data_1N89
# 
_entry.id   1N89 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1N89         
RCSB  RCSB017642   
WWPDB D_1000017642 
BMRB  4977         
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.db_id          4977 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1N89 
_pdbx_database_status.recvd_initial_deposition_date   2002-11-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pons, J.L.'     1 
'de Lamotte, F.' 2 
'Gautier, M.F.'  3 
'Delsuc, M.A.'   4 
# 
_citation.id                        primary 
_citation.title                     'Refined solution structure of a liganded type 2 wheat nonspecific lipid transfer protein.' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            278 
_citation.page_first                14249 
_citation.page_last                 14256 
_citation.year                      2003 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12525478 
_citation.pdbx_database_id_DOI      10.1074/jbc.M211683200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pons, J.L.'     1 ? 
primary 'de Lamotte, F.' 2 ? 
primary 'Gautier, M.F.'  3 ? 
primary 'Delsuc, M.A.'   4 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'lipid transfer protein'                                        6985.943 1 ? ? ? ? 
2 non-polymer syn '1-MYRISTOYL-2-HYDROXY-SN-GLYCERO-3-[PHOSPHO-RAC-(1-GLYCEROL)]' 483.553  1 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRSPHARDTLTSCGLAVPHC 
_entity_poly.pdbx_seq_one_letter_code_can   ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRSPHARDTLTSCGLAVPHC 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  CYS n 
1 3  GLN n 
1 4  ALA n 
1 5  SER n 
1 6  GLN n 
1 7  LEU n 
1 8  ALA n 
1 9  VAL n 
1 10 CYS n 
1 11 ALA n 
1 12 SER n 
1 13 ALA n 
1 14 ILE n 
1 15 LEU n 
1 16 SER n 
1 17 GLY n 
1 18 ALA n 
1 19 LYS n 
1 20 PRO n 
1 21 SER n 
1 22 GLY n 
1 23 GLU n 
1 24 CYS n 
1 25 CYS n 
1 26 GLY n 
1 27 ASN n 
1 28 LEU n 
1 29 ARG n 
1 30 ALA n 
1 31 GLN n 
1 32 GLN n 
1 33 GLY n 
1 34 CYS n 
1 35 PHE n 
1 36 CYS n 
1 37 GLN n 
1 38 TYR n 
1 39 ALA n 
1 40 LYS n 
1 41 ASP n 
1 42 PRO n 
1 43 THR n 
1 44 TYR n 
1 45 GLY n 
1 46 GLN n 
1 47 TYR n 
1 48 ILE n 
1 49 ARG n 
1 50 SER n 
1 51 PRO n 
1 52 HIS n 
1 53 ALA n 
1 54 ARG n 
1 55 ASP n 
1 56 THR n 
1 57 LEU n 
1 58 THR n 
1 59 SER n 
1 60 CYS n 
1 61 GLY n 
1 62 LEU n 
1 63 ALA n 
1 64 VAL n 
1 65 PRO n 
1 66 HIS n 
1 67 CYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'durum wheat' 
_entity_src_gen.gene_src_genus                     Triticum 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   'Triticum turgidum' 
_entity_src_gen.gene_src_strain                    'subsp. durum' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Triticum turgidum subsp. durum' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4567 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Pichia pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     Pichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               GS115 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    NLT2G_WHEAT 
_struct_ref.pdbx_db_accession          P82900 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ACQASQLAVCASAILSGAKPSGECCGNLRAQQGCFCQYAKDPTYGQYIRSPHARDTLTSCGLAVPHC 
_struct_ref.pdbx_align_begin           30 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1N89 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 67 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P82900 
_struct_ref_seq.db_align_beg                  30 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  96 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       67 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                         ?                        'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                        ?                        
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                      ?                        'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                 ?                        'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                        ?                        'C3 H7 N O2 S' 
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                       ?                        'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                 ?                        'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                         ?                        'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                       ?                        
'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                      ?                        'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                         ?                        'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                          ?                        
'C6 H15 N2 O2 1'  147.195 
PGM non-polymer         . '1-MYRISTOYL-2-HYDROXY-SN-GLYCERO-3-[PHOSPHO-RAC-(1-GLYCEROL)]' LYSOPHOSPHATIDYLGLYCEROL 
'C22 H44 O9 P -1' 483.553 
PHE 'L-peptide linking' y PHENYLALANINE                                                   ?                        'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                         ?                        'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                          ?                        'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                       ?                        'C4 H9 N O3' 
119.119 
TYR 'L-peptide linking' y TYROSINE                                                        ?                        'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                          ?                        'C5 H11 N O2' 
117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
1 1 1 DQF-COSY               
2 1 1 '2D NOESY'             
3 1 1 '2D TOCSY'             
4 1 1 3D_15N-separated_NOESY 
5 1 1 3D_15N-HSQC-TOCSY      
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         295.2 
_pdbx_nmr_exptl_sample_conditions.pressure            ambient 
_pdbx_nmr_exptl_sample_conditions.pH                  3.5 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      ? 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         '2.8 mmol 15N-LTP with 1.5 eq PGM' 
_pdbx_nmr_sample_details.solvent_system   '70 mmol Phosphate' 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.model             AMX 
_pdbx_nmr_spectrometer.field_strength    600 
# 
_pdbx_nmr_refine.entry_id           1N89 
_pdbx_nmr_refine.method             'annealing protocol' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1N89 
_pdbx_nmr_ensemble.conformers_calculated_total_number            250 
_pdbx_nmr_ensemble.conformers_submitted_total_number             9 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1N89 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'minimized average structure' 
# 
loop_
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
UXNMR ?  collection      ?                1 
Gifa  V4 'data analysis' ?                2 
CNS   ?  refinement      'Brunger et al.' 3 
# 
_exptl.entry_id          1N89 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1N89 
_struct.title                     'Solution structure of a liganded type 2 wheat non-specific Lipid Transfer Protein' 
_struct.pdbx_descriptor           'lipid transfer protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   'minimized average' 
# 
_struct_keywords.entry_id        1N89 
_struct_keywords.pdbx_keywords   'LIPID TRANSPORT' 
_struct_keywords.text            'lipid transfer protein, LIPID TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 LEU A 7  ? LEU A 15 ? LEU A 7  LEU A 15 1 ? 9  
HELX_P HELX_P2 2 GLY A 22 ? GLN A 31 ? GLY A 22 GLN A 31 1 ? 10 
HELX_P HELX_P3 3 CYS A 34 ? LYS A 40 ? CYS A 34 LYS A 40 1 ? 7  
HELX_P HELX_P4 5 TYR A 44 ? ARG A 49 ? TYR A 44 ARG A 49 1 ? 6  
HELX_P HELX_P5 4 PRO A 51 ? CYS A 60 ? PRO A 51 CYS A 60 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 2  SG ? ? ? 1_555 A CYS 34 SG ? ? A CYS 2  A CYS 34 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2 disulf ? ? A CYS 10 SG ? ? ? 1_555 A CYS 24 SG ? ? A CYS 10 A CYS 24 1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf3 disulf ? ? A CYS 25 SG ? ? ? 1_555 A CYS 60 SG ? ? A CYS 25 A CYS 60 1_555 ? ? ? ? ? ? ? 2.030 ? 
disulf4 disulf ? ? A CYS 36 SG ? ? ? 1_555 A CYS 67 SG ? ? A CYS 36 A CYS 67 1_555 ? ? ? ? ? ? ? 2.030 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    10 
_struct_site.details              'BINDING SITE FOR RESIDUE PGM A 68' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 LEU A 7  ? LEU A 7  . ? 1_555 ? 
2  AC1 10 PHE A 35 ? PHE A 35 . ? 1_555 ? 
3  AC1 10 TYR A 44 ? TYR A 44 . ? 1_555 ? 
4  AC1 10 TYR A 47 ? TYR A 47 . ? 1_555 ? 
5  AC1 10 ILE A 48 ? ILE A 48 . ? 1_555 ? 
6  AC1 10 ARG A 54 ? ARG A 54 . ? 1_555 ? 
7  AC1 10 LEU A 57 ? LEU A 57 . ? 1_555 ? 
8  AC1 10 VAL A 64 ? VAL A 64 . ? 1_555 ? 
9  AC1 10 PRO A 65 ? PRO A 65 . ? 1_555 ? 
10 AC1 10 HIS A 66 ? HIS A 66 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1N89 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1N89 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . ALA A 1 1  ? 14.037  3.118   -0.291  1.00 0.00 ? 1  ALA A N    1 
ATOM   2    C CA   . ALA A 1 1  ? 14.228  4.584   -0.144  1.00 0.00 ? 1  ALA A CA   1 
ATOM   3    C C    . ALA A 1 1  ? 13.019  5.349   -0.672  1.00 0.00 ? 1  ALA A C    1 
ATOM   4    O O    . ALA A 1 1  ? 13.154  6.443   -1.219  1.00 0.00 ? 1  ALA A O    1 
ATOM   5    C CB   . ALA A 1 1  ? 15.489  5.026   -0.870  1.00 0.00 ? 1  ALA A CB   1 
ATOM   6    H H1   . ALA A 1 1  ? 13.388  2.806   0.459   1.00 0.00 ? 1  ALA A H1   1 
ATOM   7    H H2   . ALA A 1 1  ? 14.969  2.666   -0.194  1.00 0.00 ? 1  ALA A H2   1 
ATOM   8    H H3   . ALA A 1 1  ? 13.631  2.943   -1.232  1.00 0.00 ? 1  ALA A H3   1 
ATOM   9    H HA   . ALA A 1 1  ? 14.350  4.807   0.906   1.00 0.00 ? 1  ALA A HA   1 
ATOM   10   H HB1  . ALA A 1 1  ? 16.157  4.184   -0.977  1.00 0.00 ? 1  ALA A HB1  1 
ATOM   11   H HB2  . ALA A 1 1  ? 15.979  5.803   -0.301  1.00 0.00 ? 1  ALA A HB2  1 
ATOM   12   H HB3  . ALA A 1 1  ? 15.229  5.406   -1.847  1.00 0.00 ? 1  ALA A HB3  1 
ATOM   13   N N    . CYS A 1 2  ? 11.837  4.764   -0.505  1.00 0.00 ? 2  CYS A N    1 
ATOM   14   C CA   . CYS A 1 2  ? 10.602  5.391   -0.965  1.00 0.00 ? 2  CYS A CA   1 
ATOM   15   C C    . CYS A 1 2  ? 10.641  5.621   -2.473  1.00 0.00 ? 2  CYS A C    1 
ATOM   16   O O    . CYS A 1 2  ? 11.149  6.638   -2.942  1.00 0.00 ? 2  CYS A O    1 
ATOM   17   C CB   . CYS A 1 2  ? 10.374  6.721   -0.241  1.00 0.00 ? 2  CYS A CB   1 
ATOM   18   S SG   . CYS A 1 2  ? 10.844  6.710   1.521   1.00 0.00 ? 2  CYS A SG   1 
ATOM   19   H H    . CYS A 1 2  ? 11.794  3.892   -0.062  1.00 0.00 ? 2  CYS A H    1 
ATOM   20   H HA   . CYS A 1 2  ? 9.786   4.722   -0.736  1.00 0.00 ? 2  CYS A HA   1 
ATOM   21   H HB2  . CYS A 1 2  ? 10.953  7.491   -0.728  1.00 0.00 ? 2  CYS A HB2  1 
ATOM   22   H HB3  . CYS A 1 2  ? 9.326   6.977   -0.300  1.00 0.00 ? 2  CYS A HB3  1 
ATOM   23   N N    . GLN A 1 3  ? 10.102  4.667   -3.226  1.00 0.00 ? 3  GLN A N    1 
ATOM   24   C CA   . GLN A 1 3  ? 10.078  4.766   -4.681  1.00 0.00 ? 3  GLN A CA   1 
ATOM   25   C C    . GLN A 1 3  ? 8.946   5.675   -5.149  1.00 0.00 ? 3  GLN A C    1 
ATOM   26   O O    . GLN A 1 3  ? 9.124   6.486   -6.058  1.00 0.00 ? 3  GLN A O    1 
ATOM   27   C CB   . GLN A 1 3  ? 9.922   3.377   -5.305  1.00 0.00 ? 3  GLN A CB   1 
ATOM   28   C CG   . GLN A 1 3  ? 11.241  2.742   -5.714  1.00 0.00 ? 3  GLN A CG   1 
ATOM   29   C CD   . GLN A 1 3  ? 11.657  3.119   -7.122  1.00 0.00 ? 3  GLN A CD   1 
ATOM   30   O OE1  . GLN A 1 3  ? 11.140  2.579   -8.100  1.00 0.00 ? 3  GLN A OE1  1 
ATOM   31   N NE2  . GLN A 1 3  ? 12.596  4.052   -7.233  1.00 0.00 ? 3  GLN A NE2  1 
ATOM   32   H H    . GLN A 1 3  ? 9.713   3.878   -2.794  1.00 0.00 ? 3  GLN A H    1 
ATOM   33   H HA   . GLN A 1 3  ? 11.018  5.189   -5.000  1.00 0.00 ? 3  GLN A HA   1 
ATOM   34   H HB2  . GLN A 1 3  ? 9.441   2.726   -4.590  1.00 0.00 ? 3  GLN A HB2  1 
ATOM   35   H HB3  . GLN A 1 3  ? 9.298   3.456   -6.183  1.00 0.00 ? 3  GLN A HB3  1 
ATOM   36   H HG2  . GLN A 1 3  ? 12.010  3.068   -5.029  1.00 0.00 ? 3  GLN A HG2  1 
ATOM   37   H HG3  . GLN A 1 3  ? 11.142  1.668   -5.658  1.00 0.00 ? 3  GLN A HG3  1 
ATOM   38   H HE21 . GLN A 1 3  ? 12.963  4.439   -6.410  1.00 0.00 ? 3  GLN A HE21 1 
ATOM   39   H HE22 . GLN A 1 3  ? 12.884  4.315   -8.132  1.00 0.00 ? 3  GLN A HE22 1 
ATOM   40   N N    . ALA A 1 4  ? 7.780   5.533   -4.526  1.00 0.00 ? 4  ALA A N    1 
ATOM   41   C CA   . ALA A 1 4  ? 6.620   6.340   -4.884  1.00 0.00 ? 4  ALA A CA   1 
ATOM   42   C C    . ALA A 1 4  ? 6.232   6.117   -6.342  1.00 0.00 ? 4  ALA A C    1 
ATOM   43   O O    . ALA A 1 4  ? 5.744   7.027   -7.012  1.00 0.00 ? 4  ALA A O    1 
ATOM   44   C CB   . ALA A 1 4  ? 6.904   7.813   -4.631  1.00 0.00 ? 4  ALA A CB   1 
ATOM   45   H H    . ALA A 1 4  ? 7.698   4.868   -3.811  1.00 0.00 ? 4  ALA A H    1 
ATOM   46   H HA   . ALA A 1 4  ? 5.797   6.042   -4.252  1.00 0.00 ? 4  ALA A HA   1 
ATOM   47   H HB1  . ALA A 1 4  ? 6.001   8.302   -4.298  1.00 0.00 ? 4  ALA A HB1  1 
ATOM   48   H HB2  . ALA A 1 4  ? 7.249   8.276   -5.544  1.00 0.00 ? 4  ALA A HB2  1 
ATOM   49   H HB3  . ALA A 1 4  ? 7.666   7.908   -3.870  1.00 0.00 ? 4  ALA A HB3  1 
ATOM   50   N N    . SER A 1 5  ? 6.455   4.900   -6.825  1.00 0.00 ? 5  SER A N    1 
ATOM   51   C CA   . SER A 1 5  ? 6.132   4.554   -8.206  1.00 0.00 ? 5  SER A CA   1 
ATOM   52   C C    . SER A 1 5  ? 5.748   3.081   -8.334  1.00 0.00 ? 5  SER A C    1 
ATOM   53   O O    . SER A 1 5  ? 4.876   2.725   -9.126  1.00 0.00 ? 5  SER A O    1 
ATOM   54   C CB   . SER A 1 5  ? 7.318   4.862   -9.121  1.00 0.00 ? 5  SER A CB   1 
ATOM   55   O OG   . SER A 1 5  ? 7.225   6.172   -9.654  1.00 0.00 ? 5  SER A OG   1 
ATOM   56   H H    . SER A 1 5  ? 6.848   4.220   -6.241  1.00 0.00 ? 5  SER A H    1 
ATOM   57   H HA   . SER A 1 5  ? 5.290   5.158   -8.510  1.00 0.00 ? 5  SER A HA   1 
ATOM   58   H HB2  . SER A 1 5  ? 8.236   4.783   -8.556  1.00 0.00 ? 5  SER A HB2  1 
ATOM   59   H HB3  . SER A 1 5  ? 7.335   4.154   -9.936  1.00 0.00 ? 5  SER A HB3  1 
ATOM   60   H HG   . SER A 1 5  ? 7.565   6.177   -10.552 1.00 0.00 ? 5  SER A HG   1 
ATOM   61   N N    . GLN A 1 6  ? 6.404   2.227   -7.552  1.00 0.00 ? 6  GLN A N    1 
ATOM   62   C CA   . GLN A 1 6  ? 6.133   0.801   -7.580  1.00 0.00 ? 6  GLN A CA   1 
ATOM   63   C C    . GLN A 1 6  ? 4.728   0.497   -7.068  1.00 0.00 ? 6  GLN A C    1 
ATOM   64   O O    . GLN A 1 6  ? 4.214   -0.606  -7.252  1.00 0.00 ? 6  GLN A O    1 
ATOM   65   C CB   . GLN A 1 6  ? 7.168   0.052   -6.738  1.00 0.00 ? 6  GLN A CB   1 
ATOM   66   C CG   . GLN A 1 6  ? 8.437   -0.293  -7.500  1.00 0.00 ? 6  GLN A CG   1 
ATOM   67   C CD   . GLN A 1 6  ? 9.242   -1.386  -6.825  1.00 0.00 ? 6  GLN A CD   1 
ATOM   68   O OE1  . GLN A 1 6  ? 9.569   -1.292  -5.642  1.00 0.00 ? 6  GLN A OE1  1 
ATOM   69   N NE2  . GLN A 1 6  ? 9.567   -2.431  -7.576  1.00 0.00 ? 6  GLN A NE2  1 
ATOM   70   H H    . GLN A 1 6  ? 7.085   2.562   -6.944  1.00 0.00 ? 6  GLN A H    1 
ATOM   71   H HA   . GLN A 1 6  ? 6.213   0.477   -8.601  1.00 0.00 ? 6  GLN A HA   1 
ATOM   72   H HB2  . GLN A 1 6  ? 7.438   0.666   -5.891  1.00 0.00 ? 6  GLN A HB2  1 
ATOM   73   H HB3  . GLN A 1 6  ? 6.728   -0.866  -6.380  1.00 0.00 ? 6  GLN A HB3  1 
ATOM   74   H HG2  . GLN A 1 6  ? 8.168   -0.626  -8.491  1.00 0.00 ? 6  GLN A HG2  1 
ATOM   75   H HG3  . GLN A 1 6  ? 9.050   0.593   -7.573  1.00 0.00 ? 6  GLN A HG3  1 
ATOM   76   H HE21 . GLN A 1 6  ? 9.273   -2.439  -8.511  1.00 0.00 ? 6  GLN A HE21 1 
ATOM   77   H HE22 . GLN A 1 6  ? 10.087  -3.153  -7.165  1.00 0.00 ? 6  GLN A HE22 1 
ATOM   78   N N    . LEU A 1 7  ? 4.118   1.480   -6.414  1.00 0.00 ? 7  LEU A N    1 
ATOM   79   C CA   . LEU A 1 7  ? 2.780   1.320   -5.862  1.00 0.00 ? 7  LEU A CA   1 
ATOM   80   C C    . LEU A 1 7  ? 1.754   2.126   -6.655  1.00 0.00 ? 7  LEU A C    1 
ATOM   81   O O    . LEU A 1 7  ? 0.556   1.851   -6.595  1.00 0.00 ? 7  LEU A O    1 
ATOM   82   C CB   . LEU A 1 7  ? 2.764   1.753   -4.393  1.00 0.00 ? 7  LEU A CB   1 
ATOM   83   C CG   . LEU A 1 7  ? 4.110   1.645   -3.667  1.00 0.00 ? 7  LEU A CG   1 
ATOM   84   C CD1  . LEU A 1 7  ? 4.127   2.544   -2.440  1.00 0.00 ? 7  LEU A CD1  1 
ATOM   85   C CD2  . LEU A 1 7  ? 4.393   0.199   -3.279  1.00 0.00 ? 7  LEU A CD2  1 
ATOM   86   H H    . LEU A 1 7  ? 4.582   2.333   -6.290  1.00 0.00 ? 7  LEU A H    1 
ATOM   87   H HA   . LEU A 1 7  ? 2.520   0.273   -5.920  1.00 0.00 ? 7  LEU A HA   1 
ATOM   88   H HB2  . LEU A 1 7  ? 2.435   2.781   -4.347  1.00 0.00 ? 7  LEU A HB2  1 
ATOM   89   H HB3  . LEU A 1 7  ? 2.048   1.140   -3.867  1.00 0.00 ? 7  LEU A HB3  1 
ATOM   90   H HG   . LEU A 1 7  ? 4.900   1.975   -4.333  1.00 0.00 ? 7  LEU A HG   1 
ATOM   91   H HD11 . LEU A 1 7  ? 5.148   2.720   -2.136  1.00 0.00 ? 7  LEU A HD11 1 
ATOM   92   H HD12 . LEU A 1 7  ? 3.589   2.065   -1.636  1.00 0.00 ? 7  LEU A HD12 1 
ATOM   93   H HD13 . LEU A 1 7  ? 3.655   3.486   -2.678  1.00 0.00 ? 7  LEU A HD13 1 
ATOM   94   H HD21 . LEU A 1 7  ? 5.300   -0.133  -3.763  1.00 0.00 ? 7  LEU A HD21 1 
ATOM   95   H HD22 . LEU A 1 7  ? 3.570   -0.427  -3.591  1.00 0.00 ? 7  LEU A HD22 1 
ATOM   96   H HD23 . LEU A 1 7  ? 4.511   0.128   -2.208  1.00 0.00 ? 7  LEU A HD23 1 
ATOM   97   N N    . ALA A 1 8  ? 2.229   3.126   -7.398  1.00 0.00 ? 8  ALA A N    1 
ATOM   98   C CA   . ALA A 1 8  ? 1.350   3.971   -8.198  1.00 0.00 ? 8  ALA A CA   1 
ATOM   99   C C    . ALA A 1 8  ? 0.371   3.140   -9.017  1.00 0.00 ? 8  ALA A C    1 
ATOM   100  O O    . ALA A 1 8  ? -0.817  3.451   -9.095  1.00 0.00 ? 8  ALA A O    1 
ATOM   101  C CB   . ALA A 1 8  ? 2.170   4.873   -9.108  1.00 0.00 ? 8  ALA A CB   1 
ATOM   102  H H    . ALA A 1 8  ? 3.191   3.301   -7.405  1.00 0.00 ? 8  ALA A H    1 
ATOM   103  H HA   . ALA A 1 8  ? 0.793   4.592   -7.525  1.00 0.00 ? 8  ALA A HA   1 
ATOM   104  H HB1  . ALA A 1 8  ? 2.953   5.346   -8.535  1.00 0.00 ? 8  ALA A HB1  1 
ATOM   105  H HB2  . ALA A 1 8  ? 1.530   5.631   -9.536  1.00 0.00 ? 8  ALA A HB2  1 
ATOM   106  H HB3  . ALA A 1 8  ? 2.609   4.284   -9.900  1.00 0.00 ? 8  ALA A HB3  1 
ATOM   107  N N    . VAL A 1 9  ? 0.885   2.083   -9.620  1.00 0.00 ? 9  VAL A N    1 
ATOM   108  C CA   . VAL A 1 9  ? 0.075   1.191   -10.436 1.00 0.00 ? 9  VAL A CA   1 
ATOM   109  C C    . VAL A 1 9  ? -1.103  0.633   -9.641  1.00 0.00 ? 9  VAL A C    1 
ATOM   110  O O    . VAL A 1 9  ? -2.129  0.257   -10.208 1.00 0.00 ? 9  VAL A O    1 
ATOM   111  C CB   . VAL A 1 9  ? 0.913   0.022   -10.992 1.00 0.00 ? 9  VAL A CB   1 
ATOM   112  C CG1  . VAL A 1 9  ? 1.475   -0.822  -9.858  1.00 0.00 ? 9  VAL A CG1  1 
ATOM   113  C CG2  . VAL A 1 9  ? 0.085   -0.829  -11.946 1.00 0.00 ? 9  VAL A CG2  1 
ATOM   114  H H    . VAL A 1 9  ? 1.835   1.898   -9.513  1.00 0.00 ? 9  VAL A H    1 
ATOM   115  H HA   . VAL A 1 9  ? -0.302  1.761   -11.264 1.00 0.00 ? 9  VAL A HA   1 
ATOM   116  H HB   . VAL A 1 9  ? 1.744   0.436   -11.545 1.00 0.00 ? 9  VAL A HB   1 
ATOM   117  H HG11 . VAL A 1 9  ? 0.683   -1.413  -9.422  1.00 0.00 ? 9  VAL A HG11 1 
ATOM   118  H HG12 . VAL A 1 9  ? 1.899   -0.176  -9.103  1.00 0.00 ? 9  VAL A HG12 1 
ATOM   119  H HG13 . VAL A 1 9  ? 2.243   -1.478  -10.242 1.00 0.00 ? 9  VAL A HG13 1 
ATOM   120  H HG21 . VAL A 1 9  ? 0.491   -0.750  -12.943 1.00 0.00 ? 9  VAL A HG21 1 
ATOM   121  H HG22 . VAL A 1 9  ? -0.938  -0.482  -11.945 1.00 0.00 ? 9  VAL A HG22 1 
ATOM   122  H HG23 . VAL A 1 9  ? 0.114   -1.861  -11.627 1.00 0.00 ? 9  VAL A HG23 1 
ATOM   123  N N    . CYS A 1 10 ? -0.942  0.584   -8.325  1.00 0.00 ? 10 CYS A N    1 
ATOM   124  C CA   . CYS A 1 10 ? -1.982  0.075   -7.438  1.00 0.00 ? 10 CYS A CA   1 
ATOM   125  C C    . CYS A 1 10 ? -2.928  1.192   -7.026  1.00 0.00 ? 10 CYS A C    1 
ATOM   126  O O    . CYS A 1 10 ? -4.112  0.963   -6.780  1.00 0.00 ? 10 CYS A O    1 
ATOM   127  C CB   . CYS A 1 10 ? -1.350  -0.535  -6.193  1.00 0.00 ? 10 CYS A CB   1 
ATOM   128  S SG   . CYS A 1 10 ? -2.372  -1.812  -5.390  1.00 0.00 ? 10 CYS A SG   1 
ATOM   129  H H    . CYS A 1 10 ? -0.100  0.900   -7.939  1.00 0.00 ? 10 CYS A H    1 
ATOM   130  H HA   . CYS A 1 10 ? -2.536  -0.685  -7.967  1.00 0.00 ? 10 CYS A HA   1 
ATOM   131  H HB2  . CYS A 1 10 ? -0.408  -0.981  -6.464  1.00 0.00 ? 10 CYS A HB2  1 
ATOM   132  H HB3  . CYS A 1 10 ? -1.177  0.249   -5.468  1.00 0.00 ? 10 CYS A HB3  1 
ATOM   133  N N    . ALA A 1 11 ? -2.385  2.401   -6.950  1.00 0.00 ? 11 ALA A N    1 
ATOM   134  C CA   . ALA A 1 11 ? -3.158  3.580   -6.564  1.00 0.00 ? 11 ALA A CA   1 
ATOM   135  C C    . ALA A 1 11 ? -4.518  3.599   -7.246  1.00 0.00 ? 11 ALA A C    1 
ATOM   136  O O    . ALA A 1 11 ? -5.496  4.110   -6.700  1.00 0.00 ? 11 ALA A O    1 
ATOM   137  C CB   . ALA A 1 11 ? -2.384  4.848   -6.892  1.00 0.00 ? 11 ALA A CB   1 
ATOM   138  H H    . ALA A 1 11 ? -1.435  2.501   -7.157  1.00 0.00 ? 11 ALA A H    1 
ATOM   139  H HA   . ALA A 1 11 ? -3.306  3.543   -5.500  1.00 0.00 ? 11 ALA A HA   1 
ATOM   140  H HB1  . ALA A 1 11 ? -1.384  4.774   -6.491  1.00 0.00 ? 11 ALA A HB1  1 
ATOM   141  H HB2  . ALA A 1 11 ? -2.885  5.699   -6.455  1.00 0.00 ? 11 ALA A HB2  1 
ATOM   142  H HB3  . ALA A 1 11 ? -2.333  4.972   -7.964  1.00 0.00 ? 11 ALA A HB3  1 
ATOM   143  N N    . SER A 1 12 ? -4.567  3.031   -8.440  1.00 0.00 ? 12 SER A N    1 
ATOM   144  C CA   . SER A 1 12 ? -5.801  2.967   -9.208  1.00 0.00 ? 12 SER A CA   1 
ATOM   145  C C    . SER A 1 12 ? -6.911  2.308   -8.395  1.00 0.00 ? 12 SER A C    1 
ATOM   146  O O    . SER A 1 12 ? -8.079  2.681   -8.500  1.00 0.00 ? 12 SER A O    1 
ATOM   147  C CB   . SER A 1 12 ? -5.578  2.196   -10.510 1.00 0.00 ? 12 SER A CB   1 
ATOM   148  O OG   . SER A 1 12 ? -4.516  2.758   -11.261 1.00 0.00 ? 12 SER A OG   1 
ATOM   149  H H    . SER A 1 12 ? -3.753  2.643   -8.812  1.00 0.00 ? 12 SER A H    1 
ATOM   150  H HA   . SER A 1 12 ? -6.091  3.977   -9.444  1.00 0.00 ? 12 SER A HA   1 
ATOM   151  H HB2  . SER A 1 12 ? -5.335  1.169   -10.281 1.00 0.00 ? 12 SER A HB2  1 
ATOM   152  H HB3  . SER A 1 12 ? -6.479  2.228   -11.104 1.00 0.00 ? 12 SER A HB3  1 
ATOM   153  H HG   . SER A 1 12 ? -4.629  3.710   -11.313 1.00 0.00 ? 12 SER A HG   1 
ATOM   154  N N    . ALA A 1 13 ? -6.534  1.324   -7.585  1.00 0.00 ? 13 ALA A N    1 
ATOM   155  C CA   . ALA A 1 13 ? -7.486  0.608   -6.752  1.00 0.00 ? 13 ALA A CA   1 
ATOM   156  C C    . ALA A 1 13 ? -7.745  1.349   -5.444  1.00 0.00 ? 13 ALA A C    1 
ATOM   157  O O    . ALA A 1 13 ? -8.887  1.464   -5.000  1.00 0.00 ? 13 ALA A O    1 
ATOM   158  C CB   . ALA A 1 13 ? -6.986  -0.801  -6.472  1.00 0.00 ? 13 ALA A CB   1 
ATOM   159  H H    . ALA A 1 13 ? -5.593  1.072   -7.548  1.00 0.00 ? 13 ALA A H    1 
ATOM   160  H HA   . ALA A 1 13 ? -8.408  0.533   -7.302  1.00 0.00 ? 13 ALA A HA   1 
ATOM   161  H HB1  . ALA A 1 13 ? -6.458  -0.815  -5.530  1.00 0.00 ? 13 ALA A HB1  1 
ATOM   162  H HB2  . ALA A 1 13 ? -6.318  -1.110  -7.263  1.00 0.00 ? 13 ALA A HB2  1 
ATOM   163  H HB3  . ALA A 1 13 ? -7.825  -1.479  -6.425  1.00 0.00 ? 13 ALA A HB3  1 
ATOM   164  N N    . ILE A 1 14 ? -6.676  1.851   -4.830  1.00 0.00 ? 14 ILE A N    1 
ATOM   165  C CA   . ILE A 1 14 ? -6.792  2.581   -3.573  1.00 0.00 ? 14 ILE A CA   1 
ATOM   166  C C    . ILE A 1 14 ? -7.660  3.825   -3.744  1.00 0.00 ? 14 ILE A C    1 
ATOM   167  O O    . ILE A 1 14 ? -8.621  4.031   -3.004  1.00 0.00 ? 14 ILE A O    1 
ATOM   168  C CB   . ILE A 1 14 ? -5.404  2.998   -3.028  1.00 0.00 ? 14 ILE A CB   1 
ATOM   169  C CG1  . ILE A 1 14 ? -4.589  1.766   -2.621  1.00 0.00 ? 14 ILE A CG1  1 
ATOM   170  C CG2  . ILE A 1 14 ? -5.552  3.945   -1.844  1.00 0.00 ? 14 ILE A CG2  1 
ATOM   171  C CD1  . ILE A 1 14 ? -3.889  1.091   -3.781  1.00 0.00 ? 14 ILE A CD1  1 
ATOM   172  H H    . ILE A 1 14 ? -5.792  1.728   -5.233  1.00 0.00 ? 14 ILE A H    1 
ATOM   173  H HA   . ILE A 1 14 ? -7.257  1.926   -2.850  1.00 0.00 ? 14 ILE A HA   1 
ATOM   174  H HB   . ILE A 1 14 ? -4.880  3.523   -3.812  1.00 0.00 ? 14 ILE A HB   1 
ATOM   175  H HG12 . ILE A 1 14 ? -3.833  2.066   -1.907  1.00 0.00 ? 14 ILE A HG12 1 
ATOM   176  H HG13 . ILE A 1 14 ? -5.246  1.042   -2.159  1.00 0.00 ? 14 ILE A HG13 1 
ATOM   177  H HG21 . ILE A 1 14 ? -4.883  3.640   -1.053  1.00 0.00 ? 14 ILE A HG21 1 
ATOM   178  H HG22 . ILE A 1 14 ? -6.570  3.917   -1.485  1.00 0.00 ? 14 ILE A HG22 1 
ATOM   179  H HG23 . ILE A 1 14 ? -5.307  4.950   -2.155  1.00 0.00 ? 14 ILE A HG23 1 
ATOM   180  H HD11 . ILE A 1 14 ? -4.558  0.378   -4.240  1.00 0.00 ? 14 ILE A HD11 1 
ATOM   181  H HD12 . ILE A 1 14 ? -3.009  0.578   -3.421  1.00 0.00 ? 14 ILE A HD12 1 
ATOM   182  H HD13 . ILE A 1 14 ? -3.600  1.834   -4.510  1.00 0.00 ? 14 ILE A HD13 1 
ATOM   183  N N    . LEU A 1 15 ? -7.309  4.655   -4.722  1.00 0.00 ? 15 LEU A N    1 
ATOM   184  C CA   . LEU A 1 15 ? -8.052  5.883   -4.985  1.00 0.00 ? 15 LEU A CA   1 
ATOM   185  C C    . LEU A 1 15 ? -9.394  5.583   -5.650  1.00 0.00 ? 15 LEU A C    1 
ATOM   186  O O    . LEU A 1 15 ? -10.431 5.557   -4.989  1.00 0.00 ? 15 LEU A O    1 
ATOM   187  C CB   . LEU A 1 15 ? -7.227  6.823   -5.867  1.00 0.00 ? 15 LEU A CB   1 
ATOM   188  C CG   . LEU A 1 15 ? -6.161  7.634   -5.128  1.00 0.00 ? 15 LEU A CG   1 
ATOM   189  C CD1  . LEU A 1 15 ? -5.338  8.453   -6.110  1.00 0.00 ? 15 LEU A CD1  1 
ATOM   190  C CD2  . LEU A 1 15 ? -6.806  8.536   -4.087  1.00 0.00 ? 15 LEU A CD2  1 
ATOM   191  H H    . LEU A 1 15 ? -6.530  4.439   -5.276  1.00 0.00 ? 15 LEU A H    1 
ATOM   192  H HA   . LEU A 1 15 ? -8.237  6.365   -4.037  1.00 0.00 ? 15 LEU A HA   1 
ATOM   193  H HB2  . LEU A 1 15 ? -6.739  6.232   -6.628  1.00 0.00 ? 15 LEU A HB2  1 
ATOM   194  H HB3  . LEU A 1 15 ? -7.902  7.514   -6.350  1.00 0.00 ? 15 LEU A HB3  1 
ATOM   195  H HG   . LEU A 1 15 ? -5.493  6.956   -4.618  1.00 0.00 ? 15 LEU A HG   1 
ATOM   196  H HD11 . LEU A 1 15 ? -5.946  8.706   -6.966  1.00 0.00 ? 15 LEU A HD11 1 
ATOM   197  H HD12 . LEU A 1 15 ? -4.484  7.876   -6.434  1.00 0.00 ? 15 LEU A HD12 1 
ATOM   198  H HD13 . LEU A 1 15 ? -4.999  9.358   -5.629  1.00 0.00 ? 15 LEU A HD13 1 
ATOM   199  H HD21 . LEU A 1 15 ? -6.225  9.441   -3.986  1.00 0.00 ? 15 LEU A HD21 1 
ATOM   200  H HD22 . LEU A 1 15 ? -6.840  8.022   -3.138  1.00 0.00 ? 15 LEU A HD22 1 
ATOM   201  H HD23 . LEU A 1 15 ? -7.809  8.785   -4.398  1.00 0.00 ? 15 LEU A HD23 1 
ATOM   202  N N    . SER A 1 16 ? -9.368  5.361   -6.961  1.00 0.00 ? 16 SER A N    1 
ATOM   203  C CA   . SER A 1 16 ? -10.584 5.069   -7.710  1.00 0.00 ? 16 SER A CA   1 
ATOM   204  C C    . SER A 1 16 ? -11.256 3.803   -7.187  1.00 0.00 ? 16 SER A C    1 
ATOM   205  O O    . SER A 1 16 ? -12.270 3.868   -6.492  1.00 0.00 ? 16 SER A O    1 
ATOM   206  C CB   . SER A 1 16 ? -10.268 4.917   -9.199  1.00 0.00 ? 16 SER A CB   1 
ATOM   207  O OG   . SER A 1 16 ? -11.373 4.376   -9.903  1.00 0.00 ? 16 SER A OG   1 
ATOM   208  H H    . SER A 1 16 ? -8.511  5.398   -7.436  1.00 0.00 ? 16 SER A H    1 
ATOM   209  H HA   . SER A 1 16 ? -11.261 5.900   -7.579  1.00 0.00 ? 16 SER A HA   1 
ATOM   210  H HB2  . SER A 1 16 ? -10.031 5.884   -9.615  1.00 0.00 ? 16 SER A HB2  1 
ATOM   211  H HB3  . SER A 1 16 ? -9.422  4.256   -9.320  1.00 0.00 ? 16 SER A HB3  1 
ATOM   212  H HG   . SER A 1 16 ? -11.207 4.426   -10.847 1.00 0.00 ? 16 SER A HG   1 
ATOM   213  N N    . GLY A 1 17 ? -10.684 2.652   -7.526  1.00 0.00 ? 17 GLY A N    1 
ATOM   214  C CA   . GLY A 1 17 ? -11.242 1.388   -7.082  1.00 0.00 ? 17 GLY A CA   1 
ATOM   215  C C    . GLY A 1 17 ? -11.609 0.476   -8.236  1.00 0.00 ? 17 GLY A C    1 
ATOM   216  O O    . GLY A 1 17 ? -12.616 -0.230  -8.182  1.00 0.00 ? 17 GLY A O    1 
ATOM   217  H H    . GLY A 1 17 ? -9.877  2.661   -8.082  1.00 0.00 ? 17 GLY A H    1 
ATOM   218  H HA2  . GLY A 1 17 ? -10.516 0.886   -6.459  1.00 0.00 ? 17 GLY A HA2  1 
ATOM   219  H HA3  . GLY A 1 17 ? -12.128 1.583   -6.496  1.00 0.00 ? 17 GLY A HA3  1 
ATOM   220  N N    . ALA A 1 18 ? -10.789 0.491   -9.283  1.00 0.00 ? 18 ALA A N    1 
ATOM   221  C CA   . ALA A 1 18 ? -11.032 -0.342  -10.455 1.00 0.00 ? 18 ALA A CA   1 
ATOM   222  C C    . ALA A 1 18 ? -11.091 -1.814  -10.078 1.00 0.00 ? 18 ALA A C    1 
ATOM   223  O O    . ALA A 1 18 ? -12.167 -2.407  -9.994  1.00 0.00 ? 18 ALA A O    1 
ATOM   224  C CB   . ALA A 1 18 ? -9.954  -0.104  -11.503 1.00 0.00 ? 18 ALA A CB   1 
ATOM   225  H H    . ALA A 1 18 ? -10.002 1.074   -9.266  1.00 0.00 ? 18 ALA A H    1 
ATOM   226  H HA   . ALA A 1 18 ? -11.976 -0.056  -10.876 1.00 0.00 ? 18 ALA A HA   1 
ATOM   227  H HB1  . ALA A 1 18 ? -9.794  -1.011  -12.067 1.00 0.00 ? 18 ALA A HB1  1 
ATOM   228  H HB2  . ALA A 1 18 ? -9.035  0.183   -11.015 1.00 0.00 ? 18 ALA A HB2  1 
ATOM   229  H HB3  . ALA A 1 18 ? -10.269 0.685   -12.170 1.00 0.00 ? 18 ALA A HB3  1 
ATOM   230  N N    . LYS A 1 19 ? -9.925  -2.392  -9.852  1.00 0.00 ? 19 LYS A N    1 
ATOM   231  C CA   . LYS A 1 19 ? -9.820  -3.795  -9.479  1.00 0.00 ? 19 LYS A CA   1 
ATOM   232  C C    . LYS A 1 19 ? -8.423  -4.113  -8.948  1.00 0.00 ? 19 LYS A C    1 
ATOM   233  O O    . LYS A 1 19 ? -7.424  -3.652  -9.500  1.00 0.00 ? 19 LYS A O    1 
ATOM   234  C CB   . LYS A 1 19 ? -10.141 -4.693  -10.676 1.00 0.00 ? 19 LYS A CB   1 
ATOM   235  C CG   . LYS A 1 19 ? -9.526  -4.212  -11.982 1.00 0.00 ? 19 LYS A CG   1 
ATOM   236  C CD   . LYS A 1 19 ? -10.585 -3.690  -12.940 1.00 0.00 ? 19 LYS A CD   1 
ATOM   237  C CE   . LYS A 1 19 ? -9.997  -2.707  -13.939 1.00 0.00 ? 19 LYS A CE   1 
ATOM   238  N NZ   . LYS A 1 19 ? -9.726  -3.348  -15.256 1.00 0.00 ? 19 LYS A NZ   1 
ATOM   239  H H    . LYS A 1 19 ? -9.115  -1.858  -9.936  1.00 0.00 ? 19 LYS A H    1 
ATOM   240  H HA   . LYS A 1 19 ? -10.540 -3.979  -8.700  1.00 0.00 ? 19 LYS A HA   1 
ATOM   241  H HB2  . LYS A 1 19 ? -9.770  -5.687  -10.475 1.00 0.00 ? 19 LYS A HB2  1 
ATOM   242  H HB3  . LYS A 1 19 ? -11.213 -4.737  -10.802 1.00 0.00 ? 19 LYS A HB3  1 
ATOM   243  H HG2  . LYS A 1 19 ? -8.827  -3.417  -11.768 1.00 0.00 ? 19 LYS A HG2  1 
ATOM   244  H HG3  . LYS A 1 19 ? -9.005  -5.036  -12.448 1.00 0.00 ? 19 LYS A HG3  1 
ATOM   245  H HD2  . LYS A 1 19 ? -11.011 -4.523  -13.479 1.00 0.00 ? 19 LYS A HD2  1 
ATOM   246  H HD3  . LYS A 1 19 ? -11.357 -3.194  -12.371 1.00 0.00 ? 19 LYS A HD3  1 
ATOM   247  H HE2  . LYS A 1 19 ? -10.696 -1.896  -14.081 1.00 0.00 ? 19 LYS A HE2  1 
ATOM   248  H HE3  . LYS A 1 19 ? -9.072  -2.318  -13.541 1.00 0.00 ? 19 LYS A HE3  1 
ATOM   249  H HZ1  . LYS A 1 19 ? -10.327 -4.189  -15.375 1.00 0.00 ? 19 LYS A HZ1  1 
ATOM   250  H HZ2  . LYS A 1 19 ? -8.729  -3.636  -15.316 1.00 0.00 ? 19 LYS A HZ2  1 
ATOM   251  H HZ3  . LYS A 1 19 ? -9.928  -2.679  -16.027 1.00 0.00 ? 19 LYS A HZ3  1 
ATOM   252  N N    . PRO A 1 20 ? -8.333  -4.908  -7.866  1.00 0.00 ? 20 PRO A N    1 
ATOM   253  C CA   . PRO A 1 20 ? -7.046  -5.281  -7.268  1.00 0.00 ? 20 PRO A CA   1 
ATOM   254  C C    . PRO A 1 20 ? -6.090  -5.892  -8.286  1.00 0.00 ? 20 PRO A C    1 
ATOM   255  O O    . PRO A 1 20 ? -6.364  -5.898  -9.486  1.00 0.00 ? 20 PRO A O    1 
ATOM   256  C CB   . PRO A 1 20 ? -7.429  -6.316  -6.208  1.00 0.00 ? 20 PRO A CB   1 
ATOM   257  C CG   . PRO A 1 20 ? -8.847  -6.010  -5.871  1.00 0.00 ? 20 PRO A CG   1 
ATOM   258  C CD   . PRO A 1 20 ? -9.471  -5.503  -7.141  1.00 0.00 ? 20 PRO A CD   1 
ATOM   259  H HA   . PRO A 1 20 ? -6.571  -4.434  -6.794  1.00 0.00 ? 20 PRO A HA   1 
ATOM   260  H HB2  . PRO A 1 20 ? -7.325  -7.310  -6.618  1.00 0.00 ? 20 PRO A HB2  1 
ATOM   261  H HB3  . PRO A 1 20 ? -6.787  -6.208  -5.346  1.00 0.00 ? 20 PRO A HB3  1 
ATOM   262  H HG2  . PRO A 1 20 ? -9.348  -6.907  -5.539  1.00 0.00 ? 20 PRO A HG2  1 
ATOM   263  H HG3  . PRO A 1 20 ? -8.887  -5.251  -5.105  1.00 0.00 ? 20 PRO A HG3  1 
ATOM   264  H HD2  . PRO A 1 20 ? -9.903  -6.319  -7.702  1.00 0.00 ? 20 PRO A HD2  1 
ATOM   265  H HD3  . PRO A 1 20 ? -10.220 -4.757  -6.920  1.00 0.00 ? 20 PRO A HD3  1 
ATOM   266  N N    . SER A 1 21 ? -4.967  -6.408  -7.798  1.00 0.00 ? 21 SER A N    1 
ATOM   267  C CA   . SER A 1 21 ? -3.969  -7.024  -8.663  1.00 0.00 ? 21 SER A CA   1 
ATOM   268  C C    . SER A 1 21 ? -2.851  -7.654  -7.838  1.00 0.00 ? 21 SER A C    1 
ATOM   269  O O    . SER A 1 21 ? -2.426  -7.100  -6.825  1.00 0.00 ? 21 SER A O    1 
ATOM   270  C CB   . SER A 1 21 ? -3.387  -5.988  -9.626  1.00 0.00 ? 21 SER A CB   1 
ATOM   271  O OG   . SER A 1 21 ? -4.094  -5.979  -10.854 1.00 0.00 ? 21 SER A OG   1 
ATOM   272  H H    . SER A 1 21 ? -4.806  -6.374  -6.833  1.00 0.00 ? 21 SER A H    1 
ATOM   273  H HA   . SER A 1 21 ? -4.459  -7.798  -9.234  1.00 0.00 ? 21 SER A HA   1 
ATOM   274  H HB2  . SER A 1 21 ? -3.454  -5.007  -9.180  1.00 0.00 ? 21 SER A HB2  1 
ATOM   275  H HB3  . SER A 1 21 ? -2.351  -6.223  -9.823  1.00 0.00 ? 21 SER A HB3  1 
ATOM   276  H HG   . SER A 1 21 ? -4.119  -6.868  -11.216 1.00 0.00 ? 21 SER A HG   1 
ATOM   277  N N    . GLY A 1 22 ? -2.381  -8.816  -8.278  1.00 0.00 ? 22 GLY A N    1 
ATOM   278  C CA   . GLY A 1 22 ? -1.318  -9.502  -7.568  1.00 0.00 ? 22 GLY A CA   1 
ATOM   279  C C    . GLY A 1 22 ? -0.012  -8.733  -7.591  1.00 0.00 ? 22 GLY A C    1 
ATOM   280  O O    . GLY A 1 22 ? 0.666   -8.618  -6.571  1.00 0.00 ? 22 GLY A O    1 
ATOM   281  H H    . GLY A 1 22 ? -2.759  -9.211  -9.092  1.00 0.00 ? 22 GLY A H    1 
ATOM   282  H HA2  . GLY A 1 22 ? -1.621  -9.643  -6.540  1.00 0.00 ? 22 GLY A HA2  1 
ATOM   283  H HA3  . GLY A 1 22 ? -1.162  -10.469 -8.022  1.00 0.00 ? 22 GLY A HA3  1 
ATOM   284  N N    . GLU A 1 23 ? 0.343   -8.205  -8.759  1.00 0.00 ? 23 GLU A N    1 
ATOM   285  C CA   . GLU A 1 23 ? 1.570   -7.447  -8.921  1.00 0.00 ? 23 GLU A CA   1 
ATOM   286  C C    . GLU A 1 23 ? 1.711   -6.392  -7.828  1.00 0.00 ? 23 GLU A C    1 
ATOM   287  O O    . GLU A 1 23 ? 2.813   -6.117  -7.353  1.00 0.00 ? 23 GLU A O    1 
ATOM   288  C CB   . GLU A 1 23 ? 1.576   -6.781  -10.293 1.00 0.00 ? 23 GLU A CB   1 
ATOM   289  C CG   . GLU A 1 23 ? 2.967   -6.509  -10.816 1.00 0.00 ? 23 GLU A CG   1 
ATOM   290  C CD   . GLU A 1 23 ? 3.076   -5.178  -11.533 1.00 0.00 ? 23 GLU A CD   1 
ATOM   291  O OE1  . GLU A 1 23 ? 2.768   -5.128  -12.743 1.00 0.00 ? 23 GLU A OE1  1 
ATOM   292  O OE2  . GLU A 1 23 ? 3.471   -4.185  -10.886 1.00 0.00 ? 23 GLU A OE2  1 
ATOM   293  H H    . GLU A 1 23 ? -0.233  -8.330  -9.538  1.00 0.00 ? 23 GLU A H    1 
ATOM   294  H HA   . GLU A 1 23 ? 2.400   -8.134  -8.858  1.00 0.00 ? 23 GLU A HA   1 
ATOM   295  H HB2  . GLU A 1 23 ? 1.067   -7.425  -10.997 1.00 0.00 ? 23 GLU A HB2  1 
ATOM   296  H HB3  . GLU A 1 23 ? 1.048   -5.839  -10.226 1.00 0.00 ? 23 GLU A HB3  1 
ATOM   297  H HG2  . GLU A 1 23 ? 3.652   -6.514  -9.984  1.00 0.00 ? 23 GLU A HG2  1 
ATOM   298  H HG3  . GLU A 1 23 ? 3.229   -7.298  -11.503 1.00 0.00 ? 23 GLU A HG3  1 
ATOM   299  N N    . CYS A 1 24 ? 0.585   -5.805  -7.437  1.00 0.00 ? 24 CYS A N    1 
ATOM   300  C CA   . CYS A 1 24 ? 0.572   -4.778  -6.403  1.00 0.00 ? 24 CYS A CA   1 
ATOM   301  C C    . CYS A 1 24 ? 1.257   -5.263  -5.134  1.00 0.00 ? 24 CYS A C    1 
ATOM   302  O O    . CYS A 1 24 ? 2.275   -4.715  -4.711  1.00 0.00 ? 24 CYS A O    1 
ATOM   303  C CB   . CYS A 1 24 ? -0.867  -4.355  -6.092  1.00 0.00 ? 24 CYS A CB   1 
ATOM   304  S SG   . CYS A 1 24 ? -1.016  -3.164  -4.718  1.00 0.00 ? 24 CYS A SG   1 
ATOM   305  H H    . CYS A 1 24 ? -0.258  -6.067  -7.856  1.00 0.00 ? 24 CYS A H    1 
ATOM   306  H HA   . CYS A 1 24 ? 1.108   -3.934  -6.780  1.00 0.00 ? 24 CYS A HA   1 
ATOM   307  H HB2  . CYS A 1 24 ? -1.296  -3.896  -6.970  1.00 0.00 ? 24 CYS A HB2  1 
ATOM   308  H HB3  . CYS A 1 24 ? -1.443  -5.231  -5.832  1.00 0.00 ? 24 CYS A HB3  1 
ATOM   309  N N    . CYS A 1 25 ? 0.683   -6.289  -4.534  1.00 0.00 ? 25 CYS A N    1 
ATOM   310  C CA   . CYS A 1 25 ? 1.219   -6.863  -3.304  1.00 0.00 ? 25 CYS A CA   1 
ATOM   311  C C    . CYS A 1 25 ? 2.693   -7.232  -3.461  1.00 0.00 ? 25 CYS A C    1 
ATOM   312  O O    . CYS A 1 25 ? 3.436   -7.287  -2.483  1.00 0.00 ? 25 CYS A O    1 
ATOM   313  C CB   . CYS A 1 25 ? 0.401   -8.091  -2.890  1.00 0.00 ? 25 CYS A CB   1 
ATOM   314  S SG   . CYS A 1 25 ? 0.771   -9.607  -3.835  1.00 0.00 ? 25 CYS A SG   1 
ATOM   315  H H    . CYS A 1 25 ? -0.126  -6.668  -4.929  1.00 0.00 ? 25 CYS A H    1 
ATOM   316  H HA   . CYS A 1 25 ? 1.134   -6.113  -2.531  1.00 0.00 ? 25 CYS A HA   1 
ATOM   317  H HB2  . CYS A 1 25 ? 0.589   -8.302  -1.849  1.00 0.00 ? 25 CYS A HB2  1 
ATOM   318  H HB3  . CYS A 1 25 ? -0.648  -7.872  -3.021  1.00 0.00 ? 25 CYS A HB3  1 
ATOM   319  N N    . GLY A 1 26 ? 3.108   -7.484  -4.698  1.00 0.00 ? 26 GLY A N    1 
ATOM   320  C CA   . GLY A 1 26 ? 4.491   -7.840  -4.958  1.00 0.00 ? 26 GLY A CA   1 
ATOM   321  C C    . GLY A 1 26 ? 5.405   -6.629  -5.003  1.00 0.00 ? 26 GLY A C    1 
ATOM   322  O O    . GLY A 1 26 ? 6.545   -6.685  -4.542  1.00 0.00 ? 26 GLY A O    1 
ATOM   323  H H    . GLY A 1 26 ? 2.471   -7.426  -5.440  1.00 0.00 ? 26 GLY A H    1 
ATOM   324  H HA2  . GLY A 1 26 ? 4.832   -8.506  -4.180  1.00 0.00 ? 26 GLY A HA2  1 
ATOM   325  H HA3  . GLY A 1 26 ? 4.546   -8.354  -5.906  1.00 0.00 ? 26 GLY A HA3  1 
ATOM   326  N N    . ASN A 1 27 ? 4.905   -5.535  -5.572  1.00 0.00 ? 27 ASN A N    1 
ATOM   327  C CA   . ASN A 1 27 ? 5.678   -4.307  -5.692  1.00 0.00 ? 27 ASN A CA   1 
ATOM   328  C C    . ASN A 1 27 ? 6.172   -3.822  -4.339  1.00 0.00 ? 27 ASN A C    1 
ATOM   329  O O    . ASN A 1 27 ? 7.353   -3.521  -4.163  1.00 0.00 ? 27 ASN A O    1 
ATOM   330  C CB   . ASN A 1 27 ? 4.837   -3.217  -6.358  1.00 0.00 ? 27 ASN A CB   1 
ATOM   331  C CG   . ASN A 1 27 ? 4.548   -3.518  -7.815  1.00 0.00 ? 27 ASN A CG   1 
ATOM   332  O OD1  . ASN A 1 27 ? 3.424   -3.862  -8.180  1.00 0.00 ? 27 ASN A OD1  1 
ATOM   333  N ND2  . ASN A 1 27 ? 5.565   -3.387  -8.658  1.00 0.00 ? 27 ASN A ND2  1 
ATOM   334  H H    . ASN A 1 27 ? 3.997   -5.557  -5.927  1.00 0.00 ? 27 ASN A H    1 
ATOM   335  H HA   . ASN A 1 27 ? 6.523   -4.519  -6.309  1.00 0.00 ? 27 ASN A HA   1 
ATOM   336  H HB2  . ASN A 1 27 ? 3.896   -3.127  -5.836  1.00 0.00 ? 27 ASN A HB2  1 
ATOM   337  H HB3  . ASN A 1 27 ? 5.366   -2.278  -6.301  1.00 0.00 ? 27 ASN A HB3  1 
ATOM   338  H HD21 . ASN A 1 27 ? 6.433   -3.107  -8.298  1.00 0.00 ? 27 ASN A HD21 1 
ATOM   339  H HD22 . ASN A 1 27 ? 5.408   -3.577  -9.606  1.00 0.00 ? 27 ASN A HD22 1 
ATOM   340  N N    . LEU A 1 28 ? 5.255   -3.741  -3.391  1.00 0.00 ? 28 LEU A N    1 
ATOM   341  C CA   . LEU A 1 28 ? 5.576   -3.282  -2.045  1.00 0.00 ? 28 LEU A CA   1 
ATOM   342  C C    . LEU A 1 28 ? 6.764   -4.040  -1.470  1.00 0.00 ? 28 LEU A C    1 
ATOM   343  O O    . LEU A 1 28 ? 7.601   -3.470  -0.770  1.00 0.00 ? 28 LEU A O    1 
ATOM   344  C CB   . LEU A 1 28 ? 4.364   -3.434  -1.127  1.00 0.00 ? 28 LEU A CB   1 
ATOM   345  C CG   . LEU A 1 28 ? 3.974   -4.875  -0.824  1.00 0.00 ? 28 LEU A CG   1 
ATOM   346  C CD1  . LEU A 1 28 ? 4.708   -5.380  0.408   1.00 0.00 ? 28 LEU A CD1  1 
ATOM   347  C CD2  . LEU A 1 28 ? 2.468   -4.996  -0.643  1.00 0.00 ? 28 LEU A CD2  1 
ATOM   348  H H    . LEU A 1 28 ? 4.338   -3.991  -3.607  1.00 0.00 ? 28 LEU A H    1 
ATOM   349  H HA   . LEU A 1 28 ? 5.832   -2.248  -2.110  1.00 0.00 ? 28 LEU A HA   1 
ATOM   350  H HB2  . LEU A 1 28 ? 4.581   -2.935  -0.193  1.00 0.00 ? 28 LEU A HB2  1 
ATOM   351  H HB3  . LEU A 1 28 ? 3.521   -2.944  -1.591  1.00 0.00 ? 28 LEU A HB3  1 
ATOM   352  H HG   . LEU A 1 28 ? 4.263   -5.493  -1.660  1.00 0.00 ? 28 LEU A HG   1 
ATOM   353  H HD11 . LEU A 1 28 ? 4.029   -5.404  1.248   1.00 0.00 ? 28 LEU A HD11 1 
ATOM   354  H HD12 . LEU A 1 28 ? 5.534   -4.720  0.632   1.00 0.00 ? 28 LEU A HD12 1 
ATOM   355  H HD13 . LEU A 1 28 ? 5.084   -6.375  0.221   1.00 0.00 ? 28 LEU A HD13 1 
ATOM   356  H HD21 . LEU A 1 28 ? 1.968   -4.339  -1.340  1.00 0.00 ? 28 LEU A HD21 1 
ATOM   357  H HD22 . LEU A 1 28 ? 2.203   -4.718  0.366   1.00 0.00 ? 28 LEU A HD22 1 
ATOM   358  H HD23 . LEU A 1 28 ? 2.163   -6.015  -0.827  1.00 0.00 ? 28 LEU A HD23 1 
ATOM   359  N N    . ARG A 1 29 ? 6.826   -5.330  -1.766  1.00 0.00 ? 29 ARG A N    1 
ATOM   360  C CA   . ARG A 1 29 ? 7.902   -6.177  -1.279  1.00 0.00 ? 29 ARG A CA   1 
ATOM   361  C C    . ARG A 1 29 ? 9.256   -5.610  -1.639  1.00 0.00 ? 29 ARG A C    1 
ATOM   362  O O    . ARG A 1 29 ? 10.145  -5.512  -0.793  1.00 0.00 ? 29 ARG A O    1 
ATOM   363  C CB   . ARG A 1 29 ? 7.750   -7.592  -1.826  1.00 0.00 ? 29 ARG A CB   1 
ATOM   364  C CG   . ARG A 1 29 ? 6.431   -8.230  -1.440  1.00 0.00 ? 29 ARG A CG   1 
ATOM   365  C CD   . ARG A 1 29 ? 6.536   -8.952  -0.114  1.00 0.00 ? 29 ARG A CD   1 
ATOM   366  N NE   . ARG A 1 29 ? 7.553   -10.001 -0.140  1.00 0.00 ? 29 ARG A NE   1 
ATOM   367  C CZ   . ARG A 1 29 ? 7.313   -11.263 -0.489  1.00 0.00 ? 29 ARG A CZ   1 
ATOM   368  N NH1  . ARG A 1 29 ? 6.095   -11.642 -0.858  1.00 0.00 ? 29 ARG A NH1  1 
ATOM   369  N NH2  . ARG A 1 29 ? 8.299   -12.151 -0.476  1.00 0.00 ? 29 ARG A NH2  1 
ATOM   370  H H    . ARG A 1 29 ? 6.128   -5.722  -2.318  1.00 0.00 ? 29 ARG A H    1 
ATOM   371  H HA   . ARG A 1 29 ? 7.825   -6.201  -0.220  1.00 0.00 ? 29 ARG A HA   1 
ATOM   372  H HB2  . ARG A 1 29 ? 7.813   -7.561  -2.904  1.00 0.00 ? 29 ARG A HB2  1 
ATOM   373  H HB3  . ARG A 1 29 ? 8.551   -8.206  -1.441  1.00 0.00 ? 29 ARG A HB3  1 
ATOM   374  H HG2  . ARG A 1 29 ? 5.686   -7.456  -1.351  1.00 0.00 ? 29 ARG A HG2  1 
ATOM   375  H HG3  . ARG A 1 29 ? 6.141   -8.934  -2.205  1.00 0.00 ? 29 ARG A HG3  1 
ATOM   376  H HD2  . ARG A 1 29 ? 6.791   -8.230  0.646   1.00 0.00 ? 29 ARG A HD2  1 
ATOM   377  H HD3  . ARG A 1 29 ? 5.580   -9.392  0.117   1.00 0.00 ? 29 ARG A HD3  1 
ATOM   378  H HE   . ARG A 1 29 ? 8.464   -9.751  0.118   1.00 0.00 ? 29 ARG A HE   1 
ATOM   379  H HH11 . ARG A 1 29 ? 5.348   -10.979 -0.876  1.00 0.00 ? 29 ARG A HH11 1 
ATOM   380  H HH12 . ARG A 1 29 ? 5.925   -12.592 -1.118  1.00 0.00 ? 29 ARG A HH12 1 
ATOM   381  H HH21 . ARG A 1 29 ? 9.220   -11.871 -0.205  1.00 0.00 ? 29 ARG A HH21 1 
ATOM   382  H HH22 . ARG A 1 29 ? 8.121   -13.099 -0.738  1.00 0.00 ? 29 ARG A HH22 1 
ATOM   383  N N    . ALA A 1 30 ? 9.403   -5.215  -2.888  1.00 0.00 ? 30 ALA A N    1 
ATOM   384  C CA   . ALA A 1 30 ? 10.649  -4.629  -3.343  1.00 0.00 ? 30 ALA A CA   1 
ATOM   385  C C    . ALA A 1 30 ? 11.054  -3.499  -2.406  1.00 0.00 ? 30 ALA A C    1 
ATOM   386  O O    . ALA A 1 30 ? 12.238  -3.210  -2.226  1.00 0.00 ? 30 ALA A O    1 
ATOM   387  C CB   . ALA A 1 30 ? 10.514  -4.123  -4.772  1.00 0.00 ? 30 ALA A CB   1 
ATOM   388  H H    . ALA A 1 30 ? 8.654   -5.303  -3.505  1.00 0.00 ? 30 ALA A H    1 
ATOM   389  H HA   . ALA A 1 30 ? 11.402  -5.395  -3.320  1.00 0.00 ? 30 ALA A HA   1 
ATOM   390  H HB1  . ALA A 1 30 ? 9.693   -3.424  -4.830  1.00 0.00 ? 30 ALA A HB1  1 
ATOM   391  H HB2  . ALA A 1 30 ? 10.326  -4.956  -5.432  1.00 0.00 ? 30 ALA A HB2  1 
ATOM   392  H HB3  . ALA A 1 30 ? 11.428  -3.629  -5.066  1.00 0.00 ? 30 ALA A HB3  1 
ATOM   393  N N    . GLN A 1 31 ? 10.047  -2.881  -1.796  1.00 0.00 ? 31 GLN A N    1 
ATOM   394  C CA   . GLN A 1 31 ? 10.262  -1.796  -0.850  1.00 0.00 ? 31 GLN A CA   1 
ATOM   395  C C    . GLN A 1 31 ? 10.605  -2.350  0.526   1.00 0.00 ? 31 GLN A C    1 
ATOM   396  O O    . GLN A 1 31 ? 11.754  -2.297  0.964   1.00 0.00 ? 31 GLN A O    1 
ATOM   397  C CB   . GLN A 1 31 ? 9.024   -0.897  -0.771  1.00 0.00 ? 31 GLN A CB   1 
ATOM   398  C CG   . GLN A 1 31 ? 8.366   -0.647  -2.117  1.00 0.00 ? 31 GLN A CG   1 
ATOM   399  C CD   . GLN A 1 31 ? 7.723   0.723   -2.204  1.00 0.00 ? 31 GLN A CD   1 
ATOM   400  O OE1  . GLN A 1 31 ? 6.579   0.912   -1.793  1.00 0.00 ? 31 GLN A OE1  1 
ATOM   401  N NE2  . GLN A 1 31 ? 8.460   1.687   -2.741  1.00 0.00 ? 31 GLN A NE2  1 
ATOM   402  H H    . GLN A 1 31 ? 9.129   -3.186  -1.970  1.00 0.00 ? 31 GLN A H    1 
ATOM   403  H HA   . GLN A 1 31 ? 11.097  -1.211  -1.203  1.00 0.00 ? 31 GLN A HA   1 
ATOM   404  H HB2  . GLN A 1 31 ? 8.297   -1.357  -0.120  1.00 0.00 ? 31 GLN A HB2  1 
ATOM   405  H HB3  . GLN A 1 31 ? 9.313   0.057   -0.355  1.00 0.00 ? 31 GLN A HB3  1 
ATOM   406  H HG2  . GLN A 1 31 ? 9.115   -0.726  -2.890  1.00 0.00 ? 31 GLN A HG2  1 
ATOM   407  H HG3  . GLN A 1 31 ? 7.605   -1.397  -2.277  1.00 0.00 ? 31 GLN A HG3  1 
ATOM   408  H HE21 . GLN A 1 31 ? 9.368   1.461   -3.048  1.00 0.00 ? 31 GLN A HE21 1 
ATOM   409  H HE22 . GLN A 1 31 ? 8.067   2.586   -2.810  1.00 0.00 ? 31 GLN A HE22 1 
ATOM   410  N N    . GLN A 1 32 ? 9.588   -2.881  1.204   1.00 0.00 ? 32 GLN A N    1 
ATOM   411  C CA   . GLN A 1 32 ? 9.753   -3.451  2.537   1.00 0.00 ? 32 GLN A CA   1 
ATOM   412  C C    . GLN A 1 32 ? 10.515  -2.504  3.464   1.00 0.00 ? 32 GLN A C    1 
ATOM   413  O O    . GLN A 1 32 ? 11.052  -2.922  4.490   1.00 0.00 ? 32 GLN A O    1 
ATOM   414  C CB   . GLN A 1 32 ? 10.470  -4.792  2.439   1.00 0.00 ? 32 GLN A CB   1 
ATOM   415  C CG   . GLN A 1 32 ? 9.793   -5.903  3.225   1.00 0.00 ? 32 GLN A CG   1 
ATOM   416  C CD   . GLN A 1 32 ? 9.739   -7.209  2.456   1.00 0.00 ? 32 GLN A CD   1 
ATOM   417  O OE1  . GLN A 1 32 ? 10.595  -8.077  2.627   1.00 0.00 ? 32 GLN A OE1  1 
ATOM   418  N NE2  . GLN A 1 32 ? 8.732   -7.356  1.601   1.00 0.00 ? 32 GLN A NE2  1 
ATOM   419  H H    . GLN A 1 32 ? 8.700   -2.892  0.794   1.00 0.00 ? 32 GLN A H    1 
ATOM   420  H HA   . GLN A 1 32 ? 8.768   -3.614  2.947   1.00 0.00 ? 32 GLN A HA   1 
ATOM   421  H HB2  . GLN A 1 32 ? 10.505  -5.086  1.401   1.00 0.00 ? 32 GLN A HB2  1 
ATOM   422  H HB3  . GLN A 1 32 ? 11.477  -4.677  2.808   1.00 0.00 ? 32 GLN A HB3  1 
ATOM   423  H HG2  . GLN A 1 32 ? 10.340  -6.064  4.141   1.00 0.00 ? 32 GLN A HG2  1 
ATOM   424  H HG3  . GLN A 1 32 ? 8.783   -5.597  3.458   1.00 0.00 ? 32 GLN A HG3  1 
ATOM   425  H HE21 . GLN A 1 32 ? 8.085   -6.625  1.513   1.00 0.00 ? 32 GLN A HE21 1 
ATOM   426  H HE22 . GLN A 1 32 ? 8.679   -8.189  1.090   1.00 0.00 ? 32 GLN A HE22 1 
ATOM   427  N N    . GLY A 1 33 ? 10.546  -1.228  3.099   1.00 0.00 ? 33 GLY A N    1 
ATOM   428  C CA   . GLY A 1 33 ? 11.227  -0.232  3.904   1.00 0.00 ? 33 GLY A CA   1 
ATOM   429  C C    . GLY A 1 33 ? 10.344  0.970   4.164   1.00 0.00 ? 33 GLY A C    1 
ATOM   430  O O    . GLY A 1 33 ? 9.704   1.063   5.212   1.00 0.00 ? 33 GLY A O    1 
ATOM   431  H H    . GLY A 1 33 ? 10.092  -0.957  2.276   1.00 0.00 ? 33 GLY A H    1 
ATOM   432  H HA2  . GLY A 1 33 ? 11.509  -0.675  4.848   1.00 0.00 ? 33 GLY A HA2  1 
ATOM   433  H HA3  . GLY A 1 33 ? 12.117  0.091   3.385   1.00 0.00 ? 33 GLY A HA3  1 
ATOM   434  N N    . CYS A 1 34 ? 10.294  1.885   3.202   1.00 0.00 ? 34 CYS A N    1 
ATOM   435  C CA   . CYS A 1 34 ? 9.470   3.073   3.324   1.00 0.00 ? 34 CYS A CA   1 
ATOM   436  C C    . CYS A 1 34 ? 8.007   2.685   3.454   1.00 0.00 ? 34 CYS A C    1 
ATOM   437  O O    . CYS A 1 34 ? 7.233   3.330   4.159   1.00 0.00 ? 34 CYS A O    1 
ATOM   438  C CB   . CYS A 1 34 ? 9.663   3.979   2.119   1.00 0.00 ? 34 CYS A CB   1 
ATOM   439  S SG   . CYS A 1 34 ? 9.309   5.740   2.430   1.00 0.00 ? 34 CYS A SG   1 
ATOM   440  H H    . CYS A 1 34 ? 10.815  1.751   2.388   1.00 0.00 ? 34 CYS A H    1 
ATOM   441  H HA   . CYS A 1 34 ? 9.771   3.589   4.197   1.00 0.00 ? 34 CYS A HA   1 
ATOM   442  H HB2  . CYS A 1 34 ? 10.685  3.900   1.778   1.00 0.00 ? 34 CYS A HB2  1 
ATOM   443  H HB3  . CYS A 1 34 ? 9.004   3.649   1.346   1.00 0.00 ? 34 CYS A HB3  1 
ATOM   444  N N    . PHE A 1 35 ? 7.649   1.612   2.767   1.00 0.00 ? 35 PHE A N    1 
ATOM   445  C CA   . PHE A 1 35 ? 6.288   1.090   2.784   1.00 0.00 ? 35 PHE A CA   1 
ATOM   446  C C    . PHE A 1 35 ? 5.849   0.793   4.213   1.00 0.00 ? 35 PHE A C    1 
ATOM   447  O O    . PHE A 1 35 ? 4.694   1.004   4.582   1.00 0.00 ? 35 PHE A O    1 
ATOM   448  C CB   . PHE A 1 35 ? 6.226   -0.169  1.904   1.00 0.00 ? 35 PHE A CB   1 
ATOM   449  C CG   . PHE A 1 35 ? 5.257   -1.233  2.352   1.00 0.00 ? 35 PHE A CG   1 
ATOM   450  C CD1  . PHE A 1 35 ? 3.974   -0.909  2.764   1.00 0.00 ? 35 PHE A CD1  1 
ATOM   451  C CD2  . PHE A 1 35 ? 5.639   -2.566  2.351   1.00 0.00 ? 35 PHE A CD2  1 
ATOM   452  C CE1  . PHE A 1 35 ? 3.092   -1.895  3.167   1.00 0.00 ? 35 PHE A CE1  1 
ATOM   453  C CE2  . PHE A 1 35 ? 4.763   -3.555  2.752   1.00 0.00 ? 35 PHE A CE2  1 
ATOM   454  C CZ   . PHE A 1 35 ? 3.488   -3.220  3.160   1.00 0.00 ? 35 PHE A CZ   1 
ATOM   455  H H    . PHE A 1 35 ? 8.329   1.152   2.233   1.00 0.00 ? 35 PHE A H    1 
ATOM   456  H HA   . PHE A 1 35 ? 5.641   1.842   2.374   1.00 0.00 ? 35 PHE A HA   1 
ATOM   457  H HB2  . PHE A 1 35 ? 5.950   0.120   0.903   1.00 0.00 ? 35 PHE A HB2  1 
ATOM   458  H HB3  . PHE A 1 35 ? 7.212   -0.613  1.881   1.00 0.00 ? 35 PHE A HB3  1 
ATOM   459  H HD1  . PHE A 1 35 ? 3.664   0.126   2.769   1.00 0.00 ? 35 PHE A HD1  1 
ATOM   460  H HD2  . PHE A 1 35 ? 6.637   -2.829  2.031   1.00 0.00 ? 35 PHE A HD2  1 
ATOM   461  H HE1  . PHE A 1 35 ? 2.095   -1.631  3.485   1.00 0.00 ? 35 PHE A HE1  1 
ATOM   462  H HE2  . PHE A 1 35 ? 5.075   -4.590  2.742   1.00 0.00 ? 35 PHE A HE2  1 
ATOM   463  H HZ   . PHE A 1 35 ? 2.802   -3.991  3.476   1.00 0.00 ? 35 PHE A HZ   1 
ATOM   464  N N    . CYS A 1 36 ? 6.786   0.306   5.006   1.00 0.00 ? 36 CYS A N    1 
ATOM   465  C CA   . CYS A 1 36 ? 6.517   -0.024  6.402   1.00 0.00 ? 36 CYS A CA   1 
ATOM   466  C C    . CYS A 1 36 ? 6.349   1.241   7.243   1.00 0.00 ? 36 CYS A C    1 
ATOM   467  O O    . CYS A 1 36 ? 5.369   1.385   7.974   1.00 0.00 ? 36 CYS A O    1 
ATOM   468  C CB   . CYS A 1 36 ? 7.647   -0.883  6.972   1.00 0.00 ? 36 CYS A CB   1 
ATOM   469  S SG   . CYS A 1 36 ? 7.082   -2.215  8.080   1.00 0.00 ? 36 CYS A SG   1 
ATOM   470  H H    . CYS A 1 36 ? 7.683   0.166   4.641   1.00 0.00 ? 36 CYS A H    1 
ATOM   471  H HA   . CYS A 1 36 ? 5.597   -0.588  6.436   1.00 0.00 ? 36 CYS A HA   1 
ATOM   472  H HB2  . CYS A 1 36 ? 8.187   -1.342  6.157   1.00 0.00 ? 36 CYS A HB2  1 
ATOM   473  H HB3  . CYS A 1 36 ? 8.321   -0.253  7.534   1.00 0.00 ? 36 CYS A HB3  1 
ATOM   474  N N    . GLN A 1 37 ? 7.313   2.151   7.138   1.00 0.00 ? 37 GLN A N    1 
ATOM   475  C CA   . GLN A 1 37 ? 7.276   3.395   7.887   1.00 0.00 ? 37 GLN A CA   1 
ATOM   476  C C    . GLN A 1 37 ? 6.189   4.324   7.360   1.00 0.00 ? 37 GLN A C    1 
ATOM   477  O O    . GLN A 1 37 ? 5.705   5.199   8.078   1.00 0.00 ? 37 GLN A O    1 
ATOM   478  C CB   . GLN A 1 37 ? 8.635   4.097   7.838   1.00 0.00 ? 37 GLN A CB   1 
ATOM   479  C CG   . GLN A 1 37 ? 9.179   4.286   6.432   1.00 0.00 ? 37 GLN A CG   1 
ATOM   480  C CD   . GLN A 1 37 ? 10.109  5.480   6.321   1.00 0.00 ? 37 GLN A CD   1 
ATOM   481  O OE1  . GLN A 1 37 ? 10.222  6.279   7.250   1.00 0.00 ? 37 GLN A OE1  1 
ATOM   482  N NE2  . GLN A 1 37 ? 10.783  5.609   5.181   1.00 0.00 ? 37 GLN A NE2  1 
ATOM   483  H H    . GLN A 1 37 ? 8.064   1.982   6.549   1.00 0.00 ? 37 GLN A H    1 
ATOM   484  H HA   . GLN A 1 37 ? 7.052   3.144   8.904   1.00 0.00 ? 37 GLN A HA   1 
ATOM   485  H HB2  . GLN A 1 37 ? 8.540   5.070   8.296   1.00 0.00 ? 37 GLN A HB2  1 
ATOM   486  H HB3  . GLN A 1 37 ? 9.349   3.514   8.401   1.00 0.00 ? 37 GLN A HB3  1 
ATOM   487  H HG2  . GLN A 1 37 ? 9.724   3.398   6.149   1.00 0.00 ? 37 GLN A HG2  1 
ATOM   488  H HG3  . GLN A 1 37 ? 8.350   4.429   5.755   1.00 0.00 ? 37 GLN A HG3  1 
ATOM   489  H HE21 . GLN A 1 37 ? 10.646  4.936   4.482   1.00 0.00 ? 37 GLN A HE21 1 
ATOM   490  H HE22 . GLN A 1 37 ? 11.389  6.373   5.086   1.00 0.00 ? 37 GLN A HE22 1 
ATOM   491  N N    . TYR A 1 38 ? 5.803   4.122   6.105   1.00 0.00 ? 38 TYR A N    1 
ATOM   492  C CA   . TYR A 1 38 ? 4.765   4.937   5.483   1.00 0.00 ? 38 TYR A CA   1 
ATOM   493  C C    . TYR A 1 38 ? 3.491   4.923   6.323   1.00 0.00 ? 38 TYR A C    1 
ATOM   494  O O    . TYR A 1 38 ? 2.661   5.827   6.227   1.00 0.00 ? 38 TYR A O    1 
ATOM   495  C CB   . TYR A 1 38 ? 4.468   4.429   4.069   1.00 0.00 ? 38 TYR A CB   1 
ATOM   496  C CG   . TYR A 1 38 ? 4.903   5.380   2.978   1.00 0.00 ? 38 TYR A CG   1 
ATOM   497  C CD1  . TYR A 1 38 ? 4.450   6.693   2.952   1.00 0.00 ? 38 TYR A CD1  1 
ATOM   498  C CD2  . TYR A 1 38 ? 5.768   4.965   1.972   1.00 0.00 ? 38 TYR A CD2  1 
ATOM   499  C CE1  . TYR A 1 38 ? 4.845   7.565   1.955   1.00 0.00 ? 38 TYR A CE1  1 
ATOM   500  C CE2  . TYR A 1 38 ? 6.168   5.831   0.973   1.00 0.00 ? 38 TYR A CE2  1 
ATOM   501  C CZ   . TYR A 1 38 ? 5.704   7.129   0.969   1.00 0.00 ? 38 TYR A CZ   1 
ATOM   502  O OH   . TYR A 1 38 ? 6.100   7.995   -0.025  1.00 0.00 ? 38 TYR A OH   1 
ATOM   503  H H    . TYR A 1 38 ? 6.223   3.406   5.586   1.00 0.00 ? 38 TYR A H    1 
ATOM   504  H HA   . TYR A 1 38 ? 5.131   5.951   5.422   1.00 0.00 ? 38 TYR A HA   1 
ATOM   505  H HB2  . TYR A 1 38 ? 4.982   3.492   3.916   1.00 0.00 ? 38 TYR A HB2  1 
ATOM   506  H HB3  . TYR A 1 38 ? 3.404   4.270   3.966   1.00 0.00 ? 38 TYR A HB3  1 
ATOM   507  H HD1  . TYR A 1 38 ? 3.778   7.031   3.727   1.00 0.00 ? 38 TYR A HD1  1 
ATOM   508  H HD2  . TYR A 1 38 ? 6.129   3.947   1.978   1.00 0.00 ? 38 TYR A HD2  1 
ATOM   509  H HE1  . TYR A 1 38 ? 4.482   8.582   1.953   1.00 0.00 ? 38 TYR A HE1  1 
ATOM   510  H HE2  . TYR A 1 38 ? 6.840   5.489   0.200   1.00 0.00 ? 38 TYR A HE2  1 
ATOM   511  H HH   . TYR A 1 38 ? 5.639   7.780   -0.840  1.00 0.00 ? 38 TYR A HH   1 
ATOM   512  N N    . ALA A 1 39 ? 3.344   3.889   7.148   1.00 0.00 ? 39 ALA A N    1 
ATOM   513  C CA   . ALA A 1 39 ? 2.175   3.752   8.005   1.00 0.00 ? 39 ALA A CA   1 
ATOM   514  C C    . ALA A 1 39 ? 1.979   4.977   8.895   1.00 0.00 ? 39 ALA A C    1 
ATOM   515  O O    . ALA A 1 39 ? 0.886   5.210   9.411   1.00 0.00 ? 39 ALA A O    1 
ATOM   516  C CB   . ALA A 1 39 ? 2.291   2.497   8.855   1.00 0.00 ? 39 ALA A CB   1 
ATOM   517  H H    . ALA A 1 39 ? 4.036   3.198   7.178   1.00 0.00 ? 39 ALA A H    1 
ATOM   518  H HA   . ALA A 1 39 ? 1.317   3.643   7.368   1.00 0.00 ? 39 ALA A HA   1 
ATOM   519  H HB1  . ALA A 1 39 ? 1.328   2.263   9.285   1.00 0.00 ? 39 ALA A HB1  1 
ATOM   520  H HB2  . ALA A 1 39 ? 3.008   2.662   9.646   1.00 0.00 ? 39 ALA A HB2  1 
ATOM   521  H HB3  . ALA A 1 39 ? 2.619   1.673   8.238   1.00 0.00 ? 39 ALA A HB3  1 
ATOM   522  N N    . LYS A 1 40 ? 3.040   5.758   9.073   1.00 0.00 ? 40 LYS A N    1 
ATOM   523  C CA   . LYS A 1 40 ? 2.977   6.957   9.902   1.00 0.00 ? 40 LYS A CA   1 
ATOM   524  C C    . LYS A 1 40 ? 2.692   8.192   9.056   1.00 0.00 ? 40 LYS A C    1 
ATOM   525  O O    . LYS A 1 40 ? 2.188   9.198   9.555   1.00 0.00 ? 40 LYS A O    1 
ATOM   526  C CB   . LYS A 1 40 ? 4.287   7.142   10.670  1.00 0.00 ? 40 LYS A CB   1 
ATOM   527  C CG   . LYS A 1 40 ? 4.134   7.958   11.945  1.00 0.00 ? 40 LYS A CG   1 
ATOM   528  C CD   . LYS A 1 40 ? 4.584   7.175   13.168  1.00 0.00 ? 40 LYS A CD   1 
ATOM   529  C CE   . LYS A 1 40 ? 3.681   5.981   13.430  1.00 0.00 ? 40 LYS A CE   1 
ATOM   530  N NZ   . LYS A 1 40 ? 3.863   5.436   14.803  1.00 0.00 ? 40 LYS A NZ   1 
ATOM   531  H H    . LYS A 1 40 ? 3.884   5.524   8.637   1.00 0.00 ? 40 LYS A H    1 
ATOM   532  H HA   . LYS A 1 40 ? 2.173   6.828   10.607  1.00 0.00 ? 40 LYS A HA   1 
ATOM   533  H HB2  . LYS A 1 40 ? 4.678   6.170   10.932  1.00 0.00 ? 40 LYS A HB2  1 
ATOM   534  H HB3  . LYS A 1 40 ? 4.997   7.645   10.030  1.00 0.00 ? 40 LYS A HB3  1 
ATOM   535  H HG2  . LYS A 1 40 ? 4.733   8.852   11.862  1.00 0.00 ? 40 LYS A HG2  1 
ATOM   536  H HG3  . LYS A 1 40 ? 3.095   8.229   12.064  1.00 0.00 ? 40 LYS A HG3  1 
ATOM   537  H HD2  . LYS A 1 40 ? 5.592   6.822   13.007  1.00 0.00 ? 40 LYS A HD2  1 
ATOM   538  H HD3  . LYS A 1 40 ? 4.562   7.828   14.029  1.00 0.00 ? 40 LYS A HD3  1 
ATOM   539  H HE2  . LYS A 1 40 ? 2.653   6.290   13.308  1.00 0.00 ? 40 LYS A HE2  1 
ATOM   540  H HE3  . LYS A 1 40 ? 3.911   5.208   12.711  1.00 0.00 ? 40 LYS A HE3  1 
ATOM   541  H HZ1  . LYS A 1 40 ? 4.801   4.995   14.891  1.00 0.00 ? 40 LYS A HZ1  1 
ATOM   542  H HZ2  . LYS A 1 40 ? 3.136   4.721   15.004  1.00 0.00 ? 40 LYS A HZ2  1 
ATOM   543  H HZ3  . LYS A 1 40 ? 3.784   6.201   15.504  1.00 0.00 ? 40 LYS A HZ3  1 
ATOM   544  N N    . ASP A 1 41 ? 3.016   8.105   7.772   1.00 0.00 ? 41 ASP A N    1 
ATOM   545  C CA   . ASP A 1 41 ? 2.797   9.209   6.847   1.00 0.00 ? 41 ASP A CA   1 
ATOM   546  C C    . ASP A 1 41 ? 1.321   9.617   6.828   1.00 0.00 ? 41 ASP A C    1 
ATOM   547  O O    . ASP A 1 41 ? 0.459   8.829   6.442   1.00 0.00 ? 41 ASP A O    1 
ATOM   548  C CB   . ASP A 1 41 ? 3.252   8.805   5.443   1.00 0.00 ? 41 ASP A CB   1 
ATOM   549  C CG   . ASP A 1 41 ? 3.063   9.913   4.425   1.00 0.00 ? 41 ASP A CG   1 
ATOM   550  O OD1  . ASP A 1 41 ? 1.936   10.442  4.324   1.00 0.00 ? 41 ASP A OD1  1 
ATOM   551  O OD2  . ASP A 1 41 ? 4.042   10.252  3.728   1.00 0.00 ? 41 ASP A OD2  1 
ATOM   552  H H    . ASP A 1 41 ? 3.413   7.275   7.437   1.00 0.00 ? 41 ASP A H    1 
ATOM   553  H HA   . ASP A 1 41 ? 3.391   10.045  7.181   1.00 0.00 ? 41 ASP A HA   1 
ATOM   554  H HB2  . ASP A 1 41 ? 4.302   8.549   5.474   1.00 0.00 ? 41 ASP A HB2  1 
ATOM   555  H HB3  . ASP A 1 41 ? 2.682   7.942   5.124   1.00 0.00 ? 41 ASP A HB3  1 
ATOM   556  N N    . PRO A 1 42 ? 1.008   10.857  7.253   1.00 0.00 ? 42 PRO A N    1 
ATOM   557  C CA   . PRO A 1 42 ? -0.371  11.354  7.287   1.00 0.00 ? 42 PRO A CA   1 
ATOM   558  C C    . PRO A 1 42 ? -0.900  11.720  5.903   1.00 0.00 ? 42 PRO A C    1 
ATOM   559  O O    . PRO A 1 42 ? -2.033  11.389  5.554   1.00 0.00 ? 42 PRO A O    1 
ATOM   560  C CB   . PRO A 1 42 ? -0.269  12.600  8.165   1.00 0.00 ? 42 PRO A CB   1 
ATOM   561  C CG   . PRO A 1 42 ? 1.121   13.091  7.958   1.00 0.00 ? 42 PRO A CG   1 
ATOM   562  C CD   . PRO A 1 42 ? 1.970   11.867  7.740   1.00 0.00 ? 42 PRO A CD   1 
ATOM   563  H HA   . PRO A 1 42 ? -1.037  10.640  7.747   1.00 0.00 ? 42 PRO A HA   1 
ATOM   564  H HB2  . PRO A 1 42 ? -1.000  13.329  7.847   1.00 0.00 ? 42 PRO A HB2  1 
ATOM   565  H HB3  . PRO A 1 42 ? -0.443  12.333  9.197   1.00 0.00 ? 42 PRO A HB3  1 
ATOM   566  H HG2  . PRO A 1 42 ? 1.157   13.732  7.089   1.00 0.00 ? 42 PRO A HG2  1 
ATOM   567  H HG3  . PRO A 1 42 ? 1.455   13.628  8.834   1.00 0.00 ? 42 PRO A HG3  1 
ATOM   568  H HD2  . PRO A 1 42 ? 2.730   12.063  6.999   1.00 0.00 ? 42 PRO A HD2  1 
ATOM   569  H HD3  . PRO A 1 42 ? 2.420   11.551  8.670   1.00 0.00 ? 42 PRO A HD3  1 
ATOM   570  N N    . THR A 1 43 ? -0.075  12.410  5.119   1.00 0.00 ? 43 THR A N    1 
ATOM   571  C CA   . THR A 1 43 ? -0.464  12.827  3.773   1.00 0.00 ? 43 THR A CA   1 
ATOM   572  C C    . THR A 1 43 ? -1.004  11.650  2.964   1.00 0.00 ? 43 THR A C    1 
ATOM   573  O O    . THR A 1 43 ? -1.995  11.781  2.245   1.00 0.00 ? 43 THR A O    1 
ATOM   574  C CB   . THR A 1 43 ? 0.726   13.456  3.047   1.00 0.00 ? 43 THR A CB   1 
ATOM   575  O OG1  . THR A 1 43 ? 1.875   12.634  3.158   1.00 0.00 ? 43 THR A OG1  1 
ATOM   576  C CG2  . THR A 1 43 ? 1.090   14.829  3.570   1.00 0.00 ? 43 THR A CG2  1 
ATOM   577  H H    . THR A 1 43 ? 0.814   12.648  5.454   1.00 0.00 ? 43 THR A H    1 
ATOM   578  H HA   . THR A 1 43 ? -1.244  13.566  3.870   1.00 0.00 ? 43 THR A HA   1 
ATOM   579  H HB   . THR A 1 43 ? 0.482   13.556  1.999   1.00 0.00 ? 43 THR A HB   1 
ATOM   580  H HG1  . THR A 1 43 ? 2.204   12.663  4.059   1.00 0.00 ? 43 THR A HG1  1 
ATOM   581  H HG21 . THR A 1 43 ? 1.043   14.826  4.649   1.00 0.00 ? 43 THR A HG21 1 
ATOM   582  H HG22 . THR A 1 43 ? 0.394   15.558  3.182   1.00 0.00 ? 43 THR A HG22 1 
ATOM   583  H HG23 . THR A 1 43 ? 2.090   15.081  3.254   1.00 0.00 ? 43 THR A HG23 1 
ATOM   584  N N    . TYR A 1 44 ? -0.346  10.502  3.086   1.00 0.00 ? 44 TYR A N    1 
ATOM   585  C CA   . TYR A 1 44 ? -0.762  9.303   2.366   1.00 0.00 ? 44 TYR A CA   1 
ATOM   586  C C    . TYR A 1 44 ? -1.646  8.413   3.239   1.00 0.00 ? 44 TYR A C    1 
ATOM   587  O O    . TYR A 1 44 ? -1.868  7.244   2.923   1.00 0.00 ? 44 TYR A O    1 
ATOM   588  C CB   . TYR A 1 44 ? 0.464   8.517   1.899   1.00 0.00 ? 44 TYR A CB   1 
ATOM   589  C CG   . TYR A 1 44 ? 1.250   9.210   0.809   1.00 0.00 ? 44 TYR A CG   1 
ATOM   590  C CD1  . TYR A 1 44 ? 2.049   10.310  1.094   1.00 0.00 ? 44 TYR A CD1  1 
ATOM   591  C CD2  . TYR A 1 44 ? 1.192   8.765   -0.506  1.00 0.00 ? 44 TYR A CD2  1 
ATOM   592  C CE1  . TYR A 1 44 ? 2.768   10.946  0.101   1.00 0.00 ? 44 TYR A CE1  1 
ATOM   593  C CE2  . TYR A 1 44 ? 1.908   9.397   -1.505  1.00 0.00 ? 44 TYR A CE2  1 
ATOM   594  C CZ   . TYR A 1 44 ? 2.695   10.486  -1.196  1.00 0.00 ? 44 TYR A CZ   1 
ATOM   595  O OH   . TYR A 1 44 ? 3.410   11.118  -2.188  1.00 0.00 ? 44 TYR A OH   1 
ATOM   596  H H    . TYR A 1 44 ? 0.436   10.459  3.674   1.00 0.00 ? 44 TYR A H    1 
ATOM   597  H HA   . TYR A 1 44 ? -1.328  9.615   1.501   1.00 0.00 ? 44 TYR A HA   1 
ATOM   598  H HB2  . TYR A 1 44 ? 1.125   8.365   2.739   1.00 0.00 ? 44 TYR A HB2  1 
ATOM   599  H HB3  . TYR A 1 44 ? 0.144   7.557   1.521   1.00 0.00 ? 44 TYR A HB3  1 
ATOM   600  H HD1  . TYR A 1 44 ? 2.105   10.667  2.112   1.00 0.00 ? 44 TYR A HD1  1 
ATOM   601  H HD2  . TYR A 1 44 ? 0.575   7.912   -0.745  1.00 0.00 ? 44 TYR A HD2  1 
ATOM   602  H HE1  . TYR A 1 44 ? 3.384   11.800  0.344   1.00 0.00 ? 44 TYR A HE1  1 
ATOM   603  H HE2  . TYR A 1 44 ? 1.850   9.036   -2.522  1.00 0.00 ? 44 TYR A HE2  1 
ATOM   604  H HH   . TYR A 1 44 ? 4.282   11.347  -1.858  1.00 0.00 ? 44 TYR A HH   1 
ATOM   605  N N    . GLY A 1 45 ? -2.147  8.972   4.337   1.00 0.00 ? 45 GLY A N    1 
ATOM   606  C CA   . GLY A 1 45 ? -2.998  8.212   5.234   1.00 0.00 ? 45 GLY A CA   1 
ATOM   607  C C    . GLY A 1 45 ? -4.236  7.674   4.545   1.00 0.00 ? 45 GLY A C    1 
ATOM   608  O O    . GLY A 1 45 ? -4.778  6.644   4.945   1.00 0.00 ? 45 GLY A O    1 
ATOM   609  H H    . GLY A 1 45 ? -1.937  9.906   4.540   1.00 0.00 ? 45 GLY A H    1 
ATOM   610  H HA2  . GLY A 1 45 ? -2.432  7.383   5.632   1.00 0.00 ? 45 GLY A HA2  1 
ATOM   611  H HA3  . GLY A 1 45 ? -3.303  8.851   6.050   1.00 0.00 ? 45 GLY A HA3  1 
ATOM   612  N N    . GLN A 1 46 ? -4.685  8.370   3.506   1.00 0.00 ? 46 GLN A N    1 
ATOM   613  C CA   . GLN A 1 46 ? -5.864  7.954   2.761   1.00 0.00 ? 46 GLN A CA   1 
ATOM   614  C C    . GLN A 1 46 ? -5.567  6.712   1.928   1.00 0.00 ? 46 GLN A C    1 
ATOM   615  O O    . GLN A 1 46 ? -6.468  5.936   1.609   1.00 0.00 ? 46 GLN A O    1 
ATOM   616  C CB   . GLN A 1 46 ? -6.349  9.089   1.856   1.00 0.00 ? 46 GLN A CB   1 
ATOM   617  C CG   . GLN A 1 46 ? -7.857  9.276   1.872   1.00 0.00 ? 46 GLN A CG   1 
ATOM   618  C CD   . GLN A 1 46 ? -8.284  10.612  1.296   1.00 0.00 ? 46 GLN A CD   1 
ATOM   619  O OE1  . GLN A 1 46 ? -7.947  10.948  0.161   1.00 0.00 ? 46 GLN A OE1  1 
ATOM   620  N NE2  . GLN A 1 46 ? -9.029  11.382  2.080   1.00 0.00 ? 46 GLN A NE2  1 
ATOM   621  H H    . GLN A 1 46 ? -4.211  9.180   3.232   1.00 0.00 ? 46 GLN A H    1 
ATOM   622  H HA   . GLN A 1 46 ? -6.636  7.720   3.475   1.00 0.00 ? 46 GLN A HA   1 
ATOM   623  H HB2  . GLN A 1 46 ? -5.891  10.012  2.179   1.00 0.00 ? 46 GLN A HB2  1 
ATOM   624  H HB3  . GLN A 1 46 ? -6.044  8.881   0.841   1.00 0.00 ? 46 GLN A HB3  1 
ATOM   625  H HG2  . GLN A 1 46 ? -8.311  8.488   1.288   1.00 0.00 ? 46 GLN A HG2  1 
ATOM   626  H HG3  . GLN A 1 46 ? -8.204  9.212   2.893   1.00 0.00 ? 46 GLN A HG3  1 
ATOM   627  H HE21 . GLN A 1 46 ? -9.259  11.047  2.977   1.00 0.00 ? 46 GLN A HE21 1 
ATOM   628  H HE22 . GLN A 1 46 ? -9.320  12.255  1.731   1.00 0.00 ? 46 GLN A HE22 1 
ATOM   629  N N    . TYR A 1 47 ? -4.298  6.534   1.576   1.00 0.00 ? 47 TYR A N    1 
ATOM   630  C CA   . TYR A 1 47 ? -3.879  5.390   0.778   1.00 0.00 ? 47 TYR A CA   1 
ATOM   631  C C    . TYR A 1 47 ? -3.847  4.120   1.619   1.00 0.00 ? 47 TYR A C    1 
ATOM   632  O O    . TYR A 1 47 ? -4.420  3.098   1.244   1.00 0.00 ? 47 TYR A O    1 
ATOM   633  C CB   . TYR A 1 47 ? -2.503  5.642   0.185   1.00 0.00 ? 47 TYR A CB   1 
ATOM   634  C CG   . TYR A 1 47 ? -2.231  4.870   -1.084  1.00 0.00 ? 47 TYR A CG   1 
ATOM   635  C CD1  . TYR A 1 47 ? -2.567  5.397   -2.323  1.00 0.00 ? 47 TYR A CD1  1 
ATOM   636  C CD2  . TYR A 1 47 ? -1.631  3.619   -1.040  1.00 0.00 ? 47 TYR A CD2  1 
ATOM   637  C CE1  . TYR A 1 47 ? -2.313  4.696   -3.486  1.00 0.00 ? 47 TYR A CE1  1 
ATOM   638  C CE2  . TYR A 1 47 ? -1.374  2.912   -2.198  1.00 0.00 ? 47 TYR A CE2  1 
ATOM   639  C CZ   . TYR A 1 47 ? -1.716  3.455   -3.418  1.00 0.00 ? 47 TYR A CZ   1 
ATOM   640  O OH   . TYR A 1 47 ? -1.458  2.755   -4.574  1.00 0.00 ? 47 TYR A OH   1 
ATOM   641  H H    . TYR A 1 47 ? -3.627  7.189   1.859   1.00 0.00 ? 47 TYR A H    1 
ATOM   642  H HA   . TYR A 1 47 ? -4.579  5.264   -0.019  1.00 0.00 ? 47 TYR A HA   1 
ATOM   643  H HB2  . TYR A 1 47 ? -2.394  6.695   -0.034  1.00 0.00 ? 47 TYR A HB2  1 
ATOM   644  H HB3  . TYR A 1 47 ? -1.770  5.347   0.908   1.00 0.00 ? 47 TYR A HB3  1 
ATOM   645  H HD1  . TYR A 1 47 ? -3.035  6.370   -2.371  1.00 0.00 ? 47 TYR A HD1  1 
ATOM   646  H HD2  . TYR A 1 47 ? -1.366  3.197   -0.082  1.00 0.00 ? 47 TYR A HD2  1 
ATOM   647  H HE1  . TYR A 1 47 ? -2.581  5.122   -4.442  1.00 0.00 ? 47 TYR A HE1  1 
ATOM   648  H HE2  . TYR A 1 47 ? -0.907  1.940   -2.145  1.00 0.00 ? 47 TYR A HE2  1 
ATOM   649  H HH   . TYR A 1 47 ? -1.597  1.818   -4.418  1.00 0.00 ? 47 TYR A HH   1 
ATOM   650  N N    . ILE A 1 48 ? -3.162  4.192   2.755   1.00 0.00 ? 48 ILE A N    1 
ATOM   651  C CA   . ILE A 1 48 ? -3.040  3.051   3.650   1.00 0.00 ? 48 ILE A CA   1 
ATOM   652  C C    . ILE A 1 48 ? -4.367  2.726   4.327   1.00 0.00 ? 48 ILE A C    1 
ATOM   653  O O    . ILE A 1 48 ? -4.741  1.559   4.448   1.00 0.00 ? 48 ILE A O    1 
ATOM   654  C CB   . ILE A 1 48 ? -1.970  3.298   4.730   1.00 0.00 ? 48 ILE A CB   1 
ATOM   655  C CG1  . ILE A 1 48 ? -0.663  3.757   4.080   1.00 0.00 ? 48 ILE A CG1  1 
ATOM   656  C CG2  . ILE A 1 48 ? -1.749  2.039   5.557   1.00 0.00 ? 48 ILE A CG2  1 
ATOM   657  C CD1  . ILE A 1 48 ? 0.458   3.985   5.070   1.00 0.00 ? 48 ILE A CD1  1 
ATOM   658  H H    . ILE A 1 48 ? -2.721  5.032   2.994   1.00 0.00 ? 48 ILE A H    1 
ATOM   659  H HA   . ILE A 1 48 ? -2.731  2.203   3.060   1.00 0.00 ? 48 ILE A HA   1 
ATOM   660  H HB   . ILE A 1 48 ? -2.328  4.074   5.389   1.00 0.00 ? 48 ILE A HB   1 
ATOM   661  H HG12 . ILE A 1 48 ? -0.335  3.007   3.377   1.00 0.00 ? 48 ILE A HG12 1 
ATOM   662  H HG13 . ILE A 1 48 ? -0.836  4.685   3.555   1.00 0.00 ? 48 ILE A HG13 1 
ATOM   663  H HG21 . ILE A 1 48 ? -0.695  1.919   5.758   1.00 0.00 ? 48 ILE A HG21 1 
ATOM   664  H HG22 . ILE A 1 48 ? -2.111  1.181   5.010   1.00 0.00 ? 48 ILE A HG22 1 
ATOM   665  H HG23 . ILE A 1 48 ? -2.285  2.123   6.491   1.00 0.00 ? 48 ILE A HG23 1 
ATOM   666  H HD11 . ILE A 1 48 ? 0.772   3.037   5.481   1.00 0.00 ? 48 ILE A HD11 1 
ATOM   667  H HD12 . ILE A 1 48 ? 0.109   4.625   5.867   1.00 0.00 ? 48 ILE A HD12 1 
ATOM   668  H HD13 . ILE A 1 48 ? 1.291   4.455   4.569   1.00 0.00 ? 48 ILE A HD13 1 
ATOM   669  N N    . ARG A 1 49 ? -5.077  3.760   4.774   1.00 0.00 ? 49 ARG A N    1 
ATOM   670  C CA   . ARG A 1 49 ? -6.361  3.570   5.445   1.00 0.00 ? 49 ARG A CA   1 
ATOM   671  C C    . ARG A 1 49 ? -7.501  3.354   4.455   1.00 0.00 ? 49 ARG A C    1 
ATOM   672  O O    . ARG A 1 49 ? -8.656  3.664   4.747   1.00 0.00 ? 49 ARG A O    1 
ATOM   673  C CB   . ARG A 1 49 ? -6.673  4.760   6.354   1.00 0.00 ? 49 ARG A CB   1 
ATOM   674  C CG   . ARG A 1 49 ? -5.730  4.885   7.539   1.00 0.00 ? 49 ARG A CG   1 
ATOM   675  C CD   . ARG A 1 49 ? -5.631  6.323   8.023   1.00 0.00 ? 49 ARG A CD   1 
ATOM   676  N NE   . ARG A 1 49 ? -5.107  6.408   9.384   1.00 0.00 ? 49 ARG A NE   1 
ATOM   677  C CZ   . ARG A 1 49 ? -4.590  7.516   9.912   1.00 0.00 ? 49 ARG A CZ   1 
ATOM   678  N NH1  . ARG A 1 49 ? -4.527  8.632   9.197   1.00 0.00 ? 49 ARG A NH1  1 
ATOM   679  N NH2  . ARG A 1 49 ? -4.138  7.507   11.159  1.00 0.00 ? 49 ARG A NH2  1 
ATOM   680  H H    . ARG A 1 49 ? -4.729  4.668   4.654   1.00 0.00 ? 49 ARG A H    1 
ATOM   681  H HA   . ARG A 1 49 ? -6.275  2.684   6.048   1.00 0.00 ? 49 ARG A HA   1 
ATOM   682  H HB2  . ARG A 1 49 ? -6.609  5.668   5.773   1.00 0.00 ? 49 ARG A HB2  1 
ATOM   683  H HB3  . ARG A 1 49 ? -7.680  4.656   6.732   1.00 0.00 ? 49 ARG A HB3  1 
ATOM   684  H HG2  . ARG A 1 49 ? -6.098  4.269   8.346   1.00 0.00 ? 49 ARG A HG2  1 
ATOM   685  H HG3  . ARG A 1 49 ? -4.748  4.545   7.243   1.00 0.00 ? 49 ARG A HG3  1 
ATOM   686  H HD2  . ARG A 1 49 ? -4.975  6.867   7.360   1.00 0.00 ? 49 ARG A HD2  1 
ATOM   687  H HD3  . ARG A 1 49 ? -6.615  6.766   7.998   1.00 0.00 ? 49 ARG A HD3  1 
ATOM   688  H HE   . ARG A 1 49 ? -5.142  5.597   9.934   1.00 0.00 ? 49 ARG A HE   1 
ATOM   689  H HH11 . ARG A 1 49 ? -4.867  8.646   8.258   1.00 0.00 ? 49 ARG A HH11 1 
ATOM   690  H HH12 . ARG A 1 49 ? -4.137  9.461   9.599   1.00 0.00 ? 49 ARG A HH12 1 
ATOM   691  H HH21 . ARG A 1 49 ? -4.185  6.669   11.702  1.00 0.00 ? 49 ARG A HH21 1 
ATOM   692  H HH22 . ARG A 1 49 ? -3.749  8.339   11.555  1.00 0.00 ? 49 ARG A HH22 1 
ATOM   693  N N    . SER A 1 50 ? -7.174  2.809   3.295   1.00 0.00 ? 50 SER A N    1 
ATOM   694  C CA   . SER A 1 50 ? -8.168  2.533   2.271   1.00 0.00 ? 50 SER A CA   1 
ATOM   695  C C    . SER A 1 50 ? -8.901  1.230   2.577   1.00 0.00 ? 50 SER A C    1 
ATOM   696  O O    . SER A 1 50 ? -8.436  0.430   3.387   1.00 0.00 ? 50 SER A O    1 
ATOM   697  C CB   . SER A 1 50 ? -7.505  2.454   0.906   1.00 0.00 ? 50 SER A CB   1 
ATOM   698  O OG   . SER A 1 50 ? -8.373  2.914   -0.115  1.00 0.00 ? 50 SER A OG   1 
ATOM   699  H H    . SER A 1 50 ? -6.244  2.569   3.130   1.00 0.00 ? 50 SER A H    1 
ATOM   700  H HA   . SER A 1 50 ? -8.876  3.337   2.265   1.00 0.00 ? 50 SER A HA   1 
ATOM   701  H HB2  . SER A 1 50 ? -6.611  3.063   0.904   1.00 0.00 ? 50 SER A HB2  1 
ATOM   702  H HB3  . SER A 1 50 ? -7.248  1.434   0.711   1.00 0.00 ? 50 SER A HB3  1 
ATOM   703  H HG   . SER A 1 50 ? -8.219  2.410   -0.918  1.00 0.00 ? 50 SER A HG   1 
ATOM   704  N N    . PRO A 1 51 ? -10.048 0.986   1.924   1.00 0.00 ? 51 PRO A N    1 
ATOM   705  C CA   . PRO A 1 51 ? -10.818 -0.232  2.127   1.00 0.00 ? 51 PRO A CA   1 
ATOM   706  C C    . PRO A 1 51 ? -10.252 -1.400  1.328   1.00 0.00 ? 51 PRO A C    1 
ATOM   707  O O    . PRO A 1 51 ? -10.090 -2.507  1.841   1.00 0.00 ? 51 PRO A O    1 
ATOM   708  C CB   . PRO A 1 51 ? -12.226 0.128   1.629   1.00 0.00 ? 51 PRO A CB   1 
ATOM   709  C CG   . PRO A 1 51 ? -12.118 1.452   0.928   1.00 0.00 ? 51 PRO A CG   1 
ATOM   710  C CD   . PRO A 1 51 ? -10.668 1.859   0.921   1.00 0.00 ? 51 PRO A CD   1 
