data_1N7D
# 
_entry.id   1N7D 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1N7D         
RCSB  RCSB017610   
WWPDB D_1000017610 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1N7D 
_pdbx_database_status.recvd_initial_deposition_date   2002-11-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rudenko, G.'     1 
'Henry, L.'       2 
'Henderson, K.'   3 
'Ichtchenko, K.'  4 
'Brown, M.S.'     5 
'Goldstein, J.L.' 6 
'Deisenhofer, J.' 7 
# 
_citation.id                        primary 
_citation.title                     'Structure of the LDL receptor extracellular domain at endosomal pH' 
_citation.journal_abbrev            Science 
_citation.journal_volume            298 
_citation.page_first                2353 
_citation.page_last                 2358 
_citation.year                      2002 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12459547 
_citation.pdbx_database_id_DOI      10.1126/science.1078124 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rudenko, G.'     1 ? 
primary 'Henry, L.'       2 ? 
primary 'Henderson, K.'   3 ? 
primary 'Ichtchenko, K.'  4 ? 
primary 'Brown, M.S.'     5 ? 
primary 'Goldstein, J.L.' 6 ? 
primary 'Deisenhofer, J.' 7 ? 
# 
_cell.entry_id           1N7D 
_cell.length_a           185.290 
_cell.length_b           185.290 
_cell.length_c           85.186 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1N7D 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Low-density lipoprotein receptor' 77703.617 1 ? 'N494Q, N636Q' 'extracellular domain, RESIDUES 1-699' ? 
2 branched    man 
;alpha-D-mannopyranose-(1-3)-[alpha-D-mannopyranose-(1-6)]beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
910.823   1 ? ?              ?                                      ? 
3 branched    man 
;alpha-D-mannopyranose-(1-6)-beta-D-mannopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-2-acetamido-2-deoxy-beta-D-glucopyranose
;
748.682   1 ? ?              ?                                      ? 
4 non-polymer syn 'CALCIUM ION' 40.078    8 ? ?              ?                                      ? 
5 non-polymer syn 12-TUNGSTOPHOSPHATE 2877.030  3 ? ?              ?                                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'LDL receptor' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDE
QGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWP
QRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDC
KDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCP
DGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTS
LIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVA
DTKGVKRKTLFREQGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSK
LHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHQLTQP
RGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDE
QGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWP
QRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDC
KDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCP
DGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTS
LIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVA
DTKGVKRKTLFREQGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSK
LHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHQLTQP
RGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   VAL n 
1 3   GLY n 
1 4   ASP n 
1 5   ARG n 
1 6   CYS n 
1 7   GLU n 
1 8   ARG n 
1 9   ASN n 
1 10  GLU n 
1 11  PHE n 
1 12  GLN n 
1 13  CYS n 
1 14  GLN n 
1 15  ASP n 
1 16  GLY n 
1 17  LYS n 
1 18  CYS n 
1 19  ILE n 
1 20  SER n 
1 21  TYR n 
1 22  LYS n 
1 23  TRP n 
1 24  VAL n 
1 25  CYS n 
1 26  ASP n 
1 27  GLY n 
1 28  SER n 
1 29  ALA n 
1 30  GLU n 
1 31  CYS n 
1 32  GLN n 
1 33  ASP n 
1 34  GLY n 
1 35  SER n 
1 36  ASP n 
1 37  GLU n 
1 38  SER n 
1 39  GLN n 
1 40  GLU n 
1 41  THR n 
1 42  CYS n 
1 43  LEU n 
1 44  SER n 
1 45  VAL n 
1 46  THR n 
1 47  CYS n 
1 48  LYS n 
1 49  SER n 
1 50  GLY n 
1 51  ASP n 
1 52  PHE n 
1 53  SER n 
1 54  CYS n 
1 55  GLY n 
1 56  GLY n 
1 57  ARG n 
1 58  VAL n 
1 59  ASN n 
1 60  ARG n 
1 61  CYS n 
1 62  ILE n 
1 63  PRO n 
1 64  GLN n 
1 65  PHE n 
1 66  TRP n 
1 67  ARG n 
1 68  CYS n 
1 69  ASP n 
1 70  GLY n 
1 71  GLN n 
1 72  VAL n 
1 73  ASP n 
1 74  CYS n 
1 75  ASP n 
1 76  ASN n 
1 77  GLY n 
1 78  SER n 
1 79  ASP n 
1 80  GLU n 
1 81  GLN n 
1 82  GLY n 
1 83  CYS n 
1 84  PRO n 
1 85  PRO n 
1 86  LYS n 
1 87  THR n 
1 88  CYS n 
1 89  SER n 
1 90  GLN n 
1 91  ASP n 
1 92  GLU n 
1 93  PHE n 
1 94  ARG n 
1 95  CYS n 
1 96  HIS n 
1 97  ASP n 
1 98  GLY n 
1 99  LYS n 
1 100 CYS n 
1 101 ILE n 
1 102 SER n 
1 103 ARG n 
1 104 GLN n 
1 105 PHE n 
1 106 VAL n 
1 107 CYS n 
1 108 ASP n 
1 109 SER n 
1 110 ASP n 
1 111 ARG n 
1 112 ASP n 
1 113 CYS n 
1 114 LEU n 
1 115 ASP n 
1 116 GLY n 
1 117 SER n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 SER n 
1 122 CYS n 
1 123 PRO n 
1 124 VAL n 
1 125 LEU n 
1 126 THR n 
1 127 CYS n 
1 128 GLY n 
1 129 PRO n 
1 130 ALA n 
1 131 SER n 
1 132 PHE n 
1 133 GLN n 
1 134 CYS n 
1 135 ASN n 
1 136 SER n 
1 137 SER n 
1 138 THR n 
1 139 CYS n 
1 140 ILE n 
1 141 PRO n 
1 142 GLN n 
1 143 LEU n 
1 144 TRP n 
1 145 ALA n 
1 146 CYS n 
1 147 ASP n 
1 148 ASN n 
1 149 ASP n 
1 150 PRO n 
1 151 ASP n 
1 152 CYS n 
1 153 GLU n 
1 154 ASP n 
1 155 GLY n 
1 156 SER n 
1 157 ASP n 
1 158 GLU n 
1 159 TRP n 
1 160 PRO n 
1 161 GLN n 
1 162 ARG n 
1 163 CYS n 
1 164 ARG n 
1 165 GLY n 
1 166 LEU n 
1 167 TYR n 
1 168 VAL n 
1 169 PHE n 
1 170 GLN n 
1 171 GLY n 
1 172 ASP n 
1 173 SER n 
1 174 SER n 
1 175 PRO n 
1 176 CYS n 
1 177 SER n 
1 178 ALA n 
1 179 PHE n 
1 180 GLU n 
1 181 PHE n 
1 182 HIS n 
1 183 CYS n 
1 184 LEU n 
1 185 SER n 
1 186 GLY n 
1 187 GLU n 
1 188 CYS n 
1 189 ILE n 
1 190 HIS n 
1 191 SER n 
1 192 SER n 
1 193 TRP n 
1 194 ARG n 
1 195 CYS n 
1 196 ASP n 
1 197 GLY n 
1 198 GLY n 
1 199 PRO n 
1 200 ASP n 
1 201 CYS n 
1 202 LYS n 
1 203 ASP n 
1 204 LYS n 
1 205 SER n 
1 206 ASP n 
1 207 GLU n 
1 208 GLU n 
1 209 ASN n 
1 210 CYS n 
1 211 ALA n 
1 212 VAL n 
1 213 ALA n 
1 214 THR n 
1 215 CYS n 
1 216 ARG n 
1 217 PRO n 
1 218 ASP n 
1 219 GLU n 
1 220 PHE n 
1 221 GLN n 
1 222 CYS n 
1 223 SER n 
1 224 ASP n 
1 225 GLY n 
1 226 ASN n 
1 227 CYS n 
1 228 ILE n 
1 229 HIS n 
1 230 GLY n 
1 231 SER n 
1 232 ARG n 
1 233 GLN n 
1 234 CYS n 
1 235 ASP n 
1 236 ARG n 
1 237 GLU n 
1 238 TYR n 
1 239 ASP n 
1 240 CYS n 
1 241 LYS n 
1 242 ASP n 
1 243 MET n 
1 244 SER n 
1 245 ASP n 
1 246 GLU n 
1 247 VAL n 
1 248 GLY n 
1 249 CYS n 
1 250 VAL n 
1 251 ASN n 
1 252 VAL n 
1 253 THR n 
1 254 LEU n 
1 255 CYS n 
1 256 GLU n 
1 257 GLY n 
1 258 PRO n 
1 259 ASN n 
1 260 LYS n 
1 261 PHE n 
1 262 LYS n 
1 263 CYS n 
1 264 HIS n 
1 265 SER n 
1 266 GLY n 
1 267 GLU n 
1 268 CYS n 
1 269 ILE n 
1 270 THR n 
1 271 LEU n 
1 272 ASP n 
1 273 LYS n 
1 274 VAL n 
1 275 CYS n 
1 276 ASN n 
1 277 MET n 
1 278 ALA n 
1 279 ARG n 
1 280 ASP n 
1 281 CYS n 
1 282 ARG n 
1 283 ASP n 
1 284 TRP n 
1 285 SER n 
1 286 ASP n 
1 287 GLU n 
1 288 PRO n 
1 289 ILE n 
1 290 LYS n 
1 291 GLU n 
1 292 CYS n 
1 293 GLY n 
1 294 THR n 
1 295 ASN n 
1 296 GLU n 
1 297 CYS n 
1 298 LEU n 
1 299 ASP n 
1 300 ASN n 
1 301 ASN n 
1 302 GLY n 
1 303 GLY n 
1 304 CYS n 
1 305 SER n 
1 306 HIS n 
1 307 VAL n 
1 308 CYS n 
1 309 ASN n 
1 310 ASP n 
1 311 LEU n 
1 312 LYS n 
1 313 ILE n 
1 314 GLY n 
1 315 TYR n 
1 316 GLU n 
1 317 CYS n 
1 318 LEU n 
1 319 CYS n 
1 320 PRO n 
1 321 ASP n 
1 322 GLY n 
1 323 PHE n 
1 324 GLN n 
1 325 LEU n 
1 326 VAL n 
1 327 ALA n 
1 328 GLN n 
1 329 ARG n 
1 330 ARG n 
1 331 CYS n 
1 332 GLU n 
1 333 ASP n 
1 334 ILE n 
1 335 ASP n 
1 336 GLU n 
1 337 CYS n 
1 338 GLN n 
1 339 ASP n 
1 340 PRO n 
1 341 ASP n 
1 342 THR n 
1 343 CYS n 
1 344 SER n 
1 345 GLN n 
1 346 LEU n 
1 347 CYS n 
1 348 VAL n 
1 349 ASN n 
1 350 LEU n 
1 351 GLU n 
1 352 GLY n 
1 353 GLY n 
1 354 TYR n 
1 355 LYS n 
1 356 CYS n 
1 357 GLN n 
1 358 CYS n 
1 359 GLU n 
1 360 GLU n 
1 361 GLY n 
1 362 PHE n 
1 363 GLN n 
1 364 LEU n 
1 365 ASP n 
1 366 PRO n 
1 367 HIS n 
1 368 THR n 
1 369 LYS n 
1 370 ALA n 
1 371 CYS n 
1 372 LYS n 
1 373 ALA n 
1 374 VAL n 
1 375 GLY n 
1 376 SER n 
1 377 ILE n 
1 378 ALA n 
1 379 TYR n 
1 380 LEU n 
1 381 PHE n 
1 382 PHE n 
1 383 THR n 
1 384 ASN n 
1 385 ARG n 
1 386 HIS n 
1 387 GLU n 
1 388 VAL n 
1 389 ARG n 
1 390 LYS n 
1 391 MET n 
1 392 THR n 
1 393 LEU n 
1 394 ASP n 
1 395 ARG n 
1 396 SER n 
1 397 GLU n 
1 398 TYR n 
1 399 THR n 
1 400 SER n 
1 401 LEU n 
1 402 ILE n 
1 403 PRO n 
1 404 ASN n 
1 405 LEU n 
1 406 ARG n 
1 407 ASN n 
1 408 VAL n 
1 409 VAL n 
1 410 ALA n 
1 411 LEU n 
1 412 ASP n 
1 413 THR n 
1 414 GLU n 
1 415 VAL n 
1 416 ALA n 
1 417 SER n 
1 418 ASN n 
1 419 ARG n 
1 420 ILE n 
1 421 TYR n 
1 422 TRP n 
1 423 SER n 
1 424 ASP n 
1 425 LEU n 
1 426 SER n 
1 427 GLN n 
1 428 ARG n 
1 429 MET n 
1 430 ILE n 
1 431 CYS n 
1 432 SER n 
1 433 THR n 
1 434 GLN n 
1 435 LEU n 
1 436 ASP n 
1 437 ARG n 
1 438 ALA n 
1 439 HIS n 
1 440 GLY n 
1 441 VAL n 
1 442 SER n 
1 443 SER n 
1 444 TYR n 
1 445 ASP n 
1 446 THR n 
1 447 VAL n 
1 448 ILE n 
1 449 SER n 
1 450 ARG n 
1 451 ASP n 
1 452 ILE n 
1 453 GLN n 
1 454 ALA n 
1 455 PRO n 
1 456 ASP n 
1 457 GLY n 
1 458 LEU n 
1 459 ALA n 
1 460 VAL n 
1 461 ASP n 
1 462 TRP n 
1 463 ILE n 
1 464 HIS n 
1 465 SER n 
1 466 ASN n 
1 467 ILE n 
1 468 TYR n 
1 469 TRP n 
1 470 THR n 
1 471 ASP n 
1 472 SER n 
1 473 VAL n 
1 474 LEU n 
1 475 GLY n 
1 476 THR n 
1 477 VAL n 
1 478 SER n 
1 479 VAL n 
1 480 ALA n 
1 481 ASP n 
1 482 THR n 
1 483 LYS n 
1 484 GLY n 
1 485 VAL n 
1 486 LYS n 
1 487 ARG n 
1 488 LYS n 
1 489 THR n 
1 490 LEU n 
1 491 PHE n 
1 492 ARG n 
1 493 GLU n 
1 494 GLN n 
1 495 GLY n 
1 496 SER n 
1 497 LYS n 
1 498 PRO n 
1 499 ARG n 
1 500 ALA n 
1 501 ILE n 
1 502 VAL n 
1 503 VAL n 
1 504 ASP n 
1 505 PRO n 
1 506 VAL n 
1 507 HIS n 
1 508 GLY n 
1 509 PHE n 
1 510 MET n 
1 511 TYR n 
1 512 TRP n 
1 513 THR n 
1 514 ASP n 
1 515 TRP n 
1 516 GLY n 
1 517 THR n 
1 518 PRO n 
1 519 ALA n 
1 520 LYS n 
1 521 ILE n 
1 522 LYS n 
1 523 LYS n 
1 524 GLY n 
1 525 GLY n 
1 526 LEU n 
1 527 ASN n 
1 528 GLY n 
1 529 VAL n 
1 530 ASP n 
1 531 ILE n 
1 532 TYR n 
1 533 SER n 
1 534 LEU n 
1 535 VAL n 
1 536 THR n 
1 537 GLU n 
1 538 ASN n 
1 539 ILE n 
1 540 GLN n 
1 541 TRP n 
1 542 PRO n 
1 543 ASN n 
1 544 GLY n 
1 545 ILE n 
1 546 THR n 
1 547 LEU n 
1 548 ASP n 
1 549 LEU n 
1 550 LEU n 
1 551 SER n 
1 552 GLY n 
1 553 ARG n 
1 554 LEU n 
1 555 TYR n 
1 556 TRP n 
1 557 VAL n 
1 558 ASP n 
1 559 SER n 
1 560 LYS n 
1 561 LEU n 
1 562 HIS n 
1 563 SER n 
1 564 ILE n 
1 565 SER n 
1 566 SER n 
1 567 ILE n 
1 568 ASP n 
1 569 VAL n 
1 570 ASN n 
1 571 GLY n 
1 572 GLY n 
1 573 ASN n 
1 574 ARG n 
1 575 LYS n 
1 576 THR n 
1 577 ILE n 
1 578 LEU n 
1 579 GLU n 
1 580 ASP n 
1 581 GLU n 
1 582 LYS n 
1 583 ARG n 
1 584 LEU n 
1 585 ALA n 
1 586 HIS n 
1 587 PRO n 
1 588 PHE n 
1 589 SER n 
1 590 LEU n 
1 591 ALA n 
1 592 VAL n 
1 593 PHE n 
1 594 GLU n 
1 595 ASP n 
1 596 LYS n 
1 597 VAL n 
1 598 PHE n 
1 599 TRP n 
1 600 THR n 
1 601 ASP n 
1 602 ILE n 
1 603 ILE n 
1 604 ASN n 
1 605 GLU n 
1 606 ALA n 
1 607 ILE n 
1 608 PHE n 
1 609 SER n 
1 610 ALA n 
1 611 ASN n 
1 612 ARG n 
1 613 LEU n 
1 614 THR n 
1 615 GLY n 
1 616 SER n 
1 617 ASP n 
1 618 VAL n 
1 619 ASN n 
1 620 LEU n 
1 621 LEU n 
1 622 ALA n 
1 623 GLU n 
1 624 ASN n 
1 625 LEU n 
1 626 LEU n 
1 627 SER n 
1 628 PRO n 
1 629 GLU n 
1 630 ASP n 
1 631 MET n 
1 632 VAL n 
1 633 LEU n 
1 634 PHE n 
1 635 HIS n 
1 636 GLN n 
1 637 LEU n 
1 638 THR n 
1 639 GLN n 
1 640 PRO n 
1 641 ARG n 
1 642 GLY n 
1 643 VAL n 
1 644 ASN n 
1 645 TRP n 
1 646 CYS n 
1 647 GLU n 
1 648 ARG n 
1 649 THR n 
1 650 THR n 
1 651 LEU n 
1 652 SER n 
1 653 ASN n 
1 654 GLY n 
1 655 GLY n 
1 656 CYS n 
1 657 GLN n 
1 658 TYR n 
1 659 LEU n 
1 660 CYS n 
1 661 LEU n 
1 662 PRO n 
1 663 ALA n 
1 664 PRO n 
1 665 GLN n 
1 666 ILE n 
1 667 ASN n 
1 668 PRO n 
1 669 HIS n 
1 670 SER n 
1 671 PRO n 
1 672 LYS n 
1 673 PHE n 
1 674 THR n 
1 675 CYS n 
1 676 ALA n 
1 677 CYS n 
1 678 PRO n 
1 679 ASP n 
1 680 GLY n 
1 681 MET n 
1 682 LEU n 
1 683 LEU n 
1 684 ALA n 
1 685 ARG n 
1 686 ASP n 
1 687 MET n 
1 688 ARG n 
1 689 SER n 
1 690 CYS n 
1 691 LEU n 
1 692 THR n 
1 693 GLU n 
1 694 ALA n 
1 695 GLU n 
1 696 ALA n 
1 697 ALA n 
1 698 VAL n 
1 699 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 LDLR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'cabbage looper' 
_entity_src_gen.pdbx_host_org_scientific_name      'Trichoplusia ni' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7111 
_entity_src_gen.host_org_genus                     Trichoplusia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    LDLR_HUMAN 
_struct_ref.pdbx_db_accession          P01130 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDE
QGCPPKTCSQDEFRCHDGKCISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEWP
QRCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDEFQCSDGNCIHGSRQCDREYDC
KDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMARDCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCP
DGFQLVAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTS
LIPNLRNVVALDTEVASNRIYWSDLSQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVA
DTKGVKRKTLFRENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSK
LHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQP
RGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVA
;
_struct_ref.pdbx_align_begin           22 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1N7D 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 699 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P01130 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  720 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       699 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1N7D GLN A 494 ? UNP P01130 ASN 515 ENGINEERED 494 1 
1 1N7D GLN A 636 ? UNP P01130 ASN 657 ENGINEERED 636 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                  ? 'C3 H7 N O2'     89.093   
ARG 'L-peptide linking'           y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209  
ASN 'L-peptide linking'           y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118  
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103  
BMA 'D-saccharide, beta linking'  . beta-D-mannopyranose                     ? 'C6 H12 O6'      180.156  
CA  non-polymer                   . 'CALCIUM ION'                            ? 'Ca 2'           40.078   
CYS 'L-peptide linking'           y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158  
GLN 'L-peptide linking'           y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144  
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129  
GLY 'peptide linking'             y GLYCINE                                  ? 'C2 H5 N O2'     75.067   
HIS 'L-peptide linking'           y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162  
ILE 'L-peptide linking'           y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173  
KEG non-polymer                   . 12-TUNGSTOPHOSPHATE                      ? 'O40 P W12'      2877.030 
LEU 'L-peptide linking'           y LEUCINE                                  ? 'C6 H13 N O2'    131.173  
LYS 'L-peptide linking'           y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195  
MAN 'D-saccharide, alpha linking' . alpha-D-mannopyranose                    ? 'C6 H12 O6'      180.156  
MET 'L-peptide linking'           y METHIONINE                               ? 'C5 H11 N O2 S'  149.211  
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208  
PHE 'L-peptide linking'           y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189  
PRO 'L-peptide linking'           y PROLINE                                  ? 'C5 H9 N O2'     115.130  
SER 'L-peptide linking'           y SERINE                                   ? 'C3 H7 N O3'     105.093  
THR 'L-peptide linking'           y THREONINE                                ? 'C4 H9 N O3'     119.119  
TRP 'L-peptide linking'           y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225  
TYR 'L-peptide linking'           y TYROSINE                                 ? 'C9 H11 N O3'    181.189  
VAL 'L-peptide linking'           y VALINE                                   ? 'C5 H11 N O2'    117.146  
# 
_exptl.entry_id          1N7D 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   8 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      5.43 
_exptl_crystal.density_percent_sol   77.36 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.3 
_exptl_crystal_grow.pdbx_details    
'acetate buffer pH 5.3, 1,2-hexanediol, 0.5 mM CaCl2, VAPOR DIFFUSION, HANGING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1 110 ? 1 
2 ?   ? 1 
3 ?   ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 4'   2001-12-20 ? 
2 CCD 'ADSC QUANTUM 210' ?          ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 1.21363 1.0 
2 1.21423 1.0 
3 1.10696 1.0 
4 1.23985 1.0 
# 
loop_
_diffrn_source.diffrn_id 
_diffrn_source.source 
_diffrn_source.type 
_diffrn_source.pdbx_synchrotron_site 
_diffrn_source.pdbx_synchrotron_beamline 
_diffrn_source.pdbx_wavelength 
_diffrn_source.pdbx_wavelength_list 
1 SYNCHROTRON 'ALS BEAMLINE 5.0.2' ALS 5.0.2 ? '1.21363, 1.21423, 1.10696, 1.23985' 
2 SYNCHROTRON 'ALS BEAMLINE 8.2.1' ALS 8.2.1 ? ?                                    
3 SYNCHROTRON 'APS BEAMLINE 19-ID' APS 19-ID ? ?                                    
# 
_reflns.entry_id                     1N7D 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             45.3 
_reflns.d_resolution_high            3.7 
_reflns.number_obs                   17303 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            0.09 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.8 
_reflns.B_iso_Wilson_estimate        74.7 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             3.7 
_reflns_shell.d_res_low              3.83 
_reflns_shell.percent_possible_all   64.5 
_reflns_shell.Rmerge_I_obs           0.449 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.7 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1N7D 
_refine.ls_number_reflns_obs                     16008 
_refine.ls_number_reflns_all                     17303 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             45.30 
_refine.ls_d_res_high                            3.70 
_refine.ls_percent_reflns_obs                    87.8 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.381 
_refine.ls_R_factor_R_free                       0.382 
_refine.ls_R_factor_R_free_error                 0.011 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 7.0 
_refine.ls_number_reflns_R_free                  1119 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               124.7 
_refine.aniso_B[1][1]                            20.49 
_refine.aniso_B[2][2]                            20.49 
_refine.aniso_B[3][3]                            -40.98 
_refine.aniso_B[1][2]                            9.97 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.156563 
_refine.solvent_model_param_bsol                 10 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;The sugars have not been refined, just manually placed  
in the density. The exact identity of the sugars  
in these N-linked glycosylation   
sites is not known. 
At this resolution positional 
refinement is of limited use. 
Harmonic restraints were used 
on most core residues. No simulated  
annealing was used.


The resolution of the MAD data used in the structure determination
is 3.7 Ang and the B-factors were high.
This means that the positions of the side chains
are not well determined in the model.   
The authors urge       
users to exercize caution and restraint interpreting this model.    
The authors are available for questions. 


The clusters were included in the positional refinement
(regularization of the model).
The carbohydrates were not included in the positional 
refinement (regularization of the model) but fitted manually.
The carbohydrates were modelled as the N-linked high mannose type.
;
_refine.pdbx_starting_model                      'PDB ENTRIES: 1AJJ, 1D2J, 1I0U, 1IJQ, 1FX5' 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             OVERALL 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1N7D 
_refine_analyze.Luzzati_coordinate_error_obs    1.10 
_refine_analyze.Luzzati_sigma_a_obs             1.05 
_refine_analyze.Luzzati_d_res_low_obs           50.00 
_refine_analyze.Luzzati_coordinate_error_free   1.19 
_refine_analyze.Luzzati_sigma_a_free            1.11 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4702 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         254 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               4956 
_refine_hist.d_res_high                       3.70 
_refine_hist.d_res_low                        45.30 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.031 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        4.9   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.7  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 2.52  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       3.70 
_refine_ls_shell.d_res_low                        3.87 
_refine_ls_shell.number_reflns_R_work             757 
_refine_ls_shell.R_factor_R_work                  0.455 
_refine_ls_shell.percent_reflns_obs               36.7 
_refine_ls_shell.R_factor_R_free                  0.512 
_refine_ls_shell.R_factor_R_free_error            0.062 
_refine_ls_shell.percent_reflns_R_free            8.2 
_refine_ls_shell.number_reflns_R_free             68 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM  PROTEIN.TOP      'X-RAY DIFFRACTION' 
2 WATER_REP.PARAM    ION.TOP          'X-RAY DIFFRACTION' 
3 ION.PARAM          KEG_12JUL02.TOP  'X-RAY DIFFRACTION' 
4 KEG_18JAN02.PAR    CARBOHYDRATE.TOP 'X-RAY DIFFRACTION' 
5 CARBOHYDRATE.PARAM WATER.TOP        'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1N7D 
_struct.title                     'Extracellular domain of the LDL receptor' 
_struct.pdbx_descriptor           'Low-density lipoprotein receptor' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1N7D 
_struct_keywords.pdbx_keywords   'LIPID TRANSPORT' 
_struct_keywords.text            'LDL-Receptor, familial hypercholesterolemia, LDL, cholesterol metabolism, LIPID TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 5 ? 
M N N 5 ? 
N N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?    ? A CYS 47  SG  ? ? ? 1_555 A CYS 61  SG ? ? A CYS 47  A CYS 61   1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf2  disulf ?    ? A CYS 54  SG  ? ? ? 1_555 A CYS 74  SG ? ? A CYS 54  A CYS 74   1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf3  disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 83  SG ? ? A CYS 68  A CYS 83   1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf4  disulf ?    ? A CYS 95  SG  ? ? ? 1_555 A CYS 113 SG ? ? A CYS 95  A CYS 113  1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf5  disulf ?    ? A CYS 107 SG  ? ? ? 1_555 A CYS 122 SG ? ? A CYS 107 A CYS 122  1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf6  disulf ?    ? A CYS 127 SG  ? ? ? 1_555 A CYS 139 SG ? ? A CYS 127 A CYS 139  1_555 ? ? ? ? ? ? ? 2.099 ? ?               
disulf7  disulf ?    ? A CYS 134 SG  ? ? ? 1_555 A CYS 152 SG ? ? A CYS 134 A CYS 152  1_555 ? ? ? ? ? ? ? 2.099 ? ?               
disulf8  disulf ?    ? A CYS 146 SG  ? ? ? 1_555 A CYS 163 SG ? ? A CYS 146 A CYS 163  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf9  disulf ?    ? A CYS 176 SG  ? ? ? 1_555 A CYS 188 SG ? ? A CYS 176 A CYS 188  1_555 ? ? ? ? ? ? ? 2.071 ? ?               
disulf10 disulf ?    ? A CYS 183 SG  ? ? ? 1_555 A CYS 201 SG ? ? A CYS 183 A CYS 201  1_555 ? ? ? ? ? ? ? 2.021 ? ?               
disulf11 disulf ?    ? A CYS 195 SG  ? ? ? 1_555 A CYS 210 SG ? ? A CYS 195 A CYS 210  1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf12 disulf ?    ? A CYS 215 SG  ? ? ? 1_555 A CYS 227 SG ? ? A CYS 215 A CYS 227  1_555 ? ? ? ? ? ? ? 2.014 ? ?               
disulf13 disulf ?    ? A CYS 222 SG  ? ? ? 1_555 A CYS 240 SG ? ? A CYS 222 A CYS 240  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf14 disulf ?    ? A CYS 234 SG  ? ? ? 1_555 A CYS 249 SG ? ? A CYS 234 A CYS 249  1_555 ? ? ? ? ? ? ? 2.028 ? ?               
disulf15 disulf ?    ? A CYS 255 SG  ? ? ? 1_555 A CYS 268 SG ? ? A CYS 255 A CYS 268  1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf16 disulf ?    ? A CYS 263 SG  ? ? ? 1_555 A CYS 281 SG ? ? A CYS 263 A CYS 281  1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf17 disulf ?    ? A CYS 275 SG  ? ? ? 1_555 A CYS 292 SG ? ? A CYS 275 A CYS 292  1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf18 disulf ?    ? A CYS 297 SG  ? ? ? 1_555 A CYS 308 SG ? ? A CYS 297 A CYS 308  1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf19 disulf ?    ? A CYS 304 SG  ? ? ? 1_555 A CYS 317 SG ? ? A CYS 304 A CYS 317  1_555 ? ? ? ? ? ? ? 2.019 ? ?               
disulf20 disulf ?    ? A CYS 319 SG  ? ? ? 1_555 A CYS 331 SG ? ? A CYS 319 A CYS 331  1_555 ? ? ? ? ? ? ? 2.020 ? ?               
disulf21 disulf ?    ? A CYS 337 SG  ? ? ? 1_555 A CYS 347 SG ? ? A CYS 337 A CYS 347  1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf22 disulf ?    ? A CYS 343 SG  ? ? ? 1_555 A CYS 356 SG ? ? A CYS 343 A CYS 356  1_555 ? ? ? ? ? ? ? 2.010 ? ?               
disulf23 disulf ?    ? A CYS 358 SG  ? ? ? 1_555 A CYS 371 SG ? ? A CYS 358 A CYS 371  1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf24 disulf ?    ? A CYS 646 SG  ? ? ? 1_555 A CYS 660 SG ? ? A CYS 646 A CYS 660  1_555 ? ? ? ? ? ? ? 2.062 ? ?               
disulf25 disulf ?    ? A CYS 656 SG  ? ? ? 1_555 A CYS 675 SG ? ? A CYS 656 A CYS 675  1_555 ? ? ? ? ? ? ? 2.015 ? ?               
disulf26 disulf ?    ? A CYS 677 SG  ? ? ? 1_555 A CYS 690 SG ? ? A CYS 677 A CYS 690  1_555 ? ? ? ? ? ? ? 2.027 ? ?               
covale1  covale one  ? A ASN 135 ND2 ? ? ? 1_555 B NAG .   C1 ? ? A ASN 135 B NAG 1    1_555 ? ? ? ? ? ? ? 1.728 ? N-Glycosylation 
covale2  covale one  ? A ASN 251 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 251 C NAG 1    1_555 ? ? ? ? ? ? ? 1.833 ? N-Glycosylation 
covale3  covale both ? B NAG .   O4  ? ? ? 1_555 B NAG .   C1 ? ? B NAG 1   B NAG 2    1_555 ? ? ? ? ? ? ? 1.401 ? ?               
covale4  covale both ? B NAG .   O4  ? ? ? 1_555 B BMA .   C1 ? ? B NAG 2   B BMA 3    1_555 ? ? ? ? ? ? ? 1.393 ? ?               
covale5  covale both ? B BMA .   O3  ? ? ? 1_555 B MAN .   C1 ? ? B BMA 3   B MAN 4    1_555 ? ? ? ? ? ? ? 1.400 ? ?               
covale6  covale both ? B BMA .   O6  ? ? ? 1_555 B MAN .   C1 ? ? B BMA 3   B MAN 5    1_555 ? ? ? ? ? ? ? 1.408 ? ?               
covale7  covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2    1_555 ? ? ? ? ? ? ? 1.402 ? ?               
covale8  covale both ? C NAG .   O4  ? ? ? 1_555 C BMA .   C1 ? ? C NAG 2   C BMA 3    1_555 ? ? ? ? ? ? ? 1.393 ? ?               
covale9  covale both ? C BMA .   O6  ? ? ? 1_555 C MAN .   C1 ? ? C BMA 3   C MAN 4    1_555 ? ? ? ? ? ? ? 1.408 ? ?               
metalc1  metalc ?    ? A TRP 66  O   ? ? ? 1_555 K CA  .   CA ? ? A TRP 66  A CA  1008 1_555 ? ? ? ? ? ? ? 2.165 ? ?               
metalc2  metalc ?    ? A GLN 71  O   ? ? ? 1_555 K CA  .   CA ? ? A GLN 71  A CA  1008 1_555 ? ? ? ? ? ? ? 2.864 ? ?               
metalc3  metalc ?    ? A ASP 79  O   ? ? ? 1_555 K CA  .   CA ? ? A ASP 79  A CA  1008 1_555 ? ? ? ? ? ? ? 2.826 ? ?               
metalc4  metalc ?    ? A ASP 79  OD2 ? ? ? 1_555 K CA  .   CA ? ? A ASP 79  A CA  1008 1_555 ? ? ? ? ? ? ? 2.621 ? ?               
metalc5  metalc ?    ? A GLU 80  OE1 ? ? ? 1_555 K CA  .   CA ? ? A GLU 80  A CA  1008 1_555 ? ? ? ? ? ? ? 2.567 ? ?               
metalc6  metalc ?    ? A ASP 108 OD1 ? ? ? 1_555 J CA  .   CA ? ? A ASP 108 A CA  1007 1_555 ? ? ? ? ? ? ? 2.599 ? ?               
metalc7  metalc ?    ? A ASP 112 OD2 ? ? ? 1_555 J CA  .   CA ? ? A ASP 112 A CA  1007 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
metalc8  metalc ?    ? A ASP 118 OD1 ? ? ? 1_555 J CA  .   CA ? ? A ASP 118 A CA  1007 1_555 ? ? ? ? ? ? ? 2.890 ? ?               
metalc9  metalc ?    ? A ASP 147 OD1 ? ? ? 1_555 I CA  .   CA ? ? A ASP 147 A CA  1006 1_555 ? ? ? ? ? ? ? 2.360 ? ?               
metalc10 metalc ?    ? A ASP 147 OD2 ? ? ? 1_555 I CA  .   CA ? ? A ASP 147 A CA  1006 1_555 ? ? ? ? ? ? ? 2.541 ? ?               
metalc11 metalc ?    ? A ASP 149 O   ? ? ? 1_555 I CA  .   CA ? ? A ASP 149 A CA  1006 1_555 ? ? ? ? ? ? ? 2.104 ? ?               
metalc12 metalc ?    ? A ASP 157 OD2 ? ? ? 1_555 I CA  .   CA ? ? A ASP 157 A CA  1006 1_555 ? ? ? ? ? ? ? 2.793 ? ?               
metalc13 metalc ?    ? A ASP 196 OD1 ? ? ? 1_555 F CA  .   CA ? ? A ASP 196 A CA  1003 1_555 ? ? ? ? ? ? ? 2.502 ? ?               
metalc14 metalc ?    ? A GLY 198 O   ? ? ? 1_555 F CA  .   CA ? ? A GLY 198 A CA  1003 1_555 ? ? ? ? ? ? ? 2.157 ? ?               
metalc15 metalc ?    ? A ASP 200 OD1 ? ? ? 1_555 F CA  .   CA ? ? A ASP 200 A CA  1003 1_555 ? ? ? ? ? ? ? 2.133 ? ?               
metalc16 metalc ?    ? A ASP 206 OD2 ? ? ? 1_555 F CA  .   CA ? ? A ASP 206 A CA  1003 1_555 ? ? ? ? ? ? ? 2.943 ? ?               
metalc17 metalc ?    ? A GLU 207 OE1 ? ? ? 1_555 F CA  .   CA ? ? A GLU 207 A CA  1003 1_555 ? ? ? ? ? ? ? 2.432 ? ?               
metalc18 metalc ?    ? A ARG 232 O   ? ? ? 1_555 G CA  .   CA ? ? A ARG 232 A CA  1004 1_555 ? ? ? ? ? ? ? 2.241 ? ?               
metalc19 metalc ?    ? A GLN 233 O   ? ? ? 1_555 G CA  .   CA ? ? A GLN 233 A CA  1004 1_555 ? ? ? ? ? ? ? 2.779 ? ?               
metalc20 metalc ?    ? A GLU 237 O   ? ? ? 1_555 G CA  .   CA ? ? A GLU 237 A CA  1004 1_555 ? ? ? ? ? ? ? 2.748 ? ?               
metalc21 metalc ?    ? A GLU 246 OE1 ? ? ? 1_555 G CA  .   CA ? ? A GLU 246 A CA  1004 1_555 ? ? ? ? ? ? ? 2.789 ? ?               
metalc22 metalc ?    ? A LYS 273 O   ? ? ? 1_555 H CA  .   CA ? ? A LYS 273 A CA  1005 1_555 ? ? ? ? ? ? ? 2.569 ? ?               
metalc23 metalc ?    ? A ASN 276 OD1 ? ? ? 1_555 H CA  .   CA ? ? A ASN 276 A CA  1005 1_555 ? ? ? ? ? ? ? 2.982 ? ?               
metalc24 metalc ?    ? A ASP 280 OD2 ? ? ? 1_555 H CA  .   CA ? ? A ASP 280 A CA  1005 1_555 ? ? ? ? ? ? ? 2.744 ? ?               
metalc25 metalc ?    ? A ASP 286 OD1 ? ? ? 1_555 H CA  .   CA ? ? A ASP 286 A CA  1005 1_555 ? ? ? ? ? ? ? 2.553 ? ?               
metalc26 metalc ?    ? A GLU 287 OE2 ? ? ? 1_555 H CA  .   CA ? ? A GLU 287 A CA  1005 1_555 ? ? ? ? ? ? ? 2.690 ? ?               
metalc27 metalc ?    ? A THR 294 OG1 ? ? ? 1_555 D CA  .   CA ? ? A THR 294 A CA  1001 1_555 ? ? ? ? ? ? ? 2.905 ? ?               
metalc28 metalc ?    ? A ASN 295 N   ? ? ? 1_555 D CA  .   CA ? ? A ASN 295 A CA  1001 1_555 ? ? ? ? ? ? ? 2.512 ? ?               
metalc29 metalc ?    ? A GLU 296 OE2 ? ? ? 1_555 D CA  .   CA ? ? A GLU 296 A CA  1001 1_555 ? ? ? ? ? ? ? 2.780 ? ?               
metalc30 metalc ?    ? A ASP 310 OD1 ? ? ? 1_555 D CA  .   CA ? ? A ASP 310 A CA  1001 1_555 ? ? ? ? ? ? ? 2.427 ? ?               
metalc31 metalc ?    ? A LEU 311 O   ? ? ? 1_555 D CA  .   CA ? ? A LEU 311 A CA  1001 1_555 ? ? ? ? ? ? ? 2.049 ? ?               
metalc32 metalc ?    ? A ILE 313 N   ? ? ? 1_555 D CA  .   CA ? ? A ILE 313 A CA  1001 1_555 ? ? ? ? ? ? ? 2.855 ? ?               
metalc33 metalc ?    ? A ASP 333 OD1 ? ? ? 1_555 E CA  .   CA ? ? A ASP 333 A CA  1002 1_555 ? ? ? ? ? ? ? 2.988 ? ?               
metalc34 metalc ?    ? A ASP 333 OD2 ? ? ? 1_555 E CA  .   CA ? ? A ASP 333 A CA  1002 1_555 ? ? ? ? ? ? ? 2.900 ? ?               
metalc35 metalc ?    ? A ILE 334 O   ? ? ? 1_555 E CA  .   CA ? ? A ILE 334 A CA  1002 1_555 ? ? ? ? ? ? ? 2.354 ? ?               
metalc36 metalc ?    ? A GLU 336 OE1 ? ? ? 1_555 E CA  .   CA ? ? A GLU 336 A CA  1002 1_555 ? ? ? ? ? ? ? 2.793 ? ?               
metalc37 metalc ?    ? A GLU 336 OE2 ? ? ? 1_555 E CA  .   CA ? ? A GLU 336 A CA  1002 1_555 ? ? ? ? ? ? ? 2.821 ? ?               
metalc38 metalc ?    ? A ASN 349 OD1 ? ? ? 1_555 E CA  .   CA ? ? A ASN 349 A CA  1002 1_555 ? ? ? ? ? ? ? 2.233 ? ?               
metalc39 metalc ?    ? A LEU 350 O   ? ? ? 1_555 E CA  .   CA ? ? A LEU 350 A CA  1002 1_555 ? ? ? ? ? ? ? 2.096 ? ?               
metalc40 metalc ?    ? A LYS 582 NZ  ? ? ? 1_555 F CA  .   CA ? ? A LYS 582 A CA  1003 1_555 ? ? ? ? ? ? ? 2.985 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
metalc ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASP 
_struct_mon_prot_cis.label_seq_id           339 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASP 
_struct_mon_prot_cis.auth_seq_id            339 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    340 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     340 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.60 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 4 ? 
I ? 4 ? 
J ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
I 1 2 ? anti-parallel 
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 219 ? GLN A 221 ? GLU A 219 GLN A 221 
A 2 CYS A 227 ? HIS A 229 ? CYS A 227 HIS A 229 
B 1 LYS A 390 ? MET A 391 ? LYS A 390 MET A 391 
B 2 TYR A 398 ? THR A 399 ? TYR A 398 THR A 399 
C 1 ASP A 412 ? GLU A 414 ? ASP A 412 GLU A 414 
C 2 ARG A 419 ? TRP A 422 ? ARG A 419 TRP A 422 
C 3 CYS A 431 ? GLN A 434 ? CYS A 431 GLN A 434 
D 1 LEU A 458 ? ALA A 459 ? LEU A 458 ALA A 459 
D 2 TYR A 468 ? TRP A 469 ? TYR A 468 TRP A 469 
E 1 VAL A 477 ? ALA A 480 ? VAL A 477 ALA A 480 
E 2 ARG A 487 ? LEU A 490 ? ARG A 487 LEU A 490 
F 1 ILE A 501 ? VAL A 502 ? ILE A 501 VAL A 502 
F 2 TYR A 511 ? TRP A 512 ? TYR A 511 TRP A 512 
G 1 ILE A 521 ? LYS A 522 ? ILE A 521 LYS A 522 
G 2 SER A 533 ? LEU A 534 ? SER A 533 LEU A 534 
H 1 ILE A 545 ? LEU A 547 ? ILE A 545 LEU A 547 
H 2 LEU A 554 ? ASP A 558 ? LEU A 554 ASP A 558 
H 3 SER A 563 ? ILE A 567 ? SER A 563 ILE A 567 
H 4 LYS A 575 ? ILE A 577 ? LYS A 575 ILE A 577 
I 1 ALA A 591 ? PHE A 593 ? ALA A 591 PHE A 593 
I 2 LYS A 596 ? THR A 600 ? LYS A 596 THR A 600 
I 3 ILE A 607 ? ASN A 611 ? ILE A 607 ASN A 611 
I 4 GLY A 615 ? ASN A 619 ? GLY A 615 ASN A 619 
J 1 LEU A 682 ? LEU A 683 ? LEU A 682 LEU A 683 
J 2 CYS A 690 ? LEU A 691 ? CYS A 690 LEU A 691 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N PHE A 220 ? N PHE A 220 O ILE A 228 ? O ILE A 228 
B 1 2 N LYS A 390 ? N LYS A 390 O THR A 399 ? O THR A 399 
C 1 2 N GLU A 414 ? N GLU A 414 O ARG A 419 ? O ARG A 419 
C 2 3 N TRP A 422 ? N TRP A 422 O CYS A 431 ? O CYS A 431 
D 1 2 N ALA A 459 ? N ALA A 459 O TYR A 468 ? O TYR A 468 
E 1 2 N VAL A 477 ? N VAL A 477 O LEU A 490 ? O LEU A 490 
F 1 2 N VAL A 502 ? N VAL A 502 O TYR A 511 ? O TYR A 511 
G 1 2 N ILE A 521 ? N ILE A 521 O LEU A 534 ? O LEU A 534 
H 1 2 N THR A 546 ? N THR A 546 O TYR A 555 ? O TYR A 555 
H 2 3 N LEU A 554 ? N LEU A 554 O ILE A 567 ? O ILE A 567 
H 3 4 N SER A 566 ? N SER A 566 O LYS A 575 ? O LYS A 575 
I 1 2 N ALA A 591 ? N ALA A 591 O PHE A 598 ? O PHE A 598 
I 2 3 N VAL A 597 ? N VAL A 597 O ALA A 610 ? O ALA A 610 
I 3 4 N ASN A 611 ? N ASN A 611 O GLY A 615 ? O GLY A 615 
J 1 2 O LEU A 682 ? O LEU A 682 N LEU A 691 ? N LEU A 691 
# 
_database_PDB_matrix.entry_id          1N7D 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1N7D 
_atom_sites.fract_transf_matrix[1][1]   0.005397 
_atom_sites.fract_transf_matrix[1][2]   0.003116 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006232 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011739 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
W  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 44  ? 4.883   60.555  7.663   1.00 124.70 ? 44   SER A N   1 
ATOM   2    C  CA  . SER A 1 44  ? 3.635   59.805  7.325   1.00 124.70 ? 44   SER A CA  1 
ATOM   3    C  C   . SER A 1 44  ? 4.017   58.469  6.707   1.00 124.70 ? 44   SER A C   1 
ATOM   4    O  O   . SER A 1 44  ? 3.605   58.159  5.592   1.00 124.70 ? 44   SER A O   1 
ATOM   5    C  CB  . SER A 1 44  ? 2.769   60.618  6.350   1.00 124.70 ? 44   SER A CB  1 
ATOM   6    N  N   . VAL A 1 45  ? 4.780   57.682  7.469   1.00 124.70 ? 45   VAL A N   1 
ATOM   7    C  CA  . VAL A 1 45  ? 5.271   56.379  7.043   1.00 124.70 ? 45   VAL A CA  1 
ATOM   8    C  C   . VAL A 1 45  ? 4.243   55.350  6.587   1.00 124.70 ? 45   VAL A C   1 
ATOM   9    O  O   . VAL A 1 45  ? 3.388   54.851  7.325   1.00 124.70 ? 45   VAL A O   1 
ATOM   10   C  CB  . VAL A 1 45  ? 6.227   55.761  8.119   1.00 124.70 ? 45   VAL A CB  1 
ATOM   11   C  CG1 . VAL A 1 45  ? 5.812   54.337  8.491   1.00 124.70 ? 45   VAL A CG1 1 
ATOM   12   C  CG2 . VAL A 1 45  ? 7.658   55.757  7.576   1.00 124.70 ? 45   VAL A CG2 1 
ATOM   13   N  N   . THR A 1 46  ? 4.397   55.081  5.307   1.00 124.70 ? 46   THR A N   1 
ATOM   14   C  CA  . THR A 1 46  ? 3.660   54.165  4.453   1.00 124.70 ? 46   THR A CA  1 
ATOM   15   C  C   . THR A 1 46  ? 4.439   54.740  3.294   1.00 124.70 ? 46   THR A C   1 
ATOM   16   O  O   . THR A 1 46  ? 3.875   55.053  2.238   1.00 124.70 ? 46   THR A O   1 
ATOM   17   C  CB  . THR A 1 46  ? 2.155   54.545  4.218   1.00 124.70 ? 46   THR A CB  1 
ATOM   18   O  OG1 . THR A 1 46  ? 1.852   55.797  4.851   1.00 124.70 ? 46   THR A OG1 1 
ATOM   19   C  CG2 . THR A 1 46  ? 1.229   53.442  4.737   1.00 124.70 ? 46   THR A CG2 1 
ATOM   20   N  N   . CYS A 1 47  ? 5.737   54.940  3.561   1.00 124.70 ? 47   CYS A N   1 
ATOM   21   C  CA  . CYS A 1 47  ? 6.678   55.537  2.617   1.00 124.70 ? 47   CYS A CA  1 
ATOM   22   C  C   . CYS A 1 47  ? 6.275   55.291  1.204   1.00 124.70 ? 47   CYS A C   1 
ATOM   23   O  O   . CYS A 1 47  ? 5.584   54.293  0.931   1.00 124.70 ? 47   CYS A O   1 
ATOM   24   C  CB  . CYS A 1 47  ? 8.106   54.999  2.788   1.00 124.70 ? 47   CYS A CB  1 
ATOM   25   S  SG  . CYS A 1 47  ? 9.232   56.398  3.029   1.00 124.70 ? 47   CYS A SG  1 
ATOM   26   N  N   . LYS A 1 48  ? 6.700   56.194  0.310   1.00 124.70 ? 48   LYS A N   1 
ATOM   27   C  CA  . LYS A 1 48  ? 6.408   56.018  -1.112  1.00 124.70 ? 48   LYS A CA  1 
ATOM   28   C  C   . LYS A 1 48  ? 6.668   54.551  -1.073  1.00 124.70 ? 48   LYS A C   1 
ATOM   29   O  O   . LYS A 1 48  ? 7.785   54.168  -0.732  1.00 124.70 ? 48   LYS A O   1 
ATOM   30   C  CB  . LYS A 1 48  ? 7.476   56.651  -2.006  1.00 124.70 ? 48   LYS A CB  1 
ATOM   31   C  CG  . LYS A 1 48  ? 7.483   58.149  -2.067  1.00 124.70 ? 48   LYS A CG  1 
ATOM   32   C  CD  . LYS A 1 48  ? 8.609   58.595  -2.959  1.00 124.70 ? 48   LYS A CD  1 
ATOM   33   C  CE  . LYS A 1 48  ? 8.727   60.105  -2.979  1.00 124.70 ? 48   LYS A CE  1 
ATOM   34   N  NZ  . LYS A 1 48  ? 9.824   60.552  -3.887  1.00 124.70 ? 48   LYS A NZ  1 
ATOM   35   N  N   . SER A 1 49  ? 5.670   53.717  -1.341  1.00 124.70 ? 49   SER A N   1 
ATOM   36   C  CA  . SER A 1 49  ? 5.963   52.306  -1.238  1.00 124.70 ? 49   SER A CA  1 
ATOM   37   C  C   . SER A 1 49  ? 7.296   52.073  -1.949  1.00 124.70 ? 49   SER A C   1 
ATOM   38   O  O   . SER A 1 49  ? 7.350   51.778  -3.148  1.00 124.70 ? 49   SER A O   1 
ATOM   39   C  CB  . SER A 1 49  ? 4.845   51.467  -1.832  1.00 124.70 ? 49   SER A CB  1 
ATOM   40   O  OG  . SER A 1 49  ? 4.675   50.315  -1.025  1.00 124.70 ? 49   SER A OG  1 
ATOM   41   N  N   . GLY A 1 50  ? 8.367   52.249  -1.171  1.00 124.70 ? 50   GLY A N   1 
ATOM   42   C  CA  . GLY A 1 50  ? 9.730   52.111  -1.651  1.00 124.70 ? 50   GLY A CA  1 
ATOM   43   C  C   . GLY A 1 50  ? 10.752  51.884  -0.541  1.00 124.70 ? 50   GLY A C   1 
ATOM   44   O  O   . GLY A 1 50  ? 10.408  51.688  0.631   1.00 124.70 ? 50   GLY A O   1 
ATOM   45   N  N   . ASP A 1 51  ? 12.020  51.981  -0.926  1.00 124.70 ? 51   ASP A N   1 
ATOM   46   C  CA  . ASP A 1 51  ? 13.180  51.731  -0.073  1.00 124.70 ? 51   ASP A CA  1 
ATOM   47   C  C   . ASP A 1 51  ? 13.959  53.013  0.434   1.00 124.70 ? 51   ASP A C   1 
ATOM   48   O  O   . ASP A 1 51  ? 15.168  52.910  0.464   1.00 124.70 ? 51   ASP A O   1 
ATOM   49   C  CB  . ASP A 1 51  ? 14.102  50.819  -0.961  1.00 124.70 ? 51   ASP A CB  1 
ATOM   50   C  CG  . ASP A 1 51  ? 15.120  49.943  -0.190  1.00 124.70 ? 51   ASP A CG  1 
ATOM   51   O  OD1 . ASP A 1 51  ? 15.573  50.309  0.910   1.00 124.70 ? 51   ASP A OD1 1 
ATOM   52   O  OD2 . ASP A 1 51  ? 15.503  48.873  -0.738  1.00 124.70 ? 51   ASP A OD2 1 
ATOM   53   N  N   . PHE A 1 52  ? 13.402  54.168  0.886   1.00 124.70 ? 52   PHE A N   1 
ATOM   54   C  CA  . PHE A 1 52  ? 14.399  55.265  1.231   1.00 124.70 ? 52   PHE A CA  1 
ATOM   55   C  C   . PHE A 1 52  ? 14.198  56.778  1.744   1.00 124.70 ? 52   PHE A C   1 
ATOM   56   O  O   . PHE A 1 52  ? 13.747  57.542  0.919   1.00 124.70 ? 52   PHE A O   1 
ATOM   57   C  CB  . PHE A 1 52  ? 15.238  55.400  -0.039  1.00 124.70 ? 52   PHE A CB  1 
ATOM   58   C  CG  . PHE A 1 52  ? 16.540  56.073  0.156   1.00 124.70 ? 52   PHE A CG  1 
ATOM   59   C  CD1 . PHE A 1 52  ? 17.704  55.331  0.068   1.00 124.70 ? 52   PHE A CD1 1 
ATOM   60   C  CD2 . PHE A 1 52  ? 16.621  57.440  0.431   1.00 124.70 ? 52   PHE A CD2 1 
ATOM   61   C  CE1 . PHE A 1 52  ? 18.945  55.926  0.259   1.00 124.70 ? 52   PHE A CE1 1 
ATOM   62   C  CE2 . PHE A 1 52  ? 17.852  58.052  0.626   1.00 124.70 ? 52   PHE A CE2 1 
ATOM   63   C  CZ  . PHE A 1 52  ? 19.022  57.291  0.537   1.00 124.70 ? 52   PHE A CZ  1 
ATOM   64   N  N   . SER A 1 53  ? 14.555  57.265  2.968   1.00 124.70 ? 53   SER A N   1 
ATOM   65   C  CA  . SER A 1 53  ? 14.414  58.763  3.295   1.00 124.70 ? 53   SER A CA  1 
ATOM   66   C  C   . SER A 1 53  ? 15.249  59.491  4.430   1.00 124.70 ? 53   SER A C   1 
ATOM   67   O  O   . SER A 1 53  ? 15.672  58.829  5.374   1.00 124.70 ? 53   SER A O   1 
ATOM   68   C  CB  . SER A 1 53  ? 12.946  59.162  3.484   1.00 124.70 ? 53   SER A CB  1 
ATOM   69   O  OG  . SER A 1 53  ? 12.122  58.043  3.750   1.00 124.70 ? 53   SER A OG  1 
ATOM   70   N  N   . CYS A 1 54  ? 15.421  60.841  4.338   1.00 124.70 ? 54   CYS A N   1 
ATOM   71   C  CA  . CYS A 1 54  ? 16.260  61.743  5.241   1.00 124.70 ? 54   CYS A CA  1 
ATOM   72   C  C   . CYS A 1 54  ? 15.599  62.844  6.146   1.00 124.70 ? 54   CYS A C   1 
ATOM   73   O  O   . CYS A 1 54  ? 14.618  62.626  6.863   1.00 124.70 ? 54   CYS A O   1 
ATOM   74   C  CB  . CYS A 1 54  ? 17.269  62.532  4.364   1.00 124.70 ? 54   CYS A CB  1 
ATOM   75   S  SG  . CYS A 1 54  ? 16.536  64.083  3.673   1.00 124.70 ? 54   CYS A SG  1 
ATOM   76   N  N   . GLY A 1 55  ? 16.216  64.029  6.110   1.00 124.70 ? 55   GLY A N   1 
ATOM   77   C  CA  . GLY A 1 55  ? 15.699  65.211  6.780   1.00 124.70 ? 55   GLY A CA  1 
ATOM   78   C  C   . GLY A 1 55  ? 15.881  65.477  8.249   1.00 124.70 ? 55   GLY A C   1 
ATOM   79   O  O   . GLY A 1 55  ? 16.965  65.319  8.804   1.00 124.70 ? 55   GLY A O   1 
ATOM   80   N  N   . GLY A 1 56  ? 14.782  65.895  8.869   1.00 124.70 ? 56   GLY A N   1 
ATOM   81   C  CA  . GLY A 1 56  ? 14.780  66.226  10.284  1.00 124.70 ? 56   GLY A CA  1 
ATOM   82   C  C   . GLY A 1 56  ? 14.633  67.738  10.476  1.00 124.70 ? 56   GLY A C   1 
ATOM   83   O  O   . GLY A 1 56  ? 15.639  68.412  10.790  1.00 124.70 ? 56   GLY A O   1 
ATOM   84   N  N   . ASN A 1 59  ? 12.184  63.580  5.653   1.00 124.70 ? 59   ASN A N   1 
ATOM   85   C  CA  . ASN A 1 59  ? 11.525  63.709  4.319   1.00 124.70 ? 59   ASN A CA  1 
ATOM   86   C  C   . ASN A 1 59  ? 11.302  62.323  3.726   1.00 124.70 ? 59   ASN A C   1 
ATOM   87   O  O   . ASN A 1 59  ? 12.007  61.903  2.808   1.00 124.70 ? 59   ASN A O   1 
ATOM   88   C  CB  . ASN A 1 59  ? 12.387  64.537  3.399   1.00 124.70 ? 59   ASN A CB  1 
ATOM   89   N  N   . ARG A 1 60  ? 10.298  61.633  4.259   1.00 124.70 ? 60   ARG A N   1 
ATOM   90   C  CA  . ARG A 1 60  ? 9.941   60.278  3.852   1.00 124.70 ? 60   ARG A CA  1 
ATOM   91   C  C   . ARG A 1 60  ? 9.858   59.911  2.365   1.00 124.70 ? 60   ARG A C   1 
ATOM   92   O  O   . ARG A 1 60  ? 9.037   60.457  1.629   1.00 124.70 ? 60   ARG A O   1 
ATOM   93   C  CB  . ARG A 1 60  ? 8.614   59.882  4.522   1.00 124.70 ? 60   ARG A CB  1 
ATOM   94   C  CG  . ARG A 1 60  ? 8.692   59.772  6.033   1.00 124.70 ? 60   ARG A CG  1 
ATOM   95   C  CD  . ARG A 1 60  ? 9.798   58.806  6.435   1.00 124.70 ? 60   ARG A CD  1 
ATOM   96   N  NE  . ARG A 1 60  ? 9.997   58.778  7.877   1.00 124.70 ? 60   ARG A NE  1 
ATOM   97   C  CZ  . ARG A 1 60  ? 10.890  58.011  8.493   1.00 124.70 ? 60   ARG A CZ  1 
ATOM   98   N  NH1 . ARG A 1 60  ? 11.675  57.203  7.789   1.00 124.70 ? 60   ARG A NH1 1 
ATOM   99   N  NH2 . ARG A 1 60  ? 10.997  58.051  9.818   1.00 124.70 ? 60   ARG A NH2 1 
ATOM   100  N  N   . CYS A 1 61  ? 10.720  58.967  1.957   1.00 124.70 ? 61   CYS A N   1 
ATOM   101  C  CA  . CYS A 1 61  ? 10.771  58.342  0.616   1.00 124.70 ? 61   CYS A CA  1 
ATOM   102  C  C   . CYS A 1 61  ? 11.383  58.951  -0.681  1.00 124.70 ? 61   CYS A C   1 
ATOM   103  O  O   . CYS A 1 61  ? 10.661  59.374  -1.569  1.00 124.70 ? 61   CYS A O   1 
ATOM   104  C  CB  . CYS A 1 61  ? 9.349   57.811  0.343   1.00 124.70 ? 61   CYS A CB  1 
ATOM   105  S  SG  . CYS A 1 61  ? 8.358   57.833  1.887   1.00 124.70 ? 61   CYS A SG  1 
ATOM   106  N  N   . ILE A 1 62  ? 12.715  58.942  -0.802  1.00 124.70 ? 62   ILE A N   1 
ATOM   107  C  CA  . ILE A 1 62  ? 13.397  59.462  -2.006  1.00 124.70 ? 62   ILE A CA  1 
ATOM   108  C  C   . ILE A 1 62  ? 14.061  58.335  -2.842  1.00 124.70 ? 62   ILE A C   1 
ATOM   109  O  O   . ILE A 1 62  ? 14.502  57.321  -2.297  1.00 124.70 ? 62   ILE A O   1 
ATOM   110  C  CB  . ILE A 1 62  ? 14.450  60.583  -1.641  1.00 124.70 ? 62   ILE A CB  1 
ATOM   111  C  CG1 . ILE A 1 62  ? 13.789  61.969  -1.719  1.00 124.70 ? 62   ILE A CG1 1 
ATOM   112  C  CG2 . ILE A 1 62  ? 15.653  60.534  -2.590  1.00 124.70 ? 62   ILE A CG2 1 
ATOM   113  C  CD1 . ILE A 1 62  ? 12.468  62.091  -0.972  1.00 124.70 ? 62   ILE A CD1 1 
ATOM   114  N  N   . PRO A 1 63  ? 14.111  58.509  -4.183  1.00 124.70 ? 63   PRO A N   1 
ATOM   115  C  CA  . PRO A 1 63  ? 14.635  57.691  -5.293  1.00 124.70 ? 63   PRO A CA  1 
ATOM   116  C  C   . PRO A 1 63  ? 15.860  56.796  -5.172  1.00 124.70 ? 63   PRO A C   1 
ATOM   117  O  O   . PRO A 1 63  ? 16.439  56.408  -6.192  1.00 124.70 ? 63   PRO A O   1 
ATOM   118  C  CB  . PRO A 1 63  ? 14.813  58.715  -6.401  1.00 124.70 ? 63   PRO A CB  1 
ATOM   119  C  CG  . PRO A 1 63  ? 13.586  59.530  -6.229  1.00 124.70 ? 63   PRO A CG  1 
ATOM   120  C  CD  . PRO A 1 63  ? 13.546  59.762  -4.725  1.00 124.70 ? 63   PRO A CD  1 
ATOM   121  N  N   . GLN A 1 64  ? 16.237  56.449  -3.948  1.00 124.70 ? 64   GLN A N   1 
ATOM   122  C  CA  . GLN A 1 64  ? 17.396  55.597  -3.715  1.00 124.70 ? 64   GLN A CA  1 
ATOM   123  C  C   . GLN A 1 64  ? 18.617  56.079  -4.476  1.00 124.70 ? 64   GLN A C   1 
ATOM   124  O  O   . GLN A 1 64  ? 19.673  55.443  -4.389  1.00 124.70 ? 64   GLN A O   1 
ATOM   125  C  CB  . GLN A 1 64  ? 17.092  54.149  -4.087  1.00 124.70 ? 64   GLN A CB  1 
ATOM   126  N  N   . PHE A 1 65  ? 18.491  57.160  -5.256  1.00 124.70 ? 65   PHE A N   1 
ATOM   127  C  CA  . PHE A 1 65  ? 19.680  57.659  -5.920  1.00 124.70 ? 65   PHE A CA  1 
ATOM   128  C  C   . PHE A 1 65  ? 20.018  59.120  -5.759  1.00 124.70 ? 65   PHE A C   1 
ATOM   129  O  O   . PHE A 1 65  ? 21.171  59.465  -5.985  1.00 124.70 ? 65   PHE A O   1 
ATOM   130  C  CB  . PHE A 1 65  ? 19.793  57.223  -7.382  1.00 124.70 ? 65   PHE A CB  1 
ATOM   131  C  CG  . PHE A 1 65  ? 21.001  56.338  -7.627  1.00 124.70 ? 65   PHE A CG  1 
ATOM   132  C  CD1 . PHE A 1 65  ? 20.889  54.947  -7.594  1.00 124.70 ? 65   PHE A CD1 1 
ATOM   133  C  CD2 . PHE A 1 65  ? 22.272  56.896  -7.786  1.00 124.70 ? 65   PHE A CD2 1 
ATOM   134  C  CE1 . PHE A 1 65  ? 22.020  54.125  -7.713  1.00 124.70 ? 65   PHE A CE1 1 
ATOM   135  C  CE2 . PHE A 1 65  ? 23.411  56.083  -7.906  1.00 124.70 ? 65   PHE A CE2 1 
ATOM   136  C  CZ  . PHE A 1 65  ? 23.281  54.695  -7.868  1.00 124.70 ? 65   PHE A CZ  1 
ATOM   137  N  N   . TRP A 1 66  ? 19.081  59.989  -5.353  1.00 124.70 ? 66   TRP A N   1 
ATOM   138  C  CA  . TRP A 1 66  ? 19.542  61.351  -5.083  1.00 124.70 ? 66   TRP A CA  1 
ATOM   139  C  C   . TRP A 1 66  ? 20.490  60.926  -3.972  1.00 124.70 ? 66   TRP A C   1 
ATOM   140  O  O   . TRP A 1 66  ? 21.274  61.721  -3.490  1.00 124.70 ? 66   TRP A O   1 
ATOM   141  C  CB  . TRP A 1 66  ? 18.477  62.290  -4.510  1.00 124.70 ? 66   TRP A CB  1 
ATOM   142  C  CG  . TRP A 1 66  ? 17.545  62.929  -5.525  1.00 124.70 ? 66   TRP A CG  1 
ATOM   143  C  CD1 . TRP A 1 66  ? 16.191  62.773  -5.582  1.00 124.70 ? 66   TRP A CD1 1 
ATOM   144  C  CD2 . TRP A 1 66  ? 17.881  63.870  -6.569  1.00 124.70 ? 66   TRP A CD2 1 
ATOM   145  N  NE1 . TRP A 1 66  ? 15.659  63.554  -6.576  1.00 124.70 ? 66   TRP A NE1 1 
ATOM   146  C  CE2 . TRP A 1 66  ? 16.667  64.241  -7.196  1.00 124.70 ? 66   TRP A CE2 1 
ATOM   147  C  CE3 . TRP A 1 66  ? 19.081  64.445  -7.025  1.00 124.70 ? 66   TRP A CE3 1 
ATOM   148  C  CZ2 . TRP A 1 66  ? 16.618  65.158  -8.270  1.00 124.70 ? 66   TRP A CZ2 1 
ATOM   149  C  CZ3 . TRP A 1 66  ? 19.031  65.368  -8.101  1.00 124.70 ? 66   TRP A CZ3 1 
ATOM   150  C  CH2 . TRP A 1 66  ? 17.804  65.712  -8.701  1.00 124.70 ? 66   TRP A CH2 1 
ATOM   151  N  N   . ARG A 1 67  ? 20.365  59.636  -3.601  1.00 124.70 ? 67   ARG A N   1 
ATOM   152  C  CA  . ARG A 1 67  ? 21.180  58.893  -2.615  1.00 124.70 ? 67   ARG A CA  1 
ATOM   153  C  C   . ARG A 1 67  ? 22.593  58.822  -3.181  1.00 124.70 ? 67   ARG A C   1 
ATOM   154  O  O   . ARG A 1 67  ? 22.848  58.147  -4.189  1.00 124.70 ? 67   ARG A O   1 
ATOM   155  C  CB  . ARG A 1 67  ? 20.662  57.440  -2.436  1.00 124.70 ? 67   ARG A CB  1 
ATOM   156  C  CG  . ARG A 1 67  ? 21.686  56.429  -1.823  1.00 124.70 ? 67   ARG A CG  1 
ATOM   157  C  CD  . ARG A 1 67  ? 21.732  55.029  -2.535  1.00 124.70 ? 67   ARG A CD  1 
ATOM   158  N  NE  . ARG A 1 67  ? 22.772  54.138  -1.992  1.00 124.70 ? 67   ARG A NE  1 
ATOM   159  C  CZ  . ARG A 1 67  ? 23.150  52.970  -2.519  1.00 124.70 ? 67   ARG A CZ  1 
ATOM   160  N  NH1 . ARG A 1 67  ? 22.583  52.510  -3.628  1.00 124.70 ? 67   ARG A NH1 1 
ATOM   161  N  NH2 . ARG A 1 67  ? 24.105  52.254  -1.933  1.00 124.70 ? 67   ARG A NH2 1 
ATOM   162  N  N   . CYS A 1 68  ? 23.507  59.514  -2.518  1.00 124.70 ? 68   CYS A N   1 
ATOM   163  C  CA  . CYS A 1 68  ? 24.891  59.578  -2.944  1.00 124.70 ? 68   CYS A CA  1 
ATOM   164  C  C   . CYS A 1 68  ? 25.145  59.556  -4.421  1.00 124.70 ? 68   CYS A C   1 
ATOM   165  O  O   . CYS A 1 68  ? 26.148  59.041  -4.924  1.00 124.70 ? 68   CYS A O   1 
ATOM   166  C  CB  . CYS A 1 68  ? 25.715  58.585  -2.139  1.00 124.70 ? 68   CYS A CB  1 
ATOM   167  S  SG  . CYS A 1 68  ? 25.818  59.700  -0.737  1.00 124.70 ? 68   CYS A SG  1 
ATOM   168  N  N   . ASP A 1 69  ? 24.193  60.195  -5.091  1.00 124.70 ? 69   ASP A N   1 
ATOM   169  C  CA  . ASP A 1 69  ? 24.220  60.413  -6.519  1.00 124.70 ? 69   ASP A CA  1 
ATOM   170  C  C   . ASP A 1 69  ? 25.188  61.574  -6.554  1.00 124.70 ? 69   ASP A C   1 
ATOM   171  O  O   . ASP A 1 69  ? 25.430  62.163  -7.608  1.00 124.70 ? 69   ASP A O   1 
ATOM   172  C  CB  . ASP A 1 69  ? 22.868  60.924  -7.023  1.00 124.70 ? 69   ASP A CB  1 
ATOM   173  C  CG  . ASP A 1 69  ? 22.595  62.391  -6.628  1.00 124.70 ? 69   ASP A CG  1 
ATOM   174  O  OD1 . ASP A 1 69  ? 23.029  62.834  -5.533  1.00 124.70 ? 69   ASP A OD1 1 
ATOM   175  O  OD2 . ASP A 1 69  ? 21.927  63.098  -7.422  1.00 124.70 ? 69   ASP A OD2 1 
ATOM   176  N  N   . GLY A 1 70  ? 25.710  61.920  -5.378  1.00 124.70 ? 70   GLY A N   1 
ATOM   177  C  CA  . GLY A 1 70  ? 26.623  63.041  -5.276  1.00 124.70 ? 70   GLY A CA  1 
ATOM   178  C  C   . GLY A 1 70  ? 25.910  64.305  -5.721  1.00 124.70 ? 70   GLY A C   1 
ATOM   179  O  O   . GLY A 1 70  ? 25.883  64.614  -6.913  1.00 124.70 ? 70   GLY A O   1 
ATOM   180  N  N   . GLN A 1 71  ? 25.316  65.030  -4.779  1.00 124.70 ? 71   GLN A N   1 
ATOM   181  C  CA  . GLN A 1 71  ? 24.615  66.267  -5.106  1.00 124.70 ? 71   GLN A CA  1 
ATOM   182  C  C   . GLN A 1 71  ? 23.773  66.716  -3.925  1.00 124.70 ? 71   GLN A C   1 
ATOM   183  O  O   . GLN A 1 71  ? 22.651  66.246  -3.748  1.00 124.70 ? 71   GLN A O   1 
ATOM   184  C  CB  . GLN A 1 71  ? 23.726  66.070  -6.334  1.00 124.70 ? 71   GLN A CB  1 
ATOM   185  N  N   . VAL A 1 72  ? 24.316  67.639  -3.132  1.00 124.70 ? 72   VAL A N   1 
ATOM   186  C  CA  . VAL A 1 72  ? 23.654  68.163  -1.933  1.00 124.70 ? 72   VAL A CA  1 
ATOM   187  C  C   . VAL A 1 72  ? 22.172  68.479  -2.064  1.00 124.70 ? 72   VAL A C   1 
ATOM   188  O  O   . VAL A 1 72  ? 21.798  69.568  -2.500  1.00 124.70 ? 72   VAL A O   1 
ATOM   189  C  CB  . VAL A 1 72  ? 24.393  69.418  -1.419  1.00 124.70 ? 72   VAL A CB  1 
ATOM   190  N  N   . ASP A 1 73  ? 21.338  67.517  -1.684  1.00 124.70 ? 73   ASP A N   1 
ATOM   191  C  CA  . ASP A 1 73  ? 19.883  67.669  -1.684  1.00 124.70 ? 73   ASP A CA  1 
ATOM   192  C  C   . ASP A 1 73  ? 19.541  66.867  -0.423  1.00 124.70 ? 73   ASP A C   1 
ATOM   193  O  O   . ASP A 1 73  ? 19.994  65.746  -0.318  1.00 124.70 ? 73   ASP A O   1 
ATOM   194  C  CB  . ASP A 1 73  ? 19.253  67.010  -2.927  1.00 124.70 ? 73   ASP A CB  1 
ATOM   195  C  CG  . ASP A 1 73  ? 19.750  67.611  -4.258  1.00 124.70 ? 73   ASP A CG  1 
ATOM   196  O  OD1 . ASP A 1 73  ? 20.649  67.013  -4.892  1.00 124.70 ? 73   ASP A OD1 1 
ATOM   197  O  OD2 . ASP A 1 73  ? 19.239  68.674  -4.677  1.00 124.70 ? 73   ASP A OD2 1 
ATOM   198  N  N   . CYS A 1 74  ? 18.773  67.420  0.524   1.00 124.70 ? 74   CYS A N   1 
ATOM   199  C  CA  . CYS A 1 74  ? 18.461  66.716  1.794   1.00 124.70 ? 74   CYS A CA  1 
ATOM   200  C  C   . CYS A 1 74  ? 19.569  67.127  2.776   1.00 124.70 ? 74   CYS A C   1 
ATOM   201  O  O   . CYS A 1 74  ? 20.453  66.284  3.084   1.00 124.70 ? 74   CYS A O   1 
ATOM   202  C  CB  . CYS A 1 74  ? 18.500  65.182  1.624   1.00 124.70 ? 74   CYS A CB  1 
ATOM   203  S  SG  . CYS A 1 74  ? 16.964  64.195  1.688   1.00 124.70 ? 74   CYS A SG  1 
ATOM   204  N  N   . ASN A 1 76  ? 18.816  66.433  6.330   1.00 124.70 ? 76   ASN A N   1 
ATOM   205  C  CA  . ASN A 1 76  ? 20.297  66.450  6.502   1.00 124.70 ? 76   ASN A CA  1 
ATOM   206  C  C   . ASN A 1 76  ? 20.836  65.125  7.048   1.00 124.70 ? 76   ASN A C   1 
ATOM   207  O  O   . ASN A 1 76  ? 20.182  64.449  7.842   1.00 124.70 ? 76   ASN A O   1 
ATOM   208  C  CB  . ASN A 1 76  ? 20.692  67.636  7.376   1.00 124.70 ? 76   ASN A CB  1 
ATOM   209  C  CG  . ASN A 1 76  ? 21.218  68.807  6.560   1.00 124.70 ? 76   ASN A CG  1 
ATOM   210  O  OD1 . ASN A 1 76  ? 22.380  68.801  6.136   1.00 124.70 ? 76   ASN A OD1 1 
ATOM   211  N  ND2 . ASN A 1 76  ? 20.364  69.806  6.315   1.00 124.70 ? 76   ASN A ND2 1 
ATOM   212  N  N   . GLY A 1 77  ? 22.045  64.782  6.602   1.00 124.70 ? 77   GLY A N   1 
ATOM   213  C  CA  . GLY A 1 77  ? 22.676  63.516  6.934   1.00 124.70 ? 77   GLY A CA  1 
ATOM   214  C  C   . GLY A 1 77  ? 22.191  62.783  5.706   1.00 124.70 ? 77   GLY A C   1 
ATOM   215  O  O   . GLY A 1 77  ? 21.521  61.753  5.812   1.00 124.70 ? 77   GLY A O   1 
ATOM   216  N  N   . SER A 1 78  ? 22.524  63.314  4.525   1.00 124.70 ? 78   SER A N   1 
ATOM   217  C  CA  . SER A 1 78  ? 21.972  62.710  3.312   1.00 124.70 ? 78   SER A CA  1 
ATOM   218  C  C   . SER A 1 78  ? 22.498  62.775  1.849   1.00 124.70 ? 78   SER A C   1 
ATOM   219  O  O   . SER A 1 78  ? 23.255  63.652  1.441   1.00 124.70 ? 78   SER A O   1 
ATOM   220  C  CB  . SER A 1 78  ? 20.525  63.139  3.221   1.00 124.70 ? 78   SER A CB  1 
ATOM   221  O  OG  . SER A 1 78  ? 20.399  63.953  2.074   1.00 124.70 ? 78   SER A OG  1 
ATOM   222  N  N   . ASP A 1 79  ? 21.971  61.809  1.090   1.00 124.70 ? 79   ASP A N   1 
ATOM   223  C  CA  . ASP A 1 79  ? 22.127  61.522  -0.346  1.00 124.70 ? 79   ASP A CA  1 
ATOM   224  C  C   . ASP A 1 79  ? 23.289  61.978  -1.262  1.00 124.70 ? 79   ASP A C   1 
ATOM   225  O  O   . ASP A 1 79  ? 23.123  62.162  -2.471  1.00 124.70 ? 79   ASP A O   1 
ATOM   226  C  CB  . ASP A 1 79  ? 20.799  61.882  -1.017  1.00 124.70 ? 79   ASP A CB  1 
ATOM   227  C  CG  . ASP A 1 79  ? 20.625  63.363  -1.181  1.00 124.70 ? 79   ASP A CG  1 
ATOM   228  O  OD1 . ASP A 1 79  ? 20.928  64.066  -0.197  1.00 124.70 ? 79   ASP A OD1 1 
ATOM   229  O  OD2 . ASP A 1 79  ? 20.197  63.811  -2.276  1.00 124.70 ? 79   ASP A OD2 1 
ATOM   230  N  N   . GLU A 1 80  ? 24.461  62.127  -0.681  1.00 124.70 ? 80   GLU A N   1 
ATOM   231  C  CA  . GLU A 1 80  ? 25.719  62.501  -1.344  1.00 124.70 ? 80   GLU A CA  1 
ATOM   232  C  C   . GLU A 1 80  ? 26.422  62.840  -0.049  1.00 124.70 ? 80   GLU A C   1 
ATOM   233  O  O   . GLU A 1 80  ? 27.576  63.281  0.001   1.00 124.70 ? 80   GLU A O   1 
ATOM   234  C  CB  . GLU A 1 80  ? 25.607  63.711  -2.283  1.00 124.70 ? 80   GLU A CB  1 
ATOM   235  C  CG  . GLU A 1 80  ? 25.201  65.005  -1.644  1.00 124.70 ? 80   GLU A CG  1 
ATOM   236  C  CD  . GLU A 1 80  ? 23.711  65.112  -1.530  1.00 124.70 ? 80   GLU A CD  1 
ATOM   237  O  OE1 . GLU A 1 80  ? 23.026  64.614  -2.456  1.00 124.70 ? 80   GLU A OE1 1 
ATOM   238  O  OE2 . GLU A 1 80  ? 23.230  65.699  -0.537  1.00 124.70 ? 80   GLU A OE2 1 
ATOM   239  N  N   . GLN A 1 81  ? 25.648  62.575  1.005   1.00 124.70 ? 81   GLN A N   1 
ATOM   240  C  CA  . GLN A 1 81  ? 26.009  62.739  2.402   1.00 124.70 ? 81   GLN A CA  1 
ATOM   241  C  C   . GLN A 1 81  ? 25.026  61.857  3.200   1.00 124.70 ? 81   GLN A C   1 
ATOM   242  O  O   . GLN A 1 81  ? 24.898  61.971  4.430   1.00 124.70 ? 81   GLN A O   1 
ATOM   243  C  CB  . GLN A 1 81  ? 25.905  64.199  2.818   1.00 124.70 ? 81   GLN A CB  1 
ATOM   244  N  N   . GLY A 1 82  ? 24.305  61.020  2.450   1.00 124.70 ? 82   GLY A N   1 
ATOM   245  C  CA  . GLY A 1 82  ? 23.382  60.031  2.996   1.00 124.70 ? 82   GLY A CA  1 
ATOM   246  C  C   . GLY A 1 82  ? 24.189  58.893  2.438   1.00 124.70 ? 82   GLY A C   1 
ATOM   247  O  O   . GLY A 1 82  ? 23.715  57.810  2.062   1.00 124.70 ? 82   GLY A O   1 
ATOM   248  N  N   . CYS A 1 83  ? 25.477  59.226  2.408   1.00 124.70 ? 83   CYS A N   1 
ATOM   249  C  CA  . CYS A 1 83  ? 26.536  58.425  1.834   1.00 124.70 ? 83   CYS A CA  1 
ATOM   250  C  C   . CYS A 1 83  ? 27.134  57.172  2.376   1.00 124.70 ? 83   CYS A C   1 
ATOM   251  O  O   . CYS A 1 83  ? 27.023  56.833  3.557   1.00 124.70 ? 83   CYS A O   1 
ATOM   252  C  CB  . CYS A 1 83  ? 27.758  59.303  1.483   1.00 124.70 ? 83   CYS A CB  1 
ATOM   253  S  SG  . CYS A 1 83  ? 27.766  59.956  -0.226  1.00 124.70 ? 83   CYS A SG  1 
ATOM   254  N  N   . PRO A 1 84  ? 27.819  56.477  1.449   1.00 124.70 ? 84   PRO A N   1 
ATOM   255  C  CA  . PRO A 1 84  ? 28.595  55.247  1.415   1.00 124.70 ? 84   PRO A CA  1 
ATOM   256  C  C   . PRO A 1 84  ? 29.415  55.133  2.714   1.00 124.70 ? 84   PRO A C   1 
ATOM   257  O  O   . PRO A 1 84  ? 28.804  55.103  3.788   1.00 124.70 ? 84   PRO A O   1 
ATOM   258  C  CB  . PRO A 1 84  ? 29.418  55.435  0.135   1.00 124.70 ? 84   PRO A CB  1 
ATOM   259  C  CG  . PRO A 1 84  ? 28.543  56.422  -0.752  1.00 124.70 ? 84   PRO A CG  1 
ATOM   260  C  CD  . PRO A 1 84  ? 27.336  56.747  0.078   1.00 124.70 ? 84   PRO A CD  1 
ATOM   261  N  N   . PRO A 1 85  ? 30.778  55.080  2.658   1.00 124.70 ? 85   PRO A N   1 
ATOM   262  C  CA  . PRO A 1 85  ? 31.438  54.970  3.969   1.00 124.70 ? 85   PRO A CA  1 
ATOM   263  C  C   . PRO A 1 85  ? 30.601  55.638  5.076   1.00 124.70 ? 85   PRO A C   1 
ATOM   264  O  O   . PRO A 1 85  ? 30.513  56.866  5.132   1.00 124.70 ? 85   PRO A O   1 
ATOM   265  C  CB  . PRO A 1 85  ? 32.781  55.669  3.730   1.00 124.70 ? 85   PRO A CB  1 
ATOM   266  C  CG  . PRO A 1 85  ? 33.115  55.227  2.360   1.00 124.70 ? 85   PRO A CG  1 
ATOM   267  C  CD  . PRO A 1 85  ? 31.785  55.385  1.615   1.00 124.70 ? 85   PRO A CD  1 
ATOM   268  N  N   . LYS A 1 86  ? 29.957  54.821  5.916   1.00 124.70 ? 86   LYS A N   1 
ATOM   269  C  CA  . LYS A 1 86  ? 29.109  55.315  7.010   1.00 124.70 ? 86   LYS A CA  1 
ATOM   270  C  C   . LYS A 1 86  ? 29.919  55.929  8.149   1.00 124.70 ? 86   LYS A C   1 
ATOM   271  O  O   . LYS A 1 86  ? 31.084  55.560  8.346   1.00 124.70 ? 86   LYS A O   1 
ATOM   272  C  CB  . LYS A 1 86  ? 28.230  54.181  7.534   1.00 124.70 ? 86   LYS A CB  1 
ATOM   273  C  CG  . LYS A 1 86  ? 28.957  52.876  7.716   1.00 124.70 ? 86   LYS A CG  1 
ATOM   274  C  CD  . LYS A 1 86  ? 27.955  51.750  7.784   1.00 124.70 ? 86   LYS A CD  1 
ATOM   275  C  CE  . LYS A 1 86  ? 28.638  50.420  8.008   1.00 124.70 ? 86   LYS A CE  1 
ATOM   276  N  NZ  . LYS A 1 86  ? 27.632  49.372  8.340   1.00 124.70 ? 86   LYS A NZ  1 
ATOM   277  N  N   . THR A 1 87  ? 29.321  56.837  8.925   1.00 124.70 ? 87   THR A N   1 
ATOM   278  C  CA  . THR A 1 87  ? 30.136  57.470  9.953   1.00 124.70 ? 87   THR A CA  1 
ATOM   279  C  C   . THR A 1 87  ? 29.639  57.967  11.306  1.00 124.70 ? 87   THR A C   1 
ATOM   280  O  O   . THR A 1 87  ? 28.449  57.922  11.643  1.00 124.70 ? 87   THR A O   1 
ATOM   281  C  CB  . THR A 1 87  ? 30.918  58.652  9.344   1.00 124.70 ? 87   THR A CB  1 
ATOM   282  O  OG1 . THR A 1 87  ? 30.952  58.522  7.919   1.00 124.70 ? 87   THR A OG1 1 
ATOM   283  C  CG2 . THR A 1 87  ? 32.353  58.667  9.863   1.00 124.70 ? 87   THR A CG2 1 
ATOM   284  N  N   . CYS A 1 88  ? 30.651  58.453  12.038  1.00 124.70 ? 88   CYS A N   1 
ATOM   285  C  CA  . CYS A 1 88  ? 30.630  59.028  13.380  1.00 124.70 ? 88   CYS A CA  1 
ATOM   286  C  C   . CYS A 1 88  ? 29.559  58.513  14.323  1.00 124.70 ? 88   CYS A C   1 
ATOM   287  O  O   . CYS A 1 88  ? 28.707  59.272  14.797  1.00 124.70 ? 88   CYS A O   1 
ATOM   288  C  CB  . CYS A 1 88  ? 30.607  60.569  13.286  1.00 124.70 ? 88   CYS A CB  1 
ATOM   289  S  SG  . CYS A 1 88  ? 32.190  61.333  12.661  1.00 124.70 ? 88   CYS A SG  1 
ATOM   290  N  N   . SER A 1 89  ? 29.629  57.210  14.603  1.00 124.70 ? 89   SER A N   1 
ATOM   291  C  CA  . SER A 1 89  ? 28.687  56.546  15.512  1.00 124.70 ? 89   SER A CA  1 
ATOM   292  C  C   . SER A 1 89  ? 29.046  56.867  16.979  1.00 124.70 ? 89   SER A C   1 
ATOM   293  O  O   . SER A 1 89  ? 30.186  56.678  17.421  1.00 124.70 ? 89   SER A O   1 
ATOM   294  C  CB  . SER A 1 89  ? 28.703  55.022  15.270  1.00 124.70 ? 89   SER A CB  1 
ATOM   295  N  N   . GLN A 1 90  ? 28.076  57.368  17.731  1.00 124.70 ? 90   GLN A N   1 
ATOM   296  C  CA  . GLN A 1 90  ? 28.327  57.714  19.121  1.00 124.70 ? 90   GLN A CA  1 
ATOM   297  C  C   . GLN A 1 90  ? 29.483  58.738  19.294  1.00 124.70 ? 90   GLN A C   1 
ATOM   298  O  O   . GLN A 1 90  ? 30.629  58.382  19.645  1.00 124.70 ? 90   GLN A O   1 
ATOM   299  C  CB  . GLN A 1 90  ? 28.598  56.435  19.933  1.00 124.70 ? 90   GLN A CB  1 
ATOM   300  N  N   . ASP A 1 91  ? 29.130  60.007  19.037  1.00 124.70 ? 91   ASP A N   1 
ATOM   301  C  CA  . ASP A 1 91  ? 29.989  61.203  19.138  1.00 124.70 ? 91   ASP A CA  1 
ATOM   302  C  C   . ASP A 1 91  ? 29.381  62.204  18.148  1.00 124.70 ? 91   ASP A C   1 
ATOM   303  O  O   . ASP A 1 91  ? 29.698  62.175  16.964  1.00 124.70 ? 91   ASP A O   1 
ATOM   304  C  CB  . ASP A 1 91  ? 31.470  60.881  18.766  1.00 124.70 ? 91   ASP A CB  1 
ATOM   305  N  N   . GLU A 1 92  ? 28.477  63.062  18.621  1.00 124.70 ? 92   GLU A N   1 
ATOM   306  C  CA  . GLU A 1 92  ? 27.811  64.041  17.739  1.00 124.70 ? 92   GLU A CA  1 
ATOM   307  C  C   . GLU A 1 92  ? 28.782  65.078  17.212  1.00 124.70 ? 92   GLU A C   1 
ATOM   308  O  O   . GLU A 1 92  ? 28.735  66.255  17.588  1.00 124.70 ? 92   GLU A O   1 
ATOM   309  C  CB  . GLU A 1 92  ? 26.659  64.747  18.468  1.00 124.70 ? 92   GLU A CB  1 
ATOM   310  N  N   . PHE A 1 93  ? 29.652  64.651  16.315  1.00 124.70 ? 93   PHE A N   1 
ATOM   311  C  CA  . PHE A 1 93  ? 30.609  65.584  15.803  1.00 124.70 ? 93   PHE A CA  1 
ATOM   312  C  C   . PHE A 1 93  ? 30.942  65.423  14.351  1.00 124.70 ? 93   PHE A C   1 
ATOM   313  O  O   . PHE A 1 93  ? 31.928  64.766  13.979  1.00 124.70 ? 93   PHE A O   1 
ATOM   314  C  CB  . PHE A 1 93  ? 31.876  65.530  16.634  1.00 124.70 ? 93   PHE A CB  1 
ATOM   315  N  N   . ARG A 1 94  ? 30.084  65.969  13.510  1.00 124.70 ? 94   ARG A N   1 
ATOM   316  C  CA  . ARG A 1 94  ? 30.436  65.975  12.126  1.00 124.70 ? 94   ARG A CA  1 
ATOM   317  C  C   . ARG A 1 94  ? 31.240  67.256  12.323  1.00 124.70 ? 94   ARG A C   1 
ATOM   318  O  O   . ARG A 1 94  ? 30.751  68.334  11.977  1.00 124.70 ? 94   ARG A O   1 
ATOM   319  C  CB  . ARG A 1 94  ? 29.221  66.228  11.246  1.00 124.70 ? 94   ARG A CB  1 
ATOM   320  N  N   . CYS A 1 95  ? 32.423  67.168  12.961  1.00 124.70 ? 95   CYS A N   1 
ATOM   321  C  CA  . CYS A 1 95  ? 33.241  68.378  13.130  1.00 124.70 ? 95   CYS A CA  1 
ATOM   322  C  C   . CYS A 1 95  ? 33.336  68.661  11.631  1.00 124.70 ? 95   CYS A C   1 
ATOM   323  O  O   . CYS A 1 95  ? 32.632  68.040  10.826  1.00 124.70 ? 95   CYS A O   1 
ATOM   324  C  CB  . CYS A 1 95  ? 34.727  68.172  13.599  1.00 124.70 ? 95   CYS A CB  1 
ATOM   325  S  SG  . CYS A 1 95  ? 35.468  66.931  14.752  1.00 124.70 ? 95   CYS A SG  1 
ATOM   326  N  N   . HIS A 1 96  ? 34.202  69.557  11.200  1.00 124.70 ? 96   HIS A N   1 
ATOM   327  C  CA  . HIS A 1 96  ? 34.277  69.688  9.765   1.00 124.70 ? 96   HIS A CA  1 
ATOM   328  C  C   . HIS A 1 96  ? 34.810  68.295  9.271   1.00 124.70 ? 96   HIS A C   1 
ATOM   329  O  O   . HIS A 1 96  ? 35.319  68.156  8.153   1.00 124.70 ? 96   HIS A O   1 
ATOM   330  C  CB  . HIS A 1 96  ? 35.200  70.852  9.404   1.00 124.70 ? 96   HIS A CB  1 
ATOM   331  C  CG  . HIS A 1 96  ? 36.588  70.728  9.960   1.00 124.70 ? 96   HIS A CG  1 
ATOM   332  N  ND1 . HIS A 1 96  ? 36.881  70.884  11.298  1.00 124.70 ? 96   HIS A ND1 1 
ATOM   333  C  CD2 . HIS A 1 96  ? 37.767  70.466  9.344   1.00 124.70 ? 96   HIS A CD2 1 
ATOM   334  C  CE1 . HIS A 1 96  ? 38.181  70.726  11.479  1.00 124.70 ? 96   HIS A CE1 1 
ATOM   335  N  NE2 . HIS A 1 96  ? 38.741  70.473  10.312  1.00 124.70 ? 96   HIS A NE2 1 
ATOM   336  N  N   . ASP A 1 97  ? 34.656  67.283  10.144  1.00 124.70 ? 97   ASP A N   1 
ATOM   337  C  CA  . ASP A 1 97  ? 35.039  65.865  9.967   1.00 124.70 ? 97   ASP A CA  1 
ATOM   338  C  C   . ASP A 1 97  ? 34.365  64.977  11.047  1.00 124.70 ? 97   ASP A C   1 
ATOM   339  O  O   . ASP A 1 97  ? 33.185  64.596  10.928  1.00 124.70 ? 97   ASP A O   1 
ATOM   340  C  CB  . ASP A 1 97  ? 36.554  65.684  10.099  1.00 124.70 ? 97   ASP A CB  1 
ATOM   341  C  CG  . ASP A 1 97  ? 37.305  66.204  8.904   1.00 124.70 ? 97   ASP A CG  1 
ATOM   342  O  OD1 . ASP A 1 97  ? 36.821  65.957  7.782   1.00 124.70 ? 97   ASP A OD1 1 
ATOM   343  O  OD2 . ASP A 1 97  ? 38.376  66.842  9.077   1.00 124.70 ? 97   ASP A OD2 1 
ATOM   344  N  N   . GLY A 1 98  ? 35.142  64.653  12.091  1.00 124.70 ? 98   GLY A N   1 
ATOM   345  C  CA  . GLY A 1 98  ? 34.669  63.839  13.209  1.00 124.70 ? 98   GLY A CA  1 
ATOM   346  C  C   . GLY A 1 98  ? 35.673  63.775  14.361  1.00 124.70 ? 98   GLY A C   1 
ATOM   347  O  O   . GLY A 1 98  ? 35.342  64.203  15.495  1.00 124.70 ? 98   GLY A O   1 
ATOM   348  N  N   . ARG A 1 103 ? 31.923  60.574  23.926  1.00 124.70 ? 103  ARG A N   1 
ATOM   349  C  CA  . ARG A 1 103 ? 30.693  61.372  23.788  1.00 124.70 ? 103  ARG A CA  1 
ATOM   350  C  C   . ARG A 1 103 ? 31.077  62.748  23.283  1.00 124.70 ? 103  ARG A C   1 
ATOM   351  O  O   . ARG A 1 103 ? 32.204  62.987  22.837  1.00 124.70 ? 103  ARG A O   1 
ATOM   352  C  CB  . ARG A 1 103 ? 29.992  61.563  25.141  1.00 124.70 ? 103  ARG A CB  1 
ATOM   353  C  CG  . ARG A 1 103 ? 30.580  62.711  25.998  1.00 124.70 ? 103  ARG A CG  1 
ATOM   354  C  CD  . ARG A 1 103 ? 29.665  63.156  27.145  1.00 124.70 ? 103  ARG A CD  1 
ATOM   355  N  NE  . ARG A 1 103 ? 30.270  64.220  27.946  1.00 124.70 ? 103  ARG A NE  1 
ATOM   356  C  CZ  . ARG A 1 103 ? 29.785  64.662  29.103  1.00 124.70 ? 103  ARG A CZ  1 
ATOM   357  N  NH1 . ARG A 1 103 ? 28.677  64.141  29.621  1.00 124.70 ? 103  ARG A NH1 1 
ATOM   358  N  NH2 . ARG A 1 103 ? 30.412  65.631  29.754  1.00 124.70 ? 103  ARG A NH2 1 
ATOM   359  N  N   . GLN A 1 104 ? 30.096  63.642  23.404  1.00 124.70 ? 104  GLN A N   1 
ATOM   360  C  CA  . GLN A 1 104 ? 30.159  65.045  23.030  1.00 124.70 ? 104  GLN A CA  1 
ATOM   361  C  C   . GLN A 1 104 ? 30.629  65.906  24.198  1.00 124.70 ? 104  GLN A C   1 
ATOM   362  O  O   . GLN A 1 104 ? 30.091  65.843  25.311  1.00 124.70 ? 104  GLN A O   1 
ATOM   363  C  CB  . GLN A 1 104 ? 28.781  65.514  22.586  1.00 124.70 ? 104  GLN A CB  1 
ATOM   364  C  CG  . GLN A 1 104 ? 28.329  66.762  23.277  1.00 124.70 ? 104  GLN A CG  1 
ATOM   365  C  CD  . GLN A 1 104 ? 27.209  67.442  22.514  1.00 124.70 ? 104  GLN A CD  1 
ATOM   366  O  OE1 . GLN A 1 104 ? 27.222  67.473  21.284  1.00 124.70 ? 104  GLN A OE1 1 
ATOM   367  N  NE2 . GLN A 1 104 ? 26.243  68.004  23.231  1.00 124.70 ? 104  GLN A NE2 1 
ATOM   368  N  N   . PHE A 1 105 ? 31.652  66.706  23.933  1.00 124.70 ? 105  PHE A N   1 
ATOM   369  C  CA  . PHE A 1 105 ? 32.210  67.608  24.932  1.00 124.70 ? 105  PHE A CA  1 
ATOM   370  C  C   . PHE A 1 105 ? 31.625  68.973  24.587  1.00 124.70 ? 105  PHE A C   1 
ATOM   371  O  O   . PHE A 1 105 ? 32.337  69.870  24.141  1.00 124.70 ? 105  PHE A O   1 
ATOM   372  C  CB  . PHE A 1 105 ? 33.752  67.575  24.866  1.00 124.70 ? 105  PHE A CB  1 
ATOM   373  C  CG  . PHE A 1 105 ? 34.334  66.228  25.256  1.00 124.70 ? 105  PHE A CG  1 
ATOM   374  C  CD1 . PHE A 1 105 ? 34.124  65.096  24.454  1.00 124.70 ? 105  PHE A CD1 1 
ATOM   375  C  CD2 . PHE A 1 105 ? 34.985  66.052  26.479  1.00 124.70 ? 105  PHE A CD2 1 
ATOM   376  C  CE1 . PHE A 1 105 ? 34.546  63.795  24.872  1.00 124.70 ? 105  PHE A CE1 1 
ATOM   377  C  CE2 . PHE A 1 105 ? 35.411  64.752  26.910  1.00 124.70 ? 105  PHE A CE2 1 
ATOM   378  C  CZ  . PHE A 1 105 ? 35.187  63.629  26.102  1.00 124.70 ? 105  PHE A CZ  1 
ATOM   379  N  N   . VAL A 1 106 ? 30.298  69.061  24.786  1.00 124.70 ? 106  VAL A N   1 
ATOM   380  C  CA  . VAL A 1 106 ? 29.416  70.223  24.540  1.00 124.70 ? 106  VAL A CA  1 
ATOM   381  C  C   . VAL A 1 106 ? 30.146  71.573  24.503  1.00 124.70 ? 106  VAL A C   1 
ATOM   382  O  O   . VAL A 1 106 ? 29.687  72.584  25.050  1.00 124.70 ? 106  VAL A O   1 
ATOM   383  C  CB  . VAL A 1 106 ? 28.243  70.237  25.614  1.00 124.70 ? 106  VAL A CB  1 
ATOM   384  C  CG1 . VAL A 1 106 ? 28.685  70.870  26.912  1.00 124.70 ? 106  VAL A CG1 1 
ATOM   385  C  CG2 . VAL A 1 106 ? 27.035  70.954  25.071  1.00 124.70 ? 106  VAL A CG2 1 
ATOM   386  N  N   . CYS A 1 107 ? 31.248  71.581  23.760  1.00 124.70 ? 107  CYS A N   1 
ATOM   387  C  CA  . CYS A 1 107 ? 32.148  72.720  23.661  1.00 124.70 ? 107  CYS A CA  1 
ATOM   388  C  C   . CYS A 1 107 ? 32.367  73.199  25.119  1.00 124.70 ? 107  CYS A C   1 
ATOM   389  O  O   . CYS A 1 107 ? 31.742  74.132  25.628  1.00 124.70 ? 107  CYS A O   1 
ATOM   390  C  CB  . CYS A 1 107 ? 31.628  73.867  22.736  1.00 124.70 ? 107  CYS A CB  1 
ATOM   391  S  SG  . CYS A 1 107 ? 30.955  75.243  23.768  1.00 124.70 ? 107  CYS A SG  1 
ATOM   392  N  N   . ASP A 1 108 ? 33.234  72.461  25.795  1.00 124.70 ? 108  ASP A N   1 
ATOM   393  C  CA  . ASP A 1 108 ? 33.647  72.711  27.162  1.00 124.70 ? 108  ASP A CA  1 
ATOM   394  C  C   . ASP A 1 108 ? 34.863  73.611  26.938  1.00 124.70 ? 108  ASP A C   1 
ATOM   395  O  O   . ASP A 1 108 ? 35.950  73.401  27.487  1.00 124.70 ? 108  ASP A O   1 
ATOM   396  C  CB  . ASP A 1 108 ? 34.044  71.382  27.812  1.00 124.70 ? 108  ASP A CB  1 
ATOM   397  C  CG  . ASP A 1 108 ? 33.934  70.201  26.838  1.00 124.70 ? 108  ASP A CG  1 
ATOM   398  O  OD1 . ASP A 1 108 ? 34.158  70.413  25.625  1.00 124.70 ? 108  ASP A OD1 1 
ATOM   399  O  OD2 . ASP A 1 108 ? 33.640  69.064  27.273  1.00 124.70 ? 108  ASP A OD2 1 
ATOM   400  N  N   . SER A 1 109 ? 34.643  74.599  26.075  1.00 124.70 ? 109  SER A N   1 
ATOM   401  C  CA  . SER A 1 109 ? 35.637  75.589  25.687  1.00 124.70 ? 109  SER A CA  1 
ATOM   402  C  C   . SER A 1 109 ? 37.022  74.992  25.452  1.00 124.70 ? 109  SER A C   1 
ATOM   403  O  O   . SER A 1 109 ? 38.010  75.436  26.055  1.00 124.70 ? 109  SER A O   1 
ATOM   404  C  CB  . SER A 1 109 ? 35.718  76.700  26.740  1.00 124.70 ? 109  SER A CB  1 
ATOM   405  O  OG  . SER A 1 109 ? 36.190  77.905  26.162  1.00 124.70 ? 109  SER A OG  1 
ATOM   406  N  N   . ASP A 1 110 ? 37.109  73.997  24.571  1.00 124.70 ? 110  ASP A N   1 
ATOM   407  C  CA  . ASP A 1 110 ? 38.405  73.408  24.308  1.00 124.70 ? 110  ASP A CA  1 
ATOM   408  C  C   . ASP A 1 110 ? 38.620  72.642  22.985  1.00 124.70 ? 110  ASP A C   1 
ATOM   409  O  O   . ASP A 1 110 ? 37.999  71.599  22.738  1.00 124.70 ? 110  ASP A O   1 
ATOM   410  C  CB  . ASP A 1 110 ? 38.785  72.553  25.505  1.00 124.70 ? 110  ASP A CB  1 
ATOM   411  C  CG  . ASP A 1 110 ? 40.252  72.593  25.762  1.00 124.70 ? 110  ASP A CG  1 
ATOM   412  O  OD1 . ASP A 1 110 ? 40.974  71.988  24.946  1.00 124.70 ? 110  ASP A OD1 1 
ATOM   413  O  OD2 . ASP A 1 110 ? 40.683  73.243  26.743  1.00 124.70 ? 110  ASP A OD2 1 
ATOM   414  N  N   . ARG A 1 111 ? 39.529  73.176  22.161  1.00 124.70 ? 111  ARG A N   1 
