10  ? 9.983   -8.035  -7.655  1.00 0.00 ? 10  GLU A HB3  3  
ATOM 6876  H HG2  . GLU A 1 10  ? 9.710   -6.267  -9.993  1.00 0.00 ? 10  GLU A HG2  3  
ATOM 6877  H HG3  . GLU A 1 10  ? 9.662   -5.483  -8.415  1.00 0.00 ? 10  GLU A HG3  3  
ATOM 6878  N N    . SER A 1 11  ? 6.598   -8.617  -10.100 1.00 0.00 ? 11  SER A N    3  
ATOM 6879  C CA   . SER A 1 11  ? 5.433   -8.194  -10.870 1.00 0.00 ? 11  SER A CA   3  
ATOM 6880  C C    . SER A 1 11  ? 5.137   -6.713  -10.667 1.00 0.00 ? 11  SER A C    3  
ATOM 6881  O O    . SER A 1 11  ? 4.425   -6.100  -11.463 1.00 0.00 ? 11  SER A O    3  
ATOM 6882  C CB   . SER A 1 11  ? 4.211   -9.023  -10.472 1.00 0.00 ? 11  SER A CB   3  
ATOM 6883  O OG   . SER A 1 11  ? 3.432   -9.362  -11.606 1.00 0.00 ? 11  SER A OG   3  
ATOM 6884  H H    . SER A 1 11  ? 6.489   -9.309  -9.417  1.00 0.00 ? 11  SER A H    3  
ATOM 6885  H HA   . SER A 1 11  ? 5.649   -8.362  -11.908 1.00 0.00 ? 11  SER A HA   3  
ATOM 6886  H HB2  . SER A 1 11  ? 4.538   -9.932  -9.990  1.00 0.00 ? 11  SER A HB2  3  
ATOM 6887  H HB3  . SER A 1 11  ? 3.601   -8.452  -9.786  1.00 0.00 ? 11  SER A HB3  3  
ATOM 6888  H HG   . SER A 1 11  ? 2.652   -9.847  -11.325 1.00 0.00 ? 11  SER A HG   3  
ATOM 6889  N N    . CYS A 1 12  ? 5.701   -6.145  -9.605  1.00 0.00 ? 12  CYS A N    3  
ATOM 6890  C CA   . CYS A 1 12  ? 5.520   -4.728  -9.283  1.00 0.00 ? 12  CYS A CA   3  
ATOM 6891  C C    . CYS A 1 12  ? 4.122   -4.246  -9.641  1.00 0.00 ? 12  CYS A C    3  
ATOM 6892  O O    . CYS A 1 12  ? 3.933   -3.152  -10.175 1.00 0.00 ? 12  CYS A O    3  
ATOM 6893  C CB   . CYS A 1 12  ? 6.537   -3.902  -10.031 1.00 0.00 ? 12  CYS A CB   3  
ATOM 6894  S SG   . CYS A 1 12  ? 7.407   -2.667  -9.006  1.00 0.00 ? 12  CYS A SG   3  
ATOM 6895  H H    . CYS A 1 12  ? 6.269   -6.692  -9.030  1.00 0.00 ? 12  CYS A H    3  
ATOM 6896  H HA   . CYS A 1 12  ? 5.677   -4.612  -8.220  1.00 0.00 ? 12  CYS A HA   3  
ATOM 6897  H HB2  . CYS A 1 12  ? 7.265   -4.570  -10.444 1.00 0.00 ? 12  CYS A HB2  3  
ATOM 6898  H HB3  . CYS A 1 12  ? 6.034   -3.383  -10.829 1.00 0.00 ? 12  CYS A HB3  3  
ATOM 6899  N N    . THR A 1 13  ? 3.162   -5.078  -9.337  1.00 0.00 ? 13  THR A N    3  
ATOM 6900  C CA   . THR A 1 13  ? 1.757   -4.780  -9.608  1.00 0.00 ? 13  THR A CA   3  
ATOM 6901  C C    . THR A 1 13  ? 1.070   -4.265  -8.351  1.00 0.00 ? 13  THR A C    3  
ATOM 6902  O O    . THR A 1 13  ? 0.954   -4.974  -7.359  1.00 0.00 ? 13  THR A O    3  
ATOM 6903  C CB   . THR A 1 13  ? 1.031   -6.025  -10.112 1.00 0.00 ? 13  THR A CB   3  
ATOM 6904  O OG1  . THR A 1 13  ? 1.876   -6.800  -10.944 1.00 0.00 ? 13  THR A OG1  3  
ATOM 6905  C CG2  . THR A 1 13  ? -0.226  -5.710  -10.893 1.00 0.00 ? 13  THR A CG2  3  
ATOM 6906  H H    . THR A 1 13  ? 3.410   -5.917  -8.914  1.00 0.00 ? 13  THR A H    3  
ATOM 6907  H HA   . THR A 1 13  ? 1.718   -4.014  -10.369 1.00 0.00 ? 13  THR A HA   3  
ATOM 6908  H HB   . THR A 1 13  ? 0.748   -6.625  -9.260  1.00 0.00 ? 13  THR A HB   3  
ATOM 6909  H HG1  . THR A 1 13  ? 1.676   -7.731  -10.826 1.00 0.00 ? 13  THR A HG1  3  
ATOM 6910  H HG21 . THR A 1 13  ? -0.414  -6.499  -11.606 1.00 0.00 ? 13  THR A HG21 3  
ATOM 6911  H HG22 . THR A 1 13  ? -0.100  -4.774  -11.416 1.00 0.00 ? 13  THR A HG22 3  
ATOM 6912  H HG23 . THR A 1 13  ? -1.062  -5.633  -10.212 1.00 0.00 ? 13  THR A HG23 3  
ATOM 6913  N N    . PHE A 1 14  ? 0.615   -3.024  -8.405  1.00 0.00 ? 14  PHE A N    3  
ATOM 6914  C CA   . PHE A 1 14  ? -0.056  -2.401  -7.269  1.00 0.00 ? 14  PHE A CA   3  
ATOM 6915  C C    . PHE A 1 14  ? -1.576  -2.555  -7.386  1.00 0.00 ? 14  PHE A C    3  
ATOM 6916  O O    . PHE A 1 14  ? -2.190  -2.042  -8.322  1.00 0.00 ? 14  PHE A O    3  
ATOM 6917  C CB   . PHE A 1 14  ? 0.346   -0.927  -7.187  1.00 0.00 ? 14  PHE A CB   3  
ATOM 6918  C CG   . PHE A 1 14  ? 1.786   -0.722  -7.557  1.00 0.00 ? 14  PHE A CG   3  
ATOM 6919  C CD1  . PHE A 1 14  ? 2.777   -1.480  -6.953  1.00 0.00 ? 14  PHE A CD1  3  
ATOM 6920  C CD2  . PHE A 1 14  ? 2.148   0.180   -8.543  1.00 0.00 ? 14  PHE A CD2  3  
ATOM 6921  C CE1  . PHE A 1 14  ? 4.087   -1.343  -7.317  1.00 0.00 ? 14  PHE A CE1  3  
ATOM 6922  C CE2  . PHE A 1 14  ? 3.473   0.331   -8.907  1.00 0.00 ? 14  PHE A CE2  3  
ATOM 6923  C CZ   . PHE A 1 14  ? 4.445   -0.435  -8.293  1.00 0.00 ? 14  PHE A CZ   3  
ATOM 6924  H H    . PHE A 1 14  ? 0.729   -2.513  -9.230  1.00 0.00 ? 14  PHE A H    3  
ATOM 6925  H HA   . PHE A 1 14  ? 0.288   -2.898  -6.372  1.00 0.00 ? 14  PHE A HA   3  
ATOM 6926  H HB2  . PHE A 1 14  ? -0.264  -0.351  -7.866  1.00 0.00 ? 14  PHE A HB2  3  
ATOM 6927  H HB3  . PHE A 1 14  ? 0.202   -0.570  -6.179  1.00 0.00 ? 14  PHE A HB3  3  
ATOM 6928  H HD1  . PHE A 1 14  ? 2.521   -2.176  -6.172  1.00 0.00 ? 14  PHE A HD1  3  
ATOM 6929  H HD2  . PHE A 1 14  ? 1.387   0.778   -9.020  1.00 0.00 ? 14  PHE A HD2  3  
ATOM 6930  H HE1  . PHE A 1 14  ? 4.830   -1.953  -6.839  1.00 0.00 ? 14  PHE A HE1  3  
ATOM 6931  H HE2  . PHE A 1 14  ? 3.747   1.043   -9.670  1.00 0.00 ? 14  PHE A HE2  3  
ATOM 6932  H HZ   . PHE A 1 14  ? 5.480   -0.328  -8.577  1.00 0.00 ? 14  PHE A HZ   3  
ATOM 6933  N N    . LYS A 1 15  ? -2.171  -3.279  -6.439  1.00 0.00 ? 15  LYS A N    3  
ATOM 6934  C CA   . LYS A 1 15  ? -3.617  -3.521  -6.440  1.00 0.00 ? 15  LYS A CA   3  
ATOM 6935  C C    . LYS A 1 15  ? -4.328  -2.578  -5.484  1.00 0.00 ? 15  LYS A C    3  
ATOM 6936  O O    . LYS A 1 15  ? -4.003  -2.525  -4.309  1.00 0.00 ? 15  LYS A O    3  
ATOM 6937  C CB   . LYS A 1 15  ? -3.908  -4.966  -6.023  1.00 0.00 ? 15  LYS A CB   3  
ATOM 6938  C CG   . LYS A 1 15  ? -5.397  -5.276  -5.860  1.00 0.00 ? 15  LYS A CG   3  
ATOM 6939  C CD   . LYS A 1 15  ? -5.949  -6.005  -7.074  1.00 0.00 ? 15  LYS A CD   3  
ATOM 6940  C CE   . LYS A 1 15  ? -5.272  -7.352  -7.270  1.00 0.00 ? 15  LYS A CE   3  
ATOM 6941  N NZ   . LYS A 1 15  ? -6.162  -8.326  -7.961  1.00 0.00 ? 15  LYS A NZ   3  
ATOM 6942  H H    . LYS A 1 15  ? -1.621  -3.670  -5.728  1.00 0.00 ? 15  LYS A H    3  
ATOM 6943  H HA   . LYS A 1 15  ? -3.986  -3.359  -7.441  1.00 0.00 ? 15  LYS A HA   3  
ATOM 6944  H HB2  . LYS A 1 15  ? -3.502  -5.631  -6.772  1.00 0.00 ? 15  LYS A HB2  3  
ATOM 6945  H HB3  . LYS A 1 15  ? -3.415  -5.158  -5.077  1.00 0.00 ? 15  LYS A HB3  3  
ATOM 6946  H HG2  . LYS A 1 15  ? -5.530  -5.899  -4.988  1.00 0.00 ? 15  LYS A HG2  3  
ATOM 6947  H HG3  . LYS A 1 15  ? -5.946  -4.349  -5.726  1.00 0.00 ? 15  LYS A HG3  3  
ATOM 6948  H HD2  . LYS A 1 15  ? -7.008  -6.163  -6.936  1.00 0.00 ? 15  LYS A HD2  3  
ATOM 6949  H HD3  . LYS A 1 15  ? -5.784  -5.398  -7.952  1.00 0.00 ? 15  LYS A HD3  3  
ATOM 6950  H HE2  . LYS A 1 15  ? -4.381  -7.210  -7.863  1.00 0.00 ? 15  LYS A HE2  3  
ATOM 6951  H HE3  . LYS A 1 15  ? -5.001  -7.748  -6.303  1.00 0.00 ? 15  LYS A HE3  3  
ATOM 6952  H HZ1  . LYS A 1 15  ? -7.153  -8.157  -7.691  1.00 0.00 ? 15  LYS A HZ1  3  
ATOM 6953  H HZ2  . LYS A 1 15  ? -5.904  -9.297  -7.696  1.00 0.00 ? 15  LYS A HZ2  3  
ATOM 6954  H HZ3  . LYS A 1 15  ? -6.072  -8.224  -8.992  1.00 0.00 ? 15  LYS A HZ3  3  
ATOM 6955  N N    . ILE A 1 16  ? -5.334  -1.871  -5.974  1.00 0.00 ? 16  ILE A N    3  
ATOM 6956  C CA   . ILE A 1 16  ? -6.085  -0.972  -5.114  1.00 0.00 ? 16  ILE A CA   3  
ATOM 6957  C C    . ILE A 1 16  ? -7.482  -1.492  -4.846  1.00 0.00 ? 16  ILE A C    3  
ATOM 6958  O O    . ILE A 1 16  ? -8.185  -1.929  -5.757  1.00 0.00 ? 16  ILE A O    3  
ATOM 6959  C CB   . ILE A 1 16  ? -6.172  0.455   -5.678  1.00 0.00 ? 16  ILE A CB   3  
ATOM 6960  C CG1  . ILE A 1 16  ? -6.301  1.439   -4.517  1.00 0.00 ? 16  ILE A CG1  3  
ATOM 6961  C CG2  . ILE A 1 16  ? -7.334  0.602   -6.654  1.00 0.00 ? 16  ILE A CG2  3  
ATOM 6962  C CD1  . ILE A 1 16  ? -6.041  2.870   -4.905  1.00 0.00 ? 16  ILE A CD1  3  
ATOM 6963  H H    . ILE A 1 16  ? -5.597  -1.990  -6.911  1.00 0.00 ? 16  ILE A H    3  
ATOM 6964  H HA   . ILE A 1 16  ? -5.559  -0.915  -4.171  1.00 0.00 ? 16  ILE A HA   3  
ATOM 6965  H HB   . ILE A 1 16  ? -5.264  0.659   -6.209  1.00 0.00 ? 16  ILE A HB   3  
ATOM 6966  H HG12 . ILE A 1 16  ? -7.298  1.380   -4.112  1.00 0.00 ? 16  ILE A HG12 3  
ATOM 6967  H HG13 . ILE A 1 16  ? -5.592  1.170   -3.748  1.00 0.00 ? 16  ILE A HG13 3  
ATOM 6968  H HG21 . ILE A 1 16  ? -7.138  1.425   -7.325  1.00 0.00 ? 16  ILE A HG21 3  
ATOM 6969  H HG22 . ILE A 1 16  ? -8.243  0.794   -6.104  1.00 0.00 ? 16  ILE A HG22 3  
ATOM 6970  H HG23 . ILE A 1 16  ? -7.443  -0.309  -7.223  1.00 0.00 ? 16  ILE A HG23 3  
ATOM 6971  H HD11 . ILE A 1 16  ? -6.687  3.142   -5.724  1.00 0.00 ? 16  ILE A HD11 3  
ATOM 6972  H HD12 . ILE A 1 16  ? -5.007  2.972   -5.210  1.00 0.00 ? 16  ILE A HD12 3  
ATOM 6973  H HD13 . ILE A 1 16  ? -6.240  3.514   -4.057  1.00 0.00 ? 16  ILE A HD13 3  
ATOM 6974  N N    . SER A 1 17  ? -7.876  -1.436  -3.587  1.00 0.00 ? 17  SER A N    3  
ATOM 6975  C CA   . SER A 1 17  ? -9.194  -1.897  -3.183  1.00 0.00 ? 17  SER A CA   3  
ATOM 6976  C C    . SER A 1 17  ? -10.050 -0.722  -2.706  1.00 0.00 ? 17  SER A C    3  
ATOM 6977  O O    . SER A 1 17  ? -9.595  0.427   -2.703  1.00 0.00 ? 17  SER A O    3  
ATOM 6978  C CB   . SER A 1 17  ? -9.077  -2.944  -2.073  1.00 0.00 ? 17  SER A CB   3  
ATOM 6979  O OG   . SER A 1 17  ? -9.117  -4.257  -2.604  1.00 0.00 ? 17  SER A OG   3  
ATOM 6980  H H    . SER A 1 17  ? -7.268  -1.077  -2.908  1.00 0.00 ? 17  SER A H    3  
ATOM 6981  H HA   . SER A 1 17  ? -9.659  -2.350  -4.048  1.00 0.00 ? 17  SER A HA   3  
ATOM 6982  H HB2  . SER A 1 17  ? -8.143  -2.809  -1.550  1.00 0.00 ? 17  SER A HB2  3  
ATOM 6983  H HB3  . SER A 1 17  ? -9.898  -2.824  -1.380  1.00 0.00 ? 17  SER A HB3  3  
ATOM 6984  H HG   . SER A 1 17  ? -8.555  -4.305  -3.381  1.00 0.00 ? 17  SER A HG   3  
ATOM 6985  N N    . LEU A 1 18  ? -11.276 -1.020  -2.276  1.00 0.00 ? 18  LEU A N    3  
ATOM 6986  C CA   . LEU A 1 18  ? -12.183 0.011   -1.778  1.00 0.00 ? 18  LEU A CA   3  
ATOM 6987  C C    . LEU A 1 18  ? -13.153 -0.558  -0.742  1.00 0.00 ? 18  LEU A C    3  
ATOM 6988  O O    . LEU A 1 18  ? -14.185 -1.131  -1.091  1.00 0.00 ? 18  LEU A O    3  
ATOM 6989  C CB   . LEU A 1 18  ? -12.956 0.641   -2.942  1.00 0.00 ? 18  LEU A CB   3  
ATOM 6990  C CG   . LEU A 1 18  ? -13.177 2.160   -2.867  1.00 0.00 ? 18  LEU A CG   3  
ATOM 6991  C CD1  . LEU A 1 18  ? -11.952 2.877   -2.317  1.00 0.00 ? 18  LEU A CD1  3  
ATOM 6992  C CD2  . LEU A 1 18  ? -13.512 2.698   -4.243  1.00 0.00 ? 18  LEU A CD2  3  
ATOM 6993  H H    . LEU A 1 18  ? -11.561 -1.959  -2.269  1.00 0.00 ? 18  LEU A H    3  
ATOM 6994  H HA   . LEU A 1 18  ? -11.584 0.769   -1.308  1.00 0.00 ? 18  LEU A HA   3  
ATOM 6995  H HB2  . LEU A 1 18  ? -12.418 0.429   -3.854  1.00 0.00 ? 18  LEU A HB2  3  
ATOM 6996  H HB3  . LEU A 1 18  ? -13.923 0.165   -3.000  1.00 0.00 ? 18  LEU A HB3  3  
ATOM 6997  H HG   . LEU A 1 18  ? -14.014 2.370   -2.213  1.00 0.00 ? 18  LEU A HG   3  
ATOM 6998  H HD11 . LEU A 1 18  ? -11.755 3.760   -2.909  1.00 0.00 ? 18  LEU A HD11 3  
ATOM 6999  H HD12 . LEU A 1 18  ? -11.097 2.220   -2.360  1.00 0.00 ? 18  LEU A HD12 3  
ATOM 7000  H HD13 . LEU A 1 18  ? -12.136 3.166   -1.295  1.00 0.00 ? 18  LEU A HD13 3  
ATOM 7001  H HD21 . LEU A 1 18  ? -14.146 3.565   -4.146  1.00 0.00 ? 18  LEU A HD21 3  
ATOM 7002  H HD22 . LEU A 1 18  ? -14.026 1.937   -4.812  1.00 0.00 ? 18  LEU A HD22 3  
ATOM 7003  H HD23 . LEU A 1 18  ? -12.600 2.972   -4.751  1.00 0.00 ? 18  LEU A HD23 3  
ATOM 7004  N N    . ARG A 1 19  ? -12.812 -0.389  0.534   1.00 0.00 ? 19  ARG A N    3  
ATOM 7005  C CA   . ARG A 1 19  ? -13.652 -0.878  1.633   1.00 0.00 ? 19  ARG A CA   3  
ATOM 7006  C C    . ARG A 1 19  ? -14.515 0.253   2.179   1.00 0.00 ? 19  ARG A C    3  
ATOM 7007  O O    . ARG A 1 19  ? -13.990 1.239   2.687   1.00 0.00 ? 19  ARG A O    3  
ATOM 7008  C CB   . ARG A 1 19  ? -12.787 -1.454  2.765   1.00 0.00 ? 19  ARG A CB   3  
ATOM 7009  C CG   . ARG A 1 19  ? -11.376 -1.840  2.344   1.00 0.00 ? 19  ARG A CG   3  
ATOM 7010  C CD   . ARG A 1 19  ? -10.894 -3.075  3.088   1.00 0.00 ? 19  ARG A CD   3  
ATOM 7011  N NE   . ARG A 1 19  ? -9.473  -3.333  2.863   1.00 0.00 ? 19  ARG A NE   3  
ATOM 7012  C CZ   . ARG A 1 19  ? -8.711  -4.052  3.686   1.00 0.00 ? 19  ARG A CZ   3  
ATOM 7013  N NH1  . ARG A 1 19  ? -9.228  -4.590  4.784   1.00 0.00 ? 19  ARG A NH1  3  
ATOM 7014  N NH2  . ARG A 1 19  ? -7.427  -4.234  3.408   1.00 0.00 ? 19  ARG A NH2  3  
ATOM 7015  H H    . ARG A 1 19  ? -11.977 0.082   0.745   1.00 0.00 ? 19  ARG A H    3  
ATOM 7016  H HA   . ARG A 1 19  ? -14.293 -1.654  1.244   1.00 0.00 ? 19  ARG A HA   3  
ATOM 7017  H HB2  . ARG A 1 19  ? -12.712 -0.719  3.552   1.00 0.00 ? 19  ARG A HB2  3  
ATOM 7018  H HB3  . ARG A 1 19  ? -13.272 -2.334  3.158   1.00 0.00 ? 19  ARG A HB3  3  
ATOM 7019  H HG2  . ARG A 1 19  ? -11.366 -2.044  1.284   1.00 0.00 ? 19  ARG A HG2  3  
ATOM 7020  H HG3  . ARG A 1 19  ? -10.711 -1.018  2.561   1.00 0.00 ? 19  ARG A HG3  3  
ATOM 7021  H HD2  . ARG A 1 19  ? -11.061 -2.930  4.144   1.00 0.00 ? 19  ARG A HD2  3  
ATOM 7022  H HD3  . ARG A 1 19  ? -11.464 -3.928  2.749   1.00 0.00 ? 19  ARG A HD3  3  
ATOM 7023  H HE   . ARG A 1 19  ? -9.065  -2.951  2.059   1.00 0.00 ? 19  ARG A HE   3  
ATOM 7024  H HH11 . ARG A 1 19  ? -10.195 -4.458  4.999   1.00 0.00 ? 19  ARG A HH11 3  
ATOM 7025  H HH12 . ARG A 1 19  ? -8.648  -5.128  5.396   1.00 0.00 ? 19  ARG A HH12 3  
ATOM 7026  H HH21 . ARG A 1 19  ? -7.032  -3.833  2.581   1.00 0.00 ? 19  ARG A HH21 3  
ATOM 7027  H HH22 . ARG A 1 19  ? -6.854  -4.774  4.025   1.00 0.00 ? 19  ARG A HH22 3  
ATOM 7028  N N    . ASN A 1 20  ? -15.839 0.129   2.065   1.00 0.00 ? 20  ASN A N    3  
ATOM 7029  C CA   . ASN A 1 20  ? -16.726 1.187   2.548   1.00 0.00 ? 20  ASN A CA   3  
ATOM 7030  C C    . ASN A 1 20  ? -16.216 2.525   2.011   1.00 0.00 ? 20  ASN A C    3  
ATOM 7031  O O    . ASN A 1 20  ? -16.008 3.481   2.757   1.00 0.00 ? 20  ASN A O    3  
ATOM 7032  C CB   . ASN A 1 20  ? -16.749 1.204   4.079   1.00 0.00 ? 20  ASN A CB   3  
ATOM 7033  C CG   . ASN A 1 20  ? -17.614 0.101   4.656   1.00 0.00 ? 20  ASN A CG   3  
ATOM 7034  O OD1  . ASN A 1 20  ? -18.645 0.365   5.275   1.00 0.00 ? 20  ASN A OD1  3  
ATOM 7035  N ND2  . ASN A 1 20  ? -17.197 -1.144  4.458   1.00 0.00 ? 20  ASN A ND2  3  
ATOM 7036  H H    . ASN A 1 20  ? -16.220 -0.669  1.642   1.00 0.00 ? 20  ASN A H    3  
ATOM 7037  H HA   . ASN A 1 20  ? -17.728 1.000   2.170   1.00 0.00 ? 20  ASN A HA   3  
ATOM 7038  H HB2  . ASN A 1 20  ? -15.742 1.076   4.448   1.00 0.00 ? 20  ASN A HB2  3  
ATOM 7039  H HB3  . ASN A 1 20  ? -17.133 2.154   4.418   1.00 0.00 ? 20  ASN A HB3  3  
ATOM 7040  H HD21 . ASN A 1 20  ? -16.365 -1.280  3.958   1.00 0.00 ? 20  ASN A HD21 3  
ATOM 7041  H HD22 . ASN A 1 20  ? -17.738 -1.877  4.820   1.00 0.00 ? 20  ASN A HD22 3  
ATOM 7042  N N    . PHE A 1 21  ? -15.966 2.534   0.707   1.00 0.00 ? 21  PHE A N    3  
ATOM 7043  C CA   . PHE A 1 21  ? -15.420 3.688   0.002   1.00 0.00 ? 21  PHE A CA   3  
ATOM 7044  C C    . PHE A 1 21  ? -14.131 4.174   0.657   1.00 0.00 ? 21  PHE A C    3  
ATOM 7045  O O    . PHE A 1 21  ? -13.849 5.369   0.706   1.00 0.00 ? 21  PHE A O    3  
ATOM 7046  C CB   . PHE A 1 21  ? -16.444 4.823   -0.127  1.00 0.00 ? 21  PHE A CB   3  
ATOM 7047  C CG   . PHE A 1 21  ? -16.831 5.490   1.165   1.00 0.00 ? 21  PHE A CG   3  
ATOM 7048  C CD1  . PHE A 1 21  ? -16.079 6.538   1.676   1.00 0.00 ? 21  PHE A CD1  3  
ATOM 7049  C CD2  . PHE A 1 21  ? -17.954 5.078   1.861   1.00 0.00 ? 21  PHE A CD2  3  
ATOM 7050  C CE1  . PHE A 1 21  ? -16.440 7.158   2.857   1.00 0.00 ? 21  PHE A CE1  3  
ATOM 7051  C CE2  . PHE A 1 21  ? -18.320 5.695   3.044   1.00 0.00 ? 21  PHE A CE2  3  
ATOM 7052  C CZ   . PHE A 1 21  ? -17.562 6.736   3.541   1.00 0.00 ? 21  PHE A CZ   3  
ATOM 7053  H H    . PHE A 1 21  ? -16.123 1.710   0.202   1.00 0.00 ? 21  PHE A H    3  
ATOM 7054  H HA   . PHE A 1 21  ? -15.171 3.350   -0.994  1.00 0.00 ? 21  PHE A HA   3  
ATOM 7055  H HB2  . PHE A 1 21  ? -16.036 5.583   -0.775  1.00 0.00 ? 21  PHE A HB2  3  
ATOM 7056  H HB3  . PHE A 1 21  ? -17.340 4.426   -0.578  1.00 0.00 ? 21  PHE A HB3  3  
ATOM 7057  H HD1  . PHE A 1 21  ? -15.204 6.873   1.142   1.00 0.00 ? 21  PHE A HD1  3  
ATOM 7058  H HD2  . PHE A 1 21  ? -18.547 4.265   1.472   1.00 0.00 ? 21  PHE A HD2  3  
ATOM 7059  H HE1  . PHE A 1 21  ? -15.846 7.973   3.243   1.00 0.00 ? 21  PHE A HE1  3  
ATOM 7060  H HE2  . PHE A 1 21  ? -19.198 5.365   3.577   1.00 0.00 ? 21  PHE A HE2  3  
ATOM 7061  H HZ   . PHE A 1 21  ? -17.846 7.219   4.464   1.00 0.00 ? 21  PHE A HZ   3  
ATOM 7062  N N    . ARG A 1 22  ? -13.324 3.217   1.104   1.00 0.00 ? 22  ARG A N    3  
ATOM 7063  C CA   . ARG A 1 22  ? -12.026 3.499   1.704   1.00 0.00 ? 22  ARG A CA   3  
ATOM 7064  C C    . ARG A 1 22  ? -10.969 2.972   0.751   1.00 0.00 ? 22  ARG A C    3  
ATOM 7065  O O    . ARG A 1 22  ? -11.064 1.831   0.307   1.00 0.00 ? 22  ARG A O    3  
ATOM 7066  C CB   . ARG A 1 22  ? -11.903 2.812   3.067   1.00 0.00 ? 22  ARG A CB   3  
ATOM 7067  C CG   . ARG A 1 22  ? -10.637 3.163   3.828   1.00 0.00 ? 22  ARG A CG   3  
ATOM 7068  C CD   . ARG A 1 22  ? -10.012 1.934   4.472   1.00 0.00 ? 22  ARG A CD   3  
ATOM 7069  N NE   . ARG A 1 22  ? -10.212 1.916   5.920   1.00 0.00 ? 22  ARG A NE   3  
ATOM 7070  C CZ   . ARG A 1 22  ? -10.295 0.804   6.648   1.00 0.00 ? 22  ARG A CZ   3  
ATOM 7071  N NH1  . ARG A 1 22  ? -10.190 -0.388  6.073   1.00 0.00 ? 22  ARG A NH1  3  
ATOM 7072  N NH2  . ARG A 1 22  ? -10.479 0.884   7.959   1.00 0.00 ? 22  ARG A NH2  3  
ATOM 7073  H H    . ARG A 1 22  ? -13.586 2.279   1.001   1.00 0.00 ? 22  ARG A H    3  
ATOM 7074  H HA   . ARG A 1 22  ? -11.918 4.569   1.815   1.00 0.00 ? 22  ARG A HA   3  
ATOM 7075  H HB2  . ARG A 1 22  ? -12.750 3.092   3.675   1.00 0.00 ? 22  ARG A HB2  3  
ATOM 7076  H HB3  . ARG A 1 22  ? -11.919 1.743   2.916   1.00 0.00 ? 22  ARG A HB3  3  
ATOM 7077  H HG2  . ARG A 1 22  ? -9.926  3.602   3.145   1.00 0.00 ? 22  ARG A HG2  3  
ATOM 7078  H HG3  . ARG A 1 22  ? -10.884 3.873   4.602   1.00 0.00 ? 22  ARG A HG3  3  
ATOM 7079  H HD2  . ARG A 1 22  ? -10.461 1.051   4.044   1.00 0.00 ? 22  ARG A HD2  3  
ATOM 7080  H HD3  . ARG A 1 22  ? -8.952  1.935   4.264   1.00 0.00 ? 22  ARG A HD3  3  
ATOM 7081  H HE   . ARG A 1 22  ? -10.291 2.781   6.375   1.00 0.00 ? 22  ARG A HE   3  
ATOM 7082  H HH11 . ARG A 1 22  ? -10.050 -0.459  5.087   1.00 0.00 ? 22  ARG A HH11 3  
ATOM 7083  H HH12 . ARG A 1 22  ? -10.253 -1.217  6.629   1.00 0.00 ? 22  ARG A HH12 3  
ATOM 7084  H HH21 . ARG A 1 22  ? -10.558 1.779   8.398   1.00 0.00 ? 22  ARG A HH21 3  
ATOM 7085  H HH22 . ARG A 1 22  ? -10.542 0.050   8.507   1.00 0.00 ? 22  ARG A HH22 3  
ATOM 7086  N N    . SER A 1 23  ? -9.990  3.788   0.392   1.00 0.00 ? 23  SER A N    3  
ATOM 7087  C CA   . SER A 1 23  ? -8.991  3.343   -0.558  1.00 0.00 ? 23  SER A CA   3  
ATOM 7088  C C    . SER A 1 23  ? -7.821  2.670   0.131   1.00 0.00 ? 23  SER A C    3  
ATOM 7089  O O    . SER A 1 23  ? -7.295  3.172   1.117   1.00 0.00 ? 23  SER A O    3  
ATOM 7090  C CB   . SER A 1 23  ? -8.494  4.528   -1.382  1.00 0.00 ? 23  SER A CB   3  
ATOM 7091  O OG   . SER A 1 23  ? -8.143  4.129   -2.696  1.00 0.00 ? 23  SER A OG   3  
ATOM 7092  H H    . SER A 1 23  ? -9.950  4.707   0.742   1.00 0.00 ? 23  SER A H    3  
ATOM 7093  H HA   . SER A 1 23  ? -9.461  2.632   -1.225  1.00 0.00 ? 23  SER A HA   3  
ATOM 7094  H HB2  . SER A 1 23  ? -9.270  5.273   -1.439  1.00 0.00 ? 23  SER A HB2  3  
ATOM 7095  H HB3  . SER A 1 23  ? -7.628  4.954   -0.904  1.00 0.00 ? 23  SER A HB3  3  
ATOM 7096  H HG   . SER A 1 23  ? -7.472  4.721   -3.042  1.00 0.00 ? 23  SER A HG   3  
ATOM 7097  N N    . ILE A 1 24  ? -7.405  1.544   -0.424  1.00 0.00 ? 24  ILE A N    3  
ATOM 7098  C CA   . ILE A 1 24  ? -6.263  0.802   0.094   1.00 0.00 ? 24  ILE A CA   3  
ATOM 7099  C C    . ILE A 1 24  ? -5.526  0.183   -1.073  1.00 0.00 ? 24  ILE A C    3  
ATOM 7100  O O    . ILE A 1 24  ? -6.037  -0.722  -1.729  1.00 0.00 ? 24  ILE A O    3  
ATOM 7101  C CB   . ILE A 1 24  ? -6.661  -0.310  1.081   1.00 0.00 ? 24  ILE A CB   3  
ATOM 7102  C CG1  . ILE A 1 24  ? -7.051  0.289   2.435   1.00 0.00 ? 24  ILE A CG1  3  
ATOM 7103  C CG2  . ILE A 1 24  ? -5.526  -1.328  1.246   1.00 0.00 ? 24  ILE A CG2  3  
ATOM 7104  C CD1  . ILE A 1 24  ? -8.455  -0.068  2.871   1.00 0.00 ? 24  ILE A CD1  3  
ATOM 7105  H H    . ILE A 1 24  ? -7.864  1.212   -1.229  1.00 0.00 ? 24  ILE A H    3  
ATOM 7106  H HA   . ILE A 1 24  ? -5.613  1.500   0.602   1.00 0.00 ? 24  ILE A HA   3  
ATOM 7107  H HB   . ILE A 1 24  ? -7.505  -0.817  0.668   1.00 0.00 ? 24  ILE A HB   3  
ATOM 7108  H HG12 . ILE A 1 24  ? -6.369  -0.071  3.192   1.00 0.00 ? 24  ILE A HG12 3  
ATOM 7109  H HG13 . ILE A 1 24  ? -6.983  1.365   2.380   1.00 0.00 ? 24  ILE A HG13 3  
ATOM 7110  H HG21 . ILE A 1 24  ? -5.787  -2.039  2.016   1.00 0.00 ? 24  ILE A HG21 3  
ATOM 7111  H HG22 . ILE A 1 24  ? -4.618  -0.816  1.525   1.00 0.00 ? 24  ILE A HG22 3  
ATOM 7112  H HG23 . ILE A 1 24  ? -5.366  -1.853  0.312   1.00 0.00 ? 24  ILE A HG23 3  
ATOM 7113  H HD11 . ILE A 1 24  ? -8.504  -0.086  3.949   1.00 0.00 ? 24  ILE A HD11 3  
ATOM 7114  H HD12 . ILE A 1 24  ? -8.718  -1.041  2.483   1.00 0.00 ? 24  ILE A HD12 3  
ATOM 7115  H HD13 . ILE A 1 24  ? -9.148  0.669   2.492   1.00 0.00 ? 24  ILE A HD13 3  
ATOM 7116  N N    . LEU A 1 25  ? -4.337  0.674   -1.339  1.00 0.00 ? 25  LEU A N    3  
ATOM 7117  C CA   . LEU A 1 25  ? -3.560  0.168   -2.439  1.00 0.00 ? 25  LEU A CA   3  
ATOM 7118  C C    . LEU A 1 25  ? -2.470  -0.761  -1.942  1.00 0.00 ? 25  LEU A C    3  
ATOM 7119  O O    . LEU A 1 25  ? -1.886  -0.559  -0.877  1.00 0.00 ? 25  LEU A O    3  
ATOM 7120  C CB   . LEU A 1 25  ? -3.001  1.317   -3.264  1.00 0.00 ? 25  LEU A CB   3  
ATOM 7121  C CG   . LEU A 1 25  ? -1.864  2.110   -2.621  1.00 0.00 ? 25  LEU A CG   3  
ATOM 7122  C CD1  . LEU A 1 25  ? -0.525  1.528   -3.034  1.00 0.00 ? 25  LEU A CD1  3  
ATOM 7123  C CD2  . LEU A 1 25  ? -1.956  3.588   -3.003  1.00 0.00 ? 25  LEU A CD2  3  
ATOM 7124  H H    . LEU A 1 25  ? -3.979  1.389   -0.790  1.00 0.00 ? 25  LEU A H    3  
ATOM 7125  H HA   . LEU A 1 25  ? -4.229  -0.404  -3.064  1.00 0.00 ? 25  LEU A HA   3  
ATOM 7126  H HB2  . LEU A 1 25  ? -2.654  0.916   -4.202  1.00 0.00 ? 25  LEU A HB2  3  
ATOM 7127  H HB3  . LEU A 1 25  ? -3.809  1.994   -3.464  1.00 0.00 ? 25  LEU A HB3  3  
ATOM 7128  H HG   . LEU A 1 25  ? -1.944  2.035   -1.546  1.00 0.00 ? 25  LEU A HG   3  
ATOM 7129  H HD11 . LEU A 1 25  ? -0.054  1.077   -2.175  1.00 0.00 ? 25  LEU A HD11 3  
ATOM 7130  H HD12 . LEU A 1 25  ? 0.106   2.312   -3.423  1.00 0.00 ? 25  LEU A HD12 3  
ATOM 7131  H HD13 . LEU A 1 25  ? -0.676  0.778   -3.796  1.00 0.00 ? 25  LEU A HD13 3  
ATOM 7132  H HD21 . LEU A 1 25  ? -2.629  3.704   -3.839  1.00 0.00 ? 25  LEU A HD21 3  
ATOM 7133  H HD22 . LEU A 1 25  ? -0.978  3.952   -3.276  1.00 0.00 ? 25  LEU A HD22 3  
ATOM 7134  H HD23 . LEU A 1 25  ? -2.326  4.158   -2.164  1.00 0.00 ? 25  LEU A HD23 3  
ATOM 7135  N N    . SER A 1 26  ? -2.238  -1.799  -2.717  1.00 0.00 ? 26  SER A N    3  
ATOM 7136  C CA   . SER A 1 26  ? -1.261  -2.815  -2.384  1.00 0.00 ? 26  SER A CA   3  
ATOM 7137  C C    . SER A 1 26  ? -0.322  -3.061  -3.549  1.00 0.00 ? 26  SER A C    3  
ATOM 7138  O O    . SER A 1 26  ? -0.401  -2.387  -4.572  1.00 0.00 ? 26  SER A O    3  
ATOM 7139  C CB   . SER A 1 26  ? -1.975  -4.115  -2.018  1.00 0.00 ? 26  SER A CB   3  
ATOM 7140  O OG   . SER A 1 26  ? -2.321  -4.857  -3.174  1.00 0.00 ? 26  SER A OG   3  
ATOM 7141  H H    . SER A 1 26  ? -2.760  -1.894  -3.532  1.00 0.00 ? 26  SER A H    3  
ATOM 7142  H HA   . SER A 1 26  ? -0.693  -2.472  -1.534  1.00 0.00 ? 26  SER A HA   3  
ATOM 7143  H HB2  . SER A 1 26  ? -1.335  -4.715  -1.403  1.00 0.00 ? 26  SER A HB2  3  
ATOM 7144  H HB3  . SER A 1 26  ? -2.872  -3.884  -1.475  1.00 0.00 ? 26  SER A HB3  3  
ATOM 7145  H HG   . SER A 1 26  ? -2.995  -5.503  -2.951  1.00 0.00 ? 26  SER A HG   3  
ATOM 7146  N N    . TRP A 1 27  ? 0.565   -4.029  -3.380  1.00 0.00 ? 27  TRP A N    3  
ATOM 7147  C CA   . TRP A 1 27  ? 1.527   -4.372  -4.422  1.00 0.00 ? 27  TRP A CA   3  
ATOM 7148  C C    . TRP A 1 27  ? 1.770   -5.870  -4.522  1.00 0.00 ? 27  TRP A C    3  
ATOM 7149  O O    . TRP A 1 27  ? 1.583   -6.620  -3.564  1.00 0.00 ? 27  TRP A O    3  
ATOM 7150  C CB   . TRP A 1 27  ? 2.834   -3.643  -4.193  1.00 0.00 ? 27  TRP A CB   3  
ATOM 7151  C CG   . TRP A 1 27  ? 3.428   -3.878  -2.843  1.00 0.00 ? 27  TRP A CG   3  
ATOM 7152  C CD1  . TRP A 1 27  ? 3.959   -5.030  -2.349  1.00 0.00 ? 27  TRP A CD1  3  
ATOM 7153  C CD2  . TRP A 1 27  ? 3.545   -2.912  -1.811  1.00 0.00 ? 27  TRP A CD2  3  
ATOM 7154  N NE1  . TRP A 1 27  ? 4.407   -4.830  -1.068  1.00 0.00 ? 27  TRP A NE1  3  
ATOM 7155  C CE2  . TRP A 1 27  ? 4.160   -3.532  -0.717  1.00 0.00 ? 27  TRP A CE2  3  
ATOM 7156  C CE3  . TRP A 1 27  ? 3.189   -1.578  -1.717  1.00 0.00 ? 27  TRP A CE3  3  
ATOM 7157  C CZ2  . TRP A 1 27  ? 4.424   -2.856  0.464   1.00 0.00 ? 27  TRP A CZ2  3  
ATOM 7158  C CZ3  . TRP A 1 27  ? 3.449   -0.902  -0.544  1.00 0.00 ? 27  TRP A CZ3  3  
ATOM 7159  C CH2  . TRP A 1 27  ? 4.062   -1.543  0.536   1.00 0.00 ? 27  TRP A CH2  3  
ATOM 7160  H H    . TRP A 1 27  ? 0.568   -4.528  -2.536  1.00 0.00 ? 27  TRP A H    3  
ATOM 7161  H HA   . TRP A 1 27  ? 1.128   -4.040  -5.367  1.00 0.00 ? 27  TRP A HA   3  
ATOM 7162  H HB2  . TRP A 1 27  ? 3.539   -3.954  -4.941  1.00 0.00 ? 27  TRP A HB2  3  
ATOM 7163  H HB3  . TRP A 1 27  ? 2.659   -2.583  -4.296  1.00 0.00 ? 27  TRP A HB3  3  
ATOM 7164  H HD1  . TRP A 1 27  ? 4.018   -5.950  -2.892  1.00 0.00 ? 27  TRP A HD1  3  
ATOM 7165  H HE1  . TRP A 1 27  ? 4.832   -5.505  -0.499  1.00 0.00 ? 27  TRP A HE1  3  
ATOM 7166  H HE3  . TRP A 1 27  ? 2.720   -1.076  -2.545  1.00 0.00 ? 27  TRP A HE3  3  
ATOM 7167  H HZ2  . TRP A 1 27  ? 4.888   -3.341  1.302   1.00 0.00 ? 27  TRP A HZ2  3  
ATOM 7168  H HZ3  . TRP A 1 27  ? 3.174   0.132   -0.452  1.00 0.00 ? 27  TRP A HZ3  3  
ATOM 7169  H HH2  . TRP A 1 27  ? 4.246   -0.982  1.438   1.00 0.00 ? 27  TRP A HH2  3  
ATOM 7170  N N    . GLU A 1 28  ? 2.196   -6.279  -5.705  1.00 0.00 ? 28  GLU A N    3  
ATOM 7171  C CA   . GLU A 1 28  ? 2.492   -7.665  -6.008  1.00 0.00 ? 28  GLU A CA   3  
ATOM 7172  C C    . GLU A 1 28  ? 3.893   -7.765  -6.532  1.00 0.00 ? 28  GLU A C    3  
ATOM 7173  O O    . GLU A 1 28  ? 4.131   -7.770  -7.740  1.00 0.00 ? 28  GLU A O    3  
ATOM 7174  C CB   . GLU A 1 28  ? 1.487   -8.200  -7.025  1.00 0.00 ? 28  GLU A CB   3  
ATOM 7175  C CG   . GLU A 1 28  ? 0.686   -9.390  -6.527  1.00 0.00 ? 28  GLU A CG   3  
ATOM 7176  C CD   . GLU A 1 28  ? 1.568   -10.541 -6.082  1.00 0.00 ? 28  GLU A CD   3  
ATOM 7177  O OE1  . GLU A 1 28  ? 2.089   -10.484 -4.948  1.00 0.00 ? 28  GLU A OE1  3  
ATOM 7178  O OE2  . GLU A 1 28  ? 1.736   -11.498 -6.866  1.00 0.00 ? 28  GLU A OE2  3  
ATOM 7179  H H    . GLU A 1 28  ? 2.317   -5.613  -6.414  1.00 0.00 ? 28  GLU A H    3  
ATOM 7180  H HA   . GLU A 1 28  ? 2.445   -8.245  -5.106  1.00 0.00 ? 28  GLU A HA   3  
ATOM 7181  H HB2  . GLU A 1 28  ? 0.794   -7.404  -7.269  1.00 0.00 ? 28  GLU A HB2  3  
ATOM 7182  H HB3  . GLU A 1 28  ? 2.014   -8.494  -7.921  1.00 0.00 ? 28  GLU A HB3  3  
ATOM 7183  H HG2  . GLU A 1 28  ? 0.080   -9.076  -5.691  1.00 0.00 ? 28  GLU A HG2  3  
ATOM 7184  H HG3  . GLU A 1 28  ? 0.045   -9.734  -7.326  1.00 0.00 ? 28  GLU A HG3  3  
ATOM 7185  N N    . LEU A 1 29  ? 4.824   -7.843  -5.603  1.00 0.00 ? 29  LEU A N    3  
ATOM 7186  C CA   . LEU A 1 29  ? 6.210   -7.944  -5.957  1.00 0.00 ? 29  LEU A CA   3  
ATOM 7187  C C    . LEU A 1 29  ? 6.689   -9.357  -5.707  1.00 0.00 ? 29  LEU A C    3  
ATOM 7188  O O    . LEU A 1 29  ? 6.888   -9.785  -4.569  1.00 0.00 ? 29  LEU A O    3  
ATOM 7189  C CB   . LEU A 1 29  ? 7.039   -6.952  -5.143  1.00 0.00 ? 29  LEU A CB   3  
ATOM 7190  C CG   . LEU A 1 29  ? 6.221   -5.962  -4.311  1.00 0.00 ? 29  LEU A CG   3  
ATOM 7191  C CD1  . LEU A 1 29  ? 6.685   -5.972  -2.871  1.00 0.00 ? 29  LEU A CD1  3  
ATOM 7192  C CD2  . LEU A 1 29  ? 6.302   -4.570  -4.905  1.00 0.00 ? 29  LEU A CD2  3  
ATOM 7193  H H    . LEU A 1 29  ? 4.569   -7.841  -4.657  1.00 0.00 ? 29  LEU A H    3  
ATOM 7194  H HA   . LEU A 1 29  ? 6.308   -7.708  -7.010  1.00 0.00 ? 29  LEU A HA   3  
ATOM 7195  H HB2  . LEU A 1 29  ? 7.680   -7.511  -4.476  1.00 0.00 ? 29  LEU A HB2  3  
ATOM 7196  H HB3  . LEU A 1 29  ? 7.660   -6.390  -5.824  1.00 0.00 ? 29  LEU A HB3  3  
ATOM 7197  H HG   . LEU A 1 29  ? 5.187   -6.260  -4.320  1.00 0.00 ? 29  LEU A HG   3  
ATOM 7198  H HD11 . LEU A 1 29  ? 6.455   -5.023  -2.409  1.00 0.00 ? 29  LEU A HD11 3  
ATOM 7199  H HD12 . LEU A 1 29  ? 7.750   -6.144  -2.840  1.00 0.00 ? 29  LEU A HD12 3  
ATOM 7200  H HD13 . LEU A 1 29  ? 6.176   -6.764  -2.342  1.00 0.00 ? 29  LEU A HD13 3  
ATOM 7201  H HD21 . LEU A 1 29  ? 5.357   -4.324  -5.366  1.00 0.00 ? 29  LEU A HD21 3  
ATOM 7202  H HD22 . LEU A 1 29  ? 7.082   -4.543  -5.651  1.00 0.00 ? 29  LEU A HD22 3  
ATOM 7203  H HD23 . LEU A 1 29  ? 6.518   -3.857  -4.124  1.00 0.00 ? 29  LEU A HD23 3  
ATOM 7204  N N    . LYS A 1 30  ? 6.867   -10.057 -6.793  1.00 0.00 ? 30  LYS A N    3  
ATOM 7205  C CA   . LYS A 1 30  ? 7.327   -11.440 -6.767  1.00 0.00 ? 30  LYS A CA   3  
ATOM 7206  C C    . LYS A 1 30  ? 8.774   -11.521 -6.293  1.00 0.00 ? 30  LYS A C    3  
ATOM 7207  O O    . LYS A 1 30  ? 9.499   -10.527 -6.310  1.00 0.00 ? 30  LYS A O    3  
ATOM 7208  C CB   . LYS A 1 30  ? 7.197   -12.069 -8.156  1.00 0.00 ? 30  LYS A CB   3  
ATOM 7209  C CG   . LYS A 1 30  ? 5.869   -12.774 -8.384  1.00 0.00 ? 30  LYS A CG   3  
ATOM 7210  C CD   . LYS A 1 30  ? 6.067   -14.170 -8.952  1.00 0.00 ? 30  LYS A CD   3  
ATOM 7211  C CE   . LYS A 1 30  ? 6.084   -15.221 -7.854  1.00 0.00 ? 30  LYS A CE   3  
ATOM 7212  N NZ   . LYS A 1 30  ? 7.126   -16.257 -8.094  1.00 0.00 ? 30  LYS A NZ   3  
ATOM 7213  H H    . LYS A 1 30  ? 6.662   -9.628  -7.641  1.00 0.00 ? 30  LYS A H    3  
ATOM 7214  H HA   . LYS A 1 30  ? 6.702   -11.984 -6.075  1.00 0.00 ? 30  LYS A HA   3  
ATOM 7215  H HB2  . LYS A 1 30  ? 7.301   -11.293 -8.901  1.00 0.00 ? 30  LYS A HB2  3  
ATOM 7216  H HB3  . LYS A 1 30  ? 7.991   -12.789 -8.287  1.00 0.00 ? 30  LYS A HB3  3  
ATOM 7217  H HG2  . LYS A 1 30  ? 5.348   -12.851 -7.441  1.00 0.00 ? 30  LYS A HG2  3  
ATOM 7218  H HG3  . LYS A 1 30  ? 5.279   -12.193 -9.077  1.00 0.00 ? 30  LYS A HG3  3  
ATOM 7219  H HD2  . LYS A 1 30  ? 5.259   -14.389 -9.633  1.00 0.00 ? 30  LYS A HD2  3  
ATOM 7220  H HD3  . LYS A 1 30  ? 7.008   -14.202 -9.483  1.00 0.00 ? 30  LYS A HD3  3  
ATOM 7221  H HE2  . LYS A 1 30  ? 6.284   -14.735 -6.910  1.00 0.00 ? 30  LYS A HE2  3  
ATOM 7222  H HE3  . LYS A 1 30  ? 5.116   -15.698 -7.815  1.00 0.00 ? 30  LYS A HE3  3  
ATOM 7223  H HZ1  . LYS A 1 30  ? 6.705   -17.086 -8.560  1.00 0.00 ? 30  LYS A HZ1  3  
ATOM 7224  H HZ2  . LYS A 1 30  ? 7.547   -16.558 -7.192  1.00 0.00 ? 30  LYS A HZ2  3  
ATOM 7225  H HZ3  . LYS A 1 30  ? 7.877   -15.874 -8.703  1.00 0.00 ? 30  LYS A HZ3  3  
ATOM 7226  N N    . ASN A 1 31  ? 9.188   -12.711 -5.869  1.00 0.00 ? 31  ASN A N    3  
ATOM 7227  C CA   . ASN A 1 31  ? 10.549  -12.918 -5.389  1.00 0.00 ? 31  ASN A CA   3  
ATOM 7228  C C    . ASN A 1 31  ? 11.188  -14.128 -6.063  1.00 0.00 ? 31  ASN A C    3  
ATOM 7229  O O    . ASN A 1 31  ? 10.932  -15.271 -5.683  1.00 0.00 ? 31  ASN A O    3  
ATOM 7230  C CB   . ASN A 1 31  ? 10.556  -13.104 -3.870  1.00 0.00 ? 31  ASN A CB   3  
ATOM 7231  C CG   . ASN A 1 31  ? 9.676   -12.093 -3.158  1.00 0.00 ? 31  ASN A CG   3  
ATOM 7232  O OD1  . ASN A 1 31  ? 8.974   -12.428 -2.204  1.00 0.00 ? 31  ASN A OD1  3  
ATOM 7233  N ND2  . ASN A 1 31  ? 9.711   -10.848 -3.619  1.00 0.00 ? 31  ASN A ND2  3  
ATOM 7234  H H    . ASN A 1 31  ? 8.563   -13.466 -5.878  1.00 0.00 ? 31  ASN A H    3  
ATOM 7235  H HA   . ASN A 1 31  ? 11.125  -12.039 -5.637  1.00 0.00 ? 31  ASN A HA   3  
ATOM 7236  H HB2  . ASN A 1 31  ? 10.197  -14.094 -3.633  1.00 0.00 ? 31  ASN A HB2  3  
ATOM 7237  H HB3  . ASN A 1 31  ? 11.566  -12.995 -3.505  1.00 0.00 ? 31  ASN A HB3  3  
ATOM 7238  H HD21 . ASN A 1 31  ? 10.294  -10.653 -4.382  1.00 0.00 ? 31  ASN A HD21 3  
ATOM 7239  H HD22 . ASN A 1 31  ? 9.152   -10.175 -3.177  1.00 0.00 ? 31  ASN A HD22 3  
ATOM 7240  N N    . HIS A 1 32  ? 12.022  -13.870 -7.065  1.00 0.00 ? 32  HIS A N    3  
ATOM 7241  C CA   . HIS A 1 32  ? 12.699  -14.939 -7.791  1.00 0.00 ? 32  HIS A CA   3  
ATOM 7242  C C    . HIS A 1 32  ? 14.076  -15.212 -7.193  1.00 0.00 ? 32  HIS A C    3  
ATOM 7243  O O    . HIS A 1 32  ? 14.312  -16.271 -6.612  1.00 0.00 ? 32  HIS A O    3  
ATOM 7244  C CB   . HIS A 1 32  ? 12.832  -14.574 -9.272  1.00 0.00 ? 32  HIS A CB   3  
ATOM 7245  C CG   . HIS A 1 32  ? 12.299  -15.624 -10.196 1.00 0.00 ? 32  HIS A CG   3  
ATOM 7246  N ND1  . HIS A 1 32  ? 10.953  -15.888 -10.340 1.00 0.00 ? 32  HIS A ND1  3  
ATOM 7247  C CD2  . HIS A 1 32  ? 12.938  -16.480 -11.029 1.00 0.00 ? 32  HIS A CD2  3  
ATOM 7248  C CE1  . HIS A 1 32  ? 10.787  -16.860 -11.218 1.00 0.00 ? 32  HIS A CE1  3  
ATOM 7249  N NE2  . HIS A 1 32  ? 11.976  -17.236 -11.652 1.00 0.00 ? 32  HIS A NE2  3  
ATOM 7250  H H    . HIS A 1 32  ? 12.188  -12.939 -7.322  1.00 0.00 ? 32  HIS A H    3  
ATOM 7251  H HA   . HIS A 1 32  ? 12.098  -15.831 -7.702  1.00 0.00 ? 32  HIS A HA   3  
ATOM 7252  H HB2  . HIS A 1 32  ? 12.288  -13.660 -9.459  1.00 0.00 ? 32  HIS A HB2  3  
ATOM 7253  H HB3  . HIS A 1 32  ? 13.875  -14.420 -9.507  1.00 0.00 ? 32  HIS A HB3  3  
ATOM 7254  H HD1  . HIS A 1 32  ? 10.226  -15.430 -9.867  1.00 0.00 ? 32  HIS A HD1  3  
ATOM 7255  H HD2  . HIS A 1 32  ? 14.007  -16.553 -11.177 1.00 0.00 ? 32  HIS A HD2  3  
ATOM 7256  H HE1  . HIS A 1 32  ? 9.841   -17.276 -11.531 1.00 0.00 ? 32  HIS A HE1  3  
ATOM 7257  H HE2  . HIS A 1 32  ? 12.137  -17.882 -12.371 1.00 0.00 ? 32  HIS A HE2  3  
ATOM 7258  N N    . SER A 1 33  ? 14.980  -14.249 -7.338  1.00 0.00 ? 33  SER A N    3  
ATOM 7259  C CA   . SER A 1 33  ? 16.333  -14.384 -6.811  1.00 0.00 ? 33  SER A CA   3  
ATOM 7260  C C    . SER A 1 33  ? 16.455  -13.701 -5.453  1.00 0.00 ? 33  SER A C    3  
ATOM 7261  O O    . SER A 1 33  ? 16.890  -14.311 -4.476  1.00 0.00 ? 33  SER A O    3  
ATOM 7262  C CB   . SER A 1 33  ? 17.347  -13.787 -7.788  1.00 0.00 ? 33  SER A CB   3  
ATOM 7263  O OG   . SER A 1 33  ? 17.431  -14.559 -8.973  1.00 0.00 ? 33  SER A OG   3  
ATOM 7264  H H    . SER A 1 33  ? 14.731  -13.427 -7.810  1.00 0.00 ? 33  SER A H    3  
ATOM 7265  H HA   . SER A 1 33  ? 16.539  -15.437 -6.691  1.00 0.00 ? 33  SER A HA   3  
ATOM 7266  H HB2  . SER A 1 33  ? 17.045  -12.783 -8.049  1.00 0.00 ? 33  SER A HB2  3  
ATOM 7267  H HB3  . SER A 1 33  ? 18.321  -13.759 -7.321  1.00 0.00 ? 33  SER A HB3  3  
ATOM 7268  H HG   . SER A 1 33  ? 17.118  -14.039 -9.717  1.00 0.00 ? 33  SER A HG   3  
ATOM 7269  N N    . ILE A 1 34  ? 16.065  -12.432 -5.399  1.00 0.00 ? 34  ILE A N    3  
ATOM 7270  C CA   . ILE A 1 34  ? 16.127  -11.664 -4.161  1.00 0.00 ? 34  ILE A CA   3  
ATOM 7271  C C    . ILE A 1 34  ? 14.750  -11.563 -3.514  1.00 0.00 ? 34  ILE A C    3  
ATOM 7272  O O    . ILE A 1 34  ? 13.733  -11.492 -4.205  1.00 0.00 ? 34  ILE A O    3  
ATOM 7273  C CB   . ILE A 1 34  ? 16.675  -10.244 -4.404  1.00 0.00 ? 34  ILE A CB   3  
ATOM 7274  C CG1  . ILE A 1 34  ? 17.917  -10.297 -5.296  1.00 0.00 ? 34  ILE A CG1  3  
ATOM 7275  C CG2  . ILE A 1 34  ? 16.997  -9.567  -3.080  1.00 0.00 ? 34  ILE A CG2  3  
ATOM 7276  C CD1  . ILE A 1 34  ? 19.070  -11.061 -4.683  1.00 0.00 ? 34  ILE A CD1  3  
ATOM 7277  H H    . ILE A 1 34  ? 15.725  -12.001 -6.211  1.00 0.00 ? 34  ILE A H    3  
ATOM 7278  H HA   . ILE A 1 34  ? 16.796  -12.176 -3.484  1.00 0.00 ? 34  ILE A HA   3  
ATOM 7279  H HB   . ILE A 1 34  ? 15.909  -9.666  -4.898  1.00 0.00 ? 34  ILE A HB   3  
ATOM 7280  H HG12 . ILE A 1 34  ? 17.662  -10.776 -6.230  1.00 0.00 ? 34  ILE A HG12 3  
ATOM 7281  H HG13 . ILE A 1 34  ? 18.253  -9.289  -5.494  1.00 0.00 ? 34  ILE A HG13 3  
ATOM 7282  H HG21 . ILE A 1 34  ? 17.074  -8.500  -3.231  1.00 0.00 ? 34  ILE A HG21 3  
ATOM 7283  H HG22 . ILE A 1 34  ? 17.935  -9.945  -2.702  1.00 0.00 ? 34  ILE A HG22 3  
ATOM 7284  H HG23 . ILE A 1 34  ? 16.212  -9.774  -2.369  1.00 0.00 ? 34  ILE A HG23 3  
ATOM 7285  H HD11 . ILE A 1 34  ? 19.796  -11.291 -5.448  1.00 0.00 ? 34  ILE A HD11 3  
ATOM 7286  H HD12 . ILE A 1 34  ? 18.703  -11.978 -4.247  1.00 0.00 ? 34  ILE A HD12 3  
ATOM 7287  H HD13 . ILE A 1 34  ? 19.534  -10.458 -3.916  1.00 0.00 ? 34  ILE A HD13 3  
ATOM 7288  N N    . VAL A 1 35  ? 14.722  -11.561 -2.185  1.00 0.00 ? 35  VAL A N    3  
ATOM 7289  C CA   . VAL A 1 35  ? 13.467  -11.472 -1.448  1.00 0.00 ? 35  VAL A CA   3  
ATOM 7290  C C    . VAL A 1 35  ? 13.449  -10.254 -0.525  1.00 0.00 ? 35  VAL A C    3  
ATOM 7291  O O    . VAL A 1 35  ? 13.981  -10.299 0.584   1.00 0.00 ? 35  VAL A O    3  
ATOM 7292  C CB   . VAL A 1 35  ? 13.219  -12.740 -0.608  1.00 0.00 ? 35  VAL A CB   3  
ATOM 7293  C CG1  . VAL A 1 35  ? 12.736  -13.880 -1.492  1.00 0.00 ? 35  VAL A CG1  3  
ATOM 7294  C CG2  . VAL A 1 35  ? 14.478  -13.140 0.148   1.00 0.00 ? 35  VAL A CG2  3  
ATOM 7295  H H    . VAL A 1 35  ? 15.565  -11.623 -1.689  1.00 0.00 ? 35  VAL A H    3  
ATOM 7296  H HA   . VAL A 1 35  ? 12.665  -11.381 -2.166  1.00 0.00 ? 35  VAL A HA   3  
ATOM 7297  H HB   . VAL A 1 35  ? 12.445  -12.523 0.114   1.00 0.00 ? 35  VAL A HB   3  
ATOM 7298  H HG11 . VAL A 1 35  ? 13.084  -14.820 -1.089  1.00 0.00 ? 35  VAL A HG11 3  
ATOM 7299  H HG12 . VAL A 1 35  ? 13.126  -13.751 -2.491  1.00 0.00 ? 35  VAL A HG12 3  
ATOM 7300  H HG13 . VAL A 1 35  ? 11.657  -13.879 -1.523  1.00 0.00 ? 35  VAL A HG13 3  
ATOM 7301  H HG21 . VAL A 1 35  ? 14.713  -12.383 0.882   1.00 0.00 ? 35  VAL A HG21 3  
ATOM 7302  H HG22 . VAL A 1 35  ? 15.300  -13.236 -0.546  1.00 0.00 ? 35  VAL A HG22 3  
ATOM 7303  H HG23 . VAL A 1 35  ? 14.314  -14.084 0.646   1.00 0.00 ? 35  VAL A HG23 3  
ATOM 7304  N N    . PRO A 1 36  ? 12.828  -9.146  -0.969  1.00 0.00 ? 36  PRO A N    3  
ATOM 7305  C CA   . PRO A 1 36  ? 12.740  -7.919  -0.171  1.00 0.00 ? 36  PRO A CA   3  
ATOM 7306  C C    . PRO A 1 36  ? 11.757  -8.061  0.985   1.00 0.00 ? 36  PRO A C    3  
ATOM 7307  O O    . PRO A 1 36  ? 10.878  -8.922  0.959   1.00 0.00 ? 36  PRO A O    3  
ATOM 7308  C CB   . PRO A 1 36  ? 12.239  -6.881  -1.176  1.00 0.00 ? 36  PRO A CB   3  
ATOM 7309  C CG   . PRO A 1 36  ? 11.465  -7.670  -2.173  1.00 0.00 ? 36  PRO A CG   3  
ATOM 7310  C CD   . PRO A 1 36  ? 12.159  -9.002  -2.276  1.00 0.00 ? 36  PRO A CD   3  
ATOM 7311  H HA   . PRO A 1 36  ? 13.707  -7.623  0.209   1.00 0.00 ? 36  PRO A HA   3  
ATOM 7312  H HB2  . PRO A 1 36  ? 11.614  -6.159  -0.670  1.00 0.00 ? 36  PRO A HB2  3  
ATOM 7313  H HB3  . PRO A 1 36  ? 13.079  -6.383  -1.634  1.00 0.00 ? 36  PRO A HB3  3  
ATOM 7314  H HG2  . PRO A 1 36  ? 10.450  -7.802  -1.829  1.00 0.00 ? 36  PRO A HG2  3  
ATOM 7315  H HG3  . PRO A 1 36  ? 11.477  -7.167  -3.128  1.00 0.00 ? 36  PRO A HG3  3  
ATOM 7316  H HD2  . PRO A 1 36  ? 11.438  -9.791  -2.427  1.00 0.00 ? 36  PRO A HD2  3  
ATOM 7317  H HD3  . PRO A 1 36  ? 12.881  -8.989  -3.078  1.00 0.00 ? 36  PRO A HD3  3  
ATOM 7318  N N    . THR A 1 37  ? 11.907  -7.214  1.998   1.00 0.00 ? 37  THR A N    3  
ATOM 7319  C CA   . THR A 1 37  ? 11.023  -7.257  3.158   1.00 0.00 ? 37  THR A CA   3  
ATOM 7320  C C    . THR A 1 37  ? 10.274  -5.939  3.331   1.00 0.00 ? 37  THR A C    3  
ATOM 7321  O O    . THR A 1 37  ? 9.044   -5.913  3.324   1.00 0.00 ? 37  THR A O    3  
ATOM 7322  C CB   . THR A 1 37  ? 11.812  -7.601  4.427   1.00 0.00 ? 37  THR A CB   3  
ATOM 7323  O OG1  . THR A 1 37  ? 10.937  -7.800  5.522   1.00 0.00 ? 37  THR A OG1  3  
ATOM 7324  C CG2  . THR A 1 37  ? 12.824  -6.552  4.836   1.00 0.00 ? 37  THR A CG2  3  
ATOM 7325  H H    . THR A 1 37  ? 12.625  -6.549  1.964   1.00 0.00 ? 37  THR A H    3  
ATOM 7326  H HA   . THR A 1 37  ? 10.298  -8.038  2.982   1.00 0.00 ? 37  THR A HA   3  
ATOM 7327  H HB   . THR A 1 37  ? 12.348  -8.519  4.255   1.00 0.00 ? 37  THR A HB   3  
ATOM 7328  H HG1  . THR A 1 37  ? 11.442  -8.072  6.291   1.00 0.00 ? 37  THR A HG1  3  
ATOM 7329  H HG21 . THR A 1 37  ? 12.310  -5.702  5.260   1.00 0.00 ? 37  THR A HG21 3  
ATOM 7330  H HG22 . THR A 1 37  ? 13.389  -6.239  3.971   1.00 0.00 ? 37  THR A HG22 3  
ATOM 7331  H HG23 . THR A 1 37  ? 13.495  -6.969  5.573   1.00 0.00 ? 37  THR A HG23 3  
ATOM 7332  N N    . HIS A 1 38  ? 11.015  -4.847  3.481   1.00 0.00 ? 38  HIS A N    3  
ATOM 7333  C CA   . HIS A 1 38  ? 10.403  -3.534  3.650   1.00 0.00 ? 38  HIS A CA   3  
ATOM 7334  C C    . HIS A 1 38  ? 10.189  -2.841  2.313   1.00 0.00 ? 38  HIS A C    3  
ATOM 7335  O O    . HIS A 1 38  ? 10.978  -2.994  1.381   1.00 0.00 ? 38  HIS A O    3  
ATOM 7336  C CB   . HIS A 1 38  ? 11.227  -2.656  4.577   1.00 0.00 ? 38  HIS A CB   3  
ATOM 7337  C CG   . HIS A 1 38  ? 12.515  -2.176  3.991   1.00 0.00 ? 38  HIS A CG   3  
ATOM 7338  N ND1  . HIS A 1 38  ? 13.158  -2.807  2.948   1.00 0.00 ? 38  HIS A ND1  3  
ATOM 7339  C CD2  . HIS A 1 38  ? 13.285  -1.120  4.322   1.00 0.00 ? 38  HIS A CD2  3  
ATOM 7340  C CE1  . HIS A 1 38  ? 14.273  -2.160  2.667   1.00 0.00 ? 38  HIS A CE1  3  
ATOM 7341  N NE2  . HIS A 1 38  ? 14.373  -1.128  3.485   1.00 0.00 ? 38  HIS A NE2  3  
ATOM 7342  H H    . HIS A 1 38  ? 11.989  -4.927  3.472   1.00 0.00 ? 38  HIS A H    3  
ATOM 7343  H HA   . HIS A 1 38  ? 9.446   -3.680  4.108   1.00 0.00 ? 38  HIS A HA   3  
ATOM 7344  H HB2  . HIS A 1 38  ? 10.637  -1.795  4.843   1.00 0.00 ? 38  HIS A HB2  3  
ATOM 7345  H HB3  . HIS A 1 38  ? 11.452  -3.209  5.469   1.00 0.00 ? 38  HIS A HB3  3  
ATOM 7346  H HD1  . HIS A 1 38  ? 12.842  -3.607  2.480   1.00 0.00 ? 38  HIS A HD1  3  
ATOM 7347  H HD2  . HIS A 1 38  ? 13.079  -0.404  5.102   1.00 0.00 ? 38  HIS A HD2  3  
ATOM 7348  H HE1  . HIS A 1 38  ? 14.986  -2.434  1.906   1.00 0.00 ? 38  HIS A HE1  3  
ATOM 7349  H HE2  . HIS A 1 38  ? 15.041  -0.414  3.413   1.00 0.00 ? 38  HIS A HE2  3  
ATOM 7350  N N    . TYR A 1 39  ? 9.106   -2.081  2.233   1.00 0.00 ? 39  TYR A N    3  
ATOM 7351  C CA   . TYR A 1 39  ? 8.758   -1.356  1.016   1.00 0.00 ? 39  TYR A CA   3  
ATOM 7352  C C    . TYR A 1 39  ? 8.393   0.088   1.327   1.00 0.00 ? 39  TYR A C    3  
ATOM 7353  O O    . TYR A 1 39  ? 8.273   0.464   2.491   1.00 0.00 ? 39  TYR A O    3  
ATOM 7354  C CB   . TYR A 1 39  ? 7.593   -2.049  0.317   1.00 0.00 ? 39  TYR A CB   3  
ATOM 7355  C CG   . TYR A 1 39  ? 7.818   -3.527  0.131   1.00 0.00 ? 39  TYR A CG   3  
ATOM 7356  C CD1  . TYR A 1 39  ? 8.807   -3.992  -0.716  1.00 0.00 ? 39  TYR A CD1  3  
ATOM 7357  C CD2  . TYR A 1 39  ? 7.046   -4.455  0.810   1.00 0.00 ? 39  TYR A CD2  3  
ATOM 7358  C CE1  . TYR A 1 39  ? 9.022   -5.342  -0.888  1.00 0.00 ? 39  TYR A CE1  3  
ATOM 7359  C CE2  . TYR A 1 39  ? 7.247   -5.808  0.650   1.00 0.00 ? 39  TYR A CE2  3  
ATOM 7360  C CZ   . TYR A 1 39  ? 8.238   -6.251  -0.204  1.00 0.00 ? 39  TYR A CZ   3  
ATOM 7361  O OH   . TYR A 1 39  ? 8.447   -7.601  -0.370  1.00 0.00 ? 39  TYR A OH   3  
ATOM 7362  H H    . TYR A 1 39  ? 8.522   -2.012  3.015   1.00 0.00 ? 39  TYR A H    3  
ATOM 7363  H HA   . TYR A 1 39  ? 9.617   -1.367  0.364   1.00 0.00 ? 39  TYR A HA   3  
ATOM 7364  H HB2  . TYR A 1 39  ? 6.692   -1.918  0.896   1.00 0.00 ? 39  TYR A HB2  3  
ATOM 7365  H HB3  . TYR A 1 39  ? 7.450   -1.606  -0.649  1.00 0.00 ? 39  TYR A HB3  3  
ATOM 7366  H HD1  . TYR A 1 39  ? 9.416   -3.280  -1.251  1.00 0.00 ? 39  TYR A HD1  3  
ATOM 7367  H HD2  . TYR A 1 39  ? 6.281   -4.106  1.477   1.00 0.00 ? 39  TYR A HD2  3  
ATOM 7368  H HE1  . TYR A 1 39  ? 9.801   -5.679  -1.553  1.00 0.00 ? 39  TYR A HE1  3  
ATOM 7369  H HE2  . TYR A 1 39  ? 6.625   -6.512  1.188   1.00 0.00 ? 39  TYR A HE2  3  
ATOM 7370  H HH   . TYR A 1 39  ? 9.030   -7.923  0.322   1.00 0.00 ? 39  TYR A HH   3  
ATOM 7371  N N    . THR A 1 40  ? 8.200   0.894   0.285   1.00 0.00 ? 40  THR A N    3  
ATOM 7372  C CA   . THR A 1 40  ? 7.834   2.290   0.466   1.00 0.00 ? 40  THR A CA   3  
ATOM 7373  C C    . THR A 1 40  ? 6.758   2.697   -0.526  1.00 0.00 ? 40  THR A C    3  
ATOM 7374  O O    . THR A 1 40  ? 7.051   3.088   -1.656  1.00 0.00 ? 40  THR A O    3  
ATOM 7375  C CB   . THR A 1 40  ? 9.053   3.199   0.319   1.00 0.00 ? 40  THR A CB   3  
ATOM 7376  O OG1  . THR A 1 40  ? 9.940   3.033   1.411   1.00 0.00 ? 40  THR A OG1  3  
ATOM 7377  C CG2  . THR A 1 40  ? 8.701   4.669   0.230   1.00 0.00 ? 40  THR A CG2  3  
ATOM 7378  H H    . THR A 1 40  ? 8.286   0.551   -0.629  1.00 0.00 ? 40  THR A H    3  
ATOM 7379  H HA   . THR A 1 40  ? 7.439   2.399   1.454   1.00 0.00 ? 40  THR A HA   3  
ATOM 7380  H HB   . THR A 1 40  ? 9.573   2.933   -0.582  1.00 0.00 ? 40  THR A HB   3  
ATOM 7381  H HG1  . THR A 1 40  ? 10.688  3.626   1.309   1.00 0.00 ? 40  THR A HG1  3  
ATOM 7382  H HG21 . THR A 1 40  ? 8.020   4.926   1.028   1.00 0.00 ? 40  THR A HG21 3  
ATOM 7383  H HG22 . THR A 1 40  ? 8.230   4.868   -0.723  1.00 0.00 ? 40  THR A HG22 3  
ATOM 7384  H HG23 . THR A 1 40  ? 9.600   5.261   0.318   1.00 0.00 ? 40  THR A HG23 3  
ATOM 7385  N N    . LEU A 1 41  ? 5.513   2.611   -0.088  1.00 0.00 ? 41  LEU A N    3  
ATOM 7386  C CA   . LEU A 1 41  ? 4.387   2.980   -0.928  1.00 0.00 ? 41  LEU A CA   3  
ATOM 7387  C C    . LEU A 1 41  ? 4.355   4.482   -1.133  1.00 0.00 ? 41  LEU A C    3  
ATOM 7388  O O    . LEU A 1 41  ? 4.011   5.238   -0.218  1.00 0.00 ? 41  LEU A O    3  
ATOM 7389  C CB   . LEU A 1 41  ? 3.069   2.523   -0.301  1.00 0.00 ? 41  LEU A CB   3  
ATOM 7390  C CG   . LEU A 1 41  ? 1.925   2.267   -1.292  1.00 0.00 ? 41  LEU A CG   3  
ATOM 7391  C CD1  . LEU A 1 41  ? 1.376   3.585   -1.815  1.00 0.00 ? 41  LEU A CD1  3  
ATOM 7392  C CD2  . LEU A 1 41  ? 2.386   1.381   -2.448  1.00 0.00 ? 41  LEU A CD2  3  
ATOM 7393  H H    . LEU A 1 41  ? 5.350   2.300   0.825   1.00 0.00 ? 41  LEU A H    3  
ATOM 7394  H HA   . LEU A 1 41  ? 4.512   2.498   -1.885  1.00 0.00 ? 41  LEU A HA   3  
ATOM 7395  H HB2  . LEU A 1 41  ? 3.253   1.617   0.254   1.00 0.00 ? 41  LEU A HB2  3  
ATOM 7396  H HB3  . LEU A 1 41  ? 2.745   3.285   0.392   1.00 0.00 ? 41  LEU A HB3  3  
ATOM 7397  H HG   . LEU A 1 41  ? 1.125   1.756   -0.778  1.00 0.00 ? 41  LEU A HG   3  
ATOM 7398  H HD11 . LEU A 1 41  ? 1.702   4.392   -1.175  1.00 0.00 ? 41  LEU A HD11 3  
ATOM 7399  H HD12 . LEU A 1 41  ? 0.297   3.546   -1.823  1.00 0.00 ? 41  LEU A HD12 3  
ATOM 7400  H HD13 . LEU A 1 41  ? 1.737   3.753   -2.819  1.00 0.00 ? 41  LEU A HD13 3  
ATOM 7401  H HD21 . LEU A 1 41  ? 2.438   1.966   -3.355  1.00 0.00 ? 41  LEU A HD21 3  
ATOM 7402  H HD22 . LEU A 1 41  ? 1.687   0.567   -2.588  1.00 0.00 ? 41  LEU A HD22 3  
ATOM 7403  H HD23 . LEU A 1 41  ? 3.358   0.980   -2.225  1.00 0.00 ? 41  LEU A HD23 3  
ATOM 7404  N N    . LEU A 1 42  ? 4.681   4.918   -2.340  1.00 0.00 ? 42  LEU A N    3  
ATOM 7405  C CA   . LEU A 1 42  ? 4.648   6.346   -2.647  1.00 0.00 ? 42  LEU A CA   3  
ATOM 7406  C C    . LEU A 1 42  ? 3.535   6.619   -3.644  1.00 0.00 ? 42  LEU A C    3  
ATOM 7407  O O    . LEU A 1 42  ? 3.280   5.795   -4.517  1.00 0.00 ? 42  LEU A O    3  
ATOM 7408  C CB   . LEU A 1 42  ? 5.984   6.815   -3.200  1.00 0.00 ? 42  LEU A CB   3  
ATOM 7409  C CG   . LEU A 1 42  ? 7.207   6.240   -2.483  1.00 0.00 ? 42  LEU A CG   3  
ATOM 7410  C CD1  . LEU A 1 42  ? 8.230   5.713   -3.478  1.00 0.00 ? 42  LEU A CD1  3  
ATOM 7411  C CD2  . LEU A 1 42  ? 7.828   7.293   -1.580  1.00 0.00 ? 42  LEU A CD2  3  
ATOM 7412  H H    . LEU A 1 42  ? 4.918   4.266   -3.057  1.00 0.00 ? 42  LEU A H    3  
ATOM 7413  H HA   . LEU A 1 42  ? 4.438   6.879   -1.729  1.00 0.00 ? 42  LEU A HA   3  
ATOM 7414  H HB2  . LEU A 1 42  ? 6.030   6.549   -4.242  1.00 0.00 ? 42  LEU A HB2  3  
ATOM 7415  H HB3  . LEU A 1 42  ? 6.019   7.888   -3.119  1.00 0.00 ? 42  LEU A HB3  3  
ATOM 7416  H HG   . LEU A 1 42  ? 6.891   5.415   -1.864  1.00 0.00 ? 42  LEU A HG   3  
ATOM 7417  H HD11 . LEU A 1 42  ? 7.913   4.748   -3.844  1.00 0.00 ? 42  LEU A HD11 3  
ATOM 7418  H HD12 . LEU A 1 42  ? 9.192   5.613   -2.993  1.00 0.00 ? 42  LEU A HD12 3  
ATOM 7419  H HD13 . LEU A 1 42  ? 8.315   6.401   -4.306  1.00 0.00 ? 42  LEU A HD13 3  
ATOM 7420  H HD21 . LEU A 1 42  ? 8.336   6.810   -0.760  1.00 0.00 ? 42  LEU A HD21 3  
ATOM 7421  H HD22 . LEU A 1 42  ? 7.051   7.935   -1.193  1.00 0.00 ? 42  LEU A HD22 3  
ATOM 7422  H HD23 . LEU A 1 42  ? 8.534   7.882   -2.145  1.00 0.00 ? 42  LEU A HD23 3  
ATOM 7423  N N    . TYR A 1 43  ? 2.831   7.739   -3.493  1.00 0.00 ? 43  TYR A N    3  
ATOM 7424  C CA   . TYR A 1 43  ? 1.712   8.019   -4.388  1.00 0.00 ? 43  TYR A CA   3  
ATOM 7425  C C    . TYR A 1 43  ? 1.561   9.493   -4.783  1.00 0.00 ? 43  TYR A C    3  
ATOM 7426  O O    . TYR A 1 43  ? 1.927   10.391  -4.031  1.00 0.00 ? 43  TYR A O    3  
ATOM 7427  C CB   . TYR A 1 43  ? 0.424   7.587   -3.708  1.00 0.00 ? 43  TYR A CB   3  
ATOM 7428  C CG   . TYR A 1 43  ? -0.041  8.566   -2.658  1.00 0.00 ? 43  TYR A CG   3  
ATOM 7429  C CD1  . TYR A 1 43  ? -0.795  9.664   -3.027  1.00 0.00 ? 43  TYR A CD1  3  
ATOM 7430  C CD2  . TYR A 1 43  ? 0.270   8.403   -1.317  1.00 0.00 ? 43  TYR A CD2  3  
ATOM 7431  C CE1  . TYR A 1 43  ? -1.233  10.577  -2.097  1.00 0.00 ? 43  TYR A CE1  3  
ATOM 7432  C CE2  . TYR A 1 43  ? -0.166  9.316   -0.371  1.00 0.00 ? 43  TYR A CE2  3  
ATOM 7433  C CZ   . TYR A 1 43  ? -0.918  10.402  -0.768  1.00 0.00 ? 43  TYR A CZ   3  
ATOM 7434  O OH   . TYR A 1 43  ? -1.354  11.313  0.167   1.00 0.00 ? 43  TYR A OH   3  
ATOM 7435  H H    . TYR A 1 43  ? 3.036   8.346   -2.749  1.00 0.00 ? 43  TYR A H    3  
ATOM 7436  H HA   . TYR A 1 43  ? 1.847   7.420   -5.270  1.00 0.00 ? 43  TYR A HA   3  
ATOM 7437  H HB2  . TYR A 1 43  ? -0.357  7.508   -4.451  1.00 0.00 ? 43  TYR A HB2  3  
ATOM 7438  H HB3  . TYR A 1 43  ? 0.574   6.629   -3.243  1.00 0.00 ? 43  TYR A HB3  3  
ATOM 7439  H HD1  . TYR A 1 43  ? -1.043  9.801   -4.069  1.00 0.00 ? 43  TYR A HD1  3  
ATOM 7440  H HD2  . TYR A 1 43  ? 0.860   7.551   -1.016  1.00 0.00 ? 43  TYR A HD2  3  
ATOM 7441  H HE1  . TYR A 1 43  ? -1.823  11.421  -2.418  1.00 0.00 ? 43  TYR A HE1  3  
ATOM 7442  H HE2  . TYR A 1 43  ? 0.082   9.178   0.670   1.00 0.00 ? 43  TYR A HE2  3  
ATOM 7443  H HH   . TYR A 1 43  ? -0.599  11.684  0.629   1.00 0.00 ? 43  TYR A HH   3  
ATOM 7444  N N    . THR A 1 44  ? 0.948   9.716   -5.951  1.00 0.00 ? 44  THR A N    3  
ATOM 7445  C CA   . THR A 1 44  ? 0.665   11.061  -6.451  1.00 0.00 ? 44  THR A CA   3  
ATOM 7446  C C    . THR A 1 44  ? -0.545  11.033  -7.395  1.00 0.00 ? 44  THR A C    3  
ATOM 7447  O O    . THR A 1 44  ? -1.132  9.977   -7.634  1.00 0.00 ? 44  THR A O    3  
ATOM 7448  C CB   . THR A 1 44  ? 1.878   11.659  -7.169  1.00 0.00 ? 44  THR A CB   3  
ATOM 7449  O OG1  . THR A 1 44  ? 1.540   12.892  -7.774  1.00 0.00 ? 44  THR A OG1  3  
ATOM 7450  C CG2  . THR A 1 44  ? 2.448   10.766  -8.247  1.00 0.00 ? 44  THR A CG2  3  
ATOM 7451  H H    . THR A 1 44  ? 0.648   8.950   -6.482  1.00 0.00 ? 44  THR A H    3  
ATOM 7452  H HA   . THR A 1 44  ? 0.421   11.681  -5.600  1.00 0.00 ? 44  THR A HA   3  