ATOM   711  H HA   . PRO A 1 51 ? -10.861 -0.501  3.172   1.00 0.00 ? 51 PRO A HA   1 
ATOM   712  H HB2  . PRO A 1 51 ? -12.572 -0.640  0.954   1.00 0.00 ? 51 PRO A HB2  1 
ATOM   713  H HB3  . PRO A 1 51 ? -12.896 0.189   2.474   1.00 0.00 ? 51 PRO A HB3  1 
ATOM   714  H HG2  . PRO A 1 51 ? -12.474 1.355   -0.089  1.00 0.00 ? 51 PRO A HG2  1 
ATOM   715  H HG3  . PRO A 1 51 ? -12.707 2.188   1.456   1.00 0.00 ? 51 PRO A HG3  1 
ATOM   716  H HD2  . PRO A 1 51 ? -10.238 1.685   -0.055  1.00 0.00 ? 51 PRO A HD2  1 
ATOM   717  H HD3  . PRO A 1 51 ? -10.567 2.898   1.198   1.00 0.00 ? 51 PRO A HD3  1 
ATOM   718  N N    . HIS A 1 52 ? -9.969  -1.133  0.061   1.00 0.00 ? 52 HIS A N    1 
ATOM   719  C CA   . HIS A 1 52 ? -9.434  -2.138  -0.852  1.00 0.00 ? 52 HIS A CA   1 
ATOM   720  C C    . HIS A 1 52 ? -7.927  -2.319  -0.673  1.00 0.00 ? 52 HIS A C    1 
ATOM   721  O O    . HIS A 1 52 ? -7.359  -3.318  -1.113  1.00 0.00 ? 52 HIS A O    1 
ATOM   722  C CB   . HIS A 1 52 ? -9.750  -1.754  -2.306  1.00 0.00 ? 52 HIS A CB   1 
ATOM   723  C CG   . HIS A 1 52 ? -10.875 -0.767  -2.437  1.00 0.00 ? 52 HIS A CG   1 
ATOM   724  N ND1  . HIS A 1 52 ? -10.874 0.266   -3.350  1.00 0.00 ? 52 HIS A ND1  1 
ATOM   725  C CD2  . HIS A 1 52 ? -12.032 -0.647  -1.742  1.00 0.00 ? 52 HIS A CD2  1 
ATOM   726  C CE1  . HIS A 1 52 ? -11.980 0.977   -3.208  1.00 0.00 ? 52 HIS A CE1  1 
ATOM   727  N NE2  . HIS A 1 52 ? -12.699 0.441   -2.241  1.00 0.00 ? 52 HIS A NE2  1 
ATOM   728  H H    . HIS A 1 52 ? -10.131 -0.229  -0.275  1.00 0.00 ? 52 HIS A H    1 
ATOM   729  H HA   . HIS A 1 52 ? -9.920  -3.074  -0.628  1.00 0.00 ? 52 HIS A HA   1 
ATOM   730  H HB2  . HIS A 1 52 ? -8.872  -1.316  -2.754  1.00 0.00 ? 52 HIS A HB2  1 
ATOM   731  H HB3  . HIS A 1 52 ? -10.023 -2.644  -2.854  1.00 0.00 ? 52 HIS A HB3  1 
ATOM   732  H HD1  . HIS A 1 52 ? -10.168 0.452   -4.005  1.00 0.00 ? 52 HIS A HD1  1 
ATOM   733  H HD2  . HIS A 1 52 ? -12.357 -1.279  -0.929  1.00 0.00 ? 52 HIS A HD2  1 
ATOM   734  H HE1  . HIS A 1 52 ? -12.245 1.855   -3.774  1.00 0.00 ? 52 HIS A HE1  1 
ATOM   735  H HE2  . HIS A 1 52 ? -13.612 0.706   -2.005  1.00 0.00 ? 52 HIS A HE2  1 
ATOM   736  N N    . ALA A 1 53 ? -7.282  -1.346  -0.036  1.00 0.00 ? 53 ALA A N    1 
ATOM   737  C CA   . ALA A 1 53 ? -5.847  -1.400  0.184   1.00 0.00 ? 53 ALA A CA   1 
ATOM   738  C C    . ALA A 1 53 ? -5.460  -2.599  1.032   1.00 0.00 ? 53 ALA A C    1 
ATOM   739  O O    . ALA A 1 53 ? -4.674  -3.449  0.613   1.00 0.00 ? 53 ALA A O    1 
ATOM   740  C CB   . ALA A 1 53 ? -5.362  -0.114  0.836   1.00 0.00 ? 53 ALA A CB   1 
ATOM   741  H H    . ALA A 1 53 ? -7.779  -0.573  0.286   1.00 0.00 ? 53 ALA A H    1 
ATOM   742  H HA   . ALA A 1 53 ? -5.377  -1.485  -0.771  1.00 0.00 ? 53 ALA A HA   1 
ATOM   743  H HB1  . ALA A 1 53 ? -5.992  0.121   1.681   1.00 0.00 ? 53 ALA A HB1  1 
ATOM   744  H HB2  . ALA A 1 53 ? -5.406  0.692   0.119   1.00 0.00 ? 53 ALA A HB2  1 
ATOM   745  H HB3  . ALA A 1 53 ? -4.343  -0.242  1.171   1.00 0.00 ? 53 ALA A HB3  1 
ATOM   746  N N    . ARG A 1 54 ? -6.015  -2.649  2.228   1.00 0.00 ? 54 ARG A N    1 
ATOM   747  C CA   . ARG A 1 54 ? -5.737  -3.732  3.161   1.00 0.00 ? 54 ARG A CA   1 
ATOM   748  C C    . ARG A 1 54 ? -6.091  -5.081  2.554   1.00 0.00 ? 54 ARG A C    1 
ATOM   749  O O    . ARG A 1 54 ? -5.455  -6.094  2.846   1.00 0.00 ? 54 ARG A O    1 
ATOM   750  C CB   . ARG A 1 54 ? -6.510  -3.532  4.466   1.00 0.00 ? 54 ARG A CB   1 
ATOM   751  C CG   . ARG A 1 54 ? -6.446  -2.116  5.006   1.00 0.00 ? 54 ARG A CG   1 
ATOM   752  C CD   . ARG A 1 54 ? -7.817  -1.625  5.435   1.00 0.00 ? 54 ARG A CD   1 
ATOM   753  N NE   . ARG A 1 54 ? -7.726  -0.401  6.218   1.00 0.00 ? 54 ARG A NE   1 
ATOM   754  C CZ   . ARG A 1 54 ? -8.773  0.349   6.553   1.00 0.00 ? 54 ARG A CZ   1 
ATOM   755  N NH1  . ARG A 1 54 ? -9.996  0.001   6.172   1.00 0.00 ? 54 ARG A NH1  1 
ATOM   756  N NH2  . ARG A 1 54 ? -8.597  1.450   7.270   1.00 0.00 ? 54 ARG A NH2  1 
ATOM   757  H H    . ARG A 1 54 ? -6.623  -1.935  2.490   1.00 0.00 ? 54 ARG A H    1 
ATOM   758  H HA   . ARG A 1 54 ? -4.686  -3.714  3.370   1.00 0.00 ? 54 ARG A HA   1 
ATOM   759  H HB2  . ARG A 1 54 ? -7.547  -3.781  4.299   1.00 0.00 ? 54 ARG A HB2  1 
ATOM   760  H HB3  . ARG A 1 54 ? -6.107  -4.195  5.216   1.00 0.00 ? 54 ARG A HB3  1 
ATOM   761  H HG2  . ARG A 1 54 ? -5.786  -2.097  5.860   1.00 0.00 ? 54 ARG A HG2  1 
ATOM   762  H HG3  . ARG A 1 54 ? -6.062  -1.462  4.238   1.00 0.00 ? 54 ARG A HG3  1 
ATOM   763  H HD2  . ARG A 1 54 ? -8.412  -1.437  4.554   1.00 0.00 ? 54 ARG A HD2  1 
ATOM   764  H HD3  . ARG A 1 54 ? -8.290  -2.390  6.033   1.00 0.00 ? 54 ARG A HD3  1 
ATOM   765  H HE   . ARG A 1 54 ? -6.834  -0.123  6.509   1.00 0.00 ? 54 ARG A HE   1 
ATOM   766  H HH11 . ARG A 1 54 ? -10.135 -0.828  5.630   1.00 0.00 ? 54 ARG A HH11 1 
ATOM   767  H HH12 . ARG A 1 54 ? -10.779 0.568   6.427   1.00 0.00 ? 54 ARG A HH12 1 
ATOM   768  H HH21 . ARG A 1 54 ? -7.677  1.717   7.559   1.00 0.00 ? 54 ARG A HH21 1 
ATOM   769  H HH22 . ARG A 1 54 ? -9.383  2.014   7.522   1.00 0.00 ? 54 ARG A HH22 1 
ATOM   770  N N    . ASP A 1 55 ? -7.110  -5.086  1.711   1.00 0.00 ? 55 ASP A N    1 
ATOM   771  C CA   . ASP A 1 55 ? -7.556  -6.309  1.061   1.00 0.00 ? 55 ASP A CA   1 
ATOM   772  C C    . ASP A 1 55 ? -6.499  -6.831  0.103   1.00 0.00 ? 55 ASP A C    1 
ATOM   773  O O    . ASP A 1 55 ? -6.200  -8.024  0.078   1.00 0.00 ? 55 ASP A O    1 
ATOM   774  C CB   . ASP A 1 55 ? -8.863  -6.075  0.319   1.00 0.00 ? 55 ASP A CB   1 
ATOM   775  C CG   . ASP A 1 55 ? -9.672  -7.347  0.155   1.00 0.00 ? 55 ASP A CG   1 
ATOM   776  O OD1  . ASP A 1 55 ? -10.322 -7.768  1.136   1.00 0.00 ? 55 ASP A OD1  1 
ATOM   777  O OD2  . ASP A 1 55 ? -9.655  -7.922  -0.953  1.00 0.00 ? 55 ASP A OD2  1 
ATOM   778  H H    . ASP A 1 55 ? -7.573  -4.246  1.523   1.00 0.00 ? 55 ASP A H    1 
ATOM   779  H HA   . ASP A 1 55 ? -7.717  -7.039  1.815   1.00 0.00 ? 55 ASP A HA   1 
ATOM   780  H HB2  . ASP A 1 55 ? -9.460  -5.355  0.864   1.00 0.00 ? 55 ASP A HB2  1 
ATOM   781  H HB3  . ASP A 1 55 ? -8.635  -5.689  -0.655  1.00 0.00 ? 55 ASP A HB3  1 
ATOM   782  N N    . THR A 1 56 ? -5.936  -5.926  -0.678  1.00 0.00 ? 56 THR A N    1 
ATOM   783  C CA   . THR A 1 56 ? -4.909  -6.279  -1.639  1.00 0.00 ? 56 THR A CA   1 
ATOM   784  C C    . THR A 1 56 ? -3.700  -6.889  -0.941  1.00 0.00 ? 56 THR A C    1 
ATOM   785  O O    . THR A 1 56 ? -3.235  -7.967  -1.311  1.00 0.00 ? 56 THR A O    1 
ATOM   786  C CB   . THR A 1 56 ? -4.490  -5.055  -2.437  1.00 0.00 ? 56 THR A CB   1 
ATOM   787  O OG1  . THR A 1 56 ? -5.587  -4.180  -2.630  1.00 0.00 ? 56 THR A OG1  1 
ATOM   788  C CG2  . THR A 1 56 ? -3.919  -5.390  -3.798  1.00 0.00 ? 56 THR A CG2  1 
ATOM   789  H H    . THR A 1 56 ? -6.218  -4.998  -0.604  1.00 0.00 ? 56 THR A H    1 
ATOM   790  H HA   . THR A 1 56 ? -5.322  -6.999  -2.308  1.00 0.00 ? 56 THR A HA   1 
ATOM   791  H HB   . THR A 1 56 ? -3.737  -4.537  -1.882  1.00 0.00 ? 56 THR A HB   1 
ATOM   792  H HG1  . THR A 1 56 ? -5.270  -3.340  -2.969  1.00 0.00 ? 56 THR A HG1  1 
ATOM   793  H HG21 . THR A 1 56 ? -2.866  -5.608  -3.703  1.00 0.00 ? 56 THR A HG21 1 
ATOM   794  H HG22 . THR A 1 56 ? -4.055  -4.549  -4.462  1.00 0.00 ? 56 THR A HG22 1 
ATOM   795  H HG23 . THR A 1 56 ? -4.430  -6.253  -4.200  1.00 0.00 ? 56 THR A HG23 1 
ATOM   796  N N    . LEU A 1 57 ? -3.197  -6.193  0.072   1.00 0.00 ? 57 LEU A N    1 
ATOM   797  C CA   . LEU A 1 57 ? -2.049  -6.663  0.822   1.00 0.00 ? 57 LEU A CA   1 
ATOM   798  C C    . LEU A 1 57 ? -2.371  -7.960  1.544   1.00 0.00 ? 57 LEU A C    1 
ATOM   799  O O    . LEU A 1 57 ? -1.584  -8.907  1.534   1.00 0.00 ? 57 LEU A O    1 
ATOM   800  C CB   . LEU A 1 57 ? -1.601  -5.600  1.817   1.00 0.00 ? 57 LEU A CB   1 
ATOM   801  C CG   . LEU A 1 57 ? -0.421  -4.743  1.361   1.00 0.00 ? 57 LEU A CG   1 
ATOM   802  C CD1  . LEU A 1 57 ? -0.859  -3.305  1.127   1.00 0.00 ? 57 LEU A CD1  1 
ATOM   803  C CD2  . LEU A 1 57 ? 0.711   -4.800  2.377   1.00 0.00 ? 57 LEU A CD2  1 
ATOM   804  H H    . LEU A 1 57 ? -3.608  -5.344  0.321   1.00 0.00 ? 57 LEU A H    1 
ATOM   805  H HA   . LEU A 1 57 ? -1.263  -6.840  0.129   1.00 0.00 ? 57 LEU A HA   1 
ATOM   806  H HB2  . LEU A 1 57 ? -2.437  -4.950  1.996   1.00 0.00 ? 57 LEU A HB2  1 
ATOM   807  H HB3  . LEU A 1 57 ? -1.330  -6.087  2.744   1.00 0.00 ? 57 LEU A HB3  1 
ATOM   808  H HG   . LEU A 1 57 ? -0.052  -5.133  0.428   1.00 0.00 ? 57 LEU A HG   1 
ATOM   809  H HD11 . LEU A 1 57 ? -0.586  -2.702  1.981   1.00 0.00 ? 57 LEU A HD11 1 
ATOM   810  H HD12 . LEU A 1 57 ? -1.930  -3.272  0.991   1.00 0.00 ? 57 LEU A HD12 1 
ATOM   811  H HD13 . LEU A 1 57 ? -0.371  -2.919  0.244   1.00 0.00 ? 57 LEU A HD13 1 
ATOM   812  H HD21 . LEU A 1 57 ? 0.321   -5.118  3.333   1.00 0.00 ? 57 LEU A HD21 1 
ATOM   813  H HD22 . LEU A 1 57 ? 1.153   -3.820  2.477   1.00 0.00 ? 57 LEU A HD22 1 
ATOM   814  H HD23 . LEU A 1 57 ? 1.461   -5.501  2.043   1.00 0.00 ? 57 LEU A HD23 1 
ATOM   815  N N    . THR A 1 58 ? -3.538  -7.992  2.166   1.00 0.00 ? 58 THR A N    1 
ATOM   816  C CA   . THR A 1 58 ? -3.980  -9.165  2.895   1.00 0.00 ? 58 THR A CA   1 
ATOM   817  C C    . THR A 1 58 ? -4.157  -10.345 1.952   1.00 0.00 ? 58 THR A C    1 
ATOM   818  O O    . THR A 1 58 ? -3.763  -11.467 2.270   1.00 0.00 ? 58 THR A O    1 
ATOM   819  C CB   . THR A 1 58 ? -5.285  -8.879  3.641   1.00 0.00 ? 58 THR A CB   1 
ATOM   820  O OG1  . THR A 1 58 ? -5.108  -7.828  4.575   1.00 0.00 ? 58 THR A OG1  1 
ATOM   821  C CG2  . THR A 1 58 ? -5.820  -10.077 4.396   1.00 0.00 ? 58 THR A CG2  1 
ATOM   822  H H    . THR A 1 58 ? -4.111  -7.207  2.132   1.00 0.00 ? 58 THR A H    1 
ATOM   823  H HA   . THR A 1 58 ? -3.212  -9.407  3.606   1.00 0.00 ? 58 THR A HA   1 
ATOM   824  H HB   . THR A 1 58 ? -6.037  -8.575  2.927   1.00 0.00 ? 58 THR A HB   1 
ATOM   825  H HG1  . THR A 1 58 ? -4.803  -7.041  4.118   1.00 0.00 ? 58 THR A HG1  1 
ATOM   826  H HG21 . THR A 1 58 ? -6.723  -9.799  4.919   1.00 0.00 ? 58 THR A HG21 1 
ATOM   827  H HG22 . THR A 1 58 ? -5.081  -10.413 5.108   1.00 0.00 ? 58 THR A HG22 1 
ATOM   828  H HG23 . THR A 1 58 ? -6.038  -10.873 3.700   1.00 0.00 ? 58 THR A HG23 1 
ATOM   829  N N    . SER A 1 59 ? -4.733  -10.090 0.779   1.00 0.00 ? 59 SER A N    1 
ATOM   830  C CA   . SER A 1 59 ? -4.930  -11.137 -0.205  1.00 0.00 ? 59 SER A CA   1 
ATOM   831  C C    . SER A 1 59 ? -3.621  -11.866 -0.441  1.00 0.00 ? 59 SER A C    1 
ATOM   832  O O    . SER A 1 59 ? -3.582  -13.088 -0.590  1.00 0.00 ? 59 SER A O    1 
ATOM   833  C CB   . SER A 1 59 ? -5.445  -10.549 -1.507  1.00 0.00 ? 59 SER A CB   1 
ATOM   834  O OG   . SER A 1 59 ? -6.121  -11.526 -2.280  1.00 0.00 ? 59 SER A OG   1 
ATOM   835  H H    . SER A 1 59 ? -5.015  -9.178  0.566   1.00 0.00 ? 59 SER A H    1 
ATOM   836  H HA   . SER A 1 59 ? -5.648  -11.821 0.177   1.00 0.00 ? 59 SER A HA   1 
ATOM   837  H HB2  . SER A 1 59 ? -6.127  -9.740  -1.290  1.00 0.00 ? 59 SER A HB2  1 
ATOM   838  H HB3  . SER A 1 59 ? -4.611  -10.179 -2.066  1.00 0.00 ? 59 SER A HB3  1 
ATOM   839  H HG   . SER A 1 59 ? -6.633  -11.092 -2.967  1.00 0.00 ? 59 SER A HG   1 
ATOM   840  N N    . CYS A 1 60 ? -2.549  -11.091 -0.451  1.00 0.00 ? 60 CYS A N    1 
ATOM   841  C CA   . CYS A 1 60 ? -1.216  -11.616 -0.640  1.00 0.00 ? 60 CYS A CA   1 
ATOM   842  C C    . CYS A 1 60 ? -0.681  -12.189 0.668   1.00 0.00 ? 60 CYS A C    1 
ATOM   843  O O    . CYS A 1 60 ? -0.036  -13.237 0.681   1.00 0.00 ? 60 CYS A O    1 
ATOM   844  C CB   . CYS A 1 60 ? -0.297  -10.509 -1.142  1.00 0.00 ? 60 CYS A CB   1 
ATOM   845  S SG   . CYS A 1 60 ? 0.893   -11.049 -2.411  1.00 0.00 ? 60 CYS A SG   1 
ATOM   846  H H    . CYS A 1 60 ? -2.658  -10.129 -0.310  1.00 0.00 ? 60 CYS A H    1 
ATOM   847  H HA   . CYS A 1 60 ? -1.264  -12.402 -1.379  1.00 0.00 ? 60 CYS A HA   1 
ATOM   848  H HB2  . CYS A 1 60 ? -0.898  -9.721  -1.570  1.00 0.00 ? 60 CYS A HB2  1 
ATOM   849  H HB3  . CYS A 1 60 ? 0.257   -10.111 -0.306  1.00 0.00 ? 60 CYS A HB3  1 
ATOM   850  N N    . GLY A 1 61 ? -0.951  -11.488 1.769   1.00 0.00 ? 61 GLY A N    1 
ATOM   851  C CA   . GLY A 1 61 ? -0.486  -11.940 3.063   1.00 0.00 ? 61 GLY A CA   1 
ATOM   852  C C    . GLY A 1 61 ? 1.025   -11.995 3.138   1.00 0.00 ? 61 GLY A C    1 
ATOM   853  O O    . GLY A 1 61 ? 1.598   -13.034 3.466   1.00 0.00 ? 61 GLY A O    1 
ATOM   854  H H    . GLY A 1 61 ? -1.468  -10.655 1.702   1.00 0.00 ? 61 GLY A H    1 
ATOM   855  H HA2  . GLY A 1 61 ? -0.850  -11.264 3.822   1.00 0.00 ? 61 GLY A HA2  1 
ATOM   856  H HA3  . GLY A 1 61 ? -0.882  -12.926 3.253   1.00 0.00 ? 61 GLY A HA3  1 
ATOM   857  N N    . LEU A 1 62 ? 1.675   -10.874 2.836   1.00 0.00 ? 62 LEU A N    1 
ATOM   858  C CA   . LEU A 1 62 ? 3.132   -10.815 2.878   1.00 0.00 ? 62 LEU A CA   1 
ATOM   859  C C    . LEU A 1 62 ? 3.621   -9.956  4.040   1.00 0.00 ? 62 LEU A C    1 
ATOM   860  O O    . LEU A 1 62 ? 4.340   -10.437 4.916   1.00 0.00 ? 62 LEU A O    1 
ATOM   861  C CB   . LEU A 1 62 ? 3.718   -10.290 1.555   1.00 0.00 ? 62 LEU A CB   1 
ATOM   862  C CG   . LEU A 1 62 ? 2.834   -9.338  0.732   1.00 0.00 ? 62 LEU A CG   1 
ATOM   863  C CD1  . LEU A 1 62 ? 3.109   -7.887  1.097   1.00 0.00 ? 62 LEU A CD1  1 
ATOM   864  C CD2  . LEU A 1 62 ? 3.078   -9.556  -0.753  1.00 0.00 ? 62 LEU A CD2  1 
ATOM   865  H H    . LEU A 1 62 ? 1.164   -10.076 2.584   1.00 0.00 ? 62 LEU A H    1 
ATOM   866  H HA   . LEU A 1 62 ? 3.489   -11.823 3.032   1.00 0.00 ? 62 LEU A HA   1 
ATOM   867  H HB2  . LEU A 1 62 ? 4.639   -9.774  1.783   1.00 0.00 ? 62 LEU A HB2  1 
ATOM   868  H HB3  . LEU A 1 62 ? 3.955   -11.143 0.937   1.00 0.00 ? 62 LEU A HB3  1 
ATOM   869  H HG   . LEU A 1 62 ? 1.792   -9.542  0.932   1.00 0.00 ? 62 LEU A HG   1 
ATOM   870  H HD11 . LEU A 1 62 ? 3.273   -7.315  0.197   1.00 0.00 ? 62 LEU A HD11 1 
ATOM   871  H HD12 . LEU A 1 62 ? 3.988   -7.831  1.723   1.00 0.00 ? 62 LEU A HD12 1 
ATOM   872  H HD13 . LEU A 1 62 ? 2.262   -7.483  1.630   1.00 0.00 ? 62 LEU A HD13 1 
ATOM   873  H HD21 . LEU A 1 62 ? 2.292   -9.081  -1.320  1.00 0.00 ? 62 LEU A HD21 1 
ATOM   874  H HD22 . LEU A 1 62 ? 3.086   -10.615 -0.967  1.00 0.00 ? 62 LEU A HD22 1 
ATOM   875  H HD23 . LEU A 1 62 ? 4.030   -9.126  -1.029  1.00 0.00 ? 62 LEU A HD23 1 
ATOM   876  N N    . ALA A 1 63 ? 3.234   -8.686  4.045   1.00 0.00 ? 63 ALA A N    1 
ATOM   877  C CA   . ALA A 1 63 ? 3.642   -7.775  5.100   1.00 0.00 ? 63 ALA A CA   1 
ATOM   878  C C    . ALA A 1 63 ? 2.604   -6.683  5.331   1.00 0.00 ? 63 ALA A C    1 
ATOM   879  O O    . ALA A 1 63 ? 2.128   -6.054  4.386   1.00 0.00 ? 63 ALA A O    1 
ATOM   880  C CB   . ALA A 1 63 ? 4.997   -7.165  4.774   1.00 0.00 ? 63 ALA A CB   1 
ATOM   881  H H    . ALA A 1 63 ? 2.663   -8.358  3.331   1.00 0.00 ? 63 ALA A H    1 
ATOM   882  H HA   . ALA A 1 63 ? 3.744   -8.351  6.003   1.00 0.00 ? 63 ALA A HA   1 
ATOM   883  H HB1  . ALA A 1 63 ? 5.390   -7.622  3.878   1.00 0.00 ? 63 ALA A HB1  1 
ATOM   884  H HB2  . ALA A 1 63 ? 5.677   -7.339  5.595   1.00 0.00 ? 63 ALA A HB2  1 
ATOM   885  H HB3  . ALA A 1 63 ? 4.887   -6.102  4.618   1.00 0.00 ? 63 ALA A HB3  1 
ATOM   886  N N    . VAL A 1 64 ? 2.266   -6.456  6.595   1.00 0.00 ? 64 VAL A N    1 
ATOM   887  C CA   . VAL A 1 64 ? 1.299   -5.439  6.959   1.00 0.00 ? 64 VAL A CA   1 
ATOM   888  C C    . VAL A 1 64 ? 1.988   -4.271  7.667   1.00 0.00 ? 64 VAL A C    1 
ATOM   889  O O    . VAL A 1 64 ? 2.862   -4.481  8.508   1.00 0.00 ? 64 VAL A O    1 
ATOM   890  C CB   . VAL A 1 64 ? 0.192   -6.019  7.865   1.00 0.00 ? 64 VAL A CB   1 
ATOM   891  C CG1  . VAL A 1 64 ? 0.725   -6.312  9.261   1.00 0.00 ? 64 VAL A CG1  1 
ATOM   892  C CG2  . VAL A 1 64 ? -1.000  -5.076  7.927   1.00 0.00 ? 64 VAL A CG2  1 
ATOM   893  H H    . VAL A 1 64 ? 2.680   -6.981  7.299   1.00 0.00 ? 64 VAL A H    1 
ATOM   894  H HA   . VAL A 1 64 ? 0.847   -5.084  6.053   1.00 0.00 ? 64 VAL A HA   1 
ATOM   895  H HB   . VAL A 1 64 ? -0.139  -6.952  7.433   1.00 0.00 ? 64 VAL A HB   1 
ATOM   896  H HG11 . VAL A 1 64 ? 0.276   -7.220  9.635   1.00 0.00 ? 64 VAL A HG11 1 
ATOM   897  H HG12 . VAL A 1 64 ? 0.480   -5.491  9.919   1.00 0.00 ? 64 VAL A HG12 1 
ATOM   898  H HG13 . VAL A 1 64 ? 1.798   -6.431  9.219   1.00 0.00 ? 64 VAL A HG13 1 
ATOM   899  H HG21 . VAL A 1 64 ? -1.709  -5.439  8.656   1.00 0.00 ? 64 VAL A HG21 1 
ATOM   900  H HG22 . VAL A 1 64 ? -1.474  -5.029  6.957   1.00 0.00 ? 64 VAL A HG22 1 
ATOM   901  H HG23 . VAL A 1 64 ? -0.665  -4.090  8.212   1.00 0.00 ? 64 VAL A HG23 1 
ATOM   902  N N    . PRO A 1 65 ? 1.611   -3.023  7.338   1.00 0.00 ? 65 PRO A N    1 
ATOM   903  C CA   . PRO A 1 65 ? 2.207   -1.832  7.953   1.00 0.00 ? 65 PRO A CA   1 
ATOM   904  C C    . PRO A 1 65 ? 2.067   -1.835  9.472   1.00 0.00 ? 65 PRO A C    1 
ATOM   905  O O    . PRO A 1 65 ? 1.849   -2.881  10.083  1.00 0.00 ? 65 PRO A O    1 
ATOM   906  C CB   . PRO A 1 65 ? 1.417   -0.667  7.338   1.00 0.00 ? 65 PRO A CB   1 
ATOM   907  C CG   . PRO A 1 65 ? 0.183   -1.287  6.784   1.00 0.00 ? 65 PRO A CG   1 
ATOM   908  C CD   . PRO A 1 65 ? 0.583   -2.665  6.349   1.00 0.00 ? 65 PRO A CD   1 
ATOM   909  H HA   . PRO A 1 65 ? 3.251   -1.738  7.692   1.00 0.00 ? 65 PRO A HA   1 
ATOM   910  H HB2  . PRO A 1 65 ? 1.183   0.059   8.102   1.00 0.00 ? 65 PRO A HB2  1 
ATOM   911  H HB3  . PRO A 1 65 ? 2.005   -0.201  6.561   1.00 0.00 ? 65 PRO A HB3  1 
ATOM   912  H HG2  . PRO A 1 65 ? -0.574  -1.340  7.553   1.00 0.00 ? 65 PRO A HG2  1 
ATOM   913  H HG3  . PRO A 1 65 ? -0.173  -0.714  5.942   1.00 0.00 ? 65 PRO A HG3  1 
ATOM   914  H HD2  . PRO A 1 65 ? -0.259  -3.339  6.399   1.00 0.00 ? 65 PRO A HD2  1 
ATOM   915  H HD3  . PRO A 1 65 ? 0.996   -2.644  5.352   1.00 0.00 ? 65 PRO A HD3  1 
ATOM   916  N N    . HIS A 1 66 ? 2.199   -0.659  10.075  1.00 0.00 ? 66 HIS A N    1 
ATOM   917  C CA   . HIS A 1 66 ? 2.094   -0.525  11.523  1.00 0.00 ? 66 HIS A CA   1 
ATOM   918  C C    . HIS A 1 66 ? 3.186   -1.329  12.221  1.00 0.00 ? 66 HIS A C    1 
ATOM   919  O O    . HIS A 1 66 ? 2.987   -1.839  13.324  1.00 0.00 ? 66 HIS A O    1 
ATOM   920  C CB   . HIS A 1 66 ? 0.716   -0.985  12.003  1.00 0.00 ? 66 HIS A CB   1 
ATOM   921  C CG   . HIS A 1 66 ? -0.399  -0.085  11.568  1.00 0.00 ? 66 HIS A CG   1 
ATOM   922  N ND1  . HIS A 1 66 ? -1.263  -0.399  10.541  1.00 0.00 ? 66 HIS A ND1  1 
ATOM   923  C CD2  . HIS A 1 66 ? -0.790  1.127   12.027  1.00 0.00 ? 66 HIS A CD2  1 
ATOM   924  C CE1  . HIS A 1 66 ? -2.134  0.581   10.388  1.00 0.00 ? 66 HIS A CE1  1 
ATOM   925  N NE2  . HIS A 1 66 ? -1.869  1.518   11.277  1.00 0.00 ? 66 HIS A NE2  1 
ATOM   926  H H    . HIS A 1 66 ? 2.375   0.136   9.533   1.00 0.00 ? 66 HIS A H    1 
ATOM   927  H HA   . HIS A 1 66 ? 2.220   0.519   11.768  1.00 0.00 ? 66 HIS A HA   1 
ATOM   928  H HB2  . HIS A 1 66 ? 0.516   -1.972  11.613  1.00 0.00 ? 66 HIS A HB2  1 
ATOM   929  H HB3  . HIS A 1 66 ? 0.712   -1.022  13.082  1.00 0.00 ? 66 HIS A HB3  1 
ATOM   930  H HD1  . HIS A 1 66 ? -1.240  -1.219  10.004  1.00 0.00 ? 66 HIS A HD1  1 
ATOM   931  H HD2  . HIS A 1 66 ? -0.337  1.683   12.833  1.00 0.00 ? 66 HIS A HD2  1 
ATOM   932  H HE1  . HIS A 1 66 ? -2.928  0.610   9.660   1.00 0.00 ? 66 HIS A HE1  1 
ATOM   933  H HE2  . HIS A 1 66 ? -2.424  2.308   11.447  1.00 0.00 ? 66 HIS A HE2  1 
ATOM   934  N N    . CYS A 1 67 ? 4.339   -1.437  11.569  1.00 0.00 ? 67 CYS A N    1 
ATOM   935  C CA   . CYS A 1 67 ? 5.466   -2.178  12.124  1.00 0.00 ? 67 CYS A CA   1 
ATOM   936  C C    . CYS A 1 67 ? 6.245   -1.320  13.116  1.00 0.00 ? 67 CYS A C    1 
ATOM   937  O O    . CYS A 1 67 ? 6.291   -1.690  14.308  1.00 0.00 ? 67 CYS A O    1 
ATOM   938  C CB   . CYS A 1 67 ? 6.394   -2.652  11.003  1.00 0.00 ? 67 CYS A CB   1 
ATOM   939  S SG   . CYS A 1 67 ? 6.968   -1.320  9.899   1.00 0.00 ? 67 CYS A SG   1 
ATOM   940  O OXT  . CYS A 1 67 ? 6.803   -0.286  12.692  1.00 0.00 ? 67 CYS A OXT  1 
ATOM   941  H H    . CYS A 1 67 ? 4.435   -1.007  10.694  1.00 0.00 ? 67 CYS A H    1 
ATOM   942  H HA   . CYS A 1 67 ? 5.073   -3.039  12.643  1.00 0.00 ? 67 CYS A HA   1 
ATOM   943  H HB2  . CYS A 1 67 ? 7.266   -3.114  11.440  1.00 0.00 ? 67 CYS A HB2  1 
ATOM   944  H HB3  . CYS A 1 67 ? 5.872   -3.379  10.399  1.00 0.00 ? 67 CYS A HB3  1 
HETATM 945  C C1   . PGM B 2 .  ? -4.626  -8.785  15.980  1.00 0.00 ? 68 PGM A C1   1 
HETATM 946  O O1   . PGM B 2 .  ? -5.901  -9.368  16.088  1.00 0.00 ? 68 PGM A O1   1 
HETATM 947  C C2   . PGM B 2 .  ? -4.514  -8.115  14.682  1.00 0.00 ? 68 PGM A C2   1 
HETATM 948  O O2   . PGM B 2 .  ? -3.192  -8.229  14.219  1.00 0.00 ? 68 PGM A O2   1 
HETATM 949  C C3   . PGM B 2 .  ? -4.872  -6.697  14.765  1.00 0.00 ? 68 PGM A C3   1 
HETATM 950  O O4   . PGM B 2 .  ? -4.453  -6.052  13.554  1.00 0.00 ? 68 PGM A O4   1 
HETATM 951  P P5   . PGM B 2 .  ? -5.571  -5.662  12.472  1.00 0.00 ? 68 PGM A P5   1 
HETATM 952  O O5A  . PGM B 2 .  ? -6.138  -6.899  11.889  1.00 0.00 ? 68 PGM A O5A  1 
HETATM 953  O O5B  . PGM B 2 .  ? -6.506  -4.698  13.091  1.00 0.00 ? 68 PGM A O5B  1 
HETATM 954  O O6   . PGM B 2 .  ? -4.771  -4.895  11.317  1.00 0.00 ? 68 PGM A O6   1 
HETATM 955  C C7   . PGM B 2 .  ? -5.517  -4.403  10.127  1.00 0.00 ? 68 PGM A C7   1 
HETATM 956  C C8   . PGM B 2 .  ? -4.674  -4.071  8.976   1.00 0.00 ? 68 PGM A C8   1 
HETATM 957  O O8   . PGM B 2 .  ? -4.502  -5.067  7.998   1.00 0.00 ? 68 PGM A O8   1 
HETATM 958  C C9   . PGM B 2 .  ? -5.092  -2.849  8.336   1.00 0.00 ? 68 PGM A C9   1 
HETATM 959  O OQ1  . PGM B 2 .  ? -4.809  -0.014  7.540   1.00 0.00 ? 68 PGM A OQ1  1 
HETATM 960  O OQ2  . PGM B 2 .  ? -3.987  -1.843  8.332   1.00 0.00 ? 68 PGM A OQ2  1 
HETATM 961  C CA   . PGM B 2 .  ? -3.983  -0.990  7.498   1.00 0.00 ? 68 PGM A CA   1 
HETATM 962  C CB   . PGM B 2 .  ? -2.954  -0.905  6.454   1.00 0.00 ? 68 PGM A CB   1 
HETATM 963  C CC   . PGM B 2 .  ? -3.420  -1.153  5.044   1.00 0.00 ? 68 PGM A CC   1 
HETATM 964  C CD   . PGM B 2 .  ? -2.357  -1.659  4.109   1.00 0.00 ? 68 PGM A CD   1 
HETATM 965  C CE   . PGM B 2 .  ? -1.918  -0.659  3.082   1.00 0.00 ? 68 PGM A CE   1 
HETATM 966  C CF   . PGM B 2 .  ? -0.482  -0.244  3.200   1.00 0.00 ? 68 PGM A CF   1 
HETATM 967  C CG   . PGM B 2 .  ? 0.086   0.397   1.967   1.00 0.00 ? 68 PGM A CG   1 
HETATM 968  C CH   . PGM B 2 .  ? 1.294   1.244   2.191   1.00 0.00 ? 68 PGM A CH   1 
HETATM 969  C CI   . PGM B 2 .  ? 2.108   1.523   0.971   1.00 0.00 ? 68 PGM A CI   1 
HETATM 970  C CJ   . PGM B 2 .  ? 2.257   2.970   0.637   1.00 0.00 ? 68 PGM A CJ   1 
HETATM 971  C CK   . PGM B 2 .  ? 1.510   3.430   -0.572  1.00 0.00 ? 68 PGM A CK   1 
HETATM 972  C CL   . PGM B 2 .  ? 1.860   4.805   -1.053  1.00 0.00 ? 68 PGM A CL   1 
HETATM 973  C CM   . PGM B 2 .  ? 0.805   5.484   -1.866  1.00 0.00 ? 68 PGM A CM   1 
HETATM 974  C CN   . PGM B 2 .  ? 1.102   5.599   -3.327  1.00 0.00 ? 68 PGM A CN   1 
HETATM 975  C CO   . PGM B 2 .  ? 0.893   6.958   -3.914  1.00 0.00 ? 68 PGM A CO   1 
HETATM 976  C CP   . PGM B 2 .  ? 2.061   7.481   -4.697  1.00 0.00 ? 68 PGM A CP   1 
ATOM   977  N N    . ALA A 1 1  ? 15.394  2.842   0.151   1.00 0.00 ? 1  ALA A N    2 
ATOM   978  C CA   . ALA A 1 1  ? 14.514  2.390   -0.958  1.00 0.00 ? 1  ALA A CA   2 
ATOM   979  C C    . ALA A 1 1  ? 13.137  3.039   -0.863  1.00 0.00 ? 1  ALA A C    2 
ATOM   980  O O    . ALA A 1 1  ? 12.275  2.581   -0.112  1.00 0.00 ? 1  ALA A O    2 
ATOM   981  C CB   . ALA A 1 1  ? 14.385  0.875   -0.944  1.00 0.00 ? 1  ALA A CB   2 
ATOM   982  H H1   . ALA A 1 1  ? 15.171  2.267   0.987   1.00 0.00 ? 1  ALA A H1   2 
ATOM   983  H H2   . ALA A 1 1  ? 15.194  3.849   0.323   1.00 0.00 ? 1  ALA A H2   2 
ATOM   984  H H3   . ALA A 1 1  ? 16.379  2.701   -0.148  1.00 0.00 ? 1  ALA A H3   2 
ATOM   985  H HA   . ALA A 1 1  ? 14.971  2.679   -1.893  1.00 0.00 ? 1  ALA A HA   2 
ATOM   986  H HB1  . ALA A 1 1  ? 14.288  0.512   -1.957  1.00 0.00 ? 1  ALA A HB1  2 
ATOM   987  H HB2  . ALA A 1 1  ? 13.511  0.593   -0.376  1.00 0.00 ? 1  ALA A HB2  2 
ATOM   988  H HB3  . ALA A 1 1  ? 15.265  0.443   -0.490  1.00 0.00 ? 1  ALA A HB3  2 
ATOM   989  N N    . CYS A 1 2  ? 12.937  4.107   -1.628  1.00 0.00 ? 2  CYS A N    2 
ATOM   990  C CA   . CYS A 1 2  ? 11.664  4.818   -1.630  1.00 0.00 ? 2  CYS A CA   2 
ATOM   991  C C    . CYS A 1 2  ? 11.382  5.426   -3.000  1.00 0.00 ? 2  CYS A C    2 
ATOM   992  O O    . CYS A 1 2  ? 11.461  6.641   -3.182  1.00 0.00 ? 2  CYS A O    2 
ATOM   993  C CB   . CYS A 1 2  ? 11.667  5.914   -0.562  1.00 0.00 ? 2  CYS A CB   2 
ATOM   994  S SG   . CYS A 1 2  ? 10.023  6.279   0.133   1.00 0.00 ? 2  CYS A SG   2 
ATOM   995  H H    . CYS A 1 2  ? 13.663  4.424   -2.205  1.00 0.00 ? 2  CYS A H    2 
ATOM   996  H HA   . CYS A 1 2  ? 10.887  4.106   -1.398  1.00 0.00 ? 2  CYS A HA   2 
ATOM   997  H HB2  . CYS A 1 2  ? 12.308  5.611   0.252   1.00 0.00 ? 2  CYS A HB2  2 
ATOM   998  H HB3  . CYS A 1 2  ? 12.051  6.827   -0.995  1.00 0.00 ? 2  CYS A HB3  2 
ATOM   999  N N    . GLN A 1 3  ? 11.050  4.571   -3.963  1.00 0.00 ? 3  GLN A N    2 
ATOM   1000 C CA   . GLN A 1 3  ? 10.755  5.023   -5.317  1.00 0.00 ? 3  GLN A CA   2 
ATOM   1001 C C    . GLN A 1 3  ? 9.455   5.820   -5.352  1.00 0.00 ? 3  GLN A C    2 
ATOM   1002 O O    . GLN A 1 3  ? 9.315   6.767   -6.126  1.00 0.00 ? 3  GLN A O    2 
ATOM   1003 C CB   . GLN A 1 3  ? 10.661  3.827   -6.266  1.00 0.00 ? 3  GLN A CB   2 
ATOM   1004 C CG   . GLN A 1 3  ? 11.242  4.096   -7.645  1.00 0.00 ? 3  GLN A CG   2 
ATOM   1005 C CD   . GLN A 1 3  ? 11.353  2.839   -8.486  1.00 0.00 ? 3  GLN A CD   2 
ATOM   1006 O OE1  . GLN A 1 3  ? 10.360  2.351   -9.027  1.00 0.00 ? 3  GLN A OE1  2 
ATOM   1007 N NE2  . GLN A 1 3  ? 12.564  2.306   -8.599  1.00 0.00 ? 3  GLN A NE2  2 
ATOM   1008 H H    . GLN A 1 3  ? 11.003  3.614   -3.757  1.00 0.00 ? 3  GLN A H    2 
ATOM   1009 H HA   . GLN A 1 3  ? 11.564  5.663   -5.637  1.00 0.00 ? 3  GLN A HA   2 
ATOM   1010 H HB2  . GLN A 1 3  ? 11.193  2.994   -5.831  1.00 0.00 ? 3  GLN A HB2  2 
ATOM   1011 H HB3  . GLN A 1 3  ? 9.622   3.557   -6.384  1.00 0.00 ? 3  GLN A HB3  2 
ATOM   1012 H HG2  . GLN A 1 3  ? 10.606  4.800   -8.160  1.00 0.00 ? 3  GLN A HG2  2 
ATOM   1013 H HG3  . GLN A 1 3  ? 12.228  4.521   -7.528  1.00 0.00 ? 3  GLN A HG3  2 
ATOM   1014 H HE21 . GLN A 1 3  ? 13.309  2.748   -8.140  1.00 0.00 ? 3  GLN A HE21 2 
ATOM   1015 H HE22 . GLN A 1 3  ? 12.664  1.493   -9.137  1.00 0.00 ? 3  GLN A HE22 2 
ATOM   1016 N N    . ALA A 1 4  ? 8.505   5.429   -4.507  1.00 0.00 ? 4  ALA A N    2 
ATOM   1017 C CA   . ALA A 1 4  ? 7.215   6.105   -4.440  1.00 0.00 ? 4  ALA A CA   2 
ATOM   1018 C C    . ALA A 1 4  ? 6.480   6.034   -5.777  1.00 0.00 ? 4  ALA A C    2 
ATOM   1019 O O    . ALA A 1 4  ? 5.569   6.820   -6.036  1.00 0.00 ? 4  ALA A O    2 
ATOM   1020 C CB   . ALA A 1 4  ? 7.402   7.554   -4.015  1.00 0.00 ? 4  ALA A CB   2 
ATOM   1021 H H    . ALA A 1 4  ? 8.677   4.668   -3.915  1.00 0.00 ? 4  ALA A H    2 
ATOM   1022 H HA   . ALA A 1 4  ? 6.619   5.610   -3.687  1.00 0.00 ? 4  ALA A HA   2 
ATOM   1023 H HB1  . ALA A 1 4  ? 6.541   7.878   -3.450  1.00 0.00 ? 4  ALA A HB1  2 
ATOM   1024 H HB2  . ALA A 1 4  ? 7.512   8.175   -4.892  1.00 0.00 ? 4  ALA A HB2  2 
ATOM   1025 H HB3  . ALA A 1 4  ? 8.288   7.638   -3.403  1.00 0.00 ? 4  ALA A HB3  2 
ATOM   1026 N N    . SER A 1 5  ? 6.883   5.091   -6.624  1.00 0.00 ? 5  SER A N    2 
ATOM   1027 C CA   . SER A 1 5  ? 6.261   4.924   -7.934  1.00 0.00 ? 5  SER A CA   2 
ATOM   1028 C C    . SER A 1 5  ? 5.828   3.477   -8.164  1.00 0.00 ? 5  SER A C    2 
ATOM   1029 O O    . SER A 1 5  ? 4.920   3.212   -8.952  1.00 0.00 ? 5  SER A O    2 
ATOM   1030 C CB   . SER A 1 5  ? 7.229   5.357   -9.037  1.00 0.00 ? 5  SER A CB   2 
ATOM   1031 O OG   . SER A 1 5  ? 6.542   6.012   -10.089 1.00 0.00 ? 5  SER A OG   2 
ATOM   1032 H H    . SER A 1 5  ? 7.615   4.496   -6.364  1.00 0.00 ? 5  SER A H    2 
ATOM   1033 H HA   . SER A 1 5  ? 5.388   5.557   -7.967  1.00 0.00 ? 5  SER A HA   2 
ATOM   1034 H HB2  . SER A 1 5  ? 7.961   6.036   -8.625  1.00 0.00 ? 5  SER A HB2  2 
ATOM   1035 H HB3  . SER A 1 5  ? 7.729   4.487   -9.436  1.00 0.00 ? 5  SER A HB3  2 
ATOM   1036 H HG   . SER A 1 5  ? 6.208   6.857   -9.777  1.00 0.00 ? 5  SER A HG   2 
ATOM   1037 N N    . GLN A 1 6  ? 6.481   2.543   -7.478  1.00 0.00 ? 6  GLN A N    2 
ATOM   1038 C CA   . GLN A 1 6  ? 6.164   1.133   -7.614  1.00 0.00 ? 6  GLN A CA   2 
ATOM   1039 C C    . GLN A 1 6  ? 4.804   0.812   -7.001  1.00 0.00 ? 6  GLN A C    2 
ATOM   1040 O O    . GLN A 1 6  ? 4.225   -0.241  -7.267  1.00 0.00 ? 6  GLN A O    2 
ATOM   1041 C CB   . GLN A 1 6  ? 7.249   0.282   -6.950  1.00 0.00 ? 6  GLN A CB   2 
ATOM   1042 C CG   . GLN A 1 6  ? 8.435   -0.004  -7.856  1.00 0.00 ? 6  GLN A CG   2 
ATOM   1043 C CD   . GLN A 1 6  ? 9.220   -1.226  -7.420  1.00 0.00 ? 6  GLN A CD   2 
ATOM   1044 O OE1  . GLN A 1 6  ? 9.802   -1.250  -6.335  1.00 0.00 ? 6  GLN A OE1  2 
ATOM   1045 N NE2  . GLN A 1 6  ? 9.239   -2.249  -8.266  1.00 0.00 ? 6  GLN A NE2  2 
ATOM   1046 H H    . GLN A 1 6  ? 7.192   2.804   -6.870  1.00 0.00 ? 6  GLN A H    2 
ATOM   1047 H HA   . GLN A 1 6  ? 6.138   0.909   -8.663  1.00 0.00 ? 6  GLN A HA   2 
ATOM   1048 H HB2  . GLN A 1 6  ? 7.609   0.799   -6.073  1.00 0.00 ? 6  GLN A HB2  2 
ATOM   1049 H HB3  . GLN A 1 6  ? 6.817   -0.661  -6.650  1.00 0.00 ? 6  GLN A HB3  2 
ATOM   1050 H HG2  . GLN A 1 6  ? 8.075   -0.166  -8.860  1.00 0.00 ? 6  GLN A HG2  2 
ATOM   1051 H HG3  . GLN A 1 6  ? 9.095   0.852   -7.845  1.00 0.00 ? 6  GLN A HG3  2 
ATOM   1052 H HE21 . GLN A 1 6  ? 8.753   -2.160  -9.112  1.00 0.00 ? 6  GLN A HE21 2 
ATOM   1053 H HE22 . GLN A 1 6  ? 9.738   -3.053  -8.010  1.00 0.00 ? 6  GLN A HE22 2 
ATOM   1054 N N    . LEU A 1 7  ? 4.303   1.723   -6.173  1.00 0.00 ? 7  LEU A N    2 
ATOM   1055 C CA   . LEU A 1 7  ? 3.017   1.535   -5.514  1.00 0.00 ? 7  LEU A CA   2 
ATOM   1056 C C    . LEU A 1 7  ? 1.912   2.307   -6.229  1.00 0.00 ? 7  LEU A C    2 
ATOM   1057 O O    . LEU A 1 7  ? 0.737   1.950   -6.139  1.00 0.00 ? 7  LEU A O    2 
ATOM   1058 C CB   . LEU A 1 7  ? 3.104   1.982   -4.052  1.00 0.00 ? 7  LEU A CB   2 
ATOM   1059 C CG   . LEU A 1 7  ? 4.483   1.824   -3.404  1.00 0.00 ? 7  LEU A CG   2 
ATOM   1060 C CD1  . LEU A 1 7  ? 4.594   2.709   -2.171  1.00 0.00 ? 7  LEU A CD1  2 
ATOM   1061 C CD2  . LEU A 1 7  ? 4.736   0.367   -3.043  1.00 0.00 ? 7  LEU A CD2  2 
ATOM   1062 H H    . LEU A 1 7  ? 4.813   2.540   -5.994  1.00 0.00 ? 7  LEU A H    2 
ATOM   1063 H HA   . LEU A 1 7  ? 2.782   0.482   -5.544  1.00 0.00 ? 7  LEU A HA   2 
ATOM   1064 H HB2  . LEU A 1 7  ? 2.822   3.023   -4.000  1.00 0.00 ? 7  LEU A HB2  2 
ATOM   1065 H HB3  . LEU A 1 7  ? 2.394   1.405   -3.479  1.00 0.00 ? 7  LEU A HB3  2 
ATOM   1066 H HG   . LEU A 1 7  ? 5.245   2.134   -4.108  1.00 0.00 ? 7  LEU A HG   2 
ATOM   1067 H HD11 . LEU A 1 7  ? 5.589   3.125   -2.116  1.00 0.00 ? 7  LEU A HD11 2 
ATOM   1068 H HD12 . LEU A 1 7  ? 4.400   2.120   -1.287  1.00 0.00 ? 7  LEU A HD12 2 
ATOM   1069 H HD13 . LEU A 1 7  ? 3.872   3.509   -2.236  1.00 0.00 ? 7  LEU A HD13 2 
ATOM   1070 H HD21 . LEU A 1 7  ? 4.113   -0.270  -3.653  1.00 0.00 ? 7  LEU A HD21 2 
ATOM   1071 H HD22 . LEU A 1 7  ? 4.502   0.208   -2.000  1.00 0.00 ? 7  LEU A HD22 2 
ATOM   1072 H HD23 . LEU A 1 7  ? 5.775   0.128   -3.218  1.00 0.00 ? 7  LEU A HD23 2 
ATOM   1073 N N    . ALA A 1 8  ? 2.292   3.368   -6.938  1.00 0.00 ? 8  ALA A N    2 
ATOM   1074 C CA   . ALA A 1 8  ? 1.329   4.188   -7.663  1.00 0.00 ? 8  ALA A CA   2 
ATOM   1075 C C    . ALA A 1 8  ? 0.396   3.331   -8.506  1.00 0.00 ? 8  ALA A C    2 
ATOM   1076 O O    . ALA A 1 8  ? -0.797  3.613   -8.620  1.00 0.00 ? 8  ALA A O    2 
ATOM   1077 C CB   . ALA A 1 8  ? 2.051   5.205   -8.535  1.00 0.00 ? 8  ALA A CB   2 
ATOM   1078 H H    . ALA A 1 8  ? 3.240   3.607   -6.970  1.00 0.00 ? 8  ALA A H    2 
ATOM   1079 H HA   . ALA A 1 8  ? 0.746   4.722   -6.939  1.00 0.00 ? 8  ALA A HA   2 
ATOM   1080 H HB1  . ALA A 1 8  ? 2.672   5.834   -7.916  1.00 0.00 ? 8  ALA A HB1  2 
ATOM   1081 H HB2  . ALA A 1 8  ? 1.325   5.814   -9.054  1.00 0.00 ? 8  ALA A HB2  2 
ATOM   1082 H HB3  . ALA A 1 8  ? 2.667   4.688   -9.256  1.00 0.00 ? 8  ALA A HB3  2 
ATOM   1083 N N    . VAL A 1 9  ? 0.952   2.283   -9.092  1.00 0.00 ? 9  VAL A N    2 
ATOM   1084 C CA   . VAL A 1 9  ? 0.186   1.372   -9.925  1.00 0.00 ? 9  VAL A CA   2 
ATOM   1085 C C    . VAL A 1 9  ? -0.933  0.708   -9.130  1.00 0.00 ? 9  VAL A C    2 
ATOM   1086 O O    . VAL A 1 9  ? -1.951  0.299   -9.689  1.00 0.00 ? 9  VAL A O    2 
ATOM   1087 C CB   . VAL A 1 9  ? 1.086   0.285   -10.545 1.00 0.00 ? 9  VAL A CB   2 
ATOM   1088 C CG1  . VAL A 1 9  ? 1.736   -0.559  -9.458  1.00 0.00 ? 9  VAL A CG1  2 
ATOM   1089 C CG2  . VAL A 1 9  ? 0.290   -0.588  -11.505 1.00 0.00 ? 9  VAL A CG2  2 
ATOM   1090 H H    . VAL A 1 9  ? 1.901   2.120   -8.958  1.00 0.00 ? 9  VAL A H    2 
ATOM   1091 H HA   . VAL A 1 9  ? -0.245  1.948   -10.721 1.00 0.00 ? 9  VAL A HA   2 
ATOM   1092 H HB   . VAL A 1 9  ? 1.871   0.773   -11.104 1.00 0.00 ? 9  VAL A HB   2 
ATOM   1093 H HG11 . VAL A 1 9  ? 1.020   -1.274  -9.081  1.00 0.00 ? 9  VAL A HG11 2 
ATOM   1094 H HG12 . VAL A 1 9  ? 2.063   0.082   -8.652  1.00 0.00 ? 9  VAL A HG12 2 
ATOM   1095 H HG13 . VAL A 1 9  ? 2.586   -1.083  -9.869  1.00 0.00 ? 9  VAL A HG13 2 
ATOM   1096 H HG21 . VAL A 1 9  ? -0.602  -0.063  -11.813 1.00 0.00 ? 9  VAL A HG21 2 
ATOM   1097 H HG22 . VAL A 1 9  ? 0.015   -1.508  -11.011 1.00 0.00 ? 9  VAL A HG22 2 
ATOM   1098 H HG23 . VAL A 1 9  ? 0.894   -0.812  -12.372 1.00 0.00 ? 9  VAL A HG23 2 
ATOM   1099 N N    . CYS A 1 10 ? -0.734  0.607   -7.822  1.00 0.00 ? 10 CYS A N    2 
ATOM   1100 C CA   . CYS A 1 10 ? -1.720  -0.003  -6.937  1.00 0.00 ? 10 CYS A CA   2 
ATOM   1101 C C    . CYS A 1 10 ? -2.783  1.013   -6.549  1.00 0.00 ? 10 CYS A C    2 
ATOM   1102 O O    . CYS A 1 10 ? -3.947  0.669   -6.345  1.00 0.00 ? 10 CYS A O    2 
ATOM   1103 C CB   . CYS A 1 10 ? -1.038  -0.530  -5.678  1.00 0.00 ? 10 CYS A CB   2 
ATOM   1104 S SG   . CYS A 1 10 ? -1.920  -1.905  -4.870  1.00 0.00 ? 10 CYS A SG   2 
ATOM   1105 H H    . CYS A 1 10 ? 0.097   0.955   -7.441  1.00 0.00 ? 10 CYS A H    2 
ATOM   1106 H HA   . CYS A 1 10 ? -2.186  -0.824  -7.462  1.00 0.00 ? 10 CYS A HA   2 
ATOM   1107 H HB2  . CYS A 1 10 ? -0.049  -0.873  -5.933  1.00 0.00 ? 10 CYS A HB2  2 
ATOM   1108 H HB3  . CYS A 1 10 ? -0.960  0.276   -4.960  1.00 0.00 ? 10 CYS A HB3  2 
ATOM   1109 N N    . ALA A 1 11 ? -2.362  2.269   -6.447  1.00 0.00 ? 11 ALA A N    2 
ATOM   1110 C CA   . ALA A 1 11 ? -3.257  3.364   -6.080  1.00 0.00 ? 11 ALA A CA   2 
ATOM   1111 C C    . ALA A 1 11 ? -4.584  3.271   -6.821  1.00 0.00 ? 11 ALA A C    2 
ATOM   1112 O O    . ALA A 1 11 ? -5.621  3.705   -6.321  1.00 0.00 ? 11 ALA A O    2 
ATOM   1113 C CB   . ALA A 1 11 ? -2.587  4.704   -6.352  1.00 0.00 ? 11 ALA A CB   2 
ATOM   1114 H H    . ALA A 1 11 ? -1.420  2.464   -6.623  1.00 0.00 ? 11 ALA A H    2 
ATOM   1115 H HA   . ALA A 1 11 ? -3.445  3.293   -5.024  1.00 0.00 ? 11 ALA A HA   2 
ATOM   1116 H HB1  . ALA A 1 11 ? -3.142  5.239   -7.109  1.00 0.00 ? 11 ALA A HB1  2 
ATOM   1117 H HB2  . ALA A 1 11 ? -1.577  4.538   -6.696  1.00 0.00 ? 11 ALA A HB2  2 
ATOM   1118 H HB3  . ALA A 1 11 ? -2.566  5.287   -5.442  1.00 0.00 ? 11 ALA A HB3  2 
ATOM   1119 N N    . SER A 1 12 ? -4.538  2.696   -8.014  1.00 0.00 ? 12 SER A N    2 
ATOM   1120 C CA   . SER A 1 12 ? -5.730  2.533   -8.833  1.00 0.00 ? 12 SER A CA   2 
ATOM   1121 C C    . SER A 1 12 ? -6.837  1.835   -8.048  1.00 0.00 ? 12 SER A C    2 
ATOM   1122 O O    . SER A 1 12 ? -8.001  2.233   -8.106  1.00 0.00 ? 12 SER A O    2 
ATOM   1123 C CB   . SER A 1 12 ? -5.402  1.732   -10.095 1.00 0.00 ? 12 SER A CB   2 
ATOM   1124 O OG   . SER A 1 12 ? -4.458  2.415   -10.902 1.00 0.00 ? 12 SER A OG   2 
ATOM   1125 H H    . SER A 1 12 ? -3.681  2.372   -8.349  1.00 0.00 ? 12 SER A H    2 
ATOM   1126 H HA   . SER A 1 12 ? -6.067  3.515   -9.119  1.00 0.00 ? 12 SER A HA   2 
ATOM   1127 H HB2  . SER A 1 12 ? -4.989  0.774   -9.814  1.00 0.00 ? 12 SER A HB2  2 
ATOM   1128 H HB3  . SER A 1 12 ? -6.305  1.580   -10.667 1.00 0.00 ? 12 SER A HB3  2 
ATOM   1129 H HG   . SER A 1 12 ? -4.135  1.824   -11.587 1.00 0.00 ? 12 SER A HG   2 
ATOM   1130 N N    . ALA A 1 13 ? -6.462  0.793   -7.313  1.00 0.00 ? 13 ALA A N    2 
ATOM   1131 C CA   . ALA A 1 13 ? -7.413  0.038   -6.514  1.00 0.00 ? 13 ALA A CA   2 
ATOM   1132 C C    . ALA A 1 13 ? -7.687  0.727   -5.180  1.00 0.00 ? 13 ALA A C    2 
ATOM   1133 O O    . ALA A 1 13 ? -8.749  0.547   -4.585  1.00 0.00 ? 13 ALA A O    2 
ATOM   1134 C CB   . ALA A 1 13 ? -6.902  -1.377  -6.284  1.00 0.00 ? 13 ALA A CB   2 
ATOM   1135 H H    . ALA A 1 13 ? -5.524  0.526   -7.309  1.00 0.00 ? 13 ALA A H    2 
ATOM   1136 H HA   . ALA A 1 13 ? -8.331  -0.025  -7.072  1.00 0.00 ? 13 ALA A HA   2 
ATOM   1137 H HB1  . ALA A 1 13 ? -7.737  -2.034  -6.089  1.00 0.00 ? 13 ALA A HB1  2 
ATOM   1138 H HB2  . ALA A 1 13 ? -6.233  -1.384  -5.437  1.00 0.00 ? 13 ALA A HB2  2 
ATOM   1139 H HB3  . ALA A 1 13 ? -6.375  -1.716  -7.163  1.00 0.00 ? 13 ALA A HB3  2 
ATOM   1140 N N    . ILE A 1 14 ? -6.724  1.517   -4.716  1.00 0.00 ? 14 ILE A N    2 
ATOM   1141 C CA   . ILE A 1 14 ? -6.863  2.232   -3.454  1.00 0.00 ? 14 ILE A CA   2 
ATOM   1142 C C    . ILE A 1 14 ? -7.924  3.326   -3.565  1.00 0.00 ? 14 ILE A C    2 
ATOM   1143 O O    . ILE A 1 14 ? -8.934  3.300   -2.861  1.00 0.00 ? 14 ILE A O    2 
ATOM   1144 C CB   . ILE A 1 14 ? -5.516  2.857   -3.015  1.00 0.00 ? 14 ILE A CB   2 
ATOM   1145 C CG1  . ILE A 1 14 ? -4.594  1.783   -2.431  1.00 0.00 ? 14 ILE A CG1  2 
ATOM   1146 C CG2  . ILE A 1 14 ? -5.730  3.972   -1.999  1.00 0.00 ? 14 ILE A CG2  2 
ATOM   1147 C CD1  . ILE A 1 14 ? -3.818  1.012   -3.479  1.00 0.00 ? 14 ILE A CD1  2 
ATOM   1148 H H    . ILE A 1 14 ? -5.899  1.622   -5.235  1.00 0.00 ? 14 ILE A H    2 
ATOM   1149 H HA   . ILE A 1 14 ? -7.170  1.521   -2.700  1.00 0.00 ? 14 ILE A HA   2 
ATOM   1150 H HB   . ILE A 1 14 ? -5.046  3.286   -3.886  1.00 0.00 ? 14 ILE A HB   2 
ATOM   1151 H HG12 . ILE A 1 14 ? -3.880  2.254   -1.770  1.00 0.00 ? 14 ILE A HG12 2 
ATOM   1152 H HG13 . ILE A 1 14 ? -5.187  1.077   -1.868  1.00 0.00 ? 14 ILE A HG13 2 
ATOM   1153 H HG21 . ILE A 1 14 ? -6.290  4.775   -2.456  1.00 0.00 ? 14 ILE A HG21 2 
ATOM   1154 H HG22 . ILE A 1 14 ? -4.772  4.345   -1.670  1.00 0.00 ? 14 ILE A HG22 2 
ATOM   1155 H HG23 . ILE A 1 14 ? -6.277  3.587   -1.151  1.00 0.00 ? 14 ILE A HG23 2 
ATOM   1156 H HD11 . ILE A 1 14 ? -3.277  0.206   -3.006  1.00 0.00 ? 14 ILE A HD11 2 
ATOM   1157 H HD12 . ILE A 1 14 ? -3.119  1.672   -3.971  1.00 0.00 ? 14 ILE A HD12 2 
ATOM   1158 H HD13 . ILE A 1 14 ? -4.504  0.605   -4.207  1.00 0.00 ? 14 ILE A HD13 2 
ATOM   1159 N N    . LEU A 1 15 ? -7.682  4.288   -4.448  1.00 0.00 ? 15 LEU A N    2 
ATOM   1160 C CA   . LEU A 1 15 ? -8.609  5.397   -4.647  1.00 0.00 ? 15 LEU A CA   2 
ATOM   1161 C C    . LEU A 1 15 ? -9.851  4.948   -5.413  1.00 0.00 ? 15 LEU A C    2 
ATOM   1162 O O    . LEU A 1 15 ? -10.905 4.714   -4.822  1.00 0.00 ? 15 LEU A O    2 
ATOM   1163 C CB   . LEU A 1 15 ? -7.917  6.540   -5.393  1.00 0.00 ? 15 LEU A CB   2 
ATOM   1164 C CG   . LEU A 1 15 ? -6.861  7.295   -4.583  1.00 0.00 ? 15 LEU A CG   2 
ATOM   1165 C CD1  . LEU A 1 15 ? -5.815  7.901   -5.505  1.00 0.00 ? 15 LEU A CD1  2 
ATOM   1166 C CD2  . LEU A 1 15 ? -7.514  8.374   -3.732  1.00 0.00 ? 15 LEU A CD2  2 
ATOM   1167 H H    . LEU A 1 15 ? -6.856  4.255   -4.976  1.00 0.00 ? 15 LEU A H    2 
ATOM   1168 H HA   . LEU A 1 15 ? -8.913  5.749   -3.673  1.00 0.00 ? 15 LEU A HA   2 
ATOM   1169 H HB2  . LEU A 1 15 ? -7.443  6.132   -6.273  1.00 0.00 ? 15 LEU A HB2  2 
ATOM   1170 H HB3  . LEU A 1 15 ? -8.671  7.246   -5.705  1.00 0.00 ? 15 LEU A HB3  2 
ATOM   1171 H HG   . LEU A 1 15 ? -6.362  6.602   -3.922  1.00 0.00 ? 15 LEU A HG   2 
ATOM   1172 H HD11 . LEU A 1 15 ? -5.125  8.495   -4.925  1.00 0.00 ? 15 LEU A HD11 2 
ATOM   1173 H HD12 . LEU A 1 15 ? -6.301  8.528   -6.238  1.00 0.00 ? 15 LEU A HD12 2 
ATOM   1174 H HD13 . LEU A 1 15 ? -5.277  7.111   -6.008  1.00 0.00 ? 15 LEU A HD13 2 
ATOM   1175 H HD21 . LEU A 1 15 ? -6.759  8.875   -3.146  1.00 0.00 ? 15 LEU A HD21 2 
ATOM   1176 H HD22 . LEU A 1 15 ? -8.241  7.922   -3.074  1.00 0.00 ? 15 LEU A HD22 2 
ATOM   1177 H HD23 . LEU A 1 15 ? -8.007  9.090   -4.374  1.00 0.00 ? 15 LEU A HD23 2 
ATOM   1178 N N    . SER A 1 16 ? -9.721  4.834   -6.732  1.00 0.00 ? 16 SER A N    2 
ATOM   1179 C CA   . SER A 1 16 ? -10.836 4.418   -7.578  1.00 0.00 ? 16 SER A CA   2 
ATOM   1180 C C    . SER A 1 16 ? -11.398 3.075   -7.123  1.00 0.00 ? 16 SER A C    2 
ATOM   1181 O O    . SER A 1 16 ? -12.558 2.980   -6.722  1.00 0.00 ? 16 SER A O    2 
ATOM   1182 C CB   . SER A 1 16 ? -10.390 4.332   -9.040  1.00 0.00 ? 16 SER A CB   2 
ATOM   1183 O OG   . SER A 1 16 ? -8.978  4.270   -9.141  1.00 0.00 ? 16 SER A OG   2 
ATOM   1184 H H    . SER A 1 16 ? -8.857  5.037   -7.147  1.00 0.00 ? 16 SER A H    2 
ATOM   1185 H HA   . SER A 1 16 ? -11.611 5.165   -7.492  1.00 0.00 ? 16 SER A HA   2 
ATOM   1186 H HB2  . SER A 1 16 ? -10.809 3.444   -9.491  1.00 0.00 ? 16 SER A HB2  2 
ATOM   1187 H HB3  . SER A 1 16 ? -10.739 5.204   -9.572  1.00 0.00 ? 16 SER A HB3  2 
ATOM   1188 H HG   . SER A 1 16 ? -8.720  3.420   -9.504  1.00 0.00 ? 16 SER A HG   2 
ATOM   1189 N N    . GLY A 1 17 ? -10.569 2.039   -7.188  1.00 0.00 ? 17 GLY A N    2 
ATOM   1190 C CA   . GLY A 1 17 ? -11.003 0.716   -6.780  1.00 0.00 ? 17 GLY A CA   2 
ATOM   1191 C C    . GLY A 1 17 ? -11.391 -0.154  -7.958  1.00 0.00 ? 17 GLY A C    2 
ATOM   1192 O O    . GLY A 1 17 ? -12.330 -0.946  -7.871  1.00 0.00 ? 17 GLY A O    2 
ATOM   1193 H H    . GLY A 1 17 ? -9.655  2.173   -7.516  1.00 0.00 ? 17 GLY A H    2 
ATOM   1194 H HA2  . GLY A 1 17 ? -10.201 0.236   -6.241  1.00 0.00 ? 17 GLY A HA2  2 
ATOM   1195 H HA3  . GLY A 1 17 ? -11.855 0.815   -6.124  1.00 0.00 ? 17 GLY A HA3  2 
ATOM   1196 N N    . ALA A 1 18 ? -10.667 -0.008  -9.063  1.00 0.00 ? 18 ALA A N    2 
ATOM   1197 C CA   . ALA A 1 18 ? -10.939 -0.788  -10.264 1.00 0.00 ? 18 ALA A CA   2 
ATOM   1198 C C    . ALA A 1 18 ? -10.861 -2.281  -9.978  1.00 0.00 ? 18 ALA A C    2 
ATOM   1199 O O    . ALA A 1 18 ? -11.882 -2.946  -9.809  1.00 0.00 ? 18 ALA A O    2 
ATOM   1200 C CB   . ALA A 1 18 ? -9.970  -0.400  -11.374 1.00 0.00 ? 18 ALA A CB   2 
ATOM   1201 H H    . ALA A 1 18 ? -9.931  0.639   -9.070  1.00 0.00 ? 18 ALA A H    2 
ATOM   1202 H HA   . ALA A 1 18 ? -11.933 -0.553  -10.594 1.00 0.00 ? 18 ALA A HA   2 
ATOM   1203 H HB1  . ALA A 1 18 ? -10.518 0.040   -12.193 1.00 0.00 ? 18 ALA A HB1  2 
ATOM   1204 H HB2  . ALA A 1 18 ? -9.447  -1.279  -11.722 1.00 0.00 ? 18 ALA A HB2  2 
ATOM   1205 H HB3  . ALA A 1 18 ? -9.256  0.316   -10.993 1.00 0.00 ? 18 ALA A HB3  2 
ATOM   1206 N N    . LYS A 1 19 ? -9.641  -2.790  -9.919  1.00 0.00 ? 19 LYS A N    2 
ATOM   1207 C CA   . LYS A 1 19 ? -9.393  -4.200  -9.652  1.00 0.00 ? 19 LYS A CA   2 
ATOM   1208 C C    . LYS A 1 19 ? -7.970  -4.406  -9.135  1.00 0.00 ? 19 LYS A C    2 
ATOM   1209 O O    . LYS A 1 19 ? -7.046  -3.700  -9.541  1.00 0.00 ? 19 LYS A O    2 
ATOM   1210 C CB   . LYS A 1 19 ? -9.592  -5.034  -10.921 1.00 0.00 ? 19 LYS A CB   2 
ATOM   1211 C CG   . LYS A 1 19 ? -10.961 -4.875  -11.558 1.00 0.00 ? 19 LYS A CG   2 
ATOM   1212 C CD   . LYS A 1 19 ? -10.975 -3.747  -12.576 1.00 0.00 ? 19 LYS A CD   2 
ATOM   1213 C CE   . LYS A 1 19 ? -10.618 -4.247  -13.966 1.00 0.00 ? 19 LYS A CE   2 
ATOM   1214 N NZ   . LYS A 1 19 ? -10.020 -3.173  -14.807 1.00 0.00 ? 19 LYS A NZ   2 
ATOM   1215 H H    . LYS A 1 19 ? -8.885  -2.198  -10.059 1.00 0.00 ? 19 LYS A H    2 
ATOM   1216 H HA   . LYS A 1 19 ? -10.091 -4.522  -8.901  1.00 0.00 ? 19 LYS A HA   2 
ATOM   1217 H HB2  . LYS A 1 19 ? -8.847  -4.744  -11.648 1.00 0.00 ? 19 LYS A HB2  2 
ATOM   1218 H HB3  . LYS A 1 19 ? -9.453  -6.077  -10.676 1.00 0.00 ? 19 LYS A HB3  2 
ATOM   1219 H HG2  . LYS A 1 19 ? -11.224 -5.796  -12.054 1.00 0.00 ? 19 LYS A HG2  2 
ATOM   1220 H HG3  . LYS A 1 19 ? -11.681 -4.663  -10.786 1.00 0.00 ? 19 LYS A HG3  2 
ATOM   1221 H HD2  . LYS A 1 19 ? -11.963 -3.312  -12.604 1.00 0.00 ? 19 LYS A HD2  2 
ATOM   1222 H HD3  . LYS A 1 19 ? -10.257 -2.997  -12.278 1.00 0.00 ? 19 LYS A HD3  2 
ATOM   1223 H HE2  . LYS A 1 19 ? -9.908  -5.055  -13.873 1.00 0.00 ? 19 LYS A HE2  2 
ATOM   1224 H HE3  . LYS A 1 19 ? -11.515 -4.610  -14.446 1.00 0.00 ? 19 LYS A HE3  2 
ATOM   1225 H HZ1  . LYS A 1 19 ? -10.746 -2.755  -15.423 1.00 0.00 ? 19 LYS A HZ1  2 
ATOM   1226 H HZ2  . LYS A 1 19 ? -9.261  -3.565  -15.401 1.00 0.00 ? 19 LYS A HZ2  2 
ATOM   1227 H HZ3  . LYS A 1 19 ? -9.621  -2.426  -14.203 1.00 0.00 ? 19 LYS A HZ3  2 
ATOM   1228 N N    . PRO A 1 20 ? -7.775  -5.380  -8.230  1.00 0.00 ? 20 PRO A N    2 
ATOM   1229 C CA   . PRO A 1 20 ? -6.455  -5.674  -7.662  1.00 0.00 ? 20 PRO A CA   2 
ATOM   1230 C C    . PRO A 1 20 ? -5.507  -6.280  -8.691  1.00 0.00 ? 20 PRO A C    2 
ATOM   1231 O O    . PRO A 1 20 ? -5.842  -6.384  -9.871  1.00 0.00 ? 20 PRO A O    2 
ATOM   1232 C CB   . PRO A 1 20 ? -6.760  -6.685  -6.554  1.00 0.00 ? 20 PRO A CB   2 
ATOM   1233 C CG   . PRO A 1 20 ? -8.036  -7.331  -6.970  1.00 0.00 ? 20 PRO A CG   2 
ATOM   1234 C CD   . PRO A 1 20 ? -8.820  -6.271  -7.693  1.00 0.00 ? 20 PRO A CD   2 
ATOM   1235 H HA   . PRO A 1 20 ? -6.003  -4.791  -7.234  1.00 0.00 ? 20 PRO A HA   2 
ATOM   1236 H HB2  . PRO A 1 20 ? -5.956  -7.403  -6.487  1.00 0.00 ? 20 PRO A HB2  2 
ATOM   1237 H HB3  . PRO A 1 20 ? -6.869  -6.169  -5.612  1.00 0.00 ? 20 PRO A HB3  2 
ATOM   1238 H HG2  . PRO A 1 20 ? -7.829  -8.160  -7.631  1.00 0.00 ? 20 PRO A HG2  2 
ATOM   1239 H HG3  . PRO A 1 20 ? -8.577  -7.669  -6.100  1.00 0.00 ? 20 PRO A HG3  2 
ATOM   1240 H HD2  . PRO A 1 20 ? -9.401  -6.709  -8.491  1.00 0.00 ? 20 PRO A HD2  2 
ATOM   1241 H HD3  . PRO A 1 20 ? -9.461  -5.741  -7.004  1.00 0.00 ? 20 PRO A HD3  2 
ATOM   1242 N N    . SER A 1 21 ? -4.324  -6.679  -8.237  1.00 0.00 ? 21 SER A N    2 
ATOM   1243 C CA   . SER A 1 21 ? -3.330  -7.275  -9.120  1.00 0.00 ? 21 SER A CA   2 
ATOM   1244 C C    . SER A 1 21 ? -2.135  -7.789  -8.325  1.00 0.00 ? 21 SER A C    2 
ATOM   1245 O O    . SER A 1 21 ? -1.669  -7.135  -7.392  1.00 0.00 ? 21 SER A O    2 
ATOM   1246 C CB   . SER A 1 21 ? -2.865  -6.256  -10.162 1.00 0.00 ? 21 SER A CB   2 
ATOM   1247 O OG   . SER A 1 21 ? -2.755  -4.961  -9.597  1.00 0.00 ? 21 SER A OG   2 
ATOM   1248 H H    . SER A 1 21 ? -4.115  -6.570  -7.287  1.00 0.00 ? 21 SER A H    2 
ATOM   1249 H HA   . SER A 1 21 ? -3.795  -8.107  -9.625  1.00 0.00 ? 21 SER A HA   2 
ATOM   1250 H HB2  . SER A 1 21 ? -1.899  -6.551  -10.544 1.00 0.00 ? 21 SER A HB2  2 
ATOM   1251 H HB3  . SER A 1 21 ? -3.578  -6.223  -10.973 1.00 0.00 ? 21 SER A HB3  2 
ATOM   1252 H HG   . SER A 1 21 ? -1.895  -4.591  -9.809  1.00 0.00 ? 21 SER A HG   2 
ATOM   1253 N N    . GLY A 1 22 ? -1.643  -8.965  -8.701  1.00 0.00 ? 22 GLY A N    2 
ATOM   1254 C CA   . GLY A 1 22 ? -0.506  -9.547  -8.013  1.00 0.00 ? 22 GLY A CA   2 
ATOM   1255 C C    . GLY A 1 22 ? 0.712   -8.644  -8.038  1.00 0.00 ? 22 GLY A C    2 
ATOM   1256 O O    . GLY A 1 22 ? 1.554   -8.701  -7.144  1.00 0.00 ? 22 GLY A O    2 
ATOM   1257 H H    . GLY A 1 22 ? -2.055  -9.441  -9.452  1.00 0.00 ? 22 GLY A H    2 
ATOM   1258 H HA2  . GLY A 1 22 ? -0.779  -9.736  -6.986  1.00 0.00 ? 22 GLY A HA2  2 
ATOM   1259 H HA3  . GLY A 1 22 ? -0.254  -10.485 -8.486  1.00 0.00 ? 22 GLY A HA3  2 
ATOM   1260 N N    . GLU A 1 23 ? 0.807   -7.810  -9.069  1.00 0.00 ? 23 GLU A N    2 
ATOM   1261 C CA   . GLU A 1 23 ? 1.922   -6.895  -9.217  1.00 0.00 ? 23 GLU A CA   2 
ATOM   1262 C C    . GLU A 1 23 ? 2.111   -6.052  -7.959  1.00 0.00 ? 23 GLU A C    2 
ATOM   1263 O O    . GLU A 1 23 ? 3.234   -5.842  -7.502  1.00 0.00 ? 23 GLU A O    2 
ATOM   1264 C CB   . GLU A 1 23 ? 1.675   -5.990  -10.420 1.00 0.00 ? 23 GLU A CB   2 
ATOM   1265 C CG   . GLU A 1 23 ? 2.948   -5.465  -11.039 1.00 0.00 ? 23 GLU A CG   2 
ATOM   1266 C CD   . GLU A 1 23 ? 2.791   -4.070  -11.613 1.00 0.00 ? 23 GLU A CD   2 
ATOM   1267 O OE1  . GLU A 1 23 ? 2.667   -3.113  -10.821 1.00 0.00 ? 23 GLU A OE1  2 
ATOM   1268 O OE2  . GLU A 1 23 ? 2.793   -3.936  -12.855 1.00 0.00 ? 23 GLU A OE2  2 
ATOM   1269 H H    . GLU A 1 23 ? 0.111   -7.810  -9.754  1.00 0.00 ? 23 GLU A H    2 
ATOM   1270 H HA   . GLU A 1 23 ? 2.814   -7.477  -9.390  1.00 0.00 ? 23 GLU A HA   2 
ATOM   1271 H HB2  . GLU A 1 23 ? 1.136   -6.549  -11.174 1.00 0.00 ? 23 GLU A HB2  2 
ATOM   1272 H HB3  . GLU A 1 23 ? 1.075   -5.146  -10.106 1.00 0.00 ? 23 GLU A HB3  2 
ATOM   1273 H HG2  . GLU A 1 23 ? 3.714   -5.445  -10.281 1.00 0.00 ? 23 GLU A HG2  2 
ATOM   1274 H HG3  . GLU A 1 23 ? 3.241   -6.136  -11.830 1.00 0.00 ? 23 GLU A HG3  2 
ATOM   1275 N N    . CYS A 1 24 ? 1.002   -5.568  -7.408  1.00 0.00 ? 24 CYS A N    2 
ATOM   1276 C CA   . CYS A 1 24 ? 1.040   -4.744  -6.208  1.00 0.00 ? 24 CYS A CA   2 
ATOM   1277 C C    . CYS A 1 24 ? 1.763   -5.455  -5.067  1.00 0.00 ? 24 CYS A C    2 
ATOM   1278 O O    . CYS A 1 24 ? 2.275   -4.814  -4.150  1.00 0.00 ? 24 CYS A O    2 
ATOM   1279 C CB   . CYS A 1 24 ? -0.379  -4.364  -5.774  1.00 0.00 ? 24 CYS A CB   2 
ATOM   1280 S SG   . CYS A 1 24 ? -0.441  -3.204  -4.369  1.00 0.00 ? 24 CYS A SG   2 
ATOM   1281 H H    . CYS A 1 24 ? 0.139   -5.765  -7.821  1.00 0.00 ? 24 CYS A H    2 
ATOM   1282 H HA   . CYS A 1 24 ? 1.580   -3.848  -6.452  1.00 0.00 ? 24 CYS A HA   2 
ATOM   1283 H HB2  . CYS A 1 24 ? -0.889  -3.900  -6.605  1.00 0.00 ? 24 CYS A HB2  2 
ATOM   1284 H HB3  . CYS A 1 24 ? -0.911  -5.259  -5.486  1.00 0.00 ? 24 CYS A HB3  2 
ATOM   1285 N N    . CYS A 1 25 ? 1.802   -6.781  -5.131  1.00 0.00 ? 25 CYS A N    2 
ATOM   1286 C CA   . CYS A 1 25 ? 2.466   -7.575  -4.103  1.00 0.00 ? 25 CYS A CA   2 
ATOM   1287 C C    . CYS A 1 25 ? 3.978   -7.553  -4.293  1.00 0.00 ? 25 CYS A C    2 
ATOM   1288 O O    . CYS A 1 25 ? 4.732   -7.368  -3.338  1.00 0.00 ? 25 CYS A O    2 
ATOM   1289 C CB   . CYS A 1 25 ? 1.960   -9.019  -4.132  1.00 0.00 ? 25 CYS A CB   2 
ATOM   1290 S SG   . CYS A 1 25 ? 0.215   -9.209  -3.643  1.00 0.00 ? 25 CYS A SG   2 
ATOM   1291 H H    . CYS A 1 25 ? 1.377   -7.234  -5.887  1.00 0.00 ? 25 CYS A H    2 
ATOM   1292 H HA   . CYS A 1 25 ? 2.229   -7.139  -3.143  1.00 0.00 ? 25 CYS A HA   2 
ATOM   1293 H HB2  . CYS A 1 25 ? 2.065   -9.409  -5.132  1.00 0.00 ? 25 CYS A HB2  2 
ATOM   1294 H HB3  . CYS A 1 25 ? 2.557   -9.614  -3.456  1.00 0.00 ? 25 CYS A HB3  2 
ATOM   1295 N N    . GLY A 1 26 ? 4.414   -7.743  -5.534  1.00 0.00 ? 26 GLY A N    2 
ATOM   1296 C CA   . GLY A 1 26 ? 5.834   -7.742  -5.830  1.00 0.00 ? 26 GLY A CA   2 
ATOM   1297 C C    . GLY A 1 26 ? 6.440   -6.354  -5.771  1.00 0.00 ? 26 GLY A C    2 
ATOM   1298 O O    . GLY A 1 26 ? 7.589   -6.189  -5.362  1.00 0.00 ? 26 GLY A O    2 
ATOM   1299 H H    . GLY A 1 26 ? 3.765   -7.886  -6.255  1.00 0.00 ? 26 GLY A H    2 
ATOM   1300 H HA2  . GLY A 1 26 ? 6.339   -8.374  -5.114  1.00 0.00 ? 26 GLY A HA2  2 
ATOM   1301 H HA3  . GLY A 1 26 ? 5.984   -8.147  -6.820  1.00 0.00 ? 26 GLY A HA3  2 
ATOM   1302 N N    . ASN A 1 27 ? 5.669   -5.352  -6.185  1.00 0.00 ? 27 ASN A N    2 
ATOM   1303 C CA   . ASN A 1 27 ? 6.139   -3.979  -6.180  1.00 0.00 ? 27 ASN A CA   2 
ATOM   1304 C C    . ASN A 1 27 ? 6.448   -3.517  -4.767  1.00 0.00 ? 27 ASN A C    2 
ATOM   1305 O O    . ASN A 1 27 ? 7.580   -3.151  -4.449  1.00 0.00 ? 27 ASN A O    2 
ATOM   1306 C CB   . ASN A 1 27 ? 5.098   -3.058  -6.818  1.00 0.00 ? 27 ASN A CB   2 
ATOM   1307 C CG   . ASN A 1 27 ? 4.931   -3.316  -8.302  1.00 0.00 ? 27 ASN A CG   2 
ATOM   1308 O OD1  . ASN A 1 27 ? 3.884   -3.787  -8.748  1.00 0.00 ? 27 ASN A OD1  2 
ATOM   1309 N ND2  . ASN A 1 27 ? 5.965   -3.009  -9.076  1.00 0.00 ? 27 ASN A ND2  2 
ATOM   1310 H H    . ASN A 1 27 ? 4.767   -5.541  -6.502  1.00 0.00 ? 27 ASN A H    2 
ATOM   1311 H HA   . ASN A 1 27 ? 7.035   -3.944  -6.755  1.00 0.00 ? 27 ASN A HA   2 
ATOM   1312 H HB2  . ASN A 1 27 ? 4.145   -3.212  -6.335  1.00 0.00 ? 27 ASN A HB2  2 
ATOM   1313 H HB3  . ASN A 1 27 ? 5.404   -2.031  -6.681  1.00 0.00 ? 27 ASN A HB3  2 
ATOM   1314 H HD21 . ASN A 1 27 ? 6.766   -2.638  -8.651  1.00 0.00 ? 27 ASN A HD21 2 
ATOM   1315 H HD22 . ASN A 1 27 ? 5.885   -3.166  -10.039 1.00 0.00 ? 27 ASN A HD22 2 
ATOM   1316 N N    . LEU A 1 28 ? 5.431   -3.542  -3.927  1.00 0.00 ? 28 LEU A N    2 
ATOM   1317 C CA   . LEU A 1 28 ? 5.572   -3.131  -2.538  1.00 0.00 ? 28 LEU A CA   2 
ATOM   1318 C C    . LEU A 1 28 ? 6.697   -3.905  -1.859  1.00 0.00 ? 28 LEU A C    2 
ATOM   1319 O O    . LEU A 1 28 ? 7.364   -3.396  -0.959  1.00 0.00 ? 28 LEU A O    2 
ATOM   1320 C CB   . LEU A 1 28 ? 4.253   -3.324  -1.785  1.00 0.00 ? 28 LEU A CB   2 
ATOM   1321 C CG   . LEU A 1 28 ? 4.012   -4.735  -1.259  1.00 0.00 ? 28 LEU A CG   2 
ATOM   1322 C CD1  . LEU A 1 28 ? 4.626   -4.897  0.121   1.00 0.00 ? 28 LEU A CD1  2 
ATOM   1323 C CD2  . LEU A 1 28 ? 2.523   -5.048  -1.227  1.00 0.00 ? 28 LEU A CD2  2 
ATOM   1324 H H    . LEU A 1 28 ? 4.564   -3.845  -4.251  1.00 0.00 ? 28 LEU A H    2 
ATOM   1325 H HA   . LEU A 1 28 ? 5.822   -2.094  -2.533  1.00 0.00 ? 28 LEU A HA   2 
ATOM   1326 H HB2  . LEU A 1 28 ? 4.238   -2.642  -0.947  1.00 0.00 ? 28 LEU A HB2  2 
ATOM   1327 H HB3  . LEU A 1 28 ? 3.442   -3.069  -2.450  1.00 0.00 ? 28 LEU A HB3  2 
ATOM   1328 H HG   . LEU A 1 28 ? 4.491   -5.438  -1.923  1.00 0.00 ? 28 LEU A HG   2 
ATOM   1329 H HD11 . LEU A 1 28 ? 5.402   -4.159  0.259   1.00 0.00 ? 28 LEU A HD11 2 
ATOM   1330 H HD12 . LEU A 1 28 ? 5.049   -5.885  0.214   1.00 0.00 ? 28 LEU A HD12 2 
ATOM   1331 H HD13 . LEU A 1 28 ? 3.863   -4.761  0.873   1.00 0.00 ? 28 LEU A HD13 2 
ATOM   1332 H HD21 . LEU A 1 28 ? 2.132   -4.835  -0.243  1.00 0.00 ? 28 LEU A HD21 2 
ATOM   1333 H HD22 . LEU A 1 28 ? 2.370   -6.092  -1.457  1.00 0.00 ? 28 LEU A HD22 2 
ATOM   1334 H HD23 . LEU A 1 28 ? 2.012   -4.440  -1.958  1.00 0.00 ? 28 LEU A HD23 2 
ATOM   1335 N N    . ARG A 1 29 ? 6.895   -5.140  -2.301  1.00 0.00 ? 29 ARG A N    2 
ATOM   1336 C CA   . ARG A 1 29 ? 7.929   -5.997  -1.752  1.00 0.00 ? 29 ARG A CA   2 
ATOM   1337 C C    . ARG A 1 29 ? 9.301   -5.379  -1.923  1.00 0.00 ? 29 ARG A C    2 
ATOM   1338 O O    . ARG A 1 29 ? 10.094  -5.323  -0.983  1.00 0.00 ? 29 ARG A O    2 
ATOM   1339 C CB   . ARG A 1 29 ? 7.882   -7.373  -2.423  1.00 0.00 ? 29 ARG A CB   2 
ATOM   1340 C CG   . ARG A 1 29 ? 7.301   -8.477  -1.553  1.00 0.00 ? 29 ARG A CG   2 
ATOM   1341 C CD   . ARG A 1 29 ? 6.078   -8.016  -0.775  1.00 0.00 ? 29 ARG A CD   2 
ATOM   1342 N NE   . ARG A 1 29 ? 6.338   -7.949  0.661   1.00 0.00 ? 29 ARG A NE   2 
ATOM   1343 C CZ   . ARG A 1 29 ? 6.594   -9.013  1.418   1.00 0.00 ? 29 ARG A CZ   2 
ATOM   1344 N NH1  . ARG A 1 29 ? 6.627   -10.226 0.880   1.00 0.00 ? 29 ARG A NH1  2 
ATOM   1345 N NH2  . ARG A 1 29 ? 6.818   -8.865  2.716   1.00 0.00 ? 29 ARG A NH2  2 
ATOM   1346 H H    . ARG A 1 29 ? 6.329   -5.485  -3.014  1.00 0.00 ? 29 ARG A H    2 
ATOM   1347 H HA   . ARG A 1 29 ? 7.735   -6.102  -0.710  1.00 0.00 ? 29 ARG A HA   2 
ATOM   1348 H HB2  . ARG A 1 29 ? 7.280   -7.300  -3.317  1.00 0.00 ? 29 ARG A HB2  2 
ATOM   1349 H HB3  . ARG A 1 29 ? 8.886   -7.658  -2.702  1.00 0.00 ? 29 ARG A HB3  2 
ATOM   1350 H HG2  . ARG A 1 29 ? 7.016   -9.300  -2.187  1.00 0.00 ? 29 ARG A HG2  2 
ATOM   1351 H HG3  . ARG A 1 29 ? 8.057   -8.804  -0.856  1.00 0.00 ? 29 ARG A HG3  2 
ATOM   1352 H HD2  . ARG A 1 29 ? 5.789   -7.038  -1.127  1.00 0.00 ? 29 ARG A HD2  2 
ATOM   1353 H HD3  . ARG A 1 29 ? 5.273   -8.714  -0.953  1.00 0.00 ? 29 ARG A HD3  2 
ATOM   1354 H HE   . ARG A 1 29 ? 6.322   -7.065  1.084   1.00 0.00 ? 29 ARG A HE   2 
ATOM   1355 H HH11 . ARG A 1 29 ? 6.460   -10.346 -0.098  1.00 0.00 ? 29 ARG A HH11 2 
ATOM   1356 H HH12 . ARG A 1 29 ? 6.820   -11.022 1.454   1.00 0.00 ? 29 ARG A HH12 2 
ATOM   1357 H HH21 . ARG A 1 29 ? 6.795   -7.953  3.127   1.00 0.00 ? 29 ARG A HH21 2 
ATOM   1358 H HH22 . ARG A 1 29 ? 7.009   -9.665  3.285   1.00 0.00 ? 29 ARG A HH22 2 
ATOM   1359 N N    . ALA A 1 30 ? 9.572   -4.906  -3.125  1.00 0.00 ? 30 ALA A N    2 
ATOM   1360 C CA   . ALA A 1 30 ? 10.848  -4.277  -3.423  1.00 0.00 ? 30 ALA A CA   2 
ATOM   1361 C C    . ALA A 1 30 ? 11.177  -3.215  -2.382  1.00 0.00 ? 30 ALA A C    2 
ATOM   1362 O O    . ALA A 1 30 ? 12.343  -2.903  -2.139  1.00 0.00 ? 30 ALA A O    2 
ATOM   1363 C CB   . ALA A 1 30 ? 10.828  -3.670  -4.818  1.00 0.00 ? 30 ALA A CB   2 
ATOM   1364 H H    . ALA A 1 30 ? 8.895   -4.976  -3.824  1.00 0.00 ? 30 ALA A H    2 
ATOM   1365 H HA   . ALA A 1 30 ? 11.605  -5.040  -3.397  1.00 0.00 ? 30 ALA A HA   2 
ATOM   1366 H HB1  . ALA A 1 30 ? 11.792  -3.808  -5.284  1.00 0.00 ? 30 ALA A HB1  2 
ATOM   1367 H HB2  . ALA A 1 30 ? 10.611  -2.614  -4.748  1.00 0.00 ? 30 ALA A HB2  2 
ATOM   1368 H HB3  . ALA A 1 30 ? 10.067  -4.155  -5.411  1.00 0.00 ? 30 ALA A HB3  2 
ATOM   1369 N N    . GLN A 1 31 ? 10.134  -2.670  -1.764  1.00 0.00 ? 31 GLN A N    2 
ATOM   1370 C CA   . GLN A 1 31 ? 10.298  -1.651  -0.739  1.00 0.00 ? 31 GLN A CA   2 
ATOM   1371 C C    . GLN A 1 31 ? 10.632  -2.283  0.605   1.00 0.00 ? 31 GLN A C    2 
ATOM   1372 O O    . GLN A 1 31 ? 11.764  -2.197  1.080   1.00 0.00 ? 31 GLN A O    2 
ATOM   1373 C CB   . GLN A 1 31 ? 9.033   -0.793  -0.621  1.00 0.00 ? 31 GLN A CB   2 
ATOM   1374 C CG   . GLN A 1 31 ? 8.322   -0.566  -1.945  1.00 0.00 ? 31 GLN A CG   2 
ATOM   1375 C CD   . GLN A 1 31 ? 7.973   0.890   -2.171  1.00 0.00 ? 31 GLN A CD   2 
ATOM   1376 O OE1  . GLN A 1 31 ? 6.925   1.365   -1.732  1.00 0.00 ? 31 GLN A OE1  2 
ATOM   1377 N NE2  . GLN A 1 31 ? 8.853   1.609   -2.856  1.00 0.00 ? 31 GLN A NE2  2 
ATOM   1378 H H    . GLN A 1 31 ? 9.230   -2.975  -1.995  1.00 0.00 ? 31 GLN A H    2 
ATOM   1379 H HA   . GLN A 1 31 ? 11.121  -1.018  -1.032  1.00 0.00 ? 31 GLN A HA   2 
ATOM   1380 H HB2  . GLN A 1 31 ? 8.344   -1.275  0.054   1.00 0.00 ? 31 GLN A HB2  2 
ATOM   1381 H HB3  . GLN A 1 31 ? 9.305   0.171   -0.216  1.00 0.00 ? 31 GLN A HB3  2 
ATOM   1382 H HG2  . GLN A 1 31 ? 8.965   -0.895  -2.747  1.00 0.00 ? 31 GLN A HG2  2 
ATOM   1383 H HG3  . GLN A 1 31 ? 7.411   -1.145  -1.953  1.00 0.00 ? 31 GLN A HG3  2 
ATOM   1384 H HE21 . GLN A 1 31 ? 9.670   1.161   -3.175  1.00 0.00 ? 31 GLN A HE21 2 
ATOM   1385 H HE22 . GLN A 1 31 ? 8.652   2.558   -3.014  1.00 0.00 ? 31 GLN A HE22 2 
ATOM   1386 N N    . GLN A 1 32 ? 9.632   -2.917  1.217   1.00 0.00 ? 32 GLN A N    2 
ATOM   1387 C CA   . GLN A 1 32 ? 9.805   -3.564  2.513   1.00 0.00 ? 32 GLN A CA   2 
ATOM   1388 C C    . GLN A 1 32 ? 10.526  -2.652  3.505   1.00 0.00 ? 32 GLN A C    2 
ATOM   1389 O O    . GLN A 1 32 ? 11.093  -3.118  4.493   1.00 0.00 ? 32 GLN A O    2 
ATOM   1390 C CB   . GLN A 1 32 ? 10.577  -4.865  2.344   1.00 0.00 ? 32 GLN A CB   2 
ATOM   1391 C CG   . GLN A 1 32 ? 10.016  -6.012  3.168   1.00 0.00 ? 32 GLN A CG   2 
ATOM   1392 C CD   . GLN A 1 32 ? 9.690   -7.229  2.326   1.00 0.00 ? 32 GLN A CD   2 
ATOM   1393 O OE1  . GLN A 1 32 ? 10.151  -8.336  2.608   1.00 0.00 ? 32 GLN A OE1  2 
ATOM   1394 N NE2  . GLN A 1 32 ? 8.891   -7.030  1.285   1.00 0.00 ? 32 GLN A NE2  2 
ATOM   1395 H H    . GLN A 1 32 ? 8.754   -2.950  0.785   1.00 0.00 ? 32 GLN A H    2 
ATOM   1396 H HA   . GLN A 1 32 ? 8.823   -3.789  2.902   1.00 0.00 ? 32 GLN A HA   2 
ATOM   1397 H HB2  . GLN A 1 32 ? 10.549  -5.148  1.304   1.00 0.00 ? 32 GLN A HB2  2 
ATOM   1398 H HB3  . GLN A 1 32 ? 11.601  -4.702  2.639   1.00 0.00 ? 32 GLN A HB3  2 
ATOM   1399 H HG2  . GLN A 1 32 ? 10.743  -6.293  3.914   1.00 0.00 ? 32 GLN A HG2  2 
ATOM   1400 H HG3  . GLN A 1 32 ? 9.112   -5.676  3.654   1.00 0.00 ? 32 GLN A HG3  2 
ATOM   1401 H HE21 . GLN A 1 32 ? 8.562   -6.121  1.121   1.00 0.00 ? 32 GLN A HE21 2 
ATOM   1402 H HE22 . GLN A 1 32 ? 8.662   -7.799  0.723   1.00 0.00 ? 32 GLN A HE22 2 
ATOM   1403 N N    . GLY A 1 33 ? 10.498  -1.352  3.233   1.00 0.00 ? 33 GLY A N    2 
ATOM   1404 C CA   . GLY A 1 33 ? 11.148  -0.394  4.106   1.00 0.00 ? 33 GLY A CA   2 
ATOM   1405 C C    . GLY A 1 33 ? 10.388  0.914   4.187   1.00 0.00 ? 33 GLY A C    2 
ATOM   1406 O O    . GLY A 1 33 ? 9.644   1.149   5.140   1.00 0.00 ? 33 GLY A O    2 
ATOM   1407 H H    . GLY A 1 33 ? 10.030  -1.042  2.432   1.00 0.00 ? 33 GLY A H    2 
ATOM   1408 H HA2  . GLY A 1 33 ? 11.224  -0.817  5.097   1.00 0.00 ? 33 GLY A HA2  2 
ATOM   1409 H HA3  . GLY A 1 33 ? 12.142  -0.197  3.732   1.00 0.00 ? 33 GLY A HA3  2 
ATOM   1410 N N    . CYS A 1 34 ? 10.570  1.767   3.184   1.00 0.00 ? 34 CYS A N    2 
ATOM   1411 C CA   . CYS A 1 34 ? 9.893   3.053   3.144   1.00 0.00 ? 34 CYS A CA   2 
ATOM   1412 C C    . CYS A 1 34 ? 8.385   2.859   3.152   1.00 0.00 ? 34 CYS A C    2 
ATOM   1413 O O    . CYS A 1 34 ? 7.642   3.634   3.753   1.00 0.00 ? 34 CYS A O    2 
ATOM   1414 C CB   . CYS A 1 34 ? 10.305  3.832   1.904   1.00 0.00 ? 34 CYS A CB   2 
ATOM   1415 S SG   . CYS A 1 34 ? 10.161  5.642   2.056   1.00 0.00 ? 34 CYS A SG   2 
ATOM   1416 H H    . CYS A 1 34 ? 11.171  1.525   2.454   1.00 0.00 ? 34 CYS A H    2 
ATOM   1417 H HA   . CYS A 1 34 ? 10.180  3.596   4.006   1.00 0.00 ? 34 CYS A HA   2 
ATOM   1418 H HB2  . CYS A 1 34 ? 11.331  3.600   1.661   1.00 0.00 ? 34 CYS A HB2  2 
ATOM   1419 H HB3  . CYS A 1 34 ? 9.670   3.527   1.100   1.00 0.00 ? 34 CYS A HB3  2 
ATOM   1420 N N    . PHE A 1 35 ? 7.952   1.806   2.477   1.00 0.00 ? 35 PHE A N    2 
ATOM   1421 C CA   . PHE A 1 35 ? 6.537   1.467   2.384   1.00 0.00 ? 35 PHE A CA   2 
ATOM   1422 C C    . PHE A 1 35 ? 5.942   1.285   3.772   1.00 0.00 ? 35 PHE A C    2 
ATOM   1423 O O    . PHE A 1 35 ? 4.851   1.774   4.067   1.00 0.00 ? 35 PHE A O    2 
ATOM   1424 C CB   . PHE A 1 35 ? 6.378   0.206   1.518   1.00 0.00 ? 35 PHE A CB   2 
ATOM   1425 C CG   . PHE A 1 35 ? 5.397   -0.826  2.014   1.00 0.00 ? 35 PHE A CG   2 
ATOM   1426 C CD1  . PHE A 1 35 ? 4.129   -0.468  2.447   1.00 0.00 ? 35 PHE A CD1  2 
ATOM   1427 C CD2  . PHE A 1 35 ? 5.750   -2.166  2.025   1.00 0.00 ? 35 PHE A CD2  2 
ATOM   1428 C CE1  . PHE A 1 35 ? 3.236   -1.428  2.886   1.00 0.00 ? 35 PHE A CE1  2 
ATOM   1429 C CE2  . PHE A 1 35 ? 4.862   -3.129  2.459   1.00 0.00 ? 35 PHE A CE2  2 
ATOM   1430 C CZ   . PHE A 1 35 ? 3.603   -2.761  2.891   1.00 0.00 ? 35 PHE A CZ   2 
ATOM   1431 H H    . PHE A 1 35 ? 8.608   1.236   2.028   1.00 0.00 ? 35 PHE A H    2 
ATOM   1432 H HA   . PHE A 1 35 ? 6.038   2.286   1.906   1.00 0.00 ? 35 PHE A HA   2 
ATOM   1433 H HB2  . PHE A 1 35 ? 6.060   0.503   0.531   1.00 0.00 ? 35 PHE A HB2  2 
ATOM   1434 H HB3  . PHE A 1 35 ? 7.344   -0.273  1.443   1.00 0.00 ? 35 PHE A HB3  2 
ATOM   1435 H HD1  . PHE A 1 35 ? 3.842   0.573   2.444   1.00 0.00 ? 35 PHE A HD1  2 
ATOM   1436 H HD2  . PHE A 1 35 ? 6.735   -2.455  1.690   1.00 0.00 ? 35 PHE A HD2  2 
ATOM   1437 H HE1  . PHE A 1 35 ? 2.252   -1.138  3.222   1.00 0.00 ? 35 PHE A HE1  2 
ATOM   1438 H HE2  . PHE A 1 35 ? 5.152   -4.171  2.456   1.00 0.00 ? 35 PHE A HE2  2 
ATOM   1439 H HZ   . PHE A 1 35 ? 2.906   -3.512  3.232   1.00 0.00 ? 35 PHE A HZ   2 
ATOM   1440 N N    . CYS A 1 36 ? 6.675   0.589   4.618   1.00 0.00 ? 36 CYS A N    2 
ATOM   1441 C CA   . CYS A 1 36 ? 6.237   0.345   5.986   1.00 0.00 ? 36 CYS A CA   2 
ATOM   1442 C C    . CYS A 1 36 ? 6.159   1.657   6.765   1.00 0.00 ? 36 CYS A C    2 
ATOM   1443 O O    . CYS A 1 36 ? 5.302   1.825   7.634   1.00 0.00 ? 36 CYS A O    2 
ATOM   1444 C CB   . CYS A 1 36 ? 7.190   -0.628  6.687   1.00 0.00 ? 36 CYS A CB   2 
ATOM   1445 S SG   . CYS A 1 36 ? 6.812   -0.905  8.450   1.00 0.00 ? 36 CYS A SG   2 
ATOM   1446 H H    . CYS A 1 36 ? 7.535   0.237   4.313   1.00 0.00 ? 36 CYS A H    2 
ATOM   1447 H HA   . CYS A 1 36 ? 5.252   -0.095  5.946   1.00 0.00 ? 36 CYS A HA   2 
ATOM   1448 H HB2  . CYS A 1 36 ? 7.145   -1.585  6.189   1.00 0.00 ? 36 CYS A HB2  2 
ATOM   1449 H HB3  . CYS A 1 36 ? 8.197   -0.242  6.623   1.00 0.00 ? 36 CYS A HB3  2 
ATOM   1450 N N    . GLN A 1 37 ? 7.062   2.582   6.451   1.00 0.00 ? 37 GLN A N    2 
ATOM   1451 C CA   . GLN A 1 37 ? 7.103   3.874   7.120   1.00 0.00 ? 37 GLN A CA   2 
ATOM   1452 C C    . GLN A 1 37 ? 5.791   4.628   6.952   1.00 0.00 ? 37 GLN A C    2 
ATOM   1453 O O    . GLN A 1 37 ? 5.354   5.347   7.851   1.00 0.00 ? 37 GLN A O    2 
ATOM   1454 C CB   . GLN A 1 37 ? 8.254   4.722   6.578   1.00 0.00 ? 37 GLN A CB   2 
ATOM   1455 C CG   . GLN A 1 37 ? 9.619   4.073   6.728   1.00 0.00 ? 37 GLN A CG   2 
ATOM   1456 C CD   . GLN A 1 37 ? 10.740  4.957   6.218   1.00 0.00 ? 37 GLN A CD   2 
ATOM   1457 O OE1  . GLN A 1 37 ? 11.756  5.140   6.888   1.00 0.00 ? 37 GLN A OE1  2 
ATOM   1458 N NE2  . GLN A 1 37 ? 10.558  5.510   5.024   1.00 0.00 ? 37 GLN A NE2  2 
ATOM   1459 H H    . GLN A 1 37 ? 7.721   2.388   5.757   1.00 0.00 ? 37 GLN A H    2 
ATOM   1460 H HA   . GLN A 1 37 ? 7.265   3.691   8.161   1.00 0.00 ? 37 GLN A HA   2 
ATOM   1461 H HB2  . GLN A 1 37 ? 8.082   4.910   5.529   1.00 0.00 ? 37 GLN A HB2  2 
ATOM   1462 H HB3  . GLN A 1 37 ? 8.269   5.665   7.104   1.00 0.00 ? 37 GLN A HB3  2 
ATOM   1463 H HG2  . GLN A 1 37 ? 9.792   3.865   7.774   1.00 0.00 ? 37 GLN A HG2  2 
ATOM   1464 H HG3  . GLN A 1 37 ? 9.627   3.147   6.171   1.00 0.00 ? 37 GLN A HG3  2 
ATOM   1465 H HE21 . GLN A 1 37 ? 9.722   5.318   4.547   1.00 0.00 ? 37 GLN A HE21 2 
ATOM   1466 H HE22 . GLN A 1 37 ? 11.267  6.083   4.666   1.00 0.00 ? 37 GLN A HE22 2 
ATOM   1467 N N    . TYR A 1 38 ? 5.173   4.462   5.793   1.00 0.00 ? 38 TYR A N    2 
ATOM   1468 C CA   . TYR A 1 38 ? 3.911   5.131   5.496   1.00 0.00 ? 38 TYR A CA   2 
ATOM   1469 C C    . TYR A 1 38 ? 2.805   4.680   6.449   1.00 0.00 ? 38 TYR A C    2 
ATOM   1470 O O    . TYR A 1 38 ? 1.760   5.323   6.546   1.00 0.00 ? 38 TYR A O    2 
ATOM   1471 C CB   . TYR A 1 38 ? 3.497   4.867   4.047   1.00 0.00 ? 38 TYR A CB   2 
ATOM   1472 C CG   . TYR A 1 38 ? 4.369   5.574   3.034   1.00 0.00 ? 38 TYR A CG   2 
ATOM   1473 C CD1  . TYR A 1 38 ? 4.517   6.955   3.059   1.00 0.00 ? 38 TYR A CD1  2 
ATOM   1474 C CD2  . TYR A 1 38 ? 5.047   4.860   2.055   1.00 0.00 ? 38 TYR A CD2  2 
ATOM   1475 C CE1  . TYR A 1 38 ? 5.316   7.604   2.137   1.00 0.00 ? 38 TYR A CE1  2 
ATOM   1476 C CE2  . TYR A 1 38 ? 5.849   5.501   1.130   1.00 0.00 ? 38 TYR A CE2  2 
ATOM   1477 C CZ   . TYR A 1 38 ? 5.980   6.873   1.175   1.00 0.00 ? 38 TYR A CZ   2 
ATOM   1478 O OH   . TYR A 1 38 ? 6.777   7.515   0.256   1.00 0.00 ? 38 TYR A OH   2 
ATOM   1479 H H    . TYR A 1 38 ? 5.579   3.878   5.120   1.00 0.00 ? 38 TYR A H    2 
ATOM   1480 H HA   . TYR A 1 38 ? 4.064   6.191   5.626   1.00 0.00 ? 38 TYR A HA   2 
ATOM   1481 H HB2  . TYR A 1 38 ? 3.553   3.807   3.851   1.00 0.00 ? 38 TYR A HB2  2 
ATOM   1482 H HB3  . TYR A 1 38 ? 2.480   5.202   3.904   1.00 0.00 ? 38 TYR A HB3  2 
ATOM   1483 H HD1  . TYR A 1 38 ? 3.996   7.525   3.814   1.00 0.00 ? 38 TYR A HD1  2 
ATOM   1484 H HD2  . TYR A 1 38 ? 4.940   3.788   2.021   1.00 0.00 ? 38 TYR A HD2  2 
ATOM   1485 H HE1  . TYR A 1 38 ? 5.419   8.678   2.174   1.00 0.00 ? 38 TYR A HE1  2 
ATOM   1486 H HE2  . TYR A 1 38 ? 6.370   4.928   0.377   1.00 0.00 ? 38 TYR A HE2  2 
ATOM   1487 H HH   . TYR A 1 38 ? 7.530   7.908   0.703   1.00 0.00 ? 38 TYR A HH   2 
ATOM   1488 N N    . ALA A 1 39 ? 3.039   3.573   7.152   1.00 0.00 ? 39 ALA A N    2 
ATOM   1489 C CA   . ALA A 1 39 ? 2.064   3.042   8.095   1.00 0.00 ? 39 ALA A CA   2 
ATOM   1490 C C    . ALA A 1 39 ? 1.528   4.131   9.018   1.00 0.00 ? 39 ALA A C    2 
ATOM   1491 O O    . ALA A 1 39 ? 0.394   4.058   9.491   1.00 0.00 ? 39 ALA A O    2 
ATOM   1492 C CB   . ALA A 1 39 ? 2.683   1.916   8.909   1.00 0.00 ? 39 ALA A CB   2 
ATOM   1493 H H    . ALA A 1 39 ? 3.887   3.101   7.034   1.00 0.00 ? 39 ALA A H    2 
ATOM   1494 H HA   . ALA A 1 39 ? 1.247   2.635   7.527   1.00 0.00 ? 39 ALA A HA   2 
ATOM   1495 H HB1  . ALA A 1 39 ? 2.047   1.689   9.751   1.00 0.00 ? 39 ALA A HB1  2 
ATOM   1496 H HB2  . ALA A 1 39 ? 3.655   2.223   9.265   1.00 0.00 ? 39 ALA A HB2  2 
ATOM   1497 H HB3  . ALA A 1 39 ? 2.787   1.038   8.289   1.00 0.00 ? 39 ALA A HB3  2 
ATOM   1498 N N    . LYS A 1 40 ? 2.354   5.137   9.267   1.00 0.00 ? 40 LYS A N    2 
ATOM   1499 C CA   . LYS A 1 40 ? 1.972   6.247   10.135  1.00 0.00 ? 40 LYS A CA   2 
ATOM   1500 C C    . LYS A 1 40 ? 1.988   7.571   9.378   1.00 0.00 ? 40 LYS A C    2 
ATOM   1501 O O    . LYS A 1 40 ? 1.253   8.500   9.714   1.00 0.00 ? 40 LYS A O    2 
ATOM   1502 C CB   . LYS A 1 40 ? 2.908   6.322   11.344  1.00 0.00 ? 40 LYS A CB   2 
ATOM   1503 C CG   . LYS A 1 40 ? 2.292   5.779   12.623  1.00 0.00 ? 40 LYS A CG   2 
ATOM   1504 C CD   . LYS A 1 40 ? 3.357   5.430   13.650  1.00 0.00 ? 40 LYS A CD   2 
ATOM   1505 C CE   . LYS A 1 40 ? 4.124   4.179   13.253  1.00 0.00 ? 40 LYS A CE   2 
ATOM   1506 N NZ   . LYS A 1 40 ? 4.783   3.536   14.424  1.00 0.00 ? 40 LYS A NZ   2 
ATOM   1507 H H    . LYS A 1 40 ? 3.243   5.131   8.859   1.00 0.00 ? 40 LYS A H    2 
ATOM   1508 H HA   . LYS A 1 40 ? 0.970   6.062   10.480  1.00 0.00 ? 40 LYS A HA   2 
ATOM   1509 H HB2  . LYS A 1 40 ? 3.800   5.753   11.130  1.00 0.00 ? 40 LYS A HB2  2 
ATOM   1510 H HB3  . LYS A 1 40 ? 3.181   7.353   11.512  1.00 0.00 ? 40 LYS A HB3  2 
ATOM   1511 H HG2  . LYS A 1 40 ? 1.635   6.527   13.042  1.00 0.00 ? 40 LYS A HG2  2 
ATOM   1512 H HG3  . LYS A 1 40 ? 1.725   4.889   12.389  1.00 0.00 ? 40 LYS A HG3  2 
ATOM   1513 H HD2  . LYS A 1 40 ? 4.050   6.254   13.730  1.00 0.00 ? 40 LYS A HD2  2 
ATOM   1514 H HD3  . LYS A 1 40 ? 2.882   5.263   14.605  1.00 0.00 ? 40 LYS A HD3  2 
ATOM   1515 H HE2  . LYS A 1 40 ? 3.435   3.475   12.809  1.00 0.00 ? 40 LYS A HE2  2 
ATOM   1516 H HE3  . LYS A 1 40 ? 4.879   4.449   12.529  1.00 0.00 ? 40 LYS A HE3  2 
ATOM   1517 H HZ1  . LYS A 1 40 ? 4.987   2.538   14.215  1.00 0.00 ? 40 LYS A HZ1  2 
ATOM   1518 H HZ2  . LYS A 1 40 ? 4.162   3.585   15.256  1.00 0.00 ? 40 LYS A HZ2  2 
ATOM   1519 H HZ3  . LYS A 1 40 ? 5.676   4.023   14.643  1.00 0.00 ? 40 LYS A HZ3  2 
ATOM   1520 N N    . ASP A 1 41 ? 2.829   7.649   8.356   1.00 0.00 ? 41 ASP A N    2 
ATOM   1521 C CA   . ASP A 1 41 ? 2.943   8.857   7.547   1.00 0.00 ? 41 ASP A CA   2 
ATOM   1522 C C    . ASP A 1 41 ? 1.607   9.198   6.887   1.00 0.00 ? 41 ASP A C    2 
ATOM   1523 O O    . ASP A 1 41 ? 1.181   8.518   5.953   1.00 0.00 ? 41 ASP A O    2 
ATOM   1524 C CB   . ASP A 1 41 ? 4.019   8.674   6.476   1.00 0.00 ? 41 ASP A CB   2 
ATOM   1525 C CG   . ASP A 1 41 ? 4.548   9.996   5.957   1.00 0.00 ? 41 ASP A CG   2 
ATOM   1526 O OD1  . ASP A 1 41 ? 3.849   11.019  6.116   1.00 0.00 ? 41 ASP A OD1  2 