ATOM   415  C  CA  . ARG A 1 111 ? 39.881  72.635  20.838  1.00 124.70 ? 111  ARG A CA  1 
ATOM   416  C  C   . ARG A 1 111 ? 39.975  71.099  20.730  1.00 124.70 ? 111  ARG A C   1 
ATOM   417  O  O   . ARG A 1 111 ? 41.063  70.517  20.669  1.00 124.70 ? 111  ARG A O   1 
ATOM   418  C  CB  . ARG A 1 111 ? 41.187  73.284  20.352  1.00 124.70 ? 111  ARG A CB  1 
ATOM   419  C  CG  . ARG A 1 111 ? 41.474  73.074  18.872  1.00 124.70 ? 111  ARG A CG  1 
ATOM   420  C  CD  . ARG A 1 111 ? 42.717  73.832  18.400  1.00 124.70 ? 111  ARG A CD  1 
ATOM   421  N  NE  . ARG A 1 111 ? 42.972  73.576  16.981  1.00 124.70 ? 111  ARG A NE  1 
ATOM   422  C  CZ  . ARG A 1 111 ? 43.969  74.102  16.272  1.00 124.70 ? 111  ARG A CZ  1 
ATOM   423  N  NH1 . ARG A 1 111 ? 44.837  74.933  16.839  1.00 124.70 ? 111  ARG A NH1 1 
ATOM   424  N  NH2 . ARG A 1 111 ? 44.097  73.792  14.987  1.00 124.70 ? 111  ARG A NH2 1 
ATOM   425  N  N   . ASP A 1 112 ? 38.810  70.462  20.671  1.00 124.70 ? 112  ASP A N   1 
ATOM   426  C  CA  . ASP A 1 112 ? 38.714  69.017  20.572  1.00 124.70 ? 112  ASP A CA  1 
ATOM   427  C  C   . ASP A 1 112 ? 38.167  68.558  19.220  1.00 124.70 ? 112  ASP A C   1 
ATOM   428  O  O   . ASP A 1 112 ? 37.054  68.038  19.134  1.00 124.70 ? 112  ASP A O   1 
ATOM   429  C  CB  . ASP A 1 112 ? 37.820  68.489  21.685  1.00 124.70 ? 112  ASP A CB  1 
ATOM   430  C  CG  . ASP A 1 112 ? 38.245  68.977  23.040  1.00 124.70 ? 112  ASP A CG  1 
ATOM   431  O  OD1 . ASP A 1 112 ? 39.465  68.991  23.320  1.00 124.70 ? 112  ASP A OD1 1 
ATOM   432  O  OD2 . ASP A 1 112 ? 37.358  69.340  23.832  1.00 124.70 ? 112  ASP A OD2 1 
ATOM   433  N  N   . CYS A 1 113 ? 38.965  68.750  18.173  1.00 124.70 ? 113  CYS A N   1 
ATOM   434  C  CA  . CYS A 1 113 ? 38.616  68.367  16.795  1.00 124.70 ? 113  CYS A CA  1 
ATOM   435  C  C   . CYS A 1 113 ? 39.669  68.975  15.856  1.00 124.70 ? 113  CYS A C   1 
ATOM   436  O  O   . CYS A 1 113 ? 39.399  69.166  14.665  1.00 124.70 ? 113  CYS A O   1 
ATOM   437  C  CB  . CYS A 1 113 ? 37.239  68.920  16.368  1.00 124.70 ? 113  CYS A CB  1 
ATOM   438  S  SG  . CYS A 1 113 ? 35.710  67.919  16.526  1.00 124.70 ? 113  CYS A SG  1 
ATOM   439  N  N   . LEU A 1 114 ? 40.852  69.290  16.391  1.00 124.70 ? 114  LEU A N   1 
ATOM   440  C  CA  . LEU A 1 114 ? 41.931  69.897  15.595  1.00 124.70 ? 114  LEU A CA  1 
ATOM   441  C  C   . LEU A 1 114 ? 41.480  71.229  14.976  1.00 124.70 ? 114  LEU A C   1 
ATOM   442  O  O   . LEU A 1 114 ? 42.034  71.688  13.965  1.00 124.70 ? 114  LEU A O   1 
ATOM   443  C  CB  . LEU A 1 114 ? 42.362  68.977  14.446  1.00 124.70 ? 114  LEU A CB  1 
ATOM   444  C  CG  . LEU A 1 114 ? 42.691  67.489  14.578  1.00 124.70 ? 114  LEU A CG  1 
ATOM   445  C  CD1 . LEU A 1 114 ? 43.367  67.064  13.268  1.00 124.70 ? 114  LEU A CD1 1 
ATOM   446  C  CD2 . LEU A 1 114 ? 43.604  67.213  15.769  1.00 124.70 ? 114  LEU A CD2 1 
ATOM   447  N  N   . ASP A 1 115 ? 40.467  71.837  15.580  1.00 124.70 ? 115  ASP A N   1 
ATOM   448  C  CA  . ASP A 1 115 ? 39.923  73.090  15.082  1.00 124.70 ? 115  ASP A CA  1 
ATOM   449  C  C   . ASP A 1 115 ? 38.989  73.641  16.135  1.00 124.70 ? 115  ASP A C   1 
ATOM   450  O  O   . ASP A 1 115 ? 38.205  72.900  16.727  1.00 124.70 ? 115  ASP A O   1 
ATOM   451  C  CB  . ASP A 1 115 ? 39.153  72.851  13.776  1.00 124.70 ? 115  ASP A CB  1 
ATOM   452  C  CG  . ASP A 1 115 ? 37.805  72.161  13.994  1.00 124.70 ? 115  ASP A CG  1 
ATOM   453  O  OD1 . ASP A 1 115 ? 37.669  71.338  14.925  1.00 124.70 ? 115  ASP A OD1 1 
ATOM   454  O  OD2 . ASP A 1 115 ? 36.877  72.429  13.206  1.00 124.70 ? 115  ASP A OD2 1 
ATOM   455  N  N   . GLY A 1 116 ? 39.086  74.942  16.373  1.00 124.70 ? 116  GLY A N   1 
ATOM   456  C  CA  . GLY A 1 116 ? 38.234  75.567  17.360  1.00 124.70 ? 116  GLY A CA  1 
ATOM   457  C  C   . GLY A 1 116 ? 36.765  75.213  17.178  1.00 124.70 ? 116  GLY A C   1 
ATOM   458  O  O   . GLY A 1 116 ? 35.893  75.884  17.745  1.00 124.70 ? 116  GLY A O   1 
ATOM   459  N  N   . SER A 1 117 ? 36.477  74.194  16.364  1.00 124.70 ? 117  SER A N   1 
ATOM   460  C  CA  . SER A 1 117 ? 35.101  73.752  16.165  1.00 124.70 ? 117  SER A CA  1 
ATOM   461  C  C   . SER A 1 117 ? 34.785  72.808  17.320  1.00 124.70 ? 117  SER A C   1 
ATOM   462  O  O   . SER A 1 117 ? 35.684  72.149  17.848  1.00 124.70 ? 117  SER A O   1 
ATOM   463  C  CB  . SER A 1 117 ? 34.926  73.063  14.826  1.00 124.70 ? 117  SER A CB  1 
ATOM   464  O  OG  . SER A 1 117 ? 33.901  73.713  14.097  1.00 124.70 ? 117  SER A OG  1 
ATOM   465  N  N   . ASP A 1 118 ? 33.503  72.708  17.667  1.00 124.70 ? 118  ASP A N   1 
ATOM   466  C  CA  . ASP A 1 118 ? 33.079  71.985  18.862  1.00 124.70 ? 118  ASP A CA  1 
ATOM   467  C  C   . ASP A 1 118 ? 33.602  73.150  19.709  1.00 124.70 ? 118  ASP A C   1 
ATOM   468  O  O   . ASP A 1 118 ? 34.792  73.182  20.031  1.00 124.70 ? 118  ASP A O   1 
ATOM   469  C  CB  . ASP A 1 118 ? 33.917  70.717  19.134  1.00 124.70 ? 118  ASP A CB  1 
ATOM   470  C  CG  . ASP A 1 118 ? 34.559  70.713  20.547  1.00 124.70 ? 118  ASP A CG  1 
ATOM   471  O  OD1 . ASP A 1 118 ? 33.822  70.963  21.539  1.00 124.70 ? 118  ASP A OD1 1 
ATOM   472  O  OD2 . ASP A 1 118 ? 35.792  70.462  20.665  1.00 124.70 ? 118  ASP A OD2 1 
ATOM   473  N  N   . GLU A 1 119 ? 32.742  74.136  19.986  1.00 124.70 ? 119  GLU A N   1 
ATOM   474  C  CA  . GLU A 1 119 ? 33.117  75.352  20.741  1.00 124.70 ? 119  GLU A CA  1 
ATOM   475  C  C   . GLU A 1 119 ? 33.261  76.587  19.806  1.00 124.70 ? 119  GLU A C   1 
ATOM   476  O  O   . GLU A 1 119 ? 34.238  77.346  19.904  1.00 124.70 ? 119  GLU A O   1 
ATOM   477  C  CB  . GLU A 1 119 ? 34.450  75.161  21.515  1.00 124.70 ? 119  GLU A CB  1 
ATOM   478  C  CG  . GLU A 1 119 ? 34.385  74.578  22.942  1.00 124.70 ? 119  GLU A CG  1 
ATOM   479  C  CD  . GLU A 1 119 ? 35.140  73.252  23.103  1.00 124.70 ? 119  GLU A CD  1 
ATOM   480  O  OE1 . GLU A 1 119 ? 36.073  72.996  22.317  1.00 124.70 ? 119  GLU A OE1 1 
ATOM   481  O  OE2 . GLU A 1 119 ? 34.828  72.472  24.027  1.00 124.70 ? 119  GLU A OE2 1 
ATOM   482  N  N   . ALA A 1 120 ? 32.296  76.785  18.904  1.00 124.70 ? 120  ALA A N   1 
ATOM   483  C  CA  . ALA A 1 120 ? 32.316  77.924  17.970  1.00 124.70 ? 120  ALA A CA  1 
ATOM   484  C  C   . ALA A 1 120 ? 30.895  78.170  17.456  1.00 124.70 ? 120  ALA A C   1 
ATOM   485  O  O   . ALA A 1 120 ? 30.655  78.463  16.287  1.00 124.70 ? 120  ALA A O   1 
ATOM   486  C  CB  . ALA A 1 120 ? 33.265  77.637  16.808  1.00 124.70 ? 120  ALA A CB  1 
ATOM   487  N  N   . SER A 1 121 ? 29.971  78.044  18.392  1.00 124.70 ? 121  SER A N   1 
ATOM   488  C  CA  . SER A 1 121 ? 28.532  78.192  18.218  1.00 124.70 ? 121  SER A CA  1 
ATOM   489  C  C   . SER A 1 121 ? 28.266  78.092  19.710  1.00 124.70 ? 121  SER A C   1 
ATOM   490  O  O   . SER A 1 121 ? 27.397  77.339  20.188  1.00 124.70 ? 121  SER A O   1 
ATOM   491  C  CB  . SER A 1 121 ? 27.968  76.970  17.475  1.00 124.70 ? 121  SER A CB  1 
ATOM   492  O  OG  . SER A 1 121 ? 26.787  76.472  18.087  1.00 124.70 ? 121  SER A OG  1 
ATOM   493  N  N   . CYS A 1 122 ? 29.050  78.881  20.439  1.00 124.70 ? 122  CYS A N   1 
ATOM   494  C  CA  . CYS A 1 122 ? 29.010  78.817  21.874  1.00 124.70 ? 122  CYS A CA  1 
ATOM   495  C  C   . CYS A 1 122 ? 28.891  80.137  22.711  1.00 124.70 ? 122  CYS A C   1 
ATOM   496  O  O   . CYS A 1 122 ? 29.825  80.517  23.438  1.00 124.70 ? 122  CYS A O   1 
ATOM   497  C  CB  . CYS A 1 122 ? 30.207  77.896  22.257  1.00 124.70 ? 122  CYS A CB  1 
ATOM   498  S  SG  . CYS A 1 122 ? 29.543  76.225  22.689  1.00 124.70 ? 122  CYS A SG  1 
ATOM   499  N  N   . PRO A 1 123 ? 27.712  80.834  22.624  1.00 124.70 ? 123  PRO A N   1 
ATOM   500  C  CA  . PRO A 1 123 ? 27.304  82.100  23.287  1.00 124.70 ? 123  PRO A CA  1 
ATOM   501  C  C   . PRO A 1 123 ? 27.013  82.137  24.811  1.00 124.70 ? 123  PRO A C   1 
ATOM   502  O  O   . PRO A 1 123 ? 27.154  81.130  25.510  1.00 124.70 ? 123  PRO A O   1 
ATOM   503  C  CB  . PRO A 1 123 ? 26.057  82.514  22.492  1.00 124.70 ? 123  PRO A CB  1 
ATOM   504  C  CG  . PRO A 1 123 ? 26.291  81.933  21.150  1.00 124.70 ? 123  PRO A CG  1 
ATOM   505  C  CD  . PRO A 1 123 ? 26.775  80.549  21.518  1.00 124.70 ? 123  PRO A CD  1 
ATOM   506  N  N   . VAL A 1 124 ? 26.610  83.327  25.290  1.00 124.70 ? 124  VAL A N   1 
ATOM   507  C  CA  . VAL A 1 124 ? 26.231  83.620  26.701  1.00 124.70 ? 124  VAL A CA  1 
ATOM   508  C  C   . VAL A 1 124 ? 25.414  84.921  26.700  1.00 124.70 ? 124  VAL A C   1 
ATOM   509  O  O   . VAL A 1 124 ? 25.976  85.973  26.381  1.00 124.70 ? 124  VAL A O   1 
ATOM   510  C  CB  . VAL A 1 124 ? 27.453  83.938  27.671  1.00 124.70 ? 124  VAL A CB  1 
ATOM   511  C  CG1 . VAL A 1 124 ? 27.399  83.049  28.926  1.00 124.70 ? 124  VAL A CG1 1 
ATOM   512  C  CG2 . VAL A 1 124 ? 28.780  83.818  26.933  1.00 124.70 ? 124  VAL A CG2 1 
ATOM   513  N  N   . LEU A 1 125 ? 24.122  84.892  27.040  1.00 124.70 ? 125  LEU A N   1 
ATOM   514  C  CA  . LEU A 1 125 ? 23.396  86.163  27.060  1.00 124.70 ? 125  LEU A CA  1 
ATOM   515  C  C   . LEU A 1 125 ? 24.284  86.960  28.019  1.00 124.70 ? 125  LEU A C   1 
ATOM   516  O  O   . LEU A 1 125 ? 24.882  86.386  28.945  1.00 124.70 ? 125  LEU A O   1 
ATOM   517  C  CB  . LEU A 1 125 ? 21.949  86.017  27.585  1.00 124.70 ? 125  LEU A CB  1 
ATOM   518  C  CG  . LEU A 1 125 ? 20.894  86.978  26.979  1.00 124.70 ? 125  LEU A CG  1 
ATOM   519  C  CD1 . LEU A 1 125 ? 20.812  86.784  25.472  1.00 124.70 ? 125  LEU A CD1 1 
ATOM   520  C  CD2 . LEU A 1 125 ? 19.528  86.733  27.597  1.00 124.70 ? 125  LEU A CD2 1 
ATOM   521  N  N   . THR A 1 126 ? 24.402  88.260  27.775  1.00 124.70 ? 126  THR A N   1 
ATOM   522  C  CA  . THR A 1 126 ? 25.292  89.076  28.573  1.00 124.70 ? 126  THR A CA  1 
ATOM   523  C  C   . THR A 1 126 ? 24.940  89.150  30.036  1.00 124.70 ? 126  THR A C   1 
ATOM   524  O  O   . THR A 1 126 ? 23.751  89.200  30.404  1.00 124.70 ? 126  THR A O   1 
ATOM   525  C  CB  . THR A 1 126 ? 25.434  90.461  27.958  1.00 124.70 ? 126  THR A CB  1 
ATOM   526  O  OG1 . THR A 1 126 ? 24.400  90.645  26.988  1.00 124.70 ? 126  THR A OG1 1 
ATOM   527  C  CG2 . THR A 1 126 ? 26.799  90.593  27.270  1.00 124.70 ? 126  THR A CG2 1 
ATOM   528  N  N   . CYS A 1 127 ? 25.980  89.102  30.877  1.00 124.70 ? 127  CYS A N   1 
ATOM   529  C  CA  . CYS A 1 127 ? 25.701  89.133  32.295  1.00 124.70 ? 127  CYS A CA  1 
ATOM   530  C  C   . CYS A 1 127 ? 24.943  90.414  32.548  1.00 124.70 ? 127  CYS A C   1 
ATOM   531  O  O   . CYS A 1 127 ? 25.483  91.525  32.665  1.00 124.70 ? 127  CYS A O   1 
ATOM   532  C  CB  . CYS A 1 127 ? 26.942  88.966  33.189  1.00 124.70 ? 127  CYS A CB  1 
ATOM   533  S  SG  . CYS A 1 127 ? 27.095  87.187  33.831  1.00 124.70 ? 127  CYS A SG  1 
ATOM   534  N  N   . GLY A 1 128 ? 23.634  90.181  32.564  1.00 124.70 ? 128  GLY A N   1 
ATOM   535  C  CA  . GLY A 1 128 ? 22.613  91.188  32.757  1.00 124.70 ? 128  GLY A CA  1 
ATOM   536  C  C   . GLY A 1 128 ? 22.994  92.336  33.665  1.00 124.70 ? 128  GLY A C   1 
ATOM   537  O  O   . GLY A 1 128 ? 24.119  92.384  34.175  1.00 124.70 ? 128  GLY A O   1 
ATOM   538  N  N   . PRO A 1 129 ? 22.076  93.298  33.872  1.00 124.70 ? 129  PRO A N   1 
ATOM   539  C  CA  . PRO A 1 129 ? 22.274  94.480  34.723  1.00 124.70 ? 129  PRO A CA  1 
ATOM   540  C  C   . PRO A 1 129 ? 22.772  94.233  36.133  1.00 124.70 ? 129  PRO A C   1 
ATOM   541  O  O   . PRO A 1 129 ? 22.419  94.954  37.063  1.00 124.70 ? 129  PRO A O   1 
ATOM   542  C  CB  . PRO A 1 129 ? 20.901  95.107  34.743  1.00 124.70 ? 129  PRO A CB  1 
ATOM   543  C  CG  . PRO A 1 129 ? 20.478  94.936  33.333  1.00 124.70 ? 129  PRO A CG  1 
ATOM   544  C  CD  . PRO A 1 129 ? 20.972  93.547  32.926  1.00 124.70 ? 129  PRO A CD  1 
ATOM   545  N  N   . ALA A 1 130 ? 23.584  93.221  36.329  1.00 124.70 ? 130  ALA A N   1 
ATOM   546  C  CA  . ALA A 1 130 ? 24.038  92.987  37.680  1.00 124.70 ? 130  ALA A CA  1 
ATOM   547  C  C   . ALA A 1 130 ? 25.281  92.245  37.466  1.00 124.70 ? 130  ALA A C   1 
ATOM   548  O  O   . ALA A 1 130 ? 25.305  91.027  37.628  1.00 124.70 ? 130  ALA A O   1 
ATOM   549  C  CB  . ALA A 1 130 ? 23.043  92.127  38.429  1.00 124.70 ? 130  ALA A CB  1 
ATOM   550  N  N   . SER A 1 131 ? 26.360  92.898  37.114  1.00 124.70 ? 131  SER A N   1 
ATOM   551  C  CA  . SER A 1 131 ? 27.346  91.925  36.909  1.00 124.70 ? 131  SER A CA  1 
ATOM   552  C  C   . SER A 1 131 ? 28.783  92.043  36.806  1.00 124.70 ? 131  SER A C   1 
ATOM   553  O  O   . SER A 1 131 ? 29.415  93.089  36.618  1.00 124.70 ? 131  SER A O   1 
ATOM   554  C  CB  . SER A 1 131 ? 26.912  91.062  35.732  1.00 124.70 ? 131  SER A CB  1 
ATOM   555  O  OG  . SER A 1 131 ? 28.048  90.503  35.106  1.00 124.70 ? 131  SER A OG  1 
ATOM   556  N  N   . PHE A 1 132 ? 29.261  90.821  36.896  1.00 124.70 ? 132  PHE A N   1 
ATOM   557  C  CA  . PHE A 1 132 ? 30.627  90.517  36.806  1.00 124.70 ? 132  PHE A CA  1 
ATOM   558  C  C   . PHE A 1 132 ? 30.833  89.012  36.768  1.00 124.70 ? 132  PHE A C   1 
ATOM   559  O  O   . PHE A 1 132 ? 29.899  88.218  36.941  1.00 124.70 ? 132  PHE A O   1 
ATOM   560  C  CB  . PHE A 1 132 ? 31.356  91.100  37.998  1.00 124.70 ? 132  PHE A CB  1 
ATOM   561  C  CG  . PHE A 1 132 ? 32.808  91.202  37.773  1.00 124.70 ? 132  PHE A CG  1 
ATOM   562  C  CD1 . PHE A 1 132 ? 33.354  92.318  37.153  1.00 124.70 ? 132  PHE A CD1 1 
ATOM   563  C  CD2 . PHE A 1 132 ? 33.630  90.135  38.063  1.00 124.70 ? 132  PHE A CD2 1 
ATOM   564  C  CE1 . PHE A 1 132 ? 34.715  92.351  36.822  1.00 124.70 ? 132  PHE A CE1 1 
ATOM   565  C  CE2 . PHE A 1 132 ? 34.991  90.157  37.737  1.00 124.70 ? 132  PHE A CE2 1 
ATOM   566  C  CZ  . PHE A 1 132 ? 35.532  91.256  37.119  1.00 124.70 ? 132  PHE A CZ  1 
ATOM   567  N  N   . GLN A 1 133 ? 32.090  88.642  36.562  1.00 124.70 ? 133  GLN A N   1 
ATOM   568  C  CA  . GLN A 1 133 ? 32.506  87.258  36.510  1.00 124.70 ? 133  GLN A CA  1 
ATOM   569  C  C   . GLN A 1 133 ? 33.852  86.985  37.130  1.00 124.70 ? 133  GLN A C   1 
ATOM   570  O  O   . GLN A 1 133 ? 34.725  87.846  37.237  1.00 124.70 ? 133  GLN A O   1 
ATOM   571  C  CB  . GLN A 1 133 ? 32.654  86.807  35.073  1.00 124.70 ? 133  GLN A CB  1 
ATOM   572  C  CG  . GLN A 1 133 ? 31.553  85.970  34.464  1.00 124.70 ? 133  GLN A CG  1 
ATOM   573  C  CD  . GLN A 1 133 ? 31.817  85.704  32.964  1.00 124.70 ? 133  GLN A CD  1 
ATOM   574  O  OE1 . GLN A 1 133 ? 32.955  85.665  32.537  1.00 124.70 ? 133  GLN A OE1 1 
ATOM   575  N  NE2 . GLN A 1 133 ? 30.770  85.515  32.182  1.00 124.70 ? 133  GLN A NE2 1 
ATOM   576  N  N   . CYS A 1 134 ? 33.993  85.732  37.522  1.00 124.70 ? 134  CYS A N   1 
ATOM   577  C  CA  . CYS A 1 134 ? 35.262  85.212  37.976  1.00 124.70 ? 134  CYS A CA  1 
ATOM   578  C  C   . CYS A 1 134 ? 35.413  84.882  36.454  1.00 124.70 ? 134  CYS A C   1 
ATOM   579  O  O   . CYS A 1 134 ? 34.496  84.281  35.850  1.00 124.70 ? 134  CYS A O   1 
ATOM   580  C  CB  . CYS A 1 134 ? 34.980  84.032  38.908  1.00 124.70 ? 134  CYS A CB  1 
ATOM   581  S  SG  . CYS A 1 134 ? 35.528  83.843  40.732  1.00 124.70 ? 134  CYS A SG  1 
ATOM   582  N  N   . ASN A 1 135 ? 36.479  85.388  35.808  1.00 124.70 ? 135  ASN A N   1 
ATOM   583  C  CA  . ASN A 1 135 ? 36.466  85.194  34.364  1.00 124.70 ? 135  ASN A CA  1 
ATOM   584  C  C   . ASN A 1 135 ? 36.221  83.734  34.005  1.00 124.70 ? 135  ASN A C   1 
ATOM   585  O  O   . ASN A 1 135 ? 36.428  83.304  32.916  1.00 124.70 ? 135  ASN A O   1 
ATOM   586  C  CB  . ASN A 1 135 ? 37.777  85.684  33.748  1.00 124.70 ? 135  ASN A CB  1 
ATOM   587  C  CG  . ASN A 1 135 ? 38.928  85.659  34.732  1.00 124.70 ? 135  ASN A CG  1 
ATOM   588  O  OD1 . ASN A 1 135 ? 38.761  85.268  35.887  1.00 124.70 ? 135  ASN A OD1 1 
ATOM   589  N  ND2 . ASN A 1 135 ? 40.103  86.078  34.278  1.00 124.70 ? 135  ASN A ND2 1 
ATOM   590  N  N   . SER A 1 136 ? 35.710  83.074  35.029  1.00 124.70 ? 136  SER A N   1 
ATOM   591  C  CA  . SER A 1 136 ? 35.417  81.700  34.879  1.00 124.70 ? 136  SER A CA  1 
ATOM   592  C  C   . SER A 1 136 ? 33.946  81.396  35.208  1.00 124.70 ? 136  SER A C   1 
ATOM   593  O  O   . SER A 1 136 ? 33.664  80.738  36.195  1.00 124.70 ? 136  SER A O   1 
ATOM   594  C  CB  . SER A 1 136 ? 36.396  80.936  35.764  1.00 124.70 ? 136  SER A CB  1 
ATOM   595  O  OG  . SER A 1 136 ? 37.725  81.409  35.554  1.00 124.70 ? 136  SER A OG  1 
ATOM   596  N  N   . SER A 1 137 ? 33.014  81.902  34.396  1.00 124.70 ? 137  SER A N   1 
ATOM   597  C  CA  . SER A 1 137 ? 31.581  81.604  34.558  1.00 124.70 ? 137  SER A CA  1 
ATOM   598  C  C   . SER A 1 137 ? 30.745  82.191  35.718  1.00 124.70 ? 137  SER A C   1 
ATOM   599  O  O   . SER A 1 137 ? 30.332  81.434  36.612  1.00 124.70 ? 137  SER A O   1 
ATOM   600  C  CB  . SER A 1 137 ? 31.416  80.074  34.561  1.00 124.70 ? 137  SER A CB  1 
ATOM   601  O  OG  . SER A 1 137 ? 30.060  79.670  34.630  1.00 124.70 ? 137  SER A OG  1 
ATOM   602  N  N   . THR A 1 138 ? 30.451  83.503  35.696  1.00 124.70 ? 138  THR A N   1 
ATOM   603  C  CA  . THR A 1 138 ? 29.622  84.117  36.770  1.00 124.70 ? 138  THR A CA  1 
ATOM   604  C  C   . THR A 1 138 ? 28.741  85.355  36.528  1.00 124.70 ? 138  THR A C   1 
ATOM   605  O  O   . THR A 1 138 ? 29.023  86.220  35.680  1.00 124.70 ? 138  THR A O   1 
ATOM   606  C  CB  . THR A 1 138 ? 30.458  84.489  38.015  1.00 124.70 ? 138  THR A CB  1 
ATOM   607  O  OG1 . THR A 1 138 ? 31.576  83.604  38.127  1.00 124.70 ? 138  THR A OG1 1 
ATOM   608  C  CG2 . THR A 1 138 ? 29.608  84.394  39.279  1.00 124.70 ? 138  THR A CG2 1 
ATOM   609  N  N   . CYS A 1 139 ? 27.681  85.398  37.348  1.00 124.70 ? 139  CYS A N   1 
ATOM   610  C  CA  . CYS A 1 139 ? 26.662  86.466  37.419  1.00 124.70 ? 139  CYS A CA  1 
ATOM   611  C  C   . CYS A 1 139 ? 26.419  86.758  38.955  1.00 124.70 ? 139  CYS A C   1 
ATOM   612  O  O   . CYS A 1 139 ? 26.276  85.826  39.766  1.00 124.70 ? 139  CYS A O   1 
ATOM   613  C  CB  . CYS A 1 139 ? 25.382  86.081  36.624  1.00 124.70 ? 139  CYS A CB  1 
ATOM   614  S  SG  . CYS A 1 139 ? 25.349  86.451  34.735  1.00 124.70 ? 139  CYS A SG  1 
ATOM   615  N  N   . ILE A 1 140 ? 26.342  88.062  39.314  1.00 124.70 ? 140  ILE A N   1 
ATOM   616  C  CA  . ILE A 1 140 ? 26.332  88.600  40.716  1.00 124.70 ? 140  ILE A CA  1 
ATOM   617  C  C   . ILE A 1 140 ? 26.059  90.198  40.742  1.00 124.70 ? 140  ILE A C   1 
ATOM   618  O  O   . ILE A 1 140 ? 26.534  90.840  39.841  1.00 124.70 ? 140  ILE A O   1 
ATOM   619  C  CB  . ILE A 1 140 ? 27.787  88.357  41.174  1.00 124.70 ? 140  ILE A CB  1 
ATOM   620  C  CG1 . ILE A 1 140 ? 28.125  86.865  41.204  1.00 124.70 ? 140  ILE A CG1 1 
ATOM   621  C  CG2 . ILE A 1 140 ? 28.041  88.974  42.483  1.00 124.70 ? 140  ILE A CG2 1 
ATOM   622  C  CD1 . ILE A 1 140 ? 29.473  86.578  41.792  1.00 124.70 ? 140  ILE A CD1 1 
ATOM   623  N  N   . PRO A 1 141 ? 25.323  90.858  41.720  1.00 124.70 ? 141  PRO A N   1 
ATOM   624  C  CA  . PRO A 1 141 ? 25.181  92.355  41.584  1.00 124.70 ? 141  PRO A CA  1 
ATOM   625  C  C   . PRO A 1 141 ? 26.428  93.277  41.716  1.00 124.70 ? 141  PRO A C   1 
ATOM   626  O  O   . PRO A 1 141 ? 26.957  93.387  42.802  1.00 124.70 ? 141  PRO A O   1 
ATOM   627  C  CB  . PRO A 1 141 ? 24.152  92.731  42.677  1.00 124.70 ? 141  PRO A CB  1 
ATOM   628  C  CG  . PRO A 1 141 ? 23.257  91.578  42.683  1.00 124.70 ? 141  PRO A CG  1 
ATOM   629  C  CD  . PRO A 1 141 ? 24.172  90.344  42.494  1.00 124.70 ? 141  PRO A CD  1 
ATOM   630  N  N   . GLN A 1 142 ? 26.903  93.949  40.674  1.00 124.70 ? 142  GLN A N   1 
ATOM   631  C  CA  . GLN A 1 142 ? 28.074  94.806  40.883  1.00 124.70 ? 142  GLN A CA  1 
ATOM   632  C  C   . GLN A 1 142 ? 27.868  95.679  42.135  1.00 124.70 ? 142  GLN A C   1 
ATOM   633  O  O   . GLN A 1 142 ? 27.817  96.892  42.008  1.00 124.70 ? 142  GLN A O   1 
ATOM   634  C  CB  . GLN A 1 142 ? 28.282  95.702  39.664  1.00 124.70 ? 142  GLN A CB  1 
ATOM   635  N  N   . LEU A 1 143 ? 27.803  95.079  43.329  1.00 124.70 ? 143  LEU A N   1 
ATOM   636  C  CA  . LEU A 1 143 ? 27.564  95.802  44.590  1.00 124.70 ? 143  LEU A CA  1 
ATOM   637  C  C   . LEU A 1 143 ? 28.136  95.051  45.797  1.00 124.70 ? 143  LEU A C   1 
ATOM   638  O  O   . LEU A 1 143 ? 27.929  95.416  46.977  1.00 124.70 ? 143  LEU A O   1 
ATOM   639  C  CB  . LEU A 1 143 ? 26.063  96.022  44.780  1.00 124.70 ? 143  LEU A CB  1 
ATOM   640  C  CG  . LEU A 1 143 ? 25.319  96.841  43.710  1.00 124.70 ? 143  LEU A CG  1 
ATOM   641  C  CD1 . LEU A 1 143 ? 23.833  96.849  44.038  1.00 124.70 ? 143  LEU A CD1 1 
ATOM   642  C  CD2 . LEU A 1 143 ? 25.864  98.278  43.635  1.00 124.70 ? 143  LEU A CD2 1 
ATOM   643  N  N   . TRP A 1 144 ? 28.818  93.964  45.451  1.00 124.70 ? 144  TRP A N   1 
ATOM   644  C  CA  . TRP A 1 144 ? 29.519  93.092  46.377  1.00 124.70 ? 144  TRP A CA  1 
ATOM   645  C  C   . TRP A 1 144 ? 30.861  93.363  45.725  1.00 124.70 ? 144  TRP A C   1 
ATOM   646  O  O   . TRP A 1 144 ? 31.826  92.586  45.765  1.00 124.70 ? 144  TRP A O   1 
ATOM   647  C  CB  . TRP A 1 144 ? 28.962  91.662  46.226  1.00 124.70 ? 144  TRP A CB  1 
ATOM   648  C  CG  . TRP A 1 144 ? 27.448  91.707  46.462  1.00 124.70 ? 144  TRP A CG  1 
ATOM   649  C  CD1 . TRP A 1 144 ? 26.696  92.839  46.703  1.00 124.70 ? 144  TRP A CD1 1 
ATOM   650  C  CD2 . TRP A 1 144 ? 26.516  90.612  46.488  1.00 124.70 ? 144  TRP A CD2 1 
ATOM   651  N  NE1 . TRP A 1 144 ? 25.381  92.515  46.896  1.00 124.70 ? 144  TRP A NE1 1 
ATOM   652  C  CE2 . TRP A 1 144 ? 25.244  91.154  46.803  1.00 124.70 ? 144  TRP A CE2 1 
ATOM   653  C  CE3 . TRP A 1 144 ? 26.641  89.220  46.354  1.00 124.70 ? 144  TRP A CE3 1 
ATOM   654  C  CZ2 . TRP A 1 144 ? 24.099  90.367  46.893  1.00 124.70 ? 144  TRP A CZ2 1 
ATOM   655  C  CZ3 . TRP A 1 144 ? 25.490  88.435  46.451  1.00 124.70 ? 144  TRP A CZ3 1 
ATOM   656  C  CH2 . TRP A 1 144 ? 24.246  89.011  46.755  1.00 124.70 ? 144  TRP A CH2 1 
ATOM   657  N  N   . ALA A 1 145 ? 30.827  94.553  45.120  1.00 124.70 ? 145  ALA A N   1 
ATOM   658  C  CA  . ALA A 1 145 ? 31.873  95.212  44.384  1.00 124.70 ? 145  ALA A CA  1 
ATOM   659  C  C   . ALA A 1 145 ? 33.037  95.220  45.235  1.00 124.70 ? 145  ALA A C   1 
ATOM   660  O  O   . ALA A 1 145 ? 33.178  95.992  46.241  1.00 124.70 ? 145  ALA A O   1 
ATOM   661  C  CB  . ALA A 1 145 ? 31.488  96.619  44.039  1.00 124.70 ? 145  ALA A CB  1 
ATOM   662  N  N   . CYS A 1 146 ? 33.849  94.306  44.735  1.00 124.70 ? 146  CYS A N   1 
ATOM   663  C  CA  . CYS A 1 146 ? 35.101  93.933  45.284  1.00 124.70 ? 146  CYS A CA  1 
ATOM   664  C  C   . CYS A 1 146 ? 34.829  93.836  46.789  1.00 124.70 ? 146  CYS A C   1 
ATOM   665  O  O   . CYS A 1 146 ? 35.593  94.328  47.566  1.00 124.70 ? 146  CYS A O   1 
ATOM   666  C  CB  . CYS A 1 146 ? 36.152  95.010  44.972  1.00 124.70 ? 146  CYS A CB  1 
ATOM   667  S  SG  . CYS A 1 146 ? 36.248  95.557  43.216  1.00 124.70 ? 146  CYS A SG  1 
ATOM   668  N  N   . ASP A 1 147 ? 33.770  93.241  47.296  1.00 124.70 ? 147  ASP A N   1 
ATOM   669  C  CA  . ASP A 1 147 ? 33.715  93.435  48.767  1.00 124.70 ? 147  ASP A CA  1 
ATOM   670  C  C   . ASP A 1 147 ? 34.766  92.526  49.351  1.00 124.70 ? 147  ASP A C   1 
ATOM   671  O  O   . ASP A 1 147 ? 35.191  91.607  48.658  1.00 124.70 ? 147  ASP A O   1 
ATOM   672  C  CB  . ASP A 1 147 ? 32.355  93.081  49.300  1.00 124.70 ? 147  ASP A CB  1 
ATOM   673  C  CG  . ASP A 1 147 ? 31.793  91.939  48.569  1.00 124.70 ? 147  ASP A CG  1 
ATOM   674  O  OD1 . ASP A 1 147 ? 32.539  91.376  47.739  1.00 124.70 ? 147  ASP A OD1 1 
ATOM   675  O  OD2 . ASP A 1 147 ? 30.632  91.597  48.802  1.00 124.70 ? 147  ASP A OD2 1 
ATOM   676  N  N   . ASN A 1 148 ? 35.248  92.699  50.572  1.00 124.70 ? 148  ASN A N   1 
ATOM   677  C  CA  . ASN A 1 148 ? 36.227  91.677  50.860  1.00 124.70 ? 148  ASN A CA  1 
ATOM   678  C  C   . ASN A 1 148 ? 35.551  90.381  51.227  1.00 124.70 ? 148  ASN A C   1 
ATOM   679  O  O   . ASN A 1 148 ? 36.148  89.542  51.891  1.00 124.70 ? 148  ASN A O   1 
ATOM   680  C  CB  . ASN A 1 148 ? 37.214  92.063  51.945  1.00 124.70 ? 148  ASN A CB  1 
ATOM   681  C  CG  . ASN A 1 148 ? 38.382  91.073  52.035  1.00 124.70 ? 148  ASN A CG  1 
ATOM   682  O  OD1 . ASN A 1 148 ? 38.947  90.865  53.108  1.00 124.70 ? 148  ASN A OD1 1 
ATOM   683  N  ND2 . ASN A 1 148 ? 38.747  90.467  50.901  1.00 124.70 ? 148  ASN A ND2 1 
ATOM   684  N  N   . ASP A 1 149 ? 34.307  90.186  50.822  1.00 124.70 ? 149  ASP A N   1 
ATOM   685  C  CA  . ASP A 1 149 ? 33.751  88.913  51.183  1.00 124.70 ? 149  ASP A CA  1 
ATOM   686  C  C   . ASP A 1 149 ? 33.595  88.116  49.938  1.00 124.70 ? 149  ASP A C   1 
ATOM   687  O  O   . ASP A 1 149 ? 32.665  88.306  49.158  1.00 124.70 ? 149  ASP A O   1 
ATOM   688  C  CB  . ASP A 1 149 ? 32.425  89.003  51.891  1.00 124.70 ? 149  ASP A CB  1 
ATOM   689  C  CG  . ASP A 1 149 ? 31.837  87.631  52.112  1.00 124.70 ? 149  ASP A CG  1 
ATOM   690  O  OD1 . ASP A 1 149 ? 31.911  86.817  51.169  1.00 124.70 ? 149  ASP A OD1 1 
ATOM   691  O  OD2 . ASP A 1 149 ? 31.310  87.359  53.204  1.00 124.70 ? 149  ASP A OD2 1 
ATOM   692  N  N   . PRO A 1 150 ? 34.550  87.231  49.716  1.00 124.70 ? 150  PRO A N   1 
ATOM   693  C  CA  . PRO A 1 150 ? 34.554  86.376  48.554  1.00 124.70 ? 150  PRO A CA  1 
ATOM   694  C  C   . PRO A 1 150 ? 33.189  85.871  48.302  1.00 124.70 ? 150  PRO A C   1 
ATOM   695  O  O   . PRO A 1 150 ? 32.398  85.659  49.188  1.00 124.70 ? 150  PRO A O   1 
ATOM   696  C  CB  . PRO A 1 150 ? 35.610  85.364  48.902  1.00 124.70 ? 150  PRO A CB  1 
ATOM   697  C  CG  . PRO A 1 150 ? 36.675  86.295  49.553  1.00 124.70 ? 150  PRO A CG  1 
ATOM   698  C  CD  . PRO A 1 150 ? 35.882  87.318  50.328  1.00 124.70 ? 150  PRO A CD  1 
ATOM   699  N  N   . ASP A 1 151 ? 32.888  85.751  47.042  1.00 124.70 ? 151  ASP A N   1 
ATOM   700  C  CA  . ASP A 1 151 ? 31.569  85.347  46.644  1.00 124.70 ? 151  ASP A CA  1 
ATOM   701  C  C   . ASP A 1 151 ? 31.921  85.074  45.256  1.00 124.70 ? 151  ASP A C   1 
ATOM   702  O  O   . ASP A 1 151 ? 31.143  85.245  44.313  1.00 124.70 ? 151  ASP A O   1 
ATOM   703  C  CB  . ASP A 1 151 ? 30.635  86.533  46.640  1.00 124.70 ? 151  ASP A CB  1 
ATOM   704  C  CG  . ASP A 1 151 ? 31.171  87.693  45.807  1.00 124.70 ? 151  ASP A CG  1 
ATOM   705  O  OD1 . ASP A 1 151 ? 31.843  87.477  44.773  1.00 124.70 ? 151  ASP A OD1 1 
ATOM   706  O  OD2 . ASP A 1 151 ? 30.899  88.841  46.184  1.00 124.70 ? 151  ASP A OD2 1 
ATOM   707  N  N   . CYS A 1 152 ? 33.154  84.735  45.062  1.00 124.70 ? 152  CYS A N   1 
ATOM   708  C  CA  . CYS A 1 152 ? 33.349  84.484  43.694  1.00 124.70 ? 152  CYS A CA  1 
ATOM   709  C  C   . CYS A 1 152 ? 34.080  83.230  43.627  1.00 124.70 ? 152  CYS A C   1 
ATOM   710  O  O   . CYS A 1 152 ? 35.259  83.181  43.960  1.00 124.70 ? 152  CYS A O   1 
ATOM   711  C  CB  . CYS A 1 152 ? 34.061  85.651  43.014  1.00 124.70 ? 152  CYS A CB  1 
ATOM   712  S  SG  . CYS A 1 152 ? 35.665  85.354  42.182  1.00 124.70 ? 152  CYS A SG  1 
ATOM   713  N  N   . GLU A 1 153 ? 33.391  82.163  43.269  1.00 124.70 ? 153  GLU A N   1 
ATOM   714  C  CA  . GLU A 1 153 ? 34.201  81.003  43.197  1.00 124.70 ? 153  GLU A CA  1 
ATOM   715  C  C   . GLU A 1 153 ? 35.310  81.330  42.102  1.00 124.70 ? 153  GLU A C   1 
ATOM   716  O  O   . GLU A 1 153 ? 35.322  80.859  40.947  1.00 124.70 ? 153  GLU A O   1 
ATOM   717  C  CB  . GLU A 1 153 ? 33.317  79.744  43.101  1.00 124.70 ? 153  GLU A CB  1 
ATOM   718  C  CG  . GLU A 1 153 ? 33.007  79.251  44.534  1.00 124.70 ? 153  GLU A CG  1 
ATOM   719  C  CD  . GLU A 1 153 ? 34.228  79.407  45.456  1.00 124.70 ? 153  GLU A CD  1 
ATOM   720  O  OE1 . GLU A 1 153 ? 34.470  80.538  45.940  1.00 124.70 ? 153  GLU A OE1 1 
ATOM   721  O  OE2 . GLU A 1 153 ? 34.956  78.412  45.678  1.00 124.70 ? 153  GLU A OE2 1 
ATOM   722  N  N   . ASP A 1 154 ? 36.184  82.237  42.629  1.00 124.70 ? 154  ASP A N   1 
ATOM   723  C  CA  . ASP A 1 154 ? 37.450  83.009  42.289  1.00 124.70 ? 154  ASP A CA  1 
ATOM   724  C  C   . ASP A 1 154 ? 37.943  84.005  41.180  1.00 124.70 ? 154  ASP A C   1 
ATOM   725  O  O   . ASP A 1 154 ? 38.642  83.625  40.230  1.00 124.70 ? 154  ASP A O   1 
ATOM   726  C  CB  . ASP A 1 154 ? 38.649  82.113  42.510  1.00 124.70 ? 154  ASP A CB  1 
ATOM   727  C  CG  . ASP A 1 154 ? 39.812  82.879  43.111  1.00 124.70 ? 154  ASP A CG  1 
ATOM   728  O  OD1 . ASP A 1 154 ? 39.664  84.106  43.334  1.00 124.70 ? 154  ASP A OD1 1 
ATOM   729  O  OD2 . ASP A 1 154 ? 40.868  82.265  43.369  1.00 124.70 ? 154  ASP A OD2 1 
ATOM   730  N  N   . GLY A 1 155 ? 37.703  85.309  41.407  1.00 124.70 ? 155  GLY A N   1 
ATOM   731  C  CA  . GLY A 1 155 ? 38.158  86.352  40.476  1.00 124.70 ? 155  GLY A CA  1 
ATOM   732  C  C   . GLY A 1 155 ? 37.352  87.649  40.197  1.00 124.70 ? 155  GLY A C   1 
ATOM   733  O  O   . GLY A 1 155 ? 37.564  88.306  39.123  1.00 124.70 ? 155  GLY A O   1 
ATOM   734  N  N   . SER A 1 156 ? 36.520  88.104  41.150  1.00 124.70 ? 156  SER A N   1 
ATOM   735  C  CA  . SER A 1 156 ? 35.652  89.232  40.783  1.00 124.70 ? 156  SER A CA  1 
ATOM   736  C  C   . SER A 1 156 ? 35.190  90.331  41.732  1.00 124.70 ? 156  SER A C   1 
ATOM   737  O  O   . SER A 1 156 ? 34.205  91.011  41.478  1.00 124.70 ? 156  SER A O   1 
ATOM   738  C  CB  . SER A 1 156 ? 34.405  88.630  40.118  1.00 124.70 ? 156  SER A CB  1 
ATOM   739  O  OG  . SER A 1 156 ? 33.292  88.567  40.987  1.00 124.70 ? 156  SER A OG  1 
ATOM   740  N  N   . ASP A 1 157 ? 35.873  90.525  42.832  1.00 124.70 ? 157  ASP A N   1 
ATOM   741  C  CA  . ASP A 1 157 ? 35.459  91.571  43.767  1.00 124.70 ? 157  ASP A CA  1 
ATOM   742  C  C   . ASP A 1 157 ? 36.496  91.373  44.818  1.00 124.70 ? 157  ASP A C   1 
ATOM   743  O  O   . ASP A 1 157 ? 36.534  91.996  45.886  1.00 124.70 ? 157  ASP A O   1 
ATOM   744  C  CB  . ASP A 1 157 ? 34.045  91.300  44.335  1.00 124.70 ? 157  ASP A CB  1 
ATOM   745  C  CG  . ASP A 1 157 ? 33.956  90.014  45.177  1.00 124.70 ? 157  ASP A CG  1 
ATOM   746  O  OD1 . ASP A 1 157 ? 34.259  88.895  44.684  1.00 124.70 ? 157  ASP A OD1 1 
ATOM   747  O  OD2 . ASP A 1 157 ? 33.554  90.124  46.351  1.00 124.70 ? 157  ASP A OD2 1 
ATOM   748  N  N   . GLU A 1 158 ? 37.331  90.418  44.448  1.00 124.70 ? 158  GLU A N   1 
ATOM   749  C  CA  . GLU A 1 158 ? 38.432  89.944  45.226  1.00 124.70 ? 158  GLU A CA  1 
ATOM   750  C  C   . GLU A 1 158 ? 39.339  89.148  44.335  1.00 124.70 ? 158  GLU A C   1 
ATOM   751  O  O   . GLU A 1 158 ? 39.555  87.941  44.474  1.00 124.70 ? 158  GLU A O   1 
ATOM   752  C  CB  . GLU A 1 158 ? 37.923  89.101  46.361  1.00 124.70 ? 158  GLU A CB  1 
ATOM   753  C  CG  . GLU A 1 158 ? 36.972  89.853  47.219  1.00 124.70 ? 158  GLU A CG  1 
ATOM   754  C  CD  . GLU A 1 158 ? 35.927  88.959  47.821  1.00 124.70 ? 158  GLU A CD  1 
ATOM   755  O  OE1 . GLU A 1 158 ? 35.929  87.750  47.502  1.00 124.70 ? 158  GLU A OE1 1 
ATOM   756  O  OE2 . GLU A 1 158 ? 35.104  89.470  48.599  1.00 124.70 ? 158  GLU A OE2 1 
ATOM   757  N  N   . TRP A 1 159 ? 39.835  89.868  43.357  1.00 124.70 ? 159  TRP A N   1 
ATOM   758  C  CA  . TRP A 1 159 ? 40.850  89.344  42.486  1.00 124.70 ? 159  TRP A CA  1 
ATOM   759  C  C   . TRP A 1 159 ? 41.164  90.416  41.469  1.00 124.70 ? 159  TRP A C   1 
ATOM   760  O  O   . TRP A 1 159 ? 40.721  90.276  40.330  1.00 124.70 ? 159  TRP A O   1 
ATOM   761  C  CB  . TRP A 1 159 ? 40.458  88.064  41.772  1.00 124.70 ? 159  TRP A CB  1 
ATOM   762  C  CG  . TRP A 1 159 ? 41.670  87.485  41.156  1.00 124.70 ? 159  TRP A CG  1 
ATOM   763  C  CD1 . TRP A 1 159 ? 41.699  86.566  40.169  1.00 124.70 ? 159  TRP A CD1 1 
ATOM   764  C  CD2 . TRP A 1 159 ? 43.045  87.723  41.529  1.00 124.70 ? 159  TRP A CD2 1 
ATOM   765  N  NE1 . TRP A 1 159 ? 42.993  86.190  39.902  1.00 124.70 ? 159  TRP A NE1 1 
ATOM   766  C  CE2 . TRP A 1 159 ? 43.853  86.882  40.740  1.00 124.70 ? 159  TRP A CE2 1 
ATOM   767  C  CE3 . TRP A 1 159 ? 43.684  88.542  42.491  1.00 124.70 ? 159  TRP A CE3 1 
ATOM   768  C  CZ2 . TRP A 1 159 ? 45.249  86.842  40.816  1.00 124.70 ? 159  TRP A CZ2 1 
ATOM   769  C  CZ3 . TRP A 1 159 ? 45.092  88.510  42.586  1.00 124.70 ? 159  TRP A CZ3 1 
ATOM   770  C  CH2 . TRP A 1 159 ? 45.855  87.647  41.757  1.00 124.70 ? 159  TRP A CH2 1 
ATOM   771  N  N   . PRO A 1 160 ? 41.892  91.523  41.883  1.00 124.70 ? 160  PRO A N   1 
ATOM   772  C  CA  . PRO A 1 160 ? 42.292  92.663  41.044  1.00 124.70 ? 160  PRO A CA  1 
ATOM   773  C  C   . PRO A 1 160 ? 42.514  92.401  39.545  1.00 124.70 ? 160  PRO A C   1 
ATOM   774  O  O   . PRO A 1 160 ? 43.615  92.537  38.988  1.00 124.70 ? 160  PRO A O   1 
ATOM   775  C  CB  . PRO A 1 160 ? 43.504  93.243  41.807  1.00 124.70 ? 160  PRO A CB  1 
ATOM   776  C  CG  . PRO A 1 160 ? 42.989  93.216  43.231  1.00 124.70 ? 160  PRO A CG  1 
ATOM   777  C  CD  . PRO A 1 160 ? 42.255  91.832  43.294  1.00 124.70 ? 160  PRO A CD  1 
ATOM   778  N  N   . GLN A 1 161 ? 41.410  91.978  38.928  1.00 124.70 ? 161  GLN A N   1 
ATOM   779  C  CA  . GLN A 1 161 ? 41.308  91.756  37.497  1.00 124.70 ? 161  GLN A CA  1 
ATOM   780  C  C   . GLN A 1 161 ? 40.562  93.044  37.222  1.00 124.70 ? 161  GLN A C   1 
ATOM   781  O  O   . GLN A 1 161 ? 39.441  93.052  36.707  1.00 124.70 ? 161  GLN A O   1 
ATOM   782  C  CB  . GLN A 1 161 ? 40.435  90.533  37.132  1.00 124.70 ? 161  GLN A CB  1 
ATOM   783  N  N   . ARG A 1 162 ? 41.213  94.123  37.657  1.00 124.70 ? 162  ARG A N   1 
ATOM   784  C  CA  . ARG A 1 162 ? 40.772  95.511  37.496  1.00 124.70 ? 162  ARG A CA  1 
ATOM   785  C  C   . ARG A 1 162 ? 39.733  96.124  38.461  1.00 124.70 ? 162  ARG A C   1 
ATOM   786  O  O   . ARG A 1 162 ? 38.836  96.866  38.040  1.00 124.70 ? 162  ARG A O   1 
ATOM   787  C  CB  . ARG A 1 162 ? 40.353  95.772  36.005  1.00 124.70 ? 162  ARG A CB  1 
ATOM   788  N  N   . CYS A 1 163 ? 39.833  95.783  39.743  1.00 124.70 ? 163  CYS A N   1 
ATOM   789  C  CA  . CYS A 1 163 ? 39.005  96.428  40.759  1.00 124.70 ? 163  CYS A CA  1 
ATOM   790  C  C   . CYS A 1 163 ? 39.975  97.623  40.932  1.00 124.70 ? 163  CYS A C   1 
ATOM   791  O  O   . CYS A 1 163 ? 41.082  97.541  40.400  1.00 124.70 ? 163  CYS A O   1 
ATOM   792  C  CB  . CYS A 1 163 ? 38.959  95.552  42.030  1.00 124.70 ? 163  CYS A CB  1 
ATOM   793  S  SG  . CYS A 1 163 ? 37.536  94.415  42.128  1.00 124.70 ? 163  CYS A SG  1 
ATOM   794  N  N   . ARG A 1 164 ? 39.671  98.694  41.664  1.00 124.70 ? 164  ARG A N   1 
ATOM   795  C  CA  . ARG A 1 164 ? 40.699  99.747  41.698  1.00 124.70 ? 164  ARG A CA  1 
ATOM   796  C  C   . ARG A 1 164 ? 41.945  99.515  42.581  1.00 124.70 ? 164  ARG A C   1 
ATOM   797  O  O   . ARG A 1 164 ? 42.025  98.526  43.318  1.00 124.70 ? 164  ARG A O   1 
ATOM   798  C  CB  . ARG A 1 164 ? 40.084  101.093 42.044  1.00 124.70 ? 164  ARG A CB  1 
ATOM   799  C  CG  . ARG A 1 164 ? 40.935  102.231 41.523  1.00 124.70 ? 164  ARG A CG  1 
ATOM   800  C  CD  . ARG A 1 164 ? 40.668  103.510 42.268  1.00 124.70 ? 164  ARG A CD  1 
ATOM   801  N  NE  . ARG A 1 164 ? 41.732  104.471 42.005  1.00 124.70 ? 164  ARG A NE  1 
ATOM   802  C  CZ  . ARG A 1 164 ? 41.754  105.706 42.489  1.00 124.70 ? 164  ARG A CZ  1 
ATOM   803  N  NH1 . ARG A 1 164 ? 40.766  106.128 43.264  1.00 124.70 ? 164  ARG A NH1 1 
ATOM   804  N  NH2 . ARG A 1 164 ? 42.759  106.519 42.196  1.00 124.70 ? 164  ARG A NH2 1 
ATOM   805  N  N   . GLY A 1 165 ? 42.920  100.422 42.433  1.00 124.70 ? 165  GLY A N   1 
ATOM   806  C  CA  . GLY A 1 165 ? 44.172  100.409 43.184  1.00 124.70 ? 165  GLY A CA  1 
ATOM   807  C  C   . GLY A 1 165 ? 45.322  99.522  42.705  1.00 124.70 ? 165  GLY A C   1 
ATOM   808  O  O   . GLY A 1 165 ? 46.166  99.093  43.514  1.00 124.70 ? 165  GLY A O   1 
ATOM   809  N  N   . LEU A 1 166 ? 45.425  99.298  41.398  1.00 124.70 ? 166  LEU A N   1 
ATOM   810  C  CA  . LEU A 1 166 ? 46.443  98.381  40.915  1.00 124.70 ? 166  LEU A CA  1 
ATOM   811  C  C   . LEU A 1 166 ? 47.872  98.684  40.410  1.00 124.70 ? 166  LEU A C   1 
ATOM   812  O  O   . LEU A 1 166 ? 48.323  97.908  39.584  1.00 124.70 ? 166  LEU A O   1 
ATOM   813  C  CB  . LEU A 1 166 ? 45.762  97.438  39.907  1.00 124.70 ? 166  LEU A CB  1 
ATOM   814  C  CG  . LEU A 1 166 ? 44.839  96.401  40.568  1.00 124.70 ? 166  LEU A CG  1 
ATOM   815  C  CD1 . LEU A 1 166 ? 43.923  95.778  39.542  1.00 124.70 ? 166  LEU A CD1 1 
ATOM   816  C  CD2 . LEU A 1 166 ? 45.674  95.328  41.252  1.00 124.70 ? 166  LEU A CD2 1 
ATOM   817  N  N   . TYR A 1 167 ? 48.599  99.728  40.858  1.00 124.70 ? 167  TYR A N   1 
ATOM   818  C  CA  . TYR A 1 167 ? 50.006  99.894  40.373  1.00 124.70 ? 167  TYR A CA  1 
ATOM   819  C  C   . TYR A 1 167 ? 51.205  100.395 41.247  1.00 124.70 ? 167  TYR A C   1 
ATOM   820  O  O   . TYR A 1 167 ? 51.070  101.308 42.067  1.00 124.70 ? 167  TYR A O   1 
ATOM   821  C  CB  . TYR A 1 167 ? 50.027  100.557 38.982  1.00 124.70 ? 167  TYR A CB  1 
ATOM   822  C  CG  . TYR A 1 167 ? 50.493  99.478  38.035  1.00 124.70 ? 167  TYR A CG  1 
ATOM   823  C  CD1 . TYR A 1 167 ? 50.185  98.150  38.328  1.00 124.70 ? 167  TYR A CD1 1 
ATOM   824  C  CD2 . TYR A 1 167 ? 51.364  99.720  36.978  1.00 124.70 ? 167  TYR A CD2 1 
ATOM   825  C  CE1 . TYR A 1 167 ? 50.716  97.088  37.652  1.00 124.70 ? 167  TYR A CE1 1 
ATOM   826  C  CE2 . TYR A 1 167 ? 51.918  98.632  36.263  1.00 124.70 ? 167  TYR A CE2 1 
ATOM   827  C  CZ  . TYR A 1 167 ? 51.586  97.308  36.627  1.00 124.70 ? 167  TYR A CZ  1 
ATOM   828  O  OH  . TYR A 1 167 ? 52.148  96.182  36.047  1.00 124.70 ? 167  TYR A OH  1 
ATOM   829  N  N   . VAL A 1 168 ? 52.372  99.761  41.005  1.00 124.70 ? 168  VAL A N   1 
ATOM   830  C  CA  . VAL A 1 168 ? 53.694  99.870  41.723  1.00 124.70 ? 168  VAL A CA  1 
ATOM   831  C  C   . VAL A 1 168 ? 54.779  101.026 41.725  1.00 124.70 ? 168  VAL A C   1 
ATOM   832  O  O   . VAL A 1 168 ? 54.966  101.712 40.711  1.00 124.70 ? 168  VAL A O   1 
ATOM   833  C  CB  . VAL A 1 168 ? 54.469  98.536  41.431  1.00 124.70 ? 168  VAL A CB  1 
ATOM   834  C  CG1 . VAL A 1 168 ? 53.458  97.385  41.262  1.00 124.70 ? 168  VAL A CG1 1 
ATOM   835  C  CG2 . VAL A 1 168 ? 55.328  98.665  40.156  1.00 124.70 ? 168  VAL A CG2 1 
ATOM   836  N  N   . PHE A 1 169 ? 55.520  101.187 42.852  1.00 124.70 ? 169  PHE A N   1 
ATOM   837  C  CA  . PHE A 1 169 ? 56.579  102.240 42.986  1.00 124.70 ? 169  PHE A CA  1 
ATOM   838  C  C   . PHE A 1 169 ? 57.701  102.282 44.115  1.00 124.70 ? 169  PHE A C   1 
ATOM   839  O  O   . PHE A 1 169 ? 58.308  101.255 44.458  1.00 124.70 ? 169  PHE A O   1 
ATOM   840  C  CB  . PHE A 1 169 ? 55.913  103.628 42.946  1.00 124.70 ? 169  PHE A CB  1 
ATOM   841  C  CG  . PHE A 1 169 ? 56.712  104.679 42.192  1.00 124.70 ? 169  PHE A CG  1 
ATOM   842  C  CD1 . PHE A 1 169 ? 56.418  104.979 40.862  1.00 124.70 ? 169  PHE A CD1 1 
ATOM   843  C  CD2 . PHE A 1 169 ? 57.747  105.375 42.817  1.00 124.70 ? 169  PHE A CD2 1 
ATOM   844  C  CE1 . PHE A 1 169 ? 57.142  105.960 40.168  1.00 124.70 ? 169  PHE A CE1 1 
ATOM   845  C  CE2 . PHE A 1 169 ? 58.478  106.353 42.137  1.00 124.70 ? 169  PHE A CE2 1 
ATOM   846  C  CZ  . PHE A 1 169 ? 58.174  106.647 40.809  1.00 124.70 ? 169  PHE A CZ  1 
ATOM   847  N  N   . GLN A 1 170 ? 57.936  103.500 44.655  1.00 124.70 ? 170  GLN A N   1 
ATOM   848  C  CA  . GLN A 1 170 ? 58.987  103.911 45.644  1.00 124.70 ? 170  GLN A CA  1 
ATOM   849  C  C   . GLN A 1 170 ? 59.150  103.519 47.142  1.00 124.70 ? 170  GLN A C   1 
ATOM   850  O  O   . GLN A 1 170 ? 58.884  104.335 48.040  1.00 124.70 ? 170  GLN A O   1 
ATOM   851  C  CB  . GLN A 1 170 ? 59.124  105.462 45.591  1.00 124.70 ? 170  GLN A CB  1 
ATOM   852  C  CG  . GLN A 1 170 ? 60.252  106.074 46.479  1.00 124.70 ? 170  GLN A CG  1 
ATOM   853  C  CD  . GLN A 1 170 ? 60.138  107.595 46.697  1.00 124.70 ? 170  GLN A CD  1 
ATOM   854  O  OE1 . GLN A 1 170 ? 59.126  108.217 46.355  1.00 124.70 ? 170  GLN A OE1 1 
ATOM   855  N  NE2 . GLN A 1 170 ? 61.181  108.190 47.284  1.00 124.70 ? 170  GLN A NE2 1 
ATOM   856  N  N   . GLY A 1 171 ? 59.628  102.307 47.418  1.00 124.70 ? 171  GLY A N   1 
ATOM   857  C  CA  . GLY A 1 171 ? 59.896  101.935 48.800  1.00 124.70 ? 171  GLY A CA  1 
ATOM   858  C  C   . GLY A 1 171 ? 58.869  101.323 49.730  1.00 124.70 ? 171  GLY A C   1 
ATOM   859  O  O   . GLY A 1 171 ? 59.149  101.190 50.929  1.00 124.70 ? 171  GLY A O   1 
ATOM   860  N  N   . ASP A 1 172 ? 57.688  100.968 49.229  1.00 124.70 ? 172  ASP A N   1 
ATOM   861  C  CA  . ASP A 1 172 ? 56.701  100.338 50.104  1.00 124.70 ? 172  ASP A CA  1 
ATOM   862  C  C   . ASP A 1 172 ? 56.017  99.150  49.444  1.00 124.70 ? 172  ASP A C   1 
ATOM   863  O  O   . ASP A 1 172 ? 55.050  99.266  48.679  1.00 124.70 ? 172  ASP A O   1 
ATOM   864  C  CB  . ASP A 1 172 ? 55.653  101.338 50.618  1.00 124.70 ? 172  ASP A CB  1 
ATOM   865  C  CG  . ASP A 1 172 ? 55.197  101.018 52.047  1.00 124.70 ? 172  ASP A CG  1 
ATOM   866  O  OD1 . ASP A 1 172 ? 54.958  99.822  52.353  1.00 124.70 ? 172  ASP A OD1 1 
ATOM   867  O  OD2 . ASP A 1 172 ? 55.077  101.964 52.860  1.00 124.70 ? 172  ASP A OD2 1 
ATOM   868  N  N   . SER A 1 173 ? 56.581  97.999  49.773  1.00 124.70 ? 173  SER A N   1 
ATOM   869  C  CA  . SER A 1 173 ? 56.160  96.686  49.320  1.00 124.70 ? 173  SER A CA  1 
ATOM   870  C  C   . SER A 1 173 ? 54.805  96.387  49.974  1.00 124.70 ? 173  SER A C   1 
ATOM   871  O  O   . SER A 1 173 ? 54.777  96.021  51.149  1.00 124.70 ? 173  SER A O   1 
ATOM   872  C  CB  . SER A 1 173 ? 57.200  95.705  49.837  1.00 124.70 ? 173  SER A CB  1 
ATOM   873  O  OG  . SER A 1 173 ? 58.377  96.375  50.296  1.00 124.70 ? 173  SER A OG  1 
ATOM   874  N  N   . SER A 1 174 ? 53.680  96.489  49.274  1.00 124.70 ? 174  SER A N   1 
ATOM   875  C  CA  . SER A 1 174 ? 52.473  96.234  50.055  1.00 124.70 ? 174  SER A CA  1 
ATOM   876  C  C   . SER A 1 174 ? 51.086  95.823  49.475  1.00 124.70 ? 174  SER A C   1 
ATOM   877  O  O   . SER A 1 174 ? 50.213  96.670  49.239  1.00 124.70 ? 174  SER A O   1 
ATOM   878  C  CB  . SER A 1 174 ? 52.317  97.426  51.034  1.00 124.70 ? 174  SER A CB  1 
ATOM   879  O  OG  . SER A 1 174 ? 51.063  98.082  50.950  1.00 124.70 ? 174  SER A OG  1 
ATOM   880  N  N   . PRO A 1 175 ? 50.853  94.502  49.292  1.00 124.70 ? 175  PRO A N   1 
ATOM   881  C  CA  . PRO A 1 175 ? 49.613  93.867  48.766  1.00 124.70 ? 175  PRO A CA  1 
ATOM   882  C  C   . PRO A 1 175 ? 48.181  93.940  49.436  1.00 124.70 ? 175  PRO A C   1 
ATOM   883  O  O   . PRO A 1 175 ? 47.766  93.001  50.120  1.00 124.70 ? 175  PRO A O   1 
ATOM   884  C  CB  . PRO A 1 175 ? 50.047  92.412  48.574  1.00 124.70 ? 175  PRO A CB  1 
ATOM   885  C  CG  . PRO A 1 175 ? 51.449  92.573  48.116  1.00 124.70 ? 175  PRO A CG  1 
ATOM   886  C  CD  . PRO A 1 175 ? 52.031  93.647  49.023  1.00 124.70 ? 175  PRO A CD  1 
ATOM   887  N  N   . CYS A 1 176 ? 47.463  95.052  49.245  1.00 124.70 ? 176  CYS A N   1 
ATOM   888  C  CA  . CYS A 1 176 ? 46.086  95.214  49.703  1.00 124.70 ? 176  CYS A CA  1 
ATOM   889  C  C   . CYS A 1 176 ? 45.533  96.503  49.078  1.00 124.70 ? 176  CYS A C   1 
ATOM   890  O  O   . CYS A 1 176 ? 46.079  97.620  49.311  1.00 124.70 ? 176  CYS A O   1 
ATOM   891  C  CB  . CYS A 1 176 ? 45.969  95.224  51.257  1.00 124.70 ? 176  CYS A CB  1 
ATOM   892  S  SG  . CYS A 1 176 ? 44.370  94.596  51.939  1.00 124.70 ? 176  CYS A SG  1 
ATOM   893  N  N   . SER A 1 177 ? 44.514  96.327  48.213  1.00 124.70 ? 177  SER A N   1 
ATOM   894  C  CA  . SER A 1 177 ? 43.843  97.478  47.590  1.00 124.70 ? 177  SER A CA  1 
ATOM   895  C  C   . SER A 1 177 ? 43.293  98.172  48.826  1.00 124.70 ? 177  SER A C   1 
ATOM   896  O  O   . SER A 1 177 ? 42.082  98.354  49.015  1.00 124.70 ? 177  SER A O   1 
ATOM   897  C  CB  . SER A 1 177 ? 42.698  97.065  46.658  1.00 124.70 ? 177  SER A CB  1 
ATOM   898  O  OG  . SER A 1 177 ? 42.099  98.223  46.084  1.00 124.70 ? 177  SER A OG  1 
ATOM   899  N  N   . ALA A 1 178 ? 44.261  98.537  49.655  1.00 124.70 ? 178  ALA A N   1 
ATOM   900  C  CA  . ALA A 1 178 ? 44.095  99.141  50.943  1.00 124.70 ? 178  ALA A CA  1 
ATOM   901  C  C   . ALA A 1 178 ? 43.042  100.149 51.290  1.00 124.70 ? 178  ALA A C   1 
ATOM   902  O  O   . ALA A 1 178 ? 43.200  101.368 51.150  1.00 124.70 ? 178  ALA A O   1 
ATOM   903  C  CB  . ALA A 1 178 ? 45.435  99.647  51.458  1.00 124.70 ? 178  ALA A CB  1 
ATOM   904  N  N   . PHE A 1 179 ? 41.930  99.565  51.691  1.00 124.70 ? 179  PHE A N   1 
ATOM   905  C  CA  . PHE A 1 179 ? 40.817  100.236 52.319  1.00 124.70 ? 179  PHE A CA  1 
ATOM   906  C  C   . PHE A 1 179 ? 41.133  99.218  53.499  1.00 124.70 ? 179  PHE A C   1 
ATOM   907  O  O   . PHE A 1 179 ? 40.205  98.838  54.209  1.00 124.70 ? 179  PHE A O   1 
ATOM   908  C  CB  . PHE A 1 179 ? 39.447  99.928  51.589  1.00 124.70 ? 179  PHE A CB  1 
ATOM   909  C  CG  . PHE A 1 179 ? 38.228  100.807 52.026  1.00 124.70 ? 179  PHE A CG  1 
ATOM   910  C  CD1 . PHE A 1 179 ? 38.064  102.133 51.591  1.00 124.70 ? 179  PHE A CD1 1 
ATOM   911  C  CD2 . PHE A 1 179 ? 37.218  100.261 52.821  1.00 124.70 ? 179  PHE A CD2 1 
ATOM   912  C  CE1 . PHE A 1 179 ? 36.906  102.882 51.935  1.00 124.70 ? 179  PHE A CE1 1 
ATOM   913  C  CE2 . PHE A 1 179 ? 36.070  100.996 53.168  1.00 124.70 ? 179  PHE A CE2 1 
ATOM   914  C  CZ  . PHE A 1 179 ? 35.917  102.307 52.726  1.00 124.70 ? 179  PHE A CZ  1 
ATOM   915  N  N   . GLU A 1 180 ? 42.431  98.789  53.684  1.00 124.70 ? 180  GLU A N   1 
ATOM   916  C  CA  . GLU A 1 180 ? 42.877  97.729  54.705  1.00 124.70 ? 180  GLU A CA  1 
ATOM   917  C  C   . GLU A 1 180 ? 44.333  97.381  55.291  1.00 124.70 ? 180  GLU A C   1 
ATOM   918  O  O   . GLU A 1 180 ? 45.341  97.942  54.849  1.00 124.70 ? 180  GLU A O   1 
ATOM   919  C  CB  . GLU A 1 180 ? 42.333  96.397  54.227  1.00 124.70 ? 180  GLU A CB  1 
ATOM   920  C  CG  . GLU A 1 180 ? 40.850  96.394  54.063  1.00 124.70 ? 180  GLU A CG  1 
ATOM   921  C  CD  . GLU A 1 180 ? 40.163  96.858  55.330  1.00 124.70 ? 180  GLU A CD  1 
ATOM   922  O  OE1 . GLU A 1 180 ? 40.862  97.245  56.299  1.00 124.70 ? 180  GLU A OE1 1 
ATOM   923  O  OE2 . GLU A 1 180 ? 38.918  96.843  55.368  1.00 124.70 ? 180  GLU A OE2 1 
ATOM   924  N  N   . PHE A 1 181 ? 44.410  96.396  56.229  1.00 124.70 ? 181  PHE A N   1 
ATOM   925  C  CA  . PHE A 1 181 ? 45.668  95.968  56.946  1.00 124.70 ? 181  PHE A CA  1 
ATOM   926  C  C   . PHE A 1 181 ? 46.270  94.523  56.893  1.00 124.70 ? 181  PHE A C   1 
ATOM   927  O  O   . PHE A 1 181 ? 45.646  93.563  57.352  1.00 124.70 ? 181  PHE A O   1 
ATOM   928  C  CB  . PHE A 1 181 ? 45.535  96.349  58.428  1.00 124.70 ? 181  PHE A CB  1 
ATOM   929  N  N   . HIS A 1 182 ? 47.503  94.396  56.383  1.00 124.70 ? 182  HIS A N   1 
ATOM   930  C  CA  . HIS A 1 182 ? 48.225  93.105  56.291  1.00 124.70 ? 182  HIS A CA  1 
ATOM   931  C  C   . HIS A 1 182 ? 48.955  92.834  57.600  1.00 124.70 ? 182  HIS A C   1 
ATOM   932  O  O   . HIS A 1 182 ? 49.426  93.761  58.254  1.00 124.70 ? 182  HIS A O   1 
ATOM   933  C  CB  . HIS A 1 182 ? 49.249  93.150  55.139  1.00 124.70 ? 182  HIS A CB  1 
ATOM   934  C  CG  . HIS A 1 182 ? 50.438  92.235  55.313  1.00 124.70 ? 182  HIS A CG  1 
ATOM   935  N  ND1 . HIS A 1 182 ? 50.643  91.128  54.517  1.00 124.70 ? 182  HIS A ND1 1 
ATOM   936  C  CD2 . HIS A 1 182 ? 51.491  92.276  56.172  1.00 124.70 ? 182  HIS A CD2 1 
ATOM   937  C  CE1 . HIS A 1 182 ? 51.764  90.524  54.876  1.00 124.70 ? 182  HIS A CE1 1 
ATOM   938  N  NE2 . HIS A 1 182 ? 52.298  91.200  55.879  1.00 124.70 ? 182  HIS A NE2 1 
ATOM   939  N  N   . CYS A 1 183 ? 49.089  91.571  57.980  1.00 124.70 ? 183  CYS A N   1 
ATOM   940  C  CA  . CYS A 1 183 ? 49.766  91.277  59.233  1.00 124.70 ? 183  CYS A CA  1 
ATOM   941  C  C   . CYS A 1 183 ? 50.903  90.258  59.157  1.00 124.70 ? 183  CYS A C   1 
ATOM   942  O  O   . CYS A 1 183 ? 51.157  89.678  58.103  1.00 124.70 ? 183  CYS A O   1 
ATOM   943  C  CB  . CYS A 1 183 ? 48.717  90.849  60.233  1.00 124.70 ? 183  CYS A CB  1 
ATOM   944  S  SG  . CYS A 1 183 ? 47.528  89.588  59.727  1.00 124.70 ? 183  CYS A SG  1 
ATOM   945  N  N   . LEU A 1 184 ? 51.601  90.036  60.267  1.00 124.70 ? 184  LEU A N   1 
ATOM   946  C  CA  . LEU A 1 184 ? 52.696  89.059  60.261  1.00 124.70 ? 184  LEU A CA  1 
ATOM   947  C  C   . LEU A 1 184 ? 52.195  87.634  60.547  1.00 124.70 ? 184  LEU A C   1 
ATOM   948  O  O   . LEU A 1 184 ? 52.914  86.809  61.120  1.00 124.70 ? 184  LEU A O   1 
ATOM   949  C  CB  . LEU A 1 184 ? 53.780  89.458  61.278  1.00 124.70 ? 184  LEU A CB  1 
ATOM   950  N  N   . SER A 1 185 ? 50.953  87.367  60.151  1.00 124.70 ? 185  SER A N   1 
ATOM   951  C  CA  . SER A 1 185 ? 50.311  86.061  60.319  1.00 124.70 ? 185  SER A CA  1 
ATOM   952  C  C   . SER A 1 185 ? 49.048  86.068  59.541  1.00 124.70 ? 185  SER A C   1 
ATOM   953  O  O   . SER A 1 185 ? 47.944  86.034  60.096  1.00 124.70 ? 185  SER A O   1 
ATOM   954  C  CB  . SER A 1 185 ? 49.896  85.782  61.733  1.00 124.70 ? 185  SER A CB  1 
ATOM   955  O  OG  . SER A 1 185 ? 48.946  84.716  61.762  1.00 124.70 ? 185  SER A OG  1 
ATOM   956  N  N   . GLY A 1 186 ? 49.197  86.080  58.240  1.00 124.70 ? 186  GLY A N   1 
ATOM   957  C  CA  . GLY A 1 186 ? 48.007  86.089  57.454  1.00 124.70 ? 186  GLY A CA  1 
ATOM   958  C  C   . GLY A 1 186 ? 47.884  87.448  56.874  1.00 124.70 ? 186  GLY A C   1 
ATOM   959  O  O   . GLY A 1 186 ? 48.693  88.355  57.122  1.00 124.70 ? 186  GLY A O   1 
ATOM   960  N  N   . GLU A 1 187 ? 46.831  87.585  56.102  1.00 124.70 ? 187  GLU A N   1 
ATOM   961  C  CA  . GLU A 1 187 ? 46.626  88.836  55.461  1.00 124.70 ? 187  GLU A CA  1 
ATOM   962  C  C   . GLU A 1 187 ? 45.300  89.531  55.930  1.00 124.70 ? 187  GLU A C   1 
ATOM   963  O  O   . GLU A 1 187 ? 44.521  88.940  56.702  1.00 124.70 ? 187  GLU A O   1 
ATOM   964  C  CB  . GLU A 1 187 ? 46.825  88.583  53.951  1.00 124.70 ? 187  GLU A CB  1 
ATOM   965  C  CG  . GLU A 1 187 ? 48.115  87.684  53.638  1.00 124.70 ? 187  GLU A CG  1 
ATOM   966  C  CD  . GLU A 1 187 ? 49.429  88.151  54.303  1.00 124.70 ? 187  GLU A CD  1 
ATOM   967  O  OE1 . GLU A 1 187 ? 49.422  89.209  54.951  1.00 124.70 ? 187  GLU A OE1 1 
ATOM   968  O  OE2 . GLU A 1 187 ? 50.464  87.456  54.172  1.00 124.70 ? 187  GLU A OE2 1 
ATOM   969  N  N   . CYS A 1 188 ? 45.116  90.795  55.490  1.00 124.70 ? 188  CYS A N   1 
ATOM   970  C  CA  . CYS A 1 188 ? 44.025  91.821  55.795  1.00 124.70 ? 188  CYS A CA  1 
ATOM   971  C  C   . CYS A 1 188 ? 42.445  91.685  56.041  1.00 124.70 ? 188  CYS A C   1 
ATOM   972  O  O   . CYS A 1 188 ? 41.817  90.671  55.678  1.00 124.70 ? 188  CYS A O   1 
ATOM   973  C  CB  . CYS A 1 188 ? 44.269  93.067  54.852  1.00 124.70 ? 188  CYS A CB  1 
ATOM   974  S  SG  . CYS A 1 188 ? 44.435  92.823  53.008  1.00 124.70 ? 188  CYS A SG  1 
ATOM   975  N  N   . ILE A 1 189 ? 41.853  92.772  56.627  1.00 124.70 ? 189  ILE A N   1 
ATOM   976  C  CA  . ILE A 1 189 ? 40.433  92.885  57.161  1.00 124.70 ? 189  ILE A CA  1 
ATOM   977  C  C   . ILE A 1 189 ? 39.369  94.119  57.005  1.00 124.70 ? 189  ILE A C   1 
ATOM   978  O  O   . ILE A 1 189 ? 39.802  95.253  56.783  1.00 124.70 ? 189  ILE A O   1 
ATOM   979  C  CB  . ILE A 1 189 ? 40.621  92.575  58.668  1.00 124.70 ? 189  ILE A CB  1 
ATOM   980  C  CG1 . ILE A 1 189 ? 41.961  91.840  58.848  1.00 124.70 ? 189  ILE A CG1 1 
ATOM   981  C  CG2 . ILE A 1 189 ? 39.527  91.731  59.184  1.00 124.70 ? 189  ILE A CG2 1 
ATOM   982  C  CD1 . ILE A 1 189 ? 42.270  91.371  60.245  1.00 124.70 ? 189  ILE A CD1 1 
ATOM   983  N  N   . HIS A 1 190 ? 38.025  93.839  57.159  1.00 124.70 ? 190  HIS A N   1 
ATOM   984  C  CA  . HIS A 1 190 ? 36.741  94.732  57.094  1.00 124.70 ? 190  HIS A CA  1 
ATOM   985  C  C   . HIS A 1 190 ? 36.628  95.815  58.249  1.00 124.70 ? 190  HIS A C   1 
ATOM   986  O  O   . HIS A 1 190 ? 37.320  95.665  59.233  1.00 124.70 ? 190  HIS A O   1 
ATOM   987  C  CB  . HIS A 1 190 ? 35.430  93.914  57.374  1.00 124.70 ? 190  HIS A CB  1 
ATOM   988  C  CG  . HIS A 1 190 ? 34.841  93.079  56.253  1.00 124.70 ? 190  HIS A CG  1 
ATOM   989  N  ND1 . HIS A 1 190 ? 33.486  93.036  56.047  1.00 124.70 ? 190  HIS A ND1 1 
ATOM   990  C  CD2 . HIS A 1 190 ? 35.390  92.165  55.411  1.00 124.70 ? 190  HIS A CD2 1 
ATOM   991  C  CE1 . HIS A 1 190 ? 33.206  92.128  55.112  1.00 124.70 ? 190  HIS A CE1 1 
ATOM   992  N  NE2 . HIS A 1 190 ? 34.337  91.594  54.717  1.00 124.70 ? 190  HIS A NE2 1 
ATOM   993  N  N   . SER A 1 191 ? 35.751  96.841  58.162  1.00 124.70 ? 191  SER A N   1 
ATOM   994  C  CA  . SER A 1 191 ? 35.553  97.830  59.262  1.00 124.70 ? 191  SER A CA  1 
ATOM   995  C  C   . SER A 1 191 ? 36.788  97.923  60.199  1.00 124.70 ? 191  SER A C   1 
ATOM   996  O  O   . SER A 1 191 ? 36.671  97.938  61.439  1.00 124.70 ? 191  SER A O   1 
ATOM   997  C  CB  . SER A 1 191 ? 34.346  97.388  60.097  1.00 124.70 ? 191  SER A CB  1 
ATOM   998  O  OG  . SER A 1 191 ? 34.570  96.089  60.635  1.00 124.70 ? 191  SER A OG  1 
ATOM   999  N  N   . SER A 1 192 ? 37.961  97.846  59.565  1.00 124.70 ? 192  SER A N   1 
ATOM   1000 C  CA  . SER A 1 192 ? 39.296  97.860  60.182  1.00 124.70 ? 192  SER A CA  1 
ATOM   1001 C  C   . SER A 1 192 ? 39.490  97.026  61.456  1.00 124.70 ? 192  SER A C   1 
ATOM   1002 O  O   . SER A 1 192 ? 40.146  97.526  62.346  1.00 124.70 ? 192  SER A O   1 
ATOM   1003 C  CB  . SER A 1 192 ? 39.714  99.304  60.524  1.00 124.70 ? 192  SER A CB  1 
ATOM   1004 O  OG  . SER A 1 192 ? 40.983  99.351  61.177  1.00 124.70 ? 192  SER A OG  1 
ATOM   1005 N  N   . TRP A 1 193 ? 39.032  95.780  61.594  1.00 124.70 ? 193  TRP A N   1 
ATOM   1006 C  CA  . TRP A 1 193 ? 39.180  95.109  62.940  1.00 124.70 ? 193  TRP A CA  1 
ATOM   1007 C  C   . TRP A 1 193 ? 40.541  95.170  63.651  1.00 124.70 ? 193  TRP A C   1 
ATOM   1008 O  O   . TRP A 1 193 ? 40.930  94.225  64.339  1.00 124.70 ? 193  TRP A O   1 
ATOM   1009 C  CB  . TRP A 1 193 ? 38.735  93.629  62.922  1.00 124.70 ? 193  TRP A CB  1 
ATOM   1010 C  CG  . TRP A 1 193 ? 37.827  93.358  61.809  1.00 124.70 ? 193  TRP A CG  1 
ATOM   1011 C  CD1 . TRP A 1 193 ? 37.268  94.292  61.016  1.00 124.70 ? 193  TRP A CD1 1 
ATOM   1012 C  CD2 . TRP A 1 193 ? 37.375  92.106  61.312  1.00 124.70 ? 193  TRP A CD2 1 
ATOM   1013 N  NE1 . TRP A 1 193 ? 36.529  93.727  60.030  1.00 124.70 ? 193  TRP A NE1 1 
ATOM   1014 C  CE2 . TRP A 1 193 ? 36.601  92.347  60.166  1.00 124.70 ? 193  TRP A CE2 1 
ATOM   1015 C  CE3 . TRP A 1 193 ? 37.615  90.761  61.658  1.00 124.70 ? 193  TRP A CE3 1 
ATOM   1016 C  CZ2 . TRP A 1 193 ? 35.974  91.370  59.428  1.00 124.70 ? 193  TRP A CZ2 1 
ATOM   1017 C  CZ3 . TRP A 1 193 ? 36.994  89.759  60.922  1.00 124.70 ? 193  TRP A CZ3 1 
ATOM   1018 C  CH2 . TRP A 1 193 ? 36.218  90.070  59.795  1.00 124.70 ? 193  TRP A CH2 1 
ATOM   1019 N  N   . ARG A 1 194 ? 41.256  96.277  63.476  1.00 124.70 ? 194  ARG A N   1 
ATOM   1020 C  CA  . ARG A 1 194 ? 42.550  96.494  64.103  1.00 124.70 ? 194  ARG A CA  1 
ATOM   1021 C  C   . ARG A 1 194 ? 42.313  97.059  65.508  1.00 124.70 ? 194  ARG A C   1 
ATOM   1022 O  O   . ARG A 1 194 ? 41.504  97.979  65.704  1.00 124.70 ? 194  ARG A O   1 
ATOM   1023 C  CB  . ARG A 1 194 ? 43.376  97.460  63.273  1.00 124.70 ? 194  ARG A CB  1 
ATOM   1024 N  N   . CYS A 1 195 ? 43.010  96.486  66.482  1.00 124.70 ? 195  CYS A N   1 
ATOM   1025 C  CA  . CYS A 1 195 ? 42.874  96.902  67.871  1.00 124.70 ? 195  CYS A CA  1 
ATOM   1026 C  C   . CYS A 1 195 ? 41.370  96.958  68.215  1.00 124.70 ? 195  CYS A C   1 
ATOM   1027 O  O   . CYS A 1 195 ? 40.897  97.887  68.855  1.00 124.70 ? 195  CYS A O   1 
ATOM   1028 C  CB  . CYS A 1 195 ? 43.659  98.223  68.051  1.00 124.70 ? 195  CYS A CB  1 
ATOM   1029 S  SG  . CYS A 1 195 ? 45.155  98.159  66.970  1.00 124.70 ? 195  CYS A SG  1 
ATOM   1030 N  N   . ASP A 1 196 ? 40.624  95.927  67.811  1.00 124.70 ? 196  ASP A N   1 
ATOM   1031 C  CA  . ASP A 1 196 ? 39.171  95.894  68.040  1.00 124.70 ? 196  ASP A CA  1 
ATOM   1032 C  C   . ASP A 1 196 ? 38.697  94.980  69.181  1.00 124.70 ? 196  ASP A C   1 
ATOM   1033 O  O   . ASP A 1 196 ? 37.538  94.540  69.175  1.00 124.70 ? 196  ASP A O   1 
ATOM   1034 C  CB  . ASP A 1 196 ? 38.458  95.463  66.737  1.00 124.70 ? 196  ASP A CB  1 
ATOM   1035 C  CG  . ASP A 1 196 ? 38.498  93.943  66.498  1.00 124.70 ? 196  ASP A CG  1 
ATOM   1036 O  OD1 . ASP A 1 196 ? 39.403  93.252  67.014  1.00 124.70 ? 196  ASP A OD1 1 
ATOM   1037 O  OD2 . ASP A 1 196 ? 37.616  93.442  65.772  1.00 124.70 ? 196  ASP A OD2 1 
ATOM   1038 N  N   . GLY A 1 197 ? 39.596  94.665  70.122  1.00 124.70 ? 197  GLY A N   1 
ATOM   1039 C  CA  . GLY A 1 197 ? 39.287  93.756  71.232  1.00 124.70 ? 197  GLY A CA  1 
ATOM   1040 C  C   . GLY A 1 197 ? 39.560  92.266  70.917  1.00 124.70 ? 197  GLY A C   1 
ATOM   1041 O  O   . GLY A 1 197 ? 40.104  91.520  71.744  1.00 124.70 ? 197  GLY A O   1 
ATOM   1042 N  N   . GLY A 1 198 ? 39.195  91.854  69.697  1.00 124.70 ? 198  GLY A N   1 
ATOM   1043 C  CA  . GLY A 1 198 ? 39.362  90.483  69.229  1.00 124.70 ? 198  GLY A CA  1 
ATOM   1044 C  C   . GLY A 1 198 ? 40.685  90.090  68.572  1.00 124.70 ? 198  GLY A C   1 
ATOM   1045 O  O   . GLY A 1 198 ? 41.241  90.837  67.760  1.00 124.70 ? 198  GLY A O   1 
ATOM   1046 N  N   . PRO A 1 199 ? 41.201  88.890  68.910  1.00 124.70 ? 199  PRO A N   1 
ATOM   1047 C  CA  . PRO A 1 199 ? 42.436  88.197  68.488  1.00 124.70 ? 199  PRO A CA  1 
ATOM   1048 C  C   . PRO A 1 199 ? 42.465  87.873  67.029  1.00 124.70 ? 199  PRO A C   1 
ATOM   1049 O  O   . PRO A 1 199 ? 42.439  86.692  66.692  1.00 124.70 ? 199  PRO A O   1 
ATOM   1050 C  CB  . PRO A 1 199 ? 42.389  86.889  69.264  1.00 124.70 ? 199  PRO A CB  1 
ATOM   1051 C  CG  . PRO A 1 199 ? 41.613  87.228  70.465  1.00 124.70 ? 199  PRO A CG  1 
ATOM   1052 C  CD  . PRO A 1 199 ? 40.529  88.138  69.985  1.00 124.70 ? 199  PRO A CD  1 
ATOM   1053 N  N   . ASP A 1 200 ? 42.582  88.814  66.117  1.00 124.70 ? 200  ASP A N   1 
ATOM   1054 C  CA  . ASP A 1 200 ? 42.463  88.209  64.823  1.00 124.70 ? 200  ASP A CA  1 
ATOM   1055 C  C   . ASP A 1 200 ? 43.460  88.269  63.684  1.00 124.70 ? 200  ASP A C   1 
ATOM   1056 O  O   . ASP A 1 200 ? 43.105  87.814  62.583  1.00 124.70 ? 200  ASP A O   1 
ATOM   1057 C  CB  . ASP A 1 200 ? 41.065  88.468  64.278  1.00 124.70 ? 200  ASP A CB  1 
ATOM   1058 C  CG  . ASP A 1 200 ? 40.954  89.819  63.653  1.00 124.70 ? 200  ASP A CG  1 
ATOM   1059 O  OD1 . ASP A 1 200 ? 41.731  90.692  64.085  1.00 124.70 ? 200  ASP A OD1 1 
ATOM   1060 O  OD2 . ASP A 1 200 ? 40.111  90.009  62.745  1.00 124.70 ? 200  ASP A OD2 1 
ATOM   1061 N  N   . CYS A 1 201 ? 44.649  88.855  63.803  1.00 124.70 ? 201  CYS A N   1 
ATOM   1062 C  CA  . CYS A 1 201 ? 45.485  88.523  62.656  1.00 124.70 ? 201  CYS A CA  1 
ATOM   1063 C  C   . CYS A 1 201 ? 45.620  87.131  63.293  1.00 124.70 ? 201  CYS A C   1 
ATOM   1064 O  O   . CYS A 1 201 ? 45.620  87.057  64.517  1.00 124.70 ? 201  CYS A O   1 
ATOM   1065 C  CB  . CYS A 1 201 ? 46.844  89.187  62.636  1.00 124.70 ? 201  CYS A CB  1 
ATOM   1066 S  SG  . CYS A 1 201 ? 47.872  88.403  61.328  1.00 124.70 ? 201  CYS A SG  1 
ATOM   1067 N  N   . LYS A 1 202 ? 45.701  86.030  62.559  1.00 124.70 ? 202  LYS A N   1 
ATOM   1068 C  CA  . LYS A 1 202 ? 45.764  84.771  63.300  1.00 124.70 ? 202  LYS A CA  1 
ATOM   1069 C  C   . LYS A 1 202 ? 47.120  84.351  63.915  1.00 124.70 ? 202  LYS A C   1 
ATOM   1070 O  O   . LYS A 1 202 ? 47.320  83.175  64.240  1.00 124.70 ? 202  LYS A O   1 
ATOM   1071 C  CB  . LYS A 1 202 ? 45.186  83.620  62.466  1.00 124.70 ? 202  LYS A CB  1 
ATOM   1072 C  CG  . LYS A 1 202 ? 44.883  82.366  63.287  1.00 124.70 ? 202  LYS A CG  1 
ATOM   1073 C  CD  . LYS A 1 202 ? 44.263  81.298  62.418  1.00 124.70 ? 202  LYS A CD  1 
ATOM   1074 C  CE  . LYS A 1 202 ? 43.021  80.743  63.073  1.00 124.70 ? 202  LYS A CE  1 
ATOM   1075 N  NZ  . LYS A 1 202 ? 42.375  79.693  62.256  1.00 124.70 ? 202  LYS A NZ  1 
ATOM   1076 N  N   . ASP A 1 203 ? 48.054  85.282  64.089  1.00 124.70 ? 203  ASP A N   1 
ATOM   1077 C  CA  . ASP A 1 203 ? 49.335  84.942  64.744  1.00 124.70 ? 203  ASP A CA  1 
ATOM   1078 C  C   . ASP A 1 203 ? 49.711  86.199  65.512  1.00 124.70 ? 203  ASP A C   1 
ATOM   1079 O  O   . ASP A 1 203 ? 50.824  86.709  65.354  1.00 124.70 ? 203  ASP A O   1 
ATOM   1080 C  CB  . ASP A 1 203 ? 50.491  84.652  63.750  1.00 124.70 ? 203  ASP A CB  1 
ATOM   1081 C  CG  . ASP A 1 203 ? 51.190  83.283  63.925  1.00 124.70 ? 203  ASP A CG  1 
ATOM   1082 O  OD1 . ASP A 1 203 ? 51.613  82.921  65.038  1.00 124.70 ? 203  ASP A OD1 1 
ATOM   1083 O  OD2 . ASP A 1 203 ? 51.366  82.582  62.901  1.00 124.70 ? 203  ASP A OD2 1 
ATOM   1084 N  N   . LYS A 1 204 ? 48.774  86.718  66.305  1.00 124.70 ? 204  LYS A N   1 
ATOM   1085 C  CA  . LYS A 1 204 ? 49.038  87.901  67.121  1.00 124.70 ? 204  LYS A CA  1 
ATOM   1086 C  C   . LYS A 1 204 ? 49.580  89.097  66.333  1.00 124.70 ? 204  LYS A C   1 
ATOM   1087 O  O   . LYS A 1 204 ? 50.440  89.821  66.830  1.00 124.70 ? 204  LYS A O   1 
ATOM   1088 C  CB  . LYS A 1 204 ? 50.051  87.548  68.221  1.00 124.70 ? 204  LYS A CB  1 
ATOM   1089 C  CG  . LYS A 1 204 ? 49.621  87.903  69.642  1.00 124.70 ? 204  LYS A CG  1 
ATOM   1090 C  CD  . LYS A 1 204 ? 50.804  87.849  70.608  1.00 124.70 ? 204  LYS A CD  1 
ATOM   1091 C  CE  . LYS A 1 204 ? 50.348  87.698  72.050  1.00 124.70 ? 204  LYS A CE  1 
ATOM   1092 N  NZ  . LYS A 1 204 ? 51.488  87.869  72.992  1.00 124.70 ? 204  LYS A NZ  1 
ATOM   1093 N  N   . SER A 1 205 ? 49.137  89.269  65.093  1.00 124.70 ? 205  SER A N   1 
ATOM   1094 C  CA  . SER A 1 205 ? 49.571  90.413  64.285  1.00 124.70 ? 205  SER A CA  1 
ATOM   1095 C  C   . SER A 1 205 ? 48.296  91.186  64.319  1.00 124.70 ? 205  SER A C   1 
ATOM   1096 O  O   . SER A 1 205 ? 47.831  91.809  63.360  1.00 124.70 ? 205  SER A O   1 
ATOM   1097 C  CB  . SER A 1 205 ? 49.913  90.007  62.857  1.00 124.70 ? 205  SER A CB  1 
ATOM   1098 O  OG  . SER A 1 205 ? 51.264  89.604  62.752  1.00 124.70 ? 205  SER A OG  1 
ATOM   1099 N  N   . ASP A 1 206 ? 47.733  91.078  65.496  1.00 124.70 ? 206  ASP A N   1 
ATOM   1100 C  CA  . ASP A 1 206 ? 46.486  91.656  65.810  1.00 124.70 ? 206  ASP A CA  1 
ATOM   1101 C  C   . ASP A 1 206 ? 46.659  93.009  66.414  1.00 124.70 ? 206  ASP A C   1 
ATOM   1102 O  O   . ASP A 1 206 ? 47.753  93.579  66.454  1.00 124.70 ? 206  ASP A O   1 
ATOM   1103 C  CB  . ASP A 1 206 ? 45.810  90.757  66.823  1.00 124.70 ? 206  ASP A CB  1 
ATOM   1104 C  CG  . ASP A 1 206 ? 44.361  91.087  67.001  1.00 124.70 ? 206  ASP A CG  1 
ATOM   1105 O  OD1 . ASP A 1 206 ? 43.879  90.979  68.146  1.00 124.70 ? 206  ASP A OD1 1 
ATOM   1106 O  OD2 . ASP A 1 206 ? 43.704  91.443  65.996  1.00 124.70 ? 206  ASP A OD2 1 
ATOM   1107 N  N   . GLU A 1 207 ? 45.532  93.479  66.922  1.00 124.70 ? 207  GLU A N   1 
ATOM   1108 C  CA  . GLU A 1 207 ? 45.416  94.735  67.618  1.00 124.70 ? 207  GLU A CA  1 
ATOM   1109 C  C   . GLU A 1 207 ? 46.413  94.710  68.757  1.00 124.70 ? 207  GLU A C   1 
ATOM   1110 O  O   . GLU A 1 207 ? 46.042  94.916  69.926  1.00 124.70 ? 207  GLU A O   1 
ATOM   1111 C  CB  . GLU A 1 207 ? 44.038  94.818  68.208  1.00 124.70 ? 207  GLU A CB  1 
ATOM   1112 C  CG  . GLU A 1 207 ? 43.560  93.545  68.807  1.00 124.70 ? 207  GLU A CG  1 
ATOM   1113 C  CD  . GLU A 1 207 ? 42.175  93.198  68.331  1.00 124.70 ? 207  GLU A CD  1 
ATOM   1114 O  OE1 . GLU A 1 207 ? 41.923  93.241  67.106  1.00 124.70 ? 207  GLU A OE1 1 
ATOM   1115 O  OE2 . GLU A 1 207 ? 41.338  92.874  69.185  1.00 124.70 ? 207  GLU A OE2 1 
ATOM   1116 N  N   . GLU A 1 208 ? 47.672  94.455  68.423  1.00 124.70 ? 208  GLU A N   1 
ATOM   1117 C  CA  . GLU A 1 208 ? 48.686  94.384  69.439  1.00 124.70 ? 208  GLU A CA  1 
ATOM   1118 C  C   . GLU A 1 208 ? 49.767  95.429  69.347  1.00 124.70 ? 208  GLU A C   1 
ATOM   1119 O  O   . GLU A 1 208 ? 50.560  95.487  68.399  1.00 124.70 ? 208  GLU A O   1 
ATOM   1120 C  CB  . GLU A 1 208 ? 49.301  92.996  69.490  1.00 124.70 ? 208  GLU A CB  1 
ATOM   1121 C  CG  . GLU A 1 208 ? 49.913  92.708  70.841  1.00 124.70 ? 208  GLU A CG  1 
ATOM   1122 C  CD  . GLU A 1 208 ? 48.989  93.102  72.000  1.00 124.70 ? 208  GLU A CD  1 
ATOM   1123 O  OE1 . GLU A 1 208 ? 47.810  93.456  71.756  1.00 124.70 ? 208  GLU A OE1 1 
ATOM   1124 O  OE2 . GLU A 1 208 ? 49.444  93.050  73.163  1.00 124.70 ? 208  GLU A OE2 1 
ATOM   1125 N  N   . ASN A 1 209 ? 49.758  96.241  70.398  1.00 124.70 ? 209  ASN A N   1 
ATOM   1126 C  CA  . ASN A 1 209 ? 50.647  97.364  70.629  1.00 124.70 ? 209  ASN A CA  1 
ATOM   1127 C  C   . ASN A 1 209 ? 50.507  98.490  69.621  1.00 124.70 ? 209  ASN A C   1 
ATOM   1128 O  O   . ASN A 1 209 ? 51.417  98.845  68.854  1.00 124.70 ? 209  ASN A O   1 
ATOM   1129 C  CB  . ASN A 1 209 ? 52.085  96.886  70.831  1.00 124.70 ? 209  ASN A CB  1 
ATOM   1130 C  CG  . ASN A 1 209 ? 52.266  96.198  72.184  1.00 124.70 ? 209  ASN A CG  1 
ATOM   1131 O  OD1 . ASN A 1 209 ? 51.766  96.679  73.215  1.00 124.70 ? 209  ASN A OD1 1 
ATOM   1132 N  ND2 . ASN A 1 209 ? 52.980  95.075  72.190  1.00 124.70 ? 209  ASN A ND2 1 
ATOM   1133 N  N   . CYS A 1 210 ? 49.278  99.002  69.712  1.00 124.70 ? 210  CYS A N   1 
ATOM   1134 C  CA  . CYS A 1 210 ? 48.661  100.140 69.050  1.00 124.70 ? 210  CYS A CA  1 
ATOM   1135 C  C   . CYS A 1 210 ? 47.908  100.626 70.300  1.00 124.70 ? 210  CYS A C   1 
ATOM   1136 O  O   . CYS A 1 210 ? 46.747  101.031 70.235  1.00 124.70 ? 210  CYS A O   1 
ATOM   1137 C  CB  . CYS A 1 210 ? 47.654  99.722  67.957  1.00 124.70 ? 210  CYS A CB  1 
ATOM   1138 S  SG  . CYS A 1 210 ? 46.846  98.082  68.119  1.00 124.70 ? 210  CYS A SG  1 
ATOM   1139 N  N   . ALA A 1 211 ? 48.592  100.548 71.446  1.00 124.70 ? 211  ALA A N   1 
ATOM   1140 C  CA  . ALA A 1 211 ? 48.028  100.944 72.746  1.00 124.70 ? 211  ALA A CA  1 
ATOM   1141 C  C   . ALA A 1 211 ? 47.857  102.473 72.883  1.00 124.70 ? 211  ALA A C   1 
ATOM   1142 O  O   . ALA A 1 211 ? 48.729  103.195 73.390  1.00 124.70 ? 211  ALA A O   1 
ATOM   1143 C  CB  . ALA A 1 211 ? 48.895  100.371 73.890  1.00 124.70 ? 211  ALA A CB  1 
ATOM   1144 N  N   . VAL A 1 212 ? 46.675  102.908 72.444  1.00 124.70 ? 212  VAL A N   1 
ATOM   1145 C  CA  . VAL A 1 212 ? 46.186  104.298 72.365  1.00 124.70 ? 212  VAL A CA  1 
ATOM   1146 C  C   . VAL A 1 212 ? 45.852  105.125 73.641  1.00 124.70 ? 212  VAL A C   1 
ATOM   1147 O  O   . VAL A 1 212 ? 45.055  104.698 74.488  1.00 124.70 ? 212  VAL A O   1 
ATOM   1148 C  CB  . VAL A 1 212 ? 44.983  104.287 71.421  1.00 124.70 ? 212  VAL A CB  1 
ATOM   1149 C  CG1 . VAL A 1 212 ? 45.462  103.957 69.991  1.00 124.70 ? 212  VAL A CG1 1 
ATOM   1150 C  CG2 . VAL A 1 212 ? 43.990  103.205 71.877  1.00 124.70 ? 212  VAL A CG2 1 
ATOM   1151 N  N   . ALA A 1 213 ? 46.416  106.346 73.688  1.00 124.70 ? 213  ALA A N   1 
ATOM   1152 C  CA  . ALA A 1 213 ? 46.369  107.309 74.822  1.00 124.70 ? 213  ALA A CA  1 
ATOM   1153 C  C   . ALA A 1 213 ? 45.264  108.323 75.184  1.00 124.70 ? 213  ALA A C   1 
ATOM   1154 O  O   . ALA A 1 213 ? 44.366  108.647 74.398  1.00 124.70 ? 213  ALA A O   1 
ATOM   1155 C  CB  . ALA A 1 213 ? 47.700  108.080 74.833  1.00 124.70 ? 213  ALA A CB  1 
ATOM   1156 N  N   . THR A 1 214 ? 45.417  108.832 76.416  1.00 124.70 ? 214  THR A N   1 
ATOM   1157 C  CA  . THR A 1 214 ? 44.561  109.848 77.041  1.00 124.70 ? 214  THR A CA  1 
ATOM   1158 C  C   . THR A 1 214 ? 44.837  111.095 76.213  1.00 124.70 ? 214  THR A C   1 
ATOM   1159 O  O   . THR A 1 214 ? 45.876  111.744 76.369  1.00 124.70 ? 214  THR A O   1 
ATOM   1160 C  CB  . THR A 1 214 ? 44.990  110.154 78.517  1.00 124.70 ? 214  THR A CB  1 
ATOM   1161 O  OG1 . THR A 1 214 ? 45.119  108.934 79.257  1.00 124.70 ? 214  THR A OG1 1 
ATOM   1162 C  CG2 . THR A 1 214 ? 43.957  111.030 79.207  1.00 124.70 ? 214  THR A CG2 1 
ATOM   1163 N  N   . CYS A 1 215 ? 43.903  111.424 75.335  1.00 124.70 ? 215  CYS A N   1 
ATOM   1164 C  CA  . CYS A 1 215 ? 44.047  112.559 74.437  1.00 124.70 ? 215  CYS A CA  1 
ATOM   1165 C  C   . CYS A 1 215 ? 43.847  113.962 74.991  1.00 124.70 ? 215  CYS A C   1 
ATOM   1166 O  O   . CYS A 1 215 ? 42.860  114.258 75.684  1.00 124.70 ? 215  CYS A O   1 
ATOM   1167 C  CB  . CYS A 1 215 ? 43.089  112.391 73.278  1.00 124.70 ? 215  CYS A CB  1 
ATOM   1168 S  SG  . CYS A 1 215 ? 41.485  111.834 73.919  1.00 124.70 ? 215  CYS A SG  1 
ATOM   1169 N  N   . ARG A 1 216 ? 44.781  114.832 74.611  1.00 124.70 ? 216  ARG A N   1 
ATOM   1170 C  CA  . ARG A 1 216 ? 44.767  116.243 74.988  1.00 124.70 ? 216  ARG A CA  1 
ATOM   1171 C  C   . ARG A 1 216 ? 43.470  116.906 74.469  1.00 124.70 ? 216  ARG A C   1 
ATOM   1172 O  O   . ARG A 1 216 ? 43.257  117.048 73.253  1.00 124.70 ? 216  ARG A O   1 
ATOM   1173 C  CB  . ARG A 1 216 ? 46.015  116.915 74.426  1.00 124.70 ? 216  ARG A CB  1 
ATOM   1174 C  CG  . ARG A 1 216 ? 46.281  116.595 72.960  1.00 124.70 ? 216  ARG A CG  1 
ATOM   1175 C  CD  . ARG A 1 216 ? 47.718  116.904 72.617  1.00 124.70 ? 216  ARG A CD  1 
ATOM   1176 N  NE  . ARG A 1 216 ? 48.027  116.708 71.204  1.00 124.70 ? 216  ARG A NE  1 
ATOM   1177 C  CZ  . ARG A 1 216 ? 49.229  116.922 70.677  1.00 124.70 ? 216  ARG A CZ  1 
ATOM   1178 N  NH1 . ARG A 1 216 ? 50.227  117.334 71.448  1.00 124.70 ? 216  ARG A NH1 1 
ATOM   1179 N  NH2 . ARG A 1 216 ? 49.437  116.735 69.382  1.00 124.70 ? 216  ARG A NH2 1 
ATOM   1180 N  N   . PRO A 1 217 ? 42.584  117.307 75.409  1.00 124.70 ? 217  PRO A N   1 
ATOM   1181 C  CA  . PRO A 1 217 ? 41.256  117.955 75.356  1.00 124.70 ? 217  PRO A CA  1 
ATOM   1182 C  C   . PRO A 1 217 ? 40.793  119.128 74.436  1.00 124.70 ? 217  PRO A C   1 
ATOM   1183 O  O   . PRO A 1 217 ? 41.209  120.282 74.574  1.00 124.70 ? 217  PRO A O   1 
ATOM   1184 C  CB  . PRO A 1 217 ? 40.995  118.262 76.830  1.00 124.70 ? 217  PRO A CB  1 
ATOM   1185 C  CG  . PRO A 1 217 ? 41.521  117.042 77.475  1.00 124.70 ? 217  PRO A CG  1 
ATOM   1186 C  CD  . PRO A 1 217 ? 42.868  116.885 76.798  1.00 124.70 ? 217  PRO A CD  1 
ATOM   1187 N  N   . ASP A 1 218 ? 39.847  118.755 73.571  1.00 124.70 ? 218  ASP A N   1 
ATOM   1188 C  CA  . ASP A 1 218 ? 39.111  119.515 72.569  1.00 124.70 ? 218  ASP A CA  1 
ATOM   1189 C  C   . ASP A 1 218 ? 38.263  118.369 71.998  1.00 124.70 ? 218  ASP A C   1 
ATOM   1190 O  O   . ASP A 1 218 ? 37.703  118.445 70.902  1.00 124.70 ? 218  ASP A O   1 
ATOM   1191 C  CB  . ASP A 1 218 ? 40.050  120.087 71.511  1.00 124.70 ? 218  ASP A CB  1 
ATOM   1192 C  CG  . ASP A 1 218 ? 39.880  121.593 71.364  1.00 124.70 ? 218  ASP A CG  1 
ATOM   1193 O  OD1 . ASP A 1 218 ? 38.807  122.092 71.744  1.00 124.70 ? 218  ASP A OD1 1 
ATOM   1194 O  OD2 . ASP A 1 218 ? 40.808  122.279 70.886  1.00 124.70 ? 218  ASP A OD2 1 
ATOM   1195 N  N   . GLU A 1 219 ? 38.216  117.295 72.803  1.00 124.70 ? 219  GLU A N   1 
ATOM   1196 C  CA  . GLU A 1 219 ? 37.541  116.028 72.471  1.00 124.70 ? 219  GLU A CA  1 
ATOM   1197 C  C   . GLU A 1 219 ? 37.420  115.004 73.656  1.00 124.70 ? 219  GLU A C   1 
ATOM   1198 O  O   . GLU A 1 219 ? 37.967  115.251 74.732  1.00 124.70 ? 219  GLU A O   1 
ATOM   1199 C  CB  . GLU A 1 219 ? 38.299  115.392 71.303  1.00 124.70 ? 219  GLU A CB  1 
ATOM   1200 C  CG  . GLU A 1 219 ? 39.321  114.340 71.696  1.00 124.70 ? 219  GLU A CG  1 
ATOM   1201 C  CD  . GLU A 1 219 ? 40.667  114.918 72.082  1.00 124.70 ? 219  GLU A CD  1 
ATOM   1202 O  OE1 . GLU A 1 219 ? 40.728  115.688 73.067  1.00 124.70 ? 219  GLU A OE1 1 
ATOM   1203 O  OE2 . GLU A 1 219 ? 41.663  114.587 71.395  1.00 124.70 ? 219  GLU A OE2 1 
ATOM   1204 N  N   . PHE A 1 220 ? 36.733  113.861 73.458  1.00 124.70 ? 220  PHE A N   1 
ATOM   1205 C  CA  . PHE A 1 220 ? 36.534  112.848 74.549  1.00 124.70 ? 220  PHE A CA  1 
ATOM   1206 C  C   . PHE A 1 220 ? 36.252  111.334 74.208  1.00 124.70 ? 220  PHE A C   1 
ATOM   1207 O  O   . PHE A 1 220 ? 35.970  111.000 73.059  1.00 124.70 ? 220  PHE A O   1 
ATOM   1208 C  CB  . PHE A 1 220 ? 35.373  113.286 75.408  1.00 124.70 ? 220  PHE A CB  1 
ATOM   1209 C  CG  . PHE A 1 220 ? 34.072  112.675 74.984  1.00 124.70 ? 220  PHE A CG  1 
ATOM   1210 C  CD1 . PHE A 1 220 ? 33.682  111.424 75.467  1.00 124.70 ? 220  PHE A CD1 1 
ATOM   1211 C  CD2 . PHE A 1 220 ? 33.265  113.319 74.059  1.00 124.70 ? 220  PHE A CD2 1 
ATOM   1212 C  CE1 . PHE A 1 220 ? 32.514  110.822 75.034  1.00 124.70 ? 220  PHE A CE1 1 
ATOM   1213 C  CE2 . PHE A 1 220 ? 32.085  112.724 73.614  1.00 124.70 ? 220  PHE A CE2 1 
ATOM   1214 C  CZ  . PHE A 1 220 ? 31.711  111.471 74.104  1.00 124.70 ? 220  PHE A CZ  1 
ATOM   1215 N  N   . GLN A 1 221 ? 36.256  110.445 75.228  1.00 124.70 ? 221  GLN A N   1 
ATOM   1216 C  CA  . GLN A 1 221 ? 35.998  108.984 75.039  1.00 124.70 ? 221  GLN A CA  1 
ATOM   1217 C  C   . GLN A 1 221 ? 34.680  108.349 75.528  1.00 124.70 ? 221  GLN A C   1 
ATOM   1218 O  O   . GLN A 1 221 ? 34.242  108.543 76.661  1.00 124.70 ? 221  GLN A O   1 
ATOM   1219 C  CB  . GLN A 1 221 ? 37.130  108.131 75.642  1.00 124.70 ? 221  GLN A CB  1 
ATOM   1220 C  CG  . GLN A 1 221 ? 36.852  107.605 77.065  1.00 124.70 ? 221  GLN A CG  1 