ATOM 7453  H HB   . THR A 1 44  ? 2.656   11.844  -6.446  1.00 0.00 ? 44  THR A HB   3  
ATOM 7454  H HG1  . THR A 1 44  ? 2.310   13.466  -7.781  1.00 0.00 ? 44  THR A HG1  3  
ATOM 7455  H HG21 . THR A 1 44  ? 3.443   11.099  -8.500  1.00 0.00 ? 44  THR A HG21 3  
ATOM 7456  H HG22 . THR A 1 44  ? 1.822   10.816  -9.120  1.00 0.00 ? 44  THR A HG22 3  
ATOM 7457  H HG23 . THR A 1 44  ? 2.489   9.749   -7.889  1.00 0.00 ? 44  THR A HG23 3  
ATOM 7458  N N    . ILE A 1 45  ? -0.908  12.197  -7.927  1.00 0.00 ? 45  ILE A N    3  
ATOM 7459  C CA   . ILE A 1 45  ? -2.048  12.320  -8.852  1.00 0.00 ? 45  ILE A CA   3  
ATOM 7460  C C    . ILE A 1 45  ? -1.580  12.783  -10.229 1.00 0.00 ? 45  ILE A C    3  
ATOM 7461  O O    . ILE A 1 45  ? -0.791  13.716  -10.345 1.00 0.00 ? 45  ILE A O    3  
ATOM 7462  C CB   . ILE A 1 45  ? -3.124  13.298  -8.326  1.00 0.00 ? 45  ILE A CB   3  
ATOM 7463  C CG1  . ILE A 1 45  ? -2.558  14.200  -7.224  1.00 0.00 ? 45  ILE A CG1  3  
ATOM 7464  C CG2  . ILE A 1 45  ? -4.329  12.518  -7.814  1.00 0.00 ? 45  ILE A CG2  3  
ATOM 7465  C CD1  . ILE A 1 45  ? -3.444  15.382  -6.896  1.00 0.00 ? 45  ILE A CD1  3  
ATOM 7466  H H    . ILE A 1 45  ? -0.392  12.998  -7.696  1.00 0.00 ? 45  ILE A H    3  
ATOM 7467  H HA   . ILE A 1 45  ? -2.515  11.347  -8.957  1.00 0.00 ? 45  ILE A HA   3  
ATOM 7468  H HB   . ILE A 1 45  ? -3.453  13.914  -9.151  1.00 0.00 ? 45  ILE A HB   3  
ATOM 7469  H HG12 . ILE A 1 45  ? -2.433  13.620  -6.322  1.00 0.00 ? 45  ILE A HG12 3  
ATOM 7470  H HG13 . ILE A 1 45  ? -1.597  14.581  -7.538  1.00 0.00 ? 45  ILE A HG13 3  
ATOM 7471  H HG21 . ILE A 1 45  ? -4.577  11.731  -8.517  1.00 0.00 ? 45  ILE A HG21 3  
ATOM 7472  H HG22 . ILE A 1 45  ? -5.172  13.184  -7.709  1.00 0.00 ? 45  ILE A HG22 3  
ATOM 7473  H HG23 . ILE A 1 45  ? -4.093  12.081  -6.853  1.00 0.00 ? 45  ILE A HG23 3  
ATOM 7474  H HD11 . ILE A 1 45  ? -3.192  16.210  -7.541  1.00 0.00 ? 45  ILE A HD11 3  
ATOM 7475  H HD12 . ILE A 1 45  ? -3.294  15.669  -5.866  1.00 0.00 ? 45  ILE A HD12 3  
ATOM 7476  H HD13 . ILE A 1 45  ? -4.478  15.109  -7.046  1.00 0.00 ? 45  ILE A HD13 3  
ATOM 7477  N N    . MET A 1 46  ? -2.037  12.080  -11.263 1.00 0.00 ? 46  MET A N    3  
ATOM 7478  C CA   . MET A 1 46  ? -1.639  12.365  -12.647 1.00 0.00 ? 46  MET A CA   3  
ATOM 7479  C C    . MET A 1 46  ? -1.517  13.866  -12.919 1.00 0.00 ? 46  MET A C    3  
ATOM 7480  O O    . MET A 1 46  ? -0.549  14.303  -13.538 1.00 0.00 ? 46  MET A O    3  
ATOM 7481  C CB   . MET A 1 46  ? -2.631  11.727  -13.624 1.00 0.00 ? 46  MET A CB   3  
ATOM 7482  C CG   . MET A 1 46  ? -4.058  11.710  -13.116 1.00 0.00 ? 46  MET A CG   3  
ATOM 7483  S SD   . MET A 1 46  ? -5.272  11.784  -14.447 1.00 0.00 ? 46  MET A SD   3  
ATOM 7484  C CE   . MET A 1 46  ? -4.596  10.582  -15.589 1.00 0.00 ? 46  MET A CE   3  
ATOM 7485  H H    . MET A 1 46  ? -2.608  11.306  -11.076 1.00 0.00 ? 46  MET A H    3  
ATOM 7486  H HA   . MET A 1 46  ? -0.670  11.914  -12.801 1.00 0.00 ? 46  MET A HA   3  
ATOM 7487  H HB2  . MET A 1 46  ? -2.612  12.271  -14.552 1.00 0.00 ? 46  MET A HB2  3  
ATOM 7488  H HB3  . MET A 1 46  ? -2.327  10.708  -13.809 1.00 0.00 ? 46  MET A HB3  3  
ATOM 7489  H HG2  . MET A 1 46  ? -4.209  10.800  -12.559 1.00 0.00 ? 46  MET A HG2  3  
ATOM 7490  H HG3  . MET A 1 46  ? -4.204  12.558  -12.464 1.00 0.00 ? 46  MET A HG3  3  
ATOM 7491  H HE1  . MET A 1 46  ? -4.003  11.089  -16.337 1.00 0.00 ? 46  MET A HE1  3  
ATOM 7492  H HE2  . MET A 1 46  ? -5.402  10.048  -16.070 1.00 0.00 ? 46  MET A HE2  3  
ATOM 7493  H HE3  . MET A 1 46  ? -3.973  9.883   -15.050 1.00 0.00 ? 46  MET A HE3  3  
ATOM 7494  N N    . SER A 1 47  ? -2.492  14.652  -12.474 1.00 0.00 ? 47  SER A N    3  
ATOM 7495  C CA   . SER A 1 47  ? -2.458  16.099  -12.694 1.00 0.00 ? 47  SER A CA   3  
ATOM 7496  C C    . SER A 1 47  ? -1.282  16.746  -11.958 1.00 0.00 ? 47  SER A C    3  
ATOM 7497  O O    . SER A 1 47  ? -0.769  17.784  -12.375 1.00 0.00 ? 47  SER A O    3  
ATOM 7498  C CB   . SER A 1 47  ? -3.772  16.734  -12.235 1.00 0.00 ? 47  SER A CB   3  
ATOM 7499  O OG   . SER A 1 47  ? -4.260  16.106  -11.062 1.00 0.00 ? 47  SER A OG   3  
ATOM 7500  H H    . SER A 1 47  ? -3.259  14.260  -12.008 1.00 0.00 ? 47  SER A H    3  
ATOM 7501  H HA   . SER A 1 47  ? -2.339  16.269  -13.754 1.00 0.00 ? 47  SER A HA   3  
ATOM 7502  H HB2  . SER A 1 47  ? -3.610  17.781  -12.027 1.00 0.00 ? 47  SER A HB2  3  
ATOM 7503  H HB3  . SER A 1 47  ? -4.511  16.633  -13.017 1.00 0.00 ? 47  SER A HB3  3  
ATOM 7504  H HG   . SER A 1 47  ? -3.538  15.977  -10.443 1.00 0.00 ? 47  SER A HG   3  
ATOM 7505  N N    . LYS A 1 48  ? -0.860  16.118  -10.864 1.00 0.00 ? 48  LYS A N    3  
ATOM 7506  C CA   . LYS A 1 48  ? 0.256   16.616  -10.065 1.00 0.00 ? 48  LYS A CA   3  
ATOM 7507  C C    . LYS A 1 48  ? 1.184   15.472  -9.660  1.00 0.00 ? 48  LYS A C    3  
ATOM 7508  O O    . LYS A 1 48  ? 1.331   15.172  -8.476  1.00 0.00 ? 48  LYS A O    3  
ATOM 7509  C CB   . LYS A 1 48  ? -0.258  17.336  -8.815  1.00 0.00 ? 48  LYS A CB   3  
ATOM 7510  C CG   . LYS A 1 48  ? -1.023  18.613  -9.121  1.00 0.00 ? 48  LYS A CG   3  
ATOM 7511  C CD   . LYS A 1 48  ? -1.507  19.292  -7.850  1.00 0.00 ? 48  LYS A CD   3  
ATOM 7512  C CE   . LYS A 1 48  ? -1.749  20.777  -8.071  1.00 0.00 ? 48  LYS A CE   3  
ATOM 7513  N NZ   . LYS A 1 48  ? -1.480  21.573  -6.841  1.00 0.00 ? 48  LYS A NZ   3  
ATOM 7514  H H    . LYS A 1 48  ? -1.313  15.296  -10.595 1.00 0.00 ? 48  LYS A H    3  
ATOM 7515  H HA   . LYS A 1 48  ? 0.812   17.317  -10.671 1.00 0.00 ? 48  LYS A HA   3  
ATOM 7516  H HB2  . LYS A 1 48  ? -0.911  16.669  -8.272  1.00 0.00 ? 48  LYS A HB2  3  
ATOM 7517  H HB3  . LYS A 1 48  ? 0.585   17.588  -8.187  1.00 0.00 ? 48  LYS A HB3  3  
ATOM 7518  H HG2  . LYS A 1 48  ? -0.374  19.291  -9.654  1.00 0.00 ? 48  LYS A HG2  3  
ATOM 7519  H HG3  . LYS A 1 48  ? -1.877  18.370  -9.736  1.00 0.00 ? 48  LYS A HG3  3  
ATOM 7520  H HD2  . LYS A 1 48  ? -2.431  18.830  -7.536  1.00 0.00 ? 48  LYS A HD2  3  
ATOM 7521  H HD3  . LYS A 1 48  ? -0.759  19.168  -7.080  1.00 0.00 ? 48  LYS A HD3  3  
ATOM 7522  H HE2  . LYS A 1 48  ? -1.098  21.121  -8.860  1.00 0.00 ? 48  LYS A HE2  3  
ATOM 7523  H HE3  . LYS A 1 48  ? -2.778  20.921  -8.365  1.00 0.00 ? 48  LYS A HE3  3  
ATOM 7524  H HZ1  . LYS A 1 48  ? -2.244  21.432  -6.150  1.00 0.00 ? 48  LYS A HZ1  3  
ATOM 7525  H HZ2  . LYS A 1 48  ? -1.421  22.584  -7.076  1.00 0.00 ? 48  LYS A HZ2  3  
ATOM 7526  H HZ3  . LYS A 1 48  ? -0.580  21.275  -6.413  1.00 0.00 ? 48  LYS A HZ3  3  
ATOM 7527  N N    . PRO A 1 49  ? 1.824   14.817  -10.646 1.00 0.00 ? 49  PRO A N    3  
ATOM 7528  C CA   . PRO A 1 49  ? 2.740   13.697  -10.395 1.00 0.00 ? 49  PRO A CA   3  
ATOM 7529  C C    . PRO A 1 49  ? 3.975   14.109  -9.607  1.00 0.00 ? 49  PRO A C    3  
ATOM 7530  O O    . PRO A 1 49  ? 4.739   13.265  -9.137  1.00 0.00 ? 49  PRO A O    3  
ATOM 7531  C CB   . PRO A 1 49  ? 3.136   13.218  -11.799 1.00 0.00 ? 49  PRO A CB   3  
ATOM 7532  C CG   . PRO A 1 49  ? 2.137   13.830  -12.724 1.00 0.00 ? 49  PRO A CG   3  
ATOM 7533  C CD   . PRO A 1 49  ? 1.703   15.113  -12.078 1.00 0.00 ? 49  PRO A CD   3  
ATOM 7534  H HA   . PRO A 1 49  ? 2.244   12.909  -9.870  1.00 0.00 ? 49  PRO A HA   3  
ATOM 7535  H HB2  . PRO A 1 49  ? 4.137   13.553  -12.025 1.00 0.00 ? 49  PRO A HB2  3  
ATOM 7536  H HB3  . PRO A 1 49  ? 3.096   12.140  -11.836 1.00 0.00 ? 49  PRO A HB3  3  
ATOM 7537  H HG2  . PRO A 1 49  ? 2.597   14.029  -13.681 1.00 0.00 ? 49  PRO A HG2  3  
ATOM 7538  H HG3  . PRO A 1 49  ? 1.293   13.167  -12.843 1.00 0.00 ? 49  PRO A HG3  3  
ATOM 7539  H HD2  . PRO A 1 49  ? 2.356   15.922  -12.361 1.00 0.00 ? 49  PRO A HD2  3  
ATOM 7540  H HD3  . PRO A 1 49  ? 0.686   15.343  -12.338 1.00 0.00 ? 49  PRO A HD3  3  
ATOM 7541  N N    . GLU A 1 50  ? 4.157   15.407  -9.465  1.00 0.00 ? 50  GLU A N    3  
ATOM 7542  C CA   . GLU A 1 50  ? 5.292   15.952  -8.731  1.00 0.00 ? 50  GLU A CA   3  
ATOM 7543  C C    . GLU A 1 50  ? 4.993   16.028  -7.236  1.00 0.00 ? 50  GLU A C    3  
ATOM 7544  O O    . GLU A 1 50  ? 5.841   16.444  -6.446  1.00 0.00 ? 50  GLU A O    3  
ATOM 7545  C CB   . GLU A 1 50  ? 5.638   17.343  -9.262  1.00 0.00 ? 50  GLU A CB   3  
ATOM 7546  C CG   . GLU A 1 50  ? 6.997   17.418  -9.937  1.00 0.00 ? 50  GLU A CG   3  
ATOM 7547  C CD   . GLU A 1 50  ? 7.424   18.843  -10.233 1.00 0.00 ? 50  GLU A CD   3  
ATOM 7548  O OE1  . GLU A 1 50  ? 7.726   19.583  -9.273  1.00 0.00 ? 50  GLU A OE1  3  
ATOM 7549  O OE2  . GLU A 1 50  ? 7.454   19.219  -11.424 1.00 0.00 ? 50  GLU A OE2  3  
ATOM 7550  H H    . GLU A 1 50  ? 3.508   16.016  -9.862  1.00 0.00 ? 50  GLU A H    3  
ATOM 7551  H HA   . GLU A 1 50  ? 6.135   15.296  -8.887  1.00 0.00 ? 50  GLU A HA   3  
ATOM 7552  H HB2  . GLU A 1 50  ? 4.886   17.636  -9.979  1.00 0.00 ? 50  GLU A HB2  3  
ATOM 7553  H HB3  . GLU A 1 50  ? 5.629   18.042  -8.439  1.00 0.00 ? 50  GLU A HB3  3  
ATOM 7554  H HG2  . GLU A 1 50  ? 7.733   16.966  -9.289  1.00 0.00 ? 50  GLU A HG2  3  
ATOM 7555  H HG3  . GLU A 1 50  ? 6.954   16.870  -10.867 1.00 0.00 ? 50  GLU A HG3  3  
ATOM 7556  N N    . ASP A 1 51  ? 3.783   15.632  -6.852  1.00 0.00 ? 51  ASP A N    3  
ATOM 7557  C CA   . ASP A 1 51  ? 3.374   15.663  -5.455  1.00 0.00 ? 51  ASP A CA   3  
ATOM 7558  C C    . ASP A 1 51  ? 3.202   14.248  -4.901  1.00 0.00 ? 51  ASP A C    3  
ATOM 7559  O O    . ASP A 1 51  ? 2.123   13.882  -4.433  1.00 0.00 ? 51  ASP A O    3  
ATOM 7560  C CB   . ASP A 1 51  ? 2.065   16.446  -5.313  1.00 0.00 ? 51  ASP A CB   3  
ATOM 7561  C CG   . ASP A 1 51  ? 2.052   17.336  -4.086  1.00 0.00 ? 51  ASP A CG   3  
ATOM 7562  O OD1  . ASP A 1 51  ? 1.643   16.856  -3.008  1.00 0.00 ? 51  ASP A OD1  3  
ATOM 7563  O OD2  . ASP A 1 51  ? 2.452   18.514  -4.202  1.00 0.00 ? 51  ASP A OD2  3  
ATOM 7564  H H    . ASP A 1 51  ? 3.145   15.313  -7.522  1.00 0.00 ? 51  ASP A H    3  
ATOM 7565  H HA   . ASP A 1 51  ? 4.146   16.166  -4.893  1.00 0.00 ? 51  ASP A HA   3  
ATOM 7566  H HB2  . ASP A 1 51  ? 1.926   17.067  -6.187  1.00 0.00 ? 51  ASP A HB2  3  
ATOM 7567  H HB3  . ASP A 1 51  ? 1.241   15.751  -5.240  1.00 0.00 ? 51  ASP A HB3  3  
ATOM 7568  N N    . LEU A 1 52  ? 4.270   13.454  -4.954  1.00 0.00 ? 52  LEU A N    3  
ATOM 7569  C CA   . LEU A 1 52  ? 4.223   12.083  -4.453  1.00 0.00 ? 52  LEU A CA   3  
ATOM 7570  C C    . LEU A 1 52  ? 4.456   12.049  -2.946  1.00 0.00 ? 52  LEU A C    3  
ATOM 7571  O O    . LEU A 1 52  ? 5.278   12.800  -2.422  1.00 0.00 ? 52  LEU A O    3  
ATOM 7572  C CB   . LEU A 1 52  ? 5.256   11.210  -5.170  1.00 0.00 ? 52  LEU A CB   3  
ATOM 7573  C CG   . LEU A 1 52  ? 4.664   10.086  -6.026  1.00 0.00 ? 52  LEU A CG   3  
ATOM 7574  C CD1  . LEU A 1 52  ? 5.359   10.019  -7.377  1.00 0.00 ? 52  LEU A CD1  3  
ATOM 7575  C CD2  . LEU A 1 52  ? 4.770   8.749   -5.308  1.00 0.00 ? 52  LEU A CD2  3  
ATOM 7576  H H    . LEU A 1 52  ? 5.104   13.797  -5.336  1.00 0.00 ? 52  LEU A H    3  
ATOM 7577  H HA   . LEU A 1 52  ? 3.239   11.698  -4.657  1.00 0.00 ? 52  LEU A HA   3  
ATOM 7578  H HB2  . LEU A 1 52  ? 5.853   11.847  -5.807  1.00 0.00 ? 52  LEU A HB2  3  
ATOM 7579  H HB3  . LEU A 1 52  ? 5.902   10.765  -4.428  1.00 0.00 ? 52  LEU A HB3  3  
ATOM 7580  H HG   . LEU A 1 52  ? 3.616   10.289  -6.198  1.00 0.00 ? 52  LEU A HG   3  
ATOM 7581  H HD11 . LEU A 1 52  ? 4.811   9.356   -8.031  1.00 0.00 ? 52  LEU A HD11 3  
ATOM 7582  H HD12 . LEU A 1 52  ? 6.364   9.645   -7.246  1.00 0.00 ? 52  LEU A HD12 3  
ATOM 7583  H HD13 . LEU A 1 52  ? 5.396   11.006  -7.812  1.00 0.00 ? 52  LEU A HD13 3  
ATOM 7584  H HD21 . LEU A 1 52  ? 5.711   8.280   -5.556  1.00 0.00 ? 52  LEU A HD21 3  
ATOM 7585  H HD22 . LEU A 1 52  ? 3.957   8.107   -5.616  1.00 0.00 ? 52  LEU A HD22 3  
ATOM 7586  H HD23 . LEU A 1 52  ? 4.718   8.908   -4.241  1.00 0.00 ? 52  LEU A HD23 3  
ATOM 7587  N N    . LYS A 1 53  ? 3.720   11.186  -2.248  1.00 0.00 ? 53  LYS A N    3  
ATOM 7588  C CA   . LYS A 1 53  ? 3.847   11.081  -0.799  1.00 0.00 ? 53  LYS A CA   3  
ATOM 7589  C C    . LYS A 1 53  ? 4.105   9.660   -0.340  1.00 0.00 ? 53  LYS A C    3  
ATOM 7590  O O    . LYS A 1 53  ? 3.295   8.765   -0.580  1.00 0.00 ? 53  LYS A O    3  
ATOM 7591  C CB   . LYS A 1 53  ? 2.565   11.556  -0.106  1.00 0.00 ? 53  LYS A CB   3  
ATOM 7592  C CG   . LYS A 1 53  ? 2.813   12.467  1.084   1.00 0.00 ? 53  LYS A CG   3  
ATOM 7593  C CD   . LYS A 1 53  ? 1.810   13.610  1.134   1.00 0.00 ? 53  LYS A CD   3  
ATOM 7594  C CE   . LYS A 1 53  ? 2.482   14.954  0.898   1.00 0.00 ? 53  LYS A CE   3  
ATOM 7595  N NZ   . LYS A 1 53  ? 1.633   15.864  0.082   1.00 0.00 ? 53  LYS A NZ   3  
ATOM 7596  H H    . LYS A 1 53  ? 3.069   10.619  -2.709  1.00 0.00 ? 53  LYS A H    3  
ATOM 7597  H HA   . LYS A 1 53  ? 4.667   11.706  -0.486  1.00 0.00 ? 53  LYS A HA   3  
ATOM 7598  H HB2  . LYS A 1 53  ? 1.950   12.075  -0.818  1.00 0.00 ? 53  LYS A HB2  3  
ATOM 7599  H HB3  . LYS A 1 53  ? 2.024   10.688  0.250   1.00 0.00 ? 53  LYS A HB3  3  
ATOM 7600  H HG2  . LYS A 1 53  ? 2.725   11.883  1.992   1.00 0.00 ? 53  LYS A HG2  3  
ATOM 7601  H HG3  . LYS A 1 53  ? 3.811   12.874  1.012   1.00 0.00 ? 53  LYS A HG3  3  
ATOM 7602  H HD2  . LYS A 1 53  ? 1.062   13.455  0.371   1.00 0.00 ? 53  LYS A HD2  3  
ATOM 7603  H HD3  . LYS A 1 53  ? 1.338   13.619  2.106   1.00 0.00 ? 53  LYS A HD3  3  
ATOM 7604  H HE2  . LYS A 1 53  ? 2.675   15.418  1.854   1.00 0.00 ? 53  LYS A HE2  3  
ATOM 7605  H HE3  . LYS A 1 53  ? 3.417   14.789  0.384   1.00 0.00 ? 53  LYS A HE3  3  
ATOM 7606  H HZ1  . LYS A 1 53  ? 2.230   16.456  -0.532  1.00 0.00 ? 53  LYS A HZ1  3  
ATOM 7607  H HZ2  . LYS A 1 53  ? 1.073   16.483  0.702   1.00 0.00 ? 53  LYS A HZ2  3  
ATOM 7608  H HZ3  . LYS A 1 53  ? 0.984   15.310  -0.514  1.00 0.00 ? 53  LYS A HZ3  3  
ATOM 7609  N N    . VAL A 1 54  ? 5.183   9.474   0.404   1.00 0.00 ? 54  VAL A N    3  
ATOM 7610  C CA   . VAL A 1 54  ? 5.455   8.174   0.978   1.00 0.00 ? 54  VAL A CA   3  
ATOM 7611  C C    . VAL A 1 54  ? 4.541   8.077   2.192   1.00 0.00 ? 54  VAL A C    3  
ATOM 7612  O O    . VAL A 1 54  ? 4.823   8.639   3.251   1.00 0.00 ? 54  VAL A O    3  
ATOM 7613  C CB   . VAL A 1 54  ? 6.958   7.962   1.344   1.00 0.00 ? 54  VAL A CB   3  
ATOM 7614  C CG1  . VAL A 1 54  ? 7.816   9.122   0.858   1.00 0.00 ? 54  VAL A CG1  3  
ATOM 7615  C CG2  . VAL A 1 54  ? 7.171   7.739   2.839   1.00 0.00 ? 54  VAL A CG2  3  
ATOM 7616  H H    . VAL A 1 54  ? 5.756   10.236  0.627   1.00 0.00 ? 54  VAL A H    3  
ATOM 7617  H HA   . VAL A 1 54  ? 5.159   7.422   0.253   1.00 0.00 ? 54  VAL A HA   3  
ATOM 7618  H HB   . VAL A 1 54  ? 7.290   7.073   0.829   1.00 0.00 ? 54  VAL A HB   3  
ATOM 7619  H HG11 . VAL A 1 54  ? 7.789   9.919   1.586   1.00 0.00 ? 54  VAL A HG11 3  
ATOM 7620  H HG12 . VAL A 1 54  ? 7.434   9.484   -0.085  1.00 0.00 ? 54  VAL A HG12 3  
ATOM 7621  H HG13 . VAL A 1 54  ? 8.835   8.787   0.729   1.00 0.00 ? 54  VAL A HG13 3  
ATOM 7622  H HG21 . VAL A 1 54  ? 8.189   7.425   3.013   1.00 0.00 ? 54  VAL A HG21 3  
ATOM 7623  H HG22 . VAL A 1 54  ? 6.494   6.975   3.191   1.00 0.00 ? 54  VAL A HG22 3  
ATOM 7624  H HG23 . VAL A 1 54  ? 6.984   8.661   3.371   1.00 0.00 ? 54  VAL A HG23 3  
ATOM 7625  N N    . VAL A 1 55  ? 3.400   7.434   2.006   1.00 0.00 ? 55  VAL A N    3  
ATOM 7626  C CA   . VAL A 1 55  ? 2.402   7.343   3.061   1.00 0.00 ? 55  VAL A CA   3  
ATOM 7627  C C    . VAL A 1 55  ? 2.988   6.842   4.377   1.00 0.00 ? 55  VAL A C    3  
ATOM 7628  O O    . VAL A 1 55  ? 3.804   5.921   4.400   1.00 0.00 ? 55  VAL A O    3  
ATOM 7629  C CB   . VAL A 1 55  ? 1.229   6.444   2.637   1.00 0.00 ? 55  VAL A CB   3  
ATOM 7630  C CG1  . VAL A 1 55  ? 0.121   6.478   3.680   1.00 0.00 ? 55  VAL A CG1  3  
ATOM 7631  C CG2  . VAL A 1 55  ? 0.706   6.880   1.274   1.00 0.00 ? 55  VAL A CG2  3  
ATOM 7632  H H    . VAL A 1 55  ? 3.202   7.043   1.126   1.00 0.00 ? 55  VAL A H    3  
ATOM 7633  H HA   . VAL A 1 55  ? 2.014   8.344   3.214   1.00 0.00 ? 55  VAL A HA   3  
ATOM 7634  H HB   . VAL A 1 55  ? 1.587   5.429   2.554   1.00 0.00 ? 55  VAL A HB   3  
ATOM 7635  H HG11 . VAL A 1 55  ? -0.305  7.469   3.720   1.00 0.00 ? 55  VAL A HG11 3  
ATOM 7636  H HG12 . VAL A 1 55  ? 0.529   6.222   4.646   1.00 0.00 ? 55  VAL A HG12 3  
ATOM 7637  H HG13 . VAL A 1 55  ? -0.646  5.766   3.412   1.00 0.00 ? 55  VAL A HG13 3  
ATOM 7638  H HG21 . VAL A 1 55  ? 1.306   7.703   0.901   1.00 0.00 ? 55  VAL A HG21 3  
ATOM 7639  H HG22 . VAL A 1 55  ? -0.322  7.199   1.366   1.00 0.00 ? 55  VAL A HG22 3  
ATOM 7640  H HG23 . VAL A 1 55  ? 0.765   6.052   0.584   1.00 0.00 ? 55  VAL A HG23 3  
ATOM 7641  N N    . LYS A 1 56  ? 2.556   7.464   5.473   1.00 0.00 ? 56  LYS A N    3  
ATOM 7642  C CA   . LYS A 1 56  ? 3.023   7.097   6.805   1.00 0.00 ? 56  LYS A CA   3  
ATOM 7643  C C    . LYS A 1 56  ? 2.802   5.613   7.069   1.00 0.00 ? 56  LYS A C    3  
ATOM 7644  O O    . LYS A 1 56  ? 1.725   5.079   6.803   1.00 0.00 ? 56  LYS A O    3  
ATOM 7645  C CB   . LYS A 1 56  ? 2.300   7.928   7.867   1.00 0.00 ? 56  LYS A CB   3  
ATOM 7646  C CG   . LYS A 1 56  ? 3.033   9.205   8.245   1.00 0.00 ? 56  LYS A CG   3  
ATOM 7647  C CD   . LYS A 1 56  ? 2.102   10.203  8.915   1.00 0.00 ? 56  LYS A CD   3  
ATOM 7648  C CE   . LYS A 1 56  ? 2.728   11.586  8.991   1.00 0.00 ? 56  LYS A CE   3  
ATOM 7649  N NZ   . LYS A 1 56  ? 2.767   12.253  7.661   1.00 0.00 ? 56  LYS A NZ   3  
ATOM 7650  H H    . LYS A 1 56  ? 1.904   8.190   5.382   1.00 0.00 ? 56  LYS A H    3  
ATOM 7651  H HA   . LYS A 1 56  ? 4.081   7.306   6.855   1.00 0.00 ? 56  LYS A HA   3  
ATOM 7652  H HB2  . LYS A 1 56  ? 1.323   8.197   7.493   1.00 0.00 ? 56  LYS A HB2  3  
ATOM 7653  H HB3  . LYS A 1 56  ? 2.182   7.329   8.758   1.00 0.00 ? 56  LYS A HB3  3  
ATOM 7654  H HG2  . LYS A 1 56  ? 3.833   8.961   8.928   1.00 0.00 ? 56  LYS A HG2  3  
ATOM 7655  H HG3  . LYS A 1 56  ? 3.443   9.652   7.351   1.00 0.00 ? 56  LYS A HG3  3  
ATOM 7656  H HD2  . LYS A 1 56  ? 1.187   10.265  8.345   1.00 0.00 ? 56  LYS A HD2  3  
ATOM 7657  H HD3  . LYS A 1 56  ? 1.882   9.860   9.916   1.00 0.00 ? 56  LYS A HD3  3  
ATOM 7658  H HE2  . LYS A 1 56  ? 2.148   12.192  9.671   1.00 0.00 ? 56  LYS A HE2  3  
ATOM 7659  H HE3  . LYS A 1 56  ? 3.736   11.490  9.367   1.00 0.00 ? 56  LYS A HE3  3  
ATOM 7660  H HZ1  . LYS A 1 56  ? 3.185   13.201  7.748   1.00 0.00 ? 56  LYS A HZ1  3  
ATOM 7661  H HZ2  . LYS A 1 56  ? 1.804   12.345  7.279   1.00 0.00 ? 56  LYS A HZ2  3  
ATOM 7662  H HZ3  . LYS A 1 56  ? 3.339   11.693  6.997   1.00 0.00 ? 56  LYS A HZ3  3  
ATOM 7663  N N    . ASN A 1 57  ? 3.831   4.952   7.589   1.00 0.00 ? 57  ASN A N    3  
ATOM 7664  C CA   . ASN A 1 57  ? 3.756   3.525   7.887   1.00 0.00 ? 57  ASN A CA   3  
ATOM 7665  C C    . ASN A 1 57  ? 3.795   2.688   6.608   1.00 0.00 ? 57  ASN A C    3  
ATOM 7666  O O    . ASN A 1 57  ? 3.704   1.462   6.661   1.00 0.00 ? 57  ASN A O    3  
ATOM 7667  C CB   . ASN A 1 57  ? 2.484   3.207   8.676   1.00 0.00 ? 57  ASN A CB   3  
ATOM 7668  C CG   . ASN A 1 57  ? 2.630   1.964   9.532   1.00 0.00 ? 57  ASN A CG   3  
ATOM 7669  O OD1  . ASN A 1 57  ? 2.800   0.859   9.018   1.00 0.00 ? 57  ASN A OD1  3  
ATOM 7670  N ND2  . ASN A 1 57  ? 2.565   2.140   10.847  1.00 0.00 ? 57  ASN A ND2  3  
ATOM 7671  H H    . ASN A 1 57  ? 4.663   5.435   7.775   1.00 0.00 ? 57  ASN A H    3  
ATOM 7672  H HA   . ASN A 1 57  ? 4.613   3.270   8.492   1.00 0.00 ? 57  ASN A HA   3  
ATOM 7673  H HB2  . ASN A 1 57  ? 2.250   4.040   9.321   1.00 0.00 ? 57  ASN A HB2  3  
ATOM 7674  H HB3  . ASN A 1 57  ? 1.669   3.052   7.983   1.00 0.00 ? 57  ASN A HB3  3  
ATOM 7675  H HD21 . ASN A 1 57  ? 2.429   3.049   11.186  1.00 0.00 ? 57  ASN A HD21 3  
ATOM 7676  H HD22 . ASN A 1 57  ? 2.657   1.353   11.424  1.00 0.00 ? 57  ASN A HD22 3  
ATOM 7677  N N    . CYS A 1 58  ? 3.936   3.350   5.460   1.00 0.00 ? 58  CYS A N    3  
ATOM 7678  C CA   . CYS A 1 58  ? 3.991   2.650   4.183   1.00 0.00 ? 58  CYS A CA   3  
ATOM 7679  C C    . CYS A 1 58  ? 5.376   2.781   3.540   1.00 0.00 ? 58  CYS A C    3  
ATOM 7680  O O    . CYS A 1 58  ? 5.632   2.203   2.486   1.00 0.00 ? 58  CYS A O    3  
ATOM 7681  C CB   . CYS A 1 58  ? 2.886   3.155   3.249   1.00 0.00 ? 58  CYS A CB   3  
ATOM 7682  S SG   . CYS A 1 58  ? 1.219   3.078   3.994   1.00 0.00 ? 58  CYS A SG   3  
ATOM 7683  H H    . CYS A 1 58  ? 4.010   4.324   5.471   1.00 0.00 ? 58  CYS A H    3  
ATOM 7684  H HA   . CYS A 1 58  ? 3.817   1.602   4.387   1.00 0.00 ? 58  CYS A HA   3  
ATOM 7685  H HB2  . CYS A 1 58  ? 3.086   4.183   2.986   1.00 0.00 ? 58  CYS A HB2  3  
ATOM 7686  H HB3  . CYS A 1 58  ? 2.876   2.552   2.353   1.00 0.00 ? 58  CYS A HB3  3  
ATOM 7687  N N    . ALA A 1 59  ? 6.285   3.484   4.226   1.00 0.00 ? 59  ALA A N    3  
ATOM 7688  C CA   . ALA A 1 59  ? 7.670   3.626   3.774   1.00 0.00 ? 59  ALA A CA   3  
ATOM 7689  C C    . ALA A 1 59  ? 8.459   2.508   4.428   1.00 0.00 ? 59  ALA A C    3  
ATOM 7690  O O    . ALA A 1 59  ? 8.022   2.007   5.463   1.00 0.00 ? 59  ALA A O    3  
ATOM 7691  C CB   . ALA A 1 59  ? 8.236   4.982   4.172   1.00 0.00 ? 59  ALA A CB   3  
ATOM 7692  H H    . ALA A 1 59  ? 6.036   3.868   5.092   1.00 0.00 ? 59  ALA A H    3  
ATOM 7693  H HA   . ALA A 1 59  ? 7.711   3.527   2.696   1.00 0.00 ? 59  ALA A HA   3  
ATOM 7694  H HB1  . ALA A 1 59  ? 7.478   5.553   4.686   1.00 0.00 ? 59  ALA A HB1  3  
ATOM 7695  H HB2  . ALA A 1 59  ? 8.550   5.513   3.287   1.00 0.00 ? 59  ALA A HB2  3  
ATOM 7696  H HB3  . ALA A 1 59  ? 9.086   4.839   4.826   1.00 0.00 ? 59  ALA A HB3  3  
ATOM 7697  N N    . ASN A 1 60  ? 9.587   2.081   3.844   1.00 0.00 ? 60  ASN A N    3  
ATOM 7698  C CA   . ASN A 1 60  ? 10.354  0.971   4.436   1.00 0.00 ? 60  ASN A CA   3  
ATOM 7699  C C    . ASN A 1 60  ? 9.511   0.329   5.516   1.00 0.00 ? 60  ASN A C    3  
ATOM 7700  O O    . ASN A 1 60  ? 9.702   0.542   6.713   1.00 0.00 ? 60  ASN A O    3  
ATOM 7701  C CB   . ASN A 1 60  ? 11.675  1.482   5.021   1.00 0.00 ? 60  ASN A CB   3  
ATOM 7702  C CG   . ASN A 1 60  ? 11.660  2.974   5.305   1.00 0.00 ? 60  ASN A CG   3  
ATOM 7703  O OD1  . ASN A 1 60  ? 12.529  3.714   4.844   1.00 0.00 ? 60  ASN A OD1  3  
ATOM 7704  N ND2  . ASN A 1 60  ? 10.670  3.421   6.069   1.00 0.00 ? 60  ASN A ND2  3  
ATOM 7705  H H    . ASN A 1 60  ? 9.883   2.492   3.005   1.00 0.00 ? 60  ASN A H    3  
ATOM 7706  H HA   . ASN A 1 60  ? 10.554  0.211   3.677   1.00 0.00 ? 60  ASN A HA   3  
ATOM 7707  H HB2  . ASN A 1 60  ? 11.872  0.967   5.946   1.00 0.00 ? 60  ASN A HB2  3  
ATOM 7708  H HB3  . ASN A 1 60  ? 12.473  1.277   4.322   1.00 0.00 ? 60  ASN A HB3  3  
ATOM 7709  H HD21 . ASN A 1 60  ? 10.013  2.774   6.401   1.00 0.00 ? 60  ASN A HD21 3  
ATOM 7710  H HD22 . ASN A 1 60  ? 10.637  4.380   6.270   1.00 0.00 ? 60  ASN A HD22 3  
ATOM 7711  N N    . THR A 1 61  ? 8.564   -0.457  5.040   1.00 0.00 ? 61  THR A N    3  
ATOM 7712  C CA   . THR A 1 61  ? 7.632   -1.166  5.866   1.00 0.00 ? 61  THR A CA   3  
ATOM 7713  C C    . THR A 1 61  ? 7.701   -2.616  5.479   1.00 0.00 ? 61  THR A C    3  
ATOM 7714  O O    . THR A 1 61  ? 7.729   -2.933  4.290   1.00 0.00 ? 61  THR A O    3  
ATOM 7715  C CB   . THR A 1 61  ? 6.217   -0.629  5.620   1.00 0.00 ? 61  THR A CB   3  
ATOM 7716  O OG1  . THR A 1 61  ? 5.269   -1.305  6.429   1.00 0.00 ? 61  THR A OG1  3  
ATOM 7717  C CG2  . THR A 1 61  ? 5.773   -0.762  4.170   1.00 0.00 ? 61  THR A CG2  3  
ATOM 7718  H H    . THR A 1 61  ? 8.483   -0.565  4.073   1.00 0.00 ? 61  THR A H    3  
ATOM 7719  H HA   . THR A 1 61  ? 7.904   -1.043  6.902   1.00 0.00 ? 61  THR A HA   3  
ATOM 7720  H HB   . THR A 1 61  ? 6.191   0.421   5.875   1.00 0.00 ? 61  THR A HB   3  
ATOM 7721  H HG1  . THR A 1 61  ? 5.509   -2.232  6.504   1.00 0.00 ? 61  THR A HG1  3  
ATOM 7722  H HG21 . THR A 1 61  ? 6.628   -0.984  3.541   1.00 0.00 ? 61  THR A HG21 3  
ATOM 7723  H HG22 . THR A 1 61  ? 5.321   0.164   3.845   1.00 0.00 ? 61  THR A HG22 3  
ATOM 7724  H HG23 . THR A 1 61  ? 5.051   -1.561  4.086   1.00 0.00 ? 61  THR A HG23 3  
ATOM 7725  N N    . THR A 1 62  ? 7.708   -3.504  6.448   1.00 0.00 ? 62  THR A N    3  
ATOM 7726  C CA   . THR A 1 62  ? 7.764   -4.906  6.117   1.00 0.00 ? 62  THR A CA   3  
ATOM 7727  C C    . THR A 1 62  ? 6.361   -5.469  6.154   1.00 0.00 ? 62  THR A C    3  
ATOM 7728  O O    . THR A 1 62  ? 6.016   -6.408  6.872   1.00 0.00 ? 62  THR A O    3  
ATOM 7729  C CB   . THR A 1 62  ? 8.735   -5.662  7.002   1.00 0.00 ? 62  THR A CB   3  
ATOM 7730  O OG1  . THR A 1 62  ? 8.067   -6.458  7.966   1.00 0.00 ? 62  THR A OG1  3  
ATOM 7731  C CG2  . THR A 1 62  ? 9.720   -4.770  7.734   1.00 0.00 ? 62  THR A CG2  3  
ATOM 7732  H H    . THR A 1 62  ? 7.664   -3.210  7.382   1.00 0.00 ? 62  THR A H    3  
ATOM 7733  H HA   . THR A 1 62  ? 8.118   -4.966  5.090   1.00 0.00 ? 62  THR A HA   3  
ATOM 7734  H HB   . THR A 1 62  ? 9.297   -6.303  6.354   1.00 0.00 ? 62  THR A HB   3  
ATOM 7735  H HG1  . THR A 1 62  ? 8.270   -7.383  7.814   1.00 0.00 ? 62  THR A HG1  3  
ATOM 7736  H HG21 . THR A 1 62  ? 9.198   -4.197  8.486   1.00 0.00 ? 62  THR A HG21 3  
ATOM 7737  H HG22 . THR A 1 62  ? 10.189  -4.096  7.029   1.00 0.00 ? 62  THR A HG22 3  
ATOM 7738  H HG23 . THR A 1 62  ? 10.476  -5.380  8.206   1.00 0.00 ? 62  THR A HG23 3  
ATOM 7739  N N    . ARG A 1 63  ? 5.587   -4.829  5.313   1.00 0.00 ? 63  ARG A N    3  
ATOM 7740  C CA   . ARG A 1 63  ? 4.186   -5.107  5.077   1.00 0.00 ? 63  ARG A CA   3  
ATOM 7741  C C    . ARG A 1 63  ? 3.968   -4.959  3.584   1.00 0.00 ? 63  ARG A C    3  
ATOM 7742  O O    . ARG A 1 63  ? 4.896   -4.566  2.886   1.00 0.00 ? 63  ARG A O    3  
ATOM 7743  C CB   . ARG A 1 63  ? 3.326   -4.102  5.840   1.00 0.00 ? 63  ARG A CB   3  
ATOM 7744  C CG   . ARG A 1 63  ? 2.907   -4.579  7.223   1.00 0.00 ? 63  ARG A CG   3  
ATOM 7745  C CD   . ARG A 1 63  ? 3.565   -3.763  8.325   1.00 0.00 ? 63  ARG A CD   3  
ATOM 7746  N NE   . ARG A 1 63  ? 2.584   -3.036  9.128   1.00 0.00 ? 63  ARG A NE   3  
ATOM 7747  C CZ   . ARG A 1 63  ? 1.852   -3.596  10.089  1.00 0.00 ? 63  ARG A CZ   3  
ATOM 7748  N NH1  . ARG A 1 63  ? 1.989   -4.886  10.371  1.00 0.00 ? 63  ARG A NH1  3  
ATOM 7749  N NH2  . ARG A 1 63  ? 0.983   -2.864  10.772  1.00 0.00 ? 63  ARG A NH2  3  
ATOM 7750  H H    . ARG A 1 63  ? 6.002   -4.114  4.796   1.00 0.00 ? 63  ARG A H    3  
ATOM 7751  H HA   . ARG A 1 63  ? 3.963   -6.116  5.392   1.00 0.00 ? 63  ARG A HA   3  
ATOM 7752  H HB2  . ARG A 1 63  ? 3.891   -3.182  5.949   1.00 0.00 ? 63  ARG A HB2  3  
ATOM 7753  H HB3  . ARG A 1 63  ? 2.436   -3.898  5.264   1.00 0.00 ? 63  ARG A HB3  3  
ATOM 7754  H HG2  . ARG A 1 63  ? 1.835   -4.486  7.314   1.00 0.00 ? 63  ARG A HG2  3  
ATOM 7755  H HG3  . ARG A 1 63  ? 3.191   -5.615  7.336   1.00 0.00 ? 63  ARG A HG3  3  
ATOM 7756  H HD2  . ARG A 1 63  ? 4.117   -4.431  8.969   1.00 0.00 ? 63  ARG A HD2  3  
ATOM 7757  H HD3  . ARG A 1 63  ? 4.245   -3.054  7.877   1.00 0.00 ? 63  ARG A HD3  3  
ATOM 7758  H HE   . ARG A 1 63  ? 2.462   -2.082  8.941   1.00 0.00 ? 63  ARG A HE   3  
ATOM 7759  H HH11 . ARG A 1 63  ? 2.643   -5.444  9.860   1.00 0.00 ? 63  ARG A HH11 3  
ATOM 7760  H HH12 . ARG A 1 63  ? 1.437   -5.300  11.094  1.00 0.00 ? 63  ARG A HH12 3  
ATOM 7761  H HH21 . ARG A 1 63  ? 0.875   -1.892  10.564  1.00 0.00 ? 63  ARG A HH21 3  
ATOM 7762  H HH22 . ARG A 1 63  ? 0.433   -3.285  11.494  1.00 0.00 ? 63  ARG A HH22 3  
ATOM 7763  N N    . SER A 1 64  ? 2.782   -5.248  3.064   1.00 0.00 ? 64  SER A N    3  
ATOM 7764  C CA   . SER A 1 64  ? 2.575   -5.091  1.630   1.00 0.00 ? 64  SER A CA   3  
ATOM 7765  C C    . SER A 1 64  ? 1.511   -4.043  1.298   1.00 0.00 ? 64  SER A C    3  
ATOM 7766  O O    . SER A 1 64  ? 1.830   -2.942  0.858   1.00 0.00 ? 64  SER A O    3  
ATOM 7767  C CB   . SER A 1 64  ? 2.259   -6.429  0.973   1.00 0.00 ? 64  SER A CB   3  
ATOM 7768  O OG   . SER A 1 64  ? 0.948   -6.868  1.285   1.00 0.00 ? 64  SER A OG   3  
ATOM 7769  H H    . SER A 1 64  ? 2.038   -5.546  3.627   1.00 0.00 ? 64  SER A H    3  
ATOM 7770  H HA   . SER A 1 64  ? 3.508   -4.741  1.225   1.00 0.00 ? 64  SER A HA   3  
ATOM 7771  H HB2  . SER A 1 64  ? 2.353   -6.328  -0.096  1.00 0.00 ? 64  SER A HB2  3  
ATOM 7772  H HB3  . SER A 1 64  ? 2.968   -7.162  1.319   1.00 0.00 ? 64  SER A HB3  3  
ATOM 7773  H HG   . SER A 1 64  ? 0.415   -6.876  0.487   1.00 0.00 ? 64  SER A HG   3  
ATOM 7774  N N    . PHE A 1 65  ? 0.244   -4.397  1.467   1.00 0.00 ? 65  PHE A N    3  
ATOM 7775  C CA   . PHE A 1 65  ? -0.845  -3.483  1.135   1.00 0.00 ? 65  PHE A CA   3  
ATOM 7776  C C    . PHE A 1 65  ? -0.967  -2.308  2.106   1.00 0.00 ? 65  PHE A C    3  
ATOM 7777  O O    . PHE A 1 65  ? -1.211  -2.487  3.299   1.00 0.00 ? 65  PHE A O    3  
ATOM 7778  C CB   . PHE A 1 65  ? -2.170  -4.238  1.071   1.00 0.00 ? 65  PHE A CB   3  
ATOM 7779  C CG   . PHE A 1 65  ? -2.557  -4.888  2.368   1.00 0.00 ? 65  PHE A CG   3  
ATOM 7780  C CD1  . PHE A 1 65  ? -2.132  -6.173  2.669   1.00 0.00 ? 65  PHE A CD1  3  
ATOM 7781  C CD2  . PHE A 1 65  ? -3.346  -4.215  3.287   1.00 0.00 ? 65  PHE A CD2  3  
ATOM 7782  C CE1  . PHE A 1 65  ? -2.487  -6.773  3.863   1.00 0.00 ? 65  PHE A CE1  3  
ATOM 7783  C CE2  . PHE A 1 65  ? -3.704  -4.810  4.482   1.00 0.00 ? 65  PHE A CE2  3  
ATOM 7784  C CZ   . PHE A 1 65  ? -3.274  -6.091  4.770   1.00 0.00 ? 65  PHE A CZ   3  
ATOM 7785  H H    . PHE A 1 65  ? 0.032   -5.298  1.789   1.00 0.00 ? 65  PHE A H    3  
ATOM 7786  H HA   . PHE A 1 65  ? -0.637  -3.086  0.157   1.00 0.00 ? 65  PHE A HA   3  
ATOM 7787  H HB2  . PHE A 1 65  ? -2.954  -3.549  0.796   1.00 0.00 ? 65  PHE A HB2  3  
ATOM 7788  H HB3  . PHE A 1 65  ? -2.097  -5.009  0.318   1.00 0.00 ? 65  PHE A HB3  3  
ATOM 7789  H HD1  . PHE A 1 65  ? -1.517  -6.707  1.961   1.00 0.00 ? 65  PHE A HD1  3  
ATOM 7790  H HD2  . PHE A 1 65  ? -3.682  -3.213  3.063   1.00 0.00 ? 65  PHE A HD2  3  
ATOM 7791  H HE1  . PHE A 1 65  ? -2.150  -7.775  4.085   1.00 0.00 ? 65  PHE A HE1  3  
ATOM 7792  H HE2  . PHE A 1 65  ? -4.319  -4.274  5.189   1.00 0.00 ? 65  PHE A HE2  3  
ATOM 7793  H HZ   . PHE A 1 65  ? -3.552  -6.558  5.703   1.00 0.00 ? 65  PHE A HZ   3  
ATOM 7794  N N    . CYS A 1 66  ? -0.809  -1.103  1.560   1.00 0.00 ? 66  CYS A N    3  
ATOM 7795  C CA   . CYS A 1 66  ? -0.913  0.132   2.336   1.00 0.00 ? 66  CYS A CA   3  
ATOM 7796  C C    . CYS A 1 66  ? -2.309  0.729   2.139   1.00 0.00 ? 66  CYS A C    3  
ATOM 7797  O O    . CYS A 1 66  ? -2.920  0.548   1.086   1.00 0.00 ? 66  CYS A O    3  
ATOM 7798  C CB   . CYS A 1 66  ? 0.184   1.116   1.895   1.00 0.00 ? 66  CYS A CB   3  
ATOM 7799  S SG   . CYS A 1 66  ? -0.055  2.847   2.426   1.00 0.00 ? 66  CYS A SG   3  
ATOM 7800  H H    . CYS A 1 66  ? -0.612  -1.048  0.602   1.00 0.00 ? 66  CYS A H    3  
ATOM 7801  H HA   . CYS A 1 66  ? -0.778  -0.114  3.379   1.00 0.00 ? 66  CYS A HA   3  
ATOM 7802  H HB2  . CYS A 1 66  ? 1.130   0.785   2.295   1.00 0.00 ? 66  CYS A HB2  3  
ATOM 7803  H HB3  . CYS A 1 66  ? 0.240   1.110   0.816   1.00 0.00 ? 66  CYS A HB3  3  
ATOM 7804  N N    . ASP A 1 67  ? -2.827  1.410   3.159   1.00 0.00 ? 67  ASP A N    3  
ATOM 7805  C CA   . ASP A 1 67  ? -4.171  1.984   3.080   1.00 0.00 ? 67  ASP A CA   3  
ATOM 7806  C C    . ASP A 1 67  ? -4.154  3.473   2.742   1.00 0.00 ? 67  ASP A C    3  
ATOM 7807  O O    . ASP A 1 67  ? -3.112  4.127   2.779   1.00 0.00 ? 67  ASP A O    3  
ATOM 7808  C CB   . ASP A 1 67  ? -4.923  1.759   4.388   1.00 0.00 ? 67  ASP A CB   3  
ATOM 7809  C CG   . ASP A 1 67  ? -4.299  2.500   5.555   1.00 0.00 ? 67  ASP A CG   3  
ATOM 7810  O OD1  . ASP A 1 67  ? -3.251  2.042   6.057   1.00 0.00 ? 67  ASP A OD1  3  
ATOM 7811  O OD2  . ASP A 1 67  ? -4.858  3.538   5.967   1.00 0.00 ? 67  ASP A OD2  3  
ATOM 7812  H H    . ASP A 1 67  ? -2.306  1.511   3.983   1.00 0.00 ? 67  ASP A H    3  
ATOM 7813  H HA   . ASP A 1 67  ? -4.697  1.463   2.292   1.00 0.00 ? 67  ASP A HA   3  
ATOM 7814  H HB2  . ASP A 1 67  ? -5.940  2.101   4.269   1.00 0.00 ? 67  ASP A HB2  3  
ATOM 7815  H HB3  . ASP A 1 67  ? -4.928  0.703   4.614   1.00 0.00 ? 67  ASP A HB3  3  
ATOM 7816  N N    . LEU A 1 68  ? -5.335  3.990   2.401   1.00 0.00 ? 68  LEU A N    3  
ATOM 7817  C CA   . LEU A 1 68  ? -5.503  5.395   2.035   1.00 0.00 ? 68  LEU A CA   3  
ATOM 7818  C C    . LEU A 1 68  ? -6.987  5.758   1.920   1.00 0.00 ? 68  LEU A C    3  
ATOM 7819  O O    . LEU A 1 68  ? -7.586  5.642   0.851   1.00 0.00 ? 68  LEU A O    3  
ATOM 7820  C CB   . LEU A 1 68  ? -4.810  5.673   0.700   1.00 0.00 ? 68  LEU A CB   3  
ATOM 7821  C CG   . LEU A 1 68  ? -5.004  4.582   -0.354  1.00 0.00 ? 68  LEU A CG   3  
ATOM 7822  C CD1  . LEU A 1 68  ? -4.942  5.157   -1.759  1.00 0.00 ? 68  LEU A CD1  3  
ATOM 7823  C CD2  . LEU A 1 68  ? -3.969  3.490   -0.175  1.00 0.00 ? 68  LEU A CD2  3  
ATOM 7824  H H    . LEU A 1 68  ? -6.118  3.404   2.389   1.00 0.00 ? 68  LEU A H    3  
ATOM 7825  H HA   . LEU A 1 68  ? -5.049  6.000   2.805   1.00 0.00 ? 68  LEU A HA   3  
ATOM 7826  H HB2  . LEU A 1 68  ? -5.192  6.603   0.305   1.00 0.00 ? 68  LEU A HB2  3  
ATOM 7827  H HB3  . LEU A 1 68  ? -3.752  5.784   0.882   1.00 0.00 ? 68  LEU A HB3  3  
ATOM 7828  H HG   . LEU A 1 68  ? -5.975  4.138   -0.223  1.00 0.00 ? 68  LEU A HG   3  
ATOM 7829  H HD11 . LEU A 1 68  ? -5.826  5.749   -1.945  1.00 0.00 ? 68  LEU A HD11 3  
ATOM 7830  H HD12 . LEU A 1 68  ? -4.895  4.351   -2.478  1.00 0.00 ? 68  LEU A HD12 3  
ATOM 7831  H HD13 . LEU A 1 68  ? -4.066  5.778   -1.858  1.00 0.00 ? 68  LEU A HD13 3  
ATOM 7832  H HD21 . LEU A 1 68  ? -3.667  3.120   -1.143  1.00 0.00 ? 68  LEU A HD21 3  
ATOM 7833  H HD22 . LEU A 1 68  ? -4.398  2.682   0.403   1.00 0.00 ? 68  LEU A HD22 3  
ATOM 7834  H HD23 . LEU A 1 68  ? -3.109  3.887   0.344   1.00 0.00 ? 68  LEU A HD23 3  
ATOM 7835  N N    . THR A 1 69  ? -7.597  6.179   3.014   1.00 0.00 ? 69  THR A N    3  
ATOM 7836  C CA   . THR A 1 69  ? -9.008  6.535   2.978   1.00 0.00 ? 69  THR A CA   3  
ATOM 7837  C C    . THR A 1 69  ? -9.193  7.981   2.533   1.00 0.00 ? 69  THR A C    3  
ATOM 7838  O O    . THR A 1 69  ? -9.945  8.265   1.601   1.00 0.00 ? 69  THR A O    3  
ATOM 7839  C CB   . THR A 1 69  ? -9.653  6.330   4.350   1.00 0.00 ? 69  THR A CB   3  
ATOM 7840  O OG1  . THR A 1 69  ? -9.163  5.155   4.979   1.00 0.00 ? 69  THR A OG1  3  
ATOM 7841  C CG2  . THR A 1 69  ? -11.162 6.231   4.293   1.00 0.00 ? 69  THR A CG2  3  
ATOM 7842  H H    . THR A 1 69  ? -7.103  6.240   3.859   1.00 0.00 ? 69  THR A H    3  
ATOM 7843  H HA   . THR A 1 69  ? -9.487  5.886   2.251   1.00 0.00 ? 69  THR A HA   3  
ATOM 7844  H HB   . THR A 1 69  ? -9.405  7.174   4.977   1.00 0.00 ? 69  THR A HB   3  
ATOM 7845  H HG1  . THR A 1 69  ? -8.697  4.612   4.339   1.00 0.00 ? 69  THR A HG1  3  
ATOM 7846  H HG21 . THR A 1 69  ? -11.455 5.711   3.393   1.00 0.00 ? 69  THR A HG21 3  
ATOM 7847  H HG22 . THR A 1 69  ? -11.588 7.224   4.290   1.00 0.00 ? 69  THR A HG22 3  
ATOM 7848  H HG23 . THR A 1 69  ? -11.520 5.688   5.155   1.00 0.00 ? 69  THR A HG23 3  
ATOM 7849  N N    . ASP A 1 70  ? -8.495  8.891   3.202   1.00 0.00 ? 70  ASP A N    3  
ATOM 7850  C CA   . ASP A 1 70  ? -8.575  10.309  2.874   1.00 0.00 ? 70  ASP A CA   3  
ATOM 7851  C C    . ASP A 1 70  ? -7.286  10.786  2.211   1.00 0.00 ? 70  ASP A C    3  
ATOM 7852  O O    . ASP A 1 70  ? -7.039  11.987  2.107   1.00 0.00 ? 70  ASP A O    3  
ATOM 7853  C CB   . ASP A 1 70  ? -8.849  11.132  4.134   1.00 0.00 ? 70  ASP A CB   3  
ATOM 7854  C CG   . ASP A 1 70  ? -7.811  10.899  5.214   1.00 0.00 ? 70  ASP A CG   3  
ATOM 7855  O OD1  . ASP A 1 70  ? -6.660  11.351  5.039   1.00 0.00 ? 70  ASP A OD1  3  
ATOM 7856  O OD2  . ASP A 1 70  ? -8.150  10.266  6.236   1.00 0.00 ? 70  ASP A OD2  3  
ATOM 7857  H H    . ASP A 1 70  ? -7.904  8.603   3.929   1.00 0.00 ? 70  ASP A H    3  
ATOM 7858  H HA   . ASP A 1 70  ? -9.393  10.443  2.183   1.00 0.00 ? 70  ASP A HA   3  
ATOM 7859  H HB2  . ASP A 1 70  ? -8.845  12.181  3.878   1.00 0.00 ? 70  ASP A HB2  3  
ATOM 7860  H HB3  . ASP A 1 70  ? -9.819  10.866  4.528   1.00 0.00 ? 70  ASP A HB3  3  
ATOM 7861  N N    . GLU A 1 71  ? -6.467  9.837   1.763   1.00 0.00 ? 71  GLU A N    3  
ATOM 7862  C CA   . GLU A 1 71  ? -5.206  10.161  1.110   1.00 0.00 ? 71  GLU A CA   3  
ATOM 7863  C C    . GLU A 1 71  ? -5.372  10.208  -0.406  1.00 0.00 ? 71  GLU A C    3  
ATOM 7864  O O    . GLU A 1 71  ? -4.560  10.811  -1.107  1.00 0.00 ? 71  GLU A O    3  
ATOM 7865  C CB   . GLU A 1 71  ? -4.136  9.134   1.483   1.00 0.00 ? 71  GLU A CB   3  
ATOM 7866  C CG   . GLU A 1 71  ? -3.494  9.390   2.837   1.00 0.00 ? 71  GLU A CG   3  
ATOM 7867  C CD   . GLU A 1 71  ? -2.671  10.663  2.859   1.00 0.00 ? 71  GLU A CD   3  
ATOM 7868  O OE1  . GLU A 1 71  ? -3.257  11.746  3.068   1.00 0.00 ? 71  GLU A OE1  3  
ATOM 7869  O OE2  . GLU A 1 71  ? -1.440  10.577  2.666   1.00 0.00 ? 71  GLU A OE2  3  
ATOM 7870  H H    . GLU A 1 71  ? -6.717  8.897   1.873   1.00 0.00 ? 71  GLU A H    3  
ATOM 7871  H HA   . GLU A 1 71  ? -4.894  11.135  1.456   1.00 0.00 ? 71  GLU A HA   3  
ATOM 7872  H HB2  . GLU A 1 71  ? -4.586  8.153   1.502   1.00 0.00 ? 71  GLU A HB2  3  
ATOM 7873  H HB3  . GLU A 1 71  ? -3.361  9.151   0.732   1.00 0.00 ? 71  GLU A HB3  3  
ATOM 7874  H HG2  . GLU A 1 71  ? -4.272  9.470   3.581   1.00 0.00 ? 71  GLU A HG2  3  
ATOM 7875  H HG3  . GLU A 1 71  ? -2.850  8.557   3.078   1.00 0.00 ? 71  GLU A HG3  3  
ATOM 7876  N N    . TRP A 1 72  ? -6.438  9.584   -0.908  1.00 0.00 ? 72  TRP A N    3  
ATOM 7877  C CA   . TRP A 1 72  ? -6.718  9.570   -2.338  1.00 0.00 ? 72  TRP A CA   3  
ATOM 7878  C C    . TRP A 1 72  ? -8.117  10.129  -2.595  1.00 0.00 ? 72  TRP A C    3  
ATOM 7879  O O    . TRP A 1 72  ? -8.939  9.503   -3.266  1.00 0.00 ? 72  TRP A O    3  
ATOM 7880  C CB   . TRP A 1 72  ? -6.601  8.147   -2.899  1.00 0.00 ? 72  TRP A CB   3  
ATOM 7881  C CG   . TRP A 1 72  ? -5.186  7.721   -3.192  1.00 0.00 ? 72  TRP A CG   3  
ATOM 7882  C CD1  . TRP A 1 72  ? -4.049  8.117   -2.540  1.00 0.00 ? 72  TRP A CD1  3  
ATOM 7883  C CD2  . TRP A 1 72  ? -4.757  6.802   -4.207  1.00 0.00 ? 72  TRP A CD2  3  
ATOM 7884  N NE1  . TRP A 1 72  ? -2.950  7.501   -3.092  1.00 0.00 ? 72  TRP A NE1  3  
ATOM 7885  C CE2  . TRP A 1 72  ? -3.358  6.695   -4.111  1.00 0.00 ? 72  TRP A CE2  3  
ATOM 7886  C CE3  . TRP A 1 72  ? -5.417  6.060   -5.188  1.00 0.00 ? 72  TRP A CE3  3  
ATOM 7887  C CZ2  . TRP A 1 72  ? -2.611  5.881   -4.950  1.00 0.00 ? 72  TRP A CZ2  3  
ATOM 7888  C CZ3  . TRP A 1 72  ? -4.671  5.249   -6.024  1.00 0.00 ? 72  TRP A CZ3  3  
ATOM 7889  C CH2  . TRP A 1 72  ? -3.276  5.165   -5.898  1.00 0.00 ? 72  TRP A CH2  3  
ATOM 7890  H H    . TRP A 1 72  ? -7.070  9.139   -0.306  1.00 0.00 ? 72  TRP A H    3  
ATOM 7891  H HA   . TRP A 1 72  ? -5.997  10.198  -2.828  1.00 0.00 ? 72  TRP A HA   3  
ATOM 7892  H HB2  . TRP A 1 72  ? -7.014  7.451   -2.185  1.00 0.00 ? 72  TRP A HB2  3  
ATOM 7893  H HB3  . TRP A 1 72  ? -7.164  8.084   -3.819  1.00 0.00 ? 72  TRP A HB3  3  
ATOM 7894  H HD1  . TRP A 1 72  ? -4.030  8.809   -1.717  1.00 0.00 ? 72  TRP A HD1  3  
ATOM 7895  H HE1  . TRP A 1 72  ? -2.023  7.619   -2.803  1.00 0.00 ? 72  TRP A HE1  3  
ATOM 7896  H HE3  . TRP A 1 72  ? -6.487  6.112   -5.298  1.00 0.00 ? 72  TRP A HE3  3  
ATOM 7897  H HZ2  . TRP A 1 72  ? -1.540  5.808   -4.865  1.00 0.00 ? 72  TRP A HZ2  3  
ATOM 7898  H HZ3  . TRP A 1 72  ? -5.165  4.668   -6.787  1.00 0.00 ? 72  TRP A HZ3  3  
ATOM 7899  H HH2  . TRP A 1 72  ? -2.725  4.523   -6.569  1.00 0.00 ? 72  TRP A HH2  3  
ATOM 7900  N N    . ARG A 1 73  ? -8.379  11.316  -2.042  1.00 0.00 ? 73  ARG A N    3  
ATOM 7901  C CA   . ARG A 1 73  ? -9.678  11.977  -2.189  1.00 0.00 ? 73  ARG A CA   3  
ATOM 7902  C C    . ARG A 1 73  ? -9.897  12.496  -3.611  1.00 0.00 ? 73  ARG A C    3  
ATOM 7903  O O    . ARG A 1 73  ? -10.955 13.043  -3.923  1.00 0.00 ? 73  ARG A O    3  
ATOM 7904  C CB   . ARG A 1 73  ? -9.798  13.133  -1.194  1.00 0.00 ? 73  ARG A CB   3  
ATOM 7905  C CG   . ARG A 1 73  ? -8.598  14.069  -1.198  1.00 0.00 ? 73  ARG A CG   3  
ATOM 7906  C CD   . ARG A 1 73  ? -8.989  15.487  -1.589  1.00 0.00 ? 73  ARG A CD   3  
ATOM 7907  N NE   . ARG A 1 73  ? -8.461  16.477  -0.652  1.00 0.00 ? 73  ARG A NE   3  
ATOM 7908  C CZ   . ARG A 1 73  ? -8.901  16.624  0.595   1.00 0.00 ? 73  ARG A CZ   3  
ATOM 7909  N NH1  . ARG A 1 73  ? -9.872  15.848  1.060   1.00 0.00 ? 73  ARG A NH1  3  
ATOM 7910  N NH2  . ARG A 1 73  ? -8.367  17.549  1.381   1.00 0.00 ? 73  ARG A NH2  3  
ATOM 7911  H H    . ARG A 1 73  ? -7.681  11.756  -1.514  1.00 0.00 ? 73  ARG A H    3  
ATOM 7912  H HA   . ARG A 1 73  ? -10.442 11.249  -1.967  1.00 0.00 ? 73  ARG A HA   3  
ATOM 7913  H HB2  . ARG A 1 73  ? -10.680 13.708  -1.435  1.00 0.00 ? 73  ARG A HB2  3  
ATOM 7914  H HB3  . ARG A 1 73  ? -9.906  12.726  -0.200  1.00 0.00 ? 73  ARG A HB3  3  
ATOM 7915  H HG2  . ARG A 1 73  ? -8.166  14.086  -0.209  1.00 0.00 ? 73  ARG A HG2  3  
ATOM 7916  H HG3  . ARG A 1 73  ? -7.869  13.699  -1.904  1.00 0.00 ? 73  ARG A HG3  3  
ATOM 7917  H HD2  . ARG A 1 73  ? -8.600  15.695  -2.574  1.00 0.00 ? 73  ARG A HD2  3  
ATOM 7918  H HD3  . ARG A 1 73  ? -10.066 15.560  -1.605  1.00 0.00 ? 73  ARG A HD3  3  
ATOM 7919  H HE   . ARG A 1 73  ? -7.742  17.062  -0.970  1.00 0.00 ? 73  ARG A HE   3  
ATOM 7920  H HH11 . ARG A 1 73  ? -10.279 15.148  0.472   1.00 0.00 ? 73  ARG A HH11 3  
ATOM 7921  H HH12 . ARG A 1 73  ? -10.198 15.964  1.998   1.00 0.00 ? 73  ARG A HH12 3  
ATOM 7922  H HH21 . ARG A 1 73  ? -7.634  18.135  1.036   1.00 0.00 ? 73  ARG A HH21 3  
ATOM 7923  H HH22 . ARG A 1 73  ? -8.697  17.660  2.318   1.00 0.00 ? 73  ARG A HH22 3  
ATOM 7924  N N    . SER A 1 74  ? -8.905  12.305  -4.472  1.00 0.00 ? 74  SER A N    3  
ATOM 7925  C CA   . SER A 1 74  ? -9.009  12.738  -5.860  1.00 0.00 ? 74  SER A CA   3  
ATOM 7926  C C    . SER A 1 74  ? -9.641  11.636  -6.703  1.00 0.00 ? 74  SER A C    3  
ATOM 7927  O O    . SER A 1 74  ? -9.092  11.224  -7.725  1.00 0.00 ? 74  SER A O    3  
ATOM 7928  C CB   . SER A 1 74  ? -7.633  13.113  -6.418  1.00 0.00 ? 74  SER A CB   3  
ATOM 7929  O OG   . SER A 1 74  ? -6.719  13.406  -5.376  1.00 0.00 ? 74  SER A OG   3  
ATOM 7930  H H    . SER A 1 74  ? -8.102  11.848  -4.163  1.00 0.00 ? 74  SER A H    3  
ATOM 7931  H HA   . SER A 1 74  ? -9.650  13.607  -5.887  1.00 0.00 ? 74  SER A HA   3  
ATOM 7932  H HB2  . SER A 1 74  ? -7.246  12.290  -6.999  1.00 0.00 ? 74  SER A HB2  3  
ATOM 7933  H HB3  . SER A 1 74  ? -7.730  13.983  -7.051  1.00 0.00 ? 74  SER A HB3  3  
ATOM 7934  H HG   . SER A 1 74  ? -6.651  14.358  -5.268  1.00 0.00 ? 74  SER A HG   3  
ATOM 7935  N N    . THR A 1 75  ? -10.803 11.159  -6.258  1.00 0.00 ? 75  THR A N    3  
ATOM 7936  C CA   . THR A 1 75  ? -11.522 10.100  -6.958  1.00 0.00 ? 75  THR A CA   3  
ATOM 7937  C C    . THR A 1 75  ? -11.706 10.442  -8.432  1.00 0.00 ? 75  THR A C    3  
ATOM 7938  O O    . THR A 1 75  ? -11.841 9.554   -9.272  1.00 0.00 ? 75  THR A O    3  
ATOM 7939  C CB   . THR A 1 75  ? -12.883 9.862   -6.303  1.00 0.00 ? 75  THR A CB   3  
ATOM 7940  O OG1  . THR A 1 75  ? -13.706 11.009  -6.425  1.00 0.00 ? 75  THR A OG1  3  
ATOM 7941  C CG2  . THR A 1 75  ? -12.788 9.521   -4.831  1.00 0.00 ? 75  THR A CG2  3  
ATOM 7942  H H    . THR A 1 75  ? -11.185 11.528  -5.436  1.00 0.00 ? 75  THR A H    3  
ATOM 7943  H HA   . THR A 1 75  ? -10.934 9.197   -6.882  1.00 0.00 ? 75  THR A HA   3  
ATOM 7944  H HB   . THR A 1 75  ? -13.373 9.039   -6.802  1.00 0.00 ? 75  THR A HB   3  
ATOM 7945  H HG1  . THR A 1 75  ? -14.488 10.790  -6.937  1.00 0.00 ? 75  THR A HG1  3  
ATOM 7946  H HG21 . THR A 1 75  ? -12.125 8.679   -4.699  1.00 0.00 ? 75  THR A HG21 3  
ATOM 7947  H HG22 . THR A 1 75  ? -13.769 9.270   -4.456  1.00 0.00 ? 75  THR A HG22 3  
ATOM 7948  H HG23 . THR A 1 75  ? -12.402 10.371  -4.288  1.00 0.00 ? 75  THR A HG23 3  
ATOM 7949  N N    . HIS A 1 76  ? -11.705 11.735  -8.739  1.00 0.00 ? 76  HIS A N    3  
ATOM 7950  C CA   . HIS A 1 76  ? -11.866 12.192  -10.114 1.00 0.00 ? 76  HIS A CA   3  
ATOM 7951  C C    . HIS A 1 76  ? -10.516 12.283  -10.824 1.00 0.00 ? 76  HIS A C    3  
ATOM 7952  O O    . HIS A 1 76  ? -10.409 12.890  -11.889 1.00 0.00 ? 76  HIS A O    3  
ATOM 7953  C CB   . HIS A 1 76  ? -12.561 13.554  -10.140 1.00 0.00 ? 76  HIS A CB   3  
ATOM 7954  C CG   . HIS A 1 76  ? -11.861 14.597  -9.326  1.00 0.00 ? 76  HIS A CG   3  
ATOM 7955  N ND1  . HIS A 1 76  ? -12.285 14.984  -8.072  1.00 0.00 ? 76  HIS A ND1  3  
ATOM 7956  C CD2  . HIS A 1 76  ? -10.757 15.336  -9.592  1.00 0.00 ? 76  HIS A CD2  3  
ATOM 7957  C CE1  . HIS A 1 76  ? -11.473 15.915  -7.603  1.00 0.00 ? 76  HIS A CE1  3  
ATOM 7958  N NE2  . HIS A 1 76  ? -10.538 16.145  -8.506  1.00 0.00 ? 76  HIS A NE2  3  
ATOM 7959  H H    . HIS A 1 76  ? -11.590 12.398  -8.027  1.00 0.00 ? 76  HIS A H    3  
ATOM 7960  H HA   . HIS A 1 76  ? -12.484 11.473  -10.631 1.00 0.00 ? 76  HIS A HA   3  
ATOM 7961  H HB2  . HIS A 1 76  ? -12.610 13.905  -11.160 1.00 0.00 ? 76  HIS A HB2  3  
ATOM 7962  H HB3  . HIS A 1 76  ? -13.564 13.446  -9.753  1.00 0.00 ? 76  HIS A HB3  3  
ATOM 7963  H HD1  . HIS A 1 76  ? -13.065 14.630  -7.597  1.00 0.00 ? 76  HIS A HD1  3  
ATOM 7964  H HD2  . HIS A 1 76  ? -10.160 15.294  -10.493 1.00 0.00 ? 76  HIS A HD2  3  
ATOM 7965  H HE1  . HIS A 1 76  ? -11.559 16.404  -6.643  1.00 0.00 ? 76  HIS A HE1  3  
ATOM 7966  H HE2  . HIS A 1 76  ? -9.847  16.837  -8.440  1.00 0.00 ? 76  HIS A HE2  3  
ATOM 7967  N N    . GLU A 1 77  ? -9.489  11.674  -10.234 1.00 0.00 ? 77  GLU A N    3  
ATOM 7968  C CA   . GLU A 1 77  ? -8.158  11.687  -10.816 1.00 0.00 ? 77  GLU A CA   3  
ATOM 7969  C C    . GLU A 1 77  ? -7.590  10.289  -10.891 1.00 0.00 ? 77  GLU A C    3  
ATOM 7970  O O    . GLU A 1 77  ? -8.133  9.342   -10.324 1.00 0.00 ? 77  GLU A O    3  
ATOM 7971  C CB   . GLU A 1 77  ? -7.202  12.565  -9.990  1.00 0.00 ? 77  GLU A CB   3  
ATOM 7972  C CG   . GLU A 1 77  ? -7.354  14.055  -10.247 1.00 0.00 ? 77  GLU A CG   3  
ATOM 7973  C CD   . GLU A 1 77  ? -7.341  14.400  -11.724 1.00 0.00 ? 77  GLU A CD   3  
ATOM 7974  O OE1  . GLU A 1 77  ? -6.342  14.077  -12.401 1.00 0.00 ? 77  GLU A OE1  3  
ATOM 7975  O OE2  . GLU A 1 77  ? -8.329  14.995  -12.203 1.00 0.00 ? 77  GLU A OE2  3  
ATOM 7976  H H    . GLU A 1 77  ? -9.627  11.202  -9.391  1.00 0.00 ? 77  GLU A H    3  
ATOM 7977  H HA   . GLU A 1 77  ? -8.235  12.082  -11.816 1.00 0.00 ? 77  GLU A HA   3  
ATOM 7978  H HB2  . GLU A 1 77  ? -7.390  12.386  -8.942  1.00 0.00 ? 77  GLU A HB2  3  
ATOM 7979  H HB3  . GLU A 1 77  ? -6.173  12.282  -10.210 1.00 0.00 ? 77  GLU A HB3  3  
ATOM 7980  H HG2  . GLU A 1 77  ? -8.290  14.385  -9.824  1.00 0.00 ? 77  GLU A HG2  3  
ATOM 7981  H HG3  . GLU A 1 77  ? -6.539  14.573  -9.763  1.00 0.00 ? 77  GLU A HG3  3  
ATOM 7982  N N    . ALA A 1 78  ? -6.466  10.189  -11.566 1.00 0.00 ? 78  ALA A N    3  
ATOM 7983  C CA   . ALA A 1 78  ? -5.766  8.934   -11.701 1.00 0.00 ? 78  ALA A CA   3  
ATOM 7984  C C    . ALA A 1 78  ? -4.574  8.953   -10.764 1.00 0.00 ? 78  ALA A C    3  
ATOM 7985  O O    . ALA A 1 78  ? -3.489  9.405   -11.129 1.00 0.00 ? 78  ALA A O    3  
ATOM 7986  C CB   . ALA A 1 78  ? -5.341  8.715   -13.145 1.00 0.00 ? 78  ALA A CB   3  
ATOM 7987  H H    . ALA A 1 78  ? -6.080  10.994  -11.960 1.00 0.00 ? 78  ALA A H    3  
ATOM 7988  H HA   . ALA A 1 78  ? -6.436  8.145   -11.407 1.00 0.00 ? 78  ALA A HA   3  
ATOM 7989  H HB1  . ALA A 1 78  ? -5.978  9.298   -13.794 1.00 0.00 ? 78  ALA A HB1  3  
ATOM 7990  H HB2  . ALA A 1 78  ? -5.433  7.667   -13.394 1.00 0.00 ? 78  ALA A HB2  3  
ATOM 7991  H HB3  . ALA A 1 78  ? -4.314  9.030   -13.272 1.00 0.00 ? 78  ALA A HB3  3  
ATOM 7992  N N    . TYR A 1 79  ? -4.789  8.499   -9.536  1.00 0.00 ? 79  TYR A N    3  
ATOM 7993  C CA   . TYR A 1 79  ? -3.735  8.514   -8.539  1.00 0.00 ? 79  TYR A CA   3  
ATOM 7994  C C    . TYR A 1 79  ? -2.509  7.756   -8.998  1.00 0.00 ? 79  TYR A C    3  
ATOM 7995  O O    . TYR A 1 79  ? -2.365  6.563   -8.734  1.00 0.00 ? 79  TYR A O    3  
ATOM 7996  C CB   . TYR A 1 79  ? -4.218  7.961   -7.195  1.00 0.00 ? 79  TYR A CB   3  
ATOM 7997  C CG   . TYR A 1 79  ? -4.423  9.041   -6.164  1.00 0.00 ? 79  TYR A CG   3  
ATOM 7998  C CD1  . TYR A 1 79  ? -5.632  9.711   -6.063  1.00 0.00 ? 79  TYR A CD1  3  
ATOM 7999  C CD2  . TYR A 1 79  ? -3.399  9.412   -5.306  1.00 0.00 ? 79  TYR A CD2  3  
ATOM 8000  C CE1  . TYR A 1 79  ? -5.811  10.716  -5.143  1.00 0.00 ? 79  TYR A CE1  3  
ATOM 8001  C CE2  . TYR A 1 79  ? -3.573  10.405  -4.384  1.00 0.00 ? 79  TYR A CE2  3  
ATOM 8002  C CZ   . TYR A 1 79  ? -4.777  11.062  -4.303  1.00 0.00 ? 79  TYR A CZ   3  
ATOM 8003  O OH   . TYR A 1 79  ? -4.949  12.068  -3.380  1.00 0.00 ? 79  TYR A OH   3  
ATOM 8004  H H    . TYR A 1 79  ? -5.676  8.167   -9.288  1.00 0.00 ? 79  TYR A H    3  
ATOM 8005  H HA   . TYR A 1 79  ? -3.452  9.547   -8.396  1.00 0.00 ? 79  TYR A HA   3  
ATOM 8006  H HB2  . TYR A 1 79  ? -5.153  7.438   -7.324  1.00 0.00 ? 79  TYR A HB2  3  
ATOM 8007  H HB3  . TYR A 1 79  ? -3.478  7.279   -6.811  1.00 0.00 ? 79  TYR A HB3  3  
ATOM 8008  H HD1  . TYR A 1 79  ? -6.442  9.436   -6.713  1.00 0.00 ? 79  TYR A HD1  3  
ATOM 8009  H HD2  . TYR A 1 79  ? -2.451  8.905   -5.357  1.00 0.00 ? 79  TYR A HD2  3  
ATOM 8010  H HE1  . TYR A 1 79  ? -6.759  11.219  -5.080  1.00 0.00 ? 79  TYR A HE1  3  
ATOM 8011  H HE2  . TYR A 1 79  ? -2.766  10.659  -3.733  1.00 0.00 ? 79  TYR A HE2  3  
ATOM 8012  H HH   . TYR A 1 79  ? -4.628  11.775  -2.523  1.00 0.00 ? 79  TYR A HH   3  
ATOM 8013  N N    . VAL A 1 80  ? -1.600  8.465   -9.646  1.00 0.00 ? 80  VAL A N    3  
ATOM 8014  C CA   . VAL A 1 80  ? -0.368  7.848   -10.087 1.00 0.00 ? 80  VAL A CA   3  
ATOM 8015  C C    . VAL A 1 80  ? 0.447   7.522   -8.856  1.00 0.00 ? 80  VAL A C    3  
ATOM 8016  O O    . VAL A 1 80  ? 0.750   8.397   -8.059  1.00 0.00 ? 80  VAL A O    3  
ATOM 8017  C CB   . VAL A 1 80  ? 0.458   8.747   -11.025 1.00 0.00 ? 80  VAL A CB   3  
ATOM 8018  C CG1  . VAL A 1 80  ? 0.142   8.429   -12.478 1.00 0.00 ? 80  VAL A CG1  3  
ATOM 8019  C CG2  . VAL A 1 80  ? 0.212   10.218  -10.747 1.00 0.00 ? 80  VAL A CG2  3  
ATOM 8020  H H    . VAL A 1 80  ? -1.752  9.420   -9.801  1.00 0.00 ? 80  VAL A H    3  
ATOM 8021  H HA   . VAL A 1 80  ? -0.613  6.931   -10.604 1.00 0.00 ? 80  VAL A HA   3  
ATOM 8022  H HB   . VAL A 1 80  ? 1.500   8.539   -10.843 1.00 0.00 ? 80  VAL A HB   3  
ATOM 8023  H HG11 . VAL A 1 80  ? 0.230   7.366   -12.642 1.00 0.00 ? 80  VAL A HG11 3  
ATOM 8024  H HG12 . VAL A 1 80  ? 0.835   8.952   -13.120 1.00 0.00 ? 80  VAL A HG12 3  
ATOM 8025  H HG13 . VAL A 1 80  ? -0.869  8.747   -12.703 1.00 0.00 ? 80  VAL A HG13 3  
ATOM 8026  H HG21 . VAL A 1 80  ? -0.040  10.353  -9.707  1.00 0.00 ? 80  VAL A HG21 3  
ATOM 8027  H HG22 . VAL A 1 80  ? -0.600  10.561  -11.363 1.00 0.00 ? 80  VAL A HG22 3  
ATOM 8028  H HG23 . VAL A 1 80  ? 1.103   10.783  -10.980 1.00 0.00 ? 80  VAL A HG23 3  
ATOM 8029  N N    . THR A 1 81  ? 0.770   6.257   -8.696  1.00 0.00 ? 81  THR A N    3  