ATOM   1527 O OD2  . ASP A 1 41 ? 5.662   10.009  5.391   1.00 0.00 ? 41 ASP A OD2  2 
ATOM   1528 H H    . ASP A 1 41 ? 3.385   6.876   8.140   1.00 0.00 ? 41 ASP A H    2 
ATOM   1529 H HA   . ASP A 1 41 ? 3.233   9.667   8.199   1.00 0.00 ? 41 ASP A HA   2 
ATOM   1530 H HB2  . ASP A 1 41 ? 4.846   8.117   6.896   1.00 0.00 ? 41 ASP A HB2  2 
ATOM   1531 H HB3  . ASP A 1 41 ? 3.600   8.122   5.646   1.00 0.00 ? 41 ASP A HB3  2 
ATOM   1532 N N    . PRO A 1 42 ? 0.921   10.256  7.362   1.00 0.00 ? 42 PRO A N    2 
ATOM   1533 C CA   . PRO A 1 42 ? -0.369  10.677  6.816   1.00 0.00 ? 42 PRO A CA   2 
ATOM   1534 C C    . PRO A 1 42 ? -0.227  11.535  5.559   1.00 0.00 ? 42 PRO A C    2 
ATOM   1535 O O    . PRO A 1 42 ? -0.981  12.489  5.364   1.00 0.00 ? 42 PRO A O    2 
ATOM   1536 C CB   . PRO A 1 42 ? -0.997  11.502  7.952   1.00 0.00 ? 42 PRO A CB   2 
ATOM   1537 C CG   . PRO A 1 42 ? 0.012   11.536  9.061   1.00 0.00 ? 42 PRO A CG   2 
ATOM   1538 C CD   . PRO A 1 42 ? 1.329   11.123  8.468   1.00 0.00 ? 42 PRO A CD   2 
ATOM   1539 H HA   . PRO A 1 42 ? -0.999  9.827   6.597   1.00 0.00 ? 42 PRO A HA   2 
ATOM   1540 H HB2  . PRO A 1 42 ? -1.216  12.497  7.595   1.00 0.00 ? 42 PRO A HB2  2 
ATOM   1541 H HB3  . PRO A 1 42 ? -1.913  11.027  8.274   1.00 0.00 ? 42 PRO A HB3  2 
ATOM   1542 H HG2  . PRO A 1 42 ? 0.082   12.537  9.458   1.00 0.00 ? 42 PRO A HG2  2 
ATOM   1543 H HG3  . PRO A 1 42 ? -0.279  10.846  9.839   1.00 0.00 ? 42 PRO A HG3  2 
ATOM   1544 H HD2  . PRO A 1 42 ? 1.871   11.985  8.108   1.00 0.00 ? 42 PRO A HD2  2 
ATOM   1545 H HD3  . PRO A 1 42 ? 1.915   10.578  9.193   1.00 0.00 ? 42 PRO A HD3  2 
ATOM   1546 N N    . THR A 1 43 ? 0.736   11.194  4.709   1.00 0.00 ? 43 THR A N    2 
ATOM   1547 C CA   . THR A 1 43 ? 0.963   11.937  3.476   1.00 0.00 ? 43 THR A CA   2 
ATOM   1548 C C    . THR A 1 43 ? -0.203  11.752  2.512   1.00 0.00 ? 43 THR A C    2 
ATOM   1549 O O    . THR A 1 43 ? -0.605  12.687  1.819   1.00 0.00 ? 43 THR A O    2 
ATOM   1550 C CB   . THR A 1 43 ? 2.266   11.487  2.812   1.00 0.00 ? 43 THR A CB   2 
ATOM   1551 O OG1  . THR A 1 43 ? 2.351   10.072  2.777   1.00 0.00 ? 43 THR A OG1  2 
ATOM   1552 C CG2  . THR A 1 43 ? 3.504   12.010  3.509   1.00 0.00 ? 43 THR A CG2  2 
ATOM   1553 H H    . THR A 1 43 ? 1.304   10.427  4.912   1.00 0.00 ? 43 THR A H    2 
ATOM   1554 H HA   . THR A 1 43 ? 1.042   12.982  3.732   1.00 0.00 ? 43 THR A HA   2 
ATOM   1555 H HB   . THR A 1 43 ? 2.281   11.851  1.795   1.00 0.00 ? 43 THR A HB   2 
ATOM   1556 H HG1  . THR A 1 43 ? 2.614   9.743   3.640   1.00 0.00 ? 43 THR A HG1  2 
ATOM   1557 H HG21 . THR A 1 43 ? 4.132   11.180  3.798   1.00 0.00 ? 43 THR A HG21 2 
ATOM   1558 H HG22 . THR A 1 43 ? 3.214   12.566  4.388   1.00 0.00 ? 43 THR A HG22 2 
ATOM   1559 H HG23 . THR A 1 43 ? 4.049   12.656  2.837   1.00 0.00 ? 43 THR A HG23 2 
ATOM   1560 N N    . TYR A 1 44 ? -0.744  10.538  2.474   1.00 0.00 ? 44 TYR A N    2 
ATOM   1561 C CA   . TYR A 1 44 ? -1.866  10.227  1.597   1.00 0.00 ? 44 TYR A CA   2 
ATOM   1562 C C    . TYR A 1 44 ? -3.184  10.287  2.363   1.00 0.00 ? 44 TYR A C    2 
ATOM   1563 O O    . TYR A 1 44 ? -4.106  11.006  1.977   1.00 0.00 ? 44 TYR A O    2 
ATOM   1564 C CB   . TYR A 1 44 ? -1.687  8.841   0.975   1.00 0.00 ? 44 TYR A CB   2 
ATOM   1565 C CG   . TYR A 1 44 ? -0.285  8.577   0.472   1.00 0.00 ? 44 TYR A CG   2 
ATOM   1566 C CD1  . TYR A 1 44 ? 0.135   9.062   -0.761  1.00 0.00 ? 44 TYR A CD1  2 
ATOM   1567 C CD2  . TYR A 1 44 ? 0.619   7.843   1.230   1.00 0.00 ? 44 TYR A CD2  2 
ATOM   1568 C CE1  . TYR A 1 44 ? 1.415   8.822   -1.223  1.00 0.00 ? 44 TYR A CE1  2 
ATOM   1569 C CE2  . TYR A 1 44 ? 1.901   7.599   0.775   1.00 0.00 ? 44 TYR A CE2  2 
ATOM   1570 C CZ   . TYR A 1 44 ? 2.294   8.091   -0.452  1.00 0.00 ? 44 TYR A CZ   2 
ATOM   1571 O OH   . TYR A 1 44 ? 3.569   7.850   -0.909  1.00 0.00 ? 44 TYR A OH   2 
ATOM   1572 H H    . TYR A 1 44 ? -0.380  9.835   3.052   1.00 0.00 ? 44 TYR A H    2 
ATOM   1573 H HA   . TYR A 1 44 ? -1.887  10.966  0.810   1.00 0.00 ? 44 TYR A HA   2 
ATOM   1574 H HB2  . TYR A 1 44 ? -1.920  8.089   1.714   1.00 0.00 ? 44 TYR A HB2  2 
ATOM   1575 H HB3  . TYR A 1 44 ? -2.364  8.739   0.140   1.00 0.00 ? 44 TYR A HB3  2 
ATOM   1576 H HD1  . TYR A 1 44 ? -0.556  9.634   -1.362  1.00 0.00 ? 44 TYR A HD1  2 
ATOM   1577 H HD2  . TYR A 1 44 ? 0.308   7.458   2.191   1.00 0.00 ? 44 TYR A HD2  2 
ATOM   1578 H HE1  . TYR A 1 44 ? 1.722   9.207   -2.184  1.00 0.00 ? 44 TYR A HE1  2 
ATOM   1579 H HE2  . TYR A 1 44 ? 2.589   7.027   1.379   1.00 0.00 ? 44 TYR A HE2  2 
ATOM   1580 H HH   . TYR A 1 44 ? 3.906   8.636   -1.346  1.00 0.00 ? 44 TYR A HH   2 
ATOM   1581 N N    . GLY A 1 45 ? -3.265  9.528   3.451   1.00 0.00 ? 45 GLY A N    2 
ATOM   1582 C CA   . GLY A 1 45 ? -4.473  9.509   4.255   1.00 0.00 ? 45 GLY A CA   2 
ATOM   1583 C C    . GLY A 1 45 ? -5.521  8.560   3.710   1.00 0.00 ? 45 GLY A C    2 
ATOM   1584 O O    . GLY A 1 45 ? -5.977  7.658   4.413   1.00 0.00 ? 45 GLY A O    2 
ATOM   1585 H H    . GLY A 1 45 ? -2.498  8.976   3.710   1.00 0.00 ? 45 GLY A H    2 
ATOM   1586 H HA2  . GLY A 1 45 ? -4.217  9.207   5.260   1.00 0.00 ? 45 GLY A HA2  2 
ATOM   1587 H HA3  . GLY A 1 45 ? -4.887  10.506  4.285   1.00 0.00 ? 45 GLY A HA3  2 
ATOM   1588 N N    . GLN A 1 46 ? -5.906  8.764   2.455   1.00 0.00 ? 46 GLN A N    2 
ATOM   1589 C CA   . GLN A 1 46 ? -6.907  7.923   1.816   1.00 0.00 ? 46 GLN A CA   2 
ATOM   1590 C C    . GLN A 1 46 ? -6.322  6.568   1.426   1.00 0.00 ? 46 GLN A C    2 
ATOM   1591 O O    . GLN A 1 46 ? -7.055  5.599   1.235   1.00 0.00 ? 46 GLN A O    2 
ATOM   1592 C CB   . GLN A 1 46 ? -7.476  8.621   0.579   1.00 0.00 ? 46 GLN A CB   2 
ATOM   1593 C CG   . GLN A 1 46 ? -8.115  9.966   0.881   1.00 0.00 ? 46 GLN A CG   2 
ATOM   1594 C CD   . GLN A 1 46 ? -8.331  10.801  -0.366  1.00 0.00 ? 46 GLN A CD   2 
ATOM   1595 O OE1  . GLN A 1 46 ? -9.464  11.007  -0.801  1.00 0.00 ? 46 GLN A OE1  2 
ATOM   1596 N NE2  . GLN A 1 46 ? -7.241  11.286  -0.949  1.00 0.00 ? 46 GLN A NE2  2 
ATOM   1597 H H    . GLN A 1 46 ? -5.510  9.497   1.946   1.00 0.00 ? 46 GLN A H    2 
ATOM   1598 H HA   . GLN A 1 46 ? -7.702  7.767   2.525   1.00 0.00 ? 46 GLN A HA   2 
ATOM   1599 H HB2  . GLN A 1 46 ? -6.677  8.776   -0.131  1.00 0.00 ? 46 GLN A HB2  2 
ATOM   1600 H HB3  . GLN A 1 46 ? -8.224  7.983   0.132   1.00 0.00 ? 46 GLN A HB3  2 
ATOM   1601 H HG2  . GLN A 1 46 ? -9.071  9.799   1.353   1.00 0.00 ? 46 GLN A HG2  2 
ATOM   1602 H HG3  . GLN A 1 46 ? -7.472  10.513  1.555   1.00 0.00 ? 46 GLN A HG3  2 
ATOM   1603 H HE21 . GLN A 1 46 ? -6.368  11.079  -0.544  1.00 0.00 ? 46 GLN A HE21 2 
ATOM   1604 H HE22 . GLN A 1 46 ? -7.353  11.832  -1.760  1.00 0.00 ? 46 GLN A HE22 2 
ATOM   1605 N N    . TYR A 1 47 ? -4.999  6.509   1.305   1.00 0.00 ? 47 TYR A N    2 
ATOM   1606 C CA   . TYR A 1 47 ? -4.319  5.274   0.934   1.00 0.00 ? 47 TYR A CA   2 
ATOM   1607 C C    . TYR A 1 47 ? -4.170  4.344   2.132   1.00 0.00 ? 47 TYR A C    2 
ATOM   1608 O O    . TYR A 1 47 ? -4.532  3.169   2.067   1.00 0.00 ? 47 TYR A O    2 
ATOM   1609 C CB   . TYR A 1 47 ? -2.950  5.584   0.348   1.00 0.00 ? 47 TYR A CB   2 
ATOM   1610 C CG   . TYR A 1 47 ? -2.431  4.519   -0.591  1.00 0.00 ? 47 TYR A CG   2 
ATOM   1611 C CD1  . TYR A 1 47 ? -2.020  3.283   -0.110  1.00 0.00 ? 47 TYR A CD1  2 
ATOM   1612 C CD2  . TYR A 1 47 ? -2.348  4.753   -1.957  1.00 0.00 ? 47 TYR A CD2  2 
ATOM   1613 C CE1  . TYR A 1 47 ? -1.542  2.308   -0.964  1.00 0.00 ? 47 TYR A CE1  2 
ATOM   1614 C CE2  . TYR A 1 47 ? -1.871  3.784   -2.819  1.00 0.00 ? 47 TYR A CE2  2 
ATOM   1615 C CZ   . TYR A 1 47 ? -1.469  2.564   -2.317  1.00 0.00 ? 47 TYR A CZ   2 
ATOM   1616 O OH   . TYR A 1 47 ? -0.993  1.596   -3.172  1.00 0.00 ? 47 TYR A OH   2 
ATOM   1617 H H    . TYR A 1 47 ? -4.466  7.315   1.466   1.00 0.00 ? 47 TYR A H    2 
ATOM   1618 H HA   . TYR A 1 47 ? -4.906  4.783   0.188   1.00 0.00 ? 47 TYR A HA   2 
ATOM   1619 H HB2  . TYR A 1 47 ? -2.997  6.516   -0.198  1.00 0.00 ? 47 TYR A HB2  2 
ATOM   1620 H HB3  . TYR A 1 47 ? -2.253  5.675   1.156   1.00 0.00 ? 47 TYR A HB3  2 
ATOM   1621 H HD1  . TYR A 1 47 ? -2.079  3.086   0.951   1.00 0.00 ? 47 TYR A HD1  2 
ATOM   1622 H HD2  . TYR A 1 47 ? -2.664  5.711   -2.345  1.00 0.00 ? 47 TYR A HD2  2 
ATOM   1623 H HE1  . TYR A 1 47 ? -1.228  1.352   -0.571  1.00 0.00 ? 47 TYR A HE1  2 
ATOM   1624 H HE2  . TYR A 1 47 ? -1.813  3.985   -3.878  1.00 0.00 ? 47 TYR A HE2  2 
ATOM   1625 H HH   . TYR A 1 47 ? -1.349  0.741   -2.918  1.00 0.00 ? 47 TYR A HH   2 
ATOM   1626 N N    . ILE A 1 48 ? -3.630  4.873   3.224   1.00 0.00 ? 48 ILE A N    2 
ATOM   1627 C CA   . ILE A 1 48 ? -3.429  4.086   4.433   1.00 0.00 ? 48 ILE A CA   2 
ATOM   1628 C C    . ILE A 1 48 ? -4.760  3.650   5.034   1.00 0.00 ? 48 ILE A C    2 
ATOM   1629 O O    . ILE A 1 48 ? -5.021  2.456   5.179   1.00 0.00 ? 48 ILE A O    2 
ATOM   1630 C CB   . ILE A 1 48 ? -2.621  4.869   5.488   1.00 0.00 ? 48 ILE A CB   2 
ATOM   1631 C CG1  . ILE A 1 48 ? -1.282  5.318   4.900   1.00 0.00 ? 48 ILE A CG1  2 
ATOM   1632 C CG2  . ILE A 1 48 ? -2.399  4.022   6.736   1.00 0.00 ? 48 ILE A CG2  2 
ATOM   1633 C CD1  . ILE A 1 48 ? -0.360  4.170   4.550   1.00 0.00 ? 48 ILE A CD1  2 
ATOM   1634 H H    . ILE A 1 48 ? -3.356  5.813   3.216   1.00 0.00 ? 48 ILE A H    2 
ATOM   1635 H HA   . ILE A 1 48 ? -2.869  3.206   4.162   1.00 0.00 ? 48 ILE A HA   2 
ATOM   1636 H HB   . ILE A 1 48 ? -3.191  5.740   5.772   1.00 0.00 ? 48 ILE A HB   2 
ATOM   1637 H HG12 . ILE A 1 48 ? -1.463  5.883   3.998   1.00 0.00 ? 48 ILE A HG12 2 
ATOM   1638 H HG13 . ILE A 1 48 ? -0.774  5.947   5.617   1.00 0.00 ? 48 ILE A HG13 2 
ATOM   1639 H HG21 . ILE A 1 48 ? -2.959  3.102   6.653   1.00 0.00 ? 48 ILE A HG21 2 
ATOM   1640 H HG22 . ILE A 1 48 ? -2.733  4.568   7.606   1.00 0.00 ? 48 ILE A HG22 2 
ATOM   1641 H HG23 . ILE A 1 48 ? -1.348  3.794   6.836   1.00 0.00 ? 48 ILE A HG23 2 
ATOM   1642 H HD11 . ILE A 1 48 ? -0.424  3.966   3.492   1.00 0.00 ? 48 ILE A HD11 2 
ATOM   1643 H HD12 . ILE A 1 48 ? -0.653  3.290   5.105   1.00 0.00 ? 48 ILE A HD12 2 
ATOM   1644 H HD13 . ILE A 1 48 ? 0.656   4.433   4.805   1.00 0.00 ? 48 ILE A HD13 2 
ATOM   1645 N N    . ARG A 1 49 ? -5.601  4.617   5.380   1.00 0.00 ? 49 ARG A N    2 
ATOM   1646 C CA   . ARG A 1 49 ? -6.904  4.316   5.963   1.00 0.00 ? 49 ARG A CA   2 
ATOM   1647 C C    . ARG A 1 49 ? -7.922  3.937   4.893   1.00 0.00 ? 49 ARG A C    2 
ATOM   1648 O O    . ARG A 1 49 ? -9.119  4.184   5.044   1.00 0.00 ? 49 ARG A O    2 
ATOM   1649 C CB   . ARG A 1 49 ? -7.414  5.505   6.778   1.00 0.00 ? 49 ARG A CB   2 
ATOM   1650 C CG   . ARG A 1 49 ? -6.467  5.934   7.887   1.00 0.00 ? 49 ARG A CG   2 
ATOM   1651 C CD   . ARG A 1 49 ? -7.026  7.108   8.674   1.00 0.00 ? 49 ARG A CD   2 
ATOM   1652 N NE   . ARG A 1 49 ? -6.580  7.097   10.066  1.00 0.00 ? 49 ARG A NE   2 
ATOM   1653 C CZ   . ARG A 1 49 ? -7.110  6.320   11.008  1.00 0.00 ? 49 ARG A CZ   2 
ATOM   1654 N NH1  . ARG A 1 49 ? -8.104  5.491   10.713  1.00 0.00 ? 49 ARG A NH1  2 
ATOM   1655 N NH2  . ARG A 1 49 ? -6.645  6.372   12.249  1.00 0.00 ? 49 ARG A NH2  2 
ATOM   1656 H H    . ARG A 1 49 ? -5.343  5.552   5.240   1.00 0.00 ? 49 ARG A H    2 
ATOM   1657 H HA   . ARG A 1 49 ? -6.775  3.471   6.618   1.00 0.00 ? 49 ARG A HA   2 
ATOM   1658 H HB2  . ARG A 1 49 ? -7.561  6.345   6.114   1.00 0.00 ? 49 ARG A HB2  2 
ATOM   1659 H HB3  . ARG A 1 49 ? -8.361  5.242   7.225   1.00 0.00 ? 49 ARG A HB3  2 
ATOM   1660 H HG2  . ARG A 1 49 ? -6.315  5.103   8.559   1.00 0.00 ? 49 ARG A HG2  2 
ATOM   1661 H HG3  . ARG A 1 49 ? -5.523  6.223   7.449   1.00 0.00 ? 49 ARG A HG3  2 
ATOM   1662 H HD2  . ARG A 1 49 ? -6.699  8.026   8.209   1.00 0.00 ? 49 ARG A HD2  2 
ATOM   1663 H HD3  . ARG A 1 49 ? -8.105  7.059   8.652   1.00 0.00 ? 49 ARG A HD3  2 
ATOM   1664 H HE   . ARG A 1 49 ? -5.847  7.699   10.311  1.00 0.00 ? 49 ARG A HE   2 
ATOM   1665 H HH11 . ARG A 1 49 ? -8.459  5.447   9.779   1.00 0.00 ? 49 ARG A HH11 2 
ATOM   1666 H HH12 . ARG A 1 49 ? -8.498  4.911   11.425  1.00 0.00 ? 49 ARG A HH12 2 
ATOM   1667 H HH21 . ARG A 1 49 ? -5.896  6.994   12.476  1.00 0.00 ? 49 ARG A HH21 2 
ATOM   1668 H HH22 . ARG A 1 49 ? -7.043  5.789   12.957  1.00 0.00 ? 49 ARG A HH22 2 
ATOM   1669 N N    . SER A 1 50 ? -7.441  3.328   3.818   1.00 0.00 ? 50 SER A N    2 
ATOM   1670 C CA   . SER A 1 50 ? -8.304  2.904   2.727   1.00 0.00 ? 50 SER A CA   2 
ATOM   1671 C C    . SER A 1 50 ? -8.988  1.580   3.057   1.00 0.00 ? 50 SER A C    2 
ATOM   1672 O O    . SER A 1 50 ? -8.420  0.736   3.750   1.00 0.00 ? 50 SER A O    2 
ATOM   1673 C CB   . SER A 1 50 ? -7.500  2.768   1.446   1.00 0.00 ? 50 SER A CB   2 
ATOM   1674 O OG   . SER A 1 50 ? -8.289  3.071   0.309   1.00 0.00 ? 50 SER A OG   2 
ATOM   1675 H H    . SER A 1 50 ? -6.483  3.150   3.761   1.00 0.00 ? 50 SER A H    2 
ATOM   1676 H HA   . SER A 1 50 ? -9.054  3.655   2.582   1.00 0.00 ? 50 SER A HA   2 
ATOM   1677 H HB2  . SER A 1 50 ? -6.655  3.443   1.477   1.00 0.00 ? 50 SER A HB2  2 
ATOM   1678 H HB3  . SER A 1 50 ? -7.153  1.758   1.370   1.00 0.00 ? 50 SER A HB3  2 
ATOM   1679 H HG   . SER A 1 50 ? -8.632  3.964   0.386   1.00 0.00 ? 50 SER A HG   2 
ATOM   1680 N N    . PRO A 1 51 ? -10.221 1.378   2.565   1.00 0.00 ? 51 PRO A N    2 
ATOM   1681 C CA   . PRO A 1 51 ? -10.976 0.149   2.812   1.00 0.00 ? 51 PRO A CA   2 
ATOM   1682 C C    . PRO A 1 51 ? -10.548 -0.998  1.901   1.00 0.00 ? 51 PRO A C    2 
ATOM   1683 O O    . PRO A 1 51 ? -10.433 -2.143  2.340   1.00 0.00 ? 51 PRO A O    2 
ATOM   1684 C CB   . PRO A 1 51 ? -12.411 0.567   2.504   1.00 0.00 ? 51 PRO A CB   2 
ATOM   1685 C CG   . PRO A 1 51 ? -12.276 1.614   1.451   1.00 0.00 ? 51 PRO A CG   2 
ATOM   1686 C CD   . PRO A 1 51 ? -10.978 2.331   1.729   1.00 0.00 ? 51 PRO A CD   2 
ATOM   1687 H HA   . PRO A 1 51 ? -10.902 -0.162  3.844   1.00 0.00 ? 51 PRO A HA   2 
ATOM   1688 H HB2  . PRO A 1 51 ? -12.969 -0.286  2.146   1.00 0.00 ? 51 PRO A HB2  2 
ATOM   1689 H HB3  . PRO A 1 51 ? -12.875 0.962   3.395   1.00 0.00 ? 51 PRO A HB3  2 
ATOM   1690 H HG2  . PRO A 1 51 ? -12.246 1.151   0.476   1.00 0.00 ? 51 PRO A HG2  2 
ATOM   1691 H HG3  . PRO A 1 51 ? -13.104 2.304   1.513   1.00 0.00 ? 51 PRO A HG3  2 
ATOM   1692 H HD2  . PRO A 1 51 ? -10.454 2.532   0.806   1.00 0.00 ? 51 PRO A HD2  2 
ATOM   1693 H HD3  . PRO A 1 51 ? -11.163 3.249   2.266   1.00 0.00 ? 51 PRO A HD3  2 
ATOM   1694 N N    . HIS A 1 52 ? -10.327 -0.686  0.627   1.00 0.00 ? 52 HIS A N    2 
ATOM   1695 C CA   . HIS A 1 52 ? -9.928  -1.693  -0.353  1.00 0.00 ? 52 HIS A CA   2 
ATOM   1696 C C    . HIS A 1 52 ? -8.438  -2.006  -0.270  1.00 0.00 ? 52 HIS A C    2 
ATOM   1697 O O    . HIS A 1 52 ? -8.012  -3.120  -0.573  1.00 0.00 ? 52 HIS A O    2 
ATOM   1698 C CB   . HIS A 1 52 ? -10.282 -1.227  -1.767  1.00 0.00 ? 52 HIS A CB   2 
ATOM   1699 C CG   . HIS A 1 52 ? -11.605 -0.530  -1.858  1.00 0.00 ? 52 HIS A CG   2 
ATOM   1700 N ND1  . HIS A 1 52 ? -12.809 -1.166  -1.636  1.00 0.00 ? 52 HIS A ND1  2 
ATOM   1701 C CD2  . HIS A 1 52 ? -11.910 0.758   -2.147  1.00 0.00 ? 52 HIS A CD2  2 
ATOM   1702 C CE1  . HIS A 1 52 ? -13.796 -0.300  -1.785  1.00 0.00 ? 52 HIS A CE1  2 
ATOM   1703 N NE2  . HIS A 1 52 ? -13.277 0.874   -2.094  1.00 0.00 ? 52 HIS A NE2  2 
ATOM   1704 H H    . HIS A 1 52 ? -10.446 0.243   0.336   1.00 0.00 ? 52 HIS A H    2 
ATOM   1705 H HA   . HIS A 1 52 ? -10.477 -2.591  -0.136  1.00 0.00 ? 52 HIS A HA   2 
ATOM   1706 H HB2  . HIS A 1 52 ? -9.523  -0.542  -2.114  1.00 0.00 ? 52 HIS A HB2  2 
ATOM   1707 H HB3  . HIS A 1 52 ? -10.312 -2.085  -2.423  1.00 0.00 ? 52 HIS A HB3  2 
ATOM   1708 H HD1  . HIS A 1 52 ? -12.923 -2.112  -1.405  1.00 0.00 ? 52 HIS A HD1  2 
ATOM   1709 H HD2  . HIS A 1 52 ? -11.208 1.547   -2.376  1.00 0.00 ? 52 HIS A HD2  2 
ATOM   1710 H HE1  . HIS A 1 52 ? -14.848 -0.516  -1.671  1.00 0.00 ? 52 HIS A HE1  2 
ATOM   1711 H HE2  . HIS A 1 52 ? -13.781 1.711   -2.171  1.00 0.00 ? 52 HIS A HE2  2 
ATOM   1712 N N    . ALA A 1 53 ? -7.651  -1.018  0.128   1.00 0.00 ? 53 ALA A N    2 
ATOM   1713 C CA   . ALA A 1 53 ? -6.210  -1.186  0.237   1.00 0.00 ? 53 ALA A CA   2 
ATOM   1714 C C    . ALA A 1 53 ? -5.852  -2.296  1.209   1.00 0.00 ? 53 ALA A C    2 
ATOM   1715 O O    . ALA A 1 53 ? -5.128  -3.232  0.871   1.00 0.00 ? 53 ALA A O    2 
ATOM   1716 C CB   . ALA A 1 53 ? -5.550  0.117   0.657   1.00 0.00 ? 53 ALA A CB   2 
ATOM   1717 H H    . ALA A 1 53 ? -8.047  -0.157  0.347   1.00 0.00 ? 53 ALA A H    2 
ATOM   1718 H HA   . ALA A 1 53 ? -5.843  -1.446  -0.732  1.00 0.00 ? 53 ALA A HA   2 
ATOM   1719 H HB1  . ALA A 1 53 ? -5.912  0.922   0.034   1.00 0.00 ? 53 ALA A HB1  2 
ATOM   1720 H HB2  . ALA A 1 53 ? -4.479  0.031   0.547   1.00 0.00 ? 53 ALA A HB2  2 
ATOM   1721 H HB3  . ALA A 1 53 ? -5.790  0.325   1.690   1.00 0.00 ? 53 ALA A HB3  2 
ATOM   1722 N N    . ARG A 1 54 ? -6.364  -2.176  2.420   1.00 0.00 ? 54 ARG A N    2 
ATOM   1723 C CA   . ARG A 1 54 ? -6.108  -3.155  3.467   1.00 0.00 ? 54 ARG A CA   2 
ATOM   1724 C C    . ARG A 1 54 ? -6.479  -4.557  3.008   1.00 0.00 ? 54 ARG A C    2 
ATOM   1725 O O    . ARG A 1 54 ? -5.817  -5.535  3.357   1.00 0.00 ? 54 ARG A O    2 
ATOM   1726 C CB   . ARG A 1 54 ? -6.885  -2.796  4.735   1.00 0.00 ? 54 ARG A CB   2 
ATOM   1727 C CG   . ARG A 1 54 ? -6.101  -1.924  5.702   1.00 0.00 ? 54 ARG A CG   2 
ATOM   1728 C CD   . ARG A 1 54 ? -6.979  -0.849  6.322   1.00 0.00 ? 54 ARG A CD   2 
ATOM   1729 N NE   . ARG A 1 54 ? -8.208  -1.402  6.885   1.00 0.00 ? 54 ARG A NE   2 
ATOM   1730 C CZ   . ARG A 1 54 ? -8.980  -0.757  7.757   1.00 0.00 ? 54 ARG A CZ   2 
ATOM   1731 N NH1  . ARG A 1 54 ? -8.654  0.462   8.168   1.00 0.00 ? 54 ARG A NH1  2 
ATOM   1732 N NH2  . ARG A 1 54 ? -10.081 -1.333  8.220   1.00 0.00 ? 54 ARG A NH2  2 
ATOM   1733 H H    . ARG A 1 54 ? -6.925  -1.404  2.615   1.00 0.00 ? 54 ARG A H    2 
ATOM   1734 H HA   . ARG A 1 54 ? -5.058  -3.132  3.680   1.00 0.00 ? 54 ARG A HA   2 
ATOM   1735 H HB2  . ARG A 1 54 ? -7.784  -2.267  4.454   1.00 0.00 ? 54 ARG A HB2  2 
ATOM   1736 H HB3  . ARG A 1 54 ? -7.159  -3.707  5.246   1.00 0.00 ? 54 ARG A HB3  2 
ATOM   1737 H HG2  . ARG A 1 54 ? -5.702  -2.547  6.489   1.00 0.00 ? 54 ARG A HG2  2 
ATOM   1738 H HG3  . ARG A 1 54 ? -5.290  -1.452  5.168   1.00 0.00 ? 54 ARG A HG3  2 
ATOM   1739 H HD2  . ARG A 1 54 ? -6.424  -0.358  7.108   1.00 0.00 ? 54 ARG A HD2  2 
ATOM   1740 H HD3  . ARG A 1 54 ? -7.235  -0.128  5.559   1.00 0.00 ? 54 ARG A HD3  2 
ATOM   1741 H HE   . ARG A 1 54 ? -8.472  -2.301  6.599   1.00 0.00 ? 54 ARG A HE   2 
ATOM   1742 H HH11 . ARG A 1 54 ? -7.825  0.902   7.824   1.00 0.00 ? 54 ARG A HH11 2 
ATOM   1743 H HH12 . ARG A 1 54 ? -9.239  0.941   8.823   1.00 0.00 ? 54 ARG A HH12 2 
ATOM   1744 H HH21 . ARG A 1 54 ? -10.332 -2.251  7.913   1.00 0.00 ? 54 ARG A HH21 2 
ATOM   1745 H HH22 . ARG A 1 54 ? -10.662 -0.849  8.875   1.00 0.00 ? 54 ARG A HH22 2 
ATOM   1746 N N    . ASP A 1 55 ? -7.538  -4.643  2.221   1.00 0.00 ? 55 ASP A N    2 
ATOM   1747 C CA   . ASP A 1 55 ? -8.000  -5.922  1.705   1.00 0.00 ? 55 ASP A CA   2 
ATOM   1748 C C    . ASP A 1 55 ? -7.008  -6.481  0.700   1.00 0.00 ? 55 ASP A C    2 
ATOM   1749 O O    . ASP A 1 55 ? -6.705  -7.673  0.702   1.00 0.00 ? 55 ASP A O    2 
ATOM   1750 C CB   . ASP A 1 55 ? -9.371  -5.777  1.062   1.00 0.00 ? 55 ASP A CB   2 
ATOM   1751 C CG   . ASP A 1 55 ? -10.152 -7.077  1.064   1.00 0.00 ? 55 ASP A CG   2 
ATOM   1752 O OD1  . ASP A 1 55 ? -10.884 -7.328  2.044   1.00 0.00 ? 55 ASP A OD1  2 
ATOM   1753 O OD2  . ASP A 1 55 ? -10.031 -7.843  0.085   1.00 0.00 ? 55 ASP A OD2  2 
ATOM   1754 H H    . ASP A 1 55 ? -8.015  -3.827  1.979   1.00 0.00 ? 55 ASP A H    2 
ATOM   1755 H HA   . ASP A 1 55 ? -8.072  -6.597  2.522   1.00 0.00 ? 55 ASP A HA   2 
ATOM   1756 H HB2  . ASP A 1 55 ? -9.942  -5.032  1.600   1.00 0.00 ? 55 ASP A HB2  2 
ATOM   1757 H HB3  . ASP A 1 55 ? -9.237  -5.463  0.046   1.00 0.00 ? 55 ASP A HB3  2 
ATOM   1758 N N    . THR A 1 56 ? -6.503  -5.604  -0.150  1.00 0.00 ? 56 THR A N    2 
ATOM   1759 C CA   . THR A 1 56 ? -5.539  -5.986  -1.162  1.00 0.00 ? 56 THR A CA   2 
ATOM   1760 C C    . THR A 1 56 ? -4.276  -6.545  -0.522  1.00 0.00 ? 56 THR A C    2 
ATOM   1761 O O    . THR A 1 56 ? -3.812  -7.628  -0.881  1.00 0.00 ? 56 THR A O    2 
ATOM   1762 C CB   . THR A 1 56 ? -5.196  -4.794  -2.041  1.00 0.00 ? 56 THR A CB   2 
ATOM   1763 O OG1  . THR A 1 56 ? -6.316  -3.939  -2.191  1.00 0.00 ? 56 THR A OG1  2 
ATOM   1764 C CG2  . THR A 1 56 ? -4.722  -5.182  -3.425  1.00 0.00 ? 56 THR A CG2  2 
ATOM   1765 H H    . THR A 1 56 ? -6.784  -4.675  -0.091  1.00 0.00 ? 56 THR A H    2 
ATOM   1766 H HA   . THR A 1 56 ? -5.985  -6.741  -1.768  1.00 0.00 ? 56 THR A HA   2 
ATOM   1767 H HB   . THR A 1 56 ? -4.412  -4.244  -1.566  1.00 0.00 ? 56 THR A HB   2 
ATOM   1768 H HG1  . THR A 1 56 ? -7.049  -4.434  -2.564  1.00 0.00 ? 56 THR A HG1  2 
ATOM   1769 H HG21 . THR A 1 56 ? -3.688  -4.897  -3.544  1.00 0.00 ? 56 THR A HG21 2 
ATOM   1770 H HG22 . THR A 1 56 ? -5.323  -4.676  -4.166  1.00 0.00 ? 56 THR A HG22 2 
ATOM   1771 H HG23 . THR A 1 56 ? -4.818  -6.250  -3.551  1.00 0.00 ? 56 THR A HG23 2 
ATOM   1772 N N    . LEU A 1 57 ? -3.724  -5.803  0.433   1.00 0.00 ? 57 LEU A N    2 
ATOM   1773 C CA   . LEU A 1 57 ? -2.521  -6.226  1.124   1.00 0.00 ? 57 LEU A CA   2 
ATOM   1774 C C    . LEU A 1 57 ? -2.769  -7.513  1.891   1.00 0.00 ? 57 LEU A C    2 
ATOM   1775 O O    . LEU A 1 57 ? -1.978  -8.454  1.830   1.00 0.00 ? 57 LEU A O    2 
ATOM   1776 C CB   . LEU A 1 57 ? -2.040  -5.131  2.071   1.00 0.00 ? 57 LEU A CB   2 
ATOM   1777 C CG   . LEU A 1 57 ? -0.854  -4.312  1.561   1.00 0.00 ? 57 LEU A CG   2 
ATOM   1778 C CD1  . LEU A 1 57 ? -1.239  -2.849  1.402   1.00 0.00 ? 57 LEU A CD1  2 
ATOM   1779 C CD2  . LEU A 1 57 ? 0.338   -4.452  2.497   1.00 0.00 ? 57 LEU A CD2  2 
ATOM   1780 H H    . LEU A 1 57 ? -4.137  -4.952  0.678   1.00 0.00 ? 57 LEU A H    2 
ATOM   1781 H HA   . LEU A 1 57 ? -1.774  -6.401  0.388   1.00 0.00 ? 57 LEU A HA   2 
ATOM   1782 H HB2  . LEU A 1 57 ? -2.864  -4.462  2.242   1.00 0.00 ? 57 LEU A HB2  2 
ATOM   1783 H HB3  . LEU A 1 57 ? -1.757  -5.588  3.008   1.00 0.00 ? 57 LEU A HB3  2 
ATOM   1784 H HG   . LEU A 1 57 ? -0.566  -4.687  0.595   1.00 0.00 ? 57 LEU A HG   2 
ATOM   1785 H HD11 . LEU A 1 57 ? -1.676  -2.488  2.321   1.00 0.00 ? 57 LEU A HD11 2 
ATOM   1786 H HD12 . LEU A 1 57 ? -1.956  -2.750  0.600   1.00 0.00 ? 57 LEU A HD12 2 
ATOM   1787 H HD13 . LEU A 1 57 ? -0.358  -2.268  1.169   1.00 0.00 ? 57 LEU A HD13 2 
ATOM   1788 H HD21 . LEU A 1 57 ? 1.069   -3.693  2.264   1.00 0.00 ? 57 LEU A HD21 2 
ATOM   1789 H HD22 . LEU A 1 57 ? 0.781   -5.429  2.372   1.00 0.00 ? 57 LEU A HD22 2 
ATOM   1790 H HD23 . LEU A 1 57 ? 0.009   -4.334  3.519   1.00 0.00 ? 57 LEU A HD23 2 
ATOM   1791 N N    . THR A 1 58 ? -3.877  -7.540  2.611   1.00 0.00 ? 58 THR A N    2 
ATOM   1792 C CA   . THR A 1 58 ? -4.249  -8.702  3.396   1.00 0.00 ? 58 THR A CA   2 
ATOM   1793 C C    . THR A 1 58 ? -4.466  -9.910  2.499   1.00 0.00 ? 58 THR A C    2 
ATOM   1794 O O    . THR A 1 58 ? -4.023  -11.014 2.815   1.00 0.00 ? 58 THR A O    2 
ATOM   1795 C CB   . THR A 1 58 ? -5.510  -8.417  4.214   1.00 0.00 ? 58 THR A CB   2 
ATOM   1796 O OG1  . THR A 1 58 ? -5.320  -7.290  5.052   1.00 0.00 ? 58 THR A OG1  2 
ATOM   1797 C CG2  . THR A 1 58 ? -5.929  -9.576  5.092   1.00 0.00 ? 58 THR A CG2  2 
ATOM   1798 H H    . THR A 1 58 ? -4.455  -6.758  2.612   1.00 0.00 ? 58 THR A H    2 
ATOM   1799 H HA   . THR A 1 58 ? -3.434  -8.911  4.064   1.00 0.00 ? 58 THR A HA   2 
ATOM   1800 H HB   . THR A 1 58 ? -6.325  -8.203  3.538   1.00 0.00 ? 58 THR A HB   2 
ATOM   1801 H HG1  . THR A 1 58 ? -5.841  -6.555  4.722   1.00 0.00 ? 58 THR A HG1  2 
ATOM   1802 H HG21 . THR A 1 58 ? -7.005  -9.591  5.180   1.00 0.00 ? 58 THR A HG21 2 
ATOM   1803 H HG22 . THR A 1 58 ? -5.489  -9.463  6.072   1.00 0.00 ? 58 THR A HG22 2 
ATOM   1804 H HG23 . THR A 1 58 ? -5.591  -10.502 4.651   1.00 0.00 ? 58 THR A HG23 2 
ATOM   1805 N N    . SER A 1 59 ? -5.134  -9.698  1.367   1.00 0.00 ? 59 SER A N    2 
ATOM   1806 C CA   . SER A 1 59 ? -5.382  -10.775 0.428   1.00 0.00 ? 59 SER A CA   2 
ATOM   1807 C C    . SER A 1 59 ? -4.080  -11.483 0.104   1.00 0.00 ? 59 SER A C    2 
ATOM   1808 O O    . SER A 1 59 ? -4.025  -12.708 -0.004  1.00 0.00 ? 59 SER A O    2 
ATOM   1809 C CB   . SER A 1 59 ? -6.013  -10.235 -0.843  1.00 0.00 ? 59 SER A CB   2 
ATOM   1810 O OG   . SER A 1 59 ? -6.716  -11.249 -1.540  1.00 0.00 ? 59 SER A OG   2 
ATOM   1811 H H    . SER A 1 59 ? -5.454  -8.799  1.155   1.00 0.00 ? 59 SER A H    2 
ATOM   1812 H HA   . SER A 1 59 ? -6.050  -11.465 0.882   1.00 0.00 ? 59 SER A HA   2 
ATOM   1813 H HB2  . SER A 1 59 ? -6.701  -9.440  -0.593  1.00 0.00 ? 59 SER A HB2  2 
ATOM   1814 H HB3  . SER A 1 59 ? -5.236  -9.854  -1.473  1.00 0.00 ? 59 SER A HB3  2 
ATOM   1815 H HG   . SER A 1 59 ? -6.104  -11.943 -1.798  1.00 0.00 ? 59 SER A HG   2 
ATOM   1816 N N    . CYS A 1 60 ? -3.032  -10.688 -0.031  1.00 0.00 ? 60 CYS A N    2 
ATOM   1817 C CA   . CYS A 1 60 ? -1.710  -11.199 -0.322  1.00 0.00 ? 60 CYS A CA   2 
ATOM   1818 C C    . CYS A 1 60 ? -1.043  -11.714 0.949   1.00 0.00 ? 60 CYS A C    2 
ATOM   1819 O O    . CYS A 1 60 ? -0.289  -12.687 0.914   1.00 0.00 ? 60 CYS A O    2 
ATOM   1820 C CB   . CYS A 1 60 ? -0.858  -10.101 -0.950  1.00 0.00 ? 60 CYS A CB   2 
ATOM   1821 S SG   . CYS A 1 60 ? 0.263   -10.692 -2.258  1.00 0.00 ? 60 CYS A SG   2 
ATOM   1822 H H    . CYS A 1 60 ? -3.151  -9.724  0.083   1.00 0.00 ? 60 CYS A H    2 
ATOM   1823 H HA   . CYS A 1 60 ? -1.812  -12.014 -1.023  1.00 0.00 ? 60 CYS A HA   2 
ATOM   1824 H HB2  . CYS A 1 60 ? -1.507  -9.355  -1.385  1.00 0.00 ? 60 CYS A HB2  2 
ATOM   1825 H HB3  . CYS A 1 60 ? -0.262  -9.640  -0.178  1.00 0.00 ? 60 CYS A HB3  2 
ATOM   1826 N N    . GLY A 1 61 ? -1.316  -11.048 2.072   1.00 0.00 ? 61 GLY A N    2 
ATOM   1827 C CA   . GLY A 1 61 ? -0.720  -11.453 3.331   1.00 0.00 ? 61 GLY A CA   2 
ATOM   1828 C C    . GLY A 1 61 ? 0.793   -11.486 3.255   1.00 0.00 ? 61 GLY A C    2 
ATOM   1829 O O    . GLY A 1 61 ? 1.423   -12.450 3.688   1.00 0.00 ? 61 GLY A O    2 
ATOM   1830 H H    . GLY A 1 61 ? -1.919  -10.273 2.045   1.00 0.00 ? 61 GLY A H    2 
ATOM   1831 H HA2  . GLY A 1 61 ? -1.019  -10.757 4.101   1.00 0.00 ? 61 GLY A HA2  2 
ATOM   1832 H HA3  . GLY A 1 61 ? -1.079  -12.438 3.588   1.00 0.00 ? 61 GLY A HA3  2 
ATOM   1833 N N    . LEU A 1 62 ? 1.375   -10.430 2.694   1.00 0.00 ? 62 LEU A N    2 
ATOM   1834 C CA   . LEU A 1 62 ? 2.824   -10.347 2.552   1.00 0.00 ? 62 LEU A CA   2 
ATOM   1835 C C    . LEU A 1 62 ? 3.418   -9.293  3.483   1.00 0.00 ? 62 LEU A C    2 
ATOM   1836 O O    . LEU A 1 62 ? 4.472   -9.508  4.081   1.00 0.00 ? 62 LEU A O    2 
ATOM   1837 C CB   . LEU A 1 62 ? 3.210   -10.041 1.101   1.00 0.00 ? 62 LEU A CB   2 
ATOM   1838 C CG   . LEU A 1 62 ? 2.483   -8.857  0.460   1.00 0.00 ? 62 LEU A CG   2 
ATOM   1839 C CD1  . LEU A 1 62 ? 3.072   -7.539  0.937   1.00 0.00 ? 62 LEU A CD1  2 
ATOM   1840 C CD2  . LEU A 1 62 ? 2.556   -8.949  -1.056  1.00 0.00 ? 62 LEU A CD2  2 
ATOM   1841 H H    . LEU A 1 62 ? 0.817   -9.696  2.363   1.00 0.00 ? 62 LEU A H    2 
ATOM   1842 H HA   . LEU A 1 62 ? 3.230   -11.307 2.820   1.00 0.00 ? 62 LEU A HA   2 
ATOM   1843 H HB2  . LEU A 1 62 ? 4.271   -9.843  1.069   1.00 0.00 ? 62 LEU A HB2  2 
ATOM   1844 H HB3  . LEU A 1 62 ? 3.009   -10.920 0.507   1.00 0.00 ? 62 LEU A HB3  2 
ATOM   1845 H HG   . LEU A 1 62 ? 1.442   -8.882  0.746   1.00 0.00 ? 62 LEU A HG   2 
ATOM   1846 H HD11 . LEU A 1 62 ? 3.909   -7.732  1.591   1.00 0.00 ? 62 LEU A HD11 2 
ATOM   1847 H HD12 . LEU A 1 62 ? 2.318   -6.981  1.473   1.00 0.00 ? 62 LEU A HD12 2 
ATOM   1848 H HD13 . LEU A 1 62 ? 3.405   -6.966  0.086   1.00 0.00 ? 62 LEU A HD13 2 
ATOM   1849 H HD21 . LEU A 1 62 ? 2.676   -9.982  -1.349  1.00 0.00 ? 62 LEU A HD21 2 
ATOM   1850 H HD22 . LEU A 1 62 ? 3.398   -8.374  -1.412  1.00 0.00 ? 62 LEU A HD22 2 
ATOM   1851 H HD23 . LEU A 1 62 ? 1.647   -8.556  -1.485  1.00 0.00 ? 62 LEU A HD23 2 
ATOM   1852 N N    . ALA A 1 63 ? 2.743   -8.155  3.601   1.00 0.00 ? 63 ALA A N    2 
ATOM   1853 C CA   . ALA A 1 63 ? 3.217   -7.081  4.455   1.00 0.00 ? 63 ALA A CA   2 
ATOM   1854 C C    . ALA A 1 63 ? 2.064   -6.253  5.009   1.00 0.00 ? 63 ALA A C    2 
ATOM   1855 O O    . ALA A 1 63 ? 0.963   -6.250  4.458   1.00 0.00 ? 63 ALA A O    2 
ATOM   1856 C CB   . ALA A 1 63 ? 4.190   -6.192  3.696   1.00 0.00 ? 63 ALA A CB   2 
ATOM   1857 H H    . ALA A 1 63 ? 1.914   -8.036  3.104   1.00 0.00 ? 63 ALA A H    2 
ATOM   1858 H HA   . ALA A 1 63 ? 3.746   -7.530  5.276   1.00 0.00 ? 63 ALA A HA   2 
ATOM   1859 H HB1  . ALA A 1 63 ? 4.372   -5.291  4.262   1.00 0.00 ? 63 ALA A HB1  2 
ATOM   1860 H HB2  . ALA A 1 63 ? 3.768   -5.935  2.735   1.00 0.00 ? 63 ALA A HB2  2 
ATOM   1861 H HB3  . ALA A 1 63 ? 5.121   -6.720  3.550   1.00 0.00 ? 63 ALA A HB3  2 
ATOM   1862 N N    . VAL A 1 64 ? 2.330   -5.549  6.104   1.00 0.00 ? 64 VAL A N    2 
ATOM   1863 C CA   . VAL A 1 64 ? 1.334   -4.711  6.743   1.00 0.00 ? 64 VAL A CA   2 
ATOM   1864 C C    . VAL A 1 64 ? 2.004   -3.523  7.441   1.00 0.00 ? 64 VAL A C    2 
ATOM   1865 O O    . VAL A 1 64 ? 3.208   -3.545  7.693   1.00 0.00 ? 64 VAL A O    2 
ATOM   1866 C CB   . VAL A 1 64 ? 0.487   -5.540  7.742   1.00 0.00 ? 64 VAL A CB   2 
ATOM   1867 C CG1  . VAL A 1 64 ? 0.648   -5.052  9.177   1.00 0.00 ? 64 VAL A CG1  2 
ATOM   1868 C CG2  . VAL A 1 64 ? -0.979  -5.537  7.330   1.00 0.00 ? 64 VAL A CG2  2 
ATOM   1869 H H    . VAL A 1 64 ? 3.222   -5.595  6.491   1.00 0.00 ? 64 VAL A H    2 
ATOM   1870 H HA   . VAL A 1 64 ? 0.683   -4.339  5.972   1.00 0.00 ? 64 VAL A HA   2 
ATOM   1871 H HB   . VAL A 1 64 ? 0.840   -6.558  7.699   1.00 0.00 ? 64 VAL A HB   2 
ATOM   1872 H HG11 . VAL A 1 64 ? 1.679   -5.160  9.480   1.00 0.00 ? 64 VAL A HG11 2 
ATOM   1873 H HG12 . VAL A 1 64 ? 0.019   -5.641  9.829   1.00 0.00 ? 64 VAL A HG12 2 
ATOM   1874 H HG13 . VAL A 1 64 ? 0.360   -4.014  9.242   1.00 0.00 ? 64 VAL A HG13 2 
ATOM   1875 H HG21 . VAL A 1 64 ? -1.600  -5.438  8.207   1.00 0.00 ? 64 VAL A HG21 2 
ATOM   1876 H HG22 . VAL A 1 64 ? -1.213  -6.463  6.826   1.00 0.00 ? 64 VAL A HG22 2 
ATOM   1877 H HG23 . VAL A 1 64 ? -1.164  -4.708  6.662   1.00 0.00 ? 64 VAL A HG23 2 
ATOM   1878 N N    . PRO A 1 65 ? 1.236   -2.463  7.754   1.00 0.00 ? 65 PRO A N    2 
ATOM   1879 C CA   . PRO A 1 65 ? 1.764   -1.256  8.416   1.00 0.00 ? 65 PRO A CA   2 
ATOM   1880 C C    . PRO A 1 65 ? 1.985   -1.436  9.911   1.00 0.00 ? 65 PRO A C    2 
ATOM   1881 O O    . PRO A 1 65 ? 1.859   -0.491  10.691  1.00 0.00 ? 65 PRO A O    2 
ATOM   1882 C CB   . PRO A 1 65 ? 0.655   -0.242  8.174   1.00 0.00 ? 65 PRO A CB   2 
ATOM   1883 C CG   . PRO A 1 65 ? -0.568  -1.080  8.219   1.00 0.00 ? 65 PRO A CG   2 
ATOM   1884 C CD   . PRO A 1 65 ? -0.208  -2.336  7.480   1.00 0.00 ? 65 PRO A CD   2 
ATOM   1885 H HA   . PRO A 1 65 ? 2.677   -0.925  7.959   1.00 0.00 ? 65 PRO A HA   2 
ATOM   1886 H HB2  . PRO A 1 65 ? 0.661   0.504   8.955   1.00 0.00 ? 65 PRO A HB2  2 
ATOM   1887 H HB3  . PRO A 1 65 ? 0.783   0.224   7.210   1.00 0.00 ? 65 PRO A HB3  2 
ATOM   1888 H HG2  . PRO A 1 65 ? -0.812  -1.312  9.246   1.00 0.00 ? 65 PRO A HG2  2 
ATOM   1889 H HG3  . PRO A 1 65 ? -1.386  -0.575  7.733   1.00 0.00 ? 65 PRO A HG3  2 
ATOM   1890 H HD2  . PRO A 1 65 ? -0.756  -3.177  7.875   1.00 0.00 ? 65 PRO A HD2  2 
ATOM   1891 H HD3  . PRO A 1 65 ? -0.392  -2.220  6.422   1.00 0.00 ? 65 PRO A HD3  2 
ATOM   1892 N N    . HIS A 1 66 ? 2.319   -2.648  10.294  1.00 0.00 ? 66 HIS A N    2 
ATOM   1893 C CA   . HIS A 1 66 ? 2.571   -2.977  11.692  1.00 0.00 ? 66 HIS A CA   2 
ATOM   1894 C C    . HIS A 1 66 ? 3.862   -3.778  11.834  1.00 0.00 ? 66 HIS A C    2 
ATOM   1895 O O    . HIS A 1 66 ? 3.919   -4.759  12.576  1.00 0.00 ? 66 HIS A O    2 
ATOM   1896 C CB   . HIS A 1 66 ? 1.396   -3.767  12.273  1.00 0.00 ? 66 HIS A CB   2 
ATOM   1897 C CG   . HIS A 1 66 ? 0.216   -2.916  12.621  1.00 0.00 ? 66 HIS A CG   2 
ATOM   1898 N ND1  . HIS A 1 66 ? -0.906  -2.824  11.825  1.00 0.00 ? 66 HIS A ND1  2 
ATOM   1899 C CD2  . HIS A 1 66 ? -0.016  -2.114  13.687  1.00 0.00 ? 66 HIS A CD2  2 
ATOM   1900 C CE1  . HIS A 1 66 ? -1.774  -2.002  12.388  1.00 0.00 ? 66 HIS A CE1  2 
ATOM   1901 N NE2  . HIS A 1 66 ? -1.259  -1.559  13.517  1.00 0.00 ? 66 HIS A NE2  2 
ATOM   1902 H H    . HIS A 1 66 ? 2.402   -3.339  9.618   1.00 0.00 ? 66 HIS A H    2 
ATOM   1903 H HA   . HIS A 1 66 ? 2.675   -2.050  12.237  1.00 0.00 ? 66 HIS A HA   2 
ATOM   1904 H HB2  . HIS A 1 66 ? 1.073   -4.502  11.551  1.00 0.00 ? 66 HIS A HB2  2 
ATOM   1905 H HB3  . HIS A 1 66 ? 1.720   -4.271  13.172  1.00 0.00 ? 66 HIS A HB3  2 
ATOM   1906 H HD1  . HIS A 1 66 ? -1.045  -3.290  10.975  1.00 0.00 ? 66 HIS A HD1  2 
ATOM   1907 H HD2  . HIS A 1 66 ? 0.652   -1.943  14.516  1.00 0.00 ? 66 HIS A HD2  2 
ATOM   1908 H HE1  . HIS A 1 66 ? -2.741  -1.740  11.992  1.00 0.00 ? 66 HIS A HE1  2 
ATOM   1909 H HE2  . HIS A 1 66 ? -1.660  -0.875  14.092  1.00 0.00 ? 66 HIS A HE2  2 
ATOM   1910 N N    . CYS A 1 67 ? 4.897   -3.354  11.114  1.00 0.00 ? 67 CYS A N    2 
ATOM   1911 C CA   . CYS A 1 67 ? 6.190   -4.030  11.155  1.00 0.00 ? 67 CYS A CA   2 
ATOM   1912 C C    . CYS A 1 67 ? 6.719   -4.111  12.584  1.00 0.00 ? 67 CYS A C    2 
ATOM   1913 O O    . CYS A 1 67 ? 6.156   -3.426  13.463  1.00 0.00 ? 67 CYS A O    2 
ATOM   1914 C CB   . CYS A 1 67 ? 7.201   -3.302  10.267  1.00 0.00 ? 67 CYS A CB   2 
ATOM   1915 S SG   . CYS A 1 67 ? 6.587   -2.917  8.595   1.00 0.00 ? 67 CYS A SG   2 
ATOM   1916 O OXT  . CYS A 1 67 ? 7.693   -4.860  12.812  1.00 0.00 ? 67 CYS A OXT  2 
ATOM   1917 H H    . CYS A 1 67 ? 4.788   -2.567  10.541  1.00 0.00 ? 67 CYS A H    2 
ATOM   1918 H HA   . CYS A 1 67 ? 6.050   -5.033  10.779  1.00 0.00 ? 67 CYS A HA   2 
ATOM   1919 H HB2  . CYS A 1 67 ? 7.475   -2.370  10.737  1.00 0.00 ? 67 CYS A HB2  2 
ATOM   1920 H HB3  . CYS A 1 67 ? 8.083   -3.917  10.160  1.00 0.00 ? 67 CYS A HB3  2 
HETATM 1921 C C1   . PGM B 2 .  ? 0.155   2.392   15.404  1.00 0.00 ? 68 PGM A C1   2 
HETATM 1922 O O1   . PGM B 2 .  ? 1.022   2.337   14.299  1.00 0.00 ? 68 PGM A O1   2 
HETATM 1923 C C2   . PGM B 2 .  ? -1.019  3.194   15.051  1.00 0.00 ? 68 PGM A C2   2 
HETATM 1924 O O2   . PGM B 2 .  ? -1.005  4.385   15.799  1.00 0.00 ? 68 PGM A O2   2 
HETATM 1925 C C3   . PGM B 2 .  ? -2.271  2.479   15.314  1.00 0.00 ? 68 PGM A C3   2 
HETATM 1926 O O4   . PGM B 2 .  ? -3.364  3.320   14.921  1.00 0.00 ? 68 PGM A O4   2 
HETATM 1927 P P5   . PGM B 2 .  ? -4.778  2.634   14.599  1.00 0.00 ? 68 PGM A P5   2 
HETATM 1928 O O5A  . PGM B 2 .  ? -5.162  1.755   15.727  1.00 0.00 ? 68 PGM A O5A  2 
HETATM 1929 O O5B  . PGM B 2 .  ? -5.729  3.692   14.193  1.00 0.00 ? 68 PGM A O5B  2 
HETATM 1930 O O6   . PGM B 2 .  ? -4.502  1.708   13.324  1.00 0.00 ? 68 PGM A O6   2 
HETATM 1931 C C7   . PGM B 2 .  ? -4.245  2.350   12.006  1.00 0.00 ? 68 PGM A C7   2 
HETATM 1932 C C8   . PGM B 2 .  ? -3.418  1.556   11.095  1.00 0.00 ? 68 PGM A C8   2 
HETATM 1933 O O8   . PGM B 2 .  ? -2.258  0.968   11.631  1.00 0.00 ? 68 PGM A O8   2 
HETATM 1934 C C9   . PGM B 2 .  ? -4.185  0.546   10.411  1.00 0.00 ? 68 PGM A C9   2 
HETATM 1935 O OQ1  . PGM B 2 .  ? -4.607  -1.347  8.055   1.00 0.00 ? 68 PGM A OQ1  2 
HETATM 1936 O OQ2  . PGM B 2 .  ? -3.405  -0.040  9.278   1.00 0.00 ? 68 PGM A OQ2  2 
HETATM 1937 C CA   . PGM B 2 .  ? -3.960  -0.261  8.245   1.00 0.00 ? 68 PGM A CA   2 
HETATM 1938 C CB   . PGM B 2 .  ? -3.836  0.617   7.074   1.00 0.00 ? 68 PGM A CB   2 
HETATM 1939 C CC   . PGM B 2 .  ? -3.168  0.020   5.862   1.00 0.00 ? 68 PGM A CC   2 
HETATM 1940 C CD   . PGM B 2 .  ? -1.899  0.708   5.438   1.00 0.00 ? 68 PGM A CD   2 
HETATM 1941 C CE   . PGM B 2 .  ? -1.643  0.668   3.961   1.00 0.00 ? 68 PGM A CE   2 
HETATM 1942 C CF   . PGM B 2 .  ? -0.195  0.563   3.587   1.00 0.00 ? 68 PGM A CF   2 
HETATM 1943 C CG   . PGM B 2 .  ? 0.205   1.381   2.392   1.00 0.00 ? 68 PGM A CG   2 
HETATM 1944 C CH   . PGM B 2 .  ? 1.109   0.693   1.423   1.00 0.00 ? 68 PGM A CH   2 
HETATM 1945 C CI   . PGM B 2 .  ? 2.092   1.578   0.731   1.00 0.00 ? 68 PGM A CI   2 
HETATM 1946 C CJ   . PGM B 2 .  ? 1.610   2.163   -0.555  1.00 0.00 ? 68 PGM A CJ   2 
HETATM 1947 C CK   . PGM B 2 .  ? 1.568   3.656   -0.605  1.00 0.00 ? 68 PGM A CK   2 
HETATM 1948 C CL   . PGM B 2 .  ? 1.271   4.240   -1.953  1.00 0.00 ? 68 PGM A CL   2 
HETATM 1949 C CM   . PGM B 2 .  ? 0.803   5.660   -1.942  1.00 0.00 ? 68 PGM A CM   2 
HETATM 1950 C CN   . PGM B 2 .  ? 0.221   6.148   -3.230  1.00 0.00 ? 68 PGM A CN   2 
HETATM 1951 C CO   . PGM B 2 .  ? 1.021   7.199   -3.931  1.00 0.00 ? 68 PGM A CO   2 
HETATM 1952 C CP   . PGM B 2 .  ? 0.208   8.339   -4.470  1.00 0.00 ? 68 PGM A CP   2 
ATOM   1953 N N    . ALA A 1 1  ? 8.969   10.789  0.815   1.00 0.00 ? 1  ALA A N    3 
ATOM   1954 C CA   . ALA A 1 1  ? 9.557   10.810  -0.549  1.00 0.00 ? 1  ALA A CA   3 
ATOM   1955 C C    . ALA A 1 1  ? 10.568  9.683   -0.727  1.00 0.00 ? 1  ALA A C    3 
ATOM   1956 O O    . ALA A 1 1  ? 11.764  9.866   -0.497  1.00 0.00 ? 1  ALA A O    3 
ATOM   1957 C CB   . ALA A 1 1  ? 10.214  12.155  -0.820  1.00 0.00 ? 1  ALA A CB   3 
ATOM   1958 H H1   . ALA A 1 1  ? 8.248   10.041  0.838   1.00 0.00 ? 1  ALA A H1   3 
ATOM   1959 H H2   . ALA A 1 1  ? 8.547   11.724  0.992   1.00 0.00 ? 1  ALA A H2   3 
ATOM   1960 H H3   . ALA A 1 1  ? 9.736   10.590  1.488   1.00 0.00 ? 1  ALA A H3   3 
ATOM   1961 H HA   . ALA A 1 1  ? 8.759   10.677  -1.265  1.00 0.00 ? 1  ALA A HA   3 
ATOM   1962 H HB1  . ALA A 1 1  ? 11.208  12.162  -0.398  1.00 0.00 ? 1  ALA A HB1  3 
ATOM   1963 H HB2  . ALA A 1 1  ? 9.626   12.940  -0.367  1.00 0.00 ? 1  ALA A HB2  3 
ATOM   1964 H HB3  . ALA A 1 1  ? 10.274  12.319  -1.885  1.00 0.00 ? 1  ALA A HB3  3 
ATOM   1965 N N    . CYS A 1 2  ? 10.081  8.516   -1.137  1.00 0.00 ? 2  CYS A N    3 
ATOM   1966 C CA   . CYS A 1 2  ? 10.942  7.358   -1.345  1.00 0.00 ? 2  CYS A CA   3 
ATOM   1967 C C    . CYS A 1 2  ? 11.049  7.019   -2.828  1.00 0.00 ? 2  CYS A C    3 
ATOM   1968 O O    . CYS A 1 2  ? 12.145  6.973   -3.387  1.00 0.00 ? 2  CYS A O    3 
ATOM   1969 C CB   . CYS A 1 2  ? 10.407  6.152   -0.569  1.00 0.00 ? 2  CYS A CB   3 
ATOM   1970 S SG   . CYS A 1 2  ? 11.250  5.858   1.020   1.00 0.00 ? 2  CYS A SG   3 
ATOM   1971 H H    . CYS A 1 2  ? 9.118   8.432   -1.303  1.00 0.00 ? 2  CYS A H    3 
ATOM   1972 H HA   . CYS A 1 2  ? 11.925  7.605   -0.973  1.00 0.00 ? 2  CYS A HA   3 
ATOM   1973 H HB2  . CYS A 1 2  ? 9.358   6.305   -0.360  1.00 0.00 ? 2  CYS A HB2  3 
ATOM   1974 H HB3  . CYS A 1 2  ? 10.522  5.264   -1.172  1.00 0.00 ? 2  CYS A HB3  3 
ATOM   1975 N N    . GLN A 1 3  ? 9.904   6.781   -3.460  1.00 0.00 ? 3  GLN A N    3 
ATOM   1976 C CA   . GLN A 1 3  ? 9.871   6.445   -4.879  1.00 0.00 ? 3  GLN A CA   3 
ATOM   1977 C C    . GLN A 1 3  ? 8.512   6.778   -5.487  1.00 0.00 ? 3  GLN A C    3 
ATOM   1978 O O    . GLN A 1 3  ? 8.422   7.531   -6.456  1.00 0.00 ? 3  GLN A O    3 
ATOM   1979 C CB   . GLN A 1 3  ? 10.183  4.961   -5.079  1.00 0.00 ? 3  GLN A CB   3 
ATOM   1980 C CG   . GLN A 1 3  ? 11.057  4.682   -6.291  1.00 0.00 ? 3  GLN A CG   3 
ATOM   1981 C CD   . GLN A 1 3  ? 12.111  3.628   -6.019  1.00 0.00 ? 3  GLN A CD   3 
ATOM   1982 O OE1  . GLN A 1 3  ? 12.957  3.792   -5.139  1.00 0.00 ? 3  GLN A OE1  3 
ATOM   1983 N NE2  . GLN A 1 3  ? 12.067  2.537   -6.774  1.00 0.00 ? 3  GLN A NE2  3 
ATOM   1984 H H    . GLN A 1 3  ? 9.062   6.831   -2.961  1.00 0.00 ? 3  GLN A H    3 
ATOM   1985 H HA   . GLN A 1 3  ? 10.628  7.033   -5.376  1.00 0.00 ? 3  GLN A HA   3 
ATOM   1986 H HB2  . GLN A 1 3  ? 10.692  4.591   -4.202  1.00 0.00 ? 3  GLN A HB2  3 
ATOM   1987 H HB3  . GLN A 1 3  ? 9.255   4.423   -5.200  1.00 0.00 ? 3  GLN A HB3  3 
ATOM   1988 H HG2  . GLN A 1 3  ? 10.429  4.341   -7.101  1.00 0.00 ? 3  GLN A HG2  3 
ATOM   1989 H HG3  . GLN A 1 3  ? 11.550  5.598   -6.581  1.00 0.00 ? 3  GLN A HG3  3 
ATOM   1990 H HE21 . GLN A 1 3  ? 11.365  2.475   -7.456  1.00 0.00 ? 3  GLN A HE21 3 
ATOM   1991 H HE22 . GLN A 1 3  ? 12.737  1.839   -6.620  1.00 0.00 ? 3  GLN A HE22 3 
ATOM   1992 N N    . ALA A 1 4  ? 7.457   6.211   -4.911  1.00 0.00 ? 4  ALA A N    3 
ATOM   1993 C CA   . ALA A 1 4  ? 6.102   6.446   -5.396  1.00 0.00 ? 4  ALA A CA   3 
ATOM   1994 C C    . ALA A 1 4  ? 5.940   5.953   -6.829  1.00 0.00 ? 4  ALA A C    3 
ATOM   1995 O O    . ALA A 1 4  ? 5.173   6.520   -7.608  1.00 0.00 ? 4  ALA A O    3 
ATOM   1996 C CB   . ALA A 1 4  ? 5.756   7.924   -5.301  1.00 0.00 ? 4  ALA A CB   3 
ATOM   1997 H H    . ALA A 1 4  ? 7.593   5.619   -4.141  1.00 0.00 ? 4  ALA A H    3 
ATOM   1998 H HA   . ALA A 1 4  ? 5.421   5.900   -4.759  1.00 0.00 ? 4  ALA A HA   3 
ATOM   1999 H HB1  . ALA A 1 4  ? 6.081   8.428   -6.199  1.00 0.00 ? 4  ALA A HB1  3 
ATOM   2000 H HB2  . ALA A 1 4  ? 6.254   8.357   -4.445  1.00 0.00 ? 4  ALA A HB2  3 
ATOM   2001 H HB3  . ALA A 1 4  ? 4.688   8.038   -5.192  1.00 0.00 ? 4  ALA A HB3  3 
ATOM   2002 N N    . SER A 1 5  ? 6.668   4.895   -7.172  1.00 0.00 ? 5  SER A N    3 
ATOM   2003 C CA   . SER A 1 5  ? 6.605   4.326   -8.513  1.00 0.00 ? 5  SER A CA   3 
ATOM   2004 C C    . SER A 1 5  ? 6.196   2.856   -8.466  1.00 0.00 ? 5  SER A C    3 
ATOM   2005 O O    . SER A 1 5  ? 5.425   2.390   -9.305  1.00 0.00 ? 5  SER A O    3 
ATOM   2006 C CB   . SER A 1 5  ? 7.959   4.467   -9.212  1.00 0.00 ? 5  SER A CB   3 
ATOM   2007 O OG   . SER A 1 5  ? 8.089   5.741   -9.818  1.00 0.00 ? 5  SER A OG   3 
ATOM   2008 H H    . SER A 1 5  ? 7.261   4.488   -6.507  1.00 0.00 ? 5  SER A H    3 
ATOM   2009 H HA   . SER A 1 5  ? 5.863   4.875   -9.072  1.00 0.00 ? 5  SER A HA   3 
ATOM   2010 H HB2  . SER A 1 5  ? 8.750   4.345   -8.487  1.00 0.00 ? 5  SER A HB2  3 
ATOM   2011 H HB3  . SER A 1 5  ? 8.049   3.708   -9.975  1.00 0.00 ? 5  SER A HB3  3 
ATOM   2012 H HG   . SER A 1 5  ? 8.553   5.652   -10.654 1.00 0.00 ? 5  SER A HG   3 
ATOM   2013 N N    . GLN A 1 6  ? 6.720   2.131   -7.483  1.00 0.00 ? 6  GLN A N    3 
ATOM   2014 C CA   . GLN A 1 6  ? 6.416   0.722   -7.326  1.00 0.00 ? 6  GLN A CA   3 
ATOM   2015 C C    . GLN A 1 6  ? 5.028   0.513   -6.721  1.00 0.00 ? 6  GLN A C    3 
ATOM   2016 O O    . GLN A 1 6  ? 4.564   -0.620  -6.593  1.00 0.00 ? 6  GLN A O    3 
ATOM   2017 C CB   . GLN A 1 6  ? 7.473   0.048   -6.449  1.00 0.00 ? 6  GLN A CB   3 
ATOM   2018 C CG   . GLN A 1 6  ? 8.834   -0.066  -7.117  1.00 0.00 ? 6  GLN A CG   3 
ATOM   2019 C CD   . GLN A 1 6  ? 9.377   -1.482  -7.100  1.00 0.00 ? 6  GLN A CD   3 
ATOM   2020 O OE1  . GLN A 1 6  ? 8.671   -2.434  -7.432  1.00 0.00 ? 6  GLN A OE1  3 
ATOM   2021 N NE2  . GLN A 1 6  ? 10.638  -1.628  -6.712  1.00 0.00 ? 6  GLN A NE2  3 
ATOM   2022 H H    . GLN A 1 6  ? 7.325   2.551   -6.851  1.00 0.00 ? 6  GLN A H    3 
ATOM   2023 H HA   . GLN A 1 6  ? 6.442   0.280   -8.302  1.00 0.00 ? 6  GLN A HA   3 
ATOM   2024 H HB2  . GLN A 1 6  ? 7.589   0.620   -5.540  1.00 0.00 ? 6  GLN A HB2  3 
ATOM   2025 H HB3  . GLN A 1 6  ? 7.135   -0.946  -6.197  1.00 0.00 ? 6  GLN A HB3  3 
ATOM   2026 H HG2  . GLN A 1 6  ? 8.745   0.256   -8.144  1.00 0.00 ? 6  GLN A HG2  3 
ATOM   2027 H HG3  . GLN A 1 6  ? 9.530   0.577   -6.598  1.00 0.00 ? 6  GLN A HG3  3 
ATOM   2028 H HE21 . GLN A 1 6  ? 11.141  -0.825  -6.461  1.00 0.00 ? 6  GLN A HE21 3 
ATOM   2029 H HE22 . GLN A 1 6  ? 11.015  -2.532  -6.692  1.00 0.00 ? 6  GLN A HE22 3 
ATOM   2030 N N    . LEU A 1 7  ? 4.372   1.607   -6.342  1.00 0.00 ? 7  LEU A N    3 
ATOM   2031 C CA   . LEU A 1 7  ? 3.045   1.533   -5.742  1.00 0.00 ? 7  LEU A CA   3 
ATOM   2032 C C    . LEU A 1 7  ? 1.989   2.175   -6.640  1.00 0.00 ? 7  LEU A C    3 
ATOM   2033 O O    . LEU A 1 7  ? 0.796   1.911   -6.491  1.00 0.00 ? 7  LEU A O    3 
ATOM   2034 C CB   . LEU A 1 7  ? 3.051   2.215   -4.373  1.00 0.00 ? 7  LEU A CB   3 
ATOM   2035 C CG   . LEU A 1 7  ? 4.330   2.012   -3.555  1.00 0.00 ? 7  LEU A CG   3 
ATOM   2036 C CD1  . LEU A 1 7  ? 4.486   3.118   -2.522  1.00 0.00 ? 7  LEU A CD1  3 
ATOM   2037 C CD2  . LEU A 1 7  ? 4.319   0.644   -2.884  1.00 0.00 ? 7  LEU A CD2  3 
ATOM   2038 H H    . LEU A 1 7  ? 4.792   2.484   -6.460  1.00 0.00 ? 7  LEU A H    3 
ATOM   2039 H HA   . LEU A 1 7  ? 2.800   0.490   -5.611  1.00 0.00 ? 7  LEU A HA   3 
ATOM   2040 H HB2  . LEU A 1 7  ? 2.907   3.276   -4.522  1.00 0.00 ? 7  LEU A HB2  3 
ATOM   2041 H HB3  . LEU A 1 7  ? 2.220   1.833   -3.800  1.00 0.00 ? 7  LEU A HB3  3 
ATOM   2042 H HG   . LEU A 1 7  ? 5.184   2.053   -4.219  1.00 0.00 ? 7  LEU A HG   3 
ATOM   2043 H HD11 . LEU A 1 7  ? 3.830   3.939   -2.770  1.00 0.00 ? 7  LEU A HD11 3 
ATOM   2044 H HD12 . LEU A 1 7  ? 5.509   3.464   -2.518  1.00 0.00 ? 7  LEU A HD12 3 
ATOM   2045 H HD13 . LEU A 1 7  ? 4.231   2.737   -1.544  1.00 0.00 ? 7  LEU A HD13 3 
ATOM   2046 H HD21 . LEU A 1 7  ? 3.340   0.199   -2.987  1.00 0.00 ? 7  LEU A HD21 3 
ATOM   2047 H HD22 . LEU A 1 7  ? 4.554   0.755   -1.836  1.00 0.00 ? 7  LEU A HD22 3 
ATOM   2048 H HD23 . LEU A 1 7  ? 5.055   0.008   -3.353  1.00 0.00 ? 7  LEU A HD23 3 
ATOM   2049 N N    . ALA A 1 8  ? 2.430   3.020   -7.570  1.00 0.00 ? 8  ALA A N    3 
ATOM   2050 C CA   . ALA A 1 8  ? 1.517   3.697   -8.485  1.00 0.00 ? 8  ALA A CA   3 
ATOM   2051 C C    . ALA A 1 8  ? 0.516   2.724   -9.093  1.00 0.00 ? 8  ALA A C    3 
ATOM   2052 O O    . ALA A 1 8  ? -0.695  2.940   -9.041  1.00 0.00 ? 8  ALA A O    3 
ATOM   2053 C CB   . ALA A 1 8  ? 2.297   4.408   -9.580  1.00 0.00 ? 8  ALA A CB   3 
ATOM   2054 H H    . ALA A 1 8  ? 3.389   3.196   -7.642  1.00 0.00 ? 8  ALA A H    3 
ATOM   2055 H HA   . ALA A 1 8  ? 0.980   4.435   -7.925  1.00 0.00 ? 8  ALA A HA   3 
ATOM   2056 H HB1  . ALA A 1 8  ? 1.824   5.353   -9.805  1.00 0.00 ? 8  ALA A HB1  3 
ATOM   2057 H HB2  . ALA A 1 8  ? 2.313   3.793   -10.468 1.00 0.00 ? 8  ALA A HB2  3 
ATOM   2058 H HB3  . ALA A 1 8  ? 3.309   4.582   -9.246  1.00 0.00 ? 8  ALA A HB3  3 
ATOM   2059 N N    . VAL A 1 9  ? 1.040   1.656   -9.666  1.00 0.00 ? 9  VAL A N    3 
ATOM   2060 C CA   . VAL A 1 9  ? 0.216   0.633   -10.292 1.00 0.00 ? 9  VAL A CA   3 
ATOM   2061 C C    . VAL A 1 9  ? -0.791  0.048   -9.304  1.00 0.00 ? 9  VAL A C    3 
ATOM   2062 O O    . VAL A 1 9  ? -1.818  -0.503  -9.701  1.00 0.00 ? 9  VAL A O    3 
ATOM   2063 C CB   . VAL A 1 9  ? 1.080   -0.505  -10.870 1.00 0.00 ? 9  VAL A CB   3 
ATOM   2064 C CG1  . VAL A 1 9  ? 1.879   -1.186  -9.768  1.00 0.00 ? 9  VAL A CG1  3 
ATOM   2065 C CG2  . VAL A 1 9  ? 0.215   -1.513  -11.613 1.00 0.00 ? 9  VAL A CG2  3 
ATOM   2066 H H    . VAL A 1 9  ? 2.007   1.555   -9.669  1.00 0.00 ? 9  VAL A H    3 
ATOM   2067 H HA   . VAL A 1 9  ? -0.317  1.096   -11.101 1.00 0.00 ? 9  VAL A HA   3 
ATOM   2068 H HB   . VAL A 1 9  ? 1.778   -0.076  -11.574 1.00 0.00 ? 9  VAL A HB   3 
ATOM   2069 H HG11 . VAL A 1 9  ? 2.685   -0.539  -9.456  1.00 0.00 ? 9  VAL A HG11 3 
ATOM   2070 H HG12 . VAL A 1 9  ? 2.286   -2.114  -10.140 1.00 0.00 ? 9  VAL A HG12 3 
ATOM   2071 H HG13 . VAL A 1 9  ? 1.233   -1.387  -8.927  1.00 0.00 ? 9  VAL A HG13 3 
ATOM   2072 H HG21 . VAL A 1 9  ? 0.828   -2.076  -12.301 1.00 0.00 ? 9  VAL A HG21 3 
ATOM   2073 H HG22 . VAL A 1 9  ? -0.555  -0.991  -12.162 1.00 0.00 ? 9  VAL A HG22 3 
ATOM   2074 H HG23 . VAL A 1 9  ? -0.243  -2.186  -10.904 1.00 0.00 ? 9  VAL A HG23 3 
ATOM   2075 N N    . CYS A 1 10 ? -0.488  0.172   -8.017  1.00 0.00 ? 10 CYS A N    3 
ATOM   2076 C CA   . CYS A 1 10 ? -1.362  -0.343  -6.969  1.00 0.00 ? 10 CYS A CA   3 
ATOM   2077 C C    . CYS A 1 10 ? -2.390  0.705   -6.570  1.00 0.00 ? 10 CYS A C    3 
ATOM   2078 O O    . CYS A 1 10 ? -3.518  0.380   -6.198  1.00 0.00 ? 10 CYS A O    3 
ATOM   2079 C CB   . CYS A 1 10 ? -0.538  -0.735  -5.746  1.00 0.00 ? 10 CYS A CB   3 
ATOM   2080 S SG   . CYS A 1 10 ? -1.308  -2.020  -4.709  1.00 0.00 ? 10 CYS A SG   3 
ATOM   2081 H H    . CYS A 1 10 ? 0.345   0.620   -7.766  1.00 0.00 ? 10 CYS A H    3 
ATOM   2082 H HA   . CYS A 1 10 ? -1.872  -1.215  -7.350  1.00 0.00 ? 10 CYS A HA   3 
ATOM   2083 H HB2  . CYS A 1 10 ? 0.421   -1.100  -6.073  1.00 0.00 ? 10 CYS A HB2  3 
ATOM   2084 H HB3  . CYS A 1 10 ? -0.393  0.142   -5.127  1.00 0.00 ? 10 CYS A HB3  3 
ATOM   2085 N N    . ALA A 1 11 ? -1.980  1.966   -6.649  1.00 0.00 ? 11 ALA A N    3 
ATOM   2086 C CA   . ALA A 1 11 ? -2.846  3.089   -6.298  1.00 0.00 ? 11 ALA A CA   3 
ATOM   2087 C C    . ALA A 1 11 ? -4.245  2.911   -6.870  1.00 0.00 ? 11 ALA A C    3 
ATOM   2088 O O    . ALA A 1 11 ? -5.230  3.376   -6.296  1.00 0.00 ? 11 ALA A O    3 
ATOM   2089 C CB   . ALA A 1 11 ? -2.237  4.395   -6.785  1.00 0.00 ? 11 ALA A CB   3 
ATOM   2090 H H    . ALA A 1 11 ? -1.067  2.145   -6.950  1.00 0.00 ? 11 ALA A H    3 
ATOM   2091 H HA   . ALA A 1 11 ? -2.913  3.130   -5.225  1.00 0.00 ? 11 ALA A HA   3 
ATOM   2092 H HB1  . ALA A 1 11 ? -1.165  4.363   -6.657  1.00 0.00 ? 11 ALA A HB1  3 
ATOM   2093 H HB2  . ALA A 1 11 ? -2.643  5.217   -6.215  1.00 0.00 ? 11 ALA A HB2  3 
ATOM   2094 H HB3  . ALA A 1 11 ? -2.471  4.533   -7.831  1.00 0.00 ? 11 ALA A HB3  3 
ATOM   2095 N N    . SER A 1 12 ? -4.320  2.228   -8.002  1.00 0.00 ? 12 SER A N    3 
ATOM   2096 C CA   . SER A 1 12 ? -5.591  1.973   -8.662  1.00 0.00 ? 12 SER A CA   3 
ATOM   2097 C C    . SER A 1 12 ? -6.583  1.330   -7.697  1.00 0.00 ? 12 SER A C    3 
ATOM   2098 O O    . SER A 1 12 ? -7.755  1.704   -7.652  1.00 0.00 ? 12 SER A O    3 
ATOM   2099 C CB   . SER A 1 12 ? -5.387  1.070   -9.881  1.00 0.00 ? 12 SER A CB   3 
ATOM   2100 O OG   . SER A 1 12 ? -6.488  1.156   -10.769 1.00 0.00 ? 12 SER A OG   3 
ATOM   2101 H H    . SER A 1 12 ? -3.498  1.886   -8.402  1.00 0.00 ? 12 SER A H    3 
ATOM   2102 H HA   . SER A 1 12 ? -5.985  2.920   -8.989  1.00 0.00 ? 12 SER A HA   3 
ATOM   2103 H HB2  . SER A 1 12 ? -4.494  1.374   -10.405 1.00 0.00 ? 12 SER A HB2  3 
ATOM   2104 H HB3  . SER A 1 12 ? -5.283  0.046   -9.554  1.00 0.00 ? 12 SER A HB3  3 
ATOM   2105 H HG   . SER A 1 12 ? -6.743  2.075   -10.877 1.00 0.00 ? 12 SER A HG   3 
ATOM   2106 N N    . ALA A 1 13 ? -6.100  0.361   -6.926  1.00 0.00 ? 13 ALA A N    3 
ATOM   2107 C CA   . ALA A 1 13 ? -6.933  -0.336  -5.959  1.00 0.00 ? 13 ALA A CA   3 
ATOM   2108 C C    . ALA A 1 13 ? -7.130  0.502   -4.700  1.00 0.00 ? 13 ALA A C    3 
ATOM   2109 O O    . ALA A 1 13 ? -8.182  0.446   -4.063  1.00 0.00 ? 13 ALA A O    3 
ATOM   2110 C CB   . ALA A 1 13 ? -6.321  -1.684  -5.608  1.00 0.00 ? 13 ALA A CB   3 
ATOM   2111 H H    . ALA A 1 13 ? -5.160  0.109   -7.009  1.00 0.00 ? 13 ALA A H    3 
ATOM   2112 H HA   . ALA A 1 13 ? -7.891  -0.511  -6.418  1.00 0.00 ? 13 ALA A HA   3 
ATOM   2113 H HB1  . ALA A 1 13 ? -5.693  -2.017  -6.422  1.00 0.00 ? 13 ALA A HB1  3 
ATOM   2114 H HB2  . ALA A 1 13 ? -7.108  -2.405  -5.443  1.00 0.00 ? 13 ALA A HB2  3 
ATOM   2115 H HB3  . ALA A 1 13 ? -5.727  -1.587  -4.711  1.00 0.00 ? 13 ALA A HB3  3 
ATOM   2116 N N    . ILE A 1 14 ? -6.112  1.281   -4.349  1.00 0.00 ? 14 ILE A N    3 
ATOM   2117 C CA   . ILE A 1 14 ? -6.175  2.133   -3.167  1.00 0.00 ? 14 ILE A CA   3 
ATOM   2118 C C    . ILE A 1 14 ? -7.143  3.295   -3.384  1.00 0.00 ? 14 ILE A C    3 
ATOM   2119 O O    . ILE A 1 14 ? -8.146  3.420   -2.681  1.00 0.00 ? 14 ILE A O    3 
ATOM   2120 C CB   . ILE A 1 14 ? -4.778  2.689   -2.800  1.00 0.00 ? 14 ILE A CB   3 
ATOM   2121 C CG1  . ILE A 1 14 ? -3.884  1.575   -2.250  1.00 0.00 ? 14 ILE A CG1  3 
ATOM   2122 C CG2  . ILE A 1 14 ? -4.893  3.818   -1.785  1.00 0.00 ? 14 ILE A CG2  3 
ATOM   2123 C CD1  . ILE A 1 14 ? -3.065  0.873   -3.314  1.00 0.00 ? 14 ILE A CD1  3 
ATOM   2124 H H    . ILE A 1 14 ? -5.301  1.284   -4.898  1.00 0.00 ? 14 ILE A H    3 
ATOM   2125 H HA   . ILE A 1 14 ? -6.528  1.532   -2.342  1.00 0.00 ? 14 ILE A HA   3 
ATOM   2126 H HB   . ILE A 1 14 ? -4.329  3.090   -3.696  1.00 0.00 ? 14 ILE A HB   3 
ATOM   2127 H HG12 . ILE A 1 14 ? -3.198  1.999   -1.529  1.00 0.00 ? 14 ILE A HG12 3 
ATOM   2128 H HG13 . ILE A 1 14 ? -4.501  0.835   -1.761  1.00 0.00 ? 14 ILE A HG13 3 
ATOM   2129 H HG21 . ILE A 1 14 ? -4.100  3.730   -1.057  1.00 0.00 ? 14 ILE A HG21 3 
ATOM   2130 H HG22 . ILE A 1 14 ? -5.848  3.757   -1.285  1.00 0.00 ? 14 ILE A HG22 3 
ATOM   2131 H HG23 . ILE A 1 14 ? -4.812  4.768   -2.292  1.00 0.00 ? 14 ILE A HG23 3 
ATOM   2132 H HD11 . ILE A 1 14 ? -3.441  -0.130  -3.455  1.00 0.00 ? 14 ILE A HD11 3 
ATOM   2133 H HD12 . ILE A 1 14 ? -2.031  0.828   -3.004  1.00 0.00 ? 14 ILE A HD12 3 
ATOM   2134 H HD13 . ILE A 1 14 ? -3.138  1.417   -4.243  1.00 0.00 ? 14 ILE A HD13 3 
ATOM   2135 N N    . LEU A 1 15 ? -6.831  4.145   -4.357  1.00 0.00 ? 15 LEU A N    3 
ATOM   2136 C CA   . LEU A 1 15 ? -7.668  5.301   -4.662  1.00 0.00 ? 15 LEU A CA   3 
ATOM   2137 C C    . LEU A 1 15 ? -9.011  4.872   -5.247  1.00 0.00 ? 15 LEU A C    3 
ATOM   2138 O O    . LEU A 1 15 ? -10.029 4.873   -4.556  1.00 0.00 ? 15 LEU A O    3 
ATOM   2139 C CB   . LEU A 1 15 ? -6.949  6.234   -5.637  1.00 0.00 ? 15 LEU A CB   3 
ATOM   2140 C CG   . LEU A 1 15 ? -5.793  7.035   -5.035  1.00 0.00 ? 15 LEU A CG   3 
ATOM   2141 C CD1  . LEU A 1 15 ? -4.898  7.589   -6.132  1.00 0.00 ? 15 LEU A CD1  3 
ATOM   2142 C CD2  . LEU A 1 15 ? -6.325  8.160   -4.160  1.00 0.00 ? 15 LEU A CD2  3 
ATOM   2143 H H    . LEU A 1 15 ? -6.016  3.995   -4.879  1.00 0.00 ? 15 LEU A H    3 
ATOM   2144 H HA   . LEU A 1 15 ? -7.847  5.831   -3.739  1.00 0.00 ? 15 LEU A HA   3 
ATOM   2145 H HB2  . LEU A 1 15 ? -6.562  5.640   -6.452  1.00 0.00 ? 15 LEU A HB2  3 
ATOM   2146 H HB3  . LEU A 1 15 ? -7.671  6.932   -6.034  1.00 0.00 ? 15 LEU A HB3  3 
ATOM   2147 H HG   . LEU A 1 15 ? -5.196  6.382   -4.415  1.00 0.00 ? 15 LEU A HG   3 
ATOM   2148 H HD11 . LEU A 1 15 ? -3.871  7.576   -5.800  1.00 0.00 ? 15 LEU A HD11 3 
ATOM   2149 H HD12 . LEU A 1 15 ? -5.191  8.604   -6.358  1.00 0.00 ? 15 LEU A HD12 3 
ATOM   2150 H HD13 . LEU A 1 15 ? -4.997  6.980   -7.019  1.00 0.00 ? 15 LEU A HD13 3 
ATOM   2151 H HD21 . LEU A 1 15 ? -6.406  9.064   -4.745  1.00 0.00 ? 15 LEU A HD21 3 
ATOM   2152 H HD22 . LEU A 1 15 ? -5.648  8.325   -3.335  1.00 0.00 ? 15 LEU A HD22 3 
ATOM   2153 H HD23 . LEU A 1 15 ? -7.298  7.890   -3.778  1.00 0.00 ? 15 LEU A HD23 3 
ATOM   2154 N N    . SER A 1 16 ? -9.006  4.511   -6.527  1.00 0.00 ? 16 SER A N    3 
ATOM   2155 C CA   . SER A 1 16 ? -10.225 4.085   -7.209  1.00 0.00 ? 16 SER A CA   3 
ATOM   2156 C C    . SER A 1 16 ? -10.912 2.950   -6.453  1.00 0.00 ? 16 SER A C    3 
ATOM   2157 O O    . SER A 1 16 ? -11.979 3.138   -5.869  1.00 0.00 ? 16 SER A O    3 
ATOM   2158 C CB   . SER A 1 16 ? -9.906  3.643   -8.638  1.00 0.00 ? 16 SER A CB   3 
ATOM   2159 O OG   . SER A 1 16 ? -10.889 4.108   -9.547  1.00 0.00 ? 16 SER A OG   3 
ATOM   2160 H H    . SER A 1 16 ? -8.164  4.534   -7.027  1.00 0.00 ? 16 SER A H    3 
ATOM   2161 H HA   . SER A 1 16 ? -10.895 4.931   -7.246  1.00 0.00 ? 16 SER A HA   3 
ATOM   2162 H HB2  . SER A 1 16 ? -8.946  4.042   -8.930  1.00 0.00 ? 16 SER A HB2  3 
ATOM   2163 H HB3  . SER A 1 16 ? -9.876  2.564   -8.681  1.00 0.00 ? 16 SER A HB3  3 
ATOM   2164 H HG   . SER A 1 16 ? -11.094 5.026   -9.355  1.00 0.00 ? 16 SER A HG   3 
ATOM   2165 N N    . GLY A 1 17 ? -10.294 1.774   -6.471  1.00 0.00 ? 17 GLY A N    3 
ATOM   2166 C CA   . GLY A 1 17 ? -10.862 0.628   -5.786  1.00 0.00 ? 17 GLY A CA   3 
ATOM   2167 C C    . GLY A 1 17 ? -11.347 -0.440  -6.747  1.00 0.00 ? 17 GLY A C    3 
ATOM   2168 O O    . GLY A 1 17 ? -12.258 -1.204  -6.429  1.00 0.00 ? 17 GLY A O    3 
ATOM   2169 H H    . GLY A 1 17 ? -9.446  1.683   -6.954  1.00 0.00 ? 17 GLY A H    3 
ATOM   2170 H HA2  . GLY A 1 17 ? -10.111 0.200   -5.140  1.00 0.00 ? 17 GLY A HA2  3 
ATOM   2171 H HA3  . GLY A 1 17 ? -11.695 0.958   -5.183  1.00 0.00 ? 17 GLY A HA3  3 
ATOM   2172 N N    . ALA A 1 18 ? -10.735 -0.493  -7.926  1.00 0.00 ? 18 ALA A N    3 
ATOM   2173 C CA   . ALA A 1 18 ? -11.107 -1.474  -8.938  1.00 0.00 ? 18 ALA A CA   3 
ATOM   2174 C C    . ALA A 1 18 ? -10.953 -2.892  -8.409  1.00 0.00 ? 18 ALA A C    3 
ATOM   2175 O O    . ALA A 1 18 ? -11.931 -3.545  -8.043  1.00 0.00 ? 18 ALA A O    3 
ATOM   2176 C CB   . ALA A 1 18 ? -10.270 -1.279  -10.194 1.00 0.00 ? 18 ALA A CB   3 
ATOM   2177 H H    . ALA A 1 18 ? -10.016 0.143   -8.120  1.00 0.00 ? 18 ALA A H    3 
ATOM   2178 H HA   . ALA A 1 18 ? -12.136 -1.313  -9.195  1.00 0.00 ? 18 ALA A HA   3 
ATOM   2179 H HB1  . ALA A 1 18 ? -9.312  -0.858  -9.926  1.00 0.00 ? 18 ALA A HB1  3 
ATOM   2180 H HB2  . ALA A 1 18 ? -10.782 -0.608  -10.868 1.00 0.00 ? 18 ALA A HB2  3 
ATOM   2181 H HB3  . ALA A 1 18 ? -10.121 -2.232  -10.679 1.00 0.00 ? 18 ALA A HB3  3 
ATOM   2182 N N    . LYS A 1 19 ? -9.717  -3.356  -8.372  1.00 0.00 ? 19 LYS A N    3 
ATOM   2183 C CA   . LYS A 1 19 ? -9.410  -4.696  -7.888  1.00 0.00 ? 19 LYS A CA   3 
ATOM   2184 C C    . LYS A 1 19 ? -7.902  -4.893  -7.753  1.00 0.00 ? 19 LYS A C    3 
ATOM   2185 O O    . LYS A 1 19 ? -7.128  -4.385  -8.564  1.00 0.00 ? 19 LYS A O    3 
ATOM   2186 C CB   . LYS A 1 19 ? -9.995  -5.752  -8.830  1.00 0.00 ? 19 LYS A CB   3 
ATOM   2187 C CG   . LYS A 1 19 ? -9.801  -5.434  -10.305 1.00 0.00 ? 19 LYS A CG   3 
ATOM   2188 C CD   . LYS A 1 19 ? -8.452  -5.920  -10.809 1.00 0.00 ? 19 LYS A CD   3 
ATOM   2189 C CE   . LYS A 1 19 ? -7.856  -4.955  -11.821 1.00 0.00 ? 19 LYS A CE   3 
ATOM   2190 N NZ   . LYS A 1 19 ? -6.949  -3.964  -11.179 1.00 0.00 ? 19 LYS A NZ   3 
ATOM   2191 H H    . LYS A 1 19 ? -8.991  -2.780  -8.677  1.00 0.00 ? 19 LYS A H    3 
ATOM   2192 H HA   . LYS A 1 19 ? -9.864  -4.804  -6.915  1.00 0.00 ? 19 LYS A HA   3 
ATOM   2193 H HB2  . LYS A 1 19 ? -9.521  -6.701  -8.625  1.00 0.00 ? 19 LYS A HB2  3 
ATOM   2194 H HB3  . LYS A 1 19 ? -11.054 -5.840  -8.639  1.00 0.00 ? 19 LYS A HB3  3 
ATOM   2195 H HG2  . LYS A 1 19 ? -10.581 -5.919  -10.872 1.00 0.00 ? 19 LYS A HG2  3 
ATOM   2196 H HG3  . LYS A 1 19 ? -9.864  -4.365  -10.445 1.00 0.00 ? 19 LYS A HG3  3 
ATOM   2197 H HD2  . LYS A 1 19 ? -7.776  -6.010  -9.971  1.00 0.00 ? 19 LYS A HD2  3 
ATOM   2198 H HD3  . LYS A 1 19 ? -8.580  -6.885  -11.276 1.00 0.00 ? 19 LYS A HD3  3 
ATOM   2199 H HE2  . LYS A 1 19 ? -7.297  -5.520  -12.552 1.00 0.00 ? 19 LYS A HE2  3 
ATOM   2200 H HE3  . LYS A 1 19 ? -8.661  -4.428  -12.313 1.00 0.00 ? 19 LYS A HE3  3 
ATOM   2201 H HZ1  . LYS A 1 19 ? -7.062  -3.033  -11.628 1.00 0.00 ? 19 LYS A HZ1  3 
ATOM   2202 H HZ2  . LYS A 1 19 ? -5.959  -4.267  -11.281 1.00 0.00 ? 19 LYS A HZ2  3 
ATOM   2203 H HZ3  . LYS A 1 19 ? -7.171  -3.879  -10.166 1.00 0.00 ? 19 LYS A HZ3  3 
ATOM   2204 N N    . PRO A 1 20 ? -7.462  -5.635  -6.721  1.00 0.00 ? 20 PRO A N    3 
ATOM   2205 C CA   . PRO A 1 20 ? -6.038  -5.894  -6.487  1.00 0.00 ? 20 PRO A CA   3 
ATOM   2206 C C    . PRO A 1 20 ? -5.447  -6.856  -7.512  1.00 0.00 ? 20 PRO A C    3 
ATOM   2207 O O    . PRO A 1 20 ? -6.092  -7.195  -8.504  1.00 0.00 ? 20 PRO A O    3 
ATOM   2208 C CB   . PRO A 1 20 ? -6.017  -6.520  -5.092  1.00 0.00 ? 20 PRO A CB   3 
ATOM   2209 C CG   . PRO A 1 20 ? -7.356  -7.154  -4.945  1.00 0.00 ? 20 PRO A CG   3 
ATOM   2210 C CD   . PRO A 1 20 ? -8.316  -6.279  -5.704  1.00 0.00 ? 20 PRO A CD   3 
ATOM   2211 H HA   . PRO A 1 20 ? -5.465  -4.978  -6.483  1.00 0.00 ? 20 PRO A HA   3 
ATOM   2212 H HB2  . PRO A 1 20 ? -5.224  -7.251  -5.035  1.00 0.00 ? 20 PRO A HB2  3 
ATOM   2213 H HB3  . PRO A 1 20 ? -5.861  -5.751  -4.351  1.00 0.00 ? 20 PRO A HB3  3 
ATOM   2214 H HG2  . PRO A 1 20 ? -7.341  -8.148  -5.367  1.00 0.00 ? 20 PRO A HG2  3 
ATOM   2215 H HG3  . PRO A 1 20 ? -7.631  -7.193  -3.901  1.00 0.00 ? 20 PRO A HG3  3 
ATOM   2216 H HD2  . PRO A 1 20 ? -9.085  -6.877  -6.169  1.00 0.00 ? 20 PRO A HD2  3 
ATOM   2217 H HD3  . PRO A 1 20 ? -8.754  -5.542  -5.048  1.00 0.00 ? 20 PRO A HD3  3 
ATOM   2218 N N    . SER A 1 21 ? -4.217  -7.292  -7.265  1.00 0.00 ? 21 SER A N    3 
ATOM   2219 C CA   . SER A 1 21 ? -3.538  -8.212  -8.158  1.00 0.00 ? 21 SER A CA   3 
ATOM   2220 C C    . SER A 1 21 ? -2.306  -8.801  -7.479  1.00 0.00 ? 21 SER A C    3 
ATOM   2221 O O    . SER A 1 21 ? -2.172  -8.745  -6.257  1.00 0.00 ? 21 SER A O    3 
ATOM   2222 C CB   . SER A 1 21 ? -3.141  -7.497  -9.452  1.00 0.00 ? 21 SER A CB   3 
ATOM   2223 O OG   . SER A 1 21 ? -3.320  -8.340  -10.577 1.00 0.00 ? 21 SER A OG   3 
ATOM   2224 H H    . SER A 1 21 ? -3.754  -6.990  -6.461  1.00 0.00 ? 21 SER A H    3 
ATOM   2225 H HA   . SER A 1 21 ? -4.222  -9.011  -8.392  1.00 0.00 ? 21 SER A HA   3 
ATOM   2226 H HB2  . SER A 1 21 ? -3.754  -6.617  -9.577  1.00 0.00 ? 21 SER A HB2  3 
ATOM   2227 H HB3  . SER A 1 21 ? -2.102  -7.207  -9.396  1.00 0.00 ? 21 SER A HB3  3 
ATOM   2228 H HG   . SER A 1 21 ? -2.465  -8.645  -10.888 1.00 0.00 ? 21 SER A HG   3 
ATOM   2229 N N    . GLY A 1 22 ? -1.411  -9.364  -8.278  1.00 0.00 ? 22 GLY A N    3 
ATOM   2230 C CA   . GLY A 1 22 ? -0.201  -9.955  -7.739  1.00 0.00 ? 22 GLY A CA   3 
ATOM   2231 C C    . GLY A 1 22 ? 1.012   -9.067  -7.930  1.00 0.00 ? 22 GLY A C    3 
ATOM   2232 O O    . GLY A 1 22 ? 1.965   -9.131  -7.154  1.00 0.00 ? 22 GLY A O    3 
ATOM   2233 H H    . GLY A 1 22 ? -1.574  -9.377  -9.241  1.00 0.00 ? 22 GLY A H    3 
ATOM   2234 H HA2  . GLY A 1 22 ? -0.340  -10.135 -6.684  1.00 0.00 ? 22 GLY A HA2  3 
ATOM   2235 H HA3  . GLY A 1 22 ? -0.024  -10.899 -8.234  1.00 0.00 ? 22 GLY A HA3  3 
ATOM   2236 N N    . GLU A 1 23 ? 0.979   -8.239  -8.969  1.00 0.00 ? 23 GLU A N    3 
ATOM   2237 C CA   . GLU A 1 23 ? 2.075   -7.339  -9.269  1.00 0.00 ? 23 GLU A CA   3 
ATOM   2238 C C    . GLU A 1 23 ? 2.377   -6.432  -8.081  1.00 0.00 ? 23 GLU A C    3 
ATOM   2239 O O    . GLU A 1 23 ? 3.527   -6.304  -7.661  1.00 0.00 ? 23 GLU A O    3 
ATOM   2240 C CB   . GLU A 1 23 ? 1.716   -6.498  -10.489 1.00 0.00 ? 23 GLU A CB   3 
ATOM   2241 C CG   . GLU A 1 23 ? 2.925   -6.011  -11.251 1.00 0.00 ? 23 GLU A CG   3 
ATOM   2242 C CD   . GLU A 1 23 ? 2.836   -4.543  -11.624 1.00 0.00 ? 23 GLU A CD   3 
ATOM   2243 O OE1  . GLU A 1 23 ? 1.751   -4.108  -12.063 1.00 0.00 ? 23 GLU A OE1  3 
ATOM   2244 O OE2  . GLU A 1 23 ? 3.850   -3.830  -11.476 1.00 0.00 ? 23 GLU A OE2  3 
ATOM   2245 H H    . GLU A 1 23 ? 0.200   -8.233  -9.556  1.00 0.00 ? 23 GLU A H    3 
ATOM   2246 H HA   . GLU A 1 23 ? 2.948   -7.933  -9.491  1.00 0.00 ? 23 GLU A HA   3 
ATOM   2247 H HB2  . GLU A 1 23 ? 1.110   -7.095  -11.159 1.00 0.00 ? 23 GLU A HB2  3 
ATOM   2248 H HB3  . GLU A 1 23 ? 1.147   -5.637  -10.166 1.00 0.00 ? 23 GLU A HB3  3 
ATOM   2249 H HG2  . GLU A 1 23 ? 3.798   -6.161  -10.637 1.00 0.00 ? 23 GLU A HG2  3 
ATOM   2250 H HG3  . GLU A 1 23 ? 3.014   -6.595  -12.153 1.00 0.00 ? 23 GLU A HG3  3 
ATOM   2251 N N    . CYS A 1 24 ? 1.336   -5.802  -7.546  1.00 0.00 ? 24 CYS A N    3 
ATOM   2252 C CA   . CYS A 1 24 ? 1.487   -4.903  -6.409  1.00 0.00 ? 24 CYS A CA   3 
ATOM   2253 C C    . CYS A 1 24 ? 2.238   -5.580  -5.268  1.00 0.00 ? 24 CYS A C    3 
ATOM   2254 O O    . CYS A 1 24 ? 2.905   -4.920  -4.472  1.00 0.00 ? 24 CYS A O    3 
ATOM   2255 C CB   . CYS A 1 24 ? 0.117   -4.419  -5.922  1.00 0.00 ? 24 CYS A CB   3 
ATOM   2256 S SG   . CYS A 1 24 ? 0.181   -3.372  -4.429  1.00 0.00 ? 24 CYS A SG   3 
ATOM   2257 H H    . CYS A 1 24 ? 0.446   -5.943  -7.926  1.00 0.00 ? 24 CYS A H    3 
ATOM   2258 H HA   . CYS A 1 24 ? 2.058   -4.058  -6.741  1.00 0.00 ? 24 CYS A HA   3 
ATOM   2259 H HB2  . CYS A 1 24 ? -0.351  -3.842  -6.706  1.00 0.00 ? 24 CYS A HB2  3 
ATOM   2260 H HB3  . CYS A 1 24 ? -0.501  -5.276  -5.697  1.00 0.00 ? 24 CYS A HB3  3 
ATOM   2261 N N    . CYS A 1 25 ? 2.127   -6.899  -5.198  1.00 0.00 ? 25 CYS A N    3 
ATOM   2262 C CA   . CYS A 1 25 ? 2.797   -7.665  -4.155  1.00 0.00 ? 25 CYS A CA   3 
ATOM   2263 C C    . CYS A 1 25 ? 4.307   -7.627  -4.343  1.00 0.00 ? 25 CYS A C    3 
ATOM   2264 O O    . CYS A 1 25 ? 5.037   -7.147  -3.477  1.00 0.00 ? 25 CYS A O    3 
ATOM   2265 C CB   . CYS A 1 25 ? 2.313   -9.117  -4.156  1.00 0.00 ? 25 CYS A CB   3 
ATOM   2266 S SG   . CYS A 1 25 ? 0.508   -9.306  -3.981  1.00 0.00 ? 25 CYS A SG   3 
ATOM   2267 H H    . CYS A 1 25 ? 1.584   -7.367  -5.863  1.00 0.00 ? 25 CYS A H    3 
ATOM   2268 H HA   . CYS A 1 25 ? 2.554   -7.215  -3.205  1.00 0.00 ? 25 CYS A HA   3 
ATOM   2269 H HB2  . CYS A 1 25 ? 2.602   -9.584  -5.085  1.00 0.00 ? 25 CYS A HB2  3 
ATOM   2270 H HB3  . CYS A 1 25 ? 2.779   -9.643  -3.336  1.00 0.00 ? 25 CYS A HB3  3 
ATOM   2271 N N    . GLY A 1 26 ? 4.768   -8.137  -5.479  1.00 0.00 ? 26 GLY A N    3 
ATOM   2272 C CA   . GLY A 1 26 ? 6.191   -8.157  -5.762  1.00 0.00 ? 26 GLY A CA   3 
ATOM   2273 C C    . GLY A 1 26 ? 6.823   -6.781  -5.693  1.00 0.00 ? 26 GLY A C    3 
ATOM   2274 O O    . GLY A 1 26 ? 8.004   -6.650  -5.371  1.00 0.00 ? 26 GLY A O    3 
ATOM   2275 H H    . GLY A 1 26 ? 4.136   -8.507  -6.132  1.00 0.00 ? 26 GLY A H    3 
ATOM   2276 H HA2  . GLY A 1 26 ? 6.679   -8.798  -5.043  1.00 0.00 ? 26 GLY A HA2  3 
ATOM   2277 H HA3  . GLY A 1 26 ? 6.345   -8.562  -6.751  1.00 0.00 ? 26 GLY A HA3  3 
ATOM   2278 N N    . ASN A 1 27 ? 6.041   -5.752  -6.000  1.00 0.00 ? 27 ASN A N    3 
ATOM   2279 C CA   . ASN A 1 27 ? 6.536   -4.390  -5.975  1.00 0.00 ? 27 ASN A CA   3 
ATOM   2280 C C    . ASN A 1 27 ? 6.783   -3.930  -4.552  1.00 0.00 ? 27 ASN A C    3 
ATOM   2281 O O    . ASN A 1 27 ? 7.924   -3.714  -4.143  1.00 0.00 ? 27 ASN A O    3 
ATOM   2282 C CB   . ASN A 1 27 ? 5.549   -3.449  -6.668  1.00 0.00 ? 27 ASN A CB   3 
ATOM   2283 C CG   . ASN A 1 27 ? 5.403   -3.750  -8.146  1.00 0.00 ? 27 ASN A CG   3 
ATOM   2284 O OD1  . ASN A 1 27 ? 4.337   -4.158  -8.606  1.00 0.00 ? 27 ASN A OD1  3 
ATOM   2285 N ND2  . ASN A 1 27 ? 6.478   -3.548  -8.899  1.00 0.00 ? 27 ASN A ND2  3 
ATOM   2286 H H    . ASN A 1 27 ? 5.115   -5.911  -6.252  1.00 0.00 ? 27 ASN A H    3 
ATOM   2287 H HA   . ASN A 1 27 ? 7.460   -4.378  -6.501  1.00 0.00 ? 27 ASN A HA   3 
ATOM   2288 H HB2  . ASN A 1 27 ? 4.579   -3.548  -6.203  1.00 0.00 ? 27 ASN A HB2  3 
ATOM   2289 H HB3  . ASN A 1 27 ? 5.893   -2.431  -6.558  1.00 0.00 ? 27 ASN A HB3  3 
ATOM   2290 H HD21 . ASN A 1 27 ? 7.293   -3.220  -8.465  1.00 0.00 ? 27 ASN A HD21 3 
ATOM   2291 H HD22 . ASN A 1 27 ? 6.412   -3.737  -9.858  1.00 0.00 ? 27 ASN A HD22 3 
ATOM   2292 N N    . LEU A 1 28 ? 5.706   -3.785  -3.805  1.00 0.00 ? 28 LEU A N    3 
ATOM   2293 C CA   . LEU A 1 28 ? 5.796   -3.351  -2.422  1.00 0.00 ? 28 LEU A CA   3 
ATOM   2294 C C    . LEU A 1 28 ? 6.707   -4.278  -1.628  1.00 0.00 ? 28 LEU A C    3 
ATOM   2295 O O    . LEU A 1 28 ? 7.334   -3.863  -0.653  1.00 0.00 ? 28 LEU A O    3 
ATOM   2296 C CB   . LEU A 1 28 ? 4.410   -3.280  -1.778  1.00 0.00 ? 28 LEU A CB   3 
ATOM   2297 C CG   . LEU A 1 28 ? 3.650   -4.601  -1.731  1.00 0.00 ? 28 LEU A CG   3 
ATOM   2298 C CD1  . LEU A 1 28 ? 3.916   -5.321  -0.420  1.00 0.00 ? 28 LEU A CD1  3 
ATOM   2299 C CD2  . LEU A 1 28 ? 2.158   -4.366  -1.919  1.00 0.00 ? 28 LEU A CD2  3 
ATOM   2300 H H    . LEU A 1 28 ? 4.835   -3.974  -4.196  1.00 0.00 ? 28 LEU A H    3 
ATOM   2301 H HA   . LEU A 1 28 ? 6.226   -2.372  -2.425  1.00 0.00 ? 28 LEU A HA   3 
ATOM   2302 H HB2  . LEU A 1 28 ? 4.525   -2.918  -0.767  1.00 0.00 ? 28 LEU A HB2  3 
ATOM   2303 H HB3  . LEU A 1 28 ? 3.816   -2.568  -2.331  1.00 0.00 ? 28 LEU A HB3  3 
ATOM   2304 H HG   . LEU A 1 28 ? 3.996   -5.232  -2.535  1.00 0.00 ? 28 LEU A HG   3 
ATOM   2305 H HD11 . LEU A 1 28 ? 4.963   -5.242  -0.169  1.00 0.00 ? 28 LEU A HD11 3 
ATOM   2306 H HD12 . LEU A 1 28 ? 3.649   -6.360  -0.525  1.00 0.00 ? 28 LEU A HD12 3 
ATOM   2307 H HD13 . LEU A 1 28 ? 3.323   -4.874  0.363   1.00 0.00 ? 28 LEU A HD13 3 
ATOM   2308 H HD21 . LEU A 1 28 ? 1.740   -5.166  -2.512  1.00 0.00 ? 28 LEU A HD21 3 
ATOM   2309 H HD22 . LEU A 1 28 ? 2.003   -3.424  -2.423  1.00 0.00 ? 28 LEU A HD22 3 
ATOM   2310 H HD23 . LEU A 1 28 ? 1.673   -4.343  -0.954  1.00 0.00 ? 28 LEU A HD23 3 
ATOM   2311 N N    . ARG A 1 29 ? 6.783   -5.534  -2.057  1.00 0.00 ? 29 ARG A N    3 
ATOM   2312 C CA   . ARG A 1 29 ? 7.626   -6.510  -1.394  1.00 0.00 ? 29 ARG A CA   3 
ATOM   2313 C C    . ARG A 1 29 ? 9.077   -6.085  -1.459  1.00 0.00 ? 29 ARG A C    3 
ATOM   2314 O O    . ARG A 1 29 ? 9.790   -6.098  -0.456  1.00 0.00 ? 29 ARG A O    3 
ATOM   2315 C CB   . ARG A 1 29 ? 7.460   -7.894  -2.031  1.00 0.00 ? 29 ARG A CB   3 
ATOM   2316 C CG   . ARG A 1 29 ? 6.585   -8.844  -1.230  1.00 0.00 ? 29 ARG A CG   3 
ATOM   2317 C CD   . ARG A 1 29 ? 5.368   -8.143  -0.653  1.00 0.00 ? 29 ARG A CD   3 
ATOM   2318 N NE   . ARG A 1 29 ? 5.576   -7.738  0.735   1.00 0.00 ? 29 ARG A NE   3 
ATOM   2319 C CZ   . ARG A 1 29 ? 5.703   -8.594  1.747   1.00 0.00 ? 29 ARG A CZ   3 
ATOM   2320 N NH1  . ARG A 1 29 ? 5.650   -9.902  1.528   1.00 0.00 ? 29 ARG A NH1  3 
ATOM   2321 N NH2  . ARG A 1 29 ? 5.885   -8.141  2.980   1.00 0.00 ? 29 ARG A NH2  3 
ATOM   2322 H H    . ARG A 1 29 ? 6.267   -5.806  -2.837  1.00 0.00 ? 29 ARG A H    3 
ATOM   2323 H HA   . ARG A 1 29 ? 7.323   -6.547  -0.372  1.00 0.00 ? 29 ARG A HA   3 
ATOM   2324 H HB2  . ARG A 1 29 ? 7.023   -7.776  -3.010  1.00 0.00 ? 29 ARG A HB2  3 
ATOM   2325 H HB3  . ARG A 1 29 ? 8.436   -8.345  -2.138  1.00 0.00 ? 29 ARG A HB3  3 
ATOM   2326 H HG2  . ARG A 1 29 ? 6.252   -9.638  -1.878  1.00 0.00 ? 29 ARG A HG2  3 
ATOM   2327 H HG3  . ARG A 1 29 ? 7.169   -9.257  -0.421  1.00 0.00 ? 29 ARG A HG3  3 
ATOM   2328 H HD2  . ARG A 1 29 ? 5.163   -7.267  -1.248  1.00 0.00 ? 29 ARG A HD2  3 
ATOM   2329 H HD3  . ARG A 1 29 ? 4.525   -8.815  -0.701  1.00 0.00 ? 29 ARG A HD3  3 
ATOM   2330 H HE   . ARG A 1 29 ? 5.623   -6.777  0.924   1.00 0.00 ? 29 ARG A HE   3 
ATOM   2331 H HH11 . ARG A 1 29 ? 5.515   -10.250 0.600   1.00 0.00 ? 29 ARG A HH11 3 
ATOM   2332 H HH12 . ARG A 1 29 ? 5.746   -10.541 2.292   1.00 0.00 ? 29 ARG A HH12 3 
ATOM   2333 H HH21 . ARG A 1 29 ? 5.927   -7.157  3.150   1.00 0.00 ? 29 ARG A HH21 3 
ATOM   2334 H HH22 . ARG A 1 29 ? 5.980   -8.784  3.740   1.00 0.00 ? 29 ARG A HH22 3 
ATOM   2335 N N    . ALA A 1 30 ? 9.503   -5.692  -2.648  1.00 0.00 ? 30 ALA A N    3 
ATOM   2336 C CA   . ALA A 1 30 ? 10.867  -5.242  -2.853  1.00 0.00 ? 30 ALA A CA   3 
ATOM   2337 C C    . ALA A 1 30 ? 11.214  -4.141  -1.860  1.00 0.00 ? 30 ALA A C    3 
ATOM   2338 O O    . ALA A 1 30 ? 12.381  -3.925  -1.532  1.00 0.00 ? 30 ALA A O    3 
ATOM   2339 C CB   . ALA A 1 30 ? 11.059  -4.754  -4.281  1.00 0.00 ? 30 ALA A CB   3 
ATOM   2340 H H    . ALA A 1 30 ? 8.880   -5.696  -3.401  1.00 0.00 ? 30 ALA A H    3 
ATOM   2341 H HA   . ALA A 1 30 ? 11.519  -6.082  -2.690  1.00 0.00 ? 30 ALA A HA   3 
ATOM   2342 H HB1  . ALA A 1 30 ? 10.527  -3.824  -4.419  1.00 0.00 ? 30 ALA A HB1  3 