ATOM   1221 C  CD  . GLN A 1 221 ? 37.746  106.424 77.474  1.00 124.70 ? 221  GLN A CD  1 
ATOM   1222 O  OE1 . GLN A 1 221 ? 38.529  105.920 76.674  1.00 124.70 ? 221  GLN A OE1 1 
ATOM   1223 N  NE2 . GLN A 1 221 ? 37.619  105.979 78.729  1.00 124.70 ? 221  GLN A NE2 1 
ATOM   1224 N  N   . CYS A 1 222 ? 34.096  107.534 74.659  1.00 124.70 ? 222  CYS A N   1 
ATOM   1225 C  CA  . CYS A 1 222 ? 32.856  106.829 74.942  1.00 124.70 ? 222  CYS A CA  1 
ATOM   1226 C  C   . CYS A 1 222 ? 33.096  105.427 75.550  1.00 124.70 ? 222  CYS A C   1 
ATOM   1227 O  O   . CYS A 1 222 ? 32.808  104.415 74.906  1.00 124.70 ? 222  CYS A O   1 
ATOM   1228 C  CB  . CYS A 1 222 ? 32.089  106.655 73.643  1.00 124.70 ? 222  CYS A CB  1 
ATOM   1229 S  SG  . CYS A 1 222 ? 31.052  107.973 72.963  1.00 124.70 ? 222  CYS A SG  1 
ATOM   1230 N  N   . SER A 1 223 ? 33.624  105.376 76.774  1.00 124.70 ? 223  SER A N   1 
ATOM   1231 C  CA  . SER A 1 223 ? 33.875  104.118 77.509  1.00 124.70 ? 223  SER A CA  1 
ATOM   1232 C  C   . SER A 1 223 ? 34.692  103.080 76.759  1.00 124.70 ? 223  SER A C   1 
ATOM   1233 O  O   . SER A 1 223 ? 34.395  101.881 76.691  1.00 124.70 ? 223  SER A O   1 
ATOM   1234 C  CB  . SER A 1 223 ? 32.555  103.508 77.980  1.00 124.70 ? 223  SER A CB  1 
ATOM   1235 O  OG  . SER A 1 223 ? 31.945  102.738 76.966  1.00 124.70 ? 223  SER A OG  1 
ATOM   1236 N  N   . ASP A 1 224 ? 35.745  103.614 76.192  1.00 124.70 ? 224  ASP A N   1 
ATOM   1237 C  CA  . ASP A 1 224 ? 36.714  102.888 75.424  1.00 124.70 ? 224  ASP A CA  1 
ATOM   1238 C  C   . ASP A 1 224 ? 37.449  104.103 74.874  1.00 124.70 ? 224  ASP A C   1 
ATOM   1239 O  O   . ASP A 1 224 ? 36.811  105.053 74.393  1.00 124.70 ? 224  ASP A O   1 
ATOM   1240 C  CB  . ASP A 1 224 ? 36.051  102.091 74.302  1.00 124.70 ? 224  ASP A CB  1 
ATOM   1241 N  N   . GLY A 1 225 ? 38.777  104.086 74.969  1.00 124.70 ? 225  GLY A N   1 
ATOM   1242 C  CA  . GLY A 1 225 ? 39.602  105.207 74.523  1.00 124.70 ? 225  GLY A CA  1 
ATOM   1243 C  C   . GLY A 1 225 ? 39.283  106.072 73.300  1.00 124.70 ? 225  GLY A C   1 
ATOM   1244 O  O   . GLY A 1 225 ? 40.153  106.846 72.913  1.00 124.70 ? 225  GLY A O   1 
ATOM   1245 N  N   . ASN A 1 226 ? 38.094  105.974 72.684  1.00 124.70 ? 226  ASN A N   1 
ATOM   1246 C  CA  . ASN A 1 226 ? 37.776  106.788 71.499  1.00 124.70 ? 226  ASN A CA  1 
ATOM   1247 C  C   . ASN A 1 226 ? 37.632  108.277 71.700  1.00 124.70 ? 226  ASN A C   1 
ATOM   1248 O  O   . ASN A 1 226 ? 36.561  108.811 71.989  1.00 124.70 ? 226  ASN A O   1 
ATOM   1249 C  CB  . ASN A 1 226 ? 36.581  106.215 70.725  1.00 124.70 ? 226  ASN A CB  1 
ATOM   1250 C  CG  . ASN A 1 226 ? 37.037  105.333 69.582  1.00 124.70 ? 226  ASN A CG  1 
ATOM   1251 O  OD1 . ASN A 1 226 ? 38.239  105.167 69.374  1.00 124.70 ? 226  ASN A OD1 1 
ATOM   1252 N  ND2 . ASN A 1 226 ? 36.099  104.771 68.839  1.00 124.70 ? 226  ASN A ND2 1 
ATOM   1253 N  N   . CYS A 1 227 ? 38.791  108.909 71.583  1.00 124.70 ? 227  CYS A N   1 
ATOM   1254 C  CA  . CYS A 1 227 ? 38.949  110.333 71.683  1.00 124.70 ? 227  CYS A CA  1 
ATOM   1255 C  C   . CYS A 1 227 ? 38.154  110.834 70.504  1.00 124.70 ? 227  CYS A C   1 
ATOM   1256 O  O   . CYS A 1 227 ? 38.701  111.104 69.421  1.00 124.70 ? 227  CYS A O   1 
ATOM   1257 C  CB  . CYS A 1 227 ? 40.410  110.661 71.529  1.00 124.70 ? 227  CYS A CB  1 
ATOM   1258 S  SG  . CYS A 1 227 ? 41.293  110.068 72.969  1.00 124.70 ? 227  CYS A SG  1 
ATOM   1259 N  N   . ILE A 1 228 ? 36.841  110.865 70.748  1.00 124.70 ? 228  ILE A N   1 
ATOM   1260 C  CA  . ILE A 1 228 ? 35.788  111.311 69.841  1.00 124.70 ? 228  ILE A CA  1 
ATOM   1261 C  C   . ILE A 1 228 ? 36.022  112.797 69.744  1.00 124.70 ? 228  ILE A C   1 
ATOM   1262 O  O   . ILE A 1 228 ? 36.717  113.350 70.599  1.00 124.70 ? 228  ILE A O   1 
ATOM   1263 C  CB  . ILE A 1 228 ? 34.441  111.002 70.433  1.00 124.70 ? 228  ILE A CB  1 
ATOM   1264 N  N   . HIS A 1 229 ? 35.427  113.501 68.788  1.00 124.70 ? 229  HIS A N   1 
ATOM   1265 C  CA  . HIS A 1 229 ? 35.930  114.859 68.716  1.00 124.70 ? 229  HIS A CA  1 
ATOM   1266 C  C   . HIS A 1 229 ? 35.330  116.125 68.035  1.00 124.70 ? 229  HIS A C   1 
ATOM   1267 O  O   . HIS A 1 229 ? 34.492  116.031 67.114  1.00 124.70 ? 229  HIS A O   1 
ATOM   1268 C  CB  . HIS A 1 229 ? 37.356  114.655 68.249  1.00 124.70 ? 229  HIS A CB  1 
ATOM   1269 C  CG  . HIS A 1 229 ? 37.864  115.762 67.409  1.00 124.70 ? 229  HIS A CG  1 
ATOM   1270 N  ND1 . HIS A 1 229 ? 38.616  116.782 67.937  1.00 124.70 ? 229  HIS A ND1 1 
ATOM   1271 C  CD2 . HIS A 1 229 ? 37.646  116.074 66.109  1.00 124.70 ? 229  HIS A CD2 1 
ATOM   1272 C  CE1 . HIS A 1 229 ? 38.839  117.684 66.998  1.00 124.70 ? 229  HIS A CE1 1 
ATOM   1273 N  NE2 . HIS A 1 229 ? 38.263  117.281 65.880  1.00 124.70 ? 229  HIS A NE2 1 
ATOM   1274 N  N   . GLY A 1 230 ? 35.849  117.284 68.527  1.00 124.70 ? 230  GLY A N   1 
ATOM   1275 C  CA  . GLY A 1 230 ? 35.491  118.662 68.152  1.00 124.70 ? 230  GLY A CA  1 
ATOM   1276 C  C   . GLY A 1 230 ? 34.117  118.522 68.698  1.00 124.70 ? 230  GLY A C   1 
ATOM   1277 O  O   . GLY A 1 230 ? 33.910  117.515 69.368  1.00 124.70 ? 230  GLY A O   1 
ATOM   1278 N  N   . SER A 1 231 ? 33.146  119.394 68.592  1.00 124.70 ? 231  SER A N   1 
ATOM   1279 C  CA  . SER A 1 231 ? 32.025  118.667 69.124  1.00 124.70 ? 231  SER A CA  1 
ATOM   1280 C  C   . SER A 1 231 ? 31.119  118.205 68.000  1.00 124.70 ? 231  SER A C   1 
ATOM   1281 O  O   . SER A 1 231 ? 30.135  118.858 67.650  1.00 124.70 ? 231  SER A O   1 
ATOM   1282 C  CB  . SER A 1 231 ? 31.319  119.346 70.289  1.00 124.70 ? 231  SER A CB  1 
ATOM   1283 O  OG  . SER A 1 231 ? 31.072  118.343 71.281  1.00 124.70 ? 231  SER A OG  1 
ATOM   1284 N  N   . ARG A 1 232 ? 31.554  117.082 67.396  1.00 124.70 ? 232  ARG A N   1 
ATOM   1285 C  CA  . ARG A 1 232 ? 30.887  116.343 66.303  1.00 124.70 ? 232  ARG A CA  1 
ATOM   1286 C  C   . ARG A 1 232 ? 29.674  115.893 67.084  1.00 124.70 ? 232  ARG A C   1 
ATOM   1287 O  O   . ARG A 1 232 ? 28.973  114.924 66.770  1.00 124.70 ? 232  ARG A O   1 
ATOM   1288 C  CB  . ARG A 1 232 ? 31.761  115.128 65.930  1.00 124.70 ? 232  ARG A CB  1 
ATOM   1289 C  CG  . ARG A 1 232 ? 32.319  115.150 64.513  1.00 124.70 ? 232  ARG A CG  1 
ATOM   1290 C  CD  . ARG A 1 232 ? 33.697  114.479 64.388  1.00 124.70 ? 232  ARG A CD  1 
ATOM   1291 N  NE  . ARG A 1 232 ? 34.381  114.985 63.190  1.00 124.70 ? 232  ARG A NE  1 
ATOM   1292 C  CZ  . ARG A 1 232 ? 35.396  114.394 62.554  1.00 124.70 ? 232  ARG A CZ  1 
ATOM   1293 N  NH1 . ARG A 1 232 ? 35.894  113.237 62.985  1.00 124.70 ? 232  ARG A NH1 1 
ATOM   1294 N  NH2 . ARG A 1 232 ? 35.901  114.958 61.457  1.00 124.70 ? 232  ARG A NH2 1 
ATOM   1295 N  N   . GLN A 1 233 ? 29.522  116.693 68.132  1.00 124.70 ? 233  GLN A N   1 
ATOM   1296 C  CA  . GLN A 1 233 ? 28.621  116.667 69.266  1.00 124.70 ? 233  GLN A CA  1 
ATOM   1297 C  C   . GLN A 1 233 ? 27.134  116.749 69.325  1.00 124.70 ? 233  GLN A C   1 
ATOM   1298 O  O   . GLN A 1 233 ? 26.420  116.769 68.322  1.00 124.70 ? 233  GLN A O   1 
ATOM   1299 C  CB  . GLN A 1 233 ? 29.128  117.647 70.256  1.00 124.70 ? 233  GLN A CB  1 
ATOM   1300 N  N   . CYS A 1 234 ? 26.729  116.739 70.599  1.00 124.70 ? 234  CYS A N   1 
ATOM   1301 C  CA  . CYS A 1 234 ? 25.371  116.785 71.066  1.00 124.70 ? 234  CYS A CA  1 
ATOM   1302 C  C   . CYS A 1 234 ? 24.477  117.669 70.253  1.00 124.70 ? 234  CYS A C   1 
ATOM   1303 O  O   . CYS A 1 234 ? 24.165  118.810 70.627  1.00 124.70 ? 234  CYS A O   1 
ATOM   1304 C  CB  . CYS A 1 234 ? 25.376  117.187 72.504  1.00 124.70 ? 234  CYS A CB  1 
ATOM   1305 S  SG  . CYS A 1 234 ? 25.740  115.866 73.604  1.00 124.70 ? 234  CYS A SG  1 
ATOM   1306 N  N   . ASP A 1 235 ? 24.044  117.043 69.156  1.00 124.70 ? 235  ASP A N   1 
ATOM   1307 C  CA  . ASP A 1 235 ? 23.185  117.601 68.129  1.00 124.70 ? 235  ASP A CA  1 
ATOM   1308 C  C   . ASP A 1 235 ? 22.336  116.447 67.620  1.00 124.70 ? 235  ASP A C   1 
ATOM   1309 O  O   . ASP A 1 235 ? 21.808  116.493 66.506  1.00 124.70 ? 235  ASP A O   1 
ATOM   1310 C  CB  . ASP A 1 235 ? 24.039  118.123 66.996  1.00 124.70 ? 235  ASP A CB  1 
ATOM   1311 C  CG  . ASP A 1 235 ? 24.720  117.010 66.240  1.00 124.70 ? 235  ASP A CG  1 
ATOM   1312 O  OD1 . ASP A 1 235 ? 24.751  115.883 66.771  1.00 124.70 ? 235  ASP A OD1 1 
ATOM   1313 O  OD2 . ASP A 1 235 ? 25.235  117.259 65.126  1.00 124.70 ? 235  ASP A OD2 1 
ATOM   1314 N  N   . ARG A 1 236 ? 22.246  115.411 68.454  1.00 124.70 ? 236  ARG A N   1 
ATOM   1315 C  CA  . ARG A 1 236 ? 21.457  114.224 68.185  1.00 124.70 ? 236  ARG A CA  1 
ATOM   1316 C  C   . ARG A 1 236 ? 22.066  113.493 67.003  1.00 124.70 ? 236  ARG A C   1 
ATOM   1317 O  O   . ARG A 1 236 ? 21.348  112.946 66.174  1.00 124.70 ? 236  ARG A O   1 
ATOM   1318 C  CB  . ARG A 1 236 ? 20.016  114.646 67.887  1.00 124.70 ? 236  ARG A CB  1 
ATOM   1319 N  N   . GLU A 1 237 ? 23.391  113.556 66.893  1.00 124.70 ? 237  GLU A N   1 
ATOM   1320 C  CA  . GLU A 1 237 ? 24.115  112.886 65.813  1.00 124.70 ? 237  GLU A CA  1 
ATOM   1321 C  C   . GLU A 1 237 ? 25.026  111.862 66.441  1.00 124.70 ? 237  GLU A C   1 
ATOM   1322 O  O   . GLU A 1 237 ? 26.121  112.175 66.916  1.00 124.70 ? 237  GLU A O   1 
ATOM   1323 C  CB  . GLU A 1 237 ? 24.967  113.859 64.987  1.00 124.70 ? 237  GLU A CB  1 
ATOM   1324 C  CG  . GLU A 1 237 ? 24.225  114.625 63.893  1.00 124.70 ? 237  GLU A CG  1 
ATOM   1325 C  CD  . GLU A 1 237 ? 23.577  113.723 62.850  1.00 124.70 ? 237  GLU A CD  1 
ATOM   1326 O  OE1 . GLU A 1 237 ? 23.781  112.482 62.891  1.00 124.70 ? 237  GLU A OE1 1 
ATOM   1327 O  OE2 . GLU A 1 237 ? 22.859  114.272 61.981  1.00 124.70 ? 237  GLU A OE2 1 
ATOM   1328 N  N   . TYR A 1 238 ? 24.565  110.625 66.421  1.00 124.70 ? 238  TYR A N   1 
ATOM   1329 C  CA  . TYR A 1 238 ? 25.305  109.536 67.004  1.00 124.70 ? 238  TYR A CA  1 
ATOM   1330 C  C   . TYR A 1 238 ? 26.704  109.370 66.500  1.00 124.70 ? 238  TYR A C   1 
ATOM   1331 O  O   . TYR A 1 238 ? 26.911  108.776 65.447  1.00 124.70 ? 238  TYR A O   1 
ATOM   1332 C  CB  . TYR A 1 238 ? 24.557  108.247 66.775  1.00 124.70 ? 238  TYR A CB  1 
ATOM   1333 C  CG  . TYR A 1 238 ? 24.002  107.755 68.054  1.00 124.70 ? 238  TYR A CG  1 
ATOM   1334 C  CD1 . TYR A 1 238 ? 22.671  107.363 68.159  1.00 124.70 ? 238  TYR A CD1 1 
ATOM   1335 C  CD2 . TYR A 1 238 ? 24.804  107.736 69.191  1.00 124.70 ? 238  TYR A CD2 1 
ATOM   1336 C  CE1 . TYR A 1 238 ? 22.154  106.961 69.384  1.00 124.70 ? 238  TYR A CE1 1 
ATOM   1337 C  CE2 . TYR A 1 238 ? 24.310  107.359 70.383  1.00 124.70 ? 238  TYR A CE2 1 
ATOM   1338 C  CZ  . TYR A 1 238 ? 22.989  106.965 70.496  1.00 124.70 ? 238  TYR A CZ  1 
ATOM   1339 O  OH  . TYR A 1 238 ? 22.514  106.575 71.730  1.00 124.70 ? 238  TYR A OH  1 
ATOM   1340 N  N   . ASP A 1 239 ? 27.687  109.853 67.240  1.00 124.70 ? 239  ASP A N   1 
ATOM   1341 C  CA  . ASP A 1 239 ? 29.028  109.678 66.732  1.00 124.70 ? 239  ASP A CA  1 
ATOM   1342 C  C   . ASP A 1 239 ? 30.078  109.148 67.694  1.00 124.70 ? 239  ASP A C   1 
ATOM   1343 O  O   . ASP A 1 239 ? 30.728  109.924 68.398  1.00 124.70 ? 239  ASP A O   1 
ATOM   1344 C  CB  . ASP A 1 239 ? 29.559  110.982 66.131  1.00 124.70 ? 239  ASP A CB  1 
ATOM   1345 C  CG  . ASP A 1 239 ? 28.569  111.666 65.202  1.00 124.70 ? 239  ASP A CG  1 
ATOM   1346 O  OD1 . ASP A 1 239 ? 27.697  110.995 64.616  1.00 124.70 ? 239  ASP A OD1 1 
ATOM   1347 O  OD2 . ASP A 1 239 ? 28.682  112.898 65.038  1.00 124.70 ? 239  ASP A OD2 1 
ATOM   1348 N  N   . CYS A 1 240 ? 30.269  107.830 67.723  1.00 124.70 ? 240  CYS A N   1 
ATOM   1349 C  CA  . CYS A 1 240 ? 31.334  107.296 68.571  1.00 124.70 ? 240  CYS A CA  1 
ATOM   1350 C  C   . CYS A 1 240 ? 31.563  105.787 68.717  1.00 124.70 ? 240  CYS A C   1 
ATOM   1351 O  O   . CYS A 1 240 ? 32.136  105.370 69.724  1.00 124.70 ? 240  CYS A O   1 
ATOM   1352 C  CB  . CYS A 1 240 ? 31.221  107.890 69.978  1.00 124.70 ? 240  CYS A CB  1 
ATOM   1353 S  SG  . CYS A 1 240 ? 30.319  107.041 71.302  1.00 124.70 ? 240  CYS A SG  1 
ATOM   1354 N  N   . LYS A 1 241 ? 31.146  104.960 67.756  1.00 124.70 ? 241  LYS A N   1 
ATOM   1355 C  CA  . LYS A 1 241 ? 31.300  103.496 67.908  1.00 124.70 ? 241  LYS A CA  1 
ATOM   1356 C  C   . LYS A 1 241 ? 30.740  103.204 69.298  1.00 124.70 ? 241  LYS A C   1 
ATOM   1357 O  O   . LYS A 1 241 ? 31.351  102.540 70.148  1.00 124.70 ? 241  LYS A O   1 
ATOM   1358 C  CB  . LYS A 1 241 ? 32.768  103.080 67.847  1.00 124.70 ? 241  LYS A CB  1 
ATOM   1359 N  N   . ASP A 1 242 ? 29.563  103.759 69.522  1.00 124.70 ? 242  ASP A N   1 
ATOM   1360 C  CA  . ASP A 1 242 ? 28.880  103.666 70.802  1.00 124.70 ? 242  ASP A CA  1 
ATOM   1361 C  C   . ASP A 1 242 ? 27.656  104.545 70.616  1.00 124.70 ? 242  ASP A C   1 
ATOM   1362 O  O   . ASP A 1 242 ? 27.286  104.914 69.500  1.00 124.70 ? 242  ASP A O   1 
ATOM   1363 C  CB  . ASP A 1 242 ? 29.770  104.309 71.902  1.00 124.70 ? 242  ASP A CB  1 
ATOM   1364 C  CG  . ASP A 1 242 ? 28.963  104.905 73.080  1.00 124.70 ? 242  ASP A CG  1 
ATOM   1365 O  OD1 . ASP A 1 242 ? 27.873  104.373 73.394  1.00 124.70 ? 242  ASP A OD1 1 
ATOM   1366 O  OD2 . ASP A 1 242 ? 29.429  105.880 73.715  1.00 124.70 ? 242  ASP A OD2 1 
ATOM   1367 N  N   . MET A 1 243 ? 27.062  104.905 71.744  1.00 124.70 ? 243  MET A N   1 
ATOM   1368 C  CA  . MET A 1 243 ? 26.001  105.866 71.780  1.00 124.70 ? 243  MET A CA  1 
ATOM   1369 C  C   . MET A 1 243 ? 26.342  107.085 72.674  1.00 124.70 ? 243  MET A C   1 
ATOM   1370 O  O   . MET A 1 243 ? 25.429  107.649 73.262  1.00 124.70 ? 243  MET A O   1 
ATOM   1371 C  CB  . MET A 1 243 ? 24.690  105.249 72.261  1.00 124.70 ? 243  MET A CB  1 
ATOM   1372 C  CG  . MET A 1 243 ? 24.637  103.742 72.132  1.00 124.70 ? 243  MET A CG  1 
ATOM   1373 S  SD  . MET A 1 243 ? 23.037  103.096 71.628  1.00 124.70 ? 243  MET A SD  1 
ATOM   1374 C  CE  . MET A 1 243 ? 23.439  101.273 71.609  1.00 124.70 ? 243  MET A CE  1 
ATOM   1375 N  N   . SER A 1 244 ? 27.611  107.503 72.791  1.00 124.70 ? 244  SER A N   1 
ATOM   1376 C  CA  . SER A 1 244 ? 27.956  108.690 73.605  1.00 124.70 ? 244  SER A CA  1 
ATOM   1377 C  C   . SER A 1 244 ? 28.408  109.912 72.827  1.00 124.70 ? 244  SER A C   1 
ATOM   1378 O  O   . SER A 1 244 ? 29.576  110.257 72.737  1.00 124.70 ? 244  SER A O   1 
ATOM   1379 C  CB  . SER A 1 244 ? 29.026  108.408 74.662  1.00 124.70 ? 244  SER A CB  1 
ATOM   1380 O  OG  . SER A 1 244 ? 28.513  107.757 75.802  1.00 124.70 ? 244  SER A OG  1 
ATOM   1381 N  N   . ASP A 1 245 ? 27.450  110.537 72.206  1.00 124.70 ? 245  ASP A N   1 
ATOM   1382 C  CA  . ASP A 1 245 ? 27.677  111.783 71.520  1.00 124.70 ? 245  ASP A CA  1 
ATOM   1383 C  C   . ASP A 1 245 ? 26.197  112.046 71.713  1.00 124.70 ? 245  ASP A C   1 
ATOM   1384 O  O   . ASP A 1 245 ? 25.410  111.126 71.496  1.00 124.70 ? 245  ASP A O   1 
ATOM   1385 C  CB  . ASP A 1 245 ? 28.064  111.572 70.055  1.00 124.70 ? 245  ASP A CB  1 
ATOM   1386 C  CG  . ASP A 1 245 ? 29.057  112.605 69.585  1.00 124.70 ? 245  ASP A CG  1 
ATOM   1387 O  OD1 . ASP A 1 245 ? 28.745  113.809 69.705  1.00 124.70 ? 245  ASP A OD1 1 
ATOM   1388 O  OD2 . ASP A 1 245 ? 30.147  112.208 69.121  1.00 124.70 ? 245  ASP A OD2 1 
ATOM   1389 N  N   . GLU A 1 246 ? 25.794  113.230 72.165  1.00 124.70 ? 246  GLU A N   1 
ATOM   1390 C  CA  . GLU A 1 246 ? 24.367  113.470 72.417  1.00 124.70 ? 246  GLU A CA  1 
ATOM   1391 C  C   . GLU A 1 246 ? 23.919  112.448 73.458  1.00 124.70 ? 246  GLU A C   1 
ATOM   1392 O  O   . GLU A 1 246 ? 23.070  111.605 73.204  1.00 124.70 ? 246  GLU A O   1 
ATOM   1393 C  CB  . GLU A 1 246 ? 23.553  113.283 71.146  1.00 124.70 ? 246  GLU A CB  1 
ATOM   1394 C  CG  . GLU A 1 246 ? 23.933  114.240 70.079  1.00 124.70 ? 246  GLU A CG  1 
ATOM   1395 C  CD  . GLU A 1 246 ? 25.151  113.787 69.338  1.00 124.70 ? 246  GLU A CD  1 
ATOM   1396 O  OE1 . GLU A 1 246 ? 25.560  112.654 69.602  1.00 124.70 ? 246  GLU A OE1 1 
ATOM   1397 O  OE2 . GLU A 1 246 ? 25.686  114.525 68.487  1.00 124.70 ? 246  GLU A OE2 1 
ATOM   1398 N  N   . VAL A 1 247 ? 24.523  112.474 74.633  1.00 124.70 ? 247  VAL A N   1 
ATOM   1399 C  CA  . VAL A 1 247 ? 24.132  111.465 75.611  1.00 124.70 ? 247  VAL A CA  1 
ATOM   1400 C  C   . VAL A 1 247 ? 23.825  112.235 76.850  1.00 124.70 ? 247  VAL A C   1 
ATOM   1401 O  O   . VAL A 1 247 ? 24.690  112.920 77.409  1.00 124.70 ? 247  VAL A O   1 
ATOM   1402 C  CB  . VAL A 1 247 ? 25.237  110.327 75.936  1.00 124.70 ? 247  VAL A CB  1 
ATOM   1403 C  CG1 . VAL A 1 247 ? 24.933  109.056 75.161  1.00 124.70 ? 247  VAL A CG1 1 
ATOM   1404 C  CG2 . VAL A 1 247 ? 26.657  110.791 75.625  1.00 124.70 ? 247  VAL A CG2 1 
ATOM   1405 N  N   . GLY A 1 248 ? 22.562  112.130 77.247  1.00 124.70 ? 248  GLY A N   1 
ATOM   1406 C  CA  . GLY A 1 248 ? 22.057  112.825 78.403  1.00 124.70 ? 248  GLY A CA  1 
ATOM   1407 C  C   . GLY A 1 248 ? 22.150  114.264 78.037  1.00 124.70 ? 248  GLY A C   1 
ATOM   1408 O  O   . GLY A 1 248 ? 22.340  115.087 78.927  1.00 124.70 ? 248  GLY A O   1 
ATOM   1409 N  N   . CYS A 1 249 ? 22.044  114.570 76.749  1.00 124.70 ? 249  CYS A N   1 
ATOM   1410 C  CA  . CYS A 1 249 ? 22.196  115.938 76.387  1.00 124.70 ? 249  CYS A CA  1 
ATOM   1411 C  C   . CYS A 1 249 ? 20.962  116.803 76.532  1.00 124.70 ? 249  CYS A C   1 
ATOM   1412 O  O   . CYS A 1 249 ? 20.456  117.381 75.575  1.00 124.70 ? 249  CYS A O   1 
ATOM   1413 C  CB  . CYS A 1 249 ? 22.817  116.039 75.011  1.00 124.70 ? 249  CYS A CB  1 
ATOM   1414 S  SG  . CYS A 1 249 ? 24.631  116.564 75.152  1.00 124.70 ? 249  CYS A SG  1 
ATOM   1415 N  N   . VAL A 1 250 ? 20.538  116.922 77.790  1.00 124.70 ? 250  VAL A N   1 
ATOM   1416 C  CA  . VAL A 1 250 ? 19.436  117.780 78.211  1.00 124.70 ? 250  VAL A CA  1 
ATOM   1417 C  C   . VAL A 1 250 ? 19.107  117.688 79.708  1.00 124.70 ? 250  VAL A C   1 
ATOM   1418 O  O   . VAL A 1 250 ? 18.275  118.452 80.193  1.00 124.70 ? 250  VAL A O   1 
ATOM   1419 C  CB  . VAL A 1 250 ? 18.131  117.453 77.419  1.00 124.70 ? 250  VAL A CB  1 
ATOM   1420 C  CG1 . VAL A 1 250 ? 16.868  117.989 78.197  1.00 124.70 ? 250  VAL A CG1 1 
ATOM   1421 C  CG2 . VAL A 1 250 ? 18.179  118.074 76.010  1.00 124.70 ? 250  VAL A CG2 1 
ATOM   1422 N  N   . ASN A 1 251 ? 19.732  116.832 80.500  1.00 124.70 ? 251  ASN A N   1 
ATOM   1423 C  CA  . ASN A 1 251 ? 19.186  116.697 81.832  1.00 124.70 ? 251  ASN A CA  1 
ATOM   1424 C  C   . ASN A 1 251 ? 18.677  118.030 82.341  1.00 124.70 ? 251  ASN A C   1 
ATOM   1425 O  O   . ASN A 1 251 ? 19.418  118.956 82.697  1.00 124.70 ? 251  ASN A O   1 
ATOM   1426 C  CB  . ASN A 1 251 ? 20.212  116.047 82.753  1.00 124.70 ? 251  ASN A CB  1 
ATOM   1427 C  CG  . ASN A 1 251 ? 20.586  114.659 82.269  1.00 124.70 ? 251  ASN A CG  1 
ATOM   1428 O  OD1 . ASN A 1 251 ? 19.726  113.892 81.829  1.00 124.70 ? 251  ASN A OD1 1 
ATOM   1429 N  ND2 . ASN A 1 251 ? 21.869  114.329 82.344  1.00 124.70 ? 251  ASN A ND2 1 
ATOM   1430 N  N   . VAL A 1 252 ? 17.337  118.028 82.341  1.00 124.70 ? 252  VAL A N   1 
ATOM   1431 C  CA  . VAL A 1 252 ? 16.392  119.047 82.759  1.00 124.70 ? 252  VAL A CA  1 
ATOM   1432 C  C   . VAL A 1 252 ? 15.576  118.183 83.687  1.00 124.70 ? 252  VAL A C   1 
ATOM   1433 O  O   . VAL A 1 252 ? 15.466  116.988 83.424  1.00 124.70 ? 252  VAL A O   1 
ATOM   1434 C  CB  . VAL A 1 252 ? 15.493  119.421 81.595  1.00 124.70 ? 252  VAL A CB  1 
ATOM   1435 C  CG1 . VAL A 1 252 ? 14.175  119.969 82.114  1.00 124.70 ? 252  VAL A CG1 1 
ATOM   1436 C  CG2 . VAL A 1 252 ? 16.219  120.374 80.676  1.00 124.70 ? 252  VAL A CG2 1 
ATOM   1437 N  N   . THR A 1 253 ? 14.984  118.706 84.750  1.00 124.70 ? 253  THR A N   1 
ATOM   1438 C  CA  . THR A 1 253 ? 14.276  117.734 85.553  1.00 124.70 ? 253  THR A CA  1 
ATOM   1439 C  C   . THR A 1 253 ? 12.790  117.788 85.747  1.00 124.70 ? 253  THR A C   1 
ATOM   1440 O  O   . THR A 1 253 ? 12.193  118.700 86.315  1.00 124.70 ? 253  THR A O   1 
ATOM   1441 C  CB  . THR A 1 253 ? 14.945  117.513 86.910  1.00 124.70 ? 253  THR A CB  1 
ATOM   1442 O  OG1 . THR A 1 253 ? 16.362  117.371 86.724  1.00 124.70 ? 253  THR A OG1 1 
ATOM   1443 C  CG2 . THR A 1 253 ? 14.418  116.224 87.532  1.00 124.70 ? 253  THR A CG2 1 
ATOM   1444 N  N   . LEU A 1 254 ? 12.246  116.710 85.227  1.00 124.70 ? 254  LEU A N   1 
ATOM   1445 C  CA  . LEU A 1 254 ? 10.859  116.319 85.202  1.00 124.70 ? 254  LEU A CA  1 
ATOM   1446 C  C   . LEU A 1 254 ? 10.265  116.219 86.624  1.00 124.70 ? 254  LEU A C   1 
ATOM   1447 O  O   . LEU A 1 254 ? 10.976  115.789 87.542  1.00 124.70 ? 254  LEU A O   1 
ATOM   1448 C  CB  . LEU A 1 254 ? 10.865  114.942 84.518  1.00 124.70 ? 254  LEU A CB  1 
ATOM   1449 C  CG  . LEU A 1 254 ? 12.280  114.321 84.687  1.00 124.70 ? 254  LEU A CG  1 
ATOM   1450 C  CD1 . LEU A 1 254 ? 12.361  113.420 85.921  1.00 124.70 ? 254  LEU A CD1 1 
ATOM   1451 C  CD2 . LEU A 1 254 ? 12.646  113.541 83.454  1.00 124.70 ? 254  LEU A CD2 1 
ATOM   1452 N  N   . CYS A 1 255 ? 9.009   116.634 86.844  1.00 124.70 ? 255  CYS A N   1 
ATOM   1453 C  CA  . CYS A 1 255 ? 8.431   116.417 88.186  1.00 124.70 ? 255  CYS A CA  1 
ATOM   1454 C  C   . CYS A 1 255 ? 8.203   114.894 88.132  1.00 124.70 ? 255  CYS A C   1 
ATOM   1455 O  O   . CYS A 1 255 ? 7.184   114.372 87.643  1.00 124.70 ? 255  CYS A O   1 
ATOM   1456 C  CB  . CYS A 1 255 ? 7.117   117.189 88.427  1.00 124.70 ? 255  CYS A CB  1 
ATOM   1457 S  SG  . CYS A 1 255 ? 7.295   119.006 88.609  1.00 124.70 ? 255  CYS A SG  1 
ATOM   1458 N  N   . GLU A 1 256 ? 9.234   114.220 88.625  1.00 124.70 ? 256  GLU A N   1 
ATOM   1459 C  CA  . GLU A 1 256 ? 9.390   112.783 88.638  1.00 124.70 ? 256  GLU A CA  1 
ATOM   1460 C  C   . GLU A 1 256 ? 8.613   112.046 89.709  1.00 124.70 ? 256  GLU A C   1 
ATOM   1461 O  O   . GLU A 1 256 ? 8.931   112.152 90.894  1.00 124.70 ? 256  GLU A O   1 
ATOM   1462 C  CB  . GLU A 1 256 ? 10.889  112.495 88.759  1.00 124.70 ? 256  GLU A CB  1 
ATOM   1463 C  CG  . GLU A 1 256 ? 11.577  113.266 89.913  1.00 124.70 ? 256  GLU A CG  1 
ATOM   1464 C  CD  . GLU A 1 256 ? 12.749  114.153 89.472  1.00 124.70 ? 256  GLU A CD  1 
ATOM   1465 O  OE1 . GLU A 1 256 ? 13.397  113.834 88.451  1.00 124.70 ? 256  GLU A OE1 1 
ATOM   1466 O  OE2 . GLU A 1 256 ? 13.034  115.157 90.168  1.00 124.70 ? 256  GLU A OE2 1 
ATOM   1467 N  N   . GLY A 1 257 ? 7.610   111.291 89.258  1.00 124.70 ? 257  GLY A N   1 
ATOM   1468 C  CA  . GLY A 1 257 ? 6.746   110.502 90.126  1.00 124.70 ? 257  GLY A CA  1 
ATOM   1469 C  C   . GLY A 1 257 ? 7.015   110.509 91.633  1.00 124.70 ? 257  GLY A C   1 
ATOM   1470 O  O   . GLY A 1 257 ? 6.074   110.603 92.419  1.00 124.70 ? 257  GLY A O   1 
ATOM   1471 N  N   . PRO A 1 258 ? 8.274   110.401 92.082  1.00 124.70 ? 258  PRO A N   1 
ATOM   1472 C  CA  . PRO A 1 258 ? 8.688   110.384 93.492  1.00 124.70 ? 258  PRO A CA  1 
ATOM   1473 C  C   . PRO A 1 258 ? 8.309   111.481 94.461  1.00 124.70 ? 258  PRO A C   1 
ATOM   1474 O  O   . PRO A 1 258 ? 9.151   112.288 94.902  1.00 124.70 ? 258  PRO A O   1 
ATOM   1475 C  CB  . PRO A 1 258 ? 10.188  110.212 93.401  1.00 124.70 ? 258  PRO A CB  1 
ATOM   1476 C  CG  . PRO A 1 258 ? 10.334  109.308 92.243  1.00 124.70 ? 258  PRO A CG  1 
ATOM   1477 C  CD  . PRO A 1 258 ? 9.291   109.743 91.243  1.00 124.70 ? 258  PRO A CD  1 
ATOM   1478 N  N   . ASN A 1 259 ? 7.033   111.430 94.813  1.00 124.70 ? 259  ASN A N   1 
ATOM   1479 C  CA  . ASN A 1 259 ? 6.425   112.326 95.753  1.00 124.70 ? 259  ASN A CA  1 
ATOM   1480 C  C   . ASN A 1 259 ? 6.766   113.771 95.468  1.00 124.70 ? 259  ASN A C   1 
ATOM   1481 O  O   . ASN A 1 259 ? 7.383   114.448 96.279  1.00 124.70 ? 259  ASN A O   1 
ATOM   1482 C  CB  . ASN A 1 259 ? 6.832   111.942 97.186  1.00 124.70 ? 259  ASN A CB  1 
ATOM   1483 C  CG  . ASN A 1 259 ? 6.361   110.554 97.579  1.00 124.70 ? 259  ASN A CG  1 
ATOM   1484 O  OD1 . ASN A 1 259 ? 7.162   109.717 97.996  1.00 124.70 ? 259  ASN A OD1 1 
ATOM   1485 N  ND2 . ASN A 1 259 ? 5.059   110.305 97.457  1.00 124.70 ? 259  ASN A ND2 1 
ATOM   1486 N  N   . LYS A 1 260 ? 6.368   114.240 94.294  1.00 124.70 ? 260  LYS A N   1 
ATOM   1487 C  CA  . LYS A 1 260 ? 6.569   115.630 93.938  1.00 124.70 ? 260  LYS A CA  1 
ATOM   1488 C  C   . LYS A 1 260 ? 5.363   115.983 93.097  1.00 124.70 ? 260  LYS A C   1 
ATOM   1489 O  O   . LYS A 1 260 ? 4.620   115.090 92.686  1.00 124.70 ? 260  LYS A O   1 
ATOM   1490 C  CB  . LYS A 1 260 ? 7.888   115.819 93.208  1.00 124.70 ? 260  LYS A CB  1 
ATOM   1491 C  CG  . LYS A 1 260 ? 9.071   115.275 94.003  1.00 124.70 ? 260  LYS A CG  1 
ATOM   1492 C  CD  . LYS A 1 260 ? 9.993   116.377 94.485  1.00 124.70 ? 260  LYS A CD  1 
ATOM   1493 C  CE  . LYS A 1 260 ? 11.155  115.794 95.269  1.00 124.70 ? 260  LYS A CE  1 
ATOM   1494 N  NZ  . LYS A 1 260 ? 12.222  116.804 95.535  1.00 124.70 ? 260  LYS A NZ  1 
ATOM   1495 N  N   . PHE A 1 261 ? 5.126   117.261 92.847  1.00 124.70 ? 261  PHE A N   1 
ATOM   1496 C  CA  . PHE A 1 261 ? 3.926   117.562 92.100  1.00 124.70 ? 261  PHE A CA  1 
ATOM   1497 C  C   . PHE A 1 261 ? 3.995   118.397 90.867  1.00 124.70 ? 261  PHE A C   1 
ATOM   1498 O  O   . PHE A 1 261 ? 4.749   119.359 90.779  1.00 124.70 ? 261  PHE A O   1 
ATOM   1499 C  CB  . PHE A 1 261 ? 2.883   118.202 93.015  1.00 124.70 ? 261  PHE A CB  1 
ATOM   1500 C  CG  . PHE A 1 261 ? 1.463   117.823 92.675  1.00 124.70 ? 261  PHE A CG  1 
ATOM   1501 C  CD1 . PHE A 1 261 ? 0.503   117.738 93.679  1.00 124.70 ? 261  PHE A CD1 1 
ATOM   1502 C  CD2 . PHE A 1 261 ? 1.083   117.528 91.362  1.00 124.70 ? 261  PHE A CD2 1 
ATOM   1503 C  CE1 . PHE A 1 261 ? -0.809  117.362 93.386  1.00 124.70 ? 261  PHE A CE1 1 
ATOM   1504 C  CE2 . PHE A 1 261 ? -0.231  117.149 91.056  1.00 124.70 ? 261  PHE A CE2 1 
ATOM   1505 C  CZ  . PHE A 1 261 ? -1.177  117.066 92.074  1.00 124.70 ? 261  PHE A CZ  1 
ATOM   1506 N  N   . LYS A 1 262 ? 3.184   118.006 89.898  1.00 124.70 ? 262  LYS A N   1 
ATOM   1507 C  CA  . LYS A 1 262 ? 3.066   118.805 88.713  1.00 124.70 ? 262  LYS A CA  1 
ATOM   1508 C  C   . LYS A 1 262 ? 2.271   119.935 89.363  1.00 124.70 ? 262  LYS A C   1 
ATOM   1509 O  O   . LYS A 1 262 ? 1.091   120.100 89.065  1.00 124.70 ? 262  LYS A O   1 
ATOM   1510 C  CB  . LYS A 1 262 ? 2.233   118.088 87.654  1.00 124.70 ? 262  LYS A CB  1 
ATOM   1511 N  N   . CYS A 1 263 ? 2.909   120.631 90.323  1.00 124.70 ? 263  CYS A N   1 
ATOM   1512 C  CA  . CYS A 1 263 ? 2.298   121.760 91.032  1.00 124.70 ? 263  CYS A CA  1 
ATOM   1513 C  C   . CYS A 1 263 ? 1.624   122.351 89.830  1.00 124.70 ? 263  CYS A C   1 
ATOM   1514 O  O   . CYS A 1 263 ? 2.248   122.977 88.973  1.00 124.70 ? 263  CYS A O   1 
ATOM   1515 C  CB  . CYS A 1 263 ? 3.396   122.664 91.673  1.00 124.70 ? 263  CYS A CB  1 
ATOM   1516 S  SG  . CYS A 1 263 ? 3.207   124.494 91.922  1.00 124.70 ? 263  CYS A SG  1 
ATOM   1517 N  N   . HIS A 1 264 ? 0.336   122.048 89.734  1.00 124.70 ? 264  HIS A N   1 
ATOM   1518 C  CA  . HIS A 1 264 ? -0.415  122.468 88.581  1.00 124.70 ? 264  HIS A CA  1 
ATOM   1519 C  C   . HIS A 1 264 ? -0.251  123.964 88.358  1.00 124.70 ? 264  HIS A C   1 
ATOM   1520 O  O   . HIS A 1 264 ? -0.785  124.795 89.104  1.00 124.70 ? 264  HIS A O   1 
ATOM   1521 C  CB  . HIS A 1 264 ? -1.889  122.034 88.691  1.00 124.70 ? 264  HIS A CB  1 
ATOM   1522 C  CG  . HIS A 1 264 ? -2.643  122.176 87.400  1.00 124.70 ? 264  HIS A CG  1 
ATOM   1523 N  ND1 . HIS A 1 264 ? -2.158  121.687 86.210  1.00 124.70 ? 264  HIS A ND1 1 
ATOM   1524 C  CD2 . HIS A 1 264 ? -3.804  122.809 87.106  1.00 124.70 ? 264  HIS A CD2 1 
ATOM   1525 C  CE1 . HIS A 1 264 ? -2.984  122.018 85.228  1.00 124.70 ? 264  HIS A CE1 1 
ATOM   1526 N  NE2 . HIS A 1 264 ? -3.988  122.698 85.745  1.00 124.70 ? 264  HIS A NE2 1 
ATOM   1527 N  N   . SER A 1 265 ? 0.532   124.257 87.313  1.00 124.70 ? 265  SER A N   1 
ATOM   1528 C  CA  . SER A 1 265 ? 0.888   125.596 86.876  1.00 124.70 ? 265  SER A CA  1 
ATOM   1529 C  C   . SER A 1 265 ? 1.737   126.203 87.963  1.00 124.70 ? 265  SER A C   1 
ATOM   1530 O  O   . SER A 1 265 ? 1.475   127.316 88.409  1.00 124.70 ? 265  SER A O   1 
ATOM   1531 C  CB  . SER A 1 265 ? -0.355  126.447 86.633  1.00 124.70 ? 265  SER A CB  1 
ATOM   1532 O  OG  . SER A 1 265 ? -0.095  127.466 85.684  1.00 124.70 ? 265  SER A OG  1 
ATOM   1533 N  N   . GLY A 1 266 ? 2.762   125.445 88.362  1.00 124.70 ? 266  GLY A N   1 
ATOM   1534 C  CA  . GLY A 1 266 ? 3.695   125.882 89.384  1.00 124.70 ? 266  GLY A CA  1 
ATOM   1535 C  C   . GLY A 1 266 ? 5.100   125.277 89.481  1.00 124.70 ? 266  GLY A C   1 
ATOM   1536 O  O   . GLY A 1 266 ? 6.044   125.754 88.844  1.00 124.70 ? 266  GLY A O   1 
ATOM   1537 N  N   . GLU A 1 267 ? 5.214   124.191 90.244  1.00 124.70 ? 267  GLU A N   1 
ATOM   1538 C  CA  . GLU A 1 267 ? 6.492   123.568 90.563  1.00 124.70 ? 267  GLU A CA  1 
ATOM   1539 C  C   . GLU A 1 267 ? 6.459   122.062 90.835  1.00 124.70 ? 267  GLU A C   1 
ATOM   1540 O  O   . GLU A 1 267 ? 5.478   121.382 90.550  1.00 124.70 ? 267  GLU A O   1 
ATOM   1541 C  CB  . GLU A 1 267 ? 7.061   124.285 91.799  1.00 124.70 ? 267  GLU A CB  1 
ATOM   1542 C  CG  . GLU A 1 267 ? 7.290   125.765 91.577  1.00 124.70 ? 267  GLU A CG  1 
ATOM   1543 C  CD  . GLU A 1 267 ? 8.235   126.020 90.405  1.00 124.70 ? 267  GLU A CD  1 
ATOM   1544 O  OE1 . GLU A 1 267 ? 8.784   125.038 89.861  1.00 124.70 ? 267  GLU A OE1 1 
ATOM   1545 O  OE2 . GLU A 1 267 ? 8.465   127.194 90.037  1.00 124.70 ? 267  GLU A OE2 1 
ATOM   1546 N  N   . CYS A 1 268 ? 7.582   121.557 91.341  1.00 124.70 ? 268  CYS A N   1 
ATOM   1547 C  CA  . CYS A 1 268 ? 7.736   120.150 91.701  1.00 124.70 ? 268  CYS A CA  1 
ATOM   1548 C  C   . CYS A 1 268 ? 7.836   120.341 93.188  1.00 124.70 ? 268  CYS A C   1 
ATOM   1549 O  O   . CYS A 1 268 ? 8.781   120.955 93.677  1.00 124.70 ? 268  CYS A O   1 
ATOM   1550 C  CB  . CYS A 1 268 ? 9.034   119.527 91.168  1.00 124.70 ? 268  CYS A CB  1 
ATOM   1551 S  SG  . CYS A 1 268 ? 9.168   119.317 89.357  1.00 124.70 ? 268  CYS A SG  1 
ATOM   1552 N  N   . ILE A 1 269 ? 6.856   119.812 93.909  1.00 124.70 ? 269  ILE A N   1 
ATOM   1553 C  CA  . ILE A 1 269 ? 6.773   120.036 95.352  1.00 124.70 ? 269  ILE A CA  1 
ATOM   1554 C  C   . ILE A 1 269 ? 6.073   118.944 96.135  1.00 124.70 ? 269  ILE A C   1 
ATOM   1555 O  O   . ILE A 1 269 ? 5.000   118.501 95.725  1.00 124.70 ? 269  ILE A O   1 
ATOM   1556 C  CB  . ILE A 1 269 ? 5.966   121.318 95.598  1.00 124.70 ? 269  ILE A CB  1 
ATOM   1557 C  CG1 . ILE A 1 269 ? 4.514   121.087 95.149  1.00 124.70 ? 269  ILE A CG1 1 
ATOM   1558 C  CG2 . ILE A 1 269 ? 6.549   122.476 94.782  1.00 124.70 ? 269  ILE A CG2 1 
ATOM   1559 C  CD1 . ILE A 1 269 ? 3.476   121.420 96.181  1.00 124.70 ? 269  ILE A CD1 1 
ATOM   1560 N  N   . THR A 1 270 ? 6.638   118.535 97.270  1.00 124.70 ? 270  THR A N   1 
ATOM   1561 C  CA  . THR A 1 270 ? 5.959   117.500 98.030  1.00 124.70 ? 270  THR A CA  1 
ATOM   1562 C  C   . THR A 1 270 ? 6.399   117.180 99.473  1.00 124.70 ? 270  THR A C   1 
ATOM   1563 O  O   . THR A 1 270 ? 7.381   117.680 100.016 1.00 124.70 ? 270  THR A O   1 
ATOM   1564 C  CB  . THR A 1 270 ? 5.933   116.177 97.179  1.00 124.70 ? 270  THR A CB  1 
ATOM   1565 O  OG1 . THR A 1 270 ? 5.300   116.431 95.918  1.00 124.70 ? 270  THR A OG1 1 
ATOM   1566 C  CG2 . THR A 1 270 ? 5.125   115.073 97.863  1.00 124.70 ? 270  THR A CG2 1 
ATOM   1567 N  N   . LEU A 1 271 ? 5.613   116.299 100.060 1.00 124.70 ? 271  LEU A N   1 
ATOM   1568 C  CA  . LEU A 1 271 ? 5.777   115.747 101.391 1.00 124.70 ? 271  LEU A CA  1 
ATOM   1569 C  C   . LEU A 1 271 ? 4.616   114.774 101.369 1.00 124.70 ? 271  LEU A C   1 
ATOM   1570 O  O   . LEU A 1 271 ? 4.186   114.269 102.415 1.00 124.70 ? 271  LEU A O   1 
ATOM   1571 C  CB  . LEU A 1 271 ? 5.463   116.769 102.482 1.00 124.70 ? 271  LEU A CB  1 
ATOM   1572 C  CG  . LEU A 1 271 ? 6.448   117.875 102.792 1.00 124.70 ? 271  LEU A CG  1 
ATOM   1573 C  CD1 . LEU A 1 271 ? 6.060   118.531 104.103 1.00 124.70 ? 271  LEU A CD1 1 
ATOM   1574 C  CD2 . LEU A 1 271 ? 7.843   117.290 102.895 1.00 124.70 ? 271  LEU A CD2 1 
ATOM   1575 N  N   . ASP A 1 272 ? 4.126   114.494 100.162 1.00 124.70 ? 272  ASP A N   1 
ATOM   1576 C  CA  . ASP A 1 272 ? 2.898   113.728 100.014 1.00 124.70 ? 272  ASP A CA  1 
ATOM   1577 C  C   . ASP A 1 272 ? 2.026   114.726 100.800 1.00 124.70 ? 272  ASP A C   1 
ATOM   1578 O  O   . ASP A 1 272 ? 1.152   114.357 101.601 1.00 124.70 ? 272  ASP A O   1 
ATOM   1579 C  CB  . ASP A 1 272 ? 2.963   112.380 100.712 1.00 124.70 ? 272  ASP A CB  1 
ATOM   1580 N  N   . LYS A 1 273 ? 2.354   116.007 100.557 1.00 124.70 ? 273  LYS A N   1 
ATOM   1581 C  CA  . LYS A 1 273 ? 1.732   117.215 101.130 1.00 124.70 ? 273  LYS A CA  1 
ATOM   1582 C  C   . LYS A 1 273 ? 0.419   117.423 100.379 1.00 124.70 ? 273  LYS A C   1 
ATOM   1583 O  O   . LYS A 1 273 ? 0.112   118.511 99.855  1.00 124.70 ? 273  LYS A O   1 
ATOM   1584 C  CB  . LYS A 1 273 ? 2.672   118.399 100.903 1.00 124.70 ? 273  LYS A CB  1 
ATOM   1585 C  CG  . LYS A 1 273 ? 2.057   119.742 101.153 1.00 124.70 ? 273  LYS A CG  1 
ATOM   1586 C  CD  . LYS A 1 273 ? 3.063   120.823 100.870 1.00 124.70 ? 273  LYS A CD  1 
ATOM   1587 C  CE  . LYS A 1 273 ? 3.442   121.556 102.146 1.00 124.70 ? 273  LYS A CE  1 
ATOM   1588 N  NZ  . LYS A 1 273 ? 4.138   122.844 101.859 1.00 124.70 ? 273  LYS A NZ  1 
ATOM   1589 N  N   . VAL A 1 274 ? -0.326  116.319 100.377 1.00 124.70 ? 274  VAL A N   1 
ATOM   1590 C  CA  . VAL A 1 274 ? -1.603  116.065 99.706  1.00 124.70 ? 274  VAL A CA  1 
ATOM   1591 C  C   . VAL A 1 274 ? -2.949  116.704 100.063 1.00 124.70 ? 274  VAL A C   1 
ATOM   1592 O  O   . VAL A 1 274 ? -3.687  116.142 100.877 1.00 124.70 ? 274  VAL A O   1 
ATOM   1593 C  CB  . VAL A 1 274 ? -1.863  114.537 99.736  1.00 124.70 ? 274  VAL A CB  1 
ATOM   1594 C  CG1 . VAL A 1 274 ? -0.722  113.772 99.050  1.00 124.70 ? 274  VAL A CG1 1 
ATOM   1595 C  CG2 . VAL A 1 274 ? -1.961  114.082 101.175 1.00 124.70 ? 274  VAL A CG2 1 
ATOM   1596 N  N   . CYS A 1 275 ? -3.300  117.830 99.444  1.00 124.70 ? 275  CYS A N   1 
ATOM   1597 C  CA  . CYS A 1 275 ? -4.623  118.387 99.711  1.00 124.70 ? 275  CYS A CA  1 
ATOM   1598 C  C   . CYS A 1 275 ? -4.809  118.510 101.228 1.00 124.70 ? 275  CYS A C   1 
ATOM   1599 O  O   . CYS A 1 275 ? -5.729  117.903 101.784 1.00 124.70 ? 275  CYS A O   1 
ATOM   1600 C  CB  . CYS A 1 275 ? -5.666  117.413 99.094  1.00 124.70 ? 275  CYS A CB  1 
ATOM   1601 S  SG  . CYS A 1 275 ? -7.477  117.751 99.178  1.00 124.70 ? 275  CYS A SG  1 
ATOM   1602 N  N   . ASN A 1 276 ? -3.956  119.314 101.873 1.00 124.70 ? 276  ASN A N   1 
ATOM   1603 C  CA  . ASN A 1 276 ? -3.927  119.482 103.334 1.00 124.70 ? 276  ASN A CA  1 
ATOM   1604 C  C   . ASN A 1 276 ? -3.865  120.938 103.879 1.00 124.70 ? 276  ASN A C   1 
ATOM   1605 O  O   . ASN A 1 276 ? -2.777  121.500 104.008 1.00 124.70 ? 276  ASN A O   1 
ATOM   1606 C  CB  . ASN A 1 276 ? -2.694  118.731 103.857 1.00 124.70 ? 276  ASN A CB  1 
ATOM   1607 C  CG  . ASN A 1 276 ? -1.416  119.225 103.208 1.00 124.70 ? 276  ASN A CG  1 
ATOM   1608 O  OD1 . ASN A 1 276 ? -1.397  120.325 102.642 1.00 124.70 ? 276  ASN A OD1 1 
ATOM   1609 N  ND2 . ASN A 1 276 ? -0.344  118.432 103.284 1.00 124.70 ? 276  ASN A ND2 1 
ATOM   1610 N  N   . MET A 1 277 ? -4.999  121.545 104.232 1.00 124.70 ? 277  MET A N   1 
ATOM   1611 C  CA  . MET A 1 277 ? -4.991  122.924 104.775 1.00 124.70 ? 277  MET A CA  1 
ATOM   1612 C  C   . MET A 1 277 ? -3.729  123.699 104.348 1.00 124.70 ? 277  MET A C   1 
ATOM   1613 O  O   . MET A 1 277 ? -2.956  124.106 105.203 1.00 124.70 ? 277  MET A O   1 
ATOM   1614 C  CB  . MET A 1 277 ? -5.021  122.942 106.328 1.00 124.70 ? 277  MET A CB  1 
ATOM   1615 C  CG  . MET A 1 277 ? -5.927  121.929 107.025 1.00 124.70 ? 277  MET A CG  1 
ATOM   1616 S  SD  . MET A 1 277 ? -5.511  121.784 108.826 1.00 124.70 ? 277  MET A SD  1 
ATOM   1617 C  CE  . MET A 1 277 ? -5.606  123.547 109.384 1.00 124.70 ? 277  MET A CE  1 
ATOM   1618 N  N   . ALA A 1 278 ? -3.493  123.894 103.052 1.00 124.70 ? 278  ALA A N   1 
ATOM   1619 C  CA  . ALA A 1 278 ? -2.302  124.638 102.633 1.00 124.70 ? 278  ALA A CA  1 
ATOM   1620 C  C   . ALA A 1 278 ? -2.169  124.925 101.133 1.00 124.70 ? 278  ALA A C   1 
ATOM   1621 O  O   . ALA A 1 278 ? -2.509  124.091 100.285 1.00 124.70 ? 278  ALA A O   1 
ATOM   1622 C  CB  . ALA A 1 278 ? -1.041  123.923 103.135 1.00 124.70 ? 278  ALA A CB  1 
ATOM   1623 N  N   . ARG A 1 279 ? -1.659  126.127 100.844 1.00 124.70 ? 279  ARG A N   1 
ATOM   1624 C  CA  . ARG A 1 279 ? -1.415  126.632 99.487  1.00 124.70 ? 279  ARG A CA  1 
ATOM   1625 C  C   . ARG A 1 279 ? 0.065   126.434 99.195  1.00 124.70 ? 279  ARG A C   1 
ATOM   1626 O  O   . ARG A 1 279 ? 0.879   127.309 99.475  1.00 124.70 ? 279  ARG A O   1 
ATOM   1627 C  CB  . ARG A 1 279 ? -1.702  128.130 99.379  1.00 124.70 ? 279  ARG A CB  1 
ATOM   1628 C  CG  . ARG A 1 279 ? -1.202  128.727 98.042  1.00 124.70 ? 279  ARG A CG  1 
ATOM   1629 C  CD  . ARG A 1 279 ? -1.201  130.241 98.098  1.00 124.70 ? 279  ARG A CD  1 
ATOM   1630 N  NE  . ARG A 1 279 ? -1.206  130.878 96.783  1.00 124.70 ? 279  ARG A NE  1 
ATOM   1631 C  CZ  . ARG A 1 279 ? -1.353  132.187 96.589  1.00 124.70 ? 279  ARG A CZ  1 
ATOM   1632 N  NH1 . ARG A 1 279 ? -1.505  132.997 97.623  1.00 124.70 ? 279  ARG A NH1 1 
ATOM   1633 N  NH2 . ARG A 1 279 ? -1.358  132.690 95.363  1.00 124.70 ? 279  ARG A NH2 1 
ATOM   1634 N  N   . ASP A 1 280 ? 0.394   125.283 98.624  1.00 124.70 ? 280  ASP A N   1 
ATOM   1635 C  CA  . ASP A 1 280 ? 1.754   124.903 98.302  1.00 124.70 ? 280  ASP A CA  1 
ATOM   1636 C  C   . ASP A 1 280 ? 1.942   124.710 96.797  1.00 124.70 ? 280  ASP A C   1 
ATOM   1637 O  O   . ASP A 1 280 ? 2.462   123.724 96.280  1.00 124.70 ? 280  ASP A O   1 
ATOM   1638 C  CB  . ASP A 1 280 ? 2.108   123.658 99.083  1.00 124.70 ? 280  ASP A CB  1 
ATOM   1639 C  CG  . ASP A 1 280 ? 1.911   123.844 100.579 1.00 124.70 ? 280  ASP A CG  1 
ATOM   1640 O  OD1 . ASP A 1 280 ? 2.346   124.890 101.103 1.00 124.70 ? 280  ASP A OD1 1 
ATOM   1641 O  OD2 . ASP A 1 280 ? 1.347   122.944 101.241 1.00 124.70 ? 280  ASP A OD2 1 
ATOM   1642 N  N   . CYS A 1 281 ? 1.581   125.788 96.131  1.00 124.70 ? 281  CYS A N   1 
ATOM   1643 C  CA  . CYS A 1 281 ? 1.663   125.995 94.700  1.00 124.70 ? 281  CYS A CA  1 
ATOM   1644 C  C   . CYS A 1 281 ? 0.861   127.280 94.726  1.00 124.70 ? 281  CYS A C   1 
ATOM   1645 O  O   . CYS A 1 281 ? -0.139  127.371 95.446  1.00 124.70 ? 281  CYS A O   1 
ATOM   1646 C  CB  . CYS A 1 281 ? 0.890   124.928 93.922  1.00 124.70 ? 281  CYS A CB  1 
ATOM   1647 S  SG  . CYS A 1 281 ? 1.221   124.889 92.112  1.00 124.70 ? 281  CYS A SG  1 
ATOM   1648 N  N   . ARG A 1 282 ? 1.288   128.296 94.001  1.00 124.70 ? 282  ARG A N   1 
ATOM   1649 C  CA  . ARG A 1 282 ? 0.502   129.521 93.991  1.00 124.70 ? 282  ARG A CA  1 
ATOM   1650 C  C   . ARG A 1 282 ? -0.838  129.221 93.309  1.00 124.70 ? 282  ARG A C   1 
ATOM   1651 O  O   . ARG A 1 282 ? -1.415  130.076 92.630  1.00 124.70 ? 282  ARG A O   1 
ATOM   1652 C  CB  . ARG A 1 282 ? 1.237   130.597 93.236  1.00 124.70 ? 282  ARG A CB  1 
ATOM   1653 N  N   . ASP A 1 283 ? -1.338  128.009 93.523  1.00 124.70 ? 283  ASP A N   1 
ATOM   1654 C  CA  . ASP A 1 283 ? -2.561  127.584 92.902  1.00 124.70 ? 283  ASP A CA  1 
ATOM   1655 C  C   . ASP A 1 283 ? -3.340  126.657 93.813  1.00 124.70 ? 283  ASP A C   1 
ATOM   1656 O  O   . ASP A 1 283 ? -2.769  125.859 94.567  1.00 124.70 ? 283  ASP A O   1 
ATOM   1657 C  CB  . ASP A 1 283 ? -2.197  126.881 91.601  1.00 124.70 ? 283  ASP A CB  1 
ATOM   1658 C  CG  . ASP A 1 283 ? -3.118  127.241 90.476  1.00 124.70 ? 283  ASP A CG  1 
ATOM   1659 O  OD1 . ASP A 1 283 ? -4.292  126.833 90.537  1.00 124.70 ? 283  ASP A OD1 1 
ATOM   1660 O  OD2 . ASP A 1 283 ? -2.675  127.933 89.536  1.00 124.70 ? 283  ASP A OD2 1 
ATOM   1661 N  N   . TRP A 1 284 ? -4.656  126.785 93.751  1.00 124.70 ? 284  TRP A N   1 
ATOM   1662 C  CA  . TRP A 1 284 ? -5.511  125.927 94.522  1.00 124.70 ? 284  TRP A CA  1 
ATOM   1663 C  C   . TRP A 1 284 ? -5.437  124.620 93.741  1.00 124.70 ? 284  TRP A C   1 
ATOM   1664 O  O   . TRP A 1 284 ? -6.395  123.856 93.708  1.00 124.70 ? 284  TRP A O   1 
ATOM   1665 C  CB  . TRP A 1 284 ? -6.917  126.473 94.541  1.00 124.70 ? 284  TRP A CB  1 
ATOM   1666 N  N   . SER A 1 285 ? -4.301  124.423 93.057  1.00 124.70 ? 285  SER A N   1 
ATOM   1667 C  CA  . SER A 1 285 ? -3.991  123.207 92.304  1.00 124.70 ? 285  SER A CA  1 
ATOM   1668 C  C   . SER A 1 285 ? -2.970  122.574 93.207  1.00 124.70 ? 285  SER A C   1 
ATOM   1669 O  O   . SER A 1 285 ? -1.951  121.995 92.822  1.00 124.70 ? 285  SER A O   1 
ATOM   1670 C  CB  . SER A 1 285 ? -3.435  123.498 90.925  1.00 124.70 ? 285  SER A CB  1 
ATOM   1671 O  OG  . SER A 1 285 ? -4.468  123.266 89.985  1.00 124.70 ? 285  SER A OG  1 
ATOM   1672 N  N   . ASP A 1 286 ? -3.304  122.837 94.458  1.00 124.70 ? 286  ASP A N   1 
ATOM   1673 C  CA  . ASP A 1 286 ? -2.696  122.350 95.660  1.00 124.70 ? 286  ASP A CA  1 
ATOM   1674 C  C   . ASP A 1 286 ? -4.008  122.161 96.419  1.00 124.70 ? 286  ASP A C   1 
ATOM   1675 O  O   . ASP A 1 286 ? -4.460  123.052 97.168  1.00 124.70 ? 286  ASP A O   1 
ATOM   1676 C  CB  . ASP A 1 286 ? -1.839  123.376 96.408  1.00 124.70 ? 286  ASP A CB  1 
ATOM   1677 C  CG  . ASP A 1 286 ? -1.557  122.934 97.845  1.00 124.70 ? 286  ASP A CG  1 
ATOM   1678 O  OD1 . ASP A 1 286 ? -1.833  121.760 98.161  1.00 124.70 ? 286  ASP A OD1 1 
ATOM   1679 O  OD2 . ASP A 1 286 ? -1.066  123.731 98.660  1.00 124.70 ? 286  ASP A OD2 1 
ATOM   1680 N  N   . GLU A 1 287 ? -4.657  121.030 96.133  1.00 124.70 ? 287  GLU A N   1 
ATOM   1681 C  CA  . GLU A 1 287 ? -5.881  120.618 96.810  1.00 124.70 ? 287  GLU A CA  1 
ATOM   1682 C  C   . GLU A 1 287 ? -7.286  120.994 96.314  1.00 124.70 ? 287  GLU A C   1 
ATOM   1683 O  O   . GLU A 1 287 ? -8.130  121.315 97.152  1.00 124.70 ? 287  GLU A O   1 
ATOM   1684 C  CB  . GLU A 1 287 ? -5.735  121.018 98.293  1.00 124.70 ? 287  GLU A CB  1 
ATOM   1685 C  CG  . GLU A 1 287 ? -4.249  120.931 98.729  1.00 124.70 ? 287  GLU A CG  1 
ATOM   1686 C  CD  . GLU A 1 287 ? -3.923  121.474 100.107 1.00 124.70 ? 287  GLU A CD  1 
ATOM   1687 O  OE1 . GLU A 1 287 ? -4.739  122.237 100.656 1.00 124.70 ? 287  GLU A OE1 1 
ATOM   1688 O  OE2 . GLU A 1 287 ? -2.828  121.145 100.629 1.00 124.70 ? 287  GLU A OE2 1 
ATOM   1689 N  N   . PRO A 1 288 ? -7.579  120.968 94.983  1.00 124.70 ? 288  PRO A N   1 
ATOM   1690 C  CA  . PRO A 1 288 ? -8.979  121.358 94.819  1.00 124.70 ? 288  PRO A CA  1 
ATOM   1691 C  C   . PRO A 1 288 ? -9.778  120.325 95.525  1.00 124.70 ? 288  PRO A C   1 
ATOM   1692 O  O   . PRO A 1 288 ? -9.258  119.278 95.907  1.00 124.70 ? 288  PRO A O   1 
ATOM   1693 C  CB  . PRO A 1 288 ? -9.214  121.261 93.322  1.00 124.70 ? 288  PRO A CB  1 
ATOM   1694 C  CG  . PRO A 1 288 ? -7.974  121.682 92.779  1.00 124.70 ? 288  PRO A CG  1 
ATOM   1695 C  CD  . PRO A 1 288 ? -6.910  121.000 93.673  1.00 124.70 ? 288  PRO A CD  1 
ATOM   1696 N  N   . ILE A 1 289 ? -11.034 120.643 95.740  1.00 124.70 ? 289  ILE A N   1 
ATOM   1697 C  CA  . ILE A 1 289 ? -11.894 119.687 96.344  1.00 124.70 ? 289  ILE A CA  1 
ATOM   1698 C  C   . ILE A 1 289 ? -13.022 119.668 95.369  1.00 124.70 ? 289  ILE A C   1 
ATOM   1699 O  O   . ILE A 1 289 ? -14.011 120.410 95.430  1.00 124.70 ? 289  ILE A O   1 
ATOM   1700 C  CB  . ILE A 1 289 ? -12.355 120.047 97.762  1.00 124.70 ? 289  ILE A CB  1 
ATOM   1701 C  CG1 . ILE A 1 289 ? -13.209 118.895 98.301  1.00 124.70 ? 289  ILE A CG1 1 
ATOM   1702 C  CG2 . ILE A 1 289 ? -13.120 121.352 97.764  1.00 124.70 ? 289  ILE A CG2 1 
ATOM   1703 C  CD1 . ILE A 1 289 ? -13.614 119.052 99.753  1.00 124.70 ? 289  ILE A CD1 1 
ATOM   1704 N  N   . LYS A 1 290 ? -12.753 118.883 94.357  1.00 124.70 ? 290  LYS A N   1 
ATOM   1705 C  CA  . LYS A 1 290 ? -13.740 118.625 93.380  1.00 124.70 ? 290  LYS A CA  1 
ATOM   1706 C  C   . LYS A 1 290 ? -13.348 117.219 93.277  1.00 124.70 ? 290  LYS A C   1 
ATOM   1707 O  O   . LYS A 1 290 ? -12.562 116.710 92.460  1.00 124.70 ? 290  LYS A O   1 
ATOM   1708 C  CB  . LYS A 1 290 ? -13.654 119.440 92.120  1.00 124.70 ? 290  LYS A CB  1 
ATOM   1709 C  CG  . LYS A 1 290 ? -15.101 119.744 91.682  1.00 124.70 ? 290  LYS A CG  1 
ATOM   1710 C  CD  . LYS A 1 290 ? -16.072 118.639 92.196  1.00 124.70 ? 290  LYS A CD  1 
ATOM   1711 C  CE  . LYS A 1 290 ? -17.559 118.987 92.051  1.00 124.70 ? 290  LYS A CE  1 
ATOM   1712 N  NZ  . LYS A 1 290 ? -18.378 117.752 92.223  1.00 124.70 ? 290  LYS A NZ  1 
ATOM   1713 N  N   . GLU A 1 291 ? -13.854 116.717 94.384  1.00 124.70 ? 291  GLU A N   1 
ATOM   1714 C  CA  . GLU A 1 291 ? -13.794 115.415 94.925  1.00 124.70 ? 291  GLU A CA  1 
ATOM   1715 C  C   . GLU A 1 291 ? -12.398 115.113 95.381  1.00 124.70 ? 291  GLU A C   1 
ATOM   1716 O  O   . GLU A 1 291 ? -11.871 114.024 95.132  1.00 124.70 ? 291  GLU A O   1 
ATOM   1717 C  CB  . GLU A 1 291 ? -14.353 114.367 93.975  1.00 124.70 ? 291  GLU A CB  1 
ATOM   1718 C  CG  . GLU A 1 291 ? -15.204 113.327 94.726  1.00 124.70 ? 291  GLU A CG  1 
ATOM   1719 C  CD  . GLU A 1 291 ? -15.771 113.826 96.079  1.00 124.70 ? 291  GLU A CD  1 
ATOM   1720 O  OE1 . GLU A 1 291 ? -15.941 115.057 96.286  1.00 124.70 ? 291  GLU A OE1 1 
ATOM   1721 O  OE2 . GLU A 1 291 ? -16.062 112.965 96.939  1.00 124.70 ? 291  GLU A OE2 1 
ATOM   1722 N  N   . CYS A 1 292 ? -11.792 116.105 96.039  1.00 124.70 ? 292  CYS A N   1 
ATOM   1723 C  CA  . CYS A 1 292 ? -10.480 115.895 96.609  1.00 124.70 ? 292  CYS A CA  1 
ATOM   1724 C  C   . CYS A 1 292 ? -10.777 114.889 97.725  1.00 124.70 ? 292  CYS A C   1 
ATOM   1725 O  O   . CYS A 1 292 ? -10.083 114.859 98.743  1.00 124.70 ? 292  CYS A O   1 
ATOM   1726 C  CB  . CYS A 1 292 ? -9.888  117.177 97.206  1.00 124.70 ? 292  CYS A CB  1 
ATOM   1727 S  SG  . CYS A 1 292 ? -8.032  117.250 97.288  1.00 124.70 ? 292  CYS A SG  1 
ATOM   1728 N  N   . GLY A 1 293 ? -11.834 114.089 97.543  1.00 124.70 ? 293  GLY A N   1 
ATOM   1729 C  CA  . GLY A 1 293 ? -12.166 113.056 98.508  1.00 124.70 ? 293  GLY A CA  1 
ATOM   1730 C  C   . GLY A 1 293 ? -10.975 112.124 98.381  1.00 124.70 ? 293  GLY A C   1 
ATOM   1731 O  O   . GLY A 1 293 ? -10.576 111.784 97.258  1.00 124.70 ? 293  GLY A O   1 
ATOM   1732 N  N   . THR A 1 294 ? -10.376 111.749 99.508  1.00 124.70 ? 294  THR A N   1 
ATOM   1733 C  CA  . THR A 1 294 ? -9.215  110.870 99.484  1.00 124.70 ? 294  THR A CA  1 
ATOM   1734 C  C   . THR A 1 294 ? -9.524  109.521 100.163 1.00 124.70 ? 294  THR A C   1 
ATOM   1735 O  O   . THR A 1 294 ? -10.153 109.461 101.223 1.00 124.70 ? 294  THR A O   1 
ATOM   1736 C  CB  . THR A 1 294 ? -7.965  111.597 100.075 1.00 124.70 ? 294  THR A CB  1 
ATOM   1737 O  OG1 . THR A 1 294 ? -6.880  110.676 100.196 1.00 124.70 ? 294  THR A OG1 1 
ATOM   1738 C  CG2 . THR A 1 294 ? -8.276  112.204 101.420 1.00 124.70 ? 294  THR A CG2 1 
ATOM   1739 N  N   . ASN A 1 295 ? -9.053  108.464 99.494  1.00 124.70 ? 295  ASN A N   1 
ATOM   1740 C  CA  . ASN A 1 295 ? -9.249  107.029 99.776  1.00 124.70 ? 295  ASN A CA  1 
ATOM   1741 C  C   . ASN A 1 295 ? -10.712 106.654 99.753  1.00 124.70 ? 295  ASN A C   1 
ATOM   1742 O  O   . ASN A 1 295 ? -11.330 106.249 100.754 1.00 124.70 ? 295  ASN A O   1 
ATOM   1743 C  CB  . ASN A 1 295 ? -8.635  106.474 101.060 1.00 124.70 ? 295  ASN A CB  1 
ATOM   1744 C  CG  . ASN A 1 295 ? -8.719  104.926 101.093 1.00 124.70 ? 295  ASN A CG  1 
ATOM   1745 O  OD1 . ASN A 1 295 ? -8.553  104.291 102.136 1.00 124.70 ? 295  ASN A OD1 1 
ATOM   1746 N  ND2 . ASN A 1 295 ? -8.982  104.324 99.924  1.00 124.70 ? 295  ASN A ND2 1 
ATOM   1747 N  N   . GLU A 1 296 ? -11.228 106.782 98.545  1.00 124.70 ? 296  GLU A N   1 
ATOM   1748 C  CA  . GLU A 1 296 ? -12.588 106.502 98.203  1.00 124.70 ? 296  GLU A CA  1 
ATOM   1749 C  C   . GLU A 1 296 ? -12.516 105.183 97.456  1.00 124.70 ? 296  GLU A C   1 
ATOM   1750 O  O   . GLU A 1 296 ? -13.233 105.009 96.490  1.00 124.70 ? 296  GLU A O   1 
ATOM   1751 C  CB  . GLU A 1 296 ? -13.112 107.619 97.291  1.00 124.70 ? 296  GLU A CB  1 
ATOM   1752 C  CG  . GLU A 1 296 ? -12.295 108.927 97.400  1.00 124.70 ? 296  GLU A CG  1 
ATOM   1753 C  CD  . GLU A 1 296 ? -10.821 108.758 96.979  1.00 124.70 ? 296  GLU A CD  1 
ATOM   1754 O  OE1 . GLU A 1 296 ? -10.473 107.691 96.421  1.00 124.70 ? 296  GLU A OE1 1 
ATOM   1755 O  OE2 . GLU A 1 296 ? -10.008 109.683 97.195  1.00 124.70 ? 296  GLU A OE2 1 
ATOM   1756 N  N   . CYS A 1 297 ? -11.627 104.269 97.860  1.00 124.70 ? 297  CYS A N   1 
ATOM   1757 C  CA  . CYS A 1 297 ? -11.603 102.979 97.178  1.00 124.70 ? 297  CYS A CA  1 
ATOM   1758 C  C   . CYS A 1 297 ? -13.041 102.534 97.379  1.00 124.70 ? 297  CYS A C   1 
ATOM   1759 O  O   . CYS A 1 297 ? -13.764 103.118 98.207  1.00 124.70 ? 297  CYS A O   1 
ATOM   1760 C  CB  . CYS A 1 297 ? -10.666 101.965 97.842  1.00 124.70 ? 297  CYS A CB  1 
ATOM   1761 S  SG  . CYS A 1 297 ? -9.005  101.695 97.167  1.00 124.70 ? 297  CYS A SG  1 
ATOM   1762 N  N   . LEU A 1 298 ? -13.463 101.504 96.655  1.00 124.70 ? 298  LEU A N   1 
ATOM   1763 C  CA  . LEU A 1 298 ? -14.846 101.075 96.772  1.00 124.70 ? 298  LEU A CA  1 
ATOM   1764 C  C   . LEU A 1 298 ? -15.673 102.330 96.420  1.00 124.70 ? 298  LEU A C   1 
ATOM   1765 O  O   . LEU A 1 298 ? -16.842 102.481 96.823  1.00 124.70 ? 298  LEU A O   1 
ATOM   1766 C  CB  . LEU A 1 298 ? -15.137 100.523 98.183  1.00 124.70 ? 298  LEU A CB  1 
ATOM   1767 C  CG  . LEU A 1 298 ? -14.272 99.292  98.541  1.00 124.70 ? 298  LEU A CG  1 
ATOM   1768 C  CD1 . LEU A 1 298 ? -14.452 98.912  100.001 1.00 124.70 ? 298  LEU A CD1 1 
ATOM   1769 C  CD2 . LEU A 1 298 ? -14.639 98.113  97.650  1.00 124.70 ? 298  LEU A CD2 1 
ATOM   1770 N  N   . ASP A 1 299 ? -14.993 103.234 95.680  1.00 124.70 ? 299  ASP A N   1 
ATOM   1771 C  CA  . ASP A 1 299 ? -15.555 104.470 95.073  1.00 124.70 ? 299  ASP A CA  1 
ATOM   1772 C  C   . ASP A 1 299 ? -16.011 103.580 93.980  1.00 124.70 ? 299  ASP A C   1 
ATOM   1773 O  O   . ASP A 1 299 ? -15.592 103.719 92.824  1.00 124.70 ? 299  ASP A O   1 
ATOM   1774 C  CB  . ASP A 1 299 ? -14.465 105.375 94.459  1.00 124.70 ? 299  ASP A CB  1 
ATOM   1775 C  CG  . ASP A 1 299 ? -14.974 106.231 93.283  1.00 124.70 ? 299  ASP A CG  1 
ATOM   1776 O  OD1 . ASP A 1 299 ? -15.942 105.837 92.598  1.00 124.70 ? 299  ASP A OD1 1 
ATOM   1777 O  OD2 . ASP A 1 299 ? -14.385 107.303 93.023  1.00 124.70 ? 299  ASP A OD2 1 
ATOM   1778 N  N   . ASN A 1 300 ? -16.848 102.630 94.373  1.00 124.70 ? 300  ASN A N   1 
ATOM   1779 C  CA  . ASN A 1 300 ? -17.236 101.621 93.452  1.00 124.70 ? 300  ASN A CA  1 
ATOM   1780 C  C   . ASN A 1 300 ? -15.815 101.185 93.085  1.00 124.70 ? 300  ASN A C   1 
ATOM   1781 O  O   . ASN A 1 300 ? -15.220 101.638 92.088  1.00 124.70 ? 300  ASN A O   1 
ATOM   1782 C  CB  . ASN A 1 300 ? -18.016 102.229 92.290  1.00 124.70 ? 300  ASN A CB  1 
ATOM   1783 C  CG  . ASN A 1 300 ? -19.440 102.581 92.688  1.00 124.70 ? 300  ASN A CG  1 
ATOM   1784 O  OD1 . ASN A 1 300 ? -20.050 103.507 92.143  1.00 124.70 ? 300  ASN A OD1 1 
ATOM   1785 N  ND2 . ASN A 1 300 ? -19.981 101.829 93.647  1.00 124.70 ? 300  ASN A ND2 1 
ATOM   1786 N  N   . ASN A 1 301 ? -15.260 100.344 93.967  1.00 124.70 ? 301  ASN A N   1 
ATOM   1787 C  CA  . ASN A 1 301 ? -13.941 99.767  93.758  1.00 124.70 ? 301  ASN A CA  1 
ATOM   1788 C  C   . ASN A 1 301 ? -14.352 98.890  92.563  1.00 124.70 ? 301  ASN A C   1 
ATOM   1789 O  O   . ASN A 1 301 ? -13.762 97.846  92.278  1.00 124.70 ? 301  ASN A O   1 
ATOM   1790 C  CB  . ASN A 1 301 ? -13.493 98.905  94.959  1.00 124.70 ? 301  ASN A CB  1 
ATOM   1791 C  CG  . ASN A 1 301 ? -12.038 98.447  94.857  1.00 124.70 ? 301  ASN A CG  1 
ATOM   1792 O  OD1 . ASN A 1 301 ? -11.581 97.663  95.691  1.00 124.70 ? 301  ASN A OD1 1 
ATOM   1793 N  ND2 . ASN A 1 301 ? -11.311 98.926  93.839  1.00 124.70 ? 301  ASN A ND2 1 
ATOM   1794 N  N   . GLY A 1 302 ? -15.493 99.301  91.994  1.00 124.70 ? 302  GLY A N   1 
ATOM   1795 C  CA  . GLY A 1 302 ? -16.152 98.719  90.835  1.00 124.70 ? 302  GLY A CA  1 
ATOM   1796 C  C   . GLY A 1 302 ? -16.179 99.788  89.755  1.00 124.70 ? 302  GLY A C   1 
ATOM   1797 O  O   . GLY A 1 302 ? -16.376 99.487  88.582  1.00 124.70 ? 302  GLY A O   1 
ATOM   1798 N  N   . GLY A 1 303 ? -16.024 101.047 90.161  1.00 124.70 ? 303  GLY A N   1 
ATOM   1799 C  CA  . GLY A 1 303 ? -15.923 102.136 89.202  1.00 124.70 ? 303  GLY A CA  1 
ATOM   1800 C  C   . GLY A 1 303 ? -14.415 102.036 89.097  1.00 124.70 ? 303  GLY A C   1 
ATOM   1801 O  O   . GLY A 1 303 ? -13.704 102.715 88.344  1.00 124.70 ? 303  GLY A O   1 
ATOM   1802 N  N   . CYS A 1 304 ? -13.977 101.093 89.926  1.00 124.70 ? 304  CYS A N   1 
ATOM   1803 C  CA  . CYS A 1 304 ? -12.614 100.677 90.174  1.00 124.70 ? 304  CYS A CA  1 
ATOM   1804 C  C   . CYS A 1 304 ? -12.529 99.208  89.747  1.00 124.70 ? 304  CYS A C   1 
ATOM   1805 O  O   . CYS A 1 304 ? -13.474 98.660  89.148  1.00 124.70 ? 304  CYS A O   1 
ATOM   1806 C  CB  . CYS A 1 304 ? -12.333 100.786 91.666  1.00 124.70 ? 304  CYS A CB  1 
ATOM   1807 S  SG  . CYS A 1 304 ? -10.918 101.791 92.223  1.00 124.70 ? 304  CYS A SG  1 
ATOM   1808 N  N   . SER A 1 305 ? -11.444 98.539  90.132  1.00 124.70 ? 305  SER A N   1 
ATOM   1809 C  CA  . SER A 1 305 ? -11.215 97.165  89.662  1.00 124.70 ? 305  SER A CA  1 
ATOM   1810 C  C   . SER A 1 305 ? -10.624 96.108  90.581  1.00 124.70 ? 305  SER A C   1 
ATOM   1811 O  O   . SER A 1 305 ? -10.159 96.402  91.692  1.00 124.70 ? 305  SER A O   1 
ATOM   1812 C  CB  . SER A 1 305 ? -10.243 97.207  88.518  1.00 124.70 ? 305  SER A CB  1 
ATOM   1813 O  OG  . SER A 1 305 ? -9.143  98.057  88.794  1.00 124.70 ? 305  SER A OG  1 
ATOM   1814 N  N   . HIS A 1 306 ? -10.540 94.885  90.023  1.00 124.70 ? 306  HIS A N   1 
ATOM   1815 C  CA  . HIS A 1 306 ? -9.943  93.749  90.719  1.00 124.70 ? 306  HIS A CA  1 
ATOM   1816 C  C   . HIS A 1 306 ? -8.459  94.034  90.977  1.00 124.70 ? 306  HIS A C   1 
ATOM   1817 O  O   . HIS A 1 306 ? -7.517  93.752  90.194  1.00 124.70 ? 306  HIS A O   1 
ATOM   1818 C  CB  . HIS A 1 306 ? -10.172 92.438  89.967  1.00 124.70 ? 306  HIS A CB  1 
ATOM   1819 C  CG  . HIS A 1 306 ? -11.580 91.915  90.090  1.00 124.70 ? 306  HIS A CG  1 
ATOM   1820 N  ND1 . HIS A 1 306 ? -12.137 91.583  91.300  1.00 124.70 ? 306  HIS A ND1 1 
ATOM   1821 C  CD2 . HIS A 1 306 ? -12.540 91.718  89.154  1.00 124.70 ? 306  HIS A CD2 1 
ATOM   1822 C  CE1 . HIS A 1 306 ? -13.397 91.205  91.113  1.00 124.70 ? 306  HIS A CE1 1 
ATOM   1823 N  NE2 . HIS A 1 306 ? -13.661 91.280  89.826  1.00 124.70 ? 306  HIS A NE2 1 
ATOM   1824 N  N   . VAL A 1 307 ? -8.469  94.630  92.181  1.00 124.70 ? 307  VAL A N   1 
ATOM   1825 C  CA  . VAL A 1 307 ? -7.602  95.232  93.231  1.00 124.70 ? 307  VAL A CA  1 
ATOM   1826 C  C   . VAL A 1 307 ? -6.916  96.644  93.256  1.00 124.70 ? 307  VAL A C   1 
ATOM   1827 O  O   . VAL A 1 307 ? -5.748  96.851  92.958  1.00 124.70 ? 307  VAL A O   1 
ATOM   1828 C  CB  . VAL A 1 307 ? -6.649  94.174  93.879  1.00 124.70 ? 307  VAL A CB  1 
ATOM   1829 C  CG1 . VAL A 1 307 ? -5.477  94.857  94.554  1.00 124.70 ? 307  VAL A CG1 1 
ATOM   1830 C  CG2 . VAL A 1 307 ? -7.457  93.398  94.938  1.00 124.70 ? 307  VAL A CG2 1 
ATOM   1831 N  N   . CYS A 1 308 ? -7.649  97.517  93.970  1.00 124.70 ? 308  CYS A N   1 
ATOM   1832 C  CA  . CYS A 1 308 ? -7.394  98.974  94.290  1.00 124.70 ? 308  CYS A CA  1 
ATOM   1833 C  C   . CYS A 1 308 ? -6.482  99.317  95.531  1.00 124.70 ? 308  CYS A C   1 
ATOM   1834 O  O   . CYS A 1 308 ? -6.709  98.805  96.637  1.00 124.70 ? 308  CYS A O   1 
ATOM   1835 C  CB  . CYS A 1 308 ? -8.733  99.715  94.617  1.00 124.70 ? 308  CYS A CB  1 
ATOM   1836 S  SG  . CYS A 1 308 ? -8.988  99.790  96.431  1.00 124.70 ? 308  CYS A SG  1 
ATOM   1837 N  N   . ASN A 1 309 ? -5.463  100.162 95.355  1.00 124.70 ? 309  ASN A N   1 
ATOM   1838 C  CA  . ASN A 1 309 ? -4.670  100.643 96.491  1.00 124.70 ? 309  ASN A CA  1 
ATOM   1839 C  C   . ASN A 1 309 ? -4.458  102.113 96.263  1.00 124.70 ? 309  ASN A C   1 
ATOM   1840 O  O   . ASN A 1 309 ? -3.335  102.579 96.027  1.00 124.70 ? 309  ASN A O   1 
ATOM   1841 C  CB  . ASN A 1 309 ? -3.298  100.005 96.675  1.00 124.70 ? 309  ASN A CB  1 
ATOM   1842 C  CG  . ASN A 1 309 ? -2.600  100.535 97.940  1.00 124.70 ? 309  ASN A CG  1 
ATOM   1843 O  OD1 . ASN A 1 309 ? -1.371  100.531 98.046  1.00 124.70 ? 309  ASN A OD1 1 
ATOM   1844 N  ND2 . ASN A 1 309 ? -3.403  100.999 98.906  1.00 124.70 ? 309  ASN A ND2 1 
ATOM   1845 N  N   . ASP A 1 310 ? -5.572  102.829 96.310  1.00 124.70 ? 310  ASP A N   1 
ATOM   1846 C  CA  . ASP A 1 310 ? -5.576  104.259 96.135  1.00 124.70 ? 310  ASP A CA  1 
ATOM   1847 C  C   . ASP A 1 310 ? -4.934  104.806 97.398  1.00 124.70 ? 310  ASP A C   1 
ATOM   1848 O  O   . ASP A 1 310 ? -4.620  104.059 98.320  1.00 124.70 ? 310  ASP A O   1 
ATOM   1849 C  CB  . ASP A 1 310 ? -7.002  104.762 96.062  1.00 124.70 ? 310  ASP A CB  1 
ATOM   1850 C  CG  . ASP A 1 310 ? -7.263  105.839 97.077  1.00 124.70 ? 310  ASP A CG  1 
ATOM   1851 O  OD1 . ASP A 1 310 ? -6.739  106.954 96.904  1.00 124.70 ? 310  ASP A OD1 1 
ATOM   1852 O  OD2 . ASP A 1 310 ? -7.956  105.568 98.067  1.00 124.70 ? 310  ASP A OD2 1 
ATOM   1853 N  N   . LEU A 1 311 ? -4.755  106.114 97.446  1.00 124.70 ? 311  LEU A N   1 
ATOM   1854 C  CA  . LEU A 1 311 ? -4.160  106.748 98.602  1.00 124.70 ? 311  LEU A CA  1 
ATOM   1855 C  C   . LEU A 1 311 ? -4.633  108.184 98.553  1.00 124.70 ? 311  LEU A C   1 
ATOM   1856 O  O   . LEU A 1 311 ? -5.382  108.564 97.650  1.00 124.70 ? 311  LEU A O   1 
ATOM   1857 C  CB  . LEU A 1 311 ? -2.632  106.717 98.477  1.00 124.70 ? 311  LEU A CB  1 
ATOM   1858 C  CG  . LEU A 1 311 ? -2.038  105.980 97.264  1.00 124.70 ? 311  LEU A CG  1 
ATOM   1859 C  CD1 . LEU A 1 311 ? -0.978  106.840 96.578  1.00 124.70 ? 311  LEU A CD1 1 
ATOM   1860 C  CD2 . LEU A 1 311 ? -1.461  104.646 97.717  1.00 124.70 ? 311  LEU A CD2 1 
ATOM   1861 N  N   . LYS A 1 312 ? -4.196  108.984 99.517  1.00 124.70 ? 312  LYS A N   1 
ATOM   1862 C  CA  . LYS A 1 312 ? -4.553  110.382 99.503  1.00 124.70 ? 312  LYS A CA  1 
ATOM   1863 C  C   . LYS A 1 312 ? -4.118  110.961 98.142  1.00 124.70 ? 312  LYS A C   1 
ATOM   1864 O  O   . LYS A 1 312 ? -3.009  111.482 97.956  1.00 124.70 ? 312  LYS A O   1 
ATOM   1865 C  CB  . LYS A 1 312 ? -3.908  111.122 100.677 1.00 124.70 ? 312  LYS A CB  1 
ATOM   1866 N  N   . ILE A 1 313 ? -5.057  110.747 97.218  1.00 124.70 ? 313  ILE A N   1 
ATOM   1867 C  CA  . ILE A 1 313 ? -5.189  111.119 95.800  1.00 124.70 ? 313  ILE A CA  1 
ATOM   1868 C  C   . ILE A 1 313 ? -4.410  110.724 94.566  1.00 124.70 ? 313  ILE A C   1 
ATOM   1869 O  O   . ILE A 1 313 ? -3.941  111.529 93.771  1.00 124.70 ? 313  ILE A O   1 
ATOM   1870 C  CB  . ILE A 1 313 ? -5.423  112.604 95.626  1.00 124.70 ? 313  ILE A CB  1 
ATOM   1871 C  CG1 . ILE A 1 313 ? -6.288  113.130 96.764  1.00 124.70 ? 313  ILE A CG1 1 
ATOM   1872 C  CG2 . ILE A 1 313 ? -6.210  112.832 94.314  1.00 124.70 ? 313  ILE A CG2 1 
ATOM   1873 C  CD1 . ILE A 1 313 ? -6.494  114.616 96.674  1.00 124.70 ? 313  ILE A CD1 1 
ATOM   1874 N  N   . GLY A 1 314 ? -4.373  109.438 94.390  1.00 124.70 ? 314  GLY A N   1 
ATOM   1875 C  CA  . GLY A 1 314 ? -3.830  108.830 93.229  1.00 124.70 ? 314  GLY A CA  1 
ATOM   1876 C  C   . GLY A 1 314 ? -4.871  107.772 93.573  1.00 124.70 ? 314  GLY A C   1 
ATOM   1877 O  O   . GLY A 1 314 ? -4.528  106.607 93.518  1.00 124.70 ? 314  GLY A O   1 
ATOM   1878 N  N   . TYR A 1 315 ? -6.084  108.169 94.043  1.00 124.70 ? 315  TYR A N   1 
ATOM   1879 C  CA  . TYR A 1 315 ? -7.182  107.230 94.362  1.00 124.70 ? 315  TYR A CA  1 
ATOM   1880 C  C   . TYR A 1 315 ? -7.491  106.384 93.111  1.00 124.70 ? 315  TYR A C   1 
ATOM   1881 O  O   . TYR A 1 315 ? -8.637  106.155 92.721  1.00 124.70 ? 315  TYR A O   1 
ATOM   1882 C  CB  . TYR A 1 315 ? -8.421  107.982 94.974  1.00 124.70 ? 315  TYR A CB  1 
ATOM   1883 C  CG  . TYR A 1 315 ? -9.185  109.060 94.207  1.00 124.70 ? 315  TYR A CG  1 
ATOM   1884 C  CD1 . TYR A 1 315 ? -10.203 108.716 93.327  1.00 124.70 ? 315  TYR A CD1 1 
ATOM   1885 C  CD2 . TYR A 1 315 ? -8.943  110.424 94.426  1.00 124.70 ? 315  TYR A CD2 1 
ATOM   1886 C  CE1 . TYR A 1 315 ? -10.969 109.692 92.677  1.00 124.70 ? 315  TYR A CE1 1 
ATOM   1887 C  CE2 . TYR A 1 315 ? -9.706  111.414 93.775  1.00 124.70 ? 315  TYR A CE2 1 
ATOM   1888 C  CZ  . TYR A 1 315 ? -10.715 111.035 92.903  1.00 124.70 ? 315  TYR A CZ  1 
ATOM   1889 O  OH  . TYR A 1 315 ? -11.465 111.993 92.259  1.00 124.70 ? 315  TYR A OH  1 
ATOM   1890 N  N   . GLU A 1 316 ? -6.377  105.883 92.560  1.00 124.70 ? 316  GLU A N   1 
ATOM   1891 C  CA  . GLU A 1 316 ? -6.237  105.084 91.338  1.00 124.70 ? 316  GLU A CA  1 
ATOM   1892 C  C   . GLU A 1 316 ? -6.691  103.621 91.371  1.00 124.70 ? 316  GLU A C   1 
ATOM   1893 O  O   . GLU A 1 316 ? -6.051  102.726 91.943  1.00 124.70 ? 316  GLU A O   1 
ATOM   1894 C  CB  . GLU A 1 316 ? -4.777  105.214 90.826  1.00 124.70 ? 316  GLU A CB  1 
ATOM   1895 C  CG  . GLU A 1 316 ? -3.953  103.936 90.641  1.00 124.70 ? 316  GLU A CG  1 
ATOM   1896 C  CD  . GLU A 1 316 ? -3.142  103.541 91.878  1.00 124.70 ? 316  GLU A CD  1 
ATOM   1897 O  OE1 . GLU A 1 316 ? -2.690  104.449 92.607  1.00 124.70 ? 316  GLU A OE1 1 
ATOM   1898 O  OE2 . GLU A 1 316 ? -2.937  102.325 92.108  1.00 124.70 ? 316  GLU A OE2 1 
ATOM   1899 N  N   . CYS A 1 317 ? -7.834  103.438 90.717  1.00 124.70 ? 317  CYS A N   1 
ATOM   1900 C  CA  . CYS A 1 317 ? -8.568  102.186 90.530  1.00 124.70 ? 317  CYS A CA  1 
ATOM   1901 C  C   . CYS A 1 317 ? -7.780  101.240 89.672  1.00 124.70 ? 317  CYS A C   1 
ATOM   1902 O  O   . CYS A 1 317 ? -7.619  101.535 88.495  1.00 124.70 ? 317  CYS A O   1 
ATOM   1903 C  CB  . CYS A 1 317 ? -9.863  102.524 89.811  1.00 124.70 ? 317  CYS A CB  1 
ATOM   1904 S  SG  . CYS A 1 317 ? -10.946 103.360 90.953  1.00 124.70 ? 317  CYS A SG  1 
ATOM   1905 N  N   . LEU A 1 318 ? -7.353  100.084 90.185  1.00 124.70 ? 318  LEU A N   1 
ATOM   1906 C  CA  . LEU A 1 318 ? -6.499  99.254  89.338  1.00 124.70 ? 318  LEU A CA  1 
ATOM   1907 C  C   . LEU A 1 318 ? -6.506  97.732  89.147  1.00 124.70 ? 318  LEU A C   1 
ATOM   1908 O  O   . LEU A 1 318 ? -7.202  96.940  89.802  1.00 124.70 ? 318  LEU A O   1 
ATOM   1909 C  CB  . LEU A 1 318 ? -5.045  99.637  89.610  1.00 124.70 ? 318  LEU A CB  1 
ATOM   1910 C  CG  . LEU A 1 318 ? -4.560  101.086 89.541  1.00 124.70 ? 318  LEU A CG  1 
ATOM   1911 C  CD1 . LEU A 1 318 ? -3.071  101.025 89.209  1.00 124.70 ? 318  LEU A CD1 1 
ATOM   1912 C  CD2 . LEU A 1 318 ? -5.259  101.901 88.466  1.00 124.70 ? 318  LEU A CD2 1 
ATOM   1913 N  N   . CYS A 1 319 ? -5.580  97.411  88.248  1.00 124.70 ? 319  CYS A N   1 
ATOM   1914 C  CA  . CYS A 1 319 ? -5.231  96.124  87.670  1.00 124.70 ? 319  CYS A CA  1 
ATOM   1915 C  C   . CYS A 1 319 ? -4.030  95.376  88.295  1.00 124.70 ? 319  CYS A C   1 
ATOM   1916 O  O   . CYS A 1 319 ? -3.030  96.004  88.696  1.00 124.70 ? 319  CYS A O   1 
ATOM   1917 C  CB  . CYS A 1 319 ? -4.951  96.451  86.226  1.00 124.70 ? 319  CYS A CB  1 
ATOM   1918 S  SG  . CYS A 1 319 ? -3.607  95.586  85.404  1.00 124.70 ? 319  CYS A SG  1 
ATOM   1919 N  N   . PRO A 1 320 ? -4.093  94.023  88.334  1.00 124.70 ? 320  PRO A N   1 
ATOM   1920 C  CA  . PRO A 1 320 ? -3.062  93.132  88.891  1.00 124.70 ? 320  PRO A CA  1 
ATOM   1921 C  C   . PRO A 1 320 ? -1.576  93.239  88.493  1.00 124.70 ? 320  PRO A C   1 
ATOM   1922 O  O   . PRO A 1 320 ? -1.175  93.980  87.578  1.00 124.70 ? 320  PRO A O   1 
ATOM   1923 C  CB  . PRO A 1 320 ? -3.638  91.751  88.616  1.00 124.70 ? 320  PRO A CB  1 
ATOM   1924 C  CG  . PRO A 1 320 ? -5.087  91.993  88.841  1.00 124.70 ? 320  PRO A CG  1 
ATOM   1925 C  CD  . PRO A 1 320 ? -5.313  93.247  88.031  1.00 124.70 ? 320  PRO A CD  1 
ATOM   1926 N  N   . ASP A 1 321 ? -0.774  92.468  89.229  1.00 124.70 ? 321  ASP A N   1 
ATOM   1927 C  CA  . ASP A 1 321 ? 0.678   92.393  89.078  1.00 124.70 ? 321  ASP A CA  1 
ATOM   1928 C  C   . ASP A 1 321 ? 1.129   90.928  88.872  1.00 124.70 ? 321  ASP A C   1 
ATOM   1929 O  O   . ASP A 1 321 ? 0.768   90.034  89.651  1.00 124.70 ? 321  ASP A O   1 
ATOM   1930 C  CB  . ASP A 1 321 ? 1.340   92.971  90.335  1.00 124.70 ? 321  ASP A CB  1 
ATOM   1931 C  CG  . ASP A 1 321 ? 2.844   93.170  90.178  1.00 124.70 ? 321  ASP A CG  1 
ATOM   1932 O  OD1 . ASP A 1 321 ? 3.523   92.303  89.575  1.00 124.70 ? 321  ASP A OD1 1 
ATOM   1933 O  OD2 . ASP A 1 321 ? 3.353   94.196  90.681  1.00 124.70 ? 321  ASP A OD2 1 
ATOM   1934 N  N   . GLY A 1 322 ? 1.936   90.707  87.831  1.00 124.70 ? 322  GLY A N   1 
ATOM   1935 C  CA  . GLY A 1 322 ? 2.418   89.374  87.487  1.00 124.70 ? 322  GLY A CA  1 
ATOM   1936 C  C   . GLY A 1 322 ? 1.727   88.894  86.207  1.00 124.70 ? 322  GLY A C   1 
ATOM   1937 O  O   . GLY A 1 322 ? 2.162   87.921  85.571  1.00 124.70 ? 322  GLY A O   1 
ATOM   1938 N  N   . PHE A 1 323 ? 0.645   89.604  85.849  1.00 124.70 ? 323  PHE A N   1 
ATOM   1939 C  CA  . PHE A 1 323 ? -0.217  89.357  84.680  1.00 124.70 ? 323  PHE A CA  1 
ATOM   1940 C  C   . PHE A 1 323 ? -0.696  90.804  84.265  1.00 124.70 ? 323  PHE A C   1 
ATOM   1941 O  O   . PHE A 1 323 ? -0.931  91.629  85.161  1.00 124.70 ? 323  PHE A O   1 
ATOM   1942 C  CB  . PHE A 1 323 ? -1.273  88.334  85.149  1.00 124.70 ? 323  PHE A CB  1 
ATOM   1943 C  CG  . PHE A 1 323 ? -0.636  87.104  85.822  1.00 124.70 ? 323  PHE A CG  1 
ATOM   1944 C  CD1 . PHE A 1 323 ? -0.413  87.068  87.210  1.00 124.70 ? 323  PHE A CD1 1 
ATOM   1945 C  CD2 . PHE A 1 323 ? -0.133  86.049  85.049  1.00 124.70 ? 323  PHE A CD2 1 
ATOM   1946 C  CE1 . PHE A 1 323 ? 0.304   86.008  87.810  1.00 124.70 ? 323  PHE A CE1 1 
ATOM   1947 C  CE2 . PHE A 1 323 ? 0.584   84.987  85.640  1.00 124.70 ? 323  PHE A CE2 1 
ATOM   1948 C  CZ  . PHE A 1 323 ? 0.803   84.971  87.023  1.00 124.70 ? 323  PHE A CZ  1 
ATOM   1949 N  N   . GLN A 1 324 ? -0.835  91.118  82.953  1.00 124.70 ? 324  GLN A N   1 
ATOM   1950 C  CA  . GLN A 1 324 ? -1.051  92.543  82.508  1.00 124.70 ? 324  GLN A CA  1 
ATOM   1951 C  C   . GLN A 1 324 ? -1.926  93.148  81.336  1.00 124.70 ? 324  GLN A C   1 
ATOM   1952 O  O   . GLN A 1 324 ? -1.924  92.606  80.227  1.00 124.70 ? 324  GLN A O   1 
ATOM   1953 C  CB  . GLN A 1 324 ? 0.360   93.111  82.283  1.00 124.70 ? 324  GLN A CB  1 
ATOM   1954 C  CG  . GLN A 1 324 ? 1.473   92.198  82.787  1.00 124.70 ? 324  GLN A CG  1 
ATOM   1955 C  CD  . GLN A 1 324 ? 1.897   92.545  84.226  1.00 124.70 ? 324  GLN A CD  1 
ATOM   1956 O  OE1 . GLN A 1 324 ? 2.266   91.677  84.999  1.00 124.70 ? 324  GLN A OE1 1 
ATOM   1957 N  NE2 . GLN A 1 324 ? 1.849   93.823  84.572  1.00 124.70 ? 324  GLN A NE2 1 
ATOM   1958 N  N   . LEU A 1 325 ? -2.587  94.309  81.591  1.00 124.70 ? 325  LEU A N   1 
ATOM   1959 C  CA  . LEU A 1 325 ? -3.406  95.112  80.600  1.00 124.70 ? 325  LEU A CA  1 
ATOM   1960 C  C   . LEU A 1 325 ? -4.381  96.233  81.174  1.00 124.70 ? 325  LEU A C   1 
ATOM   1961 O  O   . LEU A 1 325 ? -4.844  96.088  82.288  1.00 124.70 ? 325  LEU A O   1 
ATOM   1962 C  CB  . LEU A 1 325 ? -4.242  94.170  79.714  1.00 124.70 ? 325  LEU A CB  1 
ATOM   1963 C  CG  . LEU A 1 325 ? -4.272  94.586  78.237  1.00 124.70 ? 325  LEU A CG  1 
ATOM   1964 C  CD1 . LEU A 1 325 ? -2.908  94.320  77.575  1.00 124.70 ? 325  LEU A CD1 1 
ATOM   1965 C  CD2 . LEU A 1 325 ? -5.370  93.818  77.506  1.00 124.70 ? 325  LEU A CD2 1 
ATOM   1966 N  N   . VAL A 1 326 ? -4.697  97.355  80.490  1.00 124.70 ? 326  VAL A N   1 
ATOM   1967 C  CA  . VAL A 1 326 ? -5.709  98.300  81.105  1.00 124.70 ? 326  VAL A CA  1 
ATOM   1968 C  C   . VAL A 1 326 ? -6.449  99.444  80.322  1.00 124.70 ? 326  VAL A C   1 
ATOM   1969 O  O   . VAL A 1 326 ? -5.956  99.908  79.280  1.00 124.70 ? 326  VAL A O   1 
ATOM   1970 C  CB  . VAL A 1 326 ? -5.160  99.011  82.394  1.00 124.70 ? 326  VAL A CB  1 
ATOM   1971 C  CG1 . VAL A 1 326 ? -3.955  98.310  82.937  1.00 124.70 ? 326  VAL A CG1 1 
ATOM   1972 C  CG2 . VAL A 1 326 ? -4.853  100.476 82.115  1.00 124.70 ? 326  VAL A CG2 1 
ATOM   1973 N  N   . ALA A 1 327 ? -7.597  99.895  80.881  1.00 124.70 ? 327  ALA A N   1 
ATOM   1974 C  CA  . ALA A 1 327 ? -8.433  101.006 80.374  1.00 124.70 ? 327  ALA A CA  1 
ATOM   1975 C  C   . ALA A 1 327 ? -8.405  102.051 81.516  1.00 124.70 ? 327  ALA A C   1 
ATOM   1976 O  O   . ALA A 1 327 ? -9.435  102.599 81.923  1.00 124.70 ? 327  ALA A O   1 
ATOM   1977 C  CB  . ALA A 1 327 ? -9.885  100.534 80.101  1.00 124.70 ? 327  ALA A CB  1 
ATOM   1978 N  N   . GLN A 1 328 ? -7.189  102.347 81.987  1.00 124.70 ? 328  GLN A N   1 
ATOM   1979 C  CA  . GLN A 1 328 ? -6.957  103.230 83.135  1.00 124.70 ? 328  GLN A CA  1 
ATOM   1980 C  C   . GLN A 1 328 ? -7.926  102.720 84.233  1.00 124.70 ? 328  GLN A C   1 
ATOM   1981 O  O   . GLN A 1 328 ? -8.282  103.488 85.147  1.00 124.70 ? 328  GLN A O   1 
ATOM   1982 C  CB  . GLN A 1 328 ? -7.193  104.728 82.770  1.00 124.70 ? 328  GLN A CB  1 
ATOM   1983 C  CG  . GLN A 1 328 ? -8.622  105.142 82.395  1.00 124.70 ? 328  GLN A CG  1 
ATOM   1984 C  CD  . GLN A 1 328 ? -8.752  106.618 81.888  1.00 124.70 ? 328  GLN A CD  1 
ATOM   1985 O  OE1 . GLN A 1 328 ? -7.778  107.352 81.798  1.00 124.70 ? 328  GLN A OE1 1 
ATOM   1986 N  NE2 . GLN A 1 328 ? -9.968  107.026 81.561  1.00 124.70 ? 328  GLN A NE2 1 
ATOM   1987 N  N   . ARG A 1 329 ? -8.302  101.420 84.137  1.00 124.70 ? 329  ARG A N   1 
ATOM   1988 C  CA  . ARG A 1 329 ? -9.255  100.750 85.048  1.00 124.70 ? 329  ARG A CA  1 
ATOM   1989 C  C   . ARG A 1 329 ? -9.463  99.235  84.934  1.00 124.70 ? 329  ARG A C   1 
ATOM   1990 O  O   . ARG A 1 329 ? -9.911  98.747  83.906  1.00 124.70 ? 329  ARG A O   1 
ATOM   1991 C  CB  . ARG A 1 329 ? -10.670 101.303 84.886  1.00 124.70 ? 329  ARG A CB  1 
ATOM   1992 C  CG  . ARG A 1 329 ? -10.791 102.782 84.755  1.00 124.70 ? 329  ARG A CG  1 
ATOM   1993 C  CD  . ARG A 1 329 ? -11.019 103.406 86.096  1.00 124.70 ? 329  ARG A CD  1 
ATOM   1994 N  NE  . ARG A 1 329 ? -11.084 104.855 85.973  1.00 124.70 ? 329  ARG A NE  1 
ATOM   1995 C  CZ  . ARG A 1 329 ? -11.223 105.680 87.000  1.00 124.70 ? 329  ARG A CZ  1 
ATOM   1996 N  NH1 . ARG A 1 329 ? -11.316 105.190 88.229  1.00 124.70 ? 329  ARG A NH1 1 
ATOM   1997 N  NH2 . ARG A 1 329 ? -11.257 106.991 86.801  1.00 124.70 ? 329  ARG A NH2 1 
ATOM   1998 N  N   . ARG A 1 330 ? -9.101  98.481  85.969  1.00 124.70 ? 330  ARG A N   1 
ATOM   1999 C  CA  . ARG A 1 330 ? -9.424  97.018  86.051  1.00 124.70 ? 330  ARG A CA  1 
ATOM   2000 C  C   . ARG A 1 330 ? -8.984  95.877  85.113  1.00 124.70 ? 330  ARG A C   1 
ATOM   2001 O  O   . ARG A 1 330 ? -9.778  94.991  84.820  1.00 124.70 ? 330  ARG A O   1 
ATOM   2002 C  CB  . ARG A 1 330 ? -10.965 96.864  86.191  1.00 124.70 ? 330  ARG A CB  1 
ATOM   2003 C  CG  . ARG A 1 330 ? -11.720 96.603  84.917  1.00 124.70 ? 330  ARG A CG  1 
ATOM   2004 C  CD  . ARG A 1 330 ? -13.194 96.548  85.192  1.00 124.70 ? 330  ARG A CD  1 
ATOM   2005 N  NE  . ARG A 1 330 ? -13.950 96.587  83.946  1.00 124.70 ? 330  ARG A NE  1 
ATOM   2006 C  CZ  . ARG A 1 330 ? -15.270 96.723  83.888  1.00 124.70 ? 330  ARG A CZ  1 
ATOM   2007 N  NH1 . ARG A 1 330 ? -15.952 96.829  85.023  1.00 124.70 ? 330  ARG A NH1 1 
ATOM   2008 N  NH2 . ARG A 1 330 ? -15.904 96.758  82.709  1.00 124.70 ? 330  ARG A NH2 1 
ATOM   2009 N  N   . CYS A 1 331 ? -7.728  95.784  84.726  1.00 124.70 ? 331  CYS A N   1 
ATOM   2010 C  CA  . CYS A 1 331 ? -7.366  94.698  83.821  1.00 124.70 ? 331  CYS A CA  1 
ATOM   2011 C  C   . CYS A 1 331 ? -7.668  93.212  83.968  1.00 124.70 ? 331  CYS A C   1 
ATOM   2012 O  O   . CYS A 1 331 ? -8.204  92.662  84.946  1.00 124.70 ? 331  CYS A O   1 
ATOM   2013 C  CB  . CYS A 1 331 ? -5.881  94.731  83.510  1.00 124.70 ? 331  CYS A CB  1 
ATOM   2014 S  SG  . CYS A 1 331 ? -4.829  94.078  84.845  1.00 124.70 ? 331  CYS A SG  1 
ATOM   2015 N  N   . GLU A 1 332 ? -7.159  92.631  82.893  1.00 124.70 ? 332  GLU A N   1 
ATOM   2016 C  CA  . GLU A 1 332 ? -7.150  91.269  82.495  1.00 124.70 ? 332  GLU A CA  1 
ATOM   2017 C  C   . GLU A 1 332 ? -5.665  90.887  82.388  1.00 124.70 ? 332  GLU A C   1 
ATOM   2018 O  O   . GLU A 1 332 ? -4.811  91.711  82.021  1.00 124.70 ? 332  GLU A O   1 
ATOM   2019 C  CB  . GLU A 1 332 ? -7.833  91.208  81.128  1.00 124.70 ? 332  GLU A CB  1 
ATOM   2020 C  CG  . GLU A 1 332 ? -7.310  92.271  80.140  1.00 124.70 ? 332  GLU A CG  1 
ATOM   2021 C  CD  . GLU A 1 332 ? -8.299  92.571  79.018  1.00 124.70 ? 332  GLU A CD  1 
ATOM   2022 O  OE1 . GLU A 1 332 ? -8.933  91.616  78.510  1.00 124.70 ? 332  GLU A OE1 1 
ATOM   2023 O  OE2 . GLU A 1 332 ? -8.435  93.760  78.635  1.00 124.70 ? 332  GLU A OE2 1 
ATOM   2024 N  N   . ASP A 1 333 ? -5.363  89.643  82.743  1.00 124.70 ? 333  ASP A N   1 
ATOM   2025 C  CA  . ASP A 1 333 ? -4.003  89.142  82.655  1.00 124.70 ? 333  ASP A CA  1 
ATOM   2026 C  C   . ASP A 1 333 ? -3.532  89.337  81.221  1.00 124.70 ? 333  ASP A C   1 