ATOM 8030  C CA   . THR A 1 81  ? 1.517   5.811   -7.534  1.00 0.00 ? 81  THR A CA   3  
ATOM 8031  C C    . THR A 1 81  ? 2.875   5.254   -7.928  1.00 0.00 ? 81  THR A C    3  
ATOM 8032  O O    . THR A 1 81  ? 3.024   4.664   -8.993  1.00 0.00 ? 81  THR A O    3  
ATOM 8033  C CB   . THR A 1 81  ? 0.708   4.750   -6.792  1.00 0.00 ? 81  THR A CB   3  
ATOM 8034  O OG1  . THR A 1 81  ? -0.613  4.688   -7.292  1.00 0.00 ? 81  THR A OG1  3  
ATOM 8035  C CG2  . THR A 1 81  ? 0.612   4.988   -5.311  1.00 0.00 ? 81  THR A CG2  3  
ATOM 8036  H H    . THR A 1 81  ? 0.494   5.612   -9.379  1.00 0.00 ? 81  THR A H    3  
ATOM 8037  H HA   . THR A 1 81  ? 1.658   6.658   -6.876  1.00 0.00 ? 81  THR A HA   3  
ATOM 8038  H HB   . THR A 1 81  ? 1.170   3.797   -6.937  1.00 0.00 ? 81  THR A HB   3  
ATOM 8039  H HG1  . THR A 1 81  ? -1.067  5.511   -7.099  1.00 0.00 ? 81  THR A HG1  3  
ATOM 8040  H HG21 . THR A 1 81  ? 0.399   6.026   -5.135  1.00 0.00 ? 81  THR A HG21 3  
ATOM 8041  H HG22 . THR A 1 81  ? 1.544   4.721   -4.840  1.00 0.00 ? 81  THR A HG22 3  
ATOM 8042  H HG23 . THR A 1 81  ? -0.183  4.382   -4.905  1.00 0.00 ? 81  THR A HG23 3  
ATOM 8043  N N    . VAL A 1 82  ? 3.849   5.422   -7.044  1.00 0.00 ? 82  VAL A N    3  
ATOM 8044  C CA   . VAL A 1 82  ? 5.194   4.913   -7.260  1.00 0.00 ? 82  VAL A CA   3  
ATOM 8045  C C    . VAL A 1 82  ? 5.616   4.103   -6.052  1.00 0.00 ? 82  VAL A C    3  
ATOM 8046  O O    . VAL A 1 82  ? 6.053   4.664   -5.049  1.00 0.00 ? 82  VAL A O    3  
ATOM 8047  C CB   . VAL A 1 82  ? 6.228   6.041   -7.467  1.00 0.00 ? 82  VAL A CB   3  
ATOM 8048  C CG1  . VAL A 1 82  ? 7.622   5.459   -7.704  1.00 0.00 ? 82  VAL A CG1  3  
ATOM 8049  C CG2  . VAL A 1 82  ? 5.818   6.947   -8.617  1.00 0.00 ? 82  VAL A CG2  3  
ATOM 8050  H H    . VAL A 1 82  ? 3.655   5.878   -6.201  1.00 0.00 ? 82  VAL A H    3  
ATOM 8051  H HA   . VAL A 1 82  ? 5.186   4.280   -8.134  1.00 0.00 ? 82  VAL A HA   3  
ATOM 8052  H HB   . VAL A 1 82  ? 6.263   6.634   -6.565  1.00 0.00 ? 82  VAL A HB   3  
ATOM 8053  H HG11 . VAL A 1 82  ? 7.568   4.686   -8.456  1.00 0.00 ? 82  VAL A HG11 3  
ATOM 8054  H HG12 . VAL A 1 82  ? 8.003   5.036   -6.783  1.00 0.00 ? 82  VAL A HG12 3  
ATOM 8055  H HG13 . VAL A 1 82  ? 8.287   6.241   -8.040  1.00 0.00 ? 82  VAL A HG13 3  
ATOM 8056  H HG21 . VAL A 1 82  ? 6.182   7.946   -8.435  1.00 0.00 ? 82  VAL A HG21 3  
ATOM 8057  H HG22 . VAL A 1 82  ? 4.741   6.965   -8.696  1.00 0.00 ? 82  VAL A HG22 3  
ATOM 8058  H HG23 . VAL A 1 82  ? 6.240   6.573   -9.538  1.00 0.00 ? 82  VAL A HG23 3  
ATOM 8059  N N    . LEU A 1 83  ? 5.502   2.788   -6.134  1.00 0.00 ? 83  LEU A N    3  
ATOM 8060  C CA   . LEU A 1 83  ? 5.905   1.965   -5.012  1.00 0.00 ? 83  LEU A CA   3  
ATOM 8061  C C    . LEU A 1 83  ? 7.374   1.617   -5.161  1.00 0.00 ? 83  LEU A C    3  
ATOM 8062  O O    . LEU A 1 83  ? 7.786   0.981   -6.135  1.00 0.00 ? 83  LEU A O    3  
ATOM 8063  C CB   . LEU A 1 83  ? 5.044   0.704   -4.875  1.00 0.00 ? 83  LEU A CB   3  
ATOM 8064  C CG   . LEU A 1 83  ? 5.715   -0.429  -4.098  1.00 0.00 ? 83  LEU A CG   3  
ATOM 8065  C CD1  . LEU A 1 83  ? 5.602   -0.241  -2.598  1.00 0.00 ? 83  LEU A CD1  3  
ATOM 8066  C CD2  . LEU A 1 83  ? 5.160   -1.778  -4.486  1.00 0.00 ? 83  LEU A CD2  3  
ATOM 8067  H H    . LEU A 1 83  ? 5.167   2.372   -6.961  1.00 0.00 ? 83  LEU A H    3  
ATOM 8068  H HA   . LEU A 1 83  ? 5.790   2.563   -4.117  1.00 0.00 ? 83  LEU A HA   3  
ATOM 8069  H HB2  . LEU A 1 83  ? 4.125   0.970   -4.372  1.00 0.00 ? 83  LEU A HB2  3  
ATOM 8070  H HB3  . LEU A 1 83  ? 4.807   0.346   -5.862  1.00 0.00 ? 83  LEU A HB3  3  
ATOM 8071  H HG   . LEU A 1 83  ? 6.747   -0.418  -4.343  1.00 0.00 ? 83  LEU A HG   3  
ATOM 8072  H HD11 . LEU A 1 83  ? 5.585   -1.215  -2.120  1.00 0.00 ? 83  LEU A HD11 3  
ATOM 8073  H HD12 . LEU A 1 83  ? 4.695   0.288   -2.370  1.00 0.00 ? 83  LEU A HD12 3  
ATOM 8074  H HD13 . LEU A 1 83  ? 6.450   0.321   -2.239  1.00 0.00 ? 83  LEU A HD13 3  
ATOM 8075  H HD21 . LEU A 1 83  ? 5.788   -2.214  -5.245  1.00 0.00 ? 83  LEU A HD21 3  
ATOM 8076  H HD22 . LEU A 1 83  ? 4.158   -1.660  -4.864  1.00 0.00 ? 83  LEU A HD22 3  
ATOM 8077  H HD23 . LEU A 1 83  ? 5.150   -2.418  -3.615  1.00 0.00 ? 83  LEU A HD23 3  
ATOM 8078  N N    . GLU A 1 84  ? 8.159   2.070   -4.202  1.00 0.00 ? 84  GLU A N    3  
ATOM 8079  C CA   . GLU A 1 84  ? 9.591   1.850   -4.217  1.00 0.00 ? 84  GLU A CA   3  
ATOM 8080  C C    . GLU A 1 84  ? 10.017  0.922   -3.087  1.00 0.00 ? 84  GLU A C    3  
ATOM 8081  O O    . GLU A 1 84  ? 10.028  1.308   -1.920  1.00 0.00 ? 84  GLU A O    3  
ATOM 8082  C CB   . GLU A 1 84  ? 10.288  3.199   -4.105  1.00 0.00 ? 84  GLU A CB   3  
ATOM 8083  C CG   . GLU A 1 84  ? 10.154  4.061   -5.349  1.00 0.00 ? 84  GLU A CG   3  
ATOM 8084  C CD   . GLU A 1 84  ? 11.291  5.054   -5.499  1.00 0.00 ? 84  GLU A CD   3  
ATOM 8085  O OE1  . GLU A 1 84  ? 12.444  4.690   -5.182  1.00 0.00 ? 84  GLU A OE1  3  
ATOM 8086  O OE2  . GLU A 1 84  ? 11.029  6.195   -5.933  1.00 0.00 ? 84  GLU A OE2  3  
ATOM 8087  H H    . GLU A 1 84  ? 7.765   2.588   -3.470  1.00 0.00 ? 84  GLU A H    3  
ATOM 8088  H HA   . GLU A 1 84  ? 9.850   1.396   -5.156  1.00 0.00 ? 84  GLU A HA   3  
ATOM 8089  H HB2  . GLU A 1 84  ? 9.850   3.731   -3.291  1.00 0.00 ? 84  GLU A HB2  3  
ATOM 8090  H HB3  . GLU A 1 84  ? 11.329  3.049   -3.899  1.00 0.00 ? 84  GLU A HB3  3  
ATOM 8091  H HG2  . GLU A 1 84  ? 10.135  3.419   -6.214  1.00 0.00 ? 84  GLU A HG2  3  
ATOM 8092  H HG3  . GLU A 1 84  ? 9.227   4.606   -5.295  1.00 0.00 ? 84  GLU A HG3  3  
ATOM 8093  N N    . GLY A 1 85  ? 10.360  -0.309  -3.447  1.00 0.00 ? 85  GLY A N    3  
ATOM 8094  C CA   . GLY A 1 85  ? 10.775  -1.282  -2.458  1.00 0.00 ? 85  GLY A CA   3  
ATOM 8095  C C    . GLY A 1 85  ? 12.244  -1.634  -2.552  1.00 0.00 ? 85  GLY A C    3  
ATOM 8096  O O    . GLY A 1 85  ? 12.764  -1.905  -3.635  1.00 0.00 ? 85  GLY A O    3  
ATOM 8097  H H    . GLY A 1 85  ? 10.326  -0.560  -4.394  1.00 0.00 ? 85  GLY A H    3  
ATOM 8098  H HA2  . GLY A 1 85  ? 10.575  -0.891  -1.473  1.00 0.00 ? 85  GLY A HA2  3  
ATOM 8099  H HA3  . GLY A 1 85  ? 10.196  -2.176  -2.590  1.00 0.00 ? 85  GLY A HA3  3  
ATOM 8100  N N    . PHE A 1 86  ? 12.902  -1.642  -1.404  1.00 0.00 ? 86  PHE A N    3  
ATOM 8101  C CA   . PHE A 1 86  ? 14.317  -1.975  -1.315  1.00 0.00 ? 86  PHE A CA   3  
ATOM 8102  C C    . PHE A 1 86  ? 14.461  -3.343  -0.665  1.00 0.00 ? 86  PHE A C    3  
ATOM 8103  O O    . PHE A 1 86  ? 13.828  -3.619  0.354   1.00 0.00 ? 86  PHE A O    3  
ATOM 8104  C CB   . PHE A 1 86  ? 15.053  -0.903  -0.500  1.00 0.00 ? 86  PHE A CB   3  
ATOM 8105  C CG   . PHE A 1 86  ? 14.470  0.474   -0.660  1.00 0.00 ? 86  PHE A CG   3  
ATOM 8106  C CD1  . PHE A 1 86  ? 13.291  0.820   -0.019  1.00 0.00 ? 86  PHE A CD1  3  
ATOM 8107  C CD2  . PHE A 1 86  ? 15.094  1.416   -1.461  1.00 0.00 ? 86  PHE A CD2  3  
ATOM 8108  C CE1  . PHE A 1 86  ? 12.745  2.080   -0.175  1.00 0.00 ? 86  PHE A CE1  3  
ATOM 8109  C CE2  . PHE A 1 86  ? 14.554  2.679   -1.619  1.00 0.00 ? 86  PHE A CE2  3  
ATOM 8110  C CZ   . PHE A 1 86  ? 13.377  3.011   -0.975  1.00 0.00 ? 86  PHE A CZ   3  
ATOM 8111  H H    . PHE A 1 86  ? 12.415  -1.427  -0.581  1.00 0.00 ? 86  PHE A H    3  
ATOM 8112  H HA   . PHE A 1 86  ? 14.731  -2.015  -2.314  1.00 0.00 ? 86  PHE A HA   3  
ATOM 8113  H HB2  . PHE A 1 86  ? 15.010  -1.160  0.545   1.00 0.00 ? 86  PHE A HB2  3  
ATOM 8114  H HB3  . PHE A 1 86  ? 16.084  -0.864  -0.813  1.00 0.00 ? 86  PHE A HB3  3  
ATOM 8115  H HD1  . PHE A 1 86  ? 12.796  0.094   0.609   1.00 0.00 ? 86  PHE A HD1  3  
ATOM 8116  H HD2  . PHE A 1 86  ? 16.015  1.157   -1.966  1.00 0.00 ? 86  PHE A HD2  3  
ATOM 8117  H HE1  . PHE A 1 86  ? 11.826  2.337   0.330   1.00 0.00 ? 86  PHE A HE1  3  
ATOM 8118  H HE2  . PHE A 1 86  ? 15.050  3.405   -2.246  1.00 0.00 ? 86  PHE A HE2  3  
ATOM 8119  H HZ   . PHE A 1 86  ? 12.950  3.996   -1.100  1.00 0.00 ? 86  PHE A HZ   3  
ATOM 8120  N N    . SER A 1 87  ? 15.280  -4.206  -1.253  1.00 0.00 ? 87  SER A N    3  
ATOM 8121  C CA   . SER A 1 87  ? 15.466  -5.537  -0.707  1.00 0.00 ? 87  SER A CA   3  
ATOM 8122  C C    . SER A 1 87  ? 16.430  -5.479  0.471   1.00 0.00 ? 87  SER A C    3  
ATOM 8123  O O    . SER A 1 87  ? 17.646  -5.414  0.288   1.00 0.00 ? 87  SER A O    3  
ATOM 8124  C CB   . SER A 1 87  ? 16.001  -6.488  -1.779  1.00 0.00 ? 87  SER A CB   3  
ATOM 8125  O OG   . SER A 1 87  ? 15.499  -7.800  -1.592  1.00 0.00 ? 87  SER A OG   3  
ATOM 8126  H H    . SER A 1 87  ? 15.764  -3.945  -2.067  1.00 0.00 ? 87  SER A H    3  
ATOM 8127  H HA   . SER A 1 87  ? 14.499  -5.888  -0.370  1.00 0.00 ? 87  SER A HA   3  
ATOM 8128  H HB2  . SER A 1 87  ? 15.697  -6.136  -2.753  1.00 0.00 ? 87  SER A HB2  3  
ATOM 8129  H HB3  . SER A 1 87  ? 17.079  -6.516  -1.727  1.00 0.00 ? 87  SER A HB3  3  
ATOM 8130  H HG   . SER A 1 87  ? 14.809  -7.974  -2.237  1.00 0.00 ? 87  SER A HG   3  
ATOM 8131  N N    . GLY A 1 88  ? 15.881  -5.481  1.681   1.00 0.00 ? 88  GLY A N    3  
ATOM 8132  C CA   . GLY A 1 88  ? 16.712  -5.404  2.867   1.00 0.00 ? 88  GLY A CA   3  
ATOM 8133  C C    . GLY A 1 88  ? 17.229  -3.996  3.097   1.00 0.00 ? 88  GLY A C    3  
ATOM 8134  O O    . GLY A 1 88  ? 16.551  -3.171  3.707   1.00 0.00 ? 88  GLY A O    3  
ATOM 8135  H H    . GLY A 1 88  ? 14.906  -5.518  1.768   1.00 0.00 ? 88  GLY A H    3  
ATOM 8136  H HA2  . GLY A 1 88  ? 16.130  -5.710  3.724   1.00 0.00 ? 88  GLY A HA2  3  
ATOM 8137  H HA3  . GLY A 1 88  ? 17.552  -6.072  2.754   1.00 0.00 ? 88  GLY A HA3  3  
ATOM 8138  N N    . ASN A 1 89  ? 18.429  -3.719  2.598   1.00 0.00 ? 89  ASN A N    3  
ATOM 8139  C CA   . ASN A 1 89  ? 19.032  -2.396  2.739   1.00 0.00 ? 89  ASN A CA   3  
ATOM 8140  C C    . ASN A 1 89  ? 19.326  -1.771  1.371   1.00 0.00 ? 89  ASN A C    3  
ATOM 8141  O O    . ASN A 1 89  ? 19.764  -0.623  1.285   1.00 0.00 ? 89  ASN A O    3  
ATOM 8142  C CB   . ASN A 1 89  ? 20.321  -2.488  3.556   1.00 0.00 ? 89  ASN A CB   3  
ATOM 8143  C CG   . ASN A 1 89  ? 20.055  -2.709  5.032   1.00 0.00 ? 89  ASN A CG   3  
ATOM 8144  O OD1  . ASN A 1 89  ? 19.786  -1.765  5.774   1.00 0.00 ? 89  ASN A OD1  3  
ATOM 8145  N ND2  . ASN A 1 89  ? 20.127  -3.963  5.466   1.00 0.00 ? 89  ASN A ND2  3  
ATOM 8146  H H    . ASN A 1 89  ? 18.918  -4.417  2.115   1.00 0.00 ? 89  ASN A H    3  
ATOM 8147  H HA   . ASN A 1 89  ? 18.329  -1.766  3.264   1.00 0.00 ? 89  ASN A HA   3  
ATOM 8148  H HB2  . ASN A 1 89  ? 20.915  -3.312  3.189   1.00 0.00 ? 89  ASN A HB2  3  
ATOM 8149  H HB3  . ASN A 1 89  ? 20.879  -1.570  3.443   1.00 0.00 ? 89  ASN A HB3  3  
ATOM 8150  H HD21 . ASN A 1 89  ? 20.345  -4.665  4.818   1.00 0.00 ? 89  ASN A HD21 3  
ATOM 8151  H HD22 . ASN A 1 89  ? 19.959  -4.134  6.416   1.00 0.00 ? 89  ASN A HD22 3  
ATOM 8152  N N    . THR A 1 90  ? 19.099  -2.540  0.308   1.00 0.00 ? 90  THR A N    3  
ATOM 8153  C CA   . THR A 1 90  ? 19.353  -2.081  -1.055  1.00 0.00 ? 90  THR A CA   3  
ATOM 8154  C C    . THR A 1 90  ? 18.061  -1.870  -1.828  1.00 0.00 ? 90  THR A C    3  
ATOM 8155  O O    . THR A 1 90  ? 17.082  -2.574  -1.611  1.00 0.00 ? 90  THR A O    3  
ATOM 8156  C CB   . THR A 1 90  ? 20.192  -3.120  -1.801  1.00 0.00 ? 90  THR A CB   3  
ATOM 8157  O OG1  . THR A 1 90  ? 21.567  -2.979  -1.493  1.00 0.00 ? 90  THR A OG1  3  
ATOM 8158  C CG2  . THR A 1 90  ? 20.042  -3.045  -3.309  1.00 0.00 ? 90  THR A CG2  3  
ATOM 8159  H H    . THR A 1 90  ? 18.762  -3.449  0.443   1.00 0.00 ? 90  THR A H    3  
ATOM 8160  H HA   . THR A 1 90  ? 19.899  -1.152  -1.007  1.00 0.00 ? 90  THR A HA   3  
ATOM 8161  H HB   . THR A 1 90  ? 19.869  -4.105  -1.491  1.00 0.00 ? 90  THR A HB   3  
ATOM 8162  H HG1  . THR A 1 90  ? 21.810  -2.051  -1.531  1.00 0.00 ? 90  THR A HG1  3  
ATOM 8163  H HG21 . THR A 1 90  ? 20.646  -3.812  -3.770  1.00 0.00 ? 90  THR A HG21 3  
ATOM 8164  H HG22 . THR A 1 90  ? 20.365  -2.075  -3.656  1.00 0.00 ? 90  THR A HG22 3  
ATOM 8165  H HG23 . THR A 1 90  ? 19.001  -3.195  -3.575  1.00 0.00 ? 90  THR A HG23 3  
ATOM 8166  N N    . THR A 1 91  ? 18.084  -0.942  -2.780  1.00 0.00 ? 91  THR A N    3  
ATOM 8167  C CA   . THR A 1 91  ? 16.921  -0.714  -3.622  1.00 0.00 ? 91  THR A CA   3  
ATOM 8168  C C    . THR A 1 91  ? 16.880  -1.783  -4.692  1.00 0.00 ? 91  THR A C    3  
ATOM 8169  O O    . THR A 1 91  ? 17.850  -2.010  -5.415  1.00 0.00 ? 91  THR A O    3  
ATOM 8170  C CB   . THR A 1 91  ? 16.943  0.663   -4.274  1.00 0.00 ? 91  THR A CB   3  
ATOM 8171  O OG1  . THR A 1 91  ? 17.835  1.538   -3.604  1.00 0.00 ? 91  THR A OG1  3  
ATOM 8172  C CG2  . THR A 1 91  ? 15.585  1.330   -4.327  1.00 0.00 ? 91  THR A CG2  3  
ATOM 8173  H H    . THR A 1 91  ? 18.908  -0.439  -2.947  1.00 0.00 ? 91  THR A H    3  
ATOM 8174  H HA   . THR A 1 91  ? 16.033  -0.818  -3.011  1.00 0.00 ? 91  THR A HA   3  
ATOM 8175  H HB   . THR A 1 91  ? 17.279  0.543   -5.285  1.00 0.00 ? 91  THR A HB   3  
ATOM 8176  H HG1  . THR A 1 91  ? 17.806  1.368   -2.659  1.00 0.00 ? 91  THR A HG1  3  
ATOM 8177  H HG21 . THR A 1 91  ? 14.853  0.697   -3.848  1.00 0.00 ? 91  THR A HG21 3  
ATOM 8178  H HG22 . THR A 1 91  ? 15.303  1.490   -5.358  1.00 0.00 ? 91  THR A HG22 3  
ATOM 8179  H HG23 . THR A 1 91  ? 15.630  2.280   -3.816  1.00 0.00 ? 91  THR A HG23 3  
ATOM 8180  N N    . LEU A 1 92  ? 15.760  -2.453  -4.746  1.00 0.00 ? 92  LEU A N    3  
ATOM 8181  C CA   . LEU A 1 92  ? 15.551  -3.541  -5.676  1.00 0.00 ? 92  LEU A CA   3  
ATOM 8182  C C    . LEU A 1 92  ? 14.545  -3.156  -6.753  1.00 0.00 ? 92  LEU A C    3  
ATOM 8183  O O    . LEU A 1 92  ? 14.503  -3.770  -7.819  1.00 0.00 ? 92  LEU A O    3  
ATOM 8184  C CB   . LEU A 1 92  ? 15.087  -4.760  -4.879  1.00 0.00 ? 92  LEU A CB   3  
ATOM 8185  C CG   . LEU A 1 92  ? 14.247  -5.796  -5.637  1.00 0.00 ? 92  LEU A CG   3  
ATOM 8186  C CD1  . LEU A 1 92  ? 15.142  -6.684  -6.487  1.00 0.00 ? 92  LEU A CD1  3  
ATOM 8187  C CD2  . LEU A 1 92  ? 13.430  -6.634  -4.663  1.00 0.00 ? 92  LEU A CD2  3  
ATOM 8188  H H    . LEU A 1 92  ? 15.056  -2.222  -4.114  1.00 0.00 ? 92  LEU A H    3  
ATOM 8189  H HA   . LEU A 1 92  ? 16.496  -3.767  -6.144  1.00 0.00 ? 92  LEU A HA   3  
ATOM 8190  H HB2  . LEU A 1 92  ? 15.966  -5.259  -4.497  1.00 0.00 ? 92  LEU A HB2  3  
ATOM 8191  H HB3  . LEU A 1 92  ? 14.511  -4.395  -4.038  1.00 0.00 ? 92  LEU A HB3  3  
ATOM 8192  H HG   . LEU A 1 92  ? 13.562  -5.288  -6.299  1.00 0.00 ? 92  LEU A HG   3  
ATOM 8193  H HD11 . LEU A 1 92  ? 16.059  -6.160  -6.713  1.00 0.00 ? 92  LEU A HD11 3  
ATOM 8194  H HD12 . LEU A 1 92  ? 14.633  -6.932  -7.406  1.00 0.00 ? 92  LEU A HD12 3  
ATOM 8195  H HD13 . LEU A 1 92  ? 15.369  -7.590  -5.945  1.00 0.00 ? 92  LEU A HD13 3  
ATOM 8196  H HD21 . LEU A 1 92  ? 12.400  -6.662  -4.988  1.00 0.00 ? 92  LEU A HD21 3  
ATOM 8197  H HD22 . LEU A 1 92  ? 13.483  -6.195  -3.677  1.00 0.00 ? 92  LEU A HD22 3  
ATOM 8198  H HD23 . LEU A 1 92  ? 13.824  -7.639  -4.630  1.00 0.00 ? 92  LEU A HD23 3  
ATOM 8199  N N    . PHE A 1 93  ? 13.741  -2.135  -6.478  1.00 0.00 ? 93  PHE A N    3  
ATOM 8200  C CA   . PHE A 1 93  ? 12.753  -1.686  -7.442  1.00 0.00 ? 93  PHE A CA   3  
ATOM 8201  C C    . PHE A 1 93  ? 12.150  -0.340  -7.049  1.00 0.00 ? 93  PHE A C    3  
ATOM 8202  O O    . PHE A 1 93  ? 12.375  0.167   -5.950  1.00 0.00 ? 93  PHE A O    3  
ATOM 8203  C CB   . PHE A 1 93  ? 11.656  -2.736  -7.607  1.00 0.00 ? 93  PHE A CB   3  
ATOM 8204  C CG   . PHE A 1 93  ? 10.922  -3.053  -6.338  1.00 0.00 ? 93  PHE A CG   3  
ATOM 8205  C CD1  . PHE A 1 93  ? 11.557  -3.705  -5.291  1.00 0.00 ? 93  PHE A CD1  3  
ATOM 8206  C CD2  . PHE A 1 93  ? 9.591   -2.707  -6.200  1.00 0.00 ? 93  PHE A CD2  3  
ATOM 8207  C CE1  . PHE A 1 93  ? 10.873  -4.008  -4.127  1.00 0.00 ? 93  PHE A CE1  3  
ATOM 8208  C CE2  . PHE A 1 93  ? 8.902   -3.002  -5.045  1.00 0.00 ? 93  PHE A CE2  3  
ATOM 8209  C CZ   . PHE A 1 93  ? 9.538   -3.654  -4.007  1.00 0.00 ? 93  PHE A CZ   3  
ATOM 8210  H H    . PHE A 1 93  ? 13.817  -1.673  -5.618  1.00 0.00 ? 93  PHE A H    3  
ATOM 8211  H HA   . PHE A 1 93  ? 13.258  -1.567  -8.389  1.00 0.00 ? 93  PHE A HA   3  
ATOM 8212  H HB2  . PHE A 1 93  ? 10.934  -2.381  -8.326  1.00 0.00 ? 93  PHE A HB2  3  
ATOM 8213  H HB3  . PHE A 1 93  ? 12.099  -3.651  -7.972  1.00 0.00 ? 93  PHE A HB3  3  
ATOM 8214  H HD1  . PHE A 1 93  ? 12.596  -3.976  -5.388  1.00 0.00 ? 93  PHE A HD1  3  
ATOM 8215  H HD2  . PHE A 1 93  ? 9.091   -2.197  -7.009  1.00 0.00 ? 93  PHE A HD2  3  
ATOM 8216  H HE1  . PHE A 1 93  ? 11.382  -4.518  -3.311  1.00 0.00 ? 93  PHE A HE1  3  
ATOM 8217  H HE2  . PHE A 1 93  ? 7.865   -2.721  -4.953  1.00 0.00 ? 93  PHE A HE2  3  
ATOM 8218  H HZ   . PHE A 1 93  ? 8.994   -3.884  -3.105  1.00 0.00 ? 93  PHE A HZ   3  
ATOM 8219  N N    . SER A 1 94  ? 11.401  0.232   -7.981  1.00 0.00 ? 94  SER A N    3  
ATOM 8220  C CA   . SER A 1 94  ? 10.760  1.532   -7.806  1.00 0.00 ? 94  SER A CA   3  
ATOM 8221  C C    . SER A 1 94  ? 9.835   1.774   -8.994  1.00 0.00 ? 94  SER A C    3  
ATOM 8222  O O    . SER A 1 94  ? 10.161  2.559   -9.885  1.00 0.00 ? 94  SER A O    3  
ATOM 8223  C CB   . SER A 1 94  ? 11.828  2.632   -7.752  1.00 0.00 ? 94  SER A CB   3  
ATOM 8224  O OG   . SER A 1 94  ? 13.124  2.102   -7.977  1.00 0.00 ? 94  SER A OG   3  
ATOM 8225  H H    . SER A 1 94  ? 11.287  -0.229  -8.838  1.00 0.00 ? 94  SER A H    3  
ATOM 8226  H HA   . SER A 1 94  ? 10.189  1.535   -6.880  1.00 0.00 ? 94  SER A HA   3  
ATOM 8227  H HB2  . SER A 1 94  ? 11.622  3.373   -8.510  1.00 0.00 ? 94  SER A HB2  3  
ATOM 8228  H HB3  . SER A 1 94  ? 11.810  3.101   -6.784  1.00 0.00 ? 94  SER A HB3  3  
ATOM 8229  H HG   . SER A 1 94  ? 13.326  2.138   -8.915  1.00 0.00 ? 94  SER A HG   3  
ATOM 8230  N N    . CYS A 1 95  ? 8.695   1.083   -9.040  1.00 0.00 ? 95  CYS A N    3  
ATOM 8231  C CA   . CYS A 1 95  ? 7.779   1.237   -10.166 1.00 0.00 ? 95  CYS A CA   3  
ATOM 8232  C C    . CYS A 1 95  ? 6.576   2.086   -9.803  1.00 0.00 ? 95  CYS A C    3  
ATOM 8233  O O    . CYS A 1 95  ? 6.276   2.297   -8.629  1.00 0.00 ? 95  CYS A O    3  
ATOM 8234  C CB   . CYS A 1 95  ? 7.305   -0.130  -10.687 1.00 0.00 ? 95  CYS A CB   3  
ATOM 8235  S SG   . CYS A 1 95  ? 8.430   -1.526  -10.342 1.00 0.00 ? 95  CYS A SG   3  
ATOM 8236  H H    . CYS A 1 95  ? 8.456   0.449   -8.329  1.00 0.00 ? 95  CYS A H    3  
ATOM 8237  H HA   . CYS A 1 95  ? 8.313   1.738   -10.949 1.00 0.00 ? 95  CYS A HA   3  
ATOM 8238  H HB2  . CYS A 1 95  ? 6.353   -0.364  -10.239 1.00 0.00 ? 95  CYS A HB2  3  
ATOM 8239  H HB3  . CYS A 1 95  ? 7.181   -0.069  -11.759 1.00 0.00 ? 95  CYS A HB3  3  
ATOM 8240  N N    . SER A 1 96  ? 5.891   2.572   -10.832 1.00 0.00 ? 96  SER A N    3  
ATOM 8241  C CA   . SER A 1 96  ? 4.716   3.402   -10.640 1.00 0.00 ? 96  SER A CA   3  
ATOM 8242  C C    . SER A 1 96  ? 3.559   2.908   -11.498 1.00 0.00 ? 96  SER A C    3  
ATOM 8243  O O    . SER A 1 96  ? 3.722   2.007   -12.324 1.00 0.00 ? 96  SER A O    3  
ATOM 8244  C CB   . SER A 1 96  ? 5.033   4.859   -10.982 1.00 0.00 ? 96  SER A CB   3  
ATOM 8245  O OG   . SER A 1 96  ? 6.430   5.062   -11.112 1.00 0.00 ? 96  SER A OG   3  
ATOM 8246  H H    . SER A 1 96  ? 6.180   2.369   -11.746 1.00 0.00 ? 96  SER A H    3  
ATOM 8247  H HA   . SER A 1 96  ? 4.434   3.335   -9.603  1.00 0.00 ? 96  SER A HA   3  
ATOM 8248  H HB2  . SER A 1 96  ? 4.557   5.121   -11.916 1.00 0.00 ? 96  SER A HB2  3  
ATOM 8249  H HB3  . SER A 1 96  ? 4.659   5.499   -10.198 1.00 0.00 ? 96  SER A HB3  3  
ATOM 8250  H HG   . SER A 1 96  ? 6.714   4.788   -11.987 1.00 0.00 ? 96  SER A HG   3  
ATOM 8251  N N    . HIS A 1 97  ? 2.389   3.506   -11.296 1.00 0.00 ? 97  HIS A N    3  
ATOM 8252  C CA   . HIS A 1 97  ? 1.202   3.131   -12.049 1.00 0.00 ? 97  HIS A CA   3  
ATOM 8253  C C    . HIS A 1 97  ? 0.111   4.182   -11.892 1.00 0.00 ? 97  HIS A C    3  
ATOM 8254  O O    . HIS A 1 97  ? -0.130  4.681   -10.793 1.00 0.00 ? 97  HIS A O    3  
ATOM 8255  C CB   . HIS A 1 97  ? 0.688   1.768   -11.580 1.00 0.00 ? 97  HIS A CB   3  
ATOM 8256  C CG   . HIS A 1 97  ? -0.548  1.311   -12.294 1.00 0.00 ? 97  HIS A CG   3  
ATOM 8257  N ND1  . HIS A 1 97  ? -0.642  1.244   -13.667 1.00 0.00 ? 97  HIS A ND1  3  
ATOM 8258  C CD2  . HIS A 1 97  ? -1.746  0.897   -11.815 1.00 0.00 ? 97  HIS A CD2  3  
ATOM 8259  C CE1  . HIS A 1 97  ? -1.844  0.809   -14.004 1.00 0.00 ? 97  HIS A CE1  3  
ATOM 8260  N NE2  . HIS A 1 97  ? -2.532  0.591   -12.898 1.00 0.00 ? 97  HIS A NE2  3  
ATOM 8261  H H    . HIS A 1 97  ? 2.324   4.218   -10.623 1.00 0.00 ? 97  HIS A H    3  
ATOM 8262  H HA   . HIS A 1 97  ? 1.476   3.065   -13.091 1.00 0.00 ? 97  HIS A HA   3  
ATOM 8263  H HB2  . HIS A 1 97  ? 1.456   1.027   -11.743 1.00 0.00 ? 97  HIS A HB2  3  
ATOM 8264  H HB3  . HIS A 1 97  ? 0.463   1.820   -10.525 1.00 0.00 ? 97  HIS A HB3  3  
ATOM 8265  H HD1  . HIS A 1 97  ? 0.066   1.480   -14.302 1.00 0.00 ? 97  HIS A HD1  3  
ATOM 8266  H HD2  . HIS A 1 97  ? -2.029  0.821   -10.775 1.00 0.00 ? 97  HIS A HD2  3  
ATOM 8267  H HE1  . HIS A 1 97  ? -2.201  0.657   -15.011 1.00 0.00 ? 97  HIS A HE1  3  
ATOM 8268  H HE2  . HIS A 1 97  ? -3.480  0.346   -12.863 1.00 0.00 ? 97  HIS A HE2  3  
ATOM 8269  N N    . ASN A 1 98  ? -0.548  4.512   -12.995 1.00 0.00 ? 98  ASN A N    3  
ATOM 8270  C CA   . ASN A 1 98  ? -1.617  5.500   -12.974 1.00 0.00 ? 98  ASN A CA   3  
ATOM 8271  C C    . ASN A 1 98  ? -2.920  4.864   -12.516 1.00 0.00 ? 98  ASN A C    3  
ATOM 8272  O O    . ASN A 1 98  ? -3.656  4.289   -13.318 1.00 0.00 ? 98  ASN A O    3  
ATOM 8273  C CB   . ASN A 1 98  ? -1.798  6.125   -14.357 1.00 0.00 ? 98  ASN A CB   3  
ATOM 8274  C CG   . ASN A 1 98  ? -1.882  5.086   -15.458 1.00 0.00 ? 98  ASN A CG   3  
ATOM 8275  O OD1  . ASN A 1 98  ? -2.948  4.533   -15.726 1.00 0.00 ? 98  ASN A OD1  3  
ATOM 8276  N ND2  . ASN A 1 98  ? -0.753  4.814   -16.102 1.00 0.00 ? 98  ASN A ND2  3  
ATOM 8277  H H    . ASN A 1 98  ? -0.312  4.078   -13.842 1.00 0.00 ? 98  ASN A H    3  
ATOM 8278  H HA   . ASN A 1 98  ? -1.342  6.272   -12.273 1.00 0.00 ? 98  ASN A HA   3  
ATOM 8279  H HB2  . ASN A 1 98  ? -2.708  6.705   -14.367 1.00 0.00 ? 98  ASN A HB2  3  
ATOM 8280  H HB3  . ASN A 1 98  ? -0.961  6.774   -14.562 1.00 0.00 ? 98  ASN A HB3  3  
ATOM 8281  H HD21 . ASN A 1 98  ? 0.060   5.292   -15.834 1.00 0.00 ? 98  ASN A HD21 3  
ATOM 8282  H HD22 . ASN A 1 98  ? -0.778  4.146   -16.818 1.00 0.00 ? 98  ASN A HD22 3  
ATOM 8283  N N    . PHE A 1 99  ? -3.201  4.966   -11.222 1.00 0.00 ? 99  PHE A N    3  
ATOM 8284  C CA   . PHE A 1 99  ? -4.423  4.390   -10.671 1.00 0.00 ? 99  PHE A CA   3  
ATOM 8285  C C    . PHE A 1 99  ? -5.642  5.162   -11.142 1.00 0.00 ? 99  PHE A C    3  
ATOM 8286  O O    . PHE A 1 99  ? -5.833  6.320   -10.771 1.00 0.00 ? 99  PHE A O    3  
ATOM 8287  C CB   . PHE A 1 99  ? -4.414  4.419   -9.146  1.00 0.00 ? 99  PHE A CB   3  
ATOM 8288  C CG   . PHE A 1 99  ? -3.520  3.408   -8.493  1.00 0.00 ? 99  PHE A CG   3  
ATOM 8289  C CD1  . PHE A 1 99  ? -2.207  3.242   -8.898  1.00 0.00 ? 99  PHE A CD1  3  
ATOM 8290  C CD2  . PHE A 1 99  ? -3.992  2.649   -7.437  1.00 0.00 ? 99  PHE A CD2  3  
ATOM 8291  C CE1  . PHE A 1 99  ? -1.383  2.337   -8.255  1.00 0.00 ? 99  PHE A CE1  3  
ATOM 8292  C CE2  . PHE A 1 99  ? -3.177  1.742   -6.798  1.00 0.00 ? 99  PHE A CE2  3  
ATOM 8293  C CZ   . PHE A 1 99  ? -1.873  1.589   -7.202  1.00 0.00 ? 99  PHE A CZ   3  
ATOM 8294  H H    . PHE A 1 99  ? -2.575  5.436   -10.630 1.00 0.00 ? 99  PHE A H    3  
ATOM 8295  H HA   . PHE A 1 99  ? -4.497  3.368   -11.007 1.00 0.00 ? 99  PHE A HA   3  
ATOM 8296  H HB2  . PHE A 1 99  ? -4.097  5.394   -8.818  1.00 0.00 ? 99  PHE A HB2  3  
ATOM 8297  H HB3  . PHE A 1 99  ? -5.420  4.244   -8.792  1.00 0.00 ? 99  PHE A HB3  3  
ATOM 8298  H HD1  . PHE A 1 99  ? -1.827  3.828   -9.719  1.00 0.00 ? 99  PHE A HD1  3  
ATOM 8299  H HD2  . PHE A 1 99  ? -5.017  2.766   -7.121  1.00 0.00 ? 99  PHE A HD2  3  
ATOM 8300  H HE1  . PHE A 1 99  ? -0.359  2.213   -8.577  1.00 0.00 ? 99  PHE A HE1  3  
ATOM 8301  H HE2  . PHE A 1 99  ? -3.557  1.158   -5.974  1.00 0.00 ? 99  PHE A HE2  3  
ATOM 8302  H HZ   . PHE A 1 99  ? -1.237  0.891   -6.691  1.00 0.00 ? 99  PHE A HZ   3  
ATOM 8303  N N    . TRP A 1 100 ? -6.481  4.505   -11.926 1.00 0.00 ? 100 TRP A N    3  
ATOM 8304  C CA   . TRP A 1 100 ? -7.702  5.121   -12.414 1.00 0.00 ? 100 TRP A CA   3  
ATOM 8305  C C    . TRP A 1 100 ? -8.844  4.797   -11.465 1.00 0.00 ? 100 TRP A C    3  
ATOM 8306  O O    . TRP A 1 100 ? -9.609  3.877   -11.711 1.00 0.00 ? 100 TRP A O    3  
ATOM 8307  C CB   . TRP A 1 100 ? -8.029  4.622   -13.823 1.00 0.00 ? 100 TRP A CB   3  
ATOM 8308  C CG   . TRP A 1 100 ? -8.269  5.726   -14.808 1.00 0.00 ? 100 TRP A CG   3  
ATOM 8309  C CD1  . TRP A 1 100 ? -8.017  5.691   -16.149 1.00 0.00 ? 100 TRP A CD1  3  
ATOM 8310  C CD2  . TRP A 1 100 ? -8.810  7.025   -14.535 1.00 0.00 ? 100 TRP A CD2  3  
ATOM 8311  N NE1  . TRP A 1 100 ? -8.368  6.886   -16.727 1.00 0.00 ? 100 TRP A NE1  3  
ATOM 8312  C CE2  . TRP A 1 100 ? -8.856  7.722   -15.757 1.00 0.00 ? 100 TRP A CE2  3  
ATOM 8313  C CE3  . TRP A 1 100 ? -9.260  7.668   -13.377 1.00 0.00 ? 100 TRP A CE3  3  
ATOM 8314  C CZ2  . TRP A 1 100 ? -9.333  9.026   -15.855 1.00 0.00 ? 100 TRP A CZ2  3  
ATOM 8315  C CZ3  . TRP A 1 100 ? -9.733  8.963   -13.476 1.00 0.00 ? 100 TRP A CZ3  3  
ATOM 8316  C CH2  . TRP A 1 100 ? -9.767  9.630   -14.706 1.00 0.00 ? 100 TRP A CH2  3  
ATOM 8317  H H    . TRP A 1 100 ? -6.286  3.575   -12.164 1.00 0.00 ? 100 TRP A H    3  
ATOM 8318  H HA   . TRP A 1 100 ? -7.557  6.188   -12.440 1.00 0.00 ? 100 TRP A HA   3  
ATOM 8319  H HB2  . TRP A 1 100 ? -7.207  4.026   -14.186 1.00 0.00 ? 100 TRP A HB2  3  
ATOM 8320  H HB3  . TRP A 1 100 ? -8.917  4.012   -13.785 1.00 0.00 ? 100 TRP A HB3  3  
ATOM 8321  H HD1  . TRP A 1 100 ? -7.601  4.839   -16.667 1.00 0.00 ? 100 TRP A HD1  3  
ATOM 8322  H HE1  . TRP A 1 100 ? -8.282  7.104   -17.677 1.00 0.00 ? 100 TRP A HE1  3  
ATOM 8323  H HE3  . TRP A 1 100 ? -9.243  7.171   -12.419 1.00 0.00 ? 100 TRP A HE3  3  
ATOM 8324  H HZ2  . TRP A 1 100 ? -9.366  9.554   -16.796 1.00 0.00 ? 100 TRP A HZ2  3  
ATOM 8325  H HZ3  . TRP A 1 100 ? -10.084 9.476   -12.592 1.00 0.00 ? 100 TRP A HZ3  3  
ATOM 8326  H HH2  . TRP A 1 100 ? -10.144 10.642  -14.736 1.00 0.00 ? 100 TRP A HH2  3  
ATOM 8327  N N    . LEU A 1 101 ? -8.951  5.547   -10.373 1.00 0.00 ? 101 LEU A N    3  
ATOM 8328  C CA   . LEU A 1 101 ? -10.010 5.312   -9.398  1.00 0.00 ? 101 LEU A CA   3  
ATOM 8329  C C    . LEU A 1 101 ? -11.366 5.595   -10.017 1.00 0.00 ? 101 LEU A C    3  
ATOM 8330  O O    . LEU A 1 101 ? -12.206 4.703   -10.139 1.00 0.00 ? 101 LEU A O    3  
ATOM 8331  C CB   . LEU A 1 101 ? -9.811  6.192   -8.165  1.00 0.00 ? 101 LEU A CB   3  
ATOM 8332  C CG   . LEU A 1 101 ? -8.457  6.037   -7.476  1.00 0.00 ? 101 LEU A CG   3  
ATOM 8333  C CD1  . LEU A 1 101 ? -7.743  7.378   -7.383  1.00 0.00 ? 101 LEU A CD1  3  
ATOM 8334  C CD2  . LEU A 1 101 ? -8.633  5.426   -6.096  1.00 0.00 ? 101 LEU A CD2  3  
ATOM 8335  H H    . LEU A 1 101 ? -8.310  6.273   -10.220 1.00 0.00 ? 101 LEU A H    3  
ATOM 8336  H HA   . LEU A 1 101 ? -9.968  4.274   -9.104  1.00 0.00 ? 101 LEU A HA   3  
ATOM 8337  H HB2  . LEU A 1 101 ? -9.929  7.224   -8.462  1.00 0.00 ? 101 LEU A HB2  3  
ATOM 8338  H HB3  . LEU A 1 101 ? -10.583 5.951   -7.448  1.00 0.00 ? 101 LEU A HB3  3  
ATOM 8339  H HG   . LEU A 1 101 ? -7.841  5.371   -8.062  1.00 0.00 ? 101 LEU A HG   3  
ATOM 8340  H HD11 . LEU A 1 101 ? -8.447  8.175   -7.569  1.00 0.00 ? 101 LEU A HD11 3  
ATOM 8341  H HD12 . LEU A 1 101 ? -6.956  7.415   -8.119  1.00 0.00 ? 101 LEU A HD12 3  
ATOM 8342  H HD13 . LEU A 1 101 ? -7.320  7.494   -6.397  1.00 0.00 ? 101 LEU A HD13 3  
ATOM 8343  H HD21 . LEU A 1 101 ? -8.648  6.213   -5.354  1.00 0.00 ? 101 LEU A HD21 3  
ATOM 8344  H HD22 . LEU A 1 101 ? -7.811  4.756   -5.893  1.00 0.00 ? 101 LEU A HD22 3  
ATOM 8345  H HD23 . LEU A 1 101 ? -9.562  4.878   -6.061  1.00 0.00 ? 101 LEU A HD23 3  
ATOM 8346  N N    . ALA A 1 102 ? -11.567 6.847   -10.412 1.00 0.00 ? 102 ALA A N    3  
ATOM 8347  C CA   . ALA A 1 102 ? -12.816 7.274   -11.029 1.00 0.00 ? 102 ALA A CA   3  
ATOM 8348  C C    . ALA A 1 102 ? -13.321 6.247   -12.042 1.00 0.00 ? 102 ALA A C    3  
ATOM 8349  O O    . ALA A 1 102 ? -14.524 6.135   -12.278 1.00 0.00 ? 102 ALA A O    3  
ATOM 8350  C CB   . ALA A 1 102 ? -12.620 8.631   -11.699 1.00 0.00 ? 102 ALA A CB   3  
ATOM 8351  H H    . ALA A 1 102 ? -10.855 7.508   -10.283 1.00 0.00 ? 102 ALA A H    3  
ATOM 8352  H HA   . ALA A 1 102 ? -13.552 7.389   -10.248 1.00 0.00 ? 102 ALA A HA   3  
ATOM 8353  H HB1  . ALA A 1 102 ? -11.630 9.009   -11.472 1.00 0.00 ? 102 ALA A HB1  3  
ATOM 8354  H HB2  . ALA A 1 102 ? -13.361 9.324   -11.332 1.00 0.00 ? 102 ALA A HB2  3  
ATOM 8355  H HB3  . ALA A 1 102 ? -12.726 8.524   -12.769 1.00 0.00 ? 102 ALA A HB3  3  
ATOM 8356  N N    . ILE A 1 103 ? -12.392 5.520   -12.659 1.00 0.00 ? 103 ILE A N    3  
ATOM 8357  C CA   . ILE A 1 103 ? -12.741 4.528   -13.669 1.00 0.00 ? 103 ILE A CA   3  
ATOM 8358  C C    . ILE A 1 103 ? -12.604 3.085   -13.163 1.00 0.00 ? 103 ILE A C    3  
ATOM 8359  O O    . ILE A 1 103 ? -13.189 2.170   -13.743 1.00 0.00 ? 103 ILE A O    3  
ATOM 8360  C CB   . ILE A 1 103 ? -11.858 4.717   -14.928 1.00 0.00 ? 103 ILE A CB   3  
ATOM 8361  C CG1  . ILE A 1 103 ? -12.333 5.931   -15.730 1.00 0.00 ? 103 ILE A CG1  3  
ATOM 8362  C CG2  . ILE A 1 103 ? -11.872 3.469   -15.805 1.00 0.00 ? 103 ILE A CG2  3  
ATOM 8363  C CD1  . ILE A 1 103 ? -12.113 7.251   -15.024 1.00 0.00 ? 103 ILE A CD1  3  
ATOM 8364  H H    . ILE A 1 103 ? -11.446 5.674   -12.455 1.00 0.00 ? 103 ILE A H    3  
ATOM 8365  H HA   . ILE A 1 103 ? -13.768 4.698   -13.956 1.00 0.00 ? 103 ILE A HA   3  
ATOM 8366  H HB   . ILE A 1 103 ? -10.837 4.889   -14.603 1.00 0.00 ? 103 ILE A HB   3  
ATOM 8367  H HG12 . ILE A 1 103 ? -11.799 5.966   -16.668 1.00 0.00 ? 103 ILE A HG12 3  
ATOM 8368  H HG13 . ILE A 1 103 ? -13.391 5.832   -15.928 1.00 0.00 ? 103 ILE A HG13 3  
ATOM 8369  H HG21 . ILE A 1 103 ? -11.607 3.737   -16.817 1.00 0.00 ? 103 ILE A HG21 3  
ATOM 8370  H HG22 . ILE A 1 103 ? -12.860 3.033   -15.795 1.00 0.00 ? 103 ILE A HG22 3  
ATOM 8371  H HG23 . ILE A 1 103 ? -11.159 2.753   -15.424 1.00 0.00 ? 103 ILE A HG23 3  
ATOM 8372  H HD11 . ILE A 1 103 ? -11.580 7.925   -15.678 1.00 0.00 ? 103 ILE A HD11 3  
ATOM 8373  H HD12 . ILE A 1 103 ? -11.535 7.087   -14.127 1.00 0.00 ? 103 ILE A HD12 3  
ATOM 8374  H HD13 . ILE A 1 103 ? -13.068 7.683   -14.763 1.00 0.00 ? 103 ILE A HD13 3  
ATOM 8375  N N    . ASP A 1 104 ? -11.809 2.868   -12.117 1.00 0.00 ? 104 ASP A N    3  
ATOM 8376  C CA   . ASP A 1 104 ? -11.596 1.511   -11.606 1.00 0.00 ? 104 ASP A CA   3  
ATOM 8377  C C    . ASP A 1 104 ? -12.410 1.206   -10.351 1.00 0.00 ? 104 ASP A C    3  
ATOM 8378  O O    . ASP A 1 104 ? -13.112 0.197   -10.304 1.00 0.00 ? 104 ASP A O    3  
ATOM 8379  C CB   . ASP A 1 104 ? -10.112 1.296   -11.304 1.00 0.00 ? 104 ASP A CB   3  
ATOM 8380  C CG   . ASP A 1 104 ? -9.766  -0.168  -11.115 1.00 0.00 ? 104 ASP A CG   3  
ATOM 8381  O OD1  . ASP A 1 104 ? -10.016 -0.962  -12.046 1.00 0.00 ? 104 ASP A OD1  3  
ATOM 8382  O OD2  . ASP A 1 104 ? -9.244  -0.520  -10.036 1.00 0.00 ? 104 ASP A OD2  3  
ATOM 8383  H H    . ASP A 1 104 ? -11.336 3.619   -11.706 1.00 0.00 ? 104 ASP A H    3  
ATOM 8384  H HA   . ASP A 1 104 ? -11.890 0.821   -12.382 1.00 0.00 ? 104 ASP A HA   3  
ATOM 8385  H HB2  . ASP A 1 104 ? -9.524  1.683   -12.123 1.00 0.00 ? 104 ASP A HB2  3  
ATOM 8386  H HB3  . ASP A 1 104 ? -9.855  1.829   -10.398 1.00 0.00 ? 104 ASP A HB3  3  
ATOM 8387  N N    . MET A 1 105 ? -12.312 2.072   -9.338  1.00 0.00 ? 105 MET A N    3  
ATOM 8388  C CA   . MET A 1 105 ? -13.040 1.882   -8.074  1.00 0.00 ? 105 MET A CA   3  
ATOM 8389  C C    . MET A 1 105 ? -13.295 0.396   -7.785  1.00 0.00 ? 105 MET A C    3  
ATOM 8390  O O    . MET A 1 105 ? -14.317 -0.153  -8.196  1.00 0.00 ? 105 MET A O    3  
ATOM 8391  C CB   . MET A 1 105 ? -14.369 2.646   -8.116  1.00 0.00 ? 105 MET A CB   3  
ATOM 8392  C CG   . MET A 1 105 ? -14.410 3.870   -7.210  1.00 0.00 ? 105 MET A CG   3  
ATOM 8393  S SD   . MET A 1 105 ? -12.931 4.895   -7.334  1.00 0.00 ? 105 MET A SD   3  
ATOM 8394  C CE   . MET A 1 105 ? -12.633 5.288   -5.611  1.00 0.00 ? 105 MET A CE   3  
ATOM 8395  H H    . MET A 1 105 ? -11.732 2.856   -9.438  1.00 0.00 ? 105 MET A H    3  
ATOM 8396  H HA   . MET A 1 105 ? -12.430 2.287   -7.280  1.00 0.00 ? 105 MET A HA   3  
ATOM 8397  H HB2  . MET A 1 105 ? -14.549 2.971   -9.130  1.00 0.00 ? 105 MET A HB2  3  
ATOM 8398  H HB3  . MET A 1 105 ? -15.164 1.978   -7.817  1.00 0.00 ? 105 MET A HB3  3  
ATOM 8399  H HG2  . MET A 1 105 ? -15.263 4.470   -7.482  1.00 0.00 ? 105 MET A HG2  3  
ATOM 8400  H HG3  . MET A 1 105 ? -14.520 3.541   -6.190  1.00 0.00 ? 105 MET A HG3  3  
ATOM 8401  H HE1  . MET A 1 105 ? -12.331 6.321   -5.524  1.00 0.00 ? 105 MET A HE1  3  
ATOM 8402  H HE2  . MET A 1 105 ? -11.850 4.650   -5.224  1.00 0.00 ? 105 MET A HE2  3  
ATOM 8403  H HE3  . MET A 1 105 ? -13.538 5.130   -5.044  1.00 0.00 ? 105 MET A HE3  3  
ATOM 8404  N N    . SER A 1 106 ? -12.362 -0.253  -7.085  1.00 0.00 ? 106 SER A N    3  
ATOM 8405  C CA   . SER A 1 106 ? -12.501 -1.670  -6.764  1.00 0.00 ? 106 SER A CA   3  
ATOM 8406  C C    . SER A 1 106 ? -13.197 -1.860  -5.423  1.00 0.00 ? 106 SER A C    3  
ATOM 8407  O O    . SER A 1 106 ? -12.603 -1.643  -4.370  1.00 0.00 ? 106 SER A O    3  
ATOM 8408  C CB   . SER A 1 106 ? -11.129 -2.347  -6.739  1.00 0.00 ? 106 SER A CB   3  
ATOM 8409  O OG   . SER A 1 106 ? -10.462 -2.195  -7.980  1.00 0.00 ? 106 SER A OG   3  
ATOM 8410  H H    . SER A 1 106 ? -11.564 0.228   -6.779  1.00 0.00 ? 106 SER A H    3  
ATOM 8411  H HA   . SER A 1 106 ? -13.103 -2.126  -7.535  1.00 0.00 ? 106 SER A HA   3  
ATOM 8412  H HB2  . SER A 1 106 ? -10.524 -1.902  -5.963  1.00 0.00 ? 106 SER A HB2  3  
ATOM 8413  H HB3  . SER A 1 106 ? -11.254 -3.401  -6.538  1.00 0.00 ? 106 SER A HB3  3  
ATOM 8414  H HG   . SER A 1 106 ? -10.482 -1.272  -8.243  1.00 0.00 ? 106 SER A HG   3  
ATOM 8415  N N    . PHE A 1 107 ? -14.458 -2.272  -5.468  1.00 0.00 ? 107 PHE A N    3  
ATOM 8416  C CA   . PHE A 1 107 ? -15.233 -2.491  -4.254  1.00 0.00 ? 107 PHE A CA   3  
ATOM 8417  C C    . PHE A 1 107 ? -15.400 -3.983  -3.975  1.00 0.00 ? 107 PHE A C    3  
ATOM 8418  O O    . PHE A 1 107 ? -15.369 -4.802  -4.892  1.00 0.00 ? 107 PHE A O    3  
ATOM 8419  C CB   . PHE A 1 107 ? -16.603 -1.824  -4.384  1.00 0.00 ? 107 PHE A CB   3  
ATOM 8420  C CG   . PHE A 1 107 ? -16.674 -0.464  -3.748  1.00 0.00 ? 107 PHE A CG   3  
ATOM 8421  C CD1  . PHE A 1 107 ? -16.260 0.667   -4.436  1.00 0.00 ? 107 PHE A CD1  3  
ATOM 8422  C CD2  . PHE A 1 107 ? -17.159 -0.318  -2.461  1.00 0.00 ? 107 PHE A CD2  3  
ATOM 8423  C CE1  . PHE A 1 107 ? -16.329 1.914   -3.845  1.00 0.00 ? 107 PHE A CE1  3  
ATOM 8424  C CE2  . PHE A 1 107 ? -17.231 0.926   -1.867  1.00 0.00 ? 107 PHE A CE2  3  
ATOM 8425  C CZ   . PHE A 1 107 ? -16.815 2.044   -2.560  1.00 0.00 ? 107 PHE A CZ   3  
ATOM 8426  H H    . PHE A 1 107 ? -14.881 -2.439  -6.336  1.00 0.00 ? 107 PHE A H    3  
ATOM 8427  H HA   . PHE A 1 107 ? -14.698 -2.040  -3.432  1.00 0.00 ? 107 PHE A HA   3  
ATOM 8428  H HB2  . PHE A 1 107 ? -16.841 -1.712  -5.431  1.00 0.00 ? 107 PHE A HB2  3  
ATOM 8429  H HB3  . PHE A 1 107 ? -17.348 -2.450  -3.916  1.00 0.00 ? 107 PHE A HB3  3  
ATOM 8430  H HD1  . PHE A 1 107 ? -15.881 0.569   -5.443  1.00 0.00 ? 107 PHE A HD1  3  
ATOM 8431  H HD2  . PHE A 1 107 ? -17.481 -1.191  -1.919  1.00 0.00 ? 107 PHE A HD2  3  
ATOM 8432  H HE1  . PHE A 1 107 ? -16.001 2.787   -4.388  1.00 0.00 ? 107 PHE A HE1  3  
ATOM 8433  H HE2  . PHE A 1 107 ? -17.614 1.023   -0.862  1.00 0.00 ? 107 PHE A HE2  3  
ATOM 8434  H HZ   . PHE A 1 107 ? -16.870 3.019   -2.098  1.00 0.00 ? 107 PHE A HZ   3  
ATOM 8435  N N    . GLU A 1 108 ? -15.578 -4.330  -2.704  1.00 0.00 ? 108 GLU A N    3  
ATOM 8436  C CA   . GLU A 1 108 ? -15.752 -5.729  -2.314  1.00 0.00 ? 108 GLU A CA   3  
ATOM 8437  C C    . GLU A 1 108 ? -16.025 -5.874  -0.814  1.00 0.00 ? 108 GLU A C    3  
ATOM 8438  O O    . GLU A 1 108 ? -16.966 -6.560  -0.416  1.00 0.00 ? 108 GLU A O    3  
ATOM 8439  C CB   . GLU A 1 108 ? -14.519 -6.549  -2.700  1.00 0.00 ? 108 GLU A CB   3  
ATOM 8440  C CG   . GLU A 1 108 ? -14.809 -8.030  -2.894  1.00 0.00 ? 108 GLU A CG   3  
ATOM 8441  C CD   . GLU A 1 108 ? -14.079 -8.904  -1.892  1.00 0.00 ? 108 GLU A CD   3  
ATOM 8442  O OE1  . GLU A 1 108 ? -14.299 -8.724  -0.676  1.00 0.00 ? 108 GLU A OE1  3  
ATOM 8443  O OE2  . GLU A 1 108 ? -13.287 -9.768  -2.324  1.00 0.00 ? 108 GLU A OE2  3  
ATOM 8444  H H    . GLU A 1 108 ? -15.595 -3.632  -2.019  1.00 0.00 ? 108 GLU A H    3  
ATOM 8445  H HA   . GLU A 1 108 ? -16.604 -6.113  -2.854  1.00 0.00 ? 108 GLU A HA   3  
ATOM 8446  H HB2  . GLU A 1 108 ? -14.116 -6.159  -3.623  1.00 0.00 ? 108 GLU A HB2  3  
ATOM 8447  H HB3  . GLU A 1 108 ? -13.776 -6.450  -1.924  1.00 0.00 ? 108 GLU A HB3  3  
ATOM 8448  H HG2  . GLU A 1 108 ? -15.871 -8.193  -2.784  1.00 0.00 ? 108 GLU A HG2  3  
ATOM 8449  H HG3  . GLU A 1 108 ? -14.503 -8.316  -3.890  1.00 0.00 ? 108 GLU A HG3  3  
ATOM 8450  N N    . PRO A 1 109 ? -15.200 -5.242  0.045   1.00 0.00 ? 109 PRO A N    3  
ATOM 8451  C CA   . PRO A 1 109 ? -15.360 -5.323  1.502   1.00 0.00 ? 109 PRO A CA   3  
ATOM 8452  C C    . PRO A 1 109 ? -16.805 -5.144  1.978   1.00 0.00 ? 109 PRO A C    3  
ATOM 8453  O O    . PRO A 1 109 ? -17.268 -5.900  2.832   1.00 0.00 ? 109 PRO A O    3  
ATOM 8454  C CB   . PRO A 1 109 ? -14.471 -4.190  2.008   1.00 0.00 ? 109 PRO A CB   3  
ATOM 8455  C CG   . PRO A 1 109 ? -13.386 -4.108  0.993   1.00 0.00 ? 109 PRO A CG   3  
ATOM 8456  C CD   . PRO A 1 109 ? -14.036 -4.410  -0.328  1.00 0.00 ? 109 PRO A CD   3  
ATOM 8457  H HA   . PRO A 1 109 ? -14.984 -6.262  1.880   1.00 0.00 ? 109 PRO A HA   3  
ATOM 8458  H HB2  . PRO A 1 109 ? -15.040 -3.275  2.062   1.00 0.00 ? 109 PRO A HB2  3  
ATOM 8459  H HB3  . PRO A 1 109 ? -14.081 -4.440  2.983   1.00 0.00 ? 109 PRO A HB3  3  
ATOM 8460  H HG2  . PRO A 1 109 ? -12.964 -3.118  0.983   1.00 0.00 ? 109 PRO A HG2  3  
ATOM 8461  H HG3  . PRO A 1 109 ? -12.622 -4.840  1.210   1.00 0.00 ? 109 PRO A HG3  3  
ATOM 8462  H HD2  . PRO A 1 109 ? -14.349 -3.495  -0.806  1.00 0.00 ? 109 PRO A HD2  3  
ATOM 8463  H HD3  . PRO A 1 109 ? -13.358 -4.957  -0.964  1.00 0.00 ? 109 PRO A HD3  3  
ATOM 8464  N N    . PRO A 1 110 ? -17.546 -4.146  1.447   1.00 0.00 ? 110 PRO A N    3  
ATOM 8465  C CA   . PRO A 1 110 ? -18.938 -3.901  1.845   1.00 0.00 ? 110 PRO A CA   3  
ATOM 8466  C C    . PRO A 1 110 ? -19.737 -5.187  2.012   1.00 0.00 ? 110 PRO A C    3  
ATOM 8467  O O    . PRO A 1 110 ? -19.323 -6.251  1.553   1.00 0.00 ? 110 PRO A O    3  
ATOM 8468  C CB   . PRO A 1 110 ? -19.484 -3.092  0.674   1.00 0.00 ? 110 PRO A CB   3  
ATOM 8469  C CG   . PRO A 1 110 ? -18.314 -2.307  0.200   1.00 0.00 ? 110 PRO A CG   3  
ATOM 8470  C CD   . PRO A 1 110 ? -17.099 -3.176  0.424   1.00 0.00 ? 110 PRO A CD   3  
ATOM 8471  H HA   . PRO A 1 110 ? -18.998 -3.317  2.751   1.00 0.00 ? 110 PRO A HA   3  
ATOM 8472  H HB2  . PRO A 1 110 ? -19.847 -3.764  -0.091  1.00 0.00 ? 110 PRO A HB2  3  
ATOM 8473  H HB3  . PRO A 1 110 ? -20.286 -2.450  1.009   1.00 0.00 ? 110 PRO A HB3  3  
ATOM 8474  H HG2  . PRO A 1 110 ? -18.429 -2.088  -0.849  1.00 0.00 ? 110 PRO A HG2  3  
ATOM 8475  H HG3  . PRO A 1 110 ? -18.230 -1.392  0.768   1.00 0.00 ? 110 PRO A HG3  3  
ATOM 8476  H HD2  . PRO A 1 110 ? -16.826 -3.676  -0.490  1.00 0.00 ? 110 PRO A HD2  3  
ATOM 8477  H HD3  . PRO A 1 110 ? -16.275 -2.582  0.789   1.00 0.00 ? 110 PRO A HD3  3  
ATOM 8478  N N    . GLU A 1 111 ? -20.891 -5.082  2.659   1.00 0.00 ? 111 GLU A N    3  
ATOM 8479  C CA   . GLU A 1 111 ? -21.745 -6.246  2.868   1.00 0.00 ? 111 GLU A CA   3  
ATOM 8480  C C    . GLU A 1 111 ? -23.019 -6.120  2.049   1.00 0.00 ? 111 GLU A C    3  
ATOM 8481  O O    . GLU A 1 111 ? -23.331 -5.048  1.532   1.00 0.00 ? 111 GLU A O    3  
ATOM 8482  C CB   . GLU A 1 111 ? -22.095 -6.434  4.351   1.00 0.00 ? 111 GLU A CB   3  
ATOM 8483  C CG   . GLU A 1 111 ? -21.720 -5.263  5.245   1.00 0.00 ? 111 GLU A CG   3  
ATOM 8484  C CD   . GLU A 1 111 ? -20.301 -5.359  5.769   1.00 0.00 ? 111 GLU A CD   3  
ATOM 8485  O OE1  . GLU A 1 111 ? -19.497 -6.107  5.174   1.00 0.00 ? 111 GLU A OE1  3  
ATOM 8486  O OE2  . GLU A 1 111 ? -19.993 -4.686  6.776   1.00 0.00 ? 111 GLU A OE2  3  
ATOM 8487  H H    . GLU A 1 111 ? -21.179 -4.204  2.993   1.00 0.00 ? 111 GLU A H    3  
ATOM 8488  H HA   . GLU A 1 111 ? -21.203 -7.115  2.525   1.00 0.00 ? 111 GLU A HA   3  
ATOM 8489  H HB2  . GLU A 1 111 ? -23.159 -6.593  4.439   1.00 0.00 ? 111 GLU A HB2  3  
ATOM 8490  H HB3  . GLU A 1 111 ? -21.583 -7.310  4.715   1.00 0.00 ? 111 GLU A HB3  3  
ATOM 8491  H HG2  . GLU A 1 111 ? -21.821 -4.347  4.686   1.00 0.00 ? 111 GLU A HG2  3  
ATOM 8492  H HG3  . GLU A 1 111 ? -22.398 -5.247  6.084   1.00 0.00 ? 111 GLU A HG3  3  
ATOM 8493  N N    . PHE A 1 112 ? -23.757 -7.217  1.940   1.00 0.00 ? 112 PHE A N    3  
ATOM 8494  C CA   . PHE A 1 112 ? -25.002 -7.215  1.185   1.00 0.00 ? 112 PHE A CA   3  
ATOM 8495  C C    . PHE A 1 112 ? -25.696 -8.568  1.216   1.00 0.00 ? 112 PHE A C    3  
ATOM 8496  O O    . PHE A 1 112 ? -25.097 -9.605  0.931   1.00 0.00 ? 112 PHE A O    3  
ATOM 8497  C CB   . PHE A 1 112 ? -24.762 -6.795  -0.270  1.00 0.00 ? 112 PHE A CB   3  
ATOM 8498  C CG   . PHE A 1 112 ? -24.366 -7.922  -1.192  1.00 0.00 ? 112 PHE A CG   3  
ATOM 8499  C CD1  . PHE A 1 112 ? -25.330 -8.715  -1.804  1.00 0.00 ? 112 PHE A CD1  3  
ATOM 8500  C CD2  . PHE A 1 112 ? -23.029 -8.179  -1.455  1.00 0.00 ? 112 PHE A CD2  3  
ATOM 8501  C CE1  . PHE A 1 112 ? -24.963 -9.738  -2.659  1.00 0.00 ? 112 PHE A CE1  3  
ATOM 8502  C CE2  . PHE A 1 112 ? -22.660 -9.204  -2.307  1.00 0.00 ? 112 PHE A CE2  3  
ATOM 8503  C CZ   . PHE A 1 112 ? -23.628 -9.983  -2.909  1.00 0.00 ? 112 PHE A CZ   3  
ATOM 8504  H H    . PHE A 1 112 ? -23.460 -8.040  2.382   1.00 0.00 ? 112 PHE A H    3  
ATOM 8505  H HA   . PHE A 1 112 ? -25.656 -6.488  1.643   1.00 0.00 ? 112 PHE A HA   3  
ATOM 8506  H HB2  . PHE A 1 112 ? -25.668 -6.358  -0.661  1.00 0.00 ? 112 PHE A HB2  3  
ATOM 8507  H HB3  . PHE A 1 112 ? -23.980 -6.057  -0.293  1.00 0.00 ? 112 PHE A HB3  3  
ATOM 8508  H HD1  . PHE A 1 112 ? -26.378 -8.531  -1.608  1.00 0.00 ? 112 PHE A HD1  3  
ATOM 8509  H HD2  . PHE A 1 112 ? -22.270 -7.570  -0.985  1.00 0.00 ? 112 PHE A HD2  3  
ATOM 8510  H HE1  . PHE A 1 112 ? -25.721 -10.345 -3.132  1.00 0.00 ? 112 PHE A HE1  3  
ATOM 8511  H HE2  . PHE A 1 112 ? -21.615 -9.394  -2.502  1.00 0.00 ? 112 PHE A HE2  3  
ATOM 8512  H HZ   . PHE A 1 112 ? -23.342 -10.783 -3.575  1.00 0.00 ? 112 PHE A HZ   3  
ATOM 8513  N N    . GLU A 1 113 ? -26.979 -8.525  1.518   1.00 0.00 ? 113 GLU A N    3  
ATOM 8514  C CA   . GLU A 1 113 ? -27.816 -9.713  1.543   1.00 0.00 ? 113 GLU A CA   3  
ATOM 8515  C C    . GLU A 1 113 ? -29.025 -9.459  0.702   1.00 0.00 ? 113 GLU A C    3  
ATOM 8516  O O    . GLU A 1 113 ? -29.251 -8.345  0.234   1.00 0.00 ? 113 GLU A O    3  
ATOM 8517  C CB   . GLU A 1 113 ? -28.258 -10.093 2.956   1.00 0.00 ? 113 GLU A CB   3  
ATOM 8518  C CG   . GLU A 1 113 ? -27.221 -9.819  4.019   1.00 0.00 ? 113 GLU A CG   3  
ATOM 8519  C CD   . GLU A 1 113 ? -26.952 -11.023 4.900   1.00 0.00 ? 113 GLU A CD   3  
ATOM 8520  O OE1  . GLU A 1 113 ? -27.917 -11.740 5.237   1.00 0.00 ? 113 GLU A OE1  3  
ATOM 8521  O OE2  . GLU A 1 113 ? -25.775 -11.249 5.253   1.00 0.00 ? 113 GLU A OE2  3  
ATOM 8522  H H    . GLU A 1 113 ? -27.389 -7.653  1.695   1.00 0.00 ? 113 GLU A H    3  
ATOM 8523  H HA   . GLU A 1 113 ? -27.272 -10.536 1.100   1.00 0.00 ? 113 GLU A HA   3  
ATOM 8524  H HB2  . GLU A 1 113 ? -29.148 -9.534  3.203   1.00 0.00 ? 113 GLU A HB2  3  
ATOM 8525  H HB3  . GLU A 1 113 ? -28.491 -11.148 2.974   1.00 0.00 ? 113 GLU A HB3  3  
ATOM 8526  H HG2  . GLU A 1 113 ? -26.302 -9.533  3.533   1.00 0.00 ? 113 GLU A HG2  3  
ATOM 8527  H HG3  . GLU A 1 113 ? -27.578 -9.009  4.637   1.00 0.00 ? 113 GLU A HG3  3  
ATOM 8528  N N    . ILE A 1 114 ? -29.790 -10.493 0.501   1.00 0.00 ? 114 ILE A N    3  
ATOM 8529  C CA   . ILE A 1 114 ? -30.971 -10.389 -0.300  1.00 0.00 ? 114 ILE A CA   3  
ATOM 8530  C C    . ILE A 1 114 ? -32.028 -11.343 0.221   1.00 0.00 ? 114 ILE A C    3  
ATOM 8531  O O    . ILE A 1 114 ? -31.894 -12.562 0.118   1.00 0.00 ? 114 ILE A O    3  
ATOM 8532  C CB   . ILE A 1 114 ? -30.643 -10.692 -1.774  1.00 0.00 ? 114 ILE A CB   3  
ATOM 8533  C CG1  . ILE A 1 114 ? -29.646 -11.841 -1.864  1.00 0.00 ? 114 ILE A CG1  3  
ATOM 8534  C CG2  . ILE A 1 114 ? -30.050 -9.471  -2.454  1.00 0.00 ? 114 ILE A CG2  3  
ATOM 8535  C CD1  . ILE A 1 114 ? -29.921 -12.801 -2.991  1.00 0.00 ? 114 ILE A CD1  3  
ATOM 8536  H H    . ILE A 1 114 ? -29.548 -11.358 0.894   1.00 0.00 ? 114 ILE A H    3  
ATOM 8537  H HA   . ILE A 1 114 ? -31.339 -9.373  -0.226  1.00 0.00 ? 114 ILE A HA   3  
ATOM 8538  H HB   . ILE A 1 114 ? -31.553 -10.956 -2.284  1.00 0.00 ? 114 ILE A HB   3  
ATOM 8539  H HG12 . ILE A 1 114 ? -28.661 -11.429 -2.025  1.00 0.00 ? 114 ILE A HG12 3  
ATOM 8540  H HG13 . ILE A 1 114 ? -29.649 -12.395 -0.935  1.00 0.00 ? 114 ILE A HG13 3  
ATOM 8541  H HG21 . ILE A 1 114 ? -30.007 -8.652  -1.757  1.00 0.00 ? 114 ILE A HG21 3  
ATOM 8542  H HG22 . ILE A 1 114 ? -30.662 -9.198  -3.298  1.00 0.00 ? 114 ILE A HG22 3  
ATOM 8543  H HG23 . ILE A 1 114 ? -29.050 -9.706  -2.795  1.00 0.00 ? 114 ILE A HG23 3  
ATOM 8544  H HD11 . ILE A 1 114 ? -30.983 -12.971 -3.069  1.00 0.00 ? 114 ILE A HD11 3  
ATOM 8545  H HD12 . ILE A 1 114 ? -29.417 -13.735 -2.795  1.00 0.00 ? 114 ILE A HD12 3  
ATOM 8546  H HD13 . ILE A 1 114 ? -29.555 -12.381 -3.915  1.00 0.00 ? 114 ILE A HD13 3  
ATOM 8547  N N    . VAL A 1 115 ? -33.085 -10.772 0.768   1.00 0.00 ? 115 VAL A N    3  
ATOM 8548  C CA   . VAL A 1 115 ? -34.183 -11.552 1.292   1.00 0.00 ? 115 VAL A CA   3  
ATOM 8549  C C    . VAL A 1 115 ? -35.242 -11.675 0.217   1.00 0.00 ? 115 VAL A C    3  
ATOM 8550  O O    . VAL A 1 115 ? -35.690 -10.679 -0.339  1.00 0.00 ? 115 VAL A O    3  
ATOM 8551  C CB   . VAL A 1 115 ? -34.769 -10.912 2.560   1.00 0.00 ? 115 VAL A CB   3  
ATOM 8552  C CG1  . VAL A 1 115 ? -35.774 -11.845 3.217   1.00 0.00 ? 115 VAL A CG1  3  
ATOM 8553  C CG2  . VAL A 1 115 ? -33.642 -10.557 3.523   1.00 0.00 ? 115 VAL A CG2  3  
ATOM 8554  H H    . VAL A 1 115 ? -33.138 -9.796  0.791   1.00 0.00 ? 115 VAL A H    3  
ATOM 8555  H HA   . VAL A 1 115 ? -33.811 -12.537 1.538   1.00 0.00 ? 115 VAL A HA   3  
ATOM 8556  H HB   . VAL A 1 115 ? -35.281 -10.002 2.281   1.00 0.00 ? 115 VAL A HB   3  
ATOM 8557  H HG11 . VAL A 1 115 ? -35.299 -12.368 4.034   1.00 0.00 ? 115 VAL A HG11 3  
ATOM 8558  H HG12 . VAL A 1 115 ? -36.130 -12.559 2.490   1.00 0.00 ? 115 VAL A HG12 3  
ATOM 8559  H HG13 . VAL A 1 115 ? -36.606 -11.269 3.594   1.00 0.00 ? 115 VAL A HG13 3  
ATOM 8560  H HG21 . VAL A 1 115 ? -33.244 -11.463 3.956   1.00 0.00 ? 115 VAL A HG21 3  
ATOM 8561  H HG22 . VAL A 1 115 ? -34.022 -9.920  4.307   1.00 0.00 ? 115 VAL A HG22 3  
ATOM 8562  H HG23 . VAL A 1 115 ? -32.855 -10.041 2.988   1.00 0.00 ? 115 VAL A HG23 3  
ATOM 8563  N N    . GLY A 1 116 ? -35.605 -12.897 -0.109  1.00 0.00 ? 116 GLY A N    3  
ATOM 8564  C CA   . GLY A 1 116 ? -36.573 -13.102 -1.164  1.00 0.00 ? 116 GLY A CA   3  
ATOM 8565  C C    . GLY A 1 116 ? -37.947 -13.493 -0.677  1.00 0.00 ? 116 GLY A C    3  
ATOM 8566  O O    . GLY A 1 116 ? -38.100 -14.427 0.111   1.00 0.00 ? 116 GLY A O    3  
ATOM 8567  H H    . GLY A 1 116 ? -35.194 -13.661 0.348   1.00 0.00 ? 116 GLY A H    3  
ATOM 8568  H HA2  . GLY A 1 116 ? -36.662 -12.185 -1.728  1.00 0.00 ? 116 GLY A HA2  3  
ATOM 8569  H HA3  . GLY A 1 116 ? -36.202 -13.870 -1.823  1.00 0.00 ? 116 GLY A HA3  3  
ATOM 8570  N N    . PHE A 1 117 ? -38.953 -12.787 -1.180  1.00 0.00 ? 117 PHE A N    3  
ATOM 8571  C CA   . PHE A 1 117 ? -40.335 -13.065 -0.835  1.00 0.00 ? 117 PHE A CA   3  
ATOM 8572  C C    . PHE A 1 117 ? -40.954 -13.939 -1.917  1.00 0.00 ? 117 PHE A C    3  
ATOM 8573  O O    . PHE A 1 117 ? -40.593 -13.826 -3.090  1.00 0.00 ? 117 PHE A O    3  
ATOM 8574  C CB   . PHE A 1 117 ? -41.122 -11.764 -0.678  1.00 0.00 ? 117 PHE A CB   3  
ATOM 8575  C CG   . PHE A 1 117 ? -40.964 -11.131 0.676   1.00 0.00 ? 117 PHE A CG   3  
ATOM 8576  C CD1  . PHE A 1 117 ? -39.721 -10.699 1.116   1.00 0.00 ? 117 PHE A CD1  3  
ATOM 8577  C CD2  . PHE A 1 117 ? -42.059 -10.969 1.509   1.00 0.00 ? 117 PHE A CD2  3  
ATOM 8578  C CE1  . PHE A 1 117 ? -39.576 -10.117 2.361   1.00 0.00 ? 117 PHE A CE1  3  
ATOM 8579  C CE2  . PHE A 1 117 ? -41.919 -10.388 2.755   1.00 0.00 ? 117 PHE A CE2  3  
ATOM 8580  C CZ   . PHE A 1 117 ? -40.677 -9.962  3.182   1.00 0.00 ? 117 PHE A CZ   3  
ATOM 8581  H H    . PHE A 1 117 ? -38.760 -12.072 -1.822  1.00 0.00 ? 117 PHE A H    3  
ATOM 8582  H HA   . PHE A 1 117 ? -40.345 -13.604 0.101   1.00 0.00 ? 117 PHE A HA   3  
ATOM 8583  H HB2  . PHE A 1 117 ? -40.785 -11.055 -1.419  1.00 0.00 ? 117 PHE A HB2  3  
ATOM 8584  H HB3  . PHE A 1 117 ? -42.172 -11.967 -0.831  1.00 0.00 ? 117 PHE A HB3  3  
ATOM 8585  H HD1  . PHE A 1 117 ? -38.858 -10.819 0.476   1.00 0.00 ? 117 PHE A HD1  3  
ATOM 8586  H HD2  . PHE A 1 117 ? -43.031 -11.301 1.177   1.00 0.00 ? 117 PHE A HD2  3  
ATOM 8587  H HE1  . PHE A 1 117 ? -38.604 -9.786  2.693   1.00 0.00 ? 117 PHE A HE1  3  
ATOM 8588  H HE2  . PHE A 1 117 ? -42.781 -10.268 3.395   1.00 0.00 ? 117 PHE A HE2  3  
ATOM 8589  H HZ   . PHE A 1 117 ? -40.566 -9.508  4.155   1.00 0.00 ? 117 PHE A HZ   3  
ATOM 8590  N N    . THR A 1 118 ? -41.868 -14.817 -1.516  1.00 0.00 ? 118 THR A N    3  
ATOM 8591  C CA   . THR A 1 118 ? -42.519 -15.750 -2.439  1.00 0.00 ? 118 THR A CA   3  
ATOM 8592  C C    . THR A 1 118 ? -42.809 -15.125 -3.807  1.00 0.00 ? 118 THR A C    3  
ATOM 8593  O O    . THR A 1 118 ? -42.834 -15.829 -4.817  1.00 0.00 ? 118 THR A O    3  
ATOM 8594  C CB   . THR A 1 118 ? -43.830 -16.250 -1.829  1.00 0.00 ? 118 THR A CB   3  
ATOM 8595  O OG1  . THR A 1 118 ? -43.666 -16.620 -0.476  1.00 0.00 ? 118 THR A OG1  3  
ATOM 8596  C CG2  . THR A 1 118 ? -44.450 -17.423 -2.575  1.00 0.00 ? 118 THR A CG2  3  
ATOM 8597  H H    . THR A 1 118 ? -42.097 -14.858 -0.564  1.00 0.00 ? 118 THR A H    3  
ATOM 8598  H HA   . THR A 1 118 ? -41.857 -16.592 -2.574  1.00 0.00 ? 118 THR A HA   3  
ATOM 8599  H HB   . THR A 1 118 ? -44.523 -15.451 -1.848  1.00 0.00 ? 118 THR A HB   3  
ATOM 8600  H HG1  . THR A 1 118 ? -44.317 -16.163 0.062   1.00 0.00 ? 118 THR A HG1  3  
ATOM 8601  H HG21 . THR A 1 118 ? -45.278 -17.075 -3.174  1.00 0.00 ? 118 THR A HG21 3  
ATOM 8602  H HG22 . THR A 1 118 ? -44.805 -18.157 -1.866  1.00 0.00 ? 118 THR A HG22 3  
ATOM 8603  H HG23 . THR A 1 118 ? -43.709 -17.879 -3.219  1.00 0.00 ? 118 THR A HG23 3  
ATOM 8604  N N    . ASN A 1 119 ? -43.035 -13.815 -3.848  1.00 0.00 ? 119 ASN A N    3  
ATOM 8605  C CA   . ASN A 1 119 ? -43.327 -13.143 -5.112  1.00 0.00 ? 119 ASN A CA   3  
ATOM 8606  C C    . ASN A 1 119 ? -42.310 -12.047 -5.443  1.00 0.00 ? 119 ASN A C    3  
ATOM 8607  O O    . ASN A 1 119 ? -42.110 -11.718 -6.613  1.00 0.00 ? 119 ASN A O    3  