ATOM   2343 H HB2  . ALA A 1 30 ? 10.676  -5.493  -4.969  1.00 0.00 ? 30 ALA A HB2  3 
ATOM   2344 H HB3  . ALA A 1 30 ? 12.111  -4.598  -4.470  1.00 0.00 ? 30 ALA A HB3  3 
ATOM   2345 N N    . GLN A 1 31 ? 10.182  -3.457  -1.377  1.00 0.00 ? 31 GLN A N    3 
ATOM   2346 C CA   . GLN A 1 31 ? 10.357  -2.386  -0.409  1.00 0.00 ? 31 GLN A CA   3 
ATOM   2347 C C    . GLN A 1 31 ? 10.516  -2.952  0.994   1.00 0.00 ? 31 GLN A C    3 
ATOM   2348 O O    . GLN A 1 31 ? 11.606  -2.925  1.566   1.00 0.00 ? 31 GLN A O    3 
ATOM   2349 C CB   . GLN A 1 31 ? 9.171   -1.419  -0.459  1.00 0.00 ? 31 GLN A CB   3 
ATOM   2350 C CG   . GLN A 1 31 ? 8.726   -1.075  -1.870  1.00 0.00 ? 31 GLN A CG   3 
ATOM   2351 C CD   . GLN A 1 31 ? 7.916   0.203   -1.922  1.00 0.00 ? 31 GLN A CD   3 
ATOM   2352 O OE1  . GLN A 1 31 ? 6.714   0.200   -1.662  1.00 0.00 ? 31 GLN A OE1  3 
ATOM   2353 N NE2  . GLN A 1 31 ? 8.574   1.305   -2.256  1.00 0.00 ? 31 GLN A NE2  3 
ATOM   2354 H H    . GLN A 1 31 ? 9.274   -3.692  -1.669  1.00 0.00 ? 31 GLN A H    3 
ATOM   2355 H HA   . GLN A 1 31 ? 11.256  -1.849  -0.667  1.00 0.00 ? 31 GLN A HA   3 
ATOM   2356 H HB2  . GLN A 1 31 ? 8.335   -1.862  0.059   1.00 0.00 ? 31 GLN A HB2  3 
ATOM   2357 H HB3  . GLN A 1 31 ? 9.447   -0.501  0.039   1.00 0.00 ? 31 GLN A HB3  3 
ATOM   2358 H HG2  . GLN A 1 31 ? 9.601   -0.955  -2.491  1.00 0.00 ? 31 GLN A HG2  3 
ATOM   2359 H HG3  . GLN A 1 31 ? 8.122   -1.885  -2.252  1.00 0.00 ? 31 GLN A HG3  3 
ATOM   2360 H HE21 . GLN A 1 31 ? 9.536   1.230   -2.450  1.00 0.00 ? 31 GLN A HE21 3 
ATOM   2361 H HE22 . GLN A 1 31 ? 8.073   2.150   -2.290  1.00 0.00 ? 31 GLN A HE22 3 
ATOM   2362 N N    . GLN A 1 32 ? 9.417   -3.465  1.546   1.00 0.00 ? 32 GLN A N    3 
ATOM   2363 C CA   . GLN A 1 32 ? 9.424   -4.038  2.885   1.00 0.00 ? 32 GLN A CA   3 
ATOM   2364 C C    . GLN A 1 32 ? 10.110  -3.112  3.890   1.00 0.00 ? 32 GLN A C    3 
ATOM   2365 O O    . GLN A 1 32 ? 10.533  -3.544  4.963   1.00 0.00 ? 32 GLN A O    3 
ATOM   2366 C CB   . GLN A 1 32 ? 10.109  -5.398  2.859   1.00 0.00 ? 32 GLN A CB   3 
ATOM   2367 C CG   . GLN A 1 32 ? 9.359   -6.463  3.638   1.00 0.00 ? 32 GLN A CG   3 
ATOM   2368 C CD   . GLN A 1 32 ? 8.840   -7.577  2.749   1.00 0.00 ? 32 GLN A CD   3 
ATOM   2369 O OE1  . GLN A 1 32 ? 8.934   -8.755  3.091   1.00 0.00 ? 32 GLN A OE1  3 
ATOM   2370 N NE2  . GLN A 1 32 ? 8.290   -7.204  1.600   1.00 0.00 ? 32 GLN A NE2  3 
ATOM   2371 H H    . GLN A 1 32 ? 8.581   -3.460  1.040   1.00 0.00 ? 32 GLN A H    3 
ATOM   2372 H HA   . GLN A 1 32 ? 8.396   -4.173  3.188   1.00 0.00 ? 32 GLN A HA   3 
ATOM   2373 H HB2  . GLN A 1 32 ? 10.189  -5.722  1.830   1.00 0.00 ? 32 GLN A HB2  3 
ATOM   2374 H HB3  . GLN A 1 32 ? 11.098  -5.299  3.278   1.00 0.00 ? 32 GLN A HB3  3 
ATOM   2375 H HG2  . GLN A 1 32 ? 10.022  -6.888  4.375   1.00 0.00 ? 32 GLN A HG2  3 
ATOM   2376 H HG3  . GLN A 1 32 ? 8.519   -5.998  4.132   1.00 0.00 ? 32 GLN A HG3  3 
ATOM   2377 H HE21 . GLN A 1 32 ? 8.250   -6.247  1.395   1.00 0.00 ? 32 GLN A HE21 3 
ATOM   2378 H HE22 . GLN A 1 32 ? 7.945   -7.901  1.004   1.00 0.00 ? 32 GLN A HE22 3 
ATOM   2379 N N    . GLY A 1 33 ? 10.206  -1.835  3.534   1.00 0.00 ? 33 GLY A N    3 
ATOM   2380 C CA   . GLY A 1 33 ? 10.826  -0.854  4.404   1.00 0.00 ? 33 GLY A CA   3 
ATOM   2381 C C    . GLY A 1 33 ? 10.040  0.440   4.432   1.00 0.00 ? 33 GLY A C    3 
ATOM   2382 O O    . GLY A 1 33 ? 9.240   0.668   5.341   1.00 0.00 ? 33 GLY A O    3 
ATOM   2383 H H    . GLY A 1 33 ? 9.843   -1.554  2.670   1.00 0.00 ? 33 GLY A H    3 
ATOM   2384 H HA2  . GLY A 1 33 ? 10.882  -1.256  5.405   1.00 0.00 ? 33 GLY A HA2  3 
ATOM   2385 H HA3  . GLY A 1 33 ? 11.825  -0.650  4.049   1.00 0.00 ? 33 GLY A HA3  3 
ATOM   2386 N N    . CYS A 1 34 ? 10.253  1.283   3.426   1.00 0.00 ? 34 CYS A N    3 
ATOM   2387 C CA   . CYS A 1 34 ? 9.546   2.549   3.329   1.00 0.00 ? 34 CYS A CA   3 
ATOM   2388 C C    . CYS A 1 34 ? 8.046   2.307   3.270   1.00 0.00 ? 34 CYS A C    3 
ATOM   2389 O O    . CYS A 1 34 ? 7.251   3.070   3.820   1.00 0.00 ? 34 CYS A O    3 
ATOM   2390 C CB   . CYS A 1 34 ? 9.996   3.313   2.095   1.00 0.00 ? 34 CYS A CB   3 
ATOM   2391 S SG   . CYS A 1 34 ? 9.787   5.119   2.217   1.00 0.00 ? 34 CYS A SG   3 
ATOM   2392 H H    . CYS A 1 34 ? 10.891  1.043   2.729   1.00 0.00 ? 34 CYS A H    3 
ATOM   2393 H HA   . CYS A 1 34 ? 9.775   3.121   4.194   1.00 0.00 ? 34 CYS A HA   3 
ATOM   2394 H HB2  . CYS A 1 34 ? 11.042  3.111   1.913   1.00 0.00 ? 34 CYS A HB2  3 
ATOM   2395 H HB3  . CYS A 1 34 ? 9.415   2.973   1.259   1.00 0.00 ? 34 CYS A HB3  3 
ATOM   2396 N N    . PHE A 1 35 ? 7.679   1.226   2.600   1.00 0.00 ? 35 PHE A N    3 
ATOM   2397 C CA   . PHE A 1 35 ? 6.282   0.838   2.453   1.00 0.00 ? 35 PHE A CA   3 
ATOM   2398 C C    . PHE A 1 35 ? 5.682   0.510   3.814   1.00 0.00 ? 35 PHE A C    3 
ATOM   2399 O O    . PHE A 1 35 ? 4.540   0.862   4.109   1.00 0.00 ? 35 PHE A O    3 
ATOM   2400 C CB   . PHE A 1 35 ? 6.183   -0.358  1.494   1.00 0.00 ? 35 PHE A CB   3 
ATOM   2401 C CG   . PHE A 1 35 ? 5.123   -1.372  1.838   1.00 0.00 ? 35 PHE A CG   3 
ATOM   2402 C CD1  . PHE A 1 35 ? 3.818   -0.982  2.094   1.00 0.00 ? 35 PHE A CD1  3 
ATOM   2403 C CD2  . PHE A 1 35 ? 5.439   -2.720  1.899   1.00 0.00 ? 35 PHE A CD2  3 
ATOM   2404 C CE1  . PHE A 1 35 ? 2.850   -1.919  2.406   1.00 0.00 ? 35 PHE A CE1  3 
ATOM   2405 C CE2  . PHE A 1 35 ? 4.477   -3.659  2.209   1.00 0.00 ? 35 PHE A CE2  3 
ATOM   2406 C CZ   . PHE A 1 35 ? 3.180   -3.259  2.463   1.00 0.00 ? 35 PHE A CZ   3 
ATOM   2407 H H    . PHE A 1 35 ? 8.374   0.667   2.197   1.00 0.00 ? 35 PHE A H    3 
ATOM   2408 H HA   . PHE A 1 35 ? 5.751   1.672   2.035   1.00 0.00 ? 35 PHE A HA   3 
ATOM   2409 H HB2  . PHE A 1 35 ? 5.972   0.008   0.501   1.00 0.00 ? 35 PHE A HB2  3 
ATOM   2410 H HB3  . PHE A 1 35 ? 7.135   -0.869  1.485   1.00 0.00 ? 35 PHE A HB3  3 
ATOM   2411 H HD1  . PHE A 1 35 ? 3.559   0.066   2.050   1.00 0.00 ? 35 PHE A HD1  3 
ATOM   2412 H HD2  . PHE A 1 35 ? 6.453   -3.035  1.701   1.00 0.00 ? 35 PHE A HD2  3 
ATOM   2413 H HE1  . PHE A 1 35 ? 1.837   -1.603  2.605   1.00 0.00 ? 35 PHE A HE1  3 
ATOM   2414 H HE2  . PHE A 1 35 ? 4.739   -4.706  2.250   1.00 0.00 ? 35 PHE A HE2  3 
ATOM   2415 H HZ   . PHE A 1 35 ? 2.425   -3.992  2.706   1.00 0.00 ? 35 PHE A HZ   3 
ATOM   2416 N N    . CYS A 1 36 ? 6.470   -0.160  4.635   1.00 0.00 ? 36 CYS A N    3 
ATOM   2417 C CA   . CYS A 1 36 ? 6.040   -0.539  5.976   1.00 0.00 ? 36 CYS A CA   3 
ATOM   2418 C C    . CYS A 1 36 ? 5.857   0.698   6.849   1.00 0.00 ? 36 CYS A C    3 
ATOM   2419 O O    . CYS A 1 36 ? 4.786   0.921   7.412   1.00 0.00 ? 36 CYS A O    3 
ATOM   2420 C CB   . CYS A 1 36 ? 7.059   -1.485  6.615   1.00 0.00 ? 36 CYS A CB   3 
ATOM   2421 S SG   . CYS A 1 36 ? 6.334   -2.674  7.791   1.00 0.00 ? 36 CYS A SG   3 
ATOM   2422 H H    . CYS A 1 36 ? 7.369   -0.400  4.330   1.00 0.00 ? 36 CYS A H    3 
ATOM   2423 H HA   . CYS A 1 36 ? 5.092   -1.048  5.889   1.00 0.00 ? 36 CYS A HA   3 
ATOM   2424 H HB2  . CYS A 1 36 ? 7.550   -2.051  5.838   1.00 0.00 ? 36 CYS A HB2  3 
ATOM   2425 H HB3  . CYS A 1 36 ? 7.795   -0.901  7.148   1.00 0.00 ? 36 CYS A HB3  3 
ATOM   2426 N N    . GLN A 1 37 ? 6.911   1.502   6.952   1.00 0.00 ? 37 GLN A N    3 
ATOM   2427 C CA   . GLN A 1 37 ? 6.874   2.716   7.747   1.00 0.00 ? 37 GLN A CA   3 
ATOM   2428 C C    . GLN A 1 37 ? 5.845   3.692   7.192   1.00 0.00 ? 37 GLN A C    3 
ATOM   2429 O O    . GLN A 1 37 ? 5.317   4.536   7.917   1.00 0.00 ? 37 GLN A O    3 
ATOM   2430 C CB   . GLN A 1 37 ? 8.255   3.374   7.788   1.00 0.00 ? 37 GLN A CB   3 
ATOM   2431 C CG   . GLN A 1 37 ? 8.739   3.862   6.432   1.00 0.00 ? 37 GLN A CG   3 
ATOM   2432 C CD   . GLN A 1 37 ? 8.168   5.218   6.064   1.00 0.00 ? 37 GLN A CD   3 
ATOM   2433 O OE1  . GLN A 1 37 ? 8.014   6.092   6.916   1.00 0.00 ? 37 GLN A OE1  3 
ATOM   2434 N NE2  . GLN A 1 37 ? 7.850   5.399   4.787   1.00 0.00 ? 37 GLN A NE2  3 
ATOM   2435 H H    . GLN A 1 37 ? 7.729   1.273   6.481   1.00 0.00 ? 37 GLN A H    3 
ATOM   2436 H HA   . GLN A 1 37 ? 6.589   2.439   8.743   1.00 0.00 ? 37 GLN A HA   3 
ATOM   2437 H HB2  . GLN A 1 37 ? 8.218   4.220   8.458   1.00 0.00 ? 37 GLN A HB2  3 
ATOM   2438 H HB3  . GLN A 1 37 ? 8.971   2.658   8.164   1.00 0.00 ? 37 GLN A HB3  3 
ATOM   2439 H HG2  . GLN A 1 37 ? 9.816   3.937   6.454   1.00 0.00 ? 37 GLN A HG2  3 
ATOM   2440 H HG3  . GLN A 1 37 ? 8.444   3.146   5.680   1.00 0.00 ? 37 GLN A HG3  3 
ATOM   2441 H HE21 . GLN A 1 37 ? 8.000   4.658   4.163   1.00 0.00 ? 37 GLN A HE21 3 
ATOM   2442 H HE22 . GLN A 1 37 ? 7.480   6.266   4.521   1.00 0.00 ? 37 GLN A HE22 3 
ATOM   2443 N N    . TYR A 1 38 ? 5.557   3.562   5.902   1.00 0.00 ? 38 TYR A N    3 
ATOM   2444 C CA   . TYR A 1 38 ? 4.581   4.421   5.242   1.00 0.00 ? 38 TYR A CA   3 
ATOM   2445 C C    . TYR A 1 38 ? 3.246   4.384   5.982   1.00 0.00 ? 38 TYR A C    3 
ATOM   2446 O O    . TYR A 1 38 ? 2.440   5.309   5.877   1.00 0.00 ? 38 TYR A O    3 
ATOM   2447 C CB   . TYR A 1 38 ? 4.387   3.982   3.787   1.00 0.00 ? 38 TYR A CB   3 
ATOM   2448 C CG   . TYR A 1 38 ? 4.931   4.968   2.776   1.00 0.00 ? 38 TYR A CG   3 
ATOM   2449 C CD1  . TYR A 1 38 ? 4.466   6.276   2.734   1.00 0.00 ? 38 TYR A CD1  3 
ATOM   2450 C CD2  . TYR A 1 38 ? 5.908   4.590   1.864   1.00 0.00 ? 38 TYR A CD2  3 
ATOM   2451 C CE1  . TYR A 1 38 ? 4.960   7.180   1.812   1.00 0.00 ? 38 TYR A CE1  3 
ATOM   2452 C CE2  . TYR A 1 38 ? 6.407   5.487   0.939   1.00 0.00 ? 38 TYR A CE2  3 
ATOM   2453 C CZ   . TYR A 1 38 ? 5.930   6.781   0.918   1.00 0.00 ? 38 TYR A CZ   3 
ATOM   2454 O OH   . TYR A 1 38 ? 6.425   7.677   -0.001  1.00 0.00 ? 38 TYR A OH   3 
ATOM   2455 H H    . TYR A 1 38 ? 6.007   2.865   5.382   1.00 0.00 ? 38 TYR A H    3 
ATOM   2456 H HA   . TYR A 1 38 ? 4.962   5.431   5.258   1.00 0.00 ? 38 TYR A HA   3 
ATOM   2457 H HB2  . TYR A 1 38 ? 4.891   3.040   3.633   1.00 0.00 ? 38 TYR A HB2  3 
ATOM   2458 H HB3  . TYR A 1 38 ? 3.331   3.856   3.592   1.00 0.00 ? 38 TYR A HB3  3 
ATOM   2459 H HD1  . TYR A 1 38 ? 3.707   6.586   3.435   1.00 0.00 ? 38 TYR A HD1  3 
ATOM   2460 H HD2  . TYR A 1 38 ? 6.280   3.576   1.882   1.00 0.00 ? 38 TYR A HD2  3 
ATOM   2461 H HE1  . TYR A 1 38 ? 4.586   8.193   1.796   1.00 0.00 ? 38 TYR A HE1  3 
ATOM   2462 H HE2  . TYR A 1 38 ? 7.167   5.174   0.238   1.00 0.00 ? 38 TYR A HE2  3 
ATOM   2463 H HH   . TYR A 1 38 ? 7.374   7.563   -0.081  1.00 0.00 ? 38 TYR A HH   3 
ATOM   2464 N N    . ALA A 1 39 ? 3.020   3.306   6.731   1.00 0.00 ? 39 ALA A N    3 
ATOM   2465 C CA   . ALA A 1 39 ? 1.787   3.143   7.488   1.00 0.00 ? 39 ALA A CA   3 
ATOM   2466 C C    . ALA A 1 39 ? 1.540   4.323   8.425   1.00 0.00 ? 39 ALA A C    3 
ATOM   2467 O O    . ALA A 1 39 ? 0.408   4.572   8.838   1.00 0.00 ? 39 ALA A O    3 
ATOM   2468 C CB   . ALA A 1 39 ? 1.820   1.841   8.274   1.00 0.00 ? 39 ALA A CB   3 
ATOM   2469 H H    . ALA A 1 39 ? 3.698   2.601   6.772   1.00 0.00 ? 39 ALA A H    3 
ATOM   2470 H HA   . ALA A 1 39 ? 0.979   3.085   6.782   1.00 0.00 ? 39 ALA A HA   3 
ATOM   2471 H HB1  . ALA A 1 39 ? 0.861   1.350   8.198   1.00 0.00 ? 39 ALA A HB1  3 
ATOM   2472 H HB2  . ALA A 1 39 ? 2.037   2.051   9.311   1.00 0.00 ? 39 ALA A HB2  3 
ATOM   2473 H HB3  . ALA A 1 39 ? 2.587   1.196   7.870   1.00 0.00 ? 39 ALA A HB3  3 
ATOM   2474 N N    . LYS A 1 40 ? 2.604   5.045   8.756   1.00 0.00 ? 40 LYS A N    3 
ATOM   2475 C CA   . LYS A 1 40 ? 2.501   6.199   9.644   1.00 0.00 ? 40 LYS A CA   3 
ATOM   2476 C C    . LYS A 1 40 ? 2.818   7.495   8.900   1.00 0.00 ? 40 LYS A C    3 
ATOM   2477 O O    . LYS A 1 40 ? 3.069   8.530   9.517   1.00 0.00 ? 40 LYS A O    3 
ATOM   2478 C CB   . LYS A 1 40 ? 3.449   6.035   10.834  1.00 0.00 ? 40 LYS A CB   3 
ATOM   2479 C CG   . LYS A 1 40 ? 2.772   6.223   12.182  1.00 0.00 ? 40 LYS A CG   3 
ATOM   2480 C CD   . LYS A 1 40 ? 3.772   6.617   13.257  1.00 0.00 ? 40 LYS A CD   3 
ATOM   2481 C CE   . LYS A 1 40 ? 4.558   5.415   13.755  1.00 0.00 ? 40 LYS A CE   3 
ATOM   2482 N NZ   . LYS A 1 40 ? 3.856   4.714   14.865  1.00 0.00 ? 40 LYS A NZ   3 
ATOM   2483 H H    . LYS A 1 40 ? 3.479   4.798   8.394   1.00 0.00 ? 40 LYS A H    3 
ATOM   2484 H HA   . LYS A 1 40 ? 1.486   6.246   10.008  1.00 0.00 ? 40 LYS A HA   3 
ATOM   2485 H HB2  . LYS A 1 40 ? 3.875   5.044   10.804  1.00 0.00 ? 40 LYS A HB2  3 
ATOM   2486 H HB3  . LYS A 1 40 ? 4.244   6.761   10.750  1.00 0.00 ? 40 LYS A HB3  3 
ATOM   2487 H HG2  . LYS A 1 40 ? 2.028   7.000   12.095  1.00 0.00 ? 40 LYS A HG2  3 
ATOM   2488 H HG3  . LYS A 1 40 ? 2.296   5.296   12.467  1.00 0.00 ? 40 LYS A HG3  3 
ATOM   2489 H HD2  . LYS A 1 40 ? 4.461   7.340   12.846  1.00 0.00 ? 40 LYS A HD2  3 
ATOM   2490 H HD3  . LYS A 1 40 ? 3.238   7.057   14.087  1.00 0.00 ? 40 LYS A HD3  3 
ATOM   2491 H HE2  . LYS A 1 40 ? 4.695   4.725   12.935  1.00 0.00 ? 40 LYS A HE2  3 
ATOM   2492 H HE3  . LYS A 1 40 ? 5.522   5.752   14.105  1.00 0.00 ? 40 LYS A HE3  3 
ATOM   2493 H HZ1  . LYS A 1 40 ? 3.200   5.366   15.341  1.00 0.00 ? 40 LYS A HZ1  3 
ATOM   2494 H HZ2  . LYS A 1 40 ? 4.546   4.366   15.561  1.00 0.00 ? 40 LYS A HZ2  3 
ATOM   2495 H HZ3  . LYS A 1 40 ? 3.317   3.906   14.493  1.00 0.00 ? 40 LYS A HZ3  3 
ATOM   2496 N N    . ASP A 1 41 ? 2.806   7.429   7.573   1.00 0.00 ? 41 ASP A N    3 
ATOM   2497 C CA   . ASP A 1 41 ? 3.093   8.592   6.743   1.00 0.00 ? 41 ASP A CA   3 
ATOM   2498 C C    . ASP A 1 41 ? 1.864   9.498   6.633   1.00 0.00 ? 41 ASP A C    3 
ATOM   2499 O O    . ASP A 1 41 ? 0.848   9.107   6.057   1.00 0.00 ? 41 ASP A O    3 
ATOM   2500 C CB   . ASP A 1 41 ? 3.540   8.136   5.353   1.00 0.00 ? 41 ASP A CB   3 
ATOM   2501 C CG   . ASP A 1 41 ? 3.735   9.291   4.390   1.00 0.00 ? 41 ASP A CG   3 
ATOM   2502 O OD1  . ASP A 1 41 ? 2.728   9.771   3.828   1.00 0.00 ? 41 ASP A OD1  3 
ATOM   2503 O OD2  . ASP A 1 41 ? 4.894   9.714   4.197   1.00 0.00 ? 41 ASP A OD2  3 
ATOM   2504 H H    . ASP A 1 41 ? 2.600   6.575   7.140   1.00 0.00 ? 41 ASP A H    3 
ATOM   2505 H HA   . ASP A 1 41 ? 3.897   9.141   7.208   1.00 0.00 ? 41 ASP A HA   3 
ATOM   2506 H HB2  . ASP A 1 41 ? 4.480   7.606   5.441   1.00 0.00 ? 41 ASP A HB2  3 
ATOM   2507 H HB3  . ASP A 1 41 ? 2.792   7.470   4.944   1.00 0.00 ? 41 ASP A HB3  3 
ATOM   2508 N N    . PRO A 1 42 ? 1.937   10.723  7.187   1.00 0.00 ? 42 PRO A N    3 
ATOM   2509 C CA   . PRO A 1 42 ? 0.822   11.674  7.147   1.00 0.00 ? 42 PRO A CA   3 
ATOM   2510 C C    . PRO A 1 42 ? 0.663   12.340  5.783   1.00 0.00 ? 42 PRO A C    3 
ATOM   2511 O O    . PRO A 1 42 ? -0.409  12.849  5.454   1.00 0.00 ? 42 PRO A O    3 
ATOM   2512 C CB   . PRO A 1 42 ? 1.211   12.708  8.203   1.00 0.00 ? 42 PRO A CB   3 
ATOM   2513 C CG   . PRO A 1 42 ? 2.700   12.693  8.208   1.00 0.00 ? 42 PRO A CG   3 
ATOM   2514 C CD   . PRO A 1 42 ? 3.106   11.275  7.900   1.00 0.00 ? 42 PRO A CD   3 
ATOM   2515 H HA   . PRO A 1 42 ? -0.109  11.204  7.427   1.00 0.00 ? 42 PRO A HA   3 
ATOM   2516 H HB2  . PRO A 1 42 ? 0.825   13.677  7.922   1.00 0.00 ? 42 PRO A HB2  3 
ATOM   2517 H HB3  . PRO A 1 42 ? 0.810   12.417  9.162   1.00 0.00 ? 42 PRO A HB3  3 
ATOM   2518 H HG2  . PRO A 1 42 ? 3.076   13.363  7.449   1.00 0.00 ? 42 PRO A HG2  3 
ATOM   2519 H HG3  . PRO A 1 42 ? 3.066   12.983  9.182   1.00 0.00 ? 42 PRO A HG3  3 
ATOM   2520 H HD2  . PRO A 1 42 ? 3.982   11.264  7.268   1.00 0.00 ? 42 PRO A HD2  3 
ATOM   2521 H HD3  . PRO A 1 42 ? 3.292   10.730  8.814   1.00 0.00 ? 42 PRO A HD3  3 
ATOM   2522 N N    . THR A 1 43 ? 1.733   12.339  4.992   1.00 0.00 ? 43 THR A N    3 
ATOM   2523 C CA   . THR A 1 43 ? 1.703   12.948  3.664   1.00 0.00 ? 43 THR A CA   3 
ATOM   2524 C C    . THR A 1 43 ? 0.543   12.402  2.835   1.00 0.00 ? 43 THR A C    3 
ATOM   2525 O O    . THR A 1 43 ? -0.209  13.164  2.227   1.00 0.00 ? 43 THR A O    3 
ATOM   2526 C CB   . THR A 1 43 ? 3.027   12.714  2.935   1.00 0.00 ? 43 THR A CB   3 
ATOM   2527 O OG1  . THR A 1 43 ? 3.913   11.940  3.725   1.00 0.00 ? 43 THR A OG1  3 
ATOM   2528 C CG2  . THR A 1 43 ? 3.742   13.998  2.569   1.00 0.00 ? 43 THR A CG2  3 
ATOM   2529 H H    . THR A 1 43 ? 2.561   11.920  5.307   1.00 0.00 ? 43 THR A H    3 
ATOM   2530 H HA   . THR A 1 43 ? 1.563   14.009  3.793   1.00 0.00 ? 43 THR A HA   3 
ATOM   2531 H HB   . THR A 1 43 ? 2.830   12.177  2.021   1.00 0.00 ? 43 THR A HB   3 
ATOM   2532 H HG1  . THR A 1 43 ? 4.253   12.476  4.445   1.00 0.00 ? 43 THR A HG1  3 
ATOM   2533 H HG21 . THR A 1 43 ? 3.510   14.260  1.547   1.00 0.00 ? 43 THR A HG21 3 
ATOM   2534 H HG22 . THR A 1 43 ? 4.808   13.858  2.672   1.00 0.00 ? 43 THR A HG22 3 
ATOM   2535 H HG23 . THR A 1 43 ? 3.417   14.791  3.226   1.00 0.00 ? 43 THR A HG23 3 
ATOM   2536 N N    . TYR A 1 44 ? 0.400   11.081  2.821   1.00 0.00 ? 44 TYR A N    3 
ATOM   2537 C CA   . TYR A 1 44 ? -0.673  10.439  2.072   1.00 0.00 ? 44 TYR A CA   3 
ATOM   2538 C C    . TYR A 1 44 ? -1.916  10.290  2.942   1.00 0.00 ? 44 TYR A C    3 
ATOM   2539 O O    . TYR A 1 44 ? -2.881  11.041  2.797   1.00 0.00 ? 44 TYR A O    3 
ATOM   2540 C CB   . TYR A 1 44 ? -0.221  9.071   1.559   1.00 0.00 ? 44 TYR A CB   3 
ATOM   2541 C CG   . TYR A 1 44 ? 0.795   9.150   0.442   1.00 0.00 ? 44 TYR A CG   3 
ATOM   2542 C CD1  . TYR A 1 44 ? 0.400   9.399   -0.866  1.00 0.00 ? 44 TYR A CD1  3 
ATOM   2543 C CD2  . TYR A 1 44 ? 2.150   8.978   0.696   1.00 0.00 ? 44 TYR A CD2  3 
ATOM   2544 C CE1  . TYR A 1 44 ? 1.325   9.473   -1.889  1.00 0.00 ? 44 TYR A CE1  3 
ATOM   2545 C CE2  . TYR A 1 44 ? 3.082   9.052   -0.322  1.00 0.00 ? 44 TYR A CE2  3 
ATOM   2546 C CZ   . TYR A 1 44 ? 2.665   9.299   -1.612  1.00 0.00 ? 44 TYR A CZ   3 
ATOM   2547 O OH   . TYR A 1 44 ? 3.589   9.373   -2.629  1.00 0.00 ? 44 TYR A OH   3 
ATOM   2548 H H    . TYR A 1 44 ? 1.026   10.525  3.329   1.00 0.00 ? 44 TYR A H    3 
ATOM   2549 H HA   . TYR A 1 44 ? -0.912  11.069  1.228   1.00 0.00 ? 44 TYR A HA   3 
ATOM   2550 H HB2  . TYR A 1 44 ? 0.224   8.518   2.373   1.00 0.00 ? 44 TYR A HB2  3 
ATOM   2551 H HB3  . TYR A 1 44 ? -1.080  8.530   1.190   1.00 0.00 ? 44 TYR A HB3  3 
ATOM   2552 H HD1  . TYR A 1 44 ? -0.650  9.535   -1.080  1.00 0.00 ? 44 TYR A HD1  3 
ATOM   2553 H HD2  . TYR A 1 44 ? 2.474   8.783   1.708   1.00 0.00 ? 44 TYR A HD2  3 
ATOM   2554 H HE1  . TYR A 1 44 ? 0.998   9.668   -2.900  1.00 0.00 ? 44 TYR A HE1  3 
ATOM   2555 H HE2  . TYR A 1 44 ? 4.131   8.915   -0.104  1.00 0.00 ? 44 TYR A HE2  3 
ATOM   2556 H HH   . TYR A 1 44 ? 3.231   8.961   -3.418  1.00 0.00 ? 44 TYR A HH   3 
ATOM   2557 N N    . GLY A 1 45 ? -1.883  9.323   3.852   1.00 0.00 ? 45 GLY A N    3 
ATOM   2558 C CA   . GLY A 1 45 ? -3.009  9.100   4.742   1.00 0.00 ? 45 GLY A CA   3 
ATOM   2559 C C    . GLY A 1 45 ? -4.175  8.402   4.067   1.00 0.00 ? 45 GLY A C    3 
ATOM   2560 O O    . GLY A 1 45 ? -4.640  7.364   4.538   1.00 0.00 ? 45 GLY A O    3 
ATOM   2561 H H    . GLY A 1 45 ? -1.083  8.761   3.926   1.00 0.00 ? 45 GLY A H    3 
ATOM   2562 H HA2  . GLY A 1 45 ? -2.678  8.495   5.574   1.00 0.00 ? 45 GLY A HA2  3 
ATOM   2563 H HA3  . GLY A 1 45 ? -3.346  10.054  5.120   1.00 0.00 ? 45 GLY A HA3  3 
ATOM   2564 N N    . GLN A 1 46 ? -4.654  8.971   2.965   1.00 0.00 ? 46 GLN A N    3 
ATOM   2565 C CA   . GLN A 1 46 ? -5.774  8.397   2.234   1.00 0.00 ? 46 GLN A CA   3 
ATOM   2566 C C    . GLN A 1 46 ? -5.387  7.069   1.597   1.00 0.00 ? 46 GLN A C    3 
ATOM   2567 O O    . GLN A 1 46 ? -6.243  6.228   1.321   1.00 0.00 ? 46 GLN A O    3 
ATOM   2568 C CB   . GLN A 1 46 ? -6.257  9.369   1.156   1.00 0.00 ? 46 GLN A CB   3 
ATOM   2569 C CG   . GLN A 1 46 ? -5.220  9.647   0.081   1.00 0.00 ? 46 GLN A CG   3 
ATOM   2570 C CD   . GLN A 1 46 ? -5.421  10.992  -0.590  1.00 0.00 ? 46 GLN A CD   3 
ATOM   2571 O OE1  . GLN A 1 46 ? -6.448  11.235  -1.223  1.00 0.00 ? 46 GLN A OE1  3 
ATOM   2572 N NE2  . GLN A 1 46 ? -4.438  11.875  -0.454  1.00 0.00 ? 46 GLN A NE2  3 
ATOM   2573 H H    . GLN A 1 46 ? -4.247  9.796   2.636   1.00 0.00 ? 46 GLN A H    3 
ATOM   2574 H HA   . GLN A 1 46 ? -6.574  8.228   2.937   1.00 0.00 ? 46 GLN A HA   3 
ATOM   2575 H HB2  . GLN A 1 46 ? -7.134  8.955   0.682   1.00 0.00 ? 46 GLN A HB2  3 
ATOM   2576 H HB3  . GLN A 1 46 ? -6.520  10.306  1.624   1.00 0.00 ? 46 GLN A HB3  3 
ATOM   2577 H HG2  . GLN A 1 46 ? -4.239  9.631   0.532   1.00 0.00 ? 46 GLN A HG2  3 
ATOM   2578 H HG3  . GLN A 1 46 ? -5.282  8.874   -0.670  1.00 0.00 ? 46 GLN A HG3  3 
ATOM   2579 H HE21 . GLN A 1 46 ? -3.646  11.610  0.066   1.00 0.00 ? 46 GLN A HE21 3 
ATOM   2580 H HE22 . GLN A 1 46 ? -4.544  12.756  -0.880  1.00 0.00 ? 46 GLN A HE22 3 
ATOM   2581 N N    . TYR A 1 47 ? -4.094  6.888   1.358   1.00 0.00 ? 47 TYR A N    3 
ATOM   2582 C CA   . TYR A 1 47 ? -3.598  5.666   0.745   1.00 0.00 ? 47 TYR A CA   3 
ATOM   2583 C C    . TYR A 1 47 ? -3.573  4.525   1.756   1.00 0.00 ? 47 TYR A C    3 
ATOM   2584 O O    . TYR A 1 47 ? -4.128  3.453   1.513   1.00 0.00 ? 47 TYR A O    3 
ATOM   2585 C CB   . TYR A 1 47 ? -2.204  5.888   0.184   1.00 0.00 ? 47 TYR A CB   3 
ATOM   2586 C CG   . TYR A 1 47 ? -1.859  4.973   -0.965  1.00 0.00 ? 47 TYR A CG   3 
ATOM   2587 C CD1  . TYR A 1 47 ? -2.158  5.337   -2.270  1.00 0.00 ? 47 TYR A CD1  3 
ATOM   2588 C CD2  . TYR A 1 47 ? -1.235  3.753   -0.748  1.00 0.00 ? 47 TYR A CD2  3 
ATOM   2589 C CE1  . TYR A 1 47 ? -1.845  4.507   -3.330  1.00 0.00 ? 47 TYR A CE1  3 
ATOM   2590 C CE2  . TYR A 1 47 ? -0.918  2.917   -1.802  1.00 0.00 ? 47 TYR A CE2  3 
ATOM   2591 C CZ   . TYR A 1 47 ? -1.225  3.299   -3.091  1.00 0.00 ? 47 TYR A CZ   3 
ATOM   2592 O OH   . TYR A 1 47 ? -0.911  2.470   -4.143  1.00 0.00 ? 47 TYR A OH   3 
ATOM   2593 H H    . TYR A 1 47 ? -3.459  7.597   1.594   1.00 0.00 ? 47 TYR A H    3 
ATOM   2594 H HA   . TYR A 1 47 ? -4.254  5.407   -0.057  1.00 0.00 ? 47 TYR A HA   3 
ATOM   2595 H HB2  . TYR A 1 47 ? -2.112  6.909   -0.161  1.00 0.00 ? 47 TYR A HB2  3 
ATOM   2596 H HB3  . TYR A 1 47 ? -1.495  5.708   0.968   1.00 0.00 ? 47 TYR A HB3  3 
ATOM   2597 H HD1  . TYR A 1 47 ? -2.643  6.286   -2.451  1.00 0.00 ? 47 TYR A HD1  3 
ATOM   2598 H HD2  . TYR A 1 47 ? -0.997  3.458   0.264   1.00 0.00 ? 47 TYR A HD2  3 
ATOM   2599 H HE1  . TYR A 1 47 ? -2.086  4.807   -4.339  1.00 0.00 ? 47 TYR A HE1  3 
ATOM   2600 H HE2  . TYR A 1 47 ? -0.432  1.971   -1.613  1.00 0.00 ? 47 TYR A HE2  3 
ATOM   2601 H HH   . TYR A 1 47 ? -0.009  2.639   -4.426  1.00 0.00 ? 47 TYR A HH   3 
ATOM   2602 N N    . ILE A 1 48 ? -2.922  4.764   2.891   1.00 0.00 ? 48 ILE A N    3 
ATOM   2603 C CA   . ILE A 1 48 ? -2.821  3.760   3.940   1.00 0.00 ? 48 ILE A CA   3 
ATOM   2604 C C    . ILE A 1 48 ? -4.170  3.523   4.608   1.00 0.00 ? 48 ILE A C    3 
ATOM   2605 O O    . ILE A 1 48 ? -4.618  2.383   4.735   1.00 0.00 ? 48 ILE A O    3 
ATOM   2606 C CB   . ILE A 1 48 ? -1.791  4.167   5.013   1.00 0.00 ? 48 ILE A CB   3 
ATOM   2607 C CG1  . ILE A 1 48 ? -0.446  4.494   4.362   1.00 0.00 ? 48 ILE A CG1  3 
ATOM   2608 C CG2  . ILE A 1 48 ? -1.629  3.060   6.048   1.00 0.00 ? 48 ILE A CG2  3 
ATOM   2609 C CD1  . ILE A 1 48 ? 0.197   3.309   3.675   1.00 0.00 ? 48 ILE A CD1  3 
ATOM   2610 H H    . ILE A 1 48 ? -2.499  5.635   3.024   1.00 0.00 ? 48 ILE A H    3 
ATOM   2611 H HA   . ILE A 1 48 ? -2.489  2.840   3.485   1.00 0.00 ? 48 ILE A HA   3 
ATOM   2612 H HB   . ILE A 1 48 ? -2.161  5.046   5.519   1.00 0.00 ? 48 ILE A HB   3 
ATOM   2613 H HG12 . ILE A 1 48 ? -0.590  5.267   3.622   1.00 0.00 ? 48 ILE A HG12 3 
ATOM   2614 H HG13 . ILE A 1 48 ? 0.236   4.850   5.120   1.00 0.00 ? 48 ILE A HG13 3 
ATOM   2615 H HG21 . ILE A 1 48 ? -2.453  2.367   5.966   1.00 0.00 ? 48 ILE A HG21 3 
ATOM   2616 H HG22 . ILE A 1 48 ? -1.620  3.492   7.038   1.00 0.00 ? 48 ILE A HG22 3 
ATOM   2617 H HG23 . ILE A 1 48 ? -0.701  2.538   5.875   1.00 0.00 ? 48 ILE A HG23 3 
ATOM   2618 H HD11 . ILE A 1 48 ? 1.116   3.622   3.202   1.00 0.00 ? 48 ILE A HD11 3 
ATOM   2619 H HD12 . ILE A 1 48 ? -0.477  2.917   2.927   1.00 0.00 ? 48 ILE A HD12 3 
ATOM   2620 H HD13 . ILE A 1 48 ? 0.411   2.541   4.404   1.00 0.00 ? 48 ILE A HD13 3 
ATOM   2621 N N    . ARG A 1 49 ? -4.816  4.604   5.038   1.00 0.00 ? 49 ARG A N    3 
ATOM   2622 C CA   . ARG A 1 49 ? -6.116  4.506   5.697   1.00 0.00 ? 49 ARG A CA   3 
ATOM   2623 C C    . ARG A 1 49 ? -7.252  4.352   4.691   1.00 0.00 ? 49 ARG A C    3 
ATOM   2624 O O    . ARG A 1 49 ? -8.376  4.791   4.937   1.00 0.00 ? 49 ARG A O    3 
ATOM   2625 C CB   . ARG A 1 49 ? -6.359  5.732   6.580   1.00 0.00 ? 49 ARG A CB   3 
ATOM   2626 C CG   . ARG A 1 49 ? -5.232  6.010   7.561   1.00 0.00 ? 49 ARG A CG   3 
ATOM   2627 C CD   . ARG A 1 49 ? -5.490  7.275   8.363   1.00 0.00 ? 49 ARG A CD   3 
ATOM   2628 N NE   . ARG A 1 49 ? -5.255  8.482   7.573   1.00 0.00 ? 49 ARG A NE   3 
ATOM   2629 C CZ   . ARG A 1 49 ? -5.053  9.687   8.101   1.00 0.00 ? 49 ARG A CZ   3 
ATOM   2630 N NH1  . ARG A 1 49 ? -5.056  9.851   9.418   1.00 0.00 ? 49 ARG A NH1  3 
ATOM   2631 N NH2  . ARG A 1 49 ? -4.847  10.731  7.310   1.00 0.00 ? 49 ARG A NH2  3 
ATOM   2632 H H    . ARG A 1 49 ? -4.409  5.486   4.911   1.00 0.00 ? 49 ARG A H    3 
ATOM   2633 H HA   . ARG A 1 49 ? -6.095  3.627   6.317   1.00 0.00 ? 49 ARG A HA   3 
ATOM   2634 H HB2  . ARG A 1 49 ? -6.479  6.599   5.948   1.00 0.00 ? 49 ARG A HB2  3 
ATOM   2635 H HB3  . ARG A 1 49 ? -7.268  5.580   7.144   1.00 0.00 ? 49 ARG A HB3  3 
ATOM   2636 H HG2  . ARG A 1 49 ? -5.145  5.176   8.242   1.00 0.00 ? 49 ARG A HG2  3 
ATOM   2637 H HG3  . ARG A 1 49 ? -4.309  6.125   7.010   1.00 0.00 ? 49 ARG A HG3  3 
ATOM   2638 H HD2  . ARG A 1 49 ? -6.516  7.271   8.698   1.00 0.00 ? 49 ARG A HD2  3 
ATOM   2639 H HD3  . ARG A 1 49 ? -4.832  7.283   9.219   1.00 0.00 ? 49 ARG A HD3  3 
ATOM   2640 H HE   . ARG A 1 49 ? -5.248  8.389   6.597   1.00 0.00 ? 49 ARG A HE   3 
ATOM   2641 H HH11 . ARG A 1 49 ? -5.211  9.068   10.020  1.00 0.00 ? 49 ARG A HH11 3 
ATOM   2642 H HH12 . ARG A 1 49 ? -4.904  10.759  9.808   1.00 0.00 ? 49 ARG A HH12 3 
ATOM   2643 H HH21 . ARG A 1 49 ? -4.844  10.613  6.317   1.00 0.00 ? 49 ARG A HH21 3 
ATOM   2644 H HH22 . ARG A 1 49 ? -4.696  11.636  7.706   1.00 0.00 ? 49 ARG A HH22 3 
ATOM   2645 N N    . SER A 1 50 ? -6.957  3.717   3.567   1.00 0.00 ? 50 SER A N    3 
ATOM   2646 C CA   . SER A 1 50 ? -7.950  3.490   2.531   1.00 0.00 ? 50 SER A CA   3 
ATOM   2647 C C    . SER A 1 50 ? -8.823  2.287   2.877   1.00 0.00 ? 50 SER A C    3 
ATOM   2648 O O    . SER A 1 50 ? -8.359  1.341   3.514   1.00 0.00 ? 50 SER A O    3 
ATOM   2649 C CB   . SER A 1 50 ? -7.263  3.272   1.193   1.00 0.00 ? 50 SER A CB   3 
ATOM   2650 O OG   . SER A 1 50 ? -8.052  3.763   0.123   1.00 0.00 ? 50 SER A OG   3 
ATOM   2651 H H    . SER A 1 50 ? -6.052  3.380   3.436   1.00 0.00 ? 50 SER A H    3 
ATOM   2652 H HA   . SER A 1 50 ? -8.569  4.360   2.462   1.00 0.00 ? 50 SER A HA   3 
ATOM   2653 H HB2  . SER A 1 50 ? -6.311  3.786   1.188   1.00 0.00 ? 50 SER A HB2  3 
ATOM   2654 H HB3  . SER A 1 50 ? -7.108  2.221   1.057   1.00 0.00 ? 50 SER A HB3  3 
ATOM   2655 H HG   . SER A 1 50 ? -8.161  3.074   -0.537  1.00 0.00 ? 50 SER A HG   3 
ATOM   2656 N N    . PRO A 1 51 ? -10.099 2.300   2.460   1.00 0.00 ? 51 PRO A N    3 
ATOM   2657 C CA   . PRO A 1 51 ? -11.023 1.195   2.734   1.00 0.00 ? 51 PRO A CA   3 
ATOM   2658 C C    . PRO A 1 51 ? -10.629 -0.077  1.991   1.00 0.00 ? 51 PRO A C    3 
ATOM   2659 O O    . PRO A 1 51 ? -10.642 -1.170  2.558   1.00 0.00 ? 51 PRO A O    3 
ATOM   2660 C CB   . PRO A 1 51 ? -12.370 1.717   2.228   1.00 0.00 ? 51 PRO A CB   3 
ATOM   2661 C CG   . PRO A 1 51 ? -12.023 2.755   1.217   1.00 0.00 ? 51 PRO A CG   3 
ATOM   2662 C CD   . PRO A 1 51 ? -10.741 3.381   1.690   1.00 0.00 ? 51 PRO A CD   3 
ATOM   2663 H HA   . PRO A 1 51 ? -11.087 0.987   3.792   1.00 0.00 ? 51 PRO A HA   3 
ATOM   2664 H HB2  . PRO A 1 51 ? -12.930 0.906   1.786   1.00 0.00 ? 51 PRO A HB2  3 
ATOM   2665 H HB3  . PRO A 1 51 ? -12.927 2.140   3.050   1.00 0.00 ? 51 PRO A HB3  3 
ATOM   2666 H HG2  . PRO A 1 51 ? -11.881 2.293   0.251   1.00 0.00 ? 51 PRO A HG2  3 
ATOM   2667 H HG3  . PRO A 1 51 ? -12.806 3.496   1.168   1.00 0.00 ? 51 PRO A HG3  3 
ATOM   2668 H HD2  . PRO A 1 51 ? -10.130 3.671   0.848   1.00 0.00 ? 51 PRO A HD2  3 
ATOM   2669 H HD3  . PRO A 1 51 ? -10.946 4.233   2.321   1.00 0.00 ? 51 PRO A HD3  3 
ATOM   2670 N N    . HIS A 1 52 ? -10.280 0.076   0.719   1.00 0.00 ? 52 HIS A N    3 
ATOM   2671 C CA   . HIS A 1 52 ? -9.881  -1.057  -0.111  1.00 0.00 ? 52 HIS A CA   3 
ATOM   2672 C C    . HIS A 1 52 ? -8.428  -1.453  0.148   1.00 0.00 ? 52 HIS A C    3 
ATOM   2673 O O    . HIS A 1 52 ? -8.007  -2.556  -0.200  1.00 0.00 ? 52 HIS A O    3 
ATOM   2674 C CB   . HIS A 1 52 ? -10.072 -0.726  -1.594  1.00 0.00 ? 52 HIS A CB   3 
ATOM   2675 C CG   . HIS A 1 52 ? -11.246 0.164   -1.868  1.00 0.00 ? 52 HIS A CG   3 
ATOM   2676 N ND1  . HIS A 1 52 ? -12.554 -0.254  -1.740  1.00 0.00 ? 52 HIS A ND1  3 
ATOM   2677 C CD2  . HIS A 1 52 ? -11.304 1.459   -2.260  1.00 0.00 ? 52 HIS A CD2  3 
ATOM   2678 C CE1  . HIS A 1 52 ? -13.365 0.744   -2.043  1.00 0.00 ? 52 HIS A CE1  3 
ATOM   2679 N NE2  . HIS A 1 52 ? -12.631 1.794   -2.361  1.00 0.00 ? 52 HIS A NE2  3 
ATOM   2680 H H    . HIS A 1 52 ? -10.291 0.974   0.326   1.00 0.00 ? 52 HIS A H    3 
ATOM   2681 H HA   . HIS A 1 52 ? -10.516 -1.891  0.145   1.00 0.00 ? 52 HIS A HA   3 
ATOM   2682 H HB2  . HIS A 1 52 ? -9.188  -0.228  -1.960  1.00 0.00 ? 52 HIS A HB2  3 
ATOM   2683 H HB3  . HIS A 1 52 ? -10.215 -1.645  -2.144  1.00 0.00 ? 52 HIS A HB3  3 
ATOM   2684 H HD1  . HIS A 1 52 ? -12.846 -1.150  -1.468  1.00 0.00 ? 52 HIS A HD1  3 
ATOM   2685 H HD2  . HIS A 1 52 ? -10.461 2.107   -2.456  1.00 0.00 ? 52 HIS A HD2  3 
ATOM   2686 H HE1  . HIS A 1 52 ? -14.444 0.709   -2.028  1.00 0.00 ? 52 HIS A HE1  3 
ATOM   2687 H HE2  . HIS A 1 52 ? -12.979 2.642   -2.708  1.00 0.00 ? 52 HIS A HE2  3 
ATOM   2688 N N    . ALA A 1 53 ? -7.664  -0.548  0.755   1.00 0.00 ? 53 ALA A N    3 
ATOM   2689 C CA   . ALA A 1 53 ? -6.261  -0.805  1.050   1.00 0.00 ? 53 ALA A CA   3 
ATOM   2690 C C    . ALA A 1 53 ? -6.093  -2.076  1.867   1.00 0.00 ? 53 ALA A C    3 
ATOM   2691 O O    . ALA A 1 53 ? -5.297  -2.952  1.528   1.00 0.00 ? 53 ALA A O    3 
ATOM   2692 C CB   . ALA A 1 53 ? -5.648  0.378   1.782   1.00 0.00 ? 53 ALA A CB   3 
ATOM   2693 H H    . ALA A 1 53 ? -8.049  0.312   1.005   1.00 0.00 ? 53 ALA A H    3 
ATOM   2694 H HA   . ALA A 1 53 ? -5.750  -0.923  0.118   1.00 0.00 ? 53 ALA A HA   3 
ATOM   2695 H HB1  . ALA A 1 53 ? -6.367  0.783   2.479   1.00 0.00 ? 53 ALA A HB1  3 
ATOM   2696 H HB2  . ALA A 1 53 ? -5.370  1.139   1.068   1.00 0.00 ? 53 ALA A HB2  3 
ATOM   2697 H HB3  . ALA A 1 53 ? -4.770  0.052   2.320   1.00 0.00 ? 53 ALA A HB3  3 
ATOM   2698 N N    . ARG A 1 54 ? -6.850  -2.160  2.946   1.00 0.00 ? 54 ARG A N    3 
ATOM   2699 C CA   . ARG A 1 54 ? -6.804  -3.312  3.835   1.00 0.00 ? 54 ARG A CA   3 
ATOM   2700 C C    . ARG A 1 54 ? -7.050  -4.603  3.071   1.00 0.00 ? 54 ARG A C    3 
ATOM   2701 O O    . ARG A 1 54 ? -6.319  -5.582  3.224   1.00 0.00 ? 54 ARG A O    3 
ATOM   2702 C CB   . ARG A 1 54 ? -7.836  -3.160  4.954   1.00 0.00 ? 54 ARG A CB   3 
ATOM   2703 C CG   . ARG A 1 54 ? -7.282  -2.503  6.207   1.00 0.00 ? 54 ARG A CG   3 
ATOM   2704 C CD   . ARG A 1 54 ? -6.738  -3.535  7.180   1.00 0.00 ? 54 ARG A CD   3 
ATOM   2705 N NE   . ARG A 1 54 ? -5.515  -4.163  6.684   1.00 0.00 ? 54 ARG A NE   3 
ATOM   2706 C CZ   . ARG A 1 54 ? -5.090  -5.366  7.064   1.00 0.00 ? 54 ARG A CZ   3 
ATOM   2707 N NH1  . ARG A 1 54 ? -5.778  -6.074  7.951   1.00 0.00 ? 54 ARG A NH1  3 
ATOM   2708 N NH2  . ARG A 1 54 ? -3.970  -5.863  6.556   1.00 0.00 ? 54 ARG A NH2  3 
ATOM   2709 H H    . ARG A 1 54 ? -7.454  -1.424  3.151   1.00 0.00 ? 54 ARG A H    3 
ATOM   2710 H HA   . ARG A 1 54 ? -5.826  -3.349  4.264   1.00 0.00 ? 54 ARG A HA   3 
ATOM   2711 H HB2  . ARG A 1 54 ? -8.658  -2.560  4.592   1.00 0.00 ? 54 ARG A HB2  3 
ATOM   2712 H HB3  . ARG A 1 54 ? -8.207  -4.139  5.222   1.00 0.00 ? 54 ARG A HB3  3 
ATOM   2713 H HG2  . ARG A 1 54 ? -6.485  -1.831  5.927   1.00 0.00 ? 54 ARG A HG2  3 
ATOM   2714 H HG3  . ARG A 1 54 ? -8.073  -1.947  6.690   1.00 0.00 ? 54 ARG A HG3  3 
ATOM   2715 H HD2  . ARG A 1 54 ? -6.526  -3.048  8.120   1.00 0.00 ? 54 ARG A HD2  3 
ATOM   2716 H HD3  . ARG A 1 54 ? -7.488  -4.297  7.330   1.00 0.00 ? 54 ARG A HD3  3 
ATOM   2717 H HE   . ARG A 1 54 ? -4.983  -3.662  6.031   1.00 0.00 ? 54 ARG A HE   3 
ATOM   2718 H HH11 . ARG A 1 54 ? -6.622  -5.706  8.341   1.00 0.00 ? 54 ARG A HH11 3 
ATOM   2719 H HH12 . ARG A 1 54 ? -5.452  -6.977  8.231   1.00 0.00 ? 54 ARG A HH12 3 
ATOM   2720 H HH21 . ARG A 1 54 ? -3.446  -5.334  5.889   1.00 0.00 ? 54 ARG A HH21 3 
ATOM   2721 H HH22 . ARG A 1 54 ? -3.650  -6.766  6.841   1.00 0.00 ? 54 ARG A HH22 3 
ATOM   2722 N N    . ASP A 1 55 ? -8.082  -4.591  2.247   1.00 0.00 ? 55 ASP A N    3 
ATOM   2723 C CA   . ASP A 1 55 ? -8.435  -5.753  1.446   1.00 0.00 ? 55 ASP A CA   3 
ATOM   2724 C C    . ASP A 1 55 ? -7.353  -6.044  0.421   1.00 0.00 ? 55 ASP A C    3 
ATOM   2725 O O    . ASP A 1 55 ? -6.985  -7.196  0.193   1.00 0.00 ? 55 ASP A O    3 
ATOM   2726 C CB   . ASP A 1 55 ? -9.771  -5.539  0.750   1.00 0.00 ? 55 ASP A CB   3 
ATOM   2727 C CG   . ASP A 1 55 ? -10.473 -6.844  0.429   1.00 0.00 ? 55 ASP A CG   3 
ATOM   2728 O OD1  . ASP A 1 55 ? -10.191 -7.421  -0.642  1.00 0.00 ? 55 ASP A OD1  3 
ATOM   2729 O OD2  . ASP A 1 55 ? -11.304 -7.288  1.249   1.00 0.00 ? 55 ASP A OD2  3 
ATOM   2730 H H    . ASP A 1 55 ? -8.615  -3.777  2.175   1.00 0.00 ? 55 ASP A H    3 
ATOM   2731 H HA   . ASP A 1 55 ? -8.518  -6.589  2.099   1.00 0.00 ? 55 ASP A HA   3 
ATOM   2732 H HB2  . ASP A 1 55 ? -10.415 -4.948  1.388   1.00 0.00 ? 55 ASP A HB2  3 
ATOM   2733 H HB3  . ASP A 1 55 ? -9.593  -5.013  -0.168  1.00 0.00 ? 55 ASP A HB3  3 
ATOM   2734 N N    . THR A 1 56 ? -6.843  -4.984  -0.186  1.00 0.00 ? 56 THR A N    3 
ATOM   2735 C CA   . THR A 1 56 ? -5.794  -5.102  -1.184  1.00 0.00 ? 56 THR A CA   3 
ATOM   2736 C C    . THR A 1 56 ? -4.577  -5.813  -0.603  1.00 0.00 ? 56 THR A C    3 
ATOM   2737 O O    . THR A 1 56 ? -3.919  -6.599  -1.284  1.00 0.00 ? 56 THR A O    3 
ATOM   2738 C CB   . THR A 1 56 ? -5.400  -3.728  -1.704  1.00 0.00 ? 56 THR A CB   3 
ATOM   2739 O OG1  . THR A 1 56 ? -6.516  -3.065  -2.270  1.00 0.00 ? 56 THR A OG1  3 
ATOM   2740 C CG2  . THR A 1 56 ? -4.307  -3.768  -2.750  1.00 0.00 ? 56 THR A CG2  3 
ATOM   2741 H H    . THR A 1 56 ? -7.180  -4.102  0.049   1.00 0.00 ? 56 THR A H    3 
ATOM   2742 H HA   . THR A 1 56 ? -6.180  -5.675  -1.994  1.00 0.00 ? 56 THR A HA   3 
ATOM   2743 H HB   . THR A 1 56 ? -5.045  -3.149  -0.879  1.00 0.00 ? 56 THR A HB   3 
ATOM   2744 H HG1  . THR A 1 56 ? -7.207  -2.980  -1.610  1.00 0.00 ? 56 THR A HG1  3 
ATOM   2745 H HG21 . THR A 1 56 ? -3.544  -4.470  -2.447  1.00 0.00 ? 56 THR A HG21 3 
ATOM   2746 H HG22 . THR A 1 56 ? -3.872  -2.785  -2.854  1.00 0.00 ? 56 THR A HG22 3 
ATOM   2747 H HG23 . THR A 1 56 ? -4.726  -4.079  -3.696  1.00 0.00 ? 56 THR A HG23 3 
ATOM   2748 N N    . LEU A 1 57 ? -4.289  -5.532  0.664   1.00 0.00 ? 57 LEU A N    3 
ATOM   2749 C CA   . LEU A 1 57 ? -3.162  -6.140  1.345   1.00 0.00 ? 57 LEU A CA   3 
ATOM   2750 C C    . LEU A 1 57 ? -3.320  -7.649  1.397   1.00 0.00 ? 57 LEU A C    3 
ATOM   2751 O O    . LEU A 1 57 ? -2.487  -8.396  0.884   1.00 0.00 ? 57 LEU A O    3 
ATOM   2752 C CB   . LEU A 1 57 ? -3.030  -5.569  2.753   1.00 0.00 ? 57 LEU A CB   3 
ATOM   2753 C CG   . LEU A 1 57 ? -1.881  -4.582  2.940   1.00 0.00 ? 57 LEU A CG   3 
ATOM   2754 C CD1  . LEU A 1 57 ? -2.407  -3.211  3.337   1.00 0.00 ? 57 LEU A CD1  3 
ATOM   2755 C CD2  . LEU A 1 57 ? -0.895  -5.098  3.976   1.00 0.00 ? 57 LEU A CD2  3 
ATOM   2756 H H    . LEU A 1 57 ? -4.849  -4.902  1.153   1.00 0.00 ? 57 LEU A H    3 
ATOM   2757 H HA   . LEU A 1 57 ? -2.286  -5.904  0.792   1.00 0.00 ? 57 LEU A HA   3 
ATOM   2758 H HB2  . LEU A 1 57 ? -3.951  -5.065  2.991   1.00 0.00 ? 57 LEU A HB2  3 
ATOM   2759 H HB3  . LEU A 1 57 ? -2.889  -6.388  3.444   1.00 0.00 ? 57 LEU A HB3  3 
ATOM   2760 H HG   . LEU A 1 57 ? -1.360  -4.479  2.004   1.00 0.00 ? 57 LEU A HG   3 
ATOM   2761 H HD11 . LEU A 1 57 ? -2.647  -3.209  4.390   1.00 0.00 ? 57 LEU A HD11 3 
ATOM   2762 H HD12 . LEU A 1 57 ? -3.294  -2.985  2.765   1.00 0.00 ? 57 LEU A HD12 3 
ATOM   2763 H HD13 . LEU A 1 57 ? -1.652  -2.464  3.139   1.00 0.00 ? 57 LEU A HD13 3 
ATOM   2764 H HD21 . LEU A 1 57 ? 0.113   -4.890  3.649   1.00 0.00 ? 57 LEU A HD21 3 
ATOM   2765 H HD22 . LEU A 1 57 ? -1.022  -6.163  4.094   1.00 0.00 ? 57 LEU A HD22 3 
ATOM   2766 H HD23 . LEU A 1 57 ? -1.076  -4.607  4.920   1.00 0.00 ? 57 LEU A HD23 3 
ATOM   2767 N N    . THR A 1 58 ? -4.404  -8.085  2.015   1.00 0.00 ? 58 THR A N    3 
ATOM   2768 C CA   . THR A 1 58 ? -4.697  -9.502  2.136   1.00 0.00 ? 58 THR A CA   3 
ATOM   2769 C C    . THR A 1 58 ? -4.813  -10.129 0.757   1.00 0.00 ? 58 THR A C    3 
ATOM   2770 O O    . THR A 1 58 ? -4.260  -11.199 0.501   1.00 0.00 ? 58 THR A O    3 
ATOM   2771 C CB   . THR A 1 58 ? -5.984  -9.721  2.932   1.00 0.00 ? 58 THR A CB   3 
ATOM   2772 O OG1  . THR A 1 58 ? -6.057  -8.824  4.027   1.00 0.00 ? 58 THR A OG1  3 
ATOM   2773 C CG2  . THR A 1 58 ? -6.118  -11.126 3.478   1.00 0.00 ? 58 THR A CG2  3 
ATOM   2774 H H    . THR A 1 58 ? -5.021  -7.434  2.391   1.00 0.00 ? 58 THR A H    3 
ATOM   2775 H HA   . THR A 1 58 ? -3.873  -9.960  2.655   1.00 0.00 ? 58 THR A HA   3 
ATOM   2776 H HB   . THR A 1 58 ? -6.830  -9.536  2.285   1.00 0.00 ? 58 THR A HB   3 
ATOM   2777 H HG1  . THR A 1 58 ? -5.193  -8.747  4.438   1.00 0.00 ? 58 THR A HG1  3 
ATOM   2778 H HG21 . THR A 1 58 ? -5.248  -11.704 3.203   1.00 0.00 ? 58 THR A HG21 3 
ATOM   2779 H HG22 . THR A 1 58 ? -7.002  -11.590 3.066   1.00 0.00 ? 58 THR A HG22 3 
ATOM   2780 H HG23 . THR A 1 58 ? -6.199  -11.088 4.554   1.00 0.00 ? 58 THR A HG23 3 
ATOM   2781 N N    . SER A 1 59 ? -5.510  -9.440  -0.141  1.00 0.00 ? 59 SER A N    3 
ATOM   2782 C CA   . SER A 1 59 ? -5.665  -9.911  -1.503  1.00 0.00 ? 59 SER A CA   3 
ATOM   2783 C C    . SER A 1 59 ? -4.299  -10.220 -2.087  1.00 0.00 ? 59 SER A C    3 
ATOM   2784 O O    . SER A 1 59 ? -4.143  -11.100 -2.935  1.00 0.00 ? 59 SER A O    3 
ATOM   2785 C CB   . SER A 1 59 ? -6.357  -8.854  -2.338  1.00 0.00 ? 59 SER A CB   3 
ATOM   2786 O OG   . SER A 1 59 ? -7.033  -9.428  -3.443  1.00 0.00 ? 59 SER A OG   3 
ATOM   2787 H H    . SER A 1 59 ? -5.907  -8.584  0.110   1.00 0.00 ? 59 SER A H    3 
ATOM   2788 H HA   . SER A 1 59 ? -6.258  -10.796 -1.490  1.00 0.00 ? 59 SER A HA   3 
ATOM   2789 H HB2  . SER A 1 59 ? -7.067  -8.324  -1.723  1.00 0.00 ? 59 SER A HB2  3 
ATOM   2790 H HB3  . SER A 1 59 ? -5.616  -8.171  -2.700  1.00 0.00 ? 59 SER A HB3  3 
ATOM   2791 H HG   . SER A 1 59 ? -6.405  -9.603  -4.147  1.00 0.00 ? 59 SER A HG   3 
ATOM   2792 N N    . CYS A 1 60 ? -3.310  -9.484  -1.600  1.00 0.00 ? 60 CYS A N    3 
ATOM   2793 C CA   . CYS A 1 60 ? -1.940  -9.645  -2.021  1.00 0.00 ? 60 CYS A CA   3 
ATOM   2794 C C    . CYS A 1 60 ? -1.356  -10.916 -1.413  1.00 0.00 ? 60 CYS A C    3 
ATOM   2795 O O    . CYS A 1 60 ? -0.614  -11.648 -2.067  1.00 0.00 ? 60 CYS A O    3 
ATOM   2796 C CB   . CYS A 1 60 ? -1.143  -8.424  -1.572  1.00 0.00 ? 60 CYS A CB   3 
ATOM   2797 S SG   . CYS A 1 60 ? -0.044  -7.717  -2.844  1.00 0.00 ? 60 CYS A SG   3 
ATOM   2798 H H    . CYS A 1 60 ? -3.510  -8.811  -0.919  1.00 0.00 ? 60 CYS A H    3 
ATOM   2799 H HA   . CYS A 1 60 ? -1.919  -9.716  -3.097  1.00 0.00 ? 60 CYS A HA   3 
ATOM   2800 H HB2  . CYS A 1 60 ? -1.834  -7.649  -1.275  1.00 0.00 ? 60 CYS A HB2  3 
ATOM   2801 H HB3  . CYS A 1 60 ? -0.545  -8.697  -0.721  1.00 0.00 ? 60 CYS A HB3  3 
ATOM   2802 N N    . GLY A 1 61 ? -1.713  -11.177 -0.155  1.00 0.00 ? 61 GLY A N    3 
ATOM   2803 C CA   . GLY A 1 61 ? -1.232  -12.365 0.523   1.00 0.00 ? 61 GLY A CA   3 
ATOM   2804 C C    . GLY A 1 61 ? 0.232   -12.286 0.910   1.00 0.00 ? 61 GLY A C    3 
ATOM   2805 O O    . GLY A 1 61 ? 1.020   -13.160 0.549   1.00 0.00 ? 61 GLY A O    3 
ATOM   2806 H H    . GLY A 1 61 ? -2.319  -10.559 0.315   1.00 0.00 ? 61 GLY A H    3 
ATOM   2807 H HA2  . GLY A 1 61 ? -1.818  -12.515 1.417   1.00 0.00 ? 61 GLY A HA2  3 
ATOM   2808 H HA3  . GLY A 1 61 ? -1.373  -13.215 -0.129  1.00 0.00 ? 61 GLY A HA3  3 
ATOM   2809 N N    . LEU A 1 62 ? 0.599   -11.250 1.659   1.00 0.00 ? 62 LEU A N    3 
ATOM   2810 C CA   . LEU A 1 62 ? 1.981   -11.091 2.102   1.00 0.00 ? 62 LEU A CA   3 
ATOM   2811 C C    . LEU A 1 62 ? 2.043   -10.730 3.587   1.00 0.00 ? 62 LEU A C    3 
ATOM   2812 O O    . LEU A 1 62 ? 2.066   -11.614 4.443   1.00 0.00 ? 62 LEU A O    3 
ATOM   2813 C CB   . LEU A 1 62 ? 2.729   -10.044 1.261   1.00 0.00 ? 62 LEU A CB   3 
ATOM   2814 C CG   . LEU A 1 62 ? 1.860   -9.024  0.504   1.00 0.00 ? 62 LEU A CG   3 
ATOM   2815 C CD1  . LEU A 1 62 ? 2.219   -7.604  0.922   1.00 0.00 ? 62 LEU A CD1  3 
ATOM   2816 C CD2  . LEU A 1 62 ? 2.031   -9.189  -1.002  1.00 0.00 ? 62 LEU A CD2  3 
ATOM   2817 H H    . LEU A 1 62 ? -0.072  -10.589 1.929   1.00 0.00 ? 62 LEU A H    3 
ATOM   2818 H HA   . LEU A 1 62 ? 2.468   -12.047 1.970   1.00 0.00 ? 62 LEU A HA   3 
ATOM   2819 H HB2  . LEU A 1 62 ? 3.388   -9.499  1.921   1.00 0.00 ? 62 LEU A HB2  3 
ATOM   2820 H HB3  . LEU A 1 62 ? 3.336   -10.571 0.541   1.00 0.00 ? 62 LEU A HB3  3 
ATOM   2821 H HG   . LEU A 1 62 ? 0.817   -9.187  0.741   1.00 0.00 ? 62 LEU A HG   3 
ATOM   2822 H HD11 . LEU A 1 62 ? 3.294   -7.515  1.015   1.00 0.00 ? 62 LEU A HD11 3 
ATOM   2823 H HD12 . LEU A 1 62 ? 1.755   -7.378  1.870   1.00 0.00 ? 62 LEU A HD12 3 
ATOM   2824 H HD13 . LEU A 1 62 ? 1.866   -6.910  0.175   1.00 0.00 ? 62 LEU A HD13 3 
ATOM   2825 H HD21 . LEU A 1 62 ? 2.176   -8.219  -1.456  1.00 0.00 ? 62 LEU A HD21 3 
ATOM   2826 H HD22 . LEU A 1 62 ? 1.147   -9.651  -1.415  1.00 0.00 ? 62 LEU A HD22 3 
ATOM   2827 H HD23 . LEU A 1 62 ? 2.890   -9.811  -1.205  1.00 0.00 ? 62 LEU A HD23 3 
ATOM   2828 N N    . ALA A 1 63 ? 2.072   -9.435  3.892   1.00 0.00 ? 63 ALA A N    3 
ATOM   2829 C CA   . ALA A 1 63 ? 2.133   -8.981  5.271   1.00 0.00 ? 63 ALA A CA   3 
ATOM   2830 C C    . ALA A 1 63 ? 1.454   -7.627  5.441   1.00 0.00 ? 63 ALA A C    3 
ATOM   2831 O O    . ALA A 1 63 ? 0.963   -7.041  4.476   1.00 0.00 ? 63 ALA A O    3 
ATOM   2832 C CB   . ALA A 1 63 ? 3.578   -8.914  5.742   1.00 0.00 ? 63 ALA A CB   3 
ATOM   2833 H H    . ALA A 1 63 ? 2.050   -8.774  3.179   1.00 0.00 ? 63 ALA A H    3 
ATOM   2834 H HA   . ALA A 1 63 ? 1.617   -9.706  5.874   1.00 0.00 ? 63 ALA A HA   3 
ATOM   2835 H HB1  . ALA A 1 63 ? 3.646   -8.264  6.602   1.00 0.00 ? 63 ALA A HB1  3 
ATOM   2836 H HB2  . ALA A 1 63 ? 4.198   -8.526  4.948   1.00 0.00 ? 63 ALA A HB2  3 
ATOM   2837 H HB3  . ALA A 1 63 ? 3.915   -9.904  6.012   1.00 0.00 ? 63 ALA A HB3  3 
ATOM   2838 N N    . VAL A 1 64 ? 1.435   -7.136  6.675   1.00 0.00 ? 64 VAL A N    3 
ATOM   2839 C CA   . VAL A 1 64 ? 0.824   -5.857  6.986   1.00 0.00 ? 64 VAL A CA   3 
ATOM   2840 C C    . VAL A 1 64 ? 1.896   -4.820  7.344   1.00 0.00 ? 64 VAL A C    3 
ATOM   2841 O O    . VAL A 1 64 ? 2.940   -5.167  7.896   1.00 0.00 ? 64 VAL A O    3 
ATOM   2842 C CB   . VAL A 1 64 ? -0.206  -6.005  8.135   1.00 0.00 ? 64 VAL A CB   3 
ATOM   2843 C CG1  . VAL A 1 64 ? 0.372   -5.567  9.473   1.00 0.00 ? 64 VAL A CG1  3 
ATOM   2844 C CG2  . VAL A 1 64 ? -1.479  -5.232  7.820   1.00 0.00 ? 64 VAL A CG2  3 
ATOM   2845 H H    . VAL A 1 64 ? 1.841   -7.647  7.395   1.00 0.00 ? 64 VAL A H    3 
ATOM   2846 H HA   . VAL A 1 64 ? 0.304   -5.528  6.106   1.00 0.00 ? 64 VAL A HA   3 
ATOM   2847 H HB   . VAL A 1 64 ? -0.466  -7.050  8.215   1.00 0.00 ? 64 VAL A HB   3 
ATOM   2848 H HG11 . VAL A 1 64 ? 1.409   -5.863  9.532   1.00 0.00 ? 64 VAL A HG11 3 
ATOM   2849 H HG12 . VAL A 1 64 ? -0.182  -6.034  10.274  1.00 0.00 ? 64 VAL A HG12 3 
ATOM   2850 H HG13 . VAL A 1 64 ? 0.297   -4.495  9.560   1.00 0.00 ? 64 VAL A HG13 3 
ATOM   2851 H HG21 . VAL A 1 64 ? -1.581  -5.125  6.751   1.00 0.00 ? 64 VAL A HG21 3 
ATOM   2852 H HG22 . VAL A 1 64 ? -1.429  -4.254  8.277   1.00 0.00 ? 64 VAL A HG22 3 
ATOM   2853 H HG23 . VAL A 1 64 ? -2.331  -5.768  8.211   1.00 0.00 ? 64 VAL A HG23 3 
ATOM   2854 N N    . PRO A 1 65 ? 1.664   -3.534  7.017   1.00 0.00 ? 65 PRO A N    3 
ATOM   2855 C CA   . PRO A 1 65 ? 2.626   -2.452  7.288   1.00 0.00 ? 65 PRO A CA   3 
ATOM   2856 C C    . PRO A 1 65 ? 2.570   -1.923  8.715   1.00 0.00 ? 65 PRO A C    3 
ATOM   2857 O O    . PRO A 1 65 ? 2.824   -0.744  8.964   1.00 0.00 ? 65 PRO A O    3 
ATOM   2858 C CB   . PRO A 1 65 ? 2.170   -1.373  6.318   1.00 0.00 ? 65 PRO A CB   3 
ATOM   2859 C CG   . PRO A 1 65 ? 0.694   -1.535  6.327   1.00 0.00 ? 65 PRO A CG   3 
ATOM   2860 C CD   . PRO A 1 65 ? 0.462   -3.020  6.330   1.00 0.00 ? 65 PRO A CD   3 
ATOM   2861 H HA   . PRO A 1 65 ? 3.630   -2.753  7.062   1.00 0.00 ? 65 PRO A HA   3 
ATOM   2862 H HB2  . PRO A 1 65 ? 2.474   -0.400  6.679   1.00 0.00 ? 65 PRO A HB2  3 
ATOM   2863 H HB3  . PRO A 1 65 ? 2.585   -1.556  5.339   1.00 0.00 ? 65 PRO A HB3  3 
ATOM   2864 H HG2  . PRO A 1 65 ? 0.287   -1.095  7.226   1.00 0.00 ? 65 PRO A HG2  3 
ATOM   2865 H HG3  . PRO A 1 65 ? 0.262   -1.084  5.448   1.00 0.00 ? 65 PRO A HG3  3 
ATOM   2866 H HD2  . PRO A 1 65 ? -0.434  -3.260  6.881   1.00 0.00 ? 65 PRO A HD2  3 
ATOM   2867 H HD3  . PRO A 1 65 ? 0.403   -3.396  5.320   1.00 0.00 ? 65 PRO A HD3  3 
ATOM   2868 N N    . HIS A 1 66 ? 2.250   -2.800  9.640   1.00 0.00 ? 66 HIS A N    3 
ATOM   2869 C CA   . HIS A 1 66 ? 2.172   -2.433  11.052  1.00 0.00 ? 66 HIS A CA   3 
ATOM   2870 C C    . HIS A 1 66 ? 3.403   -2.925  11.806  1.00 0.00 ? 66 HIS A C    3 
ATOM   2871 O O    . HIS A 1 66 ? 3.326   -3.266  12.986  1.00 0.00 ? 66 HIS A O    3 
ATOM   2872 C CB   . HIS A 1 66 ? 0.907   -3.008  11.692  1.00 0.00 ? 66 HIS A CB   3 
ATOM   2873 C CG   . HIS A 1 66 ? -0.326  -2.221  11.393  1.00 0.00 ? 66 HIS A CG   3 
ATOM   2874 N ND1  . HIS A 1 66 ? -0.960  -2.259  10.172  1.00 0.00 ? 66 HIS A ND1  3 
ATOM   2875 C CD2  . HIS A 1 66 ? -1.048  -1.375  12.165  1.00 0.00 ? 66 HIS A CD2  3 
ATOM   2876 C CE1  . HIS A 1 66 ? -2.017  -1.471  10.205  1.00 0.00 ? 66 HIS A CE1  3 
ATOM   2877 N NE2  . HIS A 1 66 ? -2.093  -0.924  11.402  1.00 0.00 ? 66 HIS A NE2  3 
ATOM   2878 H H    . HIS A 1 66 ? 2.070   -3.715  9.368   1.00 0.00 ? 66 HIS A H    3 
ATOM   2879 H HA   . HIS A 1 66 ? 2.136   -1.356  11.111  1.00 0.00 ? 66 HIS A HA   3 
ATOM   2880 H HB2  . HIS A 1 66 ? 0.751   -4.011  11.333  1.00 0.00 ? 66 HIS A HB2  3 
ATOM   2881 H HB3  . HIS A 1 66 ? 1.033   -3.032  12.764  1.00 0.00 ? 66 HIS A HB3  3 
ATOM   2882 H HD1  . HIS A 1 66 ? -0.676  -2.783  9.395   1.00 0.00 ? 66 HIS A HD1  3 
ATOM   2883 H HD2  . HIS A 1 66 ? -0.840  -1.107  13.189  1.00 0.00 ? 66 HIS A HD2  3 
ATOM   2884 H HE1  . HIS A 1 66 ? -2.702  -1.308  9.394   1.00 0.00 ? 66 HIS A HE1  3 
ATOM   2885 H HE2  . HIS A 1 66 ? -2.749  -0.249  11.675  1.00 0.00 ? 66 HIS A HE2  3 
ATOM   2886 N N    . CYS A 1 67 ? 4.538   -2.958  11.114  1.00 0.00 ? 67 CYS A N    3 
ATOM   2887 C CA   . CYS A 1 67 ? 5.787   -3.409  11.716  1.00 0.00 ? 67 CYS A CA   3 
ATOM   2888 C C    . CYS A 1 67 ? 6.265   -2.427  12.781  1.00 0.00 ? 67 CYS A C    3 
ATOM   2889 O O    . CYS A 1 67 ? 5.553   -1.432  13.029  1.00 0.00 ? 67 CYS A O    3 
ATOM   2890 C CB   . CYS A 1 67 ? 6.863   -3.577  10.641  1.00 0.00 ? 67 CYS A CB   3 
ATOM   2891 S SG   . CYS A 1 67 ? 7.096   -2.109  9.586   1.00 0.00 ? 67 CYS A SG   3 
ATOM   2892 O OXT  . CYS A 1 67 ? 7.348   -2.662  13.358  1.00 0.00 ? 67 CYS A OXT  3 
ATOM   2893 H H    . CYS A 1 67 ? 4.534   -2.674  10.176  1.00 0.00 ? 67 CYS A H    3 
ATOM   2894 H HA   . CYS A 1 67 ? 5.605   -4.366  12.182  1.00 0.00 ? 67 CYS A HA   3 
ATOM   2895 H HB2  . CYS A 1 67 ? 7.808   -3.791  11.118  1.00 0.00 ? 67 CYS A HB2  3 
ATOM   2896 H HB3  . CYS A 1 67 ? 6.594   -4.403  10.000  1.00 0.00 ? 67 CYS A HB3  3 
HETATM 2897 C C1   . PGM B 2 .  ? -8.721  0.489   17.619  1.00 0.00 ? 68 PGM A C1   3 
HETATM 2898 O O1   . PGM B 2 .  ? -10.020 0.091   17.981  1.00 0.00 ? 68 PGM A O1   3 
HETATM 2899 C C2   . PGM B 2 .  ? -8.649  0.623   16.162  1.00 0.00 ? 68 PGM A C2   3 
HETATM 2900 O O2   . PGM B 2 .  ? -8.705  -0.655  15.579  1.00 0.00 ? 68 PGM A O2   3 
HETATM 2901 C C3   . PGM B 2 .  ? -7.418  1.291   15.733  1.00 0.00 ? 68 PGM A C3   3 
HETATM 2902 O O4   . PGM B 2 .  ? -7.492  1.512   14.318  1.00 0.00 ? 68 PGM A O4   3 
HETATM 2903 P P5   . PGM B 2 .  ? -6.532  0.655   13.361  1.00 0.00 ? 68 PGM A P5   3 
HETATM 2904 O O5A  . PGM B 2 .  ? -5.146  1.163   13.479  1.00 0.00 ? 68 PGM A O5A  3 
HETATM 2905 O O5B  . PGM B 2 .  ? -6.766  -0.781  13.628  1.00 0.00 ? 68 PGM A O5B  3 
HETATM 2906 O O6   . PGM B 2 .  ? -7.047  0.968   11.879  1.00 0.00 ? 68 PGM A O6   3 
HETATM 2907 C C7   . PGM B 2 .  ? -6.186  0.597   10.722  1.00 0.00 ? 68 PGM A C7   3 
HETATM 2908 C C8   . PGM B 2 .  ? -6.832  -0.278  9.741   1.00 0.00 ? 68 PGM A C8   3 
HETATM 2909 O O8   . PGM B 2 .  ? -6.680  -1.665  9.919   1.00 0.00 ? 68 PGM A O8   3 
HETATM 2910 C C9   . PGM B 2 .  ? -6.470  0.066   8.390   1.00 0.00 ? 68 PGM A C9   3 
HETATM 2911 O OQ1  . PGM B 2 .  ? -3.832  1.159   7.616   1.00 0.00 ? 68 PGM A OQ1  3 
HETATM 2912 O OQ2  . PGM B 2 .  ? -5.136  -0.507  8.032   1.00 0.00 ? 68 PGM A OQ2  3 
HETATM 2913 C CA   . PGM B 2 .  ? -4.435  0.086   7.270   1.00 0.00 ? 68 PGM A CA   3 
HETATM 2914 C CB   . PGM B 2 .  ? -4.294  -0.296  5.859   1.00 0.00 ? 68 PGM A CB   3 
HETATM 2915 C CC   . PGM B 2 .  ? -2.886  -0.512  5.370   1.00 0.00 ? 68 PGM A CC   3 
HETATM 2916 C CD   . PGM B 2 .  ? -2.645  -0.100  3.945   1.00 0.00 ? 68 PGM A CD   3 
HETATM 2917 C CE   . PGM B 2 .  ? -1.253  0.389   3.676   1.00 0.00 ? 68 PGM A CE   3 
HETATM 2918 C CF   . PGM B 2 .  ? -0.856  0.360   2.231   1.00 0.00 ? 68 PGM A CF   3 
HETATM 2919 C CG   . PGM B 2 .  ? 0.593   0.657   1.976   1.00 0.00 ? 68 PGM A CG   3 
HETATM 2920 C CH   . PGM B 2 .  ? 0.929   1.023   0.569   1.00 0.00 ? 68 PGM A CH   3 
HETATM 2921 C CI   . PGM B 2 .  ? 2.245   1.707   0.389   1.00 0.00 ? 68 PGM A CI   3 
HETATM 2922 C CJ   . PGM B 2 .  ? 2.193   3.196   0.476   1.00 0.00 ? 68 PGM A CJ   3 
HETATM 2923 C CK   . PGM B 2 .  ? 1.935   3.905   -0.814  1.00 0.00 ? 68 PGM A CK   3 
HETATM 2924 C CL   . PGM B 2 .  ? 1.789   5.392   -0.706  1.00 0.00 ? 68 PGM A CL   3 
HETATM 2925 C CM   . PGM B 2 .  ? 2.269   6.166   -1.892  1.00 0.00 ? 68 PGM A CM   3 
HETATM 2926 C CN   . PGM B 2 .  ? 1.247   6.398   -2.957  1.00 0.00 ? 68 PGM A CN   3 
HETATM 2927 C CO   . PGM B 2 .  ? 1.608   5.876   -4.311  1.00 0.00 ? 68 PGM A CO   3 
HETATM 2928 C CP   . PGM B 2 .  ? 1.096   6.705   -5.451  1.00 0.00 ? 68 PGM A CP   3 
ATOM   2929 N N    . ALA A 1 1  ? 16.180  6.925   -0.291  1.00 0.00 ? 1  ALA A N    4 
ATOM   2930 C CA   . ALA A 1 1  ? 15.281  5.823   0.140   1.00 0.00 ? 1  ALA A CA   4 
ATOM   2931 C C    . ALA A 1 1  ? 13.851  6.069   -0.328  1.00 0.00 ? 1  ALA A C    4 
ATOM   2932 O O    . ALA A 1 1  ? 13.492  7.188   -0.697  1.00 0.00 ? 1  ALA A O    4 
ATOM   2933 C CB   . ALA A 1 1  ? 15.322  5.671   1.653   1.00 0.00 ? 1  ALA A CB   4 
ATOM   2934 H H1   . ALA A 1 1  ? 17.040  6.878   0.292   1.00 0.00 ? 1  ALA A H1   4 
ATOM   2935 H H2   . ALA A 1 1  ? 15.674  7.822   -0.144  1.00 0.00 ? 1  ALA A H2   4 
ATOM   2936 H H3   . ALA A 1 1  ? 16.402  6.778   -1.296  1.00 0.00 ? 1  ALA A H3   4 
ATOM   2937 H HA   . ALA A 1 1  ? 15.637  4.903   -0.298  1.00 0.00 ? 1  ALA A HA   4 
ATOM   2938 H HB1  . ALA A 1 1  ? 14.430  5.162   1.988   1.00 0.00 ? 1  ALA A HB1  4 
ATOM   2939 H HB2  . ALA A 1 1  ? 15.372  6.648   2.112   1.00 0.00 ? 1  ALA A HB2  4 
ATOM   2940 H HB3  . ALA A 1 1  ? 16.191  5.096   1.934   1.00 0.00 ? 1  ALA A HB3  4 
ATOM   2941 N N    . CYS A 1 2  ? 13.039  5.018   -0.310  1.00 0.00 ? 2  CYS A N    4 
ATOM   2942 C CA   . CYS A 1 2  ? 11.647  5.119   -0.733  1.00 0.00 ? 2  CYS A CA   4 
ATOM   2943 C C    . CYS A 1 2  ? 11.552  5.574   -2.186  1.00 0.00 ? 2  CYS A C    4 
ATOM   2944 O O    . CYS A 1 2  ? 11.661  6.763   -2.484  1.00 0.00 ? 2  CYS A O    4 
ATOM   2945 C CB   . CYS A 1 2  ? 10.887  6.094   0.169   1.00 0.00 ? 2  CYS A CB   4 
ATOM   2946 S SG   . CYS A 1 2  ? 11.216  5.873   1.948   1.00 0.00 ? 2  CYS A SG   4 
ATOM   2947 H H    . CYS A 1 2  ? 13.384  4.152   -0.006  1.00 0.00 ? 2  CYS A H    4 
ATOM   2948 H HA   . CYS A 1 2  ? 11.202  4.140   -0.645  1.00 0.00 ? 2  CYS A HA   4 
ATOM   2949 H HB2  . CYS A 1 2  ? 11.163  7.104   -0.092  1.00 0.00 ? 2  CYS A HB2  4 
ATOM   2950 H HB3  . CYS A 1 2  ? 9.826   5.965   0.011   1.00 0.00 ? 2  CYS A HB3  4 
ATOM   2951 N N    . GLN A 1 3  ? 11.348  4.619   -3.088  1.00 0.00 ? 3  GLN A N    4 
ATOM   2952 C CA   . GLN A 1 3  ? 11.239  4.921   -4.510  1.00 0.00 ? 3  GLN A CA   4 
ATOM   2953 C C    . GLN A 1 3  ? 10.022  5.796   -4.789  1.00 0.00 ? 3  GLN A C    4 
ATOM   2954 O O    . GLN A 1 3  ? 10.060  6.673   -5.653  1.00 0.00 ? 3  GLN A O    4 
ATOM   2955 C CB   . GLN A 1 3  ? 11.149  3.627   -5.322  1.00 0.00 ? 3  GLN A CB   4 
ATOM   2956 C CG   . GLN A 1 3  ? 11.909  3.679   -6.638  1.00 0.00 ? 3  GLN A CG   4 
ATOM   2957 C CD   . GLN A 1 3  ? 13.193  2.875   -6.603  1.00 0.00 ? 3  GLN A CD   4 
ATOM   2958 O OE1  . GLN A 1 3  ? 13.362  1.920   -7.361  1.00 0.00 ? 3  GLN A OE1  4 
ATOM   2959 N NE2  . GLN A 1 3  ? 14.108  3.257   -5.719  1.00 0.00 ? 3  GLN A NE2  4 
ATOM   2960 H H    . GLN A 1 3  ? 11.270  3.688   -2.789  1.00 0.00 ? 3  GLN A H    4 
ATOM   2961 H HA   . GLN A 1 3  ? 12.129  5.458   -4.804  1.00 0.00 ? 3  GLN A HA   4 
ATOM   2962 H HB2  . GLN A 1 3  ? 11.551  2.816   -4.731  1.00 0.00 ? 3  GLN A HB2  4 
ATOM   2963 H HB3  . GLN A 1 3  ? 10.111  3.422   -5.539  1.00 0.00 ? 3  GLN A HB3  4 
ATOM   2964 H HG2  . GLN A 1 3  ? 11.277  3.285   -7.419  1.00 0.00 ? 3  GLN A HG2  4 
ATOM   2965 H HG3  . GLN A 1 3  ? 12.152  4.709   -6.857  1.00 0.00 ? 3  GLN A HG3  4 
ATOM   2966 H HE21 . GLN A 1 3  ? 13.905  4.026   -5.147  1.00 0.00 ? 3  GLN A HE21 4 
ATOM   2967 H HE22 . GLN A 1 3  ? 14.948  2.754   -5.675  1.00 0.00 ? 3  GLN A HE22 4 
ATOM   2968 N N    . ALA A 1 4  ? 8.942   5.553   -4.053  1.00 0.00 ? 4  ALA A N    4 
ATOM   2969 C CA   . ALA A 1 4  ? 7.713   6.319   -4.221  1.00 0.00 ? 4  ALA A CA   4 
ATOM   2970 C C    . ALA A 1 4  ? 7.189   6.219   -5.651  1.00 0.00 ? 4  ALA A C    4 
ATOM   2971 O O    . ALA A 1 4  ? 6.446   7.086   -6.112  1.00 0.00 ? 4  ALA A O    4 
ATOM   2972 C CB   . ALA A 1 4  ? 7.944   7.775   -3.844  1.00 0.00 ? 4  ALA A CB   4 
ATOM   2973 H H    . ALA A 1 4  ? 8.973   4.841   -3.380  1.00 0.00 ? 4  ALA A H    4 
ATOM   2974 H HA   . ALA A 1 4  ? 6.972   5.912   -3.548  1.00 0.00 ? 4  ALA A HA   4 
ATOM   2975 H HB1  . ALA A 1 4  ? 8.377   7.826   -2.856  1.00 0.00 ? 4  ALA A HB1  4 
ATOM   2976 H HB2  . ALA A 1 4  ? 7.002   8.303   -3.853  1.00 0.00 ? 4  ALA A HB2  4 
ATOM   2977 H HB3  . ALA A 1 4  ? 8.618   8.228   -4.556  1.00 0.00 ? 4  ALA A HB3  4 
ATOM   2978 N N    . SER A 1 5  ? 7.581   5.157   -6.350  1.00 0.00 ? 5  SER A N    4 
ATOM   2979 C CA   . SER A 1 5  ? 7.150   4.948   -7.729  1.00 0.00 ? 5  SER A CA   4 
ATOM   2980 C C    . SER A 1 5  ? 6.458   3.596   -7.890  1.00 0.00 ? 5  SER A C    4 
ATOM   2981 O O    . SER A 1 5  ? 5.523   3.458   -8.679  1.00 0.00 ? 5  SER A O    4 
ATOM   2982 C CB   . SER A 1 5  ? 8.347   5.036   -8.677  1.00 0.00 ? 5  SER A CB   4 
ATOM   2983 O OG   . SER A 1 5  ? 9.220   3.934   -8.500  1.00 0.00 ? 5  SER A OG   4 
ATOM   2984 H H    . SER A 1 5  ? 8.174   4.501   -5.931  1.00 0.00 ? 5  SER A H    4 
ATOM   2985 H HA   . SER A 1 5  ? 6.447   5.729   -7.978  1.00 0.00 ? 5  SER A HA   4 
ATOM   2986 H HB2  . SER A 1 5  ? 7.995   5.040   -9.698  1.00 0.00 ? 5  SER A HB2  4 
ATOM   2987 H HB3  . SER A 1 5  ? 8.893   5.947   -8.480  1.00 0.00 ? 5  SER A HB3  4 
ATOM   2988 H HG   . SER A 1 5  ? 9.349   3.775   -7.563  1.00 0.00 ? 5  SER A HG   4 
ATOM   2989 N N    . GLN A 1 6  ? 6.926   2.601   -7.143  1.00 0.00 ? 6  GLN A N    4 
ATOM   2990 C CA   . GLN A 1 6  ? 6.363   1.267   -7.204  1.00 0.00 ? 6  GLN A CA   4 
ATOM   2991 C C    . GLN A 1 6  ? 5.179   1.123   -6.252  1.00 0.00 ? 6  GLN A C    4 
ATOM   2992 O O    . GLN A 1 6  ? 5.103   0.165   -5.483  1.00 0.00 ? 6  GLN A O    4 
ATOM   2993 C CB   . GLN A 1 6  ? 7.435   0.228   -6.868  1.00 0.00 ? 6  GLN A CB   4 
ATOM   2994 C CG   . GLN A 1 6  ? 8.630   0.260   -7.809  1.00 0.00 ? 6  GLN A CG   4 
ATOM   2995 C CD   . GLN A 1 6  ? 8.702   -0.963  -8.702  1.00 0.00 ? 6  GLN A CD   4 
ATOM   2996 O OE1  . GLN A 1 6  ? 9.394   -1.933  -8.392  1.00 0.00 ? 6  GLN A OE1  4 
ATOM   2997 N NE2  . GLN A 1 6  ? 7.986   -0.922  -9.820  1.00 0.00 ? 6  GLN A NE2  4 
ATOM   2998 H H    . GLN A 1 6  ? 7.668   2.765   -6.543  1.00 0.00 ? 6  GLN A H    4 
ATOM   2999 H HA   . GLN A 1 6  ? 6.028   1.109   -8.208  1.00 0.00 ? 6  GLN A HA   4 
ATOM   3000 H HB2  . GLN A 1 6  ? 7.791   0.408   -5.863  1.00 0.00 ? 6  GLN A HB2  4 
ATOM   3001 H HB3  . GLN A 1 6  ? 6.993   -0.757  -6.913  1.00 0.00 ? 6  GLN A HB3  4 
ATOM   3002 H HG2  . GLN A 1 6  ? 8.557   1.138   -8.432  1.00 0.00 ? 6  GLN A HG2  4 
ATOM   3003 H HG3  . GLN A 1 6  ? 9.534   0.311   -7.220  1.00 0.00 ? 6  GLN A HG3  4 
ATOM   3004 H HE21 . GLN A 1 6  ? 7.458   -0.117  -10.002 1.00 0.00 ? 6  GLN A HE21 4 
ATOM   3005 H HE22 . GLN A 1 6  ? 8.014   -1.699  -10.416 1.00 0.00 ? 6  GLN A HE22 4 
ATOM   3006 N N    . LEU A 1 7  ? 4.259   2.081   -6.304  1.00 0.00 ? 7  LEU A N    4 
ATOM   3007 C CA   . LEU A 1 7  ? 3.084   2.057   -5.440  1.00 0.00 ? 7  LEU A CA   4 
ATOM   3008 C C    . LEU A 1 7  ? 1.903   2.776   -6.088  1.00 0.00 ? 7  LEU A C    4 
ATOM   3009 O O    . LEU A 1 7  ? 0.762   2.328   -5.985  1.00 0.00 ? 7  LEU A O    4 
ATOM   3010 C CB   . LEU A 1 7  ? 3.407   2.701   -4.090  1.00 0.00 ? 7  LEU A CB   4 
ATOM   3011 C CG   . LEU A 1 7  ? 4.608   2.103   -3.353  1.00 0.00 ? 7  LEU A CG   4 
ATOM   3012 C CD1  . LEU A 1 7  ? 4.968   2.952   -2.144  1.00 0.00 ? 7  LEU A CD1  4 
ATOM   3013 C CD2  . LEU A 1 7  ? 4.315   0.669   -2.932  1.00 0.00 ? 7  LEU A CD2  4 
ATOM   3014 H H    . LEU A 1 7  ? 4.374   2.820   -6.935  1.00 0.00 ? 7  LEU A H    4 
ATOM   3015 H HA   . LEU A 1 7  ? 2.815   1.024   -5.278  1.00 0.00 ? 7  LEU A HA   4 
ATOM   3016 H HB2  . LEU A 1 7  ? 3.599   3.752   -4.253  1.00 0.00 ? 7  LEU A HB2  4 
ATOM   3017 H HB3  . LEU A 1 7  ? 2.540   2.606   -3.453  1.00 0.00 ? 7  LEU A HB3  4 
ATOM   3018 H HG   . LEU A 1 7  ? 5.461   2.091   -4.017  1.00 0.00 ? 7  LEU A HG   4 
ATOM   3019 H HD11 . LEU A 1 7  ? 4.555   3.943   -2.263  1.00 0.00 ? 7  LEU A HD11 4 
ATOM   3020 H HD12 . LEU A 1 7  ? 6.043   3.019   -2.058  1.00 0.00 ? 7  LEU A HD12 4 
ATOM   3021 H HD13 . LEU A 1 7  ? 4.564   2.498   -1.251  1.00 0.00 ? 7  LEU A HD13 4 
ATOM   3022 H HD21 . LEU A 1 7  ? 3.633   0.218   -3.638  1.00 0.00 ? 7  LEU A HD21 4 
ATOM   3023 H HD22 . LEU A 1 7  ? 3.867   0.667   -1.949  1.00 0.00 ? 7  LEU A HD22 4 
ATOM   3024 H HD23 . LEU A 1 7  ? 5.235   0.104   -2.909  1.00 0.00 ? 7  LEU A HD23 4 
ATOM   3025 N N    . ALA A 1 8  ? 2.182   3.898   -6.751  1.00 0.00 ? 8  ALA A N    4 
ATOM   3026 C CA   . ALA A 1 8  ? 1.142   4.683   -7.410  1.00 0.00 ? 8  ALA A CA   4 
ATOM   3027 C C    . ALA A 1 8  ? 0.198   3.801   -8.217  1.00 0.00 ? 8  ALA A C    4 
ATOM   3028 O O    . ALA A 1 8  ? -1.021  3.965   -8.170  1.00 0.00 ? 8  ALA A O    4 
ATOM   3029 C CB   . ALA A 1 8  ? 1.767   5.744   -8.302  1.00 0.00 ? 8  ALA A CB   4 
ATOM   3030 H H    . ALA A 1 8  ? 3.109   4.209   -6.793  1.00 0.00 ? 8  ALA A H    4 
ATOM   3031 H HA   . ALA A 1 8  ? 0.576   5.180   -6.648  1.00 0.00 ? 8  ALA A HA   4 
ATOM   3032 H HB1  . ALA A 1 8  ? 0.989   6.349   -8.743  1.00 0.00 ? 8  ALA A HB1  4 
ATOM   3033 H HB2  . ALA A 1 8  ? 2.338   5.266   -9.085  1.00 0.00 ? 8  ALA A HB2  4 
ATOM   3034 H HB3  . ALA A 1 8  ? 2.419   6.371   -7.713  1.00 0.00 ? 8  ALA A HB3  4 
ATOM   3035 N N    . VAL A 1 9  ? 0.775   2.867   -8.954  1.00 0.00 ? 9  VAL A N    4 
ATOM   3036 C CA   . VAL A 1 9  ? 0.002   1.949   -9.777  1.00 0.00 ? 9  VAL A CA   4 
ATOM   3037 C C    . VAL A 1 9  ? -1.037  1.202   -8.945  1.00 0.00 ? 9  VAL A C    4 
ATOM   3038 O O    . VAL A 1 9  ? -2.055  0.745   -9.465  1.00 0.00 ? 9  VAL A O    4 
ATOM   3039 C CB   . VAL A 1 9  ? 0.912   0.930   -10.490 1.00 0.00 ? 9  VAL A CB   4 
ATOM   3040 C CG1  . VAL A 1 9  ? 1.660   0.076   -9.476  1.00 0.00 ? 9  VAL A CG1  4 
ATOM   3041 C CG2  . VAL A 1 9  ? 0.102   0.059   -11.439 1.00 0.00 ? 9  VAL A CG2  4 
ATOM   3042 H H    . VAL A 1 9  ? 1.746   2.796   -8.943  1.00 0.00 ? 9  VAL A H    4 
ATOM   3043 H HA   . VAL A 1 9  ? -0.504  2.532   -10.525 1.00 0.00 ? 9  VAL A HA   4 
ATOM   3044 H HB   . VAL A 1 9  ? 1.641   1.476   -11.072 1.00 0.00 ? 9  VAL A HB   4 
ATOM   3045 H HG11 . VAL A 1 9  ? 0.952   -0.397  -8.813  1.00 0.00 ? 9  VAL A HG11 4 
ATOM   3046 H HG12 . VAL A 1 9  ? 2.328   0.701   -8.902  1.00 0.00 ? 9  VAL A HG12 4 
ATOM   3047 H HG13 . VAL A 1 9  ? 2.230   -0.681  -9.994  1.00 0.00 ? 9  VAL A HG13 4 
ATOM   3048 H HG21 . VAL A 1 9  ? -0.814  0.568   -11.701 1.00 0.00 ? 9  VAL A HG21 4 
ATOM   3049 H HG22 . VAL A 1 9  ? -0.132  -0.878  -10.957 1.00 0.00 ? 9  VAL A HG22 4 
ATOM   3050 H HG23 . VAL A 1 9  ? 0.677   -0.130  -12.333 1.00 0.00 ? 9  VAL A HG23 4 
ATOM   3051 N N    . CYS A 1 10 ? -0.769  1.086   -7.651  1.00 0.00 ? 10 CYS A N    4 
ATOM   3052 C CA   . CYS A 1 10 ? -1.671  0.400   -6.733  1.00 0.00 ? 10 CYS A CA   4 
ATOM   3053 C C    . CYS A 1 10 ? -2.804  1.324   -6.313  1.00 0.00 ? 10 CYS A C    4 
ATOM   3054 O O    . CYS A 1 10 ? -3.916  0.880   -6.028  1.00 0.00 ? 10 CYS A O    4 
ATOM   3055 C CB   . CYS A 1 10 ? -0.906  -0.055  -5.496  1.00 0.00 ? 10 CYS A CB   4 
ATOM   3056 S SG   . CYS A 1 10 ? -1.636  -1.498  -4.655  1.00 0.00 ? 10 CYS A SG   4 
ATOM   3057 H H    . CYS A 1 10 ? 0.059   1.475   -7.302  1.00 0.00 ? 10 CYS A H    4 
ATOM   3058 H HA   . CYS A 1 10 ? -2.081  -0.461  -7.238  1.00 0.00 ? 10 CYS A HA   4 
ATOM   3059 H HB2  . CYS A 1 10 ? 0.101   -0.309  -5.783  1.00 0.00 ? 10 CYS A HB2  4 
ATOM   3060 H HB3  . CYS A 1 10 ? -0.878  0.759   -4.783  1.00 0.00 ? 10 CYS A HB3  4 
ATOM   3061 N N    . ALA A 1 11 ? -2.500  2.617   -6.276  1.00 0.00 ? 11 ALA A N    4 
ATOM   3062 C CA   . ALA A 1 11 ? -3.471  3.638   -5.889  1.00 0.00 ? 11 ALA A CA   4 
ATOM   3063 C C    . ALA A 1 11 ? -4.828  3.383   -6.529  1.00 0.00 ? 11 ALA A C    4 
ATOM   3064 O O    . ALA A 1 11 ? -5.869  3.718   -5.965  1.00 0.00 ? 11 ALA A O    4 
ATOM   3065 C CB   . ALA A 1 11 ? -2.960  5.021   -6.267  1.00 0.00 ? 11 ALA A CB   4 
ATOM   3066 H H    . ALA A 1 11 ? -1.592  2.891   -6.513  1.00 0.00 ? 11 ALA A H    4 
ATOM   3067 H HA   . ALA A 1 11 ? -3.581  3.602   -4.820  1.00 0.00 ? 11 ALA A HA   4 
ATOM   3068 H HB1  . ALA A 1 11 ? -3.600  5.773   -5.830  1.00 0.00 ? 11 ALA A HB1  4 
ATOM   3069 H HB2  . ALA A 1 11 ? -2.964  5.125   -7.342  1.00 0.00 ? 11 ALA A HB2  4 
ATOM   3070 H HB3  . ALA A 1 11 ? -1.953  5.145   -5.897  1.00 0.00 ? 11 ALA A HB3  4 
ATOM   3071 N N    . SER A 1 12 ? -4.801  2.783   -7.709  1.00 0.00 ? 12 SER A N    4 
ATOM   3072 C CA   . SER A 1 12 ? -6.022  2.468   -8.438  1.00 0.00 ? 12 SER A CA   4 
ATOM   3073 C C    . SER A 1 12 ? -7.003  1.711   -7.547  1.00 0.00 ? 12 SER A C    4 
ATOM   3074 O O    . SER A 1 12 ? -8.218  1.883   -7.654  1.00 0.00 ? 12 SER A O    4 
ATOM   3075 C CB   . SER A 1 12 ? -5.700  1.639   -9.682  1.00 0.00 ? 12 SER A CB   4 
ATOM   3076 O OG   . SER A 1 12 ? -4.587  2.174   -10.378 1.00 0.00 ? 12 SER A OG   4 
ATOM   3077 H H    . SER A 1 12 ? -3.937  2.543   -8.097  1.00 0.00 ? 12 SER A H    4 
ATOM   3078 H HA   . SER A 1 12 ? -6.471  3.398   -8.742  1.00 0.00 ? 12 SER A HA   4 
ATOM   3079 H HB2  . SER A 1 12 ? -5.471  0.625   -9.388  1.00 0.00 ? 12 SER A HB2  4 
ATOM   3080 H HB3  . SER A 1 12 ? -6.555  1.637   -10.342 1.00 0.00 ? 12 SER A HB3  4 
ATOM   3081 H HG   . SER A 1 12 ? -3.784  1.745   -10.075 1.00 0.00 ? 12 SER A HG   4 
ATOM   3082 N N    . ALA A 1 13 ? -6.464  0.873   -6.666  1.00 0.00 ? 13 ALA A N    4 
ATOM   3083 C CA   . ALA A 1 13 ? -7.280  0.090   -5.755  1.00 0.00 ? 13 ALA A CA   4 
ATOM   3084 C C    . ALA A 1 13 ? -7.539  0.850   -4.457  1.00 0.00 ? 13 ALA A C    4 
ATOM   3085 O O    . ALA A 1 13 ? -8.589  0.693   -3.834  1.00 0.00 ? 13 ALA A O    4 
ATOM   3086 C CB   . ALA A 1 13 ? -6.612  -1.246  -5.463  1.00 0.00 ? 13 ALA A CB   4 
ATOM   3087 H H    . ALA A 1 13 ? -5.495  0.780   -6.630  1.00 0.00 ? 13 ALA A H    4 
ATOM   3088 H HA   . ALA A 1 13 ? -8.218  -0.104  -6.242  1.00 0.00 ? 13 ALA A HA   4 
ATOM   3089 H HB1  . ALA A 1 13 ? -5.917  -1.481  -6.255  1.00 0.00 ? 13 ALA A HB1  4 
ATOM   3090 H HB2  . ALA A 1 13 ? -7.364  -2.018  -5.403  1.00 0.00 ? 13 ALA A HB2  4 
ATOM   3091 H HB3  . ALA A 1 13 ? -6.082  -1.186  -4.524  1.00 0.00 ? 13 ALA A HB3  4 
ATOM   3092 N N    . ILE A 1 14 ? -6.576  1.675   -4.056  1.00 0.00 ? 14 ILE A N    4 
ATOM   3093 C CA   . ILE A 1 14 ? -6.702  2.460   -2.834  1.00 0.00 ? 14 ILE A CA   4 
ATOM   3094 C C    . ILE A 1 14 ? -7.676  3.621   -3.030  1.00 0.00 ? 14 ILE A C    4 
ATOM   3095 O O    . ILE A 1 14 ? -8.739  3.664   -2.411  1.00 0.00 ? 14 ILE A O    4 
ATOM   3096 C CB   . ILE A 1 14 ? -5.334  3.014   -2.374  1.00 0.00 ? 14 ILE A CB   4 
ATOM   3097 C CG1  . ILE A 1 14 ? -4.404  1.872   -1.957  1.00 0.00 ? 14 ILE A CG1  4 
ATOM   3098 C CG2  . ILE A 1 14 ? -5.508  3.997   -1.224  1.00 0.00 ? 14 ILE A CG2  4 
ATOM   3099 C CD1  . ILE A 1 14 ? -3.734  1.177   -3.124  1.00 0.00 ? 14 ILE A CD1  4 
ATOM   3100 H H    . ILE A 1 14 ? -5.762  1.759   -4.596  1.00 0.00 ? 14 ILE A H    4 
ATOM   3101 H HA   . ILE A 1 14 ? -7.083  1.810   -2.059  1.00 0.00 ? 14 ILE A HA   4 
ATOM   3102 H HB   . ILE A 1 14 ? -4.890  3.544   -3.203  1.00 0.00 ? 14 ILE A HB   4 
ATOM   3103 H HG12 . ILE A 1 14 ? -3.628  2.267   -1.315  1.00 0.00 ? 14 ILE A HG12 4 
ATOM   3104 H HG13 . ILE A 1 14 ? -4.974  1.133   -1.412  1.00 0.00 ? 14 ILE A HG13 4 
ATOM   3105 H HG21 . ILE A 1 14 ? -6.423  3.774   -0.695  1.00 0.00 ? 14 ILE A HG21 4 
ATOM   3106 H HG22 . ILE A 1 14 ? -5.555  5.003   -1.614  1.00 0.00 ? 14 ILE A HG22 4 
ATOM   3107 H HG23 . ILE A 1 14 ? -4.671  3.912   -0.547  1.00 0.00 ? 14 ILE A HG23 4 
ATOM   3108 H HD11 . ILE A 1 14 ? -2.707  0.957   -2.871  1.00 0.00 ? 14 ILE A HD11 4 
ATOM   3109 H HD12 . ILE A 1 14 ? -3.762  1.820   -3.991  1.00 0.00 ? 14 ILE A HD12 4 
ATOM   3110 H HD13 . ILE A 1 14 ? -4.255  0.256   -3.342  1.00 0.00 ? 14 ILE A HD13 4 
ATOM   3111 N N    . LEU A 1 15 ? -7.300  4.561   -3.890  1.00 0.00 ? 15 LEU A N    4 
ATOM   3112 C CA   . LEU A 1 15 ? -8.134  5.726   -4.163  1.00 0.00 ? 15 LEU A CA   4 
ATOM   3113 C C    . LEU A 1 15 ? -9.442  5.323   -4.837  1.00 0.00 ? 15 LEU A C    4 
ATOM   3114 O O    . LEU A 1 15 ? -10.502 5.331   -4.212  1.00 0.00 ? 15 LEU A O    4 
ATOM   3115 C CB   . LEU A 1 15 ? -7.379  6.724   -5.043  1.00 0.00 ? 15 LEU A CB   4 
ATOM   3116 C CG   . LEU A 1 15 ? -6.173  7.390   -4.379  1.00 0.00 ? 15 LEU A CG   4 
ATOM   3117 C CD1  . LEU A 1 15 ? -5.354  8.157   -5.405  1.00 0.00 ? 15 LEU A CD1  4 
ATOM   3118 C CD2  . LEU A 1 15 ? -6.625  8.313   -3.257  1.00 0.00 ? 15 LEU A CD2  4 
ATOM   3119 H H    . LEU A 1 15 ? -6.438  4.472   -4.349  1.00 0.00 ? 15 LEU A H    4 
ATOM   3120 H HA   . LEU A 1 15 ? -8.363  6.197   -3.219  1.00 0.00 ? 15 LEU A HA   4 
ATOM   3121 H HB2  . LEU A 1 15 ? -7.037  6.205   -5.927  1.00 0.00 ? 15 LEU A HB2  4 
ATOM   3122 H HB3  . LEU A 1 15 ? -8.068  7.499   -5.345  1.00 0.00 ? 15 LEU A HB3  4 
ATOM   3123 H HG   . LEU A 1 15 ? -5.540  6.627   -3.951  1.00 0.00 ? 15 LEU A HG   4 
ATOM   3124 H HD11 . LEU A 1 15 ? -5.998  8.483   -6.209  1.00 0.00 ? 15 LEU A HD11 4 
ATOM   3125 H HD12 . LEU A 1 15 ? -4.580  7.516   -5.801  1.00 0.00 ? 15 LEU A HD12 4 
ATOM   3126 H HD13 . LEU A 1 15 ? -4.903  9.018   -4.935  1.00 0.00 ? 15 LEU A HD13 4 
ATOM   3127 H HD21 . LEU A 1 15 ? -7.612  8.022   -2.927  1.00 0.00 ? 15 LEU A HD21 4 
ATOM   3128 H HD22 . LEU A 1 15 ? -6.652  9.331   -3.617  1.00 0.00 ? 15 LEU A HD22 4 
ATOM   3129 H HD23 . LEU A 1 15 ? -5.933  8.241   -2.431  1.00 0.00 ? 15 LEU A HD23 4 
ATOM   3130 N N    . SER A 1 16 ? -9.360  4.973   -6.118  1.00 0.00 ? 16 SER A N    4 
ATOM   3131 C CA   . SER A 1 16 ? -10.539 4.570   -6.879  1.00 0.00 ? 16 SER A CA   4 
ATOM   3132 C C    . SER A 1 16 ? -11.282 3.434   -6.182  1.00 0.00 ? 16 SER A C    4 
ATOM   3133 O O    . SER A 1 16 ? -12.383 3.624   -5.666  1.00 0.00 ? 16 SER A O    4 
ATOM   3134 C CB   . SER A 1 16 ? -10.136 4.141   -8.292  1.00 0.00 ? 16 SER A CB   4 
ATOM   3135 O OG   . SER A 1 16 ? -11.074 4.599   -9.250  1.00 0.00 ? 16 SER A OG   4 
ATOM   3136 H H    . SER A 1 16 ? -8.487  4.989   -6.563  1.00 0.00 ? 16 SER A H    4 
ATOM   3137 H HA   . SER A 1 16 ? -11.196 5.424   -6.947  1.00 0.00 ? 16 SER A HA   4 
ATOM   3138 H HB2  . SER A 1 16 ? -9.168  4.555   -8.529  1.00 0.00 ? 16 SER A HB2  4 
ATOM   3139 H HB3  . SER A 1 16 ? -10.088 3.063   -8.339  1.00 0.00 ? 16 SER A HB3  4 
ATOM   3140 H HG   . SER A 1 16 ? -10.868 5.505   -9.493  1.00 0.00 ? 16 SER A HG   4 
ATOM   3141 N N    . GLY A 1 17 ? -10.672 2.253   -6.170  1.00 0.00 ? 17 GLY A N    4 
ATOM   3142 C CA   . GLY A 1 17 ? -11.292 1.106   -5.533  1.00 0.00 ? 17 GLY A CA   4 
ATOM   3143 C C    . GLY A 1 17 ? -11.734 0.054   -6.532  1.00 0.00 ? 17 GLY A C    4 
ATOM   3144 O O    . GLY A 1 17 ? -12.651 -0.721  -6.261  1.00 0.00 ? 17 GLY A O    4 
ATOM   3145 H H    . GLY A 1 17 ? -9.795  2.160   -6.596  1.00 0.00 ? 17 GLY A H    4 
ATOM   3146 H HA2  . GLY A 1 17 ? -10.583 0.661   -4.851  1.00 0.00 ? 17 GLY A HA2  4 
ATOM   3147 H HA3  . GLY A 1 17 ? -12.153 1.439   -4.973  1.00 0.00 ? 17 GLY A HA3  4 
ATOM   3148 N N    . ALA A 1 18 ? -11.081 0.026   -7.689  1.00 0.00 ? 18 ALA A N    4 
ATOM   3149 C CA   . ALA A 1 18 ? -11.412 -0.939  -8.729  1.00 0.00 ? 18 ALA A CA   4 
ATOM   3150 C C    . ALA A 1 18 ? -11.193 -2.363  -8.242  1.00 0.00 ? 18 ALA A C    4 
ATOM   3151 O O    . ALA A 1 18 ? -12.140 -3.075  -7.908  1.00 0.00 ? 18 ALA A O    4 
ATOM   3152 C CB   . ALA A 1 18 ? -10.587 -0.671  -9.979  1.00 0.00 ? 18 ALA A CB   4 
ATOM   3153 H H    . ALA A 1 18 ? -10.359 0.669   -7.846  1.00 0.00 ? 18 ALA A H    4 
ATOM   3154 H HA   . ALA A 1 18 ? -12.447 -0.816  -8.980  1.00 0.00 ? 18 ALA A HA   4 
ATOM   3155 H HB1  . ALA A 1 18 ? -11.063 0.101   -10.567 1.00 0.00 ? 18 ALA A HB1  4 
ATOM   3156 H HB2  . ALA A 1 18 ? -10.515 -1.576  -10.564 1.00 0.00 ? 18 ALA A HB2  4 
ATOM   3157 H HB3  . ALA A 1 18 ? -9.596  -0.347  -9.695  1.00 0.00 ? 18 ALA A HB3  4 