ATOM   2027 O  O   . ASP A 1 333 ? -4.350  89.367  80.296  1.00 124.70 ? 333  ASP A O   1 
ATOM   2028 C  CB  . ASP A 1 333 ? -3.959  87.661  82.974  1.00 124.70 ? 333  ASP A CB  1 
ATOM   2029 C  CG  . ASP A 1 333 ? -3.239  86.876  81.901  1.00 124.70 ? 333  ASP A CG  1 
ATOM   2030 O  OD1 . ASP A 1 333 ? -3.726  86.881  80.745  1.00 124.70 ? 333  ASP A OD1 1 
ATOM   2031 O  OD2 . ASP A 1 333 ? -2.183  86.272  82.204  1.00 124.70 ? 333  ASP A OD2 1 
ATOM   2032 N  N   . ILE A 1 334 ? -2.218  89.443  81.032  1.00 124.70 ? 334  ILE A N   1 
ATOM   2033 C  CA  . ILE A 1 334 ? -1.671  89.650  79.699  1.00 124.70 ? 334  ILE A CA  1 
ATOM   2034 C  C   . ILE A 1 334 ? -1.709  88.413  78.818  1.00 124.70 ? 334  ILE A C   1 
ATOM   2035 O  O   . ILE A 1 334 ? -1.270  87.330  79.210  1.00 124.70 ? 334  ILE A O   1 
ATOM   2036 C  CB  . ILE A 1 334 ? -0.220  90.178  79.754  1.00 124.70 ? 334  ILE A CB  1 
ATOM   2037 C  CG1 . ILE A 1 334 ? 0.398   90.161  78.344  1.00 124.70 ? 334  ILE A CG1 1 
ATOM   2038 C  CG2 . ILE A 1 334 ? 0.587   89.362  80.755  1.00 124.70 ? 334  ILE A CG2 1 
ATOM   2039 C  CD1 . ILE A 1 334 ? -0.412  90.918  77.284  1.00 124.70 ? 334  ILE A CD1 1 
ATOM   2040 N  N   . ASP A 1 335 ? -2.260  88.601  77.622  1.00 124.70 ? 335  ASP A N   1 
ATOM   2041 C  CA  . ASP A 1 335 ? -2.372  87.549  76.618  1.00 124.70 ? 335  ASP A CA  1 
ATOM   2042 C  C   . ASP A 1 335 ? -0.928  87.370  76.098  1.00 124.70 ? 335  ASP A C   1 
ATOM   2043 O  O   . ASP A 1 335 ? -0.514  88.050  75.150  1.00 124.70 ? 335  ASP A O   1 
ATOM   2044 C  CB  . ASP A 1 335 ? -3.331  88.026  75.511  1.00 124.70 ? 335  ASP A CB  1 
ATOM   2045 C  CG  . ASP A 1 335 ? -4.503  88.868  76.067  1.00 124.70 ? 335  ASP A CG  1 
ATOM   2046 O  OD1 . ASP A 1 335 ? -5.365  88.321  76.806  1.00 124.70 ? 335  ASP A OD1 1 
ATOM   2047 O  OD2 . ASP A 1 335 ? -4.553  90.088  75.775  1.00 124.70 ? 335  ASP A OD2 1 
ATOM   2048 N  N   . GLU A 1 336 ? -0.181  86.454  76.737  1.00 124.70 ? 336  GLU A N   1 
ATOM   2049 C  CA  . GLU A 1 336 ? 1.241   86.182  76.440  1.00 124.70 ? 336  GLU A CA  1 
ATOM   2050 C  C   . GLU A 1 336 ? 1.696   84.925  75.653  1.00 124.70 ? 336  GLU A C   1 
ATOM   2051 O  O   . GLU A 1 336 ? 2.499   84.159  76.199  1.00 124.70 ? 336  GLU A O   1 
ATOM   2052 C  CB  . GLU A 1 336 ? 2.057   86.164  77.754  1.00 124.70 ? 336  GLU A CB  1 
ATOM   2053 C  CG  . GLU A 1 336 ? 1.503   86.936  78.953  1.00 124.70 ? 336  GLU A CG  1 
ATOM   2054 C  CD  . GLU A 1 336 ? 0.926   86.033  80.053  1.00 124.70 ? 336  GLU A CD  1 
ATOM   2055 O  OE1 . GLU A 1 336 ? 1.110   84.796  79.984  1.00 124.70 ? 336  GLU A OE1 1 
ATOM   2056 O  OE2 . GLU A 1 336 ? 0.295   86.567  80.995  1.00 124.70 ? 336  GLU A OE2 1 
ATOM   2057 N  N   . CYS A 1 337 ? 1.239   84.688  74.415  1.00 124.70 ? 337  CYS A N   1 
ATOM   2058 C  CA  . CYS A 1 337 ? 1.736   83.509  73.685  1.00 124.70 ? 337  CYS A CA  1 
ATOM   2059 C  C   . CYS A 1 337 ? 2.513   83.734  72.371  1.00 124.70 ? 337  CYS A C   1 
ATOM   2060 O  O   . CYS A 1 337 ? 2.354   82.983  71.406  1.00 124.70 ? 337  CYS A O   1 
ATOM   2061 C  CB  . CYS A 1 337 ? 0.645   82.478  73.423  1.00 124.70 ? 337  CYS A CB  1 
ATOM   2062 S  SG  . CYS A 1 337 ? 0.855   81.011  74.506  1.00 124.70 ? 337  CYS A SG  1 
ATOM   2063 N  N   . GLN A 1 338 ? 3.399   84.734  72.360  1.00 124.70 ? 338  GLN A N   1 
ATOM   2064 C  CA  . GLN A 1 338 ? 4.286   85.037  71.210  1.00 124.70 ? 338  GLN A CA  1 
ATOM   2065 C  C   . GLN A 1 338 ? 5.770   84.829  71.701  1.00 124.70 ? 338  GLN A C   1 
ATOM   2066 O  O   . GLN A 1 338 ? 6.234   85.570  72.624  1.00 124.70 ? 338  GLN A O   1 
ATOM   2067 C  CB  . GLN A 1 338 ? 3.993   86.463  70.742  1.00 124.70 ? 338  GLN A CB  1 
ATOM   2068 C  CG  . GLN A 1 338 ? 2.491   86.794  70.677  1.00 124.70 ? 338  GLN A CG  1 
ATOM   2069 C  CD  . GLN A 1 338 ? 1.687   85.751  69.851  1.00 124.70 ? 338  GLN A CD  1 
ATOM   2070 O  OE1 . GLN A 1 338 ? 2.209   85.141  68.918  1.00 124.70 ? 338  GLN A OE1 1 
ATOM   2071 N  NE2 . GLN A 1 338 ? 0.422   85.566  70.194  1.00 124.70 ? 338  GLN A NE2 1 
ATOM   2072 N  N   . ASP A 1 339 ? 6.458   83.803  71.121  1.00 124.70 ? 339  ASP A N   1 
ATOM   2073 C  CA  . ASP A 1 339 ? 7.826   83.302  71.542  1.00 124.70 ? 339  ASP A CA  1 
ATOM   2074 C  C   . ASP A 1 339 ? 9.138   84.010  71.756  1.00 124.70 ? 339  ASP A C   1 
ATOM   2075 O  O   . ASP A 1 339 ? 9.603   84.756  70.831  1.00 124.70 ? 339  ASP A O   1 
ATOM   2076 C  CB  . ASP A 1 339 ? 8.219   82.081  70.707  1.00 124.70 ? 339  ASP A CB  1 
ATOM   2077 C  CG  . ASP A 1 339 ? 7.022   81.477  69.917  1.00 124.70 ? 339  ASP A CG  1 
ATOM   2078 O  OD1 . ASP A 1 339 ? 6.166   80.798  70.495  1.00 124.70 ? 339  ASP A OD1 1 
ATOM   2079 O  OD2 . ASP A 1 339 ? 6.951   81.720  68.683  1.00 124.70 ? 339  ASP A OD2 1 
ATOM   2080 N  N   . PRO A 1 340 ? 9.710   83.948  73.012  1.00 124.70 ? 340  PRO A N   1 
ATOM   2081 C  CA  . PRO A 1 340 ? 9.960   83.627  74.408  1.00 124.70 ? 340  PRO A CA  1 
ATOM   2082 C  C   . PRO A 1 340 ? 9.255   84.726  75.181  1.00 124.70 ? 340  PRO A C   1 
ATOM   2083 O  O   . PRO A 1 340 ? 9.768   85.413  76.089  1.00 124.70 ? 340  PRO A O   1 
ATOM   2084 C  CB  . PRO A 1 340 ? 11.478  83.666  74.519  1.00 124.70 ? 340  PRO A CB  1 
ATOM   2085 C  CG  . PRO A 1 340 ? 11.695  82.657  73.454  1.00 124.70 ? 340  PRO A CG  1 
ATOM   2086 C  CD  . PRO A 1 340 ? 10.950  83.492  72.390  1.00 124.70 ? 340  PRO A CD  1 
ATOM   2087 N  N   . ASP A 1 341 ? 8.003   84.906  74.803  1.00 124.70 ? 341  ASP A N   1 
ATOM   2088 C  CA  . ASP A 1 341 ? 7.016   85.763  75.524  1.00 124.70 ? 341  ASP A CA  1 
ATOM   2089 C  C   . ASP A 1 341 ? 6.035   84.676  75.187  1.00 124.70 ? 341  ASP A C   1 
ATOM   2090 O  O   . ASP A 1 341 ? 4.847   84.873  75.049  1.00 124.70 ? 341  ASP A O   1 
ATOM   2091 C  CB  . ASP A 1 341 ? 6.703   87.014  74.734  1.00 124.70 ? 341  ASP A CB  1 
ATOM   2092 C  CG  . ASP A 1 341 ? 7.889   87.961  74.677  1.00 124.70 ? 341  ASP A CG  1 
ATOM   2093 O  OD1 . ASP A 1 341 ? 8.787   87.858  75.547  1.00 124.70 ? 341  ASP A OD1 1 
ATOM   2094 O  OD2 . ASP A 1 341 ? 7.934   88.813  73.764  1.00 124.70 ? 341  ASP A OD2 1 
ATOM   2095 N  N   . THR A 1 342 ? 6.652   83.538  74.914  1.00 124.70 ? 342  THR A N   1 
ATOM   2096 C  CA  . THR A 1 342 ? 6.018   82.319  74.561  1.00 124.70 ? 342  THR A CA  1 
ATOM   2097 C  C   . THR A 1 342 ? 7.163   81.423  74.797  1.00 124.70 ? 342  THR A C   1 
ATOM   2098 O  O   . THR A 1 342 ? 8.304   81.837  75.021  1.00 124.70 ? 342  THR A O   1 
ATOM   2099 C  CB  . THR A 1 342 ? 5.667   82.177  73.099  1.00 124.70 ? 342  THR A CB  1 
ATOM   2100 O  OG1 . THR A 1 342 ? 4.340   82.634  72.863  1.00 124.70 ? 342  THR A OG1 1 
ATOM   2101 C  CG2 . THR A 1 342 ? 5.741   80.724  72.698  1.00 124.70 ? 342  THR A CG2 1 
ATOM   2102 N  N   . CYS A 1 343 ? 6.819   80.174  74.634  1.00 124.70 ? 343  CYS A N   1 
ATOM   2103 C  CA  . CYS A 1 343 ? 7.682   79.101  74.875  1.00 124.70 ? 343  CYS A CA  1 
ATOM   2104 C  C   . CYS A 1 343 ? 7.937   78.223  73.711  1.00 124.70 ? 343  CYS A C   1 
ATOM   2105 O  O   . CYS A 1 343 ? 7.088   77.410  73.362  1.00 124.70 ? 343  CYS A O   1 
ATOM   2106 C  CB  . CYS A 1 343 ? 7.012   78.404  75.994  1.00 124.70 ? 343  CYS A CB  1 
ATOM   2107 S  SG  . CYS A 1 343 ? 7.797   78.775  77.421  1.00 124.70 ? 343  CYS A SG  1 
ATOM   2108 N  N   . SER A 1 344 ? 9.058   78.501  73.034  1.00 124.70 ? 344  SER A N   1 
ATOM   2109 C  CA  . SER A 1 344 ? 9.468   77.654  71.910  1.00 124.70 ? 344  SER A CA  1 
ATOM   2110 C  C   . SER A 1 344 ? 9.410   76.296  72.555  1.00 124.70 ? 344  SER A C   1 
ATOM   2111 O  O   . SER A 1 344 ? 9.754   76.139  73.731  1.00 124.70 ? 344  SER A O   1 
ATOM   2112 C  CB  . SER A 1 344 ? 10.853  78.030  71.375  1.00 124.70 ? 344  SER A CB  1 
ATOM   2113 O  OG  . SER A 1 344 ? 11.866  77.899  72.357  1.00 124.70 ? 344  SER A OG  1 
ATOM   2114 N  N   . GLN A 1 345 ? 8.748   75.423  71.809  1.00 124.70 ? 345  GLN A N   1 
ATOM   2115 C  CA  . GLN A 1 345 ? 8.397   74.109  72.223  1.00 124.70 ? 345  GLN A CA  1 
ATOM   2116 C  C   . GLN A 1 345 ? 7.153   74.352  73.166  1.00 124.70 ? 345  GLN A C   1 
ATOM   2117 O  O   . GLN A 1 345 ? 7.228   74.369  74.405  1.00 124.70 ? 345  GLN A O   1 
ATOM   2118 C  CB  . GLN A 1 345 ? 9.596   73.433  72.870  1.00 124.70 ? 345  GLN A CB  1 
ATOM   2119 C  CG  . GLN A 1 345 ? 10.860  73.458  71.978  1.00 124.70 ? 345  GLN A CG  1 
ATOM   2120 C  CD  . GLN A 1 345 ? 11.750  74.668  72.299  1.00 124.70 ? 345  GLN A CD  1 
ATOM   2121 O  OE1 . GLN A 1 345 ? 11.592  75.289  73.332  1.00 124.70 ? 345  GLN A OE1 1 
ATOM   2122 N  NE2 . GLN A 1 345 ? 12.687  74.989  71.429  1.00 124.70 ? 345  GLN A NE2 1 
ATOM   2123 N  N   . LEU A 1 346 ? 6.032   74.610  72.469  1.00 124.70 ? 346  LEU A N   1 
ATOM   2124 C  CA  . LEU A 1 346 ? 4.628   74.851  72.899  1.00 124.70 ? 346  LEU A CA  1 
ATOM   2125 C  C   . LEU A 1 346 ? 4.040   75.877  73.882  1.00 124.70 ? 346  LEU A C   1 
ATOM   2126 O  O   . LEU A 1 346 ? 3.429   75.471  74.880  1.00 124.70 ? 346  LEU A O   1 
ATOM   2127 C  CB  . LEU A 1 346 ? 3.981   73.529  73.281  1.00 124.70 ? 346  LEU A CB  1 
ATOM   2128 C  CG  . LEU A 1 346 ? 2.453   73.698  73.229  1.00 124.70 ? 346  LEU A CG  1 
ATOM   2129 C  CD1 . LEU A 1 346 ? 2.025   74.015  71.798  1.00 124.70 ? 346  LEU A CD1 1 
ATOM   2130 C  CD2 . LEU A 1 346 ? 1.750   72.442  73.734  1.00 124.70 ? 346  LEU A CD2 1 
ATOM   2131 N  N   . CYS A 1 347 ? 4.152   77.181  73.613  1.00 124.70 ? 347  CYS A N   1 
ATOM   2132 C  CA  . CYS A 1 347 ? 3.531   78.147  74.530  1.00 124.70 ? 347  CYS A CA  1 
ATOM   2133 C  C   . CYS A 1 347 ? 2.050   77.882  74.525  1.00 124.70 ? 347  CYS A C   1 
ATOM   2134 O  O   . CYS A 1 347 ? 1.511   77.272  73.602  1.00 124.70 ? 347  CYS A O   1 
ATOM   2135 C  CB  . CYS A 1 347 ? 3.696   79.612  74.087  1.00 124.70 ? 347  CYS A CB  1 
ATOM   2136 S  SG  . CYS A 1 347 ? 2.816   80.895  75.115  1.00 124.70 ? 347  CYS A SG  1 
ATOM   2137 N  N   . VAL A 1 348 ? 1.409   78.332  75.589  1.00 124.70 ? 348  VAL A N   1 
ATOM   2138 C  CA  . VAL A 1 348 ? -0.032  78.249  75.738  1.00 124.70 ? 348  VAL A CA  1 
ATOM   2139 C  C   . VAL A 1 348 ? -0.356  79.553  76.451  1.00 124.70 ? 348  VAL A C   1 
ATOM   2140 O  O   . VAL A 1 348 ? 0.367   79.954  77.374  1.00 124.70 ? 348  VAL A O   1 
ATOM   2141 C  CB  . VAL A 1 348 ? -0.488  77.019  76.572  1.00 124.70 ? 348  VAL A CB  1 
ATOM   2142 C  CG1 . VAL A 1 348 ? -0.514  75.778  75.684  1.00 124.70 ? 348  VAL A CG1 1 
ATOM   2143 C  CG2 . VAL A 1 348 ? 0.439   76.801  77.758  1.00 124.70 ? 348  VAL A CG2 1 
ATOM   2144 N  N   . ASN A 1 349 ? -1.410  80.245  76.034  1.00 124.70 ? 349  ASN A N   1 
ATOM   2145 C  CA  . ASN A 1 349 ? -1.667  81.518  76.677  1.00 124.70 ? 349  ASN A CA  1 
ATOM   2146 C  C   . ASN A 1 349 ? -3.095  81.899  76.912  1.00 124.70 ? 349  ASN A C   1 
ATOM   2147 O  O   . ASN A 1 349 ? -3.857  82.124  75.970  1.00 124.70 ? 349  ASN A O   1 
ATOM   2148 C  CB  . ASN A 1 349 ? -1.007  82.629  75.882  1.00 124.70 ? 349  ASN A CB  1 
ATOM   2149 C  CG  . ASN A 1 349 ? -1.391  84.000  76.368  1.00 124.70 ? 349  ASN A CG  1 
ATOM   2150 O  OD1 . ASN A 1 349 ? -1.258  84.317  77.556  1.00 124.70 ? 349  ASN A OD1 1 
ATOM   2151 N  ND2 . ASN A 1 349 ? -1.862  84.837  75.448  1.00 124.70 ? 349  ASN A ND2 1 
ATOM   2152 N  N   . LEU A 1 350 ? -3.454  81.978  78.182  1.00 124.70 ? 350  LEU A N   1 
ATOM   2153 C  CA  . LEU A 1 350 ? -4.792  82.388  78.540  1.00 124.70 ? 350  LEU A CA  1 
ATOM   2154 C  C   . LEU A 1 350 ? -4.621  83.600  79.470  1.00 124.70 ? 350  LEU A C   1 
ATOM   2155 O  O   . LEU A 1 350 ? -3.577  84.246  79.439  1.00 124.70 ? 350  LEU A O   1 
ATOM   2156 C  CB  . LEU A 1 350 ? -5.523  81.241  79.249  1.00 124.70 ? 350  LEU A CB  1 
ATOM   2157 C  CG  . LEU A 1 350 ? -5.778  79.970  78.425  1.00 124.70 ? 350  LEU A CG  1 
ATOM   2158 C  CD1 . LEU A 1 350 ? -6.528  78.965  79.282  1.00 124.70 ? 350  LEU A CD1 1 
ATOM   2159 C  CD2 . LEU A 1 350 ? -6.560  80.271  77.153  1.00 124.70 ? 350  LEU A CD2 1 
ATOM   2160 N  N   . GLU A 1 351 ? -5.605  83.872  80.335  1.00 124.70 ? 351  GLU A N   1 
ATOM   2161 C  CA  . GLU A 1 351 ? -5.541  85.020  81.267  1.00 124.70 ? 351  GLU A CA  1 
ATOM   2162 C  C   . GLU A 1 351 ? -5.348  84.668  82.773  1.00 124.70 ? 351  GLU A C   1 
ATOM   2163 O  O   . GLU A 1 351 ? -6.334  84.390  83.462  1.00 124.70 ? 351  GLU A O   1 
ATOM   2164 C  CB  . GLU A 1 351 ? -6.808  85.853  81.110  1.00 124.70 ? 351  GLU A CB  1 
ATOM   2165 C  CG  . GLU A 1 351 ? -6.596  87.328  81.314  1.00 124.70 ? 351  GLU A CG  1 
ATOM   2166 C  CD  . GLU A 1 351 ? -7.907  88.041  81.472  1.00 124.70 ? 351  GLU A CD  1 
ATOM   2167 O  OE1 . GLU A 1 351 ? -8.803  87.875  80.608  1.00 124.70 ? 351  GLU A OE1 1 
ATOM   2168 O  OE2 . GLU A 1 351 ? -8.047  88.761  82.475  1.00 124.70 ? 351  GLU A OE2 1 
ATOM   2169 N  N   . GLY A 1 352 ? -4.097  84.693  83.266  1.00 124.70 ? 352  GLY A N   1 
ATOM   2170 C  CA  . GLY A 1 352 ? -3.799  84.382  84.666  1.00 124.70 ? 352  GLY A CA  1 
ATOM   2171 C  C   . GLY A 1 352 ? -2.856  83.200  84.779  1.00 124.70 ? 352  GLY A C   1 
ATOM   2172 O  O   . GLY A 1 352 ? -2.013  83.105  85.679  1.00 124.70 ? 352  GLY A O   1 
ATOM   2173 N  N   . GLY A 1 353 ? -3.029  82.277  83.843  1.00 124.70 ? 353  GLY A N   1 
ATOM   2174 C  CA  . GLY A 1 353 ? -2.197  81.095  83.795  1.00 124.70 ? 353  GLY A CA  1 
ATOM   2175 C  C   . GLY A 1 353 ? -1.506  80.903  82.452  1.00 124.70 ? 353  GLY A C   1 
ATOM   2176 O  O   . GLY A 1 353 ? -2.151  80.917  81.394  1.00 124.70 ? 353  GLY A O   1 
ATOM   2177 N  N   . TYR A 1 354 ? -0.187  80.706  82.498  1.00 124.70 ? 354  TYR A N   1 
ATOM   2178 C  CA  . TYR A 1 354 ? 0.619   80.484  81.296  1.00 124.70 ? 354  TYR A CA  1 
ATOM   2179 C  C   . TYR A 1 354 ? 1.660   79.373  81.570  1.00 124.70 ? 354  TYR A C   1 
ATOM   2180 O  O   . TYR A 1 354 ? 1.999   79.135  82.731  1.00 124.70 ? 354  TYR A O   1 
ATOM   2181 C  CB  . TYR A 1 354 ? 1.310   81.798  80.913  1.00 124.70 ? 354  TYR A CB  1 
ATOM   2182 C  CG  . TYR A 1 354 ? 2.426   82.210  81.851  1.00 124.70 ? 354  TYR A CG  1 
ATOM   2183 C  CD1 . TYR A 1 354 ? 3.724   81.714  81.675  1.00 124.70 ? 354  TYR A CD1 1 
ATOM   2184 C  CD2 . TYR A 1 354 ? 2.189   83.077  82.926  1.00 124.70 ? 354  TYR A CD2 1 
ATOM   2185 C  CE1 . TYR A 1 354 ? 4.773   82.069  82.547  1.00 124.70 ? 354  TYR A CE1 1 
ATOM   2186 C  CE2 . TYR A 1 354 ? 3.232   83.443  83.813  1.00 124.70 ? 354  TYR A CE2 1 
ATOM   2187 C  CZ  . TYR A 1 354 ? 4.524   82.935  83.618  1.00 124.70 ? 354  TYR A CZ  1 
ATOM   2188 O  OH  . TYR A 1 354 ? 5.551   83.288  84.484  1.00 124.70 ? 354  TYR A OH  1 
ATOM   2189 N  N   . LYS A 1 355 ? 2.148   78.689  80.523  1.00 124.70 ? 355  LYS A N   1 
ATOM   2190 C  CA  . LYS A 1 355 ? 3.175   77.608  80.659  1.00 124.70 ? 355  LYS A CA  1 
ATOM   2191 C  C   . LYS A 1 355 ? 3.763   76.989  79.332  1.00 124.70 ? 355  LYS A C   1 
ATOM   2192 O  O   . LYS A 1 355 ? 3.048   76.797  78.356  1.00 124.70 ? 355  LYS A O   1 
ATOM   2193 C  CB  . LYS A 1 355 ? 2.624   76.474  81.556  1.00 124.70 ? 355  LYS A CB  1 
ATOM   2194 N  N   . CYS A 1 356 ? 5.056   76.646  79.334  1.00 124.70 ? 356  CYS A N   1 
ATOM   2195 C  CA  . CYS A 1 356 ? 5.799   76.065  78.181  1.00 124.70 ? 356  CYS A CA  1 
ATOM   2196 C  C   . CYS A 1 356 ? 5.796   74.543  78.175  1.00 124.70 ? 356  CYS A C   1 
ATOM   2197 O  O   . CYS A 1 356 ? 5.578   73.960  79.217  1.00 124.70 ? 356  CYS A O   1 
ATOM   2198 C  CB  . CYS A 1 356 ? 7.199   76.401  78.371  1.00 124.70 ? 356  CYS A CB  1 
ATOM   2199 S  SG  . CYS A 1 356 ? 8.236   76.843  77.084  1.00 124.70 ? 356  CYS A SG  1 
ATOM   2200 N  N   . GLN A 1 357 ? 6.131   73.868  77.074  1.00 124.70 ? 357  GLN A N   1 
ATOM   2201 C  CA  . GLN A 1 357 ? 6.045   72.393  77.116  1.00 124.70 ? 357  GLN A CA  1 
ATOM   2202 C  C   . GLN A 1 357 ? 6.650   71.651  75.928  1.00 124.70 ? 357  GLN A C   1 
ATOM   2203 O  O   . GLN A 1 357 ? 6.922   72.243  74.898  1.00 124.70 ? 357  GLN A O   1 
ATOM   2204 C  CB  . GLN A 1 357 ? 4.576   71.976  77.225  1.00 124.70 ? 357  GLN A CB  1 
ATOM   2205 C  CG  . GLN A 1 357 ? 3.837   72.452  78.470  1.00 124.70 ? 357  GLN A CG  1 
ATOM   2206 C  CD  . GLN A 1 357 ? 2.390   71.980  78.518  1.00 124.70 ? 357  GLN A CD  1 
ATOM   2207 O  OE1 . GLN A 1 357 ? 1.986   71.160  77.719  1.00 124.70 ? 357  GLN A OE1 1 
ATOM   2208 N  NE2 . GLN A 1 357 ? 1.611   72.488  79.462  1.00 124.70 ? 357  GLN A NE2 1 
ATOM   2209 N  N   . CYS A 1 358 ? 6.809   70.337  76.070  1.00 124.70 ? 358  CYS A N   1 
ATOM   2210 C  CA  . CYS A 1 358 ? 7.396   69.505  75.023  1.00 124.70 ? 358  CYS A CA  1 
ATOM   2211 C  C   . CYS A 1 358 ? 6.350   68.610  74.365  1.00 124.70 ? 358  CYS A C   1 
ATOM   2212 O  O   . CYS A 1 358 ? 5.492   68.020  75.050  1.00 124.70 ? 358  CYS A O   1 
ATOM   2213 C  CB  . CYS A 1 358 ? 8.520   68.668  75.624  1.00 124.70 ? 358  CYS A CB  1 
ATOM   2214 S  SG  . CYS A 1 358 ? 9.725   69.708  76.517  1.00 124.70 ? 358  CYS A SG  1 
ATOM   2215 N  N   . GLU A 1 359 ? 6.419   68.516  73.035  1.00 124.70 ? 359  GLU A N   1 
ATOM   2216 C  CA  . GLU A 1 359 ? 5.465   67.712  72.282  1.00 124.70 ? 359  GLU A CA  1 
ATOM   2217 C  C   . GLU A 1 359 ? 5.908   66.350  71.743  1.00 124.70 ? 359  GLU A C   1 
ATOM   2218 O  O   . GLU A 1 359 ? 6.857   66.218  70.961  1.00 124.70 ? 359  GLU A O   1 
ATOM   2219 C  CB  . GLU A 1 359 ? 4.856   68.536  71.148  1.00 124.70 ? 359  GLU A CB  1 
ATOM   2220 C  CG  . GLU A 1 359 ? 3.338   68.531  71.243  1.00 124.70 ? 359  GLU A CG  1 
ATOM   2221 C  CD  . GLU A 1 359 ? 2.648   68.824  69.933  1.00 124.70 ? 359  GLU A CD  1 
ATOM   2222 O  OE1 . GLU A 1 359 ? 2.864   68.054  68.964  1.00 124.70 ? 359  GLU A OE1 1 
ATOM   2223 O  OE2 . GLU A 1 359 ? 1.885   69.819  69.881  1.00 124.70 ? 359  GLU A OE2 1 
ATOM   2224 N  N   . GLU A 1 360 ? 5.164   65.352  72.219  1.00 124.70 ? 360  GLU A N   1 
ATOM   2225 C  CA  . GLU A 1 360 ? 5.266   63.928  71.902  1.00 124.70 ? 360  GLU A CA  1 
ATOM   2226 C  C   . GLU A 1 360 ? 6.595   63.179  72.128  1.00 124.70 ? 360  GLU A C   1 
ATOM   2227 O  O   . GLU A 1 360 ? 7.245   62.755  71.173  1.00 124.70 ? 360  GLU A O   1 
ATOM   2228 C  CB  . GLU A 1 360 ? 4.757   63.711  70.465  1.00 124.70 ? 360  GLU A CB  1 
ATOM   2229 C  CG  . GLU A 1 360 ? 4.225   62.313  70.174  1.00 124.70 ? 360  GLU A CG  1 
ATOM   2230 C  CD  . GLU A 1 360 ? 3.444   61.717  71.334  1.00 124.70 ? 360  GLU A CD  1 
ATOM   2231 O  OE1 . GLU A 1 360 ? 2.920   62.476  72.181  1.00 124.70 ? 360  GLU A OE1 1 
ATOM   2232 O  OE2 . GLU A 1 360 ? 3.348   60.474  71.393  1.00 124.70 ? 360  GLU A OE2 1 
ATOM   2233 N  N   . GLY A 1 361 ? 6.970   62.960  73.387  1.00 124.70 ? 361  GLY A N   1 
ATOM   2234 C  CA  . GLY A 1 361 ? 8.222   62.265  73.650  1.00 124.70 ? 361  GLY A CA  1 
ATOM   2235 C  C   . GLY A 1 361 ? 9.270   63.348  73.699  1.00 124.70 ? 361  GLY A C   1 
ATOM   2236 O  O   . GLY A 1 361 ? 10.324  63.289  73.056  1.00 124.70 ? 361  GLY A O   1 
ATOM   2237 N  N   . PHE A 1 362 ? 8.931   64.361  74.488  1.00 124.70 ? 362  PHE A N   1 
ATOM   2238 C  CA  . PHE A 1 362 ? 9.744   65.548  74.690  1.00 124.70 ? 362  PHE A CA  1 
ATOM   2239 C  C   . PHE A 1 362 ? 9.542   66.012  76.127  1.00 124.70 ? 362  PHE A C   1 
ATOM   2240 O  O   . PHE A 1 362 ? 8.456   65.840  76.661  1.00 124.70 ? 362  PHE A O   1 
ATOM   2241 C  CB  . PHE A 1 362 ? 9.250   66.647  73.743  1.00 124.70 ? 362  PHE A CB  1 
ATOM   2242 C  CG  . PHE A 1 362 ? 10.189  66.960  72.639  1.00 124.70 ? 362  PHE A CG  1 
ATOM   2243 C  CD1 . PHE A 1 362 ? 10.489  66.003  71.681  1.00 124.70 ? 362  PHE A CD1 1 
ATOM   2244 C  CD2 . PHE A 1 362 ? 10.851  68.182  72.600  1.00 124.70 ? 362  PHE A CD2 1 
ATOM   2245 C  CE1 . PHE A 1 362 ? 11.443  66.259  70.716  1.00 124.70 ? 362  PHE A CE1 1 
ATOM   2246 C  CE2 . PHE A 1 362 ? 11.807  68.438  71.626  1.00 124.70 ? 362  PHE A CE2 1 
ATOM   2247 C  CZ  . PHE A 1 362 ? 12.103  67.472  70.685  1.00 124.70 ? 362  PHE A CZ  1 
ATOM   2248 N  N   . GLN A 1 363 ? 10.553  66.616  76.748  1.00 124.70 ? 363  GLN A N   1 
ATOM   2249 C  CA  . GLN A 1 363 ? 10.388  67.118  78.117  1.00 124.70 ? 363  GLN A CA  1 
ATOM   2250 C  C   . GLN A 1 363 ? 11.298  68.299  78.448  1.00 124.70 ? 363  GLN A C   1 
ATOM   2251 O  O   . GLN A 1 363 ? 12.163  68.639  77.647  1.00 124.70 ? 363  GLN A O   1 
ATOM   2252 C  CB  . GLN A 1 363 ? 10.633  66.005  79.133  1.00 124.70 ? 363  GLN A CB  1 
ATOM   2253 C  CG  . GLN A 1 363 ? 9.537   64.946  79.192  1.00 124.70 ? 363  GLN A CG  1 
ATOM   2254 C  CD  . GLN A 1 363 ? 8.116   65.522  79.093  1.00 124.70 ? 363  GLN A CD  1 
ATOM   2255 O  OE1 . GLN A 1 363 ? 7.896   66.742  79.209  1.00 124.70 ? 363  GLN A OE1 1 
ATOM   2256 N  NE2 . GLN A 1 363 ? 7.143   64.634  78.872  1.00 124.70 ? 363  GLN A NE2 1 
ATOM   2257 N  N   . LEU A 1 364 ? 11.090  68.926  79.613  1.00 124.70 ? 364  LEU A N   1 
ATOM   2258 C  CA  . LEU A 1 364 ? 11.919  70.061  80.068  1.00 124.70 ? 364  LEU A CA  1 
ATOM   2259 C  C   . LEU A 1 364 ? 13.109  69.520  80.915  1.00 124.70 ? 364  LEU A C   1 
ATOM   2260 O  O   . LEU A 1 364 ? 13.003  68.418  81.476  1.00 124.70 ? 364  LEU A O   1 
ATOM   2261 C  CB  . LEU A 1 364 ? 11.084  71.029  80.915  1.00 124.70 ? 364  LEU A CB  1 
ATOM   2262 C  CG  . LEU A 1 364 ? 11.903  72.214  81.436  1.00 124.70 ? 364  LEU A CG  1 
ATOM   2263 C  CD1 . LEU A 1 364 ? 11.994  73.278  80.352  1.00 124.70 ? 364  LEU A CD1 1 
ATOM   2264 C  CD2 . LEU A 1 364 ? 11.262  72.777  82.685  1.00 124.70 ? 364  LEU A CD2 1 
ATOM   2265 N  N   . ASP A 1 365 ? 14.223  70.266  81.030  1.00 124.70 ? 365  ASP A N   1 
ATOM   2266 C  CA  . ASP A 1 365 ? 15.389  69.774  81.808  1.00 124.70 ? 365  ASP A CA  1 
ATOM   2267 C  C   . ASP A 1 365 ? 16.191  70.715  82.729  1.00 124.70 ? 365  ASP A C   1 
ATOM   2268 O  O   . ASP A 1 365 ? 17.176  71.335  82.330  1.00 124.70 ? 365  ASP A O   1 
ATOM   2269 C  CB  . ASP A 1 365 ? 16.308  69.019  80.895  1.00 124.70 ? 365  ASP A CB  1 
ATOM   2270 C  CG  . ASP A 1 365 ? 16.148  67.542  81.096  1.00 124.70 ? 365  ASP A CG  1 
ATOM   2271 O  OD1 . ASP A 1 365 ? 16.484  67.120  82.220  1.00 124.70 ? 365  ASP A OD1 1 
ATOM   2272 O  OD2 . ASP A 1 365 ? 15.670  66.821  80.194  1.00 124.70 ? 365  ASP A OD2 1 
ATOM   2273 N  N   . PRO A 1 366 ? 15.736  70.812  84.001  1.00 124.70 ? 366  PRO A N   1 
ATOM   2274 C  CA  . PRO A 1 366 ? 16.065  71.526  85.250  1.00 124.70 ? 366  PRO A CA  1 
ATOM   2275 C  C   . PRO A 1 366 ? 17.404  72.133  85.652  1.00 124.70 ? 366  PRO A C   1 
ATOM   2276 O  O   . PRO A 1 366 ? 17.783  72.154  86.833  1.00 124.70 ? 366  PRO A O   1 
ATOM   2277 C  CB  . PRO A 1 366 ? 15.464  70.620  86.314  1.00 124.70 ? 366  PRO A CB  1 
ATOM   2278 C  CG  . PRO A 1 366 ? 14.183  70.298  85.660  1.00 124.70 ? 366  PRO A CG  1 
ATOM   2279 C  CD  . PRO A 1 366 ? 14.508  70.025  84.212  1.00 124.70 ? 366  PRO A CD  1 
ATOM   2280 N  N   . HIS A 1 367 ? 18.122  72.540  84.621  1.00 124.70 ? 367  HIS A N   1 
ATOM   2281 C  CA  . HIS A 1 367 ? 19.366  73.257  84.689  1.00 124.70 ? 367  HIS A CA  1 
ATOM   2282 C  C   . HIS A 1 367 ? 19.142  73.943  83.321  1.00 124.70 ? 367  HIS A C   1 
ATOM   2283 O  O   . HIS A 1 367 ? 20.084  74.311  82.608  1.00 124.70 ? 367  HIS A O   1 
ATOM   2284 C  CB  . HIS A 1 367 ? 20.592  72.311  84.752  1.00 124.70 ? 367  HIS A CB  1 
ATOM   2285 C  CG  . HIS A 1 367 ? 21.224  72.185  86.129  1.00 124.70 ? 367  HIS A CG  1 
ATOM   2286 N  ND1 . HIS A 1 367 ? 22.419  71.530  86.330  1.00 124.70 ? 367  HIS A ND1 1 
ATOM   2287 C  CD2 . HIS A 1 367 ? 20.783  72.547  87.364  1.00 124.70 ? 367  HIS A CD2 1 
ATOM   2288 C  CE1 . HIS A 1 367 ? 22.688  71.480  87.630  1.00 124.70 ? 367  HIS A CE1 1 
ATOM   2289 N  NE2 . HIS A 1 367 ? 21.712  72.087  88.277  1.00 124.70 ? 367  HIS A NE2 1 
ATOM   2290 N  N   . THR A 1 368 ? 17.840  74.102  83.010  1.00 124.70 ? 368  THR A N   1 
ATOM   2291 C  CA  . THR A 1 368 ? 17.322  74.755  81.801  1.00 124.70 ? 368  THR A CA  1 
ATOM   2292 C  C   . THR A 1 368 ? 15.815  74.962  81.679  1.00 124.70 ? 368  THR A C   1 
ATOM   2293 O  O   . THR A 1 368 ? 15.035  74.791  82.620  1.00 124.70 ? 368  THR A O   1 
ATOM   2294 C  CB  . THR A 1 368 ? 17.688  74.015  80.475  1.00 124.70 ? 368  THR A CB  1 
ATOM   2295 O  OG1 . THR A 1 368 ? 16.991  72.765  80.407  1.00 124.70 ? 368  THR A OG1 1 
ATOM   2296 C  CG2 . THR A 1 368 ? 19.178  73.759  80.360  1.00 124.70 ? 368  THR A CG2 1 
ATOM   2297 N  N   . LYS A 1 369 ? 15.465  75.285  80.430  1.00 124.70 ? 369  LYS A N   1 
ATOM   2298 C  CA  . LYS A 1 369 ? 14.117  75.533  79.909  1.00 124.70 ? 369  LYS A CA  1 
ATOM   2299 C  C   . LYS A 1 369 ? 14.109  74.991  78.467  1.00 124.70 ? 369  LYS A C   1 
ATOM   2300 O  O   . LYS A 1 369 ? 13.373  75.480  77.593  1.00 124.70 ? 369  LYS A O   1 
ATOM   2301 C  CB  . LYS A 1 369 ? 13.816  77.019  79.904  1.00 124.70 ? 369  LYS A CB  1 
ATOM   2302 N  N   . ALA A 1 370 ? 14.941  73.974  78.239  1.00 124.70 ? 370  ALA A N   1 
ATOM   2303 C  CA  . ALA A 1 370 ? 15.073  73.344  76.933  1.00 124.70 ? 370  ALA A CA  1 
ATOM   2304 C  C   . ALA A 1 370 ? 14.013  72.284  76.706  1.00 124.70 ? 370  ALA A C   1 
ATOM   2305 O  O   . ALA A 1 370 ? 13.867  71.380  77.533  1.00 124.70 ? 370  ALA A O   1 
ATOM   2306 C  CB  . ALA A 1 370 ? 16.467  72.699  76.807  1.00 124.70 ? 370  ALA A CB  1 
ATOM   2307 N  N   . CYS A 1 371 ? 13.231  72.378  75.632  1.00 124.70 ? 371  CYS A N   1 
ATOM   2308 C  CA  . CYS A 1 371 ? 12.337  71.258  75.436  1.00 124.70 ? 371  CYS A CA  1 
ATOM   2309 C  C   . CYS A 1 371 ? 13.318  70.254  74.840  1.00 124.70 ? 371  CYS A C   1 
ATOM   2310 O  O   . CYS A 1 371 ? 13.356  69.971  73.634  1.00 124.70 ? 371  CYS A O   1 
ATOM   2311 C  CB  . CYS A 1 371 ? 11.128  71.552  74.540  1.00 124.70 ? 371  CYS A CB  1 
ATOM   2312 S  SG  . CYS A 1 371 ? 9.651   71.541  75.635  1.00 124.70 ? 371  CYS A SG  1 
ATOM   2313 N  N   . LYS A 1 372 ? 14.182  69.810  75.752  1.00 124.70 ? 372  LYS A N   1 
ATOM   2314 C  CA  . LYS A 1 372 ? 15.219  68.839  75.510  1.00 124.70 ? 372  LYS A CA  1 
ATOM   2315 C  C   . LYS A 1 372 ? 14.488  67.511  75.594  1.00 124.70 ? 372  LYS A C   1 
ATOM   2316 O  O   . LYS A 1 372 ? 14.035  67.089  76.666  1.00 124.70 ? 372  LYS A O   1 
ATOM   2317 C  CB  . LYS A 1 372 ? 16.296  68.936  76.599  1.00 124.70 ? 372  LYS A CB  1 
ATOM   2318 N  N   . ALA A 1 373 ? 14.340  66.869  74.443  1.00 124.70 ? 373  ALA A N   1 
ATOM   2319 C  CA  . ALA A 1 373 ? 13.663  65.591  74.397  1.00 124.70 ? 373  ALA A CA  1 
ATOM   2320 C  C   . ALA A 1 373 ? 14.561  64.448  74.072  1.00 124.70 ? 373  ALA A C   1 
ATOM   2321 O  O   . ALA A 1 373 ? 15.622  64.579  73.451  1.00 124.70 ? 373  ALA A O   1 
ATOM   2322 C  CB  . ALA A 1 373 ? 12.608  65.612  73.427  1.00 124.70 ? 373  ALA A CB  1 
ATOM   2323 N  N   . VAL A 1 374 ? 14.099  63.297  74.503  1.00 124.70 ? 374  VAL A N   1 
ATOM   2324 C  CA  . VAL A 1 374 ? 14.837  62.108  74.253  1.00 124.70 ? 374  VAL A CA  1 
ATOM   2325 C  C   . VAL A 1 374 ? 13.845  61.008  74.124  1.00 124.70 ? 374  VAL A C   1 
ATOM   2326 O  O   . VAL A 1 374 ? 12.634  61.192  74.313  1.00 124.70 ? 374  VAL A O   1 
ATOM   2327 C  CB  . VAL A 1 374 ? 15.851  61.768  75.376  1.00 124.70 ? 374  VAL A CB  1 
ATOM   2328 C  CG1 . VAL A 1 374 ? 15.130  61.261  76.629  1.00 124.70 ? 374  VAL A CG1 1 
ATOM   2329 C  CG2 . VAL A 1 374 ? 16.869  60.733  74.851  1.00 124.70 ? 374  VAL A CG2 1 
ATOM   2330 N  N   . GLY A 1 375 ? 14.421  59.854  73.837  1.00 124.70 ? 375  GLY A N   1 
ATOM   2331 C  CA  . GLY A 1 375 ? 13.706  58.631  73.577  1.00 124.70 ? 375  GLY A CA  1 
ATOM   2332 C  C   . GLY A 1 375 ? 14.489  58.372  72.313  1.00 124.70 ? 375  GLY A C   1 
ATOM   2333 O  O   . GLY A 1 375 ? 14.739  57.231  71.898  1.00 124.70 ? 375  GLY A O   1 
ATOM   2334 N  N   . SER A 1 376 ? 14.906  59.495  71.721  1.00 124.70 ? 376  SER A N   1 
ATOM   2335 C  CA  . SER A 1 376 ? 15.701  59.465  70.519  1.00 124.70 ? 376  SER A CA  1 
ATOM   2336 C  C   . SER A 1 376 ? 16.909  60.386  70.477  1.00 124.70 ? 376  SER A C   1 
ATOM   2337 O  O   . SER A 1 376 ? 16.823  61.585  70.186  1.00 124.70 ? 376  SER A O   1 
ATOM   2338 C  CB  . SER A 1 376 ? 14.833  59.680  69.297  1.00 124.70 ? 376  SER A CB  1 
ATOM   2339 O  OG  . SER A 1 376 ? 14.831  58.474  68.557  1.00 124.70 ? 376  SER A OG  1 
ATOM   2340 N  N   . ILE A 1 377 ? 18.035  59.737  70.769  1.00 124.70 ? 377  ILE A N   1 
ATOM   2341 C  CA  . ILE A 1 377 ? 19.397  60.263  70.808  1.00 124.70 ? 377  ILE A CA  1 
ATOM   2342 C  C   . ILE A 1 377 ? 19.789  60.873  69.450  1.00 124.70 ? 377  ILE A C   1 
ATOM   2343 O  O   . ILE A 1 377 ? 19.783  60.177  68.435  1.00 124.70 ? 377  ILE A O   1 
ATOM   2344 C  CB  . ILE A 1 377 ? 20.333  59.095  71.159  1.00 124.70 ? 377  ILE A CB  1 
ATOM   2345 C  CG1 . ILE A 1 377 ? 20.107  57.941  70.163  1.00 124.70 ? 377  ILE A CG1 1 
ATOM   2346 C  CG2 . ILE A 1 377 ? 20.013  58.590  72.581  1.00 124.70 ? 377  ILE A CG2 1 
ATOM   2347 C  CD1 . ILE A 1 377 ? 20.970  56.712  70.400  1.00 124.70 ? 377  ILE A CD1 1 
ATOM   2348 N  N   . ALA A 1 378 ? 20.167  62.157  69.459  1.00 124.70 ? 378  ALA A N   1 
ATOM   2349 C  CA  . ALA A 1 378 ? 20.511  62.959  68.253  1.00 124.70 ? 378  ALA A CA  1 
ATOM   2350 C  C   . ALA A 1 378 ? 21.980  63.058  67.724  1.00 124.70 ? 378  ALA A C   1 
ATOM   2351 O  O   . ALA A 1 378 ? 22.912  63.061  68.519  1.00 124.70 ? 378  ALA A O   1 
ATOM   2352 C  CB  . ALA A 1 378 ? 19.954  64.373  68.466  1.00 124.70 ? 378  ALA A CB  1 
ATOM   2353 N  N   . TYR A 1 379 ? 22.156  63.162  66.388  1.00 124.70 ? 379  TYR A N   1 
ATOM   2354 C  CA  . TYR A 1 379 ? 23.477  63.274  65.680  1.00 124.70 ? 379  TYR A CA  1 
ATOM   2355 C  C   . TYR A 1 379 ? 23.521  64.485  64.708  1.00 124.70 ? 379  TYR A C   1 
ATOM   2356 O  O   . TYR A 1 379 ? 22.501  65.122  64.493  1.00 124.70 ? 379  TYR A O   1 
ATOM   2357 C  CB  . TYR A 1 379 ? 23.779  62.037  64.825  1.00 124.70 ? 379  TYR A CB  1 
ATOM   2358 C  CG  . TYR A 1 379 ? 23.667  60.700  65.508  1.00 124.70 ? 379  TYR A CG  1 
ATOM   2359 C  CD1 . TYR A 1 379 ? 24.802  60.015  65.946  1.00 124.70 ? 379  TYR A CD1 1 
ATOM   2360 C  CD2 . TYR A 1 379 ? 22.426  60.086  65.658  1.00 124.70 ? 379  TYR A CD2 1 
ATOM   2361 C  CE1 . TYR A 1 379 ? 24.698  58.742  66.508  1.00 124.70 ? 379  TYR A CE1 1 
ATOM   2362 C  CE2 . TYR A 1 379 ? 22.307  58.820  66.219  1.00 124.70 ? 379  TYR A CE2 1 
ATOM   2363 C  CZ  . TYR A 1 379 ? 23.447  58.150  66.638  1.00 124.70 ? 379  TYR A CZ  1 
ATOM   2364 O  OH  . TYR A 1 379 ? 23.345  56.877  67.159  1.00 124.70 ? 379  TYR A OH  1 
ATOM   2365 N  N   . LEU A 1 380 ? 24.674  64.771  64.085  1.00 124.70 ? 380  LEU A N   1 
ATOM   2366 C  CA  . LEU A 1 380 ? 24.795  65.926  63.173  1.00 124.70 ? 380  LEU A CA  1 
ATOM   2367 C  C   . LEU A 1 380 ? 25.547  65.627  61.870  1.00 124.70 ? 380  LEU A C   1 
ATOM   2368 O  O   . LEU A 1 380 ? 26.295  64.651  61.799  1.00 124.70 ? 380  LEU A O   1 
ATOM   2369 C  CB  . LEU A 1 380 ? 25.502  67.077  63.886  1.00 124.70 ? 380  LEU A CB  1 
ATOM   2370 C  CG  . LEU A 1 380 ? 25.491  68.417  63.155  1.00 124.70 ? 380  LEU A CG  1 
ATOM   2371 C  CD1 . LEU A 1 380 ? 24.079  68.976  63.187  1.00 124.70 ? 380  LEU A CD1 1 
ATOM   2372 C  CD2 . LEU A 1 380 ? 26.480  69.390  63.793  1.00 124.70 ? 380  LEU A CD2 1 
ATOM   2373 N  N   . PHE A 1 381 ? 25.384  66.498  60.860  1.00 124.70 ? 381  PHE A N   1 
ATOM   2374 C  CA  . PHE A 1 381 ? 26.022  66.327  59.524  1.00 124.70 ? 381  PHE A CA  1 
ATOM   2375 C  C   . PHE A 1 381 ? 26.526  67.548  58.746  1.00 124.70 ? 381  PHE A C   1 
ATOM   2376 O  O   . PHE A 1 381 ? 26.198  68.674  59.069  1.00 124.70 ? 381  PHE A O   1 
ATOM   2377 C  CB  . PHE A 1 381 ? 25.062  65.610  58.602  1.00 124.70 ? 381  PHE A CB  1 
ATOM   2378 C  CG  . PHE A 1 381 ? 24.803  64.231  59.018  1.00 124.70 ? 381  PHE A CG  1 
ATOM   2379 C  CD1 . PHE A 1 381 ? 25.850  63.321  59.094  1.00 124.70 ? 381  PHE A CD1 1 
ATOM   2380 C  CD2 . PHE A 1 381 ? 23.530  63.837  59.369  1.00 124.70 ? 381  PHE A CD2 1 
ATOM   2381 C  CE1 . PHE A 1 381 ? 25.633  62.036  59.514  1.00 124.70 ? 381  PHE A CE1 1 
ATOM   2382 C  CE2 . PHE A 1 381 ? 23.293  62.554  59.791  1.00 124.70 ? 381  PHE A CE2 1 
ATOM   2383 C  CZ  . PHE A 1 381 ? 24.353  61.642  59.865  1.00 124.70 ? 381  PHE A CZ  1 
ATOM   2384 N  N   . PHE A 1 382 ? 27.317  67.307  57.702  1.00 124.70 ? 382  PHE A N   1 
ATOM   2385 C  CA  . PHE A 1 382 ? 27.821  68.394  56.863  1.00 124.70 ? 382  PHE A CA  1 
ATOM   2386 C  C   . PHE A 1 382 ? 28.733  67.895  55.742  1.00 124.70 ? 382  PHE A C   1 
ATOM   2387 O  O   . PHE A 1 382 ? 29.169  66.738  55.762  1.00 124.70 ? 382  PHE A O   1 
ATOM   2388 C  CB  . PHE A 1 382 ? 28.565  69.422  57.719  1.00 124.70 ? 382  PHE A CB  1 
ATOM   2389 C  CG  . PHE A 1 382 ? 29.778  68.877  58.434  1.00 124.70 ? 382  PHE A CG  1 
ATOM   2390 C  CD1 . PHE A 1 382 ? 31.048  68.986  57.862  1.00 124.70 ? 382  PHE A CD1 1 
ATOM   2391 C  CD2 . PHE A 1 382 ? 29.659  68.306  59.698  1.00 124.70 ? 382  PHE A CD2 1 
ATOM   2392 C  CE1 . PHE A 1 382 ? 32.192  68.541  58.543  1.00 124.70 ? 382  PHE A CE1 1 
ATOM   2393 C  CE2 . PHE A 1 382 ? 30.790  67.855  60.394  1.00 124.70 ? 382  PHE A CE2 1 
ATOM   2394 C  CZ  . PHE A 1 382 ? 32.065  67.973  59.814  1.00 124.70 ? 382  PHE A CZ  1 
ATOM   2395 N  N   . THR A 1 383 ? 29.048  68.763  54.776  1.00 124.70 ? 383  THR A N   1 
ATOM   2396 C  CA  . THR A 1 383 ? 29.932  68.343  53.679  1.00 124.70 ? 383  THR A CA  1 
ATOM   2397 C  C   . THR A 1 383 ? 31.133  69.214  53.294  1.00 124.70 ? 383  THR A C   1 
ATOM   2398 O  O   . THR A 1 383 ? 31.016  70.432  53.116  1.00 124.70 ? 383  THR A O   1 
ATOM   2399 C  CB  . THR A 1 383 ? 29.189  68.164  52.339  1.00 124.70 ? 383  THR A CB  1 
ATOM   2400 O  OG1 . THR A 1 383 ? 29.072  69.441  51.688  1.00 124.70 ? 383  THR A OG1 1 
ATOM   2401 C  CG2 . THR A 1 383 ? 27.827  67.561  52.546  1.00 124.70 ? 383  THR A CG2 1 
ATOM   2402 N  N   . ASN A 1 384 ? 32.283  68.558  53.144  1.00 124.70 ? 384  ASN A N   1 
ATOM   2403 C  CA  . ASN A 1 384 ? 33.485  69.221  52.669  1.00 124.70 ? 384  ASN A CA  1 
ATOM   2404 C  C   . ASN A 1 384 ? 33.755  68.483  51.355  1.00 124.70 ? 384  ASN A C   1 
ATOM   2405 O  O   . ASN A 1 384 ? 33.163  67.430  51.107  1.00 124.70 ? 384  ASN A O   1 
ATOM   2406 C  CB  . ASN A 1 384 ? 34.648  69.112  53.680  1.00 124.70 ? 384  ASN A CB  1 
ATOM   2407 C  CG  . ASN A 1 384 ? 35.432  67.808  53.591  1.00 124.70 ? 384  ASN A CG  1 
ATOM   2408 O  OD1 . ASN A 1 384 ? 35.530  67.191  52.527  1.00 124.70 ? 384  ASN A OD1 1 
ATOM   2409 N  ND2 . ASN A 1 384 ? 36.041  67.405  54.718  1.00 124.70 ? 384  ASN A ND2 1 
ATOM   2410 N  N   . ARG A 1 385 ? 34.617  69.030  50.508  1.00 124.70 ? 385  ARG A N   1 
ATOM   2411 C  CA  . ARG A 1 385 ? 34.918  68.435  49.205  1.00 124.70 ? 385  ARG A CA  1 
ATOM   2412 C  C   . ARG A 1 385 ? 35.213  66.944  49.197  1.00 124.70 ? 385  ARG A C   1 
ATOM   2413 O  O   . ARG A 1 385 ? 36.377  66.547  49.312  1.00 124.70 ? 385  ARG A O   1 
ATOM   2414 C  CB  . ARG A 1 385 ? 36.064  69.158  48.607  1.00 124.70 ? 385  ARG A CB  1 
ATOM   2415 N  N   . HIS A 1 386 ? 34.171  66.134  49.020  1.00 124.70 ? 386  HIS A N   1 
ATOM   2416 C  CA  . HIS A 1 386 ? 34.310  64.688  48.991  1.00 124.70 ? 386  HIS A CA  1 
ATOM   2417 C  C   . HIS A 1 386 ? 34.808  64.163  50.317  1.00 124.70 ? 386  HIS A C   1 
ATOM   2418 O  O   . HIS A 1 386 ? 35.907  63.563  50.432  1.00 124.70 ? 386  HIS A O   1 
ATOM   2419 C  CB  . HIS A 1 386 ? 35.224  64.271  47.882  1.00 124.70 ? 386  HIS A CB  1 
ATOM   2420 N  N   . GLU A 1 387 ? 33.901  64.413  51.272  1.00 124.70 ? 387  GLU A N   1 
ATOM   2421 C  CA  . GLU A 1 387 ? 33.875  64.060  52.700  1.00 124.70 ? 387  GLU A CA  1 
ATOM   2422 C  C   . GLU A 1 387 ? 32.375  64.121  53.074  1.00 124.70 ? 387  GLU A C   1 
ATOM   2423 O  O   . GLU A 1 387 ? 31.920  65.014  53.826  1.00 124.70 ? 387  GLU A O   1 
ATOM   2424 C  CB  . GLU A 1 387 ? 34.642  65.053  53.564  1.00 124.70 ? 387  GLU A CB  1 
ATOM   2425 C  CG  . GLU A 1 387 ? 34.698  64.660  55.030  1.00 124.70 ? 387  GLU A CG  1 
ATOM   2426 C  CD  . GLU A 1 387 ? 35.530  63.410  55.282  1.00 124.70 ? 387  GLU A CD  1 
ATOM   2427 O  OE1 . GLU A 1 387 ? 36.128  62.893  54.317  1.00 124.70 ? 387  GLU A OE1 1 
ATOM   2428 O  OE2 . GLU A 1 387 ? 35.594  62.949  56.448  1.00 124.70 ? 387  GLU A OE2 1 
ATOM   2429 N  N   . ARG A 1 389 ? 31.054  64.182  57.213  1.00 124.70 ? 389  ARG A N   1 
ATOM   2430 C  CA  . ARG A 1 389 ? 31.331  63.243  58.332  1.00 124.70 ? 389  ARG A CA  1 
ATOM   2431 C  C   . ARG A 1 389 ? 30.316  63.410  59.452  1.00 124.70 ? 389  ARG A C   1 
ATOM   2432 O  O   . ARG A 1 389 ? 29.766  64.478  59.645  1.00 124.70 ? 389  ARG A O   1 
ATOM   2433 C  CB  . ARG A 1 389 ? 32.721  63.491  58.912  1.00 124.70 ? 389  ARG A CB  1 
ATOM   2434 C  CG  . ARG A 1 389 ? 33.491  64.650  58.312  1.00 124.70 ? 389  ARG A CG  1 
ATOM   2435 C  CD  . ARG A 1 389 ? 34.784  64.845  59.089  1.00 124.70 ? 389  ARG A CD  1 
ATOM   2436 N  NE  . ARG A 1 389 ? 35.781  65.658  58.388  1.00 124.70 ? 389  ARG A NE  1 
ATOM   2437 C  CZ  . ARG A 1 389 ? 37.016  65.887  58.840  1.00 124.70 ? 389  ARG A CZ  1 
ATOM   2438 N  NH1 . ARG A 1 389 ? 37.416  65.371  59.996  1.00 124.70 ? 389  ARG A NH1 1 
ATOM   2439 N  NH2 . ARG A 1 389 ? 37.866  66.624  58.136  1.00 124.70 ? 389  ARG A NH2 1 
ATOM   2440 N  N   . LYS A 1 390 ? 30.066  62.390  60.243  1.00 124.70 ? 390  LYS A N   1 
ATOM   2441 C  CA  . LYS A 1 390 ? 29.116  62.645  61.302  1.00 124.70 ? 390  LYS A CA  1 
ATOM   2442 C  C   . LYS A 1 390 ? 29.759  63.108  62.604  1.00 124.70 ? 390  LYS A C   1 
ATOM   2443 O  O   . LYS A 1 390 ? 30.809  62.620  63.006  1.00 124.70 ? 390  LYS A O   1 
ATOM   2444 C  CB  . LYS A 1 390 ? 28.220  61.436  61.534  1.00 124.70 ? 390  LYS A CB  1 
ATOM   2445 C  CG  . LYS A 1 390 ? 28.850  60.219  62.158  1.00 124.70 ? 390  LYS A CG  1 
ATOM   2446 C  CD  . LYS A 1 390 ? 27.727  59.219  62.404  1.00 124.70 ? 390  LYS A CD  1 
ATOM   2447 C  CE  . LYS A 1 390 ? 28.229  57.857  62.836  1.00 124.70 ? 390  LYS A CE  1 
ATOM   2448 N  NZ  . LYS A 1 390 ? 27.215  56.796  62.549  1.00 124.70 ? 390  LYS A NZ  1 
ATOM   2449 N  N   . MET A 1 391 ? 29.127  64.069  63.265  1.00 124.70 ? 391  MET A N   1 
ATOM   2450 C  CA  . MET A 1 391 ? 29.678  64.578  64.512  1.00 124.70 ? 391  MET A CA  1 
ATOM   2451 C  C   . MET A 1 391 ? 28.668  64.374  65.630  1.00 124.70 ? 391  MET A C   1 
ATOM   2452 O  O   . MET A 1 391 ? 27.541  64.805  65.500  1.00 124.70 ? 391  MET A O   1 
ATOM   2453 C  CB  . MET A 1 391 ? 29.969  66.059  64.361  1.00 124.70 ? 391  MET A CB  1 
ATOM   2454 C  CG  . MET A 1 391 ? 30.425  66.687  65.609  1.00 124.70 ? 391  MET A CG  1 
ATOM   2455 S  SD  . MET A 1 391 ? 30.238  68.389  65.412  1.00 124.70 ? 391  MET A SD  1 
ATOM   2456 C  CE  . MET A 1 391 ? 29.039  68.589  66.791  1.00 124.70 ? 391  MET A CE  1 
ATOM   2457 N  N   . THR A 1 392 ? 29.018  63.727  66.728  1.00 124.70 ? 392  THR A N   1 
ATOM   2458 C  CA  . THR A 1 392 ? 27.993  63.573  67.762  1.00 124.70 ? 392  THR A CA  1 
ATOM   2459 C  C   . THR A 1 392 ? 27.668  64.935  68.448  1.00 124.70 ? 392  THR A C   1 
ATOM   2460 O  O   . THR A 1 392 ? 28.524  65.485  69.151  1.00 124.70 ? 392  THR A O   1 
ATOM   2461 C  CB  . THR A 1 392 ? 28.442  62.510  68.781  1.00 124.70 ? 392  THR A CB  1 
ATOM   2462 O  OG1 . THR A 1 392 ? 29.332  61.584  68.143  1.00 124.70 ? 392  THR A OG1 1 
ATOM   2463 C  CG2 . THR A 1 392 ? 27.248  61.741  69.291  1.00 124.70 ? 392  THR A CG2 1 
ATOM   2464 N  N   . LEU A 1 393 ? 26.448  65.468  68.250  1.00 124.70 ? 393  LEU A N   1 
ATOM   2465 C  CA  . LEU A 1 393 ? 26.068  66.774  68.818  1.00 124.70 ? 393  LEU A CA  1 
ATOM   2466 C  C   . LEU A 1 393 ? 26.517  66.876  70.274  1.00 124.70 ? 393  LEU A C   1 
ATOM   2467 O  O   . LEU A 1 393 ? 25.785  66.630  71.241  1.00 124.70 ? 393  LEU A O   1 
ATOM   2468 C  CB  . LEU A 1 393 ? 24.561  67.063  68.625  1.00 124.70 ? 393  LEU A CB  1 
ATOM   2469 C  CG  . LEU A 1 393 ? 24.197  68.529  68.311  1.00 124.70 ? 393  LEU A CG  1 
ATOM   2470 C  CD1 . LEU A 1 393 ? 25.224  69.124  67.370  1.00 124.70 ? 393  LEU A CD1 1 
ATOM   2471 C  CD2 . LEU A 1 393 ? 22.804  68.608  67.693  1.00 124.70 ? 393  LEU A CD2 1 
ATOM   2472 N  N   . ASP A 1 394 ? 27.766  67.329  70.302  1.00 124.70 ? 394  ASP A N   1 
ATOM   2473 C  CA  . ASP A 1 394 ? 28.705  67.559  71.375  1.00 124.70 ? 394  ASP A CA  1 
ATOM   2474 C  C   . ASP A 1 394 ? 28.965  66.532  72.415  1.00 124.70 ? 394  ASP A C   1 
ATOM   2475 O  O   . ASP A 1 394 ? 29.077  66.805  73.607  1.00 124.70 ? 394  ASP A O   1 
ATOM   2476 C  CB  . ASP A 1 394 ? 28.598  68.934  72.033  1.00 124.70 ? 394  ASP A CB  1 
ATOM   2477 C  CG  . ASP A 1 394 ? 29.989  69.490  72.400  1.00 124.70 ? 394  ASP A CG  1 
ATOM   2478 O  OD1 . ASP A 1 394 ? 30.266  69.716  73.599  1.00 124.70 ? 394  ASP A OD1 1 
ATOM   2479 O  OD2 . ASP A 1 394 ? 30.813  69.668  71.474  1.00 124.70 ? 394  ASP A OD2 1 
ATOM   2480 N  N   . ARG A 1 395 ? 28.856  65.319  71.954  1.00 124.70 ? 395  ARG A N   1 
ATOM   2481 C  CA  . ARG A 1 395 ? 29.423  64.233  72.698  1.00 124.70 ? 395  ARG A CA  1 
ATOM   2482 C  C   . ARG A 1 395 ? 30.284  64.075  71.457  1.00 124.70 ? 395  ARG A C   1 
ATOM   2483 O  O   . ARG A 1 395 ? 29.942  63.392  70.543  1.00 124.70 ? 395  ARG A O   1 
ATOM   2484 C  CB  . ARG A 1 395 ? 28.431  63.123  72.896  1.00 124.70 ? 395  ARG A CB  1 
ATOM   2485 C  CG  . ARG A 1 395 ? 27.327  62.998  71.860  1.00 124.70 ? 395  ARG A CG  1 
ATOM   2486 C  CD  . ARG A 1 395 ? 26.433  61.839  72.275  1.00 124.70 ? 395  ARG A CD  1 
ATOM   2487 N  NE  . ARG A 1 395 ? 25.436  61.497  71.272  1.00 124.70 ? 395  ARG A NE  1 
ATOM   2488 C  CZ  . ARG A 1 395 ? 24.530  60.535  71.424  1.00 124.70 ? 395  ARG A CZ  1 
ATOM   2489 N  NH1 . ARG A 1 395 ? 24.497  59.826  72.539  1.00 124.70 ? 395  ARG A NH1 1 
ATOM   2490 N  NH2 . ARG A 1 395 ? 23.650  60.277  70.465  1.00 124.70 ? 395  ARG A NH2 1 
ATOM   2491 N  N   . SER A 1 396 ? 31.267  64.959  71.372  1.00 124.70 ? 396  SER A N   1 
ATOM   2492 C  CA  . SER A 1 396 ? 32.088  65.116  70.171  1.00 124.70 ? 396  SER A CA  1 
ATOM   2493 C  C   . SER A 1 396 ? 32.848  63.982  69.459  1.00 124.70 ? 396  SER A C   1 
ATOM   2494 O  O   . SER A 1 396 ? 34.041  64.135  69.167  1.00 124.70 ? 396  SER A O   1 
ATOM   2495 C  CB  . SER A 1 396 ? 33.045  66.288  70.390  1.00 124.70 ? 396  SER A CB  1 
ATOM   2496 O  OG  . SER A 1 396 ? 33.091  67.124  69.248  1.00 124.70 ? 396  SER A OG  1 
ATOM   2497 N  N   . GLU A 1 397 ? 32.138  62.875  69.181  1.00 124.70 ? 397  GLU A N   1 
ATOM   2498 C  CA  . GLU A 1 397 ? 32.639  61.671  68.493  1.00 124.70 ? 397  GLU A CA  1 
ATOM   2499 C  C   . GLU A 1 397 ? 32.438  61.807  66.954  1.00 124.70 ? 397  GLU A C   1 
ATOM   2500 O  O   . GLU A 1 397 ? 31.310  61.773  66.442  1.00 124.70 ? 397  GLU A O   1 
ATOM   2501 C  CB  . GLU A 1 397 ? 31.909  60.421  69.039  1.00 124.70 ? 397  GLU A CB  1 
ATOM   2502 C  CG  . GLU A 1 397 ? 32.525  59.068  68.579  1.00 124.70 ? 397  GLU A CG  1 
ATOM   2503 C  CD  . GLU A 1 397 ? 33.445  58.389  69.607  1.00 124.70 ? 397  GLU A CD  1 
ATOM   2504 O  OE1 . GLU A 1 397 ? 34.431  59.005  70.080  1.00 124.70 ? 397  GLU A OE1 1 
ATOM   2505 O  OE2 . GLU A 1 397 ? 33.174  57.212  69.928  1.00 124.70 ? 397  GLU A OE2 1 
ATOM   2506 N  N   . TYR A 1 398 ? 33.561  61.939  66.244  1.00 124.70 ? 398  TYR A N   1 
ATOM   2507 C  CA  . TYR A 1 398 ? 33.637  62.142  64.791  1.00 124.70 ? 398  TYR A CA  1 
ATOM   2508 C  C   . TYR A 1 398 ? 33.567  60.983  63.812  1.00 124.70 ? 398  TYR A C   1 
ATOM   2509 O  O   . TYR A 1 398 ? 34.612  60.510  63.367  1.00 124.70 ? 398  TYR A O   1 
ATOM   2510 C  CB  . TYR A 1 398 ? 34.936  62.844  64.456  1.00 124.70 ? 398  TYR A CB  1 
ATOM   2511 C  CG  . TYR A 1 398 ? 34.801  64.247  63.975  1.00 124.70 ? 398  TYR A CG  1 
ATOM   2512 C  CD1 . TYR A 1 398 ? 35.877  64.880  63.359  1.00 124.70 ? 398  TYR A CD1 1 
ATOM   2513 C  CD2 . TYR A 1 398 ? 33.631  64.971  64.180  1.00 124.70 ? 398  TYR A CD2 1 
ATOM   2514 C  CE1 . TYR A 1 398 ? 35.805  66.198  62.963  1.00 124.70 ? 398  TYR A CE1 1 
ATOM   2515 C  CE2 . TYR A 1 398 ? 33.541  66.302  63.785  1.00 124.70 ? 398  TYR A CE2 1 
ATOM   2516 C  CZ  . TYR A 1 398 ? 34.640  66.908  63.177  1.00 124.70 ? 398  TYR A CZ  1 
ATOM   2517 O  OH  . TYR A 1 398 ? 34.599  68.228  62.792  1.00 124.70 ? 398  TYR A OH  1 
ATOM   2518 N  N   . THR A 1 399 ? 32.378  60.545  63.425  1.00 124.70 ? 399  THR A N   1 
ATOM   2519 C  CA  . THR A 1 399 ? 32.324  59.475  62.442  1.00 124.70 ? 399  THR A CA  1 
ATOM   2520 C  C   . THR A 1 399 ? 32.339  60.103  61.046  1.00 124.70 ? 399  THR A C   1 
ATOM   2521 O  O   . THR A 1 399 ? 31.545  61.016  60.797  1.00 124.70 ? 399  THR A O   1 
ATOM   2522 N  N   . SER A 1 400 ? 33.229  59.657  60.147  1.00 124.70 ? 400  SER A N   1 
ATOM   2523 C  CA  . SER A 1 400 ? 33.267  60.204  58.788  1.00 124.70 ? 400  SER A CA  1 
ATOM   2524 C  C   . SER A 1 400 ? 31.871  60.115  58.169  1.00 124.70 ? 400  SER A C   1 
ATOM   2525 O  O   . SER A 1 400 ? 31.125  59.193  58.491  1.00 124.70 ? 400  SER A O   1 
ATOM   2526 N  N   . LEU A 1 401 ? 31.504  61.033  57.274  1.00 124.70 ? 401  LEU A N   1 
ATOM   2527 C  CA  . LEU A 1 401 ? 30.156  61.005  56.714  1.00 124.70 ? 401  LEU A CA  1 
ATOM   2528 C  C   . LEU A 1 401 ? 30.083  60.721  55.234  1.00 124.70 ? 401  LEU A C   1 
ATOM   2529 O  O   . LEU A 1 401 ? 29.390  59.804  54.785  1.00 124.70 ? 401  LEU A O   1 
ATOM   2530 N  N   . ILE A 1 402 ? 30.790  61.521  54.462  1.00 124.70 ? 402  ILE A N   1 
ATOM   2531 C  CA  . ILE A 1 402 ? 30.781  61.280  53.047  1.00 124.70 ? 402  ILE A CA  1 
ATOM   2532 C  C   . ILE A 1 402 ? 31.971  60.446  52.618  1.00 124.70 ? 402  ILE A C   1 
ATOM   2533 O  O   . ILE A 1 402 ? 33.115  60.922  52.588  1.00 124.70 ? 402  ILE A O   1 
ATOM   2534 N  N   . PRO A 1 403 ? 31.721  59.173  52.276  1.00 124.70 ? 403  PRO A N   1 
ATOM   2535 C  CA  . PRO A 1 403 ? 32.755  58.230  51.829  1.00 124.70 ? 403  PRO A CA  1 
ATOM   2536 C  C   . PRO A 1 403 ? 33.503  58.708  50.578  1.00 124.70 ? 403  PRO A C   1 
ATOM   2537 O  O   . PRO A 1 403 ? 33.516  58.055  49.542  1.00 124.70 ? 403  PRO A O   1 
ATOM   2538 C  CB  . PRO A 1 403 ? 31.964  56.938  51.632  1.00 124.70 ? 403  PRO A CB  1 
ATOM   2539 C  CG  . PRO A 1 403 ? 31.041  57.020  52.839  1.00 124.70 ? 403  PRO A CG  1 
ATOM   2540 C  CD  . PRO A 1 403 ? 30.487  58.444  52.628  1.00 124.70 ? 403  PRO A CD  1 
ATOM   2541 N  N   . ASN A 1 404 ? 34.052  59.911  50.701  1.00 124.70 ? 404  ASN A N   1 
ATOM   2542 C  CA  . ASN A 1 404 ? 34.870  60.573  49.686  1.00 124.70 ? 404  ASN A CA  1 
ATOM   2543 C  C   . ASN A 1 404 ? 34.386  60.724  48.219  1.00 124.70 ? 404  ASN A C   1 
ATOM   2544 O  O   . ASN A 1 404 ? 34.978  60.166  47.290  1.00 124.70 ? 404  ASN A O   1 
ATOM   2545 C  CB  . ASN A 1 404 ? 36.269  59.931  49.736  1.00 124.70 ? 404  ASN A CB  1 
ATOM   2546 C  CG  . ASN A 1 404 ? 36.356  58.627  48.963  1.00 124.70 ? 404  ASN A CG  1 
ATOM   2547 O  OD1 . ASN A 1 404 ? 35.366  58.139  48.394  1.00 124.70 ? 404  ASN A OD1 1 
ATOM   2548 N  ND2 . ASN A 1 404 ? 37.562  58.061  48.923  1.00 124.70 ? 404  ASN A ND2 1 
ATOM   2549 N  N   . LEU A 1 405 ? 33.351  61.534  48.003  1.00 124.70 ? 405  LEU A N   1 
ATOM   2550 C  CA  . LEU A 1 405 ? 32.831  61.728  46.645  1.00 124.70 ? 405  LEU A CA  1 
ATOM   2551 C  C   . LEU A 1 405 ? 33.235  63.064  45.984  1.00 124.70 ? 405  LEU A C   1 
ATOM   2552 O  O   . LEU A 1 405 ? 33.020  64.123  46.563  1.00 124.70 ? 405  LEU A O   1 
ATOM   2553 C  CB  . LEU A 1 405 ? 31.323  61.599  46.662  1.00 124.70 ? 405  LEU A CB  1 
ATOM   2554 N  N   . ARG A 1 406 ? 33.773  63.013  44.759  1.00 124.70 ? 406  ARG A N   1 
ATOM   2555 C  CA  . ARG A 1 406 ? 34.223  64.220  44.046  1.00 124.70 ? 406  ARG A CA  1 
ATOM   2556 C  C   . ARG A 1 406 ? 33.274  65.426  44.045  1.00 124.70 ? 406  ARG A C   1 
ATOM   2557 O  O   . ARG A 1 406 ? 32.312  65.472  43.277  1.00 124.70 ? 406  ARG A O   1 
ATOM   2558 C  CB  . ARG A 1 406 ? 34.598  63.866  42.603  1.00 124.70 ? 406  ARG A CB  1 
ATOM   2559 N  N   . ASN A 1 407 ? 33.598  66.386  44.916  1.00 124.70 ? 407  ASN A N   1 
ATOM   2560 C  CA  . ASN A 1 407 ? 32.923  67.672  45.119  1.00 124.70 ? 407  ASN A CA  1 
ATOM   2561 C  C   . ASN A 1 407 ? 31.413  67.766  45.401  1.00 124.70 ? 407  ASN A C   1 
ATOM   2562 O  O   . ASN A 1 407 ? 30.692  68.395  44.630  1.00 124.70 ? 407  ASN A O   1 
ATOM   2563 C  CB  . ASN A 1 407 ? 33.257  68.587  43.941  1.00 124.70 ? 407  ASN A CB  1 
ATOM   2564 C  CG  . ASN A 1 407 ? 33.233  70.050  44.320  1.00 124.70 ? 407  ASN A CG  1 
ATOM   2565 O  OD1 . ASN A 1 407 ? 33.431  70.918  43.471  1.00 124.70 ? 407  ASN A OD1 1 
ATOM   2566 N  ND2 . ASN A 1 407 ? 32.999  70.336  45.606  1.00 124.70 ? 407  ASN A ND2 1 
ATOM   2567 N  N   . VAL A 1 408 ? 30.955  67.221  46.533  1.00 124.70 ? 408  VAL A N   1 
ATOM   2568 C  CA  . VAL A 1 408 ? 29.526  67.238  46.929  1.00 124.70 ? 408  VAL A CA  1 
ATOM   2569 C  C   . VAL A 1 408 ? 28.980  68.588  47.539  1.00 124.70 ? 408  VAL A C   1 
ATOM   2570 O  O   . VAL A 1 408 ? 29.792  69.401  47.995  1.00 124.70 ? 408  VAL A O   1 
ATOM   2571 C  CB  . VAL A 1 408 ? 29.274  66.078  47.896  1.00 124.70 ? 408  VAL A CB  1 
ATOM   2572 C  CG1 . VAL A 1 408 ? 29.998  66.339  49.188  1.00 124.70 ? 408  VAL A CG1 1 
ATOM   2573 C  CG2 . VAL A 1 408 ? 27.793  65.881  48.102  1.00 124.70 ? 408  VAL A CG2 1 
ATOM   2574 N  N   . VAL A 1 409 ? 27.631  68.798  47.591  1.00 124.70 ? 409  VAL A N   1 
ATOM   2575 C  CA  . VAL A 1 409 ? 26.999  70.090  48.057  1.00 124.70 ? 409  VAL A CA  1 
ATOM   2576 C  C   . VAL A 1 409 ? 25.579  70.395  48.743  1.00 124.70 ? 409  VAL A C   1 
ATOM   2577 O  O   . VAL A 1 409 ? 25.123  71.511  48.595  1.00 124.70 ? 409  VAL A O   1 
ATOM   2578 C  CB  . VAL A 1 409 ? 27.072  71.095  46.860  1.00 124.70 ? 409  VAL A CB  1 
ATOM   2579 C  CG1 . VAL A 1 409 ? 26.388  72.414  47.165  1.00 124.70 ? 409  VAL A CG1 1 
ATOM   2580 C  CG2 . VAL A 1 409 ? 28.496  71.392  46.525  1.00 124.70 ? 409  VAL A CG2 1 
ATOM   2581 N  N   . ALA A 1 410 ? 24.869  69.523  49.483  1.00 124.70 ? 410  ALA A N   1 
ATOM   2582 C  CA  . ALA A 1 410 ? 23.530  69.930  50.097  1.00 124.70 ? 410  ALA A CA  1 
ATOM   2583 C  C   . ALA A 1 410 ? 22.730  68.768  50.753  1.00 124.70 ? 410  ALA A C   1 
ATOM   2584 O  O   . ALA A 1 410 ? 21.574  68.547  50.423  1.00 124.70 ? 410  ALA A O   1 
ATOM   2585 C  CB  . ALA A 1 410 ? 22.623  70.559  49.016  1.00 124.70 ? 410  ALA A CB  1 
ATOM   2586 N  N   . LEU A 1 411 ? 23.246  68.091  51.753  1.00 124.70 ? 411  LEU A N   1 
ATOM   2587 C  CA  . LEU A 1 411 ? 22.569  66.843  52.157  1.00 124.70 ? 411  LEU A CA  1 
ATOM   2588 C  C   . LEU A 1 411 ? 21.316  66.536  53.008  1.00 124.70 ? 411  LEU A C   1 
ATOM   2589 O  O   . LEU A 1 411 ? 21.316  66.739  54.229  1.00 124.70 ? 411  LEU A O   1 
ATOM   2590 C  CB  . LEU A 1 411 ? 23.685  65.927  52.638  1.00 124.70 ? 411  LEU A CB  1 
ATOM   2591 C  CG  . LEU A 1 411 ? 24.571  66.621  53.688  1.00 124.70 ? 411  LEU A CG  1 
ATOM   2592 C  CD1 . LEU A 1 411 ? 25.753  65.700  54.024  1.00 124.70 ? 411  LEU A CD1 1 
ATOM   2593 C  CD2 . LEU A 1 411 ? 25.082  67.976  53.192  1.00 124.70 ? 411  LEU A CD2 1 
ATOM   2594 N  N   . ASP A 1 412 ? 20.273  66.009  52.344  1.00 124.70 ? 412  ASP A N   1 
ATOM   2595 C  CA  . ASP A 1 412 ? 19.084  65.584  53.043  1.00 124.70 ? 412  ASP A CA  1 
ATOM   2596 C  C   . ASP A 1 412 ? 18.965  64.090  53.072  1.00 124.70 ? 412  ASP A C   1 
ATOM   2597 O  O   . ASP A 1 412 ? 19.401  63.372  52.158  1.00 124.70 ? 412  ASP A O   1 
ATOM   2598 C  CB  . ASP A 1 412 ? 17.796  66.216  52.555  1.00 124.70 ? 412  ASP A CB  1 
ATOM   2599 C  CG  . ASP A 1 412 ? 16.940  66.598  53.731  1.00 124.70 ? 412  ASP A CG  1 
ATOM   2600 O  OD1 . ASP A 1 412 ? 17.466  66.382  54.841  1.00 124.70 ? 412  ASP A OD1 1 
ATOM   2601 O  OD2 . ASP A 1 412 ? 15.804  67.090  53.602  1.00 124.70 ? 412  ASP A OD2 1 
ATOM   2602 N  N   . THR A 1 413 ? 18.327  63.650  54.148  1.00 124.70 ? 413  THR A N   1 
ATOM   2603 C  CA  . THR A 1 413 ? 18.224  62.245  54.480  1.00 124.70 ? 413  THR A CA  1 
ATOM   2604 C  C   . THR A 1 413 ? 16.927  61.765  55.030  1.00 124.70 ? 413  THR A C   1 
ATOM   2605 O  O   . THR A 1 413 ? 16.034  62.526  55.390  1.00 124.70 ? 413  THR A O   1 
ATOM   2606 C  CB  . THR A 1 413 ? 19.194  61.915  55.629  1.00 124.70 ? 413  THR A CB  1 
ATOM   2607 O  OG1 . THR A 1 413 ? 19.143  60.516  55.928  1.00 124.70 ? 413  THR A OG1 1 
ATOM   2608 C  CG2 . THR A 1 413 ? 18.768  62.673  56.894  1.00 124.70 ? 413  THR A CG2 1 
ATOM   2609 N  N   . GLU A 1 414 ? 16.844  60.456  55.118  1.00 124.70 ? 414  GLU A N   1 
ATOM   2610 C  CA  . GLU A 1 414 ? 15.728  59.937  55.812  1.00 124.70 ? 414  GLU A CA  1 
ATOM   2611 C  C   . GLU A 1 414 ? 15.803  58.545  56.400  1.00 124.70 ? 414  GLU A C   1 
ATOM   2612 O  O   . GLU A 1 414 ? 16.369  57.567  55.866  1.00 124.70 ? 414  GLU A O   1 
ATOM   2613 C  CB  . GLU A 1 414 ? 14.427  60.233  55.094  1.00 124.70 ? 414  GLU A CB  1 
ATOM   2614 C  CG  . GLU A 1 414 ? 14.104  59.576  53.819  1.00 124.70 ? 414  GLU A CG  1 
ATOM   2615 C  CD  . GLU A 1 414 ? 12.695  59.967  53.486  1.00 124.70 ? 414  GLU A CD  1 
ATOM   2616 O  OE1 . GLU A 1 414 ? 12.132  60.726  54.305  1.00 124.70 ? 414  GLU A OE1 1 
ATOM   2617 O  OE2 . GLU A 1 414 ? 12.152  59.538  52.450  1.00 124.70 ? 414  GLU A OE2 1 
ATOM   2618 N  N   . VAL A 1 415 ? 15.236  58.600  57.600  1.00 124.70 ? 415  VAL A N   1 
ATOM   2619 C  CA  . VAL A 1 415 ? 15.103  57.615  58.641  1.00 124.70 ? 415  VAL A CA  1 
ATOM   2620 C  C   . VAL A 1 415 ? 14.145  56.439  58.577  1.00 124.70 ? 415  VAL A C   1 
ATOM   2621 O  O   . VAL A 1 415 ? 13.089  56.457  57.940  1.00 124.70 ? 415  VAL A O   1 
ATOM   2622 C  CB  . VAL A 1 415 ? 14.837  58.393  59.962  1.00 124.70 ? 415  VAL A CB  1 
ATOM   2623 C  CG1 . VAL A 1 415 ? 14.438  57.453  61.074  1.00 124.70 ? 415  VAL A CG1 1 
ATOM   2624 C  CG2 . VAL A 1 415 ? 16.071  59.195  60.343  1.00 124.70 ? 415  VAL A CG2 1 
ATOM   2625 N  N   . ALA A 1 416 ? 14.572  55.433  59.337  1.00 124.70 ? 416  ALA A N   1 
ATOM   2626 C  CA  . ALA A 1 416 ? 13.918  54.140  59.551  1.00 124.70 ? 416  ALA A CA  1 
ATOM   2627 C  C   . ALA A 1 416 ? 13.520  53.499  58.236  1.00 124.70 ? 416  ALA A C   1 
ATOM   2628 O  O   . ALA A 1 416 ? 12.480  52.851  58.120  1.00 124.70 ? 416  ALA A O   1 
ATOM   2629 C  CB  . ALA A 1 416 ? 12.695  54.297  60.461  1.00 124.70 ? 416  ALA A CB  1 
ATOM   2630 N  N   . SER A 1 417 ? 14.366  53.766  57.249  1.00 124.70 ? 417  SER A N   1 
ATOM   2631 C  CA  . SER A 1 417 ? 14.334  53.345  55.837  1.00 124.70 ? 417  SER A CA  1 
ATOM   2632 C  C   . SER A 1 417 ? 15.772  53.804  55.844  1.00 124.70 ? 417  SER A C   1 
ATOM   2633 O  O   . SER A 1 417 ? 16.058  54.888  56.338  1.00 124.70 ? 417  SER A O   1 
ATOM   2634 C  CB  . SER A 1 417 ? 13.381  54.245  55.018  1.00 124.70 ? 417  SER A CB  1 
ATOM   2635 O  OG  . SER A 1 417 ? 12.033  53.791  55.153  1.00 124.70 ? 417  SER A OG  1 
ATOM   2636 N  N   . ASN A 1 418 ? 16.739  53.097  55.335  1.00 124.70 ? 418  ASN A N   1 
ATOM   2637 C  CA  . ASN A 1 418 ? 17.954  53.726  55.787  1.00 124.70 ? 418  ASN A CA  1 
ATOM   2638 C  C   . ASN A 1 418 ? 18.676  54.493  54.752  1.00 124.70 ? 418  ASN A C   1 
ATOM   2639 O  O   . ASN A 1 418 ? 19.367  53.901  53.957  1.00 124.70 ? 418  ASN A O   1 
ATOM   2640 C  CB  . ASN A 1 418 ? 18.836  52.674  56.485  1.00 124.70 ? 418  ASN A CB  1 
ATOM   2641 C  CG  . ASN A 1 418 ? 18.252  52.194  57.823  1.00 124.70 ? 418  ASN A CG  1 
ATOM   2642 O  OD1 . ASN A 1 418 ? 17.459  51.248  57.876  1.00 124.70 ? 418  ASN A OD1 1 
ATOM   2643 N  ND2 . ASN A 1 418 ? 18.659  52.846  58.906  1.00 124.70 ? 418  ASN A ND2 1 
ATOM   2644 N  N   . ARG A 1 419 ? 18.593  55.811  54.746  1.00 124.70 ? 419  ARG A N   1 
ATOM   2645 C  CA  . ARG A 1 419 ? 19.263  56.394  53.622  1.00 124.70 ? 419  ARG A CA  1 
ATOM   2646 C  C   . ARG A 1 419 ? 19.606  57.829  53.758  1.00 124.70 ? 419  ARG A C   1 
ATOM   2647 O  O   . ARG A 1 419 ? 19.139  58.492  54.674  1.00 124.70 ? 419  ARG A O   1 
ATOM   2648 C  CB  . ARG A 1 419 ? 18.395  56.182  52.396  1.00 124.70 ? 419  ARG A CB  1 
ATOM   2649 N  N   . ILE A 1 420 ? 20.448  58.296  52.845  1.00 124.70 ? 420  ILE A N   1 
ATOM   2650 C  CA  . ILE A 1 420 ? 20.837  59.691  52.810  1.00 124.70 ? 420  ILE A CA  1 
ATOM   2651 C  C   . ILE A 1 420 ? 21.135  60.021  51.376  1.00 124.70 ? 420  ILE A C   1 
ATOM   2652 O  O   . ILE A 1 420 ? 21.413  59.124  50.582  1.00 124.70 ? 420  ILE A O   1 
ATOM   2653 C  CB  . ILE A 1 420 ? 22.096  59.975  53.646  1.00 124.70 ? 420  ILE A CB  1 
ATOM   2654 C  CG1 . ILE A 1 420 ? 23.329  59.332  53.002  1.00 124.70 ? 420  ILE A CG1 1 
ATOM   2655 C  CG2 . ILE A 1 420 ? 21.902  59.458  55.057  1.00 124.70 ? 420  ILE A CG2 1 
ATOM   2656 C  CD1 . ILE A 1 420 ? 24.640  59.797  53.602  1.00 124.70 ? 420  ILE A CD1 1 
ATOM   2657 N  N   . TYR A 1 421 ? 21.066  61.297  51.025  1.00 124.70 ? 421  TYR A N   1 
ATOM   2658 C  CA  . TYR A 1 421 ? 21.363  61.646  49.659  1.00 124.70 ? 421  TYR A CA  1 
ATOM   2659 C  C   . TYR A 1 421 ? 22.014  62.960  49.473  1.00 124.70 ? 421  TYR A C   1 
ATOM   2660 O  O   . TYR A 1 421 ? 21.871  63.875  50.272  1.00 124.70 ? 421  TYR A O   1 
ATOM   2661 C  CB  . TYR A 1 421 ? 20.137  61.625  48.798  1.00 124.70 ? 421  TYR A CB  1 
ATOM   2662 C  CG  . TYR A 1 421 ? 19.016  60.842  49.374  1.00 124.70 ? 421  TYR A CG  1 
ATOM   2663 C  CD1 . TYR A 1 421 ? 18.074  61.457  50.180  1.00 124.70 ? 421  TYR A CD1 1 
ATOM   2664 C  CD2 . TYR A 1 421 ? 18.843  59.501  49.060  1.00 124.70 ? 421  TYR A CD2 1 
ATOM   2665 C  CE1 . TYR A 1 421 ? 16.959  60.754  50.652  1.00 124.70 ? 421  TYR A CE1 1 
ATOM   2666 C  CE2 . TYR A 1 421 ? 17.738  58.777  49.522  1.00 124.70 ? 421  TYR A CE2 1 
ATOM   2667 C  CZ  . TYR A 1 421 ? 16.793  59.408  50.311  1.00 124.70 ? 421  TYR A CZ  1 
ATOM   2668 O  OH  . TYR A 1 421 ? 15.668  58.711  50.701  1.00 124.70 ? 421  TYR A OH  1 
ATOM   2669 N  N   . TRP A 1 422 ? 22.697  63.053  48.352  1.00 124.70 ? 422  TRP A N   1 
ATOM   2670 C  CA  . TRP A 1 422 ? 23.430  64.234  48.057  1.00 124.70 ? 422  TRP A CA  1 
ATOM   2671 C  C   . TRP A 1 422 ? 23.620  64.500  46.608  1.00 124.70 ? 422  TRP A C   1 
ATOM   2672 O  O   . TRP A 1 422 ? 23.383  63.665  45.737  1.00 124.70 ? 422  TRP A O   1 
ATOM   2673 C  CB  . TRP A 1 422 ? 24.799  64.136  48.677  1.00 124.70 ? 422  TRP A CB  1 
ATOM   2674 C  CG  . TRP A 1 422 ? 25.576  62.987  48.109  1.00 124.70 ? 422  TRP A CG  1 
ATOM   2675 C  CD1 . TRP A 1 422 ? 26.794  63.046  47.474  1.00 124.70 ? 422  TRP A CD1 1 
ATOM   2676 C  CD2 . TRP A 1 422 ? 25.246  61.594  48.196  1.00 124.70 ? 422  TRP A CD2 1 
ATOM   2677 N  NE1 . TRP A 1 422 ? 27.225  61.776  47.141  1.00 124.70 ? 422  TRP A NE1 1 
ATOM   2678 C  CE2 . TRP A 1 422 ? 26.259  60.856  47.538  1.00 124.70 ? 422  TRP A CE2 1 
ATOM   2679 C  CE3 . TRP A 1 422 ? 24.126  60.882  48.673  1.00 124.70 ? 422  TRP A CE3 1 
ATOM   2680 C  CZ2 . TRP A 1 422 ? 26.274  59.455  47.468  1.00 124.70 ? 422  TRP A CZ2 1 
ATOM   2681 C  CZ3 . TRP A 1 422 ? 24.123  59.482  48.599  1.00 124.70 ? 422  TRP A CZ3 1 
ATOM   2682 C  CH2 . TRP A 1 422 ? 25.165  58.791  47.955  1.00 124.70 ? 422  TRP A CH2 1 
ATOM   2683 N  N   . SER A 1 423 ? 24.163  65.685  46.418  1.00 124.70 ? 423  SER A N   1 
ATOM   2684 C  CA  . SER A 1 423 ? 24.450  66.291  45.155  1.00 124.70 ? 423  SER A CA  1 
ATOM   2685 C  C   . SER A 1 423 ? 25.809  65.970  44.612  1.00 124.70 ? 423  SER A C   1 
ATOM   2686 O  O   . SER A 1 423 ? 26.729  66.748  44.857  1.00 124.70 ? 423  SER A O   1 
ATOM   2687 C  CB  . SER A 1 423 ? 24.446  67.775  45.363  1.00 124.70 ? 423  SER A CB  1 
ATOM   2688 O  OG  . SER A 1 423 ? 25.487  68.050  46.287  1.00 124.70 ? 423  SER A OG  1 
ATOM   2689 N  N   . ASP A 1 424 ? 26.038  64.878  43.902  1.00 124.70 ? 424  ASP A N   1 
ATOM   2690 C  CA  . ASP A 1 424 ? 27.390  64.915  43.445  1.00 124.70 ? 424  ASP A CA  1 
ATOM   2691 C  C   . ASP A 1 424 ? 27.418  65.871  42.277  1.00 124.70 ? 424  ASP A C   1 
ATOM   2692 O  O   . ASP A 1 424 ? 26.477  65.973  41.478  1.00 124.70 ? 424  ASP A O   1 
ATOM   2693 C  CB  . ASP A 1 424 ? 28.027  63.605  43.052  1.00 124.70 ? 424  ASP A CB  1 
ATOM   2694 C  CG  . ASP A 1 424 ? 29.533  63.750  43.056  1.00 124.70 ? 424  ASP A CG  1 
ATOM   2695 O  OD1 . ASP A 1 424 ? 29.972  64.921  42.942  1.00 124.70 ? 424  ASP A OD1 1 
ATOM   2696 O  OD2 . ASP A 1 424 ? 30.271  62.755  43.184  1.00 124.70 ? 424  ASP A OD2 1 
ATOM   2697 N  N   . LEU A 1 425 ? 28.516  66.600  42.215  1.00 124.70 ? 425  LEU A N   1 
ATOM   2698 C  CA  . LEU A 1 425 ? 28.704  67.594  41.195  1.00 124.70 ? 425  LEU A CA  1 
ATOM   2699 C  C   . LEU A 1 425 ? 29.945  67.329  40.331  1.00 124.70 ? 425  LEU A C   1 
ATOM   2700 O  O   . LEU A 1 425 ? 30.653  68.244  39.917  1.00 124.70 ? 425  LEU A O   1 
ATOM   2701 C  CB  . LEU A 1 425 ? 28.763  68.981  41.860  1.00 124.70 ? 425  LEU A CB  1 
ATOM   2702 C  CG  . LEU A 1 425 ? 28.872  70.248  40.999  1.00 124.70 ? 425  LEU A CG  1 
ATOM   2703 C  CD1 . LEU A 1 425 ? 27.523  70.567  40.394  1.00 124.70 ? 425  LEU A CD1 1 
ATOM   2704 C  CD2 . LEU A 1 425 ? 29.358  71.413  41.836  1.00 124.70 ? 425  LEU A CD2 1 
ATOM   2705 N  N   . SER A 1 426 ? 30.223  66.067  40.068  1.00 124.70 ? 426  SER A N   1 
ATOM   2706 C  CA  . SER A 1 426 ? 31.329  65.731  39.188  1.00 124.70 ? 426  SER A CA  1 
ATOM   2707 C  C   . SER A 1 426 ? 31.050  64.283  38.934  1.00 124.70 ? 426  SER A C   1 
ATOM   2708 O  O   . SER A 1 426 ? 31.909  63.405  38.829  1.00 124.70 ? 426  SER A O   1 
ATOM   2709 C  CB  . SER A 1 426 ? 32.692  65.962  39.824  1.00 124.70 ? 426  SER A CB  1 
ATOM   2710 O  OG  . SER A 1 426 ? 33.699  65.706  38.866  1.00 124.70 ? 426  SER A OG  1 
ATOM   2711 N  N   . GLN A 1 427 ? 29.747  64.112  38.878  1.00 124.70 ? 427  GLN A N   1 
ATOM   2712 C  CA  . GLN A 1 427 ? 29.020  62.911  38.617  1.00 124.70 ? 427  GLN A CA  1 
ATOM   2713 C  C   . GLN A 1 427 ? 27.677  63.588  38.647  1.00 124.70 ? 427  GLN A C   1 
ATOM   2714 O  O   . GLN A 1 427 ? 26.851  63.348  39.522  1.00 124.70 ? 427  GLN A O   1 
ATOM   2715 C  CB  . GLN A 1 427 ? 29.143  61.886  39.738  1.00 124.70 ? 427  GLN A CB  1 
ATOM   2716 C  CG  . GLN A 1 427 ? 28.598  60.506  39.354  1.00 124.70 ? 427  GLN A CG  1 
ATOM   2717 C  CD  . GLN A 1 427 ? 29.034  60.040  37.946  1.00 124.70 ? 427  GLN A CD  1 
ATOM   2718 O  OE1 . GLN A 1 427 ? 29.909  60.623  37.340  1.00 124.70 ? 427  GLN A OE1 1 
ATOM   2719 N  NE2 . GLN A 1 427 ? 28.421  58.981  37.442  1.00 124.70 ? 427  GLN A NE2 1 
ATOM   2720 N  N   . ARG A 1 428 ? 27.532  64.504  37.692  1.00 124.70 ? 428  ARG A N   1 
ATOM   2721 C  CA  . ARG A 1 428 ? 26.331  65.291  37.497  1.00 124.70 ? 428  ARG A CA  1 
ATOM   2722 C  C   . ARG A 1 428 ? 25.205  64.280  37.579  1.00 124.70 ? 428  ARG A C   1 
ATOM   2723 O  O   . ARG A 1 428 ? 24.605  63.867  36.584  1.00 124.70 ? 428  ARG A O   1 
ATOM   2724 C  CB  . ARG A 1 428 ? 26.389  65.950  36.140  1.00 124.70 ? 428  ARG A CB  1 
ATOM   2725 N  N   . MET A 1 429 ? 24.959  63.895  38.821  1.00 124.70 ? 429  MET A N   1 
ATOM   2726 C  CA  . MET A 1 429 ? 23.982  62.901  39.200  1.00 124.70 ? 429  MET A CA  1 
ATOM   2727 C  C   . MET A 1 429 ? 24.036  62.829  40.731  1.00 124.70 ? 429  MET A C   1 
ATOM   2728 O  O   . MET A 1 429 ? 25.099  62.599  41.324  1.00 124.70 ? 429  MET A O   1 
ATOM   2729 C  CB  . MET A 1 429 ? 24.368  61.542  38.605  1.00 124.70 ? 429  MET A CB  1 
ATOM   2730 C  CG  . MET A 1 429 ? 25.602  60.924  39.225  1.00 124.70 ? 429  MET A CG  1 
ATOM   2731 S  SD  . MET A 1 429 ? 26.113  59.459  38.337  1.00 124.70 ? 429  MET A SD  1 
ATOM   2732 C  CE  . MET A 1 429 ? 24.956  58.260  38.875  1.00 124.70 ? 429  MET A CE  1 
ATOM   2733 N  N   . ILE A 1 430 ? 22.894  63.038  41.369  1.00 124.70 ? 430  ILE A N   1 
ATOM   2734 C  CA  . ILE A 1 430 ? 22.864  62.989  42.811  1.00 124.70 ? 430  ILE A CA  1 
ATOM   2735 C  C   . ILE A 1 430 ? 22.659  61.563  43.263  1.00 124.70 ? 430  ILE A C   1 
ATOM   2736 O  O   . ILE A 1 430 ? 22.269  60.708  42.474  1.00 124.70 ? 430  ILE A O   1 
ATOM   2737 C  CB  . ILE A 1 430 ? 21.766  63.886  43.361  1.00 124.70 ? 430  ILE A CB  1 
ATOM   2738 C  CG1 . ILE A 1 430 ? 20.402  63.222  43.210  1.00 124.70 ? 430  ILE A CG1 1 
ATOM   2739 C  CG2 . ILE A 1 430 ? 21.800  65.224  42.623  1.00 124.70 ? 430  ILE A CG2 1 
ATOM   2740 C  CD1 . ILE A 1 430 ? 19.303  63.982  43.931  1.00 124.70 ? 430  ILE A CD1 1 
ATOM   2741 N  N   . CYS A 1 431 ? 22.922  61.283  44.530  1.00 124.70 ? 431  CYS A N   1 
ATOM   2742 C  CA  . CYS A 1 431 ? 22.771  59.913  44.952  1.00 124.70 ? 431  CYS A CA  1 
ATOM   2743 C  C   . CYS A 1 431 ? 22.162  59.630  46.298  1.00 124.70 ? 431  CYS A C   1 
ATOM   2744 O  O   . CYS A 1 431 ? 22.002  60.509  47.141  1.00 124.70 ? 431  CYS A O   1 
ATOM   2745 C  CB  . CYS A 1 431 ? 24.112  59.201  44.837  1.00 124.70 ? 431  CYS A CB  1 
ATOM   2746 S  SG  . CYS A 1 431 ? 24.612  58.915  43.132  1.00 124.70 ? 431  CYS A SG  1 
ATOM   2747 N  N   . SER A 1 432 ? 21.853  58.353  46.471  1.00 124.70 ? 432  SER A N   1 
ATOM   2748 C  CA  . SER A 1 432 ? 21.221  57.817  47.661  1.00 124.70 ? 432  SER A CA  1 
ATOM   2749 C  C   . SER A 1 432 ? 21.914  56.549  48.106  1.00 124.70 ? 432  SER A C   1 
ATOM   2750 O  O   . SER A 1 432 ? 22.606  55.902  47.332  1.00 124.70 ? 432  SER A O   1 
ATOM   2751 C  CB  . SER A 1 432 ? 19.761  57.476  47.340  1.00 124.70 ? 432  SER A CB  1 
ATOM   2752 O  OG  . SER A 1 432 ? 19.488  56.095  47.513  1.00 124.70 ? 432  SER A OG  1 
ATOM   2753 N  N   . THR A 1 433 ? 21.733  56.192  49.363  1.00 124.70 ? 433  THR A N   1 
ATOM   2754 C  CA  . THR A 1 433 ? 22.304  54.952  49.830  1.00 124.70 ? 433  THR A CA  1 
ATOM   2755 C  C   . THR A 1 433 ? 21.518  54.512  51.019  1.00 124.70 ? 433  THR A C   1 
ATOM   2756 O  O   . THR A 1 433 ? 20.876  55.312  51.688  1.00 124.70 ? 433  THR A O   1 
ATOM   2757 C  CB  . THR A 1 433 ? 23.800  55.042  50.216  1.00 124.70 ? 433  THR A CB  1 
ATOM   2758 O  OG1 . THR A 1 433 ? 24.393  53.744  50.048  1.00 124.70 ? 433  THR A OG1 1 
ATOM   2759 C  CG2 . THR A 1 433 ? 23.973  55.457  51.684  1.00 124.70 ? 433  THR A CG2 1 
ATOM   2760 N  N   . GLN A 1 434 ? 21.582  53.217  51.268  1.00 124.70 ? 434  GLN A N   1 
ATOM   2761 C  CA  . GLN A 1 434 ? 20.855  52.628  52.363  1.00 124.70 ? 434  GLN A CA  1 
ATOM   2762 C  C   . GLN A 1 434 ? 21.807  52.218  53.479  1.00 124.70 ? 434  GLN A C   1 
ATOM   2763 O  O   . GLN A 1 434 ? 22.496  51.215  53.395  1.00 124.70 ? 434  GLN A O   1 
ATOM   2764 C  CB  . GLN A 1 434 ? 20.040  51.427  51.867  1.00 124.70 ? 434  GLN A CB  1 
ATOM   2765 C  CG  . GLN A 1 434 ? 19.000  51.746  50.765  1.00 124.70 ? 434  GLN A CG  1 
ATOM   2766 C  CD  . GLN A 1 434 ? 17.909  52.736  51.230  1.00 124.70 ? 434  GLN A CD  1 
ATOM   2767 O  OE1 . GLN A 1 434 ? 17.913  53.168  52.365  1.00 124.70 ? 434  GLN A OE1 1 
ATOM   2768 N  NE2 . GLN A 1 434 ? 16.982  53.086  50.349  1.00 124.70 ? 434  GLN A NE2 1 
ATOM   2769 N  N   . LEU A 1 435 ? 21.805  52.995  54.546  1.00 124.70 ? 435  LEU A N   1 
ATOM   2770 C  CA  . LEU A 1 435 ? 22.680  52.804  55.692  1.00 124.70 ? 435  LEU A CA  1 
ATOM   2771 C  C   . LEU A 1 435 ? 22.858  51.530  56.485  1.00 124.70 ? 435  LEU A C   1 
ATOM   2772 O  O   . LEU A 1 435 ? 22.047  51.239  57.339  1.00 124.70 ? 435  LEU A O   1 
ATOM   2773 C  CB  . LEU A 1 435 ? 22.349  53.883  56.690  1.00 124.70 ? 435  LEU A CB  1 
ATOM   2774 C  CG  . LEU A 1 435 ? 23.535  54.808  56.895  1.00 124.70 ? 435  LEU A CG  1 
ATOM   2775 C  CD1 . LEU A 1 435 ? 24.106  55.238  55.539  1.00 124.70 ? 435  LEU A CD1 1 
ATOM   2776 C  CD2 . LEU A 1 435 ? 23.090  55.997  57.710  1.00 124.70 ? 435  LEU A CD2 1 
ATOM   2777 N  N   . ASP A 1 436 ? 23.953  50.827  56.256  1.00 124.70 ? 436  ASP A N   1 
ATOM   2778 C  CA  . ASP A 1 436 ? 24.280  49.623  57.009  1.00 124.70 ? 436  ASP A CA  1 
ATOM   2779 C  C   . ASP A 1 436 ? 25.556  49.326  56.270  1.00 124.70 ? 436  ASP A C   1 
ATOM   2780 O  O   . ASP A 1 436 ? 25.975  48.185  56.081  1.00 124.70 ? 436  ASP A O   1 
ATOM   2781 C  CB  . ASP A 1 436 ? 23.182  48.550  56.867  1.00 124.70 ? 436  ASP A CB  1 
ATOM   2782 C  CG  . ASP A 1 436 ? 21.853  49.014  57.453  1.00 124.70 ? 436  ASP A CG  1 
ATOM   2783 O  OD1 . ASP A 1 436 ? 20.810  48.800  56.807  1.00 124.70 ? 436  ASP A OD1 1 
ATOM   2784 O  OD2 . ASP A 1 436 ? 21.861  49.620  58.557  1.00 124.70 ? 436  ASP A OD2 1 
ATOM   2785 N  N   . ARG A 1 437 ? 26.129  50.452  55.834  1.00 124.70 ? 437  ARG A N   1 
ATOM   2786 C  CA  . ARG A 1 437 ? 27.363  50.571  55.068  1.00 124.70 ? 437  ARG A CA  1 
ATOM   2787 C  C   . ARG A 1 437 ? 28.536  49.822  55.647  1.00 124.70 ? 437  ARG A C   1 
ATOM   2788 O  O   . ARG A 1 437 ? 29.359  50.417  56.347  1.00 124.70 ? 437  ARG A O   1 
ATOM   2789 C  CB  . ARG A 1 437 ? 27.740  52.063  54.919  1.00 124.70 ? 437  ARG A CB  1 
ATOM   2790 N  N   . ALA A 1 438 ? 28.623  48.533  55.322  1.00 124.70 ? 438  ALA A N   1 
ATOM   2791 C  CA  . ALA A 1 438 ? 29.741  47.715  55.765  1.00 124.70 ? 438  ALA A CA  1 
ATOM   2792 C  C   . ALA A 1 438 ? 30.953  48.240  54.974  1.00 124.70 ? 438  ALA A C   1 
ATOM   2793 O  O   . ALA A 1 438 ? 30.814  48.591  53.797  1.00 124.70 ? 438  ALA A O   1 
ATOM   2794 C  CB  . ALA A 1 438 ? 29.488  46.221  55.453  1.00 124.70 ? 438  ALA A CB  1 
ATOM   2795 N  N   . HIS A 1 439 ? 32.113  48.328  55.641  1.00 124.70 ? 439  HIS A N   1 
ATOM   2796 C  CA  . HIS A 1 439 ? 33.366  48.793  55.045  1.00 124.70 ? 439  HIS A CA  1 
ATOM   2797 C  C   . HIS A 1 439 ? 33.609  48.076  53.731  1.00 124.70 ? 439  HIS A C   1 
ATOM   2798 O  O   . HIS A 1 439 ? 34.464  47.191  53.597  1.00 124.70 ? 439  HIS A O   1 
ATOM   2799 C  CB  . HIS A 1 439 ? 34.497  48.545  55.999  1.00 124.70 ? 439  HIS A CB  1 
ATOM   2800 N  N   . GLY A 1 440 ? 32.800  48.489  52.773  1.00 124.70 ? 440  GLY A N   1 
ATOM   2801 C  CA  . GLY A 1 440 ? 32.806  47.953  51.438  1.00 124.70 ? 440  GLY A CA  1 
ATOM   2802 C  C   . GLY A 1 440 ? 31.647  48.731  50.857  1.00 124.70 ? 440  GLY A C   1 
ATOM   2803 O  O   . GLY A 1 440 ? 30.586  48.120  50.575  1.00 124.70 ? 440  GLY A O   1 
ATOM   2804 N  N   . SER A 1 442 ? 32.590  51.001  46.628  1.00 124.70 ? 442  SER A N   1 
ATOM   2805 C  CA  . SER A 1 442 ? 32.352  50.527  45.227  1.00 124.70 ? 442  SER A CA  1 
ATOM   2806 C  C   . SER A 1 442 ? 30.947  49.964  45.072  1.00 124.70 ? 442  SER A C   1 
ATOM   2807 O  O   . SER A 1 442 ? 30.712  49.203  44.126  1.00 124.70 ? 442  SER A O   1 
ATOM   2808 C  CB  . SER A 1 442 ? 33.291  49.358  44.887  1.00 124.70 ? 442  SER A CB  1 
ATOM   2809 O  OG  . SER A 1 442 ? 32.656  48.092  45.116  1.00 124.70 ? 442  SER A OG  1 
ATOM   2810 N  N   . SER A 1 443 ? 30.002  50.292  45.958  1.00 124.70 ? 443  SER A N   1 
ATOM   2811 C  CA  . SER A 1 443 ? 28.723  49.589  45.826  1.00 124.70 ? 443  SER A CA  1 
ATOM   2812 C  C   . SER A 1 443 ? 27.292  50.048  46.171  1.00 124.70 ? 443  SER A C   1 
ATOM   2813 O  O   . SER A 1 443 ? 26.477  49.193  46.529  1.00 124.70 ? 443  SER A O   1 
ATOM   2814 C  CB  . SER A 1 443 ? 28.901  48.201  46.464  1.00 124.70 ? 443  SER A CB  1 
ATOM   2815 O  OG  . SER A 1 443 ? 29.953  47.454  45.848  1.00 124.70 ? 443  SER A OG  1 
ATOM   2816 N  N   . TYR A 1 444 ? 26.935  51.327  46.124  1.00 124.70 ? 444  TYR A N   1 
ATOM   2817 C  CA  . TYR A 1 444 ? 25.503  51.583  46.333  1.00 124.70 ? 444  TYR A CA  1 
ATOM   2818 C  C   . TYR A 1 444 ? 25.065  52.949  45.869  1.00 124.70 ? 444  TYR A C   1 
ATOM   2819 O  O   . TYR A 1 444 ? 24.946  53.856  46.704  1.00 124.70 ? 444  TYR A O   1 
ATOM   2820 C  CB  . TYR A 1 444 ? 25.084  51.393  47.796  1.00 124.70 ? 444  TYR A CB  1 
ATOM   2821 C  CG  . TYR A 1 444 ? 23.633  50.981  47.886  1.00 124.70 ? 444  TYR A CG  1 
ATOM   2822 C  CD1 . TYR A 1 444 ? 23.257  49.646  47.728  1.00 124.70 ? 444  TYR A CD1 1 
ATOM   2823 C  CD2 . TYR A 1 444 ? 22.626  51.936  48.022  1.00 124.70 ? 444  TYR A CD2 1 
ATOM   2824 C  CE1 . TYR A 1 444 ? 21.906  49.270  47.696  1.00 124.70 ? 444  TYR A CE1 1 
ATOM   2825 C  CE2 . TYR A 1 444 ? 21.270  51.577  47.989  1.00 124.70 ? 444  TYR A CE2 1 
ATOM   2826 C  CZ  . TYR A 1 444 ? 20.914  50.243  47.823  1.00 124.70 ? 444  TYR A CZ  1 
ATOM   2827 O  OH  . TYR A 1 444 ? 19.576  49.888  47.754  1.00 124.70 ? 444  TYR A OH  1 
ATOM   2828 N  N   . ASP A 1 445 ? 24.755  53.135  44.579  1.00 124.70 ? 445  ASP A N   1 
ATOM   2829 C  CA  . ASP A 1 445 ? 24.438  54.526  44.262  1.00 124.70 ? 445  ASP A CA  1 
ATOM   2830 C  C   . ASP A 1 445 ? 23.646  55.319  43.187  1.00 124.70 ? 445  ASP A C   1 
ATOM   2831 O  O   . ASP A 1 445 ? 24.084  56.421  42.932  1.00 124.70 ? 445  ASP A O   1 
ATOM   2832 C  CB  . ASP A 1 445 ? 25.763  55.226  44.325  1.00 124.70 ? 445  ASP A CB  1 