ATOM 8608  C CB   . ASN A 1 119 ? -44.738 -12.549 -5.076  1.00 0.00 ? 119 ASN A CB   3  
ATOM 8609  C CG   . ASN A 1 119 ? -45.636 -13.125 -6.154  1.00 0.00 ? 119 ASN A CG   3  
ATOM 8610  O OD1  . ASN A 1 119 ? -46.808 -13.414 -5.913  1.00 0.00 ? 119 ASN A OD1  3  
ATOM 8611  N ND2  . ASN A 1 119 ? -45.088 -13.295 -7.352  1.00 0.00 ? 119 ASN A ND2  3  
ATOM 8612  H H    . ASN A 1 119 ? -43.012 -13.294 -3.019  1.00 0.00 ? 119 ASN A H    3  
ATOM 8613  H HA   . ASN A 1 119 ? -43.288 -13.888 -5.893  1.00 0.00 ? 119 ASN A HA   3  
ATOM 8614  H HB2  . ASN A 1 119 ? -45.184 -12.757 -4.115  1.00 0.00 ? 119 ASN A HB2  3  
ATOM 8615  H HB3  . ASN A 1 119 ? -44.678 -11.480 -5.216  1.00 0.00 ? 119 ASN A HB3  3  
ATOM 8616  H HD21 . ASN A 1 119 ? -44.149 -13.043 -7.473  1.00 0.00 ? 119 ASN A HD21 3  
ATOM 8617  H HD22 . ASN A 1 119 ? -45.646 -13.666 -8.068  1.00 0.00 ? 119 ASN A HD22 3  
ATOM 8618  N N    . HIS A 1 120 ? -41.701 -11.453 -4.420  1.00 0.00 ? 120 HIS A N    3  
ATOM 8619  C CA   . HIS A 1 120 ? -40.749 -10.360 -4.646  1.00 0.00 ? 120 HIS A CA   3  
ATOM 8620  C C    . HIS A 1 120 ? -39.361 -10.661 -4.095  1.00 0.00 ? 120 HIS A C    3  
ATOM 8621  O O    . HIS A 1 120 ? -39.107 -11.732 -3.544  1.00 0.00 ? 120 HIS A O    3  
ATOM 8622  C CB   . HIS A 1 120 ? -41.282 -9.055  -4.047  1.00 0.00 ? 120 HIS A CB   3  
ATOM 8623  C CG   . HIS A 1 120 ? -41.934 -9.213  -2.709  1.00 0.00 ? 120 HIS A CG   3  
ATOM 8624  N ND1  . HIS A 1 120 ? -43.085 -9.948  -2.514  1.00 0.00 ? 120 HIS A ND1  3  
ATOM 8625  C CD2  . HIS A 1 120 ? -41.601 -8.711  -1.496  1.00 0.00 ? 120 HIS A CD2  3  
ATOM 8626  C CE1  . HIS A 1 120 ? -43.432 -9.889  -1.240  1.00 0.00 ? 120 HIS A CE1  3  
ATOM 8627  N NE2  . HIS A 1 120 ? -42.548 -9.144  -0.601  1.00 0.00 ? 120 HIS A NE2  3  
ATOM 8628  H H    . HIS A 1 120 ? -41.927 -11.729 -3.504  1.00 0.00 ? 120 HIS A H    3  
ATOM 8629  H HA   . HIS A 1 120 ? -40.658 -10.221 -5.712  1.00 0.00 ? 120 HIS A HA   3  
ATOM 8630  H HB2  . HIS A 1 120 ? -40.466 -8.359  -3.937  1.00 0.00 ? 120 HIS A HB2  3  
ATOM 8631  H HB3  . HIS A 1 120 ? -42.013 -8.635  -4.723  1.00 0.00 ? 120 HIS A HB3  3  
ATOM 8632  H HD1  . HIS A 1 120 ? -43.575 -10.439 -3.206  1.00 0.00 ? 120 HIS A HD1  3  
ATOM 8633  H HD2  . HIS A 1 120 ? -40.748 -8.086  -1.274  1.00 0.00 ? 120 HIS A HD2  3  
ATOM 8634  H HE1  . HIS A 1 120 ? -44.292 -10.369 -0.796  1.00 0.00 ? 120 HIS A HE1  3  
ATOM 8635  H HE2  . HIS A 1 120 ? -42.631 -8.844  0.328   1.00 0.00 ? 120 HIS A HE2  3  
ATOM 8636  N N    . ILE A 1 121 ? -38.471 -9.687  -4.255  1.00 0.00 ? 121 ILE A N    3  
ATOM 8637  C CA   . ILE A 1 121 ? -37.095 -9.795  -3.789  1.00 0.00 ? 121 ILE A CA   3  
ATOM 8638  C C    . ILE A 1 121 ? -36.727 -8.585  -2.941  1.00 0.00 ? 121 ILE A C    3  
ATOM 8639  O O    . ILE A 1 121 ? -37.195 -7.478  -3.190  1.00 0.00 ? 121 ILE A O    3  
ATOM 8640  C CB   . ILE A 1 121 ? -36.098 -9.869  -4.965  1.00 0.00 ? 121 ILE A CB   3  
ATOM 8641  C CG1  . ILE A 1 121 ? -36.450 -11.021 -5.915  1.00 0.00 ? 121 ILE A CG1  3  
ATOM 8642  C CG2  . ILE A 1 121 ? -34.673 -10.006 -4.438  1.00 0.00 ? 121 ILE A CG2  3  
ATOM 8643  C CD1  . ILE A 1 121 ? -35.391 -11.300 -6.971  1.00 0.00 ? 121 ILE A CD1  3  
ATOM 8644  H H    . ILE A 1 121 ? -38.753 -8.859  -4.698  1.00 0.00 ? 121 ILE A H    3  
ATOM 8645  H HA   . ILE A 1 121 ? -36.999 -10.695 -3.196  1.00 0.00 ? 121 ILE A HA   3  
ATOM 8646  H HB   . ILE A 1 121 ? -36.160 -8.939  -5.506  1.00 0.00 ? 121 ILE A HB   3  
ATOM 8647  H HG12 . ILE A 1 121 ? -36.588 -11.921 -5.338  1.00 0.00 ? 121 ILE A HG12 3  
ATOM 8648  H HG13 . ILE A 1 121 ? -37.371 -10.786 -6.425  1.00 0.00 ? 121 ILE A HG13 3  
ATOM 8649  H HG21 . ILE A 1 121 ? -34.332 -9.047  -4.076  1.00 0.00 ? 121 ILE A HG21 3  
ATOM 8650  H HG22 . ILE A 1 121 ? -34.024 -10.342 -5.231  1.00 0.00 ? 121 ILE A HG22 3  
ATOM 8651  H HG23 . ILE A 1 121 ? -34.655 -10.719 -3.630  1.00 0.00 ? 121 ILE A HG23 3  
ATOM 8652  H HD11 . ILE A 1 121 ? -35.260 -10.432 -7.600  1.00 0.00 ? 121 ILE A HD11 3  
ATOM 8653  H HD12 . ILE A 1 121 ? -35.698 -12.140 -7.578  1.00 0.00 ? 121 ILE A HD12 3  
ATOM 8654  H HD13 . ILE A 1 121 ? -34.455 -11.537 -6.487  1.00 0.00 ? 121 ILE A HD13 3  
ATOM 8655  N N    . ASN A 1 122 ? -35.865 -8.799  -1.962  1.00 0.00 ? 122 ASN A N    3  
ATOM 8656  C CA   . ASN A 1 122 ? -35.403 -7.724  -1.098  1.00 0.00 ? 122 ASN A CA   3  
ATOM 8657  C C    . ASN A 1 122 ? -33.880 -7.716  -1.082  1.00 0.00 ? 122 ASN A C    3  
ATOM 8658  O O    . ASN A 1 122 ? -33.253 -8.524  -0.408  1.00 0.00 ? 122 ASN A O    3  
ATOM 8659  C CB   . ASN A 1 122 ? -35.955 -7.884  0.323   1.00 0.00 ? 122 ASN A CB   3  
ATOM 8660  C CG   . ASN A 1 122 ? -37.270 -7.158  0.523   1.00 0.00 ? 122 ASN A CG   3  
ATOM 8661  O OD1  . ASN A 1 122 ? -37.376 -6.261  1.359   1.00 0.00 ? 122 ASN A OD1  3  
ATOM 8662  N ND2  . ASN A 1 122 ? -38.281 -7.542  -0.247  1.00 0.00 ? 122 ASN A ND2  3  
ATOM 8663  H H    . ASN A 1 122 ? -35.510 -9.703  -1.830  1.00 0.00 ? 122 ASN A H    3  
ATOM 8664  H HA   . ASN A 1 122 ? -35.754 -6.787  -1.513  1.00 0.00 ? 122 ASN A HA   3  
ATOM 8665  H HB2  . ASN A 1 122 ? -36.115 -8.928  0.525   1.00 0.00 ? 122 ASN A HB2  3  
ATOM 8666  H HB3  . ASN A 1 122 ? -35.238 -7.490  1.027   1.00 0.00 ? 122 ASN A HB3  3  
ATOM 8667  H HD21 . ASN A 1 122 ? -38.123 -8.263  -0.892  1.00 0.00 ? 122 ASN A HD21 3  
ATOM 8668  H HD22 . ASN A 1 122 ? -39.144 -7.090  -0.139  1.00 0.00 ? 122 ASN A HD22 3  
ATOM 8669  N N    . VAL A 1 123 ? -33.298 -6.804  -1.844  1.00 0.00 ? 123 VAL A N    3  
ATOM 8670  C CA   . VAL A 1 123 ? -31.849 -6.697  -1.938  1.00 0.00 ? 123 VAL A CA   3  
ATOM 8671  C C    . VAL A 1 123 ? -31.319 -5.588  -1.046  1.00 0.00 ? 123 VAL A C    3  
ATOM 8672  O O    . VAL A 1 123 ? -31.670 -4.424  -1.214  1.00 0.00 ? 123 VAL A O    3  
ATOM 8673  C CB   . VAL A 1 123 ? -31.401 -6.420  -3.384  1.00 0.00 ? 123 VAL A CB   3  
ATOM 8674  C CG1  . VAL A 1 123 ? -29.883 -6.357  -3.478  1.00 0.00 ? 123 VAL A CG1  3  
ATOM 8675  C CG2  . VAL A 1 123 ? -31.962 -7.474  -4.319  1.00 0.00 ? 123 VAL A CG2  3  
ATOM 8676  H H    . VAL A 1 123 ? -33.864 -6.197  -2.357  1.00 0.00 ? 123 VAL A H    3  
ATOM 8677  H HA   . VAL A 1 123 ? -31.426 -7.641  -1.625  1.00 0.00 ? 123 VAL A HA   3  
ATOM 8678  H HB   . VAL A 1 123 ? -31.796 -5.461  -3.682  1.00 0.00 ? 123 VAL A HB   3  
ATOM 8679  H HG11 . VAL A 1 123 ? -29.449 -7.081  -2.805  1.00 0.00 ? 123 VAL A HG11 3  
ATOM 8680  H HG12 . VAL A 1 123 ? -29.547 -5.367  -3.208  1.00 0.00 ? 123 VAL A HG12 3  
ATOM 8681  H HG13 . VAL A 1 123 ? -29.578 -6.578  -4.489  1.00 0.00 ? 123 VAL A HG13 3  
ATOM 8682  H HG21 . VAL A 1 123 ? -32.741 -7.037  -4.923  1.00 0.00 ? 123 VAL A HG21 3  
ATOM 8683  H HG22 . VAL A 1 123 ? -32.370 -8.289  -3.739  1.00 0.00 ? 123 VAL A HG22 3  
ATOM 8684  H HG23 . VAL A 1 123 ? -31.176 -7.846  -4.959  1.00 0.00 ? 123 VAL A HG23 3  
ATOM 8685  N N    . MET A 1 124 ? -30.462 -5.951  -0.103  1.00 0.00 ? 124 MET A N    3  
ATOM 8686  C CA   . MET A 1 124 ? -29.886 -4.967  0.801   1.00 0.00 ? 124 MET A CA   3  
ATOM 8687  C C    . MET A 1 124 ? -28.379 -4.882  0.662   1.00 0.00 ? 124 MET A C    3  
ATOM 8688  O O    . MET A 1 124 ? -27.661 -5.814  1.022   1.00 0.00 ? 124 MET A O    3  
ATOM 8689  C CB   . MET A 1 124 ? -30.217 -5.280  2.256   1.00 0.00 ? 124 MET A CB   3  
ATOM 8690  C CG   . MET A 1 124 ? -30.412 -4.032  3.090   1.00 0.00 ? 124 MET A CG   3  
ATOM 8691  S SD   . MET A 1 124 ? -32.075 -3.390  2.974   1.00 0.00 ? 124 MET A SD   3  
ATOM 8692  C CE   . MET A 1 124 ? -33.018 -4.870  3.320   1.00 0.00 ? 124 MET A CE   3  
ATOM 8693  H H    . MET A 1 124 ? -30.211 -6.892  -0.020  1.00 0.00 ? 124 MET A H    3  
ATOM 8694  H HA   . MET A 1 124 ? -30.315 -4.009  0.552   1.00 0.00 ? 124 MET A HA   3  
ATOM 8695  H HB2  . MET A 1 124 ? -31.119 -5.866  2.296   1.00 0.00 ? 124 MET A HB2  3  
ATOM 8696  H HB3  . MET A 1 124 ? -29.406 -5.846  2.689   1.00 0.00 ? 124 MET A HB3  3  
ATOM 8697  H HG2  . MET A 1 124 ? -30.221 -4.263  4.111   1.00 0.00 ? 124 MET A HG2  3  
ATOM 8698  H HG3  . MET A 1 124 ? -29.717 -3.277  2.759   1.00 0.00 ? 124 MET A HG3  3  
ATOM 8699  H HE1  . MET A 1 124 ? -33.026 -5.506  2.445   1.00 0.00 ? 124 MET A HE1  3  
ATOM 8700  H HE2  . MET A 1 124 ? -34.030 -4.600  3.582   1.00 0.00 ? 124 MET A HE2  3  
ATOM 8701  H HE3  . MET A 1 124 ? -32.560 -5.399  4.143   1.00 0.00 ? 124 MET A HE3  3  
ATOM 8702  N N    . VAL A 1 125 ? -27.898 -3.749  0.178   1.00 0.00 ? 125 VAL A N    3  
ATOM 8703  C CA   . VAL A 1 125 ? -26.469 -3.544  0.044   1.00 0.00 ? 125 VAL A CA   3  
ATOM 8704  C C    . VAL A 1 125 ? -25.983 -2.715  1.211   1.00 0.00 ? 125 VAL A C    3  
ATOM 8705  O O    . VAL A 1 125 ? -26.376 -1.566  1.378   1.00 0.00 ? 125 VAL A O    3  
ATOM 8706  C CB   . VAL A 1 125 ? -26.121 -2.836  -1.271  1.00 0.00 ? 125 VAL A CB   3  
ATOM 8707  C CG1  . VAL A 1 125 ? -24.612 -2.769  -1.457  1.00 0.00 ? 125 VAL A CG1  3  
ATOM 8708  C CG2  . VAL A 1 125 ? -26.800 -3.543  -2.435  1.00 0.00 ? 125 VAL A CG2  3  
ATOM 8709  H H    . VAL A 1 125 ? -28.513 -3.029  -0.071  1.00 0.00 ? 125 VAL A H    3  
ATOM 8710  H HA   . VAL A 1 125 ? -25.983 -4.506  0.070   1.00 0.00 ? 125 VAL A HA   3  
ATOM 8711  H HB   . VAL A 1 125 ? -26.498 -1.825  -1.223  1.00 0.00 ? 125 VAL A HB   3  
ATOM 8712  H HG11 . VAL A 1 125 ? -24.167 -3.699  -1.133  1.00 0.00 ? 125 VAL A HG11 3  
ATOM 8713  H HG12 . VAL A 1 125 ? -24.211 -1.957  -0.867  1.00 0.00 ? 125 VAL A HG12 3  
ATOM 8714  H HG13 . VAL A 1 125 ? -24.384 -2.604  -2.498  1.00 0.00 ? 125 VAL A HG13 3  
ATOM 8715  H HG21 . VAL A 1 125 ? -27.776 -3.107  -2.603  1.00 0.00 ? 125 VAL A HG21 3  
ATOM 8716  H HG22 . VAL A 1 125 ? -26.913 -4.592  -2.200  1.00 0.00 ? 125 VAL A HG22 3  
ATOM 8717  H HG23 . VAL A 1 125 ? -26.201 -3.435  -3.324  1.00 0.00 ? 125 VAL A HG23 3  
ATOM 8718  N N    . LYS A 1 126 ? -25.180 -3.327  2.055   1.00 0.00 ? 126 LYS A N    3  
ATOM 8719  C CA   . LYS A 1 126 ? -24.709 -2.669  3.254   1.00 0.00 ? 126 LYS A CA   3  
ATOM 8720  C C    . LYS A 1 126 ? -23.491 -1.769  3.037   1.00 0.00 ? 126 LYS A C    3  
ATOM 8721  O O    . LYS A 1 126 ? -22.352 -2.164  3.305   1.00 0.00 ? 126 LYS A O    3  
ATOM 8722  C CB   . LYS A 1 126 ? -24.433 -3.734  4.311   1.00 0.00 ? 126 LYS A CB   3  
ATOM 8723  C CG   . LYS A 1 126 ? -25.650 -4.612  4.587   1.00 0.00 ? 126 LYS A CG   3  
ATOM 8724  C CD   . LYS A 1 126 ? -26.728 -3.853  5.332   1.00 0.00 ? 126 LYS A CD   3  
ATOM 8725  C CE   . LYS A 1 126 ? -26.206 -3.259  6.632   1.00 0.00 ? 126 LYS A CE   3  
ATOM 8726  N NZ   . LYS A 1 126 ? -25.874 -1.814  6.490   1.00 0.00 ? 126 LYS A NZ   3  
ATOM 8727  H H    . LYS A 1 126 ? -24.948 -4.268  1.914   1.00 0.00 ? 126 LYS A H    3  
ATOM 8728  H HA   . LYS A 1 126 ? -25.517 -2.050  3.611   1.00 0.00 ? 126 LYS A HA   3  
ATOM 8729  H HB2  . LYS A 1 126 ? -23.625 -4.366  3.971   1.00 0.00 ? 126 LYS A HB2  3  
ATOM 8730  H HB3  . LYS A 1 126 ? -24.144 -3.251  5.232   1.00 0.00 ? 126 LYS A HB3  3  
ATOM 8731  H HG2  . LYS A 1 126 ? -26.067 -4.947  3.646   1.00 0.00 ? 126 LYS A HG2  3  
ATOM 8732  H HG3  . LYS A 1 126 ? -25.348 -5.464  5.176   1.00 0.00 ? 126 LYS A HG3  3  
ATOM 8733  H HD2  . LYS A 1 126 ? -27.085 -3.057  4.699   1.00 0.00 ? 126 LYS A HD2  3  
ATOM 8734  H HD3  . LYS A 1 126 ? -27.540 -4.529  5.554   1.00 0.00 ? 126 LYS A HD3  3  
ATOM 8735  H HE2  . LYS A 1 126 ? -26.962 -3.372  7.394   1.00 0.00 ? 126 LYS A HE2  3  
ATOM 8736  H HE3  . LYS A 1 126 ? -25.316 -3.797  6.927   1.00 0.00 ? 126 LYS A HE3  3  
ATOM 8737  H HZ1  . LYS A 1 126 ? -26.747 -1.250  6.454   1.00 0.00 ? 126 LYS A HZ1  3  
ATOM 8738  H HZ2  . LYS A 1 126 ? -25.335 -1.655  5.616   1.00 0.00 ? 126 LYS A HZ2  3  
ATOM 8739  H HZ3  . LYS A 1 126 ? -25.303 -1.497  7.300   1.00 0.00 ? 126 LYS A HZ3  3  
ATOM 8740  N N    . PHE A 1 127 ? -23.761 -0.538  2.589   1.00 0.00 ? 127 PHE A N    3  
ATOM 8741  C CA   . PHE A 1 127 ? -22.728 0.476   2.374   1.00 0.00 ? 127 PHE A CA   3  
ATOM 8742  C C    . PHE A 1 127 ? -22.529 1.249   3.673   1.00 0.00 ? 127 PHE A C    3  
ATOM 8743  O O    . PHE A 1 127 ? -23.474 1.425   4.442   1.00 0.00 ? 127 PHE A O    3  
ATOM 8744  C CB   . PHE A 1 127 ? -23.173 1.481   1.310   1.00 0.00 ? 127 PHE A CB   3  
ATOM 8745  C CG   . PHE A 1 127 ? -22.801 1.149   -0.103  1.00 0.00 ? 127 PHE A CG   3  
ATOM 8746  C CD1  . PHE A 1 127 ? -21.552 1.480   -0.602  1.00 0.00 ? 127 PHE A CD1  3  
ATOM 8747  C CD2  . PHE A 1 127 ? -23.722 0.554   -0.946  1.00 0.00 ? 127 PHE A CD2  3  
ATOM 8748  C CE1  . PHE A 1 127 ? -21.224 1.213   -1.918  1.00 0.00 ? 127 PHE A CE1  3  
ATOM 8749  C CE2  . PHE A 1 127 ? -23.407 0.294   -2.264  1.00 0.00 ? 127 PHE A CE2  3  
ATOM 8750  C CZ   . PHE A 1 127 ? -22.154 0.624   -2.753  1.00 0.00 ? 127 PHE A CZ   3  
ATOM 8751  H H    . PHE A 1 127 ? -24.690 -0.289  2.407   1.00 0.00 ? 127 PHE A H    3  
ATOM 8752  H HA   . PHE A 1 127 ? -21.798 0.001   2.078   1.00 0.00 ? 127 PHE A HA   3  
ATOM 8753  H HB2  . PHE A 1 127 ? -24.244 1.567   1.348   1.00 0.00 ? 127 PHE A HB2  3  
ATOM 8754  H HB3  . PHE A 1 127 ? -22.741 2.445   1.544   1.00 0.00 ? 127 PHE A HB3  3  
ATOM 8755  H HD1  . PHE A 1 127 ? -20.825 1.941   0.050   1.00 0.00 ? 127 PHE A HD1  3  
ATOM 8756  H HD2  . PHE A 1 127 ? -24.698 0.294   -0.565  1.00 0.00 ? 127 PHE A HD2  3  
ATOM 8757  H HE1  . PHE A 1 127 ? -20.246 1.472   -2.295  1.00 0.00 ? 127 PHE A HE1  3  
ATOM 8758  H HE2  . PHE A 1 127 ? -24.138 -0.169  -2.907  1.00 0.00 ? 127 PHE A HE2  3  
ATOM 8759  H HZ   . PHE A 1 127 ? -21.904 0.431   -3.787  1.00 0.00 ? 127 PHE A HZ   3  
ATOM 8760  N N    . PRO A 1 128 ? -21.315 1.751   3.914   1.00 0.00 ? 128 PRO A N    3  
ATOM 8761  C CA   . PRO A 1 128 ? -20.990 2.527   5.116   1.00 0.00 ? 128 PRO A CA   3  
ATOM 8762  C C    . PRO A 1 128 ? -21.985 3.647   5.385   1.00 0.00 ? 128 PRO A C    3  
ATOM 8763  O O    . PRO A 1 128 ? -22.656 4.131   4.474   1.00 0.00 ? 128 PRO A O    3  
ATOM 8764  C CB   . PRO A 1 128 ? -19.609 3.120   4.798   1.00 0.00 ? 128 PRO A CB   3  
ATOM 8765  C CG   . PRO A 1 128 ? -19.428 2.908   3.332   1.00 0.00 ? 128 PRO A CG   3  
ATOM 8766  C CD   . PRO A 1 128 ? -20.162 1.641   3.022   1.00 0.00 ? 128 PRO A CD   3  
ATOM 8767  H HA   . PRO A 1 128 ? -20.918 1.894   5.988   1.00 0.00 ? 128 PRO A HA   3  
ATOM 8768  H HB2  . PRO A 1 128 ? -19.601 4.171   5.051   1.00 0.00 ? 128 PRO A HB2  3  
ATOM 8769  H HB3  . PRO A 1 128 ? -18.852 2.601   5.368   1.00 0.00 ? 128 PRO A HB3  3  
ATOM 8770  H HG2  . PRO A 1 128 ? -19.860 3.734   2.787   1.00 0.00 ? 128 PRO A HG2  3  
ATOM 8771  H HG3  . PRO A 1 128 ? -18.383 2.808   3.098   1.00 0.00 ? 128 PRO A HG3  3  
ATOM 8772  H HD2  . PRO A 1 128 ? -20.473 1.619   1.986   1.00 0.00 ? 128 PRO A HD2  3  
ATOM 8773  H HD3  . PRO A 1 128 ? -19.562 0.778   3.265   1.00 0.00 ? 128 PRO A HD3  3  
ATOM 8774  N N    . SER A 1 129 ? -22.058 4.068   6.644   1.00 0.00 ? 129 SER A N    3  
ATOM 8775  C CA   . SER A 1 129 ? -22.952 5.147   7.036   1.00 0.00 ? 129 SER A CA   3  
ATOM 8776  C C    . SER A 1 129 ? -22.310 6.493   6.713   1.00 0.00 ? 129 SER A C    3  
ATOM 8777  O O    . SER A 1 129 ? -21.434 6.965   7.439   1.00 0.00 ? 129 SER A O    3  
ATOM 8778  C CB   . SER A 1 129 ? -23.270 5.062   8.530   1.00 0.00 ? 129 SER A CB   3  
ATOM 8779  O OG   . SER A 1 129 ? -22.185 4.505   9.253   1.00 0.00 ? 129 SER A OG   3  
ATOM 8780  H H    . SER A 1 129 ? -21.485 3.651   7.321   1.00 0.00 ? 129 SER A H    3  
ATOM 8781  H HA   . SER A 1 129 ? -23.869 5.045   6.470   1.00 0.00 ? 129 SER A HA   3  
ATOM 8782  H HB2  . SER A 1 129 ? -23.467 6.053   8.911   1.00 0.00 ? 129 SER A HB2  3  
ATOM 8783  H HB3  . SER A 1 129 ? -24.141 4.441   8.676   1.00 0.00 ? 129 SER A HB3  3  
ATOM 8784  H HG   . SER A 1 129 ? -21.390 5.015   9.081   1.00 0.00 ? 129 SER A HG   3  
ATOM 8785  N N    . ILE A 1 130 ? -22.745 7.100   5.617   1.00 0.00 ? 130 ILE A N    3  
ATOM 8786  C CA   . ILE A 1 130 ? -22.207 8.387   5.192   1.00 0.00 ? 130 ILE A CA   3  
ATOM 8787  C C    . ILE A 1 130 ? -23.308 9.307   4.680   1.00 0.00 ? 130 ILE A C    3  
ATOM 8788  O O    . ILE A 1 130 ? -24.262 8.858   4.045   1.00 0.00 ? 130 ILE A O    3  
ATOM 8789  C CB   . ILE A 1 130 ? -21.142 8.208   4.087   1.00 0.00 ? 130 ILE A CB   3  
ATOM 8790  C CG1  . ILE A 1 130 ? -20.688 9.572   3.540   1.00 0.00 ? 130 ILE A CG1  3  
ATOM 8791  C CG2  . ILE A 1 130 ? -21.679 7.317   2.974   1.00 0.00 ? 130 ILE A CG2  3  
ATOM 8792  C CD1  . ILE A 1 130 ? -21.476 10.059  2.336   1.00 0.00 ? 130 ILE A CD1  3  
ATOM 8793  H H    . ILE A 1 130 ? -23.444 6.668   5.085   1.00 0.00 ? 130 ILE A H    3  
ATOM 8794  H HA   . ILE A 1 130 ? -21.733 8.848   6.046   1.00 0.00 ? 130 ILE A HA   3  
ATOM 8795  H HB   . ILE A 1 130 ? -20.291 7.708   4.526   1.00 0.00 ? 130 ILE A HB   3  
ATOM 8796  H HG12 . ILE A 1 130 ? -20.789 10.313  4.318   1.00 0.00 ? 130 ILE A HG12 3  
ATOM 8797  H HG13 . ILE A 1 130 ? -19.649 9.505   3.250   1.00 0.00 ? 130 ILE A HG13 3  
ATOM 8798  H HG21 . ILE A 1 130 ? -21.676 6.289   3.302   1.00 0.00 ? 130 ILE A HG21 3  
ATOM 8799  H HG22 . ILE A 1 130 ? -21.053 7.418   2.100   1.00 0.00 ? 130 ILE A HG22 3  
ATOM 8800  H HG23 . ILE A 1 130 ? -22.688 7.615   2.730   1.00 0.00 ? 130 ILE A HG23 3  
ATOM 8801  H HD11 . ILE A 1 130 ? -22.522 10.142  2.592   1.00 0.00 ? 130 ILE A HD11 3  
ATOM 8802  H HD12 . ILE A 1 130 ? -21.361 9.357   1.524   1.00 0.00 ? 130 ILE A HD12 3  
ATOM 8803  H HD13 . ILE A 1 130 ? -21.104 11.026  2.030   1.00 0.00 ? 130 ILE A HD13 3  
ATOM 8804  N N    . VAL A 1 131 ? -23.163 10.599  4.957   1.00 0.00 ? 131 VAL A N    3  
ATOM 8805  C CA   . VAL A 1 131 ? -24.144 11.581  4.518   1.00 0.00 ? 131 VAL A CA   3  
ATOM 8806  C C    . VAL A 1 131 ? -23.737 12.214  3.190   1.00 0.00 ? 131 VAL A C    3  
ATOM 8807  O O    . VAL A 1 131 ? -22.901 13.117  3.148   1.00 0.00 ? 131 VAL A O    3  
ATOM 8808  C CB   . VAL A 1 131 ? -24.337 12.694  5.566   1.00 0.00 ? 131 VAL A CB   3  
ATOM 8809  C CG1  . VAL A 1 131 ? -25.169 12.188  6.734   1.00 0.00 ? 131 VAL A CG1  3  
ATOM 8810  C CG2  . VAL A 1 131 ? -22.992 13.218  6.046   1.00 0.00 ? 131 VAL A CG2  3  
ATOM 8811  H H    . VAL A 1 131 ? -22.381 10.895  5.467   1.00 0.00 ? 131 VAL A H    3  
ATOM 8812  H HA   . VAL A 1 131 ? -25.088 11.072  4.387   1.00 0.00 ? 131 VAL A HA   3  
ATOM 8813  H HB   . VAL A 1 131 ? -24.871 13.509  5.101   1.00 0.00 ? 131 VAL A HB   3  
ATOM 8814  H HG11 . VAL A 1 131 ? -25.452 13.021  7.362   1.00 0.00 ? 131 VAL A HG11 3  
ATOM 8815  H HG12 . VAL A 1 131 ? -24.589 11.484  7.312   1.00 0.00 ? 131 VAL A HG12 3  
ATOM 8816  H HG13 . VAL A 1 131 ? -26.058 11.701  6.360   1.00 0.00 ? 131 VAL A HG13 3  
ATOM 8817  H HG21 . VAL A 1 131 ? -22.776 12.814  7.024   1.00 0.00 ? 131 VAL A HG21 3  
ATOM 8818  H HG22 . VAL A 1 131 ? -23.026 14.296  6.102   1.00 0.00 ? 131 VAL A HG22 3  
ATOM 8819  H HG23 . VAL A 1 131 ? -22.220 12.917  5.353   1.00 0.00 ? 131 VAL A HG23 3  
ATOM 8820  N N    . GLU A 1 132 ? -24.328 11.711  2.108   1.00 0.00 ? 132 GLU A N    3  
ATOM 8821  C CA   . GLU A 1 132 ? -24.044 12.190  0.750   1.00 0.00 ? 132 GLU A CA   3  
ATOM 8822  C C    . GLU A 1 132 ? -23.876 13.706  0.692   1.00 0.00 ? 132 GLU A C    3  
ATOM 8823  O O    . GLU A 1 132 ? -23.173 14.228  -0.171  1.00 0.00 ? 132 GLU A O    3  
ATOM 8824  C CB   . GLU A 1 132 ? -25.158 11.764  -0.187  1.00 0.00 ? 132 GLU A CB   3  
ATOM 8825  C CG   . GLU A 1 132 ? -26.502 12.373  0.154   1.00 0.00 ? 132 GLU A CG   3  
ATOM 8826  C CD   . GLU A 1 132 ? -26.868 13.530  -0.755  1.00 0.00 ? 132 GLU A CD   3  
ATOM 8827  O OE1  . GLU A 1 132 ? -25.957 14.088  -1.403  1.00 0.00 ? 132 GLU A OE1  3  
ATOM 8828  O OE2  . GLU A 1 132 ? -28.066 13.878  -0.820  1.00 0.00 ? 132 GLU A OE2  3  
ATOM 8829  H H    . GLU A 1 132 ? -24.954 10.967  2.232   1.00 0.00 ? 132 GLU A H    3  
ATOM 8830  H HA   . GLU A 1 132 ? -23.123 11.728  0.426   1.00 0.00 ? 132 GLU A HA   3  
ATOM 8831  H HB2  . GLU A 1 132 ? -24.898 12.052  -1.192  1.00 0.00 ? 132 GLU A HB2  3  
ATOM 8832  H HB3  . GLU A 1 132 ? -25.252 10.696  -0.136  1.00 0.00 ? 132 GLU A HB3  3  
ATOM 8833  H HG2  . GLU A 1 132 ? -27.258 11.610  0.065   1.00 0.00 ? 132 GLU A HG2  3  
ATOM 8834  H HG3  . GLU A 1 132 ? -26.467 12.729  1.173   1.00 0.00 ? 132 GLU A HG3  3  
ATOM 8835  N N    . GLU A 1 133 ? -24.503 14.405  1.628   1.00 0.00 ? 133 GLU A N    3  
ATOM 8836  C CA   . GLU A 1 133 ? -24.393 15.865  1.700   1.00 0.00 ? 133 GLU A CA   3  
ATOM 8837  C C    . GLU A 1 133 ? -22.920 16.302  1.740   1.00 0.00 ? 133 GLU A C    3  
ATOM 8838  O O    . GLU A 1 133 ? -22.603 17.478  1.565   1.00 0.00 ? 133 GLU A O    3  
ATOM 8839  C CB   . GLU A 1 133 ? -25.127 16.390  2.935   1.00 0.00 ? 133 GLU A CB   3  
ATOM 8840  C CG   . GLU A 1 133 ? -24.549 15.883  4.246   1.00 0.00 ? 133 GLU A CG   3  
ATOM 8841  C CD   . GLU A 1 133 ? -23.830 16.968  5.024   1.00 0.00 ? 133 GLU A CD   3  
ATOM 8842  O OE1  . GLU A 1 133 ? -22.823 17.499  4.510   1.00 0.00 ? 133 GLU A OE1  3  
ATOM 8843  O OE2  . GLU A 1 133 ? -24.274 17.288  6.147   1.00 0.00 ? 133 GLU A OE2  3  
ATOM 8844  H H    . GLU A 1 133 ? -25.033 13.927  2.296   1.00 0.00 ? 133 GLU A H    3  
ATOM 8845  H HA   . GLU A 1 133 ? -24.855 16.276  0.815   1.00 0.00 ? 133 GLU A HA   3  
ATOM 8846  H HB2  . GLU A 1 133 ? -25.078 17.469  2.937   1.00 0.00 ? 133 GLU A HB2  3  
ATOM 8847  H HB3  . GLU A 1 133 ? -26.162 16.086  2.882   1.00 0.00 ? 133 GLU A HB3  3  
ATOM 8848  H HG2  . GLU A 1 133 ? -25.353 15.498  4.855   1.00 0.00 ? 133 GLU A HG2  3  
ATOM 8849  H HG3  . GLU A 1 133 ? -23.848 15.090  4.033   1.00 0.00 ? 133 GLU A HG3  3  
ATOM 8850  N N    . GLU A 1 134 ? -22.030 15.330  1.942   1.00 0.00 ? 134 GLU A N    3  
ATOM 8851  C CA   . GLU A 1 134 ? -20.593 15.572  1.975   1.00 0.00 ? 134 GLU A CA   3  
ATOM 8852  C C    . GLU A 1 134 ? -19.882 14.481  1.180   1.00 0.00 ? 134 GLU A C    3  
ATOM 8853  O O    . GLU A 1 134 ? -18.785 14.047  1.531   1.00 0.00 ? 134 GLU A O    3  
ATOM 8854  C CB   . GLU A 1 134 ? -20.082 15.596  3.417   1.00 0.00 ? 134 GLU A CB   3  
ATOM 8855  C CG   . GLU A 1 134 ? -20.572 14.429  4.257   1.00 0.00 ? 134 GLU A CG   3  
ATOM 8856  C CD   . GLU A 1 134 ? -19.600 14.054  5.359   1.00 0.00 ? 134 GLU A CD   3  
ATOM 8857  O OE1  . GLU A 1 134 ? -18.626 13.327  5.070   1.00 0.00 ? 134 GLU A OE1  3  
ATOM 8858  O OE2  . GLU A 1 134 ? -19.813 14.486  6.511   1.00 0.00 ? 134 GLU A OE2  3  
ATOM 8859  H H    . GLU A 1 134 ? -22.359 14.418  2.042   1.00 0.00 ? 134 GLU A H    3  
ATOM 8860  H HA   . GLU A 1 134 ? -20.403 16.528  1.510   1.00 0.00 ? 134 GLU A HA   3  
ATOM 8861  H HB2  . GLU A 1 134 ? -19.002 15.574  3.404   1.00 0.00 ? 134 GLU A HB2  3  
ATOM 8862  H HB3  . GLU A 1 134 ? -20.409 16.512  3.887   1.00 0.00 ? 134 GLU A HB3  3  
ATOM 8863  H HG2  . GLU A 1 134 ? -21.516 14.697  4.707   1.00 0.00 ? 134 GLU A HG2  3  
ATOM 8864  H HG3  . GLU A 1 134 ? -20.712 13.573  3.613   1.00 0.00 ? 134 GLU A HG3  3  
ATOM 8865  N N    . LEU A 1 135 ? -20.542 14.032  0.115   1.00 0.00 ? 135 LEU A N    3  
ATOM 8866  C CA   . LEU A 1 135 ? -20.020 12.976  -0.745  1.00 0.00 ? 135 LEU A CA   3  
ATOM 8867  C C    . LEU A 1 135 ? -18.838 13.453  -1.579  1.00 0.00 ? 135 LEU A C    3  
ATOM 8868  O O    . LEU A 1 135 ? -18.836 14.570  -2.096  1.00 0.00 ? 135 LEU A O    3  
ATOM 8869  C CB   . LEU A 1 135 ? -21.128 12.470  -1.673  1.00 0.00 ? 135 LEU A CB   3  
ATOM 8870  C CG   . LEU A 1 135 ? -21.020 11.002  -2.083  1.00 0.00 ? 135 LEU A CG   3  
ATOM 8871  C CD1  . LEU A 1 135 ? -20.904 10.115  -0.856  1.00 0.00 ? 135 LEU A CD1  3  
ATOM 8872  C CD2  . LEU A 1 135 ? -22.223 10.597  -2.921  1.00 0.00 ? 135 LEU A CD2  3  
ATOM 8873  H H    . LEU A 1 135 ? -21.418 14.417  -0.092  1.00 0.00 ? 135 LEU A H    3  
ATOM 8874  H HA   . LEU A 1 135 ? -19.696 12.163  -0.113  1.00 0.00 ? 135 LEU A HA   3  
ATOM 8875  H HB2  . LEU A 1 135 ? -22.076 12.613  -1.177  1.00 0.00 ? 135 LEU A HB2  3  
ATOM 8876  H HB3  . LEU A 1 135 ? -21.117 13.071  -2.570  1.00 0.00 ? 135 LEU A HB3  3  
ATOM 8877  H HG   . LEU A 1 135 ? -20.131 10.865  -2.680  1.00 0.00 ? 135 LEU A HG   3  
ATOM 8878  H HD11 . LEU A 1 135 ? -19.862 9.934   -0.640  1.00 0.00 ? 135 LEU A HD11 3  
ATOM 8879  H HD12 . LEU A 1 135 ? -21.403 9.175   -1.043  1.00 0.00 ? 135 LEU A HD12 3  
ATOM 8880  H HD13 . LEU A 1 135 ? -21.368 10.608  -0.016  1.00 0.00 ? 135 LEU A HD13 3  
ATOM 8881  H HD21 . LEU A 1 135 ? -22.139 9.554   -3.190  1.00 0.00 ? 135 LEU A HD21 3  
ATOM 8882  H HD22 . LEU A 1 135 ? -22.255 11.198  -3.818  1.00 0.00 ? 135 LEU A HD22 3  
ATOM 8883  H HD23 . LEU A 1 135 ? -23.129 10.750  -2.351  1.00 0.00 ? 135 LEU A HD23 3  
ATOM 8884  N N    . GLN A 1 136 ? -17.845 12.584  -1.721  1.00 0.00 ? 136 GLN A N    3  
ATOM 8885  C CA   . GLN A 1 136 ? -16.661 12.891  -2.511  1.00 0.00 ? 136 GLN A CA   3  
ATOM 8886  C C    . GLN A 1 136 ? -16.721 12.164  -3.851  1.00 0.00 ? 136 GLN A C    3  
ATOM 8887  O O    . GLN A 1 136 ? -16.171 12.630  -4.849  1.00 0.00 ? 136 GLN A O    3  
ATOM 8888  C CB   . GLN A 1 136 ? -15.394 12.492  -1.753  1.00 0.00 ? 136 GLN A CB   3  
ATOM 8889  C CG   . GLN A 1 136 ? -14.121 13.075  -2.346  1.00 0.00 ? 136 GLN A CG   3  
ATOM 8890  C CD   . GLN A 1 136 ? -13.916 14.529  -1.969  1.00 0.00 ? 136 GLN A CD   3  
ATOM 8891  O OE1  . GLN A 1 136 ? -13.397 14.837  -0.896  1.00 0.00 ? 136 GLN A OE1  3  
ATOM 8892  N NE2  . GLN A 1 136 ? -14.325 15.432  -2.852  1.00 0.00 ? 136 GLN A NE2  3  
ATOM 8893  H H    . GLN A 1 136 ? -17.918 11.704  -1.296  1.00 0.00 ? 136 GLN A H    3  
ATOM 8894  H HA   . GLN A 1 136 ? -16.647 13.956  -2.690  1.00 0.00 ? 136 GLN A HA   3  
ATOM 8895  H HB2  . GLN A 1 136 ? -15.477 12.832  -0.731  1.00 0.00 ? 136 GLN A HB2  3  
ATOM 8896  H HB3  . GLN A 1 136 ? -15.308 11.415  -1.759  1.00 0.00 ? 136 GLN A HB3  3  
ATOM 8897  H HG2  . GLN A 1 136 ? -13.278 12.504  -1.988  1.00 0.00 ? 136 GLN A HG2  3  
ATOM 8898  H HG3  . GLN A 1 136 ? -14.175 13.001  -3.422  1.00 0.00 ? 136 GLN A HG3  3  
ATOM 8899  H HE21 . GLN A 1 136 ? -14.730 15.114  -3.686  1.00 0.00 ? 136 GLN A HE21 3  
ATOM 8900  H HE22 . GLN A 1 136 ? -14.206 16.380  -2.634  1.00 0.00 ? 136 GLN A HE22 3  
ATOM 8901  N N    . PHE A 1 137 ? -17.398 11.017  -3.863  1.00 0.00 ? 137 PHE A N    3  
ATOM 8902  C CA   . PHE A 1 137 ? -17.536 10.219  -5.080  1.00 0.00 ? 137 PHE A CA   3  
ATOM 8903  C C    . PHE A 1 137 ? -18.994 10.091  -5.515  1.00 0.00 ? 137 PHE A C    3  
ATOM 8904  O O    . PHE A 1 137 ? -19.900 9.967   -4.692  1.00 0.00 ? 137 PHE A O    3  
ATOM 8905  C CB   . PHE A 1 137 ? -16.918 8.819   -4.903  1.00 0.00 ? 137 PHE A CB   3  
ATOM 8906  C CG   . PHE A 1 137 ? -17.608 7.910   -3.911  1.00 0.00 ? 137 PHE A CG   3  
ATOM 8907  C CD1  . PHE A 1 137 ? -18.565 8.381   -3.021  1.00 0.00 ? 137 PHE A CD1  3  
ATOM 8908  C CD2  . PHE A 1 137 ? -17.282 6.562   -3.875  1.00 0.00 ? 137 PHE A CD2  3  
ATOM 8909  C CE1  . PHE A 1 137 ? -19.178 7.527   -2.123  1.00 0.00 ? 137 PHE A CE1  3  
ATOM 8910  C CE2  . PHE A 1 137 ? -17.892 5.706   -2.979  1.00 0.00 ? 137 PHE A CE2  3  
ATOM 8911  C CZ   . PHE A 1 137 ? -18.841 6.189   -2.102  1.00 0.00 ? 137 PHE A CZ   3  
ATOM 8912  H H    . PHE A 1 137 ? -17.811 10.704  -3.034  1.00 0.00 ? 137 PHE A H    3  
ATOM 8913  H HA   . PHE A 1 137 ? -16.996 10.730  -5.863  1.00 0.00 ? 137 PHE A HA   3  
ATOM 8914  H HB2  . PHE A 1 137 ? -16.935 8.317   -5.856  1.00 0.00 ? 137 PHE A HB2  3  
ATOM 8915  H HB3  . PHE A 1 137 ? -15.892 8.925   -4.590  1.00 0.00 ? 137 PHE A HB3  3  
ATOM 8916  H HD1  . PHE A 1 137 ? -18.833 9.422   -3.032  1.00 0.00 ? 137 PHE A HD1  3  
ATOM 8917  H HD2  . PHE A 1 137 ? -16.539 6.181   -4.559  1.00 0.00 ? 137 PHE A HD2  3  
ATOM 8918  H HE1  . PHE A 1 137 ? -19.919 7.908   -1.437  1.00 0.00 ? 137 PHE A HE1  3  
ATOM 8919  H HE2  . PHE A 1 137 ? -17.626 4.660   -2.965  1.00 0.00 ? 137 PHE A HE2  3  
ATOM 8920  H HZ   . PHE A 1 137 ? -19.319 5.522   -1.401  1.00 0.00 ? 137 PHE A HZ   3  
ATOM 8921  N N    . ASP A 1 138 ? -19.209 10.096  -6.826  1.00 0.00 ? 138 ASP A N    3  
ATOM 8922  C CA   . ASP A 1 138 ? -20.548 9.948   -7.383  1.00 0.00 ? 138 ASP A CA   3  
ATOM 8923  C C    . ASP A 1 138 ? -20.746 8.500   -7.811  1.00 0.00 ? 138 ASP A C    3  
ATOM 8924  O O    . ASP A 1 138 ? -21.390 8.210   -8.819  1.00 0.00 ? 138 ASP A O    3  
ATOM 8925  C CB   . ASP A 1 138 ? -20.745 10.886  -8.576  1.00 0.00 ? 138 ASP A CB   3  
ATOM 8926  C CG   . ASP A 1 138 ? -21.323 12.227  -8.168  1.00 0.00 ? 138 ASP A CG   3  
ATOM 8927  O OD1  . ASP A 1 138 ? -22.296 12.241  -7.385  1.00 0.00 ? 138 ASP A OD1  3  
ATOM 8928  O OD2  . ASP A 1 138 ? -20.804 13.263  -8.633  1.00 0.00 ? 138 ASP A OD2  3  
ATOM 8929  H H    . ASP A 1 138 ? -18.445 10.179  -7.434  1.00 0.00 ? 138 ASP A H    3  
ATOM 8930  H HA   . ASP A 1 138 ? -21.263 10.191  -6.611  1.00 0.00 ? 138 ASP A HA   3  
ATOM 8931  H HB2  . ASP A 1 138 ? -19.792 11.057  -9.054  1.00 0.00 ? 138 ASP A HB2  3  
ATOM 8932  H HB3  . ASP A 1 138 ? -21.419 10.423  -9.282  1.00 0.00 ? 138 ASP A HB3  3  
ATOM 8933  N N    . LEU A 1 139 ? -20.153 7.600   -7.033  1.00 0.00 ? 139 LEU A N    3  
ATOM 8934  C CA   . LEU A 1 139 ? -20.209 6.173   -7.299  1.00 0.00 ? 139 LEU A CA   3  
ATOM 8935  C C    . LEU A 1 139 ? -21.592 5.598   -7.063  1.00 0.00 ? 139 LEU A C    3  
ATOM 8936  O O    . LEU A 1 139 ? -22.200 5.811   -6.015  1.00 0.00 ? 139 LEU A O    3  
ATOM 8937  C CB   . LEU A 1 139 ? -19.212 5.454   -6.399  1.00 0.00 ? 139 LEU A CB   3  
ATOM 8938  C CG   . LEU A 1 139 ? -18.326 4.424   -7.088  1.00 0.00 ? 139 LEU A CG   3  
ATOM 8939  C CD1  . LEU A 1 139 ? -17.504 5.078   -8.186  1.00 0.00 ? 139 LEU A CD1  3  
ATOM 8940  C CD2  . LEU A 1 139 ? -17.423 3.758   -6.066  1.00 0.00 ? 139 LEU A CD2  3  
ATOM 8941  H H    . LEU A 1 139 ? -19.644 7.911   -6.258  1.00 0.00 ? 139 LEU A H    3  
ATOM 8942  H HA   . LEU A 1 139 ? -19.931 6.012   -8.328  1.00 0.00 ? 139 LEU A HA   3  
ATOM 8943  H HB2  . LEU A 1 139 ? -18.576 6.197   -5.952  1.00 0.00 ? 139 LEU A HB2  3  
ATOM 8944  H HB3  . LEU A 1 139 ? -19.759 4.955   -5.613  1.00 0.00 ? 139 LEU A HB3  3  
ATOM 8945  H HG   . LEU A 1 139 ? -18.946 3.663   -7.538  1.00 0.00 ? 139 LEU A HG   3  
ATOM 8946  H HD11 . LEU A 1 139 ? -18.162 5.455   -8.954  1.00 0.00 ? 139 LEU A HD11 3  
ATOM 8947  H HD12 . LEU A 1 139 ? -16.833 4.347   -8.614  1.00 0.00 ? 139 LEU A HD12 3  
ATOM 8948  H HD13 . LEU A 1 139 ? -16.931 5.894   -7.768  1.00 0.00 ? 139 LEU A HD13 3  
ATOM 8949  H HD21 . LEU A 1 139 ? -16.842 4.514   -5.555  1.00 0.00 ? 139 LEU A HD21 3  
ATOM 8950  H HD22 . LEU A 1 139 ? -16.759 3.068   -6.566  1.00 0.00 ? 139 LEU A HD22 3  
ATOM 8951  H HD23 . LEU A 1 139 ? -18.027 3.221   -5.347  1.00 0.00 ? 139 LEU A HD23 3  
ATOM 8952  N N    . SER A 1 140 ? -22.069 4.848   -8.040  1.00 0.00 ? 140 SER A N    3  
ATOM 8953  C CA   . SER A 1 140 ? -23.370 4.211   -7.942  1.00 0.00 ? 140 SER A CA   3  
ATOM 8954  C C    . SER A 1 140 ? -23.216 2.704   -7.884  1.00 0.00 ? 140 SER A C    3  
ATOM 8955  O O    . SER A 1 140 ? -22.436 2.120   -8.636  1.00 0.00 ? 140 SER A O    3  
ATOM 8956  C CB   . SER A 1 140 ? -24.254 4.570   -9.138  1.00 0.00 ? 140 SER A CB   3  
ATOM 8957  O OG   . SER A 1 140 ? -24.764 5.887   -9.023  1.00 0.00 ? 140 SER A OG   3  
ATOM 8958  H H    . SER A 1 140 ? -21.529 4.709   -8.845  1.00 0.00 ? 140 SER A H    3  
ATOM 8959  H HA   . SER A 1 140 ? -23.844 4.552   -7.035  1.00 0.00 ? 140 SER A HA   3  
ATOM 8960  H HB2  . SER A 1 140 ? -23.674 4.498   -10.046 1.00 0.00 ? 140 SER A HB2  3  
ATOM 8961  H HB3  . SER A 1 140 ? -25.086 3.874   -9.186  1.00 0.00 ? 140 SER A HB3  3  
ATOM 8962  H HG   . SER A 1 140 ? -24.039 6.500   -8.877  1.00 0.00 ? 140 SER A HG   3  
ATOM 8963  N N    . LEU A 1 141 ? -23.982 2.074   -7.013  1.00 0.00 ? 141 LEU A N    3  
ATOM 8964  C CA   . LEU A 1 141 ? -23.944 0.637   -6.892  1.00 0.00 ? 141 LEU A CA   3  
ATOM 8965  C C    . LEU A 1 141 ? -24.935 0.038   -7.877  1.00 0.00 ? 141 LEU A C    3  
ATOM 8966  O O    . LEU A 1 141 ? -25.971 0.633   -8.173  1.00 0.00 ? 141 LEU A O    3  
ATOM 8967  C CB   . LEU A 1 141 ? -24.264 0.199   -5.457  1.00 0.00 ? 141 LEU A CB   3  
ATOM 8968  C CG   . LEU A 1 141 ? -24.177 -1.306  -5.193  1.00 0.00 ? 141 LEU A CG   3  
ATOM 8969  C CD1  . LEU A 1 141 ? -25.361 -2.024  -5.816  1.00 0.00 ? 141 LEU A CD1  3  
ATOM 8970  C CD2  . LEU A 1 141 ? -22.864 -1.872  -5.715  1.00 0.00 ? 141 LEU A CD2  3  
ATOM 8971  H H    . LEU A 1 141 ? -24.590 2.585   -6.450  1.00 0.00 ? 141 LEU A H    3  
ATOM 8972  H HA   . LEU A 1 141 ? -22.953 0.309   -7.153  1.00 0.00 ? 141 LEU A HA   3  
ATOM 8973  H HB2  . LEU A 1 141 ? -23.576 0.695   -4.792  1.00 0.00 ? 141 LEU A HB2  3  
ATOM 8974  H HB3  . LEU A 1 141 ? -25.265 0.524   -5.219  1.00 0.00 ? 141 LEU A HB3  3  
ATOM 8975  H HG   . LEU A 1 141 ? -24.213 -1.479  -4.128  1.00 0.00 ? 141 LEU A HG   3  
ATOM 8976  H HD11 . LEU A 1 141 ? -25.020 -2.632  -6.640  1.00 0.00 ? 141 LEU A HD11 3  
ATOM 8977  H HD12 . LEU A 1 141 ? -26.075 -1.297  -6.176  1.00 0.00 ? 141 LEU A HD12 3  
ATOM 8978  H HD13 . LEU A 1 141 ? -25.831 -2.653  -5.076  1.00 0.00 ? 141 LEU A HD13 3  
ATOM 8979  H HD21 . LEU A 1 141 ? -22.528 -1.293  -6.559  1.00 0.00 ? 141 LEU A HD21 3  
ATOM 8980  H HD22 . LEU A 1 141 ? -23.012 -2.895  -6.021  1.00 0.00 ? 141 LEU A HD22 3  
ATOM 8981  H HD23 . LEU A 1 141 ? -22.120 -1.833  -4.934  1.00 0.00 ? 141 LEU A HD23 3  
ATOM 8982  N N    . VAL A 1 142 ? -24.600 -1.131  -8.390  1.00 0.00 ? 142 VAL A N    3  
ATOM 8983  C CA   . VAL A 1 142 ? -25.444 -1.812  -9.358  1.00 0.00 ? 142 VAL A CA   3  
ATOM 8984  C C    . VAL A 1 142 ? -25.887 -3.166  -8.835  1.00 0.00 ? 142 VAL A C    3  
ATOM 8985  O O    . VAL A 1 142 ? -25.070 -4.004  -8.453  1.00 0.00 ? 142 VAL A O    3  
ATOM 8986  C CB   . VAL A 1 142 ? -24.728 -2.004  -10.709 1.00 0.00 ? 142 VAL A CB   3  
ATOM 8987  C CG1  . VAL A 1 142 ? -25.699 -2.542  -11.752 1.00 0.00 ? 142 VAL A CG1  3  
ATOM 8988  C CG2  . VAL A 1 142 ? -24.101 -0.697  -11.174 1.00 0.00 ? 142 VAL A CG2  3  
ATOM 8989  H H    . VAL A 1 142 ? -23.765 -1.545  -8.108  1.00 0.00 ? 142 VAL A H    3  
ATOM 8990  H HA   . VAL A 1 142 ? -26.320 -1.198  -9.526  1.00 0.00 ? 142 VAL A HA   3  
ATOM 8991  H HB   . VAL A 1 142 ? -23.940 -2.731  -10.576 1.00 0.00 ? 142 VAL A HB   3  
ATOM 8992  H HG11 . VAL A 1 142 ? -25.255 -3.390  -12.253 1.00 0.00 ? 142 VAL A HG11 3  
ATOM 8993  H HG12 . VAL A 1 142 ? -25.918 -1.770  -12.476 1.00 0.00 ? 142 VAL A HG12 3  
ATOM 8994  H HG13 . VAL A 1 142 ? -26.614 -2.852  -11.269 1.00 0.00 ? 142 VAL A HG13 3  
ATOM 8995  H HG21 . VAL A 1 142 ? -24.670 -0.298  -12.000 1.00 0.00 ? 142 VAL A HG21 3  
ATOM 8996  H HG22 . VAL A 1 142 ? -23.085 -0.879  -11.491 1.00 0.00 ? 142 VAL A HG22 3  
ATOM 8997  H HG23 . VAL A 1 142 ? -24.102 0.013   -10.360 1.00 0.00 ? 142 VAL A HG23 3  
ATOM 8998  N N    . ILE A 1 143 ? -27.189 -3.362  -8.822  1.00 0.00 ? 143 ILE A N    3  
ATOM 8999  C CA   . ILE A 1 143 ? -27.784 -4.598  -8.350  1.00 0.00 ? 143 ILE A CA   3  
ATOM 9000  C C    . ILE A 1 143 ? -28.169 -5.484  -9.536  1.00 0.00 ? 143 ILE A C    3  
ATOM 9001  O O    . ILE A 1 143 ? -29.178 -5.244  -10.188 1.00 0.00 ? 143 ILE A O    3  
ATOM 9002  C CB   . ILE A 1 143 ? -29.051 -4.336  -7.485  1.00 0.00 ? 143 ILE A CB   3  
ATOM 9003  C CG1  . ILE A 1 143 ? -29.438 -2.839  -7.448  1.00 0.00 ? 143 ILE A CG1  3  
ATOM 9004  C CG2  . ILE A 1 143 ? -28.849 -4.865  -6.078  1.00 0.00 ? 143 ILE A CG2  3  
ATOM 9005  C CD1  . ILE A 1 143 ? -28.359 -1.918  -6.908  1.00 0.00 ? 143 ILE A CD1  3  
ATOM 9006  H H    . ILE A 1 143 ? -27.772 -2.649  -9.141  1.00 0.00 ? 143 ILE A H    3  
ATOM 9007  H HA   . ILE A 1 143 ? -27.046 -5.113  -7.741  1.00 0.00 ? 143 ILE A HA   3  
ATOM 9008  H HB   . ILE A 1 143 ? -29.869 -4.891  -7.923  1.00 0.00 ? 143 ILE A HB   3  
ATOM 9009  H HG12 . ILE A 1 143 ? -29.683 -2.513  -8.442  1.00 0.00 ? 143 ILE A HG12 3  
ATOM 9010  H HG13 . ILE A 1 143 ? -30.308 -2.715  -6.824  1.00 0.00 ? 143 ILE A HG13 3  
ATOM 9011  H HG21 . ILE A 1 143 ? -28.032 -4.338  -5.609  1.00 0.00 ? 143 ILE A HG21 3  
ATOM 9012  H HG22 . ILE A 1 143 ? -28.623 -5.921  -6.121  1.00 0.00 ? 143 ILE A HG22 3  
ATOM 9013  H HG23 . ILE A 1 143 ? -29.752 -4.712  -5.507  1.00 0.00 ? 143 ILE A HG23 3  
ATOM 9014  H HD11 . ILE A 1 143 ? -28.811 -1.183  -6.256  1.00 0.00 ? 143 ILE A HD11 3  
ATOM 9015  H HD12 . ILE A 1 143 ? -27.865 -1.410  -7.730  1.00 0.00 ? 143 ILE A HD12 3  
ATOM 9016  H HD13 . ILE A 1 143 ? -27.636 -2.496  -6.356  1.00 0.00 ? 143 ILE A HD13 3  
ATOM 9017  N N    . GLU A 1 144 ? -27.368 -6.504  -9.819  1.00 0.00 ? 144 GLU A N    3  
ATOM 9018  C CA   . GLU A 1 144 ? -27.662 -7.399  -10.942 1.00 0.00 ? 144 GLU A CA   3  
ATOM 9019  C C    . GLU A 1 144 ? -28.376 -8.660  -10.452 1.00 0.00 ? 144 GLU A C    3  
ATOM 9020  O O    . GLU A 1 144 ? -27.786 -9.503  -9.777  1.00 0.00 ? 144 GLU A O    3  
ATOM 9021  C CB   . GLU A 1 144 ? -26.376 -7.743  -11.705 1.00 0.00 ? 144 GLU A CB   3  
ATOM 9022  C CG   . GLU A 1 144 ? -26.276 -7.069  -13.061 1.00 0.00 ? 144 GLU A CG   3  
ATOM 9023  C CD   . GLU A 1 144 ? -26.234 -5.560  -12.949 1.00 0.00 ? 144 GLU A CD   3  
ATOM 9024  O OE1  . GLU A 1 144 ? -26.675 -5.033  -11.906 1.00 0.00 ? 144 GLU A OE1  3  
ATOM 9025  O OE2  . GLU A 1 144 ? -25.771 -4.907  -13.904 1.00 0.00 ? 144 GLU A OE2  3  
ATOM 9026  H H    . GLU A 1 144 ? -26.569 -6.658  -9.267  1.00 0.00 ? 144 GLU A H    3  
ATOM 9027  H HA   . GLU A 1 144 ? -28.330 -6.874  -11.610 1.00 0.00 ? 144 GLU A HA   3  
ATOM 9028  H HB2  . GLU A 1 144 ? -25.531 -7.432  -11.120 1.00 0.00 ? 144 GLU A HB2  3  
ATOM 9029  H HB3  . GLU A 1 144 ? -26.325 -8.801  -11.853 1.00 0.00 ? 144 GLU A HB3  3  
ATOM 9030  H HG2  . GLU A 1 144 ? -25.375 -7.404  -13.551 1.00 0.00 ? 144 GLU A HG2  3  
ATOM 9031  H HG3  . GLU A 1 144 ? -27.134 -7.349  -13.654 1.00 0.00 ? 144 GLU A HG3  3  
ATOM 9032  N N    . GLU A 1 145 ? -29.667 -8.757  -10.778 1.00 0.00 ? 145 GLU A N    3  
ATOM 9033  C CA   . GLU A 1 145 ? -30.498 -9.885  -10.355 1.00 0.00 ? 145 GLU A CA   3  
ATOM 9034  C C    . GLU A 1 145 ? -30.502 -11.031 -11.375 1.00 0.00 ? 145 GLU A C    3  
ATOM 9035  O O    . GLU A 1 145 ? -30.995 -10.883 -12.493 1.00 0.00 ? 145 GLU A O    3  
ATOM 9036  C CB   . GLU A 1 145 ? -31.934 -9.399  -10.102 1.00 0.00 ? 145 GLU A CB   3  
ATOM 9037  C CG   . GLU A 1 145 ? -32.948 -10.517 -9.937  1.00 0.00 ? 145 GLU A CG   3  
ATOM 9038  C CD   . GLU A 1 145 ? -33.639 -10.873 -11.239 1.00 0.00 ? 145 GLU A CD   3  
ATOM 9039  O OE1  . GLU A 1 145 ? -34.620 -10.187 -11.598 1.00 0.00 ? 145 GLU A OE1  3  
ATOM 9040  O OE2  . GLU A 1 145 ? -33.201 -11.837 -11.900 1.00 0.00 ? 145 GLU A OE2  3  
ATOM 9041  H H    . GLU A 1 145 ? -30.079 -8.036  -11.299 1.00 0.00 ? 145 GLU A H    3  
ATOM 9042  H HA   . GLU A 1 145 ? -30.096 -10.255 -9.425  1.00 0.00 ? 145 GLU A HA   3  
ATOM 9043  H HB2  . GLU A 1 145 ? -31.944 -8.802  -9.204  1.00 0.00 ? 145 GLU A HB2  3  
ATOM 9044  H HB3  . GLU A 1 145 ? -32.247 -8.784  -10.931 1.00 0.00 ? 145 GLU A HB3  3  
ATOM 9045  H HG2  . GLU A 1 145 ? -32.439 -11.388 -9.566  1.00 0.00 ? 145 GLU A HG2  3  
ATOM 9046  H HG3  . GLU A 1 145 ? -33.696 -10.206 -9.225  1.00 0.00 ? 145 GLU A HG3  3  
ATOM 9047  N N    . GLN A 1 146 ? -29.963 -12.178 -10.961 1.00 0.00 ? 146 GLN A N    3  
ATOM 9048  C CA   . GLN A 1 146 ? -29.909 -13.372 -11.808 1.00 0.00 ? 146 GLN A CA   3  
ATOM 9049  C C    . GLN A 1 146 ? -30.887 -14.421 -11.286 1.00 0.00 ? 146 GLN A C    3  
ATOM 9050  O O    . GLN A 1 146 ? -30.484 -15.418 -10.690 1.00 0.00 ? 146 GLN A O    3  
ATOM 9051  C CB   . GLN A 1 146 ? -28.496 -13.939 -11.810 1.00 0.00 ? 146 GLN A CB   3  
ATOM 9052  C CG   . GLN A 1 146 ? -28.113 -14.642 -13.101 1.00 0.00 ? 146 GLN A CG   3  
ATOM 9053  C CD   . GLN A 1 146 ? -28.269 -16.149 -13.014 1.00 0.00 ? 146 GLN A CD   3  
ATOM 9054  O OE1  . GLN A 1 146 ? -28.840 -16.672 -12.057 1.00 0.00 ? 146 GLN A OE1  3  
ATOM 9055  N NE2  . GLN A 1 146 ? -27.760 -16.855 -14.016 1.00 0.00 ? 146 GLN A NE2  3  
ATOM 9056  H H    . GLN A 1 146 ? -29.594 -12.223 -10.053 1.00 0.00 ? 146 GLN A H    3  
ATOM 9057  H HA   . GLN A 1 146 ? -30.184 -13.088 -12.810 1.00 0.00 ? 146 GLN A HA   3  
ATOM 9058  H HB2  . GLN A 1 146 ? -27.813 -13.127 -11.651 1.00 0.00 ? 146 GLN A HB2  3  
ATOM 9059  H HB3  . GLN A 1 146 ? -28.402 -14.644 -10.997 1.00 0.00 ? 146 GLN A HB3  3  
ATOM 9060  H HG2  . GLN A 1 146 ? -28.741 -14.275 -13.898 1.00 0.00 ? 146 GLN A HG2  3  
ATOM 9061  H HG3  . GLN A 1 146 ? -27.080 -14.414 -13.322 1.00 0.00 ? 146 GLN A HG3  3  
ATOM 9062  H HE21 . GLN A 1 146 ? -27.317 -16.372 -14.745 1.00 0.00 ? 146 GLN A HE21 3  
ATOM 9063  H HE22 . GLN A 1 146 ? -27.846 -17.831 -13.986 1.00 0.00 ? 146 GLN A HE22 3  
ATOM 9064  N N    . SER A 1 147 ? -32.173 -14.151 -11.467 1.00 0.00 ? 147 SER A N    3  
ATOM 9065  C CA   . SER A 1 147 ? -33.235 -15.026 -10.955 1.00 0.00 ? 147 SER A CA   3  
ATOM 9066  C C    . SER A 1 147 ? -33.663 -16.127 -11.918 1.00 0.00 ? 147 SER A C    3  
ATOM 9067  O O    . SER A 1 147 ? -33.887 -15.897 -13.099 1.00 0.00 ? 147 SER A O    3  
ATOM 9068  C CB   . SER A 1 147 ? -34.452 -14.183 -10.554 1.00 0.00 ? 147 SER A CB   3  
ATOM 9069  O OG   . SER A 1 147 ? -35.429 -14.159 -11.576 1.00 0.00 ? 147 SER A OG   3  
ATOM 9070  H H    . SER A 1 147 ? -32.415 -13.313 -11.907 1.00 0.00 ? 147 SER A H    3  
ATOM 9071  H HA   . SER A 1 147 ? -32.858 -15.499 -10.071 1.00 0.00 ? 147 SER A HA   3  
ATOM 9072  H HB2  . SER A 1 147 ? -34.894 -14.598 -9.658  1.00 0.00 ? 147 SER A HB2  3  
ATOM 9073  H HB3  . SER A 1 147 ? -34.132 -13.170 -10.356 1.00 0.00 ? 147 SER A HB3  3  
ATOM 9074  H HG   . SER A 1 147 ? -36.107 -13.516 -11.357 1.00 0.00 ? 147 SER A HG   3  
ATOM 9075  N N    . GLU A 1 148 ? -33.809 -17.327 -11.363 1.00 0.00 ? 148 GLU A N    3  
ATOM 9076  C CA   . GLU A 1 148 ? -34.250 -18.500 -12.112 1.00 0.00 ? 148 GLU A CA   3  
ATOM 9077  C C    . GLU A 1 148 ? -33.578 -18.616 -13.483 1.00 0.00 ? 148 GLU A C    3  
ATOM 9078  O O    . GLU A 1 148 ? -34.220 -18.981 -14.467 1.00 0.00 ? 148 GLU A O    3  
ATOM 9079  C CB   . GLU A 1 148 ? -35.774 -18.462 -12.270 1.00 0.00 ? 148 GLU A CB   3  
ATOM 9080  C CG   . GLU A 1 148 ? -36.430 -19.833 -12.377 1.00 0.00 ? 148 GLU A CG   3  
ATOM 9081  C CD   . GLU A 1 148 ? -35.586 -20.848 -13.127 1.00 0.00 ? 148 GLU A CD   3  
ATOM 9082  O OE1  . GLU A 1 148 ? -34.754 -21.521 -12.482 1.00 0.00 ? 148 GLU A OE1  3  
ATOM 9083  O OE2  . GLU A 1 148 ? -35.758 -20.969 -14.358 1.00 0.00 ? 148 GLU A OE2  3  
ATOM 9084  H H    . GLU A 1 148 ? -33.637 -17.420 -10.402 1.00 0.00 ? 148 GLU A H    3  
ATOM 9085  H HA   . GLU A 1 148 ? -33.990 -19.371 -11.531 1.00 0.00 ? 148 GLU A HA   3  
ATOM 9086  H HB2  . GLU A 1 148 ? -36.198 -17.959 -11.409 1.00 0.00 ? 148 GLU A HB2  3  
ATOM 9087  H HB3  . GLU A 1 148 ? -36.018 -17.900 -13.159 1.00 0.00 ? 148 GLU A HB3  3  
ATOM 9088  H HG2  . GLU A 1 148 ? -36.612 -20.208 -11.381 1.00 0.00 ? 148 GLU A HG2  3  
ATOM 9089  H HG3  . GLU A 1 148 ? -37.372 -19.720 -12.894 1.00 0.00 ? 148 GLU A HG3  3  
ATOM 9090  N N    . GLY A 1 149 ? -32.282 -18.322 -13.543 1.00 0.00 ? 149 GLY A N    3  
ATOM 9091  C CA   . GLY A 1 149 ? -31.558 -18.428 -14.800 1.00 0.00 ? 149 GLY A CA   3  
ATOM 9092  C C    . GLY A 1 149 ? -31.642 -17.180 -15.661 1.00 0.00 ? 149 GLY A C    3  
ATOM 9093  O O    . GLY A 1 149 ? -31.047 -17.128 -16.738 1.00 0.00 ? 149 GLY A O    3  
ATOM 9094  H H    . GLY A 1 149 ? -31.808 -18.041 -12.732 1.00 0.00 ? 149 GLY A H    3  
ATOM 9095  H HA2  . GLY A 1 149 ? -30.519 -18.626 -14.583 1.00 0.00 ? 149 GLY A HA2  3  
ATOM 9096  H HA3  . GLY A 1 149 ? -31.958 -19.261 -15.359 1.00 0.00 ? 149 GLY A HA3  3  
ATOM 9097  N N    . ILE A 1 150 ? -32.369 -16.172 -15.196 1.00 0.00 ? 150 ILE A N    3  
ATOM 9098  C CA   . ILE A 1 150 ? -32.507 -14.929 -15.942 1.00 0.00 ? 150 ILE A CA   3  
ATOM 9099  C C    . ILE A 1 150 ? -31.633 -13.844 -15.325 1.00 0.00 ? 150 ILE A C    3  
ATOM 9100  O O    . ILE A 1 150 ? -31.644 -13.642 -14.111 1.00 0.00 ? 150 ILE A O    3  
ATOM 9101  C CB   . ILE A 1 150 ? -33.982 -14.458 -16.011 1.00 0.00 ? 150 ILE A CB   3  
ATOM 9102  C CG1  . ILE A 1 150 ? -34.410 -13.770 -14.699 1.00 0.00 ? 150 ILE A CG1  3  
ATOM 9103  C CG2  . ILE A 1 150 ? -34.887 -15.639 -16.343 1.00 0.00 ? 150 ILE A CG2  3  
ATOM 9104  C CD1  . ILE A 1 150 ? -35.770 -14.189 -14.171 1.00 0.00 ? 150 ILE A CD1  3  
ATOM 9105  H H    . ILE A 1 150 ? -32.816 -16.260 -14.333 1.00 0.00 ? 150 ILE A H    3  
ATOM 9106  H HA   . ILE A 1 150 ? -32.165 -15.114 -16.951 1.00 0.00 ? 150 ILE A HA   3  
ATOM 9107  H HB   . ILE A 1 150 ? -34.063 -13.747 -16.821 1.00 0.00 ? 150 ILE A HB   3  
ATOM 9108  H HG12 . ILE A 1 150 ? -33.685 -13.989 -13.934 1.00 0.00 ? 150 ILE A HG12 3  
ATOM 9109  H HG13 . ILE A 1 150 ? -34.435 -12.702 -14.860 1.00 0.00 ? 150 ILE A HG13 3  
ATOM 9110  H HG21 . ILE A 1 150 ? -34.590 -16.066 -17.289 1.00 0.00 ? 150 ILE A HG21 3  
ATOM 9111  H HG22 . ILE A 1 150 ? -35.911 -15.301 -16.407 1.00 0.00 ? 150 ILE A HG22 3  
ATOM 9112  H HG23 . ILE A 1 150 ? -34.803 -16.386 -15.568 1.00 0.00 ? 150 ILE A HG23 3  
ATOM 9113  H HD11 . ILE A 1 150 ? -36.446 -14.354 -14.996 1.00 0.00 ? 150 ILE A HD11 3  
ATOM 9114  H HD12 . ILE A 1 150 ? -36.162 -13.410 -13.535 1.00 0.00 ? 150 ILE A HD12 3  
ATOM 9115  H HD13 . ILE A 1 150 ? -35.671 -15.101 -13.597 1.00 0.00 ? 150 ILE A HD13 3  
ATOM 9116  N N    . VAL A 1 151 ? -30.870 -13.155 -16.165 1.00 0.00 ? 151 VAL A N    3  
ATOM 9117  C CA   . VAL A 1 151 ? -29.984 -12.101 -15.694 1.00 0.00 ? 151 VAL A CA   3  
ATOM 9118  C C    . VAL A 1 151 ? -30.647 -10.735 -15.799 1.00 0.00 ? 151 VAL A C    3  
ATOM 9119  O O    . VAL A 1 151 ? -31.352 -10.447 -16.766 1.00 0.00 ? 151 VAL A O    3  
ATOM 9120  C CB   . VAL A 1 151 ? -28.665 -12.081 -16.488 1.00 0.00 ? 151 VAL A CB   3  
ATOM 9121  C CG1  . VAL A 1 151 ? -27.793 -13.267 -16.107 1.00 0.00 ? 151 VAL A CG1  3  
ATOM 9122  C CG2  . VAL A 1 151 ? -28.943 -12.073 -17.983 1.00 0.00 ? 151 VAL A CG2  3  
ATOM 9123  H H    . VAL A 1 151 ? -30.902 -13.358 -17.123 1.00 0.00 ? 151 VAL A H    3  
ATOM 9124  H HA   . VAL A 1 151 ? -29.752 -12.299 -14.657 1.00 0.00 ? 151 VAL A HA   3  
ATOM 9125  H HB   . VAL A 1 151 ? -28.131 -11.176 -16.238 1.00 0.00 ? 151 VAL A HB   3  
ATOM 9126  H HG11 . VAL A 1 151 ? -27.186 -13.008 -15.252 1.00 0.00 ? 151 VAL A HG11 3  
ATOM 9127  H HG12 . VAL A 1 151 ? -27.153 -13.525 -16.937 1.00 0.00 ? 151 VAL A HG12 3  
ATOM 9128  H HG13 . VAL A 1 151 ? -28.420 -14.111 -15.861 1.00 0.00 ? 151 VAL A HG13 3  
ATOM 9129  H HG21 . VAL A 1 151 ? -29.752 -11.391 -18.196 1.00 0.00 ? 151 VAL A HG21 3  
ATOM 9130  H HG22 . VAL A 1 151 ? -29.217 -13.068 -18.303 1.00 0.00 ? 151 VAL A HG22 3  
ATOM 9131  H HG23 . VAL A 1 151 ? -28.056 -11.756 -18.513 1.00 0.00 ? 151 VAL A HG23 3  
ATOM 9132  N N    . LYS A 1 152 ? -30.412 -9.894  -14.799 1.00 0.00 ? 152 LYS A N    3  
ATOM 9133  C CA   . LYS A 1 152 ? -30.977 -8.556  -14.777 1.00 0.00 ? 152 LYS A CA   3  
ATOM 9134  C C    . LYS A 1 152 ? -29.971 -7.581  -14.190 1.00 0.00 ? 152 LYS A C    3  
ATOM 9135  O O    . LYS A 1 152 ? -29.249 -7.915  -13.252 1.00 0.00 ? 152 LYS A O    3  
ATOM 9136  C CB   . LYS A 1 152 ? -32.275 -8.535  -13.965 1.00 0.00 ? 152 LYS A CB   3  
ATOM 9137  C CG   . LYS A 1 152 ? -33.508 -8.232  -14.800 1.00 0.00 ? 152 LYS A CG   3  
ATOM 9138  C CD   . LYS A 1 152 ? -33.429 -6.851  -15.432 1.00 0.00 ? 152 LYS A CD   3  
ATOM 9139  C CE   . LYS A 1 152 ? -34.403 -6.712  -16.591 1.00 0.00 ? 152 LYS A CE   3  
ATOM 9140  N NZ   . LYS A 1 152 ? -34.279 -5.391  -17.266 1.00 0.00 ? 152 LYS A NZ   3  
ATOM 9141  H H    . LYS A 1 152 ? -29.836 -10.178 -14.057 1.00 0.00 ? 152 LYS A H    3  
ATOM 9142  H HA   . LYS A 1 152 ? -31.191 -8.268  -15.796 1.00 0.00 ? 152 LYS A HA   3  
ATOM 9143  H HB2  . LYS A 1 152 ? -32.410 -9.499  -13.499 1.00 0.00 ? 152 LYS A HB2  3  
ATOM 9144  H HB3  . LYS A 1 152 ? -32.195 -7.781  -13.194 1.00 0.00 ? 152 LYS A HB3  3  
ATOM 9145  H HG2  . LYS A 1 152 ? -33.591 -8.970  -15.583 1.00 0.00 ? 152 LYS A HG2  3  
ATOM 9146  H HG3  . LYS A 1 152 ? -34.381 -8.278  -14.165 1.00 0.00 ? 152 LYS A HG3  3  
ATOM 9147  H HD2  . LYS A 1 152 ? -33.666 -6.109  -14.685 1.00 0.00 ? 152 LYS A HD2  3  
ATOM 9148  H HD3  . LYS A 1 152 ? -32.425 -6.690  -15.796 1.00 0.00 ? 152 LYS A HD3  3  
ATOM 9149  H HE2  . LYS A 1 152 ? -34.201 -7.493  -17.309 1.00 0.00 ? 152 LYS A HE2  3  
ATOM 9150  H HE3  . LYS A 1 152 ? -35.409 -6.822  -16.214 1.00 0.00 ? 152 LYS A HE3  3  
ATOM 9151  H HZ1  . LYS A 1 152 ? -33.885 -4.689  -16.607 1.00 0.00 ? 152 LYS A HZ1  3  
ATOM 9152  H HZ2  . LYS A 1 152 ? -35.212 -5.064  -17.586 1.00 0.00 ? 152 LYS A HZ2  3  
ATOM 9153  H HZ3  . LYS A 1 152 ? -33.649 -5.468  -18.090 1.00 0.00 ? 152 LYS A HZ3  3  
ATOM 9154  N N    . LYS A 1 153 ? -29.926 -6.377  -14.741 1.00 0.00 ? 153 LYS A N    3  
ATOM 9155  C CA   . LYS A 1 153 ? -29.001 -5.363  -14.260 1.00 0.00 ? 153 LYS A CA   3  
ATOM 9156  C C    . LYS A 1 153 ? -29.763 -4.177  -13.678 1.00 0.00 ? 153 LYS A C    3  
ATOM 9157  O O    . LYS A 1 153 ? -30.135 -3.247  -14.394 1.00 0.00 ? 153 LYS A O    3  
ATOM 9158  C CB   . LYS A 1 153 ? -28.084 -4.894  -15.391 1.00 0.00 ? 153 LYS A CB   3  
ATOM 9159  C CG   . LYS A 1 153 ? -28.833 -4.461  -16.642 1.00 0.00 ? 153 LYS A CG   3  
ATOM 9160  C CD   . LYS A 1 153 ? -28.505 -5.356  -17.828 1.00 0.00 ? 153 LYS A CD   3  
ATOM 9161  C CE   . LYS A 1 153 ? -27.485 -4.708  -18.752 1.00 0.00 ? 153 LYS A CE   3  
ATOM 9162  N NZ   . LYS A 1 153 ? -26.454 -5.680  -19.211 1.00 0.00 ? 153 LYS A NZ   3  
ATOM 9163  H H    . LYS A 1 153 ? -30.530 -6.167  -15.483 1.00 0.00 ? 153 LYS A H    3  
ATOM 9164  H HA   . LYS A 1 153 ? -28.398 -5.814  -13.476 1.00 0.00 ? 153 LYS A HA   3  
ATOM 9165  H HB2  . LYS A 1 153 ? -27.499 -4.057  -15.040 1.00 0.00 ? 153 LYS A HB2  3  
ATOM 9166  H HB3  . LYS A 1 153 ? -27.417 -5.702  -15.656 1.00 0.00 ? 153 LYS A HB3  3  
ATOM 9167  H HG2  . LYS A 1 153 ? -29.894 -4.511  -16.450 1.00 0.00 ? 153 LYS A HG2  3  
ATOM 9168  H HG3  . LYS A 1 153 ? -28.556 -3.445  -16.882 1.00 0.00 ? 153 LYS A HG3  3  
ATOM 9169  H HD2  . LYS A 1 153 ? -28.103 -6.288  -17.463 1.00 0.00 ? 153 LYS A HD2  3  
ATOM 9170  H HD3  . LYS A 1 153 ? -29.412 -5.546  -18.384 1.00 0.00 ? 153 LYS A HD3  3  
ATOM 9171  H HE2  . LYS A 1 153 ? -28.000 -4.311  -19.614 1.00 0.00 ? 153 LYS A HE2  3  
ATOM 9172  H HE3  . LYS A 1 153 ? -26.998 -3.903  -18.223 1.00 0.00 ? 153 LYS A HE3  3  
ATOM 9173  H HZ1  . LYS A 1 153 ? -26.172 -5.468  -20.189 1.00 0.00 ? 153 LYS A HZ1  3  
ATOM 9174  H HZ2  . LYS A 1 153 ? -26.832 -6.648  -19.173 1.00 0.00 ? 153 LYS A HZ2  3  
ATOM 9175  H HZ3  . LYS A 1 153 ? -25.614 -5.625  -18.600 1.00 0.00 ? 153 LYS A HZ3  3  
ATOM 9176  N N    . HIS A 1 154 ? -29.986 -4.224  -12.373 1.00 0.00 ? 154 HIS A N    3  
ATOM 9177  C CA   . HIS A 1 154 ? -30.700 -3.163  -11.673 1.00 0.00 ? 154 HIS A CA   3  
ATOM 9178  C C    . HIS A 1 154 ? -29.722 -2.097  -11.191 1.00 0.00 ? 154 HIS A C    3  
ATOM 9179  O O    . HIS A 1 154 ? -28.795 -2.397  -10.455 1.00 0.00 ? 154 HIS A O    3  
ATOM 9180  C CB   . HIS A 1 154 ? -31.473 -3.749  -10.483 1.00 0.00 ? 154 HIS A CB   3  
ATOM 9181  C CG   . HIS A 1 154 ? -32.597 -4.656  -10.890 1.00 0.00 ? 154 HIS A CG   3  
ATOM 9182  N ND1  . HIS A 1 154 ? -33.669 -4.229  -11.645 1.00 0.00 ? 154 HIS A ND1  3  
ATOM 9183  C CD2  . HIS A 1 154 ? -32.811 -5.977  -10.650 1.00 0.00 ? 154 HIS A CD2  3  
ATOM 9184  C CE1  . HIS A 1 154 ? -34.493 -5.242  -11.851 1.00 0.00 ? 154 HIS A CE1  3  