ATOM   3158 N N    . LYS A 1 19 ? -9.935  -2.766  -8.206  1.00 0.00 ? 19 LYS A N    4 
ATOM   3159 C CA   . LYS A 1 19 ? -9.566  -4.103  -7.761  1.00 0.00 ? 19 LYS A CA   4 
ATOM   3160 C C    . LYS A 1 19 ? -8.049  -4.238  -7.647  1.00 0.00 ? 19 LYS A C    4 
ATOM   3161 O O    . LYS A 1 19 ? -7.303  -3.489  -8.277  1.00 0.00 ? 19 LYS A O    4 
ATOM   3162 C CB   . LYS A 1 19 ? -10.113 -5.157  -8.726  1.00 0.00 ? 19 LYS A CB   4 
ATOM   3163 C CG   . LYS A 1 19 ? -9.925  -4.797  -10.191 1.00 0.00 ? 19 LYS A CG   4 
ATOM   3164 C CD   . LYS A 1 19 ? -11.255 -4.715  -10.924 1.00 0.00 ? 19 LYS A CD   4 
ATOM   3165 C CE   . LYS A 1 19 ? -11.075 -4.227  -12.352 1.00 0.00 ? 19 LYS A CE   4 
ATOM   3166 N NZ   . LYS A 1 19 ? -12.176 -4.690  -13.241 1.00 0.00 ? 19 LYS A NZ   4 
ATOM   3167 H H    . LYS A 1 19 ? -9.237  -2.144  -8.485  1.00 0.00 ? 19 LYS A H    4 
ATOM   3168 H HA   . LYS A 1 19 ? -10.002 -4.258  -6.786  1.00 0.00 ? 19 LYS A HA   4 
ATOM   3169 H HB2  . LYS A 1 19 ? -9.610  -6.094  -8.540  1.00 0.00 ? 19 LYS A HB2  4 
ATOM   3170 H HB3  . LYS A 1 19 ? -11.170 -5.283  -8.540  1.00 0.00 ? 19 LYS A HB3  4 
ATOM   3171 H HG2  . LYS A 1 19 ? -9.431  -3.839  -10.256 1.00 0.00 ? 19 LYS A HG2  4 
ATOM   3172 H HG3  . LYS A 1 19 ? -9.311  -5.552  -10.661 1.00 0.00 ? 19 LYS A HG3  4 
ATOM   3173 H HD2  . LYS A 1 19 ? -11.705 -5.696  -10.943 1.00 0.00 ? 19 LYS A HD2  4 
ATOM   3174 H HD3  . LYS A 1 19 ? -11.903 -4.030  -10.397 1.00 0.00 ? 19 LYS A HD3  4 
ATOM   3175 H HE2  . LYS A 1 19 ? -11.057 -3.147  -12.350 1.00 0.00 ? 19 LYS A HE2  4 
ATOM   3176 H HE3  . LYS A 1 19 ? -10.136 -4.601  -12.731 1.00 0.00 ? 19 LYS A HE3  4 
ATOM   3177 H HZ1  . LYS A 1 19 ? -13.086 -4.643  -12.738 1.00 0.00 ? 19 LYS A HZ1  4 
ATOM   3178 H HZ2  . LYS A 1 19 ? -12.008 -5.673  -13.537 1.00 0.00 ? 19 LYS A HZ2  4 
ATOM   3179 H HZ3  . LYS A 1 19 ? -12.228 -4.089  -14.088 1.00 0.00 ? 19 LYS A HZ3  4 
ATOM   3180 N N    . PRO A 1 20 ? -7.572  -5.200  -6.839  1.00 0.00 ? 20 PRO A N    4 
ATOM   3181 C CA   . PRO A 1 20 ? -6.136  -5.429  -6.646  1.00 0.00 ? 20 PRO A CA   4 
ATOM   3182 C C    . PRO A 1 20 ? -5.443  -5.859  -7.934  1.00 0.00 ? 20 PRO A C    4 
ATOM   3183 O O    . PRO A 1 20 ? -6.011  -5.754  -9.021  1.00 0.00 ? 20 PRO A O    4 
ATOM   3184 C CB   . PRO A 1 20 ? -6.082  -6.556  -5.608  1.00 0.00 ? 20 PRO A CB   4 
ATOM   3185 C CG   . PRO A 1 20 ? -7.414  -7.219  -5.688  1.00 0.00 ? 20 PRO A CG   4 
ATOM   3186 C CD   . PRO A 1 20 ? -8.391  -6.138  -6.052  1.00 0.00 ? 20 PRO A CD   4 
ATOM   3187 H HA   . PRO A 1 20 ? -5.647  -4.550  -6.253  1.00 0.00 ? 20 PRO A HA   4 
ATOM   3188 H HB2  . PRO A 1 20 ? -5.285  -7.240  -5.858  1.00 0.00 ? 20 PRO A HB2  4 
ATOM   3189 H HB3  . PRO A 1 20 ? -5.910  -6.137  -4.628  1.00 0.00 ? 20 PRO A HB3  4 
ATOM   3190 H HG2  . PRO A 1 20 ? -7.399  -7.983  -6.452  1.00 0.00 ? 20 PRO A HG2  4 
ATOM   3191 H HG3  . PRO A 1 20 ? -7.669  -7.649  -4.731  1.00 0.00 ? 20 PRO A HG3  4 
ATOM   3192 H HD2  . PRO A 1 20 ? -9.197  -6.541  -6.647  1.00 0.00 ? 20 PRO A HD2  4 
ATOM   3193 H HD3  . PRO A 1 20 ? -8.776  -5.661  -5.163  1.00 0.00 ? 20 PRO A HD3  4 
ATOM   3194 N N    . SER A 1 21 ? -4.212  -6.343  -7.804  1.00 0.00 ? 21 SER A N    4 
ATOM   3195 C CA   . SER A 1 21 ? -3.441  -6.789  -8.958  1.00 0.00 ? 21 SER A CA   4 
ATOM   3196 C C    . SER A 1 21 ? -2.121  -7.416  -8.519  1.00 0.00 ? 21 SER A C    4 
ATOM   3197 O O    . SER A 1 21 ? -1.509  -6.980  -7.544  1.00 0.00 ? 21 SER A O    4 
ATOM   3198 C CB   . SER A 1 21 ? -3.173  -5.618  -9.904  1.00 0.00 ? 21 SER A CB   4 
ATOM   3199 O OG   . SER A 1 21 ? -3.254  -6.027  -11.259 1.00 0.00 ? 21 SER A OG   4 
ATOM   3200 H H    . SER A 1 21 ? -3.814  -6.402  -6.912  1.00 0.00 ? 21 SER A H    4 
ATOM   3201 H HA   . SER A 1 21 ? -4.024  -7.534  -9.476  1.00 0.00 ? 21 SER A HA   4 
ATOM   3202 H HB2  . SER A 1 21 ? -3.906  -4.843  -9.732  1.00 0.00 ? 21 SER A HB2  4 
ATOM   3203 H HB3  . SER A 1 21 ? -2.184  -5.225  -9.718  1.00 0.00 ? 21 SER A HB3  4 
ATOM   3204 H HG   . SER A 1 21 ? -3.697  -5.349  -11.773 1.00 0.00 ? 21 SER A HG   4 
ATOM   3205 N N    . GLY A 1 22 ? -1.690  -8.441  -9.246  1.00 0.00 ? 22 GLY A N    4 
ATOM   3206 C CA   . GLY A 1 22 ? -0.446  -9.111  -8.917  1.00 0.00 ? 22 GLY A CA   4 
ATOM   3207 C C    . GLY A 1 22 ? 0.747   -8.176  -8.956  1.00 0.00 ? 22 GLY A C    4 
ATOM   3208 O O    . GLY A 1 22 ? 1.745   -8.404  -8.271  1.00 0.00 ? 22 GLY A O    4 
ATOM   3209 H H    . GLY A 1 22 ? -2.220  -8.745  -10.012 1.00 0.00 ? 22 GLY A H    4 
ATOM   3210 H HA2  . GLY A 1 22 ? -0.528  -9.531  -7.925  1.00 0.00 ? 22 GLY A HA2  4 
ATOM   3211 H HA3  . GLY A 1 22 ? -0.284  -9.913  -9.622  1.00 0.00 ? 22 GLY A HA3  4 
ATOM   3212 N N    . GLU A 1 23 ? 0.648   -7.123  -9.761  1.00 0.00 ? 23 GLU A N    4 
ATOM   3213 C CA   . GLU A 1 23 ? 1.717   -6.157  -9.892  1.00 0.00 ? 23 GLU A CA   4 
ATOM   3214 C C    . GLU A 1 23 ? 2.025   -5.505  -8.550  1.00 0.00 ? 23 GLU A C    4 
ATOM   3215 O O    . GLU A 1 23 ? 3.160   -5.539  -8.076  1.00 0.00 ? 23 GLU A O    4 
ATOM   3216 C CB   . GLU A 1 23 ? 1.313   -5.095  -10.909 1.00 0.00 ? 23 GLU A CB   4 
ATOM   3217 C CG   . GLU A 1 23 ? 2.493   -4.435  -11.580 1.00 0.00 ? 23 GLU A CG   4 
ATOM   3218 C CD   . GLU A 1 23 ? 2.482   -2.925  -11.446 1.00 0.00 ? 23 GLU A CD   4 
ATOM   3219 O OE1  . GLU A 1 23 ? 1.436   -2.311  -11.743 1.00 0.00 ? 23 GLU A OE1  4 
ATOM   3220 O OE2  . GLU A 1 23 ? 3.519   -2.357  -11.044 1.00 0.00 ? 23 GLU A OE2  4 
ATOM   3221 H H    . GLU A 1 23 ? -0.164  -6.992  -10.285 1.00 0.00 ? 23 GLU A H    4 
ATOM   3222 H HA   . GLU A 1 23 ? 2.597   -6.672  -10.247 1.00 0.00 ? 23 GLU A HA   4 
ATOM   3223 H HB2  . GLU A 1 23 ? 0.702   -5.557  -11.674 1.00 0.00 ? 23 GLU A HB2  4 
ATOM   3224 H HB3  . GLU A 1 23 ? 0.736   -4.330  -10.406 1.00 0.00 ? 23 GLU A HB3  4 
ATOM   3225 H HG2  . GLU A 1 23 ? 3.396   -4.818  -11.133 1.00 0.00 ? 23 GLU A HG2  4 
ATOM   3226 H HG3  . GLU A 1 23 ? 2.474   -4.693  -12.627 1.00 0.00 ? 23 GLU A HG3  4 
ATOM   3227 N N    . CYS A 1 24 ? 1.002   -4.910  -7.944  1.00 0.00 ? 24 CYS A N    4 
ATOM   3228 C CA   . CYS A 1 24 ? 1.155   -4.246  -6.657  1.00 0.00 ? 24 CYS A CA   4 
ATOM   3229 C C    . CYS A 1 24 ? 1.738   -5.194  -5.614  1.00 0.00 ? 24 CYS A C    4 
ATOM   3230 O O    . CYS A 1 24 ? 2.374   -4.762  -4.653  1.00 0.00 ? 24 CYS A O    4 
ATOM   3231 C CB   . CYS A 1 24 ? -0.190  -3.700  -6.173  1.00 0.00 ? 24 CYS A CB   4 
ATOM   3232 S SG   . CYS A 1 24 ? -0.108  -2.833  -4.571  1.00 0.00 ? 24 CYS A SG   4 
ATOM   3233 H H    . CYS A 1 24 ? 0.125   -4.917  -8.374  1.00 0.00 ? 24 CYS A H    4 
ATOM   3234 H HA   . CYS A 1 24 ? 1.834   -3.427  -6.797  1.00 0.00 ? 24 CYS A HA   4 
ATOM   3235 H HB2  . CYS A 1 24 ? -0.571  -3.002  -6.903  1.00 0.00 ? 24 CYS A HB2  4 
ATOM   3236 H HB3  . CYS A 1 24 ? -0.886  -4.519  -6.069  1.00 0.00 ? 24 CYS A HB3  4 
ATOM   3237 N N    . CYS A 1 25 ? 1.515   -6.486  -5.813  1.00 0.00 ? 25 CYS A N    4 
ATOM   3238 C CA   . CYS A 1 25 ? 2.015   -7.501  -4.893  1.00 0.00 ? 25 CYS A CA   4 
ATOM   3239 C C    . CYS A 1 25 ? 3.539   -7.540  -4.904  1.00 0.00 ? 25 CYS A C    4 
ATOM   3240 O O    . CYS A 1 25 ? 4.178   -7.539  -3.851  1.00 0.00 ? 25 CYS A O    4 
ATOM   3241 C CB   . CYS A 1 25 ? 1.452   -8.875  -5.265  1.00 0.00 ? 25 CYS A CB   4 
ATOM   3242 S SG   . CYS A 1 25 ? 0.240   -9.529  -4.073  1.00 0.00 ? 25 CYS A SG   4 
ATOM   3243 H H    . CYS A 1 25 ? 1.001   -6.764  -6.598  1.00 0.00 ? 25 CYS A H    4 
ATOM   3244 H HA   . CYS A 1 25 ? 1.680   -7.241  -3.900  1.00 0.00 ? 25 CYS A HA   4 
ATOM   3245 H HB2  . CYS A 1 25 ? 0.963   -8.807  -6.225  1.00 0.00 ? 25 CYS A HB2  4 
ATOM   3246 H HB3  . CYS A 1 25 ? 2.264   -9.585  -5.331  1.00 0.00 ? 25 CYS A HB3  4 
ATOM   3247 N N    . GLY A 1 26 ? 4.115   -7.579  -6.100  1.00 0.00 ? 26 GLY A N    4 
ATOM   3248 C CA   . GLY A 1 26 ? 5.560   -7.623  -6.227  1.00 0.00 ? 26 GLY A CA   4 
ATOM   3249 C C    . GLY A 1 26 ? 6.206   -6.265  -6.038  1.00 0.00 ? 26 GLY A C    4 
ATOM   3250 O O    . GLY A 1 26 ? 7.376   -6.175  -5.665  1.00 0.00 ? 26 GLY A O    4 
ATOM   3251 H H    . GLY A 1 26 ? 3.555   -7.581  -6.904  1.00 0.00 ? 26 GLY A H    4 
ATOM   3252 H HA2  . GLY A 1 26 ? 5.954   -8.302  -5.486  1.00 0.00 ? 26 GLY A HA2  4 
ATOM   3253 H HA3  . GLY A 1 26 ? 5.811   -7.995  -7.210  1.00 0.00 ? 26 GLY A HA3  4 
ATOM   3254 N N    . ASN A 1 27 ? 5.448   -5.204  -6.300  1.00 0.00 ? 27 ASN A N    4 
ATOM   3255 C CA   . ASN A 1 27 ? 5.958   -3.852  -6.160  1.00 0.00 ? 27 ASN A CA   4 
ATOM   3256 C C    . ASN A 1 27 ? 6.291   -3.545  -4.714  1.00 0.00 ? 27 ASN A C    4 
ATOM   3257 O O    . ASN A 1 27 ? 7.444   -3.289  -4.367  1.00 0.00 ? 27 ASN A O    4 
ATOM   3258 C CB   . ASN A 1 27 ? 4.942   -2.840  -6.692  1.00 0.00 ? 27 ASN A CB   4 
ATOM   3259 C CG   . ASN A 1 27 ? 4.784   -2.916  -8.198  1.00 0.00 ? 27 ASN A CG   4 
ATOM   3260 O OD1  . ASN A 1 27 ? 3.701   -3.208  -8.706  1.00 0.00 ? 27 ASN A OD1  4 
ATOM   3261 N ND2  . ASN A 1 27 ? 5.865   -2.652  -8.920  1.00 0.00 ? 27 ASN A ND2  4 
ATOM   3262 H H    . ASN A 1 27 ? 4.530   -5.332  -6.596  1.00 0.00 ? 27 ASN A H    4 
ATOM   3263 H HA   . ASN A 1 27 ? 6.852   -3.787  -6.736  1.00 0.00 ? 27 ASN A HA   4 
ATOM   3264 H HB2  . ASN A 1 27 ? 3.981   -3.031  -6.238  1.00 0.00 ? 27 ASN A HB2  4 
ATOM   3265 H HB3  . ASN A 1 27 ? 5.267   -1.844  -6.432  1.00 0.00 ? 27 ASN A HB3  4 
ATOM   3266 H HD21 . ASN A 1 27 ? 6.694   -2.425  -8.448  1.00 0.00 ? 27 ASN A HD21 4 
ATOM   3267 H HD22 . ASN A 1 27 ? 5.791   -2.696  -9.896  1.00 0.00 ? 27 ASN A HD22 4 
ATOM   3268 N N    . LEU A 1 28 ? 5.272   -3.575  -3.875  1.00 0.00 ? 28 LEU A N    4 
ATOM   3269 C CA   . LEU A 1 28 ? 5.446   -3.304  -2.456  1.00 0.00 ? 28 LEU A CA   4 
ATOM   3270 C C    . LEU A 1 28 ? 6.509   -4.222  -1.861  1.00 0.00 ? 28 LEU A C    4 
ATOM   3271 O O    . LEU A 1 28 ? 7.136   -3.894  -0.853  1.00 0.00 ? 28 LEU A O    4 
ATOM   3272 C CB   . LEU A 1 28 ? 4.123   -3.460  -1.703  1.00 0.00 ? 28 LEU A CB   4 
ATOM   3273 C CG   . LEU A 1 28 ? 3.407   -4.792  -1.916  1.00 0.00 ? 28 LEU A CG   4 
ATOM   3274 C CD1  . LEU A 1 28 ? 3.771   -5.773  -0.813  1.00 0.00 ? 28 LEU A CD1  4 
ATOM   3275 C CD2  . LEU A 1 28 ? 1.901   -4.585  -1.970  1.00 0.00 ? 28 LEU A CD2  4 
ATOM   3276 H H    . LEU A 1 28 ? 4.387   -3.787  -4.220  1.00 0.00 ? 28 LEU A H    4 
ATOM   3277 H HA   . LEU A 1 28 ? 5.778   -2.288  -2.364  1.00 0.00 ? 28 LEU A HA   4 
ATOM   3278 H HB2  . LEU A 1 28 ? 4.320   -3.346  -0.647  1.00 0.00 ? 28 LEU A HB2  4 
ATOM   3279 H HB3  . LEU A 1 28 ? 3.461   -2.667  -2.016  1.00 0.00 ? 28 LEU A HB3  4 
ATOM   3280 H HG   . LEU A 1 28 ? 3.723   -5.213  -2.858  1.00 0.00 ? 28 LEU A HG   4 
ATOM   3281 H HD11 . LEU A 1 28 ? 3.264   -5.496  0.099   1.00 0.00 ? 28 LEU A HD11 4 
ATOM   3282 H HD12 . LEU A 1 28 ? 4.840   -5.755  -0.651  1.00 0.00 ? 28 LEU A HD12 4 
ATOM   3283 H HD13 . LEU A 1 28 ? 3.469   -6.768  -1.105  1.00 0.00 ? 28 LEU A HD13 4 
ATOM   3284 H HD21 . LEU A 1 28 ? 1.465   -5.295  -2.657  1.00 0.00 ? 28 LEU A HD21 4 
ATOM   3285 H HD22 . LEU A 1 28 ? 1.687   -3.581  -2.306  1.00 0.00 ? 28 LEU A HD22 4 
ATOM   3286 H HD23 . LEU A 1 28 ? 1.481   -4.733  -0.986  1.00 0.00 ? 28 LEU A HD23 4 
ATOM   3287 N N    . ARG A 1 29 ? 6.706   -5.373  -2.496  1.00 0.00 ? 29 ARG A N    4 
ATOM   3288 C CA   . ARG A 1 29 ? 7.686   -6.340  -2.044  1.00 0.00 ? 29 ARG A CA   4 
ATOM   3289 C C    . ARG A 1 29 ? 9.090   -5.782  -2.140  1.00 0.00 ? 29 ARG A C    4 
ATOM   3290 O O    . ARG A 1 29 ? 9.845   -5.795  -1.169  1.00 0.00 ? 29 ARG A O    4 
ATOM   3291 C CB   . ARG A 1 29 ? 7.578   -7.628  -2.866  1.00 0.00 ? 29 ARG A CB   4 
ATOM   3292 C CG   . ARG A 1 29 ? 6.874   -8.766  -2.147  1.00 0.00 ? 29 ARG A CG   4 
ATOM   3293 C CD   . ARG A 1 29 ? 5.627   -8.292  -1.422  1.00 0.00 ? 29 ARG A CD   4 
ATOM   3294 N NE   . ARG A 1 29 ? 5.825   -8.240  0.024   1.00 0.00 ? 29 ARG A NE   4 
ATOM   3295 C CZ   . ARG A 1 29 ? 6.029   -9.314  0.783   1.00 0.00 ? 29 ARG A CZ   4 
ATOM   3296 N NH1  . ARG A 1 29 ? 6.059   -10.524 0.238   1.00 0.00 ? 29 ARG A NH1  4 
ATOM   3297 N NH2  . ARG A 1 29 ? 6.202   -9.178  2.091   1.00 0.00 ? 29 ARG A NH2  4 
ATOM   3298 H H    . ARG A 1 29 ? 6.177   -5.578  -3.286  1.00 0.00 ? 29 ARG A H    4 
ATOM   3299 H HA   . ARG A 1 29 ? 7.477   -6.549  -1.024  1.00 0.00 ? 29 ARG A HA   4 
ATOM   3300 H HB2  . ARG A 1 29 ? 7.031   -7.415  -3.773  1.00 0.00 ? 29 ARG A HB2  4 
ATOM   3301 H HB3  . ARG A 1 29 ? 8.572   -7.959  -3.128  1.00 0.00 ? 29 ARG A HB3  4 
ATOM   3302 H HG2  . ARG A 1 29 ? 6.590   -9.510  -2.873  1.00 0.00 ? 29 ARG A HG2  4 
ATOM   3303 H HG3  . ARG A 1 29 ? 7.554   -9.199  -1.431  1.00 0.00 ? 29 ARG A HG3  4 
ATOM   3304 H HD2  . ARG A 1 29 ? 5.373   -7.306  -1.778  1.00 0.00 ? 29 ARG A HD2  4 
ATOM   3305 H HD3  . ARG A 1 29 ? 4.817   -8.973  -1.641  1.00 0.00 ? 29 ARG A HD3  4 
ATOM   3306 H HE   . ARG A 1 29 ? 5.806   -7.358  0.452   1.00 0.00 ? 29 ARG A HE   4 
ATOM   3307 H HH11 . ARG A 1 29 ? 5.929   -10.634 -0.747  1.00 0.00 ? 29 ARG A HH11 4 
ATOM   3308 H HH12 . ARG A 1 29 ? 6.213   -11.327 0.814   1.00 0.00 ? 29 ARG A HH12 4 
ATOM   3309 H HH21 . ARG A 1 29 ? 6.180   -8.269  2.507   1.00 0.00 ? 29 ARG A HH21 4 
ATOM   3310 H HH22 . ARG A 1 29 ? 6.355   -9.985  2.661   1.00 0.00 ? 29 ARG A HH22 4 
ATOM   3311 N N    . ALA A 1 30 ? 9.430   -5.284  -3.315  1.00 0.00 ? 30 ALA A N    4 
ATOM   3312 C CA   . ALA A 1 30 ? 10.745  -4.707  -3.538  1.00 0.00 ? 30 ALA A CA   4 
ATOM   3313 C C    . ALA A 1 30 ? 11.080  -3.704  -2.441  1.00 0.00 ? 30 ALA A C    4 
ATOM   3314 O O    . ALA A 1 30 ? 12.248  -3.454  -2.143  1.00 0.00 ? 30 ALA A O    4 
ATOM   3315 C CB   . ALA A 1 30 ? 10.809  -4.046  -4.908  1.00 0.00 ? 30 ALA A CB   4 
ATOM   3316 H H    . ALA A 1 30 ? 8.779   -5.299  -4.042  1.00 0.00 ? 30 ALA A H    4 
ATOM   3317 H HA   . ALA A 1 30 ? 11.463  -5.507  -3.514  1.00 0.00 ? 30 ALA A HA   4 
ATOM   3318 H HB1  . ALA A 1 30 ? 10.966  -2.984  -4.791  1.00 0.00 ? 30 ALA A HB1  4 
ATOM   3319 H HB2  . ALA A 1 30 ? 9.881   -4.217  -5.434  1.00 0.00 ? 30 ALA A HB2  4 
ATOM   3320 H HB3  . ALA A 1 30 ? 11.625  -4.470  -5.474  1.00 0.00 ? 30 ALA A HB3  4 
ATOM   3321 N N    . GLN A 1 31 ? 10.038  -3.143  -1.838  1.00 0.00 ? 31 GLN A N    4 
ATOM   3322 C CA   . GLN A 1 31 ? 10.201  -2.175  -0.762  1.00 0.00 ? 31 GLN A CA   4 
ATOM   3323 C C    . GLN A 1 31 ? 10.456  -2.876  0.566   1.00 0.00 ? 31 GLN A C    4 
ATOM   3324 O O    . GLN A 1 31 ? 11.565  -2.839  1.098   1.00 0.00 ? 31 GLN A O    4 
ATOM   3325 C CB   . GLN A 1 31 ? 8.969   -1.271  -0.663  1.00 0.00 ? 31 GLN A CB   4 
ATOM   3326 C CG   . GLN A 1 31 ? 8.347   -0.940  -2.009  1.00 0.00 ? 31 GLN A CG   4 
ATOM   3327 C CD   . GLN A 1 31 ? 8.040   0.535   -2.164  1.00 0.00 ? 31 GLN A CD   4 
ATOM   3328 O OE1  . GLN A 1 31 ? 6.970   1.003   -1.775  1.00 0.00 ? 31 GLN A OE1  4 
ATOM   3329 N NE2  . GLN A 1 31 ? 8.981   1.276   -2.734  1.00 0.00 ? 31 GLN A NE2  4 
ATOM   3330 H H    . GLN A 1 31 ? 9.131   -3.401  -2.114  1.00 0.00 ? 31 GLN A H    4 
ATOM   3331 H HA   . GLN A 1 31 ? 11.060  -1.566  -0.995  1.00 0.00 ? 31 GLN A HA   4 
ATOM   3332 H HB2  . GLN A 1 31 ? 8.223   -1.762  -0.057  1.00 0.00 ? 31 GLN A HB2  4 
ATOM   3333 H HB3  . GLN A 1 31 ? 9.255   -0.344  -0.187  1.00 0.00 ? 31 GLN A HB3  4 
ATOM   3334 H HG2  . GLN A 1 31 ? 9.033   -1.232  -2.790  1.00 0.00 ? 31 GLN A HG2  4 
ATOM   3335 H HG3  . GLN A 1 31 ? 7.429   -1.497  -2.112  1.00 0.00 ? 31 GLN A HG3  4 
ATOM   3336 H HE21 . GLN A 1 31 ? 9.811   0.832   -3.021  1.00 0.00 ? 31 GLN A HE21 4 
ATOM   3337 H HE22 . GLN A 1 31 ? 8.808   2.237   -2.846  1.00 0.00 ? 31 GLN A HE22 4 
ATOM   3338 N N    . GLN A 1 32 ? 9.414   -3.513  1.102   1.00 0.00 ? 32 GLN A N    4 
ATOM   3339 C CA   . GLN A 1 32 ? 9.512   -4.222  2.372   1.00 0.00 ? 32 GLN A CA   4 
ATOM   3340 C C    . GLN A 1 32 ? 10.174  -3.363  3.449   1.00 0.00 ? 32 GLN A C    4 
ATOM   3341 O O    . GLN A 1 32 ? 10.655  -3.876  4.460   1.00 0.00 ? 32 GLN A O    4 
ATOM   3342 C CB   . GLN A 1 32 ? 10.286  -5.519  2.183   1.00 0.00 ? 32 GLN A CB   4 
ATOM   3343 C CG   . GLN A 1 32 ? 9.637   -6.713  2.861   1.00 0.00 ? 32 GLN A CG   4 
ATOM   3344 C CD   . GLN A 1 32 ? 9.216   -7.785  1.875   1.00 0.00 ? 32 GLN A CD   4 
ATOM   3345 O OE1  . GLN A 1 32 ? 9.617   -8.943  1.990   1.00 0.00 ? 32 GLN A OE1  4 
ATOM   3346 N NE2  . GLN A 1 32 ? 8.403   -7.401  0.899   1.00 0.00 ? 32 GLN A NE2  4 
ATOM   3347 H H    . GLN A 1 32 ? 8.558   -3.508  0.630   1.00 0.00 ? 32 GLN A H    4 
ATOM   3348 H HA   . GLN A 1 32 ? 8.508   -4.461  2.692   1.00 0.00 ? 32 GLN A HA   4 
ATOM   3349 H HB2  . GLN A 1 32 ? 10.355  -5.725  1.125   1.00 0.00 ? 32 GLN A HB2  4 
ATOM   3350 H HB3  . GLN A 1 32 ? 11.278  -5.394  2.585   1.00 0.00 ? 32 GLN A HB3  4 
ATOM   3351 H HG2  . GLN A 1 32 ? 10.340  -7.142  3.559   1.00 0.00 ? 32 GLN A HG2  4 
ATOM   3352 H HG3  . GLN A 1 32 ? 8.762   -6.372  3.394   1.00 0.00 ? 32 GLN A HG3  4 
ATOM   3353 H HE21 . GLN A 1 32 ? 8.124   -6.461  0.872   1.00 0.00 ? 32 GLN A HE21 4 
ATOM   3354 H HE22 . GLN A 1 32 ? 8.115   -8.070  0.245   1.00 0.00 ? 32 GLN A HE22 4 
ATOM   3355 N N    . GLY A 1 33 ? 10.188  -2.054  3.227   1.00 0.00 ? 33 GLY A N    4 
ATOM   3356 C CA   . GLY A 1 33 ? 10.781  -1.138  4.182   1.00 0.00 ? 33 GLY A CA   4 
ATOM   3357 C C    . GLY A 1 33 ? 9.947   0.115   4.349   1.00 0.00 ? 33 GLY A C    4 
ATOM   3358 O O    . GLY A 1 33 ? 9.154   0.222   5.284   1.00 0.00 ? 33 GLY A O    4 
ATOM   3359 H H    . GLY A 1 33 ? 9.784   -1.704  2.407   1.00 0.00 ? 33 GLY A H    4 
ATOM   3360 H HA2  . GLY A 1 33 ? 10.868  -1.633  5.138   1.00 0.00 ? 33 GLY A HA2  4 
ATOM   3361 H HA3  . GLY A 1 33 ? 11.766  -0.860  3.838   1.00 0.00 ? 33 GLY A HA3  4 
ATOM   3362 N N    . CYS A 1 34 ? 10.116  1.060   3.430   1.00 0.00 ? 34 CYS A N    4 
ATOM   3363 C CA   . CYS A 1 34 ? 9.363   2.302   3.468   1.00 0.00 ? 34 CYS A CA   4 
ATOM   3364 C C    . CYS A 1 34 ? 7.875   2.018   3.363   1.00 0.00 ? 34 CYS A C    4 
ATOM   3365 O O    . CYS A 1 34 ? 7.047   2.711   3.951   1.00 0.00 ? 34 CYS A O    4 
ATOM   3366 C CB   . CYS A 1 34 ? 9.798   3.218   2.337   1.00 0.00 ? 34 CYS A CB   4 
ATOM   3367 S SG   . CYS A 1 34 ? 9.525   4.993   2.647   1.00 0.00 ? 34 CYS A SG   4 
ATOM   3368 H H    . CYS A 1 34 ? 10.753  0.915   2.707   1.00 0.00 ? 34 CYS A H    4 
ATOM   3369 H HA   . CYS A 1 34 ? 9.562   2.775   4.394   1.00 0.00 ? 34 CYS A HA   4 
ATOM   3370 H HB2  . CYS A 1 34 ? 10.851  3.071   2.147   1.00 0.00 ? 34 CYS A HB2  4 
ATOM   3371 H HB3  . CYS A 1 34 ? 9.241   2.953   1.465   1.00 0.00 ? 34 CYS A HB3  4 
ATOM   3372 N N    . PHE A 1 35 ? 7.555   0.980   2.607   1.00 0.00 ? 35 PHE A N    4 
ATOM   3373 C CA   . PHE A 1 35 ? 6.175   0.558   2.401   1.00 0.00 ? 35 PHE A CA   4 
ATOM   3374 C C    . PHE A 1 35 ? 5.488   0.298   3.734   1.00 0.00 ? 35 PHE A C    4 
ATOM   3375 O O    . PHE A 1 35 ? 4.359   0.731   3.966   1.00 0.00 ? 35 PHE A O    4 
ATOM   3376 C CB   . PHE A 1 35 ? 6.163   -0.696  1.514   1.00 0.00 ? 35 PHE A CB   4 
ATOM   3377 C CG   . PHE A 1 35 ? 5.328   -1.840  2.025   1.00 0.00 ? 35 PHE A CG   4 
ATOM   3378 C CD1  . PHE A 1 35 ? 5.841   -2.717  2.967   1.00 0.00 ? 35 PHE A CD1  4 
ATOM   3379 C CD2  . PHE A 1 35 ? 4.041   -2.045  1.554   1.00 0.00 ? 35 PHE A CD2  4 
ATOM   3380 C CE1  . PHE A 1 35 ? 5.086   -3.776  3.432   1.00 0.00 ? 35 PHE A CE1  4 
ATOM   3381 C CE2  . PHE A 1 35 ? 3.281   -3.102  2.016   1.00 0.00 ? 35 PHE A CE2  4 
ATOM   3382 C CZ   . PHE A 1 35 ? 3.804   -3.969  2.956   1.00 0.00 ? 35 PHE A CZ   4 
ATOM   3383 H H    . PHE A 1 35 ? 8.276   0.478   2.175   1.00 0.00 ? 35 PHE A H    4 
ATOM   3384 H HA   . PHE A 1 35 ? 5.658   1.351   1.898   1.00 0.00 ? 35 PHE A HA   4 
ATOM   3385 H HB2  . PHE A 1 35 ? 5.791   -0.431  0.537   1.00 0.00 ? 35 PHE A HB2  4 
ATOM   3386 H HB3  . PHE A 1 35 ? 7.178   -1.051  1.419   1.00 0.00 ? 35 PHE A HB3  4 
ATOM   3387 H HD1  . PHE A 1 35 ? 6.842   -2.566  3.342   1.00 0.00 ? 35 PHE A HD1  4 
ATOM   3388 H HD2  . PHE A 1 35 ? 3.632   -1.368  0.819   1.00 0.00 ? 35 PHE A HD2  4 
ATOM   3389 H HE1  . PHE A 1 35 ? 5.500   -4.454  4.164   1.00 0.00 ? 35 PHE A HE1  4 
ATOM   3390 H HE2  . PHE A 1 35 ? 2.280   -3.251  1.641   1.00 0.00 ? 35 PHE A HE2  4 
ATOM   3391 H HZ   . PHE A 1 35 ? 3.211   -4.797  3.318   1.00 0.00 ? 35 PHE A HZ   4 
ATOM   3392 N N    . CYS A 1 36 ? 6.187   -0.409  4.599   1.00 0.00 ? 36 CYS A N    4 
ATOM   3393 C CA   . CYS A 1 36 ? 5.669   -0.739  5.922   1.00 0.00 ? 36 CYS A CA   4 
ATOM   3394 C C    . CYS A 1 36 ? 5.467   0.522   6.759   1.00 0.00 ? 36 CYS A C    4 
ATOM   3395 O O    . CYS A 1 36 ? 4.370   0.783   7.252   1.00 0.00 ? 36 CYS A O    4 
ATOM   3396 C CB   . CYS A 1 36 ? 6.619   -1.697  6.642   1.00 0.00 ? 36 CYS A CB   4 
ATOM   3397 S SG   . CYS A 1 36 ? 5.828   -2.681  7.956   1.00 0.00 ? 36 CYS A SG   4 
ATOM   3398 H H    . CYS A 1 36 ? 7.079   -0.716  4.338   1.00 0.00 ? 36 CYS A H    4 
ATOM   3399 H HA   . CYS A 1 36 ? 4.713   -1.225  5.790   1.00 0.00 ? 36 CYS A HA   4 
ATOM   3400 H HB2  . CYS A 1 36 ? 7.037   -2.386  5.924   1.00 0.00 ? 36 CYS A HB2  4 
ATOM   3401 H HB3  . CYS A 1 36 ? 7.418   -1.127  7.094   1.00 0.00 ? 36 CYS A HB3  4 
ATOM   3402 N N    . GLN A 1 37 ? 6.535   1.298   6.921   1.00 0.00 ? 37 GLN A N    4 
ATOM   3403 C CA   . GLN A 1 37 ? 6.479   2.524   7.700   1.00 0.00 ? 37 GLN A CA   4 
ATOM   3404 C C    . GLN A 1 37 ? 5.579   3.560   7.037   1.00 0.00 ? 37 GLN A C    4 
ATOM   3405 O O    . GLN A 1 37 ? 5.060   4.459   7.698   1.00 0.00 ? 37 GLN A O    4 
ATOM   3406 C CB   . GLN A 1 37 ? 7.883   3.101   7.904   1.00 0.00 ? 37 GLN A CB   4 
ATOM   3407 C CG   . GLN A 1 37 ? 8.662   3.301   6.614   1.00 0.00 ? 37 GLN A CG   4 
ATOM   3408 C CD   . GLN A 1 37 ? 10.005  3.970   6.847   1.00 0.00 ? 37 GLN A CD   4 
ATOM   3409 O OE1  . GLN A 1 37 ? 10.412  4.187   7.988   1.00 0.00 ? 37 GLN A OE1  4 
ATOM   3410 N NE2  . GLN A 1 37 ? 10.702  4.301   5.764   1.00 0.00 ? 37 GLN A NE2  4 
ATOM   3411 H H    . GLN A 1 37 ? 7.377   1.038   6.512   1.00 0.00 ? 37 GLN A H    4 
ATOM   3412 H HA   . GLN A 1 37 ? 6.067   2.271   8.656   1.00 0.00 ? 37 GLN A HA   4 
ATOM   3413 H HB2  . GLN A 1 37 ? 7.795   4.057   8.396   1.00 0.00 ? 37 GLN A HB2  4 
ATOM   3414 H HB3  . GLN A 1 37 ? 8.444   2.431   8.537   1.00 0.00 ? 37 GLN A HB3  4 
ATOM   3415 H HG2  . GLN A 1 37 ? 8.831   2.338   6.158   1.00 0.00 ? 37 GLN A HG2  4 
ATOM   3416 H HG3  . GLN A 1 37 ? 8.079   3.919   5.947   1.00 0.00 ? 37 GLN A HG3  4 
ATOM   3417 H HE21 . GLN A 1 37 ? 10.320  4.100   4.885   1.00 0.00 ? 37 GLN A HE21 4 
ATOM   3418 H HE22 . GLN A 1 37 ? 11.573  4.733   5.889   1.00 0.00 ? 37 GLN A HE22 4 
ATOM   3419 N N    . TYR A 1 38 ? 5.394   3.424   5.729   1.00 0.00 ? 38 TYR A N    4 
ATOM   3420 C CA   . TYR A 1 38 ? 4.549   4.346   4.977   1.00 0.00 ? 38 TYR A CA   4 
ATOM   3421 C C    . TYR A 1 38 ? 3.126   4.355   5.531   1.00 0.00 ? 38 TYR A C    4 
ATOM   3422 O O    . TYR A 1 38 ? 2.356   5.280   5.275   1.00 0.00 ? 38 TYR A O    4 
ATOM   3423 C CB   . TYR A 1 38 ? 4.529   3.960   3.494   1.00 0.00 ? 38 TYR A CB   4 
ATOM   3424 C CG   . TYR A 1 38 ? 5.436   4.804   2.622   1.00 0.00 ? 38 TYR A CG   4 
ATOM   3425 C CD1  . TYR A 1 38 ? 5.585   6.167   2.848   1.00 0.00 ? 38 TYR A CD1  4 
ATOM   3426 C CD2  . TYR A 1 38 ? 6.142   4.234   1.570   1.00 0.00 ? 38 TYR A CD2  4 
ATOM   3427 C CE1  . TYR A 1 38 ? 6.410   6.937   2.051   1.00 0.00 ? 38 TYR A CE1  4 
ATOM   3428 C CE2  . TYR A 1 38 ? 6.970   4.998   0.769   1.00 0.00 ? 38 TYR A CE2  4 
ATOM   3429 C CZ   . TYR A 1 38 ? 7.100   6.348   1.014   1.00 0.00 ? 38 TYR A CZ   4 
ATOM   3430 O OH   . TYR A 1 38 ? 7.922   7.112   0.218   1.00 0.00 ? 38 TYR A OH   4 
ATOM   3431 H H    . TYR A 1 38 ? 5.832   2.685   5.259   1.00 0.00 ? 38 TYR A H    4 
ATOM   3432 H HA   . TYR A 1 38 ? 4.968   5.335   5.079   1.00 0.00 ? 38 TYR A HA   4 
ATOM   3433 H HB2  . TYR A 1 38 ? 4.841   2.931   3.395   1.00 0.00 ? 38 TYR A HB2  4 
ATOM   3434 H HB3  . TYR A 1 38 ? 3.521   4.060   3.118   1.00 0.00 ? 38 TYR A HB3  4 
ATOM   3435 H HD1  . TYR A 1 38 ? 5.045   6.626   3.661   1.00 0.00 ? 38 TYR A HD1  4 
ATOM   3436 H HD2  . TYR A 1 38 ? 6.038   3.177   1.379   1.00 0.00 ? 38 TYR A HD2  4 
ATOM   3437 H HE1  . TYR A 1 38 ? 6.512   7.995   2.244   1.00 0.00 ? 38 TYR A HE1  4 
ATOM   3438 H HE2  . TYR A 1 38 ? 7.510   4.536   -0.044  1.00 0.00 ? 38 TYR A HE2  4 
ATOM   3439 H HH   . TYR A 1 38 ? 7.814   6.850   -0.699  1.00 0.00 ? 38 TYR A HH   4 
ATOM   3440 N N    . ALA A 1 39 ? 2.781   3.314   6.289   1.00 0.00 ? 39 ALA A N    4 
ATOM   3441 C CA   . ALA A 1 39 ? 1.451   3.196   6.875   1.00 0.00 ? 39 ALA A CA   4 
ATOM   3442 C C    . ALA A 1 39 ? 1.047   4.456   7.637   1.00 0.00 ? 39 ALA A C    4 
ATOM   3443 O O    . ALA A 1 39 ? -0.140  4.714   7.839   1.00 0.00 ? 39 ALA A O    4 
ATOM   3444 C CB   . ALA A 1 39 ? 1.390   1.987   7.793   1.00 0.00 ? 39 ALA A CB   4 
ATOM   3445 H H    . ALA A 1 39 ? 3.434   2.604   6.452   1.00 0.00 ? 39 ALA A H    4 
ATOM   3446 H HA   . ALA A 1 39 ? 0.756   3.038   6.072   1.00 0.00 ? 39 ALA A HA   4 
ATOM   3447 H HB1  . ALA A 1 39 ? 1.705   2.273   8.786   1.00 0.00 ? 39 ALA A HB1  4 
ATOM   3448 H HB2  . ALA A 1 39 ? 2.043   1.215   7.416   1.00 0.00 ? 39 ALA A HB2  4 
ATOM   3449 H HB3  . ALA A 1 39 ? 0.377   1.615   7.831   1.00 0.00 ? 39 ALA A HB3  4 
ATOM   3450 N N    . LYS A 1 40 ? 2.035   5.231   8.066   1.00 0.00 ? 40 LYS A N    4 
ATOM   3451 C CA   . LYS A 1 40 ? 1.774   6.457   8.814   1.00 0.00 ? 40 LYS A CA   4 
ATOM   3452 C C    . LYS A 1 40 ? 1.811   7.683   7.908   1.00 0.00 ? 40 LYS A C    4 
ATOM   3453 O O    . LYS A 1 40 ? 1.208   8.711   8.215   1.00 0.00 ? 40 LYS A O    4 
ATOM   3454 C CB   . LYS A 1 40 ? 2.793   6.614   9.944   1.00 0.00 ? 40 LYS A CB   4 
ATOM   3455 C CG   . LYS A 1 40 ? 2.248   7.354   11.156  1.00 0.00 ? 40 LYS A CG   4 
ATOM   3456 C CD   . LYS A 1 40 ? 2.014   6.413   12.327  1.00 0.00 ? 40 LYS A CD   4 
ATOM   3457 C CE   . LYS A 1 40 ? 3.320   6.027   13.001  1.00 0.00 ? 40 LYS A CE   4 
ATOM   3458 N NZ   . LYS A 1 40 ? 3.092   5.337   14.300  1.00 0.00 ? 40 LYS A NZ   4 
ATOM   3459 H H    . LYS A 1 40 ? 2.960   4.970   7.880   1.00 0.00 ? 40 LYS A H    4 
ATOM   3460 H HA   . LYS A 1 40 ? 0.790   6.375   9.242   1.00 0.00 ? 40 LYS A HA   4 
ATOM   3461 H HB2  . LYS A 1 40 ? 3.116   5.633   10.261  1.00 0.00 ? 40 LYS A HB2  4 
ATOM   3462 H HB3  . LYS A 1 40 ? 3.646   7.160   9.570   1.00 0.00 ? 40 LYS A HB3  4 
ATOM   3463 H HG2  . LYS A 1 40 ? 2.959   8.111   11.452  1.00 0.00 ? 40 LYS A HG2  4 
ATOM   3464 H HG3  . LYS A 1 40 ? 1.312   7.822   10.888  1.00 0.00 ? 40 LYS A HG3  4 
ATOM   3465 H HD2  . LYS A 1 40 ? 1.380   6.905   13.050  1.00 0.00 ? 40 LYS A HD2  4 
ATOM   3466 H HD3  . LYS A 1 40 ? 1.526   5.519   11.966  1.00 0.00 ? 40 LYS A HD3  4 
ATOM   3467 H HE2  . LYS A 1 40 ? 3.867   5.366   12.344  1.00 0.00 ? 40 LYS A HE2  4 
ATOM   3468 H HE3  . LYS A 1 40 ? 3.899   6.922   13.174  1.00 0.00 ? 40 LYS A HE3  4 
ATOM   3469 H HZ1  . LYS A 1 40 ? 3.804   4.591   14.439  1.00 0.00 ? 40 LYS A HZ1  4 
ATOM   3470 H HZ2  . LYS A 1 40 ? 2.147   4.905   14.315  1.00 0.00 ? 40 LYS A HZ2  4 
ATOM   3471 H HZ3  . LYS A 1 40 ? 3.162   6.018   15.084  1.00 0.00 ? 40 LYS A HZ3  4 
ATOM   3472 N N    . ASP A 1 41 ? 2.523   7.568   6.794   1.00 0.00 ? 41 ASP A N    4 
ATOM   3473 C CA   . ASP A 1 41 ? 2.643   8.668   5.843   1.00 0.00 ? 41 ASP A CA   4 
ATOM   3474 C C    . ASP A 1 41 ? 1.267   9.122   5.351   1.00 0.00 ? 41 ASP A C    4 
ATOM   3475 O O    . ASP A 1 41 ? 0.605   8.410   4.596   1.00 0.00 ? 41 ASP A O    4 
ATOM   3476 C CB   . ASP A 1 41 ? 3.508   8.242   4.656   1.00 0.00 ? 41 ASP A CB   4 
ATOM   3477 C CG   . ASP A 1 41 ? 3.653   9.338   3.617   1.00 0.00 ? 41 ASP A CG   4 
ATOM   3478 O OD1  . ASP A 1 41 ? 2.740   9.483   2.776   1.00 0.00 ? 41 ASP A OD1  4 
ATOM   3479 O OD2  . ASP A 1 41 ? 4.678   10.050  3.644   1.00 0.00 ? 41 ASP A OD2  4 
ATOM   3480 H H    . ASP A 1 41 ? 2.981   6.724   6.608   1.00 0.00 ? 41 ASP A H    4 
ATOM   3481 H HA   . ASP A 1 41 ? 3.124   9.491   6.348   1.00 0.00 ? 41 ASP A HA   4 
ATOM   3482 H HB2  . ASP A 1 41 ? 4.495   7.982   5.014   1.00 0.00 ? 41 ASP A HB2  4 
ATOM   3483 H HB3  . ASP A 1 41 ? 3.059   7.378   4.183   1.00 0.00 ? 41 ASP A HB3  4 
ATOM   3484 N N    . PRO A 1 42 ? 0.815   10.318  5.774   1.00 0.00 ? 42 PRO A N    4 
ATOM   3485 C CA   . PRO A 1 42 ? -0.482  10.859  5.378   1.00 0.00 ? 42 PRO A CA   4 
ATOM   3486 C C    . PRO A 1 42 ? -0.416  11.671  4.085   1.00 0.00 ? 42 PRO A C    4 
ATOM   3487 O O    . PRO A 1 42 ? -1.446  12.042  3.523   1.00 0.00 ? 42 PRO A O    4 
ATOM   3488 C CB   . PRO A 1 42 ? -0.827  11.762  6.556   1.00 0.00 ? 42 PRO A CB   4 
ATOM   3489 C CG   . PRO A 1 42 ? 0.491   12.286  7.026   1.00 0.00 ? 42 PRO A CG   4 
ATOM   3490 C CD   . PRO A 1 42 ? 1.527   11.240  6.680   1.00 0.00 ? 42 PRO A CD   4 
ATOM   3491 H HA   . PRO A 1 42 ? -1.227  10.084  5.283   1.00 0.00 ? 42 PRO A HA   4 
ATOM   3492 H HB2  . PRO A 1 42 ? -1.476  12.560  6.225   1.00 0.00 ? 42 PRO A HB2  4 
ATOM   3493 H HB3  . PRO A 1 42 ? -1.318  11.185  7.325   1.00 0.00 ? 42 PRO A HB3  4 
ATOM   3494 H HG2  . PRO A 1 42 ? 0.715   13.213  6.520   1.00 0.00 ? 42 PRO A HG2  4 
ATOM   3495 H HG3  . PRO A 1 42 ? 0.461   12.442  8.094   1.00 0.00 ? 42 PRO A HG3  4 
ATOM   3496 H HD2  . PRO A 1 42 ? 2.368   11.696  6.179   1.00 0.00 ? 42 PRO A HD2  4 
ATOM   3497 H HD3  . PRO A 1 42 ? 1.854   10.727  7.572   1.00 0.00 ? 42 PRO A HD3  4 
ATOM   3498 N N    . THR A 1 43 ? 0.801   11.950  3.620   1.00 0.00 ? 43 THR A N    4 
ATOM   3499 C CA   . THR A 1 43 ? 0.995   12.725  2.396   1.00 0.00 ? 43 THR A CA   4 
ATOM   3500 C C    . THR A 1 43 ? 0.183   12.150  1.238   1.00 0.00 ? 43 THR A C    4 
ATOM   3501 O O    . THR A 1 43 ? -0.203  12.874  0.320   1.00 0.00 ? 43 THR A O    4 
ATOM   3502 C CB   . THR A 1 43 ? 2.479   12.772  2.021   1.00 0.00 ? 43 THR A CB   4 
ATOM   3503 O OG1  . THR A 1 43 ? 3.245   11.938  2.876   1.00 0.00 ? 43 THR A OG1  4 
ATOM   3504 C CG2  . THR A 1 43 ? 3.069   14.165  2.088   1.00 0.00 ? 43 THR A CG2  4 
ATOM   3505 H H    . THR A 1 43 ? 1.585   11.633  4.112   1.00 0.00 ? 43 THR A H    4 
ATOM   3506 H HA   . THR A 1 43 ? 0.656   13.731  2.588   1.00 0.00 ? 43 THR A HA   4 
ATOM   3507 H HB   . THR A 1 43 ? 2.594   12.415  1.009   1.00 0.00 ? 43 THR A HB   4 
ATOM   3508 H HG1  . THR A 1 43 ? 3.364   12.370  3.725   1.00 0.00 ? 43 THR A HG1  4 
ATOM   3509 H HG21 . THR A 1 43 ? 3.007   14.629  1.115   1.00 0.00 ? 43 THR A HG21 4 
ATOM   3510 H HG22 . THR A 1 43 ? 4.103   14.104  2.393   1.00 0.00 ? 43 THR A HG22 4 
ATOM   3511 H HG23 . THR A 1 43 ? 2.516   14.756  2.804   1.00 0.00 ? 43 THR A HG23 4 
ATOM   3512 N N    . TYR A 1 44 ? -0.074  10.847  1.285   1.00 0.00 ? 44 TYR A N    4 
ATOM   3513 C CA   . TYR A 1 44 ? -0.840  10.184  0.236   1.00 0.00 ? 44 TYR A CA   4 
ATOM   3514 C C    . TYR A 1 44 ? -2.290  10.659  0.238   1.00 0.00 ? 44 TYR A C    4 
ATOM   3515 O O    . TYR A 1 44 ? -2.780  11.190  -0.758  1.00 0.00 ? 44 TYR A O    4 
ATOM   3516 C CB   . TYR A 1 44 ? -0.785  8.666   0.414   1.00 0.00 ? 44 TYR A CB   4 
ATOM   3517 C CG   . TYR A 1 44 ? 0.612   8.095   0.321   1.00 0.00 ? 44 TYR A CG   4 
ATOM   3518 C CD1  . TYR A 1 44 ? 1.498   8.532   -0.656  1.00 0.00 ? 44 TYR A CD1  4 
ATOM   3519 C CD2  . TYR A 1 44 ? 1.045   7.119   1.210   1.00 0.00 ? 44 TYR A CD2  4 
ATOM   3520 C CE1  . TYR A 1 44 ? 2.776   8.012   -0.745  1.00 0.00 ? 44 TYR A CE1  4 
ATOM   3521 C CE2  . TYR A 1 44 ? 2.321   6.595   1.128   1.00 0.00 ? 44 TYR A CE2  4 
ATOM   3522 C CZ   . TYR A 1 44 ? 3.182   7.044   0.149   1.00 0.00 ? 44 TYR A CZ   4 
ATOM   3523 O OH   . TYR A 1 44 ? 4.453   6.524   0.064   1.00 0.00 ? 44 TYR A OH   4 
ATOM   3524 H H    . TYR A 1 44 ? 0.260   10.319  2.040   1.00 0.00 ? 44 TYR A H    4 
ATOM   3525 H HA   . TYR A 1 44 ? -0.392  10.442  -0.713  1.00 0.00 ? 44 TYR A HA   4 
ATOM   3526 H HB2  . TYR A 1 44 ? -1.184  8.410   1.384   1.00 0.00 ? 44 TYR A HB2  4 
ATOM   3527 H HB3  . TYR A 1 44 ? -1.386  8.200   -0.352  1.00 0.00 ? 44 TYR A HB3  4 
ATOM   3528 H HD1  . TYR A 1 44 ? 1.177   9.291   -1.354  1.00 0.00 ? 44 TYR A HD1  4 
ATOM   3529 H HD2  . TYR A 1 44 ? 0.369   6.769   1.976   1.00 0.00 ? 44 TYR A HD2  4 
ATOM   3530 H HE1  . TYR A 1 44 ? 3.450   8.364   -1.511  1.00 0.00 ? 44 TYR A HE1  4 
ATOM   3531 H HE2  . TYR A 1 44 ? 2.639   5.837   1.829   1.00 0.00 ? 44 TYR A HE2  4 
ATOM   3532 H HH   . TYR A 1 44 ? 5.072   7.224   -0.157  1.00 0.00 ? 44 TYR A HH   4 
ATOM   3533 N N    . GLY A 1 45 ? -2.971  10.467  1.364   1.00 0.00 ? 45 GLY A N    4 
ATOM   3534 C CA   . GLY A 1 45 ? -4.357  10.885  1.473   1.00 0.00 ? 45 GLY A CA   4 
ATOM   3535 C C    . GLY A 1 45 ? -5.299  9.725   1.731   1.00 0.00 ? 45 GLY A C    4 
ATOM   3536 O O    . GLY A 1 45 ? -5.941  9.222   0.809   1.00 0.00 ? 45 GLY A O    4 
ATOM   3537 H H    . GLY A 1 45 ? -2.528  10.040  2.127   1.00 0.00 ? 45 GLY A H    4 
ATOM   3538 H HA2  . GLY A 1 45 ? -4.445  11.593  2.284   1.00 0.00 ? 45 GLY A HA2  4 
ATOM   3539 H HA3  . GLY A 1 45 ? -4.648  11.372  0.553   1.00 0.00 ? 45 GLY A HA3  4 
ATOM   3540 N N    . GLN A 1 46 ? -5.383  9.301   2.988   1.00 0.00 ? 46 GLN A N    4 
ATOM   3541 C CA   . GLN A 1 46 ? -6.254  8.196   3.368   1.00 0.00 ? 46 GLN A CA   4 
ATOM   3542 C C    . GLN A 1 46 ? -5.900  6.934   2.591   1.00 0.00 ? 46 GLN A C    4 
ATOM   3543 O O    . GLN A 1 46 ? -6.723  6.033   2.431   1.00 0.00 ? 46 GLN A O    4 
ATOM   3544 C CB   . GLN A 1 46 ? -7.703  8.577   3.107   1.00 0.00 ? 46 GLN A CB   4 
ATOM   3545 C CG   . GLN A 1 46 ? -8.705  7.777   3.924   1.00 0.00 ? 46 GLN A CG   4 
ATOM   3546 C CD   . GLN A 1 46 ? -9.844  7.237   3.082   1.00 0.00 ? 46 GLN A CD   4 
ATOM   3547 O OE1  . GLN A 1 46 ? -11.014 7.366   3.443   1.00 0.00 ? 46 GLN A OE1  4 
ATOM   3548 N NE2  . GLN A 1 46 ? -9.508  6.626   1.952   1.00 0.00 ? 46 GLN A NE2  4 
ATOM   3549 H H    . GLN A 1 46 ? -4.851  9.742   3.674   1.00 0.00 ? 46 GLN A H    4 
ATOM   3550 H HA   . GLN A 1 46 ? -6.120  8.010   4.422   1.00 0.00 ? 46 GLN A HA   4 
ATOM   3551 H HB2  . GLN A 1 46 ? -7.826  9.623   3.343   1.00 0.00 ? 46 GLN A HB2  4 
ATOM   3552 H HB3  . GLN A 1 46 ? -7.915  8.425   2.061   1.00 0.00 ? 46 GLN A HB3  4 
ATOM   3553 H HG2  . GLN A 1 46 ? -8.192  6.945   4.384   1.00 0.00 ? 46 GLN A HG2  4 
ATOM   3554 H HG3  . GLN A 1 46 ? -9.115  8.415   4.692   1.00 0.00 ? 46 GLN A HG3  4 
ATOM   3555 H HE21 . GLN A 1 46 ? -8.552  6.560   1.727   1.00 0.00 ? 46 GLN A HE21 4 
ATOM   3556 H HE22 . GLN A 1 46 ? -10.229 6.267   1.386   1.00 0.00 ? 46 GLN A HE22 4 
ATOM   3557 N N    . TYR A 1 47 ? -4.669  6.889   2.105   1.00 0.00 ? 47 TYR A N    4 
ATOM   3558 C CA   . TYR A 1 47 ? -4.185  5.756   1.333   1.00 0.00 ? 47 TYR A CA   4 
ATOM   3559 C C    . TYR A 1 47 ? -4.113  4.500   2.195   1.00 0.00 ? 47 TYR A C    4 
ATOM   3560 O O    . TYR A 1 47 ? -4.678  3.462   1.851   1.00 0.00 ? 47 TYR A O    4 
ATOM   3561 C CB   . TYR A 1 47 ? -2.809  6.070   0.774   1.00 0.00 ? 47 TYR A CB   4 
ATOM   3562 C CG   . TYR A 1 47 ? -2.474  5.317   -0.487  1.00 0.00 ? 47 TYR A CG   4 
ATOM   3563 C CD1  . TYR A 1 47 ? -2.864  5.807   -1.724  1.00 0.00 ? 47 TYR A CD1  4 
ATOM   3564 C CD2  . TYR A 1 47 ? -1.764  4.126   -0.443  1.00 0.00 ? 47 TYR A CD2  4 
ATOM   3565 C CE1  . TYR A 1 47 ? -2.558  5.128   -2.888  1.00 0.00 ? 47 TYR A CE1  4 
ATOM   3566 C CE2  . TYR A 1 47 ? -1.452  3.441   -1.601  1.00 0.00 ? 47 TYR A CE2  4 
ATOM   3567 C CZ   . TYR A 1 47 ? -1.851  3.945   -2.821  1.00 0.00 ? 47 TYR A CZ   4 
ATOM   3568 O OH   . TYR A 1 47 ? -1.541  3.266   -3.976  1.00 0.00 ? 47 TYR A OH   4 
ATOM   3569 H H    . TYR A 1 47 ? -4.070  7.644   2.264   1.00 0.00 ? 47 TYR A H    4 
ATOM   3570 H HA   . TYR A 1 47 ? -4.858  5.587   0.521   1.00 0.00 ? 47 TYR A HA   4 
ATOM   3571 H HB2  . TYR A 1 47 ? -2.744  7.128   0.560   1.00 0.00 ? 47 TYR A HB2  4 
ATOM   3572 H HB3  . TYR A 1 47 ? -2.080  5.808   1.514   1.00 0.00 ? 47 TYR A HB3  4 
ATOM   3573 H HD1  . TYR A 1 47 ? -3.418  6.735   -1.768  1.00 0.00 ? 47 TYR A HD1  4 
ATOM   3574 H HD2  . TYR A 1 47 ? -1.455  3.735   0.515   1.00 0.00 ? 47 TYR A HD2  4 
ATOM   3575 H HE1  . TYR A 1 47 ? -2.871  5.524   -3.842  1.00 0.00 ? 47 TYR A HE1  4 
ATOM   3576 H HE2  . TYR A 1 47 ? -0.899  2.515   -1.548  1.00 0.00 ? 47 TYR A HE2  4 
ATOM   3577 H HH   . TYR A 1 47 ? -1.629  2.322   -3.826  1.00 0.00 ? 47 TYR A HH   4 
ATOM   3578 N N    . ILE A 1 48 ? -3.403  4.605   3.313   1.00 0.00 ? 48 ILE A N    4 
ATOM   3579 C CA   . ILE A 1 48 ? -3.238  3.486   4.227   1.00 0.00 ? 48 ILE A CA   4 
ATOM   3580 C C    . ILE A 1 48 ? -4.534  3.171   4.968   1.00 0.00 ? 48 ILE A C    4 
ATOM   3581 O O    . ILE A 1 48 ? -4.846  2.007   5.218   1.00 0.00 ? 48 ILE A O    4 
ATOM   3582 C CB   . ILE A 1 48 ? -2.124  3.767   5.254   1.00 0.00 ? 48 ILE A CB   4 
ATOM   3583 C CG1  . ILE A 1 48 ? -0.835  4.174   4.535   1.00 0.00 ? 48 ILE A CG1  4 
ATOM   3584 C CG2  . ILE A 1 48 ? -1.888  2.548   6.137   1.00 0.00 ? 48 ILE A CG2  4 
ATOM   3585 C CD1  . ILE A 1 48 ? -0.177  3.039   3.777   1.00 0.00 ? 48 ILE A CD1  4 
ATOM   3586 H H    . ILE A 1 48 ? -2.971  5.457   3.524   1.00 0.00 ? 48 ILE A H    4 
ATOM   3587 H HA   . ILE A 1 48 ? -2.950  2.625   3.645   1.00 0.00 ? 48 ILE A HA   4 
ATOM   3588 H HB   . ILE A 1 48 ? -2.446  4.580   5.887   1.00 0.00 ? 48 ILE A HB   4 
ATOM   3589 H HG12 . ILE A 1 48 ? -1.059  4.957   3.827   1.00 0.00 ? 48 ILE A HG12 4 
ATOM   3590 H HG13 . ILE A 1 48 ? -0.127  4.544   5.261   1.00 0.00 ? 48 ILE A HG13 4 
ATOM   3591 H HG21 . ILE A 1 48 ? -1.086  2.755   6.830   1.00 0.00 ? 48 ILE A HG21 4 
ATOM   3592 H HG22 . ILE A 1 48 ? -1.621  1.703   5.519   1.00 0.00 ? 48 ILE A HG22 4 
ATOM   3593 H HG23 . ILE A 1 48 ? -2.790  2.322   6.686   1.00 0.00 ? 48 ILE A HG23 4 
ATOM   3594 H HD11 . ILE A 1 48 ? -0.744  2.828   2.882   1.00 0.00 ? 48 ILE A HD11 4 
ATOM   3595 H HD12 . ILE A 1 48 ? -0.149  2.157   4.400   1.00 0.00 ? 48 ILE A HD12 4 
ATOM   3596 H HD13 . ILE A 1 48 ? 0.829   3.322   3.507   1.00 0.00 ? 48 ILE A HD13 4 
ATOM   3597 N N    . ARG A 1 49 ? -5.285  4.210   5.324   1.00 0.00 ? 49 ARG A N    4 
ATOM   3598 C CA   . ARG A 1 49 ? -6.544  4.028   6.043   1.00 0.00 ? 49 ARG A CA   4 
ATOM   3599 C C    . ARG A 1 49 ? -7.689  3.656   5.108   1.00 0.00 ? 49 ARG A C    4 
ATOM   3600 O O    . ARG A 1 49 ? -8.858  3.890   5.417   1.00 0.00 ? 49 ARG A O    4 
ATOM   3601 C CB   . ARG A 1 49 ? -6.900  5.289   6.833   1.00 0.00 ? 49 ARG A CB   4 
ATOM   3602 C CG   . ARG A 1 49 ? -5.734  5.865   7.620   1.00 0.00 ? 49 ARG A CG   4 
ATOM   3603 C CD   . ARG A 1 49 ? -5.902  7.359   7.851   1.00 0.00 ? 49 ARG A CD   4 
ATOM   3604 N NE   . ARG A 1 49 ? -5.607  7.736   9.232   1.00 0.00 ? 49 ARG A NE   4 
ATOM   3605 C CZ   . ARG A 1 49 ? -5.741  8.972   9.707   1.00 0.00 ? 49 ARG A CZ   4 
ATOM   3606 N NH1  . ARG A 1 49 ? -6.163  9.952   8.917   1.00 0.00 ? 49 ARG A NH1  4 
ATOM   3607 N NH2  . ARG A 1 49 ? -5.451  9.230   10.975  1.00 0.00 ? 49 ARG A NH2  4 
ATOM   3608 H H    . ARG A 1 49 ? -4.986  5.117   5.102   1.00 0.00 ? 49 ARG A H    4 
ATOM   3609 H HA   . ARG A 1 49 ? -6.401  3.214   6.727   1.00 0.00 ? 49 ARG A HA   4 
ATOM   3610 H HB2  . ARG A 1 49 ? -7.249  6.044   6.144   1.00 0.00 ? 49 ARG A HB2  4 
ATOM   3611 H HB3  . ARG A 1 49 ? -7.693  5.053   7.526   1.00 0.00 ? 49 ARG A HB3  4 
ATOM   3612 H HG2  . ARG A 1 49 ? -5.677  5.368   8.577   1.00 0.00 ? 49 ARG A HG2  4 
ATOM   3613 H HG3  . ARG A 1 49 ? -4.821  5.696   7.069   1.00 0.00 ? 49 ARG A HG3  4 
ATOM   3614 H HD2  . ARG A 1 49 ? -5.231  7.889   7.193   1.00 0.00 ? 49 ARG A HD2  4 
ATOM   3615 H HD3  . ARG A 1 49 ? -6.921  7.634   7.623   1.00 0.00 ? 49 ARG A HD3  4 
ATOM   3616 H HE   . ARG A 1 49 ? -5.293  7.032   9.836   1.00 0.00 ? 49 ARG A HE   4 
ATOM   3617 H HH11 . ARG A 1 49 ? -6.382  9.765   7.960   1.00 0.00 ? 49 ARG A HH11 4 
ATOM   3618 H HH12 . ARG A 1 49 ? -6.262  10.879  9.280   1.00 0.00 ? 49 ARG A HH12 4 
ATOM   3619 H HH21 . ARG A 1 49 ? -5.132  8.496   11.574  1.00 0.00 ? 49 ARG A HH21 4 
ATOM   3620 H HH22 . ARG A 1 49 ? -5.552  10.159  11.332  1.00 0.00 ? 49 ARG A HH22 4 
ATOM   3621 N N    . SER A 1 50 ? -7.349  3.065   3.977   1.00 0.00 ? 50 SER A N    4 
ATOM   3622 C CA   . SER A 1 50 ? -8.341  2.642   3.003   1.00 0.00 ? 50 SER A CA   4 
ATOM   3623 C C    . SER A 1 50 ? -8.955  1.304   3.406   1.00 0.00 ? 50 SER A C    4 
ATOM   3624 O O    . SER A 1 50 ? -8.333  0.521   4.124   1.00 0.00 ? 50 SER A O    4 
ATOM   3625 C CB   . SER A 1 50 ? -7.712  2.536   1.625   1.00 0.00 ? 50 SER A CB   4 
ATOM   3626 O OG   . SER A 1 50 ? -8.651  2.841   0.608   1.00 0.00 ? 50 SER A OG   4 
ATOM   3627 H H    . SER A 1 50 ? -6.407  2.893   3.799   1.00 0.00 ? 50 SER A H    4 
ATOM   3628 H HA   . SER A 1 50 ? -9.115  3.382   2.972   1.00 0.00 ? 50 SER A HA   4 
ATOM   3629 H HB2  . SER A 1 50 ? -6.882  3.225   1.553   1.00 0.00 ? 50 SER A HB2  4 
ATOM   3630 H HB3  . SER A 1 50 ? -7.364  1.533   1.486   1.00 0.00 ? 50 SER A HB3  4 
ATOM   3631 H HG   . SER A 1 50 ? -8.296  3.531   0.042   1.00 0.00 ? 50 SER A HG   4 
ATOM   3632 N N    . PRO A 1 51 ? -10.179 1.012   2.937   1.00 0.00 ? 51 PRO A N    4 
ATOM   3633 C CA   . PRO A 1 51 ? -10.851 -0.241  3.242   1.00 0.00 ? 51 PRO A CA   4 
ATOM   3634 C C    . PRO A 1 51 ? -10.368 -1.379  2.350   1.00 0.00 ? 51 PRO A C    4 
ATOM   3635 O O    . PRO A 1 51 ? -10.191 -2.511  2.800   1.00 0.00 ? 51 PRO A O    4 
ATOM   3636 C CB   . PRO A 1 51 ? -12.332 0.060   2.983   1.00 0.00 ? 51 PRO A CB   4 
ATOM   3637 C CG   . PRO A 1 51 ? -12.385 1.328   2.181   1.00 0.00 ? 51 PRO A CG   4 
ATOM   3638 C CD   . PRO A 1 51 ? -10.983 1.866   2.053   1.00 0.00 ? 51 PRO A CD   4 
ATOM   3639 H HA   . PRO A 1 51 ? -10.714 -0.519  4.278   1.00 0.00 ? 51 PRO A HA   4 
ATOM   3640 H HB2  . PRO A 1 51 ? -12.772 -0.762  2.438   1.00 0.00 ? 51 PRO A HB2  4 
ATOM   3641 H HB3  . PRO A 1 51 ? -12.842 0.176   3.928   1.00 0.00 ? 51 PRO A HB3  4 
ATOM   3642 H HG2  . PRO A 1 51 ? -12.786 1.120   1.199   1.00 0.00 ? 51 PRO A HG2  4 
ATOM   3643 H HG3  . PRO A 1 51 ? -13.012 2.047   2.688   1.00 0.00 ? 51 PRO A HG3  4 
ATOM   3644 H HD2  . PRO A 1 51 ? -10.645 1.780   1.031   1.00 0.00 ? 51 PRO A HD2  4 
ATOM   3645 H HD3  . PRO A 1 51 ? -10.946 2.896   2.376   1.00 0.00 ? 51 PRO A HD3  4 
ATOM   3646 N N    . HIS A 1 52 ? -10.172 -1.062  1.076   1.00 0.00 ? 52 HIS A N    4 
ATOM   3647 C CA   . HIS A 1 52 ? -9.725  -2.038  0.088   1.00 0.00 ? 52 HIS A CA   4 
ATOM   3648 C C    . HIS A 1 52 ? -8.217  -2.254  0.155   1.00 0.00 ? 52 HIS A C    4 
ATOM   3649 O O    . HIS A 1 52 ? -7.721  -3.341  -0.143  1.00 0.00 ? 52 HIS A O    4 
ATOM   3650 C CB   . HIS A 1 52 ? -10.133 -1.586  -1.320  1.00 0.00 ? 52 HIS A CB   4 
ATOM   3651 C CG   . HIS A 1 52 ? -11.304 -0.647  -1.330  1.00 0.00 ? 52 HIS A CG   4 
ATOM   3652 N ND1  . HIS A 1 52 ? -11.413 0.421   -2.195  1.00 0.00 ? 52 HIS A ND1  4 
ATOM   3653 C CD2  . HIS A 1 52 ? -12.412 -0.611  -0.552  1.00 0.00 ? 52 HIS A CD2  4 
ATOM   3654 C CE1  . HIS A 1 52 ? -12.536 1.073   -1.945  1.00 0.00 ? 52 HIS A CE1  4 
ATOM   3655 N NE2  . HIS A 1 52 ? -13.159 0.464   -0.956  1.00 0.00 ? 52 HIS A NE2  4 
ATOM   3656 H H    . HIS A 1 52 ? -10.341 -0.142  0.789   1.00 0.00 ? 52 HIS A H    4 
ATOM   3657 H HA   . HIS A 1 52 ? -10.212 -2.970  0.308   1.00 0.00 ? 52 HIS A HA   4 
ATOM   3658 H HB2  . HIS A 1 52 ? -9.299  -1.081  -1.785  1.00 0.00 ? 52 HIS A HB2  4 
ATOM   3659 H HB3  . HIS A 1 52 ? -10.396 -2.453  -1.908  1.00 0.00 ? 52 HIS A HB3  4 
ATOM   3660 H HD1  . HIS A 1 52 ? -10.764 0.667   -2.886  1.00 0.00 ? 52 HIS A HD1  4 
ATOM   3661 H HD2  . HIS A 1 52 ? -12.650 -1.290  0.253   1.00 0.00 ? 52 HIS A HD2  4 
ATOM   3662 H HE1  . HIS A 1 52 ? -12.878 1.960   -2.450  1.00 0.00 ? 52 HIS A HE1  4 
ATOM   3663 H HE2  . HIS A 1 52 ? -13.981 0.781   -0.526  1.00 0.00 ? 52 HIS A HE2  4 
ATOM   3664 N N    . ALA A 1 53 ? -7.495  -1.211  0.537   1.00 0.00 ? 53 ALA A N    4 
ATOM   3665 C CA   . ALA A 1 53 ? -6.042  -1.275  0.634   1.00 0.00 ? 53 ALA A CA   4 
ATOM   3666 C C    . ALA A 1 53 ? -5.590  -2.437  1.505   1.00 0.00 ? 53 ALA A C    4 
ATOM   3667 O O    . ALA A 1 53 ? -4.633  -3.140  1.180   1.00 0.00 ? 53 ALA A O    4 
ATOM   3668 C CB   . ALA A 1 53 ? -5.486  0.035   1.171   1.00 0.00 ? 53 ALA A CB   4 
ATOM   3669 H H    . ALA A 1 53 ? -7.951  -0.375  0.752   1.00 0.00 ? 53 ALA A H    4 
ATOM   3670 H HA   . ALA A 1 53 ? -5.659  -1.418  -0.355  1.00 0.00 ? 53 ALA A HA   4 
ATOM   3671 H HB1  . ALA A 1 53 ? -4.410  -0.028  1.229   1.00 0.00 ? 53 ALA A HB1  4 
ATOM   3672 H HB2  . ALA A 1 53 ? -5.889  0.220   2.156   1.00 0.00 ? 53 ALA A HB2  4 
ATOM   3673 H HB3  . ALA A 1 53 ? -5.765  0.842   0.510   1.00 0.00 ? 53 ALA A HB3  4 
ATOM   3674 N N    . ARG A 1 54 ? -6.286  -2.628  2.612   1.00 0.00 ? 54 ARG A N    4 
ATOM   3675 C CA   . ARG A 1 54 ? -5.972  -3.692  3.542   1.00 0.00 ? 54 ARG A CA   4 
ATOM   3676 C C    . ARG A 1 54 ? -6.216  -5.056  2.906   1.00 0.00 ? 54 ARG A C    4 
ATOM   3677 O O    . ARG A 1 54 ? -5.546  -6.035  3.233   1.00 0.00 ? 54 ARG A O    4 
ATOM   3678 C CB   . ARG A 1 54 ? -6.801  -3.518  4.819   1.00 0.00 ? 54 ARG A CB   4 
ATOM   3679 C CG   . ARG A 1 54 ? -7.275  -4.821  5.433   1.00 0.00 ? 54 ARG A CG   4 
ATOM   3680 C CD   . ARG A 1 54 ? -7.858  -4.601  6.817   1.00 0.00 ? 54 ARG A CD   4 
ATOM   3681 N NE   . ARG A 1 54 ? -9.258  -4.190  6.762   1.00 0.00 ? 54 ARG A NE   4 
ATOM   3682 C CZ   . ARG A 1 54 ? -10.097 -4.274  7.792   1.00 0.00 ? 54 ARG A CZ   4 
ATOM   3683 N NH1  . ARG A 1 54 ? -9.681  -4.753  8.958   1.00 0.00 ? 54 ARG A NH1  4 
ATOM   3684 N NH2  . ARG A 1 54 ? -11.355 -3.877  7.657   1.00 0.00 ? 54 ARG A NH2  4 
ATOM   3685 H H    . ARG A 1 54 ? -7.028  -2.036  2.810   1.00 0.00 ? 54 ARG A H    4 
ATOM   3686 H HA   . ARG A 1 54 ? -4.935  -3.608  3.786   1.00 0.00 ? 54 ARG A HA   4 
ATOM   3687 H HB2  . ARG A 1 54 ? -6.202  -3.000  5.553   1.00 0.00 ? 54 ARG A HB2  4 
ATOM   3688 H HB3  . ARG A 1 54 ? -7.669  -2.918  4.590   1.00 0.00 ? 54 ARG A HB3  4 
ATOM   3689 H HG2  . ARG A 1 54 ? -8.032  -5.248  4.795   1.00 0.00 ? 54 ARG A HG2  4 
ATOM   3690 H HG3  . ARG A 1 54 ? -6.435  -5.496  5.504   1.00 0.00 ? 54 ARG A HG3  4 
ATOM   3691 H HD2  . ARG A 1 54 ? -7.784  -5.522  7.376   1.00 0.00 ? 54 ARG A HD2  4 
ATOM   3692 H HD3  . ARG A 1 54 ? -7.286  -3.832  7.315   1.00 0.00 ? 54 ARG A HD3  4 
ATOM   3693 H HE   . ARG A 1 54 ? -9.591  -3.832  5.912   1.00 0.00 ? 54 ARG A HE   4 
ATOM   3694 H HH11 . ARG A 1 54 ? -8.734  -5.053  9.067   1.00 0.00 ? 54 ARG A HH11 4 
ATOM   3695 H HH12 . ARG A 1 54 ? -10.316 -4.813  9.728   1.00 0.00 ? 54 ARG A HH12 4 
ATOM   3696 H HH21 . ARG A 1 54 ? -11.673 -3.515  6.781   1.00 0.00 ? 54 ARG A HH21 4 
ATOM   3697 H HH22 . ARG A 1 54 ? -11.985 -3.940  8.431   1.00 0.00 ? 54 ARG A HH22 4 
ATOM   3698 N N    . ASP A 1 55 ? -7.178  -5.108  1.996   1.00 0.00 ? 55 ASP A N    4 
ATOM   3699 C CA   . ASP A 1 55 ? -7.512  -6.346  1.309   1.00 0.00 ? 55 ASP A CA   4 
ATOM   3700 C C    . ASP A 1 55 ? -6.406  -6.741  0.346   1.00 0.00 ? 55 ASP A C    4 
ATOM   3701 O O    . ASP A 1 55 ? -6.056  -7.915  0.224   1.00 0.00 ? 55 ASP A O    4 
ATOM   3702 C CB   . ASP A 1 55 ? -8.826  -6.202  0.559   1.00 0.00 ? 55 ASP A CB   4 
ATOM   3703 C CG   . ASP A 1 55 ? -9.526  -7.531  0.354   1.00 0.00 ? 55 ASP A CG   4 
ATOM   3704 O OD1  . ASP A 1 55 ? -9.012  -8.358  -0.429  1.00 0.00 ? 55 ASP A OD1  4 
ATOM   3705 O OD2  . ASP A 1 55 ? -10.587 -7.745  0.976   1.00 0.00 ? 55 ASP A OD2  4 
ATOM   3706 H H    . ASP A 1 55 ? -7.671  -4.294  1.781   1.00 0.00 ? 55 ASP A H    4 
ATOM   3707 H HA   . ASP A 1 55 ? -7.616  -7.110  2.041   1.00 0.00 ? 55 ASP A HA   4 
ATOM   3708 H HB2  . ASP A 1 55 ? -9.484  -5.547  1.113   1.00 0.00 ? 55 ASP A HB2  4 
ATOM   3709 H HB3  . ASP A 1 55 ? -8.621  -5.775  -0.404  1.00 0.00 ? 55 ASP A HB3  4 
ATOM   3710 N N    . THR A 1 56 ? -5.859  -5.746  -0.331  1.00 0.00 ? 56 THR A N    4 
ATOM   3711 C CA   . THR A 1 56 ? -4.788  -5.962  -1.286  1.00 0.00 ? 56 THR A CA   4 
ATOM   3712 C C    . THR A 1 56 ? -3.592  -6.631  -0.620  1.00 0.00 ? 56 THR A C    4 
ATOM   3713 O O    . THR A 1 56 ? -3.060  -7.620  -1.126  1.00 0.00 ? 56 THR A O    4 
ATOM   3714 C CB   . THR A 1 56 ? -4.367  -4.642  -1.910  1.00 0.00 ? 56 THR A CB   4 
ATOM   3715 O OG1  . THR A 1 56 ? -5.477  -3.775  -2.057  1.00 0.00 ? 56 THR A OG1  4 
ATOM   3716 C CG2  . THR A 1 56 ? -3.719  -4.798  -3.269  1.00 0.00 ? 56 THR A CG2  4 
ATOM   3717 H H    . THR A 1 56 ? -6.186  -4.841  -0.182  1.00 0.00 ? 56 THR A H    4 
ATOM   3718 H HA   . THR A 1 56 ? -5.160  -6.599  -2.056  1.00 0.00 ? 56 THR A HA   4 
ATOM   3719 H HB   . THR A 1 56 ? -3.658  -4.176  -1.259  1.00 0.00 ? 56 THR A HB   4 
ATOM   3720 H HG1  . THR A 1 56 ? -5.172  -2.865  -2.087  1.00 0.00 ? 56 THR A HG1  4 
ATOM   3721 H HG21 . THR A 1 56 ? -4.480  -4.779  -4.035  1.00 0.00 ? 56 THR A HG21 4 
ATOM   3722 H HG22 . THR A 1 56 ? -3.190  -5.739  -3.310  1.00 0.00 ? 56 THR A HG22 4 
ATOM   3723 H HG23 . THR A 1 56 ? -3.024  -3.987  -3.432  1.00 0.00 ? 56 THR A HG23 4 
ATOM   3724 N N    . LEU A 1 57 ? -3.173  -6.086  0.518   1.00 0.00 ? 57 LEU A N    4 
ATOM   3725 C CA   . LEU A 1 57 ? -2.042  -6.629  1.252   1.00 0.00 ? 57 LEU A CA   4 
ATOM   3726 C C    . LEU A 1 57 ? -2.295  -8.075  1.645   1.00 0.00 ? 57 LEU A C    4 
ATOM   3727 O O    . LEU A 1 57 ? -1.470  -8.955  1.396   1.00 0.00 ? 57 LEU A O    4 
ATOM   3728 C CB   . LEU A 1 57 ? -1.756  -5.781  2.489   1.00 0.00 ? 57 LEU A CB   4 
ATOM   3729 C CG   . LEU A 1 57 ? -0.541  -4.862  2.372   1.00 0.00 ? 57 LEU A CG   4 
ATOM   3730 C CD1  . LEU A 1 57 ? -0.959  -3.403  2.460   1.00 0.00 ? 57 LEU A CD1  4 
ATOM   3731 C CD2  . LEU A 1 57 ? 0.488   -5.189  3.444   1.00 0.00 ? 57 LEU A CD2  4 
ATOM   3732 H H    . LEU A 1 57 ? -3.633  -5.300  0.870   1.00 0.00 ? 57 LEU A H    4 
ATOM   3733 H HA   . LEU A 1 57 ? -1.197  -6.592  0.608   1.00 0.00 ? 57 LEU A HA   4 
ATOM   3734 H HB2  . LEU A 1 57 ? -2.623  -5.171  2.677   1.00 0.00 ? 57 LEU A HB2  4 
ATOM   3735 H HB3  . LEU A 1 57 ? -1.603  -6.442  3.330   1.00 0.00 ? 57 LEU A HB3  4 
ATOM   3736 H HG   . LEU A 1 57 ? -0.083  -5.018  1.411   1.00 0.00 ? 57 LEU A HG   4 
ATOM   3737 H HD11 . LEU A 1 57 ? -0.344  -2.812  1.798   1.00 0.00 ? 57 LEU A HD11 4 
ATOM   3738 H HD12 . LEU A 1 57 ? -0.835  -3.053  3.475   1.00 0.00 ? 57 LEU A HD12 4 
ATOM   3739 H HD13 . LEU A 1 57 ? -1.995  -3.307  2.170   1.00 0.00 ? 57 LEU A HD13 4 
ATOM   3740 H HD21 . LEU A 1 57 ? 1.000   -6.104  3.185   1.00 0.00 ? 57 LEU A HD21 4 
ATOM   3741 H HD22 . LEU A 1 57 ? -0.009  -5.312  4.395   1.00 0.00 ? 57 LEU A HD22 4 
ATOM   3742 H HD23 . LEU A 1 57 ? 1.203   -4.383  3.513   1.00 0.00 ? 57 LEU A HD23 4 
ATOM   3743 N N    . THR A 1 58 ? -3.444  -8.311  2.253   1.00 0.00 ? 58 THR A N    4 
ATOM   3744 C CA   . THR A 1 58 ? -3.824  -9.647  2.680   1.00 0.00 ? 58 THR A CA   4 
ATOM   3745 C C    . THR A 1 58 ? -3.906  -10.581 1.483   1.00 0.00 ? 58 THR A C    4 
ATOM   3746 O O    . THR A 1 58 ? -3.400  -11.702 1.522   1.00 0.00 ? 58 THR A O    4 
ATOM   3747 C CB   . THR A 1 58 ? -5.161  -9.617  3.421   1.00 0.00 ? 58 THR A CB   4 
ATOM   3748 O OG1  . THR A 1 58 ? -5.190  -8.558  4.361   1.00 0.00 ? 58 THR A OG1  4 
ATOM   3749 C CG2  . THR A 1 58 ? -5.461  -10.900 4.166   1.00 0.00 ? 58 THR A CG2  4 
ATOM   3750 H H    . THR A 1 58 ? -4.051  -7.569  2.415   1.00 0.00 ? 58 THR A H    4 
ATOM   3751 H HA   . THR A 1 58 ? -3.057  -10.004 3.343   1.00 0.00 ? 58 THR A HA   4 
ATOM   3752 H HB   . THR A 1 58 ? -5.955  -9.457  2.705   1.00 0.00 ? 58 THR A HB   4 
ATOM   3753 H HG1  . THR A 1 58 ? -4.370  -8.551  4.861   1.00 0.00 ? 58 THR A HG1  4 
ATOM   3754 H HG21 . THR A 1 58 ? -6.468  -10.863 4.555   1.00 0.00 ? 58 THR A HG21 4 
ATOM   3755 H HG22 . THR A 1 58 ? -4.763  -11.015 4.982   1.00 0.00 ? 58 THR A HG22 4 
ATOM   3756 H HG23 . THR A 1 58 ? -5.367  -11.738 3.491   1.00 0.00 ? 58 THR A HG23 4 
ATOM   3757 N N    . SER A 1 59 ? -4.525  -10.103 0.407   1.00 0.00 ? 59 SER A N    4 
ATOM   3758 C CA   . SER A 1 59 ? -4.644  -10.884 -0.809  1.00 0.00 ? 59 SER A CA   4 
ATOM   3759 C C    . SER A 1 59 ? -3.281  -11.421 -1.208  1.00 0.00 ? 59 SER A C    4 
ATOM   3760 O O    . SER A 1 59 ? -3.158  -12.502 -1.785  1.00 0.00 ? 59 SER A O    4 
ATOM   3761 C CB   . SER A 1 59 ? -5.207  -10.021 -1.920  1.00 0.00 ? 59 SER A CB   4 
ATOM   3762 O OG   . SER A 1 59 ? -5.865  -10.805 -2.900  1.00 0.00 ? 59 SER A OG   4 
ATOM   3763 H H    . SER A 1 59 ? -4.890  -9.197  0.423   1.00 0.00 ? 59 SER A H    4 
ATOM   3764 H HA   . SER A 1 59 ? -5.307  -11.697 -0.625  1.00 0.00 ? 59 SER A HA   4 
ATOM   3765 H HB2  . SER A 1 59 ? -5.907  -9.315  -1.502  1.00 0.00 ? 59 SER A HB2  4 
ATOM   3766 H HB3  . SER A 1 59 ? -4.397  -9.495  -2.381  1.00 0.00 ? 59 SER A HB3  4 
ATOM   3767 H HG   . SER A 1 59 ? -5.341  -10.820 -3.703  1.00 0.00 ? 59 SER A HG   4 
ATOM   3768 N N    . CYS A 1 60 ? -2.261  -10.644 -0.874  1.00 0.00 ? 60 CYS A N    4 
ATOM   3769 C CA   . CYS A 1 60 ? -0.889  -11.000 -1.160  1.00 0.00 ? 60 CYS A CA   4 
ATOM   3770 C C    . CYS A 1 60 ? -0.405  -12.064 -0.180  1.00 0.00 ? 60 CYS A C    4 
ATOM   3771 O O    . CYS A 1 60 ? 0.312   -12.991 -0.558  1.00 0.00 ? 60 CYS A O    4 
ATOM   3772 C CB   . CYS A 1 60 ? -0.018  -9.751  -1.062  1.00 0.00 ? 60 CYS A CB   4 
ATOM   3773 S SG   . CYS A 1 60 ? 1.281   -9.643  -2.335  1.00 0.00 ? 60 CYS A SG   4 
ATOM   3774 H H    . CYS A 1 60 ? -2.440  -9.803  -0.408  1.00 0.00 ? 60 CYS A H    4 
ATOM   3775 H HA   . CYS A 1 60 ? -0.842  -11.392 -2.165  1.00 0.00 ? 60 CYS A HA   4 
ATOM   3776 H HB2  . CYS A 1 60 ? -0.646  -8.877  -1.163  1.00 0.00 ? 60 CYS A HB2  4 
ATOM   3777 H HB3  . CYS A 1 60 ? 0.456   -9.732  -0.094  1.00 0.00 ? 60 CYS A HB3  4 
ATOM   3778 N N    . GLY A 1 61 ? -0.813  -11.929 1.082   1.00 0.00 ? 61 GLY A N    4 
ATOM   3779 C CA   . GLY A 1 61 ? -0.420  -12.891 2.094   1.00 0.00 ? 61 GLY A CA   4 
ATOM   3780 C C    . GLY A 1 61 ? 1.026   -12.740 2.530   1.00 0.00 ? 61 GLY A C    4 
ATOM   3781 O O    . GLY A 1 61 ? 1.793   -13.702 2.491   1.00 0.00 ? 61 GLY A O    4 
ATOM   3782 H H    . GLY A 1 61 ? -1.392  -11.172 1.326   1.00 0.00 ? 61 GLY A H    4 
ATOM   3783 H HA2  . GLY A 1 61 ? -1.057  -12.766 2.957   1.00 0.00 ? 61 GLY A HA2  4 
ATOM   3784 H HA3  . GLY A 1 61 ? -0.561  -13.887 1.700   1.00 0.00 ? 61 GLY A HA3  4 
ATOM   3785 N N    . LEU A 1 62 ? 1.398   -11.537 2.958   1.00 0.00 ? 62 LEU A N    4 
ATOM   3786 C CA   . LEU A 1 62 ? 2.762   -11.279 3.413   1.00 0.00 ? 62 LEU A CA   4 
ATOM   3787 C C    . LEU A 1 62 ? 2.760   -10.732 4.837   1.00 0.00 ? 62 LEU A C    4 
ATOM   3788 O O    . LEU A 1 62 ? 2.986   -11.470 5.796   1.00 0.00 ? 62 LEU A O    4 
ATOM   3789 C CB   . LEU A 1 62 ? 3.493   -10.301 2.479   1.00 0.00 ? 62 LEU A CB   4 
ATOM   3790 C CG   . LEU A 1 62 ? 2.693   -9.809  1.270   1.00 0.00 ? 62 LEU A CG   4 
ATOM   3791 C CD1  . LEU A 1 62 ? 3.158   -8.422  0.847   1.00 0.00 ? 62 LEU A CD1  4 
ATOM   3792 C CD2  . LEU A 1 62 ? 2.826   -10.797 0.118   1.00 0.00 ? 62 LEU A CD2  4 
ATOM   3793 H H    . LEU A 1 62 ? 0.741   -10.809 2.975   1.00 0.00 ? 62 LEU A H    4 
ATOM   3794 H HA   . LEU A 1 62 ? 3.290   -12.222 3.411   1.00 0.00 ? 62 LEU A HA   4 
ATOM   3795 H HB2  . LEU A 1 62 ? 3.795   -9.439  3.056   1.00 0.00 ? 62 LEU A HB2  4 
ATOM   3796 H HB3  . LEU A 1 62 ? 4.384   -10.791 2.114   1.00 0.00 ? 62 LEU A HB3  4 
ATOM   3797 H HG   . LEU A 1 62 ? 1.648   -9.740  1.538   1.00 0.00 ? 62 LEU A HG   4 
ATOM   3798 H HD11 . LEU A 1 62 ? 2.338   -7.725  0.936   1.00 0.00 ? 62 LEU A HD11 4 
ATOM   3799 H HD12 . LEU A 1 62 ? 3.494   -8.451  -0.179  1.00 0.00 ? 62 LEU A HD12 4 
ATOM   3800 H HD13 . LEU A 1 62 ? 3.972   -8.102  1.481   1.00 0.00 ? 62 LEU A HD13 4 
ATOM   3801 H HD21 . LEU A 1 62 ? 3.316   -10.315 -0.716  1.00 0.00 ? 62 LEU A HD21 4 
ATOM   3802 H HD22 . LEU A 1 62 ? 1.847   -11.130 -0.186  1.00 0.00 ? 62 LEU A HD22 4 
ATOM   3803 H HD23 . LEU A 1 62 ? 3.412   -11.647 0.436   1.00 0.00 ? 62 LEU A HD23 4 
ATOM   3804 N N    . ALA A 1 63 ? 2.506   -9.434  4.967   1.00 0.00 ? 63 ALA A N    4 
ATOM   3805 C CA   . ALA A 1 63 ? 2.477   -8.794  6.270   1.00 0.00 ? 63 ALA A CA   4 
ATOM   3806 C C    . ALA A 1 63 ? 1.525   -7.605  6.287   1.00 0.00 ? 63 ALA A C    4 
ATOM   3807 O O    . ALA A 1 63 ? 1.059   -7.152  5.242   1.00 0.00 ? 63 ALA A O    4 
ATOM   3808 C CB   . ALA A 1 63 ? 3.877   -8.360  6.676   1.00 0.00 ? 63 ALA A CB   4 
ATOM   3809 H H    . ALA A 1 63 ? 2.331   -8.899  4.170   1.00 0.00 ? 63 ALA A H    4 
ATOM   3810 H HA   . ALA A 1 63 ? 2.134   -9.524  6.981   1.00 0.00 ? 63 ALA A HA   4 
ATOM   3811 H HB1  . ALA A 1 63 ? 4.284   -7.704  5.921   1.00 0.00 ? 63 ALA A HB1  4 
ATOM   3812 H HB2  . ALA A 1 63 ? 4.510   -9.230  6.775   1.00 0.00 ? 63 ALA A HB2  4 
ATOM   3813 H HB3  . ALA A 1 63 ? 3.833   -7.838  7.620   1.00 0.00 ? 63 ALA A HB3  4 
ATOM   3814 N N    . VAL A 1 64 ? 1.246   -7.101  7.484   1.00 0.00 ? 64 VAL A N    4 
ATOM   3815 C CA   . VAL A 1 64 ? 0.361   -5.967  7.654   1.00 0.00 ? 64 VAL A CA   4 
ATOM   3816 C C    . VAL A 1 64 ? 1.143   -4.729  8.093   1.00 0.00 ? 64 VAL A C    4 
ATOM   3817 O O    . VAL A 1 64 ? 2.031   -4.821  8.941   1.00 0.00 ? 64 VAL A O    4 
ATOM   3818 C CB   . VAL A 1 64 ? -0.736  -6.276  8.693   1.00 0.00 ? 64 VAL A CB   4 
ATOM   3819 C CG1  . VAL A 1 64 ? -0.145  -6.385  10.091  1.00 0.00 ? 64 VAL A CG1  4 
ATOM   3820 C CG2  . VAL A 1 64 ? -1.832  -5.222  8.648   1.00 0.00 ? 64 VAL A CG2  4 
ATOM   3821 H H    . VAL A 1 64 ? 1.645   -7.503  8.273   1.00 0.00 ? 64 VAL A H    4 
ATOM   3822 H HA   . VAL A 1 64 ? -0.108  -5.775  6.709   1.00 0.00 ? 64 VAL A HA   4 
ATOM   3823 H HB   . VAL A 1 64 ? -1.174  -7.230  8.442   1.00 0.00 ? 64 VAL A HB   4 
ATOM   3824 H HG11 . VAL A 1 64 ? 0.057   -5.396  10.475  1.00 0.00 ? 64 VAL A HG11 4 
ATOM   3825 H HG12 . VAL A 1 64 ? 0.775   -6.949  10.050  1.00 0.00 ? 64 VAL A HG12 4 
ATOM   3826 H HG13 . VAL A 1 64 ? -0.846  -6.887  10.741  1.00 0.00 ? 64 VAL A HG13 4 
ATOM   3827 H HG21 . VAL A 1 64 ? -2.522  -5.386  9.463   1.00 0.00 ? 64 VAL A HG21 4 
ATOM   3828 H HG22 . VAL A 1 64 ? -2.360  -5.291  7.709   1.00 0.00 ? 64 VAL A HG22 4 
ATOM   3829 H HG23 . VAL A 1 64 ? -1.391  -4.240  8.742   1.00 0.00 ? 64 VAL A HG23 4 
ATOM   3830 N N    . PRO A 1 65 ? 0.828   -3.550  7.526   1.00 0.00 ? 65 PRO A N    4 
ATOM   3831 C CA   . PRO A 1 65 ? 1.515   -2.303  7.876   1.00 0.00 ? 65 PRO A CA   4 
ATOM   3832 C C    . PRO A 1 65 ? 1.414   -1.991  9.365   1.00 0.00 ? 65 PRO A C    4 
ATOM   3833 O O    . PRO A 1 65 ? 1.140   -2.874  10.177  1.00 0.00 ? 65 PRO A O    4 
ATOM   3834 C CB   . PRO A 1 65 ? 0.784   -1.236  7.047   1.00 0.00 ? 65 PRO A CB   4 
ATOM   3835 C CG   . PRO A 1 65 ? -0.505  -1.867  6.655   1.00 0.00 ? 65 PRO A CG   4 
ATOM   3836 C CD   . PRO A 1 65 ? -0.212  -3.331  6.509   1.00 0.00 ? 65 PRO A CD   4 
ATOM   3837 H HA   . PRO A 1 65 ? 2.556   -2.334  7.588   1.00 0.00 ? 65 PRO A HA   4 
ATOM   3838 H HB2  . PRO A 1 65 ? 0.622   -0.356  7.650   1.00 0.00 ? 65 PRO A HB2  4 
ATOM   3839 H HB3  . PRO A 1 65 ? 1.376   -0.981  6.181   1.00 0.00 ? 65 PRO A HB3  4 
ATOM   3840 H HG2  . PRO A 1 65 ? -1.241  -1.705  7.428   1.00 0.00 ? 65 PRO A HG2  4 
ATOM   3841 H HG3  . PRO A 1 65 ? -0.846  -1.456  5.717   1.00 0.00 ? 65 PRO A HG3  4 
ATOM   3842 H HD2  . PRO A 1 65 ? -1.094  -3.917  6.718   1.00 0.00 ? 65 PRO A HD2  4 
ATOM   3843 H HD3  . PRO A 1 65 ? 0.163   -3.545  5.519   1.00 0.00 ? 65 PRO A HD3  4 
ATOM   3844 N N    . HIS A 1 66 ? 1.639   -0.731  9.718   1.00 0.00 ? 66 HIS A N    4 
ATOM   3845 C CA   . HIS A 1 66 ? 1.576   -0.303  11.110  1.00 0.00 ? 66 HIS A CA   4 
ATOM   3846 C C    . HIS A 1 66 ? 2.620   -1.035  11.947  1.00 0.00 ? 66 HIS A C    4 
ATOM   3847 O O    . HIS A 1 66 ? 2.414   -1.288  13.134  1.00 0.00 ? 66 HIS A O    4 
ATOM   3848 C CB   . HIS A 1 66 ? 0.179   -0.551  11.682  1.00 0.00 ? 66 HIS A CB   4 
ATOM   3849 C CG   . HIS A 1 66 ? -0.867  0.358   11.118  1.00 0.00 ? 66 HIS A CG   4 
ATOM   3850 N ND1  . HIS A 1 66 ? -1.680  0.004   10.063  1.00 0.00 ? 66 HIS A ND1  4 
ATOM   3851 C CD2  . HIS A 1 66 ? -1.235  1.613   11.468  1.00 0.00 ? 66 HIS A CD2  4 
ATOM   3852 C CE1  . HIS A 1 66 ? -2.499  1.002   9.789   1.00 0.00 ? 66 HIS A CE1  4 
ATOM   3853 N NE2  . HIS A 1 66 ? -2.251  1.989   10.627  1.00 0.00 ? 66 HIS A NE2  4 
ATOM   3854 H H    . HIS A 1 66 ? 1.854   -0.074  9.026   1.00 0.00 ? 66 HIS A H    4 
ATOM   3855 H HA   . HIS A 1 66 ? 1.786   0.756   11.141  1.00 0.00 ? 66 HIS A HA   4 
ATOM   3856 H HB2  . HIS A 1 66 ? -0.116  -1.567  11.467  1.00 0.00 ? 66 HIS A HB2  4 
ATOM   3857 H HB3  . HIS A 1 66 ? 0.204   -0.407  12.752  1.00 0.00 ? 66 HIS A HB3  4 
ATOM   3858 H HD1  . HIS A 1 66 ? -1.658  -0.851  9.584   1.00 0.00 ? 66 HIS A HD1  4 
ATOM   3859 H HD2  . HIS A 1 66 ? -0.809  2.207   12.261  1.00 0.00 ? 66 HIS A HD2  4 
ATOM   3860 H HE1  . HIS A 1 66 ? -3.247  1.008   9.014   1.00 0.00 ? 66 HIS A HE1  4 
ATOM   3861 H HE2  . HIS A 1 66 ? -2.780  2.811   10.705  1.00 0.00 ? 66 HIS A HE2  4 
ATOM   3862 N N    . CYS A 1 67 ? 3.742   -1.373  11.318  1.00 0.00 ? 67 CYS A N    4 
ATOM   3863 C CA   . CYS A 1 67 ? 4.821   -2.076  12.001  1.00 0.00 ? 67 CYS A CA   4 
ATOM   3864 C C    . CYS A 1 67 ? 5.661   -1.110  12.830  1.00 0.00 ? 67 CYS A C    4 
ATOM   3865 O O    . CYS A 1 67 ? 6.225   -0.164  12.242  1.00 0.00 ? 67 CYS A O    4 
ATOM   3866 C CB   . CYS A 1 67 ? 5.708   -2.801  10.987  1.00 0.00 ? 67 CYS A CB   4 
ATOM   3867 S SG   . CYS A 1 67 ? 6.361   -1.727  9.667   1.00 0.00 ? 67 CYS A SG   4 
ATOM   3868 O OXT  . CYS A 1 67 ? 5.749   -1.309  14.060  1.00 0.00 ? 67 CYS A OXT  4 
ATOM   3869 H H    . CYS A 1 67 ? 3.846   -1.143  10.371  1.00 0.00 ? 67 CYS A H    4 
ATOM   3870 H HA   . CYS A 1 67 ? 4.376   -2.805  12.662  1.00 0.00 ? 67 CYS A HA   4 
ATOM   3871 H HB2  . CYS A 1 67 ? 6.551   -3.236  11.502  1.00 0.00 ? 67 CYS A HB2  4 
ATOM   3872 H HB3  . CYS A 1 67 ? 5.135   -3.588  10.517  1.00 0.00 ? 67 CYS A HB3  4 
HETATM 3873 C C1   . PGM B 2 .  ? -10.842 -0.905  15.792  1.00 0.00 ? 68 PGM A C1   4 
HETATM 3874 O O1   . PGM B 2 .  ? -10.234 -0.256  16.881  1.00 0.00 ? 68 PGM A O1   4 
HETATM 3875 C C2   . PGM B 2 .  ? -9.992  -0.756  14.608  1.00 0.00 ? 68 PGM A C2   4 
HETATM 3876 O O2   . PGM B 2 .  ? -10.757 -0.216  13.559  1.00 0.00 ? 68 PGM A O2   4 
HETATM 3877 C C3   . PGM B 2 .  ? -9.423  -2.035  14.177  1.00 0.00 ? 68 PGM A C3   4 
HETATM 3878 O O4   . PGM B 2 .  ? -8.476  -1.780  13.131  1.00 0.00 ? 68 PGM A O4   4 
HETATM 3879 P P5   . PGM B 2 .  ? -6.922  -2.042  13.428  1.00 0.00 ? 68 PGM A P5   4 
HETATM 3880 O O5A  . PGM B 2 .  ? -6.494  -1.195  14.565  1.00 0.00 ? 68 PGM A O5A  4 
HETATM 3881 O O5B  . PGM B 2 .  ? -6.706  -3.501  13.534  1.00 0.00 ? 68 PGM A O5B  4 
HETATM 3882 O O6   . PGM B 2 .  ? -6.163  -1.527  12.117  1.00 0.00 ? 68 PGM A O6   4 
HETATM 3883 C C7   . PGM B 2 .  ? -6.326  -2.282  10.845  1.00 0.00 ? 68 PGM A C7   4 
HETATM 3884 C C8   . PGM B 2 .  ? -5.396  -1.890  9.783   1.00 0.00 ? 68 PGM A C8   4 
HETATM 3885 O O8   . PGM B 2 .  ? -4.311  -1.074  10.150  1.00 0.00 ? 68 PGM A O8   4 
HETATM 3886 C C9   . PGM B 2 .  ? -6.077  -1.293  8.662   1.00 0.00 ? 68 PGM A C9   4 
HETATM 3887 O OQ1  . PGM B 2 .  ? -6.144  -0.185  5.925   1.00 0.00 ? 68 PGM A OQ1  4 
HETATM 3888 O OQ2  . PGM B 2 .  ? -5.118  -0.553  7.786   1.00 0.00 ? 68 PGM A OQ2  4 
HETATM 3889 C CA   . PGM B 2 .  ? -5.186  -0.693  6.603   1.00 0.00 ? 68 PGM A CA   4 
HETATM 3890 C CB   . PGM B 2 .  ? -4.124  -1.334  5.817   1.00 0.00 ? 68 PGM A CB   4 
HETATM 3891 C CC   . PGM B 2 .  ? -3.212  -0.405  5.059   1.00 0.00 ? 68 PGM A CC   4 
HETATM 3892 C CD   . PGM B 2 .  ? -2.825  -0.883  3.687   1.00 0.00 ? 68 PGM A CD   4 
HETATM 3893 C CE   . PGM B 2 .  ? -2.257  0.187   2.805   1.00 0.00 ? 68 PGM A CE   4 
HETATM 3894 C CF   . PGM B 2 .  ? -1.281  -0.310  1.781   1.00 0.00 ? 68 PGM A CF   4 
HETATM 3895 C CG   . PGM B 2 .  ? -0.310  0.723   1.290   1.00 0.00 ? 68 PGM A CG   4 
HETATM 3896 C CH   . PGM B 2 .  ? 1.085   0.237   1.084   1.00 0.00 ? 68 PGM A CH   4 
HETATM 3897 C CI   . PGM B 2 .  ? 2.147   1.064   1.730   1.00 0.00 ? 68 PGM A CI   4 
HETATM 3898 C CJ   . PGM B 2 .  ? 2.941   1.907   0.790   1.00 0.00 ? 68 PGM A CJ   4 
HETATM 3899 C CK   . PGM B 2 .  ? 2.405   3.281   0.549   1.00 0.00 ? 68 PGM A CK   4 
HETATM 3900 C CL   . PGM B 2 .  ? 1.641   3.453   -0.727  1.00 0.00 ? 68 PGM A CL   4 
HETATM 3901 C CM   . PGM B 2 .  ? 2.059   4.615   -1.568  1.00 0.00 ? 68 PGM A CM   4 
HETATM 3902 C CN   . PGM B 2 .  ? 0.943   5.482   -2.057  1.00 0.00 ? 68 PGM A CN   4 
HETATM 3903 C CO   . PGM B 2 .  ? 1.249   6.285   -3.281  1.00 0.00 ? 68 PGM A CO   4 
HETATM 3904 C CP   . PGM B 2 .  ? 0.226   7.332   -3.607  1.00 0.00 ? 68 PGM A CP   4 
ATOM   3905 N N    . ALA A 1 1  ? 15.325  2.008   -5.232  1.00 0.00 ? 1  ALA A N    5 
ATOM   3906 C CA   . ALA A 1 1  ? 14.748  2.357   -3.908  1.00 0.00 ? 1  ALA A CA   5 
ATOM   3907 C C    . ALA A 1 1  ? 13.241  2.130   -3.890  1.00 0.00 ? 1  ALA A C    5 
ATOM   3908 O O    . ALA A 1 1  ? 12.642  1.793   -4.911  1.00 0.00 ? 1  ALA A O    5 
ATOM   3909 C CB   . ALA A 1 1  ? 15.068  3.803   -3.559  1.00 0.00 ? 1  ALA A CB   5 
ATOM   3910 H H1   . ALA A 1 1  ? 15.188  2.823   -5.862  1.00 0.00 ? 1  ALA A H1   5 
ATOM   3911 H H2   . ALA A 1 1  ? 14.820  1.170   -5.585  1.00 0.00 ? 1  ALA A H2   5 
ATOM   3912 H H3   . ALA A 1 1  ? 16.336  1.807   -5.094  1.00 0.00 ? 1  ALA A H3   5 
ATOM   3913 H HA   . ALA A 1 1  ? 15.205  1.724   -3.160  1.00 0.00 ? 1  ALA A HA   5 
ATOM   3914 H HB1  . ALA A 1 1  ? 14.303  4.448   -3.963  1.00 0.00 ? 1  ALA A HB1  5 
ATOM   3915 H HB2  . ALA A 1 1  ? 16.025  4.072   -3.980  1.00 0.00 ? 1  ALA A HB2  5 
ATOM   3916 H HB3  . ALA A 1 1  ? 15.103  3.915   -2.485  1.00 0.00 ? 1  ALA A HB3  5 
ATOM   3917 N N    . CYS A 1 2  ? 12.633  2.318   -2.723  1.00 0.00 ? 2  CYS A N    5 
ATOM   3918 C CA   . CYS A 1 2  ? 11.194  2.133   -2.573  1.00 0.00 ? 2  CYS A CA   5 
ATOM   3919 C C    . CYS A 1 2  ? 10.439  3.401   -2.964  1.00 0.00 ? 2  CYS A C    5 
ATOM   3920 O O    . CYS A 1 2  ? 9.757   4.011   -2.141  1.00 0.00 ? 2  CYS A O    5 
ATOM   3921 C CB   . CYS A 1 2  ? 10.855  1.741   -1.133  1.00 0.00 ? 2  CYS A CB   5 
ATOM   3922 S SG   . CYS A 1 2  ? 11.530  2.871   0.128   1.00 0.00 ? 2  CYS A SG   5 
ATOM   3923 H H    . CYS A 1 2  ? 13.165  2.586   -1.945  1.00 0.00 ? 2  CYS A H    5 
ATOM   3924 H HA   . CYS A 1 2  ? 10.894  1.333   -3.233  1.00 0.00 ? 2  CYS A HA   5 
ATOM   3925 H HB2  . CYS A 1 2  ? 9.782   1.726   -1.016  1.00 0.00 ? 2  CYS A HB2  5 
ATOM   3926 H HB3  . CYS A 1 2  ? 11.248  0.755   -0.934  1.00 0.00 ? 2  CYS A HB3  5 
ATOM   3927 N N    . GLN A 1 3  ? 10.568  3.791   -4.228  1.00 0.00 ? 3  GLN A N    5 
ATOM   3928 C CA   . GLN A 1 3  ? 9.900   4.985   -4.734  1.00 0.00 ? 3  GLN A CA   5 
ATOM   3929 C C    . GLN A 1 3  ? 8.384   4.820   -4.695  1.00 0.00 ? 3  GLN A C    5 
ATOM   3930 O O    . GLN A 1 3  ? 7.869   3.704   -4.760  1.00 0.00 ? 3  GLN A O    5 
ATOM   3931 C CB   . GLN A 1 3  ? 10.356  5.281   -6.164  1.00 0.00 ? 3  GLN A CB   5 
ATOM   3932 C CG   . GLN A 1 3  ? 10.342  6.761   -6.513  1.00 0.00 ? 3  GLN A CG   5 
ATOM   3933 C CD   . GLN A 1 3  ? 11.735  7.354   -6.596  1.00 0.00 ? 3  GLN A CD   5 
ATOM   3934 O OE1  . GLN A 1 3  ? 12.503  7.301   -5.636  1.00 0.00 ? 3  GLN A OE1  5 
ATOM   3935 N NE2  . GLN A 1 3  ? 12.067  7.926   -7.748  1.00 0.00 ? 3  GLN A NE2  5 
ATOM   3936 H H    . GLN A 1 3  ? 11.126  3.263   -4.836  1.00 0.00 ? 3  GLN A H    5 
ATOM   3937 H HA   . GLN A 1 3  ? 10.177  5.813   -4.099  1.00 0.00 ? 3  GLN A HA   5 
ATOM   3938 H HB2  . GLN A 1 3  ? 11.363  4.913   -6.292  1.00 0.00 ? 3  GLN A HB2  5 
ATOM   3939 H HB3  . GLN A 1 3  ? 9.703   4.765   -6.851  1.00 0.00 ? 3  GLN A HB3  5 
ATOM   3940 H HG2  . GLN A 1 3  ? 9.856   6.887   -7.468  1.00 0.00 ? 3  GLN A HG2  5 
ATOM   3941 H HG3  . GLN A 1 3  ? 9.785   7.291   -5.754  1.00 0.00 ? 3  GLN A HG3  5 
ATOM   3942 H HE21 . GLN A 1 3  ? 11.405  7.932   -8.470  1.00 0.00 ? 3  GLN A HE21 5 
ATOM   3943 H HE22 . GLN A 1 3  ? 12.962  8.318   -7.829  1.00 0.00 ? 3  GLN A HE22 5 
ATOM   3944 N N    . ALA A 1 4  ? 7.676   5.939   -4.589  1.00 0.00 ? 4  ALA A N    5 
ATOM   3945 C CA   . ALA A 1 4  ? 6.220   5.922   -4.541  1.00 0.00 ? 4  ALA A CA   5 
ATOM   3946 C C    . ALA A 1 4  ? 5.628   5.419   -5.854  1.00 0.00 ? 4  ALA A C    5 
ATOM   3947 O O    . ALA A 1 4  ? 4.529   4.865   -5.878  1.00 0.00 ? 4  ALA A O    5 
ATOM   3948 C CB   . ALA A 1 4  ? 5.687   7.310   -4.215  1.00 0.00 ? 4  ALA A CB   5 
ATOM   3949 H H    . ALA A 1 4  ? 8.144   6.798   -4.541  1.00 0.00 ? 4  ALA A H    5 
ATOM   3950 H HA   . ALA A 1 4  ? 5.923   5.255   -3.746  1.00 0.00 ? 4  ALA A HA   5 
ATOM   3951 H HB1  . ALA A 1 4  ? 4.956   7.239   -3.424  1.00 0.00 ? 4  ALA A HB1  5 
ATOM   3952 H HB2  . ALA A 1 4  ? 5.225   7.735   -5.095  1.00 0.00 ? 4  ALA A HB2  5 
ATOM   3953 H HB3  . ALA A 1 4  ? 6.503   7.943   -3.896  1.00 0.00 ? 4  ALA A HB3  5 
ATOM   3954 N N    . SER A 1 5  ? 6.362   5.614   -6.946  1.00 0.00 ? 5  SER A N    5 
ATOM   3955 C CA   . SER A 1 5  ? 5.908   5.181   -8.263  1.00 0.00 ? 5  SER A CA   5 
ATOM   3956 C C    . SER A 1 5  ? 5.559   3.695   -8.263  1.00 0.00 ? 5  SER A C    5 
ATOM   3957 O O    . SER A 1 5  ? 4.720   3.244   -9.042  1.00 0.00 ? 5  SER A O    5 
ATOM   3958 C CB   . SER A 1 5  ? 6.984   5.462   -9.313  1.00 0.00 ? 5  SER A CB   5 
ATOM   3959 O OG   . SER A 1 5  ? 6.406   5.887   -10.535 1.00 0.00 ? 5  SER A OG   5 
ATOM   3960 H H    . SER A 1 5  ? 7.230   6.062   -6.864  1.00 0.00 ? 5  SER A H    5 
ATOM   3961 H HA   . SER A 1 5  ? 5.022   5.745   -8.510  1.00 0.00 ? 5  SER A HA   5 
ATOM   3962 H HB2  . SER A 1 5  ? 7.643   6.238   -8.952  1.00 0.00 ? 5  SER A HB2  5 
ATOM   3963 H HB3  . SER A 1 5  ? 7.554   4.561   -9.492  1.00 0.00 ? 5  SER A HB3  5 
ATOM   3964 H HG   . SER A 1 5  ? 7.048   6.399   -11.032 1.00 0.00 ? 5  SER A HG   5 
ATOM   3965 N N    . GLN A 1 6  ? 6.209   2.939   -7.384  1.00 0.00 ? 6  GLN A N    5 
ATOM   3966 C CA   . GLN A 1 6  ? 5.971   1.511   -7.281  1.00 0.00 ? 6  GLN A CA   5 
ATOM   3967 C C    . GLN A 1 6  ? 4.595   1.223   -6.687  1.00 0.00 ? 6  GLN A C    5 
ATOM   3968 O O    . GLN A 1 6  ? 4.116   0.090   -6.728  1.00 0.00 ? 6  GLN A O    5 
ATOM   3969 C CB   . GLN A 1 6  ? 7.055   0.855   -6.424  1.00 0.00 ? 6  GLN A CB   5 
ATOM   3970 C CG   . GLN A 1 6  ? 8.391   0.715   -7.135  1.00 0.00 ? 6  GLN A CG   5 
ATOM   3971 C CD   . GLN A 1 6  ? 9.431   0.007   -6.289  1.00 0.00 ? 6  GLN A CD   5 
ATOM   3972 O OE1  . GLN A 1 6  ? 9.546   -1.218  -6.324  1.00 0.00 ? 6  GLN A OE1  5 
ATOM   3973 N NE2  . GLN A 1 6  ? 10.194  0.777   -5.522  1.00 0.00 ? 6  GLN A NE2  5 