ATOM   2833 C  CG  . ASP A 1 445 ? 26.720  54.615  43.362  1.00 124.70 ? 445  ASP A CG  1 
ATOM   2834 O  OD1 . ASP A 1 445 ? 27.212  53.495  43.655  1.00 124.70 ? 445  ASP A OD1 1 
ATOM   2835 O  OD2 . ASP A 1 445 ? 26.933  55.227  42.288  1.00 124.70 ? 445  ASP A OD2 1 
ATOM   2836 N  N   . THR A 1 446 ? 22.538  54.958  42.555  1.00 124.70 ? 446  THR A N   1 
ATOM   2837 C  CA  . THR A 1 446 ? 22.101  56.052  41.652  1.00 124.70 ? 446  THR A CA  1 
ATOM   2838 C  C   . THR A 1 446 ? 20.673  56.620  41.494  1.00 124.70 ? 446  THR A C   1 
ATOM   2839 O  O   . THR A 1 446 ? 19.684  55.901  41.576  1.00 124.70 ? 446  THR A O   1 
ATOM   2840 C  CB  . THR A 1 446 ? 22.653  55.839  40.218  1.00 124.70 ? 446  THR A CB  1 
ATOM   2841 O  OG1 . THR A 1 446 ? 24.059  56.138  40.197  1.00 124.70 ? 446  THR A OG1 1 
ATOM   2842 C  CG2 . THR A 1 446 ? 21.929  56.767  39.218  1.00 124.70 ? 446  THR A CG2 1 
ATOM   2843 N  N   . VAL A 1 447 ? 20.601  57.935  41.238  1.00 124.70 ? 447  VAL A N   1 
ATOM   2844 C  CA  . VAL A 1 447 ? 19.339  58.655  40.996  1.00 124.70 ? 447  VAL A CA  1 
ATOM   2845 C  C   . VAL A 1 447 ? 19.498  60.071  40.379  1.00 124.70 ? 447  VAL A C   1 
ATOM   2846 O  O   . VAL A 1 447 ? 20.072  60.971  40.995  1.00 124.70 ? 447  VAL A O   1 
ATOM   2847 C  CB  . VAL A 1 447 ? 18.488  58.784  42.291  1.00 124.70 ? 447  VAL A CB  1 
ATOM   2848 C  CG1 . VAL A 1 447 ? 17.748  60.114  42.318  1.00 124.70 ? 447  VAL A CG1 1 
ATOM   2849 C  CG2 . VAL A 1 447 ? 17.502  57.635  42.375  1.00 124.70 ? 447  VAL A CG2 1 
ATOM   2850 N  N   . ILE A 1 448 ? 18.935  60.255  39.176  1.00 124.70 ? 448  ILE A N   1 
ATOM   2851 C  CA  . ILE A 1 448 ? 18.932  61.508  38.355  1.00 124.70 ? 448  ILE A CA  1 
ATOM   2852 C  C   . ILE A 1 448 ? 20.305  61.955  37.830  1.00 124.70 ? 448  ILE A C   1 
ATOM   2853 O  O   . ILE A 1 448 ? 20.843  63.009  38.183  1.00 124.70 ? 448  ILE A O   1 
ATOM   2854 C  CB  . ILE A 1 448 ? 18.203  62.713  39.054  1.00 124.70 ? 448  ILE A CB  1 
ATOM   2855 C  CG1 . ILE A 1 448 ? 17.683  63.688  37.984  1.00 124.70 ? 448  ILE A CG1 1 
ATOM   2856 C  CG2 . ILE A 1 448 ? 19.126  63.441  40.003  1.00 124.70 ? 448  ILE A CG2 1 
ATOM   2857 C  CD1 . ILE A 1 448 ? 16.304  63.331  37.425  1.00 124.70 ? 448  ILE A CD1 1 
ATOM   2858 N  N   . SER A 1 449 ? 20.824  61.108  36.940  1.00 124.70 ? 449  SER A N   1 
ATOM   2859 C  CA  . SER A 1 449 ? 22.122  61.237  36.284  1.00 124.70 ? 449  SER A CA  1 
ATOM   2860 C  C   . SER A 1 449 ? 22.139  61.932  34.903  1.00 124.70 ? 449  SER A C   1 
ATOM   2861 O  O   . SER A 1 449 ? 22.956  61.568  34.067  1.00 124.70 ? 449  SER A O   1 
ATOM   2862 C  CB  . SER A 1 449 ? 22.739  59.829  36.171  1.00 124.70 ? 449  SER A CB  1 
ATOM   2863 O  OG  . SER A 1 449 ? 21.738  58.861  35.847  1.00 124.70 ? 449  SER A OG  1 
ATOM   2864 N  N   . ARG A 1 450 ? 21.260  62.916  34.667  1.00 124.70 ? 450  ARG A N   1 
ATOM   2865 C  CA  . ARG A 1 450 ? 21.219  63.644  33.389  1.00 124.70 ? 450  ARG A CA  1 
ATOM   2866 C  C   . ARG A 1 450 ? 20.378  64.892  33.342  1.00 124.70 ? 450  ARG A C   1 
ATOM   2867 O  O   . ARG A 1 450 ? 19.586  65.065  32.440  1.00 124.70 ? 450  ARG A O   1 
ATOM   2868 C  CB  . ARG A 1 450 ? 20.775  62.743  32.301  1.00 124.70 ? 450  ARG A CB  1 
ATOM   2869 N  N   . ASP A 1 451 ? 20.621  65.818  34.250  1.00 124.70 ? 451  ASP A N   1 
ATOM   2870 C  CA  . ASP A 1 451 ? 19.881  67.084  34.237  1.00 124.70 ? 451  ASP A CA  1 
ATOM   2871 C  C   . ASP A 1 451 ? 20.535  67.890  35.353  1.00 124.70 ? 451  ASP A C   1 
ATOM   2872 O  O   . ASP A 1 451 ? 20.012  67.945  36.442  1.00 124.70 ? 451  ASP A O   1 
ATOM   2873 C  CB  . ASP A 1 451 ? 18.365  66.879  34.557  1.00 124.70 ? 451  ASP A CB  1 
ATOM   2874 C  CG  . ASP A 1 451 ? 17.428  67.671  33.609  1.00 124.70 ? 451  ASP A CG  1 
ATOM   2875 O  OD1 . ASP A 1 451 ? 17.732  68.843  33.316  1.00 124.70 ? 451  ASP A OD1 1 
ATOM   2876 O  OD2 . ASP A 1 451 ? 16.395  67.123  33.152  1.00 124.70 ? 451  ASP A OD2 1 
ATOM   2877 N  N   . ILE A 1 452 ? 21.671  68.531  35.173  1.00 124.70 ? 452  ILE A N   1 
ATOM   2878 C  CA  . ILE A 1 452 ? 22.152  69.206  36.385  1.00 124.70 ? 452  ILE A CA  1 
ATOM   2879 C  C   . ILE A 1 452 ? 21.943  70.719  36.338  1.00 124.70 ? 452  ILE A C   1 
ATOM   2880 O  O   . ILE A 1 452 ? 22.869  71.479  36.708  1.00 124.70 ? 452  ILE A O   1 
ATOM   2881 C  CB  . ILE A 1 452 ? 23.638  68.905  36.636  1.00 124.70 ? 452  ILE A CB  1 
ATOM   2882 C  CG1 . ILE A 1 452 ? 24.404  69.119  35.327  1.00 124.70 ? 452  ILE A CG1 1 
ATOM   2883 C  CG2 . ILE A 1 452 ? 23.825  67.450  37.135  1.00 124.70 ? 452  ILE A CG2 1 
ATOM   2884 C  CD1 . ILE A 1 452 ? 25.680  69.835  35.458  1.00 124.70 ? 452  ILE A CD1 1 
ATOM   2885 N  N   . PRO A 1 455 ? 22.765  71.376  41.359  1.00 124.70 ? 455  PRO A N   1 
ATOM   2886 C  CA  . PRO A 1 455 ? 21.889  70.927  42.457  1.00 124.70 ? 455  PRO A CA  1 
ATOM   2887 C  C   . PRO A 1 455 ? 22.358  71.560  43.745  1.00 124.70 ? 455  PRO A C   1 
ATOM   2888 O  O   . PRO A 1 455 ? 23.170  70.997  44.470  1.00 124.70 ? 455  PRO A O   1 
ATOM   2889 C  CB  . PRO A 1 455 ? 21.993  69.415  42.520  1.00 124.70 ? 455  PRO A CB  1 
ATOM   2890 C  CG  . PRO A 1 455 ? 22.404  69.080  41.067  1.00 124.70 ? 455  PRO A CG  1 
ATOM   2891 C  CD  . PRO A 1 455 ? 23.351  70.214  40.668  1.00 124.70 ? 455  PRO A CD  1 
ATOM   2892 N  N   . ASP A 1 456 ? 21.853  72.750  44.026  1.00 124.70 ? 456  ASP A N   1 
ATOM   2893 C  CA  . ASP A 1 456 ? 22.258  73.433  45.243  1.00 124.70 ? 456  ASP A CA  1 
ATOM   2894 C  C   . ASP A 1 456 ? 21.310  73.157  46.378  1.00 124.70 ? 456  ASP A C   1 
ATOM   2895 O  O   . ASP A 1 456 ? 20.798  74.055  47.006  1.00 124.70 ? 456  ASP A O   1 
ATOM   2896 C  CB  . ASP A 1 456 ? 22.368  74.935  45.006  1.00 124.70 ? 456  ASP A CB  1 
ATOM   2897 C  CG  . ASP A 1 456 ? 23.445  75.275  44.011  1.00 124.70 ? 456  ASP A CG  1 
ATOM   2898 O  OD1 . ASP A 1 456 ? 24.337  74.420  43.788  1.00 124.70 ? 456  ASP A OD1 1 
ATOM   2899 O  OD2 . ASP A 1 456 ? 23.406  76.392  43.454  1.00 124.70 ? 456  ASP A OD2 1 
ATOM   2900 N  N   . GLY A 1 457 ? 21.054  71.900  46.653  1.00 124.70 ? 457  GLY A N   1 
ATOM   2901 C  CA  . GLY A 1 457 ? 20.161  71.676  47.750  1.00 124.70 ? 457  GLY A CA  1 
ATOM   2902 C  C   . GLY A 1 457 ? 19.192  70.592  47.457  1.00 124.70 ? 457  GLY A C   1 
ATOM   2903 O  O   . GLY A 1 457 ? 18.986  70.199  46.315  1.00 124.70 ? 457  GLY A O   1 
ATOM   2904 N  N   . LEU A 1 458 ? 18.595  70.100  48.522  1.00 124.70 ? 458  LEU A N   1 
ATOM   2905 C  CA  . LEU A 1 458 ? 17.635  69.042  48.401  1.00 124.70 ? 458  LEU A CA  1 
ATOM   2906 C  C   . LEU A 1 458 ? 16.757  69.193  49.607  1.00 124.70 ? 458  LEU A C   1 
ATOM   2907 O  O   . LEU A 1 458 ? 16.935  70.091  50.431  1.00 124.70 ? 458  LEU A O   1 
ATOM   2908 C  CB  . LEU A 1 458 ? 18.347  67.694  48.436  1.00 124.70 ? 458  LEU A CB  1 
ATOM   2909 C  CG  . LEU A 1 458 ? 19.637  67.653  47.611  1.00 124.70 ? 458  LEU A CG  1 
ATOM   2910 C  CD1 . LEU A 1 458 ? 20.623  66.643  48.182  1.00 124.70 ? 458  LEU A CD1 1 
ATOM   2911 C  CD2 . LEU A 1 458 ? 19.286  67.337  46.177  1.00 124.70 ? 458  LEU A CD2 1 
ATOM   2912 N  N   . ALA A 1 459 ? 15.795  68.303  49.684  1.00 124.70 ? 459  ALA A N   1 
ATOM   2913 C  CA  . ALA A 1 459 ? 14.859  68.246  50.774  1.00 124.70 ? 459  ALA A CA  1 
ATOM   2914 C  C   . ALA A 1 459 ? 14.307  66.912  50.409  1.00 124.70 ? 459  ALA A C   1 
ATOM   2915 O  O   . ALA A 1 459 ? 14.441  66.486  49.264  1.00 124.70 ? 459  ALA A O   1 
ATOM   2916 C  CB  . ALA A 1 459 ? 13.804  69.313  50.651  1.00 124.70 ? 459  ALA A CB  1 
ATOM   2917 N  N   . VAL A 1 460 ? 13.706  66.236  51.365  1.00 124.70 ? 460  VAL A N   1 
ATOM   2918 C  CA  . VAL A 1 460 ? 13.168  64.925  51.084  1.00 124.70 ? 460  VAL A CA  1 
ATOM   2919 C  C   . VAL A 1 460 ? 11.715  64.973  51.454  1.00 124.70 ? 460  VAL A C   1 
ATOM   2920 O  O   . VAL A 1 460 ? 11.337  65.748  52.319  1.00 124.70 ? 460  VAL A O   1 
ATOM   2921 C  CB  . VAL A 1 460 ? 13.818  63.849  51.985  1.00 124.70 ? 460  VAL A CB  1 
ATOM   2922 C  CG1 . VAL A 1 460 ? 13.568  62.471  51.415  1.00 124.70 ? 460  VAL A CG1 1 
ATOM   2923 C  CG2 . VAL A 1 460 ? 15.294  64.120  52.151  1.00 124.70 ? 460  VAL A CG2 1 
ATOM   2924 N  N   . ASP A 1 461 ? 10.872  64.213  50.779  1.00 124.70 ? 461  ASP A N   1 
ATOM   2925 C  CA  . ASP A 1 461 ? 9.525   64.194  51.274  1.00 124.70 ? 461  ASP A CA  1 
ATOM   2926 C  C   . ASP A 1 461 ? 9.652   62.860  51.942  1.00 124.70 ? 461  ASP A C   1 
ATOM   2927 O  O   . ASP A 1 461 ? 10.376  61.998  51.441  1.00 124.70 ? 461  ASP A O   1 
ATOM   2928 C  CB  . ASP A 1 461 ? 8.455   64.124  50.216  1.00 124.70 ? 461  ASP A CB  1 
ATOM   2929 C  CG  . ASP A 1 461 ? 7.077   64.058  50.837  1.00 124.70 ? 461  ASP A CG  1 
ATOM   2930 O  OD1 . ASP A 1 461 ? 6.918   63.292  51.809  1.00 124.70 ? 461  ASP A OD1 1 
ATOM   2931 O  OD2 . ASP A 1 461 ? 6.157   64.764  50.380  1.00 124.70 ? 461  ASP A OD2 1 
ATOM   2932 N  N   . TRP A 1 462 ? 8.953   62.669  53.052  1.00 124.70 ? 462  TRP A N   1 
ATOM   2933 C  CA  . TRP A 1 462 ? 9.093   61.426  53.789  1.00 124.70 ? 462  TRP A CA  1 
ATOM   2934 C  C   . TRP A 1 462 ? 7.853   60.664  54.243  1.00 124.70 ? 462  TRP A C   1 
ATOM   2935 O  O   . TRP A 1 462 ? 7.905   59.989  55.266  1.00 124.70 ? 462  TRP A O   1 
ATOM   2936 C  CB  . TRP A 1 462 ? 9.940   61.718  55.001  1.00 124.70 ? 462  TRP A CB  1 
ATOM   2937 C  CG  . TRP A 1 462 ? 9.283   62.676  55.868  1.00 124.70 ? 462  TRP A CG  1 
ATOM   2938 C  CD1 . TRP A 1 462 ? 8.134   62.482  56.544  1.00 124.70 ? 462  TRP A CD1 1 
ATOM   2939 C  CD2 . TRP A 1 462 ? 9.740   63.983  56.208  1.00 124.70 ? 462  TRP A CD2 1 
ATOM   2940 N  NE1 . TRP A 1 462 ? 7.832   63.580  57.298  1.00 124.70 ? 462  TRP A NE1 1 
ATOM   2941 C  CE2 . TRP A 1 462 ? 8.805   64.520  57.111  1.00 124.70 ? 462  TRP A CE2 1 
ATOM   2942 C  CE3 . TRP A 1 462 ? 10.848  64.750  55.842  1.00 124.70 ? 462  TRP A CE3 1 
ATOM   2943 C  CZ2 . TRP A 1 462 ? 8.946   65.784  57.663  1.00 124.70 ? 462  TRP A CZ2 1 
ATOM   2944 C  CZ3 . TRP A 1 462 ? 10.987  66.006  56.389  1.00 124.70 ? 462  TRP A CZ3 1 
ATOM   2945 C  CH2 . TRP A 1 462 ? 10.038  66.513  57.291  1.00 124.70 ? 462  TRP A CH2 1 
ATOM   2946 N  N   . ILE A 1 463 ? 6.751   60.772  53.507  1.00 124.70 ? 463  ILE A N   1 
ATOM   2947 C  CA  . ILE A 1 463 ? 5.504   60.061  53.846  1.00 124.70 ? 463  ILE A CA  1 
ATOM   2948 C  C   . ILE A 1 463 ? 4.664   59.851  52.576  1.00 124.70 ? 463  ILE A C   1 
ATOM   2949 O  O   . ILE A 1 463 ? 3.457   59.582  52.615  1.00 124.70 ? 463  ILE A O   1 
ATOM   2950 C  CB  . ILE A 1 463 ? 4.667   60.845  54.878  1.00 124.70 ? 463  ILE A CB  1 
ATOM   2951 C  CG1 . ILE A 1 463 ? 4.160   62.154  54.264  1.00 124.70 ? 463  ILE A CG1 1 
ATOM   2952 C  CG2 . ILE A 1 463 ? 5.504   61.132  56.107  1.00 124.70 ? 463  ILE A CG2 1 
ATOM   2953 C  CD1 . ILE A 1 463 ? 3.202   62.914  55.155  1.00 124.70 ? 463  ILE A CD1 1 
ATOM   2954 N  N   . HIS A 1 464 ? 5.366   60.008  51.462  1.00 124.70 ? 464  HIS A N   1 
ATOM   2955 C  CA  . HIS A 1 464 ? 4.892   59.874  50.095  1.00 124.70 ? 464  HIS A CA  1 
ATOM   2956 C  C   . HIS A 1 464 ? 6.274   59.673  49.538  1.00 124.70 ? 464  HIS A C   1 
ATOM   2957 O  O   . HIS A 1 464 ? 6.908   60.655  49.174  1.00 124.70 ? 464  HIS A O   1 
ATOM   2958 C  CB  . HIS A 1 464 ? 4.438   61.215  49.509  1.00 124.70 ? 464  HIS A CB  1 
ATOM   2959 C  CG  . HIS A 1 464 ? 3.212   61.804  50.130  1.00 124.70 ? 464  HIS A CG  1 
ATOM   2960 N  ND1 . HIS A 1 464 ? 2.998   63.164  50.173  1.00 124.70 ? 464  HIS A ND1 1 
ATOM   2961 C  CD2 . HIS A 1 464 ? 2.096   61.227  50.638  1.00 124.70 ? 464  HIS A CD2 1 
ATOM   2962 C  CE1 . HIS A 1 464 ? 1.799   63.403  50.680  1.00 124.70 ? 464  HIS A CE1 1 
ATOM   2963 N  NE2 . HIS A 1 464 ? 1.232   62.246  50.968  1.00 124.70 ? 464  HIS A NE2 1 
ATOM   2964 N  N   . SER A 1 465 ? 6.798   58.464  49.504  1.00 124.70 ? 465  SER A N   1 
ATOM   2965 C  CA  . SER A 1 465 ? 8.131   58.397  48.966  1.00 124.70 ? 465  SER A CA  1 
ATOM   2966 C  C   . SER A 1 465 ? 8.003   59.085  47.599  1.00 124.70 ? 465  SER A C   1 
ATOM   2967 O  O   . SER A 1 465 ? 7.625   58.445  46.611  1.00 124.70 ? 465  SER A O   1 
ATOM   2968 C  CB  . SER A 1 465 ? 8.603   56.945  48.869  1.00 124.70 ? 465  SER A CB  1 
ATOM   2969 O  OG  . SER A 1 465 ? 9.907   56.829  49.433  1.00 124.70 ? 465  SER A OG  1 
ATOM   2970 N  N   . ASN A 1 466 ? 8.300   60.400  47.594  1.00 124.70 ? 466  ASN A N   1 
ATOM   2971 C  CA  . ASN A 1 466 ? 8.232   61.336  46.441  1.00 124.70 ? 466  ASN A CA  1 
ATOM   2972 C  C   . ASN A 1 466 ? 9.164   62.538  46.826  1.00 124.70 ? 466  ASN A C   1 
ATOM   2973 O  O   . ASN A 1 466 ? 9.092   63.003  47.950  1.00 124.70 ? 466  ASN A O   1 
ATOM   2974 C  CB  . ASN A 1 466 ? 6.752   61.729  46.232  1.00 124.70 ? 466  ASN A CB  1 
ATOM   2975 C  CG  . ASN A 1 466 ? 5.829   60.487  46.091  1.00 124.70 ? 466  ASN A CG  1 
ATOM   2976 O  OD1 . ASN A 1 466 ? 6.078   59.611  45.261  1.00 124.70 ? 466  ASN A OD1 1 
ATOM   2977 N  ND2 . ASN A 1 466 ? 4.783   60.412  46.907  1.00 124.70 ? 466  ASN A ND2 1 
ATOM   2978 N  N   . ILE A 1 467 ? 10.001  63.045  45.901  1.00 124.70 ? 467  ILE A N   1 
ATOM   2979 C  CA  . ILE A 1 467 ? 11.071  64.069  46.202  1.00 124.70 ? 467  ILE A CA  1 
ATOM   2980 C  C   . ILE A 1 467 ? 11.345  65.475  45.528  1.00 124.70 ? 467  ILE A C   1 
ATOM   2981 O  O   . ILE A 1 467 ? 10.731  65.772  44.547  1.00 124.70 ? 467  ILE A O   1 
ATOM   2982 C  CB  . ILE A 1 467 ? 12.393  63.376  46.083  1.00 124.70 ? 467  ILE A CB  1 
ATOM   2983 C  CG1 . ILE A 1 467 ? 13.407  64.073  46.961  1.00 124.70 ? 467  ILE A CG1 1 
ATOM   2984 C  CG2 . ILE A 1 467 ? 12.857  63.425  44.638  1.00 124.70 ? 467  ILE A CG2 1 
ATOM   2985 C  CD1 . ILE A 1 467 ? 14.805  63.789  46.561  1.00 124.70 ? 467  ILE A CD1 1 
ATOM   2986 N  N   . TYR A 1 468 ? 12.351  66.257  46.002  1.00 124.70 ? 468  TYR A N   1 
ATOM   2987 C  CA  . TYR A 1 468 ? 12.682  67.615  45.479  1.00 124.70 ? 468  TYR A CA  1 
ATOM   2988 C  C   . TYR A 1 468 ? 14.144  68.028  45.247  1.00 124.70 ? 468  TYR A C   1 
ATOM   2989 O  O   . TYR A 1 468 ? 15.118  67.365  45.637  1.00 124.70 ? 468  TYR A O   1 
ATOM   2990 C  CB  . TYR A 1 468 ? 12.118  68.721  46.401  1.00 124.70 ? 468  TYR A CB  1 
ATOM   2991 C  CG  . TYR A 1 468 ? 10.664  68.617  46.677  1.00 124.70 ? 468  TYR A CG  1 
ATOM   2992 C  CD1 . TYR A 1 468 ? 10.195  67.748  47.648  1.00 124.70 ? 468  TYR A CD1 1 
ATOM   2993 C  CD2 . TYR A 1 468 ? 9.752   69.272  45.865  1.00 124.70 ? 468  TYR A CD2 1 
ATOM   2994 C  CE1 . TYR A 1 468 ? 8.880   67.517  47.785  1.00 124.70 ? 468  TYR A CE1 1 
ATOM   2995 C  CE2 . TYR A 1 468 ? 8.460   69.049  45.987  1.00 124.70 ? 468  TYR A CE2 1 
ATOM   2996 C  CZ  . TYR A 1 468 ? 8.026   68.148  46.952  1.00 124.70 ? 468  TYR A CZ  1 
ATOM   2997 O  OH  . TYR A 1 468 ? 6.755   67.719  47.050  1.00 124.70 ? 468  TYR A OH  1 
ATOM   2998 N  N   . TRP A 1 469 ? 14.255  69.199  44.623  1.00 124.70 ? 469  TRP A N   1 
ATOM   2999 C  CA  . TRP A 1 469 ? 15.533  69.832  44.357  1.00 124.70 ? 469  TRP A CA  1 
ATOM   3000 C  C   . TRP A 1 469 ? 15.540  71.137  43.620  1.00 124.70 ? 469  TRP A C   1 
ATOM   3001 O  O   . TRP A 1 469 ? 14.573  71.560  42.968  1.00 124.70 ? 469  TRP A O   1 
ATOM   3002 C  CB  . TRP A 1 469 ? 16.484  68.907  43.606  1.00 124.70 ? 469  TRP A CB  1 
ATOM   3003 C  CG  . TRP A 1 469 ? 16.186  68.730  42.159  1.00 124.70 ? 469  TRP A CG  1 
ATOM   3004 C  CD1 . TRP A 1 469 ? 16.798  69.347  41.098  1.00 124.70 ? 469  TRP A CD1 1 
ATOM   3005 C  CD2 . TRP A 1 469 ? 15.293  67.778  41.611  1.00 124.70 ? 469  TRP A CD2 1 
ATOM   3006 N  NE1 . TRP A 1 469 ? 16.345  68.814  39.919  1.00 124.70 ? 469  TRP A NE1 1 
ATOM   3007 C  CE2 . TRP A 1 469 ? 15.418  67.845  40.204  1.00 124.70 ? 469  TRP A CE2 1 
ATOM   3008 C  CE3 . TRP A 1 469 ? 14.399  66.862  42.173  1.00 124.70 ? 469  TRP A CE3 1 
ATOM   3009 C  CZ2 . TRP A 1 469 ? 14.679  67.026  39.349  1.00 124.70 ? 469  TRP A CZ2 1 
ATOM   3010 C  CZ3 . TRP A 1 469 ? 13.671  66.060  41.336  1.00 124.70 ? 469  TRP A CZ3 1 
ATOM   3011 C  CH2 . TRP A 1 469 ? 13.813  66.139  39.930  1.00 124.70 ? 469  TRP A CH2 1 
ATOM   3012 N  N   . THR A 1 470 ? 16.693  71.766  43.784  1.00 124.70 ? 470  THR A N   1 
ATOM   3013 C  CA  . THR A 1 470 ? 17.032  72.999  43.134  1.00 124.70 ? 470  THR A CA  1 
ATOM   3014 C  C   . THR A 1 470 ? 18.222  72.630  42.279  1.00 124.70 ? 470  THR A C   1 
ATOM   3015 O  O   . THR A 1 470 ? 19.224  72.091  42.761  1.00 124.70 ? 470  THR A O   1 
ATOM   3016 C  CB  . THR A 1 470 ? 17.427  74.102  44.129  1.00 124.70 ? 470  THR A CB  1 
ATOM   3017 O  OG1 . THR A 1 470 ? 17.771  75.285  43.400  1.00 124.70 ? 470  THR A OG1 1 
ATOM   3018 C  CG2 . THR A 1 470 ? 18.603  73.673  44.988  1.00 124.70 ? 470  THR A CG2 1 
ATOM   3019 N  N   . ASP A 1 471 ? 18.031  72.749  40.981  1.00 124.70 ? 471  ASP A N   1 
ATOM   3020 C  CA  . ASP A 1 471 ? 19.143  72.477  40.130  1.00 124.70 ? 471  ASP A CA  1 
ATOM   3021 C  C   . ASP A 1 471 ? 19.664  73.836  39.783  1.00 124.70 ? 471  ASP A C   1 
ATOM   3022 O  O   . ASP A 1 471 ? 18.903  74.735  39.433  1.00 124.70 ? 471  ASP A O   1 
ATOM   3023 C  CB  . ASP A 1 471 ? 18.741  71.712  38.887  1.00 124.70 ? 471  ASP A CB  1 
ATOM   3024 C  CG  . ASP A 1 471 ? 19.946  71.239  38.109  1.00 124.70 ? 471  ASP A CG  1 
ATOM   3025 O  OD1 . ASP A 1 471 ? 20.998  71.920  38.181  1.00 124.70 ? 471  ASP A OD1 1 
ATOM   3026 O  OD2 . ASP A 1 471 ? 19.842  70.200  37.427  1.00 124.70 ? 471  ASP A OD2 1 
ATOM   3027 N  N   . SER A 1 472 ? 20.954  74.012  39.976  1.00 124.70 ? 472  SER A N   1 
ATOM   3028 C  CA  . SER A 1 472 ? 21.497  75.278  39.663  1.00 124.70 ? 472  SER A CA  1 
ATOM   3029 C  C   . SER A 1 472 ? 21.556  75.509  38.171  1.00 124.70 ? 472  SER A C   1 
ATOM   3030 O  O   . SER A 1 472 ? 22.600  75.824  37.618  1.00 124.70 ? 472  SER A O   1 
ATOM   3031 C  CB  . SER A 1 472 ? 22.847  75.453  40.318  1.00 124.70 ? 472  SER A CB  1 
ATOM   3032 O  OG  . SER A 1 472 ? 22.692  75.259  41.701  1.00 124.70 ? 472  SER A OG  1 
ATOM   3033 N  N   . VAL A 1 473 ? 20.437  75.255  37.506  1.00 124.70 ? 473  VAL A N   1 
ATOM   3034 C  CA  . VAL A 1 473 ? 20.288  75.624  36.105  1.00 124.70 ? 473  VAL A CA  1 
ATOM   3035 C  C   . VAL A 1 473 ? 19.551  76.751  36.765  1.00 124.70 ? 473  VAL A C   1 
ATOM   3036 O  O   . VAL A 1 473 ? 18.841  76.504  37.752  1.00 124.70 ? 473  VAL A O   1 
ATOM   3037 C  CB  . VAL A 1 473 ? 19.310  74.753  35.341  1.00 124.70 ? 473  VAL A CB  1 
ATOM   3038 C  CG1 . VAL A 1 473 ? 18.357  75.634  34.531  1.00 124.70 ? 473  VAL A CG1 1 
ATOM   3039 C  CG2 . VAL A 1 473 ? 20.095  73.831  34.421  1.00 124.70 ? 473  VAL A CG2 1 
ATOM   3040 N  N   . LEU A 1 474 ? 19.639  77.978  36.315  1.00 124.70 ? 474  LEU A N   1 
ATOM   3041 C  CA  . LEU A 1 474 ? 18.985  78.844  37.241  1.00 124.70 ? 474  LEU A CA  1 
ATOM   3042 C  C   . LEU A 1 474 ? 17.542  79.244  37.128  1.00 124.70 ? 474  LEU A C   1 
ATOM   3043 O  O   . LEU A 1 474 ? 17.159  80.208  36.468  1.00 124.70 ? 474  LEU A O   1 
ATOM   3044 C  CB  . LEU A 1 474 ? 19.956  79.965  37.583  1.00 124.70 ? 474  LEU A CB  1 
ATOM   3045 C  CG  . LEU A 1 474 ? 21.103  79.096  38.175  1.00 124.70 ? 474  LEU A CG  1 
ATOM   3046 C  CD1 . LEU A 1 474 ? 22.278  79.930  38.610  1.00 124.70 ? 474  LEU A CD1 1 
ATOM   3047 C  CD2 . LEU A 1 474 ? 20.573  78.262  39.362  1.00 124.70 ? 474  LEU A CD2 1 
ATOM   3048 N  N   . GLY A 1 475 ? 16.778  78.415  37.853  1.00 124.70 ? 475  GLY A N   1 
ATOM   3049 C  CA  . GLY A 1 475 ? 15.339  78.489  37.986  1.00 124.70 ? 475  GLY A CA  1 
ATOM   3050 C  C   . GLY A 1 475 ? 14.678  77.120  37.881  1.00 124.70 ? 475  GLY A C   1 
ATOM   3051 O  O   . GLY A 1 475 ? 14.112  76.791  36.847  1.00 124.70 ? 475  GLY A O   1 
ATOM   3052 N  N   . THR A 1 476 ? 14.766  76.293  38.913  1.00 124.70 ? 476  THR A N   1 
ATOM   3053 C  CA  . THR A 1 476 ? 14.099  75.001  38.856  1.00 124.70 ? 476  THR A CA  1 
ATOM   3054 C  C   . THR A 1 476 ? 13.771  74.560  40.239  1.00 124.70 ? 476  THR A C   1 
ATOM   3055 O  O   . THR A 1 476 ? 14.256  75.093  41.227  1.00 124.70 ? 476  THR A O   1 
ATOM   3056 C  CB  . THR A 1 476 ? 14.940  73.873  38.227  1.00 124.70 ? 476  THR A CB  1 
ATOM   3057 O  OG1 . THR A 1 476 ? 16.171  73.731  38.945  1.00 124.70 ? 476  THR A OG1 1 
ATOM   3058 C  CG2 . THR A 1 476 ? 15.208  74.149  36.775  1.00 124.70 ? 476  THR A CG2 1 
ATOM   3059 N  N   . VAL A 1 477 ? 12.928  73.561  40.293  1.00 124.70 ? 477  VAL A N   1 
ATOM   3060 C  CA  . VAL A 1 477 ? 12.505  72.989  41.531  1.00 124.70 ? 477  VAL A CA  1 
ATOM   3061 C  C   . VAL A 1 477 ? 11.890  71.797  40.921  1.00 124.70 ? 477  VAL A C   1 
ATOM   3062 O  O   . VAL A 1 477 ? 11.785  71.696  39.706  1.00 124.70 ? 477  VAL A O   1 
ATOM   3063 C  CB  . VAL A 1 477 ? 11.398  73.793  42.183  1.00 124.70 ? 477  VAL A CB  1 
ATOM   3064 C  CG1 . VAL A 1 477 ? 11.049  73.179  43.523  1.00 124.70 ? 477  VAL A CG1 1 
ATOM   3065 C  CG2 . VAL A 1 477 ? 11.821  75.241  42.338  1.00 124.70 ? 477  VAL A CG2 1 
ATOM   3066 N  N   . SER A 1 478 ? 11.464  70.874  41.725  1.00 124.70 ? 478  SER A N   1 
ATOM   3067 C  CA  . SER A 1 478 ? 10.869  69.774  41.081  1.00 124.70 ? 478  SER A CA  1 
ATOM   3068 C  C   . SER A 1 478 ? 10.612  68.887  42.190  1.00 124.70 ? 478  SER A C   1 
ATOM   3069 O  O   . SER A 1 478 ? 10.705  69.228  43.353  1.00 124.70 ? 478  SER A O   1 
ATOM   3070 C  CB  . SER A 1 478 ? 11.883  69.078  40.189  1.00 124.70 ? 478  SER A CB  1 
ATOM   3071 O  OG  . SER A 1 478 ? 12.905  68.564  41.005  1.00 124.70 ? 478  SER A OG  1 
ATOM   3072 N  N   . VAL A 1 479 ? 10.374  67.685  41.760  1.00 124.70 ? 479  VAL A N   1 
ATOM   3073 C  CA  . VAL A 1 479 ? 10.184  66.594  42.613  1.00 124.70 ? 479  VAL A CA  1 
ATOM   3074 C  C   . VAL A 1 479 ? 10.569  65.503  41.665  1.00 124.70 ? 479  VAL A C   1 
ATOM   3075 O  O   . VAL A 1 479 ? 10.181  65.517  40.500  1.00 124.70 ? 479  VAL A O   1 
ATOM   3076 C  CB  . VAL A 1 479 ? 8.734   66.485  43.103  1.00 124.70 ? 479  VAL A CB  1 
ATOM   3077 C  CG1 . VAL A 1 479 ? 7.790   67.055  42.082  1.00 124.70 ? 479  VAL A CG1 1 
ATOM   3078 C  CG2 . VAL A 1 479 ? 8.401   65.047  43.416  1.00 124.70 ? 479  VAL A CG2 1 
ATOM   3079 N  N   . ALA A 1 480 ? 11.410  64.599  42.122  1.00 124.70 ? 480  ALA A N   1 
ATOM   3080 C  CA  . ALA A 1 480 ? 11.797  63.494  41.264  1.00 124.70 ? 480  ALA A CA  1 
ATOM   3081 C  C   . ALA A 1 480 ? 11.162  62.412  42.013  1.00 124.70 ? 480  ALA A C   1 
ATOM   3082 O  O   . ALA A 1 480 ? 10.918  62.554  43.209  1.00 124.70 ? 480  ALA A O   1 
ATOM   3083 C  CB  . ALA A 1 480 ? 13.280  63.274  41.257  1.00 124.70 ? 480  ALA A CB  1 
ATOM   3084 N  N   . ASP A 1 481 ? 10.865  61.303  41.388  1.00 124.70 ? 481  ASP A N   1 
ATOM   3085 C  CA  . ASP A 1 481 ? 10.273  60.444  42.315  1.00 124.70 ? 481  ASP A CA  1 
ATOM   3086 C  C   . ASP A 1 481 ? 11.201  59.589  43.037  1.00 124.70 ? 481  ASP A C   1 
ATOM   3087 O  O   . ASP A 1 481 ? 12.422  59.561  42.850  1.00 124.70 ? 481  ASP A O   1 
ATOM   3088 C  CB  . ASP A 1 481 ? 9.152   59.609  41.782  1.00 124.70 ? 481  ASP A CB  1 
ATOM   3089 C  CG  . ASP A 1 481 ? 8.083   59.395  42.833  1.00 124.70 ? 481  ASP A CG  1 
ATOM   3090 O  OD1 . ASP A 1 481 ? 8.436   59.353  44.031  1.00 124.70 ? 481  ASP A OD1 1 
ATOM   3091 O  OD2 . ASP A 1 481 ? 6.895   59.272  42.480  1.00 124.70 ? 481  ASP A OD2 1 
ATOM   3092 N  N   . THR A 1 482 ? 10.540  58.902  43.927  1.00 124.70 ? 482  THR A N   1 
ATOM   3093 C  CA  . THR A 1 482 ? 11.173  58.026  44.803  1.00 124.70 ? 482  THR A CA  1 
ATOM   3094 C  C   . THR A 1 482 ? 11.409  56.709  44.198  1.00 124.70 ? 482  THR A C   1 
ATOM   3095 O  O   . THR A 1 482 ? 10.764  56.282  43.219  1.00 124.70 ? 482  THR A O   1 
ATOM   3096 C  CB  . THR A 1 482 ? 10.380  57.910  46.041  1.00 124.70 ? 482  THR A CB  1 
ATOM   3097 O  OG1 . THR A 1 482 ? 10.378  59.196  46.677  1.00 124.70 ? 482  THR A OG1 1 
ATOM   3098 C  CG2 . THR A 1 482 ? 10.997  56.890  46.951  1.00 124.70 ? 482  THR A CG2 1 
ATOM   3099 N  N   . LYS A 1 483 ? 12.389  56.074  44.812  1.00 124.70 ? 483  LYS A N   1 
ATOM   3100 C  CA  . LYS A 1 483 ? 12.815  54.802  44.354  1.00 124.70 ? 483  LYS A CA  1 
ATOM   3101 C  C   . LYS A 1 483 ? 13.266  55.241  42.938  1.00 124.70 ? 483  LYS A C   1 
ATOM   3102 O  O   . LYS A 1 483 ? 13.020  54.561  41.946  1.00 124.70 ? 483  LYS A O   1 
ATOM   3103 C  CB  . LYS A 1 483 ? 11.605  53.840  44.380  1.00 124.70 ? 483  LYS A CB  1 
ATOM   3104 C  CG  . LYS A 1 483 ? 10.793  53.910  45.707  1.00 124.70 ? 483  LYS A CG  1 
ATOM   3105 C  CD  . LYS A 1 483 ? 10.338  52.537  46.195  1.00 124.70 ? 483  LYS A CD  1 
ATOM   3106 C  CE  . LYS A 1 483 ? 10.168  52.514  47.713  1.00 124.70 ? 483  LYS A CE  1 
ATOM   3107 N  NZ  . LYS A 1 483 ? 10.115  51.117  48.224  1.00 124.70 ? 483  LYS A NZ  1 
ATOM   3108 N  N   . GLY A 1 484 ? 13.874  56.439  42.883  1.00 124.70 ? 484  GLY A N   1 
ATOM   3109 C  CA  . GLY A 1 484 ? 14.407  57.056  41.658  1.00 124.70 ? 484  GLY A CA  1 
ATOM   3110 C  C   . GLY A 1 484 ? 13.781  56.941  40.260  1.00 124.70 ? 484  GLY A C   1 
ATOM   3111 O  O   . GLY A 1 484 ? 14.474  56.521  39.323  1.00 124.70 ? 484  GLY A O   1 
ATOM   3112 N  N   . VAL A 1 485 ? 12.513  57.335  40.082  1.00 124.70 ? 485  VAL A N   1 
ATOM   3113 C  CA  . VAL A 1 485 ? 11.871  57.223  38.755  1.00 124.70 ? 485  VAL A CA  1 
ATOM   3114 C  C   . VAL A 1 485 ? 10.533  57.966  38.491  1.00 124.70 ? 485  VAL A C   1 
ATOM   3115 O  O   . VAL A 1 485 ? 9.493   57.308  38.448  1.00 124.70 ? 485  VAL A O   1 
ATOM   3116 C  CB  . VAL A 1 485 ? 11.578  55.714  38.395  1.00 124.70 ? 485  VAL A CB  1 
ATOM   3117 C  CG1 . VAL A 1 485 ? 11.248  55.576  36.911  1.00 124.70 ? 485  VAL A CG1 1 
ATOM   3118 C  CG2 . VAL A 1 485 ? 12.749  54.806  38.764  1.00 124.70 ? 485  VAL A CG2 1 
ATOM   3119 N  N   . LYS A 1 486 ? 10.541  59.290  38.304  1.00 124.70 ? 486  LYS A N   1 
ATOM   3120 C  CA  . LYS A 1 486 ? 9.310   60.071  37.993  1.00 124.70 ? 486  LYS A CA  1 
ATOM   3121 C  C   . LYS A 1 486 ? 9.697   61.531  37.916  1.00 124.70 ? 486  LYS A C   1 
ATOM   3122 O  O   . LYS A 1 486 ? 10.119  62.089  38.917  1.00 124.70 ? 486  LYS A O   1 
ATOM   3123 C  CB  . LYS A 1 486 ? 8.237   60.007  39.091  1.00 124.70 ? 486  LYS A CB  1 
ATOM   3124 C  CG  . LYS A 1 486 ? 7.743   58.650  39.541  1.00 124.70 ? 486  LYS A CG  1 
ATOM   3125 C  CD  . LYS A 1 486 ? 6.736   58.042  38.619  1.00 124.70 ? 486  LYS A CD  1 
ATOM   3126 C  CE  . LYS A 1 486 ? 6.206   56.765  39.245  1.00 124.70 ? 486  LYS A CE  1 
ATOM   3127 N  NZ  . LYS A 1 486 ? 4.718   56.771  39.343  1.00 124.70 ? 486  LYS A NZ  1 
ATOM   3128 N  N   . ARG A 1 487 ? 9.551   62.207  36.793  1.00 124.70 ? 487  ARG A N   1 
ATOM   3129 C  CA  . ARG A 1 487 ? 9.985   63.583  36.906  1.00 124.70 ? 487  ARG A CA  1 
ATOM   3130 C  C   . ARG A 1 487 ? 9.165   64.723  36.341  1.00 124.70 ? 487  ARG A C   1 
ATOM   3131 O  O   . ARG A 1 487 ? 8.797   64.739  35.166  1.00 124.70 ? 487  ARG A O   1 
ATOM   3132 C  CB  . ARG A 1 487 ? 11.420  63.708  36.417  1.00 124.70 ? 487  ARG A CB  1 
ATOM   3133 C  CG  . ARG A 1 487 ? 11.998  65.040  36.747  1.00 124.70 ? 487  ARG A CG  1 
ATOM   3134 C  CD  . ARG A 1 487 ? 13.330  65.167  36.149  1.00 124.70 ? 487  ARG A CD  1 
ATOM   3135 N  NE  . ARG A 1 487 ? 13.544  66.545  35.752  1.00 124.70 ? 487  ARG A NE  1 
ATOM   3136 C  CZ  . ARG A 1 487 ? 14.551  66.927  34.987  1.00 124.70 ? 487  ARG A CZ  1 
ATOM   3137 N  NH1 . ARG A 1 487 ? 15.413  66.013  34.553  1.00 124.70 ? 487  ARG A NH1 1 
ATOM   3138 N  NH2 . ARG A 1 487 ? 14.694  68.204  34.656  1.00 124.70 ? 487  ARG A NH2 1 
ATOM   3139 N  N   . LYS A 1 488 ? 8.897   65.691  37.209  1.00 124.70 ? 488  LYS A N   1 
ATOM   3140 C  CA  . LYS A 1 488 ? 8.152   66.879  36.841  1.00 124.70 ? 488  LYS A CA  1 
ATOM   3141 C  C   . LYS A 1 488 ? 8.903   68.055  37.436  1.00 124.70 ? 488  LYS A C   1 
ATOM   3142 O  O   . LYS A 1 488 ? 9.239   68.076  38.619  1.00 124.70 ? 488  LYS A O   1 
ATOM   3143 C  CB  . LYS A 1 488 ? 6.728   66.816  37.381  1.00 124.70 ? 488  LYS A CB  1 
ATOM   3144 N  N   . THR A 1 489 ? 9.175   69.029  36.588  1.00 124.70 ? 489  THR A N   1 
ATOM   3145 C  CA  . THR A 1 489 ? 9.900   70.222  36.970  1.00 124.70 ? 489  THR A CA  1 
ATOM   3146 C  C   . THR A 1 489 ? 8.908   71.309  37.383  1.00 124.70 ? 489  THR A C   1 
ATOM   3147 O  O   . THR A 1 489 ? 7.716   71.203  37.103  1.00 124.70 ? 489  THR A O   1 
ATOM   3148 C  CB  . THR A 1 489 ? 10.753  70.685  35.767  1.00 124.70 ? 489  THR A CB  1 
ATOM   3149 O  OG1 . THR A 1 489 ? 11.731  69.676  35.466  1.00 124.70 ? 489  THR A OG1 1 
ATOM   3150 C  CG2 . THR A 1 489 ? 11.444  72.002  36.051  1.00 124.70 ? 489  THR A CG2 1 
ATOM   3151 N  N   . LEU A 1 490 ? 9.408   72.331  38.074  1.00 124.70 ? 490  LEU A N   1 
ATOM   3152 C  CA  . LEU A 1 490 ? 8.613   73.472  38.524  1.00 124.70 ? 490  LEU A CA  1 
ATOM   3153 C  C   . LEU A 1 490 ? 9.508   74.675  38.724  1.00 124.70 ? 490  LEU A C   1 
ATOM   3154 O  O   . LEU A 1 490 ? 10.715  74.567  38.933  1.00 124.70 ? 490  LEU A O   1 
ATOM   3155 C  CB  . LEU A 1 490 ? 7.898   73.185  39.842  1.00 124.70 ? 490  LEU A CB  1 
ATOM   3156 C  CG  . LEU A 1 490 ? 6.797   72.133  39.801  1.00 124.70 ? 490  LEU A CG  1 
ATOM   3157 C  CD1 . LEU A 1 490 ? 6.152   72.006  41.169  1.00 124.70 ? 490  LEU A CD1 1 
ATOM   3158 C  CD2 . LEU A 1 490 ? 5.767   72.525  38.750  1.00 124.70 ? 490  LEU A CD2 1 
ATOM   3159 N  N   . PHE A 1 491 ? 8.881   75.829  38.682  1.00 124.70 ? 491  PHE A N   1 
ATOM   3160 C  CA  . PHE A 1 491 ? 9.557   77.094  38.834  1.00 124.70 ? 491  PHE A CA  1 
ATOM   3161 C  C   . PHE A 1 491 ? 10.662  77.423  37.855  1.00 124.70 ? 491  PHE A C   1 
ATOM   3162 O  O   . PHE A 1 491 ? 11.785  77.784  38.231  1.00 124.70 ? 491  PHE A O   1 
ATOM   3163 C  CB  . PHE A 1 491 ? 10.102  77.309  40.236  1.00 124.70 ? 491  PHE A CB  1 
ATOM   3164 C  CG  . PHE A 1 491 ? 10.491  78.745  40.489  1.00 124.70 ? 491  PHE A CG  1 
ATOM   3165 C  CD1 . PHE A 1 491 ? 9.510   79.730  40.576  1.00 124.70 ? 491  PHE A CD1 1 
ATOM   3166 C  CD2 . PHE A 1 491 ? 11.833  79.123  40.562  1.00 124.70 ? 491  PHE A CD2 1 
ATOM   3167 C  CE1 . PHE A 1 491 ? 9.855   81.066  40.729  1.00 124.70 ? 491  PHE A CE1 1 
ATOM   3168 C  CE2 . PHE A 1 491 ? 12.188  80.459  40.714  1.00 124.70 ? 491  PHE A CE2 1 
ATOM   3169 C  CZ  . PHE A 1 491 ? 11.194  81.435  40.797  1.00 124.70 ? 491  PHE A CZ  1 
ATOM   3170 N  N   . ARG A 1 492 ? 10.376  77.259  36.582  1.00 124.70 ? 492  ARG A N   1 
ATOM   3171 C  CA  . ARG A 1 492 ? 11.373  77.722  35.657  1.00 124.70 ? 492  ARG A CA  1 
ATOM   3172 C  C   . ARG A 1 492 ? 11.410  79.230  35.967  1.00 124.70 ? 492  ARG A C   1 
ATOM   3173 O  O   . ARG A 1 492 ? 10.400  79.812  36.351  1.00 124.70 ? 492  ARG A O   1 
ATOM   3174 C  CB  . ARG A 1 492 ? 10.938  77.450  34.226  1.00 124.70 ? 492  ARG A CB  1 
ATOM   3175 C  CG  . ARG A 1 492 ? 11.439  76.110  33.686  1.00 124.70 ? 492  ARG A CG  1 
ATOM   3176 C  CD  . ARG A 1 492 ? 12.811  76.263  33.046  1.00 124.70 ? 492  ARG A CD  1 
ATOM   3177 N  NE  . ARG A 1 492 ? 13.333  74.989  32.559  1.00 124.70 ? 492  ARG A NE  1 
ATOM   3178 C  CZ  . ARG A 1 492 ? 14.481  74.852  31.898  1.00 124.70 ? 492  ARG A CZ  1 
ATOM   3179 N  NH1 . ARG A 1 492 ? 15.233  75.918  31.636  1.00 124.70 ? 492  ARG A NH1 1 
ATOM   3180 N  NH2 . ARG A 1 492 ? 14.881  73.648  31.504  1.00 124.70 ? 492  ARG A NH2 1 
ATOM   3181 N  N   . GLU A 1 493 ? 12.592  79.823  35.874  1.00 124.70 ? 493  GLU A N   1 
ATOM   3182 C  CA  . GLU A 1 493 ? 12.810  81.240  36.137  1.00 124.70 ? 493  GLU A CA  1 
ATOM   3183 C  C   . GLU A 1 493 ? 14.294  81.387  35.976  1.00 124.70 ? 493  GLU A C   1 
ATOM   3184 O  O   . GLU A 1 493 ? 15.035  80.963  36.848  1.00 124.70 ? 493  GLU A O   1 
ATOM   3185 C  CB  . GLU A 1 493 ? 12.445  81.590  37.573  1.00 124.70 ? 493  GLU A CB  1 
ATOM   3186 C  CG  . GLU A 1 493 ? 12.709  83.039  37.895  1.00 124.70 ? 493  GLU A CG  1 
ATOM   3187 C  CD  . GLU A 1 493 ? 11.938  83.948  36.982  1.00 124.70 ? 493  GLU A CD  1 
ATOM   3188 O  OE1 . GLU A 1 493 ? 11.256  83.429  36.074  1.00 124.70 ? 493  GLU A OE1 1 
ATOM   3189 O  OE2 . GLU A 1 493 ? 12.006  85.175  37.169  1.00 124.70 ? 493  GLU A OE2 1 
ATOM   3190 N  N   . GLN A 1 494 ? 14.766  81.966  34.887  1.00 124.70 ? 494  GLN A N   1 
ATOM   3191 C  CA  . GLN A 1 494 ? 16.207  82.024  34.774  1.00 124.70 ? 494  GLN A CA  1 
ATOM   3192 C  C   . GLN A 1 494 ? 16.840  83.244  35.397  1.00 124.70 ? 494  GLN A C   1 
ATOM   3193 O  O   . GLN A 1 494 ? 17.557  84.011  34.765  1.00 124.70 ? 494  GLN A O   1 
ATOM   3194 C  CB  . GLN A 1 494 ? 16.628  81.842  33.329  1.00 124.70 ? 494  GLN A CB  1 
ATOM   3195 C  CG  . GLN A 1 494 ? 16.248  80.470  32.808  1.00 124.70 ? 494  GLN A CG  1 
ATOM   3196 C  CD  . GLN A 1 494 ? 17.320  79.899  31.905  1.00 124.70 ? 494  GLN A CD  1 
ATOM   3197 O  OE1 . GLN A 1 494 ? 18.487  80.141  32.124  1.00 124.70 ? 494  GLN A OE1 1 
ATOM   3198 N  NE2 . GLN A 1 494 ? 16.936  79.128  30.907  1.00 124.70 ? 494  GLN A NE2 1 
ATOM   3199 N  N   . GLY A 1 495 ? 16.532  83.368  36.675  1.00 124.70 ? 495  GLY A N   1 
ATOM   3200 C  CA  . GLY A 1 495 ? 17.005  84.401  37.570  1.00 124.70 ? 495  GLY A CA  1 
ATOM   3201 C  C   . GLY A 1 495 ? 16.486  83.599  38.738  1.00 124.70 ? 495  GLY A C   1 
ATOM   3202 O  O   . GLY A 1 495 ? 15.280  83.513  38.947  1.00 124.70 ? 495  GLY A O   1 
ATOM   3203 N  N   . SER A 1 496 ? 17.368  82.977  39.496  1.00 124.70 ? 496  SER A N   1 
ATOM   3204 C  CA  . SER A 1 496 ? 16.873  82.081  40.544  1.00 124.70 ? 496  SER A CA  1 
ATOM   3205 C  C   . SER A 1 496 ? 18.092  81.553  41.202  1.00 124.70 ? 496  SER A C   1 
ATOM   3206 O  O   . SER A 1 496 ? 18.265  80.340  41.271  1.00 124.70 ? 496  SER A O   1 
ATOM   3207 C  CB  . SER A 1 496 ? 16.299  80.824  39.919  1.00 124.70 ? 496  SER A CB  1 
ATOM   3208 O  OG  . SER A 1 496 ? 17.393  79.997  39.510  1.00 124.70 ? 496  SER A OG  1 
ATOM   3209 N  N   . LYS A 1 497 ? 18.961  82.329  41.764  1.00 124.70 ? 497  LYS A N   1 
ATOM   3210 C  CA  . LYS A 1 497 ? 20.102  81.537  42.172  1.00 124.70 ? 497  LYS A CA  1 
ATOM   3211 C  C   . LYS A 1 497 ? 20.068  80.454  43.346  1.00 124.70 ? 497  LYS A C   1 
ATOM   3212 O  O   . LYS A 1 497 ? 21.117  80.185  43.895  1.00 124.70 ? 497  LYS A O   1 
ATOM   3213 C  CB  . LYS A 1 497 ? 21.277  82.517  42.305  1.00 124.70 ? 497  LYS A CB  1 
ATOM   3214 C  CG  . LYS A 1 497 ? 21.386  83.539  41.152  1.00 124.70 ? 497  LYS A CG  1 
ATOM   3215 C  CD  . LYS A 1 497 ? 22.172  83.012  39.947  1.00 124.70 ? 497  LYS A CD  1 
ATOM   3216 C  CE  . LYS A 1 497 ? 22.092  83.995  38.771  1.00 124.70 ? 497  LYS A CE  1 
ATOM   3217 N  NZ  . LYS A 1 497 ? 23.218  83.907  37.792  1.00 124.70 ? 497  LYS A NZ  1 
ATOM   3218 N  N   . PRO A 1 498 ? 18.898  79.808  43.717  1.00 124.70 ? 498  PRO A N   1 
ATOM   3219 C  CA  . PRO A 1 498 ? 18.833  78.801  44.802  1.00 124.70 ? 498  PRO A CA  1 
ATOM   3220 C  C   . PRO A 1 498 ? 19.821  77.715  45.208  1.00 124.70 ? 498  PRO A C   1 
ATOM   3221 O  O   . PRO A 1 498 ? 20.659  77.237  44.434  1.00 124.70 ? 498  PRO A O   1 
ATOM   3222 C  CB  . PRO A 1 498 ? 17.457  78.176  44.607  1.00 124.70 ? 498  PRO A CB  1 
ATOM   3223 C  CG  . PRO A 1 498 ? 16.649  79.337  44.317  1.00 124.70 ? 498  PRO A CG  1 
ATOM   3224 C  CD  . PRO A 1 498 ? 17.529  80.352  43.588  1.00 124.70 ? 498  PRO A CD  1 
ATOM   3225 N  N   . ARG A 1 499 ? 19.631  77.342  46.476  1.00 124.70 ? 499  ARG A N   1 
ATOM   3226 C  CA  . ARG A 1 499 ? 20.371  76.329  47.201  1.00 124.70 ? 499  ARG A CA  1 
ATOM   3227 C  C   . ARG A 1 499 ? 19.672  75.964  48.490  1.00 124.70 ? 499  ARG A C   1 
ATOM   3228 O  O   . ARG A 1 499 ? 20.312  75.632  49.487  1.00 124.70 ? 499  ARG A O   1 
ATOM   3229 C  CB  . ARG A 1 499 ? 21.766  76.796  47.597  1.00 124.70 ? 499  ARG A CB  1 
ATOM   3230 C  CG  . ARG A 1 499 ? 22.496  75.701  48.382  1.00 124.70 ? 499  ARG A CG  1 
ATOM   3231 C  CD  . ARG A 1 499 ? 23.489  76.224  49.379  1.00 124.70 ? 499  ARG A CD  1 
ATOM   3232 N  NE  . ARG A 1 499 ? 23.934  75.130  50.232  1.00 124.70 ? 499  ARG A NE  1 
ATOM   3233 C  CZ  . ARG A 1 499 ? 23.552  74.974  51.492  1.00 124.70 ? 499  ARG A CZ  1 
ATOM   3234 N  NH1 . ARG A 1 499 ? 22.721  75.845  52.049  1.00 124.70 ? 499  ARG A NH1 1 
ATOM   3235 N  NH2 . ARG A 1 499 ? 23.995  73.948  52.192  1.00 124.70 ? 499  ARG A NH2 1 
ATOM   3236 N  N   . ALA A 1 500 ? 18.369  76.017  48.545  1.00 124.70 ? 500  ALA A N   1 
ATOM   3237 C  CA  . ALA A 1 500 ? 17.892  75.654  49.836  1.00 124.70 ? 500  ALA A CA  1 
ATOM   3238 C  C   . ALA A 1 500 ? 16.458  75.534  49.926  1.00 124.70 ? 500  ALA A C   1 
ATOM   3239 O  O   . ALA A 1 500 ? 15.708  76.495  49.816  1.00 124.70 ? 500  ALA A O   1 
ATOM   3240 C  CB  . ALA A 1 500 ? 18.374  76.635  50.870  1.00 124.70 ? 500  ALA A CB  1 
ATOM   3241 N  N   . ILE A 1 501 ? 16.048  74.316  50.126  1.00 124.70 ? 501  ILE A N   1 
ATOM   3242 C  CA  . ILE A 1 501 ? 14.664  74.179  50.306  1.00 124.70 ? 501  ILE A CA  1 
ATOM   3243 C  C   . ILE A 1 501 ? 14.465  73.058  51.303  1.00 124.70 ? 501  ILE A C   1 
ATOM   3244 O  O   . ILE A 1 501 ? 15.328  72.191  51.510  1.00 124.70 ? 501  ILE A O   1 
ATOM   3245 C  CB  . ILE A 1 501 ? 13.937  73.953  48.955  1.00 124.70 ? 501  ILE A CB  1 
ATOM   3246 C  CG1 . ILE A 1 501 ? 13.864  72.462  48.669  1.00 124.70 ? 501  ILE A CG1 1 
ATOM   3247 C  CG2 . ILE A 1 501 ? 14.665  74.677  47.826  1.00 124.70 ? 501  ILE A CG2 1 
ATOM   3248 C  CD1 . ILE A 1 501 ? 13.304  72.138  47.318  1.00 124.70 ? 501  ILE A CD1 1 
ATOM   3249 N  N   . VAL A 1 502 ? 13.308  73.150  51.940  1.00 124.70 ? 502  VAL A N   1 
ATOM   3250 C  CA  . VAL A 1 502 ? 12.831  72.236  52.952  1.00 124.70 ? 502  VAL A CA  1 
ATOM   3251 C  C   . VAL A 1 502 ? 11.354  72.086  52.665  1.00 124.70 ? 502  VAL A C   1 
ATOM   3252 O  O   . VAL A 1 502 ? 10.700  73.028  52.229  1.00 124.70 ? 502  VAL A O   1 
ATOM   3253 C  CB  . VAL A 1 502 ? 12.994  72.844  54.336  1.00 124.70 ? 502  VAL A CB  1 
ATOM   3254 C  CG1 . VAL A 1 502 ? 14.470  72.997  54.662  1.00 124.70 ? 502  VAL A CG1 1 
ATOM   3255 C  CG2 . VAL A 1 502 ? 12.313  74.197  54.382  1.00 124.70 ? 502  VAL A CG2 1 
ATOM   3256 N  N   . VAL A 1 503 ? 10.818  70.906  52.896  1.00 124.70 ? 503  VAL A N   1 
ATOM   3257 C  CA  . VAL A 1 503 ? 9.410   70.700  52.629  1.00 124.70 ? 503  VAL A CA  1 
ATOM   3258 C  C   . VAL A 1 503 ? 8.712   70.557  53.941  1.00 124.70 ? 503  VAL A C   1 
ATOM   3259 O  O   . VAL A 1 503 ? 9.299   70.087  54.910  1.00 124.70 ? 503  VAL A O   1 
ATOM   3260 C  CB  . VAL A 1 503 ? 9.189   69.420  51.855  1.00 124.70 ? 503  VAL A CB  1 
ATOM   3261 C  CG1 . VAL A 1 503 ? 9.721   69.576  50.459  1.00 124.70 ? 503  VAL A CG1 1 
ATOM   3262 C  CG2 . VAL A 1 503 ? 9.912   68.281  52.552  1.00 124.70 ? 503  VAL A CG2 1 
ATOM   3263 N  N   . ASP A 1 504 ? 7.463   70.977  53.997  1.00 124.70 ? 504  ASP A N   1 
ATOM   3264 C  CA  . ASP A 1 504 ? 6.731   70.814  55.226  1.00 124.70 ? 504  ASP A CA  1 
ATOM   3265 C  C   . ASP A 1 504 ? 5.649   69.791  54.957  1.00 124.70 ? 504  ASP A C   1 
ATOM   3266 O  O   . ASP A 1 504 ? 4.524   70.147  54.620  1.00 124.70 ? 504  ASP A O   1 
ATOM   3267 C  CB  . ASP A 1 504 ? 6.098   72.125  55.658  1.00 124.70 ? 504  ASP A CB  1 
ATOM   3268 C  CG  . ASP A 1 504 ? 5.321   71.990  56.932  1.00 124.70 ? 504  ASP A CG  1 
ATOM   3269 O  OD1 . ASP A 1 504 ? 4.928   70.848  57.256  1.00 124.70 ? 504  ASP A OD1 1 
ATOM   3270 O  OD2 . ASP A 1 504 ? 5.088   73.020  57.600  1.00 124.70 ? 504  ASP A OD2 1 
ATOM   3271 N  N   . PRO A 1 505 ? 5.972   68.501  55.113  1.00 124.70 ? 505  PRO A N   1 
ATOM   3272 C  CA  . PRO A 1 505 ? 5.032   67.403  54.900  1.00 124.70 ? 505  PRO A CA  1 
ATOM   3273 C  C   . PRO A 1 505 ? 3.704   67.766  55.527  1.00 124.70 ? 505  PRO A C   1 
ATOM   3274 O  O   . PRO A 1 505 ? 3.628   68.729  56.282  1.00 124.70 ? 505  PRO A O   1 
ATOM   3275 C  CB  . PRO A 1 505 ? 5.720   66.246  55.592  1.00 124.70 ? 505  PRO A CB  1 
ATOM   3276 C  CG  . PRO A 1 505 ? 7.123   66.478  55.163  1.00 124.70 ? 505  PRO A CG  1 
ATOM   3277 C  CD  . PRO A 1 505 ? 7.339   67.977  55.221  1.00 124.70 ? 505  PRO A CD  1 
ATOM   3278 N  N   . VAL A 1 506 ? 2.657   67.008  55.231  1.00 124.70 ? 506  VAL A N   1 
ATOM   3279 C  CA  . VAL A 1 506 ? 1.337   67.336  55.771  1.00 124.70 ? 506  VAL A CA  1 
ATOM   3280 C  C   . VAL A 1 506 ? 0.987   68.770  55.439  1.00 124.70 ? 506  VAL A C   1 
ATOM   3281 O  O   . VAL A 1 506 ? 0.286   69.438  56.201  1.00 124.70 ? 506  VAL A O   1 
ATOM   3282 C  CB  . VAL A 1 506 ? 1.273   67.265  57.302  1.00 124.70 ? 506  VAL A CB  1 
ATOM   3283 C  CG1 . VAL A 1 506 ? 1.929   68.489  57.931  1.00 124.70 ? 506  VAL A CG1 1 
ATOM   3284 C  CG2 . VAL A 1 506 ? -0.170  67.179  57.739  1.00 124.70 ? 506  VAL A CG2 1 
ATOM   3285 N  N   . HIS A 1 507 ? 1.480   69.263  54.321  1.00 124.70 ? 507  HIS A N   1 
ATOM   3286 C  CA  . HIS A 1 507 ? 1.193   70.633  53.975  1.00 124.70 ? 507  HIS A CA  1 
ATOM   3287 C  C   . HIS A 1 507 ? 1.662   70.752  52.542  1.00 124.70 ? 507  HIS A C   1 
ATOM   3288 O  O   . HIS A 1 507 ? 2.857   70.861  52.318  1.00 124.70 ? 507  HIS A O   1 
ATOM   3289 C  CB  . HIS A 1 507 ? 2.028   71.601  54.847  1.00 124.70 ? 507  HIS A CB  1 
ATOM   3290 C  CG  . HIS A 1 507 ? 1.688   71.616  56.320  1.00 124.70 ? 507  HIS A CG  1 
ATOM   3291 N  ND1 . HIS A 1 507 ? 0.498   72.089  56.805  1.00 124.70 ? 507  HIS A ND1 1 
ATOM   3292 C  CD2 . HIS A 1 507 ? 2.417   71.230  57.398  1.00 124.70 ? 507  HIS A CD2 1 
ATOM   3293 C  CE1 . HIS A 1 507 ? 0.493   71.993  58.134  1.00 124.70 ? 507  HIS A CE1 1 
ATOM   3294 N  NE2 . HIS A 1 507 ? 1.641   71.476  58.511  1.00 124.70 ? 507  HIS A NE2 1 
ATOM   3295 N  N   . GLY A 1 508 ? 0.756   70.736  51.572  1.00 124.70 ? 508  GLY A N   1 
ATOM   3296 C  CA  . GLY A 1 508 ? 1.206   70.842  50.189  1.00 124.70 ? 508  GLY A CA  1 
ATOM   3297 C  C   . GLY A 1 508 ? 2.717   71.057  50.072  1.00 124.70 ? 508  GLY A C   1 
ATOM   3298 O  O   . GLY A 1 508 ? 3.446   70.227  49.561  1.00 124.70 ? 508  GLY A O   1 
ATOM   3299 N  N   . PHE A 1 509 ? 3.153   72.180  50.626  1.00 124.70 ? 509  PHE A N   1 
ATOM   3300 C  CA  . PHE A 1 509 ? 4.505   72.740  50.680  1.00 124.70 ? 509  PHE A CA  1 
ATOM   3301 C  C   . PHE A 1 509 ? 5.923   72.220  50.571  1.00 124.70 ? 509  PHE A C   1 
ATOM   3302 O  O   . PHE A 1 509 ? 6.240   71.031  50.564  1.00 124.70 ? 509  PHE A O   1 
ATOM   3303 C  CB  . PHE A 1 509 ? 4.519   73.646  51.879  1.00 124.70 ? 509  PHE A CB  1 
ATOM   3304 C  CG  . PHE A 1 509 ? 3.176   74.166  52.206  1.00 124.70 ? 509  PHE A CG  1 
ATOM   3305 C  CD1 . PHE A 1 509 ? 2.529   73.739  53.337  1.00 124.70 ? 509  PHE A CD1 1 
ATOM   3306 C  CD2 . PHE A 1 509 ? 2.519   75.040  51.346  1.00 124.70 ? 509  PHE A CD2 1 
ATOM   3307 C  CE1 . PHE A 1 509 ? 1.231   74.159  53.637  1.00 124.70 ? 509  PHE A CE1 1 
ATOM   3308 C  CE2 . PHE A 1 509 ? 1.224   75.470  51.631  1.00 124.70 ? 509  PHE A CE2 1 
ATOM   3309 C  CZ  . PHE A 1 509 ? 0.577   75.022  52.788  1.00 124.70 ? 509  PHE A CZ  1 
ATOM   3310 N  N   . MET A 1 510 ? 6.744   73.273  50.533  1.00 124.70 ? 510  MET A N   1 
ATOM   3311 C  CA  . MET A 1 510 ? 8.196   73.350  50.433  1.00 124.70 ? 510  MET A CA  1 
ATOM   3312 C  C   . MET A 1 510 ? 8.444   74.872  50.502  1.00 124.70 ? 510  MET A C   1 
ATOM   3313 O  O   . MET A 1 510 ? 7.513   75.658  50.364  1.00 124.70 ? 510  MET A O   1 
ATOM   3314 C  CB  . MET A 1 510 ? 8.685   72.840  49.075  1.00 124.70 ? 510  MET A CB  1 
ATOM   3315 C  CG  . MET A 1 510 ? 8.388   73.801  47.908  1.00 124.70 ? 510  MET A CG  1 
ATOM   3316 S  SD  . MET A 1 510 ? 9.006   73.370  46.228  1.00 124.70 ? 510  MET A SD  1 
ATOM   3317 C  CE  . MET A 1 510 ? 7.517   73.531  45.196  1.00 124.70 ? 510  MET A CE  1 
ATOM   3318 N  N   . TYR A 1 511 ? 9.686   75.288  50.711  1.00 124.70 ? 511  TYR A N   1 
ATOM   3319 C  CA  . TYR A 1 511 ? 10.019  76.712  50.784  1.00 124.70 ? 511  TYR A CA  1 
ATOM   3320 C  C   . TYR A 1 511 ? 11.424  76.849  50.256  1.00 124.70 ? 511  TYR A C   1 
ATOM   3321 O  O   . TYR A 1 511 ? 12.048  75.836  49.972  1.00 124.70 ? 511  TYR A O   1 
ATOM   3322 C  CB  . TYR A 1 511 ? 9.950   77.185  52.219  1.00 124.70 ? 511  TYR A CB  1 
ATOM   3323 C  CG  . TYR A 1 511 ? 8.569   77.035  52.810  1.00 124.70 ? 511  TYR A CG  1 
ATOM   3324 C  CD1 . TYR A 1 511 ? 7.660   78.094  52.796  1.00 124.70 ? 511  TYR A CD1 1 
ATOM   3325 C  CD2 . TYR A 1 511 ? 8.165   75.829  53.384  1.00 124.70 ? 511  TYR A CD2 1 
ATOM   3326 C  CE1 . TYR A 1 511 ? 6.387   77.957  53.346  1.00 124.70 ? 511  TYR A CE1 1 
ATOM   3327 C  CE2 . TYR A 1 511 ? 6.894   75.680  53.933  1.00 124.70 ? 511  TYR A CE2 1 
ATOM   3328 C  CZ  . TYR A 1 511 ? 6.013   76.748  53.914  1.00 124.70 ? 511  TYR A CZ  1 
ATOM   3329 O  OH  . TYR A 1 511 ? 4.766   76.611  54.480  1.00 124.70 ? 511  TYR A OH  1 
ATOM   3330 N  N   . TRP A 1 512 ? 11.951  78.063  50.114  1.00 124.70 ? 512  TRP A N   1 
ATOM   3331 C  CA  . TRP A 1 512 ? 13.299  78.127  49.570  1.00 124.70 ? 512  TRP A CA  1 
ATOM   3332 C  C   . TRP A 1 512 ? 14.134  79.393  49.589  1.00 124.70 ? 512  TRP A C   1 
ATOM   3333 O  O   . TRP A 1 512 ? 13.729  80.451  50.057  1.00 124.70 ? 512  TRP A O   1 
ATOM   3334 C  CB  . TRP A 1 512 ? 13.284  77.611  48.136  1.00 124.70 ? 512  TRP A CB  1 
ATOM   3335 C  CG  . TRP A 1 512 ? 12.743  78.575  47.160  1.00 124.70 ? 512  TRP A CG  1 
ATOM   3336 C  CD1 . TRP A 1 512 ? 13.282  79.774  46.819  1.00 124.70 ? 512  TRP A CD1 1 
ATOM   3337 C  CD2 . TRP A 1 512 ? 11.584  78.408  46.346  1.00 124.70 ? 512  TRP A CD2 1 
ATOM   3338 N  NE1 . TRP A 1 512 ? 12.547  80.358  45.823  1.00 124.70 ? 512  TRP A NE1 1 
ATOM   3339 C  CE2 . TRP A 1 512 ? 11.502  79.526  45.496  1.00 124.70 ? 512  TRP A CE2 1 
ATOM   3340 C  CE3 . TRP A 1 512 ? 10.628  77.392  46.211  1.00 124.70 ? 512  TRP A CE3 1 
ATOM   3341 C  CZ2 . TRP A 1 512 ? 10.472  79.694  44.561  1.00 124.70 ? 512  TRP A CZ2 1 
ATOM   3342 C  CZ3 . TRP A 1 512 ? 9.606   77.551  45.282  1.00 124.70 ? 512  TRP A CZ3 1 
ATOM   3343 C  CH2 . TRP A 1 512 ? 9.550   78.684  44.454  1.00 124.70 ? 512  TRP A CH2 1 
ATOM   3344 N  N   . THR A 1 513 ? 15.314  79.224  49.002  1.00 124.70 ? 513  THR A N   1 
ATOM   3345 C  CA  . THR A 1 513 ? 16.361  80.223  48.872  1.00 124.70 ? 513  THR A CA  1 
ATOM   3346 C  C   . THR A 1 513 ? 16.459  80.759  47.456  1.00 124.70 ? 513  THR A C   1 
ATOM   3347 O  O   . THR A 1 513 ? 16.022  80.117  46.515  1.00 124.70 ? 513  THR A O   1 
ATOM   3348 C  CB  . THR A 1 513 ? 17.705  79.575  49.190  1.00 124.70 ? 513  THR A CB  1 
ATOM   3349 O  OG1 . THR A 1 513 ? 17.586  78.879  50.422  1.00 124.70 ? 513  THR A OG1 1 
ATOM   3350 C  CG2 . THR A 1 513 ? 18.803  80.591  49.311  1.00 124.70 ? 513  THR A CG2 1 
ATOM   3351 N  N   . ASP A 1 514 ? 17.028  81.948  47.336  1.00 124.70 ? 514  ASP A N   1 
ATOM   3352 C  CA  . ASP A 1 514 ? 17.284  82.594  46.066  1.00 124.70 ? 514  ASP A CA  1 
ATOM   3353 C  C   . ASP A 1 514 ? 17.838  83.949  46.295  1.00 124.70 ? 514  ASP A C   1 
ATOM   3354 O  O   . ASP A 1 514 ? 17.826  84.490  47.390  1.00 124.70 ? 514  ASP A O   1 
ATOM   3355 C  CB  . ASP A 1 514 ? 16.058  82.792  45.167  1.00 124.70 ? 514  ASP A CB  1 
ATOM   3356 C  CG  . ASP A 1 514 ? 16.327  83.848  44.064  1.00 124.70 ? 514  ASP A CG  1 
ATOM   3357 O  OD1 . ASP A 1 514 ? 16.092  85.063  44.297  1.00 124.70 ? 514  ASP A OD1 1 
ATOM   3358 O  OD2 . ASP A 1 514 ? 16.823  83.474  42.982  1.00 124.70 ? 514  ASP A OD2 1 
ATOM   3359 N  N   . TRP A 1 515 ? 18.301  84.492  45.195  1.00 124.70 ? 515  TRP A N   1 
ATOM   3360 C  CA  . TRP A 1 515 ? 18.837  85.791  45.168  1.00 124.70 ? 515  TRP A CA  1 
ATOM   3361 C  C   . TRP A 1 515 ? 18.975  86.144  43.702  1.00 124.70 ? 515  TRP A C   1 
ATOM   3362 O  O   . TRP A 1 515 ? 20.070  86.418  43.245  1.00 124.70 ? 515  TRP A O   1 
ATOM   3363 C  CB  . TRP A 1 515 ? 20.164  85.806  45.909  1.00 124.70 ? 515  TRP A CB  1 
ATOM   3364 C  CG  . TRP A 1 515 ? 21.143  84.871  45.356  1.00 124.70 ? 515  TRP A CG  1 
ATOM   3365 C  CD1 . TRP A 1 515 ? 22.136  85.179  44.488  1.00 124.70 ? 515  TRP A CD1 1 
ATOM   3366 C  CD2 . TRP A 1 515 ? 21.282  83.474  45.654  1.00 124.70 ? 515  TRP A CD2 1 
ATOM   3367 N  NE1 . TRP A 1 515 ? 22.906  84.078  44.235  1.00 124.70 ? 515  TRP A NE1 1 
ATOM   3368 C  CE2 . TRP A 1 515 ? 22.418  83.018  44.951  1.00 124.70 ? 515  TRP A CE2 1 
ATOM   3369 C  CE3 . TRP A 1 515 ? 20.582  82.571  46.471  1.00 124.70 ? 515  TRP A CE3 1 
ATOM   3370 C  CZ2 . TRP A 1 515 ? 22.862  81.691  45.013  1.00 124.70 ? 515  TRP A CZ2 1 
ATOM   3371 C  CZ3 . TRP A 1 515 ? 21.024  81.243  46.536  1.00 124.70 ? 515  TRP A CZ3 1 
ATOM   3372 C  CH2 . TRP A 1 515 ? 22.164  80.825  45.824  1.00 124.70 ? 515  TRP A CH2 1 
ATOM   3373 N  N   . GLY A 1 516 ? 17.878  86.113  42.935  1.00 124.70 ? 516  GLY A N   1 
ATOM   3374 C  CA  . GLY A 1 516 ? 17.990  86.574  41.549  1.00 124.70 ? 516  GLY A CA  1 
ATOM   3375 C  C   . GLY A 1 516 ? 18.535  87.989  41.825  1.00 124.70 ? 516  GLY A C   1 
ATOM   3376 O  O   . GLY A 1 516 ? 19.493  88.096  42.579  1.00 124.70 ? 516  GLY A O   1 
ATOM   3377 N  N   . THR A 1 517 ? 18.040  89.092  41.247  1.00 124.70 ? 517  THR A N   1 
ATOM   3378 C  CA  . THR A 1 517 ? 18.588  90.391  41.741  1.00 124.70 ? 517  THR A CA  1 
ATOM   3379 C  C   . THR A 1 517 ? 17.676  91.057  42.735  1.00 124.70 ? 517  THR A C   1 
ATOM   3380 O  O   . THR A 1 517 ? 17.745  92.273  43.024  1.00 124.70 ? 517  THR A O   1 
ATOM   3381 C  CB  . THR A 1 517 ? 19.200  91.337  40.708  1.00 124.70 ? 517  THR A CB  1 
ATOM   3382 O  OG1 . THR A 1 517 ? 20.228  90.620  40.008  1.00 124.70 ? 517  THR A OG1 1 
ATOM   3383 C  CG2 . THR A 1 517 ? 19.887  92.530  41.394  1.00 124.70 ? 517  THR A CG2 1 
ATOM   3384 N  N   . PRO A 1 518 ? 16.708  90.230  43.174  1.00 124.70 ? 518  PRO A N   1 
ATOM   3385 C  CA  . PRO A 1 518 ? 15.669  90.323  44.186  1.00 124.70 ? 518  PRO A CA  1 
ATOM   3386 C  C   . PRO A 1 518 ? 16.445  89.469  45.241  1.00 124.70 ? 518  PRO A C   1 
ATOM   3387 O  O   . PRO A 1 518 ? 17.635  89.153  45.069  1.00 124.70 ? 518  PRO A O   1 
ATOM   3388 C  CB  . PRO A 1 518 ? 14.513  89.531  43.602  1.00 124.70 ? 518  PRO A CB  1 
ATOM   3389 C  CG  . PRO A 1 518 ? 14.473  90.056  42.279  1.00 124.70 ? 518  PRO A CG  1 
ATOM   3390 C  CD  . PRO A 1 518 ? 15.941  90.188  41.876  1.00 124.70 ? 518  PRO A CD  1 
ATOM   3391 N  N   . ALA A 1 519 ? 15.805  89.114  46.337  1.00 124.70 ? 519  ALA A N   1 
ATOM   3392 C  CA  . ALA A 1 519 ? 16.472  88.244  47.295  1.00 124.70 ? 519  ALA A CA  1 
ATOM   3393 C  C   . ALA A 1 519 ? 15.391  87.584  48.174  1.00 124.70 ? 519  ALA A C   1 
ATOM   3394 O  O   . ALA A 1 519 ? 15.553  87.415  49.385  1.00 124.70 ? 519  ALA A O   1 
ATOM   3395 C  CB  . ALA A 1 519 ? 17.498  89.028  48.123  1.00 124.70 ? 519  ALA A CB  1 
ATOM   3396 N  N   . LYS A 1 520 ? 14.295  87.167  47.541  1.00 124.70 ? 520  LYS A N   1 
ATOM   3397 C  CA  . LYS A 1 520 ? 13.165  86.580  48.263  1.00 124.70 ? 520  LYS A CA  1 
ATOM   3398 C  C   . LYS A 1 520 ? 13.156  85.062  48.411  1.00 124.70 ? 520  LYS A C   1 
ATOM   3399 O  O   . LYS A 1 520 ? 13.978  84.353  47.833  1.00 124.70 ? 520  LYS A O   1 
ATOM   3400 C  CB  . LYS A 1 520 ? 11.868  87.040  47.609  1.00 124.70 ? 520  LYS A CB  1 
ATOM   3401 N  N   . ILE A 1 521 ? 12.211  84.581  49.209  1.00 124.70 ? 521  ILE A N   1 
ATOM   3402 C  CA  . ILE A 1 521 ? 12.038  83.163  49.437  1.00 124.70 ? 521  ILE A CA  1 
ATOM   3403 C  C   . ILE A 1 521 ? 10.687  82.826  48.831  1.00 124.70 ? 521  ILE A C   1 
ATOM   3404 O  O   . ILE A 1 521 ? 10.046  83.682  48.221  1.00 124.70 ? 521  ILE A O   1 
ATOM   3405 C  CB  . ILE A 1 521 ? 12.054  82.875  50.936  1.00 124.70 ? 521  ILE A CB  1 
ATOM   3406 C  CG1 . ILE A 1 521 ? 13.477  83.098  51.455  1.00 124.70 ? 521  ILE A CG1 1 
ATOM   3407 C  CG2 . ILE A 1 521 ? 11.554  81.468  51.221  1.00 124.70 ? 521  ILE A CG2 1 
ATOM   3408 C  CD1 . ILE A 1 521 ? 13.649  82.918  52.954  1.00 124.70 ? 521  ILE A CD1 1 
ATOM   3409 N  N   . LYS A 1 522 ? 10.254  81.584  48.958  1.00 124.70 ? 522  LYS A N   1 
ATOM   3410 C  CA  . LYS A 1 522 ? 8.962   81.244  48.414  1.00 124.70 ? 522  LYS A CA  1 
ATOM   3411 C  C   . LYS A 1 522 ? 8.296   80.141  49.187  1.00 124.70 ? 522  LYS A C   1 
ATOM   3412 O  O   . LYS A 1 522 ? 8.948   79.342  49.853  1.00 124.70 ? 522  LYS A O   1 
ATOM   3413 C  CB  . LYS A 1 522 ? 9.095   80.850  46.981  1.00 124.70 ? 522  LYS A CB  1 
ATOM   3414 N  N   . LYS A 1 523 ? 6.975   80.130  49.111  1.00 124.70 ? 523  LYS A N   1 
ATOM   3415 C  CA  . LYS A 1 523 ? 6.189   79.106  49.759  1.00 124.70 ? 523  LYS A CA  1 
ATOM   3416 C  C   . LYS A 1 523 ? 5.979   78.097  48.649  1.00 124.70 ? 523  LYS A C   1 
ATOM   3417 O  O   . LYS A 1 523 ? 5.203   78.322  47.727  1.00 124.70 ? 523  LYS A O   1 
ATOM   3418 C  CB  . LYS A 1 523 ? 4.868   79.668  50.218  1.00 124.70 ? 523  LYS A CB  1 
ATOM   3419 N  N   . GLY A 1 524 ? 6.695   76.990  48.715  1.00 124.70 ? 524  GLY A N   1 
ATOM   3420 C  CA  . GLY A 1 524 ? 6.551   76.002  47.677  1.00 124.70 ? 524  GLY A CA  1 
ATOM   3421 C  C   . GLY A 1 524 ? 5.279   75.196  47.744  1.00 124.70 ? 524  GLY A C   1 
ATOM   3422 O  O   . GLY A 1 524 ? 5.219   74.155  48.394  1.00 124.70 ? 524  GLY A O   1 
ATOM   3423 N  N   . GLY A 1 525 ? 4.239   75.682  47.092  1.00 124.70 ? 525  GLY A N   1 
ATOM   3424 C  CA  . GLY A 1 525 ? 3.038   74.899  47.095  1.00 124.70 ? 525  GLY A CA  1 
ATOM   3425 C  C   . GLY A 1 525 ? 3.634   73.637  46.534  1.00 124.70 ? 525  GLY A C   1 
ATOM   3426 O  O   . GLY A 1 525 ? 4.244   73.669  45.479  1.00 124.70 ? 525  GLY A O   1 
ATOM   3427 N  N   . LEU A 1 526 ? 3.542   72.527  47.233  1.00 124.70 ? 526  LEU A N   1 
ATOM   3428 C  CA  . LEU A 1 526 ? 4.138   71.371  46.634  1.00 124.70 ? 526  LEU A CA  1 
ATOM   3429 C  C   . LEU A 1 526 ? 3.244   70.650  45.654  1.00 124.70 ? 526  LEU A C   1 
ATOM   3430 O  O   . LEU A 1 526 ? 2.731   69.557  45.867  1.00 124.70 ? 526  LEU A O   1 
ATOM   3431 C  CB  . LEU A 1 526 ? 4.660   70.412  47.674  1.00 124.70 ? 526  LEU A CB  1 
ATOM   3432 C  CG  . LEU A 1 526 ? 4.893   69.044  47.102  1.00 124.70 ? 526  LEU A CG  1 
ATOM   3433 C  CD1 . LEU A 1 526 ? 5.956   69.259  46.009  1.00 124.70 ? 526  LEU A CD1 1 
ATOM   3434 C  CD2 . LEU A 1 526 ? 5.166   68.013  48.244  1.00 124.70 ? 526  LEU A CD2 1 
ATOM   3435 N  N   . ASN A 1 527 ? 3.025   71.338  44.575  1.00 124.70 ? 527  ASN A N   1 
ATOM   3436 C  CA  . ASN A 1 527 ? 2.334   70.789  43.474  1.00 124.70 ? 527  ASN A CA  1 
ATOM   3437 C  C   . ASN A 1 527 ? 2.284   72.024  42.677  1.00 124.70 ? 527  ASN A C   1 
ATOM   3438 O  O   . ASN A 1 527 ? 1.218   72.504  42.342  1.00 124.70 ? 527  ASN A O   1 
ATOM   3439 C  CB  . ASN A 1 527 ? 0.928   70.340  43.723  1.00 124.70 ? 527  ASN A CB  1 
ATOM   3440 C  CG  . ASN A 1 527 ? 0.225   70.147  42.417  1.00 124.70 ? 527  ASN A CG  1 
ATOM   3441 O  OD1 . ASN A 1 527 ? -0.973  69.973  42.347  1.00 124.70 ? 527  ASN A OD1 1 
ATOM   3442 N  ND2 . ASN A 1 527 ? 1.002   70.214  41.338  1.00 124.70 ? 527  ASN A ND2 1 
ATOM   3443 N  N   . GLY A 1 528 ? 3.476   72.559  42.432  1.00 124.70 ? 528  GLY A N   1 
ATOM   3444 C  CA  . GLY A 1 528 ? 3.651   73.782  41.666  1.00 124.70 ? 528  GLY A CA  1 
ATOM   3445 C  C   . GLY A 1 528 ? 2.791   74.981  42.045  1.00 124.70 ? 528  GLY A C   1 
ATOM   3446 O  O   . GLY A 1 528 ? 3.236   76.118  41.986  1.00 124.70 ? 528  GLY A O   1 
ATOM   3447 N  N   . VAL A 1 529 ? 1.573   74.697  42.486  1.00 124.70 ? 529  VAL A N   1 
ATOM   3448 C  CA  . VAL A 1 529 ? 0.535   75.661  42.843  1.00 124.70 ? 529  VAL A CA  1 
ATOM   3449 C  C   . VAL A 1 529 ? 0.638   76.889  43.771  1.00 124.70 ? 529  VAL A C   1 
ATOM   3450 O  O   . VAL A 1 529 ? -0.263  77.684  43.758  1.00 124.70 ? 529  VAL A O   1 
ATOM   3451 C  CB  . VAL A 1 529 ? -0.730  74.938  43.379  1.00 124.70 ? 529  VAL A CB  1 
ATOM   3452 C  CG1 . VAL A 1 529 ? -1.959  75.871  43.251  1.00 124.70 ? 529  VAL A CG1 1 
ATOM   3453 C  CG2 . VAL A 1 529 ? -0.975  73.652  42.631  1.00 124.70 ? 529  VAL A CG2 1 
ATOM   3454 N  N   . ASP A 1 530 ? 1.580   77.135  44.656  1.00 124.70 ? 530  ASP A N   1 
ATOM   3455 C  CA  . ASP A 1 530 ? 1.348   78.427  45.381  1.00 124.70 ? 530  ASP A CA  1 
ATOM   3456 C  C   . ASP A 1 530 ? 2.622   79.252  45.537  1.00 124.70 ? 530  ASP A C   1 
ATOM   3457 O  O   . ASP A 1 530 ? 3.140   79.409  46.632  1.00 124.70 ? 530  ASP A O   1 
ATOM   3458 C  CB  . ASP A 1 530 ? 0.692   78.222  46.768  1.00 124.70 ? 530  ASP A CB  1 
ATOM   3459 C  CG  . ASP A 1 530 ? -0.299  79.320  47.104  1.00 124.70 ? 530  ASP A CG  1 
ATOM   3460 O  OD1 . ASP A 1 530 ? -0.224  80.360  46.426  1.00 124.70 ? 530  ASP A OD1 1 
ATOM   3461 O  OD2 . ASP A 1 530 ? -1.139  79.161  48.019  1.00 124.70 ? 530  ASP A OD2 1 
ATOM   3462 N  N   . ILE A 1 531 ? 3.128   79.794  44.434  1.00 124.70 ? 531  ILE A N   1 
ATOM   3463 C  CA  . ILE A 1 531 ? 4.358   80.577  44.485  1.00 124.70 ? 531  ILE A CA  1 
ATOM   3464 C  C   . ILE A 1 531 ? 4.150   82.018  44.864  1.00 124.70 ? 531  ILE A C   1 
ATOM   3465 O  O   . ILE A 1 531 ? 3.365   82.730  44.234  1.00 124.70 ? 531  ILE A O   1 
ATOM   3466 C  CB  . ILE A 1 531 ? 5.081   80.658  43.146  1.00 124.70 ? 531  ILE A CB  1 
ATOM   3467 C  CG1 . ILE A 1 531 ? 5.637   79.298  42.746  1.00 124.70 ? 531  ILE A CG1 1 
ATOM   3468 C  CG2 . ILE A 1 531 ? 6.194   81.722  43.230  1.00 124.70 ? 531  ILE A CG2 1 
ATOM   3469 C  CD1 . ILE A 1 531 ? 6.262   79.304  41.355  1.00 124.70 ? 531  ILE A CD1 1 
ATOM   3470 N  N   . TYR A 1 532 ? 4.890   82.437  45.879  1.00 124.70 ? 532  TYR A N   1 
ATOM   3471 C  CA  . TYR A 1 532 ? 4.867   83.798  46.333  1.00 124.70 ? 532  TYR A CA  1 
ATOM   3472 C  C   . TYR A 1 532 ? 6.061   84.107  47.201  1.00 124.70 ? 532  TYR A C   1 
ATOM   3473 O  O   . TYR A 1 532 ? 6.250   83.623  48.331  1.00 124.70 ? 532  TYR A O   1 
ATOM   3474 C  CB  . TYR A 1 532 ? 3.512   84.172  46.957  1.00 124.70 ? 532  TYR A CB  1 
ATOM   3475 C  CG  . TYR A 1 532 ? 3.136   83.614  48.300  1.00 124.70 ? 532  TYR A CG  1 
ATOM   3476 C  CD1 . TYR A 1 532 ? 3.596   84.211  49.471  1.00 124.70 ? 532  TYR A CD1 1 
ATOM   3477 C  CD2 . TYR A 1 532 ? 2.204   82.584  48.408  1.00 124.70 ? 532  TYR A CD2 1 
ATOM   3478 C  CE1 . TYR A 1 532 ? 3.126   83.807  50.710  1.00 124.70 ? 532  TYR A CE1 1 
ATOM   3479 C  CE2 . TYR A 1 532 ? 1.730   82.176  49.648  1.00 124.70 ? 532  TYR A CE2 1 
ATOM   3480 C  CZ  . TYR A 1 532 ? 2.194   82.799  50.789  1.00 124.70 ? 532  TYR A CZ  1 
ATOM   3481 O  OH  . TYR A 1 532 ? 1.701   82.439  52.010  1.00 124.70 ? 532  TYR A OH  1 
ATOM   3482 N  N   . SER A 1 533 ? 6.916   84.866  46.530  1.00 124.70 ? 533  SER A N   1 
ATOM   3483 C  CA  . SER A 1 533 ? 8.158   85.375  47.039  1.00 124.70 ? 533  SER A CA  1 
ATOM   3484 C  C   . SER A 1 533 ? 7.817   85.974  48.374  1.00 124.70 ? 533  SER A C   1 
ATOM   3485 O  O   . SER A 1 533 ? 6.919   86.820  48.502  1.00 124.70 ? 533  SER A O   1 
ATOM   3486 C  CB  . SER A 1 533 ? 8.696   86.429  46.073  1.00 124.70 ? 533  SER A CB  1 
ATOM   3487 O  OG  . SER A 1 533 ? 7.616   87.060  45.398  1.00 124.70 ? 533  SER A OG  1 
ATOM   3488 N  N   . LEU A 1 534 ? 8.531   85.460  49.367  1.00 124.70 ? 534  LEU A N   1 
ATOM   3489 C  CA  . LEU A 1 534 ? 8.393   85.842  50.764  1.00 124.70 ? 534  LEU A CA  1 
ATOM   3490 C  C   . LEU A 1 534 ? 9.655   86.474  51.371  1.00 124.70 ? 534  LEU A C   1 
ATOM   3491 O  O   . LEU A 1 534 ? 10.815  86.138  51.038  1.00 124.70 ? 534  LEU A O   1 
ATOM   3492 C  CB  . LEU A 1 534 ? 7.962   84.636  51.601  1.00 124.70 ? 534  LEU A CB  1 
ATOM   3493 C  CG  . LEU A 1 534 ? 7.960   84.901  53.103  1.00 124.70 ? 534  LEU A CG  1 
ATOM   3494 C  CD1 . LEU A 1 534 ? 6.554   84.870  53.653  1.00 124.70 ? 534  LEU A CD1 1 
ATOM   3495 C  CD2 . LEU A 1 534 ? 8.811   83.851  53.771  1.00 124.70 ? 534  LEU A CD2 1 
ATOM   3496 N  N   . VAL A 1 535 ? 9.378   87.364  52.319  1.00 124.70 ? 535  VAL A N   1 
ATOM   3497 C  CA  . VAL A 1 535 ? 10.381  88.176  52.981  1.00 124.70 ? 535  VAL A CA  1 
ATOM   3498 C  C   . VAL A 1 535 ? 11.151  88.728  51.816  1.00 124.70 ? 535  VAL A C   1 
ATOM   3499 O  O   . VAL A 1 535 ? 12.369  88.607  51.728  1.00 124.70 ? 535  VAL A O   1 
ATOM   3500 C  CB  . VAL A 1 535 ? 11.351  87.418  53.889  1.00 124.70 ? 535  VAL A CB  1 
ATOM   3501 C  CG1 . VAL A 1 535 ? 11.555  88.232  55.156  1.00 124.70 ? 535  VAL A CG1 1 
ATOM   3502 C  CG2 . VAL A 1 535 ? 10.840  86.040  54.208  1.00 124.70 ? 535  VAL A CG2 1 
ATOM   3503 N  N   . THR A 1 536 ? 10.382  89.281  50.888  1.00 124.70 ? 536  THR A N   1 
ATOM   3504 C  CA  . THR A 1 536 ? 10.911  89.895  49.695  1.00 124.70 ? 536  THR A CA  1 
ATOM   3505 C  C   . THR A 1 536 ? 11.693  91.067  50.196  1.00 124.70 ? 536  THR A C   1 
ATOM   3506 O  O   . THR A 1 536 ? 11.393  92.203  49.848  1.00 124.70 ? 536  THR A O   1 
ATOM   3507 C  CB  . THR A 1 536 ? 9.793   90.450  48.814  1.00 124.70 ? 536  THR A CB  1 
ATOM   3508 O  OG1 . THR A 1 536 ? 10.365  91.209  47.735  1.00 124.70 ? 536  THR A OG1 1 
ATOM   3509 C  CG2 . THR A 1 536 ? 8.867   91.359  49.647  1.00 124.70 ? 536  THR A CG2 1 
ATOM   3510 N  N   . GLU A 1 537 ? 12.695  90.849  51.022  1.00 124.70 ? 537  GLU A N   1 
ATOM   3511 C  CA  . GLU A 1 537 ? 13.351  92.053  51.439  1.00 124.70 ? 537  GLU A CA  1 
ATOM   3512 C  C   . GLU A 1 537 ? 14.469  91.939  52.431  1.00 124.70 ? 537  GLU A C   1 
ATOM   3513 O  O   . GLU A 1 537 ? 14.737  90.895  53.034  1.00 124.70 ? 537  GLU A O   1 
ATOM   3514 C  CB  . GLU A 1 537 ? 12.300  93.010  52.022  1.00 124.70 ? 537  GLU A CB  1 
ATOM   3515 C  CG  . GLU A 1 537 ? 12.798  94.425  52.206  1.00 124.70 ? 537  GLU A CG  1 
ATOM   3516 C  CD  . GLU A 1 537 ? 11.787  95.322  52.871  1.00 124.70 ? 537  GLU A CD  1 
ATOM   3517 O  OE1 . GLU A 1 537 ? 10.690  94.829  53.202  1.00 124.70 ? 537  GLU A OE1 1 
ATOM   3518 O  OE2 . GLU A 1 537 ? 12.090  96.518  53.067  1.00 124.70 ? 537  GLU A OE2 1 
ATOM   3519 N  N   . ASN A 1 538 ? 15.102  93.083  52.629  1.00 124.70 ? 538  ASN A N   1 
ATOM   3520 C  CA  . ASN A 1 538 ? 16.149  93.158  53.602  1.00 124.70 ? 538  ASN A CA  1 
ATOM   3521 C  C   . ASN A 1 538 ? 16.974  91.955  53.286  1.00 124.70 ? 538  ASN A C   1 
ATOM   3522 O  O   . ASN A 1 538 ? 17.569  91.336  54.158  1.00 124.70 ? 538  ASN A O   1 
ATOM   3523 C  CB  . ASN A 1 538 ? 15.518  92.991  54.967  1.00 124.70 ? 538  ASN A CB  1 
ATOM   3524 C  CG  . ASN A 1 538 ? 16.520  93.014  56.050  1.00 124.70 ? 538  ASN A CG  1 
ATOM   3525 O  OD1 . ASN A 1 538 ? 16.429  92.255  57.010  1.00 124.70 ? 538  ASN A OD1 1 
ATOM   3526 N  ND2 . ASN A 1 538 ? 17.499  93.894  55.919  1.00 124.70 ? 538  ASN A ND2 1 
ATOM   3527 N  N   . ILE A 1 539 ? 17.009  91.620  52.013  1.00 124.70 ? 539  ILE A N   1 
ATOM   3528 C  CA  . ILE A 1 539 ? 17.688  90.418  51.644  1.00 124.70 ? 539  ILE A CA  1 
ATOM   3529 C  C   . ILE A 1 539 ? 18.686  90.564  50.491  1.00 124.70 ? 539  ILE A C   1 
ATOM   3530 O  O   . ILE A 1 539 ? 18.511  91.342  49.539  1.00 124.70 ? 539  ILE A O   1 
ATOM   3531 C  CB  . ILE A 1 539 ? 16.602  89.381  51.356  1.00 124.70 ? 539  ILE A CB  1 
ATOM   3532 C  CG1 . ILE A 1 539 ? 17.047  87.970  51.763  1.00 124.70 ? 539  ILE A CG1 1 
ATOM   3533 C  CG2 . ILE A 1 539 ? 16.107  89.587  49.978  1.00 124.70 ? 539  ILE A CG2 1 
ATOM   3534 C  CD1 . ILE A 1 539 ? 18.417  87.556  51.367  1.00 124.70 ? 539  ILE A CD1 1 
ATOM   3535 N  N   . GLN A 1 540 ? 19.764  89.813  50.649  1.00 124.70 ? 540  GLN A N   1 
ATOM   3536 C  CA  . GLN A 1 540 ? 20.862  89.742  49.716  1.00 124.70 ? 540  GLN A CA  1 
ATOM   3537 C  C   . GLN A 1 540 ? 21.556  88.445  50.064  1.00 124.70 ? 540  GLN A C   1 
ATOM   3538 O  O   . GLN A 1 540 ? 21.858  88.178  51.232  1.00 124.70 ? 540  GLN A O   1 
ATOM   3539 C  CB  . GLN A 1 540 ? 21.823  90.915  49.922  1.00 124.70 ? 540  GLN A CB  1 
ATOM   3540 C  CG  . GLN A 1 540 ? 21.232  92.266  49.535  1.00 124.70 ? 540  GLN A CG  1 
ATOM   3541 C  CD  . GLN A 1 540 ? 20.947  92.395  48.032  1.00 124.70 ? 540  GLN A CD  1 
ATOM   3542 O  OE1 . GLN A 1 540 ? 21.867  92.479  47.217  1.00 124.70 ? 540  GLN A OE1 1 
ATOM   3543 N  NE2 . GLN A 1 540 ? 19.670  92.414  47.666  1.00 124.70 ? 540  GLN A NE2 1 
ATOM   3544 N  N   . TRP A 1 541 ? 21.748  87.606  49.062  1.00 124.70 ? 541  TRP A N   1 
ATOM   3545 C  CA  . TRP A 1 541 ? 22.448  86.360  49.281  1.00 124.70 ? 541  TRP A CA  1 
ATOM   3546 C  C   . TRP A 1 541 ? 21.849  85.407  50.331  1.00 124.70 ? 541  TRP A C   1 
ATOM   3547 O  O   . TRP A 1 541 ? 22.422  85.241  51.419  1.00 124.70 ? 541  TRP A O   1 
ATOM   3548 C  CB  . TRP A 1 541 ? 23.910  86.671  49.649  1.00 124.70 ? 541  TRP A CB  1 
ATOM   3549 C  CG  . TRP A 1 541 ? 24.831  85.504  49.532  1.00 124.70 ? 541  TRP A CG  1 
ATOM   3550 C  CD1 . TRP A 1 541 ? 24.659  84.264  50.074  1.00 124.70 ? 541  TRP A CD1 1 
ATOM   3551 C  CD2 . TRP A 1 541 ? 26.043  85.445  48.786  1.00 124.70 ? 541  TRP A CD2 1 
ATOM   3552 N  NE1 . TRP A 1 541 ? 25.682  83.432  49.705  1.00 124.70 ? 541  TRP A NE1 1 
ATOM   3553 C  CE2 . TRP A 1 541 ? 26.548  84.134  48.911  1.00 124.70 ? 541  TRP A CE2 1 
ATOM   3554 C  CE3 . TRP A 1 541 ? 26.753  86.371  48.021  1.00 124.70 ? 541  TRP A CE3 1 
ATOM   3555 C  CZ2 . TRP A 1 541 ? 27.732  83.728  48.291  1.00 124.70 ? 541  TRP A CZ2 1 
ATOM   3556 C  CZ3 . TRP A 1 541 ? 27.918  85.973  47.406  1.00 124.70 ? 541  TRP A CZ3 1 
ATOM   3557 C  CH2 . TRP A 1 541 ? 28.401  84.661  47.542  1.00 124.70 ? 541  TRP A CH2 1 
ATOM   3558 N  N   . PRO A 1 542 ? 20.660  84.824  50.052  1.00 124.70 ? 542  PRO A N   1 
ATOM   3559 C  CA  . PRO A 1 542 ? 19.985  83.866  50.949  1.00 124.70 ? 542  PRO A CA  1 
ATOM   3560 C  C   . PRO A 1 542 ? 20.970  82.703  51.173  1.00 124.70 ? 542  PRO A C   1 
ATOM   3561 O  O   . PRO A 1 542 ? 22.070  82.780  50.630  1.00 124.70 ? 542  PRO A O   1 
ATOM   3562 C  CB  . PRO A 1 542 ? 18.728  83.533  50.168  1.00 124.70 ? 542  PRO A CB  1 
ATOM   3563 C  CG  . PRO A 1 542 ? 18.333  84.922  49.742  1.00 124.70 ? 542  PRO A CG  1 
ATOM   3564 C  CD  . PRO A 1 542 ? 19.653  85.531  49.240  1.00 124.70 ? 542  PRO A CD  1 
ATOM   3565 N  N   . ASN A 1 543 ? 20.657  81.623  51.894  1.00 124.70 ? 543  ASN A N   1 
ATOM   3566 C  CA  . ASN A 1 543 ? 21.794  80.731  52.105  1.00 124.70 ? 543  ASN A CA  1 
ATOM   3567 C  C   . ASN A 1 543 ? 21.776  79.481  52.944  1.00 124.70 ? 543  ASN A C   1 
ATOM   3568 O  O   . ASN A 1 543 ? 22.620  79.354  53.815  1.00 124.70 ? 543  ASN A O   1 
ATOM   3569 C  CB  . ASN A 1 543 ? 22.897  81.576  52.701  1.00 124.70 ? 543  ASN A CB  1 
ATOM   3570 C  CG  . ASN A 1 543 ? 24.148  81.479  51.943  1.00 124.70 ? 543  ASN A CG  1 
ATOM   3571 O  OD1 . ASN A 1 543 ? 24.139  81.444  50.727  1.00 124.70 ? 543  ASN A OD1 1 
ATOM   3572 N  ND2 . ASN A 1 543 ? 25.246  81.443  52.639  1.00 124.70 ? 543  ASN A ND2 1 
ATOM   3573 N  N   . GLY A 1 544 ? 20.925  78.515  52.695  1.00 124.70 ? 544  GLY A N   1 
ATOM   3574 C  CA  . GLY A 1 544 ? 20.990  77.395  53.600  1.00 124.70 ? 544  GLY A CA  1 
ATOM   3575 C  C   . GLY A 1 544 ? 19.820  77.738  54.449  1.00 124.70 ? 544  GLY A C   1 
ATOM   3576 O  O   . GLY A 1 544 ? 19.468  78.915  54.584  1.00 124.70 ? 544  GLY A O   1 
ATOM   3577 N  N   . ILE A 1 545 ? 19.235  76.733  55.065  1.00 124.70 ? 545  ILE A N   1 
ATOM   3578 C  CA  . ILE A 1 545 ? 18.025  77.018  55.781  1.00 124.70 ? 545  ILE A CA  1 
ATOM   3579 C  C   . ILE A 1 545 ? 17.602  75.783  56.564  1.00 124.70 ? 545  ILE A C   1 
ATOM   3580 O  O   . ILE A 1 545 ? 18.110  74.691  56.327  1.00 124.70 ? 545  ILE A O   1 
ATOM   3581 C  CB  . ILE A 1 545 ? 16.988  77.363  54.707  1.00 124.70 ? 545  ILE A CB  1 
ATOM   3582 C  CG1 . ILE A 1 545 ? 16.224  78.627  55.056  1.00 124.70 ? 545  ILE A CG1 1 
ATOM   3583 C  CG2 . ILE A 1 545 ? 16.105  76.164  54.445  1.00 124.70 ? 545  ILE A CG2 1 
ATOM   3584 C  CD1 . ILE A 1 545 ? 15.610  79.257  53.822  1.00 124.70 ? 545  ILE A CD1 1 
ATOM   3585 N  N   . THR A 1 546 ? 16.681  75.958  57.503  1.00 124.70 ? 546  THR A N   1 
ATOM   3586 C  CA  . THR A 1 546 ? 16.183  74.827  58.269  1.00 124.70 ? 546  THR A CA  1 
ATOM   3587 C  C   . THR A 1 546 ? 14.894  75.225  58.976  1.00 124.70 ? 546  THR A C   1 
ATOM   3588 O  O   . THR A 1 546 ? 14.588  76.419  59.105  1.00 124.70 ? 546  THR A O   1 
ATOM   3589 C  CB  . THR A 1 546 ? 17.248  74.270  59.236  1.00 124.70 ? 546  THR A CB  1 
ATOM   3590 O  OG1 . THR A 1 546 ? 16.849  72.967  59.679  1.00 124.70 ? 546  THR A OG1 1 
ATOM   3591 C  CG2 . THR A 1 546 ? 17.424  75.172  60.421  1.00 124.70 ? 546  THR A CG2 1 
ATOM   3592 N  N   . LEU A 1 547 ? 14.164  74.225  59.469  1.00 124.70 ? 547  LEU A N   1 
ATOM   3593 C  CA  . LEU A 1 547 ? 12.826  74.472  60.010  1.00 124.70 ? 547  LEU A CA  1 
ATOM   3594 C  C   . LEU A 1 547 ? 12.252  73.630  61.195  1.00 124.70 ? 547  LEU A C   1 
ATOM   3595 O  O   . LEU A 1 547 ? 12.542  72.445  61.348  1.00 124.70 ? 547  LEU A O   1 
ATOM   3596 C  CB  . LEU A 1 547 ? 11.911  74.362  58.782  1.00 124.70 ? 547  LEU A CB  1 
ATOM   3597 C  CG  . LEU A 1 547 ? 10.417  74.609  58.664  1.00 124.70 ? 547  LEU A CG  1 
ATOM   3598 C  CD1 . LEU A 1 547 ? 10.149  76.092  58.564  1.00 124.70 ? 547  LEU A CD1 1 
ATOM   3599 C  CD2 . LEU A 1 547 ? 9.911   73.900  57.416  1.00 124.70 ? 547  LEU A CD2 1 
ATOM   3600 N  N   . ASP A 1 548 ? 11.405  74.267  62.001  1.00 124.70 ? 548  ASP A N   1 
ATOM   3601 C  CA  . ASP A 1 548 ? 10.726  73.665  63.160  1.00 124.70 ? 548  ASP A CA  1 
ATOM   3602 C  C   . ASP A 1 548 ? 9.376   73.090  62.639  1.00 124.70 ? 548  ASP A C   1 
ATOM   3603 O  O   . ASP A 1 548 ? 8.432   73.854  62.428  1.00 124.70 ? 548  ASP A O   1 
ATOM   3604 C  CB  . ASP A 1 548 ? 10.483  74.811  64.161  1.00 124.70 ? 548  ASP A CB  1 
ATOM   3605 C  CG  . ASP A 1 548 ? 10.013  74.355  65.535  1.00 124.70 ? 548  ASP A CG  1 
ATOM   3606 O  OD1 . ASP A 1 548 ? 9.807   73.142  65.753  1.00 124.70 ? 548  ASP A OD1 1 
ATOM   3607 O  OD2 . ASP A 1 548 ? 9.857   75.249  66.405  1.00 124.70 ? 548  ASP A OD2 1 
ATOM   3608 N  N   . LEU A 1 549 ? 9.253   71.782  62.407  1.00 124.70 ? 549  LEU A N   1 
ATOM   3609 C  CA  . LEU A 1 549 ? 7.964   71.295  61.893  1.00 124.70 ? 549  LEU A CA  1 
ATOM   3610 C  C   . LEU A 1 549 ? 6.899   71.272  62.970  1.00 124.70 ? 549  LEU A C   1 
ATOM   3611 O  O   . LEU A 1 549 ? 5.998   70.433  62.967  1.00 124.70 ? 549  LEU A O   1 
ATOM   3612 C  CB  . LEU A 1 549 ? 8.085   69.906  61.259  1.00 124.70 ? 549  LEU A CB  1 
ATOM   3613 C  CG  . LEU A 1 549 ? 6.821   69.411  60.540  1.00 124.70 ? 549  LEU A CG  1 
ATOM   3614 C  CD1 . LEU A 1 549 ? 6.596   70.253  59.315  1.00 124.70 ? 549  LEU A CD1 1 
ATOM   3615 C  CD2 . LEU A 1 549 ? 6.943   67.948  60.163  1.00 124.70 ? 549  LEU A CD2 1 
ATOM   3616 N  N   . LEU A 1 550 ? 7.034   72.181  63.921  1.00 124.70 ? 550  LEU A N   1 
ATOM   3617 C  CA  . LEU A 1 550 ? 6.053   72.307  64.976  1.00 124.70 ? 550  LEU A CA  1 
ATOM   3618 C  C   . LEU A 1 550 ? 5.966   73.801  65.133  1.00 124.70 ? 550  LEU A C   1 
ATOM   3619 O  O   . LEU A 1 550 ? 6.376   74.441  66.123  1.00 124.70 ? 550  LEU A O   1 
ATOM   3620 C  CB  . LEU A 1 550 ? 6.452   71.585  66.253  1.00 124.70 ? 550  LEU A CB  1 
ATOM   3621 C  CG  . LEU A 1 550 ? 5.246   71.482  67.201  1.00 124.70 ? 550  LEU A CG  1 
ATOM   3622 C  CD1 . LEU A 1 550 ? 4.077   70.782  66.501  1.00 124.70 ? 550  LEU A CD1 1 
ATOM   3623 C  CD2 . LEU A 1 550 ? 5.643   70.746  68.469  1.00 124.70 ? 550  LEU A CD2 1 
ATOM   3624 N  N   . SER A 1 551 ? 5.463   74.287  64.000  1.00 124.70 ? 551  SER A N   1 
ATOM   3625 C  CA  . SER A 1 551 ? 5.143   75.648  63.619  1.00 124.70 ? 551  SER A CA  1 
ATOM   3626 C  C   . SER A 1 551 ? 6.279   76.574  63.810  1.00 124.70 ? 551  SER A C   1 
ATOM   3627 O  O   . SER A 1 551 ? 6.122   77.685  64.300  1.00 124.70 ? 551  SER A O   1 
ATOM   3628 C  CB  . SER A 1 551 ? 3.938   76.150  64.389  1.00 124.70 ? 551  SER A CB  1 
ATOM   3629 O  OG  . SER A 1 551 ? 3.278   77.144  63.628  1.00 124.70 ? 551  SER A OG  1 
ATOM   3630 N  N   . GLY A 1 552 ? 7.446   76.098  63.434  1.00 124.70 ? 552  GLY A N   1 
ATOM   3631 C  CA  . GLY A 1 552 ? 8.600   76.910  63.606  1.00 124.70 ? 552  GLY A CA  1 
ATOM   3632 C  C   . GLY A 1 552 ? 8.649   77.926  62.545  1.00 124.70 ? 552  GLY A C   1 
ATOM   3633 O  O   . GLY A 1 552 ? 8.337   77.800  61.368  1.00 124.70 ? 552  GLY A O   1 
ATOM   3634 N  N   . ARG A 1 553 ? 9.105   79.013  63.016  1.00 124.70 ? 553  ARG A N   1 
ATOM   3635 C  CA  . ARG A 1 553 ? 9.236   80.006  62.074  1.00 124.70 ? 553  ARG A CA  1 
ATOM   3636 C  C   . ARG A 1 553 ? 10.593  79.696  61.412  1.00 124.70 ? 553  ARG A C   1 
ATOM   3637 O  O   . ARG A 1 553 ? 11.341  78.817  61.894  1.00 124.70 ? 553  ARG A O   1 
ATOM   3638 C  CB  . ARG A 1 553 ? 9.145   81.301  62.810  1.00 124.70 ? 553  ARG A CB  1 