ATOM 9185  N NE2  . HIS A 1 154 ? -33.995 -6.312  -11.258 1.00 0.00 ? 154 HIS A NE2  3  
ATOM 9186  H H    . HIS A 1 154 ? -29.658 -4.997  -11.871 1.00 0.00 ? 154 HIS A H    3  
ATOM 9187  H HA   . HIS A 1 154 ? -31.398 -2.715  -12.364 1.00 0.00 ? 154 HIS A HA   3  
ATOM 9188  H HB2  . HIS A 1 154 ? -30.797 -4.319  -9.868  1.00 0.00 ? 154 HIS A HB2  3  
ATOM 9189  H HB3  . HIS A 1 154 ? -31.885 -2.943  -9.893  1.00 0.00 ? 154 HIS A HB3  3  
ATOM 9190  H HD1  . HIS A 1 154 ? -33.806 -3.318  -11.981 1.00 0.00 ? 154 HIS A HD1  3  
ATOM 9191  H HD2  . HIS A 1 154 ? -32.168 -6.645  -10.088 1.00 0.00 ? 154 HIS A HD2  3  
ATOM 9192  H HE1  . HIS A 1 154 ? -35.416 -5.202  -12.409 1.00 0.00 ? 154 HIS A HE1  3  
ATOM 9193  H HE2  . HIS A 1 154 ? -34.361 -7.218  -11.330 1.00 0.00 ? 154 HIS A HE2  3  
ATOM 9194  N N    . LYS A 1 155 ? -29.926 -0.853  -11.612 1.00 0.00 ? 155 LYS A N    3  
ATOM 9195  C CA   . LYS A 1 155 ? -29.043 0.238   -11.204 1.00 0.00 ? 155 LYS A CA   3  
ATOM 9196  C C    . LYS A 1 155 ? -29.846 1.381   -10.586 1.00 0.00 ? 155 LYS A C    3  
ATOM 9197  O O    . LYS A 1 155 ? -30.149 2.375   -11.246 1.00 0.00 ? 155 LYS A O    3  
ATOM 9198  C CB   . LYS A 1 155 ? -28.218 0.739   -12.390 1.00 0.00 ? 155 LYS A CB   3  
ATOM 9199  C CG   . LYS A 1 155 ? -29.043 1.031   -13.632 1.00 0.00 ? 155 LYS A CG   3  
ATOM 9200  C CD   . LYS A 1 155 ? -28.966 2.498   -14.025 1.00 0.00 ? 155 LYS A CD   3  
ATOM 9201  C CE   . LYS A 1 155 ? -29.781 2.784   -15.277 1.00 0.00 ? 155 LYS A CE   3  
ATOM 9202  N NZ   . LYS A 1 155 ? -28.916 2.937   -16.480 1.00 0.00 ? 155 LYS A NZ   3  
ATOM 9203  H H    . LYS A 1 155 ? -30.682 -0.664  -12.206 1.00 0.00 ? 155 LYS A H    3  
ATOM 9204  H HA   . LYS A 1 155 ? -28.371 -0.152  -10.453 1.00 0.00 ? 155 LYS A HA   3  
ATOM 9205  H HB2  . LYS A 1 155 ? -27.706 1.644   -12.098 1.00 0.00 ? 155 LYS A HB2  3  
ATOM 9206  H HB3  . LYS A 1 155 ? -27.483 -0.011  -12.642 1.00 0.00 ? 155 LYS A HB3  3  
ATOM 9207  H HG2  . LYS A 1 155 ? -28.669 0.430   -14.447 1.00 0.00 ? 155 LYS A HG2  3  
ATOM 9208  H HG3  . LYS A 1 155 ? -30.074 0.773   -13.436 1.00 0.00 ? 155 LYS A HG3  3  
ATOM 9209  H HD2  . LYS A 1 155 ? -29.350 3.098   -13.214 1.00 0.00 ? 155 LYS A HD2  3  
ATOM 9210  H HD3  . LYS A 1 155 ? -27.934 2.757   -14.210 1.00 0.00 ? 155 LYS A HD3  3  
ATOM 9211  H HE2  . LYS A 1 155 ? -30.467 1.967   -15.441 1.00 0.00 ? 155 LYS A HE2  3  
ATOM 9212  H HE3  . LYS A 1 155 ? -30.338 3.697   -15.127 1.00 0.00 ? 155 LYS A HE3  3  
ATOM 9213  H HZ1  . LYS A 1 155 ? -28.186 2.196   -16.492 1.00 0.00 ? 155 LYS A HZ1  3  
ATOM 9214  H HZ2  . LYS A 1 155 ? -28.450 3.866   -16.469 1.00 0.00 ? 155 LYS A HZ2  3  
ATOM 9215  H HZ3  . LYS A 1 155 ? -29.489 2.859   -17.344 1.00 0.00 ? 155 LYS A HZ3  3  
ATOM 9216  N N    . PRO A 1 156 ? -30.214 1.229   -9.304  1.00 0.00 ? 156 PRO A N    3  
ATOM 9217  C CA   . PRO A 1 156 ? -31.009 2.219   -8.562  1.00 0.00 ? 156 PRO A CA   3  
ATOM 9218  C C    . PRO A 1 156 ? -30.346 3.587   -8.471  1.00 0.00 ? 156 PRO A C    3  
ATOM 9219  O O    . PRO A 1 156 ? -29.176 3.748   -8.817  1.00 0.00 ? 156 PRO A O    3  
ATOM 9220  C CB   . PRO A 1 156 ? -31.119 1.603   -7.166  1.00 0.00 ? 156 PRO A CB   3  
ATOM 9221  C CG   . PRO A 1 156 ? -30.933 0.151   -7.398  1.00 0.00 ? 156 PRO A CG   3  
ATOM 9222  C CD   . PRO A 1 156 ? -29.907 0.056   -8.476  1.00 0.00 ? 156 PRO A CD   3  
ATOM 9223  H HA   . PRO A 1 156 ? -31.992 2.318   -8.979  1.00 0.00 ? 156 PRO A HA   3  
ATOM 9224  H HB2  . PRO A 1 156 ? -30.347 2.007   -6.527  1.00 0.00 ? 156 PRO A HB2  3  
ATOM 9225  H HB3  . PRO A 1 156 ? -32.091 1.816   -6.748  1.00 0.00 ? 156 PRO A HB3  3  
ATOM 9226  H HG2  . PRO A 1 156 ? -30.585 -0.331  -6.497  1.00 0.00 ? 156 PRO A HG2  3  
ATOM 9227  H HG3  . PRO A 1 156 ? -31.859 -0.283  -7.732  1.00 0.00 ? 156 PRO A HG3  3  
ATOM 9228  H HD2  . PRO A 1 156 ? -28.917 0.119   -8.058  1.00 0.00 ? 156 PRO A HD2  3  
ATOM 9229  H HD3  . PRO A 1 156 ? -30.027 -0.855  -9.039  1.00 0.00 ? 156 PRO A HD3  3  
ATOM 9230  N N    . GLU A 1 157 ? -31.100 4.567   -7.976  1.00 0.00 ? 157 GLU A N    3  
ATOM 9231  C CA   . GLU A 1 157 ? -30.581 5.918   -7.807  1.00 0.00 ? 157 GLU A CA   3  
ATOM 9232  C C    . GLU A 1 157 ? -29.668 5.956   -6.591  1.00 0.00 ? 157 GLU A C    3  
ATOM 9233  O O    . GLU A 1 157 ? -30.133 6.000   -5.452  1.00 0.00 ? 157 GLU A O    3  
ATOM 9234  C CB   . GLU A 1 157 ? -31.725 6.919   -7.641  1.00 0.00 ? 157 GLU A CB   3  
ATOM 9235  C CG   . GLU A 1 157 ? -32.438 7.248   -8.943  1.00 0.00 ? 157 GLU A CG   3  
ATOM 9236  C CD   . GLU A 1 157 ? -33.804 6.597   -9.041  1.00 0.00 ? 157 GLU A CD   3  
ATOM 9237  O OE1  . GLU A 1 157 ? -34.439 6.388   -7.987  1.00 0.00 ? 157 GLU A OE1  3  
ATOM 9238  O OE2  . GLU A 1 157 ? -34.238 6.297   -10.173 1.00 0.00 ? 157 GLU A OE2  3  
ATOM 9239  H H    . GLU A 1 157 ? -32.020 4.371   -7.701  1.00 0.00 ? 157 GLU A H    3  
ATOM 9240  H HA   . GLU A 1 157 ? -30.007 6.171   -8.687  1.00 0.00 ? 157 GLU A HA   3  
ATOM 9241  H HB2  . GLU A 1 157 ? -32.450 6.511   -6.952  1.00 0.00 ? 157 GLU A HB2  3  
ATOM 9242  H HB3  . GLU A 1 157 ? -31.329 7.837   -7.232  1.00 0.00 ? 157 GLU A HB3  3  
ATOM 9243  H HG2  . GLU A 1 157 ? -32.560 8.318   -9.012  1.00 0.00 ? 157 GLU A HG2  3  
ATOM 9244  H HG3  . GLU A 1 157 ? -31.831 6.902   -9.767  1.00 0.00 ? 157 GLU A HG3  3  
ATOM 9245  N N    . ILE A 1 158 ? -28.369 5.899   -6.840  1.00 0.00 ? 158 ILE A N    3  
ATOM 9246  C CA   . ILE A 1 158 ? -27.383 5.884   -5.770  1.00 0.00 ? 158 ILE A CA   3  
ATOM 9247  C C    . ILE A 1 158 ? -26.989 7.288   -5.319  1.00 0.00 ? 158 ILE A C    3  
ATOM 9248  O O    . ILE A 1 158 ? -26.134 7.443   -4.447  1.00 0.00 ? 158 ILE A O    3  
ATOM 9249  C CB   . ILE A 1 158 ? -26.129 5.106   -6.208  1.00 0.00 ? 158 ILE A CB   3  
ATOM 9250  C CG1  . ILE A 1 158 ? -26.546 3.801   -6.902  1.00 0.00 ? 158 ILE A CG1  3  
ATOM 9251  C CG2  . ILE A 1 158 ? -25.217 4.831   -5.015  1.00 0.00 ? 158 ILE A CG2  3  
ATOM 9252  C CD1  . ILE A 1 158 ? -26.922 2.685   -5.948  1.00 0.00 ? 158 ILE A CD1  3  
ATOM 9253  H H    . ILE A 1 158 ? -28.062 5.835   -7.768  1.00 0.00 ? 158 ILE A H    3  
ATOM 9254  H HA   . ILE A 1 158 ? -27.820 5.363   -4.930  1.00 0.00 ? 158 ILE A HA   3  
ATOM 9255  H HB   . ILE A 1 158 ? -25.583 5.718   -6.910  1.00 0.00 ? 158 ILE A HB   3  
ATOM 9256  H HG12 . ILE A 1 158 ? -27.400 3.993   -7.531  1.00 0.00 ? 158 ILE A HG12 3  
ATOM 9257  H HG13 . ILE A 1 158 ? -25.734 3.453   -7.516  1.00 0.00 ? 158 ILE A HG13 3  
ATOM 9258  H HG21 . ILE A 1 158 ? -24.287 5.365   -5.142  1.00 0.00 ? 158 ILE A HG21 3  
ATOM 9259  H HG22 . ILE A 1 158 ? -25.016 3.770   -4.951  1.00 0.00 ? 158 ILE A HG22 3  
ATOM 9260  H HG23 . ILE A 1 158 ? -25.700 5.160   -4.107  1.00 0.00 ? 158 ILE A HG23 3  
ATOM 9261  H HD11 . ILE A 1 158 ? -26.324 1.809   -6.163  1.00 0.00 ? 158 ILE A HD11 3  
ATOM 9262  H HD12 . ILE A 1 158 ? -27.968 2.445   -6.068  1.00 0.00 ? 158 ILE A HD12 3  
ATOM 9263  H HD13 . ILE A 1 158 ? -26.740 3.006   -4.931  1.00 0.00 ? 158 ILE A HD13 3  
ATOM 9264  N N    . LYS A 1 159 ? -27.617 8.308   -5.901  1.00 0.00 ? 159 LYS A N    3  
ATOM 9265  C CA   . LYS A 1 159 ? -27.324 9.688   -5.531  1.00 0.00 ? 159 LYS A CA   3  
ATOM 9266  C C    . LYS A 1 159 ? -27.770 9.955   -4.095  1.00 0.00 ? 159 LYS A C    3  
ATOM 9267  O O    . LYS A 1 159 ? -28.770 10.633  -3.858  1.00 0.00 ? 159 LYS A O    3  
ATOM 9268  C CB   . LYS A 1 159 ? -28.020 10.657  -6.491  1.00 0.00 ? 159 LYS A CB   3  
ATOM 9269  C CG   . LYS A 1 159 ? -27.075 11.316  -7.483  1.00 0.00 ? 159 LYS A CG   3  
ATOM 9270  C CD   . LYS A 1 159 ? -27.801 11.737  -8.750  1.00 0.00 ? 159 LYS A CD   3  
ATOM 9271  C CE   . LYS A 1 159 ? -28.192 13.205  -8.706  1.00 0.00 ? 159 LYS A CE   3  
ATOM 9272  N NZ   . LYS A 1 159 ? -27.000 14.098  -8.687  1.00 0.00 ? 159 LYS A NZ   3  
ATOM 9273  H H    . LYS A 1 159 ? -28.292 8.131   -6.588  1.00 0.00 ? 159 LYS A H    3  
ATOM 9274  H HA   . LYS A 1 159 ? -26.255 9.831   -5.597  1.00 0.00 ? 159 LYS A HA   3  
ATOM 9275  H HB2  . LYS A 1 159 ? -28.770 10.116  -7.049  1.00 0.00 ? 159 LYS A HB2  3  
ATOM 9276  H HB3  . LYS A 1 159 ? -28.503 11.434  -5.917  1.00 0.00 ? 159 LYS A HB3  3  
ATOM 9277  H HG2  . LYS A 1 159 ? -26.638 12.190  -7.023  1.00 0.00 ? 159 LYS A HG2  3  
ATOM 9278  H HG3  . LYS A 1 159 ? -26.294 10.615  -7.741  1.00 0.00 ? 159 LYS A HG3  3  
ATOM 9279  H HD2  . LYS A 1 159 ? -27.151 11.573  -9.597  1.00 0.00 ? 159 LYS A HD2  3  
ATOM 9280  H HD3  . LYS A 1 159 ? -28.694 11.138  -8.857  1.00 0.00 ? 159 LYS A HD3  3  
ATOM 9281  H HE2  . LYS A 1 159 ? -28.786 13.433  -9.579  1.00 0.00 ? 159 LYS A HE2  3  
ATOM 9282  H HE3  . LYS A 1 159 ? -28.778 13.382  -7.816  1.00 0.00 ? 159 LYS A HE3  3  
ATOM 9283  H HZ1  . LYS A 1 159 ? -26.762 14.355  -7.707  1.00 0.00 ? 159 LYS A HZ1  3  
ATOM 9284  H HZ2  . LYS A 1 159 ? -27.195 14.966  -9.224  1.00 0.00 ? 159 LYS A HZ2  3  
ATOM 9285  H HZ3  . LYS A 1 159 ? -26.185 13.614  -9.115  1.00 0.00 ? 159 LYS A HZ3  3  
ATOM 9286  N N    . GLY A 1 160 ? -27.025 9.401   -3.143  1.00 0.00 ? 160 GLY A N    3  
ATOM 9287  C CA   . GLY A 1 160 ? -27.358 9.570   -1.741  1.00 0.00 ? 160 GLY A CA   3  
ATOM 9288  C C    . GLY A 1 160 ? -27.957 8.313   -1.135  1.00 0.00 ? 160 GLY A C    3  
ATOM 9289  O O    . GLY A 1 160 ? -28.466 8.337   -0.014  1.00 0.00 ? 160 GLY A O    3  
ATOM 9290  H H    . GLY A 1 160 ? -26.247 8.863   -3.396  1.00 0.00 ? 160 GLY A H    3  
ATOM 9291  H HA2  . GLY A 1 160 ? -26.461 9.825   -1.199  1.00 0.00 ? 160 GLY A HA2  3  
ATOM 9292  H HA3  . GLY A 1 160 ? -28.068 10.377  -1.644  1.00 0.00 ? 160 GLY A HA3  3  
ATOM 9293  N N    . ASN A 1 161 ? -27.908 7.215   -1.886  1.00 0.00 ? 161 ASN A N    3  
ATOM 9294  C CA   . ASN A 1 161 ? -28.459 5.946   -1.431  1.00 0.00 ? 161 ASN A CA   3  
ATOM 9295  C C    . ASN A 1 161 ? -27.385 5.046   -0.809  1.00 0.00 ? 161 ASN A C    3  
ATOM 9296  O O    . ASN A 1 161 ? -27.683 3.947   -0.342  1.00 0.00 ? 161 ASN A O    3  
ATOM 9297  C CB   . ASN A 1 161 ? -29.140 5.238   -2.602  1.00 0.00 ? 161 ASN A CB   3  
ATOM 9298  C CG   . ASN A 1 161 ? -30.296 4.359   -2.161  1.00 0.00 ? 161 ASN A CG   3  
ATOM 9299  O OD1  . ASN A 1 161 ? -31.432 4.545   -2.598  1.00 0.00 ? 161 ASN A OD1  3  
ATOM 9300  N ND2  . ASN A 1 161 ? -30.015 3.396   -1.292  1.00 0.00 ? 161 ASN A ND2  3  
ATOM 9301  H H    . ASN A 1 161 ? -27.502 7.264   -2.775  1.00 0.00 ? 161 ASN A H    3  
ATOM 9302  H HA   . ASN A 1 161 ? -29.200 6.159   -0.684  1.00 0.00 ? 161 ASN A HA   3  
ATOM 9303  H HB2  . ASN A 1 161 ? -29.522 5.983   -3.286  1.00 0.00 ? 161 ASN A HB2  3  
ATOM 9304  H HB3  . ASN A 1 161 ? -28.417 4.628   -3.114  1.00 0.00 ? 161 ASN A HB3  3  
ATOM 9305  H HD21 . ASN A 1 161 ? -29.090 3.305   -0.984  1.00 0.00 ? 161 ASN A HD21 3  
ATOM 9306  H HD22 . ASN A 1 161 ? -30.745 2.816   -0.992  1.00 0.00 ? 161 ASN A HD22 3  
ATOM 9307  N N    . MET A 1 162 ? -26.139 5.516   -0.800  1.00 0.00 ? 162 MET A N    3  
ATOM 9308  C CA   . MET A 1 162 ? -25.030 4.752   -0.230  1.00 0.00 ? 162 MET A CA   3  
ATOM 9309  C C    . MET A 1 162 ? -24.692 5.256   1.178   1.00 0.00 ? 162 MET A C    3  
ATOM 9310  O O    . MET A 1 162 ? -23.611 5.800   1.405   1.00 0.00 ? 162 MET A O    3  
ATOM 9311  C CB   . MET A 1 162 ? -23.802 4.877   -1.136  1.00 0.00 ? 162 MET A CB   3  
ATOM 9312  C CG   . MET A 1 162 ? -23.701 3.785   -2.186  1.00 0.00 ? 162 MET A CG   3  
ATOM 9313  S SD   . MET A 1 162 ? -22.199 3.915   -3.176  1.00 0.00 ? 162 MET A SD   3  
ATOM 9314  C CE   . MET A 1 162 ? -22.675 2.988   -4.631  1.00 0.00 ? 162 MET A CE   3  
ATOM 9315  H H    . MET A 1 162 ? -25.959 6.400   -1.182  1.00 0.00 ? 162 MET A H    3  
ATOM 9316  H HA   . MET A 1 162 ? -25.328 3.716   -0.176  1.00 0.00 ? 162 MET A HA   3  
ATOM 9317  H HB2  . MET A 1 162 ? -23.844 5.828   -1.646  1.00 0.00 ? 162 MET A HB2  3  
ATOM 9318  H HB3  . MET A 1 162 ? -22.911 4.844   -0.527  1.00 0.00 ? 162 MET A HB3  3  
ATOM 9319  H HG2  . MET A 1 162 ? -23.707 2.829   -1.691  1.00 0.00 ? 162 MET A HG2  3  
ATOM 9320  H HG3  . MET A 1 162 ? -24.556 3.855   -2.843  1.00 0.00 ? 162 MET A HG3  3  
ATOM 9321  H HE1  . MET A 1 162 ? -21.948 2.212   -4.819  1.00 0.00 ? 162 MET A HE1  3  
ATOM 9322  H HE2  . MET A 1 162 ? -22.721 3.652   -5.482  1.00 0.00 ? 162 MET A HE2  3  
ATOM 9323  H HE3  . MET A 1 162 ? -23.645 2.541   -4.470  1.00 0.00 ? 162 MET A HE3  3  
ATOM 9324  N N    . SER A 1 163 ? -25.630 5.104   2.113   1.00 0.00 ? 163 SER A N    3  
ATOM 9325  C CA   . SER A 1 163 ? -25.427 5.582   3.482   1.00 0.00 ? 163 SER A CA   3  
ATOM 9326  C C    . SER A 1 163 ? -25.764 4.534   4.551   1.00 0.00 ? 163 SER A C    3  
ATOM 9327  O O    . SER A 1 163 ? -26.218 4.895   5.637   1.00 0.00 ? 163 SER A O    3  
ATOM 9328  C CB   . SER A 1 163 ? -26.262 6.841   3.720   1.00 0.00 ? 163 SER A CB   3  
ATOM 9329  O OG   . SER A 1 163 ? -27.647 6.566   3.594   1.00 0.00 ? 163 SER A OG   3  
ATOM 9330  H H    . SER A 1 163 ? -26.483 4.686   1.872   1.00 0.00 ? 163 SER A H    3  
ATOM 9331  H HA   . SER A 1 163 ? -24.385 5.843   3.579   1.00 0.00 ? 163 SER A HA   3  
ATOM 9332  H HB2  . SER A 1 163 ? -26.071 7.214   4.715   1.00 0.00 ? 163 SER A HB2  3  
ATOM 9333  H HB3  . SER A 1 163 ? -25.989 7.593   2.995   1.00 0.00 ? 163 SER A HB3  3  
ATOM 9334  H HG   . SER A 1 163 ? -28.125 6.991   4.311   1.00 0.00 ? 163 SER A HG   3  
ATOM 9335  N N    . GLY A 1 164 ? -25.561 3.248   4.265   1.00 0.00 ? 164 GLY A N    3  
ATOM 9336  C CA   . GLY A 1 164 ? -25.880 2.233   5.254   1.00 0.00 ? 164 GLY A CA   3  
ATOM 9337  C C    . GLY A 1 164 ? -26.417 0.958   4.630   1.00 0.00 ? 164 GLY A C    3  
ATOM 9338  O O    . GLY A 1 164 ? -25.764 0.357   3.781   1.00 0.00 ? 164 GLY A O    3  
ATOM 9339  H H    . GLY A 1 164 ? -25.193 2.986   3.395   1.00 0.00 ? 164 GLY A H    3  
ATOM 9340  H HA2  . GLY A 1 164 ? -24.989 1.998   5.815   1.00 0.00 ? 164 GLY A HA2  3  
ATOM 9341  H HA3  . GLY A 1 164 ? -26.620 2.630   5.931   1.00 0.00 ? 164 GLY A HA3  3  
ATOM 9342  N N    . ASN A 1 165 ? -27.610 0.541   5.049   1.00 0.00 ? 165 ASN A N    3  
ATOM 9343  C CA   . ASN A 1 165 ? -28.216 -0.677  4.511   1.00 0.00 ? 165 ASN A CA   3  
ATOM 9344  C C    . ASN A 1 165 ? -29.070 -0.379  3.290   1.00 0.00 ? 165 ASN A C    3  
ATOM 9345  O O    . ASN A 1 165 ? -30.293 -0.276  3.389   1.00 0.00 ? 165 ASN A O    3  
ATOM 9346  C CB   . ASN A 1 165 ? -29.066 -1.418  5.561   1.00 0.00 ? 165 ASN A CB   3  
ATOM 9347  C CG   . ASN A 1 165 ? -29.275 -0.627  6.841   1.00 0.00 ? 165 ASN A CG   3  
ATOM 9348  O OD1  . ASN A 1 165 ? -28.706 -0.949  7.884   1.00 0.00 ? 165 ASN A OD1  3  
ATOM 9349  N ND2  . ASN A 1 165 ? -30.096 0.414   6.765   1.00 0.00 ? 165 ASN A ND2  3  
ATOM 9350  H H    . ASN A 1 165 ? -28.089 1.062   5.727   1.00 0.00 ? 165 ASN A H    3  
ATOM 9351  H HA   . ASN A 1 165 ? -27.414 -1.327  4.204   1.00 0.00 ? 165 ASN A HA   3  
ATOM 9352  H HB2  . ASN A 1 165 ? -30.035 -1.639  5.137   1.00 0.00 ? 165 ASN A HB2  3  
ATOM 9353  H HB3  . ASN A 1 165 ? -28.578 -2.349  5.810   1.00 0.00 ? 165 ASN A HB3  3  
ATOM 9354  H HD21 . ASN A 1 165 ? -30.514 0.611   5.901   1.00 0.00 ? 165 ASN A HD21 3  
ATOM 9355  H HD22 . ASN A 1 165 ? -30.251 0.941   7.576   1.00 0.00 ? 165 ASN A HD22 3  
ATOM 9356  N N    . PHE A 1 166 ? -28.423 -0.273  2.129   1.00 0.00 ? 166 PHE A N    3  
ATOM 9357  C CA   . PHE A 1 166 ? -29.132 -0.028  0.878   1.00 0.00 ? 166 PHE A CA   3  
ATOM 9358  C C    . PHE A 1 166 ? -30.353 -0.928  0.824   1.00 0.00 ? 166 PHE A C    3  
ATOM 9359  O O    . PHE A 1 166 ? -30.263 -2.106  1.146   1.00 0.00 ? 166 PHE A O    3  
ATOM 9360  C CB   . PHE A 1 166 ? -28.218 -0.317  -0.311  1.00 0.00 ? 166 PHE A CB   3  
ATOM 9361  C CG   . PHE A 1 166 ? -28.409 0.607   -1.468  1.00 0.00 ? 166 PHE A CG   3  
ATOM 9362  C CD1  . PHE A 1 166 ? -29.519 0.499   -2.287  1.00 0.00 ? 166 PHE A CD1  3  
ATOM 9363  C CD2  . PHE A 1 166 ? -27.467 1.579   -1.740  1.00 0.00 ? 166 PHE A CD2  3  
ATOM 9364  C CE1  . PHE A 1 166 ? -29.685 1.349   -3.361  1.00 0.00 ? 166 PHE A CE1  3  
ATOM 9365  C CE2  . PHE A 1 166 ? -27.625 2.431   -2.807  1.00 0.00 ? 166 PHE A CE2  3  
ATOM 9366  C CZ   . PHE A 1 166 ? -28.735 2.317   -3.621  1.00 0.00 ? 166 PHE A CZ   3  
ATOM 9367  H H    . PHE A 1 166 ? -27.451 -0.387  2.114   1.00 0.00 ? 166 PHE A H    3  
ATOM 9368  H HA   . PHE A 1 166 ? -29.444 1.005   0.856   1.00 0.00 ? 166 PHE A HA   3  
ATOM 9369  H HB2  . PHE A 1 166 ? -27.196 -0.226  0.006   1.00 0.00 ? 166 PHE A HB2  3  
ATOM 9370  H HB3  . PHE A 1 166 ? -28.394 -1.322  -0.658  1.00 0.00 ? 166 PHE A HB3  3  
ATOM 9371  H HD1  . PHE A 1 166 ? -30.261 -0.258  -2.080  1.00 0.00 ? 166 PHE A HD1  3  
ATOM 9372  H HD2  . PHE A 1 166 ? -26.598 1.669   -1.104  1.00 0.00 ? 166 PHE A HD2  3  
ATOM 9373  H HE1  . PHE A 1 166 ? -30.554 1.258   -3.996  1.00 0.00 ? 166 PHE A HE1  3  
ATOM 9374  H HE2  . PHE A 1 166 ? -26.882 3.188   -3.009  1.00 0.00 ? 166 PHE A HE2  3  
ATOM 9375  H HZ   . PHE A 1 166 ? -28.859 2.986   -4.459  1.00 0.00 ? 166 PHE A HZ   3  
ATOM 9376  N N    . THR A 1 167 ? -31.493 -0.380  0.448   1.00 0.00 ? 167 THR A N    3  
ATOM 9377  C CA   . THR A 1 167 ? -32.716 -1.172  0.405   1.00 0.00 ? 167 THR A CA   3  
ATOM 9378  C C    . THR A 1 167 ? -33.343 -1.184  -0.990  1.00 0.00 ? 167 THR A C    3  
ATOM 9379  O O    . THR A 1 167 ? -33.960 -0.206  -1.411  1.00 0.00 ? 167 THR A O    3  
ATOM 9380  C CB   . THR A 1 167 ? -33.727 -0.630  1.417   1.00 0.00 ? 167 THR A CB   3  
ATOM 9381  O OG1  . THR A 1 167 ? -33.105 0.267   2.321   1.00 0.00 ? 167 THR A OG1  3  
ATOM 9382  C CG2  . THR A 1 167 ? -34.387 -1.717  2.233   1.00 0.00 ? 167 THR A CG2  3  
ATOM 9383  H H    . THR A 1 167 ? -31.518 0.569   0.210   1.00 0.00 ? 167 THR A H    3  
ATOM 9384  H HA   . THR A 1 167 ? -32.454 -2.190  0.690   1.00 0.00 ? 167 THR A HA   3  
ATOM 9385  H HB   . THR A 1 167 ? -34.503 -0.095  0.889   1.00 0.00 ? 167 THR A HB   3  
ATOM 9386  H HG1  . THR A 1 167 ? -33.204 1.166   2.000   1.00 0.00 ? 167 THR A HG1  3  
ATOM 9387  H HG21 . THR A 1 167 ? -35.447 -1.527  2.301   1.00 0.00 ? 167 THR A HG21 3  
ATOM 9388  H HG22 . THR A 1 167 ? -33.957 -1.732  3.226   1.00 0.00 ? 167 THR A HG22 3  
ATOM 9389  H HG23 . THR A 1 167 ? -34.219 -2.673  1.756   1.00 0.00 ? 167 THR A HG23 3  
ATOM 9390  N N    . TYR A 1 168 ? -33.194 -2.302  -1.692  1.00 0.00 ? 168 TYR A N    3  
ATOM 9391  C CA   . TYR A 1 168 ? -33.758 -2.457  -3.030  1.00 0.00 ? 168 TYR A CA   3  
ATOM 9392  C C    . TYR A 1 168 ? -34.715 -3.644  -3.059  1.00 0.00 ? 168 TYR A C    3  
ATOM 9393  O O    . TYR A 1 168 ? -34.516 -4.619  -2.342  1.00 0.00 ? 168 TYR A O    3  
ATOM 9394  C CB   . TYR A 1 168 ? -32.639 -2.655  -4.067  1.00 0.00 ? 168 TYR A CB   3  
ATOM 9395  C CG   . TYR A 1 168 ? -33.141 -2.903  -5.476  1.00 0.00 ? 168 TYR A CG   3  
ATOM 9396  C CD1  . TYR A 1 168 ? -33.829 -4.065  -5.810  1.00 0.00 ? 168 TYR A CD1  3  
ATOM 9397  C CD2  . TYR A 1 168 ? -32.934 -1.963  -6.469  1.00 0.00 ? 168 TYR A CD2  3  
ATOM 9398  C CE1  . TYR A 1 168 ? -34.295 -4.274  -7.095  1.00 0.00 ? 168 TYR A CE1  3  
ATOM 9399  C CE2  . TYR A 1 168 ? -33.394 -2.166  -7.757  1.00 0.00 ? 168 TYR A CE2  3  
ATOM 9400  C CZ   . TYR A 1 168 ? -34.075 -3.322  -8.063  1.00 0.00 ? 168 TYR A CZ   3  
ATOM 9401  O OH   . TYR A 1 168 ? -34.540 -3.524  -9.341  1.00 0.00 ? 168 TYR A OH   3  
ATOM 9402  H H    . TYR A 1 168 ? -32.701 -3.047  -1.298  1.00 0.00 ? 168 TYR A H    3  
ATOM 9403  H HA   . TYR A 1 168 ? -34.307 -1.558  -3.268  1.00 0.00 ? 168 TYR A HA   3  
ATOM 9404  H HB2  . TYR A 1 168 ? -32.025 -1.767  -4.091  1.00 0.00 ? 168 TYR A HB2  3  
ATOM 9405  H HB3  . TYR A 1 168 ? -32.026 -3.496  -3.778  1.00 0.00 ? 168 TYR A HB3  3  
ATOM 9406  H HD1  . TYR A 1 168 ? -33.997 -4.814  -5.050  1.00 0.00 ? 168 TYR A HD1  3  
ATOM 9407  H HD2  . TYR A 1 168 ? -32.397 -1.062  -6.227  1.00 0.00 ? 168 TYR A HD2  3  
ATOM 9408  H HE1  . TYR A 1 168 ? -34.830 -5.180  -7.335  1.00 0.00 ? 168 TYR A HE1  3  
ATOM 9409  H HE2  . TYR A 1 168 ? -33.218 -1.419  -8.517  1.00 0.00 ? 168 TYR A HE2  3  
ATOM 9410  H HH   . TYR A 1 168 ? -34.880 -2.699  -9.693  1.00 0.00 ? 168 TYR A HH   3  
ATOM 9411  N N    . ILE A 1 169 ? -35.756 -3.561  -3.884  1.00 0.00 ? 169 ILE A N    3  
ATOM 9412  C CA   . ILE A 1 169 ? -36.724 -4.650  -3.984  1.00 0.00 ? 169 ILE A CA   3  
ATOM 9413  C C    . ILE A 1 169 ? -36.942 -5.088  -5.425  1.00 0.00 ? 169 ILE A C    3  
ATOM 9414  O O    . ILE A 1 169 ? -37.542 -4.366  -6.221  1.00 0.00 ? 169 ILE A O    3  
ATOM 9415  C CB   . ILE A 1 169 ? -38.091 -4.272  -3.382  1.00 0.00 ? 169 ILE A CB   3  
ATOM 9416  C CG1  . ILE A 1 169 ? -37.903 -3.651  -1.997  1.00 0.00 ? 169 ILE A CG1  3  
ATOM 9417  C CG2  . ILE A 1 169 ? -39.000 -5.500  -3.308  1.00 0.00 ? 169 ILE A CG2  3  
ATOM 9418  C CD1  . ILE A 1 169 ? -37.353 -4.615  -0.973  1.00 0.00 ? 169 ILE A CD1  3  
ATOM 9419  H H    . ILE A 1 169 ? -35.873 -2.754  -4.427  1.00 0.00 ? 169 ILE A H    3  
ATOM 9420  H HA   . ILE A 1 169 ? -36.334 -5.487  -3.425  1.00 0.00 ? 169 ILE A HA   3  
ATOM 9421  H HB   . ILE A 1 169 ? -38.558 -3.548  -4.033  1.00 0.00 ? 169 ILE A HB   3  
ATOM 9422  H HG12 . ILE A 1 169 ? -37.215 -2.823  -2.072  1.00 0.00 ? 169 ILE A HG12 3  
ATOM 9423  H HG13 . ILE A 1 169 ? -38.856 -3.292  -1.638  1.00 0.00 ? 169 ILE A HG13 3  
ATOM 9424  H HG21 . ILE A 1 169 ? -38.874 -6.103  -4.200  1.00 0.00 ? 169 ILE A HG21 3  
ATOM 9425  H HG22 . ILE A 1 169 ? -40.029 -5.183  -3.235  1.00 0.00 ? 169 ILE A HG22 3  
ATOM 9426  H HG23 . ILE A 1 169 ? -38.741 -6.088  -2.438  1.00 0.00 ? 169 ILE A HG23 3  
ATOM 9427  H HD11 . ILE A 1 169 ? -36.354 -4.314  -0.695  1.00 0.00 ? 169 ILE A HD11 3  
ATOM 9428  H HD12 . ILE A 1 169 ? -37.326 -5.608  -1.395  1.00 0.00 ? 169 ILE A HD12 3  
ATOM 9429  H HD13 . ILE A 1 169 ? -37.987 -4.612  -0.098  1.00 0.00 ? 169 ILE A HD13 3  
ATOM 9430  N N    . ILE A 1 170 ? -36.485 -6.294  -5.743  1.00 0.00 ? 170 ILE A N    3  
ATOM 9431  C CA   . ILE A 1 170 ? -36.669 -6.846  -7.079  1.00 0.00 ? 170 ILE A CA   3  
ATOM 9432  C C    . ILE A 1 170 ? -37.984 -7.602  -7.118  1.00 0.00 ? 170 ILE A C    3  
ATOM 9433  O O    . ILE A 1 170 ? -38.099 -8.704  -6.587  1.00 0.00 ? 170 ILE A O    3  
ATOM 9434  C CB   . ILE A 1 170 ? -35.533 -7.791  -7.506  1.00 0.00 ? 170 ILE A CB   3  
ATOM 9435  C CG1  . ILE A 1 170 ? -34.313 -7.635  -6.603  1.00 0.00 ? 170 ILE A CG1  3  
ATOM 9436  C CG2  . ILE A 1 170 ? -35.150 -7.541  -8.958  1.00 0.00 ? 170 ILE A CG2  3  
ATOM 9437  C CD1  . ILE A 1 170 ? -33.203 -8.584  -6.956  1.00 0.00 ? 170 ILE A CD1  3  
ATOM 9438  H H    . ILE A 1 170 ? -36.044 -6.834  -5.056  1.00 0.00 ? 170 ILE A H    3  
ATOM 9439  H HA   . ILE A 1 170 ? -36.716 -6.027  -7.778  1.00 0.00 ? 170 ILE A HA   3  
ATOM 9440  H HB   . ILE A 1 170 ? -35.899 -8.800  -7.431  1.00 0.00 ? 170 ILE A HB   3  
ATOM 9441  H HG12 . ILE A 1 170 ? -33.929 -6.633  -6.688  1.00 0.00 ? 170 ILE A HG12 3  
ATOM 9442  H HG13 . ILE A 1 170 ? -34.597 -7.823  -5.580  1.00 0.00 ? 170 ILE A HG13 3  
ATOM 9443  H HG21 . ILE A 1 170 ? -34.204 -8.020  -9.168  1.00 0.00 ? 170 ILE A HG21 3  
ATOM 9444  H HG22 . ILE A 1 170 ? -35.061 -6.479  -9.129  1.00 0.00 ? 170 ILE A HG22 3  
ATOM 9445  H HG23 . ILE A 1 170 ? -35.912 -7.948  -9.606  1.00 0.00 ? 170 ILE A HG23 3  
ATOM 9446  H HD11 . ILE A 1 170 ? -33.593 -9.354  -7.600  1.00 0.00 ? 170 ILE A HD11 3  
ATOM 9447  H HD12 . ILE A 1 170 ? -32.809 -9.027  -6.056  1.00 0.00 ? 170 ILE A HD12 3  
ATOM 9448  H HD13 . ILE A 1 170 ? -32.423 -8.044  -7.468  1.00 0.00 ? 170 ILE A HD13 3  
ATOM 9449  N N    . ASP A 1 171 ? -38.978 -6.984  -7.721  1.00 0.00 ? 171 ASP A N    3  
ATOM 9450  C CA   . ASP A 1 171 ? -40.307 -7.575  -7.800  1.00 0.00 ? 171 ASP A CA   3  
ATOM 9451  C C    . ASP A 1 171 ? -40.674 -7.958  -9.233  1.00 0.00 ? 171 ASP A C    3  
ATOM 9452  O O    . ASP A 1 171 ? -39.811 -8.032  -10.108 1.00 0.00 ? 171 ASP A O    3  
ATOM 9453  C CB   . ASP A 1 171 ? -41.339 -6.602  -7.215  1.00 0.00 ? 171 ASP A CB   3  
ATOM 9454  C CG   . ASP A 1 171 ? -41.785 -5.542  -8.206  1.00 0.00 ? 171 ASP A CG   3  
ATOM 9455  O OD1  . ASP A 1 171 ? -42.763 -5.791  -8.942  1.00 0.00 ? 171 ASP A OD1  3  
ATOM 9456  O OD2  . ASP A 1 171 ? -41.156 -4.464  -8.246  1.00 0.00 ? 171 ASP A OD2  3  
ATOM 9457  H H    . ASP A 1 171 ? -38.818 -6.100  -8.103  1.00 0.00 ? 171 ASP A H    3  
ATOM 9458  H HA   . ASP A 1 171 ? -40.301 -8.472  -7.198  1.00 0.00 ? 171 ASP A HA   3  
ATOM 9459  H HB2  . ASP A 1 171 ? -42.207 -7.156  -6.894  1.00 0.00 ? 171 ASP A HB2  3  
ATOM 9460  H HB3  . ASP A 1 171 ? -40.904 -6.105  -6.360  1.00 0.00 ? 171 ASP A HB3  3  
ATOM 9461  N N    . LYS A 1 172 ? -41.962 -8.209  -9.455  1.00 0.00 ? 172 LYS A N    3  
ATOM 9462  C CA   . LYS A 1 172 ? -42.457 -8.594  -10.773 1.00 0.00 ? 172 LYS A CA   3  
ATOM 9463  C C    . LYS A 1 172 ? -41.910 -9.961  -11.175 1.00 0.00 ? 172 LYS A C    3  
ATOM 9464  O O    . LYS A 1 172 ? -41.521 -10.175 -12.323 1.00 0.00 ? 172 LYS A O    3  
ATOM 9465  C CB   . LYS A 1 172 ? -42.076 -7.541  -11.819 1.00 0.00 ? 172 LYS A CB   3  
ATOM 9466  C CG   . LYS A 1 172 ? -43.178 -6.530  -12.089 1.00 0.00 ? 172 LYS A CG   3  
ATOM 9467  C CD   . LYS A 1 172 ? -44.070 -6.971  -13.239 1.00 0.00 ? 172 LYS A CD   3  
ATOM 9468  C CE   . LYS A 1 172 ? -45.053 -8.045  -12.801 1.00 0.00 ? 172 LYS A CE   3  
ATOM 9469  N NZ   . LYS A 1 172 ? -45.855 -7.616  -11.622 1.00 0.00 ? 172 LYS A NZ   3  
ATOM 9470  H H    . LYS A 1 172 ? -42.595 -8.139  -8.710  1.00 0.00 ? 172 LYS A H    3  
ATOM 9471  H HA   . LYS A 1 172 ? -43.533 -8.657  -10.715 1.00 0.00 ? 172 LYS A HA   3  
ATOM 9472  H HB2  . LYS A 1 172 ? -41.204 -7.005  -11.474 1.00 0.00 ? 172 LYS A HB2  3  
ATOM 9473  H HB3  . LYS A 1 172 ? -41.838 -8.038  -12.747 1.00 0.00 ? 172 LYS A HB3  3  
ATOM 9474  H HG2  . LYS A 1 172 ? -43.782 -6.423  -11.200 1.00 0.00 ? 172 LYS A HG2  3  
ATOM 9475  H HG3  . LYS A 1 172 ? -42.729 -5.580  -12.338 1.00 0.00 ? 172 LYS A HG3  3  
ATOM 9476  H HD2  . LYS A 1 172 ? -44.623 -6.117  -13.601 1.00 0.00 ? 172 LYS A HD2  3  
ATOM 9477  H HD3  . LYS A 1 172 ? -43.450 -7.363  -14.032 1.00 0.00 ? 172 LYS A HD3  3  
ATOM 9478  H HE2  . LYS A 1 172 ? -45.721 -8.258  -13.622 1.00 0.00 ? 172 LYS A HE2  3  
ATOM 9479  H HE3  . LYS A 1 172 ? -44.501 -8.937  -12.546 1.00 0.00 ? 172 LYS A HE3  3  
ATOM 9480  H HZ1  . LYS A 1 172 ? -46.175 -6.634  -11.745 1.00 0.00 ? 172 LYS A HZ1  3  
ATOM 9481  H HZ2  . LYS A 1 172 ? -45.281 -7.677  -10.758 1.00 0.00 ? 172 LYS A HZ2  3  
ATOM 9482  H HZ3  . LYS A 1 172 ? -46.688 -8.230  -11.515 1.00 0.00 ? 172 LYS A HZ3  3  
ATOM 9483  N N    . LEU A 1 173 ? -41.887 -10.884 -10.218 1.00 0.00 ? 173 LEU A N    3  
ATOM 9484  C CA   . LEU A 1 173 ? -41.392 -12.231 -10.470 1.00 0.00 ? 173 LEU A CA   3  
ATOM 9485  C C    . LEU A 1 173 ? -42.376 -13.281 -9.966  1.00 0.00 ? 173 LEU A C    3  
ATOM 9486  O O    . LEU A 1 173 ? -43.218 -13.001 -9.113  1.00 0.00 ? 173 LEU A O    3  
ATOM 9487  C CB   . LEU A 1 173 ? -40.030 -12.434 -9.804  1.00 0.00 ? 173 LEU A CB   3  
ATOM 9488  C CG   . LEU A 1 173 ? -39.102 -11.218 -9.838  1.00 0.00 ? 173 LEU A CG   3  
ATOM 9489  C CD1  . LEU A 1 173 ? -39.159 -10.469 -8.516  1.00 0.00 ? 173 LEU A CD1  3  
ATOM 9490  C CD2  . LEU A 1 173 ? -37.675 -11.643 -10.151 1.00 0.00 ? 173 LEU A CD2  3  
ATOM 9491  H H    . LEU A 1 173 ? -42.218 -10.653 -9.324  1.00 0.00 ? 173 LEU A H    3  
ATOM 9492  H HA   . LEU A 1 173 ? -41.280 -12.347 -11.538 1.00 0.00 ? 173 LEU A HA   3  
ATOM 9493  H HB2  . LEU A 1 173 ? -40.196 -12.707 -8.771  1.00 0.00 ? 173 LEU A HB2  3  
ATOM 9494  H HB3  . LEU A 1 173 ? -39.531 -13.254 -10.299 1.00 0.00 ? 173 LEU A HB3  3  
ATOM 9495  H HG   . LEU A 1 173 ? -39.431 -10.544 -10.617 1.00 0.00 ? 173 LEU A HG   3  
ATOM 9496  H HD11 . LEU A 1 173 ? -38.770 -11.099 -7.730  1.00 0.00 ? 173 LEU A HD11 3  
ATOM 9497  H HD12 . LEU A 1 173 ? -40.182 -10.207 -8.294  1.00 0.00 ? 173 LEU A HD12 3  
ATOM 9498  H HD13 . LEU A 1 173 ? -38.564 -9.571  -8.586  1.00 0.00 ? 173 LEU A HD13 3  
ATOM 9499  H HD21 . LEU A 1 173 ? -37.566 -11.783 -11.216 1.00 0.00 ? 173 LEU A HD21 3  
ATOM 9500  H HD22 . LEU A 1 173 ? -37.456 -12.570 -9.641  1.00 0.00 ? 173 LEU A HD22 3  
ATOM 9501  H HD23 . LEU A 1 173 ? -36.990 -10.878 -9.816  1.00 0.00 ? 173 LEU A HD23 3  
ATOM 9502  N N    . ILE A 1 174 ? -42.251 -14.493 -10.493 1.00 0.00 ? 174 ILE A N    3  
ATOM 9503  C CA   . ILE A 1 174 ? -43.114 -15.598 -10.097 1.00 0.00 ? 174 ILE A CA   3  
ATOM 9504  C C    . ILE A 1 174 ? -42.372 -16.529 -9.140  1.00 0.00 ? 174 ILE A C    3  
ATOM 9505  O O    . ILE A 1 174 ? -41.189 -16.796 -9.333  1.00 0.00 ? 174 ILE A O    3  
ATOM 9506  C CB   . ILE A 1 174 ? -43.586 -16.401 -11.326 1.00 0.00 ? 174 ILE A CB   3  
ATOM 9507  C CG1  . ILE A 1 174 ? -44.210 -15.466 -12.363 1.00 0.00 ? 174 ILE A CG1  3  
ATOM 9508  C CG2  . ILE A 1 174 ? -44.575 -17.480 -10.914 1.00 0.00 ? 174 ILE A CG2  3  
ATOM 9509  C CD1  . ILE A 1 174 ? -44.335 -16.086 -13.738 1.00 0.00 ? 174 ILE A CD1  3  
ATOM 9510  H H    . ILE A 1 174 ? -41.554 -14.650 -11.162 1.00 0.00 ? 174 ILE A H    3  
ATOM 9511  H HA   . ILE A 1 174 ? -43.980 -15.189 -9.598  1.00 0.00 ? 174 ILE A HA   3  
ATOM 9512  H HB   . ILE A 1 174 ? -42.725 -16.886 -11.762 1.00 0.00 ? 174 ILE A HB   3  
ATOM 9513  H HG12 . ILE A 1 174 ? -45.199 -15.185 -12.036 1.00 0.00 ? 174 ILE A HG12 3  
ATOM 9514  H HG13 . ILE A 1 174 ? -43.599 -14.579 -12.452 1.00 0.00 ? 174 ILE A HG13 3  
ATOM 9515  H HG21 . ILE A 1 174 ? -45.486 -17.018 -10.563 1.00 0.00 ? 174 ILE A HG21 3  
ATOM 9516  H HG22 . ILE A 1 174 ? -44.147 -18.078 -10.123 1.00 0.00 ? 174 ILE A HG22 3  
ATOM 9517  H HG23 . ILE A 1 174 ? -44.795 -18.110 -11.763 1.00 0.00 ? 174 ILE A HG23 3  
ATOM 9518  H HD11 . ILE A 1 174 ? -45.273 -16.615 -13.810 1.00 0.00 ? 174 ILE A HD11 3  
ATOM 9519  H HD12 . ILE A 1 174 ? -43.519 -16.775 -13.897 1.00 0.00 ? 174 ILE A HD12 3  
ATOM 9520  H HD13 . ILE A 1 174 ? -44.301 -15.309 -14.487 1.00 0.00 ? 174 ILE A HD13 3  
ATOM 9521  N N    . PRO A 1 175 ? -43.052 -17.033 -8.090  1.00 0.00 ? 175 PRO A N    3  
ATOM 9522  C CA   . PRO A 1 175 ? -42.442 -17.931 -7.104  1.00 0.00 ? 175 PRO A CA   3  
ATOM 9523  C C    . PRO A 1 175 ? -41.440 -18.903 -7.723  1.00 0.00 ? 175 PRO A C    3  
ATOM 9524  O O    . PRO A 1 175 ? -41.505 -19.197 -8.916  1.00 0.00 ? 175 PRO A O    3  
ATOM 9525  C CB   . PRO A 1 175 ? -43.651 -18.675 -6.551  1.00 0.00 ? 175 PRO A CB   3  
ATOM 9526  C CG   . PRO A 1 175 ? -44.754 -17.671 -6.595  1.00 0.00 ? 175 PRO A CG   3  
ATOM 9527  C CD   . PRO A 1 175 ? -44.470 -16.767 -7.772  1.00 0.00 ? 175 PRO A CD   3  
ATOM 9528  H HA   . PRO A 1 175 ? -41.962 -17.379 -6.310  1.00 0.00 ? 175 PRO A HA   3  
ATOM 9529  H HB2  . PRO A 1 175 ? -43.867 -19.532 -7.173  1.00 0.00 ? 175 PRO A HB2  3  
ATOM 9530  H HB3  . PRO A 1 175 ? -43.450 -18.997 -5.540  1.00 0.00 ? 175 PRO A HB3  3  
ATOM 9531  H HG2  . PRO A 1 175 ? -45.700 -18.174 -6.731  1.00 0.00 ? 175 PRO A HG2  3  
ATOM 9532  H HG3  . PRO A 1 175 ? -44.763 -17.099 -5.679  1.00 0.00 ? 175 PRO A HG3  3  
ATOM 9533  H HD2  . PRO A 1 175 ? -45.105 -17.026 -8.604  1.00 0.00 ? 175 PRO A HD2  3  
ATOM 9534  H HD3  . PRO A 1 175 ? -44.614 -15.733 -7.495  1.00 0.00 ? 175 PRO A HD3  3  
ATOM 9535  N N    . ASN A 1 176 ? -40.507 -19.390 -6.904  1.00 0.00 ? 176 ASN A N    3  
ATOM 9536  C CA   . ASN A 1 176 ? -39.481 -20.321 -7.369  1.00 0.00 ? 176 ASN A CA   3  
ATOM 9537  C C    . ASN A 1 176 ? -38.506 -19.614 -8.312  1.00 0.00 ? 176 ASN A C    3  
ATOM 9538  O O    . ASN A 1 176 ? -38.419 -19.939 -9.496  1.00 0.00 ? 176 ASN A O    3  
ATOM 9539  C CB   . ASN A 1 176 ? -40.127 -21.527 -8.062  1.00 0.00 ? 176 ASN A CB   3  
ATOM 9540  C CG   . ASN A 1 176 ? -39.111 -22.452 -8.708  1.00 0.00 ? 176 ASN A CG   3  
ATOM 9541  O OD1  . ASN A 1 176 ? -39.341 -22.984 -9.794  1.00 0.00 ? 176 ASN A OD1  3  
ATOM 9542  N ND2  . ASN A 1 176 ? -37.980 -22.649 -8.040  1.00 0.00 ? 176 ASN A ND2  3  
ATOM 9543  H H    . ASN A 1 176 ? -40.506 -19.110 -5.965  1.00 0.00 ? 176 ASN A H    3  
ATOM 9544  H HA   . ASN A 1 176 ? -38.935 -20.665 -6.503  1.00 0.00 ? 176 ASN A HA   3  
ATOM 9545  H HB2  . ASN A 1 176 ? -40.686 -22.093 -7.337  1.00 0.00 ? 176 ASN A HB2  3  
ATOM 9546  H HB3  . ASN A 1 176 ? -40.801 -21.176 -8.822  1.00 0.00 ? 176 ASN A HB3  3  
ATOM 9547  H HD21 . ASN A 1 176 ? -37.864 -22.194 -7.180  1.00 0.00 ? 176 ASN A HD21 3  
ATOM 9548  H HD22 . ASN A 1 176 ? -37.307 -23.243 -8.435  1.00 0.00 ? 176 ASN A HD22 3  
ATOM 9549  N N    . THR A 1 177 ? -37.787 -18.634 -7.772  1.00 0.00 ? 177 THR A N    3  
ATOM 9550  C CA   . THR A 1 177 ? -36.828 -17.856 -8.544  1.00 0.00 ? 177 THR A CA   3  
ATOM 9551  C C    . THR A 1 177 ? -35.541 -17.623 -7.761  1.00 0.00 ? 177 THR A C    3  
ATOM 9552  O O    . THR A 1 177 ? -35.373 -16.574 -7.141  1.00 0.00 ? 177 THR A O    3  
ATOM 9553  C CB   . THR A 1 177 ? -37.431 -16.501 -8.887  1.00 0.00 ? 177 THR A CB   3  
ATOM 9554  O OG1  . THR A 1 177 ? -38.840 -16.585 -8.978  1.00 0.00 ? 177 THR A OG1  3  
ATOM 9555  C CG2  . THR A 1 177 ? -36.920 -15.922 -10.185 1.00 0.00 ? 177 THR A CG2  3  
ATOM 9556  H H    . THR A 1 177 ? -37.916 -18.417 -6.831  1.00 0.00 ? 177 THR A H    3  
ATOM 9557  H HA   . THR A 1 177 ? -36.605 -18.390 -9.454  1.00 0.00 ? 177 THR A HA   3  
ATOM 9558  H HB   . THR A 1 177 ? -37.180 -15.808 -8.090  1.00 0.00 ? 177 THR A HB   3  
ATOM 9559  H HG1  . THR A 1 177 ? -39.205 -16.808 -8.118  1.00 0.00 ? 177 THR A HG1  3  
ATOM 9560  H HG21 . THR A 1 177 ? -35.891 -16.217 -10.330 1.00 0.00 ? 177 THR A HG21 3  
ATOM 9561  H HG22 . THR A 1 177 ? -36.984 -14.845 -10.148 1.00 0.00 ? 177 THR A HG22 3  
ATOM 9562  H HG23 . THR A 1 177 ? -37.519 -16.291 -11.005 1.00 0.00 ? 177 THR A HG23 3  
ATOM 9563  N N    . ASN A 1 178 ? -34.625 -18.581 -7.786  1.00 0.00 ? 178 ASN A N    3  
ATOM 9564  C CA   . ASN A 1 178 ? -33.372 -18.411 -7.071  1.00 0.00 ? 178 ASN A CA   3  
ATOM 9565  C C    . ASN A 1 178 ? -32.497 -17.425 -7.839  1.00 0.00 ? 178 ASN A C    3  
ATOM 9566  O O    . ASN A 1 178 ? -32.027 -17.730 -8.935  1.00 0.00 ? 178 ASN A O    3  
ATOM 9567  C CB   . ASN A 1 178 ? -32.663 -19.750 -6.891  1.00 0.00 ? 178 ASN A CB   3  
ATOM 9568  C CG   . ASN A 1 178 ? -32.192 -20.350 -8.203  1.00 0.00 ? 178 ASN A CG   3  
ATOM 9569  O OD1  . ASN A 1 178 ? -32.927 -20.364 -9.191  1.00 0.00 ? 178 ASN A OD1  3  
ATOM 9570  N ND2  . ASN A 1 178 ? -30.962 -20.850 -8.219  1.00 0.00 ? 178 ASN A ND2  3  
ATOM 9571  H H    . ASN A 1 178 ? -34.790 -19.402 -8.296  1.00 0.00 ? 178 ASN A H    3  
ATOM 9572  H HA   . ASN A 1 178 ? -33.601 -18.004 -6.098  1.00 0.00 ? 178 ASN A HA   3  
ATOM 9573  H HB2  . ASN A 1 178 ? -31.807 -19.609 -6.250  1.00 0.00 ? 178 ASN A HB2  3  
ATOM 9574  H HB3  . ASN A 1 178 ? -33.345 -20.442 -6.422  1.00 0.00 ? 178 ASN A HB3  3  
ATOM 9575  H HD21 . ASN A 1 178 ? -30.434 -20.805 -7.394  1.00 0.00 ? 178 ASN A HD21 3  
ATOM 9576  H HD22 . ASN A 1 178 ? -30.633 -21.245 -9.053  1.00 0.00 ? 178 ASN A HD22 3  
ATOM 9577  N N    . TYR A 1 179 ? -32.313 -16.226 -7.290  1.00 0.00 ? 179 TYR A N    3  
ATOM 9578  C CA   . TYR A 1 179 ? -31.531 -15.202 -7.980  1.00 0.00 ? 179 TYR A CA   3  
ATOM 9579  C C    . TYR A 1 179 ? -30.203 -14.915 -7.323  1.00 0.00 ? 179 TYR A C    3  
ATOM 9580  O O    . TYR A 1 179 ? -30.125 -14.697 -6.115  1.00 0.00 ? 179 TYR A O    3  
ATOM 9581  C CB   . TYR A 1 179 ? -32.293 -13.890 -8.062  1.00 0.00 ? 179 TYR A CB   3  
ATOM 9582  C CG   . TYR A 1 179 ? -33.058 -13.581 -6.818  1.00 0.00 ? 179 TYR A CG   3  
ATOM 9583  C CD1  . TYR A 1 179 ? -34.358 -14.023 -6.685  1.00 0.00 ? 179 TYR A CD1  3  
ATOM 9584  C CD2  . TYR A 1 179 ? -32.485 -12.857 -5.779  1.00 0.00 ? 179 TYR A CD2  3  
ATOM 9585  C CE1  . TYR A 1 179 ? -35.084 -13.759 -5.555  1.00 0.00 ? 179 TYR A CE1  3  
ATOM 9586  C CE2  . TYR A 1 179 ? -33.198 -12.580 -4.640  1.00 0.00 ? 179 TYR A CE2  3  
ATOM 9587  C CZ   . TYR A 1 179 ? -34.505 -13.032 -4.528  1.00 0.00 ? 179 TYR A CZ   3  
ATOM 9588  O OH   . TYR A 1 179 ? -35.227 -12.761 -3.392  1.00 0.00 ? 179 TYR A OH   3  
ATOM 9589  H H    . TYR A 1 179 ? -32.735 -16.016 -6.428  1.00 0.00 ? 179 TYR A H    3  
ATOM 9590  H HA   . TYR A 1 179 ? -31.356 -15.545 -8.975  1.00 0.00 ? 179 TYR A HA   3  
ATOM 9591  H HB2  . TYR A 1 179 ? -31.596 -13.084 -8.234  1.00 0.00 ? 179 TYR A HB2  3  
ATOM 9592  H HB3  . TYR A 1 179 ? -32.990 -13.934 -8.876  1.00 0.00 ? 179 TYR A HB3  3  
ATOM 9593  H HD1  . TYR A 1 179 ? -34.805 -14.582 -7.492  1.00 0.00 ? 179 TYR A HD1  3  
ATOM 9594  H HD2  . TYR A 1 179 ? -31.463 -12.509 -5.869  1.00 0.00 ? 179 TYR A HD2  3  
ATOM 9595  H HE1  . TYR A 1 179 ? -36.102 -14.117 -5.482  1.00 0.00 ? 179 TYR A HE1  3  
ATOM 9596  H HE2  . TYR A 1 179 ? -32.734 -12.010 -3.845  1.00 0.00 ? 179 TYR A HE2  3  
ATOM 9597  H HH   . TYR A 1 179 ? -34.634 -12.479 -2.691  1.00 0.00 ? 179 TYR A HH   3  
ATOM 9598  N N    . CYS A 1 180 ? -29.179 -14.825 -8.156  1.00 0.00 ? 180 CYS A N    3  
ATOM 9599  C CA   . CYS A 1 180 ? -27.857 -14.466 -7.699  1.00 0.00 ? 180 CYS A CA   3  
ATOM 9600  C C    . CYS A 1 180 ? -27.719 -12.961 -7.876  1.00 0.00 ? 180 CYS A C    3  
ATOM 9601  O O    . CYS A 1 180 ? -27.537 -12.468 -8.988  1.00 0.00 ? 180 CYS A O    3  
ATOM 9602  C CB   . CYS A 1 180 ? -26.785 -15.229 -8.477  1.00 0.00 ? 180 CYS A CB   3  
ATOM 9603  S SG   . CYS A 1 180 ? -26.146 -16.690 -7.588  1.00 0.00 ? 180 CYS A SG   3  
ATOM 9604  H H    . CYS A 1 180 ? -29.334 -14.939 -9.117  1.00 0.00 ? 180 CYS A H    3  
ATOM 9605  H HA   . CYS A 1 180 ? -27.780 -14.709 -6.653  1.00 0.00 ? 180 CYS A HA   3  
ATOM 9606  H HB2  . CYS A 1 180 ? -27.200 -15.567 -9.409  1.00 0.00 ? 180 CYS A HB2  3  
ATOM 9607  H HB3  . CYS A 1 180 ? -25.956 -14.573 -8.679  1.00 0.00 ? 180 CYS A HB3  3  
ATOM 9608  N N    . VAL A 1 181 ? -27.870 -12.233 -6.779  1.00 0.00 ? 181 VAL A N    3  
ATOM 9609  C CA   . VAL A 1 181 ? -27.815 -10.781 -6.811  1.00 0.00 ? 181 VAL A CA   3  
ATOM 9610  C C    . VAL A 1 181 ? -26.394 -10.273 -6.592  1.00 0.00 ? 181 VAL A C    3  
ATOM 9611  O O    . VAL A 1 181 ? -25.806 -10.477 -5.529  1.00 0.00 ? 181 VAL A O    3  
ATOM 9612  C CB   . VAL A 1 181 ? -28.785 -10.173 -5.762  1.00 0.00 ? 181 VAL A CB   3  
ATOM 9613  C CG1  . VAL A 1 181 ? -28.343 -8.782  -5.323  1.00 0.00 ? 181 VAL A CG1  3  
ATOM 9614  C CG2  . VAL A 1 181 ? -30.198 -10.129 -6.327  1.00 0.00 ? 181 VAL A CG2  3  
ATOM 9615  H H    . VAL A 1 181 ? -28.052 -12.683 -5.930  1.00 0.00 ? 181 VAL A H    3  
ATOM 9616  H HA   . VAL A 1 181 ? -28.144 -10.461 -7.789  1.00 0.00 ? 181 VAL A HA   3  
ATOM 9617  H HB   . VAL A 1 181 ? -28.799 -10.814 -4.890  1.00 0.00 ? 181 VAL A HB   3  
ATOM 9618  H HG11 . VAL A 1 181 ? -28.313 -8.125  -6.179  1.00 0.00 ? 181 VAL A HG11 3  
ATOM 9619  H HG12 . VAL A 1 181 ? -27.361 -8.838  -4.876  1.00 0.00 ? 181 VAL A HG12 3  
ATOM 9620  H HG13 . VAL A 1 181 ? -29.044 -8.397  -4.599  1.00 0.00 ? 181 VAL A HG13 3  
ATOM 9621  H HG21 . VAL A 1 181 ? -30.900 -9.946  -5.527  1.00 0.00 ? 181 VAL A HG21 3  
ATOM 9622  H HG22 . VAL A 1 181 ? -30.427 -11.075 -6.798  1.00 0.00 ? 181 VAL A HG22 3  
ATOM 9623  H HG23 . VAL A 1 181 ? -30.269 -9.337  -7.058  1.00 0.00 ? 181 VAL A HG23 3  
ATOM 9624  N N    . SER A 1 182 ? -25.858 -9.598  -7.606  1.00 0.00 ? 182 SER A N    3  
ATOM 9625  C CA   . SER A 1 182 ? -24.516 -9.040  -7.526  1.00 0.00 ? 182 SER A CA   3  
ATOM 9626  C C    . SER A 1 182 ? -24.582 -7.614  -7.023  1.00 0.00 ? 182 SER A C    3  
ATOM 9627  O O    . SER A 1 182 ? -25.634 -6.971  -7.068  1.00 0.00 ? 182 SER A O    3  
ATOM 9628  C CB   . SER A 1 182 ? -23.824 -9.044  -8.888  1.00 0.00 ? 182 SER A CB   3  
ATOM 9629  O OG   . SER A 1 182 ? -24.484 -8.177  -9.781  1.00 0.00 ? 182 SER A OG   3  
ATOM 9630  H H    . SER A 1 182 ? -26.384 -9.463  -8.422  1.00 0.00 ? 182 SER A H    3  
ATOM 9631  H HA   . SER A 1 182 ? -23.944 -9.636  -6.830  1.00 0.00 ? 182 SER A HA   3  
ATOM 9632  H HB2  . SER A 1 182 ? -22.806 -8.708  -8.775  1.00 0.00 ? 182 SER A HB2  3  
ATOM 9633  H HB3  . SER A 1 182 ? -23.830 -10.032 -9.300  1.00 0.00 ? 182 SER A HB3  3  
ATOM 9634  H HG   . SER A 1 182 ? -25.399 -8.084  -9.510  1.00 0.00 ? 182 SER A HG   3  
ATOM 9635  N N    . VAL A 1 183 ? -23.451 -7.128  -6.552  1.00 0.00 ? 183 VAL A N    3  
ATOM 9636  C CA   . VAL A 1 183 ? -23.355 -5.781  -6.031  1.00 0.00 ? 183 VAL A CA   3  
ATOM 9637  C C    . VAL A 1 183 ? -22.111 -5.086  -6.568  1.00 0.00 ? 183 VAL A C    3  
ATOM 9638  O O    . VAL A 1 183 ? -21.124 -4.922  -5.850  1.00 0.00 ? 183 VAL A O    3  
ATOM 9639  C CB   . VAL A 1 183 ? -23.263 -5.820  -4.505  1.00 0.00 ? 183 VAL A CB   3  
ATOM 9640  C CG1  . VAL A 1 183 ? -23.281 -4.422  -3.914  1.00 0.00 ? 183 VAL A CG1  3  
ATOM 9641  C CG2  . VAL A 1 183 ? -24.374 -6.681  -3.918  1.00 0.00 ? 183 VAL A CG2  3  
ATOM 9642  H H    . VAL A 1 183 ? -22.653 -7.696  -6.552  1.00 0.00 ? 183 VAL A H    3  
ATOM 9643  H HA   . VAL A 1 183 ? -24.246 -5.231  -6.320  1.00 0.00 ? 183 VAL A HA   3  
ATOM 9644  H HB   . VAL A 1 183 ? -22.319 -6.273  -4.261  1.00 0.00 ? 183 VAL A HB   3  
ATOM 9645  H HG11 . VAL A 1 183 ? -24.021 -3.825  -4.421  1.00 0.00 ? 183 VAL A HG11 3  
ATOM 9646  H HG12 . VAL A 1 183 ? -22.308 -3.969  -4.033  1.00 0.00 ? 183 VAL A HG12 3  
ATOM 9647  H HG13 . VAL A 1 183 ? -23.521 -4.481  -2.863  1.00 0.00 ? 183 VAL A HG13 3  
ATOM 9648  H HG21 . VAL A 1 183 ? -25.202 -6.727  -4.611  1.00 0.00 ? 183 VAL A HG21 3  
ATOM 9649  H HG22 . VAL A 1 183 ? -24.707 -6.252  -2.985  1.00 0.00 ? 183 VAL A HG22 3  
ATOM 9650  H HG23 . VAL A 1 183 ? -23.999 -7.679  -3.741  1.00 0.00 ? 183 VAL A HG23 3  
ATOM 9651  N N    . TYR A 1 184 ? -22.152 -4.684  -7.827  1.00 0.00 ? 184 TYR A N    3  
ATOM 9652  C CA   . TYR A 1 184 ? -21.012 -4.011  -8.444  1.00 0.00 ? 184 TYR A CA   3  
ATOM 9653  C C    . TYR A 1 184 ? -21.320 -2.535  -8.680  1.00 0.00 ? 184 TYR A C    3  
ATOM 9654  O O    . TYR A 1 184 ? -22.434 -2.183  -9.053  1.00 0.00 ? 184 TYR A O    3  
ATOM 9655  C CB   . TYR A 1 184 ? -20.615 -4.707  -9.752  1.00 0.00 ? 184 TYR A CB   3  
ATOM 9656  C CG   . TYR A 1 184 ? -21.494 -4.405  -10.948 1.00 0.00 ? 184 TYR A CG   3  
ATOM 9657  C CD1  . TYR A 1 184 ? -21.443 -3.163  -11.568 1.00 0.00 ? 184 TYR A CD1  3  
ATOM 9658  C CD2  . TYR A 1 184 ? -22.350 -5.370  -11.478 1.00 0.00 ? 184 TYR A CD2  3  
ATOM 9659  C CE1  . TYR A 1 184 ? -22.217 -2.886  -12.677 1.00 0.00 ? 184 TYR A CE1  3  
ATOM 9660  C CE2  . TYR A 1 184 ? -23.128 -5.097  -12.586 1.00 0.00 ? 184 TYR A CE2  3  
ATOM 9661  C CZ   . TYR A 1 184 ? -23.056 -3.853  -13.183 1.00 0.00 ? 184 TYR A CZ   3  
ATOM 9662  O OH   . TYR A 1 184 ? -23.824 -3.577  -14.291 1.00 0.00 ? 184 TYR A OH   3  
ATOM 9663  H H    . TYR A 1 184 ? -22.955 -4.836  -8.359  1.00 0.00 ? 184 TYR A H    3  
ATOM 9664  H HA   . TYR A 1 184 ? -20.184 -4.081  -7.752  1.00 0.00 ? 184 TYR A HA   3  
ATOM 9665  H HB2  . TYR A 1 184 ? -19.613 -4.409  -10.010 1.00 0.00 ? 184 TYR A HB2  3  
ATOM 9666  H HB3  . TYR A 1 184 ? -20.631 -5.771  -9.595  1.00 0.00 ? 184 TYR A HB3  3  
ATOM 9667  H HD1  . TYR A 1 184 ? -20.786 -2.406  -11.170 1.00 0.00 ? 184 TYR A HD1  3  
ATOM 9668  H HD2  . TYR A 1 184 ? -22.408 -6.347  -11.009 1.00 0.00 ? 184 TYR A HD2  3  
ATOM 9669  H HE1  . TYR A 1 184 ? -22.162 -1.914  -13.144 1.00 0.00 ? 184 TYR A HE1  3  
ATOM 9670  H HE2  . TYR A 1 184 ? -23.785 -5.857  -12.983 1.00 0.00 ? 184 TYR A HE2  3  
ATOM 9671  H HH   . TYR A 1 184 ? -23.312 -3.057  -14.915 1.00 0.00 ? 184 TYR A HH   3  
ATOM 9672  N N    . LEU A 1 185 ? -20.334 -1.674  -8.445  1.00 0.00 ? 185 LEU A N    3  
ATOM 9673  C CA   . LEU A 1 185 ? -20.527 -0.238  -8.611  1.00 0.00 ? 185 LEU A CA   3  
ATOM 9674  C C    . LEU A 1 185 ? -20.175 0.227   -10.019 1.00 0.00 ? 185 LEU A C    3  
ATOM 9675  O O    . LEU A 1 185 ? -19.627 -0.528  -10.821 1.00 0.00 ? 185 LEU A O    3  
ATOM 9676  C CB   . LEU A 1 185 ? -19.697 0.526   -7.580  1.00 0.00 ? 185 LEU A CB   3  
ATOM 9677  C CG   . LEU A 1 185 ? -20.029 0.197   -6.123  1.00 0.00 ? 185 LEU A CG   3  
ATOM 9678  C CD1  . LEU A 1 185 ? -19.332 -1.084  -5.691  1.00 0.00 ? 185 LEU A CD1  3  
ATOM 9679  C CD2  . LEU A 1 185 ? -19.640 1.352   -5.212  1.00 0.00 ? 185 LEU A CD2  3  
ATOM 9680  H H    . LEU A 1 185 ? -19.464 -2.008  -8.141  1.00 0.00 ? 185 LEU A H    3  
ATOM 9681  H HA   . LEU A 1 185 ? -21.570 -0.029  -8.436  1.00 0.00 ? 185 LEU A HA   3  
ATOM 9682  H HB2  . LEU A 1 185 ? -18.653 0.304   -7.751  1.00 0.00 ? 185 LEU A HB2  3  
ATOM 9683  H HB3  . LEU A 1 185 ? -19.854 1.583   -7.732  1.00 0.00 ? 185 LEU A HB3  3  
ATOM 9684  H HG   . LEU A 1 185 ? -21.095 0.043   -6.031  1.00 0.00 ? 185 LEU A HG   3  
ATOM 9685  H HD11 . LEU A 1 185 ? -20.044 -1.897  -5.690  1.00 0.00 ? 185 LEU A HD11 3  
ATOM 9686  H HD12 . LEU A 1 185 ? -18.928 -0.959  -4.698  1.00 0.00 ? 185 LEU A HD12 3  
ATOM 9687  H HD13 . LEU A 1 185 ? -18.532 -1.309  -6.380  1.00 0.00 ? 185 LEU A HD13 3  
ATOM 9688  H HD21 . LEU A 1 185 ? -19.895 2.287   -5.689  1.00 0.00 ? 185 LEU A HD21 3  
ATOM 9689  H HD22 . LEU A 1 185 ? -18.578 1.321   -5.025  1.00 0.00 ? 185 LEU A HD22 3  
ATOM 9690  H HD23 . LEU A 1 185 ? -20.173 1.268   -4.277  1.00 0.00 ? 185 LEU A HD23 3  
ATOM 9691  N N    . GLU A 1 186 ? -20.505 1.482   -10.306 1.00 0.00 ? 186 GLU A N    3  
ATOM 9692  C CA   . GLU A 1 186 ? -20.241 2.070   -11.611 1.00 0.00 ? 186 GLU A CA   3  
ATOM 9693  C C    . GLU A 1 186 ? -19.942 3.560   -11.482 1.00 0.00 ? 186 GLU A C    3  
ATOM 9694  O O    . GLU A 1 186 ? -19.909 4.105   -10.378 1.00 0.00 ? 186 GLU A O    3  
ATOM 9695  C CB   . GLU A 1 186 ? -21.444 1.864   -12.534 1.00 0.00 ? 186 GLU A CB   3  
ATOM 9696  C CG   . GLU A 1 186 ? -22.778 2.152   -11.866 1.00 0.00 ? 186 GLU A CG   3  
ATOM 9697  C CD   . GLU A 1 186 ? -23.953 1.961   -12.805 1.00 0.00 ? 186 GLU A CD   3  
ATOM 9698  O OE1  . GLU A 1 186 ? -23.890 1.052   -13.659 1.00 0.00 ? 186 GLU A OE1  3  
ATOM 9699  O OE2  . GLU A 1 186 ? -24.937 2.722   -12.687 1.00 0.00 ? 186 GLU A OE2  3  
ATOM 9700  H H    . GLU A 1 186 ? -20.943 2.026   -9.620  1.00 0.00 ? 186 GLU A H    3  
ATOM 9701  H HA   . GLU A 1 186 ? -19.381 1.574   -12.034 1.00 0.00 ? 186 GLU A HA   3  
ATOM 9702  H HB2  . GLU A 1 186 ? -21.345 2.519   -13.386 1.00 0.00 ? 186 GLU A HB2  3  
ATOM 9703  H HB3  . GLU A 1 186 ? -21.450 0.840   -12.875 1.00 0.00 ? 186 GLU A HB3  3  
ATOM 9704  H HG2  . GLU A 1 186 ? -22.897 1.485   -11.026 1.00 0.00 ? 186 GLU A HG2  3  
ATOM 9705  H HG3  . GLU A 1 186 ? -22.778 3.174   -11.516 1.00 0.00 ? 186 GLU A HG3  3  
ATOM 9706  N N    . HIS A 1 187 ? -19.729 4.212   -12.618 1.00 0.00 ? 187 HIS A N    3  
ATOM 9707  C CA   . HIS A 1 187 ? -19.437 5.640   -12.640 1.00 0.00 ? 187 HIS A CA   3  
ATOM 9708  C C    . HIS A 1 187 ? -19.827 6.247   -13.984 1.00 0.00 ? 187 HIS A C    3  
ATOM 9709  O O    . HIS A 1 187 ? -20.455 7.304   -14.042 1.00 0.00 ? 187 HIS A O    3  
ATOM 9710  C CB   . HIS A 1 187 ? -17.952 5.884   -12.369 1.00 0.00 ? 187 HIS A CB   3  
ATOM 9711  C CG   . HIS A 1 187 ? -17.608 7.328   -12.175 1.00 0.00 ? 187 HIS A CG   3  
ATOM 9712  N ND1  . HIS A 1 187 ? -18.187 8.116   -11.203 1.00 0.00 ? 187 HIS A ND1  3  
ATOM 9713  C CD2  . HIS A 1 187 ? -16.738 8.129   -12.836 1.00 0.00 ? 187 HIS A CD2  3  
ATOM 9714  C CE1  . HIS A 1 187 ? -17.690 9.337   -11.274 1.00 0.00 ? 187 HIS A CE1  3  
ATOM 9715  N NE2  . HIS A 1 187 ? -16.809 9.371   -12.256 1.00 0.00 ? 187 HIS A NE2  3  
ATOM 9716  H H    . HIS A 1 187 ? -19.773 3.721   -13.465 1.00 0.00 ? 187 HIS A H    3  
ATOM 9717  H HA   . HIS A 1 187 ? -20.019 6.111   -11.863 1.00 0.00 ? 187 HIS A HA   3  
ATOM 9718  H HB2  . HIS A 1 187 ? -17.664 5.352   -11.474 1.00 0.00 ? 187 HIS A HB2  3  
ATOM 9719  H HB3  . HIS A 1 187 ? -17.375 5.512   -13.203 1.00 0.00 ? 187 HIS A HB3  3  
ATOM 9720  H HD1  . HIS A 1 187 ? -18.863 7.823   -10.556 1.00 0.00 ? 187 HIS A HD1  3  
ATOM 9721  H HD2  . HIS A 1 187 ? -16.107 7.843   -13.665 1.00 0.00 ? 187 HIS A HD2  3  
ATOM 9722  H HE1  . HIS A 1 187 ? -17.958 10.167  -10.637 1.00 0.00 ? 187 HIS A HE1  3  
ATOM 9723  H HE2  . HIS A 1 187 ? -16.352 10.177  -12.578 1.00 0.00 ? 187 HIS A HE2  3  
ATOM 9724  N N    . SER A 1 188 ? -19.452 5.565   -15.062 1.00 0.00 ? 188 SER A N    3  
ATOM 9725  C CA   . SER A 1 188 ? -19.761 6.028   -16.410 1.00 0.00 ? 188 SER A CA   3  
ATOM 9726  C C    . SER A 1 188 ? -19.190 5.072   -17.452 1.00 0.00 ? 188 SER A C    3  
ATOM 9727  O O    . SER A 1 188 ? -18.680 5.500   -18.488 1.00 0.00 ? 188 SER A O    3  
ATOM 9728  C CB   . SER A 1 188 ? -19.204 7.437   -16.632 1.00 0.00 ? 188 SER A CB   3  
ATOM 9729  O OG   . SER A 1 188 ? -20.097 8.223   -17.402 1.00 0.00 ? 188 SER A OG   3  
ATOM 9730  H H    . SER A 1 188 ? -18.956 4.729   -14.948 1.00 0.00 ? 188 SER A H    3  
ATOM 9731  H HA   . SER A 1 188 ? -20.836 6.055   -16.513 1.00 0.00 ? 188 SER A HA   3  
ATOM 9732  H HB2  . SER A 1 188 ? -19.054 7.917   -15.677 1.00 0.00 ? 188 SER A HB2  3  
ATOM 9733  H HB3  . SER A 1 188 ? -18.260 7.370   -17.153 1.00 0.00 ? 188 SER A HB3  3  
ATOM 9734  H HG   . SER A 1 188 ? -20.315 7.759   -18.213 1.00 0.00 ? 188 SER A HG   3  
ATOM 9735  N N    . ASP A 1 189 ? -19.275 3.775   -17.170 1.00 0.00 ? 189 ASP A N    3  
ATOM 9736  C CA   . ASP A 1 189 ? -18.763 2.762   -18.085 1.00 0.00 ? 189 ASP A CA   3  
ATOM 9737  C C    . ASP A 1 189 ? -19.264 1.370   -17.710 1.00 0.00 ? 189 ASP A C    3  
ATOM 9738  O O    . ASP A 1 189 ? -19.617 1.114   -16.559 1.00 0.00 ? 189 ASP A O    3  
ATOM 9739  C CB   . ASP A 1 189 ? -17.232 2.783   -18.092 1.00 0.00 ? 189 ASP A CB   3  
ATOM 9740  C CG   . ASP A 1 189 ? -16.665 3.236   -19.423 1.00 0.00 ? 189 ASP A CG   3  
ATOM 9741  O OD1  . ASP A 1 189 ? -17.234 4.172   -20.023 1.00 0.00 ? 189 ASP A OD1  3  
ATOM 9742  O OD2  . ASP A 1 189 ? -15.651 2.656   -19.865 1.00 0.00 ? 189 ASP A OD2  3  
ATOM 9743  H H    . ASP A 1 189 ? -19.690 3.493   -16.328 1.00 0.00 ? 189 ASP A H    3  
ATOM 9744  H HA   . ASP A 1 189 ? -19.118 3.001   -19.073 1.00 0.00 ? 189 ASP A HA   3  
ATOM 9745  H HB2  . ASP A 1 189 ? -16.884 3.459   -17.326 1.00 0.00 ? 189 ASP A HB2  3  
ATOM 9746  H HB3  . ASP A 1 189 ? -16.861 1.789   -17.883 1.00 0.00 ? 189 ASP A HB3  3  
ATOM 9747  N N    . GLU A 1 190 ? -19.276 0.472   -18.691 1.00 0.00 ? 190 GLU A N    3  
ATOM 9748  C CA   . GLU A 1 190 ? -19.715 -0.902  -18.471 1.00 0.00 ? 190 GLU A CA   3  
ATOM 9749  C C    . GLU A 1 190 ? -18.512 -1.826  -18.332 1.00 0.00 ? 190 GLU A C    3  
ATOM 9750  O O    . GLU A 1 190 ? -18.603 -3.029  -18.581 1.00 0.00 ? 190 GLU A O    3  
ATOM 9751  C CB   . GLU A 1 190 ? -20.611 -1.368  -19.622 1.00 0.00 ? 190 GLU A CB   3  
ATOM 9752  C CG   . GLU A 1 190 ? -21.999 -1.798  -19.176 1.00 0.00 ? 190 GLU A CG   3  
ATOM 9753  C CD   . GLU A 1 190 ? -23.059 -0.759  -19.484 1.00 0.00 ? 190 GLU A CD   3  
ATOM 9754  O OE1  . GLU A 1 190 ? -22.920 -0.055  -20.507 1.00 0.00 ? 190 GLU A OE1  3  
ATOM 9755  O OE2  . GLU A 1 190 ? -24.028 -0.650  -18.704 1.00 0.00 ? 190 GLU A OE2  3  
ATOM 9756  H H    . GLU A 1 190 ? -18.968 0.737   -19.582 1.00 0.00 ? 190 GLU A H    3  
ATOM 9757  H HA   . GLU A 1 190 ? -20.278 -0.932  -17.550 1.00 0.00 ? 190 GLU A HA   3  
ATOM 9758  H HB2  . GLU A 1 190 ? -20.719 -0.558  -20.328 1.00 0.00 ? 190 GLU A HB2  3  
ATOM 9759  H HB3  . GLU A 1 190 ? -20.140 -2.204  -20.117 1.00 0.00 ? 190 GLU A HB3  3  
ATOM 9760  H HG2  . GLU A 1 190 ? -22.258 -2.715  -19.683 1.00 0.00 ? 190 GLU A HG2  3  
ATOM 9761  H HG3  . GLU A 1 190 ? -21.983 -1.970  -18.109 1.00 0.00 ? 190 GLU A HG3  3  
ATOM 9762  N N    . GLN A 1 191 ? -17.386 -1.253  -17.923 1.00 0.00 ? 191 GLN A N    3  