ATOM   3974 H H    . GLN A 1 6  ? 6.863   3.348   -6.793  1.00 0.00 ? 6  GLN A H    5 
ATOM   3975 H HA   . GLN A 1 6  ? 6.018   1.106   -8.273  1.00 0.00 ? 6  GLN A HA   5 
ATOM   3976 H HB2  . GLN A 1 6  ? 7.205   1.450   -5.535  1.00 0.00 ? 6  GLN A HB2  5 
ATOM   3977 H HB3  . GLN A 1 6  ? 6.721   -0.130  -6.135  1.00 0.00 ? 6  GLN A HB3  5 
ATOM   3978 H HG2  . GLN A 1 6  ? 8.244   0.151   -8.044  1.00 0.00 ? 6  GLN A HG2  5 
ATOM   3979 H HG3  . GLN A 1 6  ? 8.758   1.701   -7.381  1.00 0.00 ? 6  GLN A HG3  5 
ATOM   3980 H HE21 . GLN A 1 6  ? 10.046  1.745   -5.545  1.00 0.00 ? 6  GLN A HE21 5 
ATOM   3981 H HE22 . GLN A 1 6  ? 10.875  0.345   -4.965  1.00 0.00 ? 6  GLN A HE22 5 
ATOM   3982 N N    . LEU A 1 7  ? 3.967   2.253   -6.128  1.00 0.00 ? 7  LEU A N    5 
ATOM   3983 C CA   . LEU A 1 7  ? 2.652   2.109   -5.517  1.00 0.00 ? 7  LEU A CA   5 
ATOM   3984 C C    . LEU A 1 7  ? 1.576   2.804   -6.349  1.00 0.00 ? 7  LEU A C    5 
ATOM   3985 O O    . LEU A 1 7  ? 0.388   2.515   -6.207  1.00 0.00 ? 7  LEU A O    5 
ATOM   3986 C CB   . LEU A 1 7  ? 2.665   2.682   -4.096  1.00 0.00 ? 7  LEU A CB   5 
ATOM   3987 C CG   . LEU A 1 7  ? 4.022   2.632   -3.386  1.00 0.00 ? 7  LEU A CG   5 
ATOM   3988 C CD1  . LEU A 1 7  ? 4.048   3.603   -2.216  1.00 0.00 ? 7  LEU A CD1  5 
ATOM   3989 C CD2  . LEU A 1 7  ? 4.322   1.217   -2.912  1.00 0.00 ? 7  LEU A CD2  5 
ATOM   3990 H H    . LEU A 1 7  ? 4.401   3.131   -6.118  1.00 0.00 ? 7  LEU A H    5 
ATOM   3991 H HA   . LEU A 1 7  ? 2.424   1.055   -5.466  1.00 0.00 ? 7  LEU A HA   5 
ATOM   3992 H HB2  . LEU A 1 7  ? 2.345   3.713   -4.145  1.00 0.00 ? 7  LEU A HB2  5 
ATOM   3993 H HB3  . LEU A 1 7  ? 1.953   2.130   -3.502  1.00 0.00 ? 7  LEU A HB3  5 
ATOM   3994 H HG   . LEU A 1 7  ? 4.798   2.925   -4.081  1.00 0.00 ? 7  LEU A HG   5 
ATOM   3995 H HD11 . LEU A 1 7  ? 3.052   3.703   -1.809  1.00 0.00 ? 7  LEU A HD11 5 
ATOM   3996 H HD12 . LEU A 1 7  ? 4.396   4.567   -2.557  1.00 0.00 ? 7  LEU A HD12 5 
ATOM   3997 H HD13 . LEU A 1 7  ? 4.713   3.229   -1.452  1.00 0.00 ? 7  LEU A HD13 5 
ATOM   3998 H HD21 . LEU A 1 7  ? 4.880   1.258   -1.988  1.00 0.00 ? 7  LEU A HD21 5 
ATOM   3999 H HD22 . LEU A 1 7  ? 4.903   0.702   -3.662  1.00 0.00 ? 7  LEU A HD22 5 
ATOM   4000 H HD23 . LEU A 1 7  ? 3.394   0.688   -2.749  1.00 0.00 ? 7  LEU A HD23 5 
ATOM   4001 N N    . ALA A 1 8  ? 1.997   3.723   -7.218  1.00 0.00 ? 8  ALA A N    5 
ATOM   4002 C CA   . ALA A 1 8  ? 1.069   4.458   -8.071  1.00 0.00 ? 8  ALA A CA   5 
ATOM   4003 C C    . ALA A 1 8  ? 0.065   3.527   -8.735  1.00 0.00 ? 8  ALA A C    5 
ATOM   4004 O O    . ALA A 1 8  ? -1.143  3.643   -8.531  1.00 0.00 ? 8  ALA A O    5 
ATOM   4005 C CB   . ALA A 1 8  ? 1.833   5.248   -9.123  1.00 0.00 ? 8  ALA A CB   5 
ATOM   4006 H H    . ALA A 1 8  ? 2.955   3.913   -7.286  1.00 0.00 ? 8  ALA A H    5 
ATOM   4007 H HA   . ALA A 1 8  ? 0.537   5.153   -7.454  1.00 0.00 ? 8  ALA A HA   5 
ATOM   4008 H HB1  . ALA A 1 8  ? 1.135   5.699   -9.812  1.00 0.00 ? 8  ALA A HB1  5 
ATOM   4009 H HB2  . ALA A 1 8  ? 2.493   4.584   -9.661  1.00 0.00 ? 8  ALA A HB2  5 
ATOM   4010 H HB3  . ALA A 1 8  ? 2.414   6.021   -8.641  1.00 0.00 ? 8  ALA A HB3  5 
ATOM   4011 N N    . VAL A 1 9  ? 0.583   2.606   -9.527  1.00 0.00 ? 9  VAL A N    5 
ATOM   4012 C CA   . VAL A 1 9  ? -0.245  1.638   -10.235 1.00 0.00 ? 9  VAL A CA   5 
ATOM   4013 C C    . VAL A 1 9  ? -1.208  0.930   -9.284  1.00 0.00 ? 9  VAL A C    5 
ATOM   4014 O O    . VAL A 1 9  ? -2.273  0.468   -9.690  1.00 0.00 ? 9  VAL A O    5 
ATOM   4015 C CB   . VAL A 1 9  ? 0.619   0.587   -10.960 1.00 0.00 ? 9  VAL A CB   5 
ATOM   4016 C CG1  . VAL A 1 9  ? 1.487   -0.173  -9.967  1.00 0.00 ? 9  VAL A CG1  5 
ATOM   4017 C CG2  . VAL A 1 9  ? -0.256  -0.369  -11.759 1.00 0.00 ? 9  VAL A CG2  5 
ATOM   4018 H H    . VAL A 1 9  ? 1.550   2.578   -9.639  1.00 0.00 ? 9  VAL A H    5 
ATOM   4019 H HA   . VAL A 1 9  ? -0.815  2.174   -10.971 1.00 0.00 ? 9  VAL A HA   5 
ATOM   4020 H HB   . VAL A 1 9  ? 1.271   1.103   -11.649 1.00 0.00 ? 9  VAL A HB   5 
ATOM   4021 H HG11 . VAL A 1 9  ? 1.409   -1.233  -10.155 1.00 0.00 ? 9  VAL A HG11 5 
ATOM   4022 H HG12 . VAL A 1 9  ? 1.156   0.039   -8.961  1.00 0.00 ? 9  VAL A HG12 5 
ATOM   4023 H HG13 . VAL A 1 9  ? 2.516   0.137   -10.079 1.00 0.00 ? 9  VAL A HG13 5 
ATOM   4024 H HG21 . VAL A 1 9  ? -1.188  0.117   -12.007 1.00 0.00 ? 9  VAL A HG21 5 
ATOM   4025 H HG22 . VAL A 1 9  ? -0.456  -1.252  -11.170 1.00 0.00 ? 9  VAL A HG22 5 
ATOM   4026 H HG23 . VAL A 1 9  ? 0.256   -0.651  -12.667 1.00 0.00 ? 9  VAL A HG23 5 
ATOM   4027 N N    . CYS A 1 10 ? -0.821  0.856   -8.018  1.00 0.00 ? 10 CYS A N    5 
ATOM   4028 C CA   . CYS A 1 10 ? -1.641  0.212   -6.998  1.00 0.00 ? 10 CYS A CA   5 
ATOM   4029 C C    . CYS A 1 10 ? -2.856  1.068   -6.671  1.00 0.00 ? 10 CYS A C    5 
ATOM   4030 O O    . CYS A 1 10 ? -3.922  0.556   -6.329  1.00 0.00 ? 10 CYS A O    5 
ATOM   4031 C CB   . CYS A 1 10 ? -0.821  -0.004  -5.731  1.00 0.00 ? 10 CYS A CB   5 
ATOM   4032 S SG   . CYS A 1 10 ? -1.406  -1.383  -4.692  1.00 0.00 ? 10 CYS A SG   5 
ATOM   4033 H H    . CYS A 1 10 ? 0.038   1.248   -7.761  1.00 0.00 ? 10 CYS A H    5 
ATOM   4034 H HA   . CYS A 1 10 ? -1.970  -0.743  -7.378  1.00 0.00 ? 10 CYS A HA   5 
ATOM   4035 H HB2  . CYS A 1 10 ? 0.201   -0.204  -6.007  1.00 0.00 ? 10 CYS A HB2  5 
ATOM   4036 H HB3  . CYS A 1 10 ? -0.859  0.897   -5.131  1.00 0.00 ? 10 CYS A HB3  5 
ATOM   4037 N N    . ALA A 1 11 ? -2.675  2.379   -6.776  1.00 0.00 ? 11 ALA A N    5 
ATOM   4038 C CA   . ALA A 1 11 ? -3.739  3.337   -6.492  1.00 0.00 ? 11 ALA A CA   5 
ATOM   4039 C C    . ALA A 1 11 ? -5.059  2.907   -7.117  1.00 0.00 ? 11 ALA A C    5 
ATOM   4040 O O    . ALA A 1 11 ? -6.134  3.226   -6.611  1.00 0.00 ? 11 ALA A O    5 
ATOM   4041 C CB   . ALA A 1 11 ? -3.346  4.722   -6.984  1.00 0.00 ? 11 ALA A CB   5 
ATOM   4042 H H    . ALA A 1 11 ? -1.796  2.710   -7.049  1.00 0.00 ? 11 ALA A H    5 
ATOM   4043 H HA   . ALA A 1 11 ? -3.862  3.383   -5.424  1.00 0.00 ? 11 ALA A HA   5 
ATOM   4044 H HB1  . ALA A 1 11 ? -3.078  4.670   -8.029  1.00 0.00 ? 11 ALA A HB1  5 
ATOM   4045 H HB2  . ALA A 1 11 ? -2.502  5.081   -6.413  1.00 0.00 ? 11 ALA A HB2  5 
ATOM   4046 H HB3  . ALA A 1 11 ? -4.179  5.398   -6.859  1.00 0.00 ? 11 ALA A HB3  5 
ATOM   4047 N N    . SER A 1 12 ? -4.965  2.179   -8.220  1.00 0.00 ? 12 SER A N    5 
ATOM   4048 C CA   . SER A 1 12 ? -6.145  1.694   -8.924  1.00 0.00 ? 12 SER A CA   5 
ATOM   4049 C C    . SER A 1 12 ? -7.120  1.024   -7.960  1.00 0.00 ? 12 SER A C    5 
ATOM   4050 O O    . SER A 1 12 ? -8.335  1.069   -8.156  1.00 0.00 ? 12 SER A O    5 
ATOM   4051 C CB   . SER A 1 12 ? -5.739  0.709   -10.022 1.00 0.00 ? 12 SER A CB   5 
ATOM   4052 O OG   . SER A 1 12 ? -6.592  0.820   -11.148 1.00 0.00 ? 12 SER A OG   5 
ATOM   4053 H H    . SER A 1 12 ? -4.078  1.962   -8.568  1.00 0.00 ? 12 SER A H    5 
ATOM   4054 H HA   . SER A 1 12 ? -6.629  2.544   -9.377  1.00 0.00 ? 12 SER A HA   5 
ATOM   4055 H HB2  . SER A 1 12 ? -4.726  0.918   -10.334 1.00 0.00 ? 12 SER A HB2  5 
ATOM   4056 H HB3  . SER A 1 12 ? -5.797  -0.299  -9.639  1.00 0.00 ? 12 SER A HB3  5 
ATOM   4057 H HG   . SER A 1 12 ? -7.493  0.613   -10.888 1.00 0.00 ? 12 SER A HG   5 
ATOM   4058 N N    . ALA A 1 13 ? -6.577  0.401   -6.918  1.00 0.00 ? 13 ALA A N    5 
ATOM   4059 C CA   . ALA A 1 13 ? -7.388  -0.279  -5.924  1.00 0.00 ? 13 ALA A CA   5 
ATOM   4060 C C    . ALA A 1 13 ? -7.651  0.616   -4.716  1.00 0.00 ? 13 ALA A C    5 
ATOM   4061 O O    . ALA A 1 13 ? -8.719  0.555   -4.108  1.00 0.00 ? 13 ALA A O    5 
ATOM   4062 C CB   . ALA A 1 13 ? -6.717  -1.573  -5.490  1.00 0.00 ? 13 ALA A CB   5 
ATOM   4063 H H    . ALA A 1 13 ? -5.609  0.397   -6.818  1.00 0.00 ? 13 ALA A H    5 
ATOM   4064 H HA   . ALA A 1 13 ? -8.326  -0.527  -6.387  1.00 0.00 ? 13 ALA A HA   5 
ATOM   4065 H HB1  . ALA A 1 13 ? -6.483  -2.167  -6.362  1.00 0.00 ? 13 ALA A HB1  5 
ATOM   4066 H HB2  . ALA A 1 13 ? -7.385  -2.127  -4.847  1.00 0.00 ? 13 ALA A HB2  5 
ATOM   4067 H HB3  . ALA A 1 13 ? -5.808  -1.345  -4.955  1.00 0.00 ? 13 ALA A HB3  5 
ATOM   4068 N N    . ILE A 1 14 ? -6.670  1.445   -4.372  1.00 0.00 ? 14 ILE A N    5 
ATOM   4069 C CA   . ILE A 1 14 ? -6.799  2.350   -3.235  1.00 0.00 ? 14 ILE A CA   5 
ATOM   4070 C C    . ILE A 1 14 ? -7.718  3.524   -3.569  1.00 0.00 ? 14 ILE A C    5 
ATOM   4071 O O    . ILE A 1 14 ? -8.734  3.737   -2.908  1.00 0.00 ? 14 ILE A O    5 
ATOM   4072 C CB   . ILE A 1 14 ? -5.423  2.891   -2.785  1.00 0.00 ? 14 ILE A CB   5 
ATOM   4073 C CG1  . ILE A 1 14 ? -4.519  1.742   -2.332  1.00 0.00 ? 14 ILE A CG1  5 
ATOM   4074 C CG2  . ILE A 1 14 ? -5.585  3.911   -1.664  1.00 0.00 ? 14 ILE A CG2  5 
ATOM   4075 C CD1  . ILE A 1 14 ? -3.743  1.100   -3.462  1.00 0.00 ? 14 ILE A CD1  5 
ATOM   4076 H H    . ILE A 1 14 ? -5.840  1.448   -4.894  1.00 0.00 ? 14 ILE A H    5 
ATOM   4077 H HA   . ILE A 1 14 ? -7.229  1.793   -2.414  1.00 0.00 ? 14 ILE A HA   5 
ATOM   4078 H HB   . ILE A 1 14 ? -4.966  3.388   -3.626  1.00 0.00 ? 14 ILE A HB   5 
ATOM   4079 H HG12 . ILE A 1 14 ? -3.805  2.118   -1.612  1.00 0.00 ? 14 ILE A HG12 5 
ATOM   4080 H HG13 . ILE A 1 14 ? -5.124  0.976   -1.865  1.00 0.00 ? 14 ILE A HG13 5 
ATOM   4081 H HG21 . ILE A 1 14 ? -5.528  4.908   -2.075  1.00 0.00 ? 14 ILE A HG21 5 
ATOM   4082 H HG22 . ILE A 1 14 ? -4.797  3.776   -0.937  1.00 0.00 ? 14 ILE A HG22 5 
ATOM   4083 H HG23 . ILE A 1 14 ? -6.543  3.773   -1.187  1.00 0.00 ? 14 ILE A HG23 5 
ATOM   4084 H HD11 . ILE A 1 14 ? -3.880  1.675   -4.366  1.00 0.00 ? 14 ILE A HD11 5 
ATOM   4085 H HD12 . ILE A 1 14 ? -4.101  0.093   -3.618  1.00 0.00 ? 14 ILE A HD12 5 
ATOM   4086 H HD13 . ILE A 1 14 ? -2.693  1.073   -3.209  1.00 0.00 ? 14 ILE A HD13 5 
ATOM   4087 N N    . LEU A 1 15 ? -7.350  4.285   -4.595  1.00 0.00 ? 15 LEU A N    5 
ATOM   4088 C CA   . LEU A 1 15 ? -8.137  5.440   -5.013  1.00 0.00 ? 15 LEU A CA   5 
ATOM   4089 C C    . LEU A 1 15 ? -9.403  5.009   -5.746  1.00 0.00 ? 15 LEU A C    5 
ATOM   4090 O O    . LEU A 1 15 ? -10.504 5.086   -5.201  1.00 0.00 ? 15 LEU A O    5 
ATOM   4091 C CB   . LEU A 1 15 ? -7.301  6.352   -5.912  1.00 0.00 ? 15 LEU A CB   5 
ATOM   4092 C CG   . LEU A 1 15 ? -6.135  7.056   -5.217  1.00 0.00 ? 15 LEU A CG   5 
ATOM   4093 C CD1  . LEU A 1 15 ? -5.240  7.740   -6.238  1.00 0.00 ? 15 LEU A CD1  5 
ATOM   4094 C CD2  . LEU A 1 15 ? -6.651  8.061   -4.198  1.00 0.00 ? 15 LEU A CD2  5 
ATOM   4095 H H    . LEU A 1 15 ? -6.527  4.067   -5.080  1.00 0.00 ? 15 LEU A H    5 
ATOM   4096 H HA   . LEU A 1 15 ? -8.418  5.986   -4.125  1.00 0.00 ? 15 LEU A HA   5 
ATOM   4097 H HB2  . LEU A 1 15 ? -6.904  5.756   -6.721  1.00 0.00 ? 15 LEU A HB2  5 
ATOM   4098 H HB3  . LEU A 1 15 ? -7.951  7.106   -6.328  1.00 0.00 ? 15 LEU A HB3  5 
ATOM   4099 H HG   . LEU A 1 15 ? -5.540  6.321   -4.692  1.00 0.00 ? 15 LEU A HG   5 
ATOM   4100 H HD11 . LEU A 1 15 ? -4.254  7.875   -5.820  1.00 0.00 ? 15 LEU A HD11 5 
ATOM   4101 H HD12 . LEU A 1 15 ? -5.658  8.702   -6.495  1.00 0.00 ? 15 LEU A HD12 5 
ATOM   4102 H HD13 . LEU A 1 15 ? -5.175  7.128   -7.126  1.00 0.00 ? 15 LEU A HD13 5 
ATOM   4103 H HD21 . LEU A 1 15 ? -7.316  7.565   -3.507  1.00 0.00 ? 15 LEU A HD21 5 
ATOM   4104 H HD22 . LEU A 1 15 ? -7.184  8.849   -4.708  1.00 0.00 ? 15 LEU A HD22 5 
ATOM   4105 H HD23 . LEU A 1 15 ? -5.818  8.483   -3.656  1.00 0.00 ? 15 LEU A HD23 5 
ATOM   4106 N N    . SER A 1 16 ? -9.240  4.560   -6.987  1.00 0.00 ? 16 SER A N    5 
ATOM   4107 C CA   . SER A 1 16 ? -10.371 4.121   -7.801  1.00 0.00 ? 16 SER A CA   5 
ATOM   4108 C C    . SER A 1 16 ? -11.240 3.117   -7.048  1.00 0.00 ? 16 SER A C    5 
ATOM   4109 O O    . SER A 1 16 ? -12.447 3.310   -6.906  1.00 0.00 ? 16 SER A O    5 
ATOM   4110 C CB   . SER A 1 16 ? -9.874  3.501   -9.109  1.00 0.00 ? 16 SER A CB   5 
ATOM   4111 O OG   . SER A 1 16 ? -10.690 3.890   -10.200 1.00 0.00 ? 16 SER A OG   5 
ATOM   4112 H H    . SER A 1 16 ? -8.338  4.526   -7.368  1.00 0.00 ? 16 SER A H    5 
ATOM   4113 H HA   . SER A 1 16 ? -10.968 4.991   -8.032  1.00 0.00 ? 16 SER A HA   5 
ATOM   4114 H HB2  . SER A 1 16 ? -8.863  3.828   -9.298  1.00 0.00 ? 16 SER A HB2  5 
ATOM   4115 H HB3  . SER A 1 16 ? -9.895  2.424   -9.025  1.00 0.00 ? 16 SER A HB3  5 
ATOM   4116 H HG   . SER A 1 16 ? -10.282 3.608   -11.022 1.00 0.00 ? 16 SER A HG   5 
ATOM   4117 N N    . GLY A 1 17 ? -10.619 2.045   -6.568  1.00 0.00 ? 17 GLY A N    5 
ATOM   4118 C CA   . GLY A 1 17 ? -11.353 1.029   -5.838  1.00 0.00 ? 17 GLY A CA   5 
ATOM   4119 C C    . GLY A 1 17 ? -11.812 -0.109  -6.729  1.00 0.00 ? 17 GLY A C    5 
ATOM   4120 O O    . GLY A 1 17 ? -12.759 -0.823  -6.397  1.00 0.00 ? 17 GLY A O    5 
ATOM   4121 H H    . GLY A 1 17 ? -9.654  1.943   -6.712  1.00 0.00 ? 17 GLY A H    5 
ATOM   4122 H HA2  . GLY A 1 17 ? -10.717 0.629   -5.062  1.00 0.00 ? 17 GLY A HA2  5 
ATOM   4123 H HA3  . GLY A 1 17 ? -12.218 1.484   -5.380  1.00 0.00 ? 17 GLY A HA3  5 
ATOM   4124 N N    . ALA A 1 18 ? -11.141 -0.279  -7.864  1.00 0.00 ? 18 ALA A N    5 
ATOM   4125 C CA   . ALA A 1 18 ? -11.485 -1.336  -8.804  1.00 0.00 ? 18 ALA A CA   5 
ATOM   4126 C C    . ALA A 1 18 ? -11.179 -2.708  -8.222  1.00 0.00 ? 18 ALA A C    5 
ATOM   4127 O O    . ALA A 1 18 ? -12.075 -3.423  -7.771  1.00 0.00 ? 18 ALA A O    5 
ATOM   4128 C CB   . ALA A 1 18 ? -10.742 -1.134  -10.118 1.00 0.00 ? 18 ALA A CB   5 
ATOM   4129 H H    . ALA A 1 18 ? -10.396 0.320   -8.074  1.00 0.00 ? 18 ALA A H    5 
ATOM   4130 H HA   . ALA A 1 18 ? -12.536 -1.273  -9.002  1.00 0.00 ? 18 ALA A HA   5 
ATOM   4131 H HB1  . ALA A 1 18 ? -11.455 -0.968  -10.912 1.00 0.00 ? 18 ALA A HB1  5 
ATOM   4132 H HB2  . ALA A 1 18 ? -10.154 -2.013  -10.341 1.00 0.00 ? 18 ALA A HB2  5 
ATOM   4133 H HB3  . ALA A 1 18 ? -10.090 -0.278  -10.035 1.00 0.00 ? 18 ALA A HB3  5 
ATOM   4134 N N    . LYS A 1 19 ? -9.907  -3.064  -8.237  1.00 0.00 ? 19 LYS A N    5 
ATOM   4135 C CA   . LYS A 1 19 ? -9.458  -4.347  -7.714  1.00 0.00 ? 19 LYS A CA   5 
ATOM   4136 C C    . LYS A 1 19 ? -7.937  -4.378  -7.583  1.00 0.00 ? 19 LYS A C    5 
ATOM   4137 O O    . LYS A 1 19 ? -7.240  -3.541  -8.157  1.00 0.00 ? 19 LYS A O    5 
ATOM   4138 C CB   . LYS A 1 19 ? -9.933  -5.490  -8.616  1.00 0.00 ? 19 LYS A CB   5 
ATOM   4139 C CG   . LYS A 1 19 ? -9.807  -5.195  -10.103 1.00 0.00 ? 19 LYS A CG   5 
ATOM   4140 C CD   . LYS A 1 19 ? -8.460  -5.642  -10.648 1.00 0.00 ? 19 LYS A CD   5 
ATOM   4141 C CE   . LYS A 1 19 ? -7.988  -4.737  -11.774 1.00 0.00 ? 19 LYS A CE   5 
ATOM   4142 N NZ   . LYS A 1 19 ? -7.586  -3.393  -11.276 1.00 0.00 ? 19 LYS A NZ   5 
ATOM   4143 H H    . LYS A 1 19 ? -9.253  -2.444  -8.609  1.00 0.00 ? 19 LYS A H    5 
ATOM   4144 H HA   . LYS A 1 19 ? -9.891  -4.470  -6.735  1.00 0.00 ? 19 LYS A HA   5 
ATOM   4145 H HB2  . LYS A 1 19 ? -9.348  -6.371  -8.397  1.00 0.00 ? 19 LYS A HB2  5 
ATOM   4146 H HB3  . LYS A 1 19 ? -10.971 -5.696  -8.399  1.00 0.00 ? 19 LYS A HB3  5 
ATOM   4147 H HG2  . LYS A 1 19 ? -10.588 -5.720  -10.631 1.00 0.00 ? 19 LYS A HG2  5 
ATOM   4148 H HG3  . LYS A 1 19 ? -9.915  -4.132  -10.261 1.00 0.00 ? 19 LYS A HG3  5 
ATOM   4149 H HD2  . LYS A 1 19 ? -7.734  -5.616  -9.850  1.00 0.00 ? 19 LYS A HD2  5 
ATOM   4150 H HD3  . LYS A 1 19 ? -8.551  -6.651  -11.022 1.00 0.00 ? 19 LYS A HD3  5 
ATOM   4151 H HE2  . LYS A 1 19 ? -7.140  -5.199  -12.258 1.00 0.00 ? 19 LYS A HE2  5 
ATOM   4152 H HE3  . LYS A 1 19 ? -8.790  -4.623  -12.488 1.00 0.00 ? 19 LYS A HE3  5 
ATOM   4153 H HZ1  . LYS A 1 19 ? -7.353  -2.771  -12.077 1.00 0.00 ? 19 LYS A HZ1  5 
ATOM   4154 H HZ2  . LYS A 1 19 ? -6.752  -3.473  -10.660 1.00 0.00 ? 19 LYS A HZ2  5 
ATOM   4155 H HZ3  . LYS A 1 19 ? -8.364  -2.966  -10.734 1.00 0.00 ? 19 LYS A HZ3  5 
ATOM   4156 N N    . PRO A 1 20 ? -7.401  -5.346  -6.819  1.00 0.00 ? 20 PRO A N    5 
ATOM   4157 C CA   . PRO A 1 20 ? -5.954  -5.480  -6.610  1.00 0.00 ? 20 PRO A CA   5 
ATOM   4158 C C    . PRO A 1 20 ? -5.184  -5.590  -7.923  1.00 0.00 ? 20 PRO A C    5 
ATOM   4159 O O    . PRO A 1 20 ? -5.710  -5.281  -8.991  1.00 0.00 ? 20 PRO A O    5 
ATOM   4160 C CB   . PRO A 1 20 ? -5.824  -6.778  -5.807  1.00 0.00 ? 20 PRO A CB   5 
ATOM   4161 C CG   . PRO A 1 20 ? -7.147  -6.950  -5.143  1.00 0.00 ? 20 PRO A CG   5 
ATOM   4162 C CD   . PRO A 1 20 ? -8.161  -6.381  -6.094  1.00 0.00 ? 20 PRO A CD   5 
ATOM   4163 H HA   . PRO A 1 20 ? -5.560  -4.656  -6.033  1.00 0.00 ? 20 PRO A HA   5 
ATOM   4164 H HB2  . PRO A 1 20 ? -5.607  -7.598  -6.476  1.00 0.00 ? 20 PRO A HB2  5 
ATOM   4165 H HB3  . PRO A 1 20 ? -5.030  -6.678  -5.082  1.00 0.00 ? 20 PRO A HB3  5 
ATOM   4166 H HG2  . PRO A 1 20 ? -7.338  -7.999  -4.972  1.00 0.00 ? 20 PRO A HG2  5 
ATOM   4167 H HG3  . PRO A 1 20 ? -7.163  -6.407  -4.210  1.00 0.00 ? 20 PRO A HG3  5 
ATOM   4168 H HD2  . PRO A 1 20 ? -8.514  -7.146  -6.771  1.00 0.00 ? 20 PRO A HD2  5 
ATOM   4169 H HD3  . PRO A 1 20 ? -8.986  -5.944  -5.551  1.00 0.00 ? 20 PRO A HD3  5 
ATOM   4170 N N    . SER A 1 21 ? -3.934  -6.033  -7.834  1.00 0.00 ? 21 SER A N    5 
ATOM   4171 C CA   . SER A 1 21 ? -3.092  -6.184  -9.012  1.00 0.00 ? 21 SER A CA   5 
ATOM   4172 C C    . SER A 1 21 ? -1.781  -6.880  -8.659  1.00 0.00 ? 21 SER A C    5 
ATOM   4173 O O    . SER A 1 21 ? -1.161  -6.576  -7.640  1.00 0.00 ? 21 SER A O    5 
ATOM   4174 C CB   . SER A 1 21 ? -2.806  -4.818  -9.640  1.00 0.00 ? 21 SER A CB   5 
ATOM   4175 O OG   . SER A 1 21 ? -3.758  -4.507  -10.642 1.00 0.00 ? 21 SER A OG   5 
ATOM   4176 H H    . SER A 1 21 ? -3.571  -6.264  -6.955  1.00 0.00 ? 21 SER A H    5 
ATOM   4177 H HA   . SER A 1 21 ? -3.627  -6.792  -9.724  1.00 0.00 ? 21 SER A HA   5 
ATOM   4178 H HB2  . SER A 1 21 ? -2.845  -4.057  -8.875  1.00 0.00 ? 21 SER A HB2  5 
ATOM   4179 H HB3  . SER A 1 21 ? -1.822  -4.828  -10.087 1.00 0.00 ? 21 SER A HB3  5 
ATOM   4180 H HG   . SER A 1 21 ? -3.338  -3.995  -11.336 1.00 0.00 ? 21 SER A HG   5 
ATOM   4181 N N    . GLY A 1 22 ? -1.367  -7.815  -9.507  1.00 0.00 ? 22 GLY A N    5 
ATOM   4182 C CA   . GLY A 1 22 ? -0.134  -8.540  -9.266  1.00 0.00 ? 22 GLY A CA   5 
ATOM   4183 C C    . GLY A 1 22 ? 1.078   -7.630  -9.232  1.00 0.00 ? 22 GLY A C    5 
ATOM   4184 O O    . GLY A 1 22 ? 2.018   -7.865  -8.473  1.00 0.00 ? 22 GLY A O    5 
ATOM   4185 H H    . GLY A 1 22 ? -1.903  -8.015  -10.303 1.00 0.00 ? 22 GLY A H    5 
ATOM   4186 H HA2  . GLY A 1 22 ? -0.210  -9.055  -8.320  1.00 0.00 ? 22 GLY A HA2  5 
ATOM   4187 H HA3  . GLY A 1 22 ? 0.001   -9.270  -10.051 1.00 0.00 ? 22 GLY A HA3  5 
ATOM   4188 N N    . GLU A 1 23 ? 1.060   -6.590  -10.061 1.00 0.00 ? 23 GLU A N    5 
ATOM   4189 C CA   . GLU A 1 23 ? 2.156   -5.646  -10.131 1.00 0.00 ? 23 GLU A CA   5 
ATOM   4190 C C    . GLU A 1 23 ? 2.432   -5.029  -8.764  1.00 0.00 ? 23 GLU A C    5 
ATOM   4191 O O    . GLU A 1 23 ? 3.572   -5.007  -8.299  1.00 0.00 ? 23 GLU A O    5 
ATOM   4192 C CB   . GLU A 1 23 ? 1.815   -4.553  -11.138 1.00 0.00 ? 23 GLU A CB   5 
ATOM   4193 C CG   . GLU A 1 23 ? 3.036   -3.907  -11.750 1.00 0.00 ? 23 GLU A CG   5 
ATOM   4194 C CD   . GLU A 1 23 ? 2.998   -2.393  -11.687 1.00 0.00 ? 23 GLU A CD   5 
ATOM   4195 O OE1  . GLU A 1 23 ? 2.414   -1.775  -12.602 1.00 0.00 ? 23 GLU A OE1  5 
ATOM   4196 O OE2  . GLU A 1 23 ? 3.554   -1.824  -10.724 1.00 0.00 ? 23 GLU A OE2  5 
ATOM   4197 H H    . GLU A 1 23 ? 0.291   -6.454  -10.646 1.00 0.00 ? 23 GLU A H    5 
ATOM   4198 H HA   . GLU A 1 23 ? 3.036   -6.174  -10.466 1.00 0.00 ? 23 GLU A HA   5 
ATOM   4199 H HB2  . GLU A 1 23 ? 1.222   -4.983  -11.934 1.00 0.00 ? 23 GLU A HB2  5 
ATOM   4200 H HB3  . GLU A 1 23 ? 1.238   -3.785  -10.639 1.00 0.00 ? 23 GLU A HB3  5 
ATOM   4201 H HG2  . GLU A 1 23 ? 3.907   -4.256  -11.221 1.00 0.00 ? 23 GLU A HG2  5 
ATOM   4202 H HG3  . GLU A 1 23 ? 3.096   -4.212  -12.783 1.00 0.00 ? 23 GLU A HG3  5 
ATOM   4203 N N    . CYS A 1 24 ? 1.379   -4.527  -8.128  1.00 0.00 ? 24 CYS A N    5 
ATOM   4204 C CA   . CYS A 1 24 ? 1.500   -3.907  -6.816  1.00 0.00 ? 24 CYS A CA   5 
ATOM   4205 C C    . CYS A 1 24 ? 2.117   -4.870  -5.808  1.00 0.00 ? 24 CYS A C    5 
ATOM   4206 O O    . CYS A 1 24 ? 2.739   -4.449  -4.832  1.00 0.00 ? 24 CYS A O    5 
ATOM   4207 C CB   . CYS A 1 24 ? 0.132   -3.434  -6.320  1.00 0.00 ? 24 CYS A CB   5 
ATOM   4208 S SG   . CYS A 1 24 ? 0.163   -2.670  -4.665  1.00 0.00 ? 24 CYS A SG   5 
ATOM   4209 H H    . CYS A 1 24 ? 0.500   -4.572  -8.552  1.00 0.00 ? 24 CYS A H    5 
ATOM   4210 H HA   . CYS A 1 24 ? 2.146   -3.057  -6.922  1.00 0.00 ? 24 CYS A HA   5 
ATOM   4211 H HB2  . CYS A 1 24 ? -0.260  -2.702  -7.011  1.00 0.00 ? 24 CYS A HB2  5 
ATOM   4212 H HB3  . CYS A 1 24 ? -0.540  -4.278  -6.280  1.00 0.00 ? 24 CYS A HB3  5 
ATOM   4213 N N    . CYS A 1 25 ? 1.939   -6.161  -6.050  1.00 0.00 ? 25 CYS A N    5 
ATOM   4214 C CA   . CYS A 1 25 ? 2.477   -7.187  -5.165  1.00 0.00 ? 25 CYS A CA   5 
ATOM   4215 C C    . CYS A 1 25 ? 4.000   -7.224  -5.245  1.00 0.00 ? 25 CYS A C    5 
ATOM   4216 O O    . CYS A 1 25 ? 4.686   -7.168  -4.225  1.00 0.00 ? 25 CYS A O    5 
ATOM   4217 C CB   . CYS A 1 25 ? 1.897   -8.557  -5.526  1.00 0.00 ? 25 CYS A CB   5 
ATOM   4218 S SG   . CYS A 1 25 ? 0.774   -9.245  -4.266  1.00 0.00 ? 25 CYS A SG   5 
ATOM   4219 H H    . CYS A 1 25 ? 1.435   -6.431  -6.844  1.00 0.00 ? 25 CYS A H    5 
ATOM   4220 H HA   . CYS A 1 25 ? 2.188   -6.938  -4.155  1.00 0.00 ? 25 CYS A HA   5 
ATOM   4221 H HB2  . CYS A 1 25 ? 1.341   -8.473  -6.447  1.00 0.00 ? 25 CYS A HB2  5 
ATOM   4222 H HB3  . CYS A 1 25 ? 2.707   -9.260  -5.663  1.00 0.00 ? 25 CYS A HB3  5 
ATOM   4223 N N    . GLY A 1 26 ? 4.521   -7.317  -6.464  1.00 0.00 ? 26 GLY A N    5 
ATOM   4224 C CA   . GLY A 1 26 ? 5.959   -7.359  -6.654  1.00 0.00 ? 26 GLY A CA   5 
ATOM   4225 C C    . GLY A 1 26 ? 6.651   -6.122  -6.116  1.00 0.00 ? 26 GLY A C    5 
ATOM   4226 O O    . GLY A 1 26 ? 7.731   -6.212  -5.531  1.00 0.00 ? 26 GLY A O    5 
ATOM   4227 H H    . GLY A 1 26 ? 3.925   -7.358  -7.240  1.00 0.00 ? 26 GLY A H    5 
ATOM   4228 H HA2  . GLY A 1 26 ? 6.353   -8.228  -6.147  1.00 0.00 ? 26 GLY A HA2  5 
ATOM   4229 H HA3  . GLY A 1 26 ? 6.169   -7.445  -7.709  1.00 0.00 ? 26 GLY A HA3  5 
ATOM   4230 N N    . ASN A 1 27 ? 6.030   -4.964  -6.315  1.00 0.00 ? 27 ASN A N    5 
ATOM   4231 C CA   . ASN A 1 27 ? 6.590   -3.706  -5.850  1.00 0.00 ? 27 ASN A CA   5 
ATOM   4232 C C    . ASN A 1 27 ? 6.787   -3.724  -4.343  1.00 0.00 ? 27 ASN A C    5 
ATOM   4233 O O    . ASN A 1 27 ? 7.891   -3.515  -3.840  1.00 0.00 ? 27 ASN A O    5 
ATOM   4234 C CB   . ASN A 1 27 ? 5.683   -2.542  -6.247  1.00 0.00 ? 27 ASN A CB   5 
ATOM   4235 C CG   . ASN A 1 27 ? 6.022   -1.990  -7.617  1.00 0.00 ? 27 ASN A CG   5 
ATOM   4236 O OD1  . ASN A 1 27 ? 7.193   -1.835  -7.964  1.00 0.00 ? 27 ASN A OD1  5 
ATOM   4237 N ND2  . ASN A 1 27 ? 4.997   -1.691  -8.404  1.00 0.00 ? 27 ASN A ND2  5 
ATOM   4238 H H    . ASN A 1 27 ? 5.176   -4.954  -6.786  1.00 0.00 ? 27 ASN A H    5 
ATOM   4239 H HA   . ASN A 1 27 ? 7.540   -3.583  -6.320  1.00 0.00 ? 27 ASN A HA   5 
ATOM   4240 H HB2  . ASN A 1 27 ? 4.658   -2.880  -6.259  1.00 0.00 ? 27 ASN A HB2  5 
ATOM   4241 H HB3  . ASN A 1 27 ? 5.787   -1.748  -5.522  1.00 0.00 ? 27 ASN A HB3  5 
ATOM   4242 H HD21 . ASN A 1 27 ? 4.091   -1.839  -8.061  1.00 0.00 ? 27 ASN A HD21 5 
ATOM   4243 H HD22 . ASN A 1 27 ? 5.188   -1.335  -9.296  1.00 0.00 ? 27 ASN A HD22 5 
ATOM   4244 N N    . LEU A 1 28 ? 5.701   -3.976  -3.634  1.00 0.00 ? 28 LEU A N    5 
ATOM   4245 C CA   . LEU A 1 28 ? 5.716   -4.029  -2.180  1.00 0.00 ? 28 LEU A CA   5 
ATOM   4246 C C    . LEU A 1 28 ? 6.854   -4.901  -1.668  1.00 0.00 ? 28 LEU A C    5 
ATOM   4247 O O    . LEU A 1 28 ? 7.392   -4.667  -0.586  1.00 0.00 ? 28 LEU A O    5 
ATOM   4248 C CB   . LEU A 1 28 ? 4.377   -4.556  -1.664  1.00 0.00 ? 28 LEU A CB   5 
ATOM   4249 C CG   . LEU A 1 28 ? 3.714   -3.682  -0.612  1.00 0.00 ? 28 LEU A CG   5 
ATOM   4250 C CD1  . LEU A 1 28 ? 2.275   -4.117  -0.381  1.00 0.00 ? 28 LEU A CD1  5 
ATOM   4251 C CD2  . LEU A 1 28 ? 4.510   -3.737  0.679   1.00 0.00 ? 28 LEU A CD2  5 
ATOM   4252 H H    . LEU A 1 28 ? 4.862   -4.129  -4.106  1.00 0.00 ? 28 LEU A H    5 
ATOM   4253 H HA   . LEU A 1 28 ? 5.859   -3.031  -1.816  1.00 0.00 ? 28 LEU A HA   5 
ATOM   4254 H HB2  . LEU A 1 28 ? 3.703   -4.650  -2.500  1.00 0.00 ? 28 LEU A HB2  5 
ATOM   4255 H HB3  . LEU A 1 28 ? 4.536   -5.533  -1.236  1.00 0.00 ? 28 LEU A HB3  5 
ATOM   4256 H HG   . LEU A 1 28 ? 3.706   -2.661  -0.962  1.00 0.00 ? 28 LEU A HG   5 
ATOM   4257 H HD11 . LEU A 1 28 ? 1.994   -3.902  0.639   1.00 0.00 ? 28 LEU A HD11 5 
ATOM   4258 H HD12 . LEU A 1 28 ? 2.187   -5.177  -0.564  1.00 0.00 ? 28 LEU A HD12 5 
ATOM   4259 H HD13 . LEU A 1 28 ? 1.625   -3.579  -1.055  1.00 0.00 ? 28 LEU A HD13 5 
ATOM   4260 H HD21 . LEU A 1 28 ? 4.947   -4.722  0.792   1.00 0.00 ? 28 LEU A HD21 5 
ATOM   4261 H HD22 . LEU A 1 28 ? 3.858   -3.533  1.515   1.00 0.00 ? 28 LEU A HD22 5 
ATOM   4262 H HD23 . LEU A 1 28 ? 5.296   -2.999  0.644   1.00 0.00 ? 28 LEU A HD23 5 
ATOM   4263 N N    . ARG A 1 29 ? 7.209   -5.910  -2.447  1.00 0.00 ? 29 ARG A N    5 
ATOM   4264 C CA   . ARG A 1 29 ? 8.272   -6.818  -2.067  1.00 0.00 ? 29 ARG A CA   5 
ATOM   4265 C C    . ARG A 1 29 ? 9.613   -6.118  -2.032  1.00 0.00 ? 29 ARG A C    5 
ATOM   4266 O O    . ARG A 1 29 ? 10.315  -6.146  -1.022  1.00 0.00 ? 29 ARG A O    5 
ATOM   4267 C CB   . ARG A 1 29 ? 8.319   -8.023  -3.000  1.00 0.00 ? 29 ARG A CB   5 
ATOM   4268 C CG   . ARG A 1 29 ? 7.802   -9.292  -2.350  1.00 0.00 ? 29 ARG A CG   5 
ATOM   4269 C CD   . ARG A 1 29 ? 6.371   -9.591  -2.765  1.00 0.00 ? 29 ARG A CD   5 
ATOM   4270 N NE   . ARG A 1 29 ? 5.542   -9.969  -1.624  1.00 0.00 ? 29 ARG A NE   5 
ATOM   4271 C CZ   . ARG A 1 29 ? 5.352   -11.225 -1.224  1.00 0.00 ? 29 ARG A CZ   5 
ATOM   4272 N NH1  . ARG A 1 29 ? 5.945   -12.232 -1.855  1.00 0.00 ? 29 ARG A NH1  5 
ATOM   4273 N NH2  . ARG A 1 29 ? 4.572   -11.476 -0.181  1.00 0.00 ? 29 ARG A NH2  5 
ATOM   4274 H H    . ARG A 1 29 ? 6.741   -6.051  -3.286  1.00 0.00 ? 29 ARG A H    5 
ATOM   4275 H HA   . ARG A 1 29 ? 8.052   -7.151  -1.087  1.00 0.00 ? 29 ARG A HA   5 
ATOM   4276 H HB2  . ARG A 1 29 ? 7.717   -7.815  -3.871  1.00 0.00 ? 29 ARG A HB2  5 
ATOM   4277 H HB3  . ARG A 1 29 ? 9.340   -8.190  -3.305  1.00 0.00 ? 29 ARG A HB3  5 
ATOM   4278 H HG2  . ARG A 1 29 ? 8.432   -10.118 -2.641  1.00 0.00 ? 29 ARG A HG2  5 
ATOM   4279 H HG3  . ARG A 1 29 ? 7.836   -9.168  -1.276  1.00 0.00 ? 29 ARG A HG3  5 
ATOM   4280 H HD2  . ARG A 1 29 ? 5.952   -8.708  -3.224  1.00 0.00 ? 29 ARG A HD2  5 
ATOM   4281 H HD3  . ARG A 1 29 ? 6.377   -10.398 -3.481  1.00 0.00 ? 29 ARG A HD3  5 
ATOM   4282 H HE   . ARG A 1 29 ? 5.101   -9.247  -1.129  1.00 0.00 ? 29 ARG A HE   5 
ATOM   4283 H HH11 . ARG A 1 29 ? 6.540   -12.053 -2.637  1.00 0.00 ? 29 ARG A HH11 5 
ATOM   4284 H HH12 . ARG A 1 29 ? 5.795   -13.171 -1.547  1.00 0.00 ? 29 ARG A HH12 5 
ATOM   4285 H HH21 . ARG A 1 29 ? 4.127   -10.723 0.303   1.00 0.00 ? 29 ARG A HH21 5 
ATOM   4286 H HH22 . ARG A 1 29 ? 4.428   -12.419 0.121   1.00 0.00 ? 29 ARG A HH22 5 
ATOM   4287 N N    . ALA A 1 30 ? 9.957   -5.472  -3.131  1.00 0.00 ? 30 ALA A N    5 
ATOM   4288 C CA   . ALA A 1 30 ? 11.210  -4.741  -3.215  1.00 0.00 ? 30 ALA A CA   5 
ATOM   4289 C C    . ALA A 1 30 ? 11.362  -3.823  -2.007  1.00 0.00 ? 30 ALA A C    5 
ATOM   4290 O O    . ALA A 1 30 ? 12.473  -3.479  -1.603  1.00 0.00 ? 30 ALA A O    5 
ATOM   4291 C CB   . ALA A 1 30 ? 11.276  -3.942  -4.508  1.00 0.00 ? 30 ALA A CB   5 
ATOM   4292 H H    . ALA A 1 30 ? 9.349   -5.477  -3.891  1.00 0.00 ? 30 ALA A H    5 
ATOM   4293 H HA   . ALA A 1 30 ? 12.011  -5.459  -3.216  1.00 0.00 ? 30 ALA A HA   5 
ATOM   4294 H HB1  . ALA A 1 30 ? 11.302  -4.620  -5.349  1.00 0.00 ? 30 ALA A HB1  5 
ATOM   4295 H HB2  . ALA A 1 30 ? 12.168  -3.333  -4.510  1.00 0.00 ? 30 ALA A HB2  5 
ATOM   4296 H HB3  . ALA A 1 30 ? 10.406  -3.307  -4.584  1.00 0.00 ? 30 ALA A HB3  5 
ATOM   4297 N N    . GLN A 1 31 ? 10.225  -3.448  -1.428  1.00 0.00 ? 31 GLN A N    5 
ATOM   4298 C CA   . GLN A 1 31 ? 10.200  -2.588  -0.254  1.00 0.00 ? 31 GLN A CA   5 
ATOM   4299 C C    . GLN A 1 31 ? 10.461  -3.399  1.008   1.00 0.00 ? 31 GLN A C    5 
ATOM   4300 O O    . GLN A 1 31 ? 11.526  -3.293  1.617   1.00 0.00 ? 31 GLN A O    5 
ATOM   4301 C CB   . GLN A 1 31 ? 8.856   -1.858  -0.150  1.00 0.00 ? 31 GLN A CB   5 
ATOM   4302 C CG   . GLN A 1 31 ? 8.184   -1.620  -1.493  1.00 0.00 ? 31 GLN A CG   5 
ATOM   4303 C CD   . GLN A 1 31 ? 7.133   -0.532  -1.430  1.00 0.00 ? 31 GLN A CD   5 
ATOM   4304 O OE1  . GLN A 1 31 ? 5.992   -0.775  -1.036  1.00 0.00 ? 31 GLN A OE1  5 
ATOM   4305 N NE2  . GLN A 1 31 ? 7.514   0.677   -1.820  1.00 0.00 ? 31 GLN A NE2  5 
ATOM   4306 H H    . GLN A 1 31 ? 9.375   -3.776  -1.793  1.00 0.00 ? 31 GLN A H    5 
ATOM   4307 H HA   . GLN A 1 31 ? 10.987  -1.858  -0.360  1.00 0.00 ? 31 GLN A HA   5 
ATOM   4308 H HB2  . GLN A 1 31 ? 8.187   -2.441  0.464   1.00 0.00 ? 31 GLN A HB2  5 
ATOM   4309 H HB3  . GLN A 1 31 ? 9.016   -0.898  0.320   1.00 0.00 ? 31 GLN A HB3  5 
ATOM   4310 H HG2  . GLN A 1 31 ? 8.937   -1.331  -2.211  1.00 0.00 ? 31 GLN A HG2  5 
ATOM   4311 H HG3  . GLN A 1 31 ? 7.716   -2.538  -1.814  1.00 0.00 ? 31 GLN A HG3  5 
ATOM   4312 H HE21 . GLN A 1 31 ? 8.442   0.795   -2.124  1.00 0.00 ? 31 GLN A HE21 5 
ATOM   4313 H HE22 . GLN A 1 31 ? 6.854   1.404   -1.785  1.00 0.00 ? 31 GLN A HE22 5 
ATOM   4314 N N    . GLN A 1 32 ? 9.478   -4.211  1.399   1.00 0.00 ? 32 GLN A N    5 
ATOM   4315 C CA   . GLN A 1 32 ? 9.587   -5.041  2.585   1.00 0.00 ? 32 GLN A CA   5 
ATOM   4316 C C    . GLN A 1 32 ? 10.127  -4.256  3.777   1.00 0.00 ? 32 GLN A C    5 
ATOM   4317 O O    . GLN A 1 32 ? 10.653  -4.831  4.731   1.00 0.00 ? 32 GLN A O    5 
ATOM   4318 C CB   . GLN A 1 32 ? 10.461  -6.247  2.293   1.00 0.00 ? 32 GLN A CB   5 
ATOM   4319 C CG   . GLN A 1 32 ? 9.846   -7.540  2.787   1.00 0.00 ? 32 GLN A CG   5 
ATOM   4320 C CD   . GLN A 1 32 ? 9.003   -8.246  1.739   1.00 0.00 ? 32 GLN A CD   5 
ATOM   4321 O OE1  . GLN A 1 32 ? 9.171   -9.442  1.496   1.00 0.00 ? 32 GLN A OE1  5 
ATOM   4322 N NE2  . GLN A 1 32 ? 8.091   -7.510  1.110   1.00 0.00 ? 32 GLN A NE2  5 
ATOM   4323 H H    . GLN A 1 32 ? 8.657   -4.255  0.875   1.00 0.00 ? 32 GLN A H    5 
ATOM   4324 H HA   . GLN A 1 32 ? 8.596   -5.391  2.829   1.00 0.00 ? 32 GLN A HA   5 
ATOM   4325 H HB2  . GLN A 1 32 ? 10.610  -6.318  1.227   1.00 0.00 ? 32 GLN A HB2  5 
ATOM   4326 H HB3  . GLN A 1 32 ? 11.414  -6.112  2.778   1.00 0.00 ? 32 GLN A HB3  5 
ATOM   4327 H HG2  . GLN A 1 32 ? 10.634  -8.203  3.102   1.00 0.00 ? 32 GLN A HG2  5 
ATOM   4328 H HG3  . GLN A 1 32 ? 9.213   -7.305  3.628   1.00 0.00 ? 32 GLN A HG3  5 
ATOM   4329 H HE21 . GLN A 1 32 ? 8.019   -6.565  1.344   1.00 0.00 ? 32 GLN A HE21 5 
ATOM   4330 H HE22 . GLN A 1 32 ? 7.516   -7.948  0.449   1.00 0.00 ? 32 GLN A HE22 5 
ATOM   4331 N N    . GLY A 1 33 ? 9.986   -2.938  3.713   1.00 0.00 ? 33 GLY A N    5 
ATOM   4332 C CA   . GLY A 1 33 ? 10.452  -2.081  4.788   1.00 0.00 ? 33 GLY A CA   5 
ATOM   4333 C C    . GLY A 1 33 ? 10.292  -0.606  4.466   1.00 0.00 ? 33 GLY A C    5 
ATOM   4334 O O    . GLY A 1 33 ? 11.062  0.225   4.947   1.00 0.00 ? 33 GLY A O    5 
ATOM   4335 H H    . GLY A 1 33 ? 9.557   -2.545  2.927   1.00 0.00 ? 33 GLY A H    5 
ATOM   4336 H HA2  . GLY A 1 33 ? 9.891   -2.307  5.683   1.00 0.00 ? 33 GLY A HA2  5 
ATOM   4337 H HA3  . GLY A 1 33 ? 11.497  -2.287  4.969   1.00 0.00 ? 33 GLY A HA3  5 
ATOM   4338 N N    . CYS A 1 34 ? 9.298   -0.280  3.643   1.00 0.00 ? 34 CYS A N    5 
ATOM   4339 C CA   . CYS A 1 34 ? 9.052   1.091   3.254   1.00 0.00 ? 34 CYS A CA   5 
ATOM   4340 C C    . CYS A 1 34 ? 7.570   1.439   3.323   1.00 0.00 ? 34 CYS A C    5 
ATOM   4341 O O    . CYS A 1 34 ? 7.197   2.554   3.687   1.00 0.00 ? 34 CYS A O    5 
ATOM   4342 C CB   . CYS A 1 34 ? 9.562   1.322   1.845   1.00 0.00 ? 34 CYS A CB   5 
ATOM   4343 S SG   . CYS A 1 34 ? 10.021  3.047   1.475   1.00 0.00 ? 34 CYS A SG   5 
ATOM   4344 H H    . CYS A 1 34 ? 8.730   -0.971  3.287   1.00 0.00 ? 34 CYS A H    5 
ATOM   4345 H HA   . CYS A 1 34 ? 9.583   1.708   3.918   1.00 0.00 ? 34 CYS A HA   5 
ATOM   4346 H HB2  . CYS A 1 34 ? 10.426  0.698   1.678   1.00 0.00 ? 34 CYS A HB2  5 
ATOM   4347 H HB3  . CYS A 1 34 ? 8.784   1.043   1.163   1.00 0.00 ? 34 CYS A HB3  5 
ATOM   4348 N N    . PHE A 1 35 ? 6.733   0.480   2.959   1.00 0.00 ? 35 PHE A N    5 
ATOM   4349 C CA   . PHE A 1 35 ? 5.287   0.677   2.963   1.00 0.00 ? 35 PHE A CA   5 
ATOM   4350 C C    . PHE A 1 35 ? 4.793   1.076   4.340   1.00 0.00 ? 35 PHE A C    5 
ATOM   4351 O O    . PHE A 1 35 ? 4.182   2.129   4.522   1.00 0.00 ? 35 PHE A O    5 
ATOM   4352 C CB   . PHE A 1 35 ? 4.555   -0.591  2.499   1.00 0.00 ? 35 PHE A CB   5 
ATOM   4353 C CG   . PHE A 1 35 ? 4.965   -1.858  3.196   1.00 0.00 ? 35 PHE A CG   5 
ATOM   4354 C CD1  . PHE A 1 35 ? 6.117   -2.532  2.830   1.00 0.00 ? 35 PHE A CD1  5 
ATOM   4355 C CD2  . PHE A 1 35 ? 4.179   -2.385  4.210   1.00 0.00 ? 35 PHE A CD2  5 
ATOM   4356 C CE1  . PHE A 1 35 ? 6.478   -3.702  3.459   1.00 0.00 ? 35 PHE A CE1  5 
ATOM   4357 C CE2  . PHE A 1 35 ? 4.539   -3.557  4.846   1.00 0.00 ? 35 PHE A CE2  5 
ATOM   4358 C CZ   . PHE A 1 35 ? 5.691   -4.217  4.469   1.00 0.00 ? 35 PHE A CZ   5 
ATOM   4359 H H    . PHE A 1 35 ? 7.099   -0.375  2.675   1.00 0.00 ? 35 PHE A H    5 
ATOM   4360 H HA   . PHE A 1 35 ? 5.065   1.475   2.283   1.00 0.00 ? 35 PHE A HA   5 
ATOM   4361 H HB2  . PHE A 1 35 ? 3.504   -0.461  2.682   1.00 0.00 ? 35 PHE A HB2  5 
ATOM   4362 H HB3  . PHE A 1 35 ? 4.717   -0.730  1.439   1.00 0.00 ? 35 PHE A HB3  5 
ATOM   4363 H HD1  . PHE A 1 35 ? 6.738   -2.135  2.041   1.00 0.00 ? 35 PHE A HD1  5 
ATOM   4364 H HD2  . PHE A 1 35 ? 3.278   -1.868  4.505   1.00 0.00 ? 35 PHE A HD2  5 
ATOM   4365 H HE1  . PHE A 1 35 ? 7.374   -4.214  3.158   1.00 0.00 ? 35 PHE A HE1  5 
ATOM   4366 H HE2  . PHE A 1 35 ? 3.920   -3.957  5.634   1.00 0.00 ? 35 PHE A HE2  5 
ATOM   4367 H HZ   . PHE A 1 35 ? 5.975   -5.135  4.962   1.00 0.00 ? 35 PHE A HZ   5 
ATOM   4368 N N    . CYS A 1 36 ? 5.065   0.220   5.299   1.00 0.00 ? 36 CYS A N    5 
ATOM   4369 C CA   . CYS A 1 36 ? 4.660   0.448   6.684   1.00 0.00 ? 36 CYS A CA   5 
ATOM   4370 C C    . CYS A 1 36 ? 5.027   1.859   7.135   1.00 0.00 ? 36 CYS A C    5 
ATOM   4371 O O    . CYS A 1 36 ? 4.316   2.470   7.934   1.00 0.00 ? 36 CYS A O    5 
ATOM   4372 C CB   . CYS A 1 36 ? 5.311   -0.585  7.610   1.00 0.00 ? 36 CYS A CB   5 
ATOM   4373 S SG   . CYS A 1 36 ? 5.037   -0.274  9.387   1.00 0.00 ? 36 CYS A SG   5 
ATOM   4374 H H    . CYS A 1 36 ? 5.551   -0.590  5.063   1.00 0.00 ? 36 CYS A H    5 
ATOM   4375 H HA   . CYS A 1 36 ? 3.587   0.336   6.735   1.00 0.00 ? 36 CYS A HA   5 
ATOM   4376 H HB2  . CYS A 1 36 ? 4.912   -1.563  7.384   1.00 0.00 ? 36 CYS A HB2  5 
ATOM   4377 H HB3  . CYS A 1 36 ? 6.378   -0.590  7.437   1.00 0.00 ? 36 CYS A HB3  5 
ATOM   4378 N N    . GLN A 1 37 ? 6.142   2.370   6.622   1.00 0.00 ? 37 GLN A N    5 
ATOM   4379 C CA   . GLN A 1 37 ? 6.602   3.706   6.977   1.00 0.00 ? 37 GLN A CA   5 
ATOM   4380 C C    . GLN A 1 37 ? 5.517   4.744   6.728   1.00 0.00 ? 37 GLN A C    5 
ATOM   4381 O O    . GLN A 1 37 ? 5.398   5.726   7.460   1.00 0.00 ? 37 GLN A O    5 
ATOM   4382 C CB   . GLN A 1 37 ? 7.860   4.074   6.190   1.00 0.00 ? 37 GLN A CB   5 
ATOM   4383 C CG   . GLN A 1 37 ? 8.993   3.074   6.344   1.00 0.00 ? 37 GLN A CG   5 
ATOM   4384 C CD   . GLN A 1 37 ? 10.264  3.534   5.660   1.00 0.00 ? 37 GLN A CD   5 
ATOM   4385 O OE1  . GLN A 1 37 ? 11.313  3.660   6.292   1.00 0.00 ? 37 GLN A OE1  5 
ATOM   4386 N NE2  . GLN A 1 37 ? 10.176  3.787   4.360   1.00 0.00 ? 37 GLN A NE2  5 
ATOM   4387 H H    . GLN A 1 37 ? 6.668   1.836   5.995   1.00 0.00 ? 37 GLN A H    5 
ATOM   4388 H HA   . GLN A 1 37 ? 6.835   3.698   8.023   1.00 0.00 ? 37 GLN A HA   5 
ATOM   4389 H HB2  . GLN A 1 37 ? 7.608   4.141   5.142   1.00 0.00 ? 37 GLN A HB2  5 
ATOM   4390 H HB3  . GLN A 1 37 ? 8.212   5.038   6.527   1.00 0.00 ? 37 GLN A HB3  5 
ATOM   4391 H HG2  . GLN A 1 37 ? 9.196   2.938   7.396   1.00 0.00 ? 37 GLN A HG2  5 
ATOM   4392 H HG3  . GLN A 1 37 ? 8.688   2.133   5.912   1.00 0.00 ? 37 GLN A HG3  5 
ATOM   4393 H HE21 . GLN A 1 37 ? 9.306   3.663   3.922   1.00 0.00 ? 37 GLN A HE21 5 
ATOM   4394 H HE22 . GLN A 1 37 ? 10.982  4.085   3.890   1.00 0.00 ? 37 GLN A HE22 5 
ATOM   4395 N N    . TYR A 1 38 ? 4.728   4.515   5.690   1.00 0.00 ? 38 TYR A N    5 
ATOM   4396 C CA   . TYR A 1 38 ? 3.646   5.427   5.337   1.00 0.00 ? 38 TYR A CA   5 
ATOM   4397 C C    . TYR A 1 38 ? 2.565   5.437   6.417   1.00 0.00 ? 38 TYR A C    5 
ATOM   4398 O O    . TYR A 1 38 ? 1.784   6.383   6.516   1.00 0.00 ? 38 TYR A O    5 
ATOM   4399 C CB   . TYR A 1 38 ? 3.040   5.034   3.989   1.00 0.00 ? 38 TYR A CB   5 
ATOM   4400 C CG   . TYR A 1 38 ? 3.949   5.319   2.813   1.00 0.00 ? 38 TYR A CG   5 
ATOM   4401 C CD1  . TYR A 1 38 ? 3.944   6.561   2.191   1.00 0.00 ? 38 TYR A CD1  5 
ATOM   4402 C CD2  . TYR A 1 38 ? 4.813   4.346   2.328   1.00 0.00 ? 38 TYR A CD2  5 
ATOM   4403 C CE1  . TYR A 1 38 ? 4.774   6.824   1.118   1.00 0.00 ? 38 TYR A CE1  5 
ATOM   4404 C CE2  . TYR A 1 38 ? 5.646   4.602   1.256   1.00 0.00 ? 38 TYR A CE2  5 
ATOM   4405 C CZ   . TYR A 1 38 ? 5.623   5.842   0.654   1.00 0.00 ? 38 TYR A CZ   5 
ATOM   4406 O OH   . TYR A 1 38 ? 6.451   6.101   -0.414  1.00 0.00 ? 38 TYR A OH   5 
ATOM   4407 H H    . TYR A 1 38 ? 4.877   3.711   5.148   1.00 0.00 ? 38 TYR A H    5 
ATOM   4408 H HA   . TYR A 1 38 ? 4.065   6.419   5.257   1.00 0.00 ? 38 TYR A HA   5 
ATOM   4409 H HB2  . TYR A 1 38 ? 2.825   3.976   3.992   1.00 0.00 ? 38 TYR A HB2  5 
ATOM   4410 H HB3  . TYR A 1 38 ? 2.122   5.584   3.840   1.00 0.00 ? 38 TYR A HB3  5 
ATOM   4411 H HD1  . TYR A 1 38 ? 3.278   7.329   2.557   1.00 0.00 ? 38 TYR A HD1  5 
ATOM   4412 H HD2  . TYR A 1 38 ? 4.829   3.375   2.800   1.00 0.00 ? 38 TYR A HD2  5 
ATOM   4413 H HE1  . TYR A 1 38 ? 4.755   7.796   0.647   1.00 0.00 ? 38 TYR A HE1  5 
ATOM   4414 H HE2  . TYR A 1 38 ? 6.311   3.832   0.893   1.00 0.00 ? 38 TYR A HE2  5 
ATOM   4415 H HH   . TYR A 1 38 ? 6.281   5.465   -1.112  1.00 0.00 ? 38 TYR A HH   5 
ATOM   4416 N N    . ALA A 1 39 ? 2.525   4.378   7.222   1.00 0.00 ? 39 ALA A N    5 
ATOM   4417 C CA   . ALA A 1 39 ? 1.544   4.262   8.291   1.00 0.00 ? 39 ALA A CA   5 
ATOM   4418 C C    . ALA A 1 39 ? 1.605   5.451   9.245   1.00 0.00 ? 39 ALA A C    5 
ATOM   4419 O O    . ALA A 1 39 ? 0.640   5.740   9.953   1.00 0.00 ? 39 ALA A O    5 
ATOM   4420 C CB   . ALA A 1 39 ? 1.751   2.962   9.054   1.00 0.00 ? 39 ALA A CB   5 
ATOM   4421 H H    . ALA A 1 39 ? 3.169   3.656   7.094   1.00 0.00 ? 39 ALA A H    5 
ATOM   4422 H HA   . ALA A 1 39 ? 0.571   4.230   7.838   1.00 0.00 ? 39 ALA A HA   5 
ATOM   4423 H HB1  . ALA A 1 39 ? 2.535   3.094   9.785   1.00 0.00 ? 39 ALA A HB1  5 
ATOM   4424 H HB2  . ALA A 1 39 ? 2.030   2.180   8.364   1.00 0.00 ? 39 ALA A HB2  5 
ATOM   4425 H HB3  . ALA A 1 39 ? 0.834   2.689   9.556   1.00 0.00 ? 39 ALA A HB3  5 
ATOM   4426 N N    . LYS A 1 40 ? 2.743   6.136   9.263   1.00 0.00 ? 40 LYS A N    5 
ATOM   4427 C CA   . LYS A 1 40 ? 2.925   7.291   10.134  1.00 0.00 ? 40 LYS A CA   5 
ATOM   4428 C C    . LYS A 1 40 ? 2.788   8.597   9.356   1.00 0.00 ? 40 LYS A C    5 
ATOM   4429 O O    . LYS A 1 40 ? 2.525   9.650   9.936   1.00 0.00 ? 40 LYS A O    5 
ATOM   4430 C CB   . LYS A 1 40 ? 4.292   7.232   10.818  1.00 0.00 ? 40 LYS A CB   5 
ATOM   4431 C CG   . LYS A 1 40 ? 4.285   7.773   12.239  1.00 0.00 ? 40 LYS A CG   5 
ATOM   4432 C CD   . LYS A 1 40 ? 5.583   7.452   12.963  1.00 0.00 ? 40 LYS A CD   5 
ATOM   4433 C CE   . LYS A 1 40 ? 5.721   5.961   13.230  1.00 0.00 ? 40 LYS A CE   5 
ATOM   4434 N NZ   . LYS A 1 40 ? 6.813   5.352   12.421  1.00 0.00 ? 40 LYS A NZ   5 
ATOM   4435 H H    . LYS A 1 40 ? 3.476   5.858   8.678   1.00 0.00 ? 40 LYS A H    5 
ATOM   4436 H HA   . LYS A 1 40 ? 2.155   7.258   10.888  1.00 0.00 ? 40 LYS A HA   5 
ATOM   4437 H HB2  . LYS A 1 40 ? 4.621   6.204   10.849  1.00 0.00 ? 40 LYS A HB2  5 
ATOM   4438 H HB3  . LYS A 1 40 ? 4.997   7.809   10.239  1.00 0.00 ? 40 LYS A HB3  5 
ATOM   4439 H HG2  . LYS A 1 40 ? 4.159   8.845   12.205  1.00 0.00 ? 40 LYS A HG2  5 
ATOM   4440 H HG3  . LYS A 1 40 ? 3.462   7.329   12.779  1.00 0.00 ? 40 LYS A HG3  5 
ATOM   4441 H HD2  . LYS A 1 40 ? 6.413   7.776   12.354  1.00 0.00 ? 40 LYS A HD2  5 
ATOM   4442 H HD3  . LYS A 1 40 ? 5.597   7.980   13.905  1.00 0.00 ? 40 LYS A HD3  5 
ATOM   4443 H HE2  . LYS A 1 40 ? 5.938   5.815   14.277  1.00 0.00 ? 40 LYS A HE2  5 
ATOM   4444 H HE3  . LYS A 1 40 ? 4.788   5.475   12.985  1.00 0.00 ? 40 LYS A HE3  5 
ATOM   4445 H HZ1  . LYS A 1 40 ? 7.527   6.071   12.186  1.00 0.00 ? 40 LYS A HZ1  5 
ATOM   4446 H HZ2  . LYS A 1 40 ? 6.428   4.960   11.538  1.00 0.00 ? 40 LYS A HZ2  5 
ATOM   4447 H HZ3  . LYS A 1 40 ? 7.270   4.586   12.956  1.00 0.00 ? 40 LYS A HZ3  5 
ATOM   4448 N N    . ASP A 1 41 ? 2.968   8.520   8.043   1.00 0.00 ? 41 ASP A N    5 
ATOM   4449 C CA   . ASP A 1 41 ? 2.864   9.697   7.189   1.00 0.00 ? 41 ASP A CA   5 
ATOM   4450 C C    . ASP A 1 41 ? 1.412   10.162  7.080   1.00 0.00 ? 41 ASP A C    5 
ATOM   4451 O O    . ASP A 1 41 ? 0.526   9.375   6.749   1.00 0.00 ? 41 ASP A O    5 
ATOM   4452 C CB   . ASP A 1 41 ? 3.420   9.390   5.797   1.00 0.00 ? 41 ASP A CB   5 
ATOM   4453 C CG   . ASP A 1 41 ? 3.453   10.616  4.906   1.00 0.00 ? 41 ASP A CG   5 
ATOM   4454 O OD1  . ASP A 1 41 ? 4.356   11.460  5.090   1.00 0.00 ? 41 ASP A OD1  5 
ATOM   4455 O OD2  . ASP A 1 41 ? 2.576   10.734  4.025   1.00 0.00 ? 41 ASP A OD2  5 
ATOM   4456 H H    . ASP A 1 41 ? 3.175   7.653   7.639   1.00 0.00 ? 41 ASP A H    5 
ATOM   4457 H HA   . ASP A 1 41 ? 3.453   10.482  7.637   1.00 0.00 ? 41 ASP A HA   5 
ATOM   4458 H HB2  . ASP A 1 41 ? 4.429   9.012   5.894   1.00 0.00 ? 41 ASP A HB2  5 
ATOM   4459 H HB3  . ASP A 1 41 ? 2.799   8.639   5.326   1.00 0.00 ? 41 ASP A HB3  5 
ATOM   4460 N N    . PRO A 1 42 ? 1.145   11.452  7.360   1.00 0.00 ? 42 PRO A N    5 
ATOM   4461 C CA   . PRO A 1 42 ? -0.209  12.008  7.292   1.00 0.00 ? 42 PRO A CA   5 
ATOM   4462 C C    . PRO A 1 42 ? -0.665  12.262  5.859   1.00 0.00 ? 42 PRO A C    5 
ATOM   4463 O O    . PRO A 1 42 ? -1.807  11.974  5.500   1.00 0.00 ? 42 PRO A O    5 
ATOM   4464 C CB   . PRO A 1 42 ? -0.080  13.326  8.053   1.00 0.00 ? 42 PRO A CB   5 
ATOM   4465 C CG   . PRO A 1 42 ? 1.336   13.739  7.845   1.00 0.00 ? 42 PRO A CG   5 
ATOM   4466 C CD   . PRO A 1 42 ? 2.137   12.467  7.767   1.00 0.00 ? 42 PRO A CD   5 
ATOM   4467 H HA   . PRO A 1 42 ? -0.925  11.370  7.789   1.00 0.00 ? 42 PRO A HA   5 
ATOM   4468 H HB2  . PRO A 1 42 ? -0.769  14.050  7.644   1.00 0.00 ? 42 PRO A HB2  5 
ATOM   4469 H HB3  . PRO A 1 42 ? -0.294  13.165  9.099   1.00 0.00 ? 42 PRO A HB3  5 
ATOM   4470 H HG2  . PRO A 1 42 ? 1.424   14.294  6.923   1.00 0.00 ? 42 PRO A HG2  5 
ATOM   4471 H HG3  . PRO A 1 42 ? 1.669   14.340  8.678   1.00 0.00 ? 42 PRO A HG3  5 
ATOM   4472 H HD2  . PRO A 1 42 ? 2.918   12.559  7.026   1.00 0.00 ? 42 PRO A HD2  5 
ATOM   4473 H HD3  . PRO A 1 42 ? 2.559   12.227  8.732   1.00 0.00 ? 42 PRO A HD3  5 
ATOM   4474 N N    . THR A 1 43 ? 0.233   12.807  5.044   1.00 0.00 ? 43 THR A N    5 
ATOM   4475 C CA   . THR A 1 43 ? -0.078  13.104  3.649   1.00 0.00 ? 43 THR A CA   5 
ATOM   4476 C C    . THR A 1 43 ? -0.532  11.847  2.911   1.00 0.00 ? 43 THR A C    5 
ATOM   4477 O O    . THR A 1 43 ? -1.457  11.891  2.100   1.00 0.00 ? 43 THR A O    5 
ATOM   4478 C CB   . THR A 1 43 ? 1.140   13.712  2.947   1.00 0.00 ? 43 THR A CB   5 
ATOM   4479 O OG1  . THR A 1 43 ? 2.307   13.567  3.740   1.00 0.00 ? 43 THR A OG1  5 
ATOM   4480 C CG2  . THR A 1 43 ? 0.975   15.185  2.634   1.00 0.00 ? 43 THR A CG2  5 
ATOM   4481 H H    . THR A 1 43 ? 1.126   13.016  5.390   1.00 0.00 ? 43 THR A H    5 
ATOM   4482 H HA   . THR A 1 43 ? -0.884  13.822  3.637   1.00 0.00 ? 43 THR A HA   5 
ATOM   4483 H HB   . THR A 1 43 ? 1.300   13.194  2.012   1.00 0.00 ? 43 THR A HB   5 
ATOM   4484 H HG1  . THR A 1 43 ? 2.314   14.236  4.428   1.00 0.00 ? 43 THR A HG1  5 
ATOM   4485 H HG21 . THR A 1 43 ? 0.983   15.329  1.564   1.00 0.00 ? 43 THR A HG21 5 
ATOM   4486 H HG22 . THR A 1 43 ? 1.787   15.740  3.078   1.00 0.00 ? 43 THR A HG22 5 
ATOM   4487 H HG23 . THR A 1 43 ? 0.036   15.536  3.038   1.00 0.00 ? 43 THR A HG23 5 
ATOM   4488 N N    . TYR A 1 44 ? 0.126   10.729  3.198   1.00 0.00 ? 44 TYR A N    5 
ATOM   4489 C CA   . TYR A 1 44 ? -0.209  9.459   2.563   1.00 0.00 ? 44 TYR A CA   5 
ATOM   4490 C C    . TYR A 1 44 ? -1.166  8.643   3.429   1.00 0.00 ? 44 TYR A C    5 
ATOM   4491 O O    . TYR A 1 44 ? -1.339  7.443   3.216   1.00 0.00 ? 44 TYR A O    5 
ATOM   4492 C CB   . TYR A 1 44 ? 1.062   8.654   2.295   1.00 0.00 ? 44 TYR A CB   5 
ATOM   4493 C CG   . TYR A 1 44 ? 1.915   9.221   1.182   1.00 0.00 ? 44 TYR A CG   5 
ATOM   4494 C CD1  . TYR A 1 44 ? 1.418   9.334   -0.110  1.00 0.00 ? 44 TYR A CD1  5 
ATOM   4495 C CD2  . TYR A 1 44 ? 3.216   9.643   1.424   1.00 0.00 ? 44 TYR A CD2  5 
ATOM   4496 C CE1  . TYR A 1 44 ? 2.194   9.852   -1.130  1.00 0.00 ? 44 TYR A CE1  5 
ATOM   4497 C CE2  . TYR A 1 44 ? 3.998   10.163  0.410   1.00 0.00 ? 44 TYR A CE2  5 
ATOM   4498 C CZ   . TYR A 1 44 ? 3.482   10.265  -0.865  1.00 0.00 ? 44 TYR A CZ   5 
ATOM   4499 O OH   . TYR A 1 44 ? 4.258   10.781  -1.878  1.00 0.00 ? 44 TYR A OH   5 
ATOM   4500 H H    . TYR A 1 44 ? 0.854   10.757  3.854   1.00 0.00 ? 44 TYR A H    5 
ATOM   4501 H HA   . TYR A 1 44 ? -0.691  9.677   1.622   1.00 0.00 ? 44 TYR A HA   5 
ATOM   4502 H HB2  . TYR A 1 44 ? 1.660   8.633   3.193   1.00 0.00 ? 44 TYR A HB2  5 
ATOM   4503 H HB3  . TYR A 1 44 ? 0.790   7.644   2.025   1.00 0.00 ? 44 TYR A HB3  5 
ATOM   4504 H HD1  . TYR A 1 44 ? 0.408   9.010   -0.315  1.00 0.00 ? 44 TYR A HD1  5 
ATOM   4505 H HD2  . TYR A 1 44 ? 3.617   9.561   2.424   1.00 0.00 ? 44 TYR A HD2  5 
ATOM   4506 H HE1  . TYR A 1 44 ? 1.789   9.932   -2.128  1.00 0.00 ? 44 TYR A HE1  5 
ATOM   4507 H HE2  . TYR A 1 44 ? 5.007   10.486  0.618   1.00 0.00 ? 44 TYR A HE2  5 
ATOM   4508 H HH   . TYR A 1 44 ? 5.013   10.209  -2.027  1.00 0.00 ? 44 TYR A HH   5 
ATOM   4509 N N    . GLY A 1 45 ? -1.784  9.298   4.407   1.00 0.00 ? 45 GLY A N    5 
ATOM   4510 C CA   . GLY A 1 45 ? -2.712  8.614   5.288   1.00 0.00 ? 45 GLY A CA   5 
ATOM   4511 C C    . GLY A 1 45 ? -4.004  8.230   4.591   1.00 0.00 ? 45 GLY A C    5 
ATOM   4512 O O    . GLY A 1 45 ? -4.679  7.286   5.002   1.00 0.00 ? 45 GLY A O    5 
ATOM   4513 H H    . GLY A 1 45 ? -1.608  10.253  4.533   1.00 0.00 ? 45 GLY A H    5 
ATOM   4514 H HA2  . GLY A 1 45 ? -2.240  7.719   5.665   1.00 0.00 ? 45 GLY A HA2  5 
ATOM   4515 H HA3  . GLY A 1 45 ? -2.945  9.263   6.120   1.00 0.00 ? 45 GLY A HA3  5 
ATOM   4516 N N    . GLN A 1 46 ? -4.348  8.959   3.534   1.00 0.00 ? 46 GLN A N    5 
ATOM   4517 C CA   . GLN A 1 46 ? -5.566  8.685   2.783   1.00 0.00 ? 46 GLN A CA   5 
ATOM   4518 C C    . GLN A 1 46 ? -5.428  7.396   1.982   1.00 0.00 ? 46 GLN A C    5 
ATOM   4519 O O    . GLN A 1 46 ? -6.416  6.717   1.701   1.00 0.00 ? 46 GLN A O    5 
ATOM   4520 C CB   . GLN A 1 46 ? -5.886  9.851   1.846   1.00 0.00 ? 46 GLN A CB   5 
ATOM   4521 C CG   . GLN A 1 46 ? -6.300  11.120  2.574   1.00 0.00 ? 46 GLN A CG   5 
ATOM   4522 C CD   . GLN A 1 46 ? -6.650  12.249  1.623   1.00 0.00 ? 46 GLN A CD   5 
ATOM   4523 O OE1  . GLN A 1 46 ? -7.725  12.260  1.024   1.00 0.00 ? 46 GLN A OE1  5 
ATOM   4524 N NE2  . GLN A 1 46 ? -5.739  13.205  1.480   1.00 0.00 ? 46 GLN A NE2  5 
ATOM   4525 H H    . GLN A 1 46 ? -3.772  9.695   3.251   1.00 0.00 ? 46 GLN A H    5 
ATOM   4526 H HA   . GLN A 1 46 ? -6.369  8.573   3.492   1.00 0.00 ? 46 GLN A HA   5 
ATOM   4527 H HB2  . GLN A 1 46 ? -5.012  10.072  1.252   1.00 0.00 ? 46 GLN A HB2  5 
ATOM   4528 H HB3  . GLN A 1 46 ? -6.692  9.559   1.190   1.00 0.00 ? 46 GLN A HB3  5 
ATOM   4529 H HG2  . GLN A 1 46 ? -7.164  10.905  3.185   1.00 0.00 ? 46 GLN A HG2  5 
ATOM   4530 H HG3  . GLN A 1 46 ? -5.484  11.441  3.205   1.00 0.00 ? 46 GLN A HG3  5 
ATOM   4531 H HE21 . GLN A 1 46 ? -4.902  13.128  1.992   1.00 0.00 ? 46 GLN A HE21 5 
ATOM   4532 H HE22 . GLN A 1 46 ? -5.941  13.949  0.868   1.00 0.00 ? 46 GLN A HE22 5 
ATOM   4533 N N    . TYR A 1 47 ? -4.194  7.066   1.617   1.00 0.00 ? 47 TYR A N    5 
ATOM   4534 C CA   . TYR A 1 47 ? -3.917  5.861   0.847   1.00 0.00 ? 47 TYR A CA   5 
ATOM   4535 C C    . TYR A 1 47 ? -4.056  4.615   1.714   1.00 0.00 ? 47 TYR A C    5 
ATOM   4536 O O    . TYR A 1 47 ? -4.667  3.627   1.308   1.00 0.00 ? 47 TYR A O    5 
ATOM   4537 C CB   . TYR A 1 47 ? -2.515  5.925   0.265   1.00 0.00 ? 47 TYR A CB   5 
ATOM   4538 C CG   . TYR A 1 47 ? -2.335  5.096   -0.983  1.00 0.00 ? 47 TYR A CG   5 
ATOM   4539 C CD1  . TYR A 1 47 ? -2.776  5.559   -2.215  1.00 0.00 ? 47 TYR A CD1  5 
ATOM   4540 C CD2  . TYR A 1 47 ? -1.720  3.852   -0.929  1.00 0.00 ? 47 TYR A CD2  5 
ATOM   4541 C CE1  . TYR A 1 47 ? -2.610  4.804   -3.360  1.00 0.00 ? 47 TYR A CE1  5 
ATOM   4542 C CE2  . TYR A 1 47 ? -1.551  3.091   -2.069  1.00 0.00 ? 47 TYR A CE2  5 
ATOM   4543 C CZ   . TYR A 1 47 ? -1.996  3.571   -3.281  1.00 0.00 ? 47 TYR A CZ   5 
ATOM   4544 O OH   . TYR A 1 47 ? -1.827  2.817   -4.418  1.00 0.00 ? 47 TYR A OH   5 
ATOM   4545 H H    . TYR A 1 47 ? -3.449  7.649   1.871   1.00 0.00 ? 47 TYR A H    5 
ATOM   4546 H HA   . TYR A 1 47 ? -4.620  5.807   0.043   1.00 0.00 ? 47 TYR A HA   5 
ATOM   4547 H HB2  . TYR A 1 47 ? -2.273  6.951   0.023   1.00 0.00 ? 47 TYR A HB2  5 
ATOM   4548 H HB3  . TYR A 1 47 ? -1.828  5.559   1.003   1.00 0.00 ? 47 TYR A HB3  5 
ATOM   4549 H HD1  . TYR A 1 47 ? -3.256  6.525   -2.271  1.00 0.00 ? 47 TYR A HD1  5 
ATOM   4550 H HD2  . TYR A 1 47 ? -1.373  3.480   0.024   1.00 0.00 ? 47 TYR A HD2  5 
ATOM   4551 H HE1  . TYR A 1 47 ? -2.959  5.181   -4.310  1.00 0.00 ? 47 TYR A HE1  5 
ATOM   4552 H HE2  . TYR A 1 47 ? -1.071  2.126   -2.007  1.00 0.00 ? 47 TYR A HE2  5 
ATOM   4553 H HH   . TYR A 1 47 ? -1.345  3.327   -5.072  1.00 0.00 ? 47 TYR A HH   5 
ATOM   4554 N N    . ILE A 1 48 ? -3.475  4.668   2.907   1.00 0.00 ? 48 ILE A N    5 
ATOM   4555 C CA   . ILE A 1 48 ? -3.522  3.545   3.831   1.00 0.00 ? 48 ILE A CA   5 
ATOM   4556 C C    . ILE A 1 48 ? -4.917  3.358   4.419   1.00 0.00 ? 48 ILE A C    5 
ATOM   4557 O O    . ILE A 1 48 ? -5.314  2.239   4.742   1.00 0.00 ? 48 ILE A O    5 
ATOM   4558 C CB   . ILE A 1 48 ? -2.508  3.724   4.978   1.00 0.00 ? 48 ILE A CB   5 
ATOM   4559 C CG1  . ILE A 1 48 ? -1.112  3.990   4.409   1.00 0.00 ? 48 ILE A CG1  5 
ATOM   4560 C CG2  . ILE A 1 48 ? -2.499  2.497   5.882   1.00 0.00 ? 48 ILE A CG2  5 
ATOM   4561 C CD1  . ILE A 1 48 ? -0.030  4.069   5.463   1.00 0.00 ? 48 ILE A CD1  5 
ATOM   4562 H H    . ILE A 1 48 ? -2.997  5.479   3.169   1.00 0.00 ? 48 ILE A H    5 
ATOM   4563 H HA   . ILE A 1 48 ? -3.253  2.657   3.281   1.00 0.00 ? 48 ILE A HA   5 
ATOM   4564 H HB   . ILE A 1 48 ? -2.815  4.573   5.570   1.00 0.00 ? 48 ILE A HB   5 
ATOM   4565 H HG12 . ILE A 1 48 ? -0.851  3.194   3.728   1.00 0.00 ? 48 ILE A HG12 5 
ATOM   4566 H HG13 . ILE A 1 48 ? -1.123  4.927   3.872   1.00 0.00 ? 48 ILE A HG13 5 
ATOM   4567 H HG21 . ILE A 1 48 ? -2.729  2.794   6.895   1.00 0.00 ? 48 ILE A HG21 5 
ATOM   4568 H HG22 . ILE A 1 48 ? -1.522  2.036   5.856   1.00 0.00 ? 48 ILE A HG22 5 
ATOM   4569 H HG23 . ILE A 1 48 ? -3.239  1.789   5.538   1.00 0.00 ? 48 ILE A HG23 5 
ATOM   4570 H HD11 . ILE A 1 48 ? -0.033  3.163   6.051   1.00 0.00 ? 48 ILE A HD11 5 
ATOM   4571 H HD12 . ILE A 1 48 ? -0.215  4.917   6.107   1.00 0.00 ? 48 ILE A HD12 5 
ATOM   4572 H HD13 . ILE A 1 48 ? 0.931   4.184   4.984   1.00 0.00 ? 48 ILE A HD13 5 
ATOM   4573 N N    . ARG A 1 49 ? -5.659  4.453   4.562   1.00 0.00 ? 49 ARG A N    5 
ATOM   4574 C CA   . ARG A 1 49 ? -7.008  4.388   5.118   1.00 0.00 ? 49 ARG A CA   5 
ATOM   4575 C C    . ARG A 1 49 ? -8.036  3.953   4.081   1.00 0.00 ? 49 ARG A C    5 
ATOM   4576 O O    . ARG A 1 49 ? -9.230  4.217   4.224   1.00 0.00 ? 49 ARG A O    5 
ATOM   4577 C CB   . ARG A 1 49 ? -7.406  5.736   5.722   1.00 0.00 ? 49 ARG A CB   5 
ATOM   4578 C CG   . ARG A 1 49 ? -6.571  6.134   6.929   1.00 0.00 ? 49 ARG A CG   5 
ATOM   4579 C CD   . ARG A 1 49 ? -7.427  6.292   8.175   1.00 0.00 ? 49 ARG A CD   5 
ATOM   4580 N NE   . ARG A 1 49 ? -8.048  7.612   8.249   1.00 0.00 ? 49 ARG A NE   5 
ATOM   4581 C CZ   . ARG A 1 49 ? -7.387  8.727   8.556   1.00 0.00 ? 49 ARG A CZ   5 
ATOM   4582 N NH1  . ARG A 1 49 ? -6.087  8.685   8.819   1.00 0.00 ? 49 ARG A NH1  5 
ATOM   4583 N NH2  . ARG A 1 49 ? -8.029  9.886   8.602   1.00 0.00 ? 49 ARG A NH2  5 
ATOM   4584 H H    . ARG A 1 49 ? -5.293  5.321   4.291   1.00 0.00 ? 49 ARG A H    5 
ATOM   4585 H HA   . ARG A 1 49 ? -6.991  3.648   5.894   1.00 0.00 ? 49 ARG A HA   5 
ATOM   4586 H HB2  . ARG A 1 49 ? -7.296  6.501   4.967   1.00 0.00 ? 49 ARG A HB2  5 
ATOM   4587 H HB3  . ARG A 1 49 ? -8.442  5.690   6.025   1.00 0.00 ? 49 ARG A HB3  5 
ATOM   4588 H HG2  . ARG A 1 49 ? -5.830  5.369   7.109   1.00 0.00 ? 49 ARG A HG2  5 
ATOM   4589 H HG3  . ARG A 1 49 ? -6.078  7.072   6.720   1.00 0.00 ? 49 ARG A HG3  5 
ATOM   4590 H HD2  . ARG A 1 49 ? -8.202  5.541   8.161   1.00 0.00 ? 49 ARG A HD2  5 
ATOM   4591 H HD3  . ARG A 1 49 ? -6.803  6.148   9.045   1.00 0.00 ? 49 ARG A HD3  5 
ATOM   4592 H HE   . ARG A 1 49 ? -9.007  7.672   8.060   1.00 0.00 ? 49 ARG A HE   5 
ATOM   4593 H HH11 . ARG A 1 49 ? -5.597  7.813   8.787   1.00 0.00 ? 49 ARG A HH11 5 
ATOM   4594 H HH12 . ARG A 1 49 ? -5.596  9.525   9.049   1.00 0.00 ? 49 ARG A HH12 5 
ATOM   4595 H HH21 . ARG A 1 49 ? -9.009  9.923   8.406   1.00 0.00 ? 49 ARG A HH21 5 
ATOM   4596 H HH22 . ARG A 1 49 ? -7.534  10.723  8.833   1.00 0.00 ? 49 ARG A HH22 5 
ATOM   4597 N N    . SER A 1 50 ? -7.567  3.272   3.051   1.00 0.00 ? 50 SER A N    5 
ATOM   4598 C CA   . SER A 1 50 ? -8.434  2.777   1.996   1.00 0.00 ? 50 SER A CA   5 
ATOM   4599 C C    . SER A 1 50 ? -9.110  1.476   2.422   1.00 0.00 ? 50 SER A C    5 
ATOM   4600 O O    . SER A 1 50 ? -8.547  0.705   3.200   1.00 0.00 ? 50 SER A O    5 
ATOM   4601 C CB   . SER A 1 50 ? -7.633  2.561   0.723   1.00 0.00 ? 50 SER A CB   5 
ATOM   4602 O OG   . SER A 1 50 ? -8.417  2.820   -0.429  1.00 0.00 ? 50 SER A OG   5 
ATOM   4603 H H    . SER A 1 50 ? -6.614  3.081   3.009   1.00 0.00 ? 50 SER A H    5 
ATOM   4604 H HA   . SER A 1 50 ? -9.189  3.515   1.808   1.00 0.00 ? 50 SER A HA   5 
ATOM   4605 H HB2  . SER A 1 50 ? -6.778  3.224   0.719   1.00 0.00 ? 50 SER A HB2  5 
ATOM   4606 H HB3  . SER A 1 50 ? -7.303  1.544   0.697   1.00 0.00 ? 50 SER A HB3  5 
ATOM   4607 H HG   . SER A 1 50 ? -8.452  3.767   -0.586  1.00 0.00 ? 50 SER A HG   5 
ATOM   4608 N N    . PRO A 1 51 ? -10.326 1.207   1.919   1.00 0.00 ? 51 PRO A N    5 
ATOM   4609 C CA   . PRO A 1 51 ? -11.061 -0.013  2.258   1.00 0.00 ? 51 PRO A CA   5 
ATOM   4610 C C    . PRO A 1 51 ? -10.474 -1.247  1.579   1.00 0.00 ? 51 PRO A C    5 
ATOM   4611 O O    . PRO A 1 51 ? -10.314 -2.295  2.204   1.00 0.00 ? 51 PRO A O    5 
ATOM   4612 C CB   . PRO A 1 51 ? -12.469 0.268   1.736   1.00 0.00 ? 51 PRO A CB   5 
ATOM   4613 C CG   . PRO A 1 51 ? -12.270 1.225   0.611   1.00 0.00 ? 51 PRO A CG   5 
ATOM   4614 C CD   . PRO A 1 51 ? -11.077 2.065   0.982   1.00 0.00 ? 51 PRO A CD   5 
ATOM   4615 H HA   . PRO A 1 51 ? -11.094 -0.172  3.327   1.00 0.00 ? 51 PRO A HA   5 
ATOM   4616 H HB2  . PRO A 1 51 ? -12.921 -0.653  1.397   1.00 0.00 ? 51 PRO A HB2  5 
ATOM   4617 H HB3  . PRO A 1 51 ? -13.069 0.703   2.521   1.00 0.00 ? 51 PRO A HB3  5 
ATOM   4618 H HG2  . PRO A 1 51 ? -12.077 0.682   -0.302  1.00 0.00 ? 51 PRO A HG2  5 
ATOM   4619 H HG3  . PRO A 1 51 ? -13.145 1.848   0.500   1.00 0.00 ? 51 PRO A HG3  5 
ATOM   4620 H HD2  . PRO A 1 51 ? -10.486 2.286   0.106   1.00 0.00 ? 51 PRO A HD2  5 
ATOM   4621 H HD3  . PRO A 1 51 ? -11.393 2.978   1.465   1.00 0.00 ? 51 PRO A HD3  5 
ATOM   4622 N N    . HIS A 1 52 ? -10.161 -1.113  0.295   1.00 0.00 ? 52 HIS A N    5 
ATOM   4623 C CA   . HIS A 1 52 ? -9.595  -2.216  -0.478  1.00 0.00 ? 52 HIS A CA   5 
ATOM   4624 C C    . HIS A 1 52 ? -8.096  -2.369  -0.226  1.00 0.00 ? 52 HIS A C    5 
ATOM   4625 O O    . HIS A 1 52 ? -7.511  -3.405  -0.542  1.00 0.00 ? 52 HIS A O    5 
ATOM   4626 C CB   . HIS A 1 52 ? -9.850  -2.002  -1.973  1.00 0.00 ? 52 HIS A CB   5 
ATOM   4627 C CG   . HIS A 1 52 ? -11.178 -1.379  -2.275  1.00 0.00 ? 52 HIS A CG   5 
ATOM   4628 N ND1  . HIS A 1 52 ? -12.379 -2.021  -2.052  1.00 0.00 ? 52 HIS A ND1  5 
ATOM   4629 C CD2  . HIS A 1 52 ? -11.492 -0.162  -2.780  1.00 0.00 ? 52 HIS A CD2  5 
ATOM   4630 C CE1  . HIS A 1 52 ? -13.373 -1.226  -2.409  1.00 0.00 ? 52 HIS A CE1  5 
ATOM   4631 N NE2  . HIS A 1 52 ? -12.862 -0.093  -2.853  1.00 0.00 ? 52 HIS A NE2  5 
ATOM   4632 H H    . HIS A 1 52 ? -10.316 -0.252  -0.147  1.00 0.00 ? 52 HIS A H    5 
ATOM   4633 H HA   . HIS A 1 52 ? -10.091 -3.121  -0.167  1.00 0.00 ? 52 HIS A HA   5 
ATOM   4634 H HB2  . HIS A 1 52 ? -9.083  -1.356  -2.372  1.00 0.00 ? 52 HIS A HB2  5 
ATOM   4635 H HB3  . HIS A 1 52 ? -9.807  -2.956  -2.477  1.00 0.00 ? 52 HIS A HB3  5 
ATOM   4636 H HD1  . HIS A 1 52 ? -12.486 -2.924  -1.688  1.00 0.00 ? 52 HIS A HD1  5 
ATOM   4637 H HD2  . HIS A 1 52 ? -10.794 0.611   -3.070  1.00 0.00 ? 52 HIS A HD2  5 
ATOM   4638 H HE1  . HIS A 1 52 ? -14.424 -1.463  -2.345  1.00 0.00 ? 52 HIS A HE1  5 
ATOM   4639 H HE2  . HIS A 1 52 ? -13.374 0.639   -3.255  1.00 0.00 ? 52 HIS A HE2  5 
ATOM   4640 N N    . ALA A 1 53 ? -7.474  -1.335  0.336   1.00 0.00 ? 53 ALA A N    5 
ATOM   4641 C CA   . ALA A 1 53 ? -6.045  -1.362  0.615   1.00 0.00 ? 53 ALA A CA   5 
ATOM   4642 C C    . ALA A 1 53 ? -5.665  -2.572  1.454   1.00 0.00 ? 53 ALA A C    5 
ATOM   4643 O O    . ALA A 1 53 ? -4.719  -3.294  1.140   1.00 0.00 ? 53 ALA A O    5 
ATOM   4644 C CB   . ALA A 1 53 ? -5.615  -0.083  1.317   1.00 0.00 ? 53 ALA A CB   5 
ATOM   4645 H H    . ALA A 1 53 ? -7.985  -0.535  0.561   1.00 0.00 ? 53 ALA A H    5 
ATOM   4646 H HA   . ALA A 1 53 ? -5.532  -1.415  -0.323  1.00 0.00 ? 53 ALA A HA   5 
ATOM   4647 H HB1  . ALA A 1 53 ? -6.369  0.205   2.035   1.00 0.00 ? 53 ALA A HB1  5 
ATOM   4648 H HB2  . ALA A 1 53 ? -5.494  0.705   0.587   1.00 0.00 ? 53 ALA A HB2  5 
ATOM   4649 H HB3  . ALA A 1 53 ? -4.678  -0.249  1.827   1.00 0.00 ? 53 ALA A HB3  5 
ATOM   4650 N N    . ARG A 1 54 ? -6.410  -2.776  2.524   1.00 0.00 ? 54 ARG A N    5 
ATOM   4651 C CA   . ARG A 1 54 ? -6.169  -3.887  3.432   1.00 0.00 ? 54 ARG A CA   5 
ATOM   4652 C C    . ARG A 1 54 ? -6.255  -5.221  2.707   1.00 0.00 ? 54 ARG A C    5 
ATOM   4653 O O    . ARG A 1 54 ? -5.486  -6.142  2.980   1.00 0.00 ? 54 ARG A O    5 
ATOM   4654 C CB   . ARG A 1 54 ? -7.168  -3.857  4.591   1.00 0.00 ? 54 ARG A CB   5 
ATOM   4655 C CG   . ARG A 1 54 ? -7.171  -2.544  5.357   1.00 0.00 ? 54 ARG A CG   5 
ATOM   4656 C CD   . ARG A 1 54 ? -8.464  -2.356  6.135   1.00 0.00 ? 54 ARG A CD   5 
ATOM   4657 N NE   . ARG A 1 54 ? -9.643  -2.611  5.311   1.00 0.00 ? 54 ARG A NE   5 
ATOM   4658 C CZ   . ARG A 1 54 ? -10.847 -2.890  5.806   1.00 0.00 ? 54 ARG A CZ   5 
ATOM   4659 N NH1  . ARG A 1 54 ? -11.037 -2.944  7.118   1.00 0.00 ? 54 ARG A NH1  5 
ATOM   4660 N NH2  . ARG A 1 54 ? -11.864 -3.114  4.985   1.00 0.00 ? 54 ARG A NH2  5 
ATOM   4661 H H    . ARG A 1 54 ? -7.138  -2.157  2.711   1.00 0.00 ? 54 ARG A H    5 
ATOM   4662 H HA   . ARG A 1 54 ? -5.179  -3.773  3.822   1.00 0.00 ? 54 ARG A HA   5 
ATOM   4663 H HB2  . ARG A 1 54 ? -8.160  -4.023  4.199   1.00 0.00 ? 54 ARG A HB2  5 
ATOM   4664 H HB3  . ARG A 1 54 ? -6.925  -4.651  5.281   1.00 0.00 ? 54 ARG A HB3  5 
ATOM   4665 H HG2  . ARG A 1 54 ? -6.343  -2.540  6.049   1.00 0.00 ? 54 ARG A HG2  5 
ATOM   4666 H HG3  . ARG A 1 54 ? -7.062  -1.729  4.656   1.00 0.00 ? 54 ARG A HG3  5 
ATOM   4667 H HD2  . ARG A 1 54 ? -8.467  -3.040  6.971   1.00 0.00 ? 54 ARG A HD2  5 
ATOM   4668 H HD3  . ARG A 1 54 ? -8.504  -1.341  6.501   1.00 0.00 ? 54 ARG A HD3  5 
ATOM   4669 H HE   . ARG A 1 54 ? -9.531  -2.575  4.338   1.00 0.00 ? 54 ARG A HE   5 
ATOM   4670 H HH11 . ARG A 1 54 ? -10.275 -2.775  7.742   1.00 0.00 ? 54 ARG A HH11 5 
ATOM   4671 H HH12 . ARG A 1 54 ? -11.945 -3.153  7.483   1.00 0.00 ? 54 ARG A HH12 5 
ATOM   4672 H HH21 . ARG A 1 54 ? -11.727 -3.073  3.995   1.00 0.00 ? 54 ARG A HH21 5 
ATOM   4673 H HH22 . ARG A 1 54 ? -12.769 -3.323  5.356   1.00 0.00 ? 54 ARG A HH22 5 
ATOM   4674 N N    . ASP A 1 55 ? -7.197  -5.315  1.784   1.00 0.00 ? 55 ASP A N    5 
ATOM   4675 C CA   . ASP A 1 55 ? -7.391  -6.535  1.014   1.00 0.00 ? 55 ASP A CA   5 
ATOM   4676 C C    . ASP A 1 55 ? -6.205  -6.790  0.100   1.00 0.00 ? 55 ASP A C    5 
ATOM   4677 O O    . ASP A 1 55 ? -5.734  -7.920  -0.030  1.00 0.00 ? 55 ASP A O    5 
ATOM   4678 C CB   . ASP A 1 55 ? -8.672  -6.454  0.197   1.00 0.00 ? 55 ASP A CB   5 
ATOM   4679 C CG   . ASP A 1 55 ? -9.244  -7.822  -0.119  1.00 0.00 ? 55 ASP A CG   5 
ATOM   4680 O OD1  . ASP A 1 55 ? -8.455  -8.785  -0.225  1.00 0.00 ? 55 ASP A OD1  5 
ATOM   4681 O OD2  . ASP A 1 55 ? -10.480 -7.931  -0.261  1.00 0.00 ? 55 ASP A OD2  5 
ATOM   4682 H H    . ASP A 1 55 ? -7.773  -4.544  1.618   1.00 0.00 ? 55 ASP A H    5 
ATOM   4683 H HA   . ASP A 1 55 ? -7.472  -7.344  1.698   1.00 0.00 ? 55 ASP A HA   5 
ATOM   4684 H HB2  . ASP A 1 55 ? -9.413  -5.890  0.748   1.00 0.00 ? 55 ASP A HB2  5 
ATOM   4685 H HB3  . ASP A 1 55 ? -8.454  -5.955  -0.727  1.00 0.00 ? 55 ASP A HB3  5 
ATOM   4686 N N    . THR A 1 56 ? -5.728  -5.728  -0.525  1.00 0.00 ? 56 THR A N    5 
ATOM   4687 C CA   . THR A 1 56 ? -4.595  -5.813  -1.427  1.00 0.00 ? 56 THR A CA   5 
ATOM   4688 C C    . THR A 1 56 ? -3.366  -6.357  -0.709  1.00 0.00 ? 56 THR A C    5 
ATOM   4689 O O    . THR A 1 56 ? -2.688  -7.255  -1.208  1.00 0.00 ? 56 THR A O    5 
ATOM   4690 C CB   . THR A 1 56 ? -4.292  -4.446  -2.018  1.00 0.00 ? 56 THR A CB   5 
ATOM   4691 O OG1  . THR A 1 56 ? -5.482  -3.699  -2.197  1.00 0.00 ? 56 THR A OG1  5 
ATOM   4692 C CG2  . THR A 1 56 ? -3.581  -4.510  -3.353  1.00 0.00 ? 56 THR A CG2  5 
ATOM   4693 H H    . THR A 1 56 ? -6.148  -4.864  -0.373  1.00 0.00 ? 56 THR A H    5 
ATOM   4694 H HA   . THR A 1 56 ? -4.857  -6.477  -2.220  1.00 0.00 ? 56 THR A HA   5 
ATOM   4695 H HB   . THR A 1 56 ? -3.661  -3.919  -1.333  1.00 0.00 ? 56 THR A HB   5 
ATOM   4696 H HG1  . THR A 1 56 ? -5.533  -3.012  -1.527  1.00 0.00 ? 56 THR A HG1  5 
ATOM   4697 H HG21 . THR A 1 56 ? -3.327  -3.511  -3.674  1.00 0.00 ? 56 THR A HG21 5 
ATOM   4698 H HG22 . THR A 1 56 ? -4.229  -4.971  -4.084  1.00 0.00 ? 56 THR A HG22 5 
ATOM   4699 H HG23 . THR A 1 56 ? -2.679  -5.096  -3.252  1.00 0.00 ? 56 THR A HG23 5 
ATOM   4700 N N    . LEU A 1 57 ? -3.085  -5.806  0.468   1.00 0.00 ? 57 LEU A N    5 
ATOM   4701 C CA   . LEU A 1 57 ? -1.943  -6.232  1.256   1.00 0.00 ? 57 LEU A CA   5 
ATOM   4702 C C    . LEU A 1 57 ? -2.062  -7.698  1.638   1.00 0.00 ? 57 LEU A C    5 
ATOM   4703 O O    . LEU A 1 57 ? -1.132  -8.481  1.449   1.00 0.00 ? 57 LEU A O    5 
ATOM   4704 C CB   . LEU A 1 57 ? -1.813  -5.363  2.503   1.00 0.00 ? 57 LEU A CB   5 
ATOM   4705 C CG   . LEU A 1 57 ? -0.762  -4.258  2.415   1.00 0.00 ? 57 LEU A CG   5 
ATOM   4706 C CD1  . LEU A 1 57 ? -1.424  -2.889  2.389   1.00 0.00 ? 57 LEU A CD1  5 
ATOM   4707 C CD2  . LEU A 1 57 ? 0.220   -4.354  3.573   1.00 0.00 ? 57 LEU A CD2  5 
ATOM   4708 H H    . LEU A 1 57 ? -3.659  -5.096  0.813   1.00 0.00 ? 57 LEU A H    5 
ATOM   4709 H HA   . LEU A 1 57 ? -1.076  -6.104  0.656   1.00 0.00 ? 57 LEU A HA   5 
ATOM   4710 H HB2  . LEU A 1 57 ? -2.767  -4.902  2.680   1.00 0.00 ? 57 LEU A HB2  5 
ATOM   4711 H HB3  . LEU A 1 57 ? -1.569  -6.000  3.343   1.00 0.00 ? 57 LEU A HB3  5 
ATOM   4712 H HG   . LEU A 1 57 ? -0.212  -4.376  1.497   1.00 0.00 ? 57 LEU A HG   5 
ATOM   4713 H HD11 . LEU A 1 57 ? -0.864  -2.230  1.742   1.00 0.00 ? 57 LEU A HD11 5 
ATOM   4714 H HD12 . LEU A 1 57 ? -1.445  -2.480  3.388   1.00 0.00 ? 57 LEU A HD12 5 
ATOM   4715 H HD13 . LEU A 1 57 ? -2.434  -2.984  2.018   1.00 0.00 ? 57 LEU A HD13 5 
ATOM   4716 H HD21 . LEU A 1 57 ? 0.465   -3.362  3.921   1.00 0.00 ? 57 LEU A HD21 5 
ATOM   4717 H HD22 . LEU A 1 57 ? 1.120   -4.852  3.242   1.00 0.00 ? 57 LEU A HD22 5 
ATOM   4718 H HD23 . LEU A 1 57 ? -0.227  -4.918  4.378   1.00 0.00 ? 57 LEU A HD23 5 
ATOM   4719 N N    . THR A 1 58 ? -3.217  -8.057  2.172   1.00 0.00 ? 58 THR A N    5 
ATOM   4720 C CA   . THR A 1 58 ? -3.475  -9.426  2.581   1.00 0.00 ? 58 THR A CA   5 
ATOM   4721 C C    . THR A 1 58 ? -3.407  -10.362 1.384   1.00 0.00 ? 58 THR A C    5 
ATOM   4722 O O    . THR A 1 58 ? -2.824  -11.443 1.463   1.00 0.00 ? 58 THR A O    5 
ATOM   4723 C CB   . THR A 1 58 ? -4.840  -9.537  3.262   1.00 0.00 ? 58 THR A CB   5 
ATOM   4724 O OG1  . THR A 1 58 ? -5.121  -8.370  4.014   1.00 0.00 ? 58 THR A OG1  5 
ATOM   4725 C CG2  . THR A 1 58 ? -4.947  -10.721 4.198   1.00 0.00 ? 58 THR A CG2  5 
ATOM   4726 H H    . THR A 1 58 ? -3.909  -7.386  2.290   1.00 0.00 ? 58 THR A H    5 
ATOM   4727 H HA   . THR A 1 58 ? -2.707  -9.703  3.279   1.00 0.00 ? 58 THR A HA   5 
ATOM   4728 H HB   . THR A 1 58 ? -5.602  -9.645  2.504   1.00 0.00 ? 58 THR A HB   5 
ATOM   4729 H HG1  . THR A 1 58 ? -4.520  -8.317  4.760   1.00 0.00 ? 58 THR A HG1  5 
ATOM   4730 H HG21 . THR A 1 58 ? -5.055  -10.370 5.213   1.00 0.00 ? 58 THR A HG21 5 
ATOM   4731 H HG22 . THR A 1 58 ? -4.054  -11.325 4.119   1.00 0.00 ? 58 THR A HG22 5 
ATOM   4732 H HG23 . THR A 1 58 ? -5.808  -11.315 3.930   1.00 0.00 ? 58 THR A HG23 5 
ATOM   4733 N N    . SER A 1 59 ? -3.990  -9.935  0.268   1.00 0.00 ? 59 SER A N    5 
ATOM   4734 C CA   . SER A 1 59 ? -3.975  -10.727 -0.946  1.00 0.00 ? 59 SER A CA   5 
ATOM   4735 C C    . SER A 1 59 ? -2.552  -11.131 -1.283  1.00 0.00 ? 59 SER A C    5 
ATOM   4736 O O    . SER A 1 59 ? -2.298  -12.218 -1.802  1.00 0.00 ? 59 SER A O    5 
ATOM   4737 C CB   . SER A 1 59 ? -4.575  -9.934  -2.091  1.00 0.00 ? 59 SER A CB   5 
ATOM   4738 O OG   . SER A 1 59 ? -5.101  -10.789 -3.091  1.00 0.00 ? 59 SER A OG   5 
ATOM   4739 H H    . SER A 1 59 ? -4.427  -9.061  0.256   1.00 0.00 ? 59 SER A H    5 
ATOM   4740 H HA   . SER A 1 59 ? -4.560  -11.600 -0.783  1.00 0.00 ? 59 SER A HA   5 
ATOM   4741 H HB2  . SER A 1 59 ? -5.366  -9.305  -1.713  1.00 0.00 ? 59 SER A HB2  5 
ATOM   4742 H HB3  . SER A 1 59 ? -3.806  -9.326  -2.521  1.00 0.00 ? 59 SER A HB3  5 
ATOM   4743 H HG   . SER A 1 59 ? -6.057  -10.705 -3.114  1.00 0.00 ? 59 SER A HG   5 
ATOM   4744 N N    . CYS A 1 60 ? -1.628  -10.238 -0.964  1.00 0.00 ? 60 CYS A N    5 
ATOM   4745 C CA   . CYS A 1 60 ? -0.220  -10.466 -1.202  1.00 0.00 ? 60 CYS A CA   5 
ATOM   4746 C C    . CYS A 1 60 ? 0.367   -11.350 -0.108  1.00 0.00 ? 60 CYS A C    5 
ATOM   4747 O O    . CYS A 1 60 ? 1.269   -12.149 -0.358  1.00 0.00 ? 60 CYS A O    5 
ATOM   4748 C CB   . CYS A 1 60 ? 0.510   -9.128  -1.246  1.00 0.00 ? 60 CYS A CB   5 
ATOM   4749 S SG   . CYS A 1 60 ? 1.802   -9.030  -2.528  1.00 0.00 ? 60 CYS A SG   5 
ATOM   4750 H H    . CYS A 1 60 ? -1.905  -9.398  -0.545  1.00 0.00 ? 60 CYS A H    5 
ATOM   4751 H HA   . CYS A 1 60 ? -0.114  -10.962 -2.154  1.00 0.00 ? 60 CYS A HA   5 
ATOM   4752 H HB2  . CYS A 1 60 ? -0.205  -8.342  -1.439  1.00 0.00 ? 60 CYS A HB2  5 
ATOM   4753 H HB3  . CYS A 1 60 ? 0.971   -8.952  -0.288  1.00 0.00 ? 60 CYS A HB3  5 
ATOM   4754 N N    . GLY A 1 61 ? -0.154  -11.201 1.109   1.00 0.00 ? 61 GLY A N    5 
ATOM   4755 C CA   . GLY A 1 61 ? 0.330   -11.994 2.221   1.00 0.00 ? 61 GLY A CA   5 
ATOM   4756 C C    . GLY A 1 61 ? 1.761   -11.662 2.592   1.00 0.00 ? 61 GLY A C    5 
ATOM   4757 O O    . GLY A 1 61 ? 2.618   -12.544 2.631   1.00 0.00 ? 61 GLY A O    5 
ATOM   4758 H H    . GLY A 1 61 ? -0.875  -10.548 1.253   1.00 0.00 ? 61 GLY A H    5 
ATOM   4759 H HA2  . GLY A 1 61 ? -0.303  -11.815 3.078   1.00 0.00 ? 61 GLY A HA2  5 
ATOM   4760 H HA3  . GLY A 1 61 ? 0.272   -13.039 1.956   1.00 0.00 ? 61 GLY A HA3  5 
ATOM   4761 N N    . LEU A 1 62 ? 2.020   -10.389 2.877   1.00 0.00 ? 62 LEU A N    5 
ATOM   4762 C CA   . LEU A 1 62 ? 3.359   -9.954  3.258   1.00 0.00 ? 62 LEU A CA   5 
ATOM   4763 C C    . LEU A 1 62 ? 3.377   -9.474  4.706   1.00 0.00 ? 62 LEU A C    5 
ATOM   4764 O O    . LEU A 1 62 ? 3.723   -10.228 5.615   1.00 0.00 ? 62 LEU A O    5 
ATOM   4765 C CB   . LEU A 1 62 ? 3.890   -8.848  2.325   1.00 0.00 ? 62 LEU A CB   5 
ATOM   4766 C CG   . LEU A 1 62 ? 2.843   -8.063  1.515   1.00 0.00 ? 62 LEU A CG   5 
ATOM   4767 C CD1  . LEU A 1 62 ? 2.680   -6.652  2.062   1.00 0.00 ? 62 LEU A CD1  5 
ATOM   4768 C CD2  . LEU A 1 62 ? 3.244   -8.012  0.050   1.00 0.00 ? 62 LEU A CD2  5 
ATOM   4769 H H    . LEU A 1 62 ? 1.293   -9.733  2.839   1.00 0.00 ? 62 LEU A H    5 
ATOM   4770 H HA   . LEU A 1 62 ? 4.011   -10.813 3.179   1.00 0.00 ? 62 LEU A HA   5 
ATOM   4771 H HB2  . LEU A 1 62 ? 4.444   -8.143  2.927   1.00 0.00 ? 62 LEU A HB2  5 
ATOM   4772 H HB3  . LEU A 1 62 ? 4.577   -9.306  1.628   1.00 0.00 ? 62 LEU A HB3  5 
ATOM   4773 H HG   . LEU A 1 62 ? 1.885   -8.555  1.582   1.00 0.00 ? 62 LEU A HG   5 
ATOM   4774 H HD11 . LEU A 1 62 ? 3.579   -6.361  2.584   1.00 0.00 ? 62 LEU A HD11 5 
ATOM   4775 H HD12 . LEU A 1 62 ? 1.843   -6.624  2.743   1.00 0.00 ? 62 LEU A HD12 5 
ATOM   4776 H HD13 . LEU A 1 62 ? 2.501   -5.968  1.246   1.00 0.00 ? 62 LEU A HD13 5 
ATOM   4777 H HD21 . LEU A 1 62 ? 4.208   -7.534  -0.043  1.00 0.00 ? 62 LEU A HD21 5 
ATOM   4778 H HD22 . LEU A 1 62 ? 2.509   -7.450  -0.505  1.00 0.00 ? 62 LEU A HD22 5 
ATOM   4779 H HD23 . LEU A 1 62 ? 3.302   -9.017  -0.341  1.00 0.00 ? 62 LEU A HD23 5 
ATOM   4780 N N    . ALA A 1 63 ? 3.000   -8.219  4.914   1.00 0.00 ? 63 ALA A N    5 
ATOM   4781 C CA   . ALA A 1 63 ? 2.970   -7.642  6.247   1.00 0.00 ? 63 ALA A CA   5 
ATOM   4782 C C    . ALA A 1 63 ? 1.903   -6.559  6.356   1.00 0.00 ? 63 ALA A C    5 
ATOM   4783 O O    . ALA A 1 63 ? 1.463   -6.004  5.351   1.00 0.00 ? 63 ALA A O    5 
ATOM   4784 C CB   . ALA A 1 63 ? 4.337   -7.083  6.613   1.00 0.00 ? 63 ALA A CB   5 
ATOM   4785 H H    . ALA A 1 63 ? 2.731   -7.672  4.156   1.00 0.00 ? 63 ALA A H    5 
ATOM   4786 H HA   . ALA A 1 63 ? 2.735   -8.433  6.936   1.00 0.00 ? 63 ALA A HA   5 
ATOM   4787 H HB1  . ALA A 1 63 ? 4.436   -6.084  6.216   1.00 0.00 ? 63 ALA A HB1  5 
ATOM   4788 H HB2  . ALA A 1 63 ? 5.108   -7.715  6.196   1.00 0.00 ? 63 ALA A HB2  5 
ATOM   4789 H HB3  . ALA A 1 63 ? 4.438   -7.055  7.688   1.00 0.00 ? 63 ALA A HB3  5 