ATOM   3639 C  CG  . ARG A 1 553 ? 9.697   81.318  64.184  1.00 124.70 ? 553  ARG A CG  1 
ATOM   3640 C  CD  . ARG A 1 553 ? 9.139   82.553  64.826  1.00 124.70 ? 553  ARG A CD  1 
ATOM   3641 N  NE  . ARG A 1 553 ? 9.896   83.049  65.963  1.00 124.70 ? 553  ARG A NE  1 
ATOM   3642 C  CZ  . ARG A 1 553 ? 9.537   84.108  66.694  1.00 124.70 ? 553  ARG A CZ  1 
ATOM   3643 N  NH1 . ARG A 1 553 ? 8.427   84.792  66.418  1.00 124.70 ? 553  ARG A NH1 1 
ATOM   3644 N  NH2 . ARG A 1 553 ? 10.294  84.501  67.711  1.00 124.70 ? 553  ARG A NH2 1 
ATOM   3645 N  N   . LEU A 1 554 ? 10.918  80.420  60.338  1.00 124.70 ? 554  LEU A N   1 
ATOM   3646 C  CA  . LEU A 1 554 ? 12.129  80.166  59.591  1.00 124.70 ? 554  LEU A CA  1 
ATOM   3647 C  C   . LEU A 1 554 ? 13.451  80.558  60.186  1.00 124.70 ? 554  LEU A C   1 
ATOM   3648 O  O   . LEU A 1 554 ? 13.577  81.539  60.880  1.00 124.70 ? 554  LEU A O   1 
ATOM   3649 C  CB  . LEU A 1 554 ? 12.022  80.748  58.226  1.00 124.70 ? 554  LEU A CB  1 
ATOM   3650 N  N   . TYR A 1 555 ? 14.445  79.724  59.934  1.00 124.70 ? 555  TYR A N   1 
ATOM   3651 C  CA  . TYR A 1 555 ? 15.798  80.013  60.368  1.00 124.70 ? 555  TYR A CA  1 
ATOM   3652 C  C   . TYR A 1 555 ? 16.540  79.991  59.050  1.00 124.70 ? 555  TYR A C   1 
ATOM   3653 O  O   . TYR A 1 555 ? 16.448  79.029  58.288  1.00 124.70 ? 555  TYR A O   1 
ATOM   3654 C  CB  . TYR A 1 555 ? 16.308  78.950  61.279  1.00 124.70 ? 555  TYR A CB  1 
ATOM   3655 N  N   . TRP A 1 556 ? 17.241  81.063  58.746  1.00 124.70 ? 556  TRP A N   1 
ATOM   3656 C  CA  . TRP A 1 556 ? 17.954  81.085  57.495  1.00 124.70 ? 556  TRP A CA  1 
ATOM   3657 C  C   . TRP A 1 556 ? 19.183  81.888  57.663  1.00 124.70 ? 556  TRP A C   1 
ATOM   3658 O  O   . TRP A 1 556 ? 19.328  82.663  58.602  1.00 124.70 ? 556  TRP A O   1 
ATOM   3659 C  CB  . TRP A 1 556 ? 17.111  81.714  56.386  1.00 124.70 ? 556  TRP A CB  1 
ATOM   3660 C  CG  . TRP A 1 556 ? 17.054  83.246  56.385  1.00 124.70 ? 556  TRP A CG  1 
ATOM   3661 C  CD1 . TRP A 1 556 ? 17.923  84.111  55.770  1.00 124.70 ? 556  TRP A CD1 1 
ATOM   3662 C  CD2 . TRP A 1 556 ? 16.013  84.056  56.938  1.00 124.70 ? 556  TRP A CD2 1 
ATOM   3663 N  NE1 . TRP A 1 556 ? 17.474  85.403  55.900  1.00 124.70 ? 556  TRP A NE1 1 
ATOM   3664 C  CE2 . TRP A 1 556 ? 16.305  85.398  56.614  1.00 124.70 ? 556  TRP A CE2 1 
ATOM   3665 C  CE3 . TRP A 1 556 ? 14.860  83.776  57.678  1.00 124.70 ? 556  TRP A CE3 1 
ATOM   3666 C  CZ2 . TRP A 1 556 ? 15.471  86.459  56.993  1.00 124.70 ? 556  TRP A CZ2 1 
ATOM   3667 C  CZ3 . TRP A 1 556 ? 14.032  84.828  58.054  1.00 124.70 ? 556  TRP A CZ3 1 
ATOM   3668 C  CH2 . TRP A 1 556 ? 14.342  86.153  57.713  1.00 124.70 ? 556  TRP A CH2 1 
ATOM   3669 N  N   . VAL A 1 557 ? 20.079  81.731  56.724  1.00 124.70 ? 557  VAL A N   1 
ATOM   3670 C  CA  . VAL A 1 557 ? 21.267  82.492  56.837  1.00 124.70 ? 557  VAL A CA  1 
ATOM   3671 C  C   . VAL A 1 557 ? 21.549  83.300  55.625  1.00 124.70 ? 557  VAL A C   1 
ATOM   3672 O  O   . VAL A 1 557 ? 21.458  82.843  54.487  1.00 124.70 ? 557  VAL A O   1 
ATOM   3673 C  CB  . VAL A 1 557 ? 22.429  81.616  57.086  1.00 124.70 ? 557  VAL A CB  1 
ATOM   3674 C  CG1 . VAL A 1 557 ? 22.287  80.975  58.419  1.00 124.70 ? 557  VAL A CG1 1 
ATOM   3675 C  CG2 . VAL A 1 557 ? 22.492  80.572  56.019  1.00 124.70 ? 557  VAL A CG2 1 
ATOM   3676 N  N   . ASP A 1 558 ? 21.863  84.543  55.896  1.00 124.70 ? 558  ASP A N   1 
ATOM   3677 C  CA  . ASP A 1 558 ? 22.239  85.439  54.855  1.00 124.70 ? 558  ASP A CA  1 
ATOM   3678 C  C   . ASP A 1 558 ? 23.725  85.388  55.088  1.00 124.70 ? 558  ASP A C   1 
ATOM   3679 O  O   . ASP A 1 558 ? 24.199  85.497  56.222  1.00 124.70 ? 558  ASP A O   1 
ATOM   3680 C  CB  . ASP A 1 558 ? 21.625  86.799  55.114  1.00 124.70 ? 558  ASP A CB  1 
ATOM   3681 C  CG  . ASP A 1 558 ? 20.131  86.731  55.109  1.00 124.70 ? 558  ASP A CG  1 
ATOM   3682 O  OD1 . ASP A 1 558 ? 19.594  85.915  54.329  1.00 124.70 ? 558  ASP A OD1 1 
ATOM   3683 O  OD2 . ASP A 1 558 ? 19.500  87.479  55.874  1.00 124.70 ? 558  ASP A OD2 1 
ATOM   3684 N  N   . SER A 1 559 ? 24.457  85.145  54.020  1.00 124.70 ? 559  SER A N   1 
ATOM   3685 C  CA  . SER A 1 559 ? 25.887  85.041  54.130  1.00 124.70 ? 559  SER A CA  1 
ATOM   3686 C  C   . SER A 1 559 ? 26.548  86.316  53.777  1.00 124.70 ? 559  SER A C   1 
ATOM   3687 O  O   . SER A 1 559 ? 27.597  86.665  54.323  1.00 124.70 ? 559  SER A O   1 
ATOM   3688 C  CB  . SER A 1 559 ? 26.376  83.957  53.219  1.00 124.70 ? 559  SER A CB  1 
ATOM   3689 O  OG  . SER A 1 559 ? 26.088  82.747  53.843  1.00 124.70 ? 559  SER A OG  1 
ATOM   3690 N  N   . LYS A 1 560 ? 25.947  86.995  52.818  1.00 124.70 ? 560  LYS A N   1 
ATOM   3691 C  CA  . LYS A 1 560 ? 26.477  88.263  52.417  1.00 124.70 ? 560  LYS A CA  1 
ATOM   3692 C  C   . LYS A 1 560 ? 25.571  89.328  53.002  1.00 124.70 ? 560  LYS A C   1 
ATOM   3693 O  O   . LYS A 1 560 ? 25.051  90.226  52.354  1.00 124.70 ? 560  LYS A O   1 
ATOM   3694 C  CB  . LYS A 1 560 ? 26.577  88.364  50.909  1.00 124.70 ? 560  LYS A CB  1 
ATOM   3695 C  CG  . LYS A 1 560 ? 27.238  89.663  50.483  1.00 124.70 ? 560  LYS A CG  1 
ATOM   3696 C  CD  . LYS A 1 560 ? 28.577  89.873  51.185  1.00 124.70 ? 560  LYS A CD  1 
ATOM   3697 C  CE  . LYS A 1 560 ? 29.114  91.270  50.932  1.00 124.70 ? 560  LYS A CE  1 
ATOM   3698 N  NZ  . LYS A 1 560 ? 30.528  91.434  51.397  1.00 124.70 ? 560  LYS A NZ  1 
ATOM   3699 N  N   . LEU A 1 561 ? 25.409  89.163  54.289  1.00 124.70 ? 561  LEU A N   1 
ATOM   3700 C  CA  . LEU A 1 561 ? 24.660  90.009  55.171  1.00 124.70 ? 561  LEU A CA  1 
ATOM   3701 C  C   . LEU A 1 561 ? 25.167  89.203  56.360  1.00 124.70 ? 561  LEU A C   1 
ATOM   3702 O  O   . LEU A 1 561 ? 24.503  88.290  56.834  1.00 124.70 ? 561  LEU A O   1 
ATOM   3703 C  CB  . LEU A 1 561 ? 23.133  89.855  54.999  1.00 124.70 ? 561  LEU A CB  1 
ATOM   3704 C  CG  . LEU A 1 561 ? 22.457  90.323  53.699  1.00 124.70 ? 561  LEU A CG  1 
ATOM   3705 C  CD1 . LEU A 1 561 ? 20.948  90.276  53.866  1.00 124.70 ? 561  LEU A CD1 1 
ATOM   3706 C  CD2 . LEU A 1 561 ? 22.893  91.732  53.341  1.00 124.70 ? 561  LEU A CD2 1 
ATOM   3707 N  N   . HIS A 1 562 ? 26.385  89.487  56.795  1.00 124.70 ? 562  HIS A N   1 
ATOM   3708 C  CA  . HIS A 1 562 ? 26.948  88.739  57.903  1.00 124.70 ? 562  HIS A CA  1 
ATOM   3709 C  C   . HIS A 1 562 ? 25.906  88.610  59.073  1.00 124.70 ? 562  HIS A C   1 
ATOM   3710 O  O   . HIS A 1 562 ? 26.079  89.291  60.087  1.00 124.70 ? 562  HIS A O   1 
ATOM   3711 C  CB  . HIS A 1 562 ? 28.231  89.467  58.348  1.00 124.70 ? 562  HIS A CB  1 
ATOM   3712 C  CG  . HIS A 1 562 ? 29.267  89.621  57.255  1.00 124.70 ? 562  HIS A CG  1 
ATOM   3713 N  ND1 . HIS A 1 562 ? 30.001  88.564  56.791  1.00 124.70 ? 562  HIS A ND1 1 
ATOM   3714 C  CD2 . HIS A 1 562 ? 29.692  90.717  56.573  1.00 124.70 ? 562  HIS A CD2 1 
ATOM   3715 C  CE1 . HIS A 1 562 ? 30.851  88.992  55.859  1.00 124.70 ? 562  HIS A CE1 1 
ATOM   3716 N  NE2 . HIS A 1 562 ? 30.682  90.287  55.712  1.00 124.70 ? 562  HIS A NE2 1 
ATOM   3717 N  N   . SER A 1 563 ? 24.876  87.730  58.942  1.00 124.70 ? 563  SER A N   1 
ATOM   3718 C  CA  . SER A 1 563 ? 23.764  87.498  59.944  1.00 124.70 ? 563  SER A CA  1 
ATOM   3719 C  C   . SER A 1 563 ? 22.844  86.239  59.808  1.00 124.70 ? 563  SER A C   1 
ATOM   3720 O  O   . SER A 1 563 ? 23.032  85.430  58.906  1.00 124.70 ? 563  SER A O   1 
ATOM   3721 C  CB  . SER A 1 563 ? 22.799  88.686  59.955  1.00 124.70 ? 563  SER A CB  1 
ATOM   3722 O  OG  . SER A 1 563 ? 21.461  88.255  59.696  1.00 124.70 ? 563  SER A OG  1 
ATOM   3723 N  N   . ILE A 1 564 ? 21.841  86.122  60.705  1.00 124.70 ? 564  ILE A N   1 
ATOM   3724 C  CA  . ILE A 1 564 ? 20.834  85.028  60.730  1.00 124.70 ? 564  ILE A CA  1 
ATOM   3725 C  C   . ILE A 1 564 ? 19.520  85.384  61.440  1.00 124.70 ? 564  ILE A C   1 
ATOM   3726 O  O   . ILE A 1 564 ? 19.561  85.820  62.572  1.00 124.70 ? 564  ILE A O   1 
ATOM   3727 C  CB  . ILE A 1 564 ? 21.328  83.780  61.473  1.00 124.70 ? 564  ILE A CB  1 
ATOM   3728 C  CG1 . ILE A 1 564 ? 20.238  82.710  61.443  1.00 124.70 ? 564  ILE A CG1 1 
ATOM   3729 C  CG2 . ILE A 1 564 ? 21.627  84.107  62.923  1.00 124.70 ? 564  ILE A CG2 1 
ATOM   3730 C  CD1 . ILE A 1 564 ? 20.601  81.443  62.169  1.00 124.70 ? 564  ILE A CD1 1 
ATOM   3731 N  N   . SER A 1 565 ? 18.364  85.177  60.806  1.00 124.70 ? 565  SER A N   1 
ATOM   3732 C  CA  . SER A 1 565 ? 17.072  85.469  61.453  1.00 124.70 ? 565  SER A CA  1 
ATOM   3733 C  C   . SER A 1 565 ? 16.069  84.333  61.274  1.00 124.70 ? 565  SER A C   1 
ATOM   3734 O  O   . SER A 1 565 ? 16.241  83.471  60.415  1.00 124.70 ? 565  SER A O   1 
ATOM   3735 C  CB  . SER A 1 565 ? 16.471  86.771  60.921  1.00 124.70 ? 565  SER A CB  1 
ATOM   3736 O  OG  . SER A 1 565 ? 16.242  86.685  59.533  1.00 124.70 ? 565  SER A OG  1 
ATOM   3737 N  N   . SER A 1 566 ? 15.022  84.351  62.095  1.00 124.70 ? 566  SER A N   1 
ATOM   3738 C  CA  . SER A 1 566 ? 13.987  83.325  62.077  1.00 124.70 ? 566  SER A CA  1 
ATOM   3739 C  C   . SER A 1 566 ? 12.582  83.841  61.726  1.00 124.70 ? 566  SER A C   1 
ATOM   3740 O  O   . SER A 1 566 ? 12.274  84.979  62.022  1.00 124.70 ? 566  SER A O   1 
ATOM   3741 C  CB  . SER A 1 566 ? 13.975  82.617  63.425  1.00 124.70 ? 566  SER A CB  1 
ATOM   3742 O  OG  . SER A 1 566 ? 14.634  83.414  64.393  1.00 124.70 ? 566  SER A OG  1 
ATOM   3743 N  N   . ILE A 1 567 ? 11.717  83.027  61.111  1.00 124.70 ? 567  ILE A N   1 
ATOM   3744 C  CA  . ILE A 1 567 ? 10.384  83.546  60.746  1.00 124.70 ? 567  ILE A CA  1 
ATOM   3745 C  C   . ILE A 1 567 ? 9.234   82.565  60.479  1.00 124.70 ? 567  ILE A C   1 
ATOM   3746 O  O   . ILE A 1 567 ? 9.401   81.539  59.831  1.00 124.70 ? 567  ILE A O   1 
ATOM   3747 C  CB  . ILE A 1 567 ? 10.464  84.429  59.507  1.00 124.70 ? 567  ILE A CB  1 
ATOM   3748 C  CG1 . ILE A 1 567 ? 9.121   85.118  59.284  1.00 124.70 ? 567  ILE A CG1 1 
ATOM   3749 C  CG2 . ILE A 1 567 ? 10.793  83.579  58.300  1.00 124.70 ? 567  ILE A CG2 1 
ATOM   3750 C  CD1 . ILE A 1 567 ? 9.071   85.934  58.035  1.00 124.70 ? 567  ILE A CD1 1 
ATOM   3751 N  N   . ASP A 1 568 ? 8.044   82.907  60.957  1.00 124.70 ? 568  ASP A N   1 
ATOM   3752 C  CA  . ASP A 1 568 ? 6.886   82.041  60.784  1.00 124.70 ? 568  ASP A CA  1 
ATOM   3753 C  C   . ASP A 1 568 ? 6.672   81.707  59.313  1.00 124.70 ? 568  ASP A C   1 
ATOM   3754 O  O   . ASP A 1 568 ? 7.190   82.401  58.441  1.00 124.70 ? 568  ASP A O   1 
ATOM   3755 C  CB  . ASP A 1 568 ? 5.671   82.743  61.380  1.00 124.70 ? 568  ASP A CB  1 
ATOM   3756 C  CG  . ASP A 1 568 ? 5.893   83.133  62.829  1.00 124.70 ? 568  ASP A CG  1 
ATOM   3757 O  OD1 . ASP A 1 568 ? 7.058   83.423  63.181  1.00 124.70 ? 568  ASP A OD1 1 
ATOM   3758 O  OD2 . ASP A 1 568 ? 4.918   83.158  63.614  1.00 124.70 ? 568  ASP A OD2 1 
ATOM   3759 N  N   . VAL A 1 569 ? 5.942   80.632  59.029  1.00 124.70 ? 569  VAL A N   1 
ATOM   3760 C  CA  . VAL A 1 569 ? 5.673   80.264  57.640  1.00 124.70 ? 569  VAL A CA  1 
ATOM   3761 C  C   . VAL A 1 569 ? 4.692   81.285  57.078  1.00 124.70 ? 569  VAL A C   1 
ATOM   3762 O  O   . VAL A 1 569 ? 3.862   81.007  56.216  1.00 124.70 ? 569  VAL A O   1 
ATOM   3763 C  CB  . VAL A 1 569 ? 5.075   78.848  57.518  1.00 124.70 ? 569  VAL A CB  1 
ATOM   3764 C  CG1 . VAL A 1 569 ? 6.111   77.808  57.915  1.00 124.70 ? 569  VAL A CG1 1 
ATOM   3765 C  CG2 . VAL A 1 569 ? 3.826   78.734  58.371  1.00 124.70 ? 569  VAL A CG2 1 
ATOM   3766 N  N   . ASN A 1 570 ? 4.824   82.488  57.607  1.00 124.70 ? 570  ASN A N   1 
ATOM   3767 C  CA  . ASN A 1 570 ? 4.020   83.643  57.244  1.00 124.70 ? 570  ASN A CA  1 
ATOM   3768 C  C   . ASN A 1 570 ? 4.723   84.841  57.897  1.00 124.70 ? 570  ASN A C   1 
ATOM   3769 O  O   . ASN A 1 570 ? 5.153   84.743  59.036  1.00 124.70 ? 570  ASN A O   1 
ATOM   3770 C  CB  . ASN A 1 570 ? 2.615   83.527  57.834  1.00 124.70 ? 570  ASN A CB  1 
ATOM   3771 C  CG  . ASN A 1 570 ? 1.590   83.155  56.816  1.00 124.70 ? 570  ASN A CG  1 
ATOM   3772 O  OD1 . ASN A 1 570 ? 1.365   81.979  56.537  1.00 124.70 ? 570  ASN A OD1 1 
ATOM   3773 N  ND2 . ASN A 1 570 ? 0.952   84.159  56.250  1.00 124.70 ? 570  ASN A ND2 1 
ATOM   3774 N  N   . GLY A 1 571 ? 4.869   85.965  57.205  1.00 124.70 ? 571  GLY A N   1 
ATOM   3775 C  CA  . GLY A 1 571 ? 5.514   87.112  57.837  1.00 124.70 ? 571  GLY A CA  1 
ATOM   3776 C  C   . GLY A 1 571 ? 5.536   86.949  59.339  1.00 124.70 ? 571  GLY A C   1 
ATOM   3777 O  O   . GLY A 1 571 ? 6.547   86.527  59.891  1.00 124.70 ? 571  GLY A O   1 
ATOM   3778 N  N   . GLY A 1 572 ? 4.405   87.235  59.978  1.00 124.70 ? 572  GLY A N   1 
ATOM   3779 C  CA  . GLY A 1 572 ? 4.273   87.086  61.415  1.00 124.70 ? 572  GLY A CA  1 
ATOM   3780 C  C   . GLY A 1 572 ? 5.533   87.054  62.274  1.00 124.70 ? 572  GLY A C   1 
ATOM   3781 O  O   . GLY A 1 572 ? 5.870   86.014  62.874  1.00 124.70 ? 572  GLY A O   1 
ATOM   3782 N  N   . ASN A 1 573 ? 6.234   88.185  62.344  1.00 124.70 ? 573  ASN A N   1 
ATOM   3783 C  CA  . ASN A 1 573 ? 7.434   88.289  63.176  1.00 124.70 ? 573  ASN A CA  1 
ATOM   3784 C  C   . ASN A 1 573 ? 8.703   87.504  62.859  1.00 124.70 ? 573  ASN A C   1 
ATOM   3785 O  O   . ASN A 1 573 ? 9.042   86.547  63.563  1.00 124.70 ? 573  ASN A O   1 
ATOM   3786 C  CB  . ASN A 1 573 ? 7.085   87.966  64.626  1.00 124.70 ? 573  ASN A CB  1 
ATOM   3787 C  CG  . ASN A 1 573 ? 5.848   88.705  65.116  1.00 124.70 ? 573  ASN A CG  1 
ATOM   3788 O  OD1 . ASN A 1 573 ? 5.704   89.922  64.924  1.00 124.70 ? 573  ASN A OD1 1 
ATOM   3789 N  ND2 . ASN A 1 573 ? 4.950   87.972  65.767  1.00 124.70 ? 573  ASN A ND2 1 
ATOM   3790 N  N   . ARG A 1 574 ? 9.424   87.922  61.830  1.00 124.70 ? 574  ARG A N   1 
ATOM   3791 C  CA  . ARG A 1 574 ? 10.680  87.271  61.528  1.00 124.70 ? 574  ARG A CA  1 
ATOM   3792 C  C   . ARG A 1 574 ? 11.494  87.609  62.781  1.00 124.70 ? 574  ARG A C   1 
ATOM   3793 O  O   . ARG A 1 574 ? 11.511  88.747  63.221  1.00 124.70 ? 574  ARG A O   1 
ATOM   3794 C  CB  . ARG A 1 574 ? 11.326  87.892  60.275  1.00 124.70 ? 574  ARG A CB  1 
ATOM   3795 N  N   . LYS A 1 575 ? 12.136  86.619  63.380  1.00 124.70 ? 575  LYS A N   1 
ATOM   3796 C  CA  . LYS A 1 575 ? 12.943  86.844  64.572  1.00 124.70 ? 575  LYS A CA  1 
ATOM   3797 C  C   . LYS A 1 575 ? 14.448  86.830  64.281  1.00 124.70 ? 575  LYS A C   1 
ATOM   3798 O  O   . LYS A 1 575 ? 15.078  85.799  64.018  1.00 124.70 ? 575  LYS A O   1 
ATOM   3799 C  CB  . LYS A 1 575 ? 12.593  85.833  65.629  1.00 124.70 ? 575  LYS A CB  1 
ATOM   3800 N  N   . THR A 1 576 ? 14.977  88.040  64.350  1.00 124.70 ? 576  THR A N   1 
ATOM   3801 C  CA  . THR A 1 576 ? 16.354  88.408  64.099  1.00 124.70 ? 576  THR A CA  1 
ATOM   3802 C  C   . THR A 1 576 ? 17.409  87.820  65.031  1.00 124.70 ? 576  THR A C   1 
ATOM   3803 O  O   . THR A 1 576 ? 17.181  87.678  66.233  1.00 124.70 ? 576  THR A O   1 
ATOM   3804 C  CB  . THR A 1 576 ? 16.433  89.948  64.150  1.00 124.70 ? 576  THR A CB  1 
ATOM   3805 O  OG1 . THR A 1 576 ? 15.841  90.491  62.971  1.00 124.70 ? 576  THR A OG1 1 
ATOM   3806 C  CG2 . THR A 1 576 ? 17.841  90.425  64.260  1.00 124.70 ? 576  THR A CG2 1 
ATOM   3807 N  N   . ILE A 1 577 ? 18.566  87.474  64.470  1.00 124.70 ? 577  ILE A N   1 
ATOM   3808 C  CA  . ILE A 1 577 ? 19.654  86.963  65.285  1.00 124.70 ? 577  ILE A CA  1 
ATOM   3809 C  C   . ILE A 1 577 ? 21.070  87.079  64.783  1.00 124.70 ? 577  ILE A C   1 
ATOM   3810 O  O   . ILE A 1 577 ? 21.439  86.673  63.680  1.00 124.70 ? 577  ILE A O   1 
ATOM   3811 C  CB  . ILE A 1 577 ? 19.531  85.484  65.666  1.00 124.70 ? 577  ILE A CB  1 
ATOM   3812 C  CG1 . ILE A 1 577 ? 18.079  85.115  65.961  1.00 124.70 ? 577  ILE A CG1 1 
ATOM   3813 C  CG2 . ILE A 1 577 ? 20.456  85.219  66.863  1.00 124.70 ? 577  ILE A CG2 1 
ATOM   3814 C  CD1 . ILE A 1 577 ? 17.854  84.429  67.296  1.00 124.70 ? 577  ILE A CD1 1 
ATOM   3815 N  N   . LEU A 1 578 ? 21.844  87.661  65.670  1.00 124.70 ? 578  LEU A N   1 
ATOM   3816 C  CA  . LEU A 1 578 ? 23.268  87.820  65.572  1.00 124.70 ? 578  LEU A CA  1 
ATOM   3817 C  C   . LEU A 1 578 ? 24.120  88.388  64.456  1.00 124.70 ? 578  LEU A C   1 
ATOM   3818 O  O   . LEU A 1 578 ? 25.191  87.863  64.205  1.00 124.70 ? 578  LEU A O   1 
ATOM   3819 C  CB  . LEU A 1 578 ? 23.885  86.485  65.959  1.00 124.70 ? 578  LEU A CB  1 
ATOM   3820 C  CG  . LEU A 1 578 ? 25.389  86.612  66.184  1.00 124.70 ? 578  LEU A CG  1 
ATOM   3821 C  CD1 . LEU A 1 578 ? 25.644  87.638  67.282  1.00 124.70 ? 578  LEU A CD1 1 
ATOM   3822 C  CD2 . LEU A 1 578 ? 25.988  85.268  66.508  1.00 124.70 ? 578  LEU A CD2 1 
ATOM   3823 N  N   . GLU A 1 579 ? 23.742  89.434  63.760  1.00 124.70 ? 579  GLU A N   1 
ATOM   3824 C  CA  . GLU A 1 579 ? 24.752  89.875  62.812  1.00 124.70 ? 579  GLU A CA  1 
ATOM   3825 C  C   . GLU A 1 579 ? 26.019  90.177  63.663  1.00 124.70 ? 579  GLU A C   1 
ATOM   3826 O  O   . GLU A 1 579 ? 25.912  90.788  64.728  1.00 124.70 ? 579  GLU A O   1 
ATOM   3827 C  CB  . GLU A 1 579 ? 24.292  91.122  62.085  1.00 124.70 ? 579  GLU A CB  1 
ATOM   3828 N  N   . ASP A 1 580 ? 27.186  89.702  63.213  1.00 124.70 ? 580  ASP A N   1 
ATOM   3829 C  CA  . ASP A 1 580 ? 28.492  89.935  63.870  1.00 124.70 ? 580  ASP A CA  1 
ATOM   3830 C  C   . ASP A 1 580 ? 29.540  89.671  62.786  1.00 124.70 ? 580  ASP A C   1 
ATOM   3831 O  O   . ASP A 1 580 ? 29.454  88.674  62.071  1.00 124.70 ? 580  ASP A O   1 
ATOM   3832 C  CB  . ASP A 1 580 ? 28.711  88.990  65.065  1.00 124.70 ? 580  ASP A CB  1 
ATOM   3833 C  CG  . ASP A 1 580 ? 29.753  89.518  66.041  1.00 124.70 ? 580  ASP A CG  1 
ATOM   3834 O  OD1 . ASP A 1 580 ? 29.819  90.754  66.238  1.00 124.70 ? 580  ASP A OD1 1 
ATOM   3835 O  OD2 . ASP A 1 580 ? 30.490  88.696  66.621  1.00 124.70 ? 580  ASP A OD2 1 
ATOM   3836 N  N   . GLU A 1 581 ? 30.532  90.542  62.650  1.00 124.70 ? 581  GLU A N   1 
ATOM   3837 C  CA  . GLU A 1 581 ? 31.516  90.346  61.589  1.00 124.70 ? 581  GLU A CA  1 
ATOM   3838 C  C   . GLU A 1 581 ? 32.573  89.287  61.828  1.00 124.70 ? 581  GLU A C   1 
ATOM   3839 O  O   . GLU A 1 581 ? 33.689  89.435  61.349  1.00 124.70 ? 581  GLU A O   1 
ATOM   3840 C  CB  . GLU A 1 581 ? 32.243  91.641  61.295  1.00 124.70 ? 581  GLU A CB  1 
ATOM   3841 C  CG  . GLU A 1 581 ? 31.391  92.860  61.387  1.00 124.70 ? 581  GLU A CG  1 
ATOM   3842 C  CD  . GLU A 1 581 ? 32.234  94.113  61.382  1.00 124.70 ? 581  GLU A CD  1 
ATOM   3843 O  OE1 . GLU A 1 581 ? 32.808  94.435  60.314  1.00 124.70 ? 581  GLU A OE1 1 
ATOM   3844 O  OE2 . GLU A 1 581 ? 32.331  94.761  62.451  1.00 124.70 ? 581  GLU A OE2 1 
ATOM   3845 N  N   . LYS A 1 582 ? 32.258  88.227  62.555  1.00 124.70 ? 582  LYS A N   1 
ATOM   3846 C  CA  . LYS A 1 582 ? 33.267  87.210  62.790  1.00 124.70 ? 582  LYS A CA  1 
ATOM   3847 C  C   . LYS A 1 582 ? 32.613  85.926  63.213  1.00 124.70 ? 582  LYS A C   1 
ATOM   3848 O  O   . LYS A 1 582 ? 31.642  85.934  63.978  1.00 124.70 ? 582  LYS A O   1 
ATOM   3849 C  CB  . LYS A 1 582 ? 34.253  87.666  63.869  1.00 124.70 ? 582  LYS A CB  1 
ATOM   3850 C  CG  . LYS A 1 582 ? 35.018  88.931  63.529  1.00 124.70 ? 582  LYS A CG  1 
ATOM   3851 C  CD  . LYS A 1 582 ? 36.119  89.227  64.541  1.00 124.70 ? 582  LYS A CD  1 
ATOM   3852 C  CE  . LYS A 1 582 ? 36.766  90.588  64.277  1.00 124.70 ? 582  LYS A CE  1 
ATOM   3853 N  NZ  . LYS A 1 582 ? 37.929  90.883  65.167  1.00 124.70 ? 582  LYS A NZ  1 
ATOM   3854 N  N   . ARG A 1 583 ? 33.155  84.816  62.728  1.00 124.70 ? 583  ARG A N   1 
ATOM   3855 C  CA  . ARG A 1 583 ? 32.574  83.537  63.066  1.00 124.70 ? 583  ARG A CA  1 
ATOM   3856 C  C   . ARG A 1 583 ? 31.145  83.750  62.605  1.00 124.70 ? 583  ARG A C   1 
ATOM   3857 O  O   . ARG A 1 583 ? 30.175  83.505  63.317  1.00 124.70 ? 583  ARG A O   1 
ATOM   3858 C  CB  . ARG A 1 583 ? 32.642  83.316  64.563  1.00 124.70 ? 583  ARG A CB  1 
ATOM   3859 N  N   . LEU A 1 584 ? 31.082  84.294  61.398  1.00 124.70 ? 584  LEU A N   1 
ATOM   3860 C  CA  . LEU A 1 584 ? 29.875  84.601  60.669  1.00 124.70 ? 584  LEU A CA  1 
ATOM   3861 C  C   . LEU A 1 584 ? 30.368  85.181  59.363  1.00 124.70 ? 584  LEU A C   1 
ATOM   3862 O  O   . LEU A 1 584 ? 31.135  86.152  59.339  1.00 124.70 ? 584  LEU A O   1 
ATOM   3863 C  CB  . LEU A 1 584 ? 29.024  85.648  61.360  1.00 124.70 ? 584  LEU A CB  1 
ATOM   3864 C  CG  . LEU A 1 584 ? 28.014  86.140  60.323  1.00 124.70 ? 584  LEU A CG  1 
ATOM   3865 C  CD1 . LEU A 1 584 ? 26.751  85.312  60.338  1.00 124.70 ? 584  LEU A CD1 1 
ATOM   3866 C  CD2 . LEU A 1 584 ? 27.709  87.545  60.626  1.00 124.70 ? 584  LEU A CD2 1 
ATOM   3867 N  N   . ALA A 1 585 ? 29.917  84.563  58.284  1.00 124.70 ? 585  ALA A N   1 
ATOM   3868 C  CA  . ALA A 1 585 ? 30.255  84.975  56.942  1.00 124.70 ? 585  ALA A CA  1 
ATOM   3869 C  C   . ALA A 1 585 ? 29.836  83.768  56.137  1.00 124.70 ? 585  ALA A C   1 
ATOM   3870 O  O   . ALA A 1 585 ? 29.936  82.648  56.619  1.00 124.70 ? 585  ALA A O   1 
ATOM   3871 C  CB  . ALA A 1 585 ? 31.753  85.229  56.838  1.00 124.70 ? 585  ALA A CB  1 
ATOM   3872 N  N   . HIS A 1 586 ? 29.303  83.971  54.947  1.00 124.70 ? 586  HIS A N   1 
ATOM   3873 C  CA  . HIS A 1 586 ? 28.935  82.821  54.143  1.00 124.70 ? 586  HIS A CA  1 
ATOM   3874 C  C   . HIS A 1 586 ? 28.338  81.607  54.897  1.00 124.70 ? 586  HIS A C   1 
ATOM   3875 O  O   . HIS A 1 586 ? 28.925  80.534  54.926  1.00 124.70 ? 586  HIS A O   1 
ATOM   3876 C  CB  . HIS A 1 586 ? 30.149  82.323  53.375  1.00 124.70 ? 586  HIS A CB  1 
ATOM   3877 C  CG  . HIS A 1 586 ? 30.744  83.284  52.422  1.00 124.70 ? 586  HIS A CG  1 
ATOM   3878 N  ND1 . HIS A 1 586 ? 30.360  83.323  51.104  1.00 124.70 ? 586  HIS A ND1 1 
ATOM   3879 C  CD2 . HIS A 1 586 ? 31.777  84.147  52.548  1.00 124.70 ? 586  HIS A CD2 1 
ATOM   3880 C  CE1 . HIS A 1 586 ? 31.137  84.161  50.453  1.00 124.70 ? 586  HIS A CE1 1 
ATOM   3881 N  NE2 . HIS A 1 586 ? 32.007  84.674  51.305  1.00 124.70 ? 586  HIS A NE2 1 
ATOM   3882 N  N   . PRO A 1 587 ? 27.209  81.773  55.589  1.00 124.70 ? 587  PRO A N   1 
ATOM   3883 C  CA  . PRO A 1 587 ? 26.758  80.521  56.213  1.00 124.70 ? 587  PRO A CA  1 
ATOM   3884 C  C   . PRO A 1 587 ? 26.574  79.531  55.061  1.00 124.70 ? 587  PRO A C   1 
ATOM   3885 O  O   . PRO A 1 587 ? 26.735  79.898  53.905  1.00 124.70 ? 587  PRO A O   1 
ATOM   3886 C  CB  . PRO A 1 587 ? 25.430  80.904  56.823  1.00 124.70 ? 587  PRO A CB  1 
ATOM   3887 C  CG  . PRO A 1 587 ? 25.557  82.425  57.093  1.00 124.70 ? 587  PRO A CG  1 
ATOM   3888 C  CD  . PRO A 1 587 ? 26.773  82.941  56.373  1.00 124.70 ? 587  PRO A CD  1 
ATOM   3889 N  N   . PHE A 1 588 ? 26.232  78.290  55.334  1.00 124.70 ? 588  PHE A N   1 
ATOM   3890 C  CA  . PHE A 1 588 ? 26.076  77.377  54.221  1.00 124.70 ? 588  PHE A CA  1 
ATOM   3891 C  C   . PHE A 1 588 ? 25.364  76.186  54.780  1.00 124.70 ? 588  PHE A C   1 
ATOM   3892 O  O   . PHE A 1 588 ? 25.445  75.070  54.294  1.00 124.70 ? 588  PHE A O   1 
ATOM   3893 C  CB  . PHE A 1 588 ? 27.444  76.979  53.683  1.00 124.70 ? 588  PHE A CB  1 
ATOM   3894 C  CG  . PHE A 1 588 ? 28.126  78.044  52.876  1.00 124.70 ? 588  PHE A CG  1 
ATOM   3895 C  CD1 . PHE A 1 588 ? 29.296  78.598  53.336  1.00 124.70 ? 588  PHE A CD1 1 
ATOM   3896 C  CD2 . PHE A 1 588 ? 27.621  78.482  51.654  1.00 124.70 ? 588  PHE A CD2 1 
ATOM   3897 C  CE1 . PHE A 1 588 ? 29.952  79.561  52.603  1.00 124.70 ? 588  PHE A CE1 1 
ATOM   3898 C  CE2 . PHE A 1 588 ? 28.273  79.450  50.908  1.00 124.70 ? 588  PHE A CE2 1 
ATOM   3899 C  CZ  . PHE A 1 588 ? 29.444  79.992  51.386  1.00 124.70 ? 588  PHE A CZ  1 
ATOM   3900 N  N   . SER A 1 589 ? 24.651  76.445  55.845  1.00 124.70 ? 589  SER A N   1 
ATOM   3901 C  CA  . SER A 1 589 ? 23.928  75.396  56.479  1.00 124.70 ? 589  SER A CA  1 
ATOM   3902 C  C   . SER A 1 589 ? 23.119  76.110  57.499  1.00 124.70 ? 589  SER A C   1 
ATOM   3903 O  O   . SER A 1 589 ? 23.084  77.335  57.555  1.00 124.70 ? 589  SER A O   1 
ATOM   3904 C  CB  . SER A 1 589 ? 24.877  74.417  57.169  1.00 124.70 ? 589  SER A CB  1 
ATOM   3905 O  OG  . SER A 1 589 ? 25.635  73.692  56.226  1.00 124.70 ? 589  SER A OG  1 
ATOM   3906 N  N   . LEU A 1 590 ? 22.481  75.327  58.331  1.00 124.70 ? 590  LEU A N   1 
ATOM   3907 C  CA  . LEU A 1 590 ? 21.670  75.887  59.349  1.00 124.70 ? 590  LEU A CA  1 
ATOM   3908 C  C   . LEU A 1 590 ? 21.083  74.656  59.929  1.00 124.70 ? 590  LEU A C   1 
ATOM   3909 O  O   . LEU A 1 590 ? 20.632  73.781  59.200  1.00 124.70 ? 590  LEU A O   1 
ATOM   3910 C  CB  . LEU A 1 590 ? 20.589  76.712  58.729  1.00 124.70 ? 590  LEU A CB  1 
ATOM   3911 C  CG  . LEU A 1 590 ? 20.001  77.627  59.770  1.00 124.70 ? 590  LEU A CG  1 
ATOM   3912 C  CD1 . LEU A 1 590 ? 21.000  78.701  60.112  1.00 124.70 ? 590  LEU A CD1 1 
ATOM   3913 C  CD2 . LEU A 1 590 ? 18.751  78.232  59.222  1.00 124.70 ? 590  LEU A CD2 1 
ATOM   3914 N  N   . ALA A 1 591 ? 21.115  74.563  61.243  1.00 124.70 ? 591  ALA A N   1 
ATOM   3915 C  CA  . ALA A 1 591 ? 20.575  73.392  61.904  1.00 124.70 ? 591  ALA A CA  1 
ATOM   3916 C  C   . ALA A 1 591 ? 20.141  73.840  63.266  1.00 124.70 ? 591  ALA A C   1 
ATOM   3917 O  O   . ALA A 1 591 ? 20.912  74.452  64.006  1.00 124.70 ? 591  ALA A O   1 
ATOM   3918 C  CB  . ALA A 1 591 ? 21.631  72.316  62.020  1.00 124.70 ? 591  ALA A CB  1 
ATOM   3919 N  N   . VAL A 1 592 ? 18.900  73.548  63.603  1.00 124.70 ? 592  VAL A N   1 
ATOM   3920 C  CA  . VAL A 1 592 ? 18.420  73.969  64.888  1.00 124.70 ? 592  VAL A CA  1 
ATOM   3921 C  C   . VAL A 1 592 ? 18.060  72.819  65.765  1.00 124.70 ? 592  VAL A C   1 
ATOM   3922 O  O   . VAL A 1 592 ? 17.062  72.138  65.510  1.00 124.70 ? 592  VAL A O   1 
ATOM   3923 C  CB  . VAL A 1 592 ? 17.155  74.847  64.785  1.00 124.70 ? 592  VAL A CB  1 
ATOM   3924 C  CG1 . VAL A 1 592 ? 17.438  76.084  63.971  1.00 124.70 ? 592  VAL A CG1 1 
ATOM   3925 C  CG2 . VAL A 1 592 ? 16.010  74.055  64.169  1.00 124.70 ? 592  VAL A CG2 1 
ATOM   3926 N  N   . PHE A 1 593 ? 18.884  72.510  66.758  1.00 124.70 ? 593  PHE A N   1 
ATOM   3927 C  CA  . PHE A 1 593 ? 18.338  71.509  67.611  1.00 124.70 ? 593  PHE A CA  1 
ATOM   3928 C  C   . PHE A 1 593 ? 17.858  72.287  68.769  1.00 124.70 ? 593  PHE A C   1 
ATOM   3929 O  O   . PHE A 1 593 ? 18.354  73.389  69.049  1.00 124.70 ? 593  PHE A O   1 
ATOM   3930 C  CB  . PHE A 1 593 ? 19.205  70.361  68.041  1.00 124.70 ? 593  PHE A CB  1 
ATOM   3931 C  CG  . PHE A 1 593 ? 18.356  69.174  68.368  1.00 124.70 ? 593  PHE A CG  1 
ATOM   3932 C  CD1 . PHE A 1 593 ? 17.468  68.693  67.412  1.00 124.70 ? 593  PHE A CD1 1 
ATOM   3933 C  CD2 . PHE A 1 593 ? 18.311  68.624  69.628  1.00 124.70 ? 593  PHE A CD2 1 
ATOM   3934 C  CE1 . PHE A 1 593 ? 16.550  67.698  67.675  1.00 124.70 ? 593  PHE A CE1 1 
ATOM   3935 C  CE2 . PHE A 1 593 ? 17.380  67.610  69.918  1.00 124.70 ? 593  PHE A CE2 1 
ATOM   3936 C  CZ  . PHE A 1 593 ? 16.501  67.152  68.929  1.00 124.70 ? 593  PHE A CZ  1 
ATOM   3937 N  N   . GLU A 1 594 ? 16.898  71.716  69.467  1.00 124.70 ? 594  GLU A N   1 
ATOM   3938 C  CA  . GLU A 1 594 ? 16.289  72.518  70.458  1.00 124.70 ? 594  GLU A CA  1 
ATOM   3939 C  C   . GLU A 1 594 ? 17.074  73.384  71.357  1.00 124.70 ? 594  GLU A C   1 
ATOM   3940 O  O   . GLU A 1 594 ? 17.829  72.965  72.232  1.00 124.70 ? 594  GLU A O   1 
ATOM   3941 C  CB  . GLU A 1 594 ? 15.172  71.787  71.151  1.00 124.70 ? 594  GLU A CB  1 
ATOM   3942 C  CG  . GLU A 1 594 ? 13.884  72.547  70.816  1.00 124.70 ? 594  GLU A CG  1 
ATOM   3943 C  CD  . GLU A 1 594 ? 13.844  73.118  69.373  1.00 124.70 ? 594  GLU A CD  1 
ATOM   3944 O  OE1 . GLU A 1 594 ? 14.902  73.366  68.760  1.00 124.70 ? 594  GLU A OE1 1 
ATOM   3945 O  OE2 . GLU A 1 594 ? 12.737  73.344  68.846  1.00 124.70 ? 594  GLU A OE2 1 
ATOM   3946 N  N   . ASP A 1 595 ? 16.854  74.647  71.005  1.00 124.70 ? 595  ASP A N   1 
ATOM   3947 C  CA  . ASP A 1 595 ? 17.388  75.866  71.561  1.00 124.70 ? 595  ASP A CA  1 
ATOM   3948 C  C   . ASP A 1 595 ? 18.887  75.930  71.595  1.00 124.70 ? 595  ASP A C   1 
ATOM   3949 O  O   . ASP A 1 595 ? 19.528  76.251  72.590  1.00 124.70 ? 595  ASP A O   1 
ATOM   3950 C  CB  . ASP A 1 595 ? 16.728  76.204  72.908  1.00 124.70 ? 595  ASP A CB  1 
ATOM   3951 C  CG  . ASP A 1 595 ? 17.142  75.292  74.031  1.00 124.70 ? 595  ASP A CG  1 
ATOM   3952 O  OD1 . ASP A 1 595 ? 17.665  75.833  75.031  1.00 124.70 ? 595  ASP A OD1 1 
ATOM   3953 O  OD2 . ASP A 1 595 ? 16.930  74.060  73.942  1.00 124.70 ? 595  ASP A OD2 1 
ATOM   3954 N  N   . LYS A 1 596 ? 19.413  75.606  70.430  1.00 124.70 ? 596  LYS A N   1 
ATOM   3955 C  CA  . LYS A 1 596 ? 20.816  75.638  70.116  1.00 124.70 ? 596  LYS A CA  1 
ATOM   3956 C  C   . LYS A 1 596 ? 20.707  75.586  68.617  1.00 124.70 ? 596  LYS A C   1 
ATOM   3957 O  O   . LYS A 1 596 ? 19.883  74.861  68.051  1.00 124.70 ? 596  LYS A O   1 
ATOM   3958 C  CB  . LYS A 1 596 ? 21.585  74.438  70.680  1.00 124.70 ? 596  LYS A CB  1 
ATOM   3959 C  CG  . LYS A 1 596 ? 22.294  74.795  71.997  1.00 124.70 ? 596  LYS A CG  1 
ATOM   3960 C  CD  . LYS A 1 596 ? 23.803  74.500  71.978  1.00 124.70 ? 596  LYS A CD  1 
ATOM   3961 C  CE  . LYS A 1 596 ? 24.642  75.638  72.612  1.00 124.70 ? 596  LYS A CE  1 
ATOM   3962 N  NZ  . LYS A 1 596 ? 26.127  75.379  72.593  1.00 124.70 ? 596  LYS A NZ  1 
ATOM   3963 N  N   . VAL A 1 597 ? 21.490  76.437  67.983  1.00 124.70 ? 597  VAL A N   1 
ATOM   3964 C  CA  . VAL A 1 597 ? 21.496  76.518  66.549  1.00 124.70 ? 597  VAL A CA  1 
ATOM   3965 C  C   . VAL A 1 597 ? 22.859  76.093  66.070  1.00 124.70 ? 597  VAL A C   1 
ATOM   3966 O  O   . VAL A 1 597 ? 23.846  76.127  66.807  1.00 124.70 ? 597  VAL A O   1 
ATOM   3967 C  CB  . VAL A 1 597 ? 21.270  77.936  66.079  1.00 124.70 ? 597  VAL A CB  1 
ATOM   3968 C  CG1 . VAL A 1 597 ? 22.415  78.806  66.534  1.00 124.70 ? 597  VAL A CG1 1 
ATOM   3969 C  CG2 . VAL A 1 597 ? 21.177  77.961  64.579  1.00 124.70 ? 597  VAL A CG2 1 
ATOM   3970 N  N   . PHE A 1 598 ? 22.917  75.701  64.816  1.00 124.70 ? 598  PHE A N   1 
ATOM   3971 C  CA  . PHE A 1 598 ? 24.164  75.278  64.262  1.00 124.70 ? 598  PHE A CA  1 
ATOM   3972 C  C   . PHE A 1 598 ? 24.171  75.758  62.856  1.00 124.70 ? 598  PHE A C   1 
ATOM   3973 O  O   . PHE A 1 598 ? 23.127  76.013  62.261  1.00 124.70 ? 598  PHE A O   1 
ATOM   3974 C  CB  . PHE A 1 598 ? 24.264  73.762  64.290  1.00 124.70 ? 598  PHE A CB  1 
ATOM   3975 C  CG  . PHE A 1 598 ? 24.170  73.179  65.668  1.00 124.70 ? 598  PHE A CG  1 
ATOM   3976 C  CD1 . PHE A 1 598 ? 22.929  72.862  66.230  1.00 124.70 ? 598  PHE A CD1 1 
ATOM   3977 C  CD2 . PHE A 1 598 ? 25.326  72.961  66.413  1.00 124.70 ? 598  PHE A CD2 1 
ATOM   3978 C  CE1 . PHE A 1 598 ? 22.838  72.332  67.522  1.00 124.70 ? 598  PHE A CE1 1 
ATOM   3979 C  CE2 . PHE A 1 598 ? 25.256  72.432  67.704  1.00 124.70 ? 598  PHE A CE2 1 
ATOM   3980 C  CZ  . PHE A 1 598 ? 24.007  72.115  68.263  1.00 124.70 ? 598  PHE A CZ  1 
ATOM   3981 N  N   . TRP A 1 599 ? 25.359  75.907  62.321  1.00 124.70 ? 599  TRP A N   1 
ATOM   3982 C  CA  . TRP A 1 599 ? 25.448  76.342  60.966  1.00 124.70 ? 599  TRP A CA  1 
ATOM   3983 C  C   . TRP A 1 599 ? 26.806  76.115  60.512  1.00 124.70 ? 599  TRP A C   1 
ATOM   3984 O  O   . TRP A 1 599 ? 27.762  76.263  61.263  1.00 124.70 ? 599  TRP A O   1 
ATOM   3985 C  CB  . TRP A 1 599 ? 25.173  77.809  60.825  1.00 124.70 ? 599  TRP A CB  1 
ATOM   3986 C  CG  . TRP A 1 599 ? 25.707  78.576  61.931  1.00 124.70 ? 599  TRP A CG  1 
ATOM   3987 C  CD1 . TRP A 1 599 ? 25.195  78.637  63.186  1.00 124.70 ? 599  TRP A CD1 1 
ATOM   3988 C  CD2 . TRP A 1 599 ? 26.798  79.489  61.894  1.00 124.70 ? 599  TRP A CD2 1 
ATOM   3989 N  NE1 . TRP A 1 599 ? 25.894  79.540  63.941  1.00 124.70 ? 599  TRP A NE1 1 
ATOM   3990 C  CE2 . TRP A 1 599 ? 26.893  80.072  63.174  1.00 124.70 ? 599  TRP A CE2 1 
ATOM   3991 C  CE3 . TRP A 1 599 ? 27.712  79.862  60.916  1.00 124.70 ? 599  TRP A CE3 1 
ATOM   3992 C  CZ2 . TRP A 1 599 ? 27.849  81.032  63.488  1.00 124.70 ? 599  TRP A CZ2 1 
ATOM   3993 C  CZ3 . TRP A 1 599 ? 28.649  80.812  61.230  1.00 124.70 ? 599  TRP A CZ3 1 
ATOM   3994 C  CH2 . TRP A 1 599 ? 28.724  81.381  62.506  1.00 124.70 ? 599  TRP A CH2 1 
ATOM   3995 N  N   . THR A 1 600 ? 26.883  75.750  59.253  1.00 124.70 ? 600  THR A N   1 
ATOM   3996 C  CA  . THR A 1 600 ? 28.155  75.534  58.674  1.00 124.70 ? 600  THR A CA  1 
ATOM   3997 C  C   . THR A 1 600 ? 28.747  76.882  58.590  1.00 124.70 ? 600  THR A C   1 
ATOM   3998 O  O   . THR A 1 600 ? 28.054  77.891  58.535  1.00 124.70 ? 600  THR A O   1 
ATOM   3999 C  CB  . THR A 1 600 ? 28.081  75.064  57.256  1.00 124.70 ? 600  THR A CB  1 
ATOM   4000 O  OG1 . THR A 1 600 ? 28.076  73.637  57.229  1.00 124.70 ? 600  THR A OG1 1 
ATOM   4001 C  CG2 . THR A 1 600 ? 29.270  75.611  56.476  1.00 124.70 ? 600  THR A CG2 1 
ATOM   4002 N  N   . ASP A 1 601 ? 30.056  76.902  58.584  1.00 124.70 ? 601  ASP A N   1 
ATOM   4003 C  CA  . ASP A 1 601 ? 30.651  78.157  58.390  1.00 124.70 ? 601  ASP A CA  1 
ATOM   4004 C  C   . ASP A 1 601 ? 31.717  78.184  57.338  1.00 124.70 ? 601  ASP A C   1 
ATOM   4005 O  O   . ASP A 1 601 ? 32.386  77.181  57.024  1.00 124.70 ? 601  ASP A O   1 
ATOM   4006 C  CB  . ASP A 1 601 ? 31.172  78.736  59.665  1.00 124.70 ? 601  ASP A CB  1 
ATOM   4007 C  CG  . ASP A 1 601 ? 30.884  80.196  59.741  1.00 124.70 ? 601  ASP A CG  1 
ATOM   4008 O  OD1 . ASP A 1 601 ? 30.598  80.793  58.677  1.00 124.70 ? 601  ASP A OD1 1 
ATOM   4009 O  OD2 . ASP A 1 601 ? 30.937  80.749  60.852  1.00 124.70 ? 601  ASP A OD2 1 
ATOM   4010 N  N   . ILE A 1 602 ? 31.820  79.382  56.778  1.00 124.70 ? 602  ILE A N   1 
ATOM   4011 C  CA  . ILE A 1 602 ? 32.769  79.716  55.732  1.00 124.70 ? 602  ILE A CA  1 
ATOM   4012 C  C   . ILE A 1 602 ? 34.151  79.839  56.251  1.00 124.70 ? 602  ILE A C   1 
ATOM   4013 O  O   . ILE A 1 602 ? 34.441  79.441  57.366  1.00 124.70 ? 602  ILE A O   1 
ATOM   4014 C  CB  . ILE A 1 602 ? 32.462  81.018  55.118  1.00 124.70 ? 602  ILE A CB  1 
ATOM   4015 C  CG1 . ILE A 1 602 ? 32.818  82.175  56.065  1.00 124.70 ? 602  ILE A CG1 1 
ATOM   4016 C  CG2 . ILE A 1 602 ? 31.088  81.001  54.868  1.00 124.70 ? 602  ILE A CG2 1 
ATOM   4017 C  CD1 . ILE A 1 602 ? 32.675  83.502  55.450  1.00 124.70 ? 602  ILE A CD1 1 
ATOM   4018 N  N   . ILE A 1 603 ? 35.003  80.475  55.464  1.00 124.70 ? 603  ILE A N   1 
ATOM   4019 C  CA  . ILE A 1 603 ? 36.353  80.550  55.897  1.00 124.70 ? 603  ILE A CA  1 
ATOM   4020 C  C   . ILE A 1 603 ? 36.681  81.323  57.141  1.00 124.70 ? 603  ILE A C   1 
ATOM   4021 O  O   . ILE A 1 603 ? 36.743  82.566  57.300  1.00 124.70 ? 603  ILE A O   1 
ATOM   4022 C  CB  . ILE A 1 603 ? 37.329  80.755  54.721  1.00 124.70 ? 603  ILE A CB  1 
ATOM   4023 C  CG1 . ILE A 1 603 ? 36.909  81.910  53.830  1.00 124.70 ? 603  ILE A CG1 1 
ATOM   4024 C  CG2 . ILE A 1 603 ? 37.367  79.465  53.909  1.00 124.70 ? 603  ILE A CG2 1 
ATOM   4025 C  CD1 . ILE A 1 603 ? 37.741  82.006  52.557  1.00 124.70 ? 603  ILE A CD1 1 
ATOM   4026 N  N   . ASN A 1 604 ? 36.767  80.319  57.995  1.00 124.70 ? 604  ASN A N   1 
ATOM   4027 C  CA  . ASN A 1 604 ? 37.077  80.072  59.369  1.00 124.70 ? 604  ASN A CA  1 
ATOM   4028 C  C   . ASN A 1 604 ? 36.807  78.595  59.010  1.00 124.70 ? 604  ASN A C   1 
ATOM   4029 O  O   . ASN A 1 604 ? 35.700  78.152  59.251  1.00 124.70 ? 604  ASN A O   1 
ATOM   4030 C  CB  . ASN A 1 604 ? 35.949  80.297  60.393  1.00 124.70 ? 604  ASN A CB  1 
ATOM   4031 C  CG  . ASN A 1 604 ? 35.178  81.602  60.233  1.00 124.70 ? 604  ASN A CG  1 
ATOM   4032 O  OD1 . ASN A 1 604 ? 34.588  81.880  59.192  1.00 124.70 ? 604  ASN A OD1 1 
ATOM   4033 N  ND2 . ASN A 1 604 ? 35.143  82.392  61.308  1.00 124.70 ? 604  ASN A ND2 1 
ATOM   4034 N  N   . GLU A 1 605 ? 37.686  77.811  58.416  1.00 124.70 ? 605  GLU A N   1 
ATOM   4035 C  CA  . GLU A 1 605 ? 37.187  76.460  58.148  1.00 124.70 ? 605  GLU A CA  1 
ATOM   4036 C  C   . GLU A 1 605 ? 36.660  75.793  59.472  1.00 124.70 ? 605  GLU A C   1 
ATOM   4037 O  O   . GLU A 1 605 ? 37.355  74.988  60.078  1.00 124.70 ? 605  GLU A O   1 
ATOM   4038 C  CB  . GLU A 1 605 ? 38.296  75.683  57.453  1.00 124.70 ? 605  GLU A CB  1 
ATOM   4039 C  CG  . GLU A 1 605 ? 38.613  76.203  56.043  1.00 124.70 ? 605  GLU A CG  1 
ATOM   4040 C  CD  . GLU A 1 605 ? 39.498  77.457  56.016  1.00 124.70 ? 605  GLU A CD  1 
ATOM   4041 O  OE1 . GLU A 1 605 ? 40.283  77.670  56.970  1.00 124.70 ? 605  GLU A OE1 1 
ATOM   4042 O  OE2 . GLU A 1 605 ? 39.429  78.222  55.022  1.00 124.70 ? 605  GLU A OE2 1 
ATOM   4043 N  N   . ALA A 1 606 ? 35.424  76.144  59.899  1.00 124.70 ? 606  ALA A N   1 
ATOM   4044 C  CA  . ALA A 1 606 ? 34.799  75.673  61.178  1.00 124.70 ? 606  ALA A CA  1 
ATOM   4045 C  C   . ALA A 1 606 ? 33.239  75.688  61.339  1.00 124.70 ? 606  ALA A C   1 
ATOM   4046 O  O   . ALA A 1 606 ? 32.528  76.252  60.511  1.00 124.70 ? 606  ALA A O   1 
ATOM   4047 C  CB  . ALA A 1 606 ? 35.427  76.447  62.354  1.00 124.70 ? 606  ALA A CB  1 
ATOM   4048 N  N   . ILE A 1 607 ? 32.740  75.078  62.426  1.00 124.70 ? 607  ILE A N   1 
ATOM   4049 C  CA  . ILE A 1 607 ? 31.299  74.963  62.733  1.00 124.70 ? 607  ILE A CA  1 
ATOM   4050 C  C   . ILE A 1 607 ? 30.920  75.429  64.106  1.00 124.70 ? 607  ILE A C   1 
ATOM   4051 O  O   . ILE A 1 607 ? 31.651  75.224  65.074  1.00 124.70 ? 607  ILE A O   1 
ATOM   4052 C  CB  . ILE A 1 607 ? 30.811  73.544  62.718  1.00 124.70 ? 607  ILE A CB  1 
ATOM   4053 C  CG1 . ILE A 1 607 ? 31.124  72.906  61.378  1.00 124.70 ? 607  ILE A CG1 1 
ATOM   4054 C  CG2 . ILE A 1 607 ? 29.316  73.509  63.049  1.00 124.70 ? 607  ILE A CG2 1 
ATOM   4055 C  CD1 . ILE A 1 607 ? 30.076  73.101  60.335  1.00 124.70 ? 607  ILE A CD1 1 
ATOM   4056 N  N   . PHE A 1 608 ? 29.733  75.999  64.207  1.00 124.70 ? 608  PHE A N   1 
ATOM   4057 C  CA  . PHE A 1 608 ? 29.325  76.540  65.470  1.00 124.70 ? 608  PHE A CA  1 
ATOM   4058 C  C   . PHE A 1 608 ? 27.947  76.189  65.938  1.00 124.70 ? 608  PHE A C   1 
ATOM   4059 O  O   . PHE A 1 608 ? 27.176  75.472  65.295  1.00 124.70 ? 608  PHE A O   1 
ATOM   4060 C  CB  . PHE A 1 608 ? 29.422  78.063  65.420  1.00 124.70 ? 608  PHE A CB  1 
ATOM   4061 C  CG  . PHE A 1 608 ? 30.714  78.576  64.865  1.00 124.70 ? 608  PHE A CG  1 
ATOM   4062 C  CD1 . PHE A 1 608 ? 30.894  79.916  64.654  1.00 124.70 ? 608  PHE A CD1 1 
ATOM   4063 C  CD2 . PHE A 1 608 ? 31.748  77.721  64.543  1.00 124.70 ? 608  PHE A CD2 1 
ATOM   4064 C  CE1 . PHE A 1 608 ? 32.082  80.379  64.132  1.00 124.70 ? 608  PHE A CE1 1 
ATOM   4065 C  CE2 . PHE A 1 608 ? 32.931  78.165  64.023  1.00 124.70 ? 608  PHE A CE2 1 
ATOM   4066 C  CZ  . PHE A 1 608 ? 33.103  79.498  63.816  1.00 124.70 ? 608  PHE A CZ  1 
ATOM   4067 N  N   . SER A 1 609 ? 27.672  76.766  67.094  1.00 124.70 ? 609  SER A N   1 
ATOM   4068 C  CA  . SER A 1 609 ? 26.419  76.651  67.776  1.00 124.70 ? 609  SER A CA  1 
ATOM   4069 C  C   . SER A 1 609 ? 26.377  77.813  68.738  1.00 124.70 ? 609  SER A C   1 
ATOM   4070 O  O   . SER A 1 609 ? 27.414  78.377  69.092  1.00 124.70 ? 609  SER A O   1 
ATOM   4071 C  CB  . SER A 1 609 ? 26.343  75.368  68.573  1.00 124.70 ? 609  SER A CB  1 
ATOM   4072 O  OG  . SER A 1 609 ? 25.139  75.373  69.313  1.00 124.70 ? 609  SER A OG  1 
ATOM   4073 N  N   . ALA A 1 610 ? 25.169  78.161  69.155  1.00 124.70 ? 610  ALA A N   1 
ATOM   4074 C  CA  . ALA A 1 610 ? 24.946  79.241  70.106  1.00 124.70 ? 610  ALA A CA  1 
ATOM   4075 C  C   . ALA A 1 610 ? 23.520  79.029  70.586  1.00 124.70 ? 610  ALA A C   1 
ATOM   4076 O  O   . ALA A 1 610 ? 22.832  78.111  70.107  1.00 124.70 ? 610  ALA A O   1 
ATOM   4077 C  CB  . ALA A 1 610 ? 25.089  80.611  69.423  1.00 124.70 ? 610  ALA A CB  1 
ATOM   4078 N  N   . ASN A 1 611 ? 23.076  79.833  71.550  1.00 124.70 ? 611  ASN A N   1 
ATOM   4079 C  CA  . ASN A 1 611 ? 21.707  79.673  71.989  1.00 124.70 ? 611  ASN A CA  1 
ATOM   4080 C  C   . ASN A 1 611 ? 20.879  80.304  70.898  1.00 124.70 ? 611  ASN A C   1 
ATOM   4081 O  O   . ASN A 1 611 ? 21.256  81.319  70.291  1.00 124.70 ? 611  ASN A O   1 
ATOM   4082 C  CB  . ASN A 1 611 ? 21.455  80.307  73.351  1.00 124.70 ? 611  ASN A CB  1 
ATOM   4083 C  CG  . ASN A 1 611 ? 19.998  80.581  73.613  1.00 124.70 ? 611  ASN A CG  1 
ATOM   4084 O  OD1 . ASN A 1 611 ? 19.121  79.969  73.021  1.00 124.70 ? 611  ASN A OD1 1 
ATOM   4085 N  ND2 . ASN A 1 611 ? 19.731  81.497  74.527  1.00 124.70 ? 611  ASN A ND2 1 
ATOM   4086 N  N   . ARG A 1 612 ? 19.765  79.640  70.634  1.00 124.70 ? 612  ARG A N   1 
ATOM   4087 C  CA  . ARG A 1 612 ? 18.861  80.019  69.587  1.00 124.70 ? 612  ARG A CA  1 
ATOM   4088 C  C   . ARG A 1 612 ? 17.910  81.118  69.968  1.00 124.70 ? 612  ARG A C   1 
ATOM   4089 O  O   . ARG A 1 612 ? 16.688  81.021  69.938  1.00 124.70 ? 612  ARG A O   1 
ATOM   4090 C  CB  . ARG A 1 612 ? 18.180  78.766  69.071  1.00 124.70 ? 612  ARG A CB  1 
ATOM   4091 C  CG  . ARG A 1 612 ? 16.740  78.799  69.024  1.00 124.70 ? 612  ARG A CG  1 
ATOM   4092 C  CD  . ARG A 1 612 ? 16.304  77.421  68.926  1.00 124.70 ? 612  ARG A CD  1 
ATOM   4093 N  NE  . ARG A 1 612 ? 14.937  77.348  69.383  1.00 124.70 ? 612  ARG A NE  1 
ATOM   4094 C  CZ  . ARG A 1 612 ? 14.091  76.415  68.985  1.00 124.70 ? 612  ARG A CZ  1 
ATOM   4095 N  NH1 . ARG A 1 612 ? 14.502  75.496  68.125  1.00 124.70 ? 612  ARG A NH1 1 
ATOM   4096 N  NH2 . ARG A 1 612 ? 12.844  76.410  69.432  1.00 124.70 ? 612  ARG A NH2 1 
ATOM   4097 N  N   . LEU A 1 613 ? 18.569  82.186  70.350  1.00 124.70 ? 613  LEU A N   1 
ATOM   4098 C  CA  . LEU A 1 613 ? 17.967  83.440  70.679  1.00 124.70 ? 613  LEU A CA  1 
ATOM   4099 C  C   . LEU A 1 613 ? 19.226  84.231  70.832  1.00 124.70 ? 613  LEU A C   1 
ATOM   4100 O  O   . LEU A 1 613 ? 20.315  83.637  70.876  1.00 124.70 ? 613  LEU A O   1 
ATOM   4101 C  CB  . LEU A 1 613 ? 17.099  83.344  71.934  1.00 124.70 ? 613  LEU A CB  1 
ATOM   4102 C  CG  . LEU A 1 613 ? 15.680  83.664  71.406  1.00 124.70 ? 613  LEU A CG  1 
ATOM   4103 C  CD1 . LEU A 1 613 ? 15.534  83.268  69.917  1.00 124.70 ? 613  LEU A CD1 1 
ATOM   4104 C  CD2 . LEU A 1 613 ? 14.635  82.946  72.232  1.00 124.70 ? 613  LEU A CD2 1 
ATOM   4105 N  N   . THR A 1 614 ? 19.153  85.549  70.821  1.00 124.70 ? 614  THR A N   1 
ATOM   4106 C  CA  . THR A 1 614 ? 20.414  86.206  70.973  1.00 124.70 ? 614  THR A CA  1 
ATOM   4107 C  C   . THR A 1 614 ? 20.796  85.867  72.399  1.00 124.70 ? 614  THR A C   1 
ATOM   4108 O  O   . THR A 1 614 ? 21.048  86.727  73.235  1.00 124.70 ? 614  THR A O   1 
ATOM   4109 C  CB  . THR A 1 614 ? 20.338  87.691  70.723  1.00 124.70 ? 614  THR A CB  1 
ATOM   4110 O  OG1 . THR A 1 614 ? 19.553  87.924  69.548  1.00 124.70 ? 614  THR A OG1 1 
ATOM   4111 C  CG2 . THR A 1 614 ? 21.745  88.230  70.474  1.00 124.70 ? 614  THR A CG2 1 
ATOM   4112 N  N   . GLY A 1 615 ? 20.753  84.561  72.641  1.00 124.70 ? 615  GLY A N   1 
ATOM   4113 C  CA  . GLY A 1 615 ? 21.125  83.929  73.880  1.00 124.70 ? 615  GLY A CA  1 
ATOM   4114 C  C   . GLY A 1 615 ? 22.372  83.273  73.336  1.00 124.70 ? 615  GLY A C   1 
ATOM   4115 O  O   . GLY A 1 615 ? 22.585  82.080  73.370  1.00 124.70 ? 615  GLY A O   1 
ATOM   4116 N  N   . SER A 1 616 ? 23.199  84.109  72.752  1.00 124.70 ? 616  SER A N   1 
ATOM   4117 C  CA  . SER A 1 616 ? 24.435  83.645  72.189  1.00 124.70 ? 616  SER A CA  1 
ATOM   4118 C  C   . SER A 1 616 ? 25.327  83.186  73.315  1.00 124.70 ? 616  SER A C   1 
ATOM   4119 O  O   . SER A 1 616 ? 25.148  83.540  74.479  1.00 124.70 ? 616  SER A O   1 
ATOM   4120 C  CB  . SER A 1 616 ? 25.128  84.783  71.450  1.00 124.70 ? 616  SER A CB  1 
ATOM   4121 O  OG  . SER A 1 616 ? 25.350  85.878  72.331  1.00 124.70 ? 616  SER A OG  1 
ATOM   4122 N  N   . ASP A 1 617 ? 26.304  82.397  72.926  1.00 124.70 ? 617  ASP A N   1 
ATOM   4123 C  CA  . ASP A 1 617 ? 27.317  81.858  73.800  1.00 124.70 ? 617  ASP A CA  1 
ATOM   4124 C  C   . ASP A 1 617 ? 27.955  81.033  72.709  1.00 124.70 ? 617  ASP A C   1 
ATOM   4125 O  O   . ASP A 1 617 ? 27.294  80.192  72.107  1.00 124.70 ? 617  ASP A O   1 
ATOM   4126 C  CB  . ASP A 1 617 ? 26.700  81.002  74.926  1.00 124.70 ? 617  ASP A CB  1 
ATOM   4127 C  CG  . ASP A 1 617 ? 26.370  79.586  74.493  1.00 124.70 ? 617  ASP A CG  1 
ATOM   4128 O  OD1 . ASP A 1 617 ? 25.221  79.164  74.705  1.00 124.70 ? 617  ASP A OD1 1 
ATOM   4129 O  OD2 . ASP A 1 617 ? 27.251  78.881  73.959  1.00 124.70 ? 617  ASP A OD2 1 
ATOM   4130 N  N   . VAL A 1 618 ? 29.210  81.300  72.385  1.00 124.70 ? 618  VAL A N   1 
ATOM   4131 C  CA  . VAL A 1 618 ? 29.797  80.529  71.310  1.00 124.70 ? 618  VAL A CA  1 
ATOM   4132 C  C   . VAL A 1 618 ? 30.500  79.264  71.742  1.00 124.70 ? 618  VAL A C   1 
ATOM   4133 O  O   . VAL A 1 618 ? 31.014  79.161  72.857  1.00 124.70 ? 618  VAL A O   1 
ATOM   4134 C  CB  . VAL A 1 618 ? 30.781  81.350  70.499  1.00 124.70 ? 618  VAL A CB  1 
ATOM   4135 C  CG1 . VAL A 1 618 ? 31.074  80.631  69.198  1.00 124.70 ? 618  VAL A CG1 1 
ATOM   4136 C  CG2 . VAL A 1 618 ? 30.215  82.723  70.248  1.00 124.70 ? 618  VAL A CG2 1 
ATOM   4137 N  N   . ASN A 1 619 ? 30.501  78.293  70.843  1.00 124.70 ? 619  ASN A N   1 
ATOM   4138 C  CA  . ASN A 1 619 ? 31.158  77.023  71.079  1.00 124.70 ? 619  ASN A CA  1 
ATOM   4139 C  C   . ASN A 1 619 ? 31.462  76.503  69.687  1.00 124.70 ? 619  ASN A C   1 
ATOM   4140 O  O   . ASN A 1 619 ? 30.562  76.358  68.847  1.00 124.70 ? 619  ASN A O   1 
ATOM   4141 C  CB  . ASN A 1 619 ? 30.248  76.061  71.861  1.00 124.70 ? 619  ASN A CB  1 
ATOM   4142 C  CG  . ASN A 1 619 ? 30.188  76.388  73.355  1.00 124.70 ? 619  ASN A CG  1 
ATOM   4143 O  OD1 . ASN A 1 619 ? 31.191  76.292  74.074  1.00 124.70 ? 619  ASN A OD1 1 
ATOM   4144 N  ND2 . ASN A 1 619 ? 29.004  76.777  73.827  1.00 124.70 ? 619  ASN A ND2 1 
ATOM   4145 N  N   . LEU A 1 620 ? 32.743  76.241  69.449  1.00 124.70 ? 620  LEU A N   1 
ATOM   4146 C  CA  . LEU A 1 620 ? 33.213  75.796  68.148  1.00 124.70 ? 620  LEU A CA  1 
ATOM   4147 C  C   . LEU A 1 620 ? 33.034  74.332  67.947  1.00 124.70 ? 620  LEU A C   1 
ATOM   4148 O  O   . LEU A 1 620 ? 32.540  73.612  68.812  1.00 124.70 ? 620  LEU A O   1 
ATOM   4149 C  CB  . LEU A 1 620 ? 34.683  76.156  67.970  1.00 124.70 ? 620  LEU A CB  1 
ATOM   4150 C  CG  . LEU A 1 620 ? 35.049  77.349  68.851  1.00 124.70 ? 620  LEU A CG  1 
ATOM   4151 C  CD1 . LEU A 1 620 ? 36.420  77.827  68.477  1.00 124.70 ? 620  LEU A CD1 1 
ATOM   4152 C  CD2 . LEU A 1 620 ? 34.032  78.474  68.696  1.00 124.70 ? 620  LEU A CD2 1 
ATOM   4153 N  N   . LEU A 1 621 ? 33.485  73.850  66.813  1.00 124.70 ? 621  LEU A N   1 
ATOM   4154 C  CA  . LEU A 1 621 ? 33.252  72.454  66.638  1.00 124.70 ? 621  LEU A CA  1 
ATOM   4155 C  C   . LEU A 1 621 ? 33.826  71.926  65.361  1.00 124.70 ? 621  LEU A C   1 
ATOM   4156 O  O   . LEU A 1 621 ? 33.262  71.033  64.747  1.00 124.70 ? 621  LEU A O   1 
ATOM   4157 C  CB  . LEU A 1 621 ? 31.755  72.275  66.648  1.00 124.70 ? 621  LEU A CB  1 
ATOM   4158 C  CG  . LEU A 1 621 ? 31.221  70.874  66.694  1.00 124.70 ? 621  LEU A CG  1 
ATOM   4159 C  CD1 . LEU A 1 621 ? 31.386  70.322  68.096  1.00 124.70 ? 621  LEU A CD1 1 
ATOM   4160 C  CD2 . LEU A 1 621 ? 29.761  70.922  66.265  1.00 124.70 ? 621  LEU A CD2 1 
ATOM   4161 N  N   . ALA A 1 622 ? 34.954  72.461  64.947  1.00 124.70 ? 622  ALA A N   1 
ATOM   4162 C  CA  . ALA A 1 622 ? 35.484  71.976  63.712  1.00 124.70 ? 622  ALA A CA  1 
ATOM   4163 C  C   . ALA A 1 622 ? 36.708  72.753  63.396  1.00 124.70 ? 622  ALA A C   1 
ATOM   4164 O  O   . ALA A 1 622 ? 36.574  73.724  62.716  1.00 124.70 ? 622  ALA A O   1 
ATOM   4165 C  CB  . ALA A 1 622 ? 34.483  72.249  62.644  1.00 124.70 ? 622  ALA A CB  1 
ATOM   4166 N  N   . GLU A 1 623 ? 37.929  72.480  63.787  1.00 124.70 ? 623  GLU A N   1 
ATOM   4167 C  CA  . GLU A 1 623 ? 38.788  73.529  63.204  1.00 124.70 ? 623  GLU A CA  1 
ATOM   4168 C  C   . GLU A 1 623 ? 39.319  73.108  61.825  1.00 124.70 ? 623  GLU A C   1 
ATOM   4169 O  O   . GLU A 1 623 ? 39.673  71.934  61.636  1.00 124.70 ? 623  GLU A O   1 
ATOM   4170 C  CB  . GLU A 1 623 ? 39.922  73.968  64.136  1.00 124.70 ? 623  GLU A CB  1 
ATOM   4171 C  CG  . GLU A 1 623 ? 40.400  75.420  63.883  1.00 124.70 ? 623  GLU A CG  1 
ATOM   4172 C  CD  . GLU A 1 623 ? 39.655  76.460  64.716  1.00 124.70 ? 623  GLU A CD  1 
ATOM   4173 O  OE1 . GLU A 1 623 ? 39.039  76.060  65.725  1.00 124.70 ? 623  GLU A OE1 1 
ATOM   4174 O  OE2 . GLU A 1 623 ? 39.705  77.670  64.376  1.00 124.70 ? 623  GLU A OE2 1 
ATOM   4175 N  N   . ASN A 1 624 ? 39.360  74.080  60.895  1.00 124.70 ? 624  ASN A N   1 
ATOM   4176 C  CA  . ASN A 1 624 ? 39.789  73.966  59.478  1.00 124.70 ? 624  ASN A CA  1 
ATOM   4177 C  C   . ASN A 1 624 ? 39.041  72.934  58.604  1.00 124.70 ? 624  ASN A C   1 
ATOM   4178 O  O   . ASN A 1 624 ? 39.661  72.060  57.975  1.00 124.70 ? 624  ASN A O   1 
ATOM   4179 C  CB  . ASN A 1 624 ? 41.302  73.727  59.333  1.00 124.70 ? 624  ASN A CB  1 
ATOM   4180 C  CG  . ASN A 1 624 ? 42.151  74.714  60.118  1.00 124.70 ? 624  ASN A CG  1 
ATOM   4181 O  OD1 . ASN A 1 624 ? 42.036  75.930  59.951  1.00 124.70 ? 624  ASN A OD1 1 
ATOM   4182 N  ND2 . ASN A 1 624 ? 43.035  74.184  60.967  1.00 124.70 ? 624  ASN A ND2 1 
ATOM   4183 N  N   . LEU A 1 625 ? 37.711  73.049  58.560  1.00 124.70 ? 625  LEU A N   1 
ATOM   4184 C  CA  . LEU A 1 625 ? 36.896  72.152  57.739  1.00 124.70 ? 625  LEU A CA  1 
ATOM   4185 C  C   . LEU A 1 625 ? 37.014  72.767  56.379  1.00 124.70 ? 625  LEU A C   1 
ATOM   4186 O  O   . LEU A 1 625 ? 36.506  73.873  56.147  1.00 124.70 ? 625  LEU A O   1 
ATOM   4187 C  CB  . LEU A 1 625 ? 35.430  72.188  58.131  1.00 124.70 ? 625  LEU A CB  1 
ATOM   4188 C  CG  . LEU A 1 625 ? 35.221  72.934  59.419  1.00 124.70 ? 625  LEU A CG  1 
ATOM   4189 C  CD1 . LEU A 1 625 ? 33.754  73.139  59.719  1.00 124.70 ? 625  LEU A CD1 1 
ATOM   4190 C  CD2 . LEU A 1 625 ? 35.924  72.111  60.451  1.00 124.70 ? 625  LEU A CD2 1 
ATOM   4191 N  N   . LEU A 1 626 ? 37.706  72.074  55.484  1.00 124.70 ? 626  LEU A N   1 
ATOM   4192 C  CA  . LEU A 1 626 ? 37.870  72.594  54.140  1.00 124.70 ? 626  LEU A CA  1 
ATOM   4193 C  C   . LEU A 1 626 ? 36.627  72.290  53.317  1.00 124.70 ? 626  LEU A C   1 
ATOM   4194 O  O   . LEU A 1 626 ? 36.314  71.125  53.053  1.00 124.70 ? 626  LEU A O   1 
ATOM   4195 C  CB  . LEU A 1 626 ? 39.114  71.983  53.477  1.00 124.70 ? 626  LEU A CB  1 
ATOM   4196 N  N   . SER A 1 627 ? 35.899  73.346  52.961  1.00 124.70 ? 627  SER A N   1 
ATOM   4197 C  CA  . SER A 1 627 ? 34.701  73.229  52.116  1.00 124.70 ? 627  SER A CA  1 
ATOM   4198 C  C   . SER A 1 627 ? 33.354  72.642  52.600  1.00 124.70 ? 627  SER A C   1 
ATOM   4199 O  O   . SER A 1 627 ? 32.755  71.863  51.872  1.00 124.70 ? 627  SER A O   1 
ATOM   4200 C  CB  . SER A 1 627 ? 35.081  72.473  50.848  1.00 124.70 ? 627  SER A CB  1 
ATOM   4201 O  OG  . SER A 1 627 ? 35.754  73.315  49.932  1.00 124.70 ? 627  SER A OG  1 
ATOM   4202 N  N   . PRO A 1 628 ? 32.852  73.032  53.798  1.00 124.70 ? 628  PRO A N   1 
ATOM   4203 C  CA  . PRO A 1 628 ? 31.626  72.691  54.580  1.00 124.70 ? 628  PRO A CA  1 
ATOM   4204 C  C   . PRO A 1 628 ? 30.164  73.142  54.343  1.00 124.70 ? 628  PRO A C   1 
ATOM   4205 O  O   . PRO A 1 628 ? 29.654  73.783  55.237  1.00 124.70 ? 628  PRO A O   1 
ATOM   4206 C  CB  . PRO A 1 628 ? 31.982  73.156  55.992  1.00 124.70 ? 628  PRO A CB  1 
ATOM   4207 C  CG  . PRO A 1 628 ? 33.400  73.054  56.051  1.00 124.70 ? 628  PRO A CG  1 
ATOM   4208 C  CD  . PRO A 1 628 ? 33.863  73.579  54.718  1.00 124.70 ? 628  PRO A CD  1 
ATOM   4209 N  N   . GLU A 1 629 ? 29.412  72.787  53.302  1.00 124.70 ? 629  GLU A N   1 
ATOM   4210 C  CA  . GLU A 1 629 ? 28.084  73.428  53.297  1.00 124.70 ? 629  GLU A CA  1 
ATOM   4211 C  C   . GLU A 1 629 ? 26.690  72.832  53.603  1.00 124.70 ? 629  GLU A C   1 
ATOM   4212 O  O   . GLU A 1 629 ? 25.731  73.275  53.022  1.00 124.70 ? 629  GLU A O   1 
ATOM   4213 C  CB  . GLU A 1 629 ? 27.937  74.310  52.026  1.00 124.70 ? 629  GLU A CB  1 
ATOM   4214 C  CG  . GLU A 1 629 ? 26.583  75.073  51.979  1.00 124.70 ? 629  GLU A CG  1 
ATOM   4215 C  CD  . GLU A 1 629 ? 26.430  76.175  50.943  1.00 124.70 ? 629  GLU A CD  1 
ATOM   4216 O  OE1 . GLU A 1 629 ? 27.051  76.077  49.867  1.00 124.70 ? 629  GLU A OE1 1 
ATOM   4217 O  OE2 . GLU A 1 629 ? 25.655  77.139  51.209  1.00 124.70 ? 629  GLU A OE2 1 
ATOM   4218 N  N   . ASP A 1 630 ? 26.491  71.861  54.473  1.00 124.70 ? 630  ASP A N   1 
ATOM   4219 C  CA  . ASP A 1 630 ? 25.072  71.559  54.686  1.00 124.70 ? 630  ASP A CA  1 
ATOM   4220 C  C   . ASP A 1 630 ? 24.738  70.501  55.682  1.00 124.70 ? 630  ASP A C   1 
ATOM   4221 O  O   . ASP A 1 630 ? 24.728  69.310  55.403  1.00 124.70 ? 630  ASP A O   1 
ATOM   4222 C  CB  . ASP A 1 630 ? 24.328  71.278  53.369  1.00 124.70 ? 630  ASP A CB  1 
ATOM   4223 C  CG  . ASP A 1 630 ? 22.842  71.708  53.425  1.00 124.70 ? 630  ASP A CG  1 
ATOM   4224 O  OD1 . ASP A 1 630 ? 22.217  71.537  54.495  1.00 124.70 ? 630  ASP A OD1 1 
ATOM   4225 O  OD2 . ASP A 1 630 ? 22.289  72.200  52.405  1.00 124.70 ? 630  ASP A OD2 1 
ATOM   4226 N  N   . MET A 1 631 ? 24.425  70.965  56.871  1.00 124.70 ? 631  MET A N   1 
ATOM   4227 C  CA  . MET A 1 631 ? 24.093  70.053  57.922  1.00 124.70 ? 631  MET A CA  1 
ATOM   4228 C  C   . MET A 1 631 ? 22.609  69.816  57.866  1.00 124.70 ? 631  MET A C   1 
ATOM   4229 O  O   . MET A 1 631 ? 21.856  70.617  57.318  1.00 124.70 ? 631  MET A O   1 
ATOM   4230 C  CB  . MET A 1 631 ? 24.490  70.667  59.264  1.00 124.70 ? 631  MET A CB  1 
ATOM   4231 C  CG  . MET A 1 631 ? 25.897  71.293  59.260  1.00 124.70 ? 631  MET A CG  1 
ATOM   4232 S  SD  . MET A 1 631 ? 26.424  71.862  60.891  1.00 124.70 ? 631  MET A SD  1 
ATOM   4233 C  CE  . MET A 1 631 ? 25.276  73.225  61.097  1.00 124.70 ? 631  MET A CE  1 
ATOM   4234 N  N   . VAL A 1 632 ? 22.199  68.684  58.396  1.00 124.70 ? 632  VAL A N   1 
ATOM   4235 C  CA  . VAL A 1 632 ? 20.798  68.380  58.472  1.00 124.70 ? 632  VAL A CA  1 
ATOM   4236 C  C   . VAL A 1 632 ? 20.723  67.838  59.872  1.00 124.70 ? 632  VAL A C   1 
ATOM   4237 O  O   . VAL A 1 632 ? 21.677  67.210  60.346  1.00 124.70 ? 632  VAL A O   1 
ATOM   4238 C  CB  . VAL A 1 632 ? 20.395  67.370  57.411  1.00 124.70 ? 632  VAL A CB  1 
ATOM   4239 C  CG1 . VAL A 1 632 ? 19.995  68.113  56.150  1.00 124.70 ? 632  VAL A CG1 1 
ATOM   4240 C  CG2 . VAL A 1 632 ? 21.555  66.449  57.122  1.00 124.70 ? 632  VAL A CG2 1 
ATOM   4241 N  N   . LEU A 1 633 ? 19.636  68.127  60.570  1.00 124.70 ? 633  LEU A N   1 
ATOM   4242 C  CA  . LEU A 1 633 ? 19.566  67.648  61.917  1.00 124.70 ? 633  LEU A CA  1 
ATOM   4243 C  C   . LEU A 1 633 ? 19.051  66.254  61.902  1.00 124.70 ? 633  LEU A C   1 
ATOM   4244 O  O   . LEU A 1 633 ? 18.544  65.780  60.892  1.00 124.70 ? 633  LEU A O   1 
ATOM   4245 C  CB  . LEU A 1 633 ? 18.739  68.548  62.777  1.00 124.70 ? 633  LEU A CB  1 
ATOM   4246 C  CG  . LEU A 1 633 ? 18.933  68.056  64.194  1.00 124.70 ? 633  LEU A CG  1 
ATOM   4247 C  CD1 . LEU A 1 633 ? 20.369  68.191  64.717  1.00 124.70 ? 633  LEU A CD1 1 
ATOM   4248 C  CD2 . LEU A 1 633 ? 18.002  68.870  64.957  1.00 124.70 ? 633  LEU A CD2 1 
ATOM   4249 N  N   . PHE A 1 634 ? 19.094  65.591  63.032  1.00 124.70 ? 634  PHE A N   1 
ATOM   4250 C  CA  . PHE A 1 634 ? 18.811  64.204  62.882  1.00 124.70 ? 634  PHE A CA  1 
ATOM   4251 C  C   . PHE A 1 634 ? 18.105  63.411  63.953  1.00 124.70 ? 634  PHE A C   1 
ATOM   4252 O  O   . PHE A 1 634 ? 17.841  63.871  65.067  1.00 124.70 ? 634  PHE A O   1 
ATOM   4253 C  CB  . PHE A 1 634 ? 20.181  63.572  62.577  1.00 124.70 ? 634  PHE A CB  1 
ATOM   4254 C  CG  . PHE A 1 634 ? 20.126  62.227  61.946  1.00 124.70 ? 634  PHE A CG  1 
ATOM   4255 C  CD1 . PHE A 1 634 ? 20.026  62.093  60.565  1.00 124.70 ? 634  PHE A CD1 1 
ATOM   4256 C  CD2 . PHE A 1 634 ? 20.152  61.090  62.734  1.00 124.70 ? 634  PHE A CD2 1 
ATOM   4257 C  CE1 . PHE A 1 634 ? 19.946  60.842  59.980  1.00 124.70 ? 634  PHE A CE1 1 
ATOM   4258 C  CE2 . PHE A 1 634 ? 20.069  59.840  62.163  1.00 124.70 ? 634  PHE A CE2 1 
ATOM   4259 C  CZ  . PHE A 1 634 ? 19.964  59.712  60.778  1.00 124.70 ? 634  PHE A CZ  1 
ATOM   4260 N  N   . HIS A 1 635 ? 17.879  62.174  63.533  1.00 124.70 ? 635  HIS A N   1 
ATOM   4261 C  CA  . HIS A 1 635 ? 17.272  61.069  64.214  1.00 124.70 ? 635  HIS A CA  1 
ATOM   4262 C  C   . HIS A 1 635 ? 15.890  61.146  64.794  1.00 124.70 ? 635  HIS A C   1 
ATOM   4263 O  O   . HIS A 1 635 ? 15.636  61.259  65.988  1.00 124.70 ? 635  HIS A O   1 
ATOM   4264 C  CB  . HIS A 1 635 ? 18.233  60.445  65.202  1.00 124.70 ? 635  HIS A CB  1 
ATOM   4265 C  CG  . HIS A 1 635 ? 17.878  59.028  65.526  1.00 124.70 ? 635  HIS A CG  1 
ATOM   4266 N  ND1 . HIS A 1 635 ? 17.085  58.686  66.596  1.00 124.70 ? 635  HIS A ND1 1 
ATOM   4267 C  CD2 . HIS A 1 635 ? 18.135  57.877  64.863  1.00 124.70 ? 635  HIS A CD2 1 
ATOM   4268 C  CE1 . HIS A 1 635 ? 16.866  57.380  66.583  1.00 124.70 ? 635  HIS A CE1 1 
ATOM   4269 N  NE2 . HIS A 1 635 ? 17.492  56.868  65.541  1.00 124.70 ? 635  HIS A NE2 1 
ATOM   4270 N  N   . GLN A 1 636 ? 15.034  60.912  63.813  1.00 124.70 ? 636  GLN A N   1 
ATOM   4271 C  CA  . GLN A 1 636 ? 13.597  60.770  63.810  1.00 124.70 ? 636  GLN A CA  1 
ATOM   4272 C  C   . GLN A 1 636 ? 12.704  61.768  64.455  1.00 124.70 ? 636  GLN A C   1 
ATOM   4273 O  O   . GLN A 1 636 ? 11.644  61.412  64.953  1.00 124.70 ? 636  GLN A O   1 
ATOM   4274 C  CB  . GLN A 1 636 ? 13.240  59.371  64.314  1.00 124.70 ? 636  GLN A CB  1 
ATOM   4275 C  CG  . GLN A 1 636 ? 11.938  58.822  63.717  1.00 124.70 ? 636  GLN A CG  1 
ATOM   4276 C  CD  . GLN A 1 636 ? 11.923  58.939  62.188  1.00 124.70 ? 636  GLN A CD  1 
ATOM   4277 O  OE1 . GLN A 1 636 ? 12.820  59.515  61.598  1.00 124.70 ? 636  GLN A OE1 1 
ATOM   4278 N  NE2 . GLN A 1 636 ? 10.903  58.399  61.553  1.00 124.70 ? 636  GLN A NE2 1 
ATOM   4279 N  N   . LEU A 1 637 ? 13.091  63.026  64.448  1.00 124.70 ? 637  LEU A N   1 
ATOM   4280 C  CA  . LEU A 1 637 ? 12.175  63.967  65.032  1.00 124.70 ? 637  LEU A CA  1 
ATOM   4281 C  C   . LEU A 1 637 ? 12.197  65.349  64.425  1.00 124.70 ? 637  LEU A C   1 
ATOM   4282 O  O   . LEU A 1 637 ? 11.922  66.369  65.060  1.00 124.70 ? 637  LEU A O   1 
ATOM   4283 C  CB  . LEU A 1 637 ? 12.331  64.033  66.536  1.00 124.70 ? 637  LEU A CB  1 
ATOM   4284 C  CG  . LEU A 1 637 ? 10.916  64.427  66.977  1.00 124.70 ? 637  LEU A CG  1 
ATOM   4285 C  CD1 . LEU A 1 637 ? 10.060  63.196  67.277  1.00 124.70 ? 637  LEU A CD1 1 
ATOM   4286 C  CD2 . LEU A 1 637 ? 11.024  65.303  68.167  1.00 124.70 ? 637  LEU A CD2 1 
ATOM   4287 N  N   . THR A 1 638 ? 12.570  65.368  63.170  1.00 124.70 ? 638  THR A N   1 
ATOM   4288 C  CA  . THR A 1 638 ? 12.527  66.583  62.422  1.00 124.70 ? 638  THR A CA  1 
ATOM   4289 C  C   . THR A 1 638 ? 11.648  65.929  61.393  1.00 124.70 ? 638  THR A C   1 
ATOM   4290 O  O   . THR A 1 638 ? 11.706  66.277  60.218  1.00 124.70 ? 638  THR A O   1 
ATOM   4291 C  CB  . THR A 1 638 ? 13.886  66.917  61.793  1.00 124.70 ? 638  THR A CB  1 
ATOM   4292 O  OG1 . THR A 1 638 ? 14.831  67.207  62.831  1.00 124.70 ? 638  THR A OG1 1 
ATOM   4293 C  CG2 . THR A 1 638 ? 13.768  68.127  60.855  1.00 124.70 ? 638  THR A CG2 1 
ATOM   4294 N  N   . GLN A 1 639 ? 10.793  64.996  61.832  1.00 124.70 ? 639  GLN A N   1 
ATOM   4295 C  CA  . GLN A 1 639 ? 10.059  64.272  60.812  1.00 124.70 ? 639  GLN A CA  1 
ATOM   4296 C  C   . GLN A 1 639 ? 9.048   63.114  61.131  1.00 124.70 ? 639  GLN A C   1 
ATOM   4297 O  O   . GLN A 1 639 ? 9.143   62.055  60.526  1.00 124.70 ? 639  GLN A O   1 
ATOM   4298 C  CB  . GLN A 1 639 ? 11.189  63.785  59.923  1.00 124.70 ? 639  GLN A CB  1 
ATOM   4299 C  CG  . GLN A 1 639 ? 10.893  63.134  58.680  1.00 124.70 ? 639  GLN A CG  1 
ATOM   4300 C  CD  . GLN A 1 639 ? 11.906  62.062  58.433  1.00 124.70 ? 639  GLN A CD  1 
ATOM   4301 O  OE1 . GLN A 1 639 ? 11.843  61.006  59.051  1.00 124.70 ? 639  GLN A OE1 1 
ATOM   4302 N  NE2 . GLN A 1 639 ? 12.871  62.327  57.563  1.00 124.70 ? 639  GLN A NE2 1 
ATOM   4303 N  N   . PRO A 1 640 ? 8.094   63.295  62.075  1.00 124.70 ? 640  PRO A N   1 
ATOM   4304 C  CA  . PRO A 1 640 ? 7.031   62.351  62.542  1.00 124.70 ? 640  PRO A CA  1 
ATOM   4305 C  C   . PRO A 1 640 ? 5.546   62.344  62.006  1.00 124.70 ? 640  PRO A C   1 
ATOM   4306 O  O   . PRO A 1 640 ? 5.062   63.383  61.585  1.00 124.70 ? 640  PRO A O   1 
ATOM   4307 C  CB  . PRO A 1 640 ? 6.986   62.620  64.047  1.00 124.70 ? 640  PRO A CB  1 
ATOM   4308 C  CG  . PRO A 1 640 ? 8.342   63.108  64.363  1.00 124.70 ? 640  PRO A CG  1 
ATOM   4309 C  CD  . PRO A 1 640 ? 8.629   64.039  63.228  1.00 124.70 ? 640  PRO A CD  1 
ATOM   4310 N  N   . ARG A 1 641 ? 4.828   61.198  62.045  1.00 124.70 ? 641  ARG A N   1 
ATOM   4311 C  CA  . ARG A 1 641 ? 3.370   61.156  61.683  1.00 124.70 ? 641  ARG A CA  1 
ATOM   4312 C  C   . ARG A 1 641 ? 2.615   59.857  61.284  1.00 124.70 ? 641  ARG A C   1 
ATOM   4313 O  O   . ARG A 1 641 ? 3.186   58.764  61.234  1.00 124.70 ? 641  ARG A O   1 
ATOM   4314 C  CB  . ARG A 1 641 ? 3.028   62.234  60.635  1.00 124.70 ? 641  ARG A CB  1 
ATOM   4315 C  CG  . ARG A 1 641 ? 1.567   62.743  60.709  1.00 124.70 ? 641  ARG A CG  1 
ATOM   4316 C  CD  . ARG A 1 641 ? 1.211   63.331  62.096  1.00 124.70 ? 641  ARG A CD  1 
ATOM   4317 N  NE  . ARG A 1 641 ? -0.187  63.770  62.183  1.00 124.70 ? 641  ARG A NE  1 
ATOM   4318 C  CZ  . ARG A 1 641 ? -0.731  64.388  63.234  1.00 124.70 ? 641  ARG A CZ  1 
ATOM   4319 N  NH1 . ARG A 1 641 ? -0.005  64.657  64.314  1.00 124.70 ? 641  ARG A NH1 1 
ATOM   4320 N  NH2 . ARG A 1 641 ? -2.013  64.736  63.204  1.00 124.70 ? 641  ARG A NH2 1 
ATOM   4321 N  N   . GLY A 1 642 ? 1.313   60.002  61.010  1.00 124.70 ? 642  GLY A N   1 
ATOM   4322 C  CA  . GLY A 1 642 ? 0.484   58.867  60.621  1.00 124.70 ? 642  GLY A CA  1 
ATOM   4323 C  C   . GLY A 1 642 ? -0.526  59.072  59.485  1.00 124.70 ? 642  GLY A C   1 
ATOM   4324 O  O   . GLY A 1 642 ? -1.647  58.555  59.558  1.00 124.70 ? 642  GLY A O   1 
ATOM   4325 N  N   . VAL A 1 643 ? -0.155  59.811  58.436  1.00 124.70 ? 643  VAL A N   1 
ATOM   4326 C  CA  . VAL A 1 643 ? -1.065  60.031  57.299  1.00 124.70 ? 643  VAL A CA  1 
ATOM   4327 C  C   . VAL A 1 643 ? -0.369  60.166  55.940  1.00 124.70 ? 643  VAL A C   1 
ATOM   4328 O  O   . VAL A 1 643 ? 0.803   60.535  55.844  1.00 124.70 ? 643  VAL A O   1 
ATOM   4329 C  CB  . VAL A 1 643 ? -1.959  61.305  57.496  1.00 124.70 ? 643  VAL A CB  1 
ATOM   4330 C  CG1 . VAL A 1 643 ? -2.744  61.617  56.210  1.00 124.70 ? 643  VAL A CG1 1 
ATOM   4331 C  CG2 . VAL A 1 643 ? -2.937  61.093  58.646  1.00 124.70 ? 643  VAL A CG2 1 
ATOM   4332 N  N   . ASN A 1 644 ? -1.117  59.839  54.894  1.00 124.70 ? 644  ASN A N   1 
ATOM   4333 C  CA  . ASN A 1 644 ? -0.667  59.950  53.514  1.00 124.70 ? 644  ASN A CA  1 
ATOM   4334 C  C   . ASN A 1 644 ? -1.942  60.021  52.692  1.00 124.70 ? 644  ASN A C   1 
ATOM   4335 O  O   . ASN A 1 644 ? -2.848  59.206  52.882  1.00 124.70 ? 644  ASN A O   1 
ATOM   4336 C  CB  . ASN A 1 644 ? 0.129   58.727  53.067  1.00 124.70 ? 644  ASN A CB  1 
ATOM   4337 C  CG  . ASN A 1 644 ? 0.422   58.740  51.563  1.00 124.70 ? 644  ASN A CG  1 
ATOM   4338 O  OD1 . ASN A 1 644 ? -0.175  59.509  50.802  1.00 124.70 ? 644  ASN A OD1 1 
ATOM   4339 N  ND2 . ASN A 1 644 ? 1.338   57.879  51.130  1.00 124.70 ? 644  ASN A ND2 1 
ATOM   4340 N  N   . TRP A 1 645 ? -2.027  60.992  51.789  1.00 124.70 ? 645  TRP A N   1 
ATOM   4341 C  CA  . TRP A 1 645 ? -3.217  61.112  50.962  1.00 124.70 ? 645  TRP A CA  1 
ATOM   4342 C  C   . TRP A 1 645 ? -2.966  60.563  49.569  1.00 124.70 ? 645  TRP A C   1 
ATOM   4343 O  O   . TRP A 1 645 ? -2.746  61.312  48.622  1.00 124.70 ? 645  TRP A O   1 
ATOM   4344 C  CB  . TRP A 1 645 ? -3.674  62.567  50.860  1.00 124.70 ? 645  TRP A CB  1 
ATOM   4345 C  CG  . TRP A 1 645 ? -4.135  63.157  52.148  1.00 124.70 ? 645  TRP A CG  1 
ATOM   4346 C  CD1 . TRP A 1 645 ? -3.487  64.103  52.878  1.00 124.70 ? 645  TRP A CD1 1 
ATOM   4347 C  CD2 . TRP A 1 645 ? -5.373  62.893  52.836  1.00 124.70 ? 645  TRP A CD2 1 
ATOM   4348 N  NE1 . TRP A 1 645 ? -4.234  64.449  53.979  1.00 124.70 ? 645  TRP A NE1 1 
ATOM   4349 C  CE2 . TRP A 1 645 ? -5.392  63.713  53.987  1.00 124.70 ? 645  TRP A CE2 1 
ATOM   4350 C  CE3 . TRP A 1 645 ? -6.453  62.022  52.609  1.00 124.70 ? 645  TRP A CE3 1 
ATOM   4351 C  CZ2 . TRP A 1 645 ? -6.468  63.725  54.891  1.00 124.70 ? 645  TRP A CZ2 1 
ATOM   4352 C  CZ3 . TRP A 1 645 ? -7.526  62.031  53.512  1.00 124.70 ? 645  TRP A CZ3 1 
ATOM   4353 C  CH2 . TRP A 1 645 ? -7.513  62.869  54.646  1.00 124.70 ? 645  TRP A CH2 1 
ATOM   4354 N  N   . CYS A 1 646 ? -2.990  59.242  49.477  1.00 124.70 ? 646  CYS A N   1 
ATOM   4355 C  CA  . CYS A 1 646 ? -2.800  58.479  48.250  1.00 124.70 ? 646  CYS A CA  1 
ATOM   4356 C  C   . CYS A 1 646 ? -3.310  57.175  48.905  1.00 124.70 ? 646  CYS A C   1 
ATOM   4357 O  O   . CYS A 1 646 ? -2.826  56.060  48.671  1.00 124.70 ? 646  CYS A O   1 
ATOM   4358 C  CB  . CYS A 1 646 ? -1.285  58.468  47.847  1.00 124.70 ? 646  CYS A CB  1 
ATOM   4359 S  SG  . CYS A 1 646 ? -0.487  60.145  47.709  1.00 124.70 ? 646  CYS A SG  1 
ATOM   4360 N  N   . GLU A 1 647 ? -4.334  57.403  49.741  1.00 124.70 ? 647  GLU A N   1 
ATOM   4361 C  CA  . GLU A 1 647 ? -5.034  56.431  50.600  1.00 124.70 ? 647  GLU A CA  1 
ATOM   4362 C  C   . GLU A 1 647 ? -6.196  55.547  50.063  1.00 124.70 ? 647  GLU A C   1 
ATOM   4363 O  O   . GLU A 1 647 ? -6.929  55.923  49.147  1.00 124.70 ? 647  GLU A O   1 
ATOM   4364 C  CB  . GLU A 1 647 ? -5.493  57.196  51.848  1.00 124.70 ? 647  GLU A CB  1 
ATOM   4365 C  CG  . GLU A 1 647 ? -6.171  56.378  52.913  1.00 124.70 ? 647  GLU A CG  1 
ATOM   4366 C  CD  . GLU A 1 647 ? -6.508  57.224  54.118  1.00 124.70 ? 647  GLU A CD  1 
ATOM   4367 O  OE1 . GLU A 1 647 ? -6.741  58.442  53.927  1.00 124.70 ? 647  GLU A OE1 1 
ATOM   4368 O  OE2 . GLU A 1 647 ? -6.548  56.675  55.245  1.00 124.70 ? 647  GLU A OE2 1 
ATOM   4369 N  N   . ARG A 1 648 ? -6.372  54.395  50.722  1.00 124.70 ? 648  ARG A N   1 
ATOM   4370 C  CA  . ARG A 1 648 ? -7.348  53.360  50.378  1.00 124.70 ? 648  ARG A CA  1 
ATOM   4371 C  C   . ARG A 1 648 ? -8.850  53.564  50.481  1.00 124.70 ? 648  ARG A C   1 
ATOM   4372 O  O   . ARG A 1 648 ? -9.546  53.068  51.379  1.00 124.70 ? 648  ARG A O   1 
ATOM   4373 C  CB  . ARG A 1 648 ? -6.995  52.052  51.089  1.00 124.70 ? 648  ARG A CB  1 
ATOM   4374 C  CG  . ARG A 1 648 ? -5.697  51.464  50.622  1.00 124.70 ? 648  ARG A CG  1 
ATOM   4375 C  CD  . ARG A 1 648 ? -5.438  50.145  51.298  1.00 124.70 ? 648  ARG A CD  1 
ATOM   4376 N  NE  . ARG A 1 648 ? -4.063  49.699  51.092  1.00 124.70 ? 648  ARG A NE  1 
ATOM   4377 C  CZ  . ARG A 1 648 ? -3.593  48.526  51.511  1.00 124.70 ? 648  ARG A CZ  1 
ATOM   4378 N  NH1 . ARG A 1 648 ? -4.396  47.683  52.156  1.00 124.70 ? 648  ARG A NH1 1 
ATOM   4379 N  NH2 . ARG A 1 648 ? -2.324  48.193  51.290  1.00 124.70 ? 648  ARG A NH2 1 
ATOM   4380 N  N   . THR A 1 649 ? -9.310  54.283  49.477  1.00 124.70 ? 649  THR A N   1 
ATOM   4381 C  CA  . THR A 1 649 ? -10.691 54.564  49.152  1.00 124.70 ? 649  THR A CA  1 
ATOM   4382 C  C   . THR A 1 649 ? -10.195 54.351  47.704  1.00 124.70 ? 649  THR A C   1 
ATOM   4383 O  O   . THR A 1 649 ? -9.003  54.051  47.547  1.00 124.70 ? 649  THR A O   1 
ATOM   4384 C  CB  . THR A 1 649 ? -11.140 56.009  49.613  1.00 124.70 ? 649  THR A CB  1 
ATOM   4385 O  OG1 . THR A 1 649 ? -10.033 56.922  49.594  1.00 124.70 ? 649  THR A OG1 1 
ATOM   4386 C  CG2 . THR A 1 649 ? -11.720 55.941  51.043  1.00 124.70 ? 649  THR A CG2 1 
ATOM   4387 N  N   . THR A 1 650 ? -10.988 54.468  46.651  1.00 124.70 ? 650  THR A N   1 
ATOM   4388 C  CA  . THR A 1 650 ? -10.411 54.112  45.344  1.00 124.70 ? 650  THR A CA  1 
ATOM   4389 C  C   . THR A 1 650 ? -9.038  54.594  44.871  1.00 124.70 ? 650  THR A C   1 
ATOM   4390 O  O   . THR A 1 650 ? -8.908  55.704  44.345  1.00 124.70 ? 650  THR A O   1 
ATOM   4391 C  CB  . THR A 1 650 ? -11.373 54.394  44.203  1.00 124.70 ? 650  THR A CB  1 
ATOM   4392 O  OG1 . THR A 1 650 ? -12.722 54.323  44.689  1.00 124.70 ? 650  THR A OG1 1 
ATOM   4393 C  CG2 . THR A 1 650 ? -11.158 53.339  43.092  1.00 124.70 ? 650  THR A CG2 1 
ATOM   4394 N  N   . LEU A 1 651 ? -8.035  53.726  45.061  1.00 124.70 ? 651  LEU A N   1 
ATOM   4395 C  CA  . LEU A 1 651 ? -6.634  53.942  44.660  1.00 124.70 ? 651  LEU A CA  1 
ATOM   4396 C  C   . LEU A 1 651 ? -5.614  53.038  45.448  1.00 124.70 ? 651  LEU A C   1 
ATOM   4397 O  O   . LEU A 1 651 ? -5.944  52.352  46.419  1.00 124.70 ? 651  LEU A O   1 
ATOM   4398 C  CB  . LEU A 1 651 ? -6.271  55.439  44.865  1.00 124.70 ? 651  LEU A CB  1 
ATOM   4399 C  CG  . LEU A 1 651 ? -6.692  56.186  46.138  1.00 124.70 ? 651  LEU A CG  1 
ATOM   4400 C  CD1 . LEU A 1 651 ? -5.487  56.206  47.046  1.00 124.70 ? 651  LEU A CD1 1 
ATOM   4401 C  CD2 . LEU A 1 651 ? -7.174  57.621  45.851  1.00 124.70 ? 651  LEU A CD2 1 
ATOM   4402 N  N   . SER A 1 652 ? -4.339  53.147  45.082  1.00 124.70 ? 652  SER A N   1 
ATOM   4403 C  CA  . SER A 1 652 ? -3.193  52.448  45.735  1.00 124.70 ? 652  SER A CA  1 
ATOM   4404 C  C   . SER A 1 652 ? -2.037  53.112  44.991  1.00 124.70 ? 652  SER A C   1 
ATOM   4405 O  O   . SER A 1 652 ? -1.026  52.530  44.594  1.00 124.70 ? 652  SER A O   1 
ATOM   4406 C  CB  . SER A 1 652 ? -3.215  50.937  45.472  1.00 124.70 ? 652  SER A CB  1 
ATOM   4407 O  OG  . SER A 1 652 ? -2.275  50.253  46.292  1.00 124.70 ? 652  SER A OG  1 
ATOM   4408 N  N   . ASN A 1 653 ? -2.281  54.393  44.842  1.00 124.70 ? 653  ASN A N   1 
ATOM   4409 C  CA  . ASN A 1 653 ? -1.488  55.366  44.161  1.00 124.70 ? 653  ASN A CA  1 
ATOM   4410 C  C   . ASN A 1 653 ? -2.482  56.489  44.442  1.00 124.70 ? 653  ASN A C   1 
ATOM   4411 O  O   . ASN A 1 653 ? -3.445  56.246  45.162  1.00 124.70 ? 653  ASN A O   1 
ATOM   4412 C  CB  . ASN A 1 653 ? -1.382  55.039  42.644  1.00 124.70 ? 653  ASN A CB  1 
ATOM   4413 C  CG  . ASN A 1 653 ? -2.712  55.165  41.890  1.00 124.70 ? 653  ASN A CG  1 
ATOM   4414 O  OD1 . ASN A 1 653 ? -3.792  55.279  42.489  1.00 124.70 ? 653  ASN A OD1 1 
ATOM   4415 N  ND2 . ASN A 1 653 ? -2.633  55.109  40.558  1.00 124.70 ? 653  ASN A ND2 1 
ATOM   4416 N  N   . GLY A 1 654 ? -2.287  57.688  43.910  1.00 124.70 ? 654  GLY A N   1 
ATOM   4417 C  CA  . GLY A 1 654 ? -3.244  58.731  44.196  1.00 124.70 ? 654  GLY A CA  1 
ATOM   4418 C  C   . GLY A 1 654 ? -4.460  58.595  43.317  1.00 124.70 ? 654  GLY A C   1 
ATOM   4419 O  O   . GLY A 1 654 ? -5.397  59.389  43.389  1.00 124.70 ? 654  GLY A O   1 
ATOM   4420 N  N   . GLY A 1 655 ? -4.443  57.565  42.488  1.00 124.70 ? 655  GLY A N   1 
ATOM   4421 C  CA  . GLY A 1 655 ? -5.530  57.354  41.568  1.00 124.70 ? 655  GLY A CA  1 
ATOM   4422 C  C   . GLY A 1 655 ? -5.070  58.160  40.388  1.00 124.70 ? 655  GLY A C   1 
ATOM   4423 O  O   . GLY A 1 655 ? -5.747  58.294  39.378  1.00 124.70 ? 655  GLY A O   1 
ATOM   4424 N  N   . CYS A 1 656 ? -3.884  58.717  40.543  1.00 124.70 ? 656  CYS A N   1 
ATOM   4425 C  CA  . CYS A 1 656 ? -3.300  59.517  39.498  1.00 124.70 ? 656  CYS A CA  1 
ATOM   4426 C  C   . CYS A 1 656 ? -2.407  58.597  38.724  1.00 124.70 ? 656  CYS A C   1 
ATOM   4427 O  O   . CYS A 1 656 ? -1.763  57.740  39.318  1.00 124.70 ? 656  CYS A O   1 
ATOM   4428 C  CB  . CYS A 1 656 ? -2.387  60.576  40.091  1.00 124.70 ? 656  CYS A CB  1 
ATOM   4429 S  SG  . CYS A 1 656 ? -3.106  61.775  41.231  1.00 124.70 ? 656  CYS A SG  1 
ATOM   4430 N  N   . GLN A 1 657 ? -2.374  58.691  37.407  1.00 124.70 ? 657  GLN A N   1 
ATOM   4431 C  CA  . GLN A 1 657 ? -1.356  57.876  36.790  1.00 124.70 ? 657  GLN A CA  1 
ATOM   4432 C  C   . GLN A 1 657 ? -0.314  58.943  36.686  1.00 124.70 ? 657  GLN A C   1 
ATOM   4433 O  O   . GLN A 1 657 ? -0.668  60.098  36.438  1.00 124.70 ? 657  GLN A O   1 
ATOM   4434 C  CB  . GLN A 1 657 ? -1.763  57.270  35.461  1.00 124.70 ? 657  GLN A CB  1 
ATOM   4435 C  CG  . GLN A 1 657 ? -1.502  55.774  35.595  1.00 124.70 ? 657  GLN A CG  1 
ATOM   4436 C  CD  . GLN A 1 657 ? -1.209  55.404  37.068  1.00 124.70 ? 657  GLN A CD  1 
ATOM   4437 O  OE1 . GLN A 1 657 ? -2.124  55.259  37.894  1.00 124.70 ? 657  GLN A OE1 1 
ATOM   4438 N  NE2 . GLN A 1 657 ? 0.074   55.299  37.399  1.00 124.70 ? 657  GLN A NE2 1 
ATOM   4439 N  N   . TYR A 1 658 ? 0.953   58.600  36.884  1.00 124.70 ? 658  TYR A N   1 
ATOM   4440 C  CA  . TYR A 1 658 ? 1.941   59.663  36.936  1.00 124.70 ? 658  TYR A CA  1 
ATOM   4441 C  C   . TYR A 1 658 ? 1.368   60.298  38.204  1.00 124.70 ? 658  TYR A C   1 
ATOM   4442 O  O   . TYR A 1 658 ? 1.196   61.512  38.286  1.00 124.70 ? 658  TYR A O   1 
ATOM   4443 C  CB  . TYR A 1 658 ? 1.746   60.650  35.784  1.00 124.70 ? 658  TYR A CB  1 
ATOM   4444 C  CG  . TYR A 1 658 ? 3.020   61.067  35.142  1.00 124.70 ? 658  TYR A CG  1 
ATOM   4445 C  CD1 . TYR A 1 658 ? 3.465   60.420  33.995  1.00 124.70 ? 658  TYR A CD1 1 