ATOM 9763  C CA   . GLN A 1 191 ? -16.160 -2.013  -17.735 1.00 0.00 ? 191 GLN A CA   3  
ATOM 9764  C C    . GLN A 1 191 ? -15.754 -2.024  -16.264 1.00 0.00 ? 191 GLN A C    3  
ATOM 9765  O O    . GLN A 1 191 ? -14.890 -2.802  -15.858 1.00 0.00 ? 191 GLN A O    3  
ATOM 9766  C CB   . GLN A 1 191 ? -15.033 -1.421  -18.583 1.00 0.00 ? 191 GLN A CB   3  
ATOM 9767  C CG   . GLN A 1 191 ? -15.409 -1.219  -20.042 1.00 0.00 ? 191 GLN A CG   3  
ATOM 9768  C CD   . GLN A 1 191 ? -14.265 -1.530  -20.987 1.00 0.00 ? 191 GLN A CD   3  
ATOM 9769  O OE1  . GLN A 1 191 ? -14.046 -2.683  -21.358 1.00 0.00 ? 191 GLN A OE1  3  
ATOM 9770  N NE2  . GLN A 1 191 ? -13.527 -0.498  -21.382 1.00 0.00 ? 191 GLN A NE2  3  
ATOM 9771  H H    . GLN A 1 191 ? -17.381 -0.292  -17.732 1.00 0.00 ? 191 GLN A H    3  
ATOM 9772  H HA   . GLN A 1 191 ? -16.346 -3.027  -18.054 1.00 0.00 ? 191 GLN A HA   3  
ATOM 9773  H HB2  . GLN A 1 191 ? -14.752 -0.464  -18.170 1.00 0.00 ? 191 GLN A HB2  3  
ATOM 9774  H HB3  . GLN A 1 191 ? -14.181 -2.085  -18.542 1.00 0.00 ? 191 GLN A HB3  3  
ATOM 9775  H HG2  . GLN A 1 191 ? -16.239 -1.867  -20.280 1.00 0.00 ? 191 GLN A HG2  3  
ATOM 9776  H HG3  . GLN A 1 191 ? -15.706 -0.190  -20.184 1.00 0.00 ? 191 GLN A HG3  3  
ATOM 9777  H HE21 . GLN A 1 191 ? -13.759 0.393   -21.046 1.00 0.00 ? 191 GLN A HE21 3  
ATOM 9778  H HE22 . GLN A 1 191 ? -12.780 -0.670  -21.993 1.00 0.00 ? 191 GLN A HE22 3  
ATOM 9779  N N    . ALA A 1 192 ? -16.413 -1.192  -15.456 1.00 0.00 ? 192 ALA A N    3  
ATOM 9780  C CA   . ALA A 1 192 ? -16.159 -1.142  -14.025 1.00 0.00 ? 192 ALA A CA   3  
ATOM 9781  C C    . ALA A 1 192 ? -17.122 -2.070  -13.294 1.00 0.00 ? 192 ALA A C    3  
ATOM 9782  O O    . ALA A 1 192 ? -17.738 -1.676  -12.303 1.00 0.00 ? 192 ALA A O    3  
ATOM 9783  C CB   . ALA A 1 192 ? -16.306 0.285   -13.512 1.00 0.00 ? 192 ALA A CB   3  
ATOM 9784  H H    . ALA A 1 192 ? -17.142 -0.638  -15.805 1.00 0.00 ? 192 ALA A H    3  
ATOM 9785  H HA   . ALA A 1 192 ? -15.144 -1.468  -13.848 1.00 0.00 ? 192 ALA A HA   3  
ATOM 9786  H HB1  . ALA A 1 192 ? -16.785 0.273   -12.542 1.00 0.00 ? 192 ALA A HB1  3  
ATOM 9787  H HB2  . ALA A 1 192 ? -16.909 0.855   -14.206 1.00 0.00 ? 192 ALA A HB2  3  
ATOM 9788  H HB3  . ALA A 1 192 ? -15.330 0.739   -13.427 1.00 0.00 ? 192 ALA A HB3  3  
ATOM 9789  N N    . VAL A 1 193 ? -17.287 -3.288  -13.796 1.00 0.00 ? 193 VAL A N    3  
ATOM 9790  C CA   . VAL A 1 193 ? -18.227 -4.216  -13.176 1.00 0.00 ? 193 VAL A CA   3  
ATOM 9791  C C    . VAL A 1 193 ? -17.594 -5.058  -12.086 1.00 0.00 ? 193 VAL A C    3  
ATOM 9792  O O    . VAL A 1 193 ? -17.224 -6.213  -12.299 1.00 0.00 ? 193 VAL A O    3  
ATOM 9793  C CB   . VAL A 1 193 ? -18.901 -5.172  -14.176 1.00 0.00 ? 193 VAL A CB   3  
ATOM 9794  C CG1  . VAL A 1 193 ? -20.281 -4.664  -14.562 1.00 0.00 ? 193 VAL A CG1  3  
ATOM 9795  C CG2  . VAL A 1 193 ? -18.040 -5.401  -15.407 1.00 0.00 ? 193 VAL A CG2  3  
ATOM 9796  H H    . VAL A 1 193 ? -16.798 -3.551  -14.601 1.00 0.00 ? 193 VAL A H    3  
ATOM 9797  H HA   . VAL A 1 193 ? -19.006 -3.619  -12.724 1.00 0.00 ? 193 VAL A HA   3  
ATOM 9798  H HB   . VAL A 1 193 ? -19.027 -6.117  -13.673 1.00 0.00 ? 193 VAL A HB   3  
ATOM 9799  H HG11 . VAL A 1 193 ? -20.374 -3.625  -14.284 1.00 0.00 ? 193 VAL A HG11 3  
ATOM 9800  H HG12 . VAL A 1 193 ? -21.031 -5.244  -14.044 1.00 0.00 ? 193 VAL A HG12 3  
ATOM 9801  H HG13 . VAL A 1 193 ? -20.419 -4.767  -15.628 1.00 0.00 ? 193 VAL A HG13 3  
ATOM 9802  H HG21 . VAL A 1 193 ? -18.207 -4.601  -16.117 1.00 0.00 ? 193 VAL A HG21 3  
ATOM 9803  H HG22 . VAL A 1 193 ? -18.307 -6.346  -15.857 1.00 0.00 ? 193 VAL A HG22 3  
ATOM 9804  H HG23 . VAL A 1 193 ? -17.000 -5.421  -15.120 1.00 0.00 ? 193 VAL A HG23 3  
ATOM 9805  N N    . ILE A 1 194 ? -17.524 -4.479  -10.908 1.00 0.00 ? 194 ILE A N    3  
ATOM 9806  C CA   . ILE A 1 194 ? -16.996 -5.171  -9.746  1.00 0.00 ? 194 ILE A CA   3  
ATOM 9807  C C    . ILE A 1 194 ? -18.069 -6.114  -9.218  1.00 0.00 ? 194 ILE A C    3  
ATOM 9808  O O    . ILE A 1 194 ? -18.524 -5.993  -8.080  1.00 0.00 ? 194 ILE A O    3  
ATOM 9809  C CB   . ILE A 1 194 ? -16.576 -4.191  -8.634  1.00 0.00 ? 194 ILE A CB   3  
ATOM 9810  C CG1  . ILE A 1 194 ? -15.735 -3.053  -9.215  1.00 0.00 ? 194 ILE A CG1  3  
ATOM 9811  C CG2  . ILE A 1 194 ? -15.807 -4.925  -7.548  1.00 0.00 ? 194 ILE A CG2  3  
ATOM 9812  C CD1  . ILE A 1 194 ? -14.407 -3.510  -9.781  1.00 0.00 ? 194 ILE A CD1  3  
ATOM 9813  H H    . ILE A 1 194 ? -17.867 -3.571  -10.823 1.00 0.00 ? 194 ILE A H    3  
ATOM 9814  H HA   . ILE A 1 194 ? -16.133 -5.745  -10.053 1.00 0.00 ? 194 ILE A HA   3  
ATOM 9815  H HB   . ILE A 1 194 ? -17.471 -3.779  -8.192  1.00 0.00 ? 194 ILE A HB   3  
ATOM 9816  H HG12 . ILE A 1 194 ? -16.287 -2.575  -10.011 1.00 0.00 ? 194 ILE A HG12 3  
ATOM 9817  H HG13 . ILE A 1 194 ? -15.534 -2.330  -8.439  1.00 0.00 ? 194 ILE A HG13 3  
ATOM 9818  H HG21 . ILE A 1 194 ? -16.492 -5.249  -6.779  1.00 0.00 ? 194 ILE A HG21 3  
ATOM 9819  H HG22 . ILE A 1 194 ? -15.069 -4.263  -7.119  1.00 0.00 ? 194 ILE A HG22 3  
ATOM 9820  H HG23 . ILE A 1 194 ? -15.313 -5.786  -7.976  1.00 0.00 ? 194 ILE A HG23 3  
ATOM 9821  H HD11 . ILE A 1 194 ? -13.873 -2.659  -10.178 1.00 0.00 ? 194 ILE A HD11 3  
ATOM 9822  H HD12 . ILE A 1 194 ? -14.580 -4.227  -10.569 1.00 0.00 ? 194 ILE A HD12 3  
ATOM 9823  H HD13 . ILE A 1 194 ? -13.822 -3.969  -8.998  1.00 0.00 ? 194 ILE A HD13 3  
ATOM 9824  N N    . LYS A 1 195 ? -18.479 -7.045  -10.075 1.00 0.00 ? 195 LYS A N    3  
ATOM 9825  C CA   . LYS A 1 195 ? -19.510 -8.010  -9.733  1.00 0.00 ? 195 LYS A CA   3  
ATOM 9826  C C    . LYS A 1 195 ? -18.987 -9.012  -8.715  1.00 0.00 ? 195 LYS A C    3  
ATOM 9827  O O    . LYS A 1 195 ? -18.260 -9.946  -9.051  1.00 0.00 ? 195 LYS A O    3  
ATOM 9828  C CB   . LYS A 1 195 ? -20.016 -8.698  -11.007 1.00 0.00 ? 195 LYS A CB   3  
ATOM 9829  C CG   . LYS A 1 195 ? -21.020 -9.808  -10.753 1.00 0.00 ? 195 LYS A CG   3  
ATOM 9830  C CD   . LYS A 1 195 ? -20.925 -10.897 -11.808 1.00 0.00 ? 195 LYS A CD   3  
ATOM 9831  C CE   . LYS A 1 195 ? -21.744 -10.550 -13.041 1.00 0.00 ? 195 LYS A CE   3  
ATOM 9832  N NZ   . LYS A 1 195 ? -21.785 -11.675 -14.015 1.00 0.00 ? 195 LYS A NZ   3  
ATOM 9833  H H    . LYS A 1 195 ? -18.069 -7.084  -10.963 1.00 0.00 ? 195 LYS A H    3  
ATOM 9834  H HA   . LYS A 1 195 ? -20.329 -7.473  -9.284  1.00 0.00 ? 195 LYS A HA   3  
ATOM 9835  H HB2  . LYS A 1 195 ? -20.494 -7.954  -11.626 1.00 0.00 ? 195 LYS A HB2  3  
ATOM 9836  H HB3  . LYS A 1 195 ? -19.174 -9.108  -11.547 1.00 0.00 ? 195 LYS A HB3  3  
ATOM 9837  H HG2  . LYS A 1 195 ? -20.831 -10.238 -9.784  1.00 0.00 ? 195 LYS A HG2  3  
ATOM 9838  H HG3  . LYS A 1 195 ? -22.015 -9.389  -10.773 1.00 0.00 ? 195 LYS A HG3  3  
ATOM 9839  H HD2  . LYS A 1 195 ? -19.891 -11.015 -12.096 1.00 0.00 ? 195 LYS A HD2  3  
ATOM 9840  H HD3  . LYS A 1 195 ? -21.293 -11.822 -11.391 1.00 0.00 ? 195 LYS A HD3  3  
ATOM 9841  H HE2  . LYS A 1 195 ? -22.753 -10.315 -12.733 1.00 0.00 ? 195 LYS A HE2  3  
ATOM 9842  H HE3  . LYS A 1 195 ? -21.305 -9.686  -13.518 1.00 0.00 ? 195 LYS A HE3  3  
ATOM 9843  H HZ1  . LYS A 1 195 ? -20.996 -11.594 -14.688 1.00 0.00 ? 195 LYS A HZ1  3  
ATOM 9844  H HZ2  . LYS A 1 195 ? -22.680 -11.656 -14.545 1.00 0.00 ? 195 LYS A HZ2  3  
ATOM 9845  H HZ3  . LYS A 1 195 ? -21.710 -12.584 -13.516 1.00 0.00 ? 195 LYS A HZ3  3  
ATOM 9846  N N    . SER A 1 196 ? -19.356 -8.782  -7.459  1.00 0.00 ? 196 SER A N    3  
ATOM 9847  C CA   . SER A 1 196 ? -18.921 -9.634  -6.357  1.00 0.00 ? 196 SER A CA   3  
ATOM 9848  C C    . SER A 1 196 ? -19.677 -10.953 -6.356  1.00 0.00 ? 196 SER A C    3  
ATOM 9849  O O    . SER A 1 196 ? -20.725 -11.074 -6.990  1.00 0.00 ? 196 SER A O    3  
ATOM 9850  C CB   . SER A 1 196 ? -19.135 -8.914  -5.024  1.00 0.00 ? 196 SER A CB   3  
ATOM 9851  O OG   . SER A 1 196 ? -20.395 -8.265  -4.992  1.00 0.00 ? 196 SER A OG   3  
ATOM 9852  H H    . SER A 1 196 ? -19.930 -8.004  -7.271  1.00 0.00 ? 196 SER A H    3  
ATOM 9853  H HA   . SER A 1 196 ? -17.868 -9.833  -6.484  1.00 0.00 ? 196 SER A HA   3  
ATOM 9854  H HB2  . SER A 1 196 ? -19.095 -9.631  -4.218  1.00 0.00 ? 196 SER A HB2  3  
ATOM 9855  H HB3  . SER A 1 196 ? -18.361 -8.175  -4.887  1.00 0.00 ? 196 SER A HB3  3  
ATOM 9856  H HG   . SER A 1 196 ? -21.092 -8.913  -5.113  1.00 0.00 ? 196 SER A HG   3  
ATOM 9857  N N    . PRO A 1 197 ? -19.171 -11.964 -5.625  1.00 0.00 ? 197 PRO A N    3  
ATOM 9858  C CA   . PRO A 1 197 ? -19.835 -13.261 -5.542  1.00 0.00 ? 197 PRO A CA   3  
ATOM 9859  C C    . PRO A 1 197 ? -21.302 -13.083 -5.206  1.00 0.00 ? 197 PRO A C    3  
ATOM 9860  O O    . PRO A 1 197 ? -21.662 -12.768 -4.072  1.00 0.00 ? 197 PRO A O    3  
ATOM 9861  C CB   . PRO A 1 197 ? -19.101 -13.975 -4.416  1.00 0.00 ? 197 PRO A CB   3  
ATOM 9862  C CG   . PRO A 1 197 ? -17.746 -13.350 -4.395  1.00 0.00 ? 197 PRO A CG   3  
ATOM 9863  C CD   . PRO A 1 197 ? -17.941 -11.916 -4.812  1.00 0.00 ? 197 PRO A CD   3  
ATOM 9864  H HA   . PRO A 1 197 ? -19.738 -13.820 -6.462  1.00 0.00 ? 197 PRO A HA   3  
ATOM 9865  H HB2  . PRO A 1 197 ? -19.628 -13.818 -3.487  1.00 0.00 ? 197 PRO A HB2  3  
ATOM 9866  H HB3  . PRO A 1 197 ? -19.049 -15.029 -4.636  1.00 0.00 ? 197 PRO A HB3  3  
ATOM 9867  H HG2  . PRO A 1 197 ? -17.335 -13.398 -3.396  1.00 0.00 ? 197 PRO A HG2  3  
ATOM 9868  H HG3  . PRO A 1 197 ? -17.097 -13.858 -5.093  1.00 0.00 ? 197 PRO A HG3  3  
ATOM 9869  H HD2  . PRO A 1 197 ? -18.076 -11.287 -3.944  1.00 0.00 ? 197 PRO A HD2  3  
ATOM 9870  H HD3  . PRO A 1 197 ? -17.103 -11.574 -5.401  1.00 0.00 ? 197 PRO A HD3  3  
ATOM 9871  N N    . LEU A 1 198 ? -22.136 -13.236 -6.216  1.00 0.00 ? 198 LEU A N    3  
ATOM 9872  C CA   . LEU A 1 198 ? -23.569 -13.043 -6.061  1.00 0.00 ? 198 LEU A CA   3  
ATOM 9873  C C    . LEU A 1 198 ? -24.131 -13.704 -4.830  1.00 0.00 ? 198 LEU A C    3  
ATOM 9874  O O    . LEU A 1 198 ? -23.475 -14.473 -4.129  1.00 0.00 ? 198 LEU A O    3  
ATOM 9875  C CB   . LEU A 1 198 ? -24.347 -13.574 -7.263  1.00 0.00 ? 198 LEU A CB   3  
ATOM 9876  C CG   . LEU A 1 198 ? -23.857 -13.081 -8.606  1.00 0.00 ? 198 LEU A CG   3  
ATOM 9877  C CD1  . LEU A 1 198 ? -23.417 -14.255 -9.460  1.00 0.00 ? 198 LEU A CD1  3  
ATOM 9878  C CD2  . LEU A 1 198 ? -24.935 -12.281 -9.317  1.00 0.00 ? 198 LEU A CD2  3  
ATOM 9879  H H    . LEU A 1 198 ? -21.775 -13.453 -7.098  1.00 0.00 ? 198 LEU A H    3  
ATOM 9880  H HA   . LEU A 1 198 ? -23.745 -11.981 -5.988  1.00 0.00 ? 198 LEU A HA   3  
ATOM 9881  H HB2  . LEU A 1 198 ? -24.297 -14.654 -7.255  1.00 0.00 ? 198 LEU A HB2  3  
ATOM 9882  H HB3  . LEU A 1 198 ? -25.381 -13.284 -7.154  1.00 0.00 ? 198 LEU A HB3  3  
ATOM 9883  H HG   . LEU A 1 198 ? -23.017 -12.436 -8.437  1.00 0.00 ? 198 LEU A HG   3  
ATOM 9884  H HD11 . LEU A 1 198 ? -23.460 -13.979 -10.502 1.00 0.00 ? 198 LEU A HD11 3  
ATOM 9885  H HD12 . LEU A 1 198 ? -24.081 -15.091 -9.279  1.00 0.00 ? 198 LEU A HD12 3  
ATOM 9886  H HD13 . LEU A 1 198 ? -22.407 -14.533 -9.199  1.00 0.00 ? 198 LEU A HD13 3  
ATOM 9887  H HD21 . LEU A 1 198 ? -25.621 -12.959 -9.803  1.00 0.00 ? 198 LEU A HD21 3  
ATOM 9888  H HD22 . LEU A 1 198 ? -24.480 -11.640 -10.056 1.00 0.00 ? 198 LEU A HD22 3  
ATOM 9889  H HD23 . LEU A 1 198 ? -25.472 -11.681 -8.598  1.00 0.00 ? 198 LEU A HD23 3  
ATOM 9890  N N    . LYS A 1 199 ? -25.391 -13.408 -4.639  1.00 0.00 ? 199 LYS A N    3  
ATOM 9891  C CA   . LYS A 1 199 ? -26.183 -13.958 -3.559  1.00 0.00 ? 199 LYS A CA   3  
ATOM 9892  C C    . LYS A 1 199 ? -27.383 -14.633 -4.197  1.00 0.00 ? 199 LYS A C    3  
ATOM 9893  O O    . LYS A 1 199 ? -28.258 -13.962 -4.738  1.00 0.00 ? 199 LYS A O    3  
ATOM 9894  C CB   . LYS A 1 199 ? -26.619 -12.852 -2.598  1.00 0.00 ? 199 LYS A CB   3  
ATOM 9895  C CG   . LYS A 1 199 ? -27.045 -13.361 -1.232  1.00 0.00 ? 199 LYS A CG   3  
ATOM 9896  C CD   . LYS A 1 199 ? -26.657 -12.392 -0.127  1.00 0.00 ? 199 LYS A CD   3  
ATOM 9897  C CE   . LYS A 1 199 ? -25.319 -12.750 0.499   1.00 0.00 ? 199 LYS A CE   3  
ATOM 9898  N NZ   . LYS A 1 199 ? -25.249 -14.188 0.881   1.00 0.00 ? 199 LYS A NZ   3  
ATOM 9899  H H    . LYS A 1 199 ? -25.824 -12.810 -5.293  1.00 0.00 ? 199 LYS A H    3  
ATOM 9900  H HA   . LYS A 1 199 ? -25.590 -14.693 -3.035  1.00 0.00 ? 199 LYS A HA   3  
ATOM 9901  H HB2  . LYS A 1 199 ? -25.795 -12.168 -2.460  1.00 0.00 ? 199 LYS A HB2  3  
ATOM 9902  H HB3  . LYS A 1 199 ? -27.447 -12.320 -3.037  1.00 0.00 ? 199 LYS A HB3  3  
ATOM 9903  H HG2  . LYS A 1 199 ? -28.116 -13.483 -1.228  1.00 0.00 ? 199 LYS A HG2  3  
ATOM 9904  H HG3  . LYS A 1 199 ? -26.571 -14.313 -1.049  1.00 0.00 ? 199 LYS A HG3  3  
ATOM 9905  H HD2  . LYS A 1 199 ? -26.591 -11.397 -0.540  1.00 0.00 ? 199 LYS A HD2  3  
ATOM 9906  H HD3  . LYS A 1 199 ? -27.418 -12.412 0.641   1.00 0.00 ? 199 LYS A HD3  3  
ATOM 9907  H HE2  . LYS A 1 199 ? -24.535 -12.537 -0.211  1.00 0.00 ? 199 LYS A HE2  3  
ATOM 9908  H HE3  . LYS A 1 199 ? -25.178 -12.144 1.384   1.00 0.00 ? 199 LYS A HE3  3  
ATOM 9909  H HZ1  . LYS A 1 199 ? -24.579 -14.317 1.666   1.00 0.00 ? 199 LYS A HZ1  3  
ATOM 9910  H HZ2  . LYS A 1 199 ? -24.931 -14.758 0.071   1.00 0.00 ? 199 LYS A HZ2  3  
ATOM 9911  H HZ3  . LYS A 1 199 ? -26.187 -14.525 1.180   1.00 0.00 ? 199 LYS A HZ3  3  
ATOM 9912  N N    . CYS A 1 200 ? -27.409 -15.956 -4.176  1.00 0.00 ? 200 CYS A N    3  
ATOM 9913  C CA   . CYS A 1 200 ? -28.495 -16.688 -4.807  1.00 0.00 ? 200 CYS A CA   3  
ATOM 9914  C C    . CYS A 1 200 ? -29.607 -17.035 -3.818  1.00 0.00 ? 200 CYS A C    3  
ATOM 9915  O O    . CYS A 1 200 ? -29.730 -18.184 -3.392  1.00 0.00 ? 200 CYS A O    3  
ATOM 9916  C CB   . CYS A 1 200 ? -27.951 -17.956 -5.467  1.00 0.00 ? 200 CYS A CB   3  
ATOM 9917  S SG   . CYS A 1 200 ? -27.797 -17.841 -7.284  1.00 0.00 ? 200 CYS A SG   3  
ATOM 9918  H H    . CYS A 1 200 ? -26.685 -16.453 -3.742  1.00 0.00 ? 200 CYS A H    3  
ATOM 9919  H HA   . CYS A 1 200 ? -28.899 -16.054 -5.578  1.00 0.00 ? 200 CYS A HA   3  
ATOM 9920  H HB2  . CYS A 1 200 ? -26.970 -18.169 -5.068  1.00 0.00 ? 200 CYS A HB2  3  
ATOM 9921  H HB3  . CYS A 1 200 ? -28.611 -18.781 -5.244  1.00 0.00 ? 200 CYS A HB3  3  
ATOM 9922  N N    . THR A 1 201 ? -30.419 -16.040 -3.457  1.00 0.00 ? 201 THR A N    3  
ATOM 9923  C CA   . THR A 1 201 ? -31.519 -16.264 -2.521  1.00 0.00 ? 201 THR A CA   3  
ATOM 9924  C C    . THR A 1 201 ? -32.807 -16.632 -3.269  1.00 0.00 ? 201 THR A C    3  
ATOM 9925  O O    . THR A 1 201 ? -33.268 -15.896 -4.143  1.00 0.00 ? 201 THR A O    3  
ATOM 9926  C CB   . THR A 1 201 ? -31.730 -15.040 -1.607  1.00 0.00 ? 201 THR A CB   3  
ATOM 9927  O OG1  . THR A 1 201 ? -32.014 -15.458 -0.284  1.00 0.00 ? 201 THR A OG1  3  
ATOM 9928  C CG2  . THR A 1 201 ? -32.853 -14.111 -2.034  1.00 0.00 ? 201 THR A CG2  3  
ATOM 9929  H H    . THR A 1 201 ? -30.273 -15.145 -3.827  1.00 0.00 ? 201 THR A H    3  
ATOM 9930  H HA   . THR A 1 201 ? -31.236 -17.098 -1.901  1.00 0.00 ? 201 THR A HA   3  
ATOM 9931  H HB   . THR A 1 201 ? -30.816 -14.466 -1.584  1.00 0.00 ? 201 THR A HB   3  
ATOM 9932  H HG1  . THR A 1 201 ? -31.346 -15.111 0.312   1.00 0.00 ? 201 THR A HG1  3  
ATOM 9933  H HG21 . THR A 1 201 ? -33.063 -14.260 -3.075  1.00 0.00 ? 201 THR A HG21 3  
ATOM 9934  H HG22 . THR A 1 201 ? -32.556 -13.086 -1.873  1.00 0.00 ? 201 THR A HG22 3  
ATOM 9935  H HG23 . THR A 1 201 ? -33.738 -14.324 -1.453  1.00 0.00 ? 201 THR A HG23 3  
ATOM 9936  N N    . LEU A 1 202 ? -33.360 -17.796 -2.944  1.00 0.00 ? 202 LEU A N    3  
ATOM 9937  C CA   . LEU A 1 202 ? -34.574 -18.280 -3.598  1.00 0.00 ? 202 LEU A CA   3  
ATOM 9938  C C    . LEU A 1 202 ? -35.829 -17.899 -2.796  1.00 0.00 ? 202 LEU A C    3  
ATOM 9939  O O    . LEU A 1 202 ? -35.739 -17.532 -1.625  1.00 0.00 ? 202 LEU A O    3  
ATOM 9940  C CB   . LEU A 1 202 ? -34.481 -19.798 -3.777  1.00 0.00 ? 202 LEU A CB   3  
ATOM 9941  C CG   . LEU A 1 202 ? -35.641 -20.480 -4.519  1.00 0.00 ? 202 LEU A CG   3  
ATOM 9942  C CD1  . LEU A 1 202 ? -36.083 -19.694 -5.745  1.00 0.00 ? 202 LEU A CD1  3  
ATOM 9943  C CD2  . LEU A 1 202 ? -35.227 -21.872 -4.943  1.00 0.00 ? 202 LEU A CD2  3  
ATOM 9944  H H    . LEU A 1 202 ? -32.920 -18.355 -2.270  1.00 0.00 ? 202 LEU A H    3  
ATOM 9945  H HA   . LEU A 1 202 ? -34.622 -17.820 -4.573  1.00 0.00 ? 202 LEU A HA   3  
ATOM 9946  H HB2  . LEU A 1 202 ? -33.571 -20.014 -4.315  1.00 0.00 ? 202 LEU A HB2  3  
ATOM 9947  H HB3  . LEU A 1 202 ? -34.405 -20.243 -2.797  1.00 0.00 ? 202 LEU A HB3  3  
ATOM 9948  H HG   . LEU A 1 202 ? -36.486 -20.571 -3.855  1.00 0.00 ? 202 LEU A HG   3  
ATOM 9949  H HD11 . LEU A 1 202 ? -37.160 -19.674 -5.782  1.00 0.00 ? 202 LEU A HD11 3  
ATOM 9950  H HD12 . LEU A 1 202 ? -35.706 -20.174 -6.636  1.00 0.00 ? 202 LEU A HD12 3  
ATOM 9951  H HD13 . LEU A 1 202 ? -35.705 -18.685 -5.696  1.00 0.00 ? 202 LEU A HD13 3  
ATOM 9952  H HD21 . LEU A 1 202 ? -35.140 -22.505 -4.073  1.00 0.00 ? 202 LEU A HD21 3  
ATOM 9953  H HD22 . LEU A 1 202 ? -34.275 -21.816 -5.450  1.00 0.00 ? 202 LEU A HD22 3  
ATOM 9954  H HD23 . LEU A 1 202 ? -35.970 -22.276 -5.614  1.00 0.00 ? 202 LEU A HD23 3  
ATOM 9955  N N    . LEU A 1 203 ? -36.995 -17.996 -3.439  1.00 0.00 ? 203 LEU A N    3  
ATOM 9956  C CA   . LEU A 1 203 ? -38.277 -17.679 -2.818  1.00 0.00 ? 203 LEU A CA   3  
ATOM 9957  C C    . LEU A 1 203 ? -39.044 -18.966 -2.643  1.00 0.00 ? 203 LEU A C    3  
ATOM 9958  O O    . LEU A 1 203 ? -38.773 -19.925 -3.357  1.00 0.00 ? 203 LEU A O    3  
ATOM 9959  C CB   . LEU A 1 203 ? -39.087 -16.702 -3.680  1.00 0.00 ? 203 LEU A CB   3  
ATOM 9960  C CG   . LEU A 1 203 ? -38.278 -15.617 -4.393  1.00 0.00 ? 203 LEU A CG   3  
ATOM 9961  C CD1  . LEU A 1 203 ? -37.104 -15.166 -3.542  1.00 0.00 ? 203 LEU A CD1  3  
ATOM 9962  C CD2  . LEU A 1 203 ? -37.795 -16.113 -5.744  1.00 0.00 ? 203 LEU A CD2  3  
ATOM 9963  H H    . LEU A 1 203 ? -37.004 -18.304 -4.368  1.00 0.00 ? 203 LEU A H    3  
ATOM 9964  H HA   . LEU A 1 203 ? -38.087 -17.240 -1.850  1.00 0.00 ? 203 LEU A HA   3  
ATOM 9965  H HB2  . LEU A 1 203 ? -39.618 -17.272 -4.428  1.00 0.00 ? 203 LEU A HB2  3  
ATOM 9966  H HB3  . LEU A 1 203 ? -39.812 -16.215 -3.045  1.00 0.00 ? 203 LEU A HB3  3  
ATOM 9967  H HG   . LEU A 1 203 ? -38.913 -14.759 -4.561  1.00 0.00 ? 203 LEU A HG   3  
ATOM 9968  H HD11 . LEU A 1 203 ? -36.980 -14.098 -3.639  1.00 0.00 ? 203 LEU A HD11 3  
ATOM 9969  H HD12 . LEU A 1 203 ? -36.205 -15.665 -3.873  1.00 0.00 ? 203 LEU A HD12 3  
ATOM 9970  H HD13 . LEU A 1 203 ? -37.294 -15.414 -2.508  1.00 0.00 ? 203 LEU A HD13 3  
ATOM 9971  H HD21 . LEU A 1 203 ? -37.480 -15.271 -6.342  1.00 0.00 ? 203 LEU A HD21 3  
ATOM 9972  H HD22 . LEU A 1 203 ? -38.599 -16.631 -6.246  1.00 0.00 ? 203 LEU A HD22 3  
ATOM 9973  H HD23 . LEU A 1 203 ? -36.964 -16.787 -5.604  1.00 0.00 ? 203 LEU A HD23 3  
ATOM 9974  N N    . PRO A 1 204 ? -40.035 -19.031 -1.740  1.00 0.00 ? 204 PRO A N    3  
ATOM 9975  C CA   . PRO A 1 204 ? -40.820 -20.252 -1.578  1.00 0.00 ? 204 PRO A CA   3  
ATOM 9976  C C    . PRO A 1 204 ? -41.358 -20.652 -2.937  1.00 0.00 ? 204 PRO A C    3  
ATOM 9977  O O    . PRO A 1 204 ? -42.302 -20.043 -3.442  1.00 0.00 ? 204 PRO A O    3  
ATOM 9978  C CB   . PRO A 1 204 ? -41.942 -19.836 -0.623  1.00 0.00 ? 204 PRO A CB   3  
ATOM 9979  C CG   . PRO A 1 204 ? -41.975 -18.358 -0.752  1.00 0.00 ? 204 PRO A CG   3  
ATOM 9980  C CD   . PRO A 1 204 ? -40.545 -17.944 -0.893  1.00 0.00 ? 204 PRO A CD   3  
ATOM 9981  H HA   . PRO A 1 204 ? -40.237 -21.059 -1.155  1.00 0.00 ? 204 PRO A HA   3  
ATOM 9982  H HB2  . PRO A 1 204 ? -42.874 -20.287 -0.934  1.00 0.00 ? 204 PRO A HB2  3  
ATOM 9983  H HB3  . PRO A 1 204 ? -41.700 -20.141 0.383   1.00 0.00 ? 204 PRO A HB3  3  
ATOM 9984  H HG2  . PRO A 1 204 ? -42.520 -18.098 -1.639  1.00 0.00 ? 204 PRO A HG2  3  
ATOM 9985  H HG3  . PRO A 1 204 ? -42.425 -17.902 0.116   1.00 0.00 ? 204 PRO A HG3  3  
ATOM 9986  H HD2  . PRO A 1 204 ? -40.484 -16.983 -1.389  1.00 0.00 ? 204 PRO A HD2  3  
ATOM 9987  H HD3  . PRO A 1 204 ? -40.053 -17.920 0.061   1.00 0.00 ? 204 PRO A HD3  3  
ATOM 9988  N N    . PRO A 1 205 ? -40.740 -21.649 -3.579  1.00 0.00 ? 205 PRO A N    3  
ATOM 9989  C CA   . PRO A 1 205 ? -41.149 -22.069 -4.910  1.00 0.00 ? 205 PRO A CA   3  
ATOM 9990  C C    . PRO A 1 205 ? -42.534 -22.673 -4.915  1.00 0.00 ? 205 PRO A C    3  
ATOM 9991  O O    . PRO A 1 205 ? -42.760 -23.790 -4.451  1.00 0.00 ? 205 PRO A O    3  
ATOM 9992  C CB   . PRO A 1 205 ? -40.066 -23.054 -5.315  1.00 0.00 ? 205 PRO A CB   3  
ATOM 9993  C CG   . PRO A 1 205 ? -39.540 -23.588 -4.032  1.00 0.00 ? 205 PRO A CG   3  
ATOM 9994  C CD   . PRO A 1 205 ? -39.590 -22.432 -3.078  1.00 0.00 ? 205 PRO A CD   3  
ATOM 9995  H HA   . PRO A 1 205 ? -41.138 -21.232 -5.601  1.00 0.00 ? 205 PRO A HA   3  
ATOM 9996  H HB2  . PRO A 1 205 ? -40.484 -23.829 -5.939  1.00 0.00 ? 205 PRO A HB2  3  
ATOM 9997  H HB3  . PRO A 1 205 ? -39.306 -22.505 -5.854  1.00 0.00 ? 205 PRO A HB3  3  
ATOM 9998  H HG2  . PRO A 1 205 ? -40.167 -24.395 -3.682  1.00 0.00 ? 205 PRO A HG2  3  
ATOM 9999  H HG3  . PRO A 1 205 ? -38.523 -23.926 -4.161  1.00 0.00 ? 205 PRO A HG3  3  
ATOM 10000 H HD2  . PRO A 1 205 ? -39.766 -22.779 -2.070  1.00 0.00 ? 205 PRO A HD2  3  
ATOM 10001 H HD3  . PRO A 1 205 ? -38.677 -21.862 -3.130  1.00 0.00 ? 205 PRO A HD3  3  
ATOM 10002 N N    . GLY A 1 206 ? -43.457 -21.884 -5.435  1.00 0.00 ? 206 GLY A N    3  
ATOM 10003 C CA   . GLY A 1 206 ? -44.847 -22.283 -5.505  1.00 0.00 ? 206 GLY A CA   3  
ATOM 10004 C C    . GLY A 1 206 ? -45.048 -23.565 -6.287  1.00 0.00 ? 206 GLY A C    3  
ATOM 10005 O O    . GLY A 1 206 ? -44.342 -23.823 -7.262  1.00 0.00 ? 206 GLY A O    3  
ATOM 10006 H H    . GLY A 1 206 ? -43.183 -21.006 -5.772  1.00 0.00 ? 206 GLY A H    3  
ATOM 10007 H HA2  . GLY A 1 206 ? -45.218 -22.419 -4.499  1.00 0.00 ? 206 GLY A HA2  3  
ATOM 10008 H HA3  . GLY A 1 206 ? -45.410 -21.490 -5.976  1.00 0.00 ? 206 GLY A HA3  3  
ATOM 10009 N N    . GLN A 1 207 ? -46.012 -24.373 -5.859  1.00 0.00 ? 207 GLN A N    3  
ATOM 10010 C CA   . GLN A 1 207 ? -46.302 -25.636 -6.528  1.00 0.00 ? 207 GLN A CA   3  
ATOM 10011 C C    . GLN A 1 207 ? -47.583 -26.260 -5.986  1.00 0.00 ? 207 GLN A C    3  
ATOM 10012 O O    . GLN A 1 207 ? -48.172 -25.761 -5.026  1.00 0.00 ? 207 GLN A O    3  
ATOM 10013 C CB   . GLN A 1 207 ? -45.131 -26.607 -6.355  1.00 0.00 ? 207 GLN A CB   3  
ATOM 10014 C CG   . GLN A 1 207 ? -44.226 -26.692 -7.574  1.00 0.00 ? 207 GLN A CG   3  
ATOM 10015 C CD   . GLN A 1 207 ? -44.420 -27.977 -8.356  1.00 0.00 ? 207 GLN A CD   3  
ATOM 10016 O OE1  . GLN A 1 207 ? -44.929 -28.966 -7.829  1.00 0.00 ? 207 GLN A OE1  3  
ATOM 10017 N NE2  . GLN A 1 207 ? -44.013 -27.968 -9.620  1.00 0.00 ? 207 GLN A NE2  3  
ATOM 10018 H H    . GLN A 1 207 ? -46.541 -24.115 -5.075  1.00 0.00 ? 207 GLN A H    3  
ATOM 10019 H HA   . GLN A 1 207 ? -46.434 -25.430 -7.580  1.00 0.00 ? 207 GLN A HA   3  
ATOM 10020 H HB2  . GLN A 1 207 ? -44.536 -26.287 -5.513  1.00 0.00 ? 207 GLN A HB2  3  
ATOM 10021 H HB3  . GLN A 1 207 ? -45.522 -27.594 -6.155  1.00 0.00 ? 207 GLN A HB3  3  
ATOM 10022 H HG2  . GLN A 1 207 ? -44.440 -25.857 -8.224  1.00 0.00 ? 207 GLN A HG2  3  
ATOM 10023 H HG3  . GLN A 1 207 ? -43.198 -26.638 -7.247  1.00 0.00 ? 207 GLN A HG3  3  
ATOM 10024 H HE21 . GLN A 1 207 ? -43.614 -27.145 -9.973  1.00 0.00 ? 207 GLN A HE21 3  
ATOM 10025 H HE22 . GLN A 1 207 ? -44.128 -28.786 -10.149 1.00 0.00 ? 207 GLN A HE22 3  
ATOM 10026 N N    . GLU A 1 208 ? -48.010 -27.355 -6.607  1.00 0.00 ? 208 GLU A N    3  
ATOM 10027 C CA   . GLU A 1 208 ? -49.221 -28.050 -6.188  1.00 0.00 ? 208 GLU A CA   3  
ATOM 10028 C C    . GLU A 1 208 ? -49.097 -29.551 -6.433  1.00 0.00 ? 208 GLU A C    3  
ATOM 10029 O O    . GLU A 1 208 ? -48.213 -30.000 -7.161  1.00 0.00 ? 208 GLU A O    3  
ATOM 10030 C CB   . GLU A 1 208 ? -50.436 -27.498 -6.936  1.00 0.00 ? 208 GLU A CB   3  
ATOM 10031 C CG   . GLU A 1 208 ? -50.942 -26.176 -6.382  1.00 0.00 ? 208 GLU A CG   3  
ATOM 10032 C CD   . GLU A 1 208 ? -52.196 -25.691 -7.083  1.00 0.00 ? 208 GLU A CD   3  
ATOM 10033 O OE1  . GLU A 1 208 ? -53.301 -26.114 -6.684  1.00 0.00 ? 208 GLU A OE1  3  
ATOM 10034 O OE2  . GLU A 1 208 ? -52.072 -24.887 -8.032  1.00 0.00 ? 208 GLU A OE2  3  
ATOM 10035 H H    . GLU A 1 208 ? -47.497 -27.704 -7.366  1.00 0.00 ? 208 GLU A H    3  
ATOM 10036 H HA   . GLU A 1 208 ? -49.352 -27.879 -5.131  1.00 0.00 ? 208 GLU A HA   3  
ATOM 10037 H HB2  . GLU A 1 208 ? -50.169 -27.351 -7.973  1.00 0.00 ? 208 GLU A HB2  3  
ATOM 10038 H HB3  . GLU A 1 208 ? -51.238 -28.219 -6.878  1.00 0.00 ? 208 GLU A HB3  3  
ATOM 10039 H HG2  . GLU A 1 208 ? -51.161 -26.301 -5.333  1.00 0.00 ? 208 GLU A HG2  3  
ATOM 10040 H HG3  . GLU A 1 208 ? -50.169 -25.431 -6.502  1.00 0.00 ? 208 GLU A HG3  3  
ATOM 10041 N N    . SER A 1 209 ? -49.989 -30.321 -5.819  1.00 0.00 ? 209 SER A N    3  
ATOM 10042 C CA   . SER A 1 209 ? -49.979 -31.772 -5.970  1.00 0.00 ? 209 SER A CA   3  
ATOM 10043 C C    . SER A 1 209 ? -51.121 -32.232 -6.870  1.00 0.00 ? 209 SER A C    3  
ATOM 10044 O O    . SER A 1 209 ? -50.893 -32.776 -7.950  1.00 0.00 ? 209 SER A O    3  
ATOM 10045 C CB   . SER A 1 209 ? -50.086 -32.449 -4.603  1.00 0.00 ? 209 SER A CB   3  
ATOM 10046 O OG   . SER A 1 209 ? -48.820 -32.527 -3.970  1.00 0.00 ? 209 SER A OG   3  
ATOM 10047 H H    . SER A 1 209 ? -50.670 -29.905 -5.251  1.00 0.00 ? 209 SER A H    3  
ATOM 10048 H HA   . SER A 1 209 ? -49.041 -32.051 -6.428  1.00 0.00 ? 209 SER A HA   3  
ATOM 10049 H HB2  . SER A 1 209 ? -50.754 -31.879 -3.974  1.00 0.00 ? 209 SER A HB2  3  
ATOM 10050 H HB3  . SER A 1 209 ? -50.475 -33.448 -4.729  1.00 0.00 ? 209 SER A HB3  3  
ATOM 10051 H HG   . SER A 1 209 ? -48.362 -31.688 -4.063  1.00 0.00 ? 209 SER A HG   3  
ATOM 10052 N N    . GLU A 1 210 ? -52.351 -32.009 -6.418  1.00 0.00 ? 210 GLU A N    3  
ATOM 10053 C CA   . GLU A 1 210 ? -53.529 -32.400 -7.182  1.00 0.00 ? 210 GLU A CA   3  
ATOM 10054 C C    . GLU A 1 210 ? -54.742 -31.571 -6.772  1.00 0.00 ? 210 GLU A C    3  
ATOM 10055 O O    . GLU A 1 210 ? -55.225 -31.675 -5.645  1.00 0.00 ? 210 GLU A O    3  
ATOM 10056 C CB   . GLU A 1 210 ? -53.819 -33.890 -6.984  1.00 0.00 ? 210 GLU A CB   3  
ATOM 10057 C CG   . GLU A 1 210 ? -53.625 -34.719 -8.243  1.00 0.00 ? 210 GLU A CG   3  
ATOM 10058 C CD   . GLU A 1 210 ? -53.238 -36.154 -7.943  1.00 0.00 ? 210 GLU A CD   3  
ATOM 10059 O OE1  . GLU A 1 210 ? -52.390 -36.365 -7.051  1.00 0.00 ? 210 GLU A OE1  3  
ATOM 10060 O OE2  . GLU A 1 210 ? -53.782 -37.065 -8.601  1.00 0.00 ? 210 GLU A OE2  3  
ATOM 10061 H H    . GLU A 1 210 ? -52.468 -31.571 -5.549  1.00 0.00 ? 210 GLU A H    3  
ATOM 10062 H HA   . GLU A 1 210 ? -53.320 -32.219 -8.226  1.00 0.00 ? 210 GLU A HA   3  
ATOM 10063 H HB2  . GLU A 1 210 ? -53.158 -34.275 -6.221  1.00 0.00 ? 210 GLU A HB2  3  
ATOM 10064 H HB3  . GLU A 1 210 ? -54.840 -34.008 -6.655  1.00 0.00 ? 210 GLU A HB3  3  
ATOM 10065 H HG2  . GLU A 1 210 ? -54.549 -34.722 -8.803  1.00 0.00 ? 210 GLU A HG2  3  
ATOM 10066 H HG3  . GLU A 1 210 ? -52.846 -34.268 -8.840  1.00 0.00 ? 210 GLU A HG3  3  
ATOM 10067 N N    . PHE A 1 211 ? -55.229 -30.748 -7.695  1.00 0.00 ? 211 PHE A N    3  
ATOM 10068 C CA   . PHE A 1 211 ? -56.386 -29.901 -7.430  1.00 0.00 ? 211 PHE A CA   3  
ATOM 10069 C C    . PHE A 1 211 ? -56.103 -28.938 -6.281  1.00 0.00 ? 211 PHE A C    3  
ATOM 10070 O O    . PHE A 1 211 ? -55.108 -29.080 -5.570  1.00 0.00 ? 211 PHE A O    3  
ATOM 10071 C CB   . PHE A 1 211 ? -57.610 -30.761 -7.104  1.00 0.00 ? 211 PHE A CB   3  
ATOM 10072 C CG   . PHE A 1 211 ? -58.681 -30.703 -8.157  1.00 0.00 ? 211 PHE A CG   3  
ATOM 10073 C CD1  . PHE A 1 211 ? -58.558 -31.430 -9.330  1.00 0.00 ? 211 PHE A CD1  3  
ATOM 10074 C CD2  . PHE A 1 211 ? -59.810 -29.921 -7.971  1.00 0.00 ? 211 PHE A CD2  3  
ATOM 10075 C CE1  . PHE A 1 211 ? -59.542 -31.377 -10.300 1.00 0.00 ? 211 PHE A CE1  3  
ATOM 10076 C CE2  . PHE A 1 211 ? -60.796 -29.865 -8.937  1.00 0.00 ? 211 PHE A CE2  3  
ATOM 10077 C CZ   . PHE A 1 211 ? -60.663 -30.594 -10.102 1.00 0.00 ? 211 PHE A CZ   3  
ATOM 10078 H H    . PHE A 1 211 ? -54.801 -30.709 -8.576  1.00 0.00 ? 211 PHE A H    3  
ATOM 10079 H HA   . PHE A 1 211 ? -56.588 -29.327 -8.322  1.00 0.00 ? 211 PHE A HA   3  
ATOM 10080 H HB2  . PHE A 1 211 ? -57.301 -31.790 -7.003  1.00 0.00 ? 211 PHE A HB2  3  
ATOM 10081 H HB3  . PHE A 1 211 ? -58.042 -30.427 -6.172  1.00 0.00 ? 211 PHE A HB3  3  
ATOM 10082 H HD1  . PHE A 1 211 ? -57.682 -32.043 -9.485  1.00 0.00 ? 211 PHE A HD1  3  
ATOM 10083 H HD2  . PHE A 1 211 ? -59.915 -29.351 -7.061  1.00 0.00 ? 211 PHE A HD2  3  
ATOM 10084 H HE1  . PHE A 1 211 ? -59.434 -31.948 -11.210 1.00 0.00 ? 211 PHE A HE1  3  
ATOM 10085 H HE2  . PHE A 1 211 ? -61.671 -29.251 -8.780  1.00 0.00 ? 211 PHE A HE2  3  
ATOM 10086 H HZ   . PHE A 1 211 ? -61.433 -30.552 -10.858 1.00 0.00 ? 211 PHE A HZ   3  
ATOM 10087 N N    . SER A 1 212 ? -56.985 -27.959 -6.103  1.00 0.00 ? 212 SER A N    3  
ATOM 10088 C CA   . SER A 1 212 ? -56.829 -26.974 -5.040  1.00 0.00 ? 212 SER A CA   3  
ATOM 10089 C C    . SER A 1 212 ? -57.787 -27.259 -3.889  1.00 0.00 ? 212 SER A C    3  
ATOM 10090 O O    . SER A 1 212 ? -57.348 -27.181 -2.722  1.00 0.00 ? 212 SER A O    3  
ATOM 10091 C CB   . SER A 1 212 ? -57.072 -25.565 -5.583  1.00 0.00 ? 212 SER A CB   3  
ATOM 10092 O OG   . SER A 1 212 ? -58.006 -25.583 -6.649  1.00 0.00 ? 212 SER A OG   3  
ATOM 10093 O OXT  . SER A 1 212 ? -58.968 -27.559 -4.163  1.00 0.00 ? 212 SER A OXT  3  
ATOM 10094 H H    . SER A 1 212 ? -57.758 -27.899 -6.702  1.00 0.00 ? 212 SER A H    3  
ATOM 10095 H HA   . SER A 1 212 ? -55.816 -27.039 -4.674  1.00 0.00 ? 212 SER A HA   3  
ATOM 10096 H HB2  . SER A 1 212 ? -57.460 -24.939 -4.793  1.00 0.00 ? 212 SER A HB2  3  
ATOM 10097 H HB3  . SER A 1 212 ? -56.141 -25.154 -5.944  1.00 0.00 ? 212 SER A HB3  3  
ATOM 10098 H HG   . SER A 1 212 ? -58.896 -25.652 -6.294  1.00 0.00 ? 212 SER A HG   3  
ATOM 10099 N N    . SER A 1 1   ? -16.648 -23.782 -1.032  1.00 0.00 ? 1   SER A N    4  
ATOM 10100 C CA   . SER A 1 1   ? -17.090 -25.149 -1.412  1.00 0.00 ? 1   SER A CA   4  
ATOM 10101 C C    . SER A 1 1   ? -18.510 -25.423 -0.926  1.00 0.00 ? 1   SER A C    4  
ATOM 10102 O O    . SER A 1 1   ? -18.769 -26.431 -0.267  1.00 0.00 ? 1   SER A O    4  
ATOM 10103 C CB   . SER A 1 1   ? -16.116 -26.161 -0.805  1.00 0.00 ? 1   SER A CB   4  
ATOM 10104 O OG   . SER A 1 1   ? -15.844 -27.215 -1.713  1.00 0.00 ? 1   SER A OG   4  
ATOM 10105 H H1   . SER A 1 1   ? -15.647 -23.687 -1.297  1.00 0.00 ? 1   SER A H1   4  
ATOM 10106 H H2   . SER A 1 1   ? -16.776 -23.682 -0.004  1.00 0.00 ? 1   SER A H2   4  
ATOM 10107 H H3   . SER A 1 1   ? -17.238 -23.102 -1.552  1.00 0.00 ? 1   SER A H3   4  
ATOM 10108 H HA   . SER A 1 1   ? -17.064 -25.231 -2.488  1.00 0.00 ? 1   SER A HA   4  
ATOM 10109 H HB2  . SER A 1 1   ? -15.188 -25.665 -0.562  1.00 0.00 ? 1   SER A HB2  4  
ATOM 10110 H HB3  . SER A 1 1   ? -16.547 -26.578 0.093   1.00 0.00 ? 1   SER A HB3  4  
ATOM 10111 H HG   . SER A 1 1   ? -16.665 -27.653 -1.949  1.00 0.00 ? 1   SER A HG   4  
ATOM 10112 N N    . TYR A 1 2   ? -19.427 -24.519 -1.256  1.00 0.00 ? 2   TYR A N    4  
ATOM 10113 C CA   . TYR A 1 2   ? -20.822 -24.663 -0.853  1.00 0.00 ? 2   TYR A CA   4  
ATOM 10114 C C    . TYR A 1 2   ? -21.761 -24.290 -1.996  1.00 0.00 ? 2   TYR A C    4  
ATOM 10115 O O    . TYR A 1 2   ? -22.689 -25.033 -2.318  1.00 0.00 ? 2   TYR A O    4  
ATOM 10116 C CB   . TYR A 1 2   ? -21.113 -23.790 0.370   1.00 0.00 ? 2   TYR A CB   4  
ATOM 10117 C CG   . TYR A 1 2   ? -21.921 -24.491 1.438   1.00 0.00 ? 2   TYR A CG   4  
ATOM 10118 C CD1  . TYR A 1 2   ? -23.298 -24.631 1.315   1.00 0.00 ? 2   TYR A CD1  4  
ATOM 10119 C CD2  . TYR A 1 2   ? -21.307 -25.013 2.570   1.00 0.00 ? 2   TYR A CD2  4  
ATOM 10120 C CE1  . TYR A 1 2   ? -24.040 -25.271 2.290   1.00 0.00 ? 2   TYR A CE1  4  
ATOM 10121 C CE2  . TYR A 1 2   ? -22.042 -25.655 3.548   1.00 0.00 ? 2   TYR A CE2  4  
ATOM 10122 C CZ   . TYR A 1 2   ? -23.408 -25.781 3.404   1.00 0.00 ? 2   TYR A CZ   4  
ATOM 10123 O OH   . TYR A 1 2   ? -24.143 -26.419 4.376   1.00 0.00 ? 2   TYR A OH   4  
ATOM 10124 H H    . TYR A 1 2   ? -19.160 -23.737 -1.782  1.00 0.00 ? 2   TYR A H    4  
ATOM 10125 H HA   . TYR A 1 2   ? -20.986 -25.698 -0.592  1.00 0.00 ? 2   TYR A HA   4  
ATOM 10126 H HB2  . TYR A 1 2   ? -20.178 -23.481 0.813   1.00 0.00 ? 2   TYR A HB2  4  
ATOM 10127 H HB3  . TYR A 1 2   ? -21.663 -22.915 0.057   1.00 0.00 ? 2   TYR A HB3  4  
ATOM 10128 H HD1  . TYR A 1 2   ? -23.790 -24.231 0.441   1.00 0.00 ? 2   TYR A HD1  4  
ATOM 10129 H HD2  . TYR A 1 2   ? -20.238 -24.913 2.681   1.00 0.00 ? 2   TYR A HD2  4  
ATOM 10130 H HE1  . TYR A 1 2   ? -25.109 -25.370 2.176   1.00 0.00 ? 2   TYR A HE1  4  
ATOM 10131 H HE2  . TYR A 1 2   ? -21.547 -26.054 4.421   1.00 0.00 ? 2   TYR A HE2  4  
ATOM 10132 H HH   . TYR A 1 2   ? -24.277 -27.336 4.126   1.00 0.00 ? 2   TYR A HH   4  
ATOM 10133 N N    . ASP A 1 3   ? -21.516 -23.135 -2.606  1.00 0.00 ? 3   ASP A N    4  
ATOM 10134 C CA   . ASP A 1 3   ? -22.341 -22.663 -3.713  1.00 0.00 ? 3   ASP A CA   4  
ATOM 10135 C C    . ASP A 1 3   ? -21.559 -22.684 -5.023  1.00 0.00 ? 3   ASP A C    4  
ATOM 10136 O O    . ASP A 1 3   ? -20.557 -21.984 -5.170  1.00 0.00 ? 3   ASP A O    4  
ATOM 10137 C CB   . ASP A 1 3   ? -22.850 -21.248 -3.428  1.00 0.00 ? 3   ASP A CB   4  
ATOM 10138 C CG   . ASP A 1 3   ? -24.318 -21.226 -3.051  1.00 0.00 ? 3   ASP A CG   4  
ATOM 10139 O OD1  . ASP A 1 3   ? -24.625 -21.380 -1.850  1.00 0.00 ? 3   ASP A OD1  4  
ATOM 10140 O OD2  . ASP A 1 3   ? -25.161 -21.055 -3.957  1.00 0.00 ? 3   ASP A OD2  4  
ATOM 10141 H H    . ASP A 1 3   ? -20.762 -22.585 -2.304  1.00 0.00 ? 3   ASP A H    4  
ATOM 10142 H HA   . ASP A 1 3   ? -23.187 -23.328 -3.802  1.00 0.00 ? 3   ASP A HA   4  
ATOM 10143 H HB2  . ASP A 1 3   ? -22.282 -20.826 -2.612  1.00 0.00 ? 3   ASP A HB2  4  
ATOM 10144 H HB3  . ASP A 1 3   ? -22.714 -20.637 -4.309  1.00 0.00 ? 3   ASP A HB3  4  
ATOM 10145 N N    . SER A 1 4   ? -22.022 -23.495 -5.969  1.00 0.00 ? 4   SER A N    4  
ATOM 10146 C CA   . SER A 1 4   ? -21.364 -23.611 -7.266  1.00 0.00 ? 4   SER A CA   4  
ATOM 10147 C C    . SER A 1 4   ? -22.014 -22.696 -8.306  1.00 0.00 ? 4   SER A C    4  
ATOM 10148 O O    . SER A 1 4   ? -21.378 -21.765 -8.801  1.00 0.00 ? 4   SER A O    4  
ATOM 10149 C CB   . SER A 1 4   ? -21.391 -25.064 -7.749  1.00 0.00 ? 4   SER A CB   4  
ATOM 10150 O OG   . SER A 1 4   ? -20.110 -25.660 -7.645  1.00 0.00 ? 4   SER A OG   4  
ATOM 10151 H H    . SER A 1 4   ? -22.822 -24.031 -5.790  1.00 0.00 ? 4   SER A H    4  
ATOM 10152 H HA   . SER A 1 4   ? -20.335 -23.308 -7.137  1.00 0.00 ? 4   SER A HA   4  
ATOM 10153 H HB2  . SER A 1 4   ? -22.086 -25.628 -7.146  1.00 0.00 ? 4   SER A HB2  4  
ATOM 10154 H HB3  . SER A 1 4   ? -21.705 -25.093 -8.783  1.00 0.00 ? 4   SER A HB3  4  
ATOM 10155 H HG   . SER A 1 4   ? -19.642 -25.563 -8.478  1.00 0.00 ? 4   SER A HG   4  
ATOM 10156 N N    . PRO A 1 5   ? -23.289 -22.946 -8.660  1.00 0.00 ? 5   PRO A N    4  
ATOM 10157 C CA   . PRO A 1 5   ? -24.002 -22.134 -9.651  1.00 0.00 ? 5   PRO A CA   4  
ATOM 10158 C C    . PRO A 1 5   ? -24.438 -20.781 -9.097  1.00 0.00 ? 5   PRO A C    4  
ATOM 10159 O O    . PRO A 1 5   ? -24.350 -20.533 -7.895  1.00 0.00 ? 5   PRO A O    4  
ATOM 10160 C CB   . PRO A 1 5   ? -25.220 -22.989 -9.992  1.00 0.00 ? 5   PRO A CB   4  
ATOM 10161 C CG   . PRO A 1 5   ? -25.481 -23.779 -8.757  1.00 0.00 ? 5   PRO A CG   4  
ATOM 10162 C CD   . PRO A 1 5   ? -24.135 -24.036 -8.131  1.00 0.00 ? 5   PRO A CD   4  
ATOM 10163 H HA   . PRO A 1 5   ? -23.406 -21.982 -10.539 1.00 0.00 ? 5   PRO A HA   4  
ATOM 10164 H HB2  . PRO A 1 5   ? -26.056 -22.349 -10.237 1.00 0.00 ? 5   PRO A HB2  4  
ATOM 10165 H HB3  . PRO A 1 5   ? -24.992 -23.631 -10.830 1.00 0.00 ? 5   PRO A HB3  4  
ATOM 10166 H HG2  . PRO A 1 5   ? -26.104 -23.211 -8.083  1.00 0.00 ? 5   PRO A HG2  4  
ATOM 10167 H HG3  . PRO A 1 5   ? -25.958 -24.713 -9.013  1.00 0.00 ? 5   PRO A HG3  4  
ATOM 10168 H HD2  . PRO A 1 5   ? -24.206 -23.981 -7.056  1.00 0.00 ? 5   PRO A HD2  4  
ATOM 10169 H HD3  . PRO A 1 5   ? -23.756 -25.000 -8.436  1.00 0.00 ? 5   PRO A HD3  4  
ATOM 10170 N N    . ASP A 1 6   ? -24.911 -19.912 -9.985  1.00 0.00 ? 6   ASP A N    4  
ATOM 10171 C CA   . ASP A 1 6   ? -25.364 -18.583 -9.592  1.00 0.00 ? 6   ASP A CA   4  
ATOM 10172 C C    . ASP A 1 6   ? -26.240 -17.966 -10.678 1.00 0.00 ? 6   ASP A C    4  
ATOM 10173 O O    . ASP A 1 6   ? -26.107 -18.294 -11.857 1.00 0.00 ? 6   ASP A O    4  
ATOM 10174 C CB   . ASP A 1 6   ? -24.167 -17.674 -9.309  1.00 0.00 ? 6   ASP A CB   4  
ATOM 10175 C CG   . ASP A 1 6   ? -24.425 -16.718 -8.161  1.00 0.00 ? 6   ASP A CG   4  
ATOM 10176 O OD1  . ASP A 1 6   ? -25.437 -15.988 -8.213  1.00 0.00 ? 6   ASP A OD1  4  
ATOM 10177 O OD2  . ASP A 1 6   ? -23.616 -16.701 -7.210  1.00 0.00 ? 6   ASP A OD2  4  
ATOM 10178 H H    . ASP A 1 6   ? -24.956 -20.171 -10.929 1.00 0.00 ? 6   ASP A H    4  
ATOM 10179 H HA   . ASP A 1 6   ? -25.948 -18.685 -8.689  1.00 0.00 ? 6   ASP A HA   4  
ATOM 10180 H HB2  . ASP A 1 6   ? -23.311 -18.283 -9.060  1.00 0.00 ? 6   ASP A HB2  4  
ATOM 10181 H HB3  . ASP A 1 6   ? -23.946 -17.095 -10.194 1.00 0.00 ? 6   ASP A HB3  4  
ATOM 10182 N N    . TYR A 1 7   ? -27.137 -17.072 -10.273 1.00 0.00 ? 7   TYR A N    4  
ATOM 10183 C CA   . TYR A 1 7   ? -28.035 -16.411 -11.214 1.00 0.00 ? 7   TYR A CA   4  
ATOM 10184 C C    . TYR A 1 7   ? -27.863 -14.896 -11.155 1.00 0.00 ? 7   TYR A C    4  
ATOM 10185 O O    . TYR A 1 7   ? -28.825 -14.145 -11.316 1.00 0.00 ? 7   TYR A O    4  
ATOM 10186 C CB   . TYR A 1 7   ? -29.487 -16.787 -10.914 1.00 0.00 ? 7   TYR A CB   4  
ATOM 10187 C CG   . TYR A 1 7   ? -30.013 -17.907 -11.782 1.00 0.00 ? 7   TYR A CG   4  
ATOM 10188 C CD1  . TYR A 1 7   ? -29.901 -17.850 -13.165 1.00 0.00 ? 7   TYR A CD1  4  
ATOM 10189 C CD2  . TYR A 1 7   ? -30.620 -19.022 -11.219 1.00 0.00 ? 7   TYR A CD2  4  
ATOM 10190 C CE1  . TYR A 1 7   ? -30.380 -18.871 -13.963 1.00 0.00 ? 7   TYR A CE1  4  
ATOM 10191 C CE2  . TYR A 1 7   ? -31.101 -20.048 -12.009 1.00 0.00 ? 7   TYR A CE2  4  
ATOM 10192 C CZ   . TYR A 1 7   ? -30.979 -19.968 -13.381 1.00 0.00 ? 7   TYR A CZ   4  
ATOM 10193 O OH   . TYR A 1 7   ? -31.457 -20.987 -14.171 1.00 0.00 ? 7   TYR A OH   4  
ATOM 10194 H H    . TYR A 1 7   ? -27.197 -16.852 -9.320  1.00 0.00 ? 7   TYR A H    4  
ATOM 10195 H HA   . TYR A 1 7   ? -27.782 -16.751 -12.207 1.00 0.00 ? 7   TYR A HA   4  
ATOM 10196 H HB2  . TYR A 1 7   ? -29.565 -17.103 -9.884  1.00 0.00 ? 7   TYR A HB2  4  
ATOM 10197 H HB3  . TYR A 1 7   ? -30.117 -15.923 -11.069 1.00 0.00 ? 7   TYR A HB3  4  
ATOM 10198 H HD1  . TYR A 1 7   ? -29.431 -16.989 -13.619 1.00 0.00 ? 7   TYR A HD1  4  
ATOM 10199 H HD2  . TYR A 1 7   ? -30.716 -19.082 -10.145 1.00 0.00 ? 7   TYR A HD2  4  
ATOM 10200 H HE1  . TYR A 1 7   ? -30.283 -18.808 -15.037 1.00 0.00 ? 7   TYR A HE1  4  
ATOM 10201 H HE2  . TYR A 1 7   ? -31.571 -20.907 -11.553 1.00 0.00 ? 7   TYR A HE2  4  
ATOM 10202 H HH   . TYR A 1 7   ? -32.416 -20.958 -14.186 1.00 0.00 ? 7   TYR A HH   4  
ATOM 10203 N N    . THR A 1 8   ? -26.632 -14.454 -10.924 1.00 0.00 ? 8   THR A N    4  
ATOM 10204 C CA   . THR A 1 8   ? -26.335 -13.029 -10.845 1.00 0.00 ? 8   THR A CA   4  
ATOM 10205 C C    . THR A 1 8   ? -25.014 -12.707 -11.536 1.00 0.00 ? 8   THR A C    4  
ATOM 10206 O O    . THR A 1 8   ? -24.225 -13.602 -11.839 1.00 0.00 ? 8   THR A O    4  
ATOM 10207 C CB   . THR A 1 8   ? -26.282 -12.579 -9.384  1.00 0.00 ? 8   THR A CB   4  
ATOM 10208 O OG1  . THR A 1 8   ? -27.105 -13.402 -8.576  1.00 0.00 ? 8   THR A OG1  4  
ATOM 10209 C CG2  . THR A 1 8   ? -26.726 -11.145 -9.184  1.00 0.00 ? 8   THR A CG2  4  
ATOM 10210 H H    . THR A 1 8   ? -25.906 -15.102 -10.805 1.00 0.00 ? 8   THR A H    4  
ATOM 10211 H HA   . THR A 1 8   ? -27.129 -12.498 -11.347 1.00 0.00 ? 8   THR A HA   4  
ATOM 10212 H HB   . THR A 1 8   ? -25.265 -12.663 -9.029  1.00 0.00 ? 8   THR A HB   4  
ATOM 10213 H HG1  . THR A 1 8   ? -26.729 -14.284 -8.530  1.00 0.00 ? 8   THR A HG1  4  
ATOM 10214 H HG21 . THR A 1 8   ? -27.576 -11.120 -8.518  1.00 0.00 ? 8   THR A HG21 4  
ATOM 10215 H HG22 . THR A 1 8   ? -27.001 -10.717 -10.136 1.00 0.00 ? 8   THR A HG22 4  
ATOM 10216 H HG23 . THR A 1 8   ? -25.915 -10.575 -8.754  1.00 0.00 ? 8   THR A HG23 4  
ATOM 10217 N N    . ASP A 1 9   ? -24.780 -11.422 -11.782 1.00 0.00 ? 9   ASP A N    4  
ATOM 10218 C CA   . ASP A 1 9   ? -23.556 -10.979 -12.437 1.00 0.00 ? 9   ASP A CA   4  
ATOM 10219 C C    . ASP A 1 9   ? -23.000 -9.733  -11.755 1.00 0.00 ? 9   ASP A C    4  
ATOM 10220 O O    . ASP A 1 9   ? -23.567 -8.646  -11.868 1.00 0.00 ? 9   ASP A O    4  
ATOM 10221 C CB   . ASP A 1 9   ? -23.819 -10.694 -13.918 1.00 0.00 ? 9   ASP A CB   4  
ATOM 10222 C CG   . ASP A 1 9   ? -23.258 -11.773 -14.823 1.00 0.00 ? 9   ASP A CG   4  
ATOM 10223 O OD1  . ASP A 1 9   ? -23.860 -12.866 -14.887 1.00 0.00 ? 9   ASP A OD1  4  
ATOM 10224 O OD2  . ASP A 1 9   ? -22.217 -11.526 -15.467 1.00 0.00 ? 9   ASP A OD2  4  
ATOM 10225 H H    . ASP A 1 9   ? -25.448 -10.756 -11.517 1.00 0.00 ? 9   ASP A H    4  
ATOM 10226 H HA   . ASP A 1 9   ? -22.830 -11.774 -12.356 1.00 0.00 ? 9   ASP A HA   4  
ATOM 10227 H HB2  . ASP A 1 9   ? -24.885 -10.632 -14.082 1.00 0.00 ? 9   ASP A HB2  4  
ATOM 10228 H HB3  . ASP A 1 9   ? -23.363 -9.752  -14.186 1.00 0.00 ? 9   ASP A HB3  4  
ATOM 10229 N N    . GLU A 1 10  ? -21.889 -9.897  -11.045 1.00 0.00 ? 10  GLU A N    4  
ATOM 10230 C CA   . GLU A 1 10  ? -21.261 -8.785  -10.342 1.00 0.00 ? 10  GLU A CA   4  
ATOM 10231 C C    . GLU A 1 10  ? -19.767 -9.030  -10.153 1.00 0.00 ? 10  GLU A C    4  
ATOM 10232 O O    . GLU A 1 10  ? -19.192 -8.651  -9.133  1.00 0.00 ? 10  GLU A O    4  
ATOM 10233 C CB   . GLU A 1 10  ? -21.930 -8.572  -8.983  1.00 0.00 ? 10  GLU A CB   4  
ATOM 10234 C CG   . GLU A 1 10  ? -21.889 -7.129  -8.505  1.00 0.00 ? 10  GLU A CG   4  
ATOM 10235 C CD   . GLU A 1 10  ? -23.253 -6.467  -8.533  1.00 0.00 ? 10  GLU A CD   4  
ATOM 10236 O OE1  . GLU A 1 10  ? -24.086 -6.858  -9.378  1.00 0.00 ? 10  GLU A OE1  4  
ATOM 10237 O OE2  . GLU A 1 10  ? -23.488 -5.557  -7.711  1.00 0.00 ? 10  GLU A OE2  4  
ATOM 10238 H H    . GLU A 1 10  ? -21.483 -10.788 -10.990 1.00 0.00 ? 10  GLU A H    4  
ATOM 10239 H HA   . GLU A 1 10  ? -21.393 -7.897  -10.942 1.00 0.00 ? 10  GLU A HA   4  
ATOM 10240 H HB2  . GLU A 1 10  ? -22.963 -8.878  -9.052  1.00 0.00 ? 10  GLU A HB2  4  
ATOM 10241 H HB3  . GLU A 1 10  ? -21.430 -9.186  -8.249  1.00 0.00 ? 10  GLU A HB3  4  
ATOM 10242 H HG2  . GLU A 1 10  ? -21.518 -7.110  -7.491  1.00 0.00 ? 10  GLU A HG2  4  
ATOM 10243 H HG3  . GLU A 1 10  ? -21.220 -6.571  -9.143  1.00 0.00 ? 10  GLU A HG3  4  
ATOM 10244 N N    . SER A 1 11  ? -19.145 -9.665  -11.141 1.00 0.00 ? 11  SER A N    4  
ATOM 10245 C CA   . SER A 1 11  ? -17.717 -9.956  -11.078 1.00 0.00 ? 11  SER A CA   4  
ATOM 10246 C C    . SER A 1 11  ? -16.900 -8.825  -11.670 1.00 0.00 ? 11  SER A C    4  
ATOM 10247 O O    . SER A 1 11  ? -16.137 -9.021  -12.614 1.00 0.00 ? 11  SER A O    4  
ATOM 10248 C CB   . SER A 1 11  ? -17.393 -11.250 -11.813 1.00 0.00 ? 11  SER A CB   4  
ATOM 10249 O OG   . SER A 1 11  ? -17.847 -12.382 -11.091 1.00 0.00 ? 11  SER A OG   4  
ATOM 10250 H H    . SER A 1 11  ? -19.655 -9.941  -11.930 1.00 0.00 ? 11  SER A H    4  
ATOM 10251 H HA   . SER A 1 11  ? -17.444 -10.065 -10.041 1.00 0.00 ? 11  SER A HA   4  
ATOM 10252 H HB2  . SER A 1 11  ? -17.867 -11.239 -12.784 1.00 0.00 ? 11  SER A HB2  4  
ATOM 10253 H HB3  . SER A 1 11  ? -16.324 -11.317 -11.935 1.00 0.00 ? 11  SER A HB3  4  
ATOM 10254 H HG   . SER A 1 11  ? -17.315 -12.492 -10.300 1.00 0.00 ? 11  SER A HG   4  
ATOM 10255 N N    . CYS A 1 12  ? -17.055 -7.643  -11.106 1.00 0.00 ? 12  CYS A N    4  
ATOM 10256 C CA   . CYS A 1 12  ? -16.315 -6.486  -11.581 1.00 0.00 ? 12  CYS A CA   4  
ATOM 10257 C C    . CYS A 1 12  ? -15.001 -6.357  -10.835 1.00 0.00 ? 12  CYS A C    4  
ATOM 10258 O O    . CYS A 1 12  ? -14.925 -5.727  -9.780  1.00 0.00 ? 12  CYS A O    4  
ATOM 10259 C CB   . CYS A 1 12  ? -17.106 -5.192  -11.429 1.00 0.00 ? 12  CYS A CB   4  
ATOM 10260 S SG   . CYS A 1 12  ? -18.905 -5.398  -11.217 1.00 0.00 ? 12  CYS A SG   4  
ATOM 10261 H H    . CYS A 1 12  ? -17.673 -7.552  -10.356 1.00 0.00 ? 12  CYS A H    4  
ATOM 10262 H HA   . CYS A 1 12  ? -16.101 -6.645  -12.630 1.00 0.00 ? 12  CYS A HA   4  
ATOM 10263 H HB2  . CYS A 1 12  ? -16.733 -4.661  -10.569 1.00 0.00 ? 12  CYS A HB2  4  
ATOM 10264 H HB3  . CYS A 1 12  ? -16.944 -4.590  -12.310 1.00 0.00 ? 12  CYS A HB3  4  
ATOM 10265 N N    . THR A 1 13  ? -13.971 -6.949  -11.400 1.00 0.00 ? 13  THR A N    4  
ATOM 10266 C CA   . THR A 1 13  ? -12.640 -6.902  -10.807 1.00 0.00 ? 13  THR A CA   4  
ATOM 10267 C C    . THR A 1 13  ? -11.780 -5.866  -11.517 1.00 0.00 ? 13  THR A C    4  
ATOM 10268 O O    . THR A 1 13  ? -11.231 -6.130  -12.581 1.00 0.00 ? 13  THR A O    4  
ATOM 10269 C CB   . THR A 1 13  ? -11.967 -8.268  -10.890 1.00 0.00 ? 13  THR A CB   4  
ATOM 10270 O OG1  . THR A 1 13  ? -12.924 -9.293  -11.086 1.00 0.00 ? 13  THR A OG1  4  
ATOM 10271 C CG2  . THR A 1 13  ? -11.161 -8.619  -9.660  1.00 0.00 ? 13  THR A CG2  4  
ATOM 10272 H H    . THR A 1 13  ? -14.108 -7.422  -12.245 1.00 0.00 ? 13  THR A H    4  
ATOM 10273 H HA   . THR A 1 13  ? -12.746 -6.620  -9.770  1.00 0.00 ? 13  THR A HA   4  
ATOM 10274 H HB   . THR A 1 13  ? -11.294 -8.263  -11.732 1.00 0.00 ? 13  THR A HB   4  
ATOM 10275 H HG1  . THR A 1 13  ? -13.322 -9.199  -11.954 1.00 0.00 ? 13  THR A HG1  4  
ATOM 10276 H HG21 . THR A 1 13  ? -10.112 -8.440  -9.854  1.00 0.00 ? 13  THR A HG21 4  
ATOM 10277 H HG22 . THR A 1 13  ? -11.311 -9.661  -9.419  1.00 0.00 ? 13  THR A HG22 4  
ATOM 10278 H HG23 . THR A 1 13  ? -11.484 -8.007  -8.831  1.00 0.00 ? 13  THR A HG23 4  
ATOM 10279 N N    . PHE A 1 14  ? -11.649 -4.696  -10.916 1.00 0.00 ? 14  PHE A N    4  
ATOM 10280 C CA   . PHE A 1 14  ? -10.840 -3.630  -11.497 1.00 0.00 ? 14  PHE A CA   4  
ATOM 10281 C C    . PHE A 1 14  ? -9.404  -3.729  -10.988 1.00 0.00 ? 14  PHE A C    4  
ATOM 10282 O O    . PHE A 1 14  ? -9.136  -3.509  -9.807  1.00 0.00 ? 14  PHE A O    4  
ATOM 10283 C CB   . PHE A 1 14  ? -11.447 -2.262  -11.172 1.00 0.00 ? 14  PHE A CB   4  
ATOM 10284 C CG   . PHE A 1 14  ? -12.947 -2.297  -11.183 1.00 0.00 ? 14  PHE A CG   4  
ATOM 10285 C CD1  . PHE A 1 14  ? -13.625 -2.740  -12.307 1.00 0.00 ? 14  PHE A CD1  4  
ATOM 10286 C CD2  . PHE A 1 14  ? -13.679 -1.930  -10.066 1.00 0.00 ? 14  PHE A CD2  4  
ATOM 10287 C CE1  . PHE A 1 14  ? -14.990 -2.816  -12.320 1.00 0.00 ? 14  PHE A CE1  4  
ATOM 10288 C CE2  . PHE A 1 14  ? -15.059 -2.008  -10.074 1.00 0.00 ? 14  PHE A CE2  4  
ATOM 10289 C CZ   . PHE A 1 14  ? -15.715 -2.456  -11.205 1.00 0.00 ? 14  PHE A CZ   4  
ATOM 10290 H H    . PHE A 1 14  ? -12.085 -4.552  -10.054 1.00 0.00 ? 14  PHE A H    4  
ATOM 10291 H HA   . PHE A 1 14  ? -10.851 -3.764  -12.570 1.00 0.00 ? 14  PHE A HA   4  
ATOM 10292 H HB2  . PHE A 1 14  ? -11.118 -1.946  -10.195 1.00 0.00 ? 14  PHE A HB2  4  
ATOM 10293 H HB3  . PHE A 1 14  ? -11.123 -1.544  -11.910 1.00 0.00 ? 14  PHE A HB3  4  
ATOM 10294 H HD1  . PHE A 1 14  ? -13.078 -3.011  -13.194 1.00 0.00 ? 14  PHE A HD1  4  
ATOM 10295 H HD2  . PHE A 1 14  ? -13.164 -1.582  -9.184  1.00 0.00 ? 14  PHE A HD2  4  
ATOM 10296 H HE1  . PHE A 1 14  ? -15.486 -3.180  -13.199 1.00 0.00 ? 14  PHE A HE1  4  
ATOM 10297 H HE2  . PHE A 1 14  ? -15.623 -1.720  -9.200  1.00 0.00 ? 14  PHE A HE2  4  
ATOM 10298 H HZ   . PHE A 1 14  ? -16.792 -2.518  -11.219 1.00 0.00 ? 14  PHE A HZ   4  
ATOM 10299 N N    . LYS A 1 15  ? -8.489  -4.089  -11.882 1.00 0.00 ? 15  LYS A N    4  
ATOM 10300 C CA   . LYS A 1 15  ? -7.080  -4.251  -11.524 1.00 0.00 ? 15  LYS A CA   4  
ATOM 10301 C C    . LYS A 1 15  ? -6.264  -3.032  -11.910 1.00 0.00 ? 15  LYS A C    4  
ATOM 10302 O O    . LYS A 1 15  ? -6.314  -2.583  -13.042 1.00 0.00 ? 15  LYS A O    4  
ATOM 10303 C CB   . LYS A 1 15  ? -6.501  -5.475  -12.233 1.00 0.00 ? 15  LYS A CB   4  
ATOM 10304 C CG   . LYS A 1 15  ? -4.998  -5.649  -12.024 1.00 0.00 ? 15  LYS A CG   4  
ATOM 10305 C CD   . LYS A 1 15  ? -4.474  -6.872  -12.759 1.00 0.00 ? 15  LYS A CD   4  
ATOM 10306 C CE   . LYS A 1 15  ? -5.111  -8.151  -12.237 1.00 0.00 ? 15  LYS A CE   4  
ATOM 10307 N NZ   . LYS A 1 15  ? -4.607  -9.356  -12.953 1.00 0.00 ? 15  LYS A NZ   4  
ATOM 10308 H H    . LYS A 1 15  ? -8.768  -4.267  -12.803 1.00 0.00 ? 15  LYS A H    4  
ATOM 10309 H HA   . LYS A 1 15  ? -7.017  -4.398  -10.457 1.00 0.00 ? 15  LYS A HA   4  
ATOM 10310 H HB2  . LYS A 1 15  ? -7.004  -6.359  -11.866 1.00 0.00 ? 15  LYS A HB2  4  
ATOM 10311 H HB3  . LYS A 1 15  ? -6.690  -5.379  -13.298 1.00 0.00 ? 15  LYS A HB3  4  
ATOM 10312 H HG2  . LYS A 1 15  ? -4.480  -4.769  -12.391 1.00 0.00 ? 15  LYS A HG2  4  
ATOM 10313 H HG3  . LYS A 1 15  ? -4.802  -5.764  -10.968 1.00 0.00 ? 15  LYS A HG3  4  
ATOM 10314 H HD2  . LYS A 1 15  ? -4.699  -6.773  -13.810 1.00 0.00 ? 15  LYS A HD2  4  
ATOM 10315 H HD3  . LYS A 1 15  ? -3.404  -6.931  -12.622 1.00 0.00 ? 15  LYS A HD3  4  
ATOM 10316 H HE2  . LYS A 1 15  ? -4.884  -8.248  -11.185 1.00 0.00 ? 15  LYS A HE2  4  
ATOM 10317 H HE3  . LYS A 1 15  ? -6.181  -8.085  -12.368 1.00 0.00 ? 15  LYS A HE3  4  
ATOM 10318 H HZ1  . LYS A 1 15  ? -4.683  -10.193 -12.341 1.00 0.00 ? 15  LYS A HZ1  4  
ATOM 10319 H HZ2  . LYS A 1 15  ? -3.611  -9.224  -13.218 1.00 0.00 ? 15  LYS A HZ2  4  
ATOM 10320 H HZ3  . LYS A 1 15  ? -5.165  -9.518  -13.816 1.00 0.00 ? 15  LYS A HZ3  4  
ATOM 10321 N N    . ILE A 1 16  ? -5.455  -2.537  -10.991 1.00 0.00 ? 16  ILE A N    4  
ATOM 10322 C CA   . ILE A 1 16  ? -4.602  -1.404  -11.297 1.00 0.00 ? 16  ILE A CA   4  
ATOM 10323 C C    . ILE A 1 16  ? -3.149  -1.832  -11.331 1.00 0.00 ? 16  ILE A C    4  
ATOM 10324 O O    . ILE A 1 16  ? -2.690  -2.572  -10.462 1.00 0.00 ? 16  ILE A O    4  
ATOM 10325 C CB   . ILE A 1 16  ? -4.781  -0.246  -10.307 1.00 0.00 ? 16  ILE A CB   4  
ATOM 10326 C CG1  . ILE A 1 16  ? -4.552  1.070   -11.040 1.00 0.00 ? 16  ILE A CG1  4  
ATOM 10327 C CG2  . ILE A 1 16  ? -3.847  -0.377  -9.109  1.00 0.00 ? 16  ILE A CG2  4  
ATOM 10328 C CD1  . ILE A 1 16  ? -5.096  2.262   -10.305 1.00 0.00 ? 16  ILE A CD1  4  
ATOM 10329 H H    . ILE A 1 16  ? -5.390  -2.975  -10.117 1.00 0.00 ? 16  ILE A H    4  
ATOM 10330 H HA   . ILE A 1 16  ? -4.879  -1.039  -12.280 1.00 0.00 ? 16  ILE A HA   4  
ATOM 10331 H HB   . ILE A 1 16  ? -5.790  -0.271  -9.947  1.00 0.00 ? 16  ILE A HB   4  
ATOM 10332 H HG12 . ILE A 1 16  ? -3.495  1.218   -11.184 1.00 0.00 ? 16  ILE A HG12 4  
ATOM 10333 H HG13 . ILE A 1 16  ? -5.038  1.025   -12.004 1.00 0.00 ? 16  ILE A HG13 4  
ATOM 10334 H HG21 . ILE A 1 16  ? -4.221  0.226   -8.294  1.00 0.00 ? 16  ILE A HG21 4  
ATOM 10335 H HG22 . ILE A 1 16  ? -2.859  -0.039  -9.384  1.00 0.00 ? 16  ILE A HG22 4  
ATOM 10336 H HG23 . ILE A 1 16  ? -3.801  -1.411  -8.800  1.00 0.00 ? 16  ILE A HG23 4  
ATOM 10337 H HD11 . ILE A 1 16  ? -6.170  2.158   -10.205 1.00 0.00 ? 16  ILE A HD11 4  
ATOM 10338 H HD12 . ILE A 1 16  ? -4.863  3.163   -10.856 1.00 0.00 ? 16  ILE A HD12 4  
ATOM 10339 H HD13 . ILE A 1 16  ? -4.648  2.313   -9.325  1.00 0.00 ? 16  ILE A HD13 4  