ATOM   4790 N N    . VAL A 1 64 ? 1.496   -6.262  7.585   1.00 0.00 ? 64 VAL A N    5 
ATOM   4791 C CA   . VAL A 1 64 ? 0.491   -5.248  7.835   1.00 0.00 ? 64 VAL A CA   5 
ATOM   4792 C C    . VAL A 1 64 ? 1.116   -4.021  8.498   1.00 0.00 ? 64 VAL A C    5 
ATOM   4793 O O    . VAL A 1 64 ? 1.964   -4.155  9.381   1.00 0.00 ? 64 VAL A O    5 
ATOM   4794 C CB   . VAL A 1 64 ? -0.642  -5.801  8.726   1.00 0.00 ? 64 VAL A CB   5 
ATOM   4795 C CG1  . VAL A 1 64 ? -0.155  -6.024  10.151  1.00 0.00 ? 64 VAL A CG1  5 
ATOM   4796 C CG2  . VAL A 1 64 ? -1.847  -4.873  8.705   1.00 0.00 ? 64 VAL A CG2  5 
ATOM   4797 H H    . VAL A 1 64 ? 1.882   -6.734  8.340   1.00 0.00 ? 64 VAL A H    5 
ATOM   4798 H HA   . VAL A 1 64 ? 0.073   -4.964  6.888   1.00 0.00 ? 64 VAL A HA   5 
ATOM   4799 H HB   . VAL A 1 64 ? -0.945  -6.756  8.325   1.00 0.00 ? 64 VAL A HB   5 
ATOM   4800 H HG11 . VAL A 1 64 ? -0.956  -6.442  10.743  1.00 0.00 ? 64 VAL A HG11 5 
ATOM   4801 H HG12 . VAL A 1 64 ? 0.154   -5.081  10.578  1.00 0.00 ? 64 VAL A HG12 5 
ATOM   4802 H HG13 . VAL A 1 64 ? 0.681   -6.707  10.143  1.00 0.00 ? 64 VAL A HG13 5 
ATOM   4803 H HG21 . VAL A 1 64 ? -2.589  -5.230  9.404   1.00 0.00 ? 64 VAL A HG21 5 
ATOM   4804 H HG22 . VAL A 1 64 ? -2.270  -4.854  7.710   1.00 0.00 ? 64 VAL A HG22 5 
ATOM   4805 H HG23 . VAL A 1 64 ? -1.539  -3.876  8.984   1.00 0.00 ? 64 VAL A HG23 5 
ATOM   4806 N N    . PRO A 1 65 ? 0.713   -2.804  8.084   1.00 0.00 ? 65 PRO A N    5 
ATOM   4807 C CA   . PRO A 1 65 ? 1.249   -1.562  8.652   1.00 0.00 ? 65 PRO A CA   5 
ATOM   4808 C C    . PRO A 1 65 ? 1.067   -1.496  10.165  1.00 0.00 ? 65 PRO A C    5 
ATOM   4809 O O    . PRO A 1 65 ? 0.873   -2.518  10.822  1.00 0.00 ? 65 PRO A O    5 
ATOM   4810 C CB   . PRO A 1 65 ? 0.438   -0.459  7.957   1.00 0.00 ? 65 PRO A CB   5 
ATOM   4811 C CG   . PRO A 1 65 ? -0.750  -1.151  7.387   1.00 0.00 ? 65 PRO A CG   5 
ATOM   4812 C CD   . PRO A 1 65 ? -0.286  -2.534  7.040   1.00 0.00 ? 65 PRO A CD   5 
ATOM   4813 H HA   . PRO A 1 65 ? 2.297   -1.444  8.416   1.00 0.00 ? 65 PRO A HA   5 
ATOM   4814 H HB2  . PRO A 1 65 ? 0.147   0.289   8.679   1.00 0.00 ? 65 PRO A HB2  5 
ATOM   4815 H HB3  . PRO A 1 65 ? 1.036   -0.004  7.182   1.00 0.00 ? 65 PRO A HB3  5 
ATOM   4816 H HG2  . PRO A 1 65 ? -1.537  -1.192  8.126   1.00 0.00 ? 65 PRO A HG2  5 
ATOM   4817 H HG3  . PRO A 1 65 ? -1.088  -0.634  6.502   1.00 0.00 ? 65 PRO A HG3  5 
ATOM   4818 H HD2  . PRO A 1 65 ? -1.105  -3.234  7.091   1.00 0.00 ? 65 PRO A HD2  5 
ATOM   4819 H HD3  . PRO A 1 65 ? 0.167   -2.548  6.060   1.00 0.00 ? 65 PRO A HD3  5 
ATOM   4820 N N    . HIS A 1 66 ? 1.135   -0.289  10.713  1.00 0.00 ? 66 HIS A N    5 
ATOM   4821 C CA   . HIS A 1 66 ? 0.984   -0.097  12.151  1.00 0.00 ? 66 HIS A CA   5 
ATOM   4822 C C    . HIS A 1 66 ? 2.047   -0.885  12.911  1.00 0.00 ? 66 HIS A C    5 
ATOM   4823 O O    . HIS A 1 66 ? 1.809   -1.358  14.023  1.00 0.00 ? 66 HIS A O    5 
ATOM   4824 C CB   . HIS A 1 66 ? -0.411  -0.534  12.603  1.00 0.00 ? 66 HIS A CB   5 
ATOM   4825 C CG   . HIS A 1 66 ? -1.520  0.125   11.843  1.00 0.00 ? 66 HIS A CG   5 
ATOM   4826 N ND1  . HIS A 1 66 ? -2.452  -0.578  11.110  1.00 0.00 ? 66 HIS A ND1  5 
ATOM   4827 C CD2  . HIS A 1 66 ? -1.845  1.432   11.704  1.00 0.00 ? 66 HIS A CD2  5 
ATOM   4828 C CE1  . HIS A 1 66 ? -3.300  0.268   10.554  1.00 0.00 ? 66 HIS A CE1  5 
ATOM   4829 N NE2  . HIS A 1 66 ? -2.954  1.493   10.900  1.00 0.00 ? 66 HIS A NE2  5 
ATOM   4830 H H    . HIS A 1 66 ? 1.294   0.489   10.140  1.00 0.00 ? 66 HIS A H    5 
ATOM   4831 H HA   . HIS A 1 66 ? 1.111   0.954   12.362  1.00 0.00 ? 66 HIS A HA   5 
ATOM   4832 H HB2  . HIS A 1 66 ? -0.507  -1.601  12.471  1.00 0.00 ? 66 HIS A HB2  5 
ATOM   4833 H HB3  . HIS A 1 66 ? -0.535  -0.293  13.649  1.00 0.00 ? 66 HIS A HB3  5 
ATOM   4834 H HD1  . HIS A 1 66 ? -2.486  -1.552  11.012  1.00 0.00 ? 66 HIS A HD1  5 
ATOM   4835 H HD2  . HIS A 1 66 ? -1.328  2.271   12.145  1.00 0.00 ? 66 HIS A HD2  5 
ATOM   4836 H HE1  . HIS A 1 66 ? -4.134  0.004   9.926   1.00 0.00 ? 66 HIS A HE1  5 
ATOM   4837 H HE2  . HIS A 1 66 ? -3.362  2.314   10.554  1.00 0.00 ? 66 HIS A HE2  5 
ATOM   4838 N N    . CYS A 1 67 ? 3.220   -1.024  12.298  1.00 0.00 ? 67 CYS A N    5 
ATOM   4839 C CA   . CYS A 1 67 ? 4.324   -1.758  12.910  1.00 0.00 ? 67 CYS A CA   5 
ATOM   4840 C C    . CYS A 1 67 ? 4.687   -1.164  14.267  1.00 0.00 ? 67 CYS A C    5 
ATOM   4841 O O    . CYS A 1 67 ? 5.539   -1.757  14.962  1.00 0.00 ? 67 CYS A O    5 
ATOM   4842 C CB   . CYS A 1 67 ? 5.550   -1.744  11.991  1.00 0.00 ? 67 CYS A CB   5 
ATOM   4843 S SG   . CYS A 1 67 ? 5.183   -2.110  10.242  1.00 0.00 ? 67 CYS A SG   5 
ATOM   4844 O OXT  . CYS A 1 67 ? 4.116   -0.112  14.624  1.00 0.00 ? 67 CYS A OXT  5 
ATOM   4845 H H    . CYS A 1 67 ? 3.344   -0.625  11.413  1.00 0.00 ? 67 CYS A H    5 
ATOM   4846 H HA   . CYS A 1 67 ? 4.004   -2.779  13.051  1.00 0.00 ? 67 CYS A HA   5 
ATOM   4847 H HB2  . CYS A 1 67 ? 6.008   -0.767  12.031  1.00 0.00 ? 67 CYS A HB2  5 
ATOM   4848 H HB3  . CYS A 1 67 ? 6.258   -2.482  12.340  1.00 0.00 ? 67 CYS A HB3  5 
HETATM 4849 C C1   . PGM B 2 .  ? -12.817 -0.220  14.052  1.00 0.00 ? 68 PGM A C1   5 
HETATM 4850 O O1   . PGM B 2 .  ? -14.127 0.081   13.637  1.00 0.00 ? 68 PGM A O1   5 
HETATM 4851 C C2   . PGM B 2 .  ? -11.884 0.122   12.975  1.00 0.00 ? 68 PGM A C2   5 
HETATM 4852 O O2   . PGM B 2 .  ? -12.369 -0.400  11.763  1.00 0.00 ? 68 PGM A O2   5 
HETATM 4853 C C3   . PGM B 2 .  ? -10.542 -0.411  13.224  1.00 0.00 ? 68 PGM A C3   5 
HETATM 4854 O O4   . PGM B 2 .  ? -9.626  0.689   13.313  1.00 0.00 ? 68 PGM A O4   5 
HETATM 4855 P P5   . PGM B 2 .  ? -8.064  0.402   13.083  1.00 0.00 ? 68 PGM A P5   5 
HETATM 4856 O O5A  . PGM B 2 .  ? -7.303  1.656   13.285  1.00 0.00 ? 68 PGM A O5A  5 
HETATM 4857 O O5B  . PGM B 2 .  ? -7.681  -0.776  13.890  1.00 0.00 ? 68 PGM A O5B  5 
HETATM 4858 O O6   . PGM B 2 .  ? -7.946  -0.002  11.539  1.00 0.00 ? 68 PGM A O6   5 
HETATM 4859 C C7   . PGM B 2 .  ? -6.597  -0.228  10.953  1.00 0.00 ? 68 PGM A C7   5 
HETATM 4860 C C8   . PGM B 2 .  ? -6.517  -1.366  10.034  1.00 0.00 ? 68 PGM A C8   5 
HETATM 4861 O O8   . PGM B 2 .  ? -5.472  -2.285  10.239  1.00 0.00 ? 68 PGM A O8   5 
HETATM 4862 C C9   . PGM B 2 .  ? -6.515  -0.947  8.654   1.00 0.00 ? 68 PGM A C9   5 
HETATM 4863 O OQ1  . PGM B 2 .  ? -4.574  1.061   7.650   1.00 0.00 ? 68 PGM A OQ1  5 
HETATM 4864 O OQ2  . PGM B 2 .  ? -5.131  -0.976  8.088   1.00 0.00 ? 68 PGM A OQ2  5 
HETATM 4865 C CA   . PGM B 2 .  ? -4.811  -0.144  7.294   1.00 0.00 ? 68 PGM A CA   5 
HETATM 4866 C CB   . PGM B 2 .  ? -4.758  -0.402  5.849   1.00 0.00 ? 68 PGM A CB   5 
HETATM 4867 C CC   . PGM B 2 .  ? -3.463  -0.964  5.325   1.00 0.00 ? 68 PGM A CC   5 
HETATM 4868 C CD   . PGM B 2 .  ? -3.027  -0.407  3.999   1.00 0.00 ? 68 PGM A CD   5 
HETATM 4869 C CE   . PGM B 2 .  ? -1.621  0.115   3.986   1.00 0.00 ? 68 PGM A CE   5 
HETATM 4870 C CF   . PGM B 2 .  ? -1.041  0.294   2.616   1.00 0.00 ? 68 PGM A CF   5 
HETATM 4871 C CG   . PGM B 2 .  ? 0.459   0.351   2.576   1.00 0.00 ? 68 PGM A CG   5 
HETATM 4872 C CH   . PGM B 2 .  ? 1.037   1.029   1.379   1.00 0.00 ? 68 PGM A CH   5 
HETATM 4873 C CI   . PGM B 2 .  ? 1.452   2.447   1.592   1.00 0.00 ? 68 PGM A CI   5 
HETATM 4874 C CJ   . PGM B 2 .  ? 1.278   3.334   0.406   1.00 0.00 ? 68 PGM A CJ   5 
HETATM 4875 C CK   . PGM B 2 .  ? 1.744   4.742   0.583   1.00 0.00 ? 68 PGM A CK   5 
HETATM 4876 C CL   . PGM B 2 .  ? 0.962   5.772   -0.174  1.00 0.00 ? 68 PGM A CL   5 
HETATM 4877 C CM   . PGM B 2 .  ? 1.657   6.353   -1.363  1.00 0.00 ? 68 PGM A CM   5 
HETATM 4878 C CN   . PGM B 2 .  ? 0.916   6.233   -2.656  1.00 0.00 ? 68 PGM A CN   5 
HETATM 4879 C CO   . PGM B 2 .  ? 1.619   6.795   -3.849  1.00 0.00 ? 68 PGM A CO   5 
HETATM 4880 C CP   . PGM B 2 .  ? 0.968   6.473   -5.161  1.00 0.00 ? 68 PGM A CP   5 
ATOM   4881 N N    . ALA A 1 1  ? 9.370   6.833   1.761   1.00 0.00 ? 1  ALA A N    6 
ATOM   4882 C CA   . ALA A 1 1  ? 10.336  7.693   1.029   1.00 0.00 ? 1  ALA A CA   6 
ATOM   4883 C C    . ALA A 1 1  ? 11.324  6.849   0.231   1.00 0.00 ? 1  ALA A C    6 
ATOM   4884 O O    . ALA A 1 1  ? 12.502  7.189   0.125   1.00 0.00 ? 1  ALA A O    6 
ATOM   4885 C CB   . ALA A 1 1  ? 11.079  8.596   2.002   1.00 0.00 ? 1  ALA A CB   6 
ATOM   4886 H H1   . ALA A 1 1  ? 8.669   6.488   1.074   1.00 0.00 ? 1  ALA A H1   6 
ATOM   4887 H H2   . ALA A 1 1  ? 8.920   7.417   2.496   1.00 0.00 ? 1  ALA A H2   6 
ATOM   4888 H H3   . ALA A 1 1  ? 9.901   6.044   2.180   1.00 0.00 ? 1  ALA A H3   6 
ATOM   4889 H HA   . ALA A 1 1  ? 9.783   8.320   0.346   1.00 0.00 ? 1  ALA A HA   6 
ATOM   4890 H HB1  . ALA A 1 1  ? 10.382  9.283   2.459   1.00 0.00 ? 1  ALA A HB1  6 
ATOM   4891 H HB2  . ALA A 1 1  ? 11.837  9.151   1.471   1.00 0.00 ? 1  ALA A HB2  6 
ATOM   4892 H HB3  . ALA A 1 1  ? 11.545  7.993   2.768   1.00 0.00 ? 1  ALA A HB3  6 
ATOM   4893 N N    . CYS A 1 2  ? 10.835  5.747   -0.328  1.00 0.00 ? 2  CYS A N    6 
ATOM   4894 C CA   . CYS A 1 2  ? 11.675  4.853   -1.118  1.00 0.00 ? 2  CYS A CA   6 
ATOM   4895 C C    . CYS A 1 2  ? 11.367  4.991   -2.605  1.00 0.00 ? 2  CYS A C    6 
ATOM   4896 O O    . CYS A 1 2  ? 12.195  5.471   -3.378  1.00 0.00 ? 2  CYS A O    6 
ATOM   4897 C CB   . CYS A 1 2  ? 11.473  3.403   -0.673  1.00 0.00 ? 2  CYS A CB   6 
ATOM   4898 S SG   . CYS A 1 2  ? 11.452  3.178   1.134   1.00 0.00 ? 2  CYS A SG   6 
ATOM   4899 H H    . CYS A 1 2  ? 9.887   5.529   -0.208  1.00 0.00 ? 2  CYS A H    6 
ATOM   4900 H HA   . CYS A 1 2  ? 12.705  5.131   -0.949  1.00 0.00 ? 2  CYS A HA   6 
ATOM   4901 H HB2  . CYS A 1 2  ? 10.529  3.042   -1.056  1.00 0.00 ? 2  CYS A HB2  6 
ATOM   4902 H HB3  . CYS A 1 2  ? 12.273  2.796   -1.071  1.00 0.00 ? 2  CYS A HB3  6 
ATOM   4903 N N    . GLN A 1 3  ? 10.169  4.570   -2.997  1.00 0.00 ? 3  GLN A N    6 
ATOM   4904 C CA   . GLN A 1 3  ? 9.750   4.650   -4.392  1.00 0.00 ? 3  GLN A CA   6 
ATOM   4905 C C    . GLN A 1 3  ? 8.233   4.539   -4.509  1.00 0.00 ? 3  GLN A C    6 
ATOM   4906 O O    . GLN A 1 3  ? 7.662   3.466   -4.315  1.00 0.00 ? 3  GLN A O    6 
ATOM   4907 C CB   . GLN A 1 3  ? 10.417  3.547   -5.215  1.00 0.00 ? 3  GLN A CB   6 
ATOM   4908 C CG   . GLN A 1 3  ? 11.623  4.023   -6.008  1.00 0.00 ? 3  GLN A CG   6 
ATOM   4909 C CD   . GLN A 1 3  ? 12.707  2.967   -6.106  1.00 0.00 ? 3  GLN A CD   6 
ATOM   4910 O OE1  . GLN A 1 3  ? 12.425  1.789   -6.326  1.00 0.00 ? 3  GLN A OE1  6 
ATOM   4911 N NE2  . GLN A 1 3  ? 13.957  3.385   -5.942  1.00 0.00 ? 3  GLN A NE2  6 
ATOM   4912 H H    . GLN A 1 3  ? 9.551   4.200   -2.334  1.00 0.00 ? 3  GLN A H    6 
ATOM   4913 H HA   . GLN A 1 3  ? 10.059  5.611   -4.776  1.00 0.00 ? 3  GLN A HA   6 
ATOM   4914 H HB2  . GLN A 1 3  ? 10.738  2.761   -4.548  1.00 0.00 ? 3  GLN A HB2  6 
ATOM   4915 H HB3  . GLN A 1 3  ? 9.693   3.147   -5.909  1.00 0.00 ? 3  GLN A HB3  6 
ATOM   4916 H HG2  . GLN A 1 3  ? 11.303  4.281   -7.006  1.00 0.00 ? 3  GLN A HG2  6 
ATOM   4917 H HG3  . GLN A 1 3  ? 12.034  4.897   -5.525  1.00 0.00 ? 3  GLN A HG3  6 
ATOM   4918 H HE21 . GLN A 1 3  ? 14.108  4.338   -5.769  1.00 0.00 ? 3  GLN A HE21 6 
ATOM   4919 H HE22 . GLN A 1 3  ? 14.678  2.723   -6.000  1.00 0.00 ? 3  GLN A HE22 6 
ATOM   4920 N N    . ALA A 1 4  ? 7.590   5.654   -4.829  1.00 0.00 ? 4  ALA A N    6 
ATOM   4921 C CA   . ALA A 1 4  ? 6.144   5.689   -4.974  1.00 0.00 ? 4  ALA A CA   6 
ATOM   4922 C C    . ALA A 1 4  ? 5.718   5.216   -6.360  1.00 0.00 ? 4  ALA A C    6 
ATOM   4923 O O    . ALA A 1 4  ? 4.607   4.719   -6.544  1.00 0.00 ? 4  ALA A O    6 
ATOM   4924 C CB   . ALA A 1 4  ? 5.622   7.093   -4.710  1.00 0.00 ? 4  ALA A CB   6 
ATOM   4925 H H    . ALA A 1 4  ? 8.100   6.472   -4.970  1.00 0.00 ? 4  ALA A H    6 
ATOM   4926 H HA   . ALA A 1 4  ? 5.725   5.030   -4.234  1.00 0.00 ? 4  ALA A HA   6 
ATOM   4927 H HB1  . ALA A 1 4  ? 6.389   7.814   -4.951  1.00 0.00 ? 4  ALA A HB1  6 
ATOM   4928 H HB2  . ALA A 1 4  ? 5.353   7.187   -3.669  1.00 0.00 ? 4  ALA A HB2  6 
ATOM   4929 H HB3  . ALA A 1 4  ? 4.752   7.275   -5.324  1.00 0.00 ? 4  ALA A HB3  6 
ATOM   4930 N N    . SER A 1 5  ? 6.609   5.376   -7.334  1.00 0.00 ? 5  SER A N    6 
ATOM   4931 C CA   . SER A 1 5  ? 6.326   4.970   -8.706  1.00 0.00 ? 5  SER A CA   6 
ATOM   4932 C C    . SER A 1 5  ? 6.220   3.451   -8.829  1.00 0.00 ? 5  SER A C    6 
ATOM   4933 O O    . SER A 1 5  ? 5.754   2.937   -9.847  1.00 0.00 ? 5  SER A O    6 
ATOM   4934 C CB   . SER A 1 5  ? 7.413   5.493   -9.646  1.00 0.00 ? 5  SER A CB   6 
ATOM   4935 O OG   . SER A 1 5  ? 7.752   6.834   -9.339  1.00 0.00 ? 5  SER A OG   6 
ATOM   4936 H H    . SER A 1 5  ? 7.477   5.781   -7.126  1.00 0.00 ? 5  SER A H    6 
ATOM   4937 H HA   . SER A 1 5  ? 5.381   5.407   -8.990  1.00 0.00 ? 5  SER A HA   6 
ATOM   4938 H HB2  . SER A 1 5  ? 8.297   4.881   -9.547  1.00 0.00 ? 5  SER A HB2  6 
ATOM   4939 H HB3  . SER A 1 5  ? 7.057   5.448   -10.665 1.00 0.00 ? 5  SER A HB3  6 
ATOM   4940 H HG   . SER A 1 5  ? 7.122   7.427   -9.755  1.00 0.00 ? 5  SER A HG   6 
ATOM   4941 N N    . GLN A 1 6  ? 6.651   2.732   -7.795  1.00 0.00 ? 6  GLN A N    6 
ATOM   4942 C CA   . GLN A 1 6  ? 6.598   1.286   -7.803  1.00 0.00 ? 6  GLN A CA   6 
ATOM   4943 C C    . GLN A 1 6  ? 5.220   0.797   -7.381  1.00 0.00 ? 6  GLN A C    6 
ATOM   4944 O O    . GLN A 1 6  ? 4.753   -0.250  -7.827  1.00 0.00 ? 6  GLN A O    6 
ATOM   4945 C CB   . GLN A 1 6  ? 7.666   0.707   -6.872  1.00 0.00 ? 6  GLN A CB   6 
ATOM   4946 C CG   . GLN A 1 6  ? 9.087   0.925   -7.366  1.00 0.00 ? 6  GLN A CG   6 
ATOM   4947 C CD   . GLN A 1 6  ? 9.695   -0.330  -7.961  1.00 0.00 ? 6  GLN A CD   6 
ATOM   4948 O OE1  . GLN A 1 6  ? 10.811  -0.717  -7.616  1.00 0.00 ? 6  GLN A OE1  6 
ATOM   4949 N NE2  . GLN A 1 6  ? 8.962   -0.972  -8.863  1.00 0.00 ? 6  GLN A NE2  6 
ATOM   4950 H H    . GLN A 1 6  ? 7.010   3.181   -7.014  1.00 0.00 ? 6  GLN A H    6 
ATOM   4951 H HA   . GLN A 1 6  ? 6.794   0.964   -8.805  1.00 0.00 ? 6  GLN A HA   6 
ATOM   4952 H HB2  . GLN A 1 6  ? 7.570   1.170   -5.901  1.00 0.00 ? 6  GLN A HB2  6 
ATOM   4953 H HB3  . GLN A 1 6  ? 7.501   -0.356  -6.773  1.00 0.00 ? 6  GLN A HB3  6 
ATOM   4954 H HG2  . GLN A 1 6  ? 9.078   1.696   -8.121  1.00 0.00 ? 6  GLN A HG2  6 
ATOM   4955 H HG3  . GLN A 1 6  ? 9.697   1.244   -6.534  1.00 0.00 ? 6  GLN A HG3  6 
ATOM   4956 H HE21 . GLN A 1 6  ? 8.081   -0.606  -9.090  1.00 0.00 ? 6  GLN A HE21 6 
ATOM   4957 H HE22 . GLN A 1 6  ? 9.331   -1.787  -9.264  1.00 0.00 ? 6  GLN A HE22 6 
ATOM   4958 N N    . LEU A 1 7  ? 4.578   1.567   -6.511  1.00 0.00 ? 7  LEU A N    6 
ATOM   4959 C CA   . LEU A 1 7  ? 3.255   1.223   -6.009  1.00 0.00 ? 7  LEU A CA   6 
ATOM   4960 C C    . LEU A 1 7  ? 2.166   2.036   -6.707  1.00 0.00 ? 7  LEU A C    6 
ATOM   4961 O O    . LEU A 1 7  ? 0.982   1.716   -6.603  1.00 0.00 ? 7  LEU A O    6 
ATOM   4962 C CB   . LEU A 1 7  ? 3.192   1.456   -4.497  1.00 0.00 ? 7  LEU A CB   6 
ATOM   4963 C CG   . LEU A 1 7  ? 4.528   1.316   -3.760  1.00 0.00 ? 7  LEU A CG   6 
ATOM   4964 C CD1  . LEU A 1 7  ? 4.467   2.011   -2.409  1.00 0.00 ? 7  LEU A CD1  6 
ATOM   4965 C CD2  . LEU A 1 7  ? 4.891   -0.153  -3.590  1.00 0.00 ? 7  LEU A CD2  6 
ATOM   4966 H H    . LEU A 1 7  ? 5.009   2.387   -6.193  1.00 0.00 ? 7  LEU A H    6 
ATOM   4967 H HA   . LEU A 1 7  ? 3.087   0.175   -6.208  1.00 0.00 ? 7  LEU A HA   6 
ATOM   4968 H HB2  . LEU A 1 7  ? 2.812   2.452   -4.324  1.00 0.00 ? 7  LEU A HB2  6 
ATOM   4969 H HB3  . LEU A 1 7  ? 2.498   0.746   -4.073  1.00 0.00 ? 7  LEU A HB3  6 
ATOM   4970 H HG   . LEU A 1 7  ? 5.308   1.790   -4.345  1.00 0.00 ? 7  LEU A HG   6 
ATOM   4971 H HD11 . LEU A 1 7  ? 4.013   1.350   -1.685  1.00 0.00 ? 7  LEU A HD11 6 
ATOM   4972 H HD12 . LEU A 1 7  ? 3.878   2.912   -2.494  1.00 0.00 ? 7  LEU A HD12 6 
ATOM   4973 H HD13 . LEU A 1 7  ? 5.467   2.263   -2.088  1.00 0.00 ? 7  LEU A HD13 6 
ATOM   4974 H HD21 . LEU A 1 7  ? 5.958   -0.276  -3.704  1.00 0.00 ? 7  LEU A HD21 6 
ATOM   4975 H HD22 . LEU A 1 7  ? 4.379   -0.740  -4.339  1.00 0.00 ? 7  LEU A HD22 6 
ATOM   4976 H HD23 . LEU A 1 7  ? 4.594   -0.486  -2.607  1.00 0.00 ? 7  LEU A HD23 6 
ATOM   4977 N N    . ALA A 1 8  ? 2.569   3.089   -7.416  1.00 0.00 ? 8  ALA A N    6 
ATOM   4978 C CA   . ALA A 1 8  ? 1.621   3.943   -8.124  1.00 0.00 ? 8  ALA A CA   6 
ATOM   4979 C C    . ALA A 1 8  ? 0.655   3.119   -8.964  1.00 0.00 ? 8  ALA A C    6 
ATOM   4980 O O    . ALA A 1 8  ? -0.526  3.447   -9.079  1.00 0.00 ? 8  ALA A O    6 
ATOM   4981 C CB   . ALA A 1 8  ? 2.362   4.945   -8.996  1.00 0.00 ? 8  ALA A CB   6 
ATOM   4982 H H    . ALA A 1 8  ? 3.522   3.300   -7.462  1.00 0.00 ? 8  ALA A H    6 
ATOM   4983 H HA   . ALA A 1 8  ? 1.062   4.487   -7.389  1.00 0.00 ? 8  ALA A HA   6 
ATOM   4984 H HB1  . ALA A 1 8  ? 2.388   4.588   -10.014 1.00 0.00 ? 8  ALA A HB1  6 
ATOM   4985 H HB2  . ALA A 1 8  ? 3.372   5.063   -8.630  1.00 0.00 ? 8  ALA A HB2  6 
ATOM   4986 H HB3  . ALA A 1 8  ? 1.854   5.897   -8.961  1.00 0.00 ? 8  ALA A HB3  6 
ATOM   4987 N N    . VAL A 1 9  ? 1.169   2.048   -9.546  1.00 0.00 ? 9  VAL A N    6 
ATOM   4988 C CA   . VAL A 1 9  ? 0.367   1.164   -10.377 1.00 0.00 ? 9  VAL A CA   6 
ATOM   4989 C C    . VAL A 1 9  ? -0.804  0.582   -9.591  1.00 0.00 ? 9  VAL A C    6 
ATOM   4990 O O    . VAL A 1 9  ? -1.827  0.208   -10.164 1.00 0.00 ? 9  VAL A O    6 
ATOM   4991 C CB   . VAL A 1 9  ? 1.214   0.013   -10.956 1.00 0.00 ? 9  VAL A CB   6 
ATOM   4992 C CG1  . VAL A 1 9  ? 1.787   -0.847  -9.839  1.00 0.00 ? 9  VAL A CG1  6 
ATOM   4993 C CG2  . VAL A 1 9  ? 0.389   -0.829  -11.918 1.00 0.00 ? 9  VAL A CG2  6 
ATOM   4994 H H    . VAL A 1 9  ? 2.112   1.848   -9.413  1.00 0.00 ? 9  VAL A H    6 
ATOM   4995 H HA   . VAL A 1 9  ? -0.016  1.747   -11.193 1.00 0.00 ? 9  VAL A HA   6 
ATOM   4996 H HB   . VAL A 1 9  ? 2.038   0.443   -11.506 1.00 0.00 ? 9  VAL A HB   6 
ATOM   4997 H HG11 . VAL A 1 9  ? 2.432   -1.603  -10.262 1.00 0.00 ? 9  VAL A HG11 6 
ATOM   4998 H HG12 . VAL A 1 9  ? 0.980   -1.322  -9.300  1.00 0.00 ? 9  VAL A HG12 6 
ATOM   4999 H HG13 . VAL A 1 9  ? 2.356   -0.226  -9.163  1.00 0.00 ? 9  VAL A HG13 6 
ATOM   5000 H HG21 . VAL A 1 9  ? 0.999   -1.111  -12.763 1.00 0.00 ? 9  VAL A HG21 6 
ATOM   5001 H HG22 . VAL A 1 9  ? -0.460  -0.256  -12.262 1.00 0.00 ? 9  VAL A HG22 6 
ATOM   5002 H HG23 . VAL A 1 9  ? 0.041   -1.718  -11.411 1.00 0.00 ? 9  VAL A HG23 6 
ATOM   5003 N N    . CYS A 1 10 ? -0.642  0.512   -8.276  1.00 0.00 ? 10 CYS A N    6 
ATOM   5004 C CA   . CYS A 1 10 ? -1.678  -0.021  -7.399  1.00 0.00 ? 10 CYS A CA   6 
ATOM   5005 C C    . CYS A 1 10 ? -2.695  1.061   -7.060  1.00 0.00 ? 10 CYS A C    6 
ATOM   5006 O O    . CYS A 1 10 ? -3.894  0.798   -6.962  1.00 0.00 ? 10 CYS A O    6 
ATOM   5007 C CB   . CYS A 1 10 ? -1.051  -0.561  -6.114  1.00 0.00 ? 10 CYS A CB   6 
ATOM   5008 S SG   . CYS A 1 10 ? -2.029  -1.861  -5.293  1.00 0.00 ? 10 CYS A SG   6 
ATOM   5009 H H    . CYS A 1 10 ? 0.197   0.828   -7.884  1.00 0.00 ? 10 CYS A H    6 
ATOM   5010 H HA   . CYS A 1 10 ? -2.178  -0.826  -7.917  1.00 0.00 ? 10 CYS A HA   6 
ATOM   5011 H HB2  . CYS A 1 10 ? -0.080  -0.975  -6.345  1.00 0.00 ? 10 CYS A HB2  6 
ATOM   5012 H HB3  . CYS A 1 10 ? -0.933  0.254   -5.412  1.00 0.00 ? 10 CYS A HB3  6 
ATOM   5013 N N    . ALA A 1 11 ? -2.200  2.281   -6.880  1.00 0.00 ? 11 ALA A N    6 
ATOM   5014 C CA   . ALA A 1 11 ? -3.048  3.421   -6.549  1.00 0.00 ? 11 ALA A CA   6 
ATOM   5015 C C    . ALA A 1 11 ? -4.266  3.496   -7.462  1.00 0.00 ? 11 ALA A C    6 
ATOM   5016 O O    . ALA A 1 11 ? -5.314  4.016   -7.079  1.00 0.00 ? 11 ALA A O    6 
ATOM   5017 C CB   . ALA A 1 11 ? -2.249  4.712   -6.628  1.00 0.00 ? 11 ALA A CB   6 
ATOM   5018 H H    . ALA A 1 11 ? -1.235  2.418   -6.971  1.00 0.00 ? 11 ALA A H    6 
ATOM   5019 H HA   . ALA A 1 11 ? -3.381  3.295   -5.536  1.00 0.00 ? 11 ALA A HA   6 
ATOM   5020 H HB1  . ALA A 1 11 ? -2.550  5.372   -5.828  1.00 0.00 ? 11 ALA A HB1  6 
ATOM   5021 H HB2  . ALA A 1 11 ? -2.433  5.192   -7.579  1.00 0.00 ? 11 ALA A HB2  6 
ATOM   5022 H HB3  . ALA A 1 11 ? -1.196  4.491   -6.535  1.00 0.00 ? 11 ALA A HB3  6 
ATOM   5023 N N    . SER A 1 12 ? -4.115  2.977   -8.672  1.00 0.00 ? 12 SER A N    6 
ATOM   5024 C CA   . SER A 1 12 ? -5.191  2.980   -9.653  1.00 0.00 ? 12 SER A CA   6 
ATOM   5025 C C    . SER A 1 12 ? -6.479  2.407   -9.069  1.00 0.00 ? 12 SER A C    6 
ATOM   5026 O O    . SER A 1 12 ? -7.577  2.784   -9.477  1.00 0.00 ? 12 SER A O    6 
ATOM   5027 C CB   . SER A 1 12 ? -4.782  2.173   -10.885 1.00 0.00 ? 12 SER A CB   6 
ATOM   5028 O OG   . SER A 1 12 ? -3.672  2.764   -11.538 1.00 0.00 ? 12 SER A OG   6 
ATOM   5029 H H    . SER A 1 12 ? -3.255  2.583   -8.913  1.00 0.00 ? 12 SER A H    6 
ATOM   5030 H HA   . SER A 1 12 ? -5.364  4.001   -9.947  1.00 0.00 ? 12 SER A HA   6 
ATOM   5031 H HB2  . SER A 1 12 ? -4.514  1.171   -10.581 1.00 0.00 ? 12 SER A HB2  6 
ATOM   5032 H HB3  . SER A 1 12 ? -5.612  2.129   -11.575 1.00 0.00 ? 12 SER A HB3  6 
ATOM   5033 H HG   . SER A 1 12 ? -3.025  3.040   -10.885 1.00 0.00 ? 12 SER A HG   6 
ATOM   5034 N N    . ALA A 1 13 ? -6.339  1.488   -8.118  1.00 0.00 ? 13 ALA A N    6 
ATOM   5035 C CA   . ALA A 1 13 ? -7.491  0.863   -7.492  1.00 0.00 ? 13 ALA A CA   6 
ATOM   5036 C C    . ALA A 1 13 ? -7.290  0.664   -5.991  1.00 0.00 ? 13 ALA A C    6 
ATOM   5037 O O    . ALA A 1 13 ? -7.955  -0.170  -5.377  1.00 0.00 ? 13 ALA A O    6 
ATOM   5038 C CB   . ALA A 1 13 ? -7.790  -0.468  -8.164  1.00 0.00 ? 13 ALA A CB   6 
ATOM   5039 H H    . ALA A 1 13 ? -5.446  1.224   -7.838  1.00 0.00 ? 13 ALA A H    6 
ATOM   5040 H HA   . ALA A 1 13 ? -8.332  1.511   -7.647  1.00 0.00 ? 13 ALA A HA   6 
ATOM   5041 H HB1  . ALA A 1 13 ? -8.859  -0.600  -8.244  1.00 0.00 ? 13 ALA A HB1  6 
ATOM   5042 H HB2  . ALA A 1 13 ? -7.371  -1.270  -7.575  1.00 0.00 ? 13 ALA A HB2  6 
ATOM   5043 H HB3  . ALA A 1 13 ? -7.351  -0.479  -9.151  1.00 0.00 ? 13 ALA A HB3  6 
ATOM   5044 N N    . ILE A 1 14 ? -6.376  1.429   -5.400  1.00 0.00 ? 14 ILE A N    6 
ATOM   5045 C CA   . ILE A 1 14 ? -6.108  1.318   -3.970  1.00 0.00 ? 14 ILE A CA   6 
ATOM   5046 C C    . ILE A 1 14 ? -7.154  2.073   -3.150  1.00 0.00 ? 14 ILE A C    6 
ATOM   5047 O O    . ILE A 1 14 ? -7.658  1.564   -2.149  1.00 0.00 ? 14 ILE A O    6 
ATOM   5048 C CB   . ILE A 1 14 ? -4.691  1.830   -3.615  1.00 0.00 ? 14 ILE A CB   6 
ATOM   5049 C CG1  . ILE A 1 14 ? -4.195  1.169   -2.326  1.00 0.00 ? 14 ILE A CG1  6 
ATOM   5050 C CG2  . ILE A 1 14 ? -4.668  3.349   -3.483  1.00 0.00 ? 14 ILE A CG2  6 
ATOM   5051 C CD1  . ILE A 1 14 ? -3.167  0.083   -2.561  1.00 0.00 ? 14 ILE A CD1  6 
ATOM   5052 H H    . ILE A 1 14 ? -5.874  2.079   -5.934  1.00 0.00 ? 14 ILE A H    6 
ATOM   5053 H HA   . ILE A 1 14 ? -6.160  0.270   -3.709  1.00 0.00 ? 14 ILE A HA   6 
ATOM   5054 H HB   . ILE A 1 14 ? -4.027  1.559   -4.422  1.00 0.00 ? 14 ILE A HB   6 
ATOM   5055 H HG12 . ILE A 1 14 ? -3.744  1.919   -1.693  1.00 0.00 ? 14 ILE A HG12 6 
ATOM   5056 H HG13 . ILE A 1 14 ? -5.035  0.726   -1.809  1.00 0.00 ? 14 ILE A HG13 6 
ATOM   5057 H HG21 . ILE A 1 14 ? -5.285  3.646   -2.648  1.00 0.00 ? 14 ILE A HG21 6 
ATOM   5058 H HG22 . ILE A 1 14 ? -5.050  3.795   -4.389  1.00 0.00 ? 14 ILE A HG22 6 
ATOM   5059 H HG23 . ILE A 1 14 ? -3.654  3.680   -3.318  1.00 0.00 ? 14 ILE A HG23 6 
ATOM   5060 H HD11 . ILE A 1 14 ? -3.669  -0.862  -2.706  1.00 0.00 ? 14 ILE A HD11 6 
ATOM   5061 H HD12 . ILE A 1 14 ? -2.512  0.016   -1.705  1.00 0.00 ? 14 ILE A HD12 6 
ATOM   5062 H HD13 . ILE A 1 14 ? -2.587  0.321   -3.441  1.00 0.00 ? 14 ILE A HD13 6 
ATOM   5063 N N    . LEU A 1 15 ? -7.472  3.291   -3.580  1.00 0.00 ? 15 LEU A N    6 
ATOM   5064 C CA   . LEU A 1 15 ? -8.454  4.116   -2.885  1.00 0.00 ? 15 LEU A CA   6 
ATOM   5065 C C    . LEU A 1 15 ? -9.876  3.703   -3.254  1.00 0.00 ? 15 LEU A C    6 
ATOM   5066 O O    . LEU A 1 15 ? -10.614 3.175   -2.422  1.00 0.00 ? 15 LEU A O    6 
ATOM   5067 C CB   . LEU A 1 15 ? -8.238  5.595   -3.215  1.00 0.00 ? 15 LEU A CB   6 
ATOM   5068 C CG   . LEU A 1 15 ? -6.805  6.100   -3.021  1.00 0.00 ? 15 LEU A CG   6 
ATOM   5069 C CD1  . LEU A 1 15 ? -6.108  6.262   -4.364  1.00 0.00 ? 15 LEU A CD1  6 
ATOM   5070 C CD2  . LEU A 1 15 ? -6.800  7.416   -2.256  1.00 0.00 ? 15 LEU A CD2  6 
ATOM   5071 H H    . LEU A 1 15 ? -7.035  3.643   -4.383  1.00 0.00 ? 15 LEU A H    6 
ATOM   5072 H HA   . LEU A 1 15 ? -8.316  3.971   -1.824  1.00 0.00 ? 15 LEU A HA   6 
ATOM   5073 H HB2  . LEU A 1 15 ? -8.520  5.757   -4.245  1.00 0.00 ? 15 LEU A HB2  6 
ATOM   5074 H HB3  . LEU A 1 15 ? -8.891  6.181   -2.585  1.00 0.00 ? 15 LEU A HB3  6 
ATOM   5075 H HG   . LEU A 1 15 ? -6.250  5.375   -2.444  1.00 0.00 ? 15 LEU A HG   6 
ATOM   5076 H HD11 . LEU A 1 15 ? -6.506  7.127   -4.874  1.00 0.00 ? 15 LEU A HD11 6 
ATOM   5077 H HD12 . LEU A 1 15 ? -6.276  5.381   -4.965  1.00 0.00 ? 15 LEU A HD12 6 
ATOM   5078 H HD13 . LEU A 1 15 ? -5.048  6.393   -4.206  1.00 0.00 ? 15 LEU A HD13 6 
ATOM   5079 H HD21 . LEU A 1 15 ? -6.851  8.239   -2.954  1.00 0.00 ? 15 LEU A HD21 6 
ATOM   5080 H HD22 . LEU A 1 15 ? -5.891  7.492   -1.677  1.00 0.00 ? 15 LEU A HD22 6 
ATOM   5081 H HD23 . LEU A 1 15 ? -7.653  7.451   -1.594  1.00 0.00 ? 15 LEU A HD23 6 
ATOM   5082 N N    . SER A 1 16 ? -10.252 3.947   -4.505  1.00 0.00 ? 16 SER A N    6 
ATOM   5083 C CA   . SER A 1 16 ? -11.586 3.602   -4.983  1.00 0.00 ? 16 SER A CA   6 
ATOM   5084 C C    . SER A 1 16 ? -11.681 2.116   -5.312  1.00 0.00 ? 16 SER A C    6 
ATOM   5085 O O    . SER A 1 16 ? -12.435 1.377   -4.678  1.00 0.00 ? 16 SER A O    6 
ATOM   5086 C CB   . SER A 1 16 ? -11.938 4.434   -6.218  1.00 0.00 ? 16 SER A CB   6 
ATOM   5087 O OG   . SER A 1 16 ? -11.743 5.816   -5.974  1.00 0.00 ? 16 SER A OG   6 
ATOM   5088 H H    . SER A 1 16 ? -9.619  4.371   -5.121  1.00 0.00 ? 16 SER A H    6 
ATOM   5089 H HA   . SER A 1 16 ? -12.289 3.830   -4.196  1.00 0.00 ? 16 SER A HA   6 
ATOM   5090 H HB2  . SER A 1 16 ? -11.307 4.135   -7.042  1.00 0.00 ? 16 SER A HB2  6 
ATOM   5091 H HB3  . SER A 1 16 ? -12.973 4.268   -6.478  1.00 0.00 ? 16 SER A HB3  6 
ATOM   5092 H HG   . SER A 1 16 ? -10.893 6.087   -6.327  1.00 0.00 ? 16 SER A HG   6 
ATOM   5093 N N    . GLY A 1 17 ? -10.911 1.684   -6.306  1.00 0.00 ? 17 GLY A N    6 
ATOM   5094 C CA   . GLY A 1 17 ? -10.924 0.287   -6.700  1.00 0.00 ? 17 GLY A CA   6 
ATOM   5095 C C    . GLY A 1 17 ? -11.480 0.083   -8.096  1.00 0.00 ? 17 GLY A C    6 
ATOM   5096 O O    . GLY A 1 17 ? -12.348 -0.763  -8.308  1.00 0.00 ? 17 GLY A O    6 
ATOM   5097 H H    . GLY A 1 17 ? -10.330 2.318   -6.774  1.00 0.00 ? 17 GLY A H    6 
ATOM   5098 H HA2  . GLY A 1 17 ? -9.914  -0.094  -6.667  1.00 0.00 ? 17 GLY A HA2  6 
ATOM   5099 H HA3  . GLY A 1 17 ? -11.529 -0.268  -5.999  1.00 0.00 ? 17 GLY A HA3  6 
ATOM   5100 N N    . ALA A 1 18 ? -10.980 0.862   -9.051  1.00 0.00 ? 18 ALA A N    6 
ATOM   5101 C CA   . ALA A 1 18 ? -11.435 0.764   -10.433 1.00 0.00 ? 18 ALA A CA   6 
ATOM   5102 C C    . ALA A 1 18 ? -11.119 -0.603  -11.021 1.00 0.00 ? 18 ALA A C    6 
ATOM   5103 O O    . ALA A 1 18 ? -11.939 -1.200  -11.719 1.00 0.00 ? 18 ALA A O    6 
ATOM   5104 C CB   . ALA A 1 18 ? -10.804 1.862   -11.275 1.00 0.00 ? 18 ALA A CB   6 
ATOM   5105 H H    . ALA A 1 18 ? -10.291 1.519   -8.820  1.00 0.00 ? 18 ALA A H    6 
ATOM   5106 H HA   . ALA A 1 18 ? -12.498 0.903   -10.439 1.00 0.00 ? 18 ALA A HA   6 
ATOM   5107 H HB1  . ALA A 1 18 ? -9.728  1.778   -11.229 1.00 0.00 ? 18 ALA A HB1  6 
ATOM   5108 H HB2  . ALA A 1 18 ? -11.107 2.826   -10.895 1.00 0.00 ? 18 ALA A HB2  6 
ATOM   5109 H HB3  . ALA A 1 18 ? -11.130 1.761   -12.300 1.00 0.00 ? 18 ALA A HB3  6 
ATOM   5110 N N    . LYS A 1 19 ? -9.924  -1.087  -10.732 1.00 0.00 ? 19 LYS A N    6 
ATOM   5111 C CA   . LYS A 1 19 ? -9.478  -2.386  -11.225 1.00 0.00 ? 19 LYS A CA   6 
ATOM   5112 C C    . LYS A 1 19 ? -8.073  -2.708  -10.721 1.00 0.00 ? 19 LYS A C    6 
ATOM   5113 O O    . LYS A 1 19 ? -7.081  -2.295  -11.323 1.00 0.00 ? 19 LYS A O    6 
ATOM   5114 C CB   . LYS A 1 19 ? -9.500  -2.409  -12.755 1.00 0.00 ? 19 LYS A CB   6 
ATOM   5115 C CG   . LYS A 1 19 ? -8.719  -1.271  -13.393 1.00 0.00 ? 19 LYS A CG   6 
ATOM   5116 C CD   . LYS A 1 19 ? -9.643  -0.224  -13.996 1.00 0.00 ? 19 LYS A CD   6 
ATOM   5117 C CE   . LYS A 1 19 ? -10.555 -0.826  -15.053 1.00 0.00 ? 19 LYS A CE   6 
ATOM   5118 N NZ   . LYS A 1 19 ? -11.086 0.208   -15.983 1.00 0.00 ? 19 LYS A NZ   6 
ATOM   5119 H H    . LYS A 1 19 ? -9.326  -0.556  -10.171 1.00 0.00 ? 19 LYS A H    6 
ATOM   5120 H HA   . LYS A 1 19 ? -10.163 -3.134  -10.854 1.00 0.00 ? 19 LYS A HA   6 
ATOM   5121 H HB2  . LYS A 1 19 ? -9.075  -3.343  -13.094 1.00 0.00 ? 19 LYS A HB2  6 
ATOM   5122 H HB3  . LYS A 1 19 ? -10.525 -2.348  -13.089 1.00 0.00 ? 19 LYS A HB3  6 
ATOM   5123 H HG2  . LYS A 1 19 ? -8.105  -0.801  -12.639 1.00 0.00 ? 19 LYS A HG2  6 
ATOM   5124 H HG3  . LYS A 1 19 ? -8.088  -1.673  -14.173 1.00 0.00 ? 19 LYS A HG3  6 
ATOM   5125 H HD2  . LYS A 1 19 ? -10.250 0.201   -13.212 1.00 0.00 ? 19 LYS A HD2  6 
ATOM   5126 H HD3  . LYS A 1 19 ? -9.043  0.552   -14.450 1.00 0.00 ? 19 LYS A HD3  6 
ATOM   5127 H HE2  . LYS A 1 19 ? -9.995  -1.554  -15.621 1.00 0.00 ? 19 LYS A HE2  6 
ATOM   5128 H HE3  . LYS A 1 19 ? -11.382 -1.314  -14.560 1.00 0.00 ? 19 LYS A HE3  6 
ATOM   5129 H HZ1  . LYS A 1 19 ? -12.032 0.513   -15.676 1.00 0.00 ? 19 LYS A HZ1  6 
ATOM   5130 H HZ2  . LYS A 1 19 ? -11.155 -0.178  -16.946 1.00 0.00 ? 19 LYS A HZ2  6 
ATOM   5131 H HZ3  . LYS A 1 19 ? -10.454 1.035   -15.998 1.00 0.00 ? 19 LYS A HZ3  6 
ATOM   5132 N N    . PRO A 1 20 ? -7.965  -3.452  -9.606  1.00 0.00 ? 20 PRO A N    6 
ATOM   5133 C CA   . PRO A 1 20 ? -6.668  -3.824  -9.031  1.00 0.00 ? 20 PRO A CA   6 
ATOM   5134 C C    . PRO A 1 20 ? -5.890  -4.778  -9.931  1.00 0.00 ? 20 PRO A C    6 
ATOM   5135 O O    . PRO A 1 20 ? -6.239  -4.971  -11.096 1.00 0.00 ? 20 PRO A O    6 
ATOM   5136 C CB   . PRO A 1 20 ? -7.041  -4.513  -7.715  1.00 0.00 ? 20 PRO A CB   6 
ATOM   5137 C CG   . PRO A 1 20 ? -8.436  -4.994  -7.917  1.00 0.00 ? 20 PRO A CG   6 
ATOM   5138 C CD   . PRO A 1 20 ? -9.092  -3.990  -8.822  1.00 0.00 ? 20 PRO A CD   6 
ATOM   5139 H HA   . PRO A 1 20 ? -6.063  -2.952  -8.826  1.00 0.00 ? 20 PRO A HA   6 
ATOM   5140 H HB2  . PRO A 1 20 ? -6.362  -5.333  -7.531  1.00 0.00 ? 20 PRO A HB2  6 
ATOM   5141 H HB3  . PRO A 1 20 ? -6.983  -3.802  -6.905  1.00 0.00 ? 20 PRO A HB3  6 
ATOM   5142 H HG2  . PRO A 1 20 ? -8.424  -5.968  -8.384  1.00 0.00 ? 20 PRO A HG2  6 
ATOM   5143 H HG3  . PRO A 1 20 ? -8.950  -5.037  -6.969  1.00 0.00 ? 20 PRO A HG3  6 
ATOM   5144 H HD2  . PRO A 1 20 ? -9.813  -4.475  -9.463  1.00 0.00 ? 20 PRO A HD2  6 
ATOM   5145 H HD3  . PRO A 1 20 ? -9.564  -3.211  -8.242  1.00 0.00 ? 20 PRO A HD3  6 
ATOM   5146 N N    . SER A 1 21 ? -4.835  -5.371  -9.384  1.00 0.00 ? 21 SER A N    6 
ATOM   5147 C CA   . SER A 1 21 ? -4.008  -6.305  -10.136 1.00 0.00 ? 21 SER A CA   6 
ATOM   5148 C C    . SER A 1 21 ? -2.985  -6.977  -9.226  1.00 0.00 ? 21 SER A C    6 
ATOM   5149 O O    . SER A 1 21 ? -2.463  -6.358  -8.298  1.00 0.00 ? 21 SER A O    6 
ATOM   5150 C CB   . SER A 1 21 ? -3.296  -5.582  -11.280 1.00 0.00 ? 21 SER A CB   6 
ATOM   5151 O OG   . SER A 1 21 ? -3.036  -6.464  -12.358 1.00 0.00 ? 21 SER A OG   6 
ATOM   5152 H H    . SER A 1 21 ? -4.608  -5.177  -8.452  1.00 0.00 ? 21 SER A H    6 
ATOM   5153 H HA   . SER A 1 21 ? -4.657  -7.062  -10.547 1.00 0.00 ? 21 SER A HA   6 
ATOM   5154 H HB2  . SER A 1 21 ? -3.918  -4.774  -11.635 1.00 0.00 ? 21 SER A HB2  6 
ATOM   5155 H HB3  . SER A 1 21 ? -2.358  -5.183  -10.923 1.00 0.00 ? 21 SER A HB3  6 
ATOM   5156 H HG   . SER A 1 21 ? -3.851  -6.632  -12.838 1.00 0.00 ? 21 SER A HG   6 
ATOM   5157 N N    . GLY A 1 22 ? -2.704  -8.246  -9.498  1.00 0.00 ? 22 GLY A N    6 
ATOM   5158 C CA   . GLY A 1 22 ? -1.745  -8.983  -8.695  1.00 0.00 ? 22 GLY A CA   6 
ATOM   5159 C C    . GLY A 1 22 ? -0.377  -8.330  -8.676  1.00 0.00 ? 22 GLY A C    6 
ATOM   5160 O O    . GLY A 1 22 ? 0.368   -8.463  -7.705  1.00 0.00 ? 22 GLY A O    6 
ATOM   5161 H H    . GLY A 1 22 ? -3.152  -8.687  -10.249 1.00 0.00 ? 22 GLY A H    6 
ATOM   5162 H HA2  . GLY A 1 22 ? -2.115  -9.047  -7.682  1.00 0.00 ? 22 GLY A HA2  6 
ATOM   5163 H HA3  . GLY A 1 22 ? -1.649  -9.981  -9.095  1.00 0.00 ? 22 GLY A HA3  6 
ATOM   5164 N N    . GLU A 1 23 ? -0.043  -7.624  -9.753  1.00 0.00 ? 23 GLU A N    6 
ATOM   5165 C CA   . GLU A 1 23 ? 1.239   -6.951  -9.868  1.00 0.00 ? 23 GLU A CA   6 
ATOM   5166 C C    . GLU A 1 23 ? 1.550   -6.140  -8.612  1.00 0.00 ? 23 GLU A C    6 
ATOM   5167 O O    . GLU A 1 23 ? 2.711   -5.985  -8.232  1.00 0.00 ? 23 GLU A O    6 
ATOM   5168 C CB   . GLU A 1 23 ? 1.221   -6.036  -11.089 1.00 0.00 ? 23 GLU A CB   6 
ATOM   5169 C CG   . GLU A 1 23 ? 2.595   -5.783  -11.663 1.00 0.00 ? 23 GLU A CG   6 
ATOM   5170 C CD   . GLU A 1 23 ? 2.822   -4.330  -12.031 1.00 0.00 ? 23 GLU A CD   6 
ATOM   5171 O OE1  . GLU A 1 23 ? 1.977   -3.761  -12.753 1.00 0.00 ? 23 GLU A OE1  6 
ATOM   5172 O OE2  . GLU A 1 23 ? 3.846   -3.761  -11.597 1.00 0.00 ? 23 GLU A OE2  6 
ATOM   5173 H H    . GLU A 1 23 ? -0.672  -7.556  -10.496 1.00 0.00 ? 23 GLU A H    6 
ATOM   5174 H HA   . GLU A 1 23 ? 2.002   -7.702  -10.001 1.00 0.00 ? 23 GLU A HA   6 
ATOM   5175 H HB2  . GLU A 1 23 ? 0.609   -6.490  -11.857 1.00 0.00 ? 23 GLU A HB2  6 
ATOM   5176 H HB3  . GLU A 1 23 ? 0.789   -5.084  -10.807 1.00 0.00 ? 23 GLU A HB3  6 
ATOM   5177 H HG2  . GLU A 1 23 ? 3.331   -6.076  -10.932 1.00 0.00 ? 23 GLU A HG2  6 
ATOM   5178 H HG3  . GLU A 1 23 ? 2.708   -6.388  -12.549 1.00 0.00 ? 23 GLU A HG3  6 
ATOM   5179 N N    . CYS A 1 24 ? 0.504   -5.624  -7.976  1.00 0.00 ? 24 CYS A N    6 
ATOM   5180 C CA   . CYS A 1 24 ? 0.658   -4.826  -6.766  1.00 0.00 ? 24 CYS A CA   6 
ATOM   5181 C C    . CYS A 1 24 ? 1.466   -5.571  -5.709  1.00 0.00 ? 24 CYS A C    6 
ATOM   5182 O O    . CYS A 1 24 ? 2.091   -4.957  -4.844  1.00 0.00 ? 24 CYS A O    6 
ATOM   5183 C CB   . CYS A 1 24 ? -0.714  -4.443  -6.204  1.00 0.00 ? 24 CYS A CB   6 
ATOM   5184 S SG   . CYS A 1 24 ? -0.648  -3.270  -4.811  1.00 0.00 ? 24 CYS A SG   6 
ATOM   5185 H H    . CYS A 1 24 ? -0.393  -5.779  -8.330  1.00 0.00 ? 24 CYS A H    6 
ATOM   5186 H HA   . CYS A 1 24 ? 1.187   -3.932  -7.036  1.00 0.00 ? 24 CYS A HA   6 
ATOM   5187 H HB2  . CYS A 1 24 ? -1.301  -3.987  -6.988  1.00 0.00 ? 24 CYS A HB2  6 
ATOM   5188 H HB3  . CYS A 1 24 ? -1.215  -5.336  -5.860  1.00 0.00 ? 24 CYS A HB3  6 
ATOM   5189 N N    . CYS A 1 25 ? 1.451   -6.896  -5.787  1.00 0.00 ? 25 CYS A N    6 
ATOM   5190 C CA   . CYS A 1 25 ? 2.186   -7.725  -4.839  1.00 0.00 ? 25 CYS A CA   6 
ATOM   5191 C C    . CYS A 1 25 ? 3.678   -7.707  -5.152  1.00 0.00 ? 25 CYS A C    6 
ATOM   5192 O O    . CYS A 1 25 ? 4.505   -7.464  -4.273  1.00 0.00 ? 25 CYS A O    6 
ATOM   5193 C CB   . CYS A 1 25 ? 1.664   -9.163  -4.871  1.00 0.00 ? 25 CYS A CB   6 
ATOM   5194 S SG   . CYS A 1 25 ? 0.448   -9.542  -3.569  1.00 0.00 ? 25 CYS A SG   6 
ATOM   5195 H H    . CYS A 1 25 ? 0.937   -7.325  -6.500  1.00 0.00 ? 25 CYS A H    6 
ATOM   5196 H HA   . CYS A 1 25 ? 2.032   -7.316  -3.851  1.00 0.00 ? 25 CYS A HA   6 
ATOM   5197 H HB2  . CYS A 1 25 ? 1.191   -9.345  -5.824  1.00 0.00 ? 25 CYS A HB2  6 
ATOM   5198 H HB3  . CYS A 1 25 ? 2.495   -9.843  -4.753  1.00 0.00 ? 25 CYS A HB3  6 
ATOM   5199 N N    . GLY A 1 26 ? 4.013   -7.965  -6.411  1.00 0.00 ? 26 GLY A N    6 
ATOM   5200 C CA   . GLY A 1 26 ? 5.403   -7.975  -6.822  1.00 0.00 ? 26 GLY A CA   6 
ATOM   5201 C C    . GLY A 1 26 ? 6.068   -6.624  -6.652  1.00 0.00 ? 26 GLY A C    6 
ATOM   5202 O O    . GLY A 1 26 ? 7.263   -6.547  -6.366  1.00 0.00 ? 26 GLY A O    6 
ATOM   5203 H H    . GLY A 1 26 ? 3.309   -8.151  -7.067  1.00 0.00 ? 26 GLY A H    6 
ATOM   5204 H HA2  . GLY A 1 26 ? 5.936   -8.704  -6.231  1.00 0.00 ? 26 GLY A HA2  6 
ATOM   5205 H HA3  . GLY A 1 26 ? 5.457   -8.262  -7.862  1.00 0.00 ? 26 GLY A HA3  6 
ATOM   5206 N N    . ASN A 1 27 ? 5.297   -5.556  -6.831  1.00 0.00 ? 27 ASN A N    6 
ATOM   5207 C CA   . ASN A 1 27 ? 5.821   -4.210  -6.698  1.00 0.00 ? 27 ASN A CA   6 
ATOM   5208 C C    . ASN A 1 27 ? 6.226   -3.926  -5.265  1.00 0.00 ? 27 ASN A C    6 
ATOM   5209 O O    . ASN A 1 27 ? 7.401   -3.717  -4.965  1.00 0.00 ? 27 ASN A O    6 
ATOM   5210 C CB   . ASN A 1 27 ? 4.787   -3.187  -7.163  1.00 0.00 ? 27 ASN A CB   6 
ATOM   5211 C CG   . ASN A 1 27 ? 4.486   -3.301  -8.644  1.00 0.00 ? 27 ASN A CG   6 
ATOM   5212 O OD1  . ASN A 1 27 ? 3.400   -3.725  -9.038  1.00 0.00 ? 27 ASN A OD1  6 
ATOM   5213 N ND2  . ASN A 1 27 ? 5.451   -2.922  -9.473  1.00 0.00 ? 27 ASN A ND2  6 
ATOM   5214 H H    . ASN A 1 27 ? 4.358   -5.674  -7.059  1.00 0.00 ? 27 ASN A H    6 
ATOM   5215 H HA   . ASN A 1 27 ? 6.685   -4.140  -7.316  1.00 0.00 ? 27 ASN A HA   6 
ATOM   5216 H HB2  . ASN A 1 27 ? 3.868   -3.338  -6.616  1.00 0.00 ? 27 ASN A HB2  6 
ATOM   5217 H HB3  . ASN A 1 27 ? 5.160   -2.194  -6.964  1.00 0.00 ? 27 ASN A HB3  6 
ATOM   5218 H HD21 . ASN A 1 27 ? 6.291   -2.593  -9.089  1.00 0.00 ? 27 ASN A HD21 6 
ATOM   5219 H HD22 . ASN A 1 27 ? 5.285   -2.989  -10.436 1.00 0.00 ? 27 ASN A HD22 6 
ATOM   5220 N N    . LEU A 1 28 ? 5.241   -3.923  -4.386  1.00 0.00 ? 28 LEU A N    6 
ATOM   5221 C CA   . LEU A 1 28 ? 5.480   -3.668  -2.973  1.00 0.00 ? 28 LEU A CA   6 
ATOM   5222 C C    . LEU A 1 28 ? 6.599   -4.562  -2.451  1.00 0.00 ? 28 LEU A C    6 
ATOM   5223 O O    . LEU A 1 28 ? 7.317   -4.202  -1.517  1.00 0.00 ? 28 LEU A O    6 
ATOM   5224 C CB   . LEU A 1 28 ? 4.200   -3.880  -2.159  1.00 0.00 ? 28 LEU A CB   6 
ATOM   5225 C CG   . LEU A 1 28 ? 3.925   -5.326  -1.754  1.00 0.00 ? 28 LEU A CG   6 
ATOM   5226 C CD1  . LEU A 1 28 ? 4.570   -5.637  -0.411  1.00 0.00 ? 28 LEU A CD1  6 
ATOM   5227 C CD2  . LEU A 1 28 ? 2.429   -5.594  -1.708  1.00 0.00 ? 28 LEU A CD2  6 
ATOM   5228 H H    . LEU A 1 28 ? 4.334   -4.099  -4.698  1.00 0.00 ? 28 LEU A H    6 
ATOM   5229 H HA   . LEU A 1 28 ? 5.787   -2.647  -2.880  1.00 0.00 ? 28 LEU A HA   6 
ATOM   5230 H HB2  . LEU A 1 28 ? 4.267   -3.282  -1.261  1.00 0.00 ? 28 LEU A HB2  6 
ATOM   5231 H HB3  . LEU A 1 28 ? 3.364   -3.528  -2.744  1.00 0.00 ? 28 LEU A HB3  6 
ATOM   5232 H HG   . LEU A 1 28 ? 4.362   -5.979  -2.491  1.00 0.00 ? 28 LEU A HG   6 
ATOM   5233 H HD11 . LEU A 1 28 ? 4.007   -6.412  0.087   1.00 0.00 ? 28 LEU A HD11 6 
ATOM   5234 H HD12 . LEU A 1 28 ? 4.575   -4.747  0.200   1.00 0.00 ? 28 LEU A HD12 6 
ATOM   5235 H HD13 . LEU A 1 28 ? 5.585   -5.973  -0.568  1.00 0.00 ? 28 LEU A HD13 6 
ATOM   5236 H HD21 . LEU A 1 28 ? 2.043   -5.658  -2.715  1.00 0.00 ? 28 LEU A HD21 6 
ATOM   5237 H HD22 . LEU A 1 28 ? 1.935   -4.789  -1.184  1.00 0.00 ? 28 LEU A HD22 6 
ATOM   5238 H HD23 . LEU A 1 28 ? 2.245   -6.525  -1.192  1.00 0.00 ? 28 LEU A HD23 6 
ATOM   5239 N N    . ARG A 1 29 ? 6.740   -5.729  -3.069  1.00 0.00 ? 29 ARG A N    6 
ATOM   5240 C CA   . ARG A 1 29 ? 7.765   -6.682  -2.685  1.00 0.00 ? 29 ARG A CA   6 
ATOM   5241 C C    . ARG A 1 29 ? 9.138   -6.040  -2.727  1.00 0.00 ? 29 ARG A C    6 
ATOM   5242 O O    . ARG A 1 29 ? 9.956   -6.229  -1.826  1.00 0.00 ? 29 ARG A O    6 
ATOM   5243 C CB   . ARG A 1 29 ? 7.725   -7.906  -3.602  1.00 0.00 ? 29 ARG A CB   6 
ATOM   5244 C CG   . ARG A 1 29 ? 7.513   -9.208  -2.853  1.00 0.00 ? 29 ARG A CG   6 
ATOM   5245 C CD   . ARG A 1 29 ? 6.309   -9.975  -3.375  1.00 0.00 ? 29 ARG A CD   6 
ATOM   5246 N NE   . ARG A 1 29 ? 5.461   -10.449 -2.287  1.00 0.00 ? 29 ARG A NE   6 
ATOM   5247 C CZ   . ARG A 1 29 ? 4.609   -11.467 -2.398  1.00 0.00 ? 29 ARG A CZ   6 
ATOM   5248 N NH1  . ARG A 1 29 ? 4.474   -12.106 -3.554  1.00 0.00 ? 29 ARG A NH1  6 
ATOM   5249 N NH2  . ARG A 1 29 ? 3.889   -11.846 -1.352  1.00 0.00 ? 29 ARG A NH2  6 
ATOM   5250 H H    . ARG A 1 29 ? 6.139   -5.953  -3.802  1.00 0.00 ? 29 ARG A H    6 
ATOM   5251 H HA   . ARG A 1 29 ? 7.561   -6.986  -1.681  1.00 0.00 ? 29 ARG A HA   6 
ATOM   5252 H HB2  . ARG A 1 29 ? 6.918   -7.784  -4.310  1.00 0.00 ? 29 ARG A HB2  6 
ATOM   5253 H HB3  . ARG A 1 29 ? 8.658   -7.973  -4.141  1.00 0.00 ? 29 ARG A HB3  6 
ATOM   5254 H HG2  . ARG A 1 29 ? 8.393   -9.823  -2.962  1.00 0.00 ? 29 ARG A HG2  6 
ATOM   5255 H HG3  . ARG A 1 29 ? 7.357   -8.983  -1.810  1.00 0.00 ? 29 ARG A HG3  6 
ATOM   5256 H HD2  . ARG A 1 29 ? 5.730   -9.324  -4.014  1.00 0.00 ? 29 ARG A HD2  6 
ATOM   5257 H HD3  . ARG A 1 29 ? 6.658   -10.823 -3.945  1.00 0.00 ? 29 ARG A HD3  6 
ATOM   5258 H HE   . ARG A 1 29 ? 5.534   -9.988  -1.424  1.00 0.00 ? 29 ARG A HE   6 
ATOM   5259 H HH11 . ARG A 1 29 ? 5.012   -11.825 -4.348  1.00 0.00 ? 29 ARG A HH11 6 
ATOM   5260 H HH12 . ARG A 1 29 ? 3.833   -12.870 -3.629  1.00 0.00 ? 29 ARG A HH12 6 
ATOM   5261 H HH21 . ARG A 1 29 ? 3.985   -11.368 -0.479  1.00 0.00 ? 29 ARG A HH21 6 
ATOM   5262 H HH22 . ARG A 1 29 ? 3.248   -12.609 -1.435  1.00 0.00 ? 29 ARG A HH22 6 
ATOM   5263 N N    . ALA A 1 30 ? 9.376   -5.265  -3.771  1.00 0.00 ? 30 ALA A N    6 
ATOM   5264 C CA   . ALA A 1 30 ? 10.642  -4.573  -3.927  1.00 0.00 ? 30 ALA A CA   6 
ATOM   5265 C C    . ALA A 1 30 ? 10.941  -3.729  -2.694  1.00 0.00 ? 30 ALA A C    6 
ATOM   5266 O O    . ALA A 1 30 ? 12.096  -3.425  -2.397  1.00 0.00 ? 30 ALA A O    6 
ATOM   5267 C CB   . ALA A 1 30 ? 10.625  -3.706  -5.177  1.00 0.00 ? 30 ALA A CB   6 
ATOM   5268 H H    . ALA A 1 30 ? 8.679   -5.149  -4.444  1.00 0.00 ? 30 ALA A H    6 
ATOM   5269 H HA   . ALA A 1 30 ? 11.410  -5.317  -4.040  1.00 0.00 ? 30 ALA A HA   6 
ATOM   5270 H HB1  . ALA A 1 30 ? 11.636  -3.558  -5.527  1.00 0.00 ? 30 ALA A HB1  6 
ATOM   5271 H HB2  . ALA A 1 30 ? 10.181  -2.749  -4.946  1.00 0.00 ? 30 ALA A HB2  6 
ATOM   5272 H HB3  . ALA A 1 30 ? 10.047  -4.195  -5.947  1.00 0.00 ? 30 ALA A HB3  6 
ATOM   5273 N N    . GLN A 1 31 ? 9.882   -3.364  -1.976  1.00 0.00 ? 31 GLN A N    6 
ATOM   5274 C CA   . GLN A 1 31 ? 10.012  -2.564  -0.765  1.00 0.00 ? 31 GLN A CA   6 
ATOM   5275 C C    . GLN A 1 31 ? 10.397  -3.443  0.417   1.00 0.00 ? 31 GLN A C    6 
ATOM   5276 O O    . GLN A 1 31 ? 11.527  -3.389  0.903   1.00 0.00 ? 31 GLN A O    6 
ATOM   5277 C CB   . GLN A 1 31 ? 8.709   -1.813  -0.467  1.00 0.00 ? 31 GLN A CB   6 
ATOM   5278 C CG   . GLN A 1 31 ? 7.935   -1.400  -1.709  1.00 0.00 ? 31 GLN A CG   6 
ATOM   5279 C CD   . GLN A 1 31 ? 7.600   0.077   -1.724  1.00 0.00 ? 31 GLN A CD   6 
ATOM   5280 O OE1  . GLN A 1 31 ? 6.559   0.495   -1.216  1.00 0.00 ? 31 GLN A OE1  6 
ATOM   5281 N NE2  . GLN A 1 31 ? 8.484   0.877   -2.307  1.00 0.00 ? 31 GLN A NE2  6 
ATOM   5282 H H    . GLN A 1 31 ? 8.989   -3.652  -2.263  1.00 0.00 ? 31 GLN A H    6 
ATOM   5283 H HA   . GLN A 1 31 ? 10.800  -1.846  -0.925  1.00 0.00 ? 31 GLN A HA   6 
ATOM   5284 H HB2  . GLN A 1 31 ? 8.069   -2.444  0.130   1.00 0.00 ? 31 GLN A HB2  6 
ATOM   5285 H HB3  . GLN A 1 31 ? 8.943   -0.920  0.094   1.00 0.00 ? 31 GLN A HB3  6 
ATOM   5286 H HG2  . GLN A 1 31 ? 8.529   -1.626  -2.582  1.00 0.00 ? 31 GLN A HG2  6 
ATOM   5287 H HG3  . GLN A 1 31 ? 7.016   -1.962  -1.744  1.00 0.00 ? 31 GLN A HG3  6 
ATOM   5288 H HE21 . GLN A 1 31 ? 9.294   0.471   -2.692  1.00 0.00 ? 31 GLN A HE21 6 
ATOM   5289 H HE22 . GLN A 1 31 ? 8.291   1.840   -2.330  1.00 0.00 ? 31 GLN A HE22 6 
ATOM   5290 N N    . GLN A 1 32 ? 9.447   -4.256  0.877   1.00 0.00 ? 32 GLN A N    6 
ATOM   5291 C CA   . GLN A 1 32 ? 9.676   -5.153  2.001   1.00 0.00 ? 32 GLN A CA   6 
ATOM   5292 C C    . GLN A 1 32 ? 10.320  -4.431  3.181   1.00 0.00 ? 32 GLN A C    6 
ATOM   5293 O O    . GLN A 1 32 ? 10.906  -5.059  4.063   1.00 0.00 ? 32 GLN A O    6 
ATOM   5294 C CB   . GLN A 1 32 ? 10.541  -6.315  1.553   1.00 0.00 ? 32 GLN A CB   6 
ATOM   5295 C CG   . GLN A 1 32 ? 10.117  -7.637  2.160   1.00 0.00 ? 32 GLN A CG   6 
ATOM   5296 C CD   . GLN A 1 32 ? 9.696   -8.653  1.118   1.00 0.00 ? 32 GLN A CD   6 
ATOM   5297 O OE1  . GLN A 1 32 ? 10.437  -9.586  0.807   1.00 0.00 ? 32 GLN A OE1  6 
ATOM   5298 N NE2  . GLN A 1 32 ? 8.500   -8.473  0.572   1.00 0.00 ? 32 GLN A NE2  6 
ATOM   5299 H H    . GLN A 1 32 ? 8.572   -4.257  0.445   1.00 0.00 ? 32 GLN A H    6 
ATOM   5300 H HA   . GLN A 1 32 ? 8.721   -5.539  2.316   1.00 0.00 ? 32 GLN A HA   6 
ATOM   5301 H HB2  . GLN A 1 32 ? 10.475  -6.393  0.478   1.00 0.00 ? 32 GLN A HB2  6 
ATOM   5302 H HB3  . GLN A 1 32 ? 11.562  -6.117  1.834   1.00 0.00 ? 32 GLN A HB3  6 
ATOM   5303 H HG2  . GLN A 1 32 ? 10.942  -8.042  2.726   1.00 0.00 ? 32 GLN A HG2  6 
ATOM   5304 H HG3  . GLN A 1 32 ? 9.282   -7.455  2.820   1.00 0.00 ? 32 GLN A HG3  6 
ATOM   5305 H HE21 . GLN A 1 32 ? 7.966   -7.707  0.868   1.00 0.00 ? 32 GLN A HE21 6 
ATOM   5306 H HE22 . GLN A 1 32 ? 8.198   -9.115  -0.103  1.00 0.00 ? 32 GLN A HE22 6 
ATOM   5307 N N    . GLY A 1 33 ? 10.199  -3.111  3.191   1.00 0.00 ? 33 GLY A N    6 
ATOM   5308 C CA   . GLY A 1 33 ? 10.764  -2.318  4.265   1.00 0.00 ? 33 GLY A CA   6 
ATOM   5309 C C    . GLY A 1 33 ? 10.439  -0.845  4.120   1.00 0.00 ? 33 GLY A C    6 
ATOM   5310 O O    . GLY A 1 33 ? 11.188  0.011   4.591   1.00 0.00 ? 33 GLY A O    6 
ATOM   5311 H H    . GLY A 1 33 ? 9.719   -2.671  2.461   1.00 0.00 ? 33 GLY A H    6 
ATOM   5312 H HA2  . GLY A 1 33 ? 10.370  -2.672  5.206   1.00 0.00 ? 33 GLY A HA2  6 
ATOM   5313 H HA3  . GLY A 1 33 ? 11.836  -2.441  4.264   1.00 0.00 ? 33 GLY A HA3  6 
ATOM   5314 N N    . CYS A 1 34 ? 9.325   -0.547  3.455   1.00 0.00 ? 34 CYS A N    6 
ATOM   5315 C CA   . CYS A 1 34 ? 8.912   0.819   3.238   1.00 0.00 ? 34 CYS A CA   6 
ATOM   5316 C C    . CYS A 1 34 ? 7.427   1.010   3.508   1.00 0.00 ? 34 CYS A C    6 
ATOM   5317 O O    . CYS A 1 34 ? 7.009   2.038   4.041   1.00 0.00 ? 34 CYS A O    6 
ATOM   5318 C CB   . CYS A 1 34 ? 9.233   1.229   1.814   1.00 0.00 ? 34 CYS A CB   6 
ATOM   5319 S SG   . CYS A 1 34 ? 9.477   3.019   1.572   1.00 0.00 ? 34 CYS A SG   6 
ATOM   5320 H H    . CYS A 1 34 ? 8.782   -1.257  3.097   1.00 0.00 ? 34 CYS A H    6 
ATOM   5321 H HA   . CYS A 1 34 ? 9.460   1.420   3.900   1.00 0.00 ? 34 CYS A HA   6 
ATOM   5322 H HB2  . CYS A 1 34 ? 10.128  0.719   1.497   1.00 0.00 ? 34 CYS A HB2  6 
ATOM   5323 H HB3  . CYS A 1 34 ? 8.417   0.931   1.192   1.00 0.00 ? 34 CYS A HB3  6 
ATOM   5324 N N    . PHE A 1 35 ? 6.634   0.020   3.128   1.00 0.00 ? 35 PHE A N    6 
ATOM   5325 C CA   . PHE A 1 35 ? 5.190   0.087   3.319   1.00 0.00 ? 35 PHE A CA   6 
ATOM   5326 C C    . PHE A 1 35 ? 4.833   0.327   4.776   1.00 0.00 ? 35 PHE A C    6 
ATOM   5327 O O    . PHE A 1 35 ? 4.085   1.245   5.112   1.00 0.00 ? 35 PHE A O    6 
ATOM   5328 C CB   . PHE A 1 35 ? 4.498   -1.193  2.835   1.00 0.00 ? 35 PHE A CB   6 
ATOM   5329 C CG   . PHE A 1 35 ? 5.234   -2.480  3.109   1.00 0.00 ? 35 PHE A CG   6 
ATOM   5330 C CD1  . PHE A 1 35 ? 5.116   -3.106  4.340   1.00 0.00 ? 35 PHE A CD1  6 
ATOM   5331 C CD2  . PHE A 1 35 ? 6.014   -3.083  2.130   1.00 0.00 ? 35 PHE A CD2  6 
ATOM   5332 C CE1  . PHE A 1 35 ? 5.759   -4.301  4.593   1.00 0.00 ? 35 PHE A CE1  6 
ATOM   5333 C CE2  . PHE A 1 35 ? 6.660   -4.276  2.382   1.00 0.00 ? 35 PHE A CE2  6 
ATOM   5334 C CZ   . PHE A 1 35 ? 6.533   -4.887  3.613   1.00 0.00 ? 35 PHE A CZ   6 
ATOM   5335 H H    . PHE A 1 35 ? 7.029   -0.766  2.703   1.00 0.00 ? 35 PHE A H    6 
ATOM   5336 H HA   . PHE A 1 35 ? 4.826   0.915   2.742   1.00 0.00 ? 35 PHE A HA   6 
ATOM   5337 H HB2  . PHE A 1 35 ? 3.549   -1.266  3.336   1.00 0.00 ? 35 PHE A HB2  6 
ATOM   5338 H HB3  . PHE A 1 35 ? 4.333   -1.122  1.772   1.00 0.00 ? 35 PHE A HB3  6 
ATOM   5339 H HD1  . PHE A 1 35 ? 4.513   -2.649  5.110   1.00 0.00 ? 35 PHE A HD1  6 
ATOM   5340 H HD2  . PHE A 1 35 ? 6.121   -2.613  1.164   1.00 0.00 ? 35 PHE A HD2  6 
ATOM   5341 H HE1  . PHE A 1 35 ? 5.657   -4.777  5.557   1.00 0.00 ? 35 PHE A HE1  6 
ATOM   5342 H HE2  . PHE A 1 35 ? 7.259   -4.734  1.613   1.00 0.00 ? 35 PHE A HE2  6 
ATOM   5343 H HZ   . PHE A 1 35 ? 7.037   -5.821  3.808   1.00 0.00 ? 35 PHE A HZ   6 
ATOM   5344 N N    . CYS A 1 36 ? 5.373   -0.518  5.624   1.00 0.00 ? 36 CYS A N    6 
ATOM   5345 C CA   . CYS A 1 36 ? 5.133   -0.446  7.061   1.00 0.00 ? 36 CYS A CA   6 
ATOM   5346 C C    . CYS A 1 36 ? 5.494   0.926   7.615   1.00 0.00 ? 36 CYS A C    6 
ATOM   5347 O O    . CYS A 1 36 ? 4.712   1.539   8.341   1.00 0.00 ? 36 CYS A O    6 
ATOM   5348 C CB   . CYS A 1 36 ? 5.938   -1.526  7.784   1.00 0.00 ? 36 CYS A CB   6 
ATOM   5349 S SG   . CYS A 1 36 ? 5.150   -2.155  9.301   1.00 0.00 ? 36 CYS A SG   6 
ATOM   5350 H H    . CYS A 1 36 ? 5.948   -1.218  5.269   1.00 0.00 ? 36 CYS A H    6 
ATOM   5351 H HA   . CYS A 1 36 ? 4.082   -0.623  7.228   1.00 0.00 ? 36 CYS A HA   6 
ATOM   5352 H HB2  . CYS A 1 36 ? 6.082   -2.364  7.119   1.00 0.00 ? 36 CYS A HB2  6 
ATOM   5353 H HB3  . CYS A 1 36 ? 6.902   -1.122  8.058   1.00 0.00 ? 36 CYS A HB3  6 
ATOM   5354 N N    . GLN A 1 37 ? 6.688   1.399   7.277   1.00 0.00 ? 37 GLN A N    6 
ATOM   5355 C CA   . GLN A 1 37 ? 7.155   2.692   7.749   1.00 0.00 ? 37 GLN A CA   6 
ATOM   5356 C C    . GLN A 1 37 ? 6.341   3.829   7.140   1.00 0.00 ? 37 GLN A C    6 
ATOM   5357 O O    . GLN A 1 37 ? 6.224   4.906   7.725   1.00 0.00 ? 37 GLN A O    6 
ATOM   5358 C CB   . GLN A 1 37 ? 8.643   2.876   7.440   1.00 0.00 ? 37 GLN A CB   6 
ATOM   5359 C CG   . GLN A 1 37 ? 8.945   3.099   5.967   1.00 0.00 ? 37 GLN A CG   6 
ATOM   5360 C CD   . GLN A 1 37 ? 10.384  3.517   5.725   1.00 0.00 ? 37 GLN A CD   6 
ATOM   5361 O OE1  . GLN A 1 37 ? 11.026  4.102   6.597   1.00 0.00 ? 37 GLN A OE1  6 
ATOM   5362 N NE2  . GLN A 1 37 ? 10.898  3.218   4.537   1.00 0.00 ? 37 GLN A NE2  6 
ATOM   5363 H H    . GLN A 1 37 ? 7.267   0.864   6.705   1.00 0.00 ? 37 GLN A H    6 
ATOM   5364 H HA   . GLN A 1 37 ? 7.018   2.705   8.811   1.00 0.00 ? 37 GLN A HA   6 
ATOM   5365 H HB2  . GLN A 1 37 ? 9.010   3.729   7.992   1.00 0.00 ? 37 GLN A HB2  6 
ATOM   5366 H HB3  . GLN A 1 37 ? 9.176   1.994   7.764   1.00 0.00 ? 37 GLN A HB3  6 
ATOM   5367 H HG2  . GLN A 1 37 ? 8.758   2.181   5.434   1.00 0.00 ? 37 GLN A HG2  6 
ATOM   5368 H HG3  . GLN A 1 37 ? 8.292   3.873   5.591   1.00 0.00 ? 37 GLN A HG3  6 
ATOM   5369 H HE21 . GLN A 1 37 ? 10.329  2.752   3.891   1.00 0.00 ? 37 GLN A HE21 6 
ATOM   5370 H HE22 . GLN A 1 37 ? 11.825  3.477   4.356   1.00 0.00 ? 37 GLN A HE22 6 
ATOM   5371 N N    . TYR A 1 38 ? 5.777   3.580   5.966   1.00 0.00 ? 38 TYR A N    6 
ATOM   5372 C CA   . TYR A 1 38 ? 4.968   4.579   5.277   1.00 0.00 ? 38 TYR A CA   6 
ATOM   5373 C C    . TYR A 1 38 ? 3.768   4.983   6.129   1.00 0.00 ? 38 TYR A C    6 
ATOM   5374 O O    . TYR A 1 38 ? 3.261   6.099   6.019   1.00 0.00 ? 38 TYR A O    6 
ATOM   5375 C CB   . TYR A 1 38 ? 4.492   4.036   3.927   1.00 0.00 ? 38 TYR A CB   6 
ATOM   5376 C CG   . TYR A 1 38 ? 5.125   4.722   2.738   1.00 0.00 ? 38 TYR A CG   6 
ATOM   5377 C CD1  . TYR A 1 38 ? 4.930   6.078   2.508   1.00 0.00 ? 38 TYR A CD1  6 
ATOM   5378 C CD2  . TYR A 1 38 ? 5.917   4.012   1.844   1.00 0.00 ? 38 TYR A CD2  6 
ATOM   5379 C CE1  . TYR A 1 38 ? 5.506   6.707   1.420   1.00 0.00 ? 38 TYR A CE1  6 
ATOM   5380 C CE2  . TYR A 1 38 ? 6.496   4.634   0.754   1.00 0.00 ? 38 TYR A CE2  6 
ATOM   5381 C CZ   . TYR A 1 38 ? 6.288   5.981   0.547   1.00 0.00 ? 38 TYR A CZ   6 
ATOM   5382 O OH   . TYR A 1 38 ? 6.863   6.603   -0.537  1.00 0.00 ? 38 TYR A OH   6 
ATOM   5383 H H    . TYR A 1 38 ? 5.904   2.702   5.554   1.00 0.00 ? 38 TYR A H    6 
ATOM   5384 H HA   . TYR A 1 38 ? 5.585   5.449   5.109   1.00 0.00 ? 38 TYR A HA   6 
ATOM   5385 H HB2  . TYR A 1 38 ? 4.730   2.985   3.867   1.00 0.00 ? 38 TYR A HB2  6 
ATOM   5386 H HB3  . TYR A 1 38 ? 3.421   4.162   3.852   1.00 0.00 ? 38 TYR A HB3  6 
ATOM   5387 H HD1  . TYR A 1 38 ? 4.318   6.645   3.194   1.00 0.00 ? 38 TYR A HD1  6 
ATOM   5388 H HD2  . TYR A 1 38 ? 6.078   2.957   2.009   1.00 0.00 ? 38 TYR A HD2  6 
ATOM   5389 H HE1  . TYR A 1 38 ? 5.343   7.762   1.258   1.00 0.00 ? 38 TYR A HE1  6 
ATOM   5390 H HE2  . TYR A 1 38 ? 7.108   4.064   0.070   1.00 0.00 ? 38 TYR A HE2  6 
ATOM   5391 H HH   . TYR A 1 38 ? 6.821   6.022   -1.300  1.00 0.00 ? 38 TYR A HH   6 
ATOM   5392 N N    . ALA A 1 39 ? 3.318   4.062   6.977   1.00 0.00 ? 39 ALA A N    6 
ATOM   5393 C CA   . ALA A 1 39 ? 2.177   4.309   7.847   1.00 0.00 ? 39 ALA A CA   6 
ATOM   5394 C C    . ALA A 1 39 ? 2.384   5.547   8.716   1.00 0.00 ? 39 ALA A C    6 
ATOM   5395 O O    . ALA A 1 39 ? 1.424   6.119   9.233   1.00 0.00 ? 39 ALA A O    6 
ATOM   5396 C CB   . ALA A 1 39 ? 1.909   3.091   8.718   1.00 0.00 ? 39 ALA A CB   6 
ATOM   5397 H H    . ALA A 1 39 ? 3.760   3.191   7.014   1.00 0.00 ? 39 ALA A H    6 
ATOM   5398 H HA   . ALA A 1 39 ? 1.319   4.464   7.220   1.00 0.00 ? 39 ALA A HA   6 
ATOM   5399 H HB1  . ALA A 1 39 ? 0.849   3.010   8.907   1.00 0.00 ? 39 ALA A HB1  6 
ATOM   5400 H HB2  . ALA A 1 39 ? 2.434   3.198   9.656   1.00 0.00 ? 39 ALA A HB2  6 
ATOM   5401 H HB3  . ALA A 1 39 ? 2.255   2.203   8.212   1.00 0.00 ? 39 ALA A HB3  6 
ATOM   5402 N N    . LYS A 1 40 ? 3.639   5.953   8.879   1.00 0.00 ? 40 LYS A N    6 
ATOM   5403 C CA   . LYS A 1 40 ? 3.965   7.120   9.690   1.00 0.00 ? 40 LYS A CA   6 
ATOM   5404 C C    . LYS A 1 40 ? 3.994   8.389   8.845   1.00 0.00 ? 40 LYS A C    6 
ATOM   5405 O O    . LYS A 1 40 ? 3.821   9.494   9.359   1.00 0.00 ? 40 LYS A O    6 
ATOM   5406 C CB   . LYS A 1 40 ? 5.316   6.922   10.380  1.00 0.00 ? 40 LYS A CB   6 
ATOM   5407 C CG   . LYS A 1 40 ? 5.448   7.682   11.690  1.00 0.00 ? 40 LYS A CG   6 
ATOM   5408 C CD   . LYS A 1 40 ? 5.622   6.737   12.870  1.00 0.00 ? 40 LYS A CD   6 
ATOM   5409 C CE   . LYS A 1 40 ? 4.419   5.823   13.033  1.00 0.00 ? 40 LYS A CE   6 
ATOM   5410 N NZ   . LYS A 1 40 ? 3.418   6.386   13.981  1.00 0.00 ? 40 LYS A NZ   6 
ATOM   5411 H H    . LYS A 1 40 ? 4.361   5.456   8.445   1.00 0.00 ? 40 LYS A H    6 
ATOM   5412 H HA   . LYS A 1 40 ? 3.200   7.223   10.442  1.00 0.00 ? 40 LYS A HA   6 
ATOM   5413 H HB2  . LYS A 1 40 ? 5.453   5.870   10.581  1.00 0.00 ? 40 LYS A HB2  6 
ATOM   5414 H HB3  . LYS A 1 40 ? 6.099   7.256   9.715   1.00 0.00 ? 40 LYS A HB3  6 
ATOM   5415 H HG2  . LYS A 1 40 ? 6.309   8.331   11.634  1.00 0.00 ? 40 LYS A HG2  6 
ATOM   5416 H HG3  . LYS A 1 40 ? 4.558   8.274   11.843  1.00 0.00 ? 40 LYS A HG3  6 
ATOM   5417 H HD2  . LYS A 1 40 ? 6.501   6.132   12.708  1.00 0.00 ? 40 LYS A HD2  6 
ATOM   5418 H HD3  . LYS A 1 40 ? 5.745   7.321   13.770  1.00 0.00 ? 40 LYS A HD3  6 
ATOM   5419 H HE2  . LYS A 1 40 ? 3.951   5.688   12.069  1.00 0.00 ? 40 LYS A HE2  6 
ATOM   5420 H HE3  . LYS A 1 40 ? 4.757   4.867   13.405  1.00 0.00 ? 40 LYS A HE3  6 
ATOM   5421 H HZ1  . LYS A 1 40 ? 2.700   6.931   13.461  1.00 0.00 ? 40 LYS A HZ1  6 
ATOM   5422 H HZ2  . LYS A 1 40 ? 3.887   7.015   14.664  1.00 0.00 ? 40 LYS A HZ2  6 
ATOM   5423 H HZ3  . LYS A 1 40 ? 2.947   5.618   14.501  1.00 0.00 ? 40 LYS A HZ3  6 
ATOM   5424 N N    . ASP A 1 41 ? 4.215   8.221   7.548   1.00 0.00 ? 41 ASP A N    6 
ATOM   5425 C CA   . ASP A 1 41 ? 4.270   9.349   6.625   1.00 0.00 ? 41 ASP A CA   6 
ATOM   5426 C C    . ASP A 1 41 ? 2.896   10.009  6.481   1.00 0.00 ? 41 ASP A C    6 
ATOM   5427 O O    . ASP A 1 41 ? 1.969   9.412   5.933   1.00 0.00 ? 41 ASP A O    6 
ATOM   5428 C CB   . ASP A 1 41 ? 4.773   8.879   5.258   1.00 0.00 ? 41 ASP A CB   6 
ATOM   5429 C CG   . ASP A 1 41 ? 4.788   9.991   4.227   1.00 0.00 ? 41 ASP A CG   6 
ATOM   5430 O OD1  . ASP A 1 41 ? 5.381   11.054  4.508   1.00 0.00 ? 41 ASP A OD1  6 
ATOM   5431 O OD2  . ASP A 1 41 ? 4.207   9.800   3.138   1.00 0.00 ? 41 ASP A OD2  6 
ATOM   5432 H H    . ASP A 1 41 ? 4.345   7.316   7.202   1.00 0.00 ? 41 ASP A H    6 
ATOM   5433 H HA   . ASP A 1 41 ? 4.966   10.069  7.025   1.00 0.00 ? 41 ASP A HA   6 
ATOM   5434 H HB2  . ASP A 1 41 ? 5.782   8.501   5.365   1.00 0.00 ? 41 ASP A HB2  6 
ATOM   5435 H HB3  . ASP A 1 41 ? 4.130   8.086   4.899   1.00 0.00 ? 41 ASP A HB3  6 
ATOM   5436 N N    . PRO A 1 42 ? 2.745   11.252  6.975   1.00 0.00 ? 42 PRO A N    6 
ATOM   5437 C CA   . PRO A 1 42 ? 1.484   11.987  6.904   1.00 0.00 ? 42 PRO A CA   6 
ATOM   5438 C C    . PRO A 1 42 ? 1.358   12.807  5.623   1.00 0.00 ? 42 PRO A C    6 
ATOM   5439 O O    . PRO A 1 42 ? 2.000   13.846  5.475   1.00 0.00 ? 42 PRO A O    6 
ATOM   5440 C CB   . PRO A 1 42 ? 1.589   12.908  8.110   1.00 0.00 ? 42 PRO A CB   6 
ATOM   5441 C CG   . PRO A 1 42 ? 3.037   13.257  8.166   1.00 0.00 ? 42 PRO A CG   6 
ATOM   5442 C CD   . PRO A 1 42 ? 3.788   12.048  7.653   1.00 0.00 ? 42 PRO A CD   6 
ATOM   5443 H HA   . PRO A 1 42 ? 0.630   11.337  7.010   1.00 0.00 ? 42 PRO A HA   6 
ATOM   5444 H HB2  . PRO A 1 42 ? 0.973   13.783  7.957   1.00 0.00 ? 42 PRO A HB2  6 
ATOM   5445 H HB3  . PRO A 1 42 ? 1.274   12.384  9.000   1.00 0.00 ? 42 PRO A HB3  6 
ATOM   5446 H HG2  . PRO A 1 42 ? 3.229   14.110  7.533   1.00 0.00 ? 42 PRO A HG2  6 
ATOM   5447 H HG3  . PRO A 1 42 ? 3.324   13.471  9.184   1.00 0.00 ? 42 PRO A HG3  6 
ATOM   5448 H HD2  . PRO A 1 42 ? 4.555   12.350  6.955   1.00 0.00 ? 42 PRO A HD2  6 
ATOM   5449 H HD3  . PRO A 1 42 ? 4.220   11.496  8.475   1.00 0.00 ? 42 PRO A HD3  6 
ATOM   5450 N N    . THR A 1 43 ? 0.526   12.336  4.703   1.00 0.00 ? 43 THR A N    6 
ATOM   5451 C CA   . THR A 1 43 ? 0.315   13.027  3.439   1.00 0.00 ? 43 THR A CA   6 
ATOM   5452 C C    . THR A 1 43 ? -0.845  12.410  2.664   1.00 0.00 ? 43 THR A C    6 
ATOM   5453 O O    . THR A 1 43 ? -1.697  13.122  2.133   1.00 0.00 ? 43 THR A O    6 
ATOM   5454 C CB   . THR A 1 43 ? 1.589   12.990  2.594   1.00 0.00 ? 43 THR A CB   6 
ATOM   5455 O OG1  . THR A 1 43 ? 2.602   12.240  3.239   1.00 0.00 ? 43 THR A OG1  6 
ATOM   5456 C CG2  . THR A 1 43 ? 2.151   14.364  2.299   1.00 0.00 ? 43 THR A CG2  6 
ATOM   5457 H H    . THR A 1 43 ? 0.043   11.506  4.878   1.00 0.00 ? 43 THR A H    6 
ATOM   5458 H HA   . THR A 1 43 ? 0.075   14.053  3.661   1.00 0.00 ? 43 THR A HA   6 
ATOM   5459 H HB   . THR A 1 43 ? 1.364   12.516  1.652   1.00 0.00 ? 43 THR A HB   6 
ATOM   5460 H HG1  . THR A 1 43 ? 2.267   11.367  3.454   1.00 0.00 ? 43 THR A HG1  6 
ATOM   5461 H HG21 . THR A 1 43 ? 3.147   14.265  1.894   1.00 0.00 ? 43 THR A HG21 6 
ATOM   5462 H HG22 . THR A 1 43 ? 2.189   14.940  3.212   1.00 0.00 ? 43 THR A HG22 6 
ATOM   5463 H HG23 . THR A 1 43 ? 1.519   14.866  1.582   1.00 0.00 ? 43 THR A HG23 6 
ATOM   5464 N N    . TYR A 1 44 ? -0.870  11.083  2.601   1.00 0.00 ? 44 TYR A N    6 
ATOM   5465 C CA   . TYR A 1 44 ? -1.924  10.372  1.888   1.00 0.00 ? 44 TYR A CA   6 
ATOM   5466 C C    . TYR A 1 44 ? -3.223  10.374  2.686   1.00 0.00 ? 44 TYR A C    6 
ATOM   5467 O O    . TYR A 1 44 ? -4.236  10.913  2.239   1.00 0.00 ? 44 TYR A O    6 
ATOM   5468 C CB   . TYR A 1 44 ? -1.491  8.934   1.598   1.00 0.00 ? 44 TYR A CB   6 
ATOM   5469 C CG   . TYR A 1 44 ? -0.344  8.833   0.618   1.00 0.00 ? 44 TYR A CG   6 
ATOM   5470 C CD1  . TYR A 1 44 ? 0.954   9.140   1.005   1.00 0.00 ? 44 TYR A CD1  6 
ATOM   5471 C CD2  . TYR A 1 44 ? -0.560  8.431   -0.694  1.00 0.00 ? 44 TYR A CD2  6 
ATOM   5472 C CE1  . TYR A 1 44 ? 2.005   9.050   0.112   1.00 0.00 ? 44 TYR A CE1  6 
ATOM   5473 C CE2  . TYR A 1 44 ? 0.486   8.338   -1.593  1.00 0.00 ? 44 TYR A CE2  6 
ATOM   5474 C CZ   . TYR A 1 44 ? 1.766   8.648   -1.185  1.00 0.00 ? 44 TYR A CZ   6 
ATOM   5475 O OH   . TYR A 1 44 ? 2.809   8.557   -2.077  1.00 0.00 ? 44 TYR A OH   6 
ATOM   5476 H H    . TYR A 1 44 ? -0.161  10.570  3.043   1.00 0.00 ? 44 TYR A H    6 
ATOM   5477 H HA   . TYR A 1 44 ? -2.091  10.883  0.951   1.00 0.00 ? 44 TYR A HA   6 
ATOM   5478 H HB2  . TYR A 1 44 ? -1.181  8.466   2.520   1.00 0.00 ? 44 TYR A HB2  6 
ATOM   5479 H HB3  . TYR A 1 44 ? -2.329  8.390   1.187   1.00 0.00 ? 44 TYR A HB3  6 
ATOM   5480 H HD1  . TYR A 1 44 ? 1.138   9.454   2.022   1.00 0.00 ? 44 TYR A HD1  6 
ATOM   5481 H HD2  . TYR A 1 44 ? -1.564  8.189   -1.011  1.00 0.00 ? 44 TYR A HD2  6 
ATOM   5482 H HE1  . TYR A 1 44 ? 3.007   9.293   0.432   1.00 0.00 ? 44 TYR A HE1  6 
ATOM   5483 H HE2  . TYR A 1 44 ? 0.298   8.024   -2.609  1.00 0.00 ? 44 TYR A HE2  6 
ATOM   5484 H HH   . TYR A 1 44 ? 3.584   8.210   -1.629  1.00 0.00 ? 44 TYR A HH   6 
ATOM   5485 N N    . GLY A 1 45 ? -3.189  9.767   3.868   1.00 0.00 ? 45 GLY A N    6 
ATOM   5486 C CA   . GLY A 1 45 ? -4.373  9.709   4.706   1.00 0.00 ? 45 GLY A CA   6 
ATOM   5487 C C    . GLY A 1 45 ? -5.545  9.050   4.005   1.00 0.00 ? 45 GLY A C    6 
ATOM   5488 O O    . GLY A 1 45 ? -6.701  9.381   4.267   1.00 0.00 ? 45 GLY A O    6 
ATOM   5489 H H    . GLY A 1 45 ? -2.355  9.353   4.172   1.00 0.00 ? 45 GLY A H    6 
ATOM   5490 H HA2  . GLY A 1 45 ? -4.141  9.151   5.601   1.00 0.00 ? 45 GLY A HA2  6 
ATOM   5491 H HA3  . GLY A 1 45 ? -4.653  10.715  4.984   1.00 0.00 ? 45 GLY A HA3  6 
ATOM   5492 N N    . GLN A 1 46 ? -5.243  8.115   3.110   1.00 0.00 ? 46 GLN A N    6 
ATOM   5493 C CA   . GLN A 1 46 ? -6.273  7.407   2.365   1.00 0.00 ? 46 GLN A CA   6 
ATOM   5494 C C    . GLN A 1 46 ? -5.708  6.148   1.712   1.00 0.00 ? 46 GLN A C    6 
ATOM   5495 O O    . GLN A 1 46 ? -6.355  5.101   1.699   1.00 0.00 ? 46 GLN A O    6 
ATOM   5496 C CB   . GLN A 1 46 ? -6.877  8.326   1.303   1.00 0.00 ? 46 GLN A CB   6 
ATOM   5497 C CG   . GLN A 1 46 ? -8.386  8.475   1.414   1.00 0.00 ? 46 GLN A CG   6 
ATOM   5498 C CD   . GLN A 1 46 ? -8.883  9.801   0.874   1.00 0.00 ? 46 GLN A CD   6 
ATOM   5499 O OE1  . GLN A 1 46 ? -8.252  10.840  1.070   1.00 0.00 ? 46 GLN A OE1  6 
ATOM   5500 N NE2  . GLN A 1 46 ? -10.020 9.773   0.189   1.00 0.00 ? 46 GLN A NE2  6 
ATOM   5501 H H    . GLN A 1 46 ? -4.306  7.899   2.946   1.00 0.00 ? 46 GLN A H    6 
ATOM   5502 H HA   . GLN A 1 46 ? -7.042  7.122   3.062   1.00 0.00 ? 46 GLN A HA   6 
ATOM   5503 H HB2  . GLN A 1 46 ? -6.432  9.306   1.400   1.00 0.00 ? 46 GLN A HB2  6 
ATOM   5504 H HB3  . GLN A 1 46 ? -6.646  7.931   0.325   1.00 0.00 ? 46 GLN A HB3  6 
ATOM   5505 H HG2  . GLN A 1 46 ? -8.855  7.678   0.857   1.00 0.00 ? 46 GLN A HG2  6 
ATOM   5506 H HG3  . GLN A 1 46 ? -8.666  8.399   2.455   1.00 0.00 ? 46 GLN A HG3  6 
ATOM   5507 H HE21 . GLN A 1 46 ? -10.470 8.905   0.073   1.00 0.00 ? 46 GLN A HE21 6 
ATOM   5508 H HE22 . GLN A 1 46 ? -10.365 10.620  -0.173  1.00 0.00 ? 46 GLN A HE22 6 
ATOM   5509 N N    . TYR A 1 47 ? -4.498  6.258   1.171   1.00 0.00 ? 47 TYR A N    6 
ATOM   5510 C CA   . TYR A 1 47 ? -3.846  5.131   0.518   1.00 0.00 ? 47 TYR A CA   6 
ATOM   5511 C C    . TYR A 1 47 ? -3.668  3.969   1.487   1.00 0.00 ? 47 TYR A C    6 
ATOM   5512 O O    . TYR A 1 47 ? -4.083  2.844   1.209   1.00 0.00 ? 47 TYR A O    6 
ATOM   5513 C CB   . TYR A 1 47 ? -2.492  5.553   -0.030  1.00 0.00 ? 47 TYR A CB   6 
ATOM   5514 C CG   . TYR A 1 47 ? -2.011  4.713   -1.192  1.00 0.00 ? 47 TYR A CG   6 
ATOM   5515 C CD1  . TYR A 1 47 ? -1.810  3.346   -1.049  1.00 0.00 ? 47 TYR A CD1  6 
ATOM   5516 C CD2  . TYR A 1 47 ? -1.754  5.289   -2.430  1.00 0.00 ? 47 TYR A CD2  6 
ATOM   5517 C CE1  . TYR A 1 47 ? -1.366  2.576   -2.108  1.00 0.00 ? 47 TYR A CE1  6 
ATOM   5518 C CE2  . TYR A 1 47 ? -1.312  4.526   -3.493  1.00 0.00 ? 47 TYR A CE2  6 
ATOM   5519 C CZ   . TYR A 1 47 ? -1.119  3.170   -3.327  1.00 0.00 ? 47 TYR A CZ   6 
ATOM   5520 O OH   . TYR A 1 47 ? -0.677  2.407   -4.383  1.00 0.00 ? 47 TYR A OH   6 
ATOM   5521 H H    . TYR A 1 47 ? -4.032  7.117   1.215   1.00 0.00 ? 47 TYR A H    6 
ATOM   5522 H HA   . TYR A 1 47 ? -4.462  4.813   -0.297  1.00 0.00 ? 47 TYR A HA   6 
ATOM   5523 H HB2  . TYR A 1 47 ? -2.546  6.581   -0.362  1.00 0.00 ? 47 TYR A HB2  6 
ATOM   5524 H HB3  . TYR A 1 47 ? -1.770  5.469   0.757   1.00 0.00 ? 47 TYR A HB3  6 
ATOM   5525 H HD1  . TYR A 1 47 ? -2.005  2.883   -0.093  1.00 0.00 ? 47 TYR A HD1  6 
ATOM   5526 H HD2  . TYR A 1 47 ? -1.906  6.351   -2.557  1.00 0.00 ? 47 TYR A HD2  6 
ATOM   5527 H HE1  . TYR A 1 47 ? -1.215  1.515   -1.977  1.00 0.00 ? 47 TYR A HE1  6 
ATOM   5528 H HE2  . TYR A 1 47 ? -1.118  4.992   -4.447  1.00 0.00 ? 47 TYR A HE2  6 
ATOM   5529 H HH   . TYR A 1 47 ? 0.199   2.067   -4.188  1.00 0.00 ? 47 TYR A HH   6 
ATOM   5530 N N    . ILE A 1 48 ? -3.042  4.250   2.624   1.00 0.00 ? 48 ILE A N    6 
ATOM   5531 C CA   . ILE A 1 48 ? -2.801  3.232   3.635   1.00 0.00 ? 48 ILE A CA   6 
ATOM   5532 C C    . ILE A 1 48 ? -4.079  2.884   4.392   1.00 0.00 ? 48 ILE A C    6 
ATOM   5533 O O    . ILE A 1 48 ? -4.402  1.710   4.571   1.00 0.00 ? 48 ILE A O    6 
ATOM   5534 C CB   . ILE A 1 48 ? -1.722  3.677   4.641   1.00 0.00 ? 48 ILE A CB   6 
ATOM   5535 C CG1  . ILE A 1 48 ? -0.458  4.118   3.898   1.00 0.00 ? 48 ILE A CG1  6 
ATOM   5536 C CG2  . ILE A 1 48 ? -1.409  2.551   5.619   1.00 0.00 ? 48 ILE A CG2  6 
ATOM   5537 C CD1  . ILE A 1 48 ? 0.723   4.385   4.808   1.00 0.00 ? 48 ILE A CD1  6 
ATOM   5538 H H    . ILE A 1 48 ? -2.732  5.163   2.785   1.00 0.00 ? 48 ILE A H    6 
ATOM   5539 H HA   . ILE A 1 48 ? -2.445  2.349   3.129   1.00 0.00 ? 48 ILE A HA   6 
ATOM   5540 H HB   . ILE A 1 48 ? -2.110  4.512   5.205   1.00 0.00 ? 48 ILE A HB   6 
ATOM   5541 H HG12 . ILE A 1 48 ? -0.170  3.345   3.203   1.00 0.00 ? 48 ILE A HG12 6 
ATOM   5542 H HG13 . ILE A 1 48 ? -0.668  5.027   3.352   1.00 0.00 ? 48 ILE A HG13 6 
ATOM   5543 H HG21 . ILE A 1 48 ? -2.166  1.785   5.542   1.00 0.00 ? 48 ILE A HG21 6 
ATOM   5544 H HG22 . ILE A 1 48 ? -1.393  2.942   6.626   1.00 0.00 ? 48 ILE A HG22 6 
ATOM   5545 H HG23 . ILE A 1 48 ? -0.443  2.127   5.383   1.00 0.00 ? 48 ILE A HG23 6 
ATOM   5546 H HD11 . ILE A 1 48 ? 0.450   5.125   5.545   1.00 0.00 ? 48 ILE A HD11 6 
ATOM   5547 H HD12 . ILE A 1 48 ? 1.554   4.749   4.222   1.00 0.00 ? 48 ILE A HD12 6 
ATOM   5548 H HD13 . ILE A 1 48 ? 1.007   3.469   5.306   1.00 0.00 ? 48 ILE A HD13 6 
ATOM   5549 N N    . ARG A 1 49 ? -4.804  3.907   4.838   1.00 0.00 ? 49 ARG A N    6 
ATOM   5550 C CA   . ARG A 1 49 ? -6.045  3.694   5.579   1.00 0.00 ? 49 ARG A CA   6 
ATOM   5551 C C    . ARG A 1 49 ? -7.219  3.400   4.651   1.00 0.00 ? 49 ARG A C    6 
ATOM   5552 O O    . ARG A 1 49 ? -8.370  3.685   4.979   1.00 0.00 ? 49 ARG A O    6 
ATOM   5553 C CB   . ARG A 1 49 ? -6.363  4.907   6.456   1.00 0.00 ? 49 ARG A CB   6 
ATOM   5554 C CG   . ARG A 1 49 ? -5.155  5.462   7.194   1.00 0.00 ? 49 ARG A CG   6 
ATOM   5555 C CD   . ARG A 1 49 ? -5.530  6.654   8.060   1.00 0.00 ? 49 ARG A CD   6 
ATOM   5556 N NE   . ARG A 1 49 ? -6.041  7.768   7.265   1.00 0.00 ? 49 ARG A NE   6 
ATOM   5557 C CZ   . ARG A 1 49 ? -6.117  9.022   7.707   1.00 0.00 ? 49 ARG A CZ   6 
ATOM   5558 N NH1  . ARG A 1 49 ? -5.717  9.325   8.936   1.00 0.00 ? 49 ARG A NH1  6 
ATOM   5559 N NH2  . ARG A 1 49 ? -6.594  9.975   6.918   1.00 0.00 ? 49 ARG A NH2  6 
ATOM   5560 H H    . ARG A 1 49 ? -4.497  4.822   4.668   1.00 0.00 ? 49 ARG A H    6 
ATOM   5561 H HA   . ARG A 1 49 ? -5.896  2.836   6.209   1.00 0.00 ? 49 ARG A HA   6 
ATOM   5562 H HB2  . ARG A 1 49 ? -6.768  5.691   5.834   1.00 0.00 ? 49 ARG A HB2  6 
ATOM   5563 H HB3  . ARG A 1 49 ? -7.104  4.622   7.188   1.00 0.00 ? 49 ARG A HB3  6 
ATOM   5564 H HG2  . ARG A 1 49 ? -4.743  4.688   7.824   1.00 0.00 ? 49 ARG A HG2  6 
ATOM   5565 H HG3  . ARG A 1 49 ? -4.414  5.771   6.471   1.00 0.00 ? 49 ARG A HG3  6 
ATOM   5566 H HD2  . ARG A 1 49 ? -6.291  6.347   8.762   1.00 0.00 ? 49 ARG A HD2  6 
ATOM   5567 H HD3  . ARG A 1 49 ? -4.654  6.981   8.600   1.00 0.00 ? 49 ARG A HD3  6 
ATOM   5568 H HE   . ARG A 1 49 ? -6.343  7.573   6.354   1.00 0.00 ? 49 ARG A HE   6 
ATOM   5569 H HH11 . ARG A 1 49 ? -5.357  8.611   9.537   1.00 0.00 ? 49 ARG A HH11 6 
ATOM   5570 H HH12 . ARG A 1 49 ? -5.776  10.269  9.262   1.00 0.00 ? 49 ARG A HH12 6 
ATOM   5571 H HH21 . ARG A 1 49 ? -6.896  9.751   5.991   1.00 0.00 ? 49 ARG A HH21 6 
ATOM   5572 H HH22 . ARG A 1 49 ? -6.651  10.916  7.250   1.00 0.00 ? 49 ARG A HH22 6 
ATOM   5573 N N    . SER A 1 50 ? -6.921  2.817   3.501   1.00 0.00 ? 50 SER A N    6 
ATOM   5574 C CA   . SER A 1 50 ? -7.943  2.467   2.529   1.00 0.00 ? 50 SER A CA   6 
ATOM   5575 C C    . SER A 1 50 ? -8.620  1.154   2.913   1.00 0.00 ? 50 SER A C    6 
ATOM   5576 O O    . SER A 1 50 ? -8.007  0.298   3.550   1.00 0.00 ? 50 SER A O    6 
ATOM   5577 C CB   . SER A 1 50 ? -7.322  2.354   1.148   1.00 0.00 ? 50 SER A CB   6 
ATOM   5578 O OG   . SER A 1 50 ? -8.216  2.796   0.141   1.00 0.00 ? 50 SER A OG   6 
ATOM   5579 H H    . SER A 1 50 ? -5.992  2.603   3.304   1.00 0.00 ? 50 SER A H    6 
ATOM   5580 H HA   . SER A 1 50 ? -8.677  3.247   2.516   1.00 0.00 ? 50 SER A HA   6 
ATOM   5581 H HB2  . SER A 1 50 ? -6.423  2.956   1.106   1.00 0.00 ? 50 SER A HB2  6 
ATOM   5582 H HB3  . SER A 1 50 ? -7.077  1.328   0.969   1.00 0.00 ? 50 SER A HB3  6 
ATOM   5583 H HG   . SER A 1 50 ? -8.608  3.631   0.406   1.00 0.00 ? 50 SER A HG   6 
ATOM   5584 N N    . PRO A 1 51 ? -9.894  0.970   2.528   1.00 0.00 ? 51 PRO A N    6 
ATOM   5585 C CA   . PRO A 1 51 ? -10.635 -0.254  2.840   1.00 0.00 ? 51 PRO A CA   6 
ATOM   5586 C C    . PRO A 1 51 ? -10.174 -1.437  1.996   1.00 0.00 ? 51 PRO A C    6 
ATOM   5587 O O    . PRO A 1 51 ? -10.025 -2.551  2.498   1.00 0.00 ? 51 PRO A O    6 
ATOM   5588 C CB   . PRO A 1 51 ? -12.080 0.115   2.505   1.00 0.00 ? 51 PRO A CB   6 
ATOM   5589 C CG   . PRO A 1 51 ? -11.967 1.165   1.454   1.00 0.00 ? 51 PRO A CG   6 
ATOM   5590 C CD   . PRO A 1 51 ? -10.709 1.933   1.762   1.00 0.00 ? 51 PRO A CD   6 
ATOM   5591 H HA   . PRO A 1 51 ? -10.557 -0.507  3.887   1.00 0.00 ? 51 PRO A HA   6 
ATOM   5592 H HB2  . PRO A 1 51 ? -12.601 -0.757  2.139   1.00 0.00 ? 51 PRO A HB2  6 
ATOM   5593 H HB3  . PRO A 1 51 ? -12.573 0.493   3.388   1.00 0.00 ? 51 PRO A HB3  6 
ATOM   5594 H HG2  . PRO A 1 51 ? -11.897 0.703   0.480   1.00 0.00 ? 51 PRO A HG2  6 
ATOM   5595 H HG3  . PRO A 1 51 ? -12.825 1.820   1.498   1.00 0.00 ? 51 PRO A HG3  6 
ATOM   5596 H HD2  . PRO A 1 51 ? -10.210 2.217   0.848   1.00 0.00 ? 51 PRO A HD2  6 
ATOM   5597 H HD3  . PRO A 1 51 ? -10.935 2.805   2.357   1.00 0.00 ? 51 PRO A HD3  6 
ATOM   5598 N N    . HIS A 1 52 ? -9.954  -1.188  0.709   1.00 0.00 ? 52 HIS A N    6 
ATOM   5599 C CA   . HIS A 1 52 ? -9.513  -2.233  -0.211  1.00 0.00 ? 52 HIS A CA   6 
ATOM   5600 C C    . HIS A 1 52 ? -8.013  -2.482  -0.096  1.00 0.00 ? 52 HIS A C    6 
ATOM   5601 O O    . HIS A 1 52 ? -7.531  -3.575  -0.395  1.00 0.00 ? 52 HIS A O    6 
ATOM   5602 C CB   . HIS A 1 52 ? -9.868  -1.859  -1.653  1.00 0.00 ? 52 HIS A CB   6 
ATOM   5603 C CG   . HIS A 1 52 ? -11.202 -1.190  -1.789  1.00 0.00 ? 52 HIS A CG   6 
ATOM   5604 N ND1  . HIS A 1 52 ? -12.394 -1.818  -1.494  1.00 0.00 ? 52 HIS A ND1  6 
ATOM   5605 C CD2  . HIS A 1 52 ? -11.528 0.063   -2.186  1.00 0.00 ? 52 HIS A CD2  6 