ATOM   4446 C  CD2 . TYR A 1 658 ? 3.851   62.021  35.741  1.00 124.70 ? 658  TYR A CD2 1 
ATOM   4447 C  CE1 . TYR A 1 658 ? 4.720   60.697  33.453  1.00 124.70 ? 658  TYR A CE1 1 
ATOM   4448 C  CE2 . TYR A 1 658 ? 5.112   62.308  35.216  1.00 124.70 ? 658  TYR A CE2 1 
ATOM   4449 C  CZ  . TYR A 1 658 ? 5.544   61.640  34.072  1.00 124.70 ? 658  TYR A CZ  1 
ATOM   4450 O  OH  . TYR A 1 658 ? 6.797   61.911  33.562  1.00 124.70 ? 658  TYR A OH  1 
ATOM   4451 N  N   . LEU A 1 659 ? 1.108   59.453  39.196  1.00 124.70 ? 659  LEU A N   1 
ATOM   4452 C  CA  . LEU A 1 659 ? 0.440   59.850  40.432  1.00 124.70 ? 659  LEU A CA  1 
ATOM   4453 C  C   . LEU A 1 659 ? 0.942   60.645  41.621  1.00 124.70 ? 659  LEU A C   1 
ATOM   4454 O  O   . LEU A 1 659 ? 2.121   60.675  41.983  1.00 124.70 ? 659  LEU A O   1 
ATOM   4455 C  CB  . LEU A 1 659 ? -0.183  58.626  41.082  1.00 124.70 ? 659  LEU A CB  1 
ATOM   4456 C  CG  . LEU A 1 659 ? 0.748   58.160  42.198  1.00 124.70 ? 659  LEU A CG  1 
ATOM   4457 C  CD1 . LEU A 1 659 ? 0.022   57.331  43.173  1.00 124.70 ? 659  LEU A CD1 1 
ATOM   4458 C  CD2 . LEU A 1 659 ? 1.905   57.407  41.615  1.00 124.70 ? 659  LEU A CD2 1 
ATOM   4459 N  N   . CYS A 1 660 ? -0.098  61.203  42.237  1.00 124.70 ? 660  CYS A N   1 
ATOM   4460 C  CA  . CYS A 1 660 ? -0.203  61.963  43.486  1.00 124.70 ? 660  CYS A CA  1 
ATOM   4461 C  C   . CYS A 1 660 ? 0.687   63.006  44.153  1.00 124.70 ? 660  CYS A C   1 
ATOM   4462 O  O   . CYS A 1 660 ? 1.138   62.786  45.269  1.00 124.70 ? 660  CYS A O   1 
ATOM   4463 C  CB  . CYS A 1 660 ? -0.617  60.930  44.579  1.00 124.70 ? 660  CYS A CB  1 
ATOM   4464 S  SG  . CYS A 1 660 ? 0.518   60.319  45.917  1.00 124.70 ? 660  CYS A SG  1 
ATOM   4465 N  N   . LEU A 1 661 ? 0.907   64.160  43.542  1.00 124.70 ? 661  LEU A N   1 
ATOM   4466 C  CA  . LEU A 1 661 ? 1.677   65.165  44.259  1.00 124.70 ? 661  LEU A CA  1 
ATOM   4467 C  C   . LEU A 1 661 ? 0.706   65.817  45.253  1.00 124.70 ? 661  LEU A C   1 
ATOM   4468 O  O   . LEU A 1 661 ? -0.510  65.871  45.012  1.00 124.70 ? 661  LEU A O   1 
ATOM   4469 C  CB  . LEU A 1 661 ? 2.260   66.207  43.312  1.00 124.70 ? 661  LEU A CB  1 
ATOM   4470 C  CG  . LEU A 1 661 ? 3.655   65.796  42.837  1.00 124.70 ? 661  LEU A CG  1 
ATOM   4471 C  CD1 . LEU A 1 661 ? 4.073   66.649  41.648  1.00 124.70 ? 661  LEU A CD1 1 
ATOM   4472 C  CD2 . LEU A 1 661 ? 4.646   65.928  43.990  1.00 124.70 ? 661  LEU A CD2 1 
ATOM   4473 N  N   . PRO A 1 662 ? 1.229   66.289  46.404  1.00 124.70 ? 662  PRO A N   1 
ATOM   4474 C  CA  . PRO A 1 662 ? 0.440   66.937  47.460  1.00 124.70 ? 662  PRO A CA  1 
ATOM   4475 C  C   . PRO A 1 662 ? -0.425  68.053  46.951  1.00 124.70 ? 662  PRO A C   1 
ATOM   4476 O  O   . PRO A 1 662 ? -0.625  68.244  45.752  1.00 124.70 ? 662  PRO A O   1 
ATOM   4477 C  CB  . PRO A 1 662 ? 1.505   67.483  48.401  1.00 124.70 ? 662  PRO A CB  1 
ATOM   4478 C  CG  . PRO A 1 662 ? 2.562   66.443  48.325  1.00 124.70 ? 662  PRO A CG  1 
ATOM   4479 C  CD  . PRO A 1 662 ? 2.633   66.131  46.832  1.00 124.70 ? 662  PRO A CD  1 
ATOM   4480 N  N   . ALA A 1 663 ? -0.956  68.795  47.894  1.00 124.70 ? 663  ALA A N   1 
ATOM   4481 C  CA  . ALA A 1 663 ? -1.742  69.940  47.538  1.00 124.70 ? 663  ALA A CA  1 
ATOM   4482 C  C   . ALA A 1 663 ? -1.597  70.879  48.696  1.00 124.70 ? 663  ALA A C   1 
ATOM   4483 O  O   . ALA A 1 663 ? -1.930  70.533  49.835  1.00 124.70 ? 663  ALA A O   1 
ATOM   4484 C  CB  . ALA A 1 663 ? -3.192  69.581  47.320  1.00 124.70 ? 663  ALA A CB  1 
ATOM   4485 N  N   . PRO A 1 664 ? -1.006  72.050  48.443  1.00 124.70 ? 664  PRO A N   1 
ATOM   4486 C  CA  . PRO A 1 664 ? -0.843  73.027  49.507  1.00 124.70 ? 664  PRO A CA  1 
ATOM   4487 C  C   . PRO A 1 664 ? -2.191  73.029  50.206  1.00 124.70 ? 664  PRO A C   1 
ATOM   4488 O  O   . PRO A 1 664 ? -3.177  72.598  49.627  1.00 124.70 ? 664  PRO A O   1 
ATOM   4489 C  CB  . PRO A 1 664 ? -0.526  74.274  48.730  1.00 124.70 ? 664  PRO A CB  1 
ATOM   4490 C  CG  . PRO A 1 664 ? 0.415   73.725  47.725  1.00 124.70 ? 664  PRO A CG  1 
ATOM   4491 C  CD  . PRO A 1 664 ? -0.191  72.417  47.279  1.00 124.70 ? 664  PRO A CD  1 
ATOM   4492 N  N   . GLN A 1 665 ? -2.278  73.519  51.427  1.00 124.70 ? 665  GLN A N   1 
ATOM   4493 C  CA  . GLN A 1 665 ? -3.546  73.380  52.106  1.00 124.70 ? 665  GLN A CA  1 
ATOM   4494 C  C   . GLN A 1 665 ? -4.250  74.632  52.521  1.00 124.70 ? 665  GLN A C   1 
ATOM   4495 O  O   . GLN A 1 665 ? -3.868  75.213  53.523  1.00 124.70 ? 665  GLN A O   1 
ATOM   4496 C  CB  . GLN A 1 665 ? -3.310  72.537  53.351  1.00 124.70 ? 665  GLN A CB  1 
ATOM   4497 C  CG  . GLN A 1 665 ? -4.553  72.005  53.982  1.00 124.70 ? 665  GLN A CG  1 
ATOM   4498 C  CD  . GLN A 1 665 ? -5.269  71.100  53.036  1.00 124.70 ? 665  GLN A CD  1 
ATOM   4499 O  OE1 . GLN A 1 665 ? -4.766  70.814  51.959  1.00 124.70 ? 665  GLN A OE1 1 
ATOM   4500 N  NE2 . GLN A 1 665 ? -6.443  70.634  53.423  1.00 124.70 ? 665  GLN A NE2 1 
ATOM   4501 N  N   . ILE A 1 666 ? -5.284  75.079  51.830  1.00 124.70 ? 666  ILE A N   1 
ATOM   4502 C  CA  . ILE A 1 666 ? -5.847  76.271  52.408  1.00 124.70 ? 666  ILE A CA  1 
ATOM   4503 C  C   . ILE A 1 666 ? -7.300  76.638  52.254  1.00 124.70 ? 666  ILE A C   1 
ATOM   4504 O  O   . ILE A 1 666 ? -7.951  76.401  51.228  1.00 124.70 ? 666  ILE A O   1 
ATOM   4505 C  CB  . ILE A 1 666 ? -4.954  77.493  52.091  1.00 124.70 ? 666  ILE A CB  1 
ATOM   4506 C  CG1 . ILE A 1 666 ? -5.214  78.588  53.135  1.00 124.70 ? 666  ILE A CG1 1 
ATOM   4507 C  CG2 . ILE A 1 666 ? -5.192  77.978  50.675  1.00 124.70 ? 666  ILE A CG2 1 
ATOM   4508 C  CD1 . ILE A 1 666 ? -4.138  79.654  53.229  1.00 124.70 ? 666  ILE A CD1 1 
ATOM   4509 N  N   . ASN A 1 667 ? -7.782  77.244  53.336  1.00 124.70 ? 667  ASN A N   1 
ATOM   4510 C  CA  . ASN A 1 667 ? -9.156  77.672  53.458  1.00 124.70 ? 667  ASN A CA  1 
ATOM   4511 C  C   . ASN A 1 667 ? -9.863  76.359  53.134  1.00 124.70 ? 667  ASN A C   1 
ATOM   4512 O  O   . ASN A 1 667 ? -10.806 76.327  52.345  1.00 124.70 ? 667  ASN A O   1 
ATOM   4513 C  CB  . ASN A 1 667 ? -9.464  78.778  52.425  1.00 124.70 ? 667  ASN A CB  1 
ATOM   4514 C  CG  . ASN A 1 667 ? -8.256  79.707  52.158  1.00 124.70 ? 667  ASN A CG  1 
ATOM   4515 O  OD1 . ASN A 1 667 ? -7.730  80.366  53.072  1.00 124.70 ? 667  ASN A OD1 1 
ATOM   4516 N  ND2 . ASN A 1 667 ? -7.820  79.755  50.897  1.00 124.70 ? 667  ASN A ND2 1 
ATOM   4517 N  N   . PRO A 1 668 ? -9.394  75.255  53.763  1.00 124.70 ? 668  PRO A N   1 
ATOM   4518 C  CA  . PRO A 1 668 ? -9.851  73.874  53.653  1.00 124.70 ? 668  PRO A CA  1 
ATOM   4519 C  C   . PRO A 1 668 ? -10.976 73.651  52.703  1.00 124.70 ? 668  PRO A C   1 
ATOM   4520 O  O   . PRO A 1 668 ? -12.122 73.324  53.034  1.00 124.70 ? 668  PRO A O   1 
ATOM   4521 C  CB  . PRO A 1 668 ? -10.124 73.506  55.088  1.00 124.70 ? 668  PRO A CB  1 
ATOM   4522 C  CG  . PRO A 1 668 ? -8.857  74.023  55.697  1.00 124.70 ? 668  PRO A CG  1 
ATOM   4523 C  CD  . PRO A 1 668 ? -8.621  75.384  55.009  1.00 124.70 ? 668  PRO A CD  1 
ATOM   4524 N  N   . HIS A 1 669 ? -10.550 73.855  51.477  1.00 124.70 ? 669  HIS A N   1 
ATOM   4525 C  CA  . HIS A 1 669 ? -11.339 73.726  50.300  1.00 124.70 ? 669  HIS A CA  1 
ATOM   4526 C  C   . HIS A 1 669 ? -10.257 73.565  49.257  1.00 124.70 ? 669  HIS A C   1 
ATOM   4527 O  O   . HIS A 1 669 ? -10.267 74.265  48.256  1.00 124.70 ? 669  HIS A O   1 
ATOM   4528 C  CB  . HIS A 1 669 ? -12.091 75.017  49.982  1.00 124.70 ? 669  HIS A CB  1 
ATOM   4529 C  CG  . HIS A 1 669 ? -13.284 75.272  50.838  1.00 124.70 ? 669  HIS A CG  1 
ATOM   4530 N  ND1 . HIS A 1 669 ? -13.324 76.287  51.779  1.00 124.70 ? 669  HIS A ND1 1 
ATOM   4531 C  CD2 . HIS A 1 669 ? -14.509 74.697  50.868  1.00 124.70 ? 669  HIS A CD2 1 
ATOM   4532 C  CE1 . HIS A 1 669 ? -14.511 76.321  52.339  1.00 124.70 ? 669  HIS A CE1 1 
ATOM   4533 N  NE2 . HIS A 1 669 ? -15.257 75.364  51.805  1.00 124.70 ? 669  HIS A NE2 1 
ATOM   4534 N  N   . SER A 1 670 ? -9.269  72.718  49.479  1.00 124.70 ? 670  SER A N   1 
ATOM   4535 C  CA  . SER A 1 670 ? -8.297  72.573  48.410  1.00 124.70 ? 670  SER A CA  1 
ATOM   4536 C  C   . SER A 1 670 ? -7.497  71.333  48.630  1.00 124.70 ? 670  SER A C   1 
ATOM   4537 O  O   . SER A 1 670 ? -6.274  71.374  48.623  1.00 124.70 ? 670  SER A O   1 
ATOM   4538 C  CB  . SER A 1 670 ? -7.385  73.796  48.333  1.00 124.70 ? 670  SER A CB  1 
ATOM   4539 O  OG  . SER A 1 670 ? -6.762  74.018  49.576  1.00 124.70 ? 670  SER A OG  1 
ATOM   4540 N  N   . PRO A 1 671 ? -8.183  70.194  48.806  1.00 124.70 ? 671  PRO A N   1 
ATOM   4541 C  CA  . PRO A 1 671 ? -7.442  68.969  49.035  1.00 124.70 ? 671  PRO A CA  1 
ATOM   4542 C  C   . PRO A 1 671 ? -6.104  68.725  48.405  1.00 124.70 ? 671  PRO A C   1 
ATOM   4543 O  O   . PRO A 1 671 ? -5.793  69.120  47.267  1.00 124.70 ? 671  PRO A O   1 
ATOM   4544 C  CB  . PRO A 1 671 ? -8.474  67.896  48.753  1.00 124.70 ? 671  PRO A CB  1 
ATOM   4545 C  CG  . PRO A 1 671 ? -9.643  68.473  49.497  1.00 124.70 ? 671  PRO A CG  1 
ATOM   4546 C  CD  . PRO A 1 671 ? -9.616  69.956  49.069  1.00 124.70 ? 671  PRO A CD  1 
ATOM   4547 N  N   . LYS A 1 672 ? -5.329  68.077  49.265  1.00 124.70 ? 672  LYS A N   1 
ATOM   4548 C  CA  . LYS A 1 672 ? -3.970  67.687  49.063  1.00 124.70 ? 672  LYS A CA  1 
ATOM   4549 C  C   . LYS A 1 672 ? -3.863  66.582  48.070  1.00 124.70 ? 672  LYS A C   1 
ATOM   4550 O  O   . LYS A 1 672 ? -3.527  65.439  48.383  1.00 124.70 ? 672  LYS A O   1 
ATOM   4551 C  CB  . LYS A 1 672 ? -3.356  67.285  50.366  1.00 124.70 ? 672  LYS A CB  1 
ATOM   4552 N  N   . PHE A 1 673 ? -4.174  66.935  46.845  1.00 124.70 ? 673  PHE A N   1 
ATOM   4553 C  CA  . PHE A 1 673 ? -4.061  65.968  45.822  1.00 124.70 ? 673  PHE A CA  1 
ATOM   4554 C  C   . PHE A 1 673 ? -4.210  66.558  44.478  1.00 124.70 ? 673  PHE A C   1 
ATOM   4555 O  O   . PHE A 1 673 ? -5.206  67.210  44.148  1.00 124.70 ? 673  PHE A O   1 
ATOM   4556 C  CB  . PHE A 1 673 ? -5.063  64.857  46.018  1.00 124.70 ? 673  PHE A CB  1 
ATOM   4557 C  CG  . PHE A 1 673 ? -4.447  63.529  45.928  1.00 124.70 ? 673  PHE A CG  1 
ATOM   4558 C  CD1 . PHE A 1 673 ? -5.216  62.382  45.930  1.00 124.70 ? 673  PHE A CD1 1 
ATOM   4559 C  CD2 . PHE A 1 673 ? -3.071  63.425  45.879  1.00 124.70 ? 673  PHE A CD2 1 
ATOM   4560 C  CE1 . PHE A 1 673 ? -4.616  61.149  45.890  1.00 124.70 ? 673  PHE A CE1 1 
ATOM   4561 C  CE2 . PHE A 1 673 ? -2.485  62.226  45.843  1.00 124.70 ? 673  PHE A CE2 1 
ATOM   4562 C  CZ  . PHE A 1 673 ? -3.247  61.073  45.848  1.00 124.70 ? 673  PHE A CZ  1 
ATOM   4563 N  N   . THR A 1 674 ? -3.180  66.329  43.695  1.00 124.70 ? 674  THR A N   1 
ATOM   4564 C  CA  . THR A 1 674 ? -3.196  66.810  42.353  1.00 124.70 ? 674  THR A CA  1 
ATOM   4565 C  C   . THR A 1 674 ? -2.339  65.925  41.496  1.00 124.70 ? 674  THR A C   1 
ATOM   4566 O  O   . THR A 1 674 ? -1.104  66.002  41.501  1.00 124.70 ? 674  THR A O   1 
ATOM   4567 C  CB  . THR A 1 674 ? -2.695  68.207  42.302  1.00 124.70 ? 674  THR A CB  1 
ATOM   4568 O  OG1 . THR A 1 674 ? -1.537  68.283  43.139  1.00 124.70 ? 674  THR A OG1 1 
ATOM   4569 C  CG2 . THR A 1 674 ? -3.770  69.177  42.797  1.00 124.70 ? 674  THR A CG2 1 
ATOM   4570 N  N   . CYS A 1 675 ? -3.033  65.040  40.802  1.00 124.70 ? 675  CYS A N   1 
ATOM   4571 C  CA  . CYS A 1 675 ? -2.407  64.151  39.876  1.00 124.70 ? 675  CYS A CA  1 
ATOM   4572 C  C   . CYS A 1 675 ? -1.558  65.107  39.094  1.00 124.70 ? 675  CYS A C   1 
ATOM   4573 O  O   . CYS A 1 675 ? -1.991  66.227  38.817  1.00 124.70 ? 675  CYS A O   1 
ATOM   4574 C  CB  . CYS A 1 675 ? -3.484  63.558  38.997  1.00 124.70 ? 675  CYS A CB  1 
ATOM   4575 S  SG  . CYS A 1 675 ? -4.537  62.501  40.013  1.00 124.70 ? 675  CYS A SG  1 
ATOM   4576 N  N   . ALA A 1 676 ? -0.345  64.703  38.761  1.00 124.70 ? 676  ALA A N   1 
ATOM   4577 C  CA  . ALA A 1 676 ? 0.504   65.597  38.010  1.00 124.70 ? 676  ALA A CA  1 
ATOM   4578 C  C   . ALA A 1 676 ? 1.222   64.823  36.942  1.00 124.70 ? 676  ALA A C   1 
ATOM   4579 O  O   . ALA A 1 676 ? 1.224   63.588  36.944  1.00 124.70 ? 676  ALA A O   1 
ATOM   4580 C  CB  . ALA A 1 676 ? 1.506   66.272  38.938  1.00 124.70 ? 676  ALA A CB  1 
ATOM   4581 N  N   . CYS A 1 677 ? 1.822   65.565  36.019  1.00 124.70 ? 677  CYS A N   1 
ATOM   4582 C  CA  . CYS A 1 677 ? 2.581   64.964  34.938  1.00 124.70 ? 677  CYS A CA  1 
ATOM   4583 C  C   . CYS A 1 677 ? 3.831   65.784  34.622  1.00 124.70 ? 677  CYS A C   1 
ATOM   4584 O  O   . CYS A 1 677 ? 3.945   66.952  35.031  1.00 124.70 ? 677  CYS A O   1 
ATOM   4585 C  CB  . CYS A 1 677 ? 1.708   64.822  33.715  1.00 124.70 ? 677  CYS A CB  1 
ATOM   4586 S  SG  . CYS A 1 677 ? 0.136   63.973  34.022  1.00 124.70 ? 677  CYS A SG  1 
ATOM   4587 N  N   . PRO A 1 678 ? 4.768   65.198  33.851  1.00 124.70 ? 678  PRO A N   1 
ATOM   4588 C  CA  . PRO A 1 678 ? 6.035   65.828  33.470  1.00 124.70 ? 678  PRO A CA  1 
ATOM   4589 C  C   . PRO A 1 678 ? 5.919   67.015  32.529  1.00 124.70 ? 678  PRO A C   1 
ATOM   4590 O  O   . PRO A 1 678 ? 4.833   67.549  32.272  1.00 124.70 ? 678  PRO A O   1 
ATOM   4591 C  CB  . PRO A 1 678 ? 6.774   64.689  32.801  1.00 124.70 ? 678  PRO A CB  1 
ATOM   4592 C  CG  . PRO A 1 678 ? 5.672   64.134  31.945  1.00 124.70 ? 678  PRO A CG  1 
ATOM   4593 C  CD  . PRO A 1 678 ? 4.464   64.106  32.904  1.00 124.70 ? 678  PRO A CD  1 
ATOM   4594 N  N   . ASP A 1 679 ? 7.073   67.424  32.021  1.00 124.70 ? 679  ASP A N   1 
ATOM   4595 C  CA  . ASP A 1 679 ? 7.111   68.512  31.066  1.00 124.70 ? 679  ASP A CA  1 
ATOM   4596 C  C   . ASP A 1 679 ? 6.489   67.902  29.799  1.00 124.70 ? 679  ASP A C   1 
ATOM   4597 O  O   . ASP A 1 679 ? 6.823   66.767  29.410  1.00 124.70 ? 679  ASP A O   1 
ATOM   4598 C  CB  . ASP A 1 679 ? 8.564   68.966  30.790  1.00 124.70 ? 679  ASP A CB  1 
ATOM   4599 C  CG  . ASP A 1 679 ? 9.227   69.629  32.003  1.00 124.70 ? 679  ASP A CG  1 
ATOM   4600 O  OD1 . ASP A 1 679 ? 8.548   70.424  32.708  1.00 124.70 ? 679  ASP A OD1 1 
ATOM   4601 O  OD2 . ASP A 1 679 ? 10.437  69.365  32.233  1.00 124.70 ? 679  ASP A OD2 1 
ATOM   4602 N  N   . GLY A 1 680 ? 5.568   68.637  29.178  1.00 124.70 ? 680  GLY A N   1 
ATOM   4603 C  CA  . GLY A 1 680 ? 4.932   68.149  27.972  1.00 124.70 ? 680  GLY A CA  1 
ATOM   4604 C  C   . GLY A 1 680 ? 3.447   67.960  28.146  1.00 124.70 ? 680  GLY A C   1 
ATOM   4605 O  O   . GLY A 1 680 ? 2.663   68.831  27.796  1.00 124.70 ? 680  GLY A O   1 
ATOM   4606 N  N   . MET A 1 681 ? 3.069   66.828  28.722  1.00 124.70 ? 681  MET A N   1 
ATOM   4607 C  CA  . MET A 1 681 ? 1.670   66.482  28.919  1.00 124.70 ? 681  MET A CA  1 
ATOM   4608 C  C   . MET A 1 681 ? 0.848   67.323  29.897  1.00 124.70 ? 681  MET A C   1 
ATOM   4609 O  O   . MET A 1 681 ? 1.395   68.014  30.762  1.00 124.70 ? 681  MET A O   1 
ATOM   4610 C  CB  . MET A 1 681 ? 1.600   65.003  29.265  1.00 124.70 ? 681  MET A CB  1 
ATOM   4611 C  CG  . MET A 1 681 ? 2.223   64.162  28.164  1.00 124.70 ? 681  MET A CG  1 
ATOM   4612 S  SD  . MET A 1 681 ? 2.996   62.628  28.717  1.00 124.70 ? 681  MET A SD  1 
ATOM   4613 C  CE  . MET A 1 681 ? 1.669   61.424  28.405  1.00 124.70 ? 681  MET A CE  1 
ATOM   4614 N  N   . LEU A 1 682 ? -0.476  67.250  29.737  1.00 124.70 ? 682  LEU A N   1 
ATOM   4615 C  CA  . LEU A 1 682 ? -1.432  68.013  30.550  1.00 124.70 ? 682  LEU A CA  1 
ATOM   4616 C  C   . LEU A 1 682 ? -2.510  67.147  31.201  1.00 124.70 ? 682  LEU A C   1 
ATOM   4617 O  O   . LEU A 1 682 ? -3.028  66.243  30.555  1.00 124.70 ? 682  LEU A O   1 
ATOM   4618 C  CB  . LEU A 1 682 ? -2.150  69.032  29.671  1.00 124.70 ? 682  LEU A CB  1 
ATOM   4619 C  CG  . LEU A 1 682 ? -1.362  69.967  28.757  1.00 124.70 ? 682  LEU A CG  1 
ATOM   4620 C  CD1 . LEU A 1 682 ? -2.354  70.715  27.878  1.00 124.70 ? 682  LEU A CD1 1 
ATOM   4621 C  CD2 . LEU A 1 682 ? -0.520  70.940  29.573  1.00 124.70 ? 682  LEU A CD2 1 
ATOM   4622 N  N   . LEU A 1 683 ? -2.870  67.451  32.452  1.00 124.70 ? 683  LEU A N   1 
ATOM   4623 C  CA  . LEU A 1 683 ? -3.904  66.698  33.177  1.00 124.70 ? 683  LEU A CA  1 
ATOM   4624 C  C   . LEU A 1 683 ? -5.140  66.466  32.297  1.00 124.70 ? 683  LEU A C   1 
ATOM   4625 O  O   . LEU A 1 683 ? -6.133  67.186  32.425  1.00 124.70 ? 683  LEU A O   1 
ATOM   4626 C  CB  . LEU A 1 683 ? -4.314  67.448  34.459  1.00 124.70 ? 683  LEU A CB  1 
ATOM   4627 C  CG  . LEU A 1 683 ? -5.045  66.627  35.534  1.00 124.70 ? 683  LEU A CG  1 
ATOM   4628 C  CD1 . LEU A 1 683 ? -4.191  65.433  35.942  1.00 124.70 ? 683  LEU A CD1 1 
ATOM   4629 C  CD2 . LEU A 1 683 ? -5.343  67.496  36.747  1.00 124.70 ? 683  LEU A CD2 1 
ATOM   4630 N  N   . ALA A 1 684 ? -5.064  65.459  31.417  1.00 124.70 ? 684  ALA A N   1 
ATOM   4631 C  CA  . ALA A 1 684 ? -6.140  65.101  30.485  1.00 124.70 ? 684  ALA A CA  1 
ATOM   4632 C  C   . ALA A 1 684 ? -7.501  65.419  31.073  1.00 124.70 ? 684  ALA A C   1 
ATOM   4633 O  O   . ALA A 1 684 ? -7.646  65.517  32.292  1.00 124.70 ? 684  ALA A O   1 
ATOM   4634 C  CB  . ALA A 1 684 ? -6.063  63.612  30.119  1.00 124.70 ? 684  ALA A CB  1 
ATOM   4635 N  N   . ARG A 1 685 ? -8.493  65.591  30.202  1.00 124.70 ? 685  ARG A N   1 
ATOM   4636 C  CA  . ARG A 1 685 ? -9.855  65.907  30.637  1.00 124.70 ? 685  ARG A CA  1 
ATOM   4637 C  C   . ARG A 1 685 ? -10.409 64.779  31.506  1.00 124.70 ? 685  ARG A C   1 
ATOM   4638 O  O   . ARG A 1 685 ? -11.430 64.155  31.216  1.00 124.70 ? 685  ARG A O   1 
ATOM   4639 C  CB  . ARG A 1 685 ? -10.760 66.157  29.426  1.00 124.70 ? 685  ARG A CB  1 
ATOM   4640 N  N   . ASP A 1 686 ? -9.680  64.540  32.581  1.00 124.70 ? 686  ASP A N   1 
ATOM   4641 C  CA  . ASP A 1 686 ? -9.966  63.540  33.586  1.00 124.70 ? 686  ASP A CA  1 
ATOM   4642 C  C   . ASP A 1 686 ? -8.887  63.940  34.582  1.00 124.70 ? 686  ASP A C   1 
ATOM   4643 O  O   . ASP A 1 686 ? -7.701  63.965  34.256  1.00 124.70 ? 686  ASP A O   1 
ATOM   4644 C  CB  . ASP A 1 686 ? -9.748  62.107  33.035  1.00 124.70 ? 686  ASP A CB  1 
ATOM   4645 C  CG  . ASP A 1 686 ? -8.260  61.717  32.889  1.00 124.70 ? 686  ASP A CG  1 
ATOM   4646 O  OD1 . ASP A 1 686 ? -7.486  62.494  32.289  1.00 124.70 ? 686  ASP A OD1 1 
ATOM   4647 O  OD2 . ASP A 1 686 ? -7.868  60.619  33.357  1.00 124.70 ? 686  ASP A OD2 1 
ATOM   4648 N  N   . MET A 1 687 ? -9.296  64.322  35.778  1.00 124.70 ? 687  MET A N   1 
ATOM   4649 C  CA  . MET A 1 687 ? -8.337  64.745  36.778  1.00 124.70 ? 687  MET A CA  1 
ATOM   4650 C  C   . MET A 1 687 ? -7.355  63.619  37.116  1.00 124.70 ? 687  MET A C   1 
ATOM   4651 O  O   . MET A 1 687 ? -7.095  63.400  38.291  1.00 124.70 ? 687  MET A O   1 
ATOM   4652 C  CB  . MET A 1 687 ? -9.112  65.164  38.025  1.00 124.70 ? 687  MET A CB  1 
ATOM   4653 C  CG  . MET A 1 687 ? -10.634 65.050  37.823  1.00 124.70 ? 687  MET A CG  1 
ATOM   4654 S  SD  . MET A 1 687 ? -11.632 64.903  39.336  1.00 124.70 ? 687  MET A SD  1 
ATOM   4655 C  CE  . MET A 1 687 ? -13.096 65.933  38.920  1.00 124.70 ? 687  MET A CE  1 
ATOM   4656 N  N   . ARG A 1 688 ? -6.793  62.919  36.122  1.00 124.70 ? 688  ARG A N   1 
ATOM   4657 C  CA  . ARG A 1 688 ? -5.883  61.804  36.431  1.00 124.70 ? 688  ARG A CA  1 
ATOM   4658 C  C   . ARG A 1 688 ? -4.943  61.213  35.355  1.00 124.70 ? 688  ARG A C   1 
ATOM   4659 O  O   . ARG A 1 688 ? -4.669  60.011  35.382  1.00 124.70 ? 688  ARG A O   1 
ATOM   4660 C  CB  . ARG A 1 688 ? -6.701  60.631  36.998  1.00 124.70 ? 688  ARG A CB  1 
ATOM   4661 C  CG  . ARG A 1 688 ? -7.433  60.875  38.313  1.00 124.70 ? 688  ARG A CG  1 
ATOM   4662 C  CD  . ARG A 1 688 ? -8.378  59.731  38.612  1.00 124.70 ? 688  ARG A CD  1 
ATOM   4663 N  NE  . ARG A 1 688 ? -9.676  60.203  39.084  1.00 124.70 ? 688  ARG A NE  1 
ATOM   4664 C  CZ  . ARG A 1 688 ? -10.028 60.298  40.362  1.00 124.70 ? 688  ARG A CZ  1 
ATOM   4665 N  NH1 . ARG A 1 688 ? -9.175  59.949  41.319  1.00 124.70 ? 688  ARG A NH1 1 
ATOM   4666 N  NH2 . ARG A 1 688 ? -11.241 60.740  40.681  1.00 124.70 ? 688  ARG A NH2 1 
ATOM   4667 N  N   . SER A 1 689 ? -4.428  62.015  34.431  1.00 124.70 ? 689  SER A N   1 
ATOM   4668 C  CA  . SER A 1 689 ? -3.536  61.477  33.392  1.00 124.70 ? 689  SER A CA  1 
ATOM   4669 C  C   . SER A 1 689 ? -3.294  62.603  32.385  1.00 124.70 ? 689  SER A C   1 
ATOM   4670 O  O   . SER A 1 689 ? -4.164  63.448  32.212  1.00 124.70 ? 689  SER A O   1 
ATOM   4671 C  CB  . SER A 1 689 ? -4.212  60.280  32.706  1.00 124.70 ? 689  SER A CB  1 
ATOM   4672 O  OG  . SER A 1 689 ? -3.279  59.263  32.373  1.00 124.70 ? 689  SER A OG  1 
ATOM   4673 N  N   . CYS A 1 690 ? -2.145  62.640  31.715  1.00 124.70 ? 690  CYS A N   1 
ATOM   4674 C  CA  . CYS A 1 690 ? -1.916  63.746  30.775  1.00 124.70 ? 690  CYS A CA  1 
ATOM   4675 C  C   . CYS A 1 690 ? -1.480  63.376  29.344  1.00 124.70 ? 690  CYS A C   1 
ATOM   4676 O  O   . CYS A 1 690 ? -1.110  62.229  29.085  1.00 124.70 ? 690  CYS A O   1 
ATOM   4677 C  CB  . CYS A 1 690 ? -0.903  64.731  31.365  1.00 124.70 ? 690  CYS A CB  1 
ATOM   4678 S  SG  . CYS A 1 690 ? -1.127  65.264  33.102  1.00 124.70 ? 690  CYS A SG  1 
ATOM   4679 N  N   . LEU A 1 691 ? -1.530  64.353  28.425  1.00 124.70 ? 691  LEU A N   1 
ATOM   4680 C  CA  . LEU A 1 691 ? -1.147  64.128  27.026  1.00 124.70 ? 691  LEU A CA  1 
ATOM   4681 C  C   . LEU A 1 691 ? -0.331  65.234  26.329  1.00 124.70 ? 691  LEU A C   1 
ATOM   4682 O  O   . LEU A 1 691 ? -0.079  66.279  26.919  1.00 124.70 ? 691  LEU A O   1 
ATOM   4683 C  CB  . LEU A 1 691 ? -2.390  63.741  26.233  1.00 124.70 ? 691  LEU A CB  1 
ATOM   4684 C  CG  . LEU A 1 691 ? -2.669  62.316  26.723  1.00 124.70 ? 691  LEU A CG  1 
ATOM   4685 C  CD1 . LEU A 1 691 ? -4.018  61.830  26.273  1.00 124.70 ? 691  LEU A CD1 1 
ATOM   4686 C  CD2 . LEU A 1 691 ? -1.547  61.398  26.223  1.00 124.70 ? 691  LEU A CD2 1 
ATOM   4687 N  N   . THR A 1 692 ? 0.065   65.019  25.074  1.00 124.70 ? 692  THR A N   1 
ATOM   4688 C  CA  . THR A 1 692 ? 0.954   65.970  24.385  1.00 124.70 ? 692  THR A CA  1 
ATOM   4689 C  C   . THR A 1 692 ? 0.597   66.656  23.057  1.00 124.70 ? 692  THR A C   1 
ATOM   4690 O  O   . THR A 1 692 ? -0.180  66.141  22.250  1.00 124.70 ? 692  THR A O   1 
ATOM   4691 C  CB  . THR A 1 692 ? 2.329   65.298  24.153  1.00 124.70 ? 692  THR A CB  1 
ATOM   4692 O  OG1 . THR A 1 692 ? 2.619   65.281  22.746  1.00 124.70 ? 692  THR A OG1 1 
ATOM   4693 C  CG2 . THR A 1 692 ? 2.313   63.851  24.653  1.00 124.70 ? 692  THR A CG2 1 
ATOM   4694 N  N   . GLU A 1 693 ? 1.222   67.816  22.836  1.00 124.70 ? 693  GLU A N   1 
ATOM   4695 C  CA  . GLU A 1 693 ? 1.056   68.588  21.602  1.00 124.70 ? 693  GLU A CA  1 
ATOM   4696 C  C   . GLU A 1 693 ? 2.053   69.746  21.477  1.00 124.70 ? 693  GLU A C   1 
ATOM   4697 O  O   . GLU A 1 693 ? 2.842   69.752  20.498  1.00 124.70 ? 693  GLU A O   1 
ATOM   4698 C  CB  . GLU A 1 693 ? -0.380  69.119  21.469  1.00 124.70 ? 693  GLU A CB  1 
ATOM   4699 C  CG  . GLU A 1 693 ? -0.786  70.260  22.391  1.00 124.70 ? 693  GLU A CG  1 
ATOM   4700 C  CD  . GLU A 1 693 ? -2.213  70.731  22.109  1.00 124.70 ? 693  GLU A CD  1 
ATOM   4701 O  OE1 . GLU A 1 693 ? -2.974  69.989  21.437  1.00 124.70 ? 693  GLU A OE1 1 
ATOM   4702 O  OE2 . GLU A 1 693 ? -2.581  71.837  22.568  1.00 124.70 ? 693  GLU A OE2 1 
HETATM 4703 C  C1  . NAG B 2 .   ? 39.354  87.630  34.399  1.00 124.70 ? 1    NAG B C1  1 
HETATM 4704 C  C2  . NAG B 2 .   ? 38.412  88.715  33.851  1.00 124.70 ? 1    NAG B C2  1 
HETATM 4705 C  C3  . NAG B 2 .   ? 38.581  88.781  32.321  1.00 124.70 ? 1    NAG B C3  1 
HETATM 4706 C  C4  . NAG B 2 .   ? 40.055  89.063  31.960  1.00 124.70 ? 1    NAG B C4  1 
HETATM 4707 C  C5  . NAG B 2 .   ? 40.972  88.022  32.641  1.00 124.70 ? 1    NAG B C5  1 
HETATM 4708 C  C6  . NAG B 2 .   ? 42.453  88.357  32.495  1.00 124.70 ? 1    NAG B C6  1 
HETATM 4709 C  C7  . NAG B 2 .   ? 36.438  89.014  35.252  1.00 124.70 ? 1    NAG B C7  1 
HETATM 4710 C  C8  . NAG B 2 .   ? 34.972  88.666  35.469  1.00 124.70 ? 1    NAG B C8  1 
HETATM 4711 N  N2  . NAG B 2 .   ? 37.015  88.460  34.182  1.00 124.70 ? 1    NAG B N2  1 
HETATM 4712 O  O3  . NAG B 2 .   ? 37.720  89.813  31.787  1.00 124.70 ? 1    NAG B O3  1 
HETATM 4713 O  O4  . NAG B 2 .   ? 40.235  88.991  30.521  1.00 124.70 ? 1    NAG B O4  1 
HETATM 4714 O  O5  . NAG B 2 .   ? 40.713  87.954  34.062  1.00 124.70 ? 1    NAG B O5  1 
HETATM 4715 O  O6  . NAG B 2 .   ? 42.708  89.720  32.826  1.00 124.70 ? 1    NAG B O6  1 
HETATM 4716 O  O7  . NAG B 2 .   ? 37.049  89.712  36.061  1.00 124.70 ? 1    NAG B O7  1 
HETATM 4717 C  C1  . NAG B 2 .   ? 41.010  89.967  29.881  1.00 124.70 ? 2    NAG B C1  1 
HETATM 4718 C  C2  . NAG B 2 .   ? 41.346  89.492  28.444  1.00 124.70 ? 2    NAG B C2  1 
HETATM 4719 C  C3  . NAG B 2 .   ? 41.938  90.623  27.573  1.00 124.70 ? 2    NAG B C3  1 
HETATM 4720 C  C4  . NAG B 2 .   ? 41.145  91.933  27.687  1.00 124.70 ? 2    NAG B C4  1 
HETATM 4721 C  C5  . NAG B 2 .   ? 40.940  92.278  29.175  1.00 124.70 ? 2    NAG B C5  1 
HETATM 4722 C  C6  . NAG B 2 .   ? 40.118  93.544  29.403  1.00 124.70 ? 2    NAG B C6  1 
HETATM 4723 C  C7  . NAG B 2 .   ? 41.998  87.164  28.185  1.00 124.70 ? 2    NAG B C7  1 
HETATM 4724 C  C8  . NAG B 2 .   ? 43.109  86.134  28.294  1.00 124.70 ? 2    NAG B C8  1 
HETATM 4725 N  N2  . NAG B 2 .   ? 42.324  88.414  28.508  1.00 124.70 ? 2    NAG B N2  1 
HETATM 4726 O  O3  . NAG B 2 .   ? 41.974  90.199  26.218  1.00 124.70 ? 2    NAG B O3  1 
HETATM 4727 O  O4  . NAG B 2 .   ? 41.888  93.003  27.051  1.00 124.70 ? 2    NAG B O4  1 
HETATM 4728 O  O5  . NAG B 2 .   ? 40.257  91.195  29.851  1.00 124.70 ? 2    NAG B O5  1 
HETATM 4729 O  O6  . NAG B 2 .   ? 38.845  93.463  28.770  1.00 124.70 ? 2    NAG B O6  1 
HETATM 4730 O  O7  . NAG B 2 .   ? 40.871  86.843  27.813  1.00 124.70 ? 2    NAG B O7  1 
HETATM 4731 C  C1  . BMA B 2 .   ? 41.200  93.875  26.210  1.00 124.70 ? 3    BMA B C1  1 
HETATM 4732 C  C2  . BMA B 2 .   ? 41.983  95.193  26.065  1.00 124.70 ? 3    BMA B C2  1 
HETATM 4733 C  C3  . BMA B 2 .   ? 41.306  96.106  25.024  1.00 124.70 ? 3    BMA B C3  1 
HETATM 4734 C  C4  . BMA B 2 .   ? 41.004  95.361  23.712  1.00 124.70 ? 3    BMA B C4  1 
HETATM 4735 C  C5  . BMA B 2 .   ? 40.266  94.047  24.014  1.00 124.70 ? 3    BMA B C5  1 
HETATM 4736 C  C6  . BMA B 2 .   ? 39.944  93.184  22.787  1.00 124.70 ? 3    BMA B C6  1 
HETATM 4737 O  O2  . BMA B 2 .   ? 43.344  94.915  25.676  1.00 124.70 ? 3    BMA B O2  1 
HETATM 4738 O  O3  . BMA B 2 .   ? 42.131  97.264  24.754  1.00 124.70 ? 3    BMA B O3  1 
HETATM 4739 O  O4  . BMA B 2 .   ? 40.187  96.185  22.889  1.00 124.70 ? 3    BMA B O4  1 
HETATM 4740 O  O5  . BMA B 2 .   ? 41.039  93.243  24.932  1.00 124.70 ? 3    BMA B O5  1 
HETATM 4741 O  O6  . BMA B 2 .   ? 41.124  92.990  21.967  1.00 124.70 ? 3    BMA B O6  1 
HETATM 4742 C  C1  . MAN B 2 .   ? 41.429  98.475  24.725  1.00 124.70 ? 4    MAN B C1  1 
HETATM 4743 C  C2  . MAN B 2 .   ? 42.347  99.629  24.318  1.00 124.70 ? 4    MAN B C2  1 
HETATM 4744 C  C3  . MAN B 2 .   ? 43.391  99.855  25.411  1.00 124.70 ? 4    MAN B C3  1 
HETATM 4745 C  C4  . MAN B 2 .   ? 42.677  100.150 26.720  1.00 124.70 ? 4    MAN B C4  1 
HETATM 4746 C  C5  . MAN B 2 .   ? 41.702  99.011  27.075  1.00 124.70 ? 4    MAN B C5  1 
HETATM 4747 C  C6  . MAN B 2 .   ? 40.829  99.401  28.255  1.00 124.70 ? 4    MAN B C6  1 
HETATM 4748 O  O2  . MAN B 2 .   ? 41.574  100.814 24.163  1.00 124.70 ? 4    MAN B O2  1 
HETATM 4749 O  O3  . MAN B 2 .   ? 44.232  100.953 25.075  1.00 124.70 ? 4    MAN B O3  1 
HETATM 4750 O  O4  . MAN B 2 .   ? 43.631  100.324 27.760  1.00 124.70 ? 4    MAN B O4  1 
HETATM 4751 O  O5  . MAN B 2 .   ? 40.798  98.755  25.974  1.00 124.70 ? 4    MAN B O5  1 
HETATM 4752 O  O6  . MAN B 2 .   ? 38.799  100.453 30.767  1.00 124.70 ? 4    MAN B O6  1 
HETATM 4753 C  C1  . MAN B 2 .   ? 40.826  92.510  20.677  1.00 124.70 ? 5    MAN B C1  1 
HETATM 4754 C  C2  . MAN B 2 .   ? 42.127  92.313  19.864  1.00 124.70 ? 5    MAN B C2  1 
HETATM 4755 C  C3  . MAN B 2 .   ? 42.738  93.668  19.404  1.00 124.70 ? 5    MAN B C3  1 
HETATM 4756 C  C4  . MAN B 2 .   ? 41.683  94.616  18.810  1.00 124.70 ? 5    MAN B C4  1 
HETATM 4757 C  C5  . MAN B 2 .   ? 40.472  94.702  19.745  1.00 124.70 ? 5    MAN B C5  1 
HETATM 4758 C  C6  . MAN B 2 .   ? 39.330  95.577  19.222  1.00 124.70 ? 5    MAN B C6  1 
HETATM 4759 O  O2  . MAN B 2 .   ? 41.878  91.483  18.739  1.00 124.70 ? 5    MAN B O2  1 
HETATM 4760 O  O3  . MAN B 2 .   ? 43.763  93.453  18.435  1.00 124.70 ? 5    MAN B O3  1 
HETATM 4761 O  O4  . MAN B 2 .   ? 42.257  95.912  18.640  1.00 124.70 ? 5    MAN B O4  1 
HETATM 4762 O  O5  . MAN B 2 .   ? 39.938  93.376  19.972  1.00 124.70 ? 5    MAN B O5  1 
HETATM 4763 O  O6  . MAN B 2 .   ? 38.427  94.820  18.428  1.00 124.70 ? 5    MAN B O6  1 
HETATM 4764 C  C1  . NAG C 3 .   ? 21.444  112.715 83.102  1.00 124.70 ? 1    NAG C C1  1 
HETATM 4765 C  C2  . NAG C 3 .   ? 21.134  113.575 84.339  1.00 124.70 ? 1    NAG C C2  1 
HETATM 4766 C  C3  . NAG C 3 .   ? 22.463  113.930 85.032  1.00 124.70 ? 1    NAG C C3  1 
HETATM 4767 C  C4  . NAG C 3 .   ? 23.230  112.644 85.404  1.00 124.70 ? 1    NAG C C4  1 
HETATM 4768 C  C5  . NAG C 3 .   ? 23.403  111.754 84.153  1.00 124.70 ? 1    NAG C C5  1 
HETATM 4769 C  C6  . NAG C 3 .   ? 23.973  110.378 84.483  1.00 124.70 ? 1    NAG C C6  1 
HETATM 4770 C  C7  . NAG C 3 .   ? 19.078  114.861 84.073  1.00 124.70 ? 1    NAG C C7  1 
HETATM 4771 C  C8  . NAG C 3 .   ? 18.460  116.202 83.701  1.00 124.70 ? 1    NAG C C8  1 
HETATM 4772 N  N2  . NAG C 3 .   ? 20.412  114.796 84.002  1.00 124.70 ? 1    NAG C N2  1 
HETATM 4773 O  O3  . NAG C 3 .   ? 22.192  114.720 86.213  1.00 124.70 ? 1    NAG C O3  1 
HETATM 4774 O  O4  . NAG C 3 .   ? 24.539  112.984 85.934  1.00 124.70 ? 1    NAG C O4  1 
HETATM 4775 O  O5  . NAG C 3 .   ? 22.132  111.518 83.504  1.00 124.70 ? 1    NAG C O5  1 
HETATM 4776 O  O6  . NAG C 3 .   ? 23.279  109.782 85.577  1.00 124.70 ? 1    NAG C O6  1 
HETATM 4777 O  O7  . NAG C 3 .   ? 18.371  113.894 84.356  1.00 124.70 ? 1    NAG C O7  1 
HETATM 4778 C  C1  . NAG C 3 .   ? 25.011  112.311 87.070  1.00 124.70 ? 2    NAG C C1  1 
HETATM 4779 C  C2  . NAG C 3 .   ? 26.529  112.580 87.229  1.00 124.70 ? 2    NAG C C2  1 
HETATM 4780 C  C3  . NAG C 3 .   ? 27.066  112.128 88.605  1.00 124.70 ? 2    NAG C C3  1 
HETATM 4781 C  C4  . NAG C 3 .   ? 26.170  112.582 89.767  1.00 124.70 ? 2    NAG C C4  1 
HETATM 4782 C  C5  . NAG C 3 .   ? 24.709  112.200 89.465  1.00 124.70 ? 2    NAG C C5  1 
HETATM 4783 C  C6  . NAG C 3 .   ? 23.723  112.651 90.540  1.00 124.70 ? 2    NAG C C6  1 
HETATM 4784 C  C7  . NAG C 3 .   ? 27.875  112.488 85.206  1.00 124.70 ? 2    NAG C C7  1 
HETATM 4785 C  C8  . NAG C 3 .   ? 28.600  111.613 84.198  1.00 124.70 ? 2    NAG C C8  1 
HETATM 4786 N  N2  . NAG C 3 .   ? 27.259  111.852 86.199  1.00 124.70 ? 2    NAG C N2  1 
HETATM 4787 O  O3  . NAG C 3 .   ? 28.380  112.635 88.784  1.00 124.70 ? 2    NAG C O3  1 
HETATM 4788 O  O4  . NAG C 3 .   ? 26.591  111.922 90.987  1.00 124.70 ? 2    NAG C O4  1 
HETATM 4789 O  O5  . NAG C 3 .   ? 24.282  112.795 88.216  1.00 124.70 ? 2    NAG C O5  1 
HETATM 4790 O  O6  . NAG C 3 .   ? 23.794  114.056 90.760  1.00 124.70 ? 2    NAG C O6  1 
HETATM 4791 O  O7  . NAG C 3 .   ? 27.873  113.713 85.095  1.00 124.70 ? 2    NAG C O7  1 
HETATM 4792 C  C1  . BMA C 3 .   ? 26.705  112.687 92.146  1.00 124.70 ? 3    BMA C C1  1 
HETATM 4793 C  C2  . BMA C 3 .   ? 26.634  111.775 93.385  1.00 124.70 ? 3    BMA C C2  1 
HETATM 4794 C  C3  . BMA C 3 .   ? 26.905  112.590 94.665  1.00 124.70 ? 3    BMA C C3  1 
HETATM 4795 C  C4  . BMA C 3 .   ? 28.174  113.453 94.542  1.00 124.70 ? 3    BMA C C4  1 
HETATM 4796 C  C5  . BMA C 3 .   ? 28.129  114.268 93.240  1.00 124.70 ? 3    BMA C C5  1 
HETATM 4797 C  C6  . BMA C 3 .   ? 29.363  115.140 92.974  1.00 124.70 ? 3    BMA C C6  1 
HETATM 4798 O  O2  . BMA C 3 .   ? 27.593  110.704 93.263  1.00 124.70 ? 3    BMA C O2  1 
HETATM 4799 O  O3  . BMA C 3 .   ? 27.017  111.713 95.810  1.00 124.70 ? 3    BMA C O3  1 
HETATM 4800 O  O4  . BMA C 3 .   ? 28.242  114.339 95.653  1.00 124.70 ? 3    BMA C O4  1 
HETATM 4801 O  O5  . BMA C 3 .   ? 27.957  113.387 92.108  1.00 124.70 ? 3    BMA C O5  1 
HETATM 4802 O  O6  . BMA C 3 .   ? 30.582  114.369 93.112  1.00 124.70 ? 3    BMA C O6  1 
HETATM 4803 C  C1  . MAN C 3 .   ? 31.734  115.172 93.220  1.00 124.70 ? 4    MAN C C1  1 
HETATM 4804 C  C2  . MAN C 3 .   ? 32.995  114.286 93.349  1.00 124.70 ? 4    MAN C C2  1 
HETATM 4805 C  C3  . MAN C 3 .   ? 33.109  113.635 94.757  1.00 124.70 ? 4    MAN C C3  1 
HETATM 4806 C  C4  . MAN C 3 .   ? 32.844  114.640 95.891  1.00 124.70 ? 4    MAN C C4  1 
HETATM 4807 C  C5  . MAN C 3 .   ? 31.557  115.421 95.609  1.00 124.70 ? 4    MAN C C5  1 
HETATM 4808 C  C6  . MAN C 3 .   ? 31.227  116.494 96.648  1.00 124.70 ? 4    MAN C C6  1 
HETATM 4809 O  O2  . MAN C 3 .   ? 34.159  115.051 93.070  1.00 124.70 ? 4    MAN C O2  1 
HETATM 4810 O  O3  . MAN C 3 .   ? 34.402  113.060 94.942  1.00 124.70 ? 4    MAN C O3  1 
HETATM 4811 O  O4  . MAN C 3 .   ? 32.722  113.934 97.127  1.00 124.70 ? 4    MAN C O4  1 
HETATM 4812 O  O5  . MAN C 3 .   ? 31.658  116.075 94.322  1.00 124.70 ? 4    MAN C O5  1 
HETATM 4813 O  O6  . MAN C 3 .   ? 31.831  117.736 96.312  1.00 124.70 ? 4    MAN C O6  1 
HETATM 4814 CA CA  . CA  D 4 .   ? -7.346  109.135 97.778  1.00 124.70 ? 1001 CA  A CA  1 
HETATM 4815 CA CA  . CA  E 4 .   ? -1.649  85.045  79.631  1.00 124.70 ? 1002 CA  A CA  1 
HETATM 4816 CA CA  . CA  F 4 .   ? 40.771  91.558  65.782  1.00 124.70 ? 1003 CA  A CA  1 
HETATM 4817 CA CA  . CA  G 4 .   ? 27.446  114.188 68.236  1.00 124.70 ? 1004 CA  A CA  1 
HETATM 4818 CA CA  . CA  H 4 .   ? -0.213  121.055 100.004 1.00 124.70 ? 1005 CA  A CA  1 
HETATM 4819 CA CA  . CA  I 4 .   ? 31.352  89.341  47.880  1.00 124.70 ? 1006 CA  A CA  1 
HETATM 4820 CA CA  . CA  J 4 .   ? 35.345  69.490  23.505  1.00 124.70 ? 1007 CA  A CA  1 
HETATM 4821 CA CA  . CA  K 4 .   ? 21.696  63.631  -4.419  1.00 124.70 ? 1008 CA  A CA  1 
HETATM 4822 W  W1  . KEG L 5 .   ? 22.367  67.369  17.299  1.00 124.70 ? 6001 KEG A W1  1 
HETATM 4823 W  W2  . KEG L 5 .   ? 21.548  69.982  11.611  1.00 124.70 ? 6001 KEG A W2  1 
HETATM 4824 W  W3  . KEG L 5 .   ? 23.900  70.346  17.078  1.00 124.70 ? 6001 KEG A W3  1 
HETATM 4825 W  W4  . KEG L 5 .   ? 23.558  71.812  13.619  1.00 124.70 ? 6001 KEG A W4  1 
HETATM 4826 W  W5  . KEG L 5 .   ? 20.092  65.841  15.820  1.00 124.70 ? 6001 KEG A W5  1 
HETATM 4827 W  W6  . KEG L 5 .   ? 19.804  67.269  12.349  1.00 124.70 ? 6001 KEG A W6  1 
HETATM 4828 W  W7  . KEG L 5 .   ? 20.783  69.946  17.180  1.00 124.70 ? 6001 KEG A W7  1 
HETATM 4829 W  W8  . KEG L 5 .   ? 20.009  71.558  14.212  1.00 124.70 ? 6001 KEG A W8  1 
HETATM 4830 W  W9  . KEG L 5 .   ? 23.521  65.528  14.486  1.00 124.70 ? 6001 KEG A W9  1 
HETATM 4831 W  W10 . KEG L 5 .   ? 22.881  67.351  11.836  1.00 124.70 ? 6001 KEG A W10 1 
HETATM 4832 W  W11 . KEG L 5 .   ? 18.322  68.752  14.985  1.00 124.70 ? 6001 KEG A W11 1 
HETATM 4833 W  W12 . KEG L 5 .   ? 25.370  68.652  14.001  1.00 124.70 ? 6001 KEG A W12 1 
HETATM 4834 P  P1  . KEG L 5 .   ? 21.849  68.685  14.442  1.00 124.70 ? 6001 KEG A P1  1 
HETATM 4835 O  O1  . KEG L 5 .   ? 22.664  66.694  18.765  1.00 124.70 ? 6001 KEG A O1  1 
HETATM 4836 O  O2  . KEG L 5 .   ? 21.476  70.503  10.118  1.00 124.70 ? 6001 KEG A O2  1 
HETATM 4837 O  O5  . KEG L 5 .   ? 24.723  71.170  18.298  1.00 124.70 ? 6001 KEG A O5  1 
HETATM 4838 O  O6  . KEG L 5 .   ? 24.284  73.230  13.205  1.00 124.70 ? 6001 KEG A O6  1 
HETATM 4839 O  O7  . KEG L 5 .   ? 19.364  64.514  16.441  1.00 124.70 ? 6001 KEG A O7  1 
HETATM 4840 O  O8  . KEG L 5 .   ? 18.913  66.487  11.226  1.00 124.70 ? 6001 KEG A O8  1 
HETATM 4841 O  O9  . KEG L 5 .   ? 20.207  70.533  18.622  1.00 124.70 ? 6001 KEG A O9  1 
HETATM 4842 O  O10 . KEG L 5 .   ? 19.058  72.858  14.162  1.00 124.70 ? 6001 KEG A O10 1 
HETATM 4843 O  O11 . KEG L 5 .   ? 24.208  64.055  14.440  1.00 124.70 ? 6001 KEG A O11 1 
HETATM 4844 O  O12 . KEG L 5 .   ? 23.374  66.780  10.390  1.00 124.70 ? 6001 KEG A O12 1 
HETATM 4845 O  O13 . KEG L 5 .   ? 16.752  68.876  15.250  1.00 124.70 ? 6001 KEG A O13 1 
HETATM 4846 O  O14 . KEG L 5 .   ? 26.946  68.635  13.718  1.00 124.70 ? 6001 KEG A O14 1 
HETATM 4847 O  O17 . KEG L 5 .   ? 21.958  67.377  15.116  1.00 124.70 ? 6001 KEG A O17 1 
HETATM 4848 O  O18 . KEG L 5 .   ? 21.615  68.486  13.213  1.00 124.70 ? 6001 KEG A O18 1 
HETATM 4849 O  O19 . KEG L 5 .   ? 20.752  69.380  14.899  1.00 124.70 ? 6001 KEG A O19 1 
HETATM 4850 O  O21 . KEG L 5 .   ? 23.223  69.524  14.699  1.00 124.70 ? 6001 KEG A O21 1 
HETATM 4851 O  O23 . KEG L 5 .   ? 20.893  66.513  17.131  1.00 124.70 ? 6001 KEG A O23 1 
HETATM 4852 O  O24 . KEG L 5 .   ? 20.190  68.834  11.628  1.00 124.70 ? 6001 KEG A O24 1 
HETATM 4853 O  O25 . KEG L 5 .   ? 23.578  68.679  17.603  1.00 124.70 ? 6001 KEG A O25 1 
HETATM 4854 O  O26 . KEG L 5 .   ? 22.925  71.054  12.101  1.00 124.70 ? 6001 KEG A O26 1 
HETATM 4855 O  O27 . KEG L 5 .   ? 23.505  66.147  16.283  1.00 124.70 ? 6001 KEG A O27 1 
HETATM 4856 O  O28 . KEG L 5 .   ? 22.656  68.923  11.367  1.00 124.70 ? 6001 KEG A O28 1 
HETATM 4857 O  O29 . KEG L 5 .   ? 21.219  68.397  17.739  1.00 124.70 ? 6001 KEG A O29 1 
HETATM 4858 O  O30 . KEG L 5 .   ? 20.352  71.170  12.433  1.00 124.70 ? 6001 KEG A O30 1 
HETATM 4859 O  O31 . KEG L 5 .   ? 23.901  71.709  15.575  1.00 124.70 ? 6001 KEG A O31 1 
HETATM 4860 O  O32 . KEG L 5 .   ? 19.713  65.938  13.847  1.00 124.70 ? 6001 KEG A O32 1 
HETATM 4861 O  O33 . KEG L 5 .   ? 22.382  70.765  17.403  1.00 124.70 ? 6001 KEG A O33 1 
HETATM 4862 O  O34 . KEG L 5 .   ? 21.838  72.315  14.083  1.00 124.70 ? 6001 KEG A O34 1 
HETATM 4863 O  O35 . KEG L 5 .   ? 21.685  65.060  15.074  1.00 124.70 ? 6001 KEG A O35 1 
HETATM 4864 O  O36 . KEG L 5 .   ? 21.235  66.781  11.902  1.00 124.70 ? 6001 KEG A O36 1 
HETATM 4865 O  O37 . KEG L 5 .   ? 25.258  69.339  15.888  1.00 124.70 ? 6001 KEG A O37 1 
HETATM 4866 O  O38 . KEG L 5 .   ? 24.932  70.454  13.402  1.00 124.70 ? 6001 KEG A O38 1 
HETATM 4867 O  O39 . KEG L 5 .   ? 18.743  67.143  15.884  1.00 124.70 ? 6001 KEG A O39 1 
HETATM 4868 O  O40 . KEG L 5 .   ? 18.451  68.076  13.322  1.00 124.70 ? 6001 KEG A O40 1 
HETATM 4869 O  O41 . KEG L 5 .   ? 20.240  71.355  16.011  1.00 124.70 ? 6001 KEG A O41 1 
HETATM 4870 O  O42 . KEG L 5 .   ? 23.228  65.806  12.799  1.00 124.70 ? 6001 KEG A O42 1 
HETATM 4871 O  O43 . KEG L 5 .   ? 19.073  69.430  16.521  1.00 124.70 ? 6001 KEG A O43 1 
HETATM 4872 O  O44 . KEG L 5 .   ? 18.718  70.321  14.140  1.00 124.70 ? 6001 KEG A O44 1 
HETATM 4873 O  O45 . KEG L 5 .   ? 25.006  66.778  14.447  1.00 124.70 ? 6001 KEG A O45 1 
HETATM 4874 O  O46 . KEG L 5 .   ? 24.563  68.088  12.418  1.00 124.70 ? 6001 KEG A O46 1 
HETATM 4875 W  W1  . KEG M 5 .   ? 22.107  60.171  24.163  1.00 124.70 ? 6002 KEG A W1  1 
HETATM 4876 W  W2  . KEG M 5 .   ? 23.652  61.758  29.767  1.00 124.70 ? 6002 KEG A W2  1 
HETATM 4877 W  W3  . KEG M 5 .   ? 20.314  62.325  25.844  1.00 124.70 ? 6002 KEG A W3  1 
HETATM 4878 W  W4  . KEG M 5 .   ? 21.006  63.388  29.210  1.00 124.70 ? 6002 KEG A W4  1 
HETATM 4879 W  W5  . KEG M 5 .   ? 24.794  59.025  25.292  1.00 124.70 ? 6002 KEG A W5  1 
HETATM 4880 W  W6  . KEG M 5 .   ? 25.873  59.480  28.475  1.00 124.70 ? 6002 KEG A W6  1 
HETATM 4881 W  W7  . KEG M 5 .   ? 23.052  63.464  24.673  1.00 124.70 ? 6002 KEG A W7  1 
HETATM 4882 W  W8  . KEG M 5 .   ? 24.290  64.328  27.735  1.00 124.70 ? 6002 KEG A W8  1 
HETATM 4883 W  W9  . KEG M 5 .   ? 21.491  57.804  26.433  1.00 124.70 ? 6002 KEG A W9  1 
HETATM 4884 W  W10 . KEG M 5 .   ? 22.638  58.343  29.338  1.00 124.70 ? 6002 KEG A W10 1 
HETATM 4885 W  W11 . KEG M 5 .   ? 25.992  62.002  25.917  1.00 124.70 ? 6002 KEG A W11 1 
HETATM 4886 W  W12 . KEG M 5 .   ? 19.785  60.006  28.221  1.00 124.70 ? 6002 KEG A W12 1 
HETATM 4887 P  P1  . KEG M 5 .   ? 22.946  60.967  27.172  1.00 124.70 ? 6002 KEG A P1  1 
HETATM 4888 O  O1  . KEG M 5 .   ? 21.683  59.784  22.648  1.00 124.70 ? 6002 KEG A O1  1 
HETATM 4889 O  O2  . KEG M 5 .   ? 24.045  62.233  31.295  1.00 124.70 ? 6002 KEG A O2  1 
HETATM 4890 O  O5  . KEG M 5 .   ? 18.946  63.051  25.059  1.00 124.70 ? 6002 KEG A O5  1 
HETATM 4891 O  O6  . KEG M 5 .   ? 20.054  64.457  30.125  1.00 124.70 ? 6002 KEG A O6  1 
HETATM 4892 O  O7  . KEG M 5 .   ? 25.621  58.036  24.237  1.00 124.70 ? 6002 KEG A O7  1 
HETATM 4893 O  O8  . KEG M 5 .   ? 27.210  58.824  29.281  1.00 124.70 ? 6002 KEG A O8  1 
HETATM 4894 O  O9  . KEG M 5 .   ? 23.026  64.559  23.435  1.00 124.70 ? 6002 KEG A O9  1 
HETATM 4895 O  O10 . KEG M 5 .   ? 25.016  65.791  28.113  1.00 124.70 ? 6002 KEG A O10 1 
HETATM 4896 O  O11 . KEG M 5 .   ? 20.823  56.338  25.946  1.00 124.70 ? 6002 KEG A O11 1 
HETATM 4897 O  O12 . KEG M 5 .   ? 22.554  57.275  30.547  1.00 124.70 ? 6002 KEG A O12 1 
HETATM 4898 O  O13 . KEG M 5 .   ? 27.350  62.395  25.259  1.00 124.70 ? 6002 KEG A O13 1 
HETATM 4899 O  O14 . KEG M 5 .   ? 18.307  59.645  28.695  1.00 124.70 ? 6002 KEG A O14 1 
HETATM 4900 O  O17 . KEG M 5 .   ? 22.829  59.933  26.262  1.00 124.70 ? 6002 KEG A O17 1 
HETATM 4901 O  O18 . KEG M 5 .   ? 23.497  60.321  28.167  1.00 124.70 ? 6002 KEG A O18 1 
HETATM 4902 O  O19 . KEG M 5 .   ? 23.715  62.158  26.634  1.00 124.70 ? 6002 KEG A O19 1 
HETATM 4903 O  O21 . KEG M 5 .   ? 21.594  61.416  27.628  1.00 124.70 ? 6002 KEG A O21 1 
HETATM 4904 O  O23 . KEG M 5 .   ? 23.708  59.734  24.174  1.00 124.70 ? 6002 KEG A O23 1 
HETATM 4905 O  O24 . KEG M 5 .   ? 25.161  60.653  29.715  1.00 124.70 ? 6002 KEG A O24 1 
HETATM 4906 O  O25 . KEG M 5 .   ? 20.680  60.934  24.733  1.00 124.70 ? 6002 KEG A O25 1 
HETATM 4907 O  O26 . KEG M 5 .   ? 22.128  62.589  30.195  1.00 124.70 ? 6002 KEG A O26 1 
HETATM 4908 O  O27 . KEG M 5 .   ? 21.345  58.757  24.897  1.00 124.70 ? 6002 KEG A O27 1 
HETATM 4909 O  O28 . KEG M 5 .   ? 22.923  60.045  30.237  1.00 124.70 ? 6002 KEG A O28 1 
HETATM 4910 O  O29 . KEG M 5 .   ? 22.688  61.866  23.792  1.00 124.70 ? 6002 KEG A O29 1 
HETATM 4911 O  O30 . KEG M 5 .   ? 24.658  63.154  29.084  1.00 124.70 ? 6002 KEG A O30 1 
HETATM 4912 O  O31 . KEG M 5 .   ? 20.323  63.430  27.465  1.00 124.70 ? 6002 KEG A O31 1 
HETATM 4913 O  O32 . KEG M 5 .   ? 25.807  58.764  26.818  1.00 124.70 ? 6002 KEG A O32 1 
HETATM 4914 O  O33 . KEG M 5 .   ? 21.420  63.494  25.266  1.00 124.70 ? 6002 KEG A O33 1 
HETATM 4915 O  O34 . KEG M 5 .   ? 22.439  64.460  28.613  1.00 124.70 ? 6002 KEG A O34 1 
HETATM 4916 O  O35 . KEG M 5 .   ? 23.433  57.815  25.848  1.00 124.70 ? 6002 KEG A O35 1 
HETATM 4917 O  O36 . KEG M 5 .   ? 24.531  58.287  28.900  1.00 124.70 ? 6002 KEG A O36 1 
HETATM 4918 O  O37 . KEG M 5 .   ? 19.457  61.002  26.832  1.00 124.70 ? 6002 KEG A O37 1 
HETATM 4919 O  O38 . KEG M 5 .   ? 20.082  61.659  29.302  1.00 124.70 ? 6002 KEG A O38 1 
HETATM 4920 O  O39 . KEG M 5 .   ? 25.634  60.533  25.018  1.00 124.70 ? 6002 KEG A O39 1 
HETATM 4921 O  O40 . KEG M 5 .   ? 26.502  61.052  27.525  1.00 124.70 ? 6002 KEG A O40 1 
HETATM 4922 O  O41 . KEG M 5 .   ? 23.576  64.617  26.058  1.00 124.70 ? 6002 KEG A O41 1 
HETATM 4923 O  O42 . KEG M 5 .   ? 22.088  57.335  28.038  1.00 124.70 ? 6002 KEG A O42 1 
HETATM 4924 O  O43 . KEG M 5 .   ? 24.840  62.845  24.681  1.00 124.70 ? 6002 KEG A O43 1 
HETATM 4925 O  O44 . KEG M 5 .   ? 25.684  63.507  26.920  1.00 124.70 ? 6002 KEG A O44 1 
HETATM 4926 O  O45 . KEG M 5 .   ? 20.046  58.683  27.036  1.00 124.70 ? 6002 KEG A O45 1 
HETATM 4927 O  O46 . KEG M 5 .   ? 20.891  59.012  29.380  1.00 124.70 ? 6002 KEG A O46 1 
HETATM 4928 W  W1  . KEG N 5 .   ? 42.300  73.231  42.604  0.50 124.70 ? 6003 KEG A W1  1 
HETATM 4929 W  W2  . KEG N 5 .   ? 38.761  67.115  42.626  0.50 124.70 ? 6003 KEG A W2  1 
HETATM 4930 W  W5  . KEG N 5 .   ? 43.016  70.767  40.132  1.00 124.70 ? 6003 KEG A W5  1 
HETATM 4931 W  W6  . KEG N 5 .   ? 41.246  67.708  40.143  1.00 124.70 ? 6003 KEG A W6  1 
HETATM 4932 W  W9  . KEG N 5 .   ? 39.945  72.569  40.023  1.00 124.70 ? 6003 KEG A W9  1 
HETATM 4933 W  W10 . KEG N 5 .   ? 38.154  69.472  40.035  1.00 124.70 ? 6003 KEG A W10 1 
HETATM 4934 W  W12 . KEG N 5 .   ? 37.462  71.948  42.499  1.00 124.70 ? 6003 KEG A W12 1 
HETATM 4935 P  P1  . KEG N 5 .   ? 40.531  70.173  42.615  1.00 124.70 ? 6003 KEG A P1  1 
HETATM 4936 O  O1  . KEG N 5 .   ? 43.113  74.636  42.599  1.00 124.70 ? 6003 KEG A O1  1 
HETATM 4937 O  O2  . KEG N 5 .   ? 37.948  65.709  42.631  1.00 124.70 ? 6003 KEG A O2  1 
HETATM 4938 O  O7  . KEG N 5 .   ? 44.173  71.062  38.950  1.00 124.70 ? 6003 KEG A O7  1 
HETATM 4939 O  O8  . KEG N 5 .   ? 41.564  66.552  38.967  1.00 124.70 ? 6003 KEG A O8  1 
HETATM 4940 O  O11 . KEG N 5 .   ? 39.659  73.660  38.824  1.00 124.70 ? 6003 KEG A O11 1 
HETATM 4941 O  O12 . KEG N 5 .   ? 37.061  69.171  38.841  1.00 124.70 ? 6003 KEG A O12 1 
HETATM 4942 O  O14 . KEG N 5 .   ? 36.076  72.750  42.455  1.00 124.70 ? 6003 KEG A O14 1 
HETATM 4943 O  O17 . KEG N 5 .   ? 41.164  71.266  41.733  1.00 124.70 ? 6003 KEG A O17 1 
HETATM 4944 O  O18 . KEG N 5 .   ? 39.896  69.074  41.741  1.00 124.70 ? 6003 KEG A O18 1 
HETATM 4945 O  O23 . KEG N 5 .   ? 43.297  72.213  41.383  1.00 124.70 ? 6003 KEG A O23 1 
HETATM 4946 O  O24 . KEG N 5 .   ? 40.137  66.751  41.402  1.00 124.70 ? 6003 KEG A O24 1 
HETATM 4947 O  O27 . KEG N 5 .   ? 41.039  73.589  41.246  1.00 124.70 ? 6003 KEG A O27 1 
HETATM 4948 O  O28 . KEG N 5 .   ? 37.818  68.022  41.266  1.00 124.70 ? 6003 KEG A O28 1 
HETATM 4949 O  O32 . KEG N 5 .   ? 42.194  69.199  39.505  1.00 124.70 ? 6003 KEG A O32 1 
HETATM 4950 O  O35 . KEG N 5 .   ? 41.598  71.712  39.447  1.00 124.70 ? 6003 KEG A O35 1 
HETATM 4951 O  O36 . KEG N 5 .   ? 39.718  68.463  39.459  1.00 124.70 ? 6003 KEG A O36 1 
HETATM 4952 O  O37 . KEG N 5 .   ? 38.419  72.917  43.820  1.00 124.70 ? 6003 KEG A O37 1 
HETATM 4953 O  O38 . KEG N 5 .   ? 37.103  70.642  43.829  1.00 124.70 ? 6003 KEG A O38 1 
HETATM 4954 O  O42 . KEG N 5 .   ? 38.968  71.065  39.372  1.00 124.70 ? 6003 KEG A O42 1 
HETATM 4955 O  O45 . KEG N 5 .   ? 38.494  72.894  41.191  1.00 124.70 ? 6003 KEG A O45 1 
HETATM 4956 O  O46 . KEG N 5 .   ? 37.152  70.575  41.200  1.00 124.70 ? 6003 KEG A O46 1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   VAL 2   2   ?   ?   ?   A . n 
A 1 3   GLY 3   3   ?   ?   ?   A . n 
A 1 4   ASP 4   4   ?   ?   ?   A . n 
A 1 5   ARG 5   5   ?   ?   ?   A . n 
A 1 6   CYS 6   6   ?   ?   ?   A . n 
A 1 7   GLU 7   7   ?   ?   ?   A . n 
A 1 8   ARG 8   8   ?   ?   ?   A . n 
A 1 9   ASN 9   9   ?   ?   ?   A . n 
A 1 10  GLU 10  10  ?   ?   ?   A . n 
A 1 11  PHE 11  11  ?   ?   ?   A . n 
A 1 12  GLN 12  12  ?   ?   ?   A . n 
A 1 13  CYS 13  13  ?   ?   ?   A . n 
A 1 14  GLN 14  14  ?   ?   ?   A . n 
A 1 15  ASP 15  15  ?   ?   ?   A . n 
A 1 16  GLY 16  16  ?   ?   ?   A . n 
A 1 17  LYS 17  17  ?   ?   ?   A . n 
A 1 18  CYS 18  18  ?   ?   ?   A . n 
A 1 19  ILE 19  19  ?   ?   ?   A . n 
A 1 20  SER 20  20  ?   ?   ?   A . n 
A 1 21  TYR 21  21  ?   ?   ?   A . n 
A 1 22  LYS 22  22  ?   ?   ?   A . n 
A 1 23  TRP 23  23  ?   ?   ?   A . n 
A 1 24  VAL 24  24  ?   ?   ?   A . n 
A 1 25  CYS 25  25  ?   ?   ?   A . n 
A 1 26  ASP 26  26  ?   ?   ?   A . n 
A 1 27  GLY 27  27  ?   ?   ?   A . n 
A 1 28  SER 28  28  ?   ?   ?   A . n 
A 1 29  ALA 29  29  ?   ?   ?   A . n 
A 1 30  GLU 30  30  ?   ?   ?   A . n 
A 1 31  CYS 31  31  ?   ?   ?   A . n 
A 1 32  GLN 32  32  ?   ?   ?   A . n 
A 1 33  ASP 33  33  ?   ?   ?   A . n 
A 1 34  GLY 34  34  ?   ?   ?   A . n 
A 1 35  SER 35  35  ?   ?   ?   A . n 
A 1 36  ASP 36  36  ?   ?   ?   A . n 
A 1 37  GLU 37  37  ?   ?   ?   A . n 
A 1 38  SER 38  38  ?   ?   ?   A . n 
A 1 39  GLN 39  39  ?   ?   ?   A . n 
A 1 40  GLU 40  40  ?   ?   ?   A . n 
A 1 41  THR 41  41  ?   ?   ?   A . n 
A 1 42  CYS 42  42  ?   ?   ?   A . n 
A 1 43  LEU 43  43  ?   ?   ?   A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  VAL 45  45  45  VAL VAL A . n 
A 1 46  THR 46  46  46  THR THR A . n 
A 1 47  CYS 47  47  47  CYS CYS A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  SER 49  49  49  SER SER A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  ASP 51  51  51  ASP ASP A . n 
A 1 52  PHE 52  52  52  PHE PHE A . n 
A 1 53  SER 53  53  53  SER SER A . n 
A 1 54  CYS 54  54  54  CYS CYS A . n 
A 1 55  GLY 55  55  55  GLY GLY A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  ARG 57  57  ?   ?   ?   A . n 
A 1 58  VAL 58  58  ?   ?   ?   A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ARG 60  60  60  ARG ARG A . n 
A 1 61  CYS 61  61  61  CYS CYS A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  GLN 64  64  64  GLN GLN A . n 
A 1 65  PHE 65  65  65  PHE PHE A . n 
A 1 66  TRP 66  66  66  TRP TRP A . n 
A 1 67  ARG 67  67  67  ARG ARG A . n 
A 1 68  CYS 68  68  68  CYS CYS A . n 
A 1 69  ASP 69  69  69  ASP ASP A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  GLN 71  71  71  GLN GLN A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  ASP 73  73  73  ASP ASP A . n 
A 1 74  CYS 74  74  74  CYS CYS A . n 
A 1 75  ASP 75  75  ?   ?   ?   A . n 
A 1 76  ASN 76  76  76  ASN ASN A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  ASP 79  79  79  ASP ASP A . n 
A 1 80  GLU 80  80  80  GLU GLU A . n 
A 1 81  GLN 81  81  81  GLN GLN A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  CYS 83  83  83  CYS CYS A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  PRO 85  85  85  PRO PRO A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  THR 87  87  87  THR THR A . n 
A 1 88  CYS 88  88  88  CYS CYS A . n 
A 1 89  SER 89  89  89  SER SER A . n 
A 1 90  GLN 90  90  90  GLN GLN A . n 
A 1 91  ASP 91  91  91  ASP ASP A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  PHE 93  93  93  PHE PHE A . n 
A 1 94  ARG 94  94  94  ARG ARG A . n 
A 1 95  CYS 95  95  95  CYS CYS A . n 
A 1 96  HIS 96  96  96  HIS HIS A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  LYS 99  99  ?   ?   ?   A . n 
A 1 100 CYS 100 100 ?   ?   ?   A . n 
A 1 101 ILE 101 101 ?   ?   ?   A . n 
A 1 102 SER 102 102 ?   ?   ?   A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 GLN 104 104 104 GLN GLN A . n 
A 1 105 PHE 105 105 105 PHE PHE A . n 
A 1 106 VAL 106 106 106 VAL VAL A . n 
A 1 107 CYS 107 107 107 CYS CYS A . n 
A 1 108 ASP 108 108 108 ASP ASP A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 ASP 110 110 110 ASP ASP A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 CYS 113 113 113 CYS CYS A . n 
A 1 114 LEU 114 114 114 LEU LEU A . n 
A 1 115 ASP 115 115 115 ASP ASP A . n 
A 1 116 GLY 116 116 116 GLY GLY A . n 
A 1 117 SER 117 117 117 SER SER A . n 
A 1 118 ASP 118 118 118 ASP ASP A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 SER 121 121 121 SER SER A . n 
A 1 122 CYS 122 122 122 CYS CYS A . n 
A 1 123 PRO 123 123 123 PRO PRO A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 CYS 127 127 127 CYS CYS A . n 
A 1 128 GLY 128 128 128 GLY GLY A . n 
A 1 129 PRO 129 129 129 PRO PRO A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 SER 131 131 131 SER SER A . n 
A 1 132 PHE 132 132 132 PHE PHE A . n 
A 1 133 GLN 133 133 133 GLN GLN A . n 
A 1 134 CYS 134 134 134 CYS CYS A . n 
A 1 135 ASN 135 135 135 ASN ASN A . n 
A 1 136 SER 136 136 136 SER SER A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 CYS 139 139 139 CYS CYS A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 PRO 141 141 141 PRO PRO A . n 
A 1 142 GLN 142 142 142 GLN GLN A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 TRP 144 144 144 TRP TRP A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 CYS 146 146 146 CYS CYS A . n 
A 1 147 ASP 147 147 147 ASP ASP A . n 
A 1 148 ASN 148 148 148 ASN ASN A . n 
A 1 149 ASP 149 149 149 ASP ASP A . n 
A 1 150 PRO 150 150 150 PRO PRO A . n 
A 1 151 ASP 151 151 151 ASP ASP A . n 
A 1 152 CYS 152 152 152 CYS CYS A . n 
A 1 153 GLU 153 153 153 GLU GLU A . n 
A 1 154 ASP 154 154 154 ASP ASP A . n 
A 1 155 GLY 155 155 155 GLY GLY A . n 
A 1 156 SER 156 156 156 SER SER A . n 
A 1 157 ASP 157 157 157 ASP ASP A . n 
A 1 158 GLU 158 158 158 GLU GLU A . n 
A 1 159 TRP 159 159 159 TRP TRP A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 GLN 161 161 161 GLN GLN A . n 
A 1 162 ARG 162 162 162 ARG ARG A . n 
A 1 163 CYS 163 163 163 CYS CYS A . n 
A 1 164 ARG 164 164 164 ARG ARG A . n 
A 1 165 GLY 165 165 165 GLY GLY A . n 
A 1 166 LEU 166 166 166 LEU LEU A . n 
A 1 167 TYR 167 167 167 TYR TYR A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 PHE 169 169 169 PHE PHE A . n 
A 1 170 GLN 170 170 170 GLN GLN A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 SER 173 173 173 SER SER A . n 
A 1 174 SER 174 174 174 SER SER A . n 
A 1 175 PRO 175 175 175 PRO PRO A . n 
A 1 176 CYS 176 176 176 CYS CYS A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 ALA 178 178 178 ALA ALA A . n 
A 1 179 PHE 179 179 179 PHE PHE A . n 
A 1 180 GLU 180 180 180 GLU GLU A . n 
A 1 181 PHE 181 181 181 PHE PHE A . n 
A 1 182 HIS 182 182 182 HIS HIS A . n 
A 1 183 CYS 183 183 183 CYS CYS A . n 
A 1 184 LEU 184 184 184 LEU LEU A . n 
A 1 185 SER 185 185 185 SER SER A . n 
A 1 186 GLY 186 186 186 GLY GLY A . n 
A 1 187 GLU 187 187 187 GLU GLU A . n 
A 1 188 CYS 188 188 188 CYS CYS A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 HIS 190 190 190 HIS HIS A . n 
A 1 191 SER 191 191 191 SER SER A . n 
A 1 192 SER 192 192 192 SER SER A . n 
A 1 193 TRP 193 193 193 TRP TRP A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 CYS 195 195 195 CYS CYS A . n 
A 1 196 ASP 196 196 196 ASP ASP A . n 
A 1 197 GLY 197 197 197 GLY GLY A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 PRO 199 199 199 PRO PRO A . n 
A 1 200 ASP 200 200 200 ASP ASP A . n 
A 1 201 CYS 201 201 201 CYS CYS A . n 
A 1 202 LYS 202 202 202 LYS LYS A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 ASP 206 206 206 ASP ASP A . n 
A 1 207 GLU 207 207 207 GLU GLU A . n 
A 1 208 GLU 208 208 208 GLU GLU A . n 
A 1 209 ASN 209 209 209 ASN ASN A . n 
A 1 210 CYS 210 210 210 CYS CYS A . n 
A 1 211 ALA 211 211 211 ALA ALA A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 ALA 213 213 213 ALA ALA A . n 
A 1 214 THR 214 214 214 THR THR A . n 
A 1 215 CYS 215 215 215 CYS CYS A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 PHE 220 220 220 PHE PHE A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 CYS 222 222 222 CYS CYS A . n 
A 1 223 SER 223 223 223 SER SER A . n 
A 1 224 ASP 224 224 224 ASP ASP A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 ASN 226 226 226 ASN ASN A . n 
A 1 227 CYS 227 227 227 CYS CYS A . n 
A 1 228 ILE 228 228 228 ILE ILE A . n 
A 1 229 HIS 229 229 229 HIS HIS A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 SER 231 231 231 SER SER A . n 
A 1 232 ARG 232 232 232 ARG ARG A . n 
A 1 233 GLN 233 233 233 GLN GLN A . n 
A 1 234 CYS 234 234 234 CYS CYS A . n 
A 1 235 ASP 235 235 235 ASP ASP A . n 
A 1 236 ARG 236 236 236 ARG ARG A . n 
A 1 237 GLU 237 237 237 GLU GLU A . n 
A 1 238 TYR 238 238 238 TYR TYR A . n 
A 1 239 ASP 239 239 239 ASP ASP A . n 
A 1 240 CYS 240 240 240 CYS CYS A . n 
A 1 241 LYS 241 241 241 LYS LYS A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 MET 243 243 243 MET MET A . n 
A 1 244 SER 244 244 244 SER SER A . n 
A 1 245 ASP 245 245 245 ASP ASP A . n 
A 1 246 GLU 246 246 246 GLU GLU A . n 
A 1 247 VAL 247 247 247 VAL VAL A . n 
A 1 248 GLY 248 248 248 GLY GLY A . n 
A 1 249 CYS 249 249 249 CYS CYS A . n 
A 1 250 VAL 250 250 250 VAL VAL A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 VAL 252 252 252 VAL VAL A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 CYS 255 255 255 CYS CYS A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 GLY 257 257 257 GLY GLY A . n 
A 1 258 PRO 258 258 258 PRO PRO A . n 
A 1 259 ASN 259 259 259 ASN ASN A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 PHE 261 261 261 PHE PHE A . n 
A 1 262 LYS 262 262 262 LYS LYS A . n 
A 1 263 CYS 263 263 263 CYS CYS A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 SER 265 265 265 SER SER A . n 
A 1 266 GLY 266 266 266 GLY GLY A . n 
A 1 267 GLU 267 267 267 GLU GLU A . n 
A 1 268 CYS 268 268 268 CYS CYS A . n 
A 1 269 ILE 269 269 269 ILE ILE A . n 
A 1 270 THR 270 270 270 THR THR A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 ASP 272 272 272 ASP ASP A . n 
A 1 273 LYS 273 273 273 LYS LYS A . n 
A 1 274 VAL 274 274 274 VAL VAL A . n 
A 1 275 CYS 275 275 275 CYS CYS A . n 
A 1 276 ASN 276 276 276 ASN ASN A . n 
A 1 277 MET 277 277 277 MET MET A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 ARG 279 279 279 ARG ARG A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 CYS 281 281 281 CYS CYS A . n 
A 1 282 ARG 282 282 282 ARG ARG A . n 
A 1 283 ASP 283 283 283 ASP ASP A . n 
A 1 284 TRP 284 284 284 TRP TRP A . n 
A 1 285 SER 285 285 285 SER SER A . n 
A 1 286 ASP 286 286 286 ASP ASP A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 PRO 288 288 288 PRO PRO A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 LYS 290 290 290 LYS LYS A . n 
A 1 291 GLU 291 291 291 GLU GLU A . n 
A 1 292 CYS 292 292 292 CYS CYS A . n 
A 1 293 GLY 293 293 293 GLY GLY A . n 
A 1 294 THR 294 294 294 THR THR A . n 
A 1 295 ASN 295 295 295 ASN ASN A . n 
A 1 296 GLU 296 296 296 GLU GLU A . n 
A 1 297 CYS 297 297 297 CYS CYS A . n 
A 1 298 LEU 298 298 298 LEU LEU A . n 
A 1 299 ASP 299 299 299 ASP ASP A . n 
A 1 300 ASN 300 300 300 ASN ASN A . n 
A 1 301 ASN 301 301 301 ASN ASN A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 GLY 303 303 303 GLY GLY A . n 
A 1 304 CYS 304 304 304 CYS CYS A . n 
A 1 305 SER 305 305 305 SER SER A . n 
A 1 306 HIS 306 306 306 HIS HIS A . n 
A 1 307 VAL 307 307 307 VAL VAL A . n 
A 1 308 CYS 308 308 308 CYS CYS A . n 
A 1 309 ASN 309 309 309 ASN ASN A . n 
A 1 310 ASP 310 310 310 ASP ASP A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 LYS 312 312 312 LYS LYS A . n 
A 1 313 ILE 313 313 313 ILE ILE A . n 
A 1 314 GLY 314 314 314 GLY GLY A . n 
A 1 315 TYR 315 315 315 TYR TYR A . n 
A 1 316 GLU 316 316 316 GLU GLU A . n 
A 1 317 CYS 317 317 317 CYS CYS A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 CYS 319 319 319 CYS CYS A . n 
A 1 320 PRO 320 320 320 PRO PRO A . n 
A 1 321 ASP 321 321 321 ASP ASP A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 PHE 323 323 323 PHE PHE A . n 
A 1 324 GLN 324 324 324 GLN GLN A . n 
A 1 325 LEU 325 325 325 LEU LEU A . n 
A 1 326 VAL 326 326 326 VAL VAL A . n 
A 1 327 ALA 327 327 327 ALA ALA A . n 
A 1 328 GLN 328 328 328 GLN GLN A . n 
A 1 329 ARG 329 329 329 ARG ARG A . n 
A 1 330 ARG 330 330 330 ARG ARG A . n 
A 1 331 CYS 331 331 331 CYS CYS A . n 
A 1 332 GLU 332 332 332 GLU GLU A . n 
A 1 333 ASP 333 333 333 ASP ASP A . n 
A 1 334 ILE 334 334 334 ILE ILE A . n 
A 1 335 ASP 335 335 335 ASP ASP A . n 
A 1 336 GLU 336 336 336 GLU GLU A . n 
A 1 337 CYS 337 337 337 CYS CYS A . n 
A 1 338 GLN 338 338 338 GLN GLN A . n 
A 1 339 ASP 339 339 339 ASP ASP A . n 
A 1 340 PRO 340 340 340 PRO PRO A . n 
A 1 341 ASP 341 341 341 ASP ASP A . n 
A 1 342 THR 342 342 342 THR THR A . n 
A 1 343 CYS 343 343 343 CYS CYS A . n 
A 1 344 SER 344 344 344 SER SER A . n 
A 1 345 GLN 345 345 345 GLN GLN A . n 
A 1 346 LEU 346 346 346 LEU LEU A . n 
A 1 347 CYS 347 347 347 CYS CYS A . n 
A 1 348 VAL 348 348 348 VAL VAL A . n 
A 1 349 ASN 349 349 349 ASN ASN A . n 
A 1 350 LEU 350 350 350 LEU LEU A . n 
A 1 351 GLU 351 351 351 GLU GLU A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 GLY 353 353 353 GLY GLY A . n 
A 1 354 TYR 354 354 354 TYR TYR A . n 
A 1 355 LYS 355 355 355 LYS LYS A . n 
A 1 356 CYS 356 356 356 CYS CYS A . n 
A 1 357 GLN 357 357 357 GLN GLN A . n 
A 1 358 CYS 358 358 358 CYS CYS A . n 
A 1 359 GLU 359 359 359 GLU GLU A . n 
A 1 360 GLU 360 360 360 GLU GLU A . n 
A 1 361 GLY 361 361 361 GLY GLY A . n 
A 1 362 PHE 362 362 362 PHE PHE A . n 
A 1 363 GLN 363 363 363 GLN GLN A . n 
A 1 364 LEU 364 364 364 LEU LEU A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 PRO 366 366 366 PRO PRO A . n 
A 1 367 HIS 367 367 367 HIS HIS A . n 
A 1 368 THR 368 368 368 THR THR A . n 
A 1 369 LYS 369 369 369 LYS LYS A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 CYS 371 371 371 CYS CYS A . n 
A 1 372 LYS 372 372 372 LYS LYS A . n 
A 1 373 ALA 373 373 373 ALA ALA A . n 
A 1 374 VAL 374 374 374 VAL VAL A . n 
A 1 375 GLY 375 375 375 GLY GLY A . n 
A 1 376 SER 376 376 376 SER SER A . n 
A 1 377 ILE 377 377 377 ILE ILE A . n 
A 1 378 ALA 378 378 378 ALA ALA A . n 
A 1 379 TYR 379 379 379 TYR TYR A . n 
A 1 380 LEU 380 380 380 LEU LEU A . n 
A 1 381 PHE 381 381 381 PHE PHE A . n 
A 1 382 PHE 382 382 382 PHE PHE A . n 
A 1 383 THR 383 383 383 THR THR A . n 
A 1 384 ASN 384 384 384 ASN ASN A . n 
A 1 385 ARG 385 385 385 ARG ARG A . n 
A 1 386 HIS 386 386 386 HIS HIS A . n 
A 1 387 GLU 387 387 387 GLU GLU A . n 
A 1 388 VAL 388 388 ?   ?   ?   A . n 
A 1 389 ARG 389 389 389 ARG ARG A . n 
A 1 390 LYS 390 390 390 LYS LYS A . n 
A 1 391 MET 391 391 391 MET MET A . n 
A 1 392 THR 392 392 392 THR THR A . n 
A 1 393 LEU 393 393 393 LEU LEU A . n 
A 1 394 ASP 394 394 394 ASP ASP A . n 
A 1 395 ARG 395 395 395 ARG ARG A . n 
A 1 396 SER 396 396 396 SER SER A . n 
A 1 397 GLU 397 397 397 GLU GLU A . n 
A 1 398 TYR 398 398 398 TYR TYR A . n 
A 1 399 THR 399 399 399 THR THR A . n 
A 1 400 SER 400 400 400 SER SER A . n 
A 1 401 LEU 401 401 401 LEU LEU A . n 
A 1 402 ILE 402 402 402 ILE ILE A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 ASN 404 404 404 ASN ASN A . n 
A 1 405 LEU 405 405 405 LEU LEU A . n 
A 1 406 ARG 406 406 406 ARG ARG A . n 
A 1 407 ASN 407 407 407 ASN ASN A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 VAL 409 409 409 VAL VAL A . n 
A 1 410 ALA 410 410 410 ALA ALA A . n 
A 1 411 LEU 411 411 411 LEU LEU A . n 
A 1 412 ASP 412 412 412 ASP ASP A . n 
A 1 413 THR 413 413 413 THR THR A . n 
A 1 414 GLU 414 414 414 GLU GLU A . n 
A 1 415 VAL 415 415 415 VAL VAL A . n 
A 1 416 ALA 416 416 416 ALA ALA A . n 
A 1 417 SER 417 417 417 SER SER A . n 
A 1 418 ASN 418 418 418 ASN ASN A . n 
A 1 419 ARG 419 419 419 ARG ARG A . n 
A 1 420 ILE 420 420 420 ILE ILE A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 TRP 422 422 422 TRP TRP A . n 
A 1 423 SER 423 423 423 SER SER A . n 
A 1 424 ASP 424 424 424 ASP ASP A . n 
A 1 425 LEU 425 425 425 LEU LEU A . n 
A 1 426 SER 426 426 426 SER SER A . n 
A 1 427 GLN 427 427 427 GLN GLN A . n 
A 1 428 ARG 428 428 428 ARG ARG A . n 
A 1 429 MET 429 429 429 MET MET A . n 
A 1 430 ILE 430 430 430 ILE ILE A . n 
A 1 431 CYS 431 431 431 CYS CYS A . n 
A 1 432 SER 432 432 432 SER SER A . n 
A 1 433 THR 433 433 433 THR THR A . n 
A 1 434 GLN 434 434 434 GLN GLN A . n 
A 1 435 LEU 435 435 435 LEU LEU A . n 
A 1 436 ASP 436 436 436 ASP ASP A . n 
A 1 437 ARG 437 437 437 ARG ARG A . n 
A 1 438 ALA 438 438 438 ALA ALA A . n 
A 1 439 HIS 439 439 439 HIS HIS A . n 
A 1 440 GLY 440 440 440 GLY GLY A . n 
A 1 441 VAL 441 441 ?   ?   ?   A . n 
A 1 442 SER 442 442 442 SER SER A . n 
A 1 443 SER 443 443 443 SER SER A . n 
A 1 444 TYR 444 444 444 TYR TYR A . n 
A 1 445 ASP 445 445 445 ASP ASP A . n 
A 1 446 THR 446 446 446 THR THR A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 ILE 448 448 448 ILE ILE A . n 
A 1 449 SER 449 449 449 SER SER A . n 
A 1 450 ARG 450 450 450 ARG ARG A . n 
A 1 451 ASP 451 451 451 ASP ASP A . n 
A 1 452 ILE 452 452 452 ILE ILE A . n 
A 1 453 GLN 453 453 ?   ?   ?   A . n 
A 1 454 ALA 454 454 ?   ?   ?   A . n 
A 1 455 PRO 455 455 455 PRO PRO A . n 
A 1 456 ASP 456 456 456 ASP ASP A . n 
A 1 457 GLY 457 457 457 GLY GLY A . n 
A 1 458 LEU 458 458 458 LEU LEU A . n 
A 1 459 ALA 459 459 459 ALA ALA A . n 
A 1 460 VAL 460 460 460 VAL VAL A . n 
A 1 461 ASP 461 461 461 ASP ASP A . n 
A 1 462 TRP 462 462 462 TRP TRP A . n 
A 1 463 ILE 463 463 463 ILE ILE A . n 
A 1 464 HIS 464 464 464 HIS HIS A . n 
A 1 465 SER 465 465 465 SER SER A . n 
A 1 466 ASN 466 466 466 ASN ASN A . n 
A 1 467 ILE 467 467 467 ILE ILE A . n 
A 1 468 TYR 468 468 468 TYR TYR A . n 
A 1 469 TRP 469 469 469 TRP TRP A . n 
A 1 470 THR 470 470 470 THR THR A . n 
A 1 471 ASP 471 471 471 ASP ASP A . n 
A 1 472 SER 472 472 472 SER SER A . n 
A 1 473 VAL 473 473 473 VAL VAL A . n 
A 1 474 LEU 474 474 474 LEU LEU A . n 
A 1 475 GLY 475 475 475 GLY GLY A . n 
A 1 476 THR 476 476 476 THR THR A . n 
A 1 477 VAL 477 477 477 VAL VAL A . n 
A 1 478 SER 478 478 478 SER SER A . n 
A 1 479 VAL 479 479 479 VAL VAL A . n 
A 1 480 ALA 480 480 480 ALA ALA A . n 
A 1 481 ASP 481 481 481 ASP ASP A . n 
A 1 482 THR 482 482 482 THR THR A . n 
A 1 483 LYS 483 483 483 LYS LYS A . n 
A 1 484 GLY 484 484 484 GLY GLY A . n 
A 1 485 VAL 485 485 485 VAL VAL A . n 
A 1 486 LYS 486 486 486 LYS LYS A . n 
A 1 487 ARG 487 487 487 ARG ARG A . n 
A 1 488 LYS 488 488 488 LYS LYS A . n 
A 1 489 THR 489 489 489 THR THR A . n 
A 1 490 LEU 490 490 490 LEU LEU A . n 
A 1 491 PHE 491 491 491 PHE PHE A . n 
A 1 492 ARG 492 492 492 ARG ARG A . n 
A 1 493 GLU 493 493 493 GLU GLU A . n 
A 1 494 GLN 494 494 494 GLN GLN A . n 
A 1 495 GLY 495 495 495 GLY GLY A . n 
A 1 496 SER 496 496 496 SER SER A . n 
A 1 497 LYS 497 497 497 LYS LYS A . n 
A 1 498 PRO 498 498 498 PRO PRO A . n 
A 1 499 ARG 499 499 499 ARG ARG A . n 
A 1 500 ALA 500 500 500 ALA ALA A . n 
A 1 501 ILE 501 501 501 ILE ILE A . n 
A 1 502 VAL 502 502 502 VAL VAL A . n 
A 1 503 VAL 503 503 503 VAL VAL A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 PRO 505 505 505 PRO PRO A . n 
A 1 506 VAL 506 506 506 VAL VAL A . n 
A 1 507 HIS 507 507 507 HIS HIS A . n 
A 1 508 GLY 508 508 508 GLY GLY A . n 
A 1 509 PHE 509 509 509 PHE PHE A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 TYR 511 511 511 TYR TYR A . n 
A 1 512 TRP 512 512 512 TRP TRP A . n 
A 1 513 THR 513 513 513 THR THR A . n 
A 1 514 ASP 514 514 514 ASP ASP A . n 
A 1 515 TRP 515 515 515 TRP TRP A . n 
A 1 516 GLY 516 516 516 GLY GLY A . n 
A 1 517 THR 517 517 517 THR THR A . n 
A 1 518 PRO 518 518 518 PRO PRO A . n 
A 1 519 ALA 519 519 519 ALA ALA A . n 
A 1 520 LYS 520 520 520 LYS LYS A . n 
A 1 521 ILE 521 521 521 ILE ILE A . n 
A 1 522 LYS 522 522 522 LYS LYS A . n 
A 1 523 LYS 523 523 523 LYS LYS A . n 
A 1 524 GLY 524 524 524 GLY GLY A . n 
A 1 525 GLY 525 525 525 GLY GLY A . n 
A 1 526 LEU 526 526 526 LEU LEU A . n 
A 1 527 ASN 527 527 527 ASN ASN A . n 
A 1 528 GLY 528 528 528 GLY GLY A . n 
A 1 529 VAL 529 529 529 VAL VAL A . n 
A 1 530 ASP 530 530 530 ASP ASP A . n 
A 1 531 ILE 531 531 531 ILE ILE A . n 
A 1 532 TYR 532 532 532 TYR TYR A . n 
A 1 533 SER 533 533 533 SER SER A . n 
A 1 534 LEU 534 534 534 LEU LEU A . n 
A 1 535 VAL 535 535 535 VAL VAL A . n 
A 1 536 THR 536 536 536 THR THR A . n 
A 1 537 GLU 537 537 537 GLU GLU A . n 
A 1 538 ASN 538 538 538 ASN ASN A . n 
A 1 539 ILE 539 539 539 ILE ILE A . n 
A 1 540 GLN 540 540 540 GLN GLN A . n 
A 1 541 TRP 541 541 541 TRP TRP A . n 
A 1 542 PRO 542 542 542 PRO PRO A . n 
A 1 543 ASN 543 543 543 ASN ASN A . n 
A 1 544 GLY 544 544 544 GLY GLY A . n 
A 1 545 ILE 545 545 545 ILE ILE A . n 
A 1 546 THR 546 546 546 THR THR A . n 
A 1 547 LEU 547 547 547 LEU LEU A . n 
A 1 548 ASP 548 548 548 ASP ASP A . n 
A 1 549 LEU 549 549 549 LEU LEU A . n 
A 1 550 LEU 550 550 550 LEU LEU A . n 
A 1 551 SER 551 551 551 SER SER A . n 
A 1 552 GLY 552 552 552 GLY GLY A . n 
A 1 553 ARG 553 553 553 ARG ARG A . n 
A 1 554 LEU 554 554 554 LEU LEU A . n 
A 1 555 TYR 555 555 555 TYR TYR A . n 
A 1 556 TRP 556 556 556 TRP TRP A . n 
A 1 557 VAL 557 557 557 VAL VAL A . n 
A 1 558 ASP 558 558 558 ASP ASP A . n 
A 1 559 SER 559 559 559 SER SER A . n 
A 1 560 LYS 560 560 560 LYS LYS A . n 
A 1 561 LEU 561 561 561 LEU LEU A . n 
A 1 562 HIS 562 562 562 HIS HIS A . n 
A 1 563 SER 563 563 563 SER SER A . n 
A 1 564 ILE 564 564 564 ILE ILE A . n 
A 1 565 SER 565 565 565 SER SER A . n 
A 1 566 SER 566 566 566 SER SER A . n 
A 1 567 ILE 567 567 567 ILE ILE A . n 
A 1 568 ASP 568 568 568 ASP ASP A . n 
A 1 569 VAL 569 569 569 VAL VAL A . n 
A 1 570 ASN 570 570 570 ASN ASN A . n 
A 1 571 GLY 571 571 571 GLY GLY A . n 
A 1 572 GLY 572 572 572 GLY GLY A . n 
A 1 573 ASN 573 573 573 ASN ASN A . n 
A 1 574 ARG 574 574 574 ARG ARG A . n 
A 1 575 LYS 575 575 575 LYS LYS A . n 
A 1 576 THR 576 576 576 THR THR A . n 
A 1 577 ILE 577 577 577 ILE ILE A . n 
A 1 578 LEU 578 578 578 LEU LEU A . n 
A 1 579 GLU 579 579 579 GLU GLU A . n 
A 1 580 ASP 580 580 580 ASP ASP A . n 
A 1 581 GLU 581 581 581 GLU GLU A . n 
A 1 582 LYS 582 582 582 LYS LYS A . n 
A 1 583 ARG 583 583 583 ARG ARG A . n 
A 1 584 LEU 584 584 584 LEU LEU A . n 
A 1 585 ALA 585 585 585 ALA ALA A . n 
A 1 586 HIS 586 586 586 HIS HIS A . n 
A 1 587 PRO 587 587 587 PRO PRO A . n 
A 1 588 PHE 588 588 588 PHE PHE A . n 
A 1 589 SER 589 589 589 SER SER A . n 
A 1 590 LEU 590 590 590 LEU LEU A . n 
A 1 591 ALA 591 591 591 ALA ALA A . n 
A 1 592 VAL 592 592 592 VAL VAL A . n 
A 1 593 PHE 593 593 593 PHE PHE A . n 
A 1 594 GLU 594 594 594 GLU GLU A . n 
A 1 595 ASP 595 595 595 ASP ASP A . n 
A 1 596 LYS 596 596 596 LYS LYS A . n 
A 1 597 VAL 597 597 597 VAL VAL A . n 
A 1 598 PHE 598 598 598 PHE PHE A . n 
A 1 599 TRP 599 599 599 TRP TRP A . n 
A 1 600 THR 600 600 600 THR THR A . n 
A 1 601 ASP 601 601 601 ASP ASP A . n 
A 1 602 ILE 602 602 602 ILE ILE A . n 
A 1 603 ILE 603 603 603 ILE ILE A . n 
A 1 604 ASN 604 604 604 ASN ASN A . n 
A 1 605 GLU 605 605 605 GLU GLU A . n 
A 1 606 ALA 606 606 606 ALA ALA A . n 
A 1 607 ILE 607 607 607 ILE ILE A . n 
A 1 608 PHE 608 608 608 PHE PHE A . n 
A 1 609 SER 609 609 609 SER SER A . n 
A 1 610 ALA 610 610 610 ALA ALA A . n 
A 1 611 ASN 611 611 611 ASN ASN A . n 
A 1 612 ARG 612 612 612 ARG ARG A . n 
A 1 613 LEU 613 613 613 LEU LEU A . n 
A 1 614 THR 614 614 614 THR THR A . n 
A 1 615 GLY 615 615 615 GLY GLY A . n 
A 1 616 SER 616 616 616 SER SER A . n 
A 1 617 ASP 617 617 617 ASP ASP A . n 
A 1 618 VAL 618 618 618 VAL VAL A . n 
A 1 619 ASN 619 619 619 ASN ASN A . n 
A 1 620 LEU 620 620 620 LEU LEU A . n 
A 1 621 LEU 621 621 621 LEU LEU A . n 
A 1 622 ALA 622 622 622 ALA ALA A . n 
A 1 623 GLU 623 623 623 GLU GLU A . n 
A 1 624 ASN 624 624 624 ASN ASN A . n 
A 1 625 LEU 625 625 625 LEU LEU A . n 
A 1 626 LEU 626 626 626 LEU LEU A . n 
A 1 627 SER 627 627 627 SER SER A . n 
A 1 628 PRO 628 628 628 PRO PRO A . n 
A 1 629 GLU 629 629 629 GLU GLU A . n 
A 1 630 ASP 630 630 630 ASP ASP A . n 
A 1 631 MET 631 631 631 MET MET A . n 
A 1 632 VAL 632 632 632 VAL VAL A . n 
A 1 633 LEU 633 633 633 LEU LEU A . n 
A 1 634 PHE 634 634 634 PHE PHE A . n 
A 1 635 HIS 635 635 635 HIS HIS A . n 
A 1 636 GLN 636 636 636 GLN GLN A . n 
A 1 637 LEU 637 637 637 LEU LEU A . n 
A 1 638 THR 638 638 638 THR THR A . n 
A 1 639 GLN 639 639 639 GLN GLN A . n 
A 1 640 PRO 640 640 640 PRO PRO A . n 
A 1 641 ARG 641 641 641 ARG ARG A . n 
A 1 642 GLY 642 642 642 GLY GLY A . n 
A 1 643 VAL 643 643 643 VAL VAL A . n 
A 1 644 ASN 644 644 644 ASN ASN A . n 
A 1 645 TRP 645 645 645 TRP TRP A . n 
A 1 646 CYS 646 646 646 CYS CYS A . n 
A 1 647 GLU 647 647 647 GLU GLU A . n 
A 1 648 ARG 648 648 648 ARG ARG A . n 
A 1 649 THR 649 649 649 THR THR A . n 
A 1 650 THR 650 650 650 THR THR A . n 
A 1 651 LEU 651 651 651 LEU LEU A . n 
A 1 652 SER 652 652 652 SER SER A . n 
A 1 653 ASN 653 653 653 ASN ASN A . n 
A 1 654 GLY 654 654 654 GLY GLY A . n 
A 1 655 GLY 655 655 655 GLY GLY A . n 
A 1 656 CYS 656 656 656 CYS CYS A . n 
A 1 657 GLN 657 657 657 GLN GLN A . n 
A 1 658 TYR 658 658 658 TYR TYR A . n 
A 1 659 LEU 659 659 659 LEU LEU A . n 
A 1 660 CYS 660 660 660 CYS CYS A . n 
A 1 661 LEU 661 661 661 LEU LEU A . n 
A 1 662 PRO 662 662 662 PRO PRO A . n 
A 1 663 ALA 663 663 663 ALA ALA A . n 
A 1 664 PRO 664 664 664 PRO PRO A . n 
A 1 665 GLN 665 665 665 GLN GLN A . n 
A 1 666 ILE 666 666 666 ILE ILE A . n 
A 1 667 ASN 667 667 667 ASN ASN A . n 
A 1 668 PRO 668 668 668 PRO PRO A . n 
A 1 669 HIS 669 669 669 HIS HIS A . n 
A 1 670 SER 670 670 670 SER SER A . n 
A 1 671 PRO 671 671 671 PRO PRO A . n 
A 1 672 LYS 672 672 672 LYS LYS A . n 
A 1 673 PHE 673 673 673 PHE PHE A . n 
A 1 674 THR 674 674 674 THR THR A . n 
A 1 675 CYS 675 675 675 CYS CYS A . n 
A 1 676 ALA 676 676 676 ALA ALA A . n 
A 1 677 CYS 677 677 677 CYS CYS A . n 
A 1 678 PRO 678 678 678 PRO PRO A . n 
A 1 679 ASP 679 679 679 ASP ASP A . n 
A 1 680 GLY 680 680 680 GLY GLY A . n 
A 1 681 MET 681 681 681 MET MET A . n 
A 1 682 LEU 682 682 682 LEU LEU A . n 
A 1 683 LEU 683 683 683 LEU LEU A . n 
A 1 684 ALA 684 684 684 ALA ALA A . n 
A 1 685 ARG 685 685 685 ARG ARG A . n 
A 1 686 ASP 686 686 686 ASP ASP A . n 
A 1 687 MET 687 687 687 MET MET A . n 
A 1 688 ARG 688 688 688 ARG ARG A . n 
A 1 689 SER 689 689 689 SER SER A . n 
A 1 690 CYS 690 690 690 CYS CYS A . n 
A 1 691 LEU 691 691 691 LEU LEU A . n 
A 1 692 THR 692 692 692 THR THR A . n 
A 1 693 GLU 693 693 693 GLU GLU A . n 
A 1 694 ALA 694 694 ?   ?   ?   A . n 
A 1 695 GLU 695 695 ?   ?   ?   A . n 
A 1 696 ALA 696 696 ?   ?   ?   A . n 
A 1 697 ALA 697 697 ?   ?   ?   A . n 
A 1 698 VAL 698 698 ?   ?   ?   A . n 
A 1 699 ALA 699 699 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 CA  1 1001 1001 CA  CA  A . 