ATOM 10340 N N    . SER A 1 17  ? -2.433  -1.377  -12.341 1.00 0.00 ? 17  SER A N    4  
ATOM 10341 C CA   . SER A 1 17  ? -1.027  -1.732  -12.486 1.00 0.00 ? 17  SER A CA   4  
ATOM 10342 C C    . SER A 1 17  ? -0.166  -0.492  -12.719 1.00 0.00 ? 17  SER A C    4  
ATOM 10343 O O    . SER A 1 17  ? -0.557  0.417   -13.453 1.00 0.00 ? 17  SER A O    4  
ATOM 10344 C CB   . SER A 1 17  ? -0.848  -2.705  -13.653 1.00 0.00 ? 17  SER A CB   4  
ATOM 10345 O OG   . SER A 1 17  ? -0.675  -4.033  -13.191 1.00 0.00 ? 17  SER A OG   4  
ATOM 10346 H H    . SER A 1 17  ? -2.853  -0.798  -13.013 1.00 0.00 ? 17  SER A H    4  
ATOM 10347 H HA   . SER A 1 17  ? -0.719  -2.219  -11.570 1.00 0.00 ? 17  SER A HA   4  
ATOM 10348 H HB2  . SER A 1 17  ? -1.720  -2.667  -14.285 1.00 0.00 ? 17  SER A HB2  4  
ATOM 10349 H HB3  . SER A 1 17  ? 0.022   -2.419  -14.227 1.00 0.00 ? 17  SER A HB3  4  
ATOM 10350 H HG   . SER A 1 17  ? -1.447  -4.555  -13.420 1.00 0.00 ? 17  SER A HG   4  
ATOM 10351 N N    . LEU A 1 18  ? 0.999   -0.452  -12.077 1.00 0.00 ? 18  LEU A N    4  
ATOM 10352 C CA   . LEU A 1 18  ? 1.900   0.689   -12.207 1.00 0.00 ? 18  LEU A CA   4  
ATOM 10353 C C    . LEU A 1 18  ? 3.095   0.382   -13.113 1.00 0.00 ? 18  LEU A C    4  
ATOM 10354 O O    . LEU A 1 18  ? 3.913   -0.486  -12.810 1.00 0.00 ? 18  LEU A O    4  
ATOM 10355 C CB   . LEU A 1 18  ? 2.396   1.141   -10.830 1.00 0.00 ? 18  LEU A CB   4  
ATOM 10356 C CG   . LEU A 1 18  ? 2.394   2.658   -10.602 1.00 0.00 ? 18  LEU A CG   4  
ATOM 10357 C CD1  . LEU A 1 18  ? 1.022   3.248   -10.900 1.00 0.00 ? 18  LEU A CD1  4  
ATOM 10358 C CD2  . LEU A 1 18  ? 2.795   2.977   -9.176  1.00 0.00 ? 18  LEU A CD2  4  
ATOM 10359 H H    . LEU A 1 18  ? 1.242   -1.195  -11.485 1.00 0.00 ? 18  LEU A H    4  
ATOM 10360 H HA   . LEU A 1 18  ? 1.337   1.492   -12.646 1.00 0.00 ? 18  LEU A HA   4  
ATOM 10361 H HB2  . LEU A 1 18  ? 1.768   0.685   -10.079 1.00 0.00 ? 18  LEU A HB2  4  
ATOM 10362 H HB3  . LEU A 1 18  ? 3.405   0.781   -10.698 1.00 0.00 ? 18  LEU A HB3  4  
ATOM 10363 H HG   . LEU A 1 18  ? 3.117   3.123   -11.264 1.00 0.00 ? 18  LEU A HG   4  
ATOM 10364 H HD11 . LEU A 1 18  ? 0.511   3.456   -9.971  1.00 0.00 ? 18  LEU A HD11 4  
ATOM 10365 H HD12 . LEU A 1 18  ? 0.442   2.544   -11.476 1.00 0.00 ? 18  LEU A HD12 4  
ATOM 10366 H HD13 . LEU A 1 18  ? 1.138   4.164   -11.458 1.00 0.00 ? 18  LEU A HD13 4  
ATOM 10367 H HD21 . LEU A 1 18  ? 3.602   3.694   -9.181  1.00 0.00 ? 18  LEU A HD21 4  
ATOM 10368 H HD22 . LEU A 1 18  ? 3.115   2.074   -8.680  1.00 0.00 ? 18  LEU A HD22 4  
ATOM 10369 H HD23 . LEU A 1 18  ? 1.948   3.393   -8.655  1.00 0.00 ? 18  LEU A HD23 4  
ATOM 10370 N N    . ARG A 1 19  ? 3.195   1.126   -14.213 1.00 0.00 ? 19  ARG A N    4  
ATOM 10371 C CA   . ARG A 1 19  ? 4.299   0.971   -15.163 1.00 0.00 ? 19  ARG A CA   4  
ATOM 10372 C C    . ARG A 1 19  ? 5.160   2.228   -15.138 1.00 0.00 ? 19  ARG A C    4  
ATOM 10373 O O    . ARG A 1 19  ? 4.684   3.308   -15.483 1.00 0.00 ? 19  ARG A O    4  
ATOM 10374 C CB   . ARG A 1 19  ? 3.773   0.737   -16.587 1.00 0.00 ? 19  ARG A CB   4  
ATOM 10375 C CG   . ARG A 1 19  ? 2.335   0.240   -16.649 1.00 0.00 ? 19  ARG A CG   4  
ATOM 10376 C CD   . ARG A 1 19  ? 2.094   -0.612  -17.886 1.00 0.00 ? 19  ARG A CD   4  
ATOM 10377 N NE   . ARG A 1 19  ? 1.518   -1.912  -17.552 1.00 0.00 ? 19  ARG A NE   4  
ATOM 10378 C CZ   . ARG A 1 19  ? 1.460   -2.936  -18.400 1.00 0.00 ? 19  ARG A CZ   4  
ATOM 10379 N NH1  . ARG A 1 19  ? 1.944   -2.817  -19.630 1.00 0.00 ? 19  ARG A NH1  4  
ATOM 10380 N NH2  . ARG A 1 19  ? 0.918   -4.084  -18.017 1.00 0.00 ? 19  ARG A NH2  4  
ATOM 10381 H H    . ARG A 1 19  ? 2.516   1.814   -14.382 1.00 0.00 ? 19  ARG A H    4  
ATOM 10382 H HA   . ARG A 1 19  ? 4.895   0.125   -14.855 1.00 0.00 ? 19  ARG A HA   4  
ATOM 10383 H HB2  . ARG A 1 19  ? 3.831   1.665   -17.136 1.00 0.00 ? 19  ARG A HB2  4  
ATOM 10384 H HB3  . ARG A 1 19  ? 4.403   0.005   -17.072 1.00 0.00 ? 19  ARG A HB3  4  
ATOM 10385 H HG2  . ARG A 1 19  ? 2.130   -0.352  -15.770 1.00 0.00 ? 19  ARG A HG2  4  
ATOM 10386 H HG3  . ARG A 1 19  ? 1.671   1.092   -16.675 1.00 0.00 ? 19  ARG A HG3  4  
ATOM 10387 H HD2  . ARG A 1 19  ? 1.417   -0.088  -18.543 1.00 0.00 ? 19  ARG A HD2  4  
ATOM 10388 H HD3  . ARG A 1 19  ? 3.037   -0.766  -18.392 1.00 0.00 ? 19  ARG A HD3  4  
ATOM 10389 H HE   . ARG A 1 19  ? 1.155   -2.028  -16.649 1.00 0.00 ? 19  ARG A HE   4  
ATOM 10390 H HH11 . ARG A 1 19  ? 2.356   -1.955  -19.926 1.00 0.00 ? 19  ARG A HH11 4  
ATOM 10391 H HH12 . ARG A 1 19  ? 1.898   -3.591  -20.262 1.00 0.00 ? 19  ARG A HH12 4  
ATOM 10392 H HH21 . ARG A 1 19  ? 0.553   -4.179  -17.091 1.00 0.00 ? 19  ARG A HH21 4  
ATOM 10393 H HH22 . ARG A 1 19  ? 0.874   -4.854  -18.653 1.00 0.00 ? 19  ARG A HH22 4  
ATOM 10394 N N    . ASN A 1 20  ? 6.416   2.108   -14.700 1.00 0.00 ? 20  ASN A N    4  
ATOM 10395 C CA   . ASN A 1 20  ? 7.284   3.281   -14.612 1.00 0.00 ? 20  ASN A CA   4  
ATOM 10396 C C    . ASN A 1 20  ? 6.542   4.359   -13.823 1.00 0.00 ? 20  ASN A C    4  
ATOM 10397 O O    . ASN A 1 20  ? 6.437   5.510   -14.243 1.00 0.00 ? 20  ASN A O    4  
ATOM 10398 C CB   . ASN A 1 20  ? 7.638   3.794   -16.011 1.00 0.00 ? 20  ASN A CB   4  
ATOM 10399 C CG   . ASN A 1 20  ? 8.854   3.101   -16.597 1.00 0.00 ? 20  ASN A CG   4  
ATOM 10400 O OD1  . ASN A 1 20  ? 9.696   3.734   -17.234 1.00 0.00 ? 20  ASN A OD1  4  
ATOM 10401 N ND2  . ASN A 1 20  ? 8.953   1.793   -16.386 1.00 0.00 ? 20  ASN A ND2  4  
ATOM 10402 H H    . ASN A 1 20  ? 6.749   1.233   -14.411 1.00 0.00 ? 20  ASN A H    4  
ATOM 10403 H HA   . ASN A 1 20  ? 8.193   3.001   -14.083 1.00 0.00 ? 20  ASN A HA   4  
ATOM 10404 H HB2  . ASN A 1 20  ? 6.800   3.626   -16.672 1.00 0.00 ? 20  ASN A HB2  4  
ATOM 10405 H HB3  . ASN A 1 20  ? 7.841   4.853   -15.958 1.00 0.00 ? 20  ASN A HB3  4  
ATOM 10406 H HD21 . ASN A 1 20  ? 8.247   1.351   -15.871 1.00 0.00 ? 20  ASN A HD21 4  
ATOM 10407 H HD22 . ASN A 1 20  ? 9.730   1.323   -16.754 1.00 0.00 ? 20  ASN A HD22 4  
ATOM 10408 N N    . PHE A 1 21  ? 5.986   3.921   -12.699 1.00 0.00 ? 21  PHE A N    4  
ATOM 10409 C CA   . PHE A 1 21  ? 5.179   4.751   -11.809 1.00 0.00 ? 21  PHE A CA   4  
ATOM 10410 C C    . PHE A 1 21  ? 4.029   5.413   -12.557 1.00 0.00 ? 21  PHE A C    4  
ATOM 10411 O O    . PHE A 1 21  ? 3.634   6.536   -12.250 1.00 0.00 ? 21  PHE A O    4  
ATOM 10412 C CB   . PHE A 1 21  ? 6.021   5.798   -11.072 1.00 0.00 ? 21  PHE A CB   4  
ATOM 10413 C CG   . PHE A 1 21  ? 6.741   6.790   -11.951 1.00 0.00 ? 21  PHE A CG   4  
ATOM 10414 C CD1  . PHE A 1 21  ? 6.041   7.718   -12.711 1.00 0.00 ? 21  PHE A CD1  4  
ATOM 10415 C CD2  . PHE A 1 21  ? 8.125   6.803   -12.004 1.00 0.00 ? 21  PHE A CD2  4  
ATOM 10416 C CE1  . PHE A 1 21  ? 6.708   8.633   -13.504 1.00 0.00 ? 21  PHE A CE1  4  
ATOM 10417 C CE2  . PHE A 1 21  ? 8.795   7.716   -12.797 1.00 0.00 ? 21  PHE A CE2  4  
ATOM 10418 C CZ   . PHE A 1 21  ? 8.086   8.631   -13.548 1.00 0.00 ? 21  PHE A CZ   4  
ATOM 10419 H H    . PHE A 1 21  ? 6.098   2.973   -12.474 1.00 0.00 ? 21  PHE A H    4  
ATOM 10420 H HA   . PHE A 1 21  ? 4.751   4.088   -11.072 1.00 0.00 ? 21  PHE A HA   4  
ATOM 10421 H HB2  . PHE A 1 21  ? 5.376   6.359   -10.413 1.00 0.00 ? 21  PHE A HB2  4  
ATOM 10422 H HB3  . PHE A 1 21  ? 6.758   5.281   -10.480 1.00 0.00 ? 21  PHE A HB3  4  
ATOM 10423 H HD1  . PHE A 1 21  ? 4.967   7.726   -12.681 1.00 0.00 ? 21  PHE A HD1  4  
ATOM 10424 H HD2  . PHE A 1 21  ? 8.683   6.088   -11.418 1.00 0.00 ? 21  PHE A HD2  4  
ATOM 10425 H HE1  . PHE A 1 21  ? 6.149   9.348   -14.090 1.00 0.00 ? 21  PHE A HE1  4  
ATOM 10426 H HE2  . PHE A 1 21  ? 9.875   7.713   -12.830 1.00 0.00 ? 21  PHE A HE2  4  
ATOM 10427 H HZ   . PHE A 1 21  ? 8.609   9.345   -14.167 1.00 0.00 ? 21  PHE A HZ   4  
ATOM 10428 N N    . ARG A 1 22  ? 3.450   4.676   -13.497 1.00 0.00 ? 22  ARG A N    4  
ATOM 10429 C CA   . ARG A 1 22  ? 2.302   5.152   -14.253 1.00 0.00 ? 22  ARG A CA   4  
ATOM 10430 C C    . ARG A 1 22  ? 1.110   4.295   -13.870 1.00 0.00 ? 22  ARG A C    4  
ATOM 10431 O O    . ARG A 1 22  ? 1.237   3.078   -13.771 1.00 0.00 ? 22  ARG A O    4  
ATOM 10432 C CB   . ARG A 1 22  ? 2.563   5.059   -15.759 1.00 0.00 ? 22  ARG A CB   4  
ATOM 10433 C CG   . ARG A 1 22  ? 3.823   5.784   -16.206 1.00 0.00 ? 22  ARG A CG   4  
ATOM 10434 C CD   . ARG A 1 22  ? 4.282   5.311   -17.576 1.00 0.00 ? 22  ARG A CD   4  
ATOM 10435 N NE   . ARG A 1 22  ? 3.174   5.215   -18.524 1.00 0.00 ? 22  ARG A NE   4  
ATOM 10436 C CZ   . ARG A 1 22  ? 2.641   6.262   -19.150 1.00 0.00 ? 22  ARG A CZ   4  
ATOM 10437 N NH1  . ARG A 1 22  ? 3.109   7.485   -18.930 1.00 0.00 ? 22  ARG A NH1  4  
ATOM 10438 N NH2  . ARG A 1 22  ? 1.637   6.086   -19.998 1.00 0.00 ? 22  ARG A NH2  4  
ATOM 10439 H H    . ARG A 1 22  ? 3.776   3.769   -13.674 1.00 0.00 ? 22  ARG A H    4  
ATOM 10440 H HA   . ARG A 1 22  ? 2.111   6.178   -13.976 1.00 0.00 ? 22  ARG A HA   4  
ATOM 10441 H HB2  . ARG A 1 22  ? 2.656   4.019   -16.033 1.00 0.00 ? 22  ARG A HB2  4  
ATOM 10442 H HB3  . ARG A 1 22  ? 1.723   5.486   -16.284 1.00 0.00 ? 22  ARG A HB3  4  
ATOM 10443 H HG2  . ARG A 1 22  ? 3.621   6.843   -16.252 1.00 0.00 ? 22  ARG A HG2  4  
ATOM 10444 H HG3  . ARG A 1 22  ? 4.608   5.596   -15.489 1.00 0.00 ? 22  ARG A HG3  4  
ATOM 10445 H HD2  . ARG A 1 22  ? 5.011   6.010   -17.959 1.00 0.00 ? 22  ARG A HD2  4  
ATOM 10446 H HD3  . ARG A 1 22  ? 4.740   4.338   -17.472 1.00 0.00 ? 22  ARG A HD3  4  
ATOM 10447 H HE   . ARG A 1 22  ? 2.809   4.324   -18.705 1.00 0.00 ? 22  ARG A HE   4  
ATOM 10448 H HH11 . ARG A 1 22  ? 3.866   7.625   -18.292 1.00 0.00 ? 22  ARG A HH11 4  
ATOM 10449 H HH12 . ARG A 1 22  ? 2.703   8.267   -19.403 1.00 0.00 ? 22  ARG A HH12 4  
ATOM 10450 H HH21 . ARG A 1 22  ? 1.281   5.167   -20.167 1.00 0.00 ? 22  ARG A HH21 4  
ATOM 10451 H HH22 . ARG A 1 22  ? 1.236   6.872   -20.468 1.00 0.00 ? 22  ARG A HH22 4  
ATOM 10452 N N    . SER A 1 23  ? -0.032  4.911   -13.617 1.00 0.00 ? 23  SER A N    4  
ATOM 10453 C CA   . SER A 1 23  ? -1.195  4.153   -13.199 1.00 0.00 ? 23  SER A CA   4  
ATOM 10454 C C    . SER A 1 23  ? -2.023  3.685   -14.387 1.00 0.00 ? 23  SER A C    4  
ATOM 10455 O O    . SER A 1 23  ? -2.222  4.421   -15.345 1.00 0.00 ? 23  SER A O    4  
ATOM 10456 C CB   . SER A 1 23  ? -2.055  5.010   -12.275 1.00 0.00 ? 23  SER A CB   4  
ATOM 10457 O OG   . SER A 1 23  ? -2.743  4.213   -11.326 1.00 0.00 ? 23  SER A OG   4  
ATOM 10458 H H    . SER A 1 23  ? -0.093  5.889   -13.684 1.00 0.00 ? 23  SER A H    4  
ATOM 10459 H HA   . SER A 1 23  ? -0.848  3.290   -12.648 1.00 0.00 ? 23  SER A HA   4  
ATOM 10460 H HB2  . SER A 1 23  ? -1.424  5.710   -11.751 1.00 0.00 ? 23  SER A HB2  4  
ATOM 10461 H HB3  . SER A 1 23  ? -2.775  5.553   -12.863 1.00 0.00 ? 23  SER A HB3  4  
ATOM 10462 H HG   . SER A 1 23  ? -2.684  4.623   -10.460 1.00 0.00 ? 23  SER A HG   4  
ATOM 10463 N N    . ILE A 1 24  ? -2.521  2.459   -14.293 1.00 0.00 ? 24  ILE A N    4  
ATOM 10464 C CA   . ILE A 1 24  ? -3.367  1.873   -15.327 1.00 0.00 ? 24  ILE A CA   4  
ATOM 10465 C C    . ILE A 1 24  ? -4.338  0.910   -14.677 1.00 0.00 ? 24  ILE A C    4  
ATOM 10466 O O    . ILE A 1 24  ? -3.955  -0.190  -14.280 1.00 0.00 ? 24  ILE A O    4  
ATOM 10467 C CB   . ILE A 1 24  ? -2.580  1.091   -16.392 1.00 0.00 ? 24  ILE A CB   4  
ATOM 10468 C CG1  . ILE A 1 24  ? -1.657  2.022   -17.177 1.00 0.00 ? 24  ILE A CG1  4  
ATOM 10469 C CG2  . ILE A 1 24  ? -3.535  0.347   -17.340 1.00 0.00 ? 24  ILE A CG2  4  
ATOM 10470 C CD1  . ILE A 1 24  ? -0.521  1.298   -17.864 1.00 0.00 ? 24  ILE A CD1  4  
ATOM 10471 H H    . ILE A 1 24  ? -2.332  1.935   -13.486 1.00 0.00 ? 24  ILE A H    4  
ATOM 10472 H HA   . ILE A 1 24  ? -3.911  2.672   -15.814 1.00 0.00 ? 24  ILE A HA   4  
ATOM 10473 H HB   . ILE A 1 24  ? -1.989  0.362   -15.879 1.00 0.00 ? 24  ILE A HB   4  
ATOM 10474 H HG12 . ILE A 1 24  ? -2.230  2.533   -17.935 1.00 0.00 ? 24  ILE A HG12 4  
ATOM 10475 H HG13 . ILE A 1 24  ? -1.228  2.749   -16.504 1.00 0.00 ? 24  ILE A HG13 4  
ATOM 10476 H HG21 . ILE A 1 24  ? -4.210  -0.285  -16.770 1.00 0.00 ? 24  ILE A HG21 4  
ATOM 10477 H HG22 . ILE A 1 24  ? -2.963  -0.268  -18.018 1.00 0.00 ? 24  ILE A HG22 4  
ATOM 10478 H HG23 . ILE A 1 24  ? -4.111  1.062   -17.907 1.00 0.00 ? 24  ILE A HG23 4  
ATOM 10479 H HD11 . ILE A 1 24  ? -0.287  0.396   -17.317 1.00 0.00 ? 24  ILE A HD11 4  
ATOM 10480 H HD12 . ILE A 1 24  ? 0.349   1.938   -17.893 1.00 0.00 ? 24  ILE A HD12 4  
ATOM 10481 H HD13 . ILE A 1 24  ? -0.813  1.043   -18.872 1.00 0.00 ? 24  ILE A HD13 4  
ATOM 10482 N N    . LEU A 1 25  ? -5.586  1.310   -14.573 1.00 0.00 ? 25  LEU A N    4  
ATOM 10483 C CA   . LEU A 1 25  ? -6.580  0.456   -13.974 1.00 0.00 ? 25  LEU A CA   4  
ATOM 10484 C C    . LEU A 1 25  ? -7.387  -0.245  -15.049 1.00 0.00 ? 25  LEU A C    4  
ATOM 10485 O O    . LEU A 1 25  ? -7.669  0.307   -16.112 1.00 0.00 ? 25  LEU A O    4  
ATOM 10486 C CB   . LEU A 1 25  ? -7.441  1.229   -12.974 1.00 0.00 ? 25  LEU A CB   4  
ATOM 10487 C CG   . LEU A 1 25  ? -8.703  1.937   -13.494 1.00 0.00 ? 25  LEU A CG   4  
ATOM 10488 C CD1  . LEU A 1 25  ? -9.114  3.040   -12.522 1.00 0.00 ? 25  LEU A CD1  4  
ATOM 10489 C CD2  . LEU A 1 25  ? -8.503  2.511   -14.891 1.00 0.00 ? 25  LEU A CD2  4  
ATOM 10490 H H    . LEU A 1 25  ? -5.839  2.182   -14.911 1.00 0.00 ? 25  LEU A H    4  
ATOM 10491 H HA   . LEU A 1 25  ? -6.040  -0.304  -13.428 1.00 0.00 ? 25  LEU A HA   4  
ATOM 10492 H HB2  . LEU A 1 25  ? -7.747  0.537   -12.206 1.00 0.00 ? 25  LEU A HB2  4  
ATOM 10493 H HB3  . LEU A 1 25  ? -6.805  1.965   -12.520 1.00 0.00 ? 25  LEU A HB3  4  
ATOM 10494 H HG   . LEU A 1 25  ? -9.512  1.220   -13.538 1.00 0.00 ? 25  LEU A HG   4  
ATOM 10495 H HD11 . LEU A 1 25  ? -8.316  3.765   -12.436 1.00 0.00 ? 25  LEU A HD11 4  
ATOM 10496 H HD12 . LEU A 1 25  ? -9.313  2.609   -11.552 1.00 0.00 ? 25  LEU A HD12 4  
ATOM 10497 H HD13 . LEU A 1 25  ? -10.003 3.529   -12.886 1.00 0.00 ? 25  LEU A HD13 4  
ATOM 10498 H HD21 . LEU A 1 25  ? -8.713  3.571   -14.880 1.00 0.00 ? 25  LEU A HD21 4  
ATOM 10499 H HD22 . LEU A 1 25  ? -9.175  2.019   -15.577 1.00 0.00 ? 25  LEU A HD22 4  
ATOM 10500 H HD23 . LEU A 1 25  ? -7.491  2.348   -15.211 1.00 0.00 ? 25  LEU A HD23 4  
ATOM 10501 N N    . SER A 1 26  ? -7.696  -1.489  -14.770 1.00 0.00 ? 26  SER A N    4  
ATOM 10502 C CA   . SER A 1 26  ? -8.412  -2.342  -15.690 1.00 0.00 ? 26  SER A CA   4  
ATOM 10503 C C    . SER A 1 26  ? -9.580  -3.004  -14.989 1.00 0.00 ? 26  SER A C    4  
ATOM 10504 O O    . SER A 1 26  ? -9.850  -2.720  -13.827 1.00 0.00 ? 26  SER A O    4  
ATOM 10505 C CB   . SER A 1 26  ? -7.462  -3.409  -16.230 1.00 0.00 ? 26  SER A CB   4  
ATOM 10506 O OG   . SER A 1 26  ? -7.220  -4.415  -15.262 1.00 0.00 ? 26  SER A OG   4  
ATOM 10507 H H    . SER A 1 26  ? -7.406  -1.857  -13.919 1.00 0.00 ? 26  SER A H    4  
ATOM 10508 H HA   . SER A 1 26  ? -8.770  -1.740  -16.509 1.00 0.00 ? 26  SER A HA   4  
ATOM 10509 H HB2  . SER A 1 26  ? -7.888  -3.864  -17.101 1.00 0.00 ? 26  SER A HB2  4  
ATOM 10510 H HB3  . SER A 1 26  ? -6.527  -2.950  -16.492 1.00 0.00 ? 26  SER A HB3  4  
ATOM 10511 H HG   . SER A 1 26  ? -6.308  -4.361  -14.965 1.00 0.00 ? 26  SER A HG   4  
ATOM 10512 N N    . TRP A 1 27  ? -10.260 -3.888  -15.698 1.00 0.00 ? 27  TRP A N    4  
ATOM 10513 C CA   . TRP A 1 27  ? -11.396 -4.601  -15.130 1.00 0.00 ? 27  TRP A CA   4  
ATOM 10514 C C    . TRP A 1 27  ? -11.446 -6.048  -15.593 1.00 0.00 ? 27  TRP A C    4  
ATOM 10515 O O    . TRP A 1 27  ? -10.942 -6.400  -16.659 1.00 0.00 ? 27  TRP A O    4  
ATOM 10516 C CB   . TRP A 1 27  ? -12.694 -3.894  -15.466 1.00 0.00 ? 27  TRP A CB   4  
ATOM 10517 C CG   . TRP A 1 27  ? -12.925 -3.734  -16.932 1.00 0.00 ? 27  TRP A CG   4  
ATOM 10518 C CD1  . TRP A 1 27  ? -13.198 -4.704  -17.848 1.00 0.00 ? 27  TRP A CD1  4  
ATOM 10519 C CD2  . TRP A 1 27  ? -12.891 -2.510  -17.647 1.00 0.00 ? 27  TRP A CD2  4  
ATOM 10520 N NE1  . TRP A 1 27  ? -13.339 -4.148  -19.092 1.00 0.00 ? 27  TRP A NE1  4  
ATOM 10521 C CE2  . TRP A 1 27  ? -13.152 -2.799  -18.991 1.00 0.00 ? 27  TRP A CE2  4  
ATOM 10522 C CE3  . TRP A 1 27  ? -12.664 -1.196  -17.270 1.00 0.00 ? 27  TRP A CE3  4  
ATOM 10523 C CZ2  . TRP A 1 27  ? -13.189 -1.814  -19.966 1.00 0.00 ? 27  TRP A CZ2  4  
ATOM 10524 C CZ3  . TRP A 1 27  ? -12.700 -0.211  -18.236 1.00 0.00 ? 27  TRP A CZ3  4  
ATOM 10525 C CH2  . TRP A 1 27  ? -12.959 -0.526  -19.574 1.00 0.00 ? 27  TRP A CH2  4  
ATOM 10526 H H    . TRP A 1 27  ? -9.982  -4.073  -16.620 1.00 0.00 ? 27  TRP A H    4  
ATOM 10527 H HA   . TRP A 1 27  ? -11.288 -4.601  -14.057 1.00 0.00 ? 27  TRP A HA   4  
ATOM 10528 H HB2  . TRP A 1 27  ? -13.511 -4.449  -15.044 1.00 0.00 ? 27  TRP A HB2  4  
ATOM 10529 H HB3  . TRP A 1 27  ? -12.673 -2.908  -15.027 1.00 0.00 ? 27  TRP A HB3  4  
ATOM 10530 H HD1  . TRP A 1 27  ? -13.290 -5.744  -17.617 1.00 0.00 ? 27  TRP A HD1  4  
ATOM 10531 H HE1  . TRP A 1 27  ? -13.539 -4.638  -19.917 1.00 0.00 ? 27  TRP A HE1  4  
ATOM 10532 H HE3  . TRP A 1 27  ? -12.471 -0.947  -16.241 1.00 0.00 ? 27  TRP A HE3  4  
ATOM 10533 H HZ2  . TRP A 1 27  ? -13.375 -2.050  -20.996 1.00 0.00 ? 27  TRP A HZ2  4  
ATOM 10534 H HZ3  . TRP A 1 27  ? -12.522 0.815   -17.963 1.00 0.00 ? 27  TRP A HZ3  4  
ATOM 10535 H HH2  . TRP A 1 27  ? -12.971 0.270   -20.300 1.00 0.00 ? 27  TRP A HH2  4  
ATOM 10536 N N    . GLU A 1 28  ? -12.068 -6.872  -14.769 1.00 0.00 ? 28  GLU A N    4  
ATOM 10537 C CA   . GLU A 1 28  ? -12.221 -8.288  -15.041 1.00 0.00 ? 28  GLU A CA   4  
ATOM 10538 C C    . GLU A 1 28  ? -13.666 -8.662  -14.921 1.00 0.00 ? 28  GLU A C    4  
ATOM 10539 O O    . GLU A 1 28  ? -14.123 -9.140  -13.883 1.00 0.00 ? 28  GLU A O    4  
ATOM 10540 C CB   . GLU A 1 28  ? -11.355 -9.099  -14.082 1.00 0.00 ? 28  GLU A CB   4  
ATOM 10541 C CG   . GLU A 1 28  ? -10.510 -10.157 -14.771 1.00 0.00 ? 28  GLU A CG   4  
ATOM 10542 C CD   . GLU A 1 28  ? -11.349 -11.179 -15.513 1.00 0.00 ? 28  GLU A CD   4  
ATOM 10543 O OE1  . GLU A 1 28  ? -12.016 -11.997 -14.845 1.00 0.00 ? 28  GLU A OE1  4  
ATOM 10544 O OE2  . GLU A 1 28  ? -11.341 -11.160 -16.762 1.00 0.00 ? 28  GLU A OE2  4  
ATOM 10545 H H    . GLU A 1 28  ? -12.443 -6.512  -13.939 1.00 0.00 ? 28  GLU A H    4  
ATOM 10546 H HA   . GLU A 1 28  ? -11.924 -8.487  -16.053 1.00 0.00 ? 28  GLU A HA   4  
ATOM 10547 H HB2  . GLU A 1 28  ? -10.692 -8.417  -13.566 1.00 0.00 ? 28  GLU A HB2  4  
ATOM 10548 H HB3  . GLU A 1 28  ? -11.992 -9.587  -13.360 1.00 0.00 ? 28  GLU A HB3  4  
ATOM 10549 H HG2  . GLU A 1 28  ? -9.853  -9.672  -15.478 1.00 0.00 ? 28  GLU A HG2  4  
ATOM 10550 H HG3  . GLU A 1 28  ? -9.920  -10.670 -14.026 1.00 0.00 ? 28  GLU A HG3  4  
ATOM 10551 N N    . LEU A 1 29  ? -14.383 -8.423  -16.004 1.00 0.00 ? 29  LEU A N    4  
ATOM 10552 C CA   . LEU A 1 29  ? -15.787 -8.722  -16.047 1.00 0.00 ? 29  LEU A CA   4  
ATOM 10553 C C    . LEU A 1 29  ? -16.015 -9.973  -16.864 1.00 0.00 ? 29  LEU A C    4  
ATOM 10554 O O    . LEU A 1 29  ? -15.927 -9.975  -18.092 1.00 0.00 ? 29  LEU A O    4  
ATOM 10555 C CB   . LEU A 1 29  ? -16.570 -7.550  -16.646 1.00 0.00 ? 29  LEU A CB   4  
ATOM 10556 C CG   . LEU A 1 29  ? -15.751 -6.280  -16.900 1.00 0.00 ? 29  LEU A CG   4  
ATOM 10557 C CD1  . LEU A 1 29  ? -15.873 -5.848  -18.348 1.00 0.00 ? 29  LEU A CD1  4  
ATOM 10558 C CD2  . LEU A 1 29  ? -16.185 -5.171  -15.964 1.00 0.00 ? 29  LEU A CD2  4  
ATOM 10559 H H    . LEU A 1 29  ? -13.945 -8.031  -16.789 1.00 0.00 ? 29  LEU A H    4  
ATOM 10560 H HA   . LEU A 1 29  ? -16.125 -8.892  -15.035 1.00 0.00 ? 29  LEU A HA   4  
ATOM 10561 H HB2  . LEU A 1 29  ? -16.998 -7.872  -17.585 1.00 0.00 ? 29  LEU A HB2  4  
ATOM 10562 H HB3  . LEU A 1 29  ? -17.375 -7.303  -15.971 1.00 0.00 ? 29  LEU A HB3  4  
ATOM 10563 H HG   . LEU A 1 29  ? -14.712 -6.482  -16.706 1.00 0.00 ? 29  LEU A HG   4  
ATOM 10564 H HD11 . LEU A 1 29  ? -15.613 -4.802  -18.436 1.00 0.00 ? 29  LEU A HD11 4  
ATOM 10565 H HD12 . LEU A 1 29  ? -16.887 -6.001  -18.682 1.00 0.00 ? 29  LEU A HD12 4  
ATOM 10566 H HD13 . LEU A 1 29  ? -15.201 -6.440  -18.952 1.00 0.00 ? 29  LEU A HD13 4  
ATOM 10567 H HD21 . LEU A 1 29  ? -15.311 -4.670  -15.576 1.00 0.00 ? 29  LEU A HD21 4  
ATOM 10568 H HD22 . LEU A 1 29  ? -16.753 -5.594  -15.147 1.00 0.00 ? 29  LEU A HD22 4  
ATOM 10569 H HD23 . LEU A 1 29  ? -16.796 -4.465  -16.504 1.00 0.00 ? 29  LEU A HD23 4  
ATOM 10570 N N    . LYS A 1 30  ? -16.317 -11.025 -16.149 1.00 0.00 ? 30  LYS A N    4  
ATOM 10571 C CA   . LYS A 1 30  ? -16.585 -12.328 -16.749 1.00 0.00 ? 30  LYS A CA   4  
ATOM 10572 C C    . LYS A 1 30  ? -17.930 -12.323 -17.467 1.00 0.00 ? 30  LYS A C    4  
ATOM 10573 O O    . LYS A 1 30  ? -18.879 -11.676 -17.023 1.00 0.00 ? 30  LYS A O    4  
ATOM 10574 C CB   . LYS A 1 30  ? -16.569 -13.419 -15.678 1.00 0.00 ? 30  LYS A CB   4  
ATOM 10575 C CG   . LYS A 1 30  ? -15.172 -13.883 -15.301 1.00 0.00 ? 30  LYS A CG   4  
ATOM 10576 C CD   . LYS A 1 30  ? -15.184 -14.697 -14.018 1.00 0.00 ? 30  LYS A CD   4  
ATOM 10577 C CE   . LYS A 1 30  ? -13.787 -15.164 -13.641 1.00 0.00 ? 30  LYS A CE   4  
ATOM 10578 N NZ   . LYS A 1 30  ? -13.822 -16.269 -12.644 1.00 0.00 ? 30  LYS A NZ   4  
ATOM 10579 H H    . LYS A 1 30  ? -16.347 -10.919 -15.181 1.00 0.00 ? 30  LYS A H    4  
ATOM 10580 H HA   . LYS A 1 30  ? -15.805 -12.529 -17.469 1.00 0.00 ? 30  LYS A HA   4  
ATOM 10581 H HB2  . LYS A 1 30  ? -17.052 -13.042 -14.788 1.00 0.00 ? 30  LYS A HB2  4  
ATOM 10582 H HB3  . LYS A 1 30  ? -17.122 -14.273 -16.042 1.00 0.00 ? 30  LYS A HB3  4  
ATOM 10583 H HG2  . LYS A 1 30  ? -14.778 -14.493 -16.099 1.00 0.00 ? 30  LYS A HG2  4  
ATOM 10584 H HG3  . LYS A 1 30  ? -14.541 -13.016 -15.161 1.00 0.00 ? 30  LYS A HG3  4  
ATOM 10585 H HD2  . LYS A 1 30  ? -15.576 -14.086 -13.218 1.00 0.00 ? 30  LYS A HD2  4  
ATOM 10586 H HD3  . LYS A 1 30  ? -15.818 -15.561 -14.157 1.00 0.00 ? 30  LYS A HD3  4  
ATOM 10587 H HE2  . LYS A 1 30  ? -13.285 -15.510 -14.532 1.00 0.00 ? 30  LYS A HE2  4  
ATOM 10588 H HE3  . LYS A 1 30  ? -13.244 -14.330 -13.223 1.00 0.00 ? 30  LYS A HE3  4  
ATOM 10589 H HZ1  . LYS A 1 30  ? -13.758 -17.188 -13.128 1.00 0.00 ? 30  LYS A HZ1  4  
ATOM 10590 H HZ2  . LYS A 1 30  ? -14.709 -16.236 -12.104 1.00 0.00 ? 30  LYS A HZ2  4  
ATOM 10591 H HZ3  . LYS A 1 30  ? -13.023 -16.180 -11.984 1.00 0.00 ? 30  LYS A HZ3  4  
ATOM 10592 N N    . ASN A 1 31  ? -18.007 -13.044 -18.580 1.00 0.00 ? 31  ASN A N    4  
ATOM 10593 C CA   . ASN A 1 31  ? -19.238 -13.117 -19.360 1.00 0.00 ? 31  ASN A CA   4  
ATOM 10594 C C    . ASN A 1 31  ? -20.043 -14.363 -19.005 1.00 0.00 ? 31  ASN A C    4  
ATOM 10595 O O    . ASN A 1 31  ? -19.493 -15.458 -18.889 1.00 0.00 ? 31  ASN A O    4  
ATOM 10596 C CB   . ASN A 1 31  ? -18.919 -13.112 -20.855 1.00 0.00 ? 31  ASN A CB   4  
ATOM 10597 C CG   . ASN A 1 31  ? -17.956 -12.006 -21.237 1.00 0.00 ? 31  ASN A CG   4  
ATOM 10598 O OD1  . ASN A 1 31  ? -16.832 -11.945 -20.739 1.00 0.00 ? 31  ASN A OD1  4  
ATOM 10599 N ND2  . ASN A 1 31  ? -18.394 -11.123 -22.126 1.00 0.00 ? 31  ASN A ND2  4  
ATOM 10600 H H    . ASN A 1 31  ? -17.217 -13.537 -18.887 1.00 0.00 ? 31  ASN A H    4  
ATOM 10601 H HA   . ASN A 1 31  ? -19.828 -12.244 -19.126 1.00 0.00 ? 31  ASN A HA   4  
ATOM 10602 H HB2  . ASN A 1 31  ? -18.475 -14.059 -21.125 1.00 0.00 ? 31  ASN A HB2  4  
ATOM 10603 H HB3  . ASN A 1 31  ? -19.835 -12.976 -21.411 1.00 0.00 ? 31  ASN A HB3  4  
ATOM 10604 H HD21 . ASN A 1 31  ? -19.301 -11.233 -22.480 1.00 0.00 ? 31  ASN A HD21 4  
ATOM 10605 H HD22 . ASN A 1 31  ? -17.792 -10.396 -22.392 1.00 0.00 ? 31  ASN A HD22 4  
ATOM 10606 N N    . HIS A 1 32  ? -21.350 -14.186 -18.840 1.00 0.00 ? 32  HIS A N    4  
ATOM 10607 C CA   . HIS A 1 32  ? -22.237 -15.294 -18.504 1.00 0.00 ? 32  HIS A CA   4  
ATOM 10608 C C    . HIS A 1 32  ? -23.299 -15.480 -19.583 1.00 0.00 ? 32  HIS A C    4  
ATOM 10609 O O    . HIS A 1 32  ? -23.275 -16.458 -20.330 1.00 0.00 ? 32  HIS A O    4  
ATOM 10610 C CB   . HIS A 1 32  ? -22.905 -15.046 -17.149 1.00 0.00 ? 32  HIS A CB   4  
ATOM 10611 C CG   . HIS A 1 32  ? -22.952 -16.259 -16.274 1.00 0.00 ? 32  HIS A CG   4  
ATOM 10612 N ND1  . HIS A 1 32  ? -24.130 -16.875 -15.906 1.00 0.00 ? 32  HIS A ND1  4  
ATOM 10613 C CD2  . HIS A 1 32  ? -21.959 -16.972 -15.692 1.00 0.00 ? 32  HIS A CD2  4  
ATOM 10614 C CE1  . HIS A 1 32  ? -23.859 -17.913 -15.135 1.00 0.00 ? 32  HIS A CE1  4  
ATOM 10615 N NE2  . HIS A 1 32  ? -22.550 -17.994 -14.990 1.00 0.00 ? 32  HIS A NE2  4  
ATOM 10616 H H    . HIS A 1 32  ? -21.728 -13.288 -18.950 1.00 0.00 ? 32  HIS A H    4  
ATOM 10617 H HA   . HIS A 1 32  ? -21.640 -16.191 -18.443 1.00 0.00 ? 32  HIS A HA   4  
ATOM 10618 H HB2  . HIS A 1 32  ? -22.359 -14.278 -16.622 1.00 0.00 ? 32  HIS A HB2  4  
ATOM 10619 H HB3  . HIS A 1 32  ? -23.919 -14.712 -17.311 1.00 0.00 ? 32  HIS A HB3  4  
ATOM 10620 H HD1  . HIS A 1 32  ? -25.030 -16.593 -16.170 1.00 0.00 ? 32  HIS A HD1  4  
ATOM 10621 H HD2  . HIS A 1 32  ? -20.899 -16.774 -15.766 1.00 0.00 ? 32  HIS A HD2  4  
ATOM 10622 H HE1  . HIS A 1 32  ? -24.586 -18.582 -14.699 1.00 0.00 ? 32  HIS A HE1  4  
ATOM 10623 H HE2  . HIS A 1 32  ? -22.084 -18.627 -14.405 1.00 0.00 ? 32  HIS A HE2  4  
ATOM 10624 N N    . SER A 1 33  ? -24.228 -14.532 -19.662 1.00 0.00 ? 33  SER A N    4  
ATOM 10625 C CA   . SER A 1 33  ? -25.295 -14.586 -20.653 1.00 0.00 ? 33  SER A CA   4  
ATOM 10626 C C    . SER A 1 33  ? -25.085 -13.519 -21.723 1.00 0.00 ? 33  SER A C    4  
ATOM 10627 O O    . SER A 1 33  ? -24.883 -13.832 -22.896 1.00 0.00 ? 33  SER A O    4  
ATOM 10628 C CB   . SER A 1 33  ? -26.657 -14.396 -19.981 1.00 0.00 ? 33  SER A CB   4  
ATOM 10629 O OG   . SER A 1 33  ? -27.412 -15.596 -20.010 1.00 0.00 ? 33  SER A OG   4  
ATOM 10630 H H    . SER A 1 33  ? -24.191 -13.775 -19.041 1.00 0.00 ? 33  SER A H    4  
ATOM 10631 H HA   . SER A 1 33  ? -25.265 -15.559 -21.121 1.00 0.00 ? 33  SER A HA   4  
ATOM 10632 H HB2  . SER A 1 33  ? -26.511 -14.103 -18.953 1.00 0.00 ? 33  SER A HB2  4  
ATOM 10633 H HB3  . SER A 1 33  ? -27.210 -13.626 -20.500 1.00 0.00 ? 33  SER A HB3  4  
ATOM 10634 H HG   . SER A 1 33  ? -26.851 -16.334 -19.761 1.00 0.00 ? 33  SER A HG   4  
ATOM 10635 N N    . ILE A 1 34  ? -25.125 -12.258 -21.306 1.00 0.00 ? 34  ILE A N    4  
ATOM 10636 C CA   . ILE A 1 34  ? -24.930 -11.142 -22.224 1.00 0.00 ? 34  ILE A CA   4  
ATOM 10637 C C    . ILE A 1 34  ? -23.444 -10.850 -22.406 1.00 0.00 ? 34  ILE A C    4  
ATOM 10638 O O    . ILE A 1 34  ? -22.672 -10.895 -21.448 1.00 0.00 ? 34  ILE A O    4  
ATOM 10639 C CB   . ILE A 1 34  ? -25.643 -9.869  -21.724 1.00 0.00 ? 34  ILE A CB   4  
ATOM 10640 C CG1  . ILE A 1 34  ? -25.510 -8.743  -22.751 1.00 0.00 ? 34  ILE A CG1  4  
ATOM 10641 C CG2  . ILE A 1 34  ? -25.080 -9.435  -20.378 1.00 0.00 ? 34  ILE A CG2  4  
ATOM 10642 C CD1  . ILE A 1 34  ? -26.609 -7.707  -22.659 1.00 0.00 ? 34  ILE A CD1  4  
ATOM 10643 H H    . ILE A 1 34  ? -25.283 -12.073 -20.357 1.00 0.00 ? 34  ILE A H    4  
ATOM 10644 H HA   . ILE A 1 34  ? -25.353 -11.417 -23.179 1.00 0.00 ? 34  ILE A HA   4  
ATOM 10645 H HB   . ILE A 1 34  ? -26.689 -10.100 -21.589 1.00 0.00 ? 34  ILE A HB   4  
ATOM 10646 H HG12 . ILE A 1 34  ? -24.567 -8.239  -22.602 1.00 0.00 ? 34  ILE A HG12 4  
ATOM 10647 H HG13 . ILE A 1 34  ? -25.534 -9.167  -23.745 1.00 0.00 ? 34  ILE A HG13 4  
ATOM 10648 H HG21 . ILE A 1 34  ? -25.888 -9.112  -19.737 1.00 0.00 ? 34  ILE A HG21 4  
ATOM 10649 H HG22 . ILE A 1 34  ? -24.389 -8.619  -20.523 1.00 0.00 ? 34  ILE A HG22 4  
ATOM 10650 H HG23 . ILE A 1 34  ? -24.565 -10.265 -19.918 1.00 0.00 ? 34  ILE A HG23 4  
ATOM 10651 H HD11 . ILE A 1 34  ? -26.679 -7.172  -23.595 1.00 0.00 ? 34  ILE A HD11 4  
ATOM 10652 H HD12 . ILE A 1 34  ? -26.383 -7.013  -21.864 1.00 0.00 ? 34  ILE A HD12 4  
ATOM 10653 H HD13 . ILE A 1 34  ? -27.549 -8.197  -22.454 1.00 0.00 ? 34  ILE A HD13 4  
ATOM 10654 N N    . VAL A 1 35  ? -23.046 -10.558 -23.640 1.00 0.00 ? 35  VAL A N    4  
ATOM 10655 C CA   . VAL A 1 35  ? -21.649 -10.269 -23.940 1.00 0.00 ? 35  VAL A CA   4  
ATOM 10656 C C    . VAL A 1 35  ? -21.447 -8.800  -24.311 1.00 0.00 ? 35  VAL A C    4  
ATOM 10657 O O    . VAL A 1 35  ? -21.594 -8.421  -25.472 1.00 0.00 ? 35  VAL A O    4  
ATOM 10658 C CB   . VAL A 1 35  ? -21.130 -11.150 -25.093 1.00 0.00 ? 35  VAL A CB   4  
ATOM 10659 C CG1  . VAL A 1 35  ? -19.634 -10.952 -25.287 1.00 0.00 ? 35  VAL A CG1  4  
ATOM 10660 C CG2  . VAL A 1 35  ? -21.452 -12.615 -24.836 1.00 0.00 ? 35  VAL A CG2  4  
ATOM 10661 H H    . VAL A 1 35  ? -23.705 -10.543 -24.365 1.00 0.00 ? 35  VAL A H    4  
ATOM 10662 H HA   . VAL A 1 35  ? -21.066 -10.491 -23.058 1.00 0.00 ? 35  VAL A HA   4  
ATOM 10663 H HB   . VAL A 1 35  ? -21.630 -10.848 -26.002 1.00 0.00 ? 35  VAL A HB   4  
ATOM 10664 H HG11 . VAL A 1 35  ? -19.465 -10.230 -26.073 1.00 0.00 ? 35  VAL A HG11 4  
ATOM 10665 H HG12 . VAL A 1 35  ? -19.178 -11.893 -25.559 1.00 0.00 ? 35  VAL A HG12 4  
ATOM 10666 H HG13 . VAL A 1 35  ? -19.196 -10.593 -24.368 1.00 0.00 ? 35  VAL A HG13 4  
ATOM 10667 H HG21 . VAL A 1 35  ? -22.232 -12.688 -24.093 1.00 0.00 ? 35  VAL A HG21 4  
ATOM 10668 H HG22 . VAL A 1 35  ? -20.567 -13.121 -24.479 1.00 0.00 ? 35  VAL A HG22 4  
ATOM 10669 H HG23 . VAL A 1 35  ? -21.785 -13.076 -25.754 1.00 0.00 ? 35  VAL A HG23 4  
ATOM 10670 N N    . PRO A 1 36  ? -21.093 -7.953  -23.327 1.00 0.00 ? 36  PRO A N    4  
ATOM 10671 C CA   . PRO A 1 36  ? -20.857 -6.527  -23.563 1.00 0.00 ? 36  PRO A CA   4  
ATOM 10672 C C    . PRO A 1 36  ? -19.563 -6.292  -24.334 1.00 0.00 ? 36  PRO A C    4  
ATOM 10673 O O    . PRO A 1 36  ? -18.667 -7.136  -24.326 1.00 0.00 ? 36  PRO A O    4  
ATOM 10674 C CB   . PRO A 1 36  ? -20.752 -5.946  -22.152 1.00 0.00 ? 36  PRO A CB   4  
ATOM 10675 C CG   . PRO A 1 36  ? -20.279 -7.081  -21.312 1.00 0.00 ? 36  PRO A CG   4  
ATOM 10676 C CD   . PRO A 1 36  ? -20.881 -8.322  -21.915 1.00 0.00 ? 36  PRO A CD   4  
ATOM 10677 H HA   . PRO A 1 36  ? -21.682 -6.068  -24.087 1.00 0.00 ? 36  PRO A HA   4  
ATOM 10678 H HB2  . PRO A 1 36  ? -20.046 -5.128  -22.148 1.00 0.00 ? 36  PRO A HB2  4  
ATOM 10679 H HB3  . PRO A 1 36  ? -21.722 -5.595  -21.830 1.00 0.00 ? 36  PRO A HB3  4  
ATOM 10680 H HG2  . PRO A 1 36  ? -19.201 -7.135  -21.341 1.00 0.00 ? 36  PRO A HG2  4  
ATOM 10681 H HG3  . PRO A 1 36  ? -20.622 -6.954  -20.296 1.00 0.00 ? 36  PRO A HG3  4  
ATOM 10682 H HD2  . PRO A 1 36  ? -20.195 -9.151  -21.833 1.00 0.00 ? 36  PRO A HD2  4  
ATOM 10683 H HD3  . PRO A 1 36  ? -21.819 -8.556  -21.435 1.00 0.00 ? 36  PRO A HD3  4  
ATOM 10684 N N    . THR A 1 37  ? -19.466 -5.148  -25.003 1.00 0.00 ? 37  THR A N    4  
ATOM 10685 C CA   . THR A 1 37  ? -18.272 -4.826  -25.777 1.00 0.00 ? 37  THR A CA   4  
ATOM 10686 C C    . THR A 1 37  ? -17.604 -3.551  -25.270 1.00 0.00 ? 37  THR A C    4  
ATOM 10687 O O    . THR A 1 37  ? -16.442 -3.573  -24.864 1.00 0.00 ? 37  THR A O    4  
ATOM 10688 C CB   . THR A 1 37  ? -18.610 -4.707  -27.268 1.00 0.00 ? 37  THR A CB   4  
ATOM 10689 O OG1  . THR A 1 37  ? -17.431 -4.574  -28.041 1.00 0.00 ? 37  THR A OG1  4  
ATOM 10690 C CG2  . THR A 1 37  ? -19.513 -3.541  -27.612 1.00 0.00 ? 37  THR A CG2  4  
ATOM 10691 H H    . THR A 1 37  ? -20.211 -4.513  -24.977 1.00 0.00 ? 37  THR A H    4  
ATOM 10692 H HA   . THR A 1 37  ? -17.576 -5.643  -25.649 1.00 0.00 ? 37  THR A HA   4  
ATOM 10693 H HB   . THR A 1 37  ? -19.113 -5.608  -27.576 1.00 0.00 ? 37  THR A HB   4  
ATOM 10694 H HG1  . THR A 1 37  ? -17.494 -5.129  -28.821 1.00 0.00 ? 37  THR A HG1  4  
ATOM 10695 H HG21 . THR A 1 37  ? -19.897 -3.668  -28.613 1.00 0.00 ? 37  THR A HG21 4  
ATOM 10696 H HG22 . THR A 1 37  ? -18.950 -2.621  -27.557 1.00 0.00 ? 37  THR A HG22 4  
ATOM 10697 H HG23 . THR A 1 37  ? -20.336 -3.504  -26.914 1.00 0.00 ? 37  THR A HG23 4  
ATOM 10698 N N    . HIS A 1 38  ? -18.336 -2.444  -25.289 1.00 0.00 ? 38  HIS A N    4  
ATOM 10699 C CA   . HIS A 1 38  ? -17.796 -1.173  -24.823 1.00 0.00 ? 38  HIS A CA   4  
ATOM 10700 C C    . HIS A 1 38  ? -18.065 -0.961  -23.340 1.00 0.00 ? 38  HIS A C    4  
ATOM 10701 O O    . HIS A 1 38  ? -19.104 -1.365  -22.817 1.00 0.00 ? 38  HIS A O    4  
ATOM 10702 C CB   . HIS A 1 38  ? -18.350 -0.013  -25.633 1.00 0.00 ? 38  HIS A CB   4  
ATOM 10703 C CG   . HIS A 1 38  ? -19.777 0.312   -25.342 1.00 0.00 ? 38  HIS A CG   4  
ATOM 10704 N ND1  . HIS A 1 38  ? -20.654 -0.576  -24.759 1.00 0.00 ? 38  HIS A ND1  4  
ATOM 10705 C CD2  . HIS A 1 38  ? -20.477 1.442   -25.564 1.00 0.00 ? 38  HIS A CD2  4  
ATOM 10706 C CE1  . HIS A 1 38  ? -21.837 -0.004  -24.639 1.00 0.00 ? 38  HIS A CE1  4  
ATOM 10707 N NE2  . HIS A 1 38  ? -21.757 1.223   -25.119 1.00 0.00 ? 38  HIS A NE2  4  
ATOM 10708 H H    . HIS A 1 38  ? -19.257 -2.484  -25.614 1.00 0.00 ? 38  HIS A H    4  
ATOM 10709 H HA   . HIS A 1 38  ? -16.734 -1.194  -24.973 1.00 0.00 ? 38  HIS A HA   4  
ATOM 10710 H HB2  . HIS A 1 38  ? -17.757 0.862   -25.425 1.00 0.00 ? 38  HIS A HB2  4  
ATOM 10711 H HB3  . HIS A 1 38  ? -18.266 -0.249  -26.677 1.00 0.00 ? 38  HIS A HB3  4  
ATOM 10712 H HD1  . HIS A 1 38  ? -20.442 -1.489  -24.474 1.00 0.00 ? 38  HIS A HD1  4  
ATOM 10713 H HD2  . HIS A 1 38  ? -20.095 2.347   -26.007 1.00 0.00 ? 38  HIS A HD2  4  
ATOM 10714 H HE1  . HIS A 1 38  ? -22.723 -0.464  -24.227 1.00 0.00 ? 38  HIS A HE1  4  
ATOM 10715 H HE2  . HIS A 1 38  ? -22.460 1.902   -25.053 1.00 0.00 ? 38  HIS A HE2  4  
ATOM 10716 N N    . TYR A 1 39  ? -17.118 -0.318  -22.677 1.00 0.00 ? 39  TYR A N    4  
ATOM 10717 C CA   . TYR A 1 39  ? -17.231 -0.033  -21.250 1.00 0.00 ? 39  TYR A CA   4  
ATOM 10718 C C    . TYR A 1 39  ? -16.926 1.431   -20.973 1.00 0.00 ? 39  TYR A C    4  
ATOM 10719 O O    . TYR A 1 39  ? -16.495 2.157   -21.866 1.00 0.00 ? 39  TYR A O    4  
ATOM 10720 C CB   . TYR A 1 39  ? -16.271 -0.913  -20.452 1.00 0.00 ? 39  TYR A CB   4  
ATOM 10721 C CG   . TYR A 1 39  ? -16.403 -2.386  -20.753 1.00 0.00 ? 39  TYR A CG   4  
ATOM 10722 C CD1  . TYR A 1 39  ? -17.451 -3.129  -20.236 1.00 0.00 ? 39  TYR A CD1  4  
ATOM 10723 C CD2  . TYR A 1 39  ? -15.470 -3.030  -21.547 1.00 0.00 ? 39  TYR A CD2  4  
ATOM 10724 C CE1  . TYR A 1 39  ? -17.565 -4.478  -20.502 1.00 0.00 ? 39  TYR A CE1  4  
ATOM 10725 C CE2  . TYR A 1 39  ? -15.571 -4.377  -21.822 1.00 0.00 ? 39  TYR A CE2  4  
ATOM 10726 C CZ   . TYR A 1 39  ? -16.620 -5.101  -21.295 1.00 0.00 ? 39  TYR A CZ   4  
ATOM 10727 O OH   . TYR A 1 39  ? -16.730 -6.446  -21.564 1.00 0.00 ? 39  TYR A OH   4  
ATOM 10728 H H    . TYR A 1 39  ? -16.321 -0.024  -23.163 1.00 0.00 ? 39  TYR A H    4  
ATOM 10729 H HA   . TYR A 1 39  ? -18.244 -0.245  -20.944 1.00 0.00 ? 39  TYR A HA   4  
ATOM 10730 H HB2  . TYR A 1 39  ? -15.255 -0.623  -20.668 1.00 0.00 ? 39  TYR A HB2  4  
ATOM 10731 H HB3  . TYR A 1 39  ? -16.455 -0.768  -19.404 1.00 0.00 ? 39  TYR A HB3  4  
ATOM 10732 H HD1  . TYR A 1 39  ? -18.184 -2.640  -19.616 1.00 0.00 ? 39  TYR A HD1  4  
ATOM 10733 H HD2  . TYR A 1 39  ? -14.658 -2.460  -21.961 1.00 0.00 ? 39  TYR A HD2  4  
ATOM 10734 H HE1  . TYR A 1 39  ? -18.390 -5.038  -20.090 1.00 0.00 ? 39  TYR A HE1  4  
ATOM 10735 H HE2  . TYR A 1 39  ? -14.822 -4.858  -22.439 1.00 0.00 ? 39  TYR A HE2  4  
ATOM 10736 H HH   . TYR A 1 39  ? -16.325 -6.949  -20.853 1.00 0.00 ? 39  TYR A HH   4  
ATOM 10737 N N    . THR A 1 40  ? -17.124 1.860   -19.730 1.00 0.00 ? 40  THR A N    4  
ATOM 10738 C CA   . THR A 1 40  ? -16.841 3.236   -19.351 1.00 0.00 ? 40  THR A CA   4  
ATOM 10739 C C    . THR A 1 40  ? -16.183 3.291   -17.988 1.00 0.00 ? 40  THR A C    4  
ATOM 10740 O O    . THR A 1 40  ? -16.851 3.279   -16.954 1.00 0.00 ? 40  THR A O    4  
ATOM 10741 C CB   . THR A 1 40  ? -18.107 4.086   -19.360 1.00 0.00 ? 40  THR A CB   4  
ATOM 10742 O OG1  . THR A 1 40  ? -18.519 4.359   -20.688 1.00 0.00 ? 40  THR A OG1  4  
ATOM 10743 C CG2  . THR A 1 40  ? -17.950 5.414   -18.644 1.00 0.00 ? 40  THR A CG2  4  
ATOM 10744 H H    . THR A 1 40  ? -17.445 1.243   -19.039 1.00 0.00 ? 40  THR A H    4  
ATOM 10745 H HA   . THR A 1 40  ? -16.155 3.636   -20.067 1.00 0.00 ? 40  THR A HA   4  
ATOM 10746 H HB   . THR A 1 40  ? -18.886 3.540   -18.871 1.00 0.00 ? 40  THR A HB   4  
ATOM 10747 H HG1  . THR A 1 40  ? -19.289 4.931   -20.674 1.00 0.00 ? 40  THR A HG1  4  
ATOM 10748 H HG21 . THR A 1 40  ? -17.632 5.242   -17.621 1.00 0.00 ? 40  THR A HG21 4  
ATOM 10749 H HG22 . THR A 1 40  ? -18.894 5.936   -18.643 1.00 0.00 ? 40  THR A HG22 4  
ATOM 10750 H HG23 . THR A 1 40  ? -17.208 6.012   -19.153 1.00 0.00 ? 40  THR A HG23 4  
ATOM 10751 N N    . LEU A 1 41  ? -14.868 3.368   -18.002 1.00 0.00 ? 41  LEU A N    4  
ATOM 10752 C CA   . LEU A 1 41  ? -14.099 3.448   -16.779 1.00 0.00 ? 41  LEU A CA   4  
ATOM 10753 C C    . LEU A 1 41  ? -14.324 4.797   -16.118 1.00 0.00 ? 41  LEU A C    4  
ATOM 10754 O O    . LEU A 1 41  ? -13.803 5.818   -16.579 1.00 0.00 ? 41  LEU A O    4  
ATOM 10755 C CB   . LEU A 1 41  ? -12.611 3.260   -17.079 1.00 0.00 ? 41  LEU A CB   4  
ATOM 10756 C CG   . LEU A 1 41  ? -11.753 2.800   -15.897 1.00 0.00 ? 41  LEU A CG   4  
ATOM 10757 C CD1  . LEU A 1 41  ? -11.629 3.911   -14.867 1.00 0.00 ? 41  LEU A CD1  4  
ATOM 10758 C CD2  . LEU A 1 41  ? -12.328 1.538   -15.262 1.00 0.00 ? 41  LEU A CD2  4  
ATOM 10759 H H    . LEU A 1 41  ? -14.402 3.386   -18.862 1.00 0.00 ? 41  LEU A H    4  
ATOM 10760 H HA   . LEU A 1 41  ? -14.433 2.665   -16.116 1.00 0.00 ? 41  LEU A HA   4  
ATOM 10761 H HB2  . LEU A 1 41  ? -12.514 2.536   -17.872 1.00 0.00 ? 41  LEU A HB2  4  
ATOM 10762 H HB3  . LEU A 1 41  ? -12.218 4.202   -17.430 1.00 0.00 ? 41  LEU A HB3  4  
ATOM 10763 H HG   . LEU A 1 41  ? -10.762 2.570   -16.257 1.00 0.00 ? 41  LEU A HG   4  
ATOM 10764 H HD11 . LEU A 1 41  ? -12.193 3.650   -13.985 1.00 0.00 ? 41  LEU A HD11 4  
ATOM 10765 H HD12 . LEU A 1 41  ? -12.013 4.832   -15.280 1.00 0.00 ? 41  LEU A HD12 4  
ATOM 10766 H HD13 . LEU A 1 41  ? -10.591 4.043   -14.605 1.00 0.00 ? 41  LEU A HD13 4  
ATOM 10767 H HD21 . LEU A 1 41  ? -11.531 0.963   -14.807 1.00 0.00 ? 41  LEU A HD21 4  
ATOM 10768 H HD22 . LEU A 1 41  ? -12.809 0.943   -16.020 1.00 0.00 ? 41  LEU A HD22 4  
ATOM 10769 H HD23 . LEU A 1 41  ? -13.049 1.811   -14.507 1.00 0.00 ? 41  LEU A HD23 4  
ATOM 10770 N N    . LEU A 1 42  ? -15.063 4.803   -15.018 1.00 0.00 ? 42  LEU A N    4  
ATOM 10771 C CA   . LEU A 1 42  ? -15.295 6.050   -14.288 1.00 0.00 ? 42  LEU A CA   4  
ATOM 10772 C C    . LEU A 1 42  ? -14.458 6.027   -13.025 1.00 0.00 ? 42  LEU A C    4  
ATOM 10773 O O    . LEU A 1 42  ? -14.354 4.984   -12.388 1.00 0.00 ? 42  LEU A O    4  
ATOM 10774 C CB   . LEU A 1 42  ? -16.762 6.232   -13.927 1.00 0.00 ? 42  LEU A CB   4  
ATOM 10775 C CG   . LEU A 1 42  ? -17.761 5.738   -14.971 1.00 0.00 ? 42  LEU A CG   4  
ATOM 10776 C CD1  . LEU A 1 42  ? -18.857 4.909   -14.321 1.00 0.00 ? 42  LEU A CD1  4  
ATOM 10777 C CD2  . LEU A 1 42  ? -18.359 6.917   -15.713 1.00 0.00 ? 42  LEU A CD2  4  
ATOM 10778 H H    . LEU A 1 42  ? -15.425 3.949   -14.656 1.00 0.00 ? 42  LEU A H    4  
ATOM 10779 H HA   . LEU A 1 42  ? -14.976 6.872   -14.917 1.00 0.00 ? 42  LEU A HA   4  
ATOM 10780 H HB2  . LEU A 1 42  ? -16.944 5.716   -12.999 1.00 0.00 ? 42  LEU A HB2  4  
ATOM 10781 H HB3  . LEU A 1 42  ? -16.936 7.283   -13.771 1.00 0.00 ? 42  LEU A HB3  4  
ATOM 10782 H HG   . LEU A 1 42  ? -17.245 5.120   -15.690 1.00 0.00 ? 42  LEU A HG   4  
ATOM 10783 H HD11 . LEU A 1 42  ? -18.607 3.861   -14.392 1.00 0.00 ? 42  LEU A HD11 4  
ATOM 10784 H HD12 . LEU A 1 42  ? -19.793 5.090   -14.829 1.00 0.00 ? 42  LEU A HD12 4  
ATOM 10785 H HD13 . LEU A 1 42  ? -18.952 5.187   -13.282 1.00 0.00 ? 42  LEU A HD13 4  
ATOM 10786 H HD21 . LEU A 1 42  ? -17.626 7.707   -15.772 1.00 0.00 ? 42  LEU A HD21 4  
ATOM 10787 H HD22 . LEU A 1 42  ? -19.230 7.272   -15.184 1.00 0.00 ? 42  LEU A HD22 4  
ATOM 10788 H HD23 . LEU A 1 42  ? -18.641 6.610   -16.707 1.00 0.00 ? 42  LEU A HD23 4  
ATOM 10789 N N    . TYR A 1 43  ? -13.819 7.142   -12.677 1.00 0.00 ? 43  TYR A N    4  
ATOM 10790 C CA   . TYR A 1 43  ? -12.955 7.143   -11.498 1.00 0.00 ? 43  TYR A CA   4  
ATOM 10791 C C    . TYR A 1 43  ? -12.965 8.454   -10.696 1.00 0.00 ? 43  TYR A C    4  
ATOM 10792 O O    . TYR A 1 43  ? -13.209 9.530   -11.239 1.00 0.00 ? 43  TYR A O    4  
ATOM 10793 C CB   . TYR A 1 43  ? -11.532 6.842   -11.945 1.00 0.00 ? 43  TYR A CB   4  
ATOM 10794 C CG   . TYR A 1 43  ? -10.795 8.045   -12.479 1.00 0.00 ? 43  TYR A CG   4  
ATOM 10795 C CD1  . TYR A 1 43  ? -10.310 8.993   -11.602 1.00 0.00 ? 43  TYR A CD1  4  
ATOM 10796 C CD2  . TYR A 1 43  ? -10.571 8.228   -13.837 1.00 0.00 ? 43  TYR A CD2  4  
ATOM 10797 C CE1  . TYR A 1 43  ? -9.621  10.095  -12.047 1.00 0.00 ? 43  TYR A CE1  4  
ATOM 10798 C CE2  . TYR A 1 43  ? -9.880  9.336   -14.298 1.00 0.00 ? 43  TYR A CE2  4  
ATOM 10799 C CZ   . TYR A 1 43  ? -9.407  10.267  -13.397 1.00 0.00 ? 43  TYR A CZ   4  
ATOM 10800 O OH   . TYR A 1 43  ? -8.716  11.368  -13.848 1.00 0.00 ? 43  TYR A OH   4  
ATOM 10801 H H    . TYR A 1 43  ? -13.893 7.944   -13.240 1.00 0.00 ? 43  TYR A H    4  
ATOM 10802 H HA   . TYR A 1 43  ? -13.276 6.338   -10.863 1.00 0.00 ? 43  TYR A HA   4  
ATOM 10803 H HB2  . TYR A 1 43  ? -10.974 6.462   -11.102 1.00 0.00 ? 43  TYR A HB2  4  
ATOM 10804 H HB3  . TYR A 1 43  ? -11.561 6.091   -12.716 1.00 0.00 ? 43  TYR A HB3  4  
ATOM 10805 H HD1  . TYR A 1 43  ? -10.483 8.858   -10.546 1.00 0.00 ? 43  TYR A HD1  4  
ATOM 10806 H HD2  . TYR A 1 43  ? -10.945 7.495   -14.537 1.00 0.00 ? 43  TYR A HD2  4  
ATOM 10807 H HE1  . TYR A 1 43  ? -9.250  10.813  -11.332 1.00 0.00 ? 43  TYR A HE1  4  
ATOM 10808 H HE2  . TYR A 1 43  ? -9.714  9.468   -15.356 1.00 0.00 ? 43  TYR A HE2  4  
ATOM 10809 H HH   . TYR A 1 43  ? -7.963  11.531  -13.276 1.00 0.00 ? 43  TYR A HH   4  
ATOM 10810 N N    . THR A 1 44  ? -12.643 8.338   -9.396  1.00 0.00 ? 44  THR A N    4  
ATOM 10811 C CA   . THR A 1 44  ? -12.555 9.488   -8.491  1.00 0.00 ? 44  THR A CA   4  
ATOM 10812 C C    . THR A 1 44  ? -11.679 9.159   -7.272  1.00 0.00 ? 44  THR A C    4  
ATOM 10813 O O    . THR A 1 44  ? -11.088 8.082   -7.189  1.00 0.00 ? 44  THR A O    4  
ATOM 10814 C CB   . THR A 1 44  ? -13.939 9.933   -8.020  1.00 0.00 ? 44  THR A CB   4  
ATOM 10815 O OG1  . THR A 1 44  ? -13.846 11.127  -7.266  1.00 0.00 ? 44  THR A OG1  4  
ATOM 10816 C CG2  . THR A 1 44  ? -14.645 8.908   -7.164  1.00 0.00 ? 44  THR A CG2  4  
ATOM 10817 H H    . THR A 1 44  ? -12.438 7.451   -9.040  1.00 0.00 ? 44  THR A H    4  
ATOM 10818 H HA   . THR A 1 44  ? -12.094 10.299  -9.036  1.00 0.00 ? 44  THR A HA   4  
ATOM 10819 H HB   . THR A 1 44  ? -14.554 10.128  -8.877  1.00 0.00 ? 44  THR A HB   4  
ATOM 10820 H HG1  . THR A 1 44  ? -14.686 11.591  -7.297  1.00 0.00 ? 44  THR A HG1  4  
ATOM 10821 H HG21 . THR A 1 44  ? -15.706 8.944   -7.362  1.00 0.00 ? 44  THR A HG21 4  
ATOM 10822 H HG22 . THR A 1 44  ? -14.465 9.128   -6.125  1.00 0.00 ? 44  THR A HG22 4  
ATOM 10823 H HG23 . THR A 1 44  ? -14.269 7.923   -7.397  1.00 0.00 ? 44  THR A HG23 4  
ATOM 10824 N N    . ILE A 1 45  ? -11.608 10.096  -6.328  1.00 0.00 ? 45  ILE A N    4  
ATOM 10825 C CA   . ILE A 1 45  ? -10.809 9.921   -5.103  1.00 0.00 ? 45  ILE A CA   4  
ATOM 10826 C C    . ILE A 1 45  ? -11.699 9.906   -3.860  1.00 0.00 ? 45  ILE A C    4  
ATOM 10827 O O    . ILE A 1 45  ? -12.593 10.734  -3.714  1.00 0.00 ? 45  ILE A O    4  
ATOM 10828 C CB   . ILE A 1 45  ? -9.741  11.027  -4.947  1.00 0.00 ? 45  ILE A CB   4  
ATOM 10829 C CG1  . ILE A 1 45  ? -10.097 12.256  -5.788  1.00 0.00 ? 45  ILE A CG1  4  
ATOM 10830 C CG2  . ILE A 1 45  ? -8.372  10.485  -5.339  1.00 0.00 ? 45  ILE A CG2  4  
ATOM 10831 C CD1  . ILE A 1 45  ? -9.131  13.408  -5.614  1.00 0.00 ? 45  ILE A CD1  4  
ATOM 10832 H H    . ILE A 1 45  ? -12.110 10.928  -6.454  1.00 0.00 ? 45  ILE A H    4  
ATOM 10833 H HA   . ILE A 1 45  ? -10.289 8.972   -5.164  1.00 0.00 ? 45  ILE A HA   4  
ATOM 10834 H HB   . ILE A 1 45  ? -9.700  11.312  -3.905  1.00 0.00 ? 45  ILE A HB   4  
ATOM 10835 H HG12 . ILE A 1 45  ? -10.100 11.982  -6.832  1.00 0.00 ? 45  ILE A HG12 4  
ATOM 10836 H HG13 . ILE A 1 45  ? -11.081 12.603  -5.509  1.00 0.00 ? 45  ILE A HG13 4  
ATOM 10837 H HG21 . ILE A 1 45  ? -8.211  9.527   -4.860  1.00 0.00 ? 45  ILE A HG21 4  
ATOM 10838 H HG22 . ILE A 1 45  ? -7.606  11.178  -5.024  1.00 0.00 ? 45  ILE A HG22 4  
ATOM 10839 H HG23 . ILE A 1 45  ? -8.328  10.363  -6.413  1.00 0.00 ? 45  ILE A HG23 4  
ATOM 10840 H HD11 . ILE A 1 45  ? -8.281  13.267  -6.266  1.00 0.00 ? 45  ILE A HD11 4  
ATOM 10841 H HD12 . ILE A 1 45  ? -8.795  13.444  -4.588  1.00 0.00 ? 45  ILE A HD12 4  
ATOM 10842 H HD13 . ILE A 1 45  ? -9.626  14.334  -5.863  1.00 0.00 ? 45  ILE A HD13 4  
ATOM 10843 N N    . MET A 1 46  ? -11.473 8.913   -3.003  1.00 0.00 ? 46  MET A N    4  
ATOM 10844 C CA   . MET A 1 46  ? -12.274 8.717   -1.787  1.00 0.00 ? 46  MET A CA   4  
ATOM 10845 C C    . MET A 1 46  ? -12.658 10.036  -1.108  1.00 0.00 ? 46  MET A C    4  
ATOM 10846 O O    . MET A 1 46  ? -13.818 10.224  -0.749  1.00 0.00 ? 46  MET A O    4  
ATOM 10847 C CB   . MET A 1 46  ? -11.524 7.819   -0.799  1.00 0.00 ? 46  MET A CB   4  
ATOM 10848 C CG   . MET A 1 46  ? -10.023 8.031   -0.801  1.00 0.00 ? 46  MET A CG   4  
ATOM 10849 S SD   . MET A 1 46  ? -9.272  7.719   0.809   1.00 0.00 ? 46  MET A SD   4  
ATOM 10850 C CE   . MET A 1 46  ? -10.050 6.168   1.252   1.00 0.00 ? 46  MET A CE   4  
ATOM 10851 H H    . MET A 1 46  ? -10.789 8.252   -3.241  1.00 0.00 ? 46  MET A H    4  
ATOM 10852 H HA   . MET A 1 46  ? -13.182 8.213   -2.080  1.00 0.00 ? 46  MET A HA   4  
ATOM 10853 H HB2  . MET A 1 46  ? -11.889 8.010   0.197   1.00 0.00 ? 46  MET A HB2  4  
ATOM 10854 H HB3  . MET A 1 46  ? -11.719 6.787   -1.051  1.00 0.00 ? 46  MET A HB3  4  
ATOM 10855 H HG2  . MET A 1 46  ? -9.586  7.362   -1.523  1.00 0.00 ? 46  MET A HG2  4  
ATOM 10856 H HG3  . MET A 1 46  ? -9.817  9.051   -1.089  1.00 0.00 ? 46  MET A HG3  4  
ATOM 10857 H HE1  . MET A 1 46  ? -9.290  5.439   1.488   1.00 0.00 ? 46  MET A HE1  4  
ATOM 10858 H HE2  . MET A 1 46  ? -10.644 5.813   0.422   1.00 0.00 ? 46  MET A HE2  4  
ATOM 10859 H HE3  . MET A 1 46  ? -10.686 6.317   2.112   1.00 0.00 ? 46  MET A HE3  4  
ATOM 10860 N N    . SER A 1 47  ? -11.700 10.937  -0.911  1.00 0.00 ? 47  SER A N    4  
ATOM 10861 C CA   . SER A 1 47  ? -11.988 12.216  -0.256  1.00 0.00 ? 47  SER A CA   4  
ATOM 10862 C C    . SER A 1 47  ? -12.951 13.072  -1.087  1.00 0.00 ? 47  SER A C    4  
ATOM 10863 O O    . SER A 1 47  ? -13.557 14.014  -0.578  1.00 0.00 ? 47  SER A O    4  
ATOM 10864 C CB   . SER A 1 47  ? -10.689 12.988  -0.013  1.00 0.00 ? 47  SER A CB   4  
ATOM 10865 O OG   . SER A 1 47  ? -10.024 13.263  -1.233  1.00 0.00 ? 47  SER A OG   4  
ATOM 10866 H H    . SER A 1 47  ? -10.780 10.740  -1.183  1.00 0.00 ? 47  SER A H    4  
ATOM 10867 H HA   . SER A 1 47  ? -12.449 12.002  0.696   1.00 0.00 ? 47  SER A HA   4  
ATOM 10868 H HB2  . SER A 1 47  ? -10.915 13.922  0.479   1.00 0.00 ? 47  SER A HB2  4  
ATOM 10869 H HB3  . SER A 1 47  ? -10.036 12.399  0.615   1.00 0.00 ? 47  SER A HB3  4  
ATOM 10870 H HG   . SER A 1 47  ? -9.321  13.899  -1.078  1.00 0.00 ? 47  SER A HG   4  
ATOM 10871 N N    . LYS A 1 48  ? -13.087 12.729  -2.363  1.00 0.00 ? 48  LYS A N    4  
ATOM 10872 C CA   . LYS A 1 48  ? -13.975 13.450  -3.270  1.00 0.00 ? 48  LYS A CA   4  
ATOM 10873 C C    . LYS A 1 48  ? -14.703 12.475  -4.194  1.00 0.00 ? 48  LYS A C    4  
ATOM 10874 O O    . LYS A 1 48  ? -14.501 12.489  -5.407  1.00 0.00 ? 48  LYS A O    4  
ATOM 10875 C CB   . LYS A 1 48  ? -13.186 14.467  -4.099  1.00 0.00 ? 48  LYS A CB   4  
ATOM 10876 C CG   . LYS A 1 48  ? -12.428 15.483  -3.258  1.00 0.00 ? 48  LYS A CG   4  
ATOM 10877 C CD   . LYS A 1 48  ? -10.935 15.448  -3.546  1.00 0.00 ? 48  LYS A CD   4  
ATOM 10878 C CE   . LYS A 1 48  ? -10.238 16.695  -3.023  1.00 0.00 ? 48  LYS A CE   4  
ATOM 10879 N NZ   . LYS A 1 48  ? -8.837  16.797  -3.516  1.00 0.00 ? 48  LYS A NZ   4  
ATOM 10880 H H    . LYS A 1 48  ? -12.578 11.965  -2.695  1.00 0.00 ? 48  LYS A H    4  
ATOM 10881 H HA   . LYS A 1 48  ? -14.706 13.974  -2.672  1.00 0.00 ? 48  LYS A HA   4  
ATOM 10882 H HB2  . LYS A 1 48  ? -12.476 13.937  -4.716  1.00 0.00 ? 48  LYS A HB2  4  
ATOM 10883 H HB3  . LYS A 1 48  ? -13.873 15.002  -4.739  1.00 0.00 ? 48  LYS A HB3  4  
ATOM 10884 H HG2  . LYS A 1 48  ? -12.804 16.471  -3.481  1.00 0.00 ? 48  LYS A HG2  4  
ATOM 10885 H HG3  . LYS A 1 48  ? -12.590 15.263  -2.213  1.00 0.00 ? 48  LYS A HG3  4  
ATOM 10886 H HD2  . LYS A 1 48  ? -10.506 14.581  -3.067  1.00 0.00 ? 48  LYS A HD2  4  
ATOM 10887 H HD3  . LYS A 1 48  ? -10.786 15.384  -4.614  1.00 0.00 ? 48  LYS A HD3  4  
ATOM 10888 H HE2  . LYS A 1 48  ? -10.790 17.564  -3.350  1.00 0.00 ? 48  LYS A HE2  4  
ATOM 10889 H HE3  . LYS A 1 48  ? -10.230 16.660  -1.944  1.00 0.00 ? 48  LYS A HE3  4  
ATOM 10890 H HZ1  . LYS A 1 48  ? -8.623  17.780  -3.783  1.00 0.00 ? 48  LYS A HZ1  4  
ATOM 10891 H HZ2  . LYS A 1 48  ? -8.703  16.188  -4.348  1.00 0.00 ? 48  LYS A HZ2  4  
ATOM 10892 H HZ3  . LYS A 1 48  ? -8.174  16.499  -2.772  1.00 0.00 ? 48  LYS A HZ3  4  
ATOM 10893 N N    . PRO A 1 49  ? -15.560 11.610  -3.626  1.00 0.00 ? 49  PRO A N    4  
ATOM 10894 C CA   . PRO A 1 49  ? -16.316 10.616  -4.397  1.00 0.00 ? 49  PRO A CA   4  
ATOM 10895 C C    . PRO A 1 49  ? -17.293 11.248  -5.374  1.00 0.00 ? 49  PRO A C    4  
ATOM 10896 O O    . PRO A 1 49  ? -17.779 10.599  -6.300  1.00 0.00 ? 49  PRO A O    4  
ATOM 10897 C CB   . PRO A 1 49  ? -17.071 9.813   -3.328  1.00 0.00 ? 49  PRO A CB   4  
ATOM 10898 C CG   . PRO A 1 49  ? -16.393 10.135  -2.038  1.00 0.00 ? 49  PRO A CG   4  
ATOM 10899 C CD   . PRO A 1 49  ? -15.855 11.528  -2.190  1.00 0.00 ? 49  PRO A CD   4  
ATOM 10900 H HA   . PRO A 1 49  ? -15.660 9.972   -4.936  1.00 0.00 ? 49  PRO A HA   4  
ATOM 10901 H HB2  . PRO A 1 49  ? -18.108 10.116  -3.313  1.00 0.00 ? 49  PRO A HB2  4  
ATOM 10902 H HB3  . PRO A 1 49  ? -17.004 8.759   -3.554  1.00 0.00 ? 49  PRO A HB3  4  
ATOM 10903 H HG2  . PRO A 1 49  ? -17.106 10.095  -1.228  1.00 0.00 ? 49  PRO A HG2  4  
ATOM 10904 H HG3  . PRO A 1 49  ? -15.586 9.439   -1.864  1.00 0.00 ? 49  PRO A HG3  4  
ATOM 10905 H HD2  . PRO A 1 49  ? -16.599 12.256  -1.909  1.00 0.00 ? 49  PRO A HD2  4  
ATOM 10906 H HD3  . PRO A 1 49  ? -14.961 11.658  -1.605  1.00 0.00 ? 49  PRO A HD3  4  
ATOM 10907 N N    . GLU A 1 50  ? -17.576 12.514  -5.152  1.00 0.00 ? 50  GLU A N    4  
ATOM 10908 C CA   . GLU A 1 50  ? -18.501 13.260  -5.996  1.00 0.00 ? 50  GLU A CA   4  
ATOM 10909 C C    . GLU A 1 50  ? -17.823 13.758  -7.270  1.00 0.00 ? 50  GLU A C    4  
ATOM 10910 O O    . GLU A 1 50  ? -18.457 14.404  -8.104  1.00 0.00 ? 50  GLU A O    4  
ATOM 10911 C CB   . GLU A 1 50  ? -19.068 14.447  -5.220  1.00 0.00 ? 50  GLU A CB   4  
ATOM 10912 C CG   . GLU A 1 50  ? -20.559 14.340  -4.940  1.00 0.00 ? 50  GLU A CG   4  
ATOM 10913 C CD   . GLU A 1 50  ? -21.380 15.305  -5.774  1.00 0.00 ? 50  GLU A CD   4  
ATOM 10914 O OE1  . GLU A 1 50  ? -21.291 15.238  -7.018  1.00 0.00 ? 50  GLU A OE1  4  
ATOM 10915 O OE2  . GLU A 1 50  ? -22.111 16.127  -5.182  1.00 0.00 ? 50  GLU A OE2  4  
ATOM 10916 H H    . GLU A 1 50  ? -17.156 12.958  -4.392  1.00 0.00 ? 50  GLU A H    4  
ATOM 10917 H HA   . GLU A 1 50  ? -19.311 12.600  -6.266  1.00 0.00 ? 50  GLU A HA   4  
ATOM 10918 H HB2  . GLU A 1 50  ? -18.550 14.521  -4.276  1.00 0.00 ? 50  GLU A HB2  4  
ATOM 10919 H HB3  . GLU A 1 50  ? -18.892 15.350  -5.786  1.00 0.00 ? 50  GLU A HB3  4  
ATOM 10920 H HG2  . GLU A 1 50  ? -20.881 13.333  -5.161  1.00 0.00 ? 50  GLU A HG2  4  
ATOM 10921 H HG3  . GLU A 1 50  ? -20.732 14.552  -3.895  1.00 0.00 ? 50  GLU A HG3  4  
ATOM 10922 N N    . ASP A 1 51  ? -16.533 13.471  -7.415  1.00 0.00 ? 51  ASP A N    4  
ATOM 10923 C CA   . ASP A 1 51  ? -15.784 13.909  -8.587  1.00 0.00 ? 51  ASP A CA   4  
ATOM 10924 C C    . ASP A 1 51  ? -15.333 12.726  -9.446  1.00 0.00 ? 51  ASP A C    4  
ATOM 10925 O O    . ASP A 1 51  ? -14.137 12.524  -9.657  1.00 0.00 ? 51  ASP A O    4  
ATOM 10926 C CB   . ASP A 1 51  ? -14.568 14.732  -8.152  1.00 0.00 ? 51  ASP A CB   4  
ATOM 10927 C CG   . ASP A 1 51  ? -14.297 15.901  -9.079  1.00 0.00 ? 51  ASP A CG   4  
ATOM 10928 O OD1  . ASP A 1 51  ? -15.270 16.473  -9.613  1.00 0.00 ? 51  ASP A OD1  4  
ATOM 10929 O OD2  . ASP A 1 51  ? -13.111 16.243  -9.272  1.00 0.00 ? 51  ASP A OD2  4  
ATOM 10930 H H    . ASP A 1 51  ? -16.069 12.962  -6.720  1.00 0.00 ? 51  ASP A H    4  
ATOM 10931 H HA   . ASP A 1 51  ? -16.434 14.536  -9.178  1.00 0.00 ? 51  ASP A HA   4  
ATOM 10932 H HB2  . ASP A 1 51  ? -14.739 15.117  -7.157  1.00 0.00 ? 51  ASP A HB2  4  
ATOM 10933 H HB3  . ASP A 1 51  ? -13.696 14.095  -8.140  1.00 0.00 ? 51  ASP A HB3  4  
ATOM 10934 N N    . LEU A 1 52  ? -16.292 11.956  -9.954  1.00 0.00 ? 52  LEU A N    4  
ATOM 10935 C CA   . LEU A 1 52  ? -15.976 10.811  -10.804 1.00 0.00 ? 52  LEU A CA   4  
ATOM 10936 C C    . LEU A 1 52  ? -15.930 11.233  -12.266 1.00 0.00 ? 52  LEU A C    4  
ATOM 10937 O O    . LEU A 1 52  ? -16.748 12.036  -12.714 1.00 0.00 ? 52  LEU A O    4  
ATOM 10938 C CB   . LEU A 1 52  ? -16.992 9.683   -10.600 1.00 0.00 ? 52  LEU A CB   4  
ATOM 10939 C CG   . LEU A 1 52  ? -16.432 8.426   -9.924  1.00 0.00 ? 52  LEU A CG   4  
ATOM 10940 C CD1  . LEU A 1 52  ? -17.400 7.906   -8.874  1.00 0.00 ? 52  LEU A CD1  4  
ATOM 10941 C CD2  . LEU A 1 52  ? -16.138 7.348   -10.958 1.00 0.00 ? 52  LEU A CD2  4  
ATOM 10942 H H    . LEU A 1 52  ? -17.230 12.169  -9.768  1.00 0.00 ? 52  LEU A H    4  
ATOM 10943 H HA   . LEU A 1 52  ? -14.999 10.456  -10.527 1.00 0.00 ? 52  LEU A HA   4  
ATOM 10944 H HB2  . LEU A 1 52  ? -17.802 10.064  -9.995  1.00 0.00 ? 52  LEU A HB2  4  
ATOM 10945 H HB3  . LEU A 1 52  ? -17.388 9.401   -11.564 1.00 0.00 ? 52  LEU A HB3  4  
ATOM 10946 H HG   . LEU A 1 52  ? -15.504 8.675   -9.428  1.00 0.00 ? 52  LEU A HG   4  
ATOM 10947 H HD11 . LEU A 1 52  ? -17.542 8.657   -8.111  1.00 0.00 ? 52  LEU A HD11 4  
ATOM 10948 H HD12 . LEU A 1 52  ? -16.996 7.010   -8.425  1.00 0.00 ? 52  LEU A HD12 4  
ATOM 10949 H HD13 . LEU A 1 52  ? -18.348 7.680   -9.338  1.00 0.00 ? 52  LEU A HD13 4  
ATOM 10950 H HD21 . LEU A 1 52  ? -15.282 6.768   -10.641 1.00 0.00 ? 52  LEU A HD21 4  
ATOM 10951 H HD22 . LEU A 1 52  ? -15.927 7.810   -11.911 1.00 0.00 ? 52  LEU A HD22 4  
ATOM 10952 H HD23 . LEU A 1 52  ? -16.995 6.699   -11.054 1.00 0.00 ? 52  LEU A HD23 4  
ATOM 10953 N N    . LYS A 1 53  ? -14.960 10.704  -13.004 1.00 0.00 ? 53  LYS A N    4  
ATOM 10954 C CA   . LYS A 1 53  ? -14.812 11.055  -14.409 1.00 0.00 ? 53  LYS A CA   4  
ATOM 10955 C C    . LYS A 1 53  ? -14.803 9.844   -15.316 1.00 0.00 ? 53  LYS A C    4  
ATOM 10956 O O    . LYS A 1 53  ? -13.953 8.963   -15.191 1.00 0.00 ? 53  LYS A O    4  
ATOM 10957 C CB   . LYS A 1 53  ? -13.508 11.825  -14.648 1.00 0.00 ? 53  LYS A CB   4  
ATOM 10958 C CG   . LYS A 1 53  ? -13.683 13.069  -15.503 1.00 0.00 ? 53  LYS A CG   4  
ATOM 10959 C CD   . LYS A 1 53  ? -12.797 14.207  -15.020 1.00 0.00 ? 53  LYS A CD   4  
ATOM 10960 C CE   . LYS A 1 53  ? -13.425 15.561  -15.308 1.00 0.00 ? 53  LYS A CE   4  
ATOM 10961 N NZ   . LYS A 1 53  ? -12.414 16.654  -15.309 1.00 0.00 ? 53  LYS A NZ   4  
ATOM 10962 H H    . LYS A 1 53  ? -14.326 10.079  -12.592 1.00 0.00 ? 53  LYS A H    4  
ATOM 10963 H HA   . LYS A 1 53  ? -15.643 11.683  -14.684 1.00 0.00 ? 53  LYS A HA   4  
ATOM 10964 H HB2  . LYS A 1 53  ? -13.089 12.115  -13.699 1.00 0.00 ? 53  LYS A HB2  4  
ATOM 10965 H HB3  . LYS A 1 53  ? -12.807 11.171  -15.155 1.00 0.00 ? 53  LYS A HB3  4  
ATOM 10966 H HG2  . LYS A 1 53  ? -13.418 12.828  -16.524 1.00 0.00 ? 53  LYS A HG2  4  
ATOM 10967 H HG3  . LYS A 1 53  ? -14.715 13.382  -15.460 1.00 0.00 ? 53  LYS A HG3  4  
ATOM 10968 H HD2  . LYS A 1 53  ? -12.650 14.109  -13.955 1.00 0.00 ? 53  LYS A HD2  4  
ATOM 10969 H HD3  . LYS A 1 53  ? -11.844 14.147  -15.524 1.00 0.00 ? 53  LYS A HD3  4  
ATOM 10970 H HE2  . LYS A 1 53  ? -13.903 15.524  -16.275 1.00 0.00 ? 53  LYS A HE2  4  
ATOM 10971 H HE3  . LYS A 1 53  ? -14.166 15.769  -14.549 1.00 0.00 ? 53  LYS A HE3  4  
ATOM 10972 H HZ1  . LYS A 1 53  ? -11.666 16.450  -14.616 1.00 0.00 ? 53  LYS A HZ1  4  
ATOM 10973 H HZ2  . LYS A 1 53  ? -12.864 17.558  -15.061 1.00 0.00 ? 53  LYS A HZ2  4  
ATOM 10974 H HZ3  . LYS A 1 53  ? -11.984 16.742  -16.252 1.00 0.00 ? 53  LYS A HZ3  4  
ATOM 10975 N N    . VAL A 1 54  ? -15.695 9.857   -16.289 1.00 0.00 ? 54  VAL A N    4  
ATOM 10976 C CA   . VAL A 1 54  ? -15.716 8.807   -17.281 1.00 0.00 ? 54  VAL A CA   4  
ATOM 10977 C C    . VAL A 1 54  ? -14.631 9.182   -18.277 1.00 0.00 ? 54  VAL A C    4  
ATOM 10978 O O    . VAL A 1 54  ? -14.842 9.999   -19.174 1.00 0.00 ? 54  VAL A O    4  
ATOM 10979 C CB   . VAL A 1 54  ? -17.109 8.642   -17.964 1.00 0.00 ? 54  VAL A CB   4  
ATOM 10980 C CG1  . VAL A 1 54  ? -18.160 9.522   -17.299 1.00 0.00 ? 54  VAL A CG1  4  
ATOM 10981 C CG2  . VAL A 1 54  ? -17.068 8.914   -19.465 1.00 0.00 ? 54  VAL A CG2  4  
ATOM 10982 H H    . VAL A 1 54  ? -16.299 10.623  -16.379 1.00 0.00 ? 54  VAL A H    4  
ATOM 10983 H HA   . VAL A 1 54  ? -15.449 7.875   -16.793 1.00 0.00 ? 54  VAL A HA   4  
ATOM 10984 H HB   . VAL A 1 54  ? -17.409 7.616   -17.826 1.00 0.00 ? 54  VAL A HB   4  
ATOM 10985 H HG11 . VAL A 1 54  ? -17.973 9.565   -16.235 1.00 0.00 ? 54  VAL A HG11 4  
ATOM 10986 H HG12 . VAL A 1 54  ? -19.141 9.107   -17.476 1.00 0.00 ? 54  VAL A HG12 4  
ATOM 10987 H HG13 . VAL A 1 54  ? -18.109 10.518  -17.714 1.00 0.00 ? 54  VAL A HG13 4  
ATOM 10988 H HG21 . VAL A 1 54  ? -17.978 8.551   -19.920 1.00 0.00 ? 54  VAL A HG21 4  
ATOM 10989 H HG22 . VAL A 1 54  ? -16.222 8.406   -19.901 1.00 0.00 ? 54  VAL A HG22 4  
ATOM 10990 H HG23 . VAL A 1 54  ? -16.980 9.976   -19.636 1.00 0.00 ? 54  VAL A HG23 4  
ATOM 10991 N N    . VAL A 1 55  ? -13.439 8.645   -18.071 1.00 0.00 ? 55  VAL A N    4  
ATOM 10992 C CA   . VAL A 1 55  ? -12.312 8.992   -18.918 1.00 0.00 ? 55  VAL A CA   4  
ATOM 10993 C C    . VAL A 1 55  ? -12.652 8.827   -20.396 1.00 0.00 ? 55  VAL A C    4  
ATOM 10994 O O    . VAL A 1 55  ? -13.072 7.755   -20.831 1.00 0.00 ? 55  VAL A O    4  
ATOM 10995 C CB   . VAL A 1 55  ? -11.070 8.154   -18.573 1.00 0.00 ? 55  VAL A CB   4  
ATOM 10996 C CG1  . VAL A 1 55  ? -9.845  8.689   -19.300 1.00 0.00 ? 55  VAL A CG1  4  
ATOM 10997 C CG2  . VAL A 1 55  ? -10.843 8.143   -17.067 1.00 0.00 ? 55  VAL A CG2  4  
ATOM 10998 H H    . VAL A 1 55  ? -13.300 8.030   -17.317 1.00 0.00 ? 55  VAL A H    4  
ATOM 10999 H HA   . VAL A 1 55  ? -12.078 10.034  -18.724 1.00 0.00 ? 55  VAL A HA   4  
ATOM 11000 H HB   . VAL A 1 55  ? -11.241 7.139   -18.898 1.00 0.00 ? 55  VAL A HB   4  
ATOM 11001 H HG11 . VAL A 1 55  ? -9.235  7.863   -19.634 1.00 0.00 ? 55  VAL A HG11 4  
ATOM 11002 H HG12 . VAL A 1 55  ? -9.272  9.312   -18.629 1.00 0.00 ? 55  VAL A HG12 4  
ATOM 11003 H HG13 . VAL A 1 55  ? -10.159 9.272   -20.153 1.00 0.00 ? 55  VAL A HG13 4  
ATOM 11004 H HG21 . VAL A 1 55  ? -11.271 7.246   -16.645 1.00 0.00 ? 55  VAL A HG21 4  
ATOM 11005 H HG22 . VAL A 1 55  ? -11.316 9.010   -16.624 1.00 0.00 ? 55  VAL A HG22 4  
ATOM 11006 H HG23 . VAL A 1 55  ? -9.783  8.167   -16.862 1.00 0.00 ? 55  VAL A HG23 4  
ATOM 11007 N N    . LYS A 1 56  ? -12.473 9.901   -21.161 1.00 0.00 ? 56  LYS A N    4  
ATOM 11008 C CA   . LYS A 1 56  ? -12.766 9.883   -22.592 1.00 0.00 ? 56  LYS A CA   4  
ATOM 11009 C C    . LYS A 1 56  ? -12.094 8.697   -23.276 1.00 0.00 ? 56  LYS A C    4  
ATOM 11010 O O    . LYS A 1 56  ? -12.656 8.097   -24.194 1.00 0.00 ? 56  LYS A O    4  
ATOM 11011 C CB   . LYS A 1 56  ? -12.303 11.188  -23.243 1.00 0.00 ? 56  LYS A CB   4  
ATOM 11012 C CG   . LYS A 1 56  ? -13.272 12.343  -23.047 1.00 0.00 ? 56  LYS A CG   4  
ATOM 11013 C CD   . LYS A 1 56  ? -13.194 12.903  -21.635 1.00 0.00 ? 56  LYS A CD   4  
ATOM 11014 C CE   . LYS A 1 56  ? -14.064 14.139  -21.477 1.00 0.00 ? 56  LYS A CE   4  
ATOM 11015 N NZ   . LYS A 1 56  ? -14.451 14.368  -20.057 1.00 0.00 ? 56  LYS A NZ   4  
ATOM 11016 H H    . LYS A 1 56  ? -12.140 10.727  -20.753 1.00 0.00 ? 56  LYS A H    4  
ATOM 11017 H HA   . LYS A 1 56  ? -13.835 9.793   -22.710 1.00 0.00 ? 56  LYS A HA   4  
ATOM 11018 H HB2  . LYS A 1 56  ? -11.350 11.470  -22.819 1.00 0.00 ? 56  LYS A HB2  4  
ATOM 11019 H HB3  . LYS A 1 56  ? -12.182 11.025  -24.303 1.00 0.00 ? 56  LYS A HB3  4  
ATOM 11020 H HG2  . LYS A 1 56  ? -13.028 13.128  -23.748 1.00 0.00 ? 56  LYS A HG2  4  
ATOM 11021 H HG3  . LYS A 1 56  ? -14.277 11.993  -23.231 1.00 0.00 ? 56  LYS A HG3  4  
ATOM 11022 H HD2  . LYS A 1 56  ? -13.529 12.147  -20.940 1.00 0.00 ? 56  LYS A HD2  4  
ATOM 11023 H HD3  . LYS A 1 56  ? -12.168 13.165  -21.419 1.00 0.00 ? 56  LYS A HD3  4  
ATOM 11024 H HE2  . LYS A 1 56  ? -13.517 14.998  -21.834 1.00 0.00 ? 56  LYS A HE2  4  
ATOM 11025 H HE3  . LYS A 1 56  ? -14.959 14.011  -22.069 1.00 0.00 ? 56  LYS A HE3  4  
ATOM 11026 H HZ1  . LYS A 1 56  ? -15.424 14.730  -20.006 1.00 0.00 ? 56  LYS A HZ1  4  
ATOM 11027 H HZ2  . LYS A 1 56  ? -13.811 15.062  -19.620 1.00 0.00 ? 56  LYS A HZ2  4  
ATOM 11028 H HZ3  . LYS A 1 56  ? -14.395 13.477  -19.523 1.00 0.00 ? 56  LYS A HZ3  4  
ATOM 11029 N N    . ASN A 1 57  ? -10.892 8.364   -22.824 1.00 0.00 ? 57  ASN A N    4  
ATOM 11030 C CA   . ASN A 1 57  ? -10.145 7.248   -23.391 1.00 0.00 ? 57  ASN A CA   4  
ATOM 11031 C C    . ASN A 1 57  ? -10.532 5.926   -22.731 1.00 0.00 ? 57  ASN A C    4  
ATOM 11032 O O    . ASN A 1 57  ? -9.952  4.883   -23.033 1.00 0.00 ? 57  ASN A O    4  
ATOM 11033 C CB   . ASN A 1 57  ? -8.642  7.485   -23.235 1.00 0.00 ? 57  ASN A CB   4  
ATOM 11034 C CG   . ASN A 1 57  ? -7.813  6.454   -23.976 1.00 0.00 ? 57  ASN A CG   4  
ATOM 11035 O OD1  . ASN A 1 57  ? -7.533  6.605   -25.165 1.00 0.00 ? 57  ASN A OD1  4  
ATOM 11036 N ND2  . ASN A 1 57  ? -7.416  5.399   -23.275 1.00 0.00 ? 57  ASN A ND2  4  
ATOM 11037 H H    . ASN A 1 57  ? -10.497 8.879   -22.090 1.00 0.00 ? 57  ASN A H    4  
ATOM 11038 H HA   . ASN A 1 57  ? -10.382 7.193   -24.443 1.00 0.00 ? 57  ASN A HA   4  
ATOM 11039 H HB2  . ASN A 1 57  ? -8.396  8.463   -23.621 1.00 0.00 ? 57  ASN A HB2  4  
ATOM 11040 H HB3  . ASN A 1 57  ? -8.385  7.442   -22.187 1.00 0.00 ? 57  ASN A HB3  4  
ATOM 11041 H HD21 . ASN A 1 57  ? -7.677  5.345   -22.332 1.00 0.00 ? 57  ASN A HD21 4  
ATOM 11042 H HD22 . ASN A 1 57  ? -6.879  4.717   -23.729 1.00 0.00 ? 57  ASN A HD22 4  
ATOM 11043 N N    . CYS A 1 58  ? -11.510 5.969   -21.827 1.00 0.00 ? 58  CYS A N    4  
ATOM 11044 C CA   . CYS A 1 58  ? -11.955 4.764   -21.136 1.00 0.00 ? 58  CYS A CA   4  
ATOM 11045 C C    . CYS A 1 58  ? -13.483 4.695   -21.043 1.00 0.00 ? 58  CYS A C    4  
ATOM 11046 O O    . CYS A 1 58  ? -14.027 3.817   -20.379 1.00 0.00 ? 58  CYS A O    4  
ATOM 11047 C CB   . CYS A 1 58  ? -11.319 4.682   -19.743 1.00 0.00 ? 58  CYS A CB   4  
ATOM 11048 S SG   . CYS A 1 58  ? -9.572  5.215   -19.696 1.00 0.00 ? 58  CYS A SG   4  
ATOM 11049 H H    . CYS A 1 58  ? -11.937 6.824   -21.621 1.00 0.00 ? 58  CYS A H    4  
ATOM 11050 H HA   . CYS A 1 58  ? -11.618 3.919   -21.720 1.00 0.00 ? 58  CYS A HA   4  
ATOM 11051 H HB2  . CYS A 1 58  ? -11.875 5.309   -19.063 1.00 0.00 ? 58  CYS A HB2  4  
ATOM 11052 H HB3  . CYS A 1 58  ? -11.361 3.660   -19.396 1.00 0.00 ? 58  CYS A HB3  4  
ATOM 11053 N N    . ALA A 1 59  ? -14.170 5.585   -21.764 1.00 0.00 ? 59  ALA A N    4  
ATOM 11054 C CA   . ALA A 1 59  ? -15.633 5.581   -21.812 1.00 0.00 ? 59  ALA A CA   4  
ATOM 11055 C C    . ALA A 1 59  ? -16.046 4.758   -23.016 1.00 0.00 ? 59  ALA A C    4  
ATOM 11056 O O    . ALA A 1 59  ? -15.239 4.593   -23.930 1.00 0.00 ? 59  ALA A O    4  
ATOM 11057 C CB   . ALA A 1 59  ? -16.178 6.996   -21.932 1.00 0.00 ? 59  ALA A CB   4  
ATOM 11058 H H    . ALA A 1 59  ? -13.686 6.228   -22.322 1.00 0.00 ? 59  ALA A H    4  
ATOM 11059 H HA   . ALA A 1 59  ? -16.023 5.129   -20.907 1.00 0.00 ? 59  ALA A HA   4  
ATOM 11060 H HB1  . ALA A 1 59  ? -15.387 7.705   -21.739 1.00 0.00 ? 59  ALA A HB1  4  
ATOM 11061 H HB2  . ALA A 1 59  ? -16.972 7.137   -21.215 1.00 0.00 ? 59  ALA A HB2  4  
ATOM 11062 H HB3  . ALA A 1 59  ? -16.564 7.150   -22.931 1.00 0.00 ? 59  ALA A HB3  4  
ATOM 11063 N N    . ASN A 1 60  ? -17.271 4.222   -23.030 1.00 0.00 ? 60  ASN A N    4  
ATOM 11064 C CA   . ASN A 1 60  ? -17.708 3.392   -24.162 1.00 0.00 ? 60  ASN A CA   4  
ATOM 11065 C C    . ASN A 1 60  ? -16.504 3.073   -25.023 1.00 0.00 ? 60  ASN A C    4  
ATOM 11066 O O    . ASN A 1 60  ? -16.280 3.661   -26.081 1.00 0.00 ? 60  ASN A O    4  
ATOM 11067 C CB   . ASN A 1 60  ? -18.756 4.151   -24.976 1.00 0.00 ? 60  ASN A CB   4  
ATOM 11068 C CG   . ASN A 1 60  ? -20.128 4.119   -24.332 1.00 0.00 ? 60  ASN A CG   4  
ATOM 11069 O OD1  . ASN A 1 60  ? -20.407 3.275   -23.480 1.00 0.00 ? 60  ASN A OD1  4  
ATOM 11070 N ND2  . ASN A 1 60  ? -20.993 5.041   -24.737 1.00 0.00 ? 60  ASN A ND2  4  
ATOM 11071 H H    . ASN A 1 60  ? -17.865 4.364   -22.263 1.00 0.00 ? 60  ASN A H    4  
ATOM 11072 H HA   . ASN A 1 60  ? -18.125 2.450   -23.800 1.00 0.00 ? 60  ASN A HA   4  
ATOM 11073 H HB2  . ASN A 1 60  ? -18.450 5.183   -25.067 1.00 0.00 ? 60  ASN A HB2  4  
ATOM 11074 H HB3  . ASN A 1 60  ? -18.825 3.716   -25.958 1.00 0.00 ? 60  ASN A HB3  4  
ATOM 11075 H HD21 . ASN A 1 60  ? -20.702 5.681   -25.419 1.00 0.00 ? 60  ASN A HD21 4  
ATOM 11076 H HD22 . ASN A 1 60  ? -21.888 5.044   -24.337 1.00 0.00 ? 60  ASN A HD22 4  
ATOM 11077 N N    . THR A 1 61  ? -15.737 2.121   -24.525 1.00 0.00 ? 61  THR A N    4  
ATOM 11078 C CA   . THR A 1 61  ? -14.542 1.654   -25.163 1.00 0.00 ? 61  THR A CA   4  
ATOM 11079 C C    . THR A 1 61  ? -14.677 0.166   -25.327 1.00 0.00 ? 61  THR A C    4  
ATOM 11080 O O    . THR A 1 61  ? -15.082 -0.522  -24.391 1.00 0.00 ? 61  THR A O    4  
ATOM 11081 C CB   . THR A 1 61  ? -13.325 1.976   -24.287 1.00 0.00 ? 61  THR A CB   4  
ATOM 11082 O OG1  . THR A 1 61  ? -12.123 1.556   -24.912 1.00 0.00 ? 61  THR A OG1  4  
ATOM 11083 C CG2  . THR A 1 61  ? -13.387 1.322   -22.915 1.00 0.00 ? 61  THR A CG2  4  
ATOM 11084 H H    . THR A 1 61  ? -15.992 1.699   -23.682 1.00 0.00 ? 61  THR A H    4  
ATOM 11085 H HA   . THR A 1 61  ? -14.444 2.126   -26.127 1.00 0.00 ? 61  THR A HA   4  
ATOM 11086 H HB   . THR A 1 61  ? -13.272 3.046   -24.136 1.00 0.00 ? 61  THR A HB   4  
ATOM 11087 H HG1  . THR A 1 61  ? -12.280 0.746   -25.402 1.00 0.00 ? 61  THR A HG1  4  
ATOM 11088 H HG21 . THR A 1 61  ? -14.406 1.023   -22.697 1.00 0.00 ? 61  THR A HG21 4  
ATOM 11089 H HG22 . THR A 1 61  ? -13.053 2.025   -22.166 1.00 0.00 ? 61  THR A HG22 4  
ATOM 11090 H HG23 . THR A 1 61  ? -12.748 0.452   -22.902 1.00 0.00 ? 61  THR A HG23 4  
ATOM 11091 N N    . THR A 1 62  ? -14.328 -0.348  -26.485 1.00 0.00 ? 62  THR A N    4  
ATOM 11092 C CA   . THR A 1 62  ? -14.430 -1.773  -26.685 1.00 0.00 ? 62  THR A CA   4  
ATOM 11093 C C    . THR A 1 62  ? -13.070 -2.389  -26.456 1.00 0.00 ? 62  THR A C    4  
ATOM 11094 O O    . THR A 1 62  ? -12.453 -3.030  -27.307 1.00 0.00 ? 62  THR A O    4  
ATOM 11095 C CB   . THR A 1 62  ? -15.028 -2.118  -28.035 1.00 0.00 ? 62  THR A CB   4  
ATOM 11096 O OG1  . THR A 1 62  ? -14.061 -2.644  -28.927 1.00 0.00 ? 62  THR A OG1  4  
ATOM 11097 C CG2  . THR A 1 62  ? -15.713 -0.951  -28.721 1.00 0.00 ? 62  THR A CG2  4  
ATOM 11098 H H    . THR A 1 62  ? -13.988 0.237   -27.194 1.00 0.00 ? 62  THR A H    4  
ATOM 11099 H HA   . THR A 1 62  ? -15.097 -2.144  -25.910 1.00 0.00 ? 62  THR A HA   4  
ATOM 11100 H HB   . THR A 1 62  ? -15.773 -2.867  -27.850 1.00 0.00 ? 62  THR A HB   4  
ATOM 11101 H HG1  . THR A 1 62  ? -14.169 -3.596  -28.992 1.00 0.00 ? 62  THR A HG1  4  
ATOM 11102 H HG21 . THR A 1 62  ? -16.198 -1.297  -29.622 1.00 0.00 ? 62  THR A HG21 4  
ATOM 11103 H HG22 . THR A 1 62  ? -14.978 -0.200  -28.974 1.00 0.00 ? 62  THR A HG22 4  
ATOM 11104 H HG23 . THR A 1 62  ? -16.451 -0.522  -28.057 1.00 0.00 ? 62  THR A HG23 4  
ATOM 11105 N N    . ARG A 1 63  ? -12.654 -2.142  -25.238 1.00 0.00 ? 63  ARG A N    4  
ATOM 11106 C CA   . ARG A 1 63  ? -11.396 -2.579  -24.672 1.00 0.00 ? 63  ARG A CA   4  
ATOM 11107 C C    . ARG A 1 63  ? -11.669 -2.912  -23.217 1.00 0.00 ? 63  ARG A C    4  
ATOM 11108 O O    . ARG A 1 63  ? -12.807 -2.775  -22.781 1.00 0.00 ? 63  ARG A O    4  
ATOM 11109 C CB   . ARG A 1 63  ? -10.375 -1.448  -24.769 1.00 0.00 ? 63  ARG A CB   4  
ATOM 11110 C CG   . ARG A 1 63  ? -9.507  -1.511  -26.016 1.00 0.00 ? 63  ARG A CG   4  
ATOM 11111 C CD   . ARG A 1 63  ? -8.432  -0.437  -26.002 1.00 0.00 ? 63  ARG A CD   4  
ATOM 11112 N NE   . ARG A 1 63  ? -7.529  -0.551  -27.146 1.00 0.00 ? 63  ARG A NE   4  
ATOM 11113 C CZ   . ARG A 1 63  ? -6.414  0.164   -27.284 1.00 0.00 ? 63  ARG A CZ   4  
ATOM 11114 N NH1  . ARG A 1 63  ? -6.062  1.042   -26.354 1.00 0.00 ? 63  ARG A NH1  4  
ATOM 11115 N NH2  . ARG A 1 63  ? -5.650  -0.001  -28.355 1.00 0.00 ? 63  ARG A NH2  4  
ATOM 11116 H H    . ARG A 1 63  ? -13.255 -1.625  -24.669 1.00 0.00 ? 63  ARG A H    4  
ATOM 11117 H HA   . ARG A 1 63  ? -11.047 -3.454  -25.200 1.00 0.00 ? 63  ARG A HA   4  
ATOM 11118 H HB2  . ARG A 1 63  ? -10.911 -0.504  -24.771 1.00 0.00 ? 63  ARG A HB2  4  
ATOM 11119 H HB3  . ARG A 1 63  ? -9.732  -1.483  -23.903 1.00 0.00 ? 63  ARG A HB3  4  
ATOM 11120 H HG2  . ARG A 1 63  ? -9.033  -2.480  -26.064 1.00 0.00 ? 63  ARG A HG2  4  
ATOM 11121 H HG3  . ARG A 1 63  ? -10.133 -1.371  -26.885 1.00 0.00 ? 63  ARG A HG3  4  
ATOM 11122 H HD2  . ARG A 1 63  ? -8.908  0.532   -26.027 1.00 0.00 ? 63  ARG A HD2  4  
ATOM 11123 H HD3  . ARG A 1 63  ? -7.858  -0.532  -25.092 1.00 0.00 ? 63  ARG A HD3  4  
ATOM 11124 H HE   . ARG A 1 63  ? -7.766  -1.192  -27.848 1.00 0.00 ? 63  ARG A HE   4  
ATOM 11125 H HH11 . ARG A 1 63  ? -6.634  1.172   -25.544 1.00 0.00 ? 63  ARG A HH11 4  
ATOM 11126 H HH12 . ARG A 1 63  ? -5.223  1.576   -26.463 1.00 0.00 ? 63  ARG A HH12 4  
ATOM 11127 H HH21 . ARG A 1 63  ? -5.911  -0.661  -29.059 1.00 0.00 ? 63  ARG A HH21 4  
ATOM 11128 H HH22 . ARG A 1 63  ? -4.812  0.536   -28.459 1.00 0.00 ? 63  ARG A HH22 4  
ATOM 11129 N N    . SER A 1 64  ? -10.672 -3.321  -22.443 1.00 0.00 ? 64  SER A N    4  
ATOM 11130 C CA   . SER A 1 64  ? -10.927 -3.611  -21.038 1.00 0.00 ? 64  SER A CA   4  
ATOM 11131 C C    . SER A 1 64  ? -10.135 -2.686  -20.112 1.00 0.00 ? 64  SER A C    4  
ATOM 11132 O O    . SER A 1 64  ? -10.708 -1.859  -19.412 1.00 0.00 ? 64  SER A O    4  
ATOM 11133 C CB   . SER A 1 64  ? -10.675 -5.077  -20.722 1.00 0.00 ? 64  SER A CB   4  
ATOM 11134 O OG   . SER A 1 64  ? -9.293  -5.347  -20.560 1.00 0.00 ? 64  SER A OG   4  
ATOM 11135 H H    . SER A 1 64  ? -9.758  -3.403  -22.789 1.00 0.00 ? 64  SER A H    4  
ATOM 11136 H HA   . SER A 1 64  ? -11.972 -3.413  -20.874 1.00 0.00 ? 64  SER A HA   4  
ATOM 11137 H HB2  . SER A 1 64  ? -11.197 -5.335  -19.814 1.00 0.00 ? 64  SER A HB2  4  
ATOM 11138 H HB3  . SER A 1 64  ? -11.061 -5.674  -21.528 1.00 0.00 ? 64  SER A HB3  4  
ATOM 11139 H HG   . SER A 1 64  ? -9.141  -5.730  -19.692 1.00 0.00 ? 64  SER A HG   4  
ATOM 11140 N N    . PHE A 1 65  ? -8.818  -2.827  -20.087 1.00 0.00 ? 65  PHE A N    4  
ATOM 11141 C CA   . PHE A 1 65  ? -8.006  -1.988  -19.215 1.00 0.00 ? 65  PHE A CA   4  
ATOM 11142 C C    . PHE A 1 65  ? -7.996  -0.539  -19.684 1.00 0.00 ? 65  PHE A C    4  
ATOM 11143 O O    . PHE A 1 65  ? -8.279  -0.239  -20.845 1.00 0.00 ? 65  PHE A O    4  
ATOM 11144 C CB   . PHE A 1 65  ? -6.581  -2.522  -19.119 1.00 0.00 ? 65  PHE A CB   4  
ATOM 11145 C CG   . PHE A 1 65  ? -5.929  -2.746  -20.452 1.00 0.00 ? 65  PHE A CG   4  
ATOM 11146 C CD1  . PHE A 1 65  ? -5.279  -1.710  -21.103 1.00 0.00 ? 65  PHE A CD1  4  
ATOM 11147 C CD2  . PHE A 1 65  ? -5.966  -3.993  -21.054 1.00 0.00 ? 65  PHE A CD2  4  
ATOM 11148 C CE1  . PHE A 1 65  ? -4.677  -1.914  -22.330 1.00 0.00 ? 65  PHE A CE1  4  
ATOM 11149 C CE2  . PHE A 1 65  ? -5.366  -4.203  -22.281 1.00 0.00 ? 65  PHE A CE2  4  
ATOM 11150 C CZ   . PHE A 1 65  ? -4.721  -3.162  -22.920 1.00 0.00 ? 65  PHE A CZ   4  
ATOM 11151 H H    . PHE A 1 65  ? -8.385  -3.510  -20.641 1.00 0.00 ? 65  PHE A H    4  
ATOM 11152 H HA   . PHE A 1 65  ? -8.443  -2.018  -18.233 1.00 0.00 ? 65  PHE A HA   4  
ATOM 11153 H HB2  . PHE A 1 65  ? -5.982  -1.815  -18.566 1.00 0.00 ? 65  PHE A HB2  4  
ATOM 11154 H HB3  . PHE A 1 65  ? -6.597  -3.462  -18.588 1.00 0.00 ? 65  PHE A HB3  4  
ATOM 11155 H HD1  . PHE A 1 65  ? -5.244  -0.734  -20.642 1.00 0.00 ? 65  PHE A HD1  4  
ATOM 11156 H HD2  . PHE A 1 65  ? -6.471  -4.807  -20.556 1.00 0.00 ? 65  PHE A HD2  4  
ATOM 11157 H HE1  . PHE A 1 65  ? -4.174  -1.098  -22.827 1.00 0.00 ? 65  PHE A HE1  4  
ATOM 11158 H HE2  . PHE A 1 65  ? -5.402  -5.180  -22.740 1.00 0.00 ? 65  PHE A HE2  4  
ATOM 11159 H HZ   . PHE A 1 65  ? -4.252  -3.323  -23.879 1.00 0.00 ? 65  PHE A HZ   4  
ATOM 11160 N N    . CYS A 1 66  ? -7.659  0.348   -18.760 1.00 0.00 ? 66  CYS A N    4  
ATOM 11161 C CA   . CYS A 1 66  ? -7.590  1.777   -19.030 1.00 0.00 ? 66  CYS A CA   4  
ATOM 11162 C C    . CYS A 1 66  ? -6.373  2.354   -18.308 1.00 0.00 ? 66  CYS A C    4  
ATOM 11163 O O    . CYS A 1 66  ? -6.027  1.908   -17.213 1.00 0.00 ? 66  CYS A O    4  
ATOM 11164 C CB   . CYS A 1 66  ? -8.905  2.455   -18.600 1.00 0.00 ? 66  CYS A CB   4  
ATOM 11165 S SG   . CYS A 1 66  ? -8.766  4.211   -18.124 1.00 0.00 ? 66  CYS A SG   4  
ATOM 11166 H H    . CYS A 1 66  ? -7.432  0.026   -17.863 1.00 0.00 ? 66  CYS A H    4  
ATOM 11167 H HA   . CYS A 1 66  ? -7.455  1.905   -20.095 1.00 0.00 ? 66  CYS A HA   4  
ATOM 11168 H HB2  . CYS A 1 66  ? -9.603  2.402   -19.422 1.00 0.00 ? 66  CYS A HB2  4  
ATOM 11169 H HB3  . CYS A 1 66  ? -9.318  1.916   -17.760 1.00 0.00 ? 66  CYS A HB3  4  
ATOM 11170 N N    . ASP A 1 67  ? -5.706  3.320   -18.931 1.00 0.00 ? 67  ASP A N    4  
ATOM 11171 C CA   . ASP A 1 67  ? -4.508  3.905   -18.337 1.00 0.00 ? 67  ASP A CA   4  
ATOM 11172 C C    . ASP A 1 67  ? -4.787  5.225   -17.628 1.00 0.00 ? 67  ASP A C    4  
ATOM 11173 O O    . ASP A 1 67  ? -5.837  5.841   -17.808 1.00 0.00 ? 67  ASP A O    4  
ATOM 11174 C CB   . ASP A 1 67  ? -3.428  4.103   -19.395 1.00 0.00 ? 67  ASP A CB   4  
ATOM 11175 C CG   . ASP A 1 67  ? -3.812  5.134   -20.439 1.00 0.00 ? 67  ASP A CG   4  
ATOM 11176 O OD1  . ASP A 1 67  ? -4.092  6.290   -20.058 1.00 0.00 ? 67  ASP A OD1  4  
ATOM 11177 O OD2  . ASP A 1 67  ? -3.834  4.784   -21.638 1.00 0.00 ? 67  ASP A OD2  4  
ATOM 11178 H H    . ASP A 1 67  ? -6.015  3.630   -19.807 1.00 0.00 ? 67  ASP A H    4  
ATOM 11179 H HA   . ASP A 1 67  ? -4.137  3.201   -17.606 1.00 0.00 ? 67  ASP A HA   4  
ATOM 11180 H HB2  . ASP A 1 67  ? -2.521  4.429   -18.908 1.00 0.00 ? 67  ASP A HB2  4  
ATOM 11181 H HB3  . ASP A 1 67  ? -3.246  3.162   -19.890 1.00 0.00 ? 67  ASP A HB3  4  
ATOM 11182 N N    . LEU A 1 68  ? -3.822  5.635   -16.811 1.00 0.00 ? 68  LEU A N    4  
ATOM 11183 C CA   . LEU A 1 68  ? -3.913  6.869   -16.040 1.00 0.00 ? 68  LEU A CA   4  
ATOM 11184 C C    . LEU A 1 68  ? -2.574  7.186   -15.376 1.00 0.00 ? 68  LEU A C    4  
ATOM 11185 O O    . LEU A 1 68  ? -2.334  6.812   -14.230 1.00 0.00 ? 68  LEU A O    4  
ATOM 11186 C CB   . LEU A 1 68  ? -4.989  6.733   -14.965 1.00 0.00 ? 68  LEU A CB   4  
ATOM 11187 C CG   . LEU A 1 68  ? -4.998  5.381   -14.254 1.00 0.00 ? 68  LEU A CG   4  
ATOM 11188 C CD1  . LEU A 1 68  ? -5.456  5.521   -12.812 1.00 0.00 ? 68  LEU A CD1  4  
ATOM 11189 C CD2  . LEU A 1 68  ? -5.874  4.400   -15.004 1.00 0.00 ? 68  LEU A CD2  4  
ATOM 11190 H H    . LEU A 1 68  ? -3.019  5.084   -16.723 1.00 0.00 ? 68  LEU A H    4  
ATOM 11191 H HA   . LEU A 1 68  ? -4.177  7.671   -16.712 1.00 0.00 ? 68  LEU A HA   4  
ATOM 11192 H HB2  . LEU A 1 68  ? -4.836  7.508   -14.228 1.00 0.00 ? 68  LEU A HB2  4  
ATOM 11193 H HB3  . LEU A 1 68  ? -5.954  6.880   -15.426 1.00 0.00 ? 68  LEU A HB3  4  
ATOM 11194 H HG   . LEU A 1 68  ? -3.997  4.985   -14.246 1.00 0.00 ? 68  LEU A HG   4  
ATOM 11195 H HD11 . LEU A 1 68  ? -4.723  6.084   -12.254 1.00 0.00 ? 68  LEU A HD11 4  
ATOM 11196 H HD12 . LEU A 1 68  ? -5.564  4.540   -12.371 1.00 0.00 ? 68  LEU A HD12 4  
ATOM 11197 H HD13 . LEU A 1 68  ? -6.404  6.035   -12.781 1.00 0.00 ? 68  LEU A HD13 4  
ATOM 11198 H HD21 . LEU A 1 68  ? -6.537  4.936   -15.665 1.00 0.00 ? 68  LEU A HD21 4  
ATOM 11199 H HD22 . LEU A 1 68  ? -6.453  3.827   -14.297 1.00 0.00 ? 68  LEU A HD22 4  
ATOM 11200 H HD23 . LEU A 1 68  ? -5.247  3.733   -15.584 1.00 0.00 ? 68  LEU A HD23 4  
ATOM 11201 N N    . THR A 1 69  ? -1.695  7.873   -16.082 1.00 0.00 ? 69  THR A N    4  
ATOM 11202 C CA   . THR A 1 69  ? -0.405  8.216   -15.506 1.00 0.00 ? 69  THR A CA   4  
ATOM 11203 C C    . THR A 1 69  ? -0.520  9.504   -14.702 1.00 0.00 ? 69  THR A C    4  
ATOM 11204 O O    . THR A 1 69  ? -0.100  9.571   -13.547 1.00 0.00 ? 69  THR A O    4  
ATOM 11205 C CB   . THR A 1 69  ? 0.656   8.363   -16.598 1.00 0.00 ? 69  THR A CB   4  
ATOM 11206 O OG1  . THR A 1 69  ? 0.773   7.168   -17.348 1.00 0.00 ? 69  THR A OG1  4  
ATOM 11207 C CG2  . THR A 1 69  ? 2.028   8.704   -16.058 1.00 0.00 ? 69  THR A CG2  4  
ATOM 11208 H H    . THR A 1 69  ? -1.916  8.158   -16.993 1.00 0.00 ? 69  THR A H    4  
ATOM 11209 H HA   . THR A 1 69  ? -0.127  7.411   -14.833 1.00 0.00 ? 69  THR A HA   4  
ATOM 11210 H HB   . THR A 1 69  ? 0.359   9.156   -17.269 1.00 0.00 ? 69  THR A HB   4  
ATOM 11211 H HG1  . THR A 1 69  ? -0.062  6.981   -17.784 1.00 0.00 ? 69  THR A HG1  4  
ATOM 11212 H HG21 . THR A 1 69  ? 2.262   8.049   -15.232 1.00 0.00 ? 69  THR A HG21 4  
ATOM 11213 H HG22 . THR A 1 69  ? 2.037   9.729   -15.719 1.00 0.00 ? 69  THR A HG22 4  
ATOM 11214 H HG23 . THR A 1 69  ? 2.763   8.576   -16.838 1.00 0.00 ? 69  THR A HG23 4  
ATOM 11215 N N    . ASP A 1 70  ? -1.111  10.519  -15.321 1.00 0.00 ? 70  ASP A N    4  
ATOM 11216 C CA   . ASP A 1 70  ? -1.311  11.805  -14.669 1.00 0.00 ? 70  ASP A CA   4  
ATOM 11217 C C    . ASP A 1 70  ? -2.787  12.005  -14.328 1.00 0.00 ? 70  ASP A C    4  
ATOM 11218 O O    . ASP A 1 70  ? -3.195  13.087  -13.904 1.00 0.00 ? 70  ASP A O    4  
ATOM 11219 C CB   . ASP A 1 70  ? -0.823  12.941  -15.570 1.00 0.00 ? 70  ASP A CB   4  
ATOM 11220 C CG   . ASP A 1 70  ? 0.665   12.859  -15.849 1.00 0.00 ? 70  ASP A CG   4  
ATOM 11221 O OD1  . ASP A 1 70  ? 1.094   11.882  -16.498 1.00 0.00 ? 70  ASP A OD1  4  
ATOM 11222 O OD2  . ASP A 1 70  ? 1.401   13.772  -15.419 1.00 0.00 ? 70  ASP A OD2  4  
ATOM 11223 H H    . ASP A 1 70  ? -1.437  10.394  -16.237 1.00 0.00 ? 70  ASP A H    4  
ATOM 11224 H HA   . ASP A 1 70  ? -0.737  11.808  -13.754 1.00 0.00 ? 70  ASP A HA   4  
ATOM 11225 H HB2  . ASP A 1 70  ? -1.349  12.897  -16.512 1.00 0.00 ? 70  ASP A HB2  4  
ATOM 11226 H HB3  . ASP A 1 70  ? -1.029  13.887  -15.090 1.00 0.00 ? 70  ASP A HB3  4  
ATOM 11227 N N    . GLU A 1 71  ? -3.584  10.953  -14.518 1.00 0.00 ? 71  GLU A N    4  
ATOM 11228 C CA   . GLU A 1 71  ? -5.011  11.009  -14.233 1.00 0.00 ? 71  GLU A CA   4  
ATOM 11229 C C    . GLU A 1 71  ? -5.287  10.710  -12.763 1.00 0.00 ? 71  GLU A C    4  
ATOM 11230 O O    . GLU A 1 71  ? -6.325  11.102  -12.229 1.00 0.00 ? 71  GLU A O    4  
ATOM 11231 C CB   . GLU A 1 71  ? -5.769  10.018  -15.119 1.00 0.00 ? 71  GLU A CB   4  
ATOM 11232 C CG   . GLU A 1 71  ? -6.257  10.620  -16.427 1.00 0.00 ? 71  GLU A CG   4  
ATOM 11233 C CD   . GLU A 1 71  ? -7.297  11.703  -16.218 1.00 0.00 ? 71  GLU A CD   4  
ATOM 11234 O OE1  . GLU A 1 71  ? -6.914  12.830  -15.839 1.00 0.00 ? 71  GLU A OE1  4  
ATOM 11235 O OE2  . GLU A 1 71  ? -8.496  11.425  -16.435 1.00 0.00 ? 71  GLU A OE2  4  
ATOM 11236 H H    . GLU A 1 71  ? -3.201  10.118  -14.858 1.00 0.00 ? 71  GLU A H    4  
ATOM 11237 H HA   . GLU A 1 71  ? -5.353  12.009  -14.454 1.00 0.00 ? 71  GLU A HA   4  
ATOM 11238 H HB2  . GLU A 1 71  ? -5.116  9.189   -15.351 1.00 0.00 ? 71  GLU A HB2  4  
ATOM 11239 H HB3  . GLU A 1 71  ? -6.626  9.648   -14.575 1.00 0.00 ? 71  GLU A HB3  4  
ATOM 11240 H HG2  . GLU A 1 71  ? -5.414  11.048  -16.948 1.00 0.00 ? 71  GLU A HG2  4  
ATOM 11241 H HG3  . GLU A 1 71  ? -6.692  9.835   -17.029 1.00 0.00 ? 71  GLU A HG3  4  
ATOM 11242 N N    . TRP A 1 72  ? -4.346  10.036  -12.103 1.00 0.00 ? 72  TRP A N    4  
ATOM 11243 C CA   . TRP A 1 72  ? -4.484  9.711   -10.689 1.00 0.00 ? 72  TRP A CA   4  
ATOM 11244 C C    . TRP A 1 72  ? -3.315  10.308  -9.909  1.00 0.00 ? 72  TRP A C    4  
ATOM 11245 O O    . TRP A 1 72  ? -2.444  9.586   -9.423  1.00 0.00 ? 72  TRP A O    4  
ATOM 11246 C CB   . TRP A 1 72  ? -4.538  8.192   -10.475 1.00 0.00 ? 72  TRP A CB   4  
ATOM 11247 C CG   . TRP A 1 72  ? -5.894  7.580   -10.710 1.00 0.00 ? 72  TRP A CG   4  
ATOM 11248 C CD1  . TRP A 1 72  ? -6.907  8.073   -11.487 1.00 0.00 ? 72  TRP A CD1  4  
ATOM 11249 C CD2  . TRP A 1 72  ? -6.380  6.345   -10.165 1.00 0.00 ? 72  TRP A CD2  4  
ATOM 11250 N NE1  . TRP A 1 72  ? -7.983  7.214   -11.457 1.00 0.00 ? 72  TRP A NE1  4  
ATOM 11251 C CE2  . TRP A 1 72  ? -7.683  6.156   -10.656 1.00 0.00 ? 72  TRP A CE2  4  
ATOM 11252 C CE3  . TRP A 1 72  ? -5.843  5.381   -9.313  1.00 0.00 ? 72  TRP A CE3  4  
ATOM 11253 C CZ2  . TRP A 1 72  ? -8.451  5.050   -10.329 1.00 0.00 ? 72  TRP A CZ2  4  
ATOM 11254 C CZ3  . TRP A 1 72  ? -6.612  4.277   -8.985  1.00 0.00 ? 72  TRP A CZ3  4  
ATOM 11255 C CH2  . TRP A 1 72  ? -7.906  4.122   -9.498  1.00 0.00 ? 72  TRP A CH2  4  
ATOM 11256 H H    . TRP A 1 72  ? -3.523  9.768   -12.562 1.00 0.00 ? 72  TRP A H    4  
ATOM 11257 H HA   . TRP A 1 72  ? -5.399  10.149  -10.333 1.00 0.00 ? 72  TRP A HA   4  
ATOM 11258 H HB2  . TRP A 1 72  ? -3.840  7.718   -11.148 1.00 0.00 ? 72  TRP A HB2  4  
ATOM 11259 H HB3  . TRP A 1 72  ? -4.247  7.973   -9.457  1.00 0.00 ? 72  TRP A HB3  4  
ATOM 11260 H HD1  . TRP A 1 72  ? -6.856  8.997   -12.040 1.00 0.00 ? 72  TRP A HD1  4  
ATOM 11261 H HE1  . TRP A 1 72  ? -8.831  7.336   -11.931 1.00 0.00 ? 72  TRP A HE1  4  
ATOM 11262 H HE3  . TRP A 1 72  ? -4.849  5.486   -8.911  1.00 0.00 ? 72  TRP A HE3  4  
ATOM 11263 H HZ2  . TRP A 1 72  ? -9.446  4.917   -10.713 1.00 0.00 ? 72  TRP A HZ2  4  
ATOM 11264 H HZ3  . TRP A 1 72  ? -6.213  3.520   -8.327  1.00 0.00 ? 72  TRP A HZ3  4  
ATOM 11265 H HH2  . TRP A 1 72  ? -8.477  3.249   -9.222  1.00 0.00 ? 72  TRP A HH2  4  
ATOM 11266 N N    . ARG A 1 73  ? -3.296  11.637  -9.809  1.00 0.00 ? 73  ARG A N    4  
ATOM 11267 C CA   . ARG A 1 73  ? -2.226  12.344  -9.106  1.00 0.00 ? 73  ARG A CA   4  
ATOM 11268 C C    . ARG A 1 73  ? -2.442  12.351  -7.592  1.00 0.00 ? 73  ARG A C    4  
ATOM 11269 O O    . ARG A 1 73  ? -1.783  13.099  -6.869  1.00 0.00 ? 73  ARG A O    4  
ATOM 11270 C CB   . ARG A 1 73  ? -2.114  13.780  -9.621  1.00 0.00 ? 73  ARG A CB   4  
ATOM 11271 C CG   . ARG A 1 73  ? -3.359  14.617  -9.373  1.00 0.00 ? 73  ARG A CG   4  
ATOM 11272 C CD   . ARG A 1 73  ? -3.378  15.861  -10.247 1.00 0.00 ? 73  ARG A CD   4  
ATOM 11273 N NE   . ARG A 1 73  ? -4.310  15.731  -11.364 1.00 0.00 ? 73  ARG A NE   4  
ATOM 11274 C CZ   . ARG A 1 73  ? -5.622  15.938  -11.266 1.00 0.00 ? 73  ARG A CZ   4  
ATOM 11275 N NH1  . ARG A 1 73  ? -6.162  16.282  -10.103 1.00 0.00 ? 73  ARG A NH1  4  
ATOM 11276 N NH2  . ARG A 1 73  ? -6.395  15.801  -12.334 1.00 0.00 ? 73  ARG A NH2  4  
ATOM 11277 H H    . ARG A 1 73  ? -4.013  12.156  -10.229 1.00 0.00 ? 73  ARG A H    4  
ATOM 11278 H HA   . ARG A 1 73  ? -1.301  11.828  -9.317  1.00 0.00 ? 73  ARG A HA   4  
ATOM 11279 H HB2  . ARG A 1 73  ? -1.280  14.261  -9.133  1.00 0.00 ? 73  ARG A HB2  4  
ATOM 11280 H HB3  . ARG A 1 73  ? -1.931  13.754  -10.685 1.00 0.00 ? 73  ARG A HB3  4  
ATOM 11281 H HG2  . ARG A 1 73  ? -4.232  14.021  -9.593  1.00 0.00 ? 73  ARG A HG2  4  
ATOM 11282 H HG3  . ARG A 1 73  ? -3.378  14.916  -8.335  1.00 0.00 ? 73  ARG A HG3  4  
ATOM 11283 H HD2  . ARG A 1 73  ? -3.673  16.706  -9.642  1.00 0.00 ? 73  ARG A HD2  4  
ATOM 11284 H HD3  . ARG A 1 73  ? -2.385  16.028  -10.636 1.00 0.00 ? 73  ARG A HD3  4  
ATOM 11285 H HE   . ARG A 1 73  ? -3.939  15.477  -12.235 1.00 0.00 ? 73  ARG A HE   4  
ATOM 11286 H HH11 . ARG A 1 73  ? -5.585  16.386  -9.293  1.00 0.00 ? 73  ARG A HH11 4  
ATOM 11287 H HH12 . ARG A 1 73  ? -7.148  16.436  -10.036 1.00 0.00 ? 73  ARG A HH12 4  
ATOM 11288 H HH21 . ARG A 1 73  ? -5.994  15.542  -13.212 1.00 0.00 ? 73  ARG A HH21 4  
ATOM 11289 H HH22 . ARG A 1 73  ? -7.381  15.956  -12.261 1.00 0.00 ? 73  ARG A HH22 4  
ATOM 11290 N N    . SER A 1 74  ? -3.351  11.509  -7.115  1.00 0.00 ? 74  SER A N    4  
ATOM 11291 C CA   . SER A 1 74  ? -3.632  11.415  -5.689  1.00 0.00 ? 74  SER A CA   4  
ATOM 11292 C C    . SER A 1 74  ? -3.199  10.052  -5.163  1.00 0.00 ? 74  SER A C    4  
ATOM 11293 O O    . SER A 1 74  ? -3.969  9.353   -4.506  1.00 0.00 ? 74  SER A O    4  
ATOM 11294 C CB   . SER A 1 74  ? -5.122  11.637  -5.416  1.00 0.00 ? 74  SER A CB   4  
ATOM 11295 O OG   . SER A 1 74  ? -5.751  12.283  -6.509  1.00 0.00 ? 74  SER A OG   4  
ATOM 11296 H H    . SER A 1 74  ? -3.835  10.930  -7.732  1.00 0.00 ? 74  SER A H    4  
ATOM 11297 H HA   . SER A 1 74  ? -3.061  12.181  -5.186  1.00 0.00 ? 74  SER A HA   4  
ATOM 11298 H HB2  . SER A 1 74  ? -5.603  10.685  -5.252  1.00 0.00 ? 74  SER A HB2  4  
ATOM 11299 H HB3  . SER A 1 74  ? -5.237  12.252  -4.536  1.00 0.00 ? 74  SER A HB3  4  
ATOM 11300 H HG   . SER A 1 74  ? -6.203  13.071  -6.199  1.00 0.00 ? 74  SER A HG   4  
ATOM 11301 N N    . THR A 1 75  ? -1.958  9.679   -5.464  1.00 0.00 ? 75  THR A N    4  
ATOM 11302 C CA   . THR A 1 75  ? -1.415  8.397   -5.029  1.00 0.00 ? 75  THR A CA   4  
ATOM 11303 C C    . THR A 1 75  ? -1.596  8.213   -3.526  1.00 0.00 ? 75  THR A C    4  
ATOM 11304 O O    . THR A 1 75  ? -1.798  7.098   -3.046  1.00 0.00 ? 75  THR A O    4  
ATOM 11305 C CB   . THR A 1 75  ? 0.067   8.296   -5.393  1.00 0.00 ? 75  THR A CB   4  
ATOM 11306 O OG1  . THR A 1 75  ? 0.847   9.131   -4.555  1.00 0.00 ? 75  THR A OG1  4  
ATOM 11307 C CG2  . THR A 1 75  ? 0.359   8.684   -6.826  1.00 0.00 ? 75  THR A CG2  4  
ATOM 11308 H H    . THR A 1 75  ? -1.394  10.279  -5.996  1.00 0.00 ? 75  THR A H    4  
ATOM 11309 H HA   . THR A 1 75  ? -1.958  7.618   -5.544  1.00 0.00 ? 75  THR A HA   4  
ATOM 11310 H HB   . THR A 1 75  ? 0.393   7.275   -5.254  1.00 0.00 ? 75  THR A HB   4  
ATOM 11311 H HG1  . THR A 1 75  ? 0.658   10.051  -4.754  1.00 0.00 ? 75  THR A HG1  4  
ATOM 11312 H HG21 . THR A 1 75  ? 0.504   9.753   -6.888  1.00 0.00 ? 75  THR A HG21 4  
ATOM 11313 H HG22 . THR A 1 75  ? -0.472  8.397   -7.454  1.00 0.00 ? 75  THR A HG22 4  
ATOM 11314 H HG23 . THR A 1 75  ? 1.253   8.180   -7.161  1.00 0.00 ? 75  THR A HG23 4  
ATOM 11315 N N    . HIS A 1 76  ? -1.530  9.318   -2.791  1.00 0.00 ? 76  HIS A N    4  
ATOM 11316 C CA   . HIS A 1 76  ? -1.695  9.283   -1.344  1.00 0.00 ? 76  HIS A CA   4  
ATOM 11317 C C    . HIS A 1 76  ? -3.154  9.027   -0.967  1.00 0.00 ? 76  HIS A C    4  
ATOM 11318 O O    . HIS A 1 76  ? -3.470  8.794   0.200   1.00 0.00 ? 76  HIS A O    4  
ATOM 11319 C CB   . HIS A 1 76  ? -1.220  10.599  -0.724  1.00 0.00 ? 76  HIS A CB   4  
ATOM 11320 C CG   . HIS A 1 76  ? 0.264   10.669  -0.531  1.00 0.00 ? 76  HIS A CG   4  
ATOM 11321 N ND1  . HIS A 1 76  ? 1.146   10.935  -1.557  1.00 0.00 ? 76  HIS A ND1  4  
ATOM 11322 C CD2  . HIS A 1 76  ? 1.021   10.509  0.581   1.00 0.00 ? 76  HIS A CD2  4  
ATOM 11323 C CE1  . HIS A 1 76  ? 2.380   10.934  -1.086  1.00 0.00 ? 76  HIS A CE1  4  
ATOM 11324 N NE2  . HIS A 1 76  ? 2.331   10.679  0.208   1.00 0.00 ? 76  HIS A NE2  4  
ATOM 11325 H H    . HIS A 1 76  ? -1.372  10.178  -3.234  1.00 0.00 ? 76  HIS A H    4  
ATOM 11326 H HA   . HIS A 1 76  ? -1.090  8.476   -0.960  1.00 0.00 ? 76  HIS A HA   4  
ATOM 11327 H HB2  . HIS A 1 76  ? -1.509  11.417  -1.367  1.00 0.00 ? 76  HIS A HB2  4  
ATOM 11328 H HB3  . HIS A 1 76  ? -1.688  10.723  0.241   1.00 0.00 ? 76  HIS A HB3  4  
ATOM 11329 H HD1  . HIS A 1 76  ? 0.903   11.098  -2.493  1.00 0.00 ? 76  HIS A HD1  4  
ATOM 11330 H HD2  . HIS A 1 76  ? 0.660   10.289  1.576   1.00 0.00 ? 76  HIS A HD2  4  
ATOM 11331 H HE1  . HIS A 1 76  ? 3.277   11.114  -1.661  1.00 0.00 ? 76  HIS A HE1  4  
ATOM 11332 H HE2  . HIS A 1 76  ? 3.110   10.554  0.790   1.00 0.00 ? 76  HIS A HE2  4  
ATOM 11333 N N    . GLU A 1 77  ? -4.041  9.070   -1.960  1.00 0.00 ? 77  GLU A N    4  
ATOM 11334 C CA   . GLU A 1 77  ? -5.456  8.842   -1.734  1.00 0.00 ? 77  GLU A CA   4  
ATOM 11335 C C    . GLU A 1 77  ? -5.868  7.479   -2.238  1.00 0.00 ? 77  GLU A C    4  
ATOM 11336 O O    . GLU A 1 77  ? -5.092  6.764   -2.872  1.00 0.00 ? 77  GLU A O    4  
ATOM 11337 C CB   . GLU A 1 77  ? -6.301  9.910   -2.449  1.00 0.00 ? 77  GLU A CB   4  
ATOM 11338 C CG   . GLU A 1 77  ? -6.418  11.220  -1.687  1.00 0.00 ? 77  GLU A CG   4  
ATOM 11339 C CD   . GLU A 1 77  ? -6.793  11.024  -0.231  1.00 0.00 ? 77  GLU A CD   4  
ATOM 11340 O OE1  . GLU A 1 77  ? -7.782  10.309  0.036   1.00 0.00 ? 77  GLU A OE1  4  
ATOM 11341 O OE2  . GLU A 1 77  ? -6.098  11.584  0.642   1.00 0.00 ? 77  GLU A OE2  4  
ATOM 11342 H H    . GLU A 1 77  ? -3.737  9.258   -2.867  1.00 0.00 ? 77  GLU A H    4  
ATOM 11343 H HA   . GLU A 1 77  ? -5.639  8.889   -0.673  1.00 0.00 ? 77  GLU A HA   4  
ATOM 11344 H HB2  . GLU A 1 77  ? -5.849  10.120  -3.407  1.00 0.00 ? 77  GLU A HB2  4  
ATOM 11345 H HB3  . GLU A 1 77  ? -7.303  9.521   -2.619  1.00 0.00 ? 77  GLU A HB3  4  
ATOM 11346 H HG2  . GLU A 1 77  ? -5.469  11.732  -1.733  1.00 0.00 ? 77  GLU A HG2  4  
ATOM 11347 H HG3  . GLU A 1 77  ? -7.175  11.828  -2.161  1.00 0.00 ? 77  GLU A HG3  4  
ATOM 11348 N N    . ALA A 1 78  ? -7.115  7.154   -1.978  1.00 0.00 ? 78  ALA A N    4  
ATOM 11349 C CA   . ALA A 1 78  ? -7.690  5.905   -2.423  1.00 0.00 ? 78  ALA A CA   4  
ATOM 11350 C C    . ALA A 1 78  ? -8.594  6.191   -3.605  1.00 0.00 ? 78  ALA A C    4  
ATOM 11351 O O    . ALA A 1 78  ? -9.780  6.479   -3.443  1.00 0.00 ? 78  ALA A O    4  
ATOM 11352 C CB   . ALA A 1 78  ? -8.448  5.235   -1.287  1.00 0.00 ? 78  ALA A CB   4  
ATOM 11353 H H    . ALA A 1 78  ? -7.674  7.793   -1.497  1.00 0.00 ? 78  ALA A H    4  
ATOM 11354 H HA   . ALA A 1 78  ? -6.886  5.262   -2.736  1.00 0.00 ? 78  ALA A HA   4  
ATOM 11355 H HB1  . ALA A 1 78  ? -8.285  4.168   -1.324  1.00 0.00 ? 78  ALA A HB1  4  
ATOM 11356 H HB2  . ALA A 1 78  ? -9.504  5.445   -1.384  1.00 0.00 ? 78  ALA A HB2  4  
ATOM 11357 H HB3  . ALA A 1 78  ? -8.089  5.623   -0.344  1.00 0.00 ? 78  ALA A HB3  4  
ATOM 11358 N N    . TYR A 1 79  ? -8.019  6.156   -4.799  1.00 0.00 ? 79  TYR A N    4  
ATOM 11359 C CA   . TYR A 1 79  ? -8.768  6.463   -6.003  1.00 0.00 ? 79  TYR A CA   4  
ATOM 11360 C C    . TYR A 1 79  ? -9.979  5.571   -6.174  1.00 0.00 ? 79  TYR A C    4  
ATOM 11361 O O    . TYR A 1 79  ? -9.902  4.516   -6.803  1.00 0.00 ? 79  TYR A O    4  
ATOM 11362 C CB   . TYR A 1 79  ? -7.885  6.373   -7.250  1.00 0.00 ? 79  TYR A CB   4  
ATOM 11363 C CG   . TYR A 1 79  ? -7.674  7.711   -7.907  1.00 0.00 ? 79  TYR A CG   4  
ATOM 11364 C CD1  . TYR A 1 79  ? -8.688  8.312   -8.637  1.00 0.00 ? 79  TYR A CD1  4  
ATOM 11365 C CD2  . TYR A 1 79  ? -6.471  8.387   -7.784  1.00 0.00 ? 79  TYR A CD2  4  
ATOM 11366 C CE1  . TYR A 1 79  ? -8.511  9.534   -9.220  1.00 0.00 ? 79  TYR A CE1  4  
ATOM 11367 C CE2  . TYR A 1 79  ? -6.289  9.617   -8.360  1.00 0.00 ? 79  TYR A CE2  4  
ATOM 11368 C CZ   . TYR A 1 79  ? -7.313  10.193  -9.080  1.00 0.00 ? 79  TYR A CZ   4  
ATOM 11369 O OH   . TYR A 1 79  ? -7.135  11.427  -9.662  1.00 0.00 ? 79  TYR A OH   4  
ATOM 11370 H H    . TYR A 1 79  ? -7.066  5.943   -4.875  1.00 0.00 ? 79  TYR A H    4  
ATOM 11371 H HA   . TYR A 1 79  ? -9.115  7.481   -5.908  1.00 0.00 ? 79  TYR A HA   4  
ATOM 11372 H HB2  . TYR A 1 79  ? -6.918  5.969   -6.991  1.00 0.00 ? 79  TYR A HB2  4  
ATOM 11373 H HB3  . TYR A 1 79  ? -8.360  5.727   -7.967  1.00 0.00 ? 79  TYR A HB3  4  
ATOM 11374 H HD1  . TYR A 1 79  ? -9.627  7.805   -8.761  1.00 0.00 ? 79  TYR A HD1  4  
ATOM 11375 H HD2  . TYR A 1 79  ? -5.668  7.939   -7.228  1.00 0.00 ? 79  TYR A HD2  4  
ATOM 11376 H HE1  . TYR A 1 79  ? -9.315  9.968   -9.775  1.00 0.00 ? 79  TYR A HE1  4  
ATOM 11377 H HE2  . TYR A 1 79  ? -5.343  10.119  -8.256  1.00 0.00 ? 79  TYR A HE2  4  
ATOM 11378 H HH   . TYR A 1 79  ? -6.909  12.070  -8.986  1.00 0.00 ? 79  TYR A HH   4  
ATOM 11379 N N    . VAL A 1 80  ? -11.111 6.015   -5.655  1.00 0.00 ? 80  VAL A N    4  
ATOM 11380 C CA   . VAL A 1 80  ? -12.334 5.254   -5.808  1.00 0.00 ? 80  VAL A CA   4  
ATOM 11381 C C    . VAL A 1 80  ? -12.722 5.302   -7.268  1.00 0.00 ? 80  VAL A C    4  
ATOM 11382 O O    . VAL A 1 80  ? -12.751 6.366   -7.865  1.00 0.00 ? 80  VAL A O    4  
ATOM 11383 C CB   . VAL A 1 80  ? -13.493 5.803   -4.959  1.00 0.00 ? 80  VAL A CB   4  
ATOM 11384 C CG1  . VAL A 1 80  ? -13.519 5.132   -3.595  1.00 0.00 ? 80  VAL A CG1  4  
ATOM 11385 C CG2  . VAL A 1 80  ? -13.405 7.309   -4.805  1.00 0.00 ? 80  VAL A CG2  4  
ATOM 11386 H H    . VAL A 1 80  ? -11.128 6.874   -5.184  1.00 0.00 ? 80  VAL A H    4  
ATOM 11387 H HA   . VAL A 1 80  ? -12.139 4.230   -5.523  1.00 0.00 ? 80  VAL A HA   4  
ATOM 11388 H HB   . VAL A 1 80  ? -14.412 5.573   -5.476  1.00 0.00 ? 80  VAL A HB   4  
ATOM 11389 H HG11 . VAL A 1 80  ? -14.424 5.409   -3.074  1.00 0.00 ? 80  VAL A HG11 4  
ATOM 11390 H HG12 . VAL A 1 80  ? -12.659 5.454   -3.019  1.00 0.00 ? 80  VAL A HG12 4  
ATOM 11391 H HG13 . VAL A 1 80  ? -13.488 4.060   -3.719  1.00 0.00 ? 80  VAL A HG13 4  
ATOM 11392 H HG21 . VAL A 1 80  ? -14.401 7.724   -4.762  1.00 0.00 ? 80  VAL A HG21 4  
ATOM 11393 H HG22 . VAL A 1 80  ? -12.873 7.728   -5.645  1.00 0.00 ? 80  VAL A HG22 4  
ATOM 11394 H HG23 . VAL A 1 80  ? -12.880 7.542   -3.895  1.00 0.00 ? 80  VAL A HG23 4  
ATOM 11395 N N    . THR A 1 81  ? -12.984 4.150   -7.847  1.00 0.00 ? 81  THR A N    4  
ATOM 11396 C CA   . THR A 1 81  ? -13.322 4.085   -9.259  1.00 0.00 ? 81  THR A CA   4  
ATOM 11397 C C    . THR A 1 81  ? -14.596 3.284   -9.492  1.00 0.00 ? 81  THR A C    4  
ATOM 11398 O O    . THR A 1 81  ? -14.805 2.245   -8.872  1.00 0.00 ? 81  THR A O    4  
ATOM 11399 C CB   . THR A 1 81  ? -12.149 3.465   -10.017 1.00 0.00 ? 81  THR A CB   4  
ATOM 11400 O OG1  . THR A 1 81  ? -10.940 3.655   -9.309  1.00 0.00 ? 81  THR A OG1  4  
ATOM 11401 C CG2  . THR A 1 81  ? -11.946 4.021   -11.403 1.00 0.00 ? 81  THR A CG2  4  
ATOM 11402 H H    . THR A 1 81  ? -12.935 3.330   -7.313  1.00 0.00 ? 81  THR A H    4  
ATOM 11403 H HA   . THR A 1 81  ? -13.470 5.092   -9.617  1.00 0.00 ? 81  THR A HA   4  
ATOM 11404 H HB   . THR A 1 81  ? -12.318 2.415   -10.112 1.00 0.00 ? 81  THR A HB   4  
ATOM 11405 H HG1  . THR A 1 81  ? -10.212 3.297   -9.821  1.00 0.00 ? 81  THR A HG1  4  
ATOM 11406 H HG21 . THR A 1 81  ? -11.004 4.541   -11.447 1.00 0.00 ? 81  THR A HG21 4  
ATOM 11407 H HG22 . THR A 1 81  ? -12.740 4.705   -11.634 1.00 0.00 ? 81  THR A HG22 4  
ATOM 11408 H HG23 . THR A 1 81  ? -11.943 3.211   -12.116 1.00 0.00 ? 81  THR A HG23 4  
ATOM 11409 N N    . VAL A 1 82  ? -15.426 3.764   -10.414 1.00 0.00 ? 82  VAL A N    4  
ATOM 11410 C CA   . VAL A 1 82  ? -16.669 3.090   -10.769 1.00 0.00 ? 82  VAL A CA   4  
ATOM 11411 C C    . VAL A 1 82  ? -16.661 2.758   -12.248 1.00 0.00 ? 82  VAL A C    4  
ATOM 11412 O O    . VAL A 1 82  ? -16.820 3.643   -13.084 1.00 0.00 ? 82  VAL A O    4  
ATOM 11413 C CB   . VAL A 1 82  ? -17.917 3.957   -10.482 1.00 0.00 ? 82  VAL A CB   4  
ATOM 11414 C CG1  . VAL A 1 82  ? -19.193 3.253   -10.956 1.00 0.00 ? 82  VAL A CG1  4  
ATOM 11415 C CG2  . VAL A 1 82  ? -18.005 4.304   -9.003  1.00 0.00 ? 82  VAL A CG2  4  
ATOM 11416 H H    . VAL A 1 82  ? -15.184 4.579   -10.898 1.00 0.00 ? 82  VAL A H    4  
ATOM 11417 H HA   . VAL A 1 82  ? -16.739 2.178   -10.197 1.00 0.00 ? 82  VAL A HA   4  
ATOM 11418 H HB   . VAL A 1 82  ? -17.819 4.879   -11.038 1.00 0.00 ? 82  VAL A HB   4  
ATOM 11419 H HG11 . VAL A 1 82  ? -19.269 3.323   -12.035 1.00 0.00 ? 82  VAL A HG11 4  
ATOM 11420 H HG12 . VAL A 1 82  ? -20.055 3.724   -10.507 1.00 0.00 ? 82  VAL A HG12 4  
ATOM 11421 H HG13 . VAL A 1 82  ? -19.162 2.213   -10.666 1.00 0.00 ? 82  VAL A HG13 4  
ATOM 11422 H HG21 . VAL A 1 82  ? -18.897 3.863   -8.582  1.00 0.00 ? 82  VAL A HG21 4  
ATOM 11423 H HG22 . VAL A 1 82  ? -18.047 5.377   -8.887  1.00 0.00 ? 82  VAL A HG22 4  
ATOM 11424 H HG23 . VAL A 1 82  ? -17.136 3.920   -8.490  1.00 0.00 ? 82  VAL A HG23 4  
ATOM 11425 N N    . LEU A 1 83  ? -16.493 1.493   -12.583 1.00 0.00 ? 83  LEU A N    4  
ATOM 11426 C CA   . LEU A 1 83  ? -16.494 1.111   -13.981 1.00 0.00 ? 83  LEU A CA   4  
ATOM 11427 C C    . LEU A 1 83  ? -17.898 0.681   -14.389 1.00 0.00 ? 83  LEU A C    4  
ATOM 11428 O O    . LEU A 1 83  ? -18.385 -0.371  -13.974 1.00 0.00 ? 83  LEU A O    4  
ATOM 11429 C CB   . LEU A 1 83  ? -15.473 0.002   -14.272 1.00 0.00 ? 83  LEU A CB   4  
ATOM 11430 C CG   . LEU A 1 83  ? -15.820 -0.859  -15.484 1.00 0.00 ? 83  LEU A CG   4  
ATOM 11431 C CD1  . LEU A 1 83  ? -15.349 -0.235  -16.782 1.00 0.00 ? 83  LEU A CD1  4  
ATOM 11432 C CD2  . LEU A 1 83  ? -15.264 -2.257  -15.358 1.00 0.00 ? 83  LEU A CD2  4  
ATOM 11433 H H    . LEU A 1 83  ? -16.385 0.809   -11.885 1.00 0.00 ? 83  LEU A H    4  
ATOM 11434 H HA   . LEU A 1 83  ? -16.228 1.988   -14.555 1.00 0.00 ? 83  LEU A HA   4  
ATOM 11435 H HB2  . LEU A 1 83  ? -14.509 0.460   -14.439 1.00 0.00 ? 83  LEU A HB2  4  
ATOM 11436 H HB3  . LEU A 1 83  ? -15.408 -0.639  -13.407 1.00 0.00 ? 83  LEU A HB3  4  
ATOM 11437 H HG   . LEU A 1 83  ? -16.879 -0.935  -15.530 1.00 0.00 ? 83  LEU A HG   4  
ATOM 11438 H HD11 . LEU A 1 83  ? -16.138 0.373   -17.198 1.00 0.00 ? 83  LEU A HD11 4  
ATOM 11439 H HD12 . LEU A 1 83  ? -15.094 -1.025  -17.481 1.00 0.00 ? 83  LEU A HD12 4  
ATOM 11440 H HD13 . LEU A 1 83  ? -14.481 0.375   -16.594 1.00 0.00 ? 83  LEU A HD13 4  
ATOM 11441 H HD21 . LEU A 1 83  ? -14.949 -2.600  -16.333 1.00 0.00 ? 83  LEU A HD21 4  
ATOM 11442 H HD22 . LEU A 1 83  ? -16.032 -2.910  -14.978 1.00 0.00 ? 83  LEU A HD22 4  
ATOM 11443 H HD23 . LEU A 1 83  ? -14.421 -2.252  -14.685 1.00 0.00 ? 83  LEU A HD23 4  
ATOM 11444 N N    . GLU A 1 84  ? -18.539 1.507   -15.201 1.00 0.00 ? 84  GLU A N    4  
ATOM 11445 C CA   . GLU A 1 84  ? -19.886 1.229   -15.673 1.00 0.00 ? 84  GLU A CA   4  
ATOM 11446 C C    . GLU A 1 84  ? -19.849 0.721   -17.106 1.00 0.00 ? 84  GLU A C    4  
ATOM 11447 O O    . GLU A 1 84  ? -19.509 1.462   -18.029 1.00 0.00 ? 84  GLU A O    4  
ATOM 11448 C CB   . GLU A 1 84  ? -20.734 2.493   -15.595 1.00 0.00 ? 84  GLU A CB   4  
ATOM 11449 C CG   . GLU A 1 84  ? -21.529 2.622   -14.316 1.00 0.00 ? 84  GLU A CG   4  
ATOM 11450 C CD   . GLU A 1 84  ? -21.865 4.061   -13.977 1.00 0.00 ? 84  GLU A CD   4  
ATOM 11451 O OE1  . GLU A 1 84  ? -22.317 4.794   -14.882 1.00 0.00 ? 84  GLU A OE1  4  
ATOM 11452 O OE2  . GLU A 1 84  ? -21.676 4.455   -12.807 1.00 0.00 ? 84  GLU A OE2  4  
ATOM 11453 H H    . GLU A 1 84  ? -18.092 2.329   -15.492 1.00 0.00 ? 84  GLU A H    4  
ATOM 11454 H HA   . GLU A 1 84  ? -20.318 0.468   -15.037 1.00 0.00 ? 84  GLU A HA   4  
ATOM 11455 H HB2  . GLU A 1 84  ? -20.088 3.339   -15.670 1.00 0.00 ? 84  GLU A HB2  4  
ATOM 11456 H HB3  . GLU A 1 84  ? -21.419 2.508   -16.418 1.00 0.00 ? 84  GLU A HB3  4  
ATOM 11457 H HG2  . GLU A 1 84  ? -22.450 2.071   -14.427 1.00 0.00 ? 84  GLU A HG2  4  
ATOM 11458 H HG3  . GLU A 1 84  ? -20.951 2.201   -13.506 1.00 0.00 ? 84  GLU A HG3  4  
ATOM 11459 N N    . GLY A 1 85  ? -20.195 -0.544  -17.288 1.00 0.00 ? 85  GLY A N    4  
ATOM 11460 C CA   . GLY A 1 85  ? -20.187 -1.122  -18.614 1.00 0.00 ? 85  GLY A CA   4  
ATOM 11461 C C    . GLY A 1 85  ? -21.578 -1.364  -19.157 1.00 0.00 ? 85  GLY A C    4  
ATOM 11462 O O    . GLY A 1 85  ? -22.395 -2.041  -18.536 1.00 0.00 ? 85  GLY A O    4  
ATOM 11463 H H    . GLY A 1 85  ? -20.453 -1.090  -16.516 1.00 0.00 ? 85  GLY A H    4  
ATOM 11464 H HA2  . GLY A 1 85  ? -19.664 -0.457  -19.283 1.00 0.00 ? 85  GLY A HA2  4  
ATOM 11465 H HA3  . GLY A 1 85  ? -19.659 -2.055  -18.583 1.00 0.00 ? 85  GLY A HA3  4  
ATOM 11466 N N    . PHE A 1 86  ? -21.832 -0.817  -20.332 1.00 0.00 ? 86  PHE A N    4  
ATOM 11467 C CA   . PHE A 1 86  ? -23.115 -0.973  -20.998 1.00 0.00 ? 86  PHE A CA   4  
ATOM 11468 C C    . PHE A 1 86  ? -22.990 -2.066  -22.047 1.00 0.00 ? 86  PHE A C    4  
ATOM 11469 O O    . PHE A 1 86  ? -22.050 -2.063  -22.841 1.00 0.00 ? 86  PHE A O    4  
ATOM 11470 C CB   . PHE A 1 86  ? -23.535 0.360   -21.631 1.00 0.00 ? 86  PHE A CB   4  
ATOM 11471 C CG   . PHE A 1 86  ? -23.153 1.556   -20.800 1.00 0.00 ? 86  PHE A CG   4  
ATOM 11472 C CD1  . PHE A 1 86  ? -21.849 2.030   -20.805 1.00 0.00 ? 86  PHE A CD1  4  
ATOM 11473 C CD2  . PHE A 1 86  ? -24.089 2.196   -20.003 1.00 0.00 ? 86  PHE A CD2  4  
ATOM 11474 C CE1  . PHE A 1 86  ? -21.488 3.117   -20.032 1.00 0.00 ? 86  PHE A CE1  4  
ATOM 11475 C CE2  . PHE A 1 86  ? -23.732 3.287   -19.230 1.00 0.00 ? 86  PHE A CE2  4  
ATOM 11476 C CZ   . PHE A 1 86  ? -22.430 3.747   -19.244 1.00 0.00 ? 86  PHE A CZ   4  
ATOM 11477 H H    . PHE A 1 86  ? -21.128 -0.302  -20.776 1.00 0.00 ? 86  PHE A H    4  
ATOM 11478 H HA   . PHE A 1 86  ? -23.855 -1.271  -20.267 1.00 0.00 ? 86  PHE A HA   4  
ATOM 11479 H HB2  . PHE A 1 86  ? -23.059 0.460   -22.593 1.00 0.00 ? 86  PHE A HB2  4  
ATOM 11480 H HB3  . PHE A 1 86  ? -24.605 0.372   -21.760 1.00 0.00 ? 86  PHE A HB3  4  
ATOM 11481 H HD1  . PHE A 1 86  ? -21.111 1.542   -21.422 1.00 0.00 ? 86  PHE A HD1  4  
ATOM 11482 H HD2  . PHE A 1 86  ? -25.110 1.834   -19.985 1.00 0.00 ? 86  PHE A HD2  4  
ATOM 11483 H HE1  . PHE A 1 86  ? -20.469 3.474   -20.044 1.00 0.00 ? 86  PHE A HE1  4  
ATOM 11484 H HE2  . PHE A 1 86  ? -24.470 3.779   -18.615 1.00 0.00 ? 86  PHE A HE2  4  
ATOM 11485 H HZ   . PHE A 1 86  ? -22.147 4.595   -18.636 1.00 0.00 ? 86  PHE A HZ   4  
ATOM 11486 N N    . SER A 1 87  ? -23.922 -3.011  -22.044 1.00 0.00 ? 87  SER A N    4  
ATOM 11487 C CA   . SER A 1 87  ? -23.869 -4.099  -22.999 1.00 0.00 ? 87  SER A CA   4  
ATOM 11488 C C    . SER A 1 87  ? -24.395 -3.623  -24.348 1.00 0.00 ? 87  SER A C    4  
ATOM 11489 O O    . SER A 1 87  ? -25.606 -3.536  -24.554 1.00 0.00 ? 87  SER A O    4  
ATOM 11490 C CB   . SER A 1 87  ? -24.696 -5.288  -22.505 1.00 0.00 ? 87  SER A CB   4  
ATOM 11491 O OG   . SER A 1 87  ? -23.878 -6.240  -21.847 1.00 0.00 ? 87  SER A OG   4  
ATOM 11492 H H    . SER A 1 87  ? -24.652 -2.977  -21.387 1.00 0.00 ? 87  SER A H    4  
ATOM 11493 H HA   . SER A 1 87  ? -22.831 -4.401  -23.089 1.00 0.00 ? 87  SER A HA   4  
ATOM 11494 H HB2  . SER A 1 87  ? -25.448 -4.938  -21.814 1.00 0.00 ? 87  SER A HB2  4  
ATOM 1149