E 4 CA  1 1002 1002 CA  CA  A . 
F 4 CA  1 1003 1003 CA  CA  A . 
G 4 CA  1 1004 1004 CA  CA  A . 
H 4 CA  1 1005 1005 CA  CA  A . 
I 4 CA  1 1006 1006 CA  CA  A . 
J 4 CA  1 1007 1007 CA  CA  A . 
K 4 CA  1 1008 1008 CA  CA  A . 
L 5 KEG 1 6001 6001 KEG KEG A . 
M 5 KEG 1 6002 6002 KEG KEG A . 
N 5 KEG 1 6003 6003 KEG KEG A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A ASN 251 A ASN 251 ? ASN 'GLYCOSYLATION SITE' 
2 A ASN 135 A ASN 135 ? ASN 'GLYCOSYLATION SITE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A KEG 6003 ? N KEG . 
2 1 A KEG 6003 ? N KEG . 
3 1 A KEG 6003 ? N KEG . 
4 1 A KEG 6003 ? N KEG . 
5 1 A KEG 6003 ? N KEG . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A TRP 66  ? A TRP 66  ? 1_555 CA ? K CA . ? A CA 1008 ? 1_555 O   ? A GLN 71  ? A GLN 71  ? 1_555 140.3 ? 
2  O   ? A TRP 66  ? A TRP 66  ? 1_555 CA ? K CA . ? A CA 1008 ? 1_555 O   ? A ASP 79  ? A ASP 79  ? 1_555 49.0  ? 
3  O   ? A GLN 71  ? A GLN 71  ? 1_555 CA ? K CA . ? A CA 1008 ? 1_555 O   ? A ASP 79  ? A ASP 79  ? 1_555 98.3  ? 
4  O   ? A TRP 66  ? A TRP 66  ? 1_555 CA ? K CA . ? A CA 1008 ? 1_555 OD2 ? A ASP 79  ? A ASP 79  ? 1_555 66.3  ? 
5  O   ? A GLN 71  ? A GLN 71  ? 1_555 CA ? K CA . ? A CA 1008 ? 1_555 OD2 ? A ASP 79  ? A ASP 79  ? 1_555 86.4  ? 
6  O   ? A ASP 79  ? A ASP 79  ? 1_555 CA ? K CA . ? A CA 1008 ? 1_555 OD2 ? A ASP 79  ? A ASP 79  ? 1_555 76.2  ? 
7  O   ? A TRP 66  ? A TRP 66  ? 1_555 CA ? K CA . ? A CA 1008 ? 1_555 OE1 ? A GLU 80  ? A GLU 80  ? 1_555 96.4  ? 
8  O   ? A GLN 71  ? A GLN 71  ? 1_555 CA ? K CA . ? A CA 1008 ? 1_555 OE1 ? A GLU 80  ? A GLU 80  ? 1_555 45.4  ? 
9  O   ? A ASP 79  ? A ASP 79  ? 1_555 CA ? K CA . ? A CA 1008 ? 1_555 OE1 ? A GLU 80  ? A GLU 80  ? 1_555 53.9  ? 
10 OD2 ? A ASP 79  ? A ASP 79  ? 1_555 CA ? K CA . ? A CA 1008 ? 1_555 OE1 ? A GLU 80  ? A GLU 80  ? 1_555 69.2  ? 
11 OD1 ? A ASP 108 ? A ASP 108 ? 1_555 CA ? J CA . ? A CA 1007 ? 1_555 OD2 ? A ASP 112 ? A ASP 112 ? 1_555 110.2 ? 
12 OD1 ? A ASP 108 ? A ASP 108 ? 1_555 CA ? J CA . ? A CA 1007 ? 1_555 OD1 ? A ASP 118 ? A ASP 118 ? 1_555 97.7  ? 
13 OD2 ? A ASP 112 ? A ASP 112 ? 1_555 CA ? J CA . ? A CA 1007 ? 1_555 OD1 ? A ASP 118 ? A ASP 118 ? 1_555 131.7 ? 
14 OD1 ? A ASP 147 ? A ASP 147 ? 1_555 CA ? I CA . ? A CA 1006 ? 1_555 OD2 ? A ASP 147 ? A ASP 147 ? 1_555 53.0  ? 
15 OD1 ? A ASP 147 ? A ASP 147 ? 1_555 CA ? I CA . ? A CA 1006 ? 1_555 O   ? A ASP 149 ? A ASP 149 ? 1_555 98.4  ? 
16 OD2 ? A ASP 147 ? A ASP 147 ? 1_555 CA ? I CA . ? A CA 1006 ? 1_555 O   ? A ASP 149 ? A ASP 149 ? 1_555 113.1 ? 
17 OD1 ? A ASP 147 ? A ASP 147 ? 1_555 CA ? I CA . ? A CA 1006 ? 1_555 OD2 ? A ASP 157 ? A ASP 157 ? 1_555 47.9  ? 
18 OD2 ? A ASP 147 ? A ASP 147 ? 1_555 CA ? I CA . ? A CA 1006 ? 1_555 OD2 ? A ASP 157 ? A ASP 157 ? 1_555 100.0 ? 
19 O   ? A ASP 149 ? A ASP 149 ? 1_555 CA ? I CA . ? A CA 1006 ? 1_555 OD2 ? A ASP 157 ? A ASP 157 ? 1_555 88.8  ? 
20 OD1 ? A ASP 196 ? A ASP 196 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 O   ? A GLY 198 ? A GLY 198 ? 1_555 83.9  ? 
21 OD1 ? A ASP 196 ? A ASP 196 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 155.9 ? 
22 O   ? A GLY 198 ? A GLY 198 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 119.7 ? 
23 OD1 ? A ASP 196 ? A ASP 196 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 206 ? A ASP 206 ? 1_555 122.4 ? 
24 O   ? A GLY 198 ? A GLY 198 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 206 ? A ASP 206 ? 1_555 72.7  ? 
25 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 OD2 ? A ASP 206 ? A ASP 206 ? 1_555 66.0  ? 
26 OD1 ? A ASP 196 ? A ASP 196 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 OE1 ? A GLU 207 ? A GLU 207 ? 1_555 61.5  ? 
27 O   ? A GLY 198 ? A GLY 198 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 OE1 ? A GLU 207 ? A GLU 207 ? 1_555 68.2  ? 
28 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 OE1 ? A GLU 207 ? A GLU 207 ? 1_555 120.1 ? 
29 OD2 ? A ASP 206 ? A ASP 206 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 OE1 ? A GLU 207 ? A GLU 207 ? 1_555 61.0  ? 
30 OD1 ? A ASP 196 ? A ASP 196 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 NZ  ? A LYS 582 ? A LYS 582 ? 1_555 74.6  ? 
31 O   ? A GLY 198 ? A GLY 198 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 NZ  ? A LYS 582 ? A LYS 582 ? 1_555 108.7 ? 
32 OD1 ? A ASP 200 ? A ASP 200 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 NZ  ? A LYS 582 ? A LYS 582 ? 1_555 99.9  ? 
33 OD2 ? A ASP 206 ? A ASP 206 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 NZ  ? A LYS 582 ? A LYS 582 ? 1_555 162.7 ? 
34 OE1 ? A GLU 207 ? A GLU 207 ? 1_555 CA ? F CA . ? A CA 1003 ? 1_555 NZ  ? A LYS 582 ? A LYS 582 ? 1_555 136.0 ? 
35 O   ? A ARG 232 ? A ARG 232 ? 1_555 CA ? G CA . ? A CA 1004 ? 1_555 O   ? A GLN 233 ? A GLN 233 ? 1_555 88.1  ? 
36 O   ? A ARG 232 ? A ARG 232 ? 1_555 CA ? G CA . ? A CA 1004 ? 1_555 O   ? A GLU 237 ? A GLU 237 ? 1_555 104.8 ? 
37 O   ? A GLN 233 ? A GLN 233 ? 1_555 CA ? G CA . ? A CA 1004 ? 1_555 O   ? A GLU 237 ? A GLU 237 ? 1_555 121.1 ? 
38 O   ? A ARG 232 ? A ARG 232 ? 1_555 CA ? G CA . ? A CA 1004 ? 1_555 OE1 ? A GLU 246 ? A GLU 246 ? 1_555 164.1 ? 
39 O   ? A GLN 233 ? A GLN 233 ? 1_555 CA ? G CA . ? A CA 1004 ? 1_555 OE1 ? A GLU 246 ? A GLU 246 ? 1_555 104.2 ? 
40 O   ? A GLU 237 ? A GLU 237 ? 1_555 CA ? G CA . ? A CA 1004 ? 1_555 OE1 ? A GLU 246 ? A GLU 246 ? 1_555 60.4  ? 
41 O   ? A LYS 273 ? A LYS 273 ? 1_555 CA ? H CA . ? A CA 1005 ? 1_555 OD1 ? A ASN 276 ? A ASN 276 ? 1_555 81.9  ? 
42 O   ? A LYS 273 ? A LYS 273 ? 1_555 CA ? H CA . ? A CA 1005 ? 1_555 OD2 ? A ASP 280 ? A ASP 280 ? 1_555 129.5 ? 
43 OD1 ? A ASN 276 ? A ASN 276 ? 1_555 CA ? H CA . ? A CA 1005 ? 1_555 OD2 ? A ASP 280 ? A ASP 280 ? 1_555 89.7  ? 
44 O   ? A LYS 273 ? A LYS 273 ? 1_555 CA ? H CA . ? A CA 1005 ? 1_555 OD1 ? A ASP 286 ? A ASP 286 ? 1_555 108.2 ? 
45 OD1 ? A ASN 276 ? A ASN 276 ? 1_555 CA ? H CA . ? A CA 1005 ? 1_555 OD1 ? A ASP 286 ? A ASP 286 ? 1_555 117.0 ? 
46 OD2 ? A ASP 280 ? A ASP 280 ? 1_555 CA ? H CA . ? A CA 1005 ? 1_555 OD1 ? A ASP 286 ? A ASP 286 ? 1_555 119.7 ? 
47 O   ? A LYS 273 ? A LYS 273 ? 1_555 CA ? H CA . ? A CA 1005 ? 1_555 OE2 ? A GLU 287 ? A GLU 287 ? 1_555 99.8  ? 
48 OD1 ? A ASN 276 ? A ASN 276 ? 1_555 CA ? H CA . ? A CA 1005 ? 1_555 OE2 ? A GLU 287 ? A GLU 287 ? 1_555 54.3  ? 
49 OD2 ? A ASP 280 ? A ASP 280 ? 1_555 CA ? H CA . ? A CA 1005 ? 1_555 OE2 ? A GLU 287 ? A GLU 287 ? 1_555 115.1 ? 
50 OD1 ? A ASP 286 ? A ASP 286 ? 1_555 CA ? H CA . ? A CA 1005 ? 1_555 OE2 ? A GLU 287 ? A GLU 287 ? 1_555 62.7  ? 
51 OG1 ? A THR 294 ? A THR 294 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 N   ? A ASN 295 ? A ASN 295 ? 1_555 71.5  ? 
52 OG1 ? A THR 294 ? A THR 294 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 OE2 ? A GLU 296 ? A GLU 296 ? 1_555 102.9 ? 
53 N   ? A ASN 295 ? A ASN 295 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 OE2 ? A GLU 296 ? A GLU 296 ? 1_555 62.9  ? 
54 OG1 ? A THR 294 ? A THR 294 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 OD1 ? A ASP 310 ? A ASP 310 ? 1_555 137.4 ? 
55 N   ? A ASN 295 ? A ASN 295 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 OD1 ? A ASP 310 ? A ASP 310 ? 1_555 100.1 ? 
56 OE2 ? A GLU 296 ? A GLU 296 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 OD1 ? A ASP 310 ? A ASP 310 ? 1_555 109.9 ? 
57 OG1 ? A THR 294 ? A THR 294 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 O   ? A LEU 311 ? A LEU 311 ? 1_555 92.6  ? 
58 N   ? A ASN 295 ? A ASN 295 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 O   ? A LEU 311 ? A LEU 311 ? 1_555 128.3 ? 
59 OE2 ? A GLU 296 ? A GLU 296 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 O   ? A LEU 311 ? A LEU 311 ? 1_555 163.7 ? 
60 OD1 ? A ASP 310 ? A ASP 310 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 O   ? A LEU 311 ? A LEU 311 ? 1_555 59.2  ? 
61 OG1 ? A THR 294 ? A THR 294 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 N   ? A ILE 313 ? A ILE 313 ? 1_555 74.6  ? 
62 N   ? A ASN 295 ? A ASN 295 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 N   ? A ILE 313 ? A ILE 313 ? 1_555 146.1 ? 
63 OE2 ? A GLU 296 ? A GLU 296 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 N   ? A ILE 313 ? A ILE 313 ? 1_555 128.0 ? 
64 OD1 ? A ASP 310 ? A ASP 310 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 N   ? A ILE 313 ? A ILE 313 ? 1_555 103.7 ? 
65 O   ? A LEU 311 ? A LEU 311 ? 1_555 CA ? D CA . ? A CA 1001 ? 1_555 N   ? A ILE 313 ? A ILE 313 ? 1_555 51.4  ? 
66 OD1 ? A ASP 333 ? A ASP 333 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 OD2 ? A ASP 333 ? A ASP 333 ? 1_555 44.0  ? 
67 OD1 ? A ASP 333 ? A ASP 333 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 O   ? A ILE 334 ? A ILE 334 ? 1_555 65.3  ? 
68 OD2 ? A ASP 333 ? A ASP 333 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 O   ? A ILE 334 ? A ILE 334 ? 1_555 77.2  ? 
69 OD1 ? A ASP 333 ? A ASP 333 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 OE1 ? A GLU 336 ? A GLU 336 ? 1_555 134.0 ? 
70 OD2 ? A ASP 333 ? A ASP 333 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 OE1 ? A GLU 336 ? A GLU 336 ? 1_555 96.2  ? 
71 O   ? A ILE 334 ? A ILE 334 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 OE1 ? A GLU 336 ? A GLU 336 ? 1_555 87.1  ? 
72 OD1 ? A ASP 333 ? A ASP 333 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 OE2 ? A GLU 336 ? A GLU 336 ? 1_555 88.1  ? 
73 OD2 ? A ASP 333 ? A ASP 333 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 OE2 ? A GLU 336 ? A GLU 336 ? 1_555 58.0  ? 
74 O   ? A ILE 334 ? A ILE 334 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 OE2 ? A GLU 336 ? A GLU 336 ? 1_555 56.8  ? 
75 OE1 ? A GLU 336 ? A GLU 336 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 OE2 ? A GLU 336 ? A GLU 336 ? 1_555 46.1  ? 
76 OD1 ? A ASP 333 ? A ASP 333 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 OD1 ? A ASN 349 ? A ASN 349 ? 1_555 131.9 ? 
77 OD2 ? A ASP 333 ? A ASP 333 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 OD1 ? A ASN 349 ? A ASN 349 ? 1_555 173.9 ? 
78 O   ? A ILE 334 ? A ILE 334 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 OD1 ? A ASN 349 ? A ASN 349 ? 1_555 97.0  ? 
79 OE1 ? A GLU 336 ? A GLU 336 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 OD1 ? A ASN 349 ? A ASN 349 ? 1_555 85.1  ? 
80 OE2 ? A GLU 336 ? A GLU 336 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 OD1 ? A ASN 349 ? A ASN 349 ? 1_555 120.3 ? 
81 OD1 ? A ASP 333 ? A ASP 333 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 O   ? A LEU 350 ? A LEU 350 ? 1_555 68.2  ? 
82 OD2 ? A ASP 333 ? A ASP 333 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 O   ? A LEU 350 ? A LEU 350 ? 1_555 94.2  ? 
83 O   ? A ILE 334 ? A ILE 334 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 O   ? A LEU 350 ? A LEU 350 ? 1_555 120.1 ? 
84 OE1 ? A GLU 336 ? A GLU 336 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 O   ? A LEU 350 ? A LEU 350 ? 1_555 152.4 ? 
85 OE2 ? A GLU 336 ? A GLU 336 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 O   ? A LEU 350 ? A LEU 350 ? 1_555 152.1 ? 
86 OD1 ? A ASN 349 ? A ASN 349 ? 1_555 CA ? E CA . ? A CA 1002 ? 1_555 O   ? A LEU 350 ? A LEU 350 ? 1_555 87.2  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-01-21 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' Advisory                    
5 4 'Structure model' 'Atomic model'              
6 4 'Structure model' 'Data collection'           
7 4 'Structure model' 'Derived calculations'      
8 4 'Structure model' 'Structure summary'         
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' atom_site                     
2  4 'Structure model' chem_comp                     
3  4 'Structure model' entity                        
4  4 'Structure model' pdbx_branch_scheme            
5  4 'Structure model' pdbx_chem_comp_identifier     
6  4 'Structure model' pdbx_entity_branch            
7  4 'Structure model' pdbx_entity_branch_descriptor 
8  4 'Structure model' pdbx_entity_branch_link       
9  4 'Structure model' pdbx_entity_branch_list       
10 4 'Structure model' pdbx_entity_nonpoly           
11 4 'Structure model' pdbx_nonpoly_scheme           
12 4 'Structure model' pdbx_struct_assembly_gen      
13 4 'Structure model' pdbx_struct_conn_angle        
14 4 'Structure model' pdbx_struct_special_symmetry  
15 4 'Structure model' pdbx_unobs_or_zero_occ_atoms  
16 4 'Structure model' pdbx_validate_close_contact   
17 4 'Structure model' struct_asym                   
18 4 'Structure model' struct_conn                   
19 4 'Structure model' struct_site                   
20 4 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.Cartn_x'                          
2  4 'Structure model' '_atom_site.Cartn_y'                          
3  4 'Structure model' '_atom_site.Cartn_z'                          
4  4 'Structure model' '_atom_site.auth_asym_id'                     
5  4 'Structure model' '_atom_site.auth_seq_id'                      
6  4 'Structure model' '_atom_site.label_asym_id'                    
7  4 'Structure model' '_atom_site.label_entity_id'                  
8  4 'Structure model' '_chem_comp.name'                             
9  4 'Structure model' '_chem_comp.type'                             
10 4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 
12 4 'Structure model' '_pdbx_struct_special_symmetry.label_asym_id' 
13 4 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.label_asym_id' 
14 4 'Structure model' '_pdbx_validate_close_contact.auth_asym_id_2' 
15 4 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2'  
16 4 'Structure model' '_struct_conn.pdbx_dist_value'                
17 4 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
18 4 'Structure model' '_struct_conn.pdbx_role'                      
19 4 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
20 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
21 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
22 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
23 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
24 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
25 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
26 4 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
27 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
28 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
29 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
30 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
31 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MOSFLM 'data reduction' .         ? 1 
SCALA  'data scaling'   .         ? 2 
SHARP  phasing          .         ? 3 
CNS    refinement       1.1       ? 4 
CCP4   'data scaling'   '(SCALA)' ? 5 
# 
loop_
_pdbx_database_remark.id 
_pdbx_database_remark.text 
300 
;BIOMOLECULE: 1
THIS ENTRY CONTAINS THE CRYSTALLOGRAPHIC ASYMMETRIC UNIT
WHICH CONSISTS OF 1 CHAIN(S). SEE REMARK 350 FOR
INFORMATION ON GENERATING THE BIOLOGICAL MOLECULE(S). 
THE AUTHORS BELIEVE THE BIOLOGICAL UNIT IS A MONOMER.
;
600 
;HETEROGEN 
THE ATOMS W1 AND W2 OF THE LIGAND 
KEG 6003 ARE ON A TWO-FOLD
AXIS.  COORDINATES FOR THE HALF OF 
THE CLUSTER KEG 6003 IN THE ASYMMETRIC 
UNIT ARE INCLUDED IN THIS ENTRY. THE
SECOND HALF OF THE CLUSTER CAN BE 
GENERATED USING SYMMETRY OPERATION
Y,X,1-Z.
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 CG  A ASN 251 ? ? N2  C NAG 1   ? ? 1.75 
2  1 CB  A ASN 251 ? ? N2  C NAG 1   ? ? 1.78 
3  1 O   A CYS 152 ? ? N   A ASP 154 ? ? 1.88 
4  1 O   A CYS 134 ? ? N   A SER 136 ? ? 1.90 
5  1 O   A ASP 73  ? ? OD1 A ASP 79  ? ? 1.93 
6  1 OD1 A ASN 527 ? ? OG1 A THR 674 ? ? 1.95 
7  1 N   A LEU 554 ? ? O   A ILE 567 ? ? 1.95 
8  1 O   A PRO 141 ? ? N   A LEU 143 ? ? 1.96 
9  1 ND2 A ASN 543 ? ? OG  A SER 559 ? ? 1.96 
10 1 O   A GLN 133 ? ? C8  B NAG 1   ? ? 1.96 
11 1 ND2 A ASN 135 ? ? O5  B NAG 1   ? ? 1.98 
12 1 CB  A ASN 251 ? ? C8  C NAG 1   ? ? 2.00 
13 1 OH  A TYR 468 ? ? CD2 A LEU 526 ? ? 2.01 
14 1 O   A SER 192 ? ? N   A ARG 194 ? ? 2.02 
15 1 OH  A TYR 468 ? ? CD1 A LEU 526 ? ? 2.02 
16 1 NH2 A ARG 499 ? ? O   A GLU 629 ? ? 2.04 
17 1 OD2 A ASP 451 ? ? NH1 A ARG 487 ? ? 2.04 
18 1 O   A LEU 613 ? ? N   A GLY 615 ? ? 2.04 
19 1 CG  A ASN 135 ? ? C1  B NAG 1   ? ? 2.04 
20 1 O   A LYS 48  ? ? N   A GLY 50  ? ? 2.05 
21 1 O   A PHE 105 ? ? N   A CYS 107 ? ? 2.06 
22 1 O   A CYS 176 ? ? N   A ALA 178 ? ? 2.07 
23 1 CA  A ASN 251 ? ? C8  C NAG 1   ? ? 2.07 
24 1 O   A GLN 427 ? ? N   A MET 429 ? ? 2.09 
25 1 N   A LYS 390 ? ? O   A THR 399 ? ? 2.09 
26 1 O   A LEU 325 ? ? CB  A CYS 331 ? ? 2.10 
27 1 CB  A ASN 611 ? ? O   A GLY 615 ? ? 2.10 
28 1 CB  A ASN 251 ? ? C7  C NAG 1   ? ? 2.11 
29 1 O   A GLN 71  ? ? OE1 A GLU 80  ? ? 2.12 
30 1 O   A HIS 464 ? ? N   A ASN 466 ? ? 2.12 
31 1 OD1 A ASP 147 ? ? OD2 A ASP 157 ? ? 2.13 
32 1 O   A ASN 604 ? ? N   A ALA 606 ? ? 2.13 
33 1 N   A ASP 280 ? ? OD2 A ASP 286 ? ? 2.13 
34 1 O   A SER 566 ? ? N   A LYS 575 ? ? 2.13 
35 1 O   A ASP 147 ? ? OE2 A GLU 158 ? ? 2.14 
36 1 OD1 A ASP 149 ? ? NE2 A HIS 586 ? ? 2.15 
37 1 O   A ASP 206 ? ? N   A GLU 208 ? ? 2.16 
38 1 O   A TRP 66  ? ? O   A ASP 79  ? ? 2.16 
39 1 O   A PHE 261 ? ? O   A GLU 267 ? ? 2.16 
40 1 O   A HIS 507 ? ? N   A PHE 509 ? ? 2.17 
41 1 O   A ASN 300 ? ? N   A GLY 303 ? ? 2.17 
42 1 O   A ILE 467 ? ? CA  A VAL 479 ? ? 2.17 
43 1 O   A GLY 293 ? ? OE2 A GLU 296 ? ? 2.18 
44 1 SG  A CYS 152 ? ? N   A GLY 155 ? ? 2.18 
45 1 C   A CYS 337 ? ? OG1 A THR 342 ? ? 2.19 
46 1 O   A LEU 554 ? ? CA  A SER 566 ? ? 2.19 
47 1 O   A ASP 115 ? ? N   A SER 117 ? ? 2.19 
48 1 O   A LYS 262 ? ? N   A HIS 264 ? ? 2.19 
49 1 CD  A GLU 180 ? ? O   A ILE 189 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1  1 P1  A KEG 6003 ? ? 1_555 O17 A KEG 6003 ? ? 4_556 1.52 
2  1 P1  A KEG 6003 ? ? 1_555 O18 A KEG 6003 ? ? 4_556 1.52 
3  1 W1  A KEG 6003 ? ? 1_555 O1  A KEG 6003 ? ? 4_556 1.62 
4  1 W2  A KEG 6003 ? ? 1_555 O2  A KEG 6003 ? ? 4_556 1.63 
5  1 O18 A KEG 6003 ? ? 1_555 O18 A KEG 6003 ? ? 4_556 1.70 
6  1 O17 A KEG 6003 ? ? 1_555 O17 A KEG 6003 ? ? 4_556 1.72 
7  1 W2  A KEG 6003 ? ? 1_555 O28 A KEG 6003 ? ? 4_556 1.83 
8  1 W1  A KEG 6003 ? ? 1_555 O27 A KEG 6003 ? ? 4_556 1.85 
9  1 W2  A KEG 6003 ? ? 1_555 O24 A KEG 6003 ? ? 4_556 1.85 
10 1 W6  A KEG 6003 ? ? 1_555 O38 A KEG 6003 ? ? 4_556 1.86 
11 1 W5  A KEG 6003 ? ? 1_555 O37 A KEG 6003 ? ? 4_556 1.86 
12 1 W1  A KEG 6003 ? ? 1_555 O23 A KEG 6003 ? ? 4_556 1.89 
13 1 OD1 A ASP 218  ? ? 1_555 O   A PHE 673  ? ? 2_665 1.95 
14 1 O   A ASN 251  ? ? 1_555 ND2 A ASN 570  ? ? 2_665 1.97 
15 1 ND2 A ASN 404  ? ? 1_555 OE1 A GLN 427  ? ? 4_556 2.14 
16 1 CD  A GLU 267  ? ? 1_555 O   A ARG 574  ? ? 2_665 2.17 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A CYS 139 ? ? SG A CYS 139 ? ? 1.925 1.818 0.107  0.017 N 
2 1 CB A CYS 343 ? ? SG A CYS 343 ? ? 1.670 1.812 -0.142 0.016 N 
3 1 CB A CYS 356 ? ? SG A CYS 356 ? ? 1.711 1.812 -0.101 0.016 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1   1 N  A THR 46  ? ? CA A THR 46  ? ? C  A THR 46  ? ? 87.10  111.00 -23.90 2.70 N 
2   1 N  A LYS 48  ? ? CA A LYS 48  ? ? C  A LYS 48  ? ? 93.34  111.00 -17.66 2.70 N 
3   1 N  A PHE 52  ? ? CA A PHE 52  ? ? C  A PHE 52  ? ? 131.89 111.00 20.89  2.70 N 
4   1 C  A ILE 62  ? ? N  A PRO 63  ? ? CA A PRO 63  ? ? 133.44 119.30 14.14  1.50 Y 
5   1 N  A TRP 66  ? ? CA A TRP 66  ? ? C  A TRP 66  ? ? 94.08  111.00 -16.92 2.70 N 
6   1 CA A CYS 68  ? ? CB A CYS 68  ? ? SG A CYS 68  ? ? 92.23  114.00 -21.77 1.80 N 
7   1 N  A GLY 77  ? ? CA A GLY 77  ? ? C  A GLY 77  ? ? 95.60  113.10 -17.50 2.50 N 
8   1 N  A SER 78  ? ? CA A SER 78  ? ? C  A SER 78  ? ? 129.40 111.00 18.40  2.70 N 
9   1 N  A GLU 80  ? ? CA A GLU 80  ? ? C  A GLU 80  ? ? 93.94  111.00 -17.06 2.70 N 
10  1 N  A GLY 82  ? ? CA A GLY 82  ? ? C  A GLY 82  ? ? 91.99  113.10 -21.11 2.50 N 
11  1 N  A CYS 83  ? ? CA A CYS 83  ? ? C  A CYS 83  ? ? 127.95 111.00 16.95  2.70 N 
12  1 C  A CYS 83  ? ? N  A PRO 84  ? ? CA A PRO 84  ? ? 136.40 119.30 17.10  1.50 Y 
13  1 C  A CYS 83  ? ? N  A PRO 84  ? ? CD A PRO 84  ? ? 112.22 128.40 -16.18 2.10 Y 
14  1 N  A ARG 94  ? ? CA A ARG 94  ? ? C  A ARG 94  ? ? 90.47  111.00 -20.53 2.70 N 
15  1 CA A CYS 95  ? ? CB A CYS 95  ? ? SG A CYS 95  ? ? 130.76 114.20 16.56  1.10 N 
16  1 N  A CYS 95  ? ? CA A CYS 95  ? ? C  A CYS 95  ? ? 94.26  111.00 -16.74 2.70 N 
17  1 CA A CYS 113 ? ? CB A CYS 113 ? ? SG A CYS 113 ? ? 121.61 114.20 7.41   1.10 N 
18  1 N  A ASP 118 ? ? CA A ASP 118 ? ? C  A ASP 118 ? ? 88.67  111.00 -22.33 2.70 N 
19  1 N  A SER 121 ? ? CA A SER 121 ? ? C  A SER 121 ? ? 92.81  111.00 -18.19 2.70 N 
20  1 C  A CYS 122 ? ? N  A PRO 123 ? ? CA A PRO 123 ? ? 129.81 119.30 10.51  1.50 Y 
21  1 C  A ALA 130 ? ? N  A SER 131 ? ? CA A SER 131 ? ? 105.85 121.70 -15.85 2.50 Y 
22  1 N  A SER 131 ? ? CA A SER 131 ? ? C  A SER 131 ? ? 130.82 111.00 19.82  2.70 N 
23  1 CA A CYS 134 ? ? CB A CYS 134 ? ? SG A CYS 134 ? ? 127.15 114.20 12.95  1.10 N 
24  1 N  A CYS 134 ? ? CA A CYS 134 ? ? C  A CYS 134 ? ? 81.66  111.00 -29.34 2.70 N 
25  1 N  A TRP 144 ? ? CA A TRP 144 ? ? C  A TRP 144 ? ? 92.62  111.00 -18.38 2.70 N 
26  1 C  A GLU 153 ? ? N  A ASP 154 ? ? CA A ASP 154 ? ? 141.59 121.70 19.89  2.50 Y 
27  1 N  A ASP 154 ? ? CA A ASP 154 ? ? C  A ASP 154 ? ? 137.83 111.00 26.83  2.70 N 
28  1 N  A GLN 161 ? ? CA A GLN 161 ? ? C  A GLN 161 ? ? 94.80  111.00 -16.20 2.70 N 
29  1 N  A CYS 163 ? ? CA A CYS 163 ? ? C  A CYS 163 ? ? 93.63  111.00 -17.37 2.70 N 
30  1 N  A LEU 166 ? ? CA A LEU 166 ? ? C  A LEU 166 ? ? 129.25 111.00 18.25  2.70 N 
31  1 N  A VAL 168 ? ? CA A VAL 168 ? ? C  A VAL 168 ? ? 130.78 111.00 19.78  2.70 N 
32  1 N  A GLN 170 ? ? CA A GLN 170 ? ? C  A GLN 170 ? ? 129.68 111.00 18.68  2.70 N 
33  1 N  A PHE 179 ? ? CA A PHE 179 ? ? C  A PHE 179 ? ? 82.65  111.00 -28.35 2.70 N 
34  1 N  A GLU 180 ? ? CA A GLU 180 ? ? C  A GLU 180 ? ? 130.83 111.00 19.83  2.70 N 
35  1 N  A CYS 188 ? ? CA A CYS 188 ? ? C  A CYS 188 ? ? 132.57 111.00 21.57  2.70 N 
36  1 N  A ILE 189 ? ? CA A ILE 189 ? ? C  A ILE 189 ? ? 129.00 111.00 18.00  2.70 N 
37  1 C  A GLY 198 ? ? N  A PRO 199 ? ? CA A PRO 199 ? ? 131.70 119.30 12.40  1.50 Y 
38  1 N  A ASP 200 ? ? CA A ASP 200 ? ? C  A ASP 200 ? ? 127.40 111.00 16.40  2.70 N 
39  1 N  A CYS 201 ? ? CA A CYS 201 ? ? C  A CYS 201 ? ? 86.02  111.00 -24.98 2.70 N 
40  1 N  A ALA 213 ? ? CA A ALA 213 ? ? C  A ALA 213 ? ? 128.80 111.00 17.80  2.70 N 
41  1 C  A ARG 216 ? ? N  A PRO 217 ? ? CA A PRO 217 ? ? 133.90 119.30 14.60  1.50 Y 
42  1 N  A PRO 217 ? ? CA A PRO 217 ? ? C  A PRO 217 ? ? 128.09 112.10 15.99  2.60 N 
43  1 CA A CYS 222 ? ? CB A CYS 222 ? ? SG A CYS 222 ? ? 121.83 114.20 7.63   1.10 N 
44  1 N  A HIS 229 ? ? CA A HIS 229 ? ? C  A HIS 229 ? ? 130.49 111.00 19.49  2.70 N 
45  1 N  A GLY 230 ? ? CA A GLY 230 ? ? C  A GLY 230 ? ? 92.47  113.10 -20.63 2.50 N 
46  1 C  A GLY 230 ? ? N  A SER 231 ? ? CA A SER 231 ? ? 102.21 121.70 -19.49 2.50 Y 
47  1 N  A GLN 233 ? ? CA A GLN 233 ? ? C  A GLN 233 ? ? 130.58 111.00 19.58  2.70 N 
48  1 CA A CYS 240 ? ? CB A CYS 240 ? ? SG A CYS 240 ? ? 121.73 114.20 7.53   1.10 N 
49  1 N  A ASP 245 ? ? CA A ASP 245 ? ? C  A ASP 245 ? ? 86.31  111.00 -24.69 2.70 N 
50  1 CA A CYS 263 ? ? CB A CYS 263 ? ? SG A CYS 263 ? ? 123.69 114.20 9.49   1.10 N 
51  1 CA A CYS 275 ? ? CB A CYS 275 ? ? SG A CYS 275 ? ? 121.73 114.20 7.53   1.10 N 
52  1 N  A CYS 281 ? ? CA A CYS 281 ? ? C  A CYS 281 ? ? 94.26  111.00 -16.74 2.70 N 
53  1 C  A GLU 287 ? ? N  A PRO 288 ? ? CA A PRO 288 ? ? 108.07 119.30 -11.23 1.50 Y 
54  1 N  A LYS 290 ? ? CA A LYS 290 ? ? C  A LYS 290 ? ? 92.12  111.00 -18.88 2.70 N 
55  1 CA A LYS 290 ? ? C  A LYS 290 ? ? N  A GLU 291 ? ? 101.78 117.20 -15.42 2.20 Y 
56  1 N  A ASP 299 ? ? CA A ASP 299 ? ? C  A ASP 299 ? ? 85.31  111.00 -25.69 2.70 N 
57  1 N  A GLY 303 ? ? CA A GLY 303 ? ? C  A GLY 303 ? ? 93.75  113.10 -19.35 2.50 N 
58  1 CA A HIS 306 ? ? C  A HIS 306 ? ? N  A VAL 307 ? ? 103.07 117.20 -14.13 2.20 Y 
59  1 C  A HIS 306 ? ? N  A VAL 307 ? ? CA A VAL 307 ? ? 143.81 121.70 22.11  2.50 Y 
60  1 N  A VAL 307 ? ? CA A VAL 307 ? ? C  A VAL 307 ? ? 129.00 111.00 18.00  2.70 N 
61  1 N  A ILE 313 ? ? CA A ILE 313 ? ? C  A ILE 313 ? ? 132.38 111.00 21.38  2.70 N 
62  1 N  A GLY 314 ? ? CA A GLY 314 ? ? C  A GLY 314 ? ? 81.45  113.10 -31.65 2.50 N 
63  1 N  A LEU 318 ? ? CA A LEU 318 ? ? C  A LEU 318 ? ? 129.27 111.00 18.27  2.70 N 
64  1 N  A GLN 324 ? ? CA A GLN 324 ? ? C  A GLN 324 ? ? 131.20 111.00 20.20  2.70 N 
65  1 N  A ARG 330 ? ? CA A ARG 330 ? ? C  A ARG 330 ? ? 128.84 111.00 17.84  2.70 N 
66  1 N  A CYS 331 ? ? CA A CYS 331 ? ? C  A CYS 331 ? ? 128.09 111.00 17.09  2.70 N 
67  1 N  A ASP 339 ? ? CA A ASP 339 ? ? C  A ASP 339 ? ? 132.06 111.00 21.06  2.70 N 
68  1 C  A ASP 339 ? ? N  A PRO 340 ? ? CA A PRO 340 ? ? 162.54 127.00 35.54  2.40 Y 
69  1 C  A ASP 339 ? ? N  A PRO 340 ? ? CD A PRO 340 ? ? 88.76  120.60 -31.84 2.20 Y 
70  1 CA A PRO 340 ? ? N  A PRO 340 ? ? CD A PRO 340 ? ? 101.19 111.50 -10.31 1.40 N 
71  1 N  A ASP 341 ? ? CA A ASP 341 ? ? C  A ASP 341 ? ? 84.72  111.00 -26.28 2.70 N 
72  1 N  A LEU 346 ? ? CA A LEU 346 ? ? C  A LEU 346 ? ? 130.81 111.00 19.81  2.70 N 
73  1 CA A CYS 356 ? ? CB A CYS 356 ? ? SG A CYS 356 ? ? 123.07 114.20 8.87   1.10 N 
74  1 C  A ASP 365 ? ? N  A PRO 366 ? ? CA A PRO 366 ? ? 138.99 119.30 19.69  1.50 Y 
75  1 C  A ASP 365 ? ? N  A PRO 366 ? ? CD A PRO 366 ? ? 112.10 128.40 -16.30 2.10 Y 
76  1 N  A PRO 366 ? ? CA A PRO 366 ? ? C  A PRO 366 ? ? 127.72 112.10 15.62  2.60 N 
77  1 N  A HIS 367 ? ? CA A HIS 367 ? ? C  A HIS 367 ? ? 93.10  111.00 -17.90 2.70 N 
78  1 N  A GLY 375 ? ? CA A GLY 375 ? ? C  A GLY 375 ? ? 92.26  113.10 -20.84 2.50 N 
79  1 N  A ARG 395 ? ? CA A ARG 395 ? ? C  A ARG 395 ? ? 83.05  111.00 -27.95 2.70 N 
80  1 N  A VAL 409 ? ? CA A VAL 409 ? ? C  A VAL 409 ? ? 131.56 111.00 20.56  2.70 N 
81  1 N  A LEU 411 ? ? CA A LEU 411 ? ? C  A LEU 411 ? ? 133.67 111.00 22.67  2.70 N 
82  1 N  A SER 417 ? ? CA A SER 417 ? ? C  A SER 417 ? ? 83.57  111.00 -27.43 2.70 N 
83  1 C  A SER 417 ? ? N  A ASN 418 ? ? CA A ASN 418 ? ? 105.47 121.70 -16.23 2.50 Y 
84  1 N  A GLN 427 ? ? CA A GLN 427 ? ? C  A GLN 427 ? ? 94.15  111.00 -16.85 2.70 N 
85  1 N  A SER 443 ? ? CA A SER 443 ? ? C  A SER 443 ? ? 130.32 111.00 19.32  2.70 N 
86  1 N  A ASP 445 ? ? CA A ASP 445 ? ? C  A ASP 445 ? ? 138.31 111.00 27.31  2.70 N 
87  1 N  A THR 446 ? ? CA A THR 446 ? ? C  A THR 446 ? ? 127.25 111.00 16.25  2.70 N 
88  1 N  A HIS 464 ? ? CA A HIS 464 ? ? C  A HIS 464 ? ? 93.50  111.00 -17.50 2.70 N 
89  1 N  A ILE 467 ? ? CA A ILE 467 ? ? C  A ILE 467 ? ? 129.75 111.00 18.75  2.70 N 
90  1 N  A VAL 473 ? ? CA A VAL 473 ? ? C  A VAL 473 ? ? 79.47  111.00 -31.53 2.70 N 
91  1 CA A LEU 474 ? ? CB A LEU 474 ? ? CG A LEU 474 ? ? 98.30  115.30 -17.00 2.30 N 
92  1 N  A GLY 495 ? ? CA A GLY 495 ? ? C  A GLY 495 ? ? 89.25  113.10 -23.85 2.50 N 
93  1 N  A PRO 498 ? ? CA A PRO 498 ? ? C  A PRO 498 ? ? 130.63 112.10 18.53  2.60 N 
94  1 N  A PHE 509 ? ? CA A PHE 509 ? ? C  A PHE 509 ? ? 136.94 111.00 25.94  2.70 N 
95  1 C  A THR 517 ? ? N  A PRO 518 ? ? CA A PRO 518 ? ? 134.55 119.30 15.25  1.50 Y 
96  1 C  A THR 517 ? ? N  A PRO 518 ? ? CD A PRO 518 ? ? 95.86  128.40 -32.54 2.10 Y 
97  1 N  A PRO 518 ? ? CA A PRO 518 ? ? C  A PRO 518 ? ? 94.59  112.10 -17.51 2.60 N 
98  1 N  A GLY 525 ? ? CA A GLY 525 ? ? C  A GLY 525 ? ? 97.21  113.10 -15.89 2.50 N 
99  1 N  A VAL 529 ? ? CA A VAL 529 ? ? C  A VAL 529 ? ? 128.67 111.00 17.67  2.70 N 
100 1 CA A LEU 547 ? ? CB A LEU 547 ? ? CG A LEU 547 ? ? 129.54 115.30 14.24  2.30 N 
101 1 N  A LEU 561 ? ? CA A LEU 561 ? ? C  A LEU 561 ? ? 89.66  111.00 -21.34 2.70 N 
102 1 N  A LEU 578 ? ? CA A LEU 578 ? ? C  A LEU 578 ? ? 130.51 111.00 19.51  2.70 N 
103 1 CA A ILE 603 ? ? C  A ILE 603 ? ? N  A ASN 604 ? ? 99.13  117.20 -18.07 2.20 Y 
104 1 C  A ILE 603 ? ? N  A ASN 604 ? ? CA A ASN 604 ? ? 140.05 121.70 18.35  2.50 Y 
105 1 N  A ASN 604 ? ? CA A ASN 604 ? ? C  A ASN 604 ? ? 84.49  111.00 -26.51 2.70 N 
106 1 N  A GLY 615 ? ? CA A GLY 615 ? ? C  A GLY 615 ? ? 95.39  113.10 -17.70 2.50 N 
107 1 N  A ASP 617 ? ? CA A ASP 617 ? ? C  A ASP 617 ? ? 93.62  111.00 -17.38 2.70 N 
108 1 C  A ALA 622 ? ? N  A GLU 623 ? ? CA A GLU 623 ? ? 106.04 121.70 -15.66 2.50 Y 
109 1 C  A SER 627 ? ? N  A PRO 628 ? ? CA A PRO 628 ? ? 134.48 119.30 15.18  1.50 Y 
110 1 C  A SER 627 ? ? N  A PRO 628 ? ? CD A PRO 628 ? ? 113.87 128.40 -14.53 2.10 Y 
111 1 N  A PRO 628 ? ? CA A PRO 628 ? ? C  A PRO 628 ? ? 128.94 112.10 16.84  2.60 N 
112 1 N  A GLU 629 ? ? CA A GLU 629 ? ? C  A GLU 629 ? ? 130.05 111.00 19.05  2.70 N 
113 1 N  A THR 638 ? ? CA A THR 638 ? ? C  A THR 638 ? ? 90.34  111.00 -20.66 2.70 N 
114 1 C  A GLN 639 ? ? N  A PRO 640 ? ? CA A PRO 640 ? ? 129.32 119.30 10.02  1.50 Y 
115 1 C  A GLN 639 ? ? N  A PRO 640 ? ? CD A PRO 640 ? ? 110.94 128.40 -17.46 2.10 Y 
116 1 N  A CYS 646 ? ? CA A CYS 646 ? ? C  A CYS 646 ? ? 92.40  111.00 -18.60 2.70 N 
117 1 N  A THR 649 ? ? CA A THR 649 ? ? C  A THR 649 ? ? 82.95  111.00 -28.05 2.70 N 
118 1 N  A ASN 653 ? ? CA A ASN 653 ? ? C  A ASN 653 ? ? 92.97  111.00 -18.03 2.70 N 
119 1 N  A TYR 658 ? ? CA A TYR 658 ? ? C  A TYR 658 ? ? 94.51  111.00 -16.49 2.70 N 
120 1 N  A LEU 659 ? ? CA A LEU 659 ? ? C  A LEU 659 ? ? 130.93 111.00 19.93  2.70 N 
121 1 CA A CYS 660 ? ? CB A CYS 660 ? ? SG A CYS 660 ? ? 124.07 114.20 9.87   1.10 N 
122 1 N  A CYS 660 ? ? CA A CYS 660 ? ? C  A CYS 660 ? ? 133.28 111.00 22.28  2.70 N 
123 1 C  A ASN 667 ? ? N  A PRO 668 ? ? CA A PRO 668 ? ? 128.91 119.30 9.61   1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 THR A 46  ? ? 172.82  41.73   
2   1 CYS A 47  ? ? -27.87  153.72  
3   1 SER A 49  ? ? -45.81  87.11   
4   1 ASP A 51  ? ? -104.43 42.15   
5   1 PHE A 52  ? ? 177.76  113.39  
6   1 CYS A 54  ? ? -114.64 -134.66 
7   1 CYS A 61  ? ? 78.51   76.89   
8   1 PRO A 63  ? ? -33.58  19.41   
9   1 GLN A 64  ? ? 49.32   -1.27   
10  1 CYS A 68  ? ? 34.01   34.83   
11  1 GLN A 71  ? ? 167.06  97.27   
12  1 VAL A 72  ? ? -42.87  94.61   
13  1 ASP A 79  ? ? 21.68   30.13   
14  1 GLU A 80  ? ? 164.89  3.72    
15  1 GLN A 81  ? ? -160.29 11.57   
16  1 PRO A 84  ? ? -38.74  -119.49 
17  1 PRO A 85  ? ? -29.26  105.75  
18  1 CYS A 88  ? ? 29.73   61.79   
19  1 GLN A 90  ? ? 57.18   78.86   
20  1 ASP A 91  ? ? 153.55  92.29   
21  1 GLU A 92  ? ? -66.85  71.22   
22  1 CYS A 95  ? ? -58.19  -167.71 
23  1 HIS A 96  ? ? -64.22  19.71   
24  1 ASP A 97  ? ? -165.45 -99.35  
25  1 PHE A 105 ? ? -100.93 67.57   
26  1 VAL A 106 ? ? -21.60  46.97   
27  1 CYS A 107 ? ? 46.27   78.76   
28  1 ASP A 108 ? ? -90.66  47.57   
29  1 ARG A 111 ? ? -39.91  76.96   
30  1 ASP A 112 ? ? -111.92 69.02   
31  1 CYS A 113 ? ? 169.98  21.98   
32  1 ASP A 118 ? ? 74.31   90.11   
33  1 GLU A 119 ? ? 104.82  45.99   
34  1 ALA A 120 ? ? -159.20 40.46   
35  1 SER A 121 ? ? -172.83 48.57   
36  1 VAL A 124 ? ? -161.49 113.73  
37  1 CYS A 127 ? ? -58.39  96.44   
38  1 PRO A 129 ? ? -51.45  32.92   
39  1 ALA A 130 ? ? -156.70 78.07   
40  1 ASN A 135 ? ? -51.52  17.85   
41  1 SER A 137 ? ? 72.09   71.19   
42  1 ILE A 140 ? ? -173.48 144.21  
43  1 GLN A 142 ? ? -47.69  65.97   
44  1 LEU A 143 ? ? -154.56 5.02    
45  1 ALA A 145 ? ? -52.03  105.48  
46  1 ASN A 148 ? ? -78.84  22.40   
47  1 ASP A 151 ? ? -166.83 27.50   
48  1 GLU A 153 ? ? -60.25  72.07   
49  1 ASP A 154 ? ? 56.39   88.08   
50  1 SER A 156 ? ? -147.33 20.03   
51  1 ASP A 157 ? ? 178.90  2.19    
52  1 GLU A 158 ? ? -164.82 61.55   
53  1 TRP A 159 ? ? 178.80  73.30   
54  1 PRO A 160 ? ? -29.18  61.86   
55  1 GLN A 161 ? ? -102.27 56.09   
56  1 ARG A 162 ? ? 81.68   38.61   
57  1 PHE A 169 ? ? -165.04 -137.41 
58  1 GLN A 170 ? ? -67.59  76.51   
59  1 SER A 174 ? ? -158.90 87.77   
60  1 PRO A 175 ? ? -62.15  79.75   
61  1 CYS A 176 ? ? -169.82 115.24  
62  1 SER A 177 ? ? -61.76  60.63   
63  1 ALA A 178 ? ? -37.41  88.13   
64  1 SER A 185 ? ? -169.55 69.41   
65  1 CYS A 188 ? ? -36.98  163.65  
66  1 SER A 191 ? ? 23.41   38.68   
67  1 TRP A 193 ? ? -47.61  33.93   
68  1 PRO A 199 ? ? -63.29  69.76   
69  1 ASP A 203 ? ? -146.01 50.87   
70  1 GLU A 207 ? ? -55.65  54.76   
71  1 ASN A 209 ? ? 64.39   63.09   
72  1 ASP A 218 ? ? 178.72  17.25   
73  1 ASP A 224 ? ? 169.74  131.63  
74  1 ASN A 226 ? ? -67.76  88.17   
75  1 CYS A 227 ? ? -63.83  80.07   
76  1 ARG A 232 ? ? -66.13  21.37   
77  1 GLN A 233 ? ? -61.90  -177.53 
78  1 CYS A 234 ? ? -37.33  81.68   
79  1 ASP A 235 ? ? -146.93 20.61   
80  1 TYR A 238 ? ? -55.05  99.57   
81  1 CYS A 240 ? ? 176.53  23.78   
82  1 ASP A 242 ? ? 175.09  -162.98 
83  1 SER A 244 ? ? -109.99 73.92   
84  1 VAL A 250 ? ? 177.41  -4.04   
85  1 ASN A 251 ? ? -36.16  107.11  
86  1 PRO A 258 ? ? -54.86  73.48   
87  1 CYS A 263 ? ? -40.18  99.62   
88  1 HIS A 264 ? ? -52.74  106.68  
89  1 LEU A 271 ? ? -176.54 16.83   
90  1 VAL A 274 ? ? -68.93  91.35   
91  1 MET A 277 ? ? 23.09   60.39   
92  1 ALA A 278 ? ? -174.76 142.18  
93  1 ASP A 280 ? ? -117.71 55.44   
94  1 CYS A 281 ? ? 170.30  136.39  
95  1 ARG A 282 ? ? -66.19  34.99   
96  1 TRP A 284 ? ? -75.33  28.03   
97  1 GLU A 287 ? ? 90.47   40.79   
98  1 CYS A 292 ? ? -67.86  27.56   
99  1 ASN A 300 ? ? 54.47   81.37   
100 1 ASN A 301 ? ? -68.09  19.02   
101 1 CYS A 304 ? ? -117.76 -166.94 
102 1 HIS A 306 ? ? -63.54  90.25   
103 1 VAL A 307 ? ? 77.68   97.64   
104 1 LYS A 312 ? ? -55.23  84.78   
105 1 TYR A 315 ? ? -56.21  47.98   
106 1 PRO A 320 ? ? -50.85  171.73  
107 1 LEU A 325 ? ? 165.28  150.04  
108 1 GLN A 328 ? ? 48.47   24.74   
109 1 ARG A 329 ? ? -172.57 115.55  
110 1 CYS A 331 ? ? -50.76  179.04  
111 1 GLU A 336 ? ? -104.35 58.22   
112 1 PRO A 340 ? ? -90.09  50.51   
113 1 ASP A 341 ? ? -140.95 20.56   
114 1 GLN A 345 ? ? 77.58   76.70   
115 1 LEU A 350 ? ? -123.73 -155.27 
116 1 LYS A 355 ? ? -174.01 143.83  
117 1 GLU A 360 ? ? 57.02   70.50   
118 1 PRO A 366 ? ? -22.23  29.65   
119 1 HIS A 367 ? ? -152.47 28.02   
120 1 THR A 368 ? ? -174.28 -166.16 
121 1 LYS A 369 ? ? -144.88 29.08   
122 1 PHE A 382 ? ? 178.76  167.97  
123 1 ARG A 385 ? ? -47.49  90.51   
124 1 HIS A 386 ? ? 63.26   63.93   
125 1 LEU A 393 ? ? -44.69  87.15   
126 1 ARG A 395 ? ? -117.36 77.50   
127 1 SER A 396 ? ? -53.58  50.09   
128 1 PRO A 403 ? ? -58.83  55.28   
129 1 ARG A 406 ? ? -46.13  101.30  
130 1 VAL A 409 ? ? -152.08 26.34   
131 1 ALA A 410 ? ? 171.74  60.33   
132 1 SER A 426 ? ? -166.97 35.68   
133 1 GLN A 427 ? ? -176.65 62.71   
134 1 ARG A 428 ? ? -46.26  75.48   
135 1 MET A 429 ? ? -178.46 123.88  
136 1 LEU A 435 ? ? -52.61  103.00  
137 1 ASP A 436 ? ? 178.96  30.08   
138 1 ARG A 437 ? ? -50.46  84.53   
139 1 HIS A 439 ? ? -48.83  72.60   
140 1 SER A 443 ? ? -150.03 29.11   
141 1 TYR A 444 ? ? -162.49 84.15   
142 1 ASP A 445 ? ? -156.97 33.69   
143 1 VAL A 447 ? ? -165.45 118.50  
144 1 ILE A 448 ? ? 66.24   66.32   
145 1 SER A 449 ? ? -93.90  33.17   
146 1 ARG A 450 ? ? -168.44 54.30   
147 1 ASP A 451 ? ? -175.58 80.45   
148 1 ASP A 456 ? ? -93.75  52.92   
149 1 ILE A 463 ? ? -154.60 17.04   
150 1 HIS A 464 ? ? -159.87 86.61   
151 1 SER A 465 ? ? -53.88  93.97   
152 1 TRP A 469 ? ? 178.67  162.13  
153 1 SER A 472 ? ? -71.71  49.35   
154 1 SER A 478 ? ? 175.15  -163.90 
155 1 VAL A 485 ? ? -166.39 75.22   
156 1 LYS A 486 ? ? 177.36  117.80  
157 1 GLU A 493 ? ? 176.84  105.12  
158 1 SER A 496 ? ? -179.93 59.12   
159 1 LYS A 497 ? ? -68.78  25.72   
160 1 PRO A 498 ? ? -37.72  158.12  
161 1 ARG A 499 ? ? -166.85 31.76   
162 1 ALA A 500 ? ? -172.92 112.46  
163 1 PRO A 505 ? ? -43.37  167.99  
164 1 HIS A 507 ? ? -168.80 102.51  
165 1 PHE A 509 ? ? -22.65  172.07  
166 1 ASP A 514 ? ? 175.91  169.08  
167 1 TRP A 515 ? ? -168.23 57.91   
168 1 ALA A 519 ? ? -159.71 41.59   
169 1 ASN A 527 ? ? 174.57  56.73   
170 1 TYR A 532 ? ? -163.25 106.57  
171 1 THR A 536 ? ? -64.82  59.71   
172 1 GLU A 537 ? ? 177.23  172.69  
173 1 PRO A 542 ? ? -57.69  -176.95 
174 1 ASN A 543 ? ? 176.11  57.15   
175 1 LEU A 549 ? ? -74.62  29.66   
176 1 LYS A 560 ? ? -104.56 52.62   
177 1 LEU A 561 ? ? -173.14 80.38   
178 1 HIS A 562 ? ? -46.50  75.53   
179 1 VAL A 569 ? ? -71.43  31.26   
180 1 ASN A 573 ? ? 66.86   73.82   
181 1 GLU A 581 ? ? -77.12  31.53   
182 1 LEU A 584 ? ? -179.32 124.22  
183 1 ALA A 585 ? ? 164.86  143.21  
184 1 HIS A 586 ? ? 37.73   60.34   
185 1 PRO A 587 ? ? -58.30  176.74  
186 1 PHE A 588 ? ? -165.97 24.70   
187 1 SER A 589 ? ? -172.39 -172.02 
188 1 LEU A 590 ? ? 175.18  132.39  
189 1 GLU A 594 ? ? -43.34  108.90  
190 1 ILE A 602 ? ? -73.89  -162.76 
191 1 ILE A 603 ? ? -65.07  99.45   
192 1 ASN A 604 ? ? -179.84 80.81   
193 1 GLU A 605 ? ? -54.97  79.76   
194 1 THR A 614 ? ? -67.89  52.80   
195 1 ASP A 617 ? ? 176.14  117.90  
196 1 LEU A 621 ? ? -177.71 34.66   
197 1 ALA A 622 ? ? 177.09  87.92   
198 1 SER A 627 ? ? 72.66   45.90   
199 1 ASP A 630 ? ? -178.30 97.22   
200 1 HIS A 635 ? ? 56.73   82.71   
201 1 LEU A 637 ? ? -148.69 27.62   
202 1 GLN A 639 ? ? 178.03  49.09   
203 1 ARG A 641 ? ? 160.25  179.13  
204 1 TRP A 645 ? ? -102.17 77.85   
205 1 CYS A 646 ? ? -166.85 38.18   
206 1 ARG A 648 ? ? -66.59  76.99   
207 1 THR A 650 ? ? -46.71  96.91   
208 1 LEU A 651 ? ? 158.91  176.99  
209 1 SER A 652 ? ? -173.21 40.54   
210 1 ASN A 653 ? ? 178.69  -174.47 
211 1 CYS A 660 ? ? 38.45   62.78   
212 1 PRO A 662 ? ? -51.65  -168.67 
213 1 PRO A 664 ? ? -44.68  161.34  
214 1 PRO A 668 ? ? 0.92    68.18   
215 1 HIS A 669 ? ? -159.93 46.97   
216 1 SER A 670 ? ? -163.74 53.17   
217 1 PRO A 671 ? ? -33.20  142.94  
218 1 PRO A 678 ? ? -67.86  -169.13 
219 1 LEU A 683 ? ? -46.06  80.40   
220 1 ALA A 684 ? ? -30.72  157.11  
221 1 ARG A 685 ? ? -61.54  58.63   
222 1 ASP A 686 ? ? -172.41 119.12  
223 1 MET A 687 ? ? -60.68  46.03   
224 1 ARG A 688 ? ? -164.08 33.98   
225 1 SER A 689 ? ? 171.79  150.51  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR A 167 ? ? 0.072 'SIDE CHAIN' 
2 1 TYR A 468 ? ? 0.086 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A SER 44   ? OG  ? A SER 44  OG  
2   1 Y 1 A ASN 59   ? CG  ? A ASN 59  CG  
3   1 Y 1 A ASN 59   ? OD1 ? A ASN 59  OD1 
4   1 Y 1 A ASN 59   ? ND2 ? A ASN 59  ND2 
5   1 Y 1 A GLN 64   ? CG  ? A GLN 64  CG  
6   1 Y 1 A GLN 64   ? CD  ? A GLN 64  CD  
7   1 Y 1 A GLN 64   ? OE1 ? A GLN 64  OE1 
8   1 Y 1 A GLN 64   ? NE2 ? A GLN 64  NE2 
9   1 Y 1 A GLN 71   ? CG  ? A GLN 71  CG  
10  1 Y 1 A GLN 71   ? CD  ? A GLN 71  CD  
11  1 Y 1 A GLN 71   ? OE1 ? A GLN 71  OE1 
12  1 Y 1 A GLN 71   ? NE2 ? A GLN 71  NE2 
13  1 Y 1 A VAL 72   ? CG1 ? A VAL 72  CG1 
14  1 Y 1 A VAL 72   ? CG2 ? A VAL 72  CG2 
15  1 Y 1 A GLN 81   ? CG  ? A GLN 81  CG  
16  1 Y 1 A GLN 81   ? CD  ? A GLN 81  CD  
17  1 Y 1 A GLN 81   ? OE1 ? A GLN 81  OE1 
18  1 Y 1 A GLN 81   ? NE2 ? A GLN 81  NE2 
19  1 Y 1 A SER 89   ? OG  ? A SER 89  OG  
20  1 Y 1 A GLN 90   ? CG  ? A GLN 90  CG  
21  1 Y 1 A GLN 90   ? CD  ? A GLN 90  CD  
22  1 Y 1 A GLN 90   ? OE1 ? A GLN 90  OE1 
23  1 Y 1 A GLN 90   ? NE2 ? A GLN 90  NE2 
24  1 Y 1 A ASP 91   ? CG  ? A ASP 91  CG  
25  1 Y 1 A ASP 91   ? OD1 ? A ASP 91  OD1 
26  1 Y 1 A ASP 91   ? OD2 ? A ASP 91  OD2 
27  1 Y 1 A GLU 92   ? CG  ? A GLU 92  CG  
28  1 Y 1 A GLU 92   ? CD  ? A GLU 92  CD  
29  1 Y 1 A GLU 92   ? OE1 ? A GLU 92  OE1 
30  1 Y 1 A GLU 92   ? OE2 ? A GLU 92  OE2 
31  1 Y 1 A PHE 93   ? CG  ? A PHE 93  CG  
32  1 Y 1 A PHE 93   ? CD1 ? A PHE 93  CD1 
33  1 Y 1 A PHE 93   ? CD2 ? A PHE 93  CD2 
34  1 Y 1 A PHE 93   ? CE1 ? A PHE 93  CE1 
35  1 Y 1 A PHE 93   ? CE2 ? A PHE 93  CE2 
36  1 Y 1 A PHE 93   ? CZ  ? A PHE 93  CZ  
37  1 Y 1 A ARG 94   ? CG  ? A ARG 94  CG  
38  1 Y 1 A ARG 94   ? CD  ? A ARG 94  CD  
39  1 Y 1 A ARG 94   ? NE  ? A ARG 94  NE  
40  1 Y 1 A ARG 94   ? CZ  ? A ARG 94  CZ  
41  1 Y 1 A ARG 94   ? NH1 ? A ARG 94  NH1 
42  1 Y 1 A ARG 94   ? NH2 ? A ARG 94  NH2 
43  1 Y 1 A GLN 142  ? CG  ? A GLN 142 CG  
44  1 Y 1 A GLN 142  ? CD  ? A GLN 142 CD  
45  1 Y 1 A GLN 142  ? OE1 ? A GLN 142 OE1 
46  1 Y 1 A GLN 142  ? NE2 ? A GLN 142 NE2 
47  1 Y 1 A GLN 161  ? CG  ? A GLN 161 CG  
48  1 Y 1 A GLN 161  ? CD  ? A GLN 161 CD  
49  1 Y 1 A GLN 161  ? OE1 ? A GLN 161 OE1 
50  1 Y 1 A GLN 161  ? NE2 ? A GLN 161 NE2 
51  1 Y 1 A ARG 162  ? CG  ? A ARG 162 CG  
52  1 Y 1 A ARG 162  ? CD  ? A ARG 162 CD  
53  1 Y 1 A ARG 162  ? NE  ? A ARG 162 NE  
54  1 Y 1 A ARG 162  ? CZ  ? A ARG 162 CZ  
55  1 Y 1 A ARG 162  ? NH1 ? A ARG 162 NH1 
56  1 Y 1 A ARG 162  ? NH2 ? A ARG 162 NH2 
57  1 Y 1 A PHE 181  ? CG  ? A PHE 181 CG  
58  1 Y 1 A PHE 181  ? CD1 ? A PHE 181 CD1 
59  1 Y 1 A PHE 181  ? CD2 ? A PHE 181 CD2 
60  1 Y 1 A PHE 181  ? CE1 ? A PHE 181 CE1 
61  1 Y 1 A PHE 181  ? CE2 ? A PHE 181 CE2 
62  1 Y 1 A PHE 181  ? CZ  ? A PHE 181 CZ  
63  1 Y 1 A LEU 184  ? CG  ? A LEU 184 CG  
64  1 Y 1 A LEU 184  ? CD1 ? A LEU 184 CD1 
65  1 Y 1 A LEU 184  ? CD2 ? A LEU 184 CD2 
66  1 Y 1 A ARG 194  ? CG  ? A ARG 194 CG  
67  1 Y 1 A ARG 194  ? CD  ? A ARG 194 CD  
68  1 Y 1 A ARG 194  ? NE  ? A ARG 194 NE  
69  1 Y 1 A ARG 194  ? CZ  ? A ARG 194 CZ  
70  1 Y 1 A ARG 194  ? NH1 ? A ARG 194 NH1 
71  1 Y 1 A ARG 194  ? NH2 ? A ARG 194 NH2 
72  1 Y 1 A ASP 224  ? CG  ? A ASP 224 CG  
73  1 Y 1 A ASP 224  ? OD1 ? A ASP 224 OD1 
74  1 Y 1 A ASP 224  ? OD2 ? A ASP 224 OD2 
75  1 Y 1 A ILE 228  ? CG1 ? A ILE 228 CG1 
76  1 Y 1 A ILE 228  ? CG2 ? A ILE 228 CG2 
77  1 Y 1 A ILE 228  ? CD1 ? A ILE 228 CD1 
78  1 Y 1 A GLN 233  ? CG  ? A GLN 233 CG  
79  1 Y 1 A GLN 233  ? CD  ? A GLN 233 CD  
80  1 Y 1 A GLN 233  ? OE1 ? A GLN 233 OE1 
81  1 Y 1 A GLN 233  ? NE2 ? A GLN 233 NE2 
82  1 Y 1 A ARG 236  ? CG  ? A ARG 236 CG  
83  1 Y 1 A ARG 236  ? CD  ? A ARG 236 CD  
84  1 Y 1 A ARG 236  ? NE  ? A ARG 236 NE  
85  1 Y 1 A ARG 236  ? CZ  ? A ARG 236 CZ  
86  1 Y 1 A ARG 236  ? NH1 ? A ARG 236 NH1 
87  1 Y 1 A ARG 236  ? NH2 ? A ARG 236 NH2 
88  1 Y 1 A LYS 241  ? CG  ? A LYS 241 CG  
89  1 Y 1 A LYS 241  ? CD  ? A LYS 241 CD  
90  1 Y 1 A LYS 241  ? CE  ? A LYS 241 CE  
91  1 Y 1 A LYS 241  ? NZ  ? A LYS 241 NZ  
92  1 Y 1 A LYS 262  ? CG  ? A LYS 262 CG  
93  1 Y 1 A LYS 262  ? CD  ? A LYS 262 CD  
94  1 Y 1 A LYS 262  ? CE  ? A LYS 262 CE  
95  1 Y 1 A LYS 262  ? NZ  ? A LYS 262 NZ  
96  1 Y 1 A ASP 272  ? CG  ? A ASP 272 CG  
97  1 Y 1 A ASP 272  ? OD1 ? A ASP 272 OD1 
98  1 Y 1 A ASP 272  ? OD2 ? A ASP 272 OD2 
99  1 Y 1 A ARG 282  ? CG  ? A ARG 282 CG  
100 1 Y 1 A ARG 282  ? CD  ? A ARG 282 CD  
101 1 Y 1 A ARG 282  ? NE  ? A ARG 282 NE  
102 1 Y 1 A ARG 282  ? CZ  ? A ARG 282 CZ  
103 1 Y 1 A ARG 282  ? NH1 ? A ARG 282 NH1 
104 1 Y 1 A ARG 282  ? NH2 ? A ARG 282 NH2 
105 1 Y 1 A TRP 284  ? CG  ? A TRP 284 CG  
106 1 Y 1 A TRP 284  ? CD1 ? A TRP 284 CD1 
107 1 Y 1 A TRP 284  ? CD2 ? A TRP 284 CD2 
108 1 Y 1 A TRP 284  ? NE1 ? A TRP 284 NE1 
109 1 Y 1 A TRP 284  ? CE2 ? A TRP 284 CE2 
110 1 Y 1 A TRP 284  ? CE3 ? A TRP 284 CE3 
111 1 Y 1 A TRP 284  ? CZ2 ? A TRP 284 CZ2 
112 1 Y 1 A TRP 284  ? CZ3 ? A TRP 284 CZ3 
113 1 Y 1 A TRP 284  ? CH2 ? A TRP 284 CH2 
114 1 Y 1 A LYS 312  ? CG  ? A LYS 312 CG  
115 1 Y 1 A LYS 312  ? CD  ? A LYS 312 CD  
116 1 Y 1 A LYS 312  ? CE  ? A LYS 312 CE  
117 1 Y 1 A LYS 312  ? NZ  ? A LYS 312 NZ  
118 1 Y 1 A LYS 355  ? CG  ? A LYS 355 CG  
119 1 Y 1 A LYS 355  ? CD  ? A LYS 355 CD  
120 1 Y 1 A LYS 355  ? CE  ? A LYS 355 CE  
121 1 Y 1 A LYS 355  ? NZ  ? A LYS 355 NZ  
122 1 Y 1 A LYS 369  ? CG  ? A LYS 369 CG  
123 1 Y 1 A LYS 369  ? CD  ? A LYS 369 CD  
124 1 Y 1 A LYS 369  ? CE  ? A LYS 369 CE  
125 1 Y 1 A LYS 369  ? NZ  ? A LYS 369 NZ  
126 1 Y 1 A LYS 372  ? CG  ? A LYS 372 CG  
127 1 Y 1 A LYS 372  ? CD  ? A LYS 372 CD  
128 1 Y 1 A LYS 372  ? CE  ? A LYS 372 CE  
129 1 Y 1 A LYS 372  ? NZ  ? A LYS 372 NZ  
130 1 Y 1 A ARG 385  ? CG  ? A ARG 385 CG  
131 1 Y 1 A ARG 385  ? CD  ? A ARG 385 CD  
132 1 Y 1 A ARG 385  ? NE  ? A ARG 385 NE  
133 1 Y 1 A ARG 385  ? CZ  ? A ARG 385 CZ  
134 1 Y 1 A ARG 385  ? NH1 ? A ARG 385 NH1 
135 1 Y 1 A ARG 385  ? NH2 ? A ARG 385 NH2 
136 1 Y 1 A HIS 386  ? CG  ? A HIS 386 CG  
137 1 Y 1 A HIS 386  ? ND1 ? A HIS 386 ND1 
138 1 Y 1 A HIS 386  ? CD2 ? A HIS 386 CD2 
139 1 Y 1 A HIS 386  ? CE1 ? A HIS 386 CE1 
140 1 Y 1 A HIS 386  ? NE2 ? A HIS 386 NE2 
141 1 Y 1 A THR 399  ? CB  ? A THR 399 CB  
142 1 Y 1 A THR 399  ? OG1 ? A THR 399 OG1 
143 1 Y 1 A THR 399  ? CG2 ? A THR 399 CG2 
144 1 Y 1 A SER 400  ? CB  ? A SER 400 CB  
145 1 Y 1 A SER 400  ? OG  ? A SER 400 OG  
146 1 Y 1 A LEU 401  ? CB  ? A LEU 401 CB  
147 1 Y 1 A LEU 401  ? CG  ? A LEU 401 CG  
148 1 Y 1 A LEU 401  ? CD1 ? A LEU 401 CD1 
149 1 Y 1 A LEU 401  ? CD2 ? A LEU 401 CD2 
150 1 Y 1 A ILE 402  ? CB  ? A ILE 402 CB  
151 1 Y 1 A ILE 402  ? CG1 ? A ILE 402 CG1 
152 1 Y 1 A ILE 402  ? CG2 ? A ILE 402 CG2 
153 1 Y 1 A ILE 402  ? CD1 ? A ILE 402 CD1 
154 1 Y 1 A LEU 405  ? CG  ? A LEU 405 CG  
155 1 Y 1 A LEU 405  ? CD1 ? A LEU 405 CD1 
156 1 Y 1 A LEU 405  ? CD2 ? A LEU 405 CD2 
157 1 Y 1 A ARG 406  ? CG  ? A ARG 406 CG  
158 1 Y 1 A ARG 406  ? CD  ? A ARG 406 CD  
159 1 Y 1 A ARG 406  ? NE  ? A ARG 406 NE  
160 1 Y 1 A ARG 406  ? CZ  ? A ARG 406 CZ  
161 1 Y 1 A ARG 406  ? NH1 ? A ARG 406 NH1 
162 1 Y 1 A ARG 406  ? NH2 ? A ARG 406 NH2 
163 1 Y 1 A ARG 419  ? CG  ? A ARG 419 CG  
164 1 Y 1 A ARG 419  ? CD  ? A ARG 419 CD  
165 1 Y 1 A ARG 419  ? NE  ? A ARG 419 NE  
166 1 Y 1 A ARG 419  ? CZ  ? A ARG 419 CZ  
167 1 Y 1 A ARG 419  ? NH1 ? A ARG 419 NH1 
168 1 Y 1 A ARG 419  ? NH2 ? A ARG 419 NH2 
169 1 Y 1 A ARG 428  ? CG  ? A ARG 428 CG  
170 1 Y 1 A ARG 428  ? CD  ? A ARG 428 CD  
171 1 Y 1 A ARG 428  ? NE  ? A ARG 428 NE  
172 1 Y 1 A ARG 428  ? CZ  ? A ARG 428 CZ  
173 1 Y 1 A ARG 428  ? NH1 ? A ARG 428 NH1 
174 1 Y 1 A ARG 428  ? NH2 ? A ARG 428 NH2 
175 1 Y 1 A ARG 437  ? CG  ? A ARG 437 CG  
176 1 Y 1 A ARG 437  ? CD  ? A ARG 437 CD  
177 1 Y 1 A ARG 437  ? NE  ? A ARG 437 NE  
178 1 Y 1 A ARG 437  ? CZ  ? A ARG 437 CZ  
179 1 Y 1 A ARG 437  ? NH1 ? A ARG 437 NH1 
180 1 Y 1 A ARG 437  ? NH2 ? A ARG 437 NH2 
181 1 Y 1 A HIS 439  ? CG  ? A HIS 439 CG  
182 1 Y 1 A HIS 439  ? ND1 ? A HIS 439 ND1 
183 1 Y 1 A HIS 439  ? CD2 ? A HIS 439 CD2 
184 1 Y 1 A HIS 439  ? CE1 ? A HIS 439 CE1 
185 1 Y 1 A HIS 439  ? NE2 ? A HIS 439 NE2 
186 1 Y 1 A ARG 450  ? CG  ? A ARG 450 CG  
187 1 Y 1 A ARG 450  ? CD  ? A ARG 450 CD  
188 1 Y 1 A ARG 450  ? NE  ? A ARG 450 NE  
189 1 Y 1 A ARG 450  ? CZ  ? A ARG 450 CZ  
190 1 Y 1 A ARG 450  ? NH1 ? A ARG 450 NH1 
191 1 Y 1 A ARG 450  ? NH2 ? A ARG 450 NH2 
192 1 Y 1 A LYS 488  ? CG  ? A LYS 488 CG  
193 1 Y 1 A LYS 488  ? CD  ? A LYS 488 CD  
194 1 Y 1 A LYS 488  ? CE  ? A LYS 488 CE  
195 1 Y 1 A LYS 488  ? NZ  ? A LYS 488 NZ  
196 1 Y 1 A LYS 520  ? CG  ? A LYS 520 CG  
197 1 Y 1 A LYS 520  ? CD  ? A LYS 520 CD  
198 1 Y 1 A LYS 520  ? CE  ? A LYS 520 CE  
199 1 Y 1 A LYS 520  ? NZ  ? A LYS 520 NZ  
200 1 Y 1 A LYS 522  ? CG  ? A LYS 522 CG  
201 1 Y 1 A LYS 522  ? CD  ? A LYS 522 CD  
202 1 Y 1 A LYS 522  ? CE  ? A LYS 522 CE  
203 1 Y 1 A LYS 522  ? NZ  ? A LYS 522 NZ  
204 1 Y 1 A LYS 523  ? CG  ? A LYS 523 CG  
205 1 Y 1 A LYS 523  ? CD  ? A LYS 523 CD  
206 1 Y 1 A LYS 523  ? CE  ? A LYS 523 CE  
207 1 Y 1 A LYS 523  ? NZ  ? A LYS 523 NZ  
208 1 Y 1 A LEU 554  ? CG  ? A LEU 554 CG  
209 1 Y 1 A LEU 554  ? CD1 ? A LEU 554 CD1 
210 1 Y 1 A LEU 554  ? CD2 ? A LEU 554 CD2 
211 1 Y 1 A TYR 555  ? CG  ? A TYR 555 CG  
212 1 Y 1 A TYR 555  ? CD1 ? A TYR 555 CD1 
213 1 Y 1 A TYR 555  ? CD2 ? A TYR 555 CD2 
214 1 Y 1 A TYR 555  ? CE1 ? A TYR 555 CE1 
215 1 Y 1 A TYR 555  ? CE2 ? A TYR 555 CE2 
216 1 Y 1 A TYR 555  ? CZ  ? A TYR 555 CZ  
217 1 Y 1 A TYR 555  ? OH  ? A TYR 555 OH  
218 1 Y 1 A ARG 574  ? CG  ? A ARG 574 CG  
219 1 Y 1 A ARG 574  ? CD  ? A ARG 574 CD  
220 1 Y 1 A ARG 574  ? NE  ? A ARG 574 NE  
221 1 Y 1 A ARG 574  ? CZ  ? A ARG 574 CZ  
222 1 Y 1 A ARG 574  ? NH1 ? A ARG 574 NH1 
223 1 Y 1 A ARG 574  ? NH2 ? A ARG 574 NH2 
224 1 Y 1 A LYS 575  ? CG  ? A LYS 575 CG  
225 1 Y 1 A LYS 575  ? CD  ? A LYS 575 CD  
226 1 Y 1 A LYS 575  ? CE  ? A LYS 575 CE  
227 1 Y 1 A LYS 575  ? NZ  ? A LYS 575 NZ  
228 1 Y 1 A GLU 579  ? CG  ? A GLU 579 CG  
229 1 Y 1 A GLU 579  ? CD  ? A GLU 579 CD  
230 1 Y 1 A GLU 579  ? OE1 ? A GLU 579 OE1 
231 1 Y 1 A GLU 579  ? OE2 ? A GLU 579 OE2 
232 1 Y 1 A ARG 583  ? CG  ? A ARG 583 CG  
233 1 Y 1 A ARG 583  ? CD  ? A ARG 583 CD  
234 1 Y 1 A ARG 583  ? NE  ? A ARG 583 NE  
235 1 Y 1 A ARG 583  ? CZ  ? A ARG 583 CZ  
236 1 Y 1 A ARG 583  ? NH1 ? A ARG 583 NH1 
237 1 Y 1 A ARG 583  ? NH2 ? A ARG 583 NH2 
238 1 Y 1 A LEU 626  ? CG  ? A LEU 626 CG  
239 1 Y 1 A LEU 626  ? CD1 ? A LEU 626 CD1 
240 1 Y 1 A LEU 626  ? CD2 ? A LEU 626 CD2 
241 1 Y 1 A LYS 672  ? CG  ? A LYS 672 CG  
242 1 Y 1 A LYS 672  ? CD  ? A LYS 672 CD  
243 1 Y 1 A LYS 672  ? CE  ? A LYS 672 CE  
244 1 Y 1 A LYS 672  ? NZ  ? A LYS 672 NZ  
245 1 Y 1 A ARG 685  ? CG  ? A ARG 685 CG  
246 1 Y 1 A ARG 685  ? CD  ? A ARG 685 CD  
247 1 Y 1 A ARG 685  ? NE  ? A ARG 685 NE  
248 1 Y 1 A ARG 685  ? CZ  ? A ARG 685 CZ  
249 1 Y 1 A ARG 685  ? NH1 ? A ARG 685 NH1 
250 1 Y 1 A ARG 685  ? NH2 ? A ARG 685 NH2 
251 1 N 1 A KEG 6003 ? W3  ? N KEG 1   W3  
252 1 N 1 A KEG 6003 ? W4  ? N KEG 1   W4  
253 1 N 1 A KEG 6003 ? W7  ? N KEG 1   W7  
254 1 N 1 A KEG 6003 ? W8  ? N KEG 1   W8  
255 1 N 1 A KEG 6003 ? W11 ? N KEG 1   W11 
256 1 N 1 A KEG 6003 ? O5  ? N KEG 1   O5  
257 1 N 1 A KEG 6003 ? O6  ? N KEG 1   O6  
258 1 N 1 A KEG 6003 ? O9  ? N KEG 1   O9  
259 1 N 1 A KEG 6003 ? O10 ? N KEG 1   O10 
260 1 N 1 A KEG 6003 ? O13 ? N KEG 1   O13 
261 1 N 1 A KEG 6003 ? O19 ? N KEG 1   O19 
262 1 N 1 A KEG 6003 ? O21 ? N KEG 1   O21 
263 1 N 1 A KEG 6003 ? O25 ? N KEG 1   O25 
264 1 N 1 A KEG 6003 ? O26 ? N KEG 1   O26 
265 1 N 1 A KEG 6003 ? O29 ? N KEG 1   O29 
266 1 N 1 A KEG 6003 ? O30 ? N KEG 1   O30 
267 1 N 1 A KEG 6003 ? O31 ? N KEG 1   O31 
268 1 N 1 A KEG 6003 ? O33 ? N KEG 1   O33 
269 1 N 1 A KEG 6003 ? O34 ? N KEG 1   O34 
270 1 N 1 A KEG 6003 ? O39 ? N KEG 1   O39 
271 1 N 1 A KEG 6003 ? O40 ? N KEG 1   O40 
272 1 N 1 A KEG 6003 ? O41 ? N KEG 1   O41 
273 1 N 1 A KEG 6003 ? O43 ? N KEG 1   O43 
274 1 N 1 A KEG 6003 ? O44 ? N KEG 1   O44 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 1   ? A ALA 1   
2  1 Y 1 A VAL 2   ? A VAL 2   
3  1 Y 1 A GLY 3   ? A GLY 3   
4  1 Y 1 A ASP 4   ? A ASP 4   
5  1 Y 1 A ARG 5   ? A ARG 5   
6  1 Y 1 A CYS 6   ? A CYS 6   
7  1 Y 1 A GLU 7   ? A GLU 7   
8  1 Y 1 A ARG 8   ? A ARG 8   
9  1 Y 1 A ASN 9   ? A ASN 9   
10 1 Y 1 A GLU 10  ? A GLU 10  
11 1 Y 1 A PHE 11  ? A PHE 11  
12 1 Y 1 A GLN 12  ? A GLN 12  
13 1 Y 1 A CYS 13  ? A CYS 13  
14 1 Y 1 A GLN 14  ? A GLN 14  
15 1 Y 1 A ASP 15  ? A ASP 15  
16 1 Y 1 A GLY 16  ? A GLY 16  
17 1 Y 1 A LYS 17  ? A LYS 17  
18 1 Y 1 A CYS 18  ? A CYS 18  
19 1 Y 1 A ILE 19  ? A ILE 19  
20 1 Y 1 A SER 20  ? A SER 20  
21 1 Y 1 A TYR 21  ? A TYR 21  
22 1 Y 1 A LYS 22  ? A LYS 22  
23 1 Y 1 A TRP 23  ? A TRP 23  
24 1 Y 1 A VAL 24  ? A VAL 24  
25 1 Y 1 A CYS 25  ? A CYS 25  
26 1 Y 1 A ASP 26  ? A ASP 26  
27 1 Y 1 A GLY 27  ? A GLY 27  
28 1 Y 1 A SER 28  ? A SER 28  
29 1 Y 1 A ALA 29  ? A ALA 29  
30 1 Y 1 A GLU 30  ? A GLU 30  
31 1 Y 1 A CYS 31  ? A CYS 31  
32 1 Y 1 A GLN 32  ? A GLN 32  
33 1 Y 1 A ASP 33  ? A ASP 33  
34 1 Y 1 A GLY 34  ? A GLY 34  
35 1 Y 1 A SER 35  ? A SER 35  
36 1 Y 1 A ASP 36  ? A ASP 36  
37 1 Y 1 A GLU 37  ? A GLU 37  
38 1 Y 1 A SER 38  ? A SER 38  
39 1 Y 1 A GLN 39  ? A GLN 39  
40 1 Y 1 A GLU 40  ? A GLU 40  
41 1 Y 1 A THR 41  ? A THR 41  
42 1 Y 1 A CYS 42  ? A CYS 42  
43 1 Y 1 A LEU 43  ? A LEU 43  
44 1 Y 1 A ARG 57  ? A ARG 57  
45 1 Y 1 A VAL 58  ? A VAL 58  
46 1 Y 1 A ASP 75  ? A ASP 75  
47 1 Y 1 A LYS 99  ? A LYS 99  
48 1 Y 1 A CYS 100 ? A CYS 100 
49 1 Y 1 A ILE 101 ? A ILE 101 
50 1 Y 1 A SER 102 ? A SER 102 
51 1 Y 1 A VAL 388 ? A VAL 388 
52 1 Y 1 A VAL 441 ? A VAL 441 
53 1 Y 1 A GLN 453 ? A GLN 453 
54 1 Y 1 A ALA 454 ? A ALA 454 
55 1 Y 1 A ALA 694 ? A ALA 694 
56 1 Y 1 A GLU 695 ? A GLU 695 
57 1 Y 1 A ALA 696 ? A ALA 696 
58 1 Y 1 A ALA 697 ? A ALA 697 
59 1 Y 1 A VAL 698 ? A VAL 698 
60 1 Y 1 A ALA 699 ? A ALA 699 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
B 2 NAG 1 B NAG 1 B NAG 2030 n 
B 2 NAG 2 B NAG 2 B NAG 2031 n 
B 2 BMA 3 B BMA 3 B MAN 2032 n 
B 2 MAN 4 B MAN 4 B MAN 2035 n 
B 2 MAN 5 B MAN 5 B MAN 2033 n 
C 3 NAG 1 C NAG 1 C NAG 3030 n 
C 3 NAG 2 C NAG 2 C NAG 3031 n 
C 3 BMA 3 C BMA 3 C MAN 3032 n 
C 3 MAN 4 C MAN 4 C MAN 3033 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
BMA 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpb                         
BMA 'COMMON NAME'                         GMML     1.0 b-D-mannopyranose              
BMA 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Manp                       
BMA 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
MAN 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DManpa                         
MAN 'COMMON NAME'                         GMML     1.0 a-D-mannopyranose              
MAN 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Manp                       
MAN 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Man                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_branch.entity_id 
_pdbx_entity_branch.type 
2 oligosaccharide 
3 oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DManpa1-3[DManpa1-6]DManpb1-4DGlcpNAcb1-4DGlcpNAcb1-'                                                      
'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/3,5,4/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5][a1122h-1a_1-5]/1-1-2-3-3/a4-b1_b4-c1_c3-d1_c6-e1' WURCS PDB2Glycan 
1.1.0 
3 2 '[]{[(4+1)][a-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{[(3+1)][a-D-Manp]{}[(6+1)][a-D-Manp]{}}}}}' LINUCS PDB-CARE   
?     
4 3 DManpa1-6DManpb1-4DGlcpNAcb1-4DGlcpNAcb1-                                                                   
'Glycam Condensed Sequence' GMML       1.0   
5 3 'WURCS=2.0/3,4,3/[a2122h-1b_1-5_2*NCC/3=O][a1122h-1b_1-5][a1122h-1a_1-5]/1-1-2-3/a4-b1_b4-c1_c6-d1'         WURCS PDB2Glycan 
1.1.0 
6 3 '[]{[(4+1)][a-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-Manp]{[(6+1)][a-D-Manp]{}}}}}'                    LINUCS PDB-CARE   
?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
3 2 4 MAN C1 O1 3 BMA O3 HO3 sing ? 
4 2 5 MAN C1 O1 3 BMA O6 HO6 sing ? 
5 3 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
6 3 3 BMA C1 O1 2 NAG O4 HO4 sing ? 
7 3 4 MAN C1 O1 3 BMA O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 BMA 3 n 
2 MAN 4 n 
2 MAN 5 n 
3 NAG 1 n 
3 NAG 2 n 
3 BMA 3 n 
3 MAN 4 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'CALCIUM ION'       CA  
5 12-TUNGSTOPHOSPHATE KEG 
#