ATOM   5606 C CE1  . HIS A 1 52 ? -13.394 -0.981  -1.704  1.00 0.00 ? 52 HIS A CE1  6 
ATOM   5607 N NE2  . HIS A 1 52 ? -12.896 0.166   -2.124  1.00 0.00 ? 52 HIS A NE2  6 
ATOM   5608 H H    . HIS A 1 52 ? -10.093 -0.280  0.368   1.00 0.00 ? 52 HIS A H    6 
ATOM   5609 H HA   . HIS A 1 52 ? -10.032 -3.138  0.052   1.00 0.00 ? 52 HIS A HA   6 
ATOM   5610 H HB2  . HIS A 1 52 ? -9.118  -1.184  -2.037  1.00 0.00 ? 52 HIS A HB2  6 
ATOM   5611 H HB3  . HIS A 1 52 ? -9.881  -2.755  -2.256  1.00 0.00 ? 52 HIS A HB3  6 
ATOM   5612 H HD1  . HIS A 1 52 ? -12.492 -2.741  -1.178  1.00 0.00 ? 52 HIS A HD1  6 
ATOM   5613 H HD2  . HIS A 1 52 ? -10.840 0.838   -2.494  1.00 0.00 ? 52 HIS A HD2  6 
ATOM   5614 H HE1  . HIS A 1 52 ? -14.441 -1.198  -1.555  1.00 0.00 ? 52 HIS A HE1  6 
ATOM   5615 H HE2  . HIS A 1 52 ? -13.413 0.986   -2.274  1.00 0.00 ? 52 HIS A HE2  6 
ATOM   5616 N N    . ALA A 1 53 ? -7.279  -1.462  0.330   1.00 0.00 ? 53 ALA A N    6 
ATOM   5617 C CA   . ALA A 1 53 ? -5.834  -1.566  0.475   1.00 0.00 ? 53 ALA A CA   6 
ATOM   5618 C C    . ALA A 1 53 ? -5.451  -2.690  1.424   1.00 0.00 ? 53 ALA A C    6 
ATOM   5619 O O    . ALA A 1 53 ? -4.639  -3.554  1.094   1.00 0.00 ? 53 ALA A O    6 
ATOM   5620 C CB   . ALA A 1 53 ? -5.250  -0.248  0.958   1.00 0.00 ? 53 ALA A CB   6 
ATOM   5621 H H    . ALA A 1 53 ? -7.717  -0.620  0.545   1.00 0.00 ? 53 ALA A H    6 
ATOM   5622 H HA   . ALA A 1 53 ? -5.427  -1.776  -0.490  1.00 0.00 ? 53 ALA A HA   6 
ATOM   5623 H HB1  . ALA A 1 53 ? -4.189  -0.362  1.124   1.00 0.00 ? 53 ALA A HB1  6 
ATOM   5624 H HB2  . ALA A 1 53 ? -5.730  0.042   1.882   1.00 0.00 ? 53 ALA A HB2  6 
ATOM   5625 H HB3  . ALA A 1 53 ? -5.418  0.515   0.212   1.00 0.00 ? 53 ALA A HB3  6 
ATOM   5626 N N    . ARG A 1 54 ? -6.040  -2.661  2.606   1.00 0.00 ? 54 ARG A N    6 
ATOM   5627 C CA   . ARG A 1 54 ? -5.774  -3.664  3.626   1.00 0.00 ? 54 ARG A CA   6 
ATOM   5628 C C    . ARG A 1 54 ? -5.998  -5.070  3.088   1.00 0.00 ? 54 ARG A C    6 
ATOM   5629 O O    . ARG A 1 54 ? -5.322  -6.017  3.490   1.00 0.00 ? 54 ARG A O    6 
ATOM   5630 C CB   . ARG A 1 54 ? -6.659  -3.421  4.850   1.00 0.00 ? 54 ARG A CB   6 
ATOM   5631 C CG   . ARG A 1 54 ? -5.903  -3.468  6.166   1.00 0.00 ? 54 ARG A CG   6 
ATOM   5632 C CD   . ARG A 1 54 ? -6.733  -2.907  7.311   1.00 0.00 ? 54 ARG A CD   6 
ATOM   5633 N NE   . ARG A 1 54 ? -8.103  -3.419  7.302   1.00 0.00 ? 54 ARG A NE   6 
ATOM   5634 C CZ   . ARG A 1 54 ? -8.845  -3.583  8.396   1.00 0.00 ? 54 ARG A CZ   6 
ATOM   5635 N NH1  . ARG A 1 54 ? -8.363  -3.264  9.592   1.00 0.00 ? 54 ARG A NH1  6 
ATOM   5636 N NH2  . ARG A 1 54 ? -10.077 -4.063  8.294   1.00 0.00 ? 54 ARG A NH2  6 
ATOM   5637 H H    . ARG A 1 54 ? -6.669  -1.942  2.797   1.00 0.00 ? 54 ARG A H    6 
ATOM   5638 H HA   . ARG A 1 54 ? -4.745  -3.566  3.913   1.00 0.00 ? 54 ARG A HA   6 
ATOM   5639 H HB2  . ARG A 1 54 ? -7.120  -2.449  4.758   1.00 0.00 ? 54 ARG A HB2  6 
ATOM   5640 H HB3  . ARG A 1 54 ? -7.432  -4.175  4.876   1.00 0.00 ? 54 ARG A HB3  6 
ATOM   5641 H HG2  . ARG A 1 54 ? -5.650  -4.494  6.388   1.00 0.00 ? 54 ARG A HG2  6 
ATOM   5642 H HG3  . ARG A 1 54 ? -4.999  -2.885  6.070   1.00 0.00 ? 54 ARG A HG3  6 
ATOM   5643 H HD2  . ARG A 1 54 ? -6.263  -3.181  8.243   1.00 0.00 ? 54 ARG A HD2  6 
ATOM   5644 H HD3  . ARG A 1 54 ? -6.760  -1.831  7.226   1.00 0.00 ? 54 ARG A HD3  6 
ATOM   5645 H HE   . ARG A 1 54 ? -8.492  -3.656  6.434   1.00 0.00 ? 54 ARG A HE   6 
ATOM   5646 H HH11 . ARG A 1 54 ? -7.438  -2.897  9.679   1.00 0.00 ? 54 ARG A HH11 6 
ATOM   5647 H HH12 . ARG A 1 54 ? -8.927  -3.392  10.407  1.00 0.00 ? 54 ARG A HH12 6 
ATOM   5648 H HH21 . ARG A 1 54 ? -10.448 -4.301  7.397   1.00 0.00 ? 54 ARG A HH21 6 
ATOM   5649 H HH22 . ARG A 1 54 ? -10.635 -4.187  9.115   1.00 0.00 ? 54 ARG A HH22 6 
ATOM   5650 N N    . ASP A 1 55 ? -6.948  -5.194  2.176   1.00 0.00 ? 55 ASP A N    6 
ATOM   5651 C CA   . ASP A 1 55 ? -7.263  -6.481  1.576   1.00 0.00 ? 55 ASP A CA   6 
ATOM   5652 C C    . ASP A 1 55 ? -6.149  -6.924  0.645   1.00 0.00 ? 55 ASP A C    6 
ATOM   5653 O O    . ASP A 1 55 ? -5.768  -8.094  0.621   1.00 0.00 ? 55 ASP A O    6 
ATOM   5654 C CB   . ASP A 1 55 ? -8.580  -6.410  0.818   1.00 0.00 ? 55 ASP A CB   6 
ATOM   5655 C CG   . ASP A 1 55 ? -9.257  -7.762  0.706   1.00 0.00 ? 55 ASP A CG   6 
ATOM   5656 O OD1  . ASP A 1 55 ? -9.676  -8.304  1.750   1.00 0.00 ? 55 ASP A OD1  6 
ATOM   5657 O OD2  . ASP A 1 55 ? -9.368  -8.278  -0.426  1.00 0.00 ? 55 ASP A OD2  6 
ATOM   5658 H H    . ASP A 1 55 ? -7.445  -4.401  1.899   1.00 0.00 ? 55 ASP A H    6 
ATOM   5659 H HA   . ASP A 1 55 ? -7.356  -7.193  2.359   1.00 0.00 ? 55 ASP A HA   6 
ATOM   5660 H HB2  . ASP A 1 55 ? -9.249  -5.729  1.326   1.00 0.00 ? 55 ASP A HB2  6 
ATOM   5661 H HB3  . ASP A 1 55 ? -8.381  -6.046  -0.172  1.00 0.00 ? 55 ASP A HB3  6 
ATOM   5662 N N    . THR A 1 56 ? -5.628  -5.974  -0.113  1.00 0.00 ? 56 THR A N    6 
ATOM   5663 C CA   . THR A 1 56 ? -4.552  -6.242  -1.046  1.00 0.00 ? 56 THR A CA   6 
ATOM   5664 C C    . THR A 1 56 ? -3.327  -6.779  -0.315  1.00 0.00 ? 56 THR A C    6 
ATOM   5665 O O    . THR A 1 56 ? -2.751  -7.793  -0.709  1.00 0.00 ? 56 THR A O    6 
ATOM   5666 C CB   . THR A 1 56 ? -4.192  -4.980  -1.812  1.00 0.00 ? 56 THR A CB   6 
ATOM   5667 O OG1  . THR A 1 56 ? -5.339  -4.176  -2.027  1.00 0.00 ? 56 THR A OG1  6 
ATOM   5668 C CG2  . THR A 1 56 ? -3.561  -5.255  -3.160  1.00 0.00 ? 56 THR A CG2  6 
ATOM   5669 H H    . THR A 1 56 ? -5.975  -5.068  -0.038  1.00 0.00 ? 56 THR A H    6 
ATOM   5670 H HA   . THR A 1 56 ? -4.895  -6.977  -1.738  1.00 0.00 ? 56 THR A HA   6 
ATOM   5671 H HB   . THR A 1 56 ? -3.492  -4.423  -1.228  1.00 0.00 ? 56 THR A HB   6 
ATOM   5672 H HG1  . THR A 1 56 ? -5.922  -4.610  -2.653  1.00 0.00 ? 56 THR A HG1  6 
ATOM   5673 H HG21 . THR A 1 56 ? -3.379  -4.320  -3.670  1.00 0.00 ? 56 THR A HG21 6 
ATOM   5674 H HG22 . THR A 1 56 ? -4.228  -5.864  -3.753  1.00 0.00 ? 56 THR A HG22 6 
ATOM   5675 H HG23 . THR A 1 56 ? -2.626  -5.776  -3.021  1.00 0.00 ? 56 THR A HG23 6 
ATOM   5676 N N    . LEU A 1 57 ? -2.936  -6.091  0.754   1.00 0.00 ? 57 LEU A N    6 
ATOM   5677 C CA   . LEU A 1 57 ? -1.786  -6.497  1.541   1.00 0.00 ? 57 LEU A CA   6 
ATOM   5678 C C    . LEU A 1 57 ? -1.982  -7.894  2.105   1.00 0.00 ? 57 LEU A C    6 
ATOM   5679 O O    . LEU A 1 57 ? -1.119  -8.762  1.972   1.00 0.00 ? 57 LEU A O    6 
ATOM   5680 C CB   . LEU A 1 57 ? -1.538  -5.499  2.669   1.00 0.00 ? 57 LEU A CB   6 
ATOM   5681 C CG   . LEU A 1 57 ? -0.347  -4.568  2.450   1.00 0.00 ? 57 LEU A CG   6 
ATOM   5682 C CD1  . LEU A 1 57 ? -0.802  -3.118  2.387   1.00 0.00 ? 57 LEU A CD1  6 
ATOM   5683 C CD2  . LEU A 1 57 ? 0.693   -4.757  3.546   1.00 0.00 ? 57 LEU A CD2  6 
ATOM   5684 H H    . LEU A 1 57 ? -3.433  -5.293  1.019   1.00 0.00 ? 57 LEU A H    6 
ATOM   5685 H HA   . LEU A 1 57 ? -0.942  -6.502  0.894   1.00 0.00 ? 57 LEU A HA   6 
ATOM   5686 H HB2  . LEU A 1 57 ? -2.423  -4.897  2.775   1.00 0.00 ? 57 LEU A HB2  6 
ATOM   5687 H HB3  . LEU A 1 57 ? -1.375  -6.049  3.584   1.00 0.00 ? 57 LEU A HB3  6 
ATOM   5688 H HG   . LEU A 1 57 ? 0.112   -4.812  1.508   1.00 0.00 ? 57 LEU A HG   6 
ATOM   5689 H HD11 . LEU A 1 57 ? -0.034  -2.481  2.801   1.00 0.00 ? 57 LEU A HD11 6 
ATOM   5690 H HD12 . LEU A 1 57 ? -1.712  -3.001  2.956   1.00 0.00 ? 57 LEU A HD12 6 
ATOM   5691 H HD13 . LEU A 1 57 ? -0.982  -2.842  1.359   1.00 0.00 ? 57 LEU A HD13 6 
ATOM   5692 H HD21 . LEU A 1 57 ? 0.608   -5.752  3.954   1.00 0.00 ? 57 LEU A HD21 6 
ATOM   5693 H HD22 . LEU A 1 57 ? 0.528   -4.031  4.328   1.00 0.00 ? 57 LEU A HD22 6 
ATOM   5694 H HD23 . LEU A 1 57 ? 1.681   -4.621  3.131   1.00 0.00 ? 57 LEU A HD23 6 
ATOM   5695 N N    . THR A 1 58 ? -3.128  -8.099  2.732   1.00 0.00 ? 58 THR A N    6 
ATOM   5696 C CA   . THR A 1 58 ? -3.459  -9.386  3.320   1.00 0.00 ? 58 THR A CA   6 
ATOM   5697 C C    . THR A 1 58 ? -3.484  -10.470 2.254   1.00 0.00 ? 58 THR A C    6 
ATOM   5698 O O    . THR A 1 58 ? -2.940  -11.557 2.448   1.00 0.00 ? 58 THR A O    6 
ATOM   5699 C CB   . THR A 1 58 ? -4.808  -9.319  4.038   1.00 0.00 ? 58 THR A CB   6 
ATOM   5700 O OG1  . THR A 1 58 ? -4.861  -8.199  4.903   1.00 0.00 ? 58 THR A OG1  6 
ATOM   5701 C CG2  . THR A 1 58 ? -5.108  -10.552 4.864   1.00 0.00 ? 58 THR A CG2  6 
ATOM   5702 H H    . THR A 1 58 ? -3.765  -7.367  2.798   1.00 0.00 ? 58 THR A H    6 
ATOM   5703 H HA   . THR A 1 58 ? -2.690  -9.621  4.034   1.00 0.00 ? 58 THR A HA   6 
ATOM   5704 H HB   . THR A 1 58 ? -5.591  -9.216  3.301   1.00 0.00 ? 58 THR A HB   6 
ATOM   5705 H HG1  . THR A 1 58 ? -5.069  -7.412  4.396   1.00 0.00 ? 58 THR A HG1  6 
ATOM   5706 H HG21 . THR A 1 58 ? -5.401  -11.360 4.211   1.00 0.00 ? 58 THR A HG21 6 
ATOM   5707 H HG22 . THR A 1 58 ? -5.912  -10.336 5.553   1.00 0.00 ? 58 THR A HG22 6 
ATOM   5708 H HG23 . THR A 1 58 ? -4.226  -10.838 5.418   1.00 0.00 ? 58 THR A HG23 6 
ATOM   5709 N N    . SER A 1 59 ? -4.100  -10.162 1.116   1.00 0.00 ? 59 SER A N    6 
ATOM   5710 C CA   . SER A 1 59 ? -4.172  -11.102 0.014   1.00 0.00 ? 59 SER A CA   6 
ATOM   5711 C C    . SER A 1 59 ? -2.783  -11.619 -0.315  1.00 0.00 ? 59 SER A C    6 
ATOM   5712 O O    . SER A 1 59 ? -2.604  -12.767 -0.723  1.00 0.00 ? 59 SER A O    6 
ATOM   5713 C CB   . SER A 1 59 ? -4.773  -10.425 -1.201  1.00 0.00 ? 59 SER A CB   6 
ATOM   5714 O OG   . SER A 1 59 ? -5.383  -11.366 -2.068  1.00 0.00 ? 59 SER A OG   6 
ATOM   5715 H H    . SER A 1 59 ? -4.500  -9.278  1.009   1.00 0.00 ? 59 SER A H    6 
ATOM   5716 H HA   . SER A 1 59 ? -4.793  -11.915 0.305   1.00 0.00 ? 59 SER A HA   6 
ATOM   5717 H HB2  . SER A 1 59 ? -5.514  -9.709  -0.880  1.00 0.00 ? 59 SER A HB2  6 
ATOM   5718 H HB3  . SER A 1 59 ? -3.991  -9.920  -1.729  1.00 0.00 ? 59 SER A HB3  6 
ATOM   5719 H HG   . SER A 1 59 ? -4.705  -11.843 -2.551  1.00 0.00 ? 59 SER A HG   6 
ATOM   5720 N N    . CYS A 1 60 ? -1.804  -10.750 -0.115  1.00 0.00 ? 60 CYS A N    6 
ATOM   5721 C CA   . CYS A 1 60 ? -0.418  -11.074 -0.362  1.00 0.00 ? 60 CYS A CA   6 
ATOM   5722 C C    . CYS A 1 60 ? 0.155   -11.871 0.804   1.00 0.00 ? 60 CYS A C    6 
ATOM   5723 O O    . CYS A 1 60 ? 0.982   -12.763 0.614   1.00 0.00 ? 60 CYS A O    6 
ATOM   5724 C CB   . CYS A 1 60 ? 0.370   -9.783  -0.553  1.00 0.00 ? 60 CYS A CB   6 
ATOM   5725 S SG   . CYS A 1 60 ? 1.582   -9.841  -1.911  1.00 0.00 ? 60 CYS A SG   6 
ATOM   5726 H H    . CYS A 1 60 ? -2.024  -9.858  0.219   1.00 0.00 ? 60 CYS A H    6 
ATOM   5727 H HA   . CYS A 1 60 ? -0.361  -11.665 -1.263  1.00 0.00 ? 60 CYS A HA   6 
ATOM   5728 H HB2  . CYS A 1 60 ? -0.320  -8.979  -0.763  1.00 0.00 ? 60 CYS A HB2  6 
ATOM   5729 H HB3  . CYS A 1 60 ? 0.896   -9.561  0.360   1.00 0.00 ? 60 CYS A HB3  6 
ATOM   5730 N N    . GLY A 1 61 ? -0.291  -11.539 2.015   1.00 0.00 ? 61 GLY A N    6 
ATOM   5731 C CA   . GLY A 1 61 ? 0.189   -12.232 3.194   1.00 0.00 ? 61 GLY A CA   6 
ATOM   5732 C C    . GLY A 1 61 ? 1.646   -11.938 3.483   1.00 0.00 ? 61 GLY A C    6 
ATOM   5733 O O    . GLY A 1 61 ? 2.470   -12.851 3.541   1.00 0.00 ? 61 GLY A O    6 
ATOM   5734 H H    . GLY A 1 61 ? -0.952  -10.817 2.109   1.00 0.00 ? 61 GLY A H    6 
ATOM   5735 H HA2  . GLY A 1 61 ? -0.405  -11.927 4.044   1.00 0.00 ? 61 GLY A HA2  6 
ATOM   5736 H HA3  . GLY A 1 61 ? 0.069   -13.295 3.047   1.00 0.00 ? 61 GLY A HA3  6 
ATOM   5737 N N    . LEU A 1 62 ? 1.968   -10.660 3.669   1.00 0.00 ? 62 LEU A N    6 
ATOM   5738 C CA   . LEU A 1 62 ? 3.340   -10.259 3.960   1.00 0.00 ? 62 LEU A CA   6 
ATOM   5739 C C    . LEU A 1 62 ? 3.440   -9.614  5.339   1.00 0.00 ? 62 LEU A C    6 
ATOM   5740 O O    . LEU A 1 62 ? 3.907   -10.239 6.292   1.00 0.00 ? 62 LEU A O    6 
ATOM   5741 C CB   . LEU A 1 62 ? 3.894   -9.300  2.889   1.00 0.00 ? 62 LEU A CB   6 
ATOM   5742 C CG   . LEU A 1 62 ? 2.861   -8.577  2.008   1.00 0.00 ? 62 LEU A CG   6 
ATOM   5743 C CD1  . LEU A 1 62 ? 2.771   -7.104  2.380   1.00 0.00 ? 62 LEU A CD1  6 
ATOM   5744 C CD2  . LEU A 1 62 ? 3.226   -8.725  0.538   1.00 0.00 ? 62 LEU A CD2  6 
ATOM   5745 H H    . LEU A 1 62 ? 1.267   -9.977  3.617   1.00 0.00 ? 62 LEU A H    6 
ATOM   5746 H HA   . LEU A 1 62 ? 3.944   -11.155 3.962   1.00 0.00 ? 62 LEU A HA   6 
ATOM   5747 H HB2  . LEU A 1 62 ? 4.489   -8.550  3.389   1.00 0.00 ? 62 LEU A HB2  6 
ATOM   5748 H HB3  . LEU A 1 62 ? 4.546   -9.869  2.242   1.00 0.00 ? 62 LEU A HB3  6 
ATOM   5749 H HG   . LEU A 1 62 ? 1.886   -9.016  2.155   1.00 0.00 ? 62 LEU A HG   6 
ATOM   5750 H HD11 . LEU A 1 62 ? 2.578   -6.520  1.493   1.00 0.00 ? 62 LEU A HD11 6 
ATOM   5751 H HD12 . LEU A 1 62 ? 3.703   -6.787  2.824   1.00 0.00 ? 62 LEU A HD12 6 
ATOM   5752 H HD13 . LEU A 1 62 ? 1.967   -6.960  3.087   1.00 0.00 ? 62 LEU A HD13 6 
ATOM   5753 H HD21 . LEU A 1 62 ? 2.551   -8.133  -0.061  1.00 0.00 ? 62 LEU A HD21 6 
ATOM   5754 H HD22 . LEU A 1 62 ? 3.148   -9.762  0.251   1.00 0.00 ? 62 LEU A HD22 6 
ATOM   5755 H HD23 . LEU A 1 62 ? 4.240   -8.384  0.383   1.00 0.00 ? 62 LEU A HD23 6 
ATOM   5756 N N    . ALA A 1 63 ? 3.003   -8.364  5.442   1.00 0.00 ? 63 ALA A N    6 
ATOM   5757 C CA   . ALA A 1 63 ? 3.050   -7.647  6.706   1.00 0.00 ? 63 ALA A CA   6 
ATOM   5758 C C    . ALA A 1 63 ? 1.931   -6.616  6.811   1.00 0.00 ? 63 ALA A C    6 
ATOM   5759 O O    . ALA A 1 63 ? 1.022   -6.579  5.982   1.00 0.00 ? 63 ALA A O    6 
ATOM   5760 C CB   . ALA A 1 63 ? 4.405   -6.978  6.883   1.00 0.00 ? 63 ALA A CB   6 
ATOM   5761 H H    . ALA A 1 63 ? 2.642   -7.918  4.656   1.00 0.00 ? 63 ALA A H    6 
ATOM   5762 H HA   . ALA A 1 63 ? 2.929   -8.370  7.492   1.00 0.00 ? 63 ALA A HA   6 
ATOM   5763 H HB1  . ALA A 1 63 ? 5.143   -7.499  6.291   1.00 0.00 ? 63 ALA A HB1  6 
ATOM   5764 H HB2  . ALA A 1 63 ? 4.690   -7.013  7.925   1.00 0.00 ? 63 ALA A HB2  6 
ATOM   5765 H HB3  . ALA A 1 63 ? 4.344   -5.950  6.561   1.00 0.00 ? 63 ALA A HB3  6 
ATOM   5766 N N    . VAL A 1 64 ? 2.007   -5.781  7.844   1.00 0.00 ? 64 VAL A N    6 
ATOM   5767 C CA   . VAL A 1 64 ? 1.015   -4.748  8.077   1.00 0.00 ? 64 VAL A CA   6 
ATOM   5768 C C    . VAL A 1 64 ? 1.649   -3.524  8.738   1.00 0.00 ? 64 VAL A C    6 
ATOM   5769 O O    . VAL A 1 64 ? 2.496   -3.660  9.621   1.00 0.00 ? 64 VAL A O    6 
ATOM   5770 C CB   . VAL A 1 64 ? -0.118  -5.272  8.964   1.00 0.00 ? 64 VAL A CB   6 
ATOM   5771 C CG1  . VAL A 1 64 ? -1.167  -4.197  9.214   1.00 0.00 ? 64 VAL A CG1  6 
ATOM   5772 C CG2  . VAL A 1 64 ? -0.749  -6.511  8.348   1.00 0.00 ? 64 VAL A CG2  6 
ATOM   5773 H H    . VAL A 1 64 ? 2.750   -5.863  8.467   1.00 0.00 ? 64 VAL A H    6 
ATOM   5774 H HA   . VAL A 1 64 ? 0.602   -4.470  7.138   1.00 0.00 ? 64 VAL A HA   6 
ATOM   5775 H HB   . VAL A 1 64 ? 0.314   -5.547  9.901   1.00 0.00 ? 64 VAL A HB   6 
ATOM   5776 H HG11 . VAL A 1 64 ? -1.830  -4.518  10.004  1.00 0.00 ? 64 VAL A HG11 6 
ATOM   5777 H HG12 . VAL A 1 64 ? -1.737  -4.033  8.311   1.00 0.00 ? 64 VAL A HG12 6 
ATOM   5778 H HG13 . VAL A 1 64 ? -0.680  -3.278  9.504   1.00 0.00 ? 64 VAL A HG13 6 
ATOM   5779 H HG21 . VAL A 1 64 ? -0.798  -6.396  7.276   1.00 0.00 ? 64 VAL A HG21 6 
ATOM   5780 H HG22 . VAL A 1 64 ? -1.747  -6.640  8.741   1.00 0.00 ? 64 VAL A HG22 6 
ATOM   5781 H HG23 . VAL A 1 64 ? -0.152  -7.378  8.590   1.00 0.00 ? 64 VAL A HG23 6 
ATOM   5782 N N    . PRO A 1 65 ? 1.250   -2.307  8.325   1.00 0.00 ? 65 PRO A N    6 
ATOM   5783 C CA   . PRO A 1 65 ? 1.790   -1.066  8.893   1.00 0.00 ? 65 PRO A CA   6 
ATOM   5784 C C    . PRO A 1 65 ? 1.574   -0.982  10.400  1.00 0.00 ? 65 PRO A C    6 
ATOM   5785 O O    . PRO A 1 65 ? 1.340   -1.995  11.060  1.00 0.00 ? 65 PRO A O    6 
ATOM   5786 C CB   . PRO A 1 65 ? 1.005   0.040   8.171   1.00 0.00 ? 65 PRO A CB   6 
ATOM   5787 C CG   . PRO A 1 65 ? -0.196  -0.640  7.614   1.00 0.00 ? 65 PRO A CG   6 
ATOM   5788 C CD   . PRO A 1 65 ? 0.246   -2.035  7.284   1.00 0.00 ? 65 PRO A CD   6 
ATOM   5789 H HA   . PRO A 1 65 ? 2.843   -0.962  8.679   1.00 0.00 ? 65 PRO A HA   6 
ATOM   5790 H HB2  . PRO A 1 65 ? 0.729   0.810   8.875   1.00 0.00 ? 65 PRO A HB2  6 
ATOM   5791 H HB3  . PRO A 1 65 ? 1.615   0.464   7.388   1.00 0.00 ? 65 PRO A HB3  6 
ATOM   5792 H HG2  . PRO A 1 65 ? -0.981  -0.659  8.355   1.00 0.00 ? 65 PRO A HG2  6 
ATOM   5793 H HG3  . PRO A 1 65 ? -0.529  -0.130  6.723   1.00 0.00 ? 65 PRO A HG3  6 
ATOM   5794 H HD2  . PRO A 1 65 ? -0.584  -2.722  7.352   1.00 0.00 ? 65 PRO A HD2  6 
ATOM   5795 H HD3  . PRO A 1 65 ? 0.690   -2.069  6.301   1.00 0.00 ? 65 PRO A HD3  6 
ATOM   5796 N N    . HIS A 1 66 ? 1.655   0.229   10.940  1.00 0.00 ? 66 HIS A N    6 
ATOM   5797 C CA   . HIS A 1 66 ? 1.470   0.441   12.371  1.00 0.00 ? 66 HIS A CA   6 
ATOM   5798 C C    . HIS A 1 66 ? 2.516   -0.327  13.173  1.00 0.00 ? 66 HIS A C    6 
ATOM   5799 O O    . HIS A 1 66 ? 2.229   -0.839  14.255  1.00 0.00 ? 66 HIS A O    6 
ATOM   5800 C CB   . HIS A 1 66 ? 0.066   0.008   12.796  1.00 0.00 ? 66 HIS A CB   6 
ATOM   5801 C CG   . HIS A 1 66 ? -1.020  0.884   12.255  1.00 0.00 ? 66 HIS A CG   6 
ATOM   5802 N ND1  . HIS A 1 66 ? -1.817  0.523   11.190  1.00 0.00 ? 66 HIS A ND1  6 
ATOM   5803 C CD2  . HIS A 1 66 ? -1.444  2.111   12.639  1.00 0.00 ? 66 HIS A CD2  6 
ATOM   5804 C CE1  . HIS A 1 66 ? -2.681  1.490   10.942  1.00 0.00 ? 66 HIS A CE1  6 
ATOM   5805 N NE2  . HIS A 1 66 ? -2.476  2.464   11.807  1.00 0.00 ? 66 HIS A NE2  6 
ATOM   5806 H H    . HIS A 1 66 ? 1.845   0.997   10.363  1.00 0.00 ? 66 HIS A H    6 
ATOM   5807 H HA   . HIS A 1 66 ? 1.587   1.497   12.567  1.00 0.00 ? 66 HIS A HA   6 
ATOM   5808 H HB2  . HIS A 1 66 ? -0.114  -0.997  12.447  1.00 0.00 ? 66 HIS A HB2  6 
ATOM   5809 H HB3  . HIS A 1 66 ? 0.003   0.027   13.875  1.00 0.00 ? 66 HIS A HB3  6 
ATOM   5810 H HD1  . HIS A 1 66 ? -1.756  -0.317  10.688  1.00 0.00 ? 66 HIS A HD1  6 
ATOM   5811 H HD2  . HIS A 1 66 ? -1.045  2.702   13.448  1.00 0.00 ? 66 HIS A HD2  6 
ATOM   5812 H HE1  . HIS A 1 66 ? -3.428  1.485   10.166  1.00 0.00 ? 66 HIS A HE1  6 
ATOM   5813 H HE2  . HIS A 1 66 ? -2.920  3.338   11.789  1.00 0.00 ? 66 HIS A HE2  6 
ATOM   5814 N N    . CYS A 1 67 ? 3.729   -0.404  12.635  1.00 0.00 ? 67 CYS A N    6 
ATOM   5815 C CA   . CYS A 1 67 ? 4.817   -1.111  13.300  1.00 0.00 ? 67 CYS A CA   6 
ATOM   5816 C C    . CYS A 1 67 ? 5.794   -0.130  13.940  1.00 0.00 ? 67 CYS A C    6 
ATOM   5817 O O    . CYS A 1 67 ? 5.880   -0.110  15.186  1.00 0.00 ? 67 CYS A O    6 
ATOM   5818 C CB   . CYS A 1 67 ? 5.556   -2.008  12.304  1.00 0.00 ? 67 CYS A CB   6 
ATOM   5819 S SG   . CYS A 1 67 ? 6.096   -1.151  10.790  1.00 0.00 ? 67 CYS A SG   6 
ATOM   5820 O OXT  . CYS A 1 67 ? 6.466   0.609   13.190  1.00 0.00 ? 67 CYS A OXT  6 
ATOM   5821 H H    . CYS A 1 67 ? 3.896   0.024   11.769  1.00 0.00 ? 67 CYS A H    6 
ATOM   5822 H HA   . CYS A 1 67 ? 4.387   -1.728  14.075  1.00 0.00 ? 67 CYS A HA   6 
ATOM   5823 H HB2  . CYS A 1 67 ? 6.435   -2.415  12.781  1.00 0.00 ? 67 CYS A HB2  6 
ATOM   5824 H HB3  . CYS A 1 67 ? 4.905   -2.817  12.009  1.00 0.00 ? 67 CYS A HB3  6 
HETATM 5825 C C1   . PGM B 2 .  ? -14.178 -0.232  13.993  1.00 0.00 ? 68 PGM A C1   6 
HETATM 5826 O O1   . PGM B 2 .  ? -14.512 -0.131  15.355  1.00 0.00 ? 68 PGM A O1   6 
HETATM 5827 C C2   . PGM B 2 .  ? -12.892 0.433   13.765  1.00 0.00 ? 68 PGM A C2   6 
HETATM 5828 O O2   . PGM B 2 .  ? -13.064 1.823   13.891  1.00 0.00 ? 68 PGM A O2   6 
HETATM 5829 C C3   . PGM B 2 .  ? -12.349 0.135   12.438  1.00 0.00 ? 68 PGM A C3   6 
HETATM 5830 O O4   . PGM B 2 .  ? -10.921 0.257   12.495  1.00 0.00 ? 68 PGM A O4   6 
HETATM 5831 P P5   . PGM B 2 .  ? -10.043 -1.083  12.560  1.00 0.00 ? 68 PGM A P5   6 
HETATM 5832 O O5A  . PGM B 2 .  ? -10.221 -1.718  13.886  1.00 0.00 ? 68 PGM A O5A  6 
HETATM 5833 O O5B  . PGM B 2 .  ? -10.340 -1.895  11.360  1.00 0.00 ? 68 PGM A O5B  6 
HETATM 5834 O O6   . PGM B 2 .  ? -8.527  -0.584  12.453  1.00 0.00 ? 68 PGM A O6   6 
HETATM 5835 C C7   . PGM B 2 .  ? -7.427  -1.552  12.714  1.00 0.00 ? 68 PGM A C7   6 
HETATM 5836 C C8   . PGM B 2 .  ? -6.094  -1.073  12.339  1.00 0.00 ? 68 PGM A C8   6 
HETATM 5837 O O8   . PGM B 2 .  ? -5.689  0.168   12.860  1.00 0.00 ? 68 PGM A O8   6 
HETATM 5838 C C9   . PGM B 2 .  ? -5.904  -1.070  10.911  1.00 0.00 ? 68 PGM A C9   6 
HETATM 5839 O OQ1  . PGM B 2 .  ? -7.422  0.184   8.614   1.00 0.00 ? 68 PGM A OQ1  6 
HETATM 5840 O OQ2  . PGM B 2 .  ? -6.140  0.293   10.344  1.00 0.00 ? 68 PGM A OQ2  6 
HETATM 5841 C CA   . PGM B 2 .  ? -6.292  0.414   9.167   1.00 0.00 ? 68 PGM A CA   6 
HETATM 5842 C CB   . PGM B 2 .  ? -5.243  0.928   8.279   1.00 0.00 ? 68 PGM A CB   6 
HETATM 5843 C CC   . PGM B 2 .  ? -4.820  0.013   7.159   1.00 0.00 ? 68 PGM A CC   6 
HETATM 5844 C CD   . PGM B 2 .  ? -3.333  -0.139  6.999   1.00 0.00 ? 68 PGM A CD   6 
HETATM 5845 C CE   . PGM B 2 .  ? -2.928  -1.190  6.010   1.00 0.00 ? 68 PGM A CE   6 
HETATM 5846 C CF   . PGM B 2 .  ? -2.724  -0.681  4.615   1.00 0.00 ? 68 PGM A CF   6 
HETATM 5847 C CG   . PGM B 2 .  ? -1.288  -0.557  4.198   1.00 0.00 ? 68 PGM A CG   6 
HETATM 5848 C CH   . PGM B 2 .  ? -1.065  0.071   2.863   1.00 0.00 ? 68 PGM A CH   6 
HETATM 5849 C CI   . PGM B 2 .  ? 0.281   0.687   2.669   1.00 0.00 ? 68 PGM A CI   6 
HETATM 5850 C CJ   . PGM B 2 .  ? 0.438   1.459   1.402   1.00 0.00 ? 68 PGM A CJ   6 
HETATM 5851 C CK   . PGM B 2 .  ? 1.641   2.342   1.333   1.00 0.00 ? 68 PGM A CK   6 
HETATM 5852 C CL   . PGM B 2 .  ? 1.357   3.786   1.056   1.00 0.00 ? 68 PGM A CL   6 
HETATM 5853 C CM   . PGM B 2 .  ? 2.178   4.400   -0.032  1.00 0.00 ? 68 PGM A CM   6 
HETATM 5854 C CN   . PGM B 2 .  ? 1.429   5.293   -0.968  1.00 0.00 ? 68 PGM A CN   6 
HETATM 5855 C CO   . PGM B 2 .  ? 1.649   5.020   -2.421  1.00 0.00 ? 68 PGM A CO   6 
HETATM 5856 C CP   . PGM B 2 .  ? 2.780   5.792   -3.032  1.00 0.00 ? 68 PGM A CP   6 
ATOM   5857 N N    . ALA A 1 1  ? 16.493  3.053   -2.793  1.00 0.00 ? 1  ALA A N    7 
ATOM   5858 C CA   . ALA A 1 1  ? 15.832  3.240   -1.476  1.00 0.00 ? 1  ALA A CA   7 
ATOM   5859 C C    . ALA A 1 1  ? 14.388  3.699   -1.648  1.00 0.00 ? 1  ALA A C    7 
ATOM   5860 O O    . ALA A 1 1  ? 14.068  4.869   -1.435  1.00 0.00 ? 1  ALA A O    7 
ATOM   5861 C CB   . ALA A 1 1  ? 16.609  4.242   -0.634  1.00 0.00 ? 1  ALA A CB   7 
ATOM   5862 H H1   . ALA A 1 1  ? 16.594  3.989   -3.234  1.00 0.00 ? 1  ALA A H1   7 
ATOM   5863 H H2   . ALA A 1 1  ? 15.886  2.431   -3.366  1.00 0.00 ? 1  ALA A H2   7 
ATOM   5864 H H3   . ALA A 1 1  ? 17.422  2.619   -2.623  1.00 0.00 ? 1  ALA A H3   7 
ATOM   5865 H HA   . ALA A 1 1  ? 15.836  2.293   -0.956  1.00 0.00 ? 1  ALA A HA   7 
ATOM   5866 H HB1  . ALA A 1 1  ? 15.925  4.787   -0.001  1.00 0.00 ? 1  ALA A HB1  7 
ATOM   5867 H HB2  . ALA A 1 1  ? 17.127  4.932   -1.284  1.00 0.00 ? 1  ALA A HB2  7 
ATOM   5868 H HB3  . ALA A 1 1  ? 17.327  3.717   -0.021  1.00 0.00 ? 1  ALA A HB3  7 
ATOM   5869 N N    . CYS A 1 2  ? 13.520  2.770   -2.033  1.00 0.00 ? 2  CYS A N    7 
ATOM   5870 C CA   . CYS A 1 2  ? 12.108  3.077   -2.234  1.00 0.00 ? 2  CYS A CA   7 
ATOM   5871 C C    . CYS A 1 2  ? 11.929  4.121   -3.331  1.00 0.00 ? 2  CYS A C    7 
ATOM   5872 O O    . CYS A 1 2  ? 12.180  5.308   -3.121  1.00 0.00 ? 2  CYS A O    7 
ATOM   5873 C CB   . CYS A 1 2  ? 11.480  3.575   -0.930  1.00 0.00 ? 2  CYS A CB   7 
ATOM   5874 S SG   . CYS A 1 2  ? 11.997  2.648   0.551   1.00 0.00 ? 2  CYS A SG   7 
ATOM   5875 H H    . CYS A 1 2  ? 13.836  1.855   -2.186  1.00 0.00 ? 2  CYS A H    7 
ATOM   5876 H HA   . CYS A 1 2  ? 11.612  2.167   -2.536  1.00 0.00 ? 2  CYS A HA   7 
ATOM   5877 H HB2  . CYS A 1 2  ? 11.752  4.609   -0.780  1.00 0.00 ? 2  CYS A HB2  7 
ATOM   5878 H HB3  . CYS A 1 2  ? 10.405  3.499   -1.006  1.00 0.00 ? 2  CYS A HB3  7 
ATOM   5879 N N    . GLN A 1 3  ? 11.495  3.670   -4.503  1.00 0.00 ? 3  GLN A N    7 
ATOM   5880 C CA   . GLN A 1 3  ? 11.282  4.562   -5.638  1.00 0.00 ? 3  GLN A CA   7 
ATOM   5881 C C    . GLN A 1 3  ? 10.204  5.599   -5.330  1.00 0.00 ? 3  GLN A C    7 
ATOM   5882 O O    . GLN A 1 3  ? 10.146  6.653   -5.965  1.00 0.00 ? 3  GLN A O    7 
ATOM   5883 C CB   . GLN A 1 3  ? 10.891  3.756   -6.878  1.00 0.00 ? 3  GLN A CB   7 
ATOM   5884 C CG   . GLN A 1 3  ? 11.725  2.500   -7.075  1.00 0.00 ? 3  GLN A CG   7 
ATOM   5885 C CD   . GLN A 1 3  ? 12.002  2.206   -8.536  1.00 0.00 ? 3  GLN A CD   7 
ATOM   5886 O OE1  . GLN A 1 3  ? 12.869  2.826   -9.153  1.00 0.00 ? 3  GLN A OE1  7 
ATOM   5887 N NE2  . GLN A 1 3  ? 11.266  1.254   -9.098  1.00 0.00 ? 3  GLN A NE2  7 
ATOM   5888 H H    . GLN A 1 3  ? 11.313  2.712   -4.608  1.00 0.00 ? 3  GLN A H    7 
ATOM   5889 H HA   . GLN A 1 3  ? 12.212  5.075   -5.833  1.00 0.00 ? 3  GLN A HA   7 
ATOM   5890 H HB2  . GLN A 1 3  ? 9.855   3.464   -6.792  1.00 0.00 ? 3  GLN A HB2  7 
ATOM   5891 H HB3  . GLN A 1 3  ? 11.009  4.381   -7.751  1.00 0.00 ? 3  GLN A HB3  7 
ATOM   5892 H HG2  . GLN A 1 3  ? 12.669  2.626   -6.565  1.00 0.00 ? 3  GLN A HG2  7 
ATOM   5893 H HG3  . GLN A 1 3  ? 11.196  1.661   -6.648  1.00 0.00 ? 3  GLN A HG3  7 
ATOM   5894 H HE21 . GLN A 1 3  ? 10.595  0.801   -8.546  1.00 0.00 ? 3  GLN A HE21 7 
ATOM   5895 H HE22 . GLN A 1 3  ? 11.424  1.044   -10.042 1.00 0.00 ? 3  GLN A HE22 7 
ATOM   5896 N N    . ALA A 1 4  ? 9.350   5.295   -4.355  1.00 0.00 ? 4  ALA A N    7 
ATOM   5897 C CA   . ALA A 1 4  ? 8.271   6.200   -3.965  1.00 0.00 ? 4  ALA A CA   7 
ATOM   5898 C C    . ALA A 1 4  ? 7.172   6.256   -5.026  1.00 0.00 ? 4  ALA A C    7 
ATOM   5899 O O    . ALA A 1 4  ? 6.262   7.081   -4.941  1.00 0.00 ? 4  ALA A O    7 
ATOM   5900 C CB   . ALA A 1 4  ? 8.818   7.596   -3.697  1.00 0.00 ? 4  ALA A CB   7 
ATOM   5901 H H    . ALA A 1 4  ? 9.444   4.440   -3.887  1.00 0.00 ? 4  ALA A H    7 
ATOM   5902 H HA   . ALA A 1 4  ? 7.845   5.828   -3.044  1.00 0.00 ? 4  ALA A HA   7 
ATOM   5903 H HB1  . ALA A 1 4  ? 8.998   8.098   -4.636  1.00 0.00 ? 4  ALA A HB1  7 
ATOM   5904 H HB2  . ALA A 1 4  ? 9.744   7.520   -3.147  1.00 0.00 ? 4  ALA A HB2  7 
ATOM   5905 H HB3  . ALA A 1 4  ? 8.100   8.159   -3.119  1.00 0.00 ? 4  ALA A HB3  7 
ATOM   5906 N N    . SER A 1 5  ? 7.257   5.376   -6.020  1.00 0.00 ? 5  SER A N    7 
ATOM   5907 C CA   . SER A 1 5  ? 6.264   5.331   -7.088  1.00 0.00 ? 5  SER A CA   7 
ATOM   5908 C C    . SER A 1 5  ? 5.903   3.890   -7.446  1.00 0.00 ? 5  SER A C    7 
ATOM   5909 O O    . SER A 1 5  ? 5.267   3.637   -8.469  1.00 0.00 ? 5  SER A O    7 
ATOM   5910 C CB   . SER A 1 5  ? 6.786   6.059   -8.328  1.00 0.00 ? 5  SER A CB   7 
ATOM   5911 O OG   . SER A 1 5  ? 5.747   6.772   -8.976  1.00 0.00 ? 5  SER A OG   7 
ATOM   5912 H H    . SER A 1 5  ? 8.001   4.740   -6.036  1.00 0.00 ? 5  SER A H    7 
ATOM   5913 H HA   . SER A 1 5  ? 5.376   5.834   -6.735  1.00 0.00 ? 5  SER A HA   7 
ATOM   5914 H HB2  . SER A 1 5  ? 7.556   6.757   -8.036  1.00 0.00 ? 5  SER A HB2  7 
ATOM   5915 H HB3  . SER A 1 5  ? 7.197   5.337   -9.019  1.00 0.00 ? 5  SER A HB3  7 
ATOM   5916 H HG   . SER A 1 5  ? 5.159   6.152   -9.415  1.00 0.00 ? 5  SER A HG   7 
ATOM   5917 N N    . GLN A 1 6  ? 6.313   2.948   -6.600  1.00 0.00 ? 6  GLN A N    7 
ATOM   5918 C CA   . GLN A 1 6  ? 6.037   1.544   -6.827  1.00 0.00 ? 6  GLN A CA   7 
ATOM   5919 C C    . GLN A 1 6  ? 4.623   1.180   -6.383  1.00 0.00 ? 6  GLN A C    7 
ATOM   5920 O O    . GLN A 1 6  ? 4.069   0.166   -6.809  1.00 0.00 ? 6  GLN A O    7 
ATOM   5921 C CB   . GLN A 1 6  ? 7.058   0.682   -6.082  1.00 0.00 ? 6  GLN A CB   7 
ATOM   5922 C CG   . GLN A 1 6  ? 8.474   0.825   -6.616  1.00 0.00 ? 6  GLN A CG   7 
ATOM   5923 C CD   . GLN A 1 6  ? 9.270   -0.460  -6.510  1.00 0.00 ? 6  GLN A CD   7 
ATOM   5924 O OE1  . GLN A 1 6  ? 10.132  -0.600  -5.642  1.00 0.00 ? 6  GLN A OE1  7 
ATOM   5925 N NE2  . GLN A 1 6  ? 8.986   -1.407  -7.396  1.00 0.00 ? 6  GLN A NE2  7 
ATOM   5926 H H    . GLN A 1 6  ? 6.813   3.201   -5.809  1.00 0.00 ? 6  GLN A H    7 
ATOM   5927 H HA   . GLN A 1 6  ? 6.132   1.367   -7.878  1.00 0.00 ? 6  GLN A HA   7 
ATOM   5928 H HB2  . GLN A 1 6  ? 7.059   0.963   -5.039  1.00 0.00 ? 6  GLN A HB2  7 
ATOM   5929 H HB3  . GLN A 1 6  ? 6.768   -0.355  -6.166  1.00 0.00 ? 6  GLN A HB3  7 
ATOM   5930 H HG2  . GLN A 1 6  ? 8.426   1.116   -7.654  1.00 0.00 ? 6  GLN A HG2  7 
ATOM   5931 H HG3  . GLN A 1 6  ? 8.981   1.593   -6.051  1.00 0.00 ? 6  GLN A HG3  7 
ATOM   5932 H HE21 . GLN A 1 6  ? 8.288   -1.225  -8.060  1.00 0.00 ? 6  GLN A HE21 7 
ATOM   5933 H HE22 . GLN A 1 6  ? 9.486   -2.249  -7.351  1.00 0.00 ? 6  GLN A HE22 7 
ATOM   5934 N N    . LEU A 1 7  ? 4.046   2.011   -5.520  1.00 0.00 ? 7  LEU A N    7 
ATOM   5935 C CA   . LEU A 1 7  ? 2.700   1.775   -5.011  1.00 0.00 ? 7  LEU A CA   7 
ATOM   5936 C C    . LEU A 1 7  ? 1.660   2.571   -5.798  1.00 0.00 ? 7  LEU A C    7 
ATOM   5937 O O    . LEU A 1 7  ? 0.467   2.275   -5.738  1.00 0.00 ? 7  LEU A O    7 
ATOM   5938 C CB   . LEU A 1 7  ? 2.629   2.146   -3.527  1.00 0.00 ? 7  LEU A CB   7 
ATOM   5939 C CG   . LEU A 1 7  ? 3.894   1.843   -2.721  1.00 0.00 ? 7  LEU A CG   7 
ATOM   5940 C CD1  . LEU A 1 7  ? 3.944   2.698   -1.465  1.00 0.00 ? 7  LEU A CD1  7 
ATOM   5941 C CD2  . LEU A 1 7  ? 3.957   0.364   -2.366  1.00 0.00 ? 7  LEU A CD2  7 
ATOM   5942 H H    . LEU A 1 7  ? 4.539   2.799   -5.212  1.00 0.00 ? 7  LEU A H    7 
ATOM   5943 H HA   . LEU A 1 7  ? 2.486   0.723   -5.118  1.00 0.00 ? 7  LEU A HA   7 
ATOM   5944 H HB2  . LEU A 1 7  ? 2.423   3.204   -3.452  1.00 0.00 ? 7  LEU A HB2  7 
ATOM   5945 H HB3  . LEU A 1 7  ? 1.807   1.604   -3.082  1.00 0.00 ? 7  LEU A HB3  7 
ATOM   5946 H HG   . LEU A 1 7  ? 4.762   2.081   -3.320  1.00 0.00 ? 7  LEU A HG   7 
ATOM   5947 H HD11 . LEU A 1 7  ? 3.828   3.738   -1.733  1.00 0.00 ? 7  LEU A HD11 7 
ATOM   5948 H HD12 . LEU A 1 7  ? 4.895   2.558   -0.971  1.00 0.00 ? 7  LEU A HD12 7 
ATOM   5949 H HD13 . LEU A 1 7  ? 3.146   2.407   -0.799  1.00 0.00 ? 7  LEU A HD13 7 
ATOM   5950 H HD21 . LEU A 1 7  ? 2.963   -0.057  -2.403  1.00 0.00 ? 7  LEU A HD21 7 
ATOM   5951 H HD22 . LEU A 1 7  ? 4.359   0.249   -1.371  1.00 0.00 ? 7  LEU A HD22 7 
ATOM   5952 H HD23 . LEU A 1 7  ? 4.593   -0.149  -3.073  1.00 0.00 ? 7  LEU A HD23 7 
ATOM   5953 N N    . ALA A 1 8  ? 2.116   3.584   -6.533  1.00 0.00 ? 8  ALA A N    7 
ATOM   5954 C CA   . ALA A 1 8  ? 1.221   4.420   -7.327  1.00 0.00 ? 8  ALA A CA   7 
ATOM   5955 C C    . ALA A 1 8  ? 0.260   3.580   -8.155  1.00 0.00 ? 8  ALA A C    7 
ATOM   5956 O O    . ALA A 1 8  ? -0.957  3.753   -8.089  1.00 0.00 ? 8  ALA A O    7 
ATOM   5957 C CB   . ALA A 1 8  ? 2.025   5.346   -8.227  1.00 0.00 ? 8  ALA A CB   7 
ATOM   5958 H H    . ALA A 1 8  ? 3.075   3.777   -6.541  1.00 0.00 ? 8  ALA A H    7 
ATOM   5959 H HA   . ALA A 1 8  ? 0.653   5.024   -6.650  1.00 0.00 ? 8  ALA A HA   7 
ATOM   5960 H HB1  . ALA A 1 8  ? 1.357   6.033   -8.726  1.00 0.00 ? 8  ALA A HB1  7 
ATOM   5961 H HB2  . ALA A 1 8  ? 2.555   4.761   -8.964  1.00 0.00 ? 8  ALA A HB2  7 
ATOM   5962 H HB3  . ALA A 1 8  ? 2.734   5.902   -7.632  1.00 0.00 ? 8  ALA A HB3  7 
ATOM   5963 N N    . VAL A 1 9  ? 0.823   2.672   -8.932  1.00 0.00 ? 9  VAL A N    7 
ATOM   5964 C CA   . VAL A 1 9  ? 0.039   1.790   -9.786  1.00 0.00 ? 9  VAL A CA   7 
ATOM   5965 C C    . VAL A 1 9  ? -1.032  1.051   -8.988  1.00 0.00 ? 9  VAL A C    7 
ATOM   5966 O O    . VAL A 1 9  ? -2.058  0.642   -9.532  1.00 0.00 ? 9  VAL A O    7 
ATOM   5967 C CB   . VAL A 1 9  ? 0.937   0.763   -10.504 1.00 0.00 ? 9  VAL A CB   7 
ATOM   5968 C CG1  . VAL A 1 9  ? 1.661   -0.114  -9.494  1.00 0.00 ? 9  VAL A CG1  7 
ATOM   5969 C CG2  . VAL A 1 9  ? 0.122   -0.082  -11.475 1.00 0.00 ? 9  VAL A CG2  7 
ATOM   5970 H H    . VAL A 1 9  ? 1.793   2.596   -8.932  1.00 0.00 ? 9  VAL A H    7 
ATOM   5971 H HA   . VAL A 1 9  ? -0.440  2.399   -10.530 1.00 0.00 ? 9  VAL A HA   7 
ATOM   5972 H HB   . VAL A 1 9  ? 1.681   1.304   -11.072 1.00 0.00 ? 9  VAL A HB   7 
ATOM   5973 H HG11 . VAL A 1 9  ? 1.075   -0.999  -9.299  1.00 0.00 ? 9  VAL A HG11 7 
ATOM   5974 H HG12 . VAL A 1 9  ? 1.800   0.436   -8.574  1.00 0.00 ? 9  VAL A HG12 7 
ATOM   5975 H HG13 . VAL A 1 9  ? 2.625   -0.399  -9.890  1.00 0.00 ? 9  VAL A HG13 7 
ATOM   5976 H HG21 . VAL A 1 9  ? 0.233   -1.127  -11.226 1.00 0.00 ? 9  VAL A HG21 7 
ATOM   5977 H HG22 . VAL A 1 9  ? 0.473   0.086   -12.482 1.00 0.00 ? 9  VAL A HG22 7 
ATOM   5978 H HG23 . VAL A 1 9  ? -0.920  0.194   -11.407 1.00 0.00 ? 9  VAL A HG23 7 
ATOM   5979 N N    . CYS A 1 10 ? -0.782  0.885   -7.697  1.00 0.00 ? 10 CYS A N    7 
ATOM   5980 C CA   . CYS A 1 10 ? -1.717  0.198   -6.812  1.00 0.00 ? 10 CYS A CA   7 
ATOM   5981 C C    . CYS A 1 10 ? -2.881  1.111   -6.457  1.00 0.00 ? 10 CYS A C    7 
ATOM   5982 O O    . CYS A 1 10 ? -3.996  0.654   -6.209  1.00 0.00 ? 10 CYS A O    7 
ATOM   5983 C CB   . CYS A 1 10 ? -1.003  -0.231  -5.535  1.00 0.00 ? 10 CYS A CB   7 
ATOM   5984 S SG   . CYS A 1 10 ? -1.749  -1.675  -4.712  1.00 0.00 ? 10 CYS A SG   7 
ATOM   5985 H H    . CYS A 1 10 ? 0.053   1.235   -7.327  1.00 0.00 ? 10 CYS A H    7 
ATOM   5986 H HA   . CYS A 1 10 ? -2.091  -0.676  -7.324  1.00 0.00 ? 10 CYS A HA   7 
ATOM   5987 H HB2  . CYS A 1 10 ? 0.020   -0.471  -5.771  1.00 0.00 ? 10 CYS A HB2  7 
ATOM   5988 H HB3  . CYS A 1 10 ? -1.021  0.593   -4.832  1.00 0.00 ? 10 CYS A HB3  7 
ATOM   5989 N N    . ALA A 1 11 ? -2.599  2.409   -6.433  1.00 0.00 ? 11 ALA A N    7 
ATOM   5990 C CA   . ALA A 1 11 ? -3.601  3.423   -6.108  1.00 0.00 ? 11 ALA A CA   7 
ATOM   5991 C C    . ALA A 1 11 ? -4.930  3.129   -6.787  1.00 0.00 ? 11 ALA A C    7 
ATOM   5992 O O    . ALA A 1 11 ? -5.996  3.456   -6.266  1.00 0.00 ? 11 ALA A O    7 
ATOM   5993 C CB   . ALA A 1 11 ? -3.100  4.803   -6.506  1.00 0.00 ? 11 ALA A CB   7 
ATOM   5994 H H    . ALA A 1 11 ? -1.686  2.693   -6.639  1.00 0.00 ? 11 ALA A H    7 
ATOM   5995 H HA   . ALA A 1 11 ? -3.746  3.413   -5.042  1.00 0.00 ? 11 ALA A HA   7 
ATOM   5996 H HB1  . ALA A 1 11 ? -3.378  5.005   -7.530  1.00 0.00 ? 11 ALA A HB1  7 
ATOM   5997 H HB2  . ALA A 1 11 ? -2.024  4.837   -6.412  1.00 0.00 ? 11 ALA A HB2  7 
ATOM   5998 H HB3  . ALA A 1 11 ? -3.541  5.547   -5.860  1.00 0.00 ? 11 ALA A HB3  7 
ATOM   5999 N N    . SER A 1 12 ? -4.851  2.506   -7.952  1.00 0.00 ? 12 SER A N    7 
ATOM   6000 C CA   . SER A 1 12 ? -6.039  2.154   -8.718  1.00 0.00 ? 12 SER A CA   7 
ATOM   6001 C C    . SER A 1 12 ? -7.056  1.423   -7.845  1.00 0.00 ? 12 SER A C    7 
ATOM   6002 O O    . SER A 1 12 ? -8.264  1.530   -8.057  1.00 0.00 ? 12 SER A O    7 
ATOM   6003 C CB   . SER A 1 12 ? -5.657  1.282   -9.915  1.00 0.00 ? 12 SER A CB   7 
ATOM   6004 O OG   . SER A 1 12 ? -6.573  1.452   -10.984 1.00 0.00 ? 12 SER A OG   7 
ATOM   6005 H H    . SER A 1 12 ? -3.969  2.276   -8.304  1.00 0.00 ? 12 SER A H    7 
ATOM   6006 H HA   . SER A 1 12 ? -6.480  3.069   -9.078  1.00 0.00 ? 12 SER A HA   7 
ATOM   6007 H HB2  . SER A 1 12 ? -4.670  1.555   -10.257 1.00 0.00 ? 12 SER A HB2  7 
ATOM   6008 H HB3  . SER A 1 12 ? -5.660  0.244   -9.617  1.00 0.00 ? 12 SER A HB3  7 
ATOM   6009 H HG   . SER A 1 12 ? -7.462  1.259   -10.678 1.00 0.00 ? 12 SER A HG   7 
ATOM   6010 N N    . ALA A 1 13 ? -6.556  0.678   -6.864  1.00 0.00 ? 13 ALA A N    7 
ATOM   6011 C CA   . ALA A 1 13 ? -7.411  -0.072  -5.961  1.00 0.00 ? 13 ALA A CA   7 
ATOM   6012 C C    . ALA A 1 13 ? -7.685  0.709   -4.679  1.00 0.00 ? 13 ALA A C    7 
ATOM   6013 O O    . ALA A 1 13 ? -8.738  0.553   -4.060  1.00 0.00 ? 13 ALA A O    7 
ATOM   6014 C CB   . ALA A 1 13 ? -6.784  -1.420  -5.638  1.00 0.00 ? 13 ALA A CB   7 
ATOM   6015 H H    . ALA A 1 13 ? -5.591  0.630   -6.748  1.00 0.00 ? 13 ALA A H    7 
ATOM   6016 H HA   . ALA A 1 13 ? -8.341  -0.249  -6.468  1.00 0.00 ? 13 ALA A HA   7 
ATOM   6017 H HB1  . ALA A 1 13 ? -5.709  -1.341  -5.697  1.00 0.00 ? 13 ALA A HB1  7 
ATOM   6018 H HB2  . ALA A 1 13 ? -7.130  -2.157  -6.348  1.00 0.00 ? 13 ALA A HB2  7 
ATOM   6019 H HB3  . ALA A 1 13 ? -7.069  -1.720  -4.641  1.00 0.00 ? 13 ALA A HB3  7 
ATOM   6020 N N    . ILE A 1 14 ? -6.733  1.548   -4.283  1.00 0.00 ? 14 ILE A N    7 
ATOM   6021 C CA   . ILE A 1 14 ? -6.876  2.351   -3.074  1.00 0.00 ? 14 ILE A CA   7 
ATOM   6022 C C    . ILE A 1 14 ? -7.818  3.530   -3.309  1.00 0.00 ? 14 ILE A C    7 
ATOM   6023 O O    . ILE A 1 14 ? -8.909  3.589   -2.741  1.00 0.00 ? 14 ILE A O    7 
ATOM   6024 C CB   . ILE A 1 14 ? -5.509  2.880   -2.582  1.00 0.00 ? 14 ILE A CB   7 
ATOM   6025 C CG1  . ILE A 1 14 ? -4.629  1.725   -2.098  1.00 0.00 ? 14 ILE A CG1  7 
ATOM   6026 C CG2  . ILE A 1 14 ? -5.693  3.903   -1.469  1.00 0.00 ? 14 ILE A CG2  7 
ATOM   6027 C CD1  . ILE A 1 14 ? -3.842  1.057   -3.205  1.00 0.00 ? 14 ILE A CD1  7 
ATOM   6028 H H    . ILE A 1 14 ? -5.915  1.631   -4.817  1.00 0.00 ? 14 ILE A H    7 
ATOM   6029 H HA   . ILE A 1 14 ? -7.293  1.718   -2.303  1.00 0.00 ? 14 ILE A HA   7 
ATOM   6030 H HB   . ILE A 1 14 ? -5.020  3.371   -3.410  1.00 0.00 ? 14 ILE A HB   7 
ATOM   6031 H HG12 . ILE A 1 14 ? -3.924  2.102   -1.369  1.00 0.00 ? 14 ILE A HG12 7 
ATOM   6032 H HG13 . ILE A 1 14 ? -5.253  0.976   -1.633  1.00 0.00 ? 14 ILE A HG13 7 
ATOM   6033 H HG21 . ILE A 1 14 ? -4.904  3.790   -0.741  1.00 0.00 ? 14 ILE A HG21 7 
ATOM   6034 H HG22 . ILE A 1 14 ? -6.649  3.747   -0.992  1.00 0.00 ? 14 ILE A HG22 7 
ATOM   6035 H HG23 . ILE A 1 14 ? -5.657  4.899   -1.886  1.00 0.00 ? 14 ILE A HG23 7 
ATOM   6036 H HD11 . ILE A 1 14 ? -2.816  0.929   -2.893  1.00 0.00 ? 14 ILE A HD11 7 
ATOM   6037 H HD12 . ILE A 1 14 ? -3.874  1.672   -4.092  1.00 0.00 ? 14 ILE A HD12 7 
ATOM   6038 H HD13 . ILE A 1 14 ? -4.274  0.091   -3.422  1.00 0.00 ? 14 ILE A HD13 7 
ATOM   6039 N N    . LEU A 1 15 ? -7.383  4.469   -4.142  1.00 0.00 ? 15 LEU A N    7 
ATOM   6040 C CA   . LEU A 1 15 ? -8.181  5.653   -4.446  1.00 0.00 ? 15 LEU A CA   7 
ATOM   6041 C C    . LEU A 1 15 ? -9.426  5.291   -5.249  1.00 0.00 ? 15 LEU A C    7 
ATOM   6042 O O    . LEU A 1 15 ? -10.531 5.239   -4.709  1.00 0.00 ? 15 LEU A O    7 
ATOM   6043 C CB   . LEU A 1 15 ? -7.340  6.675   -5.215  1.00 0.00 ? 15 LEU A CB   7 
ATOM   6044 C CG   . LEU A 1 15 ? -6.252  7.367   -4.394  1.00 0.00 ? 15 LEU A CG   7 
ATOM   6045 C CD1  . LEU A 1 15 ? -5.287  8.110   -5.304  1.00 0.00 ? 15 LEU A CD1  7 
ATOM   6046 C CD2  . LEU A 1 15 ? -6.874  8.318   -3.382  1.00 0.00 ? 15 LEU A CD2  7 
ATOM   6047 H H    . LEU A 1 15 ? -6.502  4.367   -4.558  1.00 0.00 ? 15 LEU A H    7 
ATOM   6048 H HA   . LEU A 1 15 ? -8.489  6.091   -3.509  1.00 0.00 ? 15 LEU A HA   7 
ATOM   6049 H HB2  . LEU A 1 15 ? -6.870  6.170   -6.047  1.00 0.00 ? 15 LEU A HB2  7 
ATOM   6050 H HB3  . LEU A 1 15 ? -8.002  7.434   -5.605  1.00 0.00 ? 15 LEU A HB3  7 
ATOM   6051 H HG   . LEU A 1 15 ? -5.691  6.621   -3.851  1.00 0.00 ? 15 LEU A HG   7 
ATOM   6052 H HD11 . LEU A 1 15 ? -5.819  8.886   -5.836  1.00 0.00 ? 15 LEU A HD11 7 
ATOM   6053 H HD12 . LEU A 1 15 ? -4.855  7.419   -6.012  1.00 0.00 ? 15 LEU A HD12 7 
ATOM   6054 H HD13 . LEU A 1 15 ? -4.502  8.555   -4.710  1.00 0.00 ? 15 LEU A HD13 7 
ATOM   6055 H HD21 . LEU A 1 15 ? -7.492  9.038   -3.898  1.00 0.00 ? 15 LEU A HD21 7 
ATOM   6056 H HD22 . LEU A 1 15 ? -6.093  8.834   -2.845  1.00 0.00 ? 15 LEU A HD22 7 
ATOM   6057 H HD23 . LEU A 1 15 ? -7.480  7.757   -2.686  1.00 0.00 ? 15 LEU A HD23 7 
ATOM   6058 N N    . SER A 1 16 ? -9.241  5.045   -6.543  1.00 0.00 ? 16 SER A N    7 
ATOM   6059 C CA   . SER A 1 16 ? -10.352 4.692   -7.424  1.00 0.00 ? 16 SER A CA   7 
ATOM   6060 C C    . SER A 1 16 ? -11.166 3.537   -6.849  1.00 0.00 ? 16 SER A C    7 
ATOM   6061 O O    . SER A 1 16 ? -12.366 3.671   -6.605  1.00 0.00 ? 16 SER A O    7 
ATOM   6062 C CB   . SER A 1 16 ? -9.830  4.320   -8.812  1.00 0.00 ? 16 SER A CB   7 
ATOM   6063 O OG   . SER A 1 16 ? -10.897 4.017   -9.695  1.00 0.00 ? 16 SER A OG   7 
ATOM   6064 H H    . SER A 1 16 ? -8.337  5.105   -6.917  1.00 0.00 ? 16 SER A H    7 
ATOM   6065 H HA   . SER A 1 16 ? -10.991 5.558   -7.511  1.00 0.00 ? 16 SER A HA   7 
ATOM   6066 H HB2  . SER A 1 16 ? -9.268  5.148   -9.218  1.00 0.00 ? 16 SER A HB2  7 
ATOM   6067 H HB3  . SER A 1 16 ? -9.188  3.455   -8.733  1.00 0.00 ? 16 SER A HB3  7 
ATOM   6068 H HG   . SER A 1 16 ? -11.419 3.298   -9.332  1.00 0.00 ? 16 SER A HG   7 
ATOM   6069 N N    . GLY A 1 17 ? -10.507 2.404   -6.636  1.00 0.00 ? 17 GLY A N    7 
ATOM   6070 C CA   . GLY A 1 17 ? -11.187 1.243   -6.094  1.00 0.00 ? 17 GLY A CA   7 
ATOM   6071 C C    . GLY A 1 17 ? -11.579 0.250   -7.169  1.00 0.00 ? 17 GLY A C    7 
ATOM   6072 O O    . GLY A 1 17 ? -12.562 -0.478  -7.023  1.00 0.00 ? 17 GLY A O    7 
ATOM   6073 H H    . GLY A 1 17 ? -9.552  2.355   -6.850  1.00 0.00 ? 17 GLY A H    7 
ATOM   6074 H HA2  . GLY A 1 17 ? -10.532 0.754   -5.388  1.00 0.00 ? 17 GLY A HA2  7 
ATOM   6075 H HA3  . GLY A 1 17 ? -12.077 1.569   -5.577  1.00 0.00 ? 17 GLY A HA3  7 
ATOM   6076 N N    . ALA A 1 18 ? -10.809 0.220   -8.252  1.00 0.00 ? 18 ALA A N    7 
ATOM   6077 C CA   . ALA A 1 18 ? -11.080 -0.691  -9.357  1.00 0.00 ? 18 ALA A CA   7 
ATOM   6078 C C    . ALA A 1 18 ? -11.051 -2.140  -8.893  1.00 0.00 ? 18 ALA A C    7 
ATOM   6079 O O    . ALA A 1 18 ? -12.093 -2.761  -8.682  1.00 0.00 ? 18 ALA A O    7 
ATOM   6080 C CB   . ALA A 1 18 ? -10.078 -0.470  -10.481 1.00 0.00 ? 18 ALA A CB   7 
ATOM   6081 H H    . ALA A 1 18 ? -10.040 0.824   -8.309  1.00 0.00 ? 18 ALA A H    7 
ATOM   6082 H HA   . ALA A 1 18 ? -12.060 -0.472  -9.736  1.00 0.00 ? 18 ALA A HA   7 
ATOM   6083 H HB1  . ALA A 1 18 ? -9.160  -0.074  -10.073 1.00 0.00 ? 18 ALA A HB1  7 
ATOM   6084 H HB2  . ALA A 1 18 ? -10.486 0.231   -11.195 1.00 0.00 ? 18 ALA A HB2  7 
ATOM   6085 H HB3  . ALA A 1 18 ? -9.877  -1.409  -10.974 1.00 0.00 ? 18 ALA A HB3  7 
ATOM   6086 N N    . LYS A 1 19 ? -9.849  -2.667  -8.738  1.00 0.00 ? 19 LYS A N    7 
ATOM   6087 C CA   . LYS A 1 19 ? -9.664  -4.045  -8.298  1.00 0.00 ? 19 LYS A CA   7 
ATOM   6088 C C    . LYS A 1 19 ? -8.184  -4.355  -8.089  1.00 0.00 ? 19 LYS A C    7 
ATOM   6089 O O    . LYS A 1 19 ? -7.318  -3.732  -8.703  1.00 0.00 ? 19 LYS A O    7 
ATOM   6090 C CB   . LYS A 1 19 ? -10.265 -5.019  -9.316  1.00 0.00 ? 19 LYS A CB   7 
ATOM   6091 C CG   . LYS A 1 19 ? -10.086 -4.585  -10.763 1.00 0.00 ? 19 LYS A CG   7 
ATOM   6092 C CD   . LYS A 1 19 ? -8.647  -4.751  -11.222 1.00 0.00 ? 19 LYS A CD   7 
ATOM   6093 C CE   . LYS A 1 19 ? -8.535  -4.695  -12.737 1.00 0.00 ? 19 LYS A CE   7 
ATOM   6094 N NZ   . LYS A 1 19 ? -7.130  -4.492  -13.183 1.00 0.00 ? 19 LYS A NZ   7 
ATOM   6095 H H    . LYS A 1 19 ? -9.067  -2.114  -8.925  1.00 0.00 ? 19 LYS A H    7 
ATOM   6096 H HA   . LYS A 1 19 ? -10.179 -4.161  -7.356  1.00 0.00 ? 19 LYS A HA   7 
ATOM   6097 H HB2  . LYS A 1 19 ? -9.795  -5.984  -9.193  1.00 0.00 ? 19 LYS A HB2  7 
ATOM   6098 H HB3  . LYS A 1 19 ? -11.322 -5.118  -9.121  1.00 0.00 ? 19 LYS A HB3  7 
ATOM   6099 H HG2  . LYS A 1 19 ? -10.725 -5.187  -11.391 1.00 0.00 ? 19 LYS A HG2  7 
ATOM   6100 H HG3  . LYS A 1 19 ? -10.366 -3.545  -10.853 1.00 0.00 ? 19 LYS A HG3  7 
ATOM   6101 H HD2  . LYS A 1 19 ? -8.049  -3.958  -10.798 1.00 0.00 ? 19 LYS A HD2  7 
ATOM   6102 H HD3  . LYS A 1 19 ? -8.277  -5.706  -10.877 1.00 0.00 ? 19 LYS A HD3  7 
ATOM   6103 H HE2  . LYS A 1 19 ? -8.903  -5.624  -13.147 1.00 0.00 ? 19 LYS A HE2  7 
ATOM   6104 H HE3  . LYS A 1 19 ? -9.142  -3.878  -13.099 1.00 0.00 ? 19 LYS A HE3  7 
ATOM   6105 H HZ1  . LYS A 1 19 ? -6.862  -3.492  -13.078 1.00 0.00 ? 19 LYS A HZ1  7 
ATOM   6106 H HZ2  . LYS A 1 19 ? -7.028  -4.762  -14.182 1.00 0.00 ? 19 LYS A HZ2  7 
ATOM   6107 H HZ3  . LYS A 1 19 ? -6.485  -5.074  -12.611 1.00 0.00 ? 19 LYS A HZ3  7 
ATOM   6108 N N    . PRO A 1 20 ? -7.874  -5.328  -7.215  1.00 0.00 ? 20 PRO A N    7 
ATOM   6109 C CA   . PRO A 1 20 ? -6.490  -5.718  -6.928  1.00 0.00 ? 20 PRO A CA   7 
ATOM   6110 C C    . PRO A 1 20 ? -5.713  -6.061  -8.194  1.00 0.00 ? 20 PRO A C    7 
ATOM   6111 O O    . PRO A 1 20 ? -6.238  -5.961  -9.303  1.00 0.00 ? 20 PRO A O    7 
ATOM   6112 C CB   . PRO A 1 20 ? -6.642  -6.957  -6.042  1.00 0.00 ? 20 PRO A CB   7 
ATOM   6113 C CG   . PRO A 1 20 ? -7.987  -6.815  -5.418  1.00 0.00 ? 20 PRO A CG   7 
ATOM   6114 C CD   . PRO A 1 20 ? -8.844  -6.122  -6.439  1.00 0.00 ? 20 PRO A CD   7 
ATOM   6115 H HA   . PRO A 1 20 ? -5.966  -4.945  -6.385  1.00 0.00 ? 20 PRO A HA   7 
ATOM   6116 H HB2  . PRO A 1 20 ? -6.579  -7.847  -6.650  1.00 0.00 ? 20 PRO A HB2  7 
ATOM   6117 H HB3  . PRO A 1 20 ? -5.861  -6.968  -5.296  1.00 0.00 ? 20 PRO A HB3  7 
ATOM   6118 H HG2  . PRO A 1 20 ? -8.390  -7.791  -5.189  1.00 0.00 ? 20 PRO A HG2  7 
ATOM   6119 H HG3  . PRO A 1 20 ? -7.915  -6.218  -4.521  1.00 0.00 ? 20 PRO A HG3  7 
ATOM   6120 H HD2  . PRO A 1 20 ? -9.342  -6.846  -7.068  1.00 0.00 ? 20 PRO A HD2  7 
ATOM   6121 H HD3  . PRO A 1 20 ? -9.566  -5.481  -5.954  1.00 0.00 ? 20 PRO A HD3  7 
ATOM   6122 N N    . SER A 1 21 ? -4.460  -6.467  -8.021  1.00 0.00 ? 21 SER A N    7 
ATOM   6123 C CA   . SER A 1 21 ? -3.611  -6.826  -9.150  1.00 0.00 ? 21 SER A CA   7 
ATOM   6124 C C    . SER A 1 21 ? -2.273  -7.377  -8.670  1.00 0.00 ? 21 SER A C    7 
ATOM   6125 O O    . SER A 1 21 ? -1.655  -6.828  -7.759  1.00 0.00 ? 21 SER A O    7 
ATOM   6126 C CB   . SER A 1 21 ? -3.383  -5.610  -10.050 1.00 0.00 ? 21 SER A CB   7 
ATOM   6127 O OG   . SER A 1 21 ? -4.366  -5.536  -11.068 1.00 0.00 ? 21 SER A OG   7 
ATOM   6128 H H    . SER A 1 21 ? -4.097  -6.528  -7.114  1.00 0.00 ? 21 SER A H    7 
ATOM   6129 H HA   . SER A 1 21 ? -4.120  -7.591  -9.716  1.00 0.00 ? 21 SER A HA   7 
ATOM   6130 H HB2  . SER A 1 21 ? -3.430  -4.711  -9.455  1.00 0.00 ? 21 SER A HB2  7 
ATOM   6131 H HB3  . SER A 1 21 ? -2.409  -5.685  -10.512 1.00 0.00 ? 21 SER A HB3  7 
ATOM   6132 H HG   . SER A 1 21 ? -4.084  -4.914  -11.742 1.00 0.00 ? 21 SER A HG   7 
ATOM   6133 N N    . GLY A 1 22 ? -1.831  -8.467  -9.290  1.00 0.00 ? 22 GLY A N    7 
ATOM   6134 C CA   . GLY A 1 22 ? -0.568  -9.074  -8.913  1.00 0.00 ? 22 GLY A CA   7 
ATOM   6135 C C    . GLY A 1 22 ? 0.595   -8.108  -9.021  1.00 0.00 ? 22 GLY A C    7 
ATOM   6136 O O    . GLY A 1 22 ? 1.599   -8.253  -8.324  1.00 0.00 ? 22 GLY A O    7 
ATOM   6137 H H    . GLY A 1 22 ? -2.366  -8.862  -10.010 1.00 0.00 ? 22 GLY A H    7 
ATOM   6138 H HA2  . GLY A 1 22 ? -0.639  -9.422  -7.893  1.00 0.00 ? 22 GLY A HA2  7 
ATOM   6139 H HA3  . GLY A 1 22 ? -0.381  -9.919  -9.558  1.00 0.00 ? 22 GLY A HA3  7 
ATOM   6140 N N    . GLU A 1 23 ? 0.463   -7.121  -9.901  1.00 0.00 ? 23 GLU A N    7 
ATOM   6141 C CA   . GLU A 1 23 ? 1.501   -6.133  -10.107 1.00 0.00 ? 23 GLU A CA   7 
ATOM   6142 C C    . GLU A 1 23 ? 1.845   -5.417  -8.804  1.00 0.00 ? 23 GLU A C    7 
ATOM   6143 O O    . GLU A 1 23 ? 3.016   -5.269  -8.455  1.00 0.00 ? 23 GLU A O    7 
ATOM   6144 C CB   . GLU A 1 23 ? 1.034   -5.122  -11.150 1.00 0.00 ? 23 GLU A CB   7 
ATOM   6145 C CG   . GLU A 1 23 ? 2.173   -4.461  -11.887 1.00 0.00 ? 23 GLU A CG   7 
ATOM   6146 C CD   . GLU A 1 23 ? 1.950   -2.977  -12.108 1.00 0.00 ? 23 GLU A CD   7 
ATOM   6147 O OE1  . GLU A 1 23 ? 2.243   -2.189  -11.185 1.00 0.00 ? 23 GLU A OE1  7 
ATOM   6148 O OE2  . GLU A 1 23 ? 1.484   -2.604  -13.205 1.00 0.00 ? 23 GLU A OE2  7 
ATOM   6149 H H    . GLU A 1 23 ? -0.353  -7.057  -10.434 1.00 0.00 ? 23 GLU A H    7 
ATOM   6150 H HA   . GLU A 1 23 ? 2.380   -6.639  -10.475 1.00 0.00 ? 23 GLU A HA   7 
ATOM   6151 H HB2  . GLU A 1 23 ? 0.409   -5.629  -11.873 1.00 0.00 ? 23 GLU A HB2  7 
ATOM   6152 H HB3  . GLU A 1 23 ? 0.455   -4.353  -10.656 1.00 0.00 ? 23 GLU A HB3  7 
ATOM   6153 H HG2  . GLU A 1 23 ? 3.075   -4.596  -11.313 1.00 0.00 ? 23 GLU A HG2  7 
ATOM   6154 H HG3  . GLU A 1 23 ? 2.280   -4.944  -12.845 1.00 0.00 ? 23 GLU A HG3  7 
ATOM   6155 N N    . CYS A 1 24 ? 0.815   -4.968  -8.091  1.00 0.00 ? 24 CYS A N    7 
ATOM   6156 C CA   . CYS A 1 24 ? 1.003   -4.260  -6.831  1.00 0.00 ? 24 CYS A CA   7 
ATOM   6157 C C    . CYS A 1 24 ? 1.854   -5.069  -5.860  1.00 0.00 ? 24 CYS A C    7 
ATOM   6158 O O    . CYS A 1 24 ? 2.561   -4.508  -5.023  1.00 0.00 ? 24 CYS A O    7 
ATOM   6159 C CB   . CYS A 1 24 ? -0.350  -3.931  -6.195  1.00 0.00 ? 24 CYS A CB   7 
ATOM   6160 S SG   . CYS A 1 24 ? -0.230  -3.019  -4.620  1.00 0.00 ? 24 CYS A SG   7 
ATOM   6161 H H    . CYS A 1 24 ? -0.093  -5.110  -8.425  1.00 0.00 ? 24 CYS A H    7 
ATOM   6162 H HA   . CYS A 1 24 ? 1.515   -3.344  -7.053  1.00 0.00 ? 24 CYS A HA   7 
ATOM   6163 H HB2  . CYS A 1 24 ? -0.925  -3.325  -6.880  1.00 0.00 ? 24 CYS A HB2  7 
ATOM   6164 H HB3  . CYS A 1 24 ? -0.883  -4.851  -6.003  1.00 0.00 ? 24 CYS A HB3  7 
ATOM   6165 N N    . CYS A 1 25 ? 1.783   -6.386  -5.978  1.00 0.00 ? 25 CYS A N    7 
ATOM   6166 C CA   . CYS A 1 25 ? 2.551   -7.272  -5.110  1.00 0.00 ? 25 CYS A CA   7 
ATOM   6167 C C    . CYS A 1 25 ? 4.036   -7.198  -5.445  1.00 0.00 ? 25 CYS A C    7 
ATOM   6168 O O    . CYS A 1 25 ? 4.864   -6.908  -4.583  1.00 0.00 ? 25 CYS A O    7 
ATOM   6169 C CB   . CYS A 1 25 ? 2.056   -8.714  -5.238  1.00 0.00 ? 25 CYS A CB   7 
ATOM   6170 S SG   . CYS A 1 25 ? 0.820   -9.191  -3.986  1.00 0.00 ? 25 CYS A SG   7 
ATOM   6171 H H    . CYS A 1 25 ? 1.204   -6.771  -6.666  1.00 0.00 ? 25 CYS A H    7 
ATOM   6172 H HA   . CYS A 1 25 ? 2.409   -6.942  -4.092  1.00 0.00 ? 25 CYS A HA   7 
ATOM   6173 H HB2  . CYS A 1 25 ? 1.604   -8.846  -6.209  1.00 0.00 ? 25 CYS A HB2  7 
ATOM   6174 H HB3  . CYS A 1 25 ? 2.896   -9.385  -5.144  1.00 0.00 ? 25 CYS A HB3  7 
ATOM   6175 N N    . GLY A 1 26 ? 4.366   -7.457  -6.706  1.00 0.00 ? 26 GLY A N    7 
ATOM   6176 C CA   . GLY A 1 26 ? 5.751   -7.409  -7.132  1.00 0.00 ? 26 GLY A CA   7 
ATOM   6177 C C    . GLY A 1 26 ? 6.398   -6.068  -6.845  1.00 0.00 ? 26 GLY A C    7 
ATOM   6178 O O    . GLY A 1 26 ? 7.601   -5.992  -6.596  1.00 0.00 ? 26 GLY A O    7 
ATOM   6179 H H    . GLY A 1 26 ? 3.663   -7.679  -7.352  1.00 0.00 ? 26 GLY A H    7 
ATOM   6180 H HA2  . GLY A 1 26 ? 6.302   -8.181  -6.614  1.00 0.00 ? 26 GLY A HA2  7 
ATOM   6181 H HA3  . GLY A 1 26 ? 5.797   -7.599  -8.194  1.00 0.00 ? 26 GLY A HA3  7 
ATOM   6182 N N    . ASN A 1 27 ? 5.597   -5.007  -6.882  1.00 0.00 ? 27 ASN A N    7 
ATOM   6183 C CA   . ASN A 1 27 ? 6.093   -3.669  -6.627  1.00 0.00 ? 27 ASN A CA   7 
ATOM   6184 C C    . ASN A 1 27 ? 6.456   -3.493  -5.166  1.00 0.00 ? 27 ASN A C    7 
ATOM   6185 O O    . ASN A 1 27 ? 7.624   -3.318  -4.818  1.00 0.00 ? 27 ASN A O    7 
ATOM   6186 C CB   . ASN A 1 27 ? 5.054   -2.626  -7.041  1.00 0.00 ? 27 ASN A CB   7 
ATOM   6187 C CG   . ASN A 1 27 ? 4.797   -2.627  -8.534  1.00 0.00 ? 27 ASN A CG   7 
ATOM   6188 O OD1  . ASN A 1 27 ? 3.693   -2.935  -8.986  1.00 0.00 ? 27 ASN A OD1  7 
ATOM   6189 N ND2  . ASN A 1 27 ? 5.817   -2.283  -9.311  1.00 0.00 ? 27 ASN A ND2  7 
ATOM   6190 H H    . ASN A 1 27 ? 4.653   -5.127  -7.087  1.00 0.00 ? 27 ASN A H    7 
ATOM   6191 H HA   . ASN A 1 27 ? 6.972   -3.539  -7.212  1.00 0.00 ? 27 ASN A HA   7 
ATOM   6192 H HB2  . ASN A 1 27 ? 4.123   -2.834  -6.534  1.00 0.00 ? 27 ASN A HB2  7 
ATOM   6193 H HB3  . ASN A 1 27 ? 5.403   -1.645  -6.754  1.00 0.00 ? 27 ASN A HB3  7 
ATOM   6194 H HD21 . ASN A 1 27 ? 6.667   -2.050  -8.882  1.00 0.00 ? 27 ASN A HD21 7 
ATOM   6195 H HD22 . ASN A 1 27 ? 5.679   -2.275  -10.281 1.00 0.00 ? 27 ASN A HD22 7 
ATOM   6196 N N    . LEU A 1 28 ? 5.448   -3.544  -4.315  1.00 0.00 ? 28 LEU A N    7 
ATOM   6197 C CA   . LEU A 1 28 ? 5.656   -3.394  -2.884  1.00 0.00 ? 28 LEU A CA   7 
ATOM   6198 C C    . LEU A 1 28 ? 6.717   -4.373  -2.391  1.00 0.00 ? 28 LEU A C    7 
ATOM   6199 O O    . LEU A 1 28 ? 7.386   -4.130  -1.387  1.00 0.00 ? 28 LEU A O    7 
ATOM   6200 C CB   . LEU A 1 28 ? 4.347   -3.593  -2.117  1.00 0.00 ? 28 LEU A CB   7 
ATOM   6201 C CG   . LEU A 1 28 ? 3.772   -5.004  -2.178  1.00 0.00 ? 28 LEU A CG   7 
ATOM   6202 C CD1  . LEU A 1 28 ? 4.261   -5.833  -1.002  1.00 0.00 ? 28 LEU A CD1  7 
ATOM   6203 C CD2  . LEU A 1 28 ? 2.251   -4.959  -2.207  1.00 0.00 ? 28 LEU A CD2  7 
ATOM   6204 H H    . LEU A 1 28 ? 4.548   -3.687  -4.661  1.00 0.00 ? 28 LEU A H    7 
ATOM   6205 H HA   . LEU A 1 28 ? 6.005   -2.396  -2.718  1.00 0.00 ? 28 LEU A HA   7 
ATOM   6206 H HB2  . LEU A 1 28 ? 4.521   -3.342  -1.080  1.00 0.00 ? 28 LEU A HB2  7 
ATOM   6207 H HB3  . LEU A 1 28 ? 3.613   -2.911  -2.517  1.00 0.00 ? 28 LEU A HB3  7 
ATOM   6208 H HG   . LEU A 1 28 ? 4.112   -5.478  -3.084  1.00 0.00 ? 28 LEU A HG   7 
ATOM   6209 H HD11 . LEU A 1 28 ? 3.603   -5.684  -0.159  1.00 0.00 ? 28 LEU A HD11 7 
ATOM   6210 H HD12 . LEU A 1 28 ? 5.262   -5.527  -0.736  1.00 0.00 ? 28 LEU A HD12 7 
ATOM   6211 H HD13 . LEU A 1 28 ? 4.264   -6.876  -1.275  1.00 0.00 ? 28 LEU A HD13 7 
ATOM   6212 H HD21 . LEU A 1 28 ? 1.868   -5.923  -2.507  1.00 0.00 ? 28 LEU A HD21 7 
ATOM   6213 H HD22 . LEU A 1 28 ? 1.926   -4.208  -2.911  1.00 0.00 ? 28 LEU A HD22 7 
ATOM   6214 H HD23 . LEU A 1 28 ? 1.880   -4.715  -1.223  1.00 0.00 ? 28 LEU A HD23 7 
ATOM   6215 N N    . ARG A 1 29 ? 6.869   -5.479  -3.114  1.00 0.00 ? 29 ARG A N    7 
ATOM   6216 C CA   . ARG A 1 29 ? 7.846   -6.492  -2.769  1.00 0.00 ? 29 ARG A CA   7 
ATOM   6217 C C    . ARG A 1 29 ? 9.243   -5.906  -2.733  1.00 0.00 ? 29 ARG A C    7 
ATOM   6218 O O    . ARG A 1 29 ? 10.014  -6.160  -1.808  1.00 0.00 ? 29 ARG A O    7 
ATOM   6219 C CB   . ARG A 1 29 ? 7.779   -7.647  -3.769  1.00 0.00 ? 29 ARG A CB   7 
ATOM   6220 C CG   . ARG A 1 29 ? 7.137   -8.911  -3.220  1.00 0.00 ? 29 ARG A CG   7 
ATOM   6221 C CD   . ARG A 1 29 ? 5.810   -8.633  -2.529  1.00 0.00 ? 29 ARG A CD   7 
ATOM   6222 N NE   . ARG A 1 29 ? 5.518   -9.623  -1.495  1.00 0.00 ? 29 ARG A NE   7 
ATOM   6223 C CZ   . ARG A 1 29 ? 5.023   -10.833 -1.745  1.00 0.00 ? 29 ARG A CZ   7 
ATOM   6224 N NH1  . ARG A 1 29 ? 4.766   -11.208 -2.992  1.00 0.00 ? 29 ARG A NH1  7 
ATOM   6225 N NH2  . ARG A 1 29 ? 4.786   -11.672 -0.746  1.00 0.00 ? 29 ARG A NH2  7 
ATOM   6226 H H    . ARG A 1 29 ? 6.310   -5.616  -3.900  1.00 0.00 ? 29 ARG A H    7 
ATOM   6227 H HA   . ARG A 1 29 ? 7.608   -6.849  -1.795  1.00 0.00 ? 29 ARG A HA   7 
ATOM   6228 H HB2  . ARG A 1 29 ? 7.208   -7.328  -4.629  1.00 0.00 ? 29 ARG A HB2  7 
ATOM   6229 H HB3  . ARG A 1 29 ? 8.782   -7.891  -4.088  1.00 0.00 ? 29 ARG A HB3  7 
ATOM   6230 H HG2  . ARG A 1 29 ? 6.963   -9.591  -4.038  1.00 0.00 ? 29 ARG A HG2  7 
ATOM   6231 H HG3  . ARG A 1 29 ? 7.813   -9.364  -2.513  1.00 0.00 ? 29 ARG A HG3  7 
ATOM   6232 H HD2  . ARG A 1 29 ? 5.850   -7.655  -2.076  1.00 0.00 ? 29 ARG A HD2  7 
ATOM   6233 H HD3  . ARG A 1 29 ? 5.023   -8.656  -3.267  1.00 0.00 ? 29 ARG A HD3  7 
ATOM   6234 H HE   . ARG A 1 29 ? 5.700   -9.373  -0.565  1.00 0.00 ? 29 ARG A HE   7 
ATOM   6235 H HH11 . ARG A 1 29 ? 4.944   -10.582 -3.751  1.00 0.00 ? 29 ARG A HH11 7 
ATOM   6236 H HH12 . ARG A 1 29 ? 4.395   -12.119 -3.173  1.00 0.00 ? 29 ARG A HH12 7 
ATOM   6237 H HH21 . ARG A 1 29 ? 4.979   -11.395 0.196   1.00 0.00 ? 29 ARG A HH21 7 
ATOM   6238 H HH22 . ARG A 1 29 ? 4.414   -12.581 -0.933  1.00 0.00 ? 29 ARG A HH22 7 
ATOM   6239 N N    . ALA A 1 30 ? 9.558   -5.106  -3.737  1.00 0.00 ? 30 ALA A N    7 
ATOM   6240 C CA   . ALA A 1 30 ? 10.860  -4.469  -3.809  1.00 0.00 ? 30 ALA A CA   7 
ATOM   6241 C C    . ALA A 1 30 ? 11.161  -3.731  -2.509  1.00 0.00 ? 30 ALA A C    7 
ATOM   6242 O O    . ALA A 1 30 ? 12.320  -3.541  -2.138  1.00 0.00 ? 30 ALA A O    7 
ATOM   6243 C CB   . ALA A 1 30 ? 10.921  -3.514  -4.992  1.00 0.00 ? 30 ALA A CB   7 
ATOM   6244 H H    . ALA A 1 30 ? 8.897   -4.935  -4.436  1.00 0.00 ? 30 ALA A H    7 
ATOM   6245 H HA   . ALA A 1 30 ? 11.595  -5.238  -3.955  1.00 0.00 ? 30 ALA A HA   7 
ATOM   6246 H HB1  . ALA A 1 30 ? 10.747  -2.505  -4.649  1.00 0.00 ? 30 ALA A HB1  7 
ATOM   6247 H HB2  . ALA A 1 30 ? 10.163  -3.786  -5.712  1.00 0.00 ? 30 ALA A HB2  7 
ATOM   6248 H HB3  . ALA A 1 30 ? 11.895  -3.575  -5.454  1.00 0.00 ? 30 ALA A HB3  7 
ATOM   6249 N N    . GLN A 1 31 ? 10.099  -3.329  -1.819  1.00 0.00 ? 31 GLN A N    7 
ATOM   6250 C CA   . GLN A 1 31 ? 10.224  -2.621  -0.551  1.00 0.00 ? 31 GLN A CA   7 
ATOM   6251 C C    . GLN A 1 31 ? 10.464  -3.596  0.594   1.00 0.00 ? 31 GLN A C    7 
ATOM   6252 O O    . GLN A 1 31 ? 11.561  -3.665  1.147   1.00 0.00 ? 31 GLN A O    7 
ATOM   6253 C CB   . GLN A 1 31 ? 8.975   -1.775  -0.279  1.00 0.00 ? 31 GLN A CB   7 
ATOM   6254 C CG   . GLN A 1 31 ? 8.297   -1.267  -1.539  1.00 0.00 ? 31 GLN A CG   7 
ATOM   6255 C CD   . GLN A 1 31 ? 7.643   0.084   -1.340  1.00 0.00 ? 31 GLN A CD   7 
ATOM   6256 O OE1  . GLN A 1 31 ? 6.525   0.178   -0.834  1.00 0.00 ? 31 GLN A OE1  7 
ATOM   6257 N NE2  . GLN A 1 31 ? 8.339   1.139   -1.739  1.00 0.00 ? 31 GLN A NE2  7 
ATOM   6258 H H    . GLN A 1 31 ? 9.202   -3.528  -2.168  1.00 0.00 ? 31 GLN A H    7 
ATOM   6259 H HA   . GLN A 1 31 ? 11.077  -1.965  -0.621  1.00 0.00 ? 31 GLN A HA   7 
ATOM   6260 H HB2  . GLN A 1 31 ? 8.262   -2.369  0.272   1.00 0.00 ? 31 GLN A HB2  7 
ATOM   6261 H HB3  . GLN A 1 31 ? 9.256   -0.920  0.319   1.00 0.00 ? 31 GLN A HB3  7 
ATOM   6262 H HG2  . GLN A 1 31 ? 9.036   -1.180  -2.320  1.00 0.00 ? 31 GLN A HG2  7 
ATOM   6263 H HG3  . GLN A 1 31 ? 7.543   -1.976  -1.836  1.00 0.00 ? 31 GLN A HG3  7 
ATOM   6264 H HE21 . GLN A 1 31 ? 9.227   0.986   -2.135  1.00 0.00 ? 31 GLN A HE21 7 
ATOM   6265 H HE22 . GLN A 1 31 ? 7.938   2.028   -1.622  1.00 0.00 ? 31 GLN A HE22 7 
ATOM   6266 N N    . GLN A 1 32 ? 9.424   -4.351  0.945   1.00 0.00 ? 32 GLN A N    7 
ATOM   6267 C CA   . GLN A 1 32 ? 9.509   -5.325  2.022   1.00 0.00 ? 32 GLN A CA   7 
ATOM   6268 C C    . GLN A 1 32 ? 10.065  -4.704  3.302   1.00 0.00 ? 32 GLN A C    7 
ATOM   6269 O O    . GLN A 1 32 ? 10.510  -5.411  4.207   1.00 0.00 ? 32 GLN A O    7 
ATOM   6270 C CB   . GLN A 1 32 ? 10.368  -6.495  1.580   1.00 0.00 ? 32 GLN A CB   7 
ATOM   6271 C CG   . GLN A 1 32 ? 9.798   -7.840  1.988   1.00 0.00 ? 32 GLN A CG   7 
ATOM   6272 C CD   . GLN A 1 32 ? 9.440   -8.708  0.798   1.00 0.00 ? 32 GLN A CD   7 
ATOM   6273 O OE1  . GLN A 1 32 ? 10.148  -9.663  0.476   1.00 0.00 ? 32 GLN A OE1  7 
ATOM   6274 N NE2  . GLN A 1 32 ? 8.336   -8.379  0.140   1.00 0.00 ? 32 GLN A NE2  7 
ATOM   6275 H H    . GLN A 1 32 ? 8.581   -4.253  0.463   1.00 0.00 ? 32 GLN A H    7 
ATOM   6276 H HA   . GLN A 1 32 ? 8.513   -5.686  2.221   1.00 0.00 ? 32 GLN A HA   7 
ATOM   6277 H HB2  . GLN A 1 32 ? 10.447  -6.469  0.503   1.00 0.00 ? 32 GLN A HB2  7 
ATOM   6278 H HB3  . GLN A 1 32 ? 11.350  -6.392  2.012   1.00 0.00 ? 32 GLN A HB3  7 
ATOM   6279 H HG2  . GLN A 1 32 ? 10.526  -8.360  2.590   1.00 0.00 ? 32 GLN A HG2  7 
ATOM   6280 H HG3  . GLN A 1 32 ? 8.904   -7.668  2.569   1.00 0.00 ? 32 GLN A HG3  7 
ATOM   6281 H HE21 . GLN A 1 32 ? 7.823   -7.605  0.454   1.00 0.00 ? 32 GLN A HE21 7 
ATOM   6282 H HE22 . GLN A 1 32 ? 8.078   -8.924  -0.632  1.00 0.00 ? 32 GLN A HE22 7 
ATOM   6283 N N    . GLY A 1 33 ? 10.028  -3.379  3.369   1.00 0.00 ? 33 GLY A N    7 
ATOM   6284 C CA   . GLY A 1 33 ? 10.520  -2.673  4.536   1.00 0.00 ? 33 GLY A CA   7 
ATOM   6285 C C    . GLY A 1 33 ? 10.429  -1.170  4.369   1.00 0.00 ? 33 GLY A C    7 
ATOM   6286 O O    . GLY A 1 33 ? 11.227  -0.424  4.937   1.00 0.00 ? 33 GLY A O    7 
ATOM   6287 H H    . GLY A 1 33 ? 9.660   -2.874  2.617   1.00 0.00 ? 33 GLY A H    7 
ATOM   6288 H HA2  . GLY A 1 33 ? 9.936   -2.967  5.396   1.00 0.00 ? 33 GLY A HA2  7 
ATOM   6289 H HA3  . GLY A 1 33 ? 11.551  -2.945  4.703   1.00 0.00 ? 33 GLY A HA3  7 
ATOM   6290 N N    . CYS A 1 34 ? 9.460   -0.725  3.573   1.00 0.00 ? 34 CYS A N    7 
ATOM   6291 C CA   . CYS A 1 34 ? 9.270   0.682   3.313   1.00 0.00 ? 34 CYS A CA   7 
ATOM   6292 C C    . CYS A 1 34 ? 7.796   1.061   3.344   1.00 0.00 ? 34 CYS A C    7 
ATOM   6293 O O    . CYS A 1 34 ? 7.433   2.162   3.759   1.00 0.00 ? 34 CYS A O    7 
ATOM   6294 C CB   . CYS A 1 34 ? 9.853   1.028   1.959   1.00 0.00 ? 34 CYS A CB   7 
ATOM   6295 S SG   . CYS A 1 34 ? 10.385  2.762   1.778   1.00 0.00 ? 34 CYS A SG   7 
ATOM   6296 H H    . CYS A 1 34 ? 8.874   -1.356  3.145   1.00 0.00 ? 34 CYS A H    7 
ATOM   6297 H HA   . CYS A 1 34 ? 9.783   1.216   4.060   1.00 0.00 ? 34 CYS A HA   7 
ATOM   6298 H HB2  . CYS A 1 34 ? 10.701  0.390   1.771   1.00 0.00 ? 34 CYS A HB2  7 
ATOM   6299 H HB3  . CYS A 1 34 ? 9.100   0.845   1.219   1.00 0.00 ? 34 CYS A HB3  7 
ATOM   6300 N N    . PHE A 1 35 ? 6.951   0.145   2.886   1.00 0.00 ? 35 PHE A N    7 
ATOM   6301 C CA   . PHE A 1 35 ? 5.511   0.383   2.842   1.00 0.00 ? 35 PHE A CA   7 
ATOM   6302 C C    . PHE A 1 35 ? 4.987   0.855   4.188   1.00 0.00 ? 35 PHE A C    7 
ATOM   6303 O O    . PHE A 1 35 ? 4.276   1.855   4.285   1.00 0.00 ? 35 PHE A O    7 
ATOM   6304 C CB   . PHE A 1 35 ? 4.740   -0.874  2.412   1.00 0.00 ? 35 PHE A CB   7 
ATOM   6305 C CG   . PHE A 1 35 ? 5.372   -2.194  2.779   1.00 0.00 ? 35 PHE A CG   7 
ATOM   6306 C CD1  . PHE A 1 35 ? 5.255   -2.694  4.067   1.00 0.00 ? 35 PHE A CD1  7 
ATOM   6307 C CD2  . PHE A 1 35 ? 6.049   -2.954  1.832   1.00 0.00 ? 35 PHE A CD2  7 
ATOM   6308 C CE1  . PHE A 1 35 ? 5.806   -3.914  4.408   1.00 0.00 ? 35 PHE A CE1  7 
ATOM   6309 C CE2  . PHE A 1 35 ? 6.595   -4.176  2.169   1.00 0.00 ? 35 PHE A CE2  7 
ATOM   6310 C CZ   . PHE A 1 35 ? 6.476   -4.656  3.458   1.00 0.00 ? 35 PHE A CZ   7 
ATOM   6311 H H    . PHE A 1 35 ? 7.308   -0.703  2.562   1.00 0.00 ? 35 PHE A H    7 
ATOM   6312 H HA   . PHE A 1 35 ? 5.335   1.159   2.122   1.00 0.00 ? 35 PHE A HA   7 
ATOM   6313 H HB2  . PHE A 1 35 ? 3.773   -0.850  2.885   1.00 0.00 ? 35 PHE A HB2  7 
ATOM   6314 H HB3  . PHE A 1 35 ? 4.609   -0.854  1.341   1.00 0.00 ? 35 PHE A HB3  7 
ATOM   6315 H HD1  . PHE A 1 35 ? 4.729   -2.118  4.813   1.00 0.00 ? 35 PHE A HD1  7 
ATOM   6316 H HD2  . PHE A 1 35 ? 6.155   -2.585  0.823   1.00 0.00 ? 35 PHE A HD2  7 
ATOM   6317 H HE1  . PHE A 1 35 ? 5.711   -4.288  5.416   1.00 0.00 ? 35 PHE A HE1  7 
ATOM   6318 H HE2  . PHE A 1 35 ? 7.112   -4.758  1.424   1.00 0.00 ? 35 PHE A HE2  7 
ATOM   6319 H HZ   . PHE A 1 35 ? 6.904   -5.612  3.720   1.00 0.00 ? 35 PHE A HZ   7 
ATOM   6320 N N    . CYS A 1 36 ? 5.345   0.115   5.213   1.00 0.00 ? 36 CYS A N    7 
ATOM   6321 C CA   . CYS A 1 36 ? 4.924   0.416   6.578   1.00 0.00 ? 36 CYS A CA   7 
ATOM   6322 C C    . CYS A 1 36 ? 5.246   1.861   6.949   1.00 0.00 ? 36 CYS A C    7 
ATOM   6323 O O    . CYS A 1 36 ? 4.443   2.543   7.585   1.00 0.00 ? 36 CYS A O    7 
ATOM   6324 C CB   . CYS A 1 36 ? 5.602   -0.538  7.564   1.00 0.00 ? 36 CYS A CB   7 
ATOM   6325 S SG   . CYS A 1 36 ? 4.502   -1.147  8.884   1.00 0.00 ? 36 CYS A SG   7 
ATOM   6326 H H    . CYS A 1 36 ? 5.906   -0.663  5.042   1.00 0.00 ? 36 CYS A H    7 
ATOM   6327 H HA   . CYS A 1 36 ? 3.855   0.275   6.633   1.00 0.00 ? 36 CYS A HA   7 
ATOM   6328 H HB2  . CYS A 1 36 ? 5.973   -1.397  7.025   1.00 0.00 ? 36 CYS A HB2  7 
ATOM   6329 H HB3  . CYS A 1 36 ? 6.431   -0.030  8.035   1.00 0.00 ? 36 CYS A HB3  7 
ATOM   6330 N N    . GLN A 1 37 ? 6.429   2.318   6.553   1.00 0.00 ? 37 GLN A N    7 
ATOM   6331 C CA   . GLN A 1 37 ? 6.862   3.678   6.848   1.00 0.00 ? 37 GLN A CA   7 
ATOM   6332 C C    . GLN A 1 37 ? 5.845   4.701   6.357   1.00 0.00 ? 37 GLN A C    7 
ATOM   6333 O O    . GLN A 1 37 ? 5.709   5.783   6.929   1.00 0.00 ? 37 GLN A O    7 
ATOM   6334 C CB   . GLN A 1 37 ? 8.224   3.952   6.211   1.00 0.00 ? 37 GLN A CB   7 
ATOM   6335 C CG   . GLN A 1 37 ? 9.342   3.090   6.772   1.00 0.00 ? 37 GLN A CG   7 
ATOM   6336 C CD   . GLN A 1 37 ? 10.654  3.290   6.040   1.00 0.00 ? 37 GLN A CD   7 
ATOM   6337 O OE1  . GLN A 1 37 ? 11.701  3.480   6.659   1.00 0.00 ? 37 GLN A OE1  7 
ATOM   6338 N NE2  . GLN A 1 37 ? 10.604  3.248   4.714   1.00 0.00 ? 37 GLN A NE2  7 
ATOM   6339 H H    . GLN A 1 37 ? 7.026   1.726   6.056   1.00 0.00 ? 37 GLN A H    7 
ATOM   6340 H HA   . GLN A 1 37 ? 6.951   3.763   7.913   1.00 0.00 ? 37 GLN A HA   7 
ATOM   6341 H HB2  . GLN A 1 37 ? 8.154   3.770   5.150   1.00 0.00 ? 37 GLN A HB2  7 
ATOM   6342 H HB3  . GLN A 1 37 ? 8.481   4.988   6.374   1.00 0.00 ? 37 GLN A HB3  7 
ATOM   6343 H HG2  . GLN A 1 37 ? 9.487   3.341   7.812   1.00 0.00 ? 37 GLN A HG2  7 
ATOM   6344 H HG3  . GLN A 1 37 ? 9.055   2.052   6.690   1.00 0.00 ? 37 GLN A HG3  7 
ATOM   6345 H HE21 . GLN A 1 37 ? 9.734   3.092   4.288   1.00 0.00 ? 37 GLN A HE21 7 
ATOM   6346 H HE22 . GLN A 1 37 ? 11.437  3.372   4.215   1.00 0.00 ? 37 GLN A HE22 7 
ATOM   6347 N N    . TYR A 1 38 ? 5.135   4.350   5.295   1.00 0.00 ? 38 TYR A N    7 
ATOM   6348 C CA   . TYR A 1 38 ? 4.128   5.233   4.719   1.00 0.00 ? 38 TYR A CA   7 
ATOM   6349 C C    . TYR A 1 38 ? 2.829   5.182   5.520   1.00 0.00 ? 38 TYR A C    7 
ATOM   6350 O O    . TYR A 1 38 ? 2.023   6.110   5.473   1.00 0.00 ? 38 TYR A O    7 
ATOM   6351 C CB   . TYR A 1 38 ? 3.861   4.849   3.262   1.00 0.00 ? 38 TYR A CB   7 
ATOM   6352 C CG   . TYR A 1 38 ? 5.006   5.180   2.332   1.00 0.00 ? 38 TYR A CG   7 
ATOM   6353 C CD1  . TYR A 1 38 ? 5.320   6.499   2.030   1.00 0.00 ? 38 TYR A CD1  7 
ATOM   6354 C CD2  . TYR A 1 38 ? 5.773   4.174   1.758   1.00 0.00 ? 38 TYR A CD2  7 
ATOM   6355 C CE1  . TYR A 1 38 ? 6.367   6.806   1.181   1.00 0.00 ? 38 TYR A CE1  7 
ATOM   6356 C CE2  . TYR A 1 38 ? 6.822   4.474   0.909   1.00 0.00 ? 38 TYR A CE2  7 
ATOM   6357 C CZ   . TYR A 1 38 ? 7.114   5.791   0.624   1.00 0.00 ? 38 TYR A CZ   7 
ATOM   6358 O OH   . TYR A 1 38 ? 8.157   6.093   -0.221  1.00 0.00 ? 38 TYR A OH   7 
ATOM   6359 H H    . TYR A 1 38 ? 5.294   3.474   4.888   1.00 0.00 ? 38 TYR A H    7 
ATOM   6360 H HA   . TYR A 1 38 ? 4.515   6.241   4.749   1.00 0.00 ? 38 TYR A HA   7 
ATOM   6361 H HB2  . TYR A 1 38 ? 3.684   3.785   3.205   1.00 0.00 ? 38 TYR A HB2  7 
ATOM   6362 H HB3  . TYR A 1 38 ? 2.984   5.375   2.913   1.00 0.00 ? 38 TYR A HB3  7 
ATOM   6363 H HD1  . TYR A 1 38 ? 4.733   7.292   2.468   1.00 0.00 ? 38 TYR A HD1  7 
ATOM   6364 H HD2  . TYR A 1 38 ? 5.541   3.144   1.983   1.00 0.00 ? 38 TYR A HD2  7 
ATOM   6365 H HE1  . TYR A 1 38 ? 6.596   7.838   0.959   1.00 0.00 ? 38 TYR A HE1  7 
ATOM   6366 H HE2  . TYR A 1 38 ? 7.407   3.678   0.473   1.00 0.00 ? 38 TYR A HE2  7 
ATOM   6367 H HH   . TYR A 1 38 ? 7.902   6.815   -0.799  1.00 0.00 ? 38 TYR A HH   7 
ATOM   6368 N N    . ALA A 1 39 ? 2.633   4.089   6.252   1.00 0.00 ? 39 ALA A N    7 
ATOM   6369 C CA   . ALA A 1 39 ? 1.436   3.909   7.060   1.00 0.00 ? 39 ALA A CA   7 
ATOM   6370 C C    . ALA A 1 39 ? 1.245   5.049   8.057   1.00 0.00 ? 39 ALA A C    7 
ATOM   6371 O O    . ALA A 1 39 ? 0.145   5.257   8.569   1.00 0.00 ? 39 ALA A O    7 
ATOM   6372 C CB   . ALA A 1 39 ? 1.493   2.577   7.789   1.00 0.00 ? 39 ALA A CB   7 
ATOM   6373 H H    . ALA A 1 39 ? 3.307   3.383   6.245   1.00 0.00 ? 39 ALA A H    7 
ATOM   6374 H HA   . ALA A 1 39 ? 0.595   3.886   6.392   1.00 0.00 ? 39 ALA A HA   7 
ATOM   6375 H HB1  . ALA A 1 39 ? 2.319   2.582   8.485   1.00 0.00 ? 39 ALA A HB1  7 
ATOM   6376 H HB2  . ALA A 1 39 ? 1.630   1.780   7.074   1.00 0.00 ? 39 ALA A HB2  7 
ATOM   6377 H HB3  . ALA A 1 39 ? 0.570   2.422   8.328   1.00 0.00 ? 39 ALA A HB3  7 
ATOM   6378 N N    . LYS A 1 40 ? 2.318   5.783   8.335   1.00 0.00 ? 40 LYS A N    7 
ATOM   6379 C CA   . LYS A 1 40 ? 2.257   6.896   9.277   1.00 0.00 ? 40 LYS A CA   7 
ATOM   6380 C C    . LYS A 1 40 ? 2.372   8.240   8.560   1.00 0.00 ? 40 LYS A C    7 
ATOM   6381 O O    . LYS A 1 40 ? 2.504   9.283   9.200   1.00 0.00 ? 40 LYS A O    7 
ATOM   6382 C CB   . LYS A 1 40 ? 3.368   6.768   10.321  1.00 0.00 ? 40 LYS A CB   7 
ATOM   6383 C CG   . LYS A 1 40 ? 3.065   7.493   11.622  1.00 0.00 ? 40 LYS A CG   7 
ATOM   6384 C CD   . LYS A 1 40 ? 1.926   6.828   12.378  1.00 0.00 ? 40 LYS A CD   7 
ATOM   6385 C CE   . LYS A 1 40 ? 0.615   7.571   12.178  1.00 0.00 ? 40 LYS A CE   7 
ATOM   6386 N NZ   . LYS A 1 40 ? -0.261  7.488   13.380  1.00 0.00 ? 40 LYS A NZ   7 
ATOM   6387 H H    . LYS A 1 40 ? 3.168   5.571   7.900   1.00 0.00 ? 40 LYS A H    7 
ATOM   6388 H HA   . LYS A 1 40 ? 1.302   6.852   9.778   1.00 0.00 ? 40 LYS A HA   7 
ATOM   6389 H HB2  . LYS A 1 40 ? 3.518   5.722   10.543  1.00 0.00 ? 40 LYS A HB2  7 
ATOM   6390 H HB3  . LYS A 1 40 ? 4.281   7.175   9.911   1.00 0.00 ? 40 LYS A HB3  7 
ATOM   6391 H HG2  . LYS A 1 40 ? 3.949   7.484   12.242  1.00 0.00 ? 40 LYS A HG2  7 
ATOM   6392 H HG3  . LYS A 1 40 ? 2.791   8.514   11.399  1.00 0.00 ? 40 LYS A HG3  7 
ATOM   6393 H HD2  . LYS A 1 40 ? 1.813   5.816   12.021  1.00 0.00 ? 40 LYS A HD2  7 
ATOM   6394 H HD3  . LYS A 1 40 ? 2.166   6.815   13.432  1.00 0.00 ? 40 LYS A HD3  7 
ATOM   6395 H HE2  . LYS A 1 40 ? 0.832   8.609   11.973  1.00 0.00 ? 40 LYS A HE2  7 
ATOM   6396 H HE3  . LYS A 1 40 ? 0.097   7.139   11.335  1.00 0.00 ? 40 LYS A HE3  7 
ATOM   6397 H HZ1  . LYS A 1 40 ? -0.702  6.547   13.436  1.00 0.00 ? 40 LYS A HZ1  7 
ATOM   6398 H HZ2  . LYS A 1 40 ? -1.010  8.207   13.327  1.00 0.00 ? 40 LYS A HZ2  7 
ATOM   6399 H HZ3  . LYS A 1 40 ? 0.299   7.649   14.242  1.00 0.00 ? 40 LYS A HZ3  7 
ATOM   6400 N N    . ASP A 1 41 ? 2.320   8.210   7.232   1.00 0.00 ? 41 ASP A N    7 
ATOM   6401 C CA   . ASP A 1 41 ? 2.416   9.428   6.438   1.00 0.00 ? 41 ASP A CA   7 
ATOM   6402 C C    . ASP A 1 41 ? 1.071   10.157  6.403   1.00 0.00 ? 41 ASP A C    7 
ATOM   6403 O O    . ASP A 1 41 ? 0.035   9.546   6.140   1.00 0.00 ? 41 ASP A O    7 
ATOM   6404 C CB   . ASP A 1 41 ? 2.878   9.088   5.018   1.00 0.00 ? 41 ASP A CB   7 
ATOM   6405 C CG   . ASP A 1 41 ? 2.905   10.299  4.105   1.00 0.00 ? 41 ASP A CG   7 
ATOM   6406 O OD1  . ASP A 1 41 ? 1.834   10.904  3.887   1.00 0.00 ? 41 ASP A OD1  7 
ATOM   6407 O OD2  . ASP A 1 41 ? 3.998   10.643  3.608   1.00 0.00 ? 41 ASP A OD2  7 
ATOM   6408 H H    . ASP A 1 41 ? 2.212   7.351   6.774   1.00 0.00 ? 41 ASP A H    7 
ATOM   6409 H HA   . ASP A 1 41 ? 3.151   10.067  6.902   1.00 0.00 ? 41 ASP A HA   7 
ATOM   6410 H HB2  . ASP A 1 41 ? 3.876   8.674   5.063   1.00 0.00 ? 41 ASP A HB2  7 
ATOM   6411 H HB3  . ASP A 1 41 ? 2.205   8.353   4.597   1.00 0.00 ? 41 ASP A HB3  7 
ATOM   6412 N N    . PRO A 1 42 ? 1.066   11.475  6.676   1.00 0.00 ? 42 PRO A N    7 
ATOM   6413 C CA   . PRO A 1 42 ? -0.165  12.275  6.681   1.00 0.00 ? 42 PRO A CA   7 
ATOM   6414 C C    . PRO A 1 42 ? -0.806  12.384  5.299   1.00 0.00 ? 42 PRO A C    7 
ATOM   6415 O O    . PRO A 1 42 ? -1.957  11.992  5.107   1.00 0.00 ? 42 PRO A O    7 
ATOM   6416 C CB   . PRO A 1 42 ? 0.295   13.653  7.167   1.00 0.00 ? 42 PRO A CB   7 
ATOM   6417 C CG   . PRO A 1 42 ? 1.758   13.699  6.889   1.00 0.00 ? 42 PRO A CG   7 
ATOM   6418 C CD   . PRO A 1 42 ? 2.253   12.285  7.009   1.00 0.00 ? 42 PRO A CD   7 
ATOM   6419 H HA   . PRO A 1 42 ? -0.889  11.872  7.374   1.00 0.00 ? 42 PRO A HA   7 
ATOM   6420 H HB2  . PRO A 1 42 ? -0.234  14.423  6.624   1.00 0.00 ? 42 PRO A HB2  7 
ATOM   6421 H HB3  . PRO A 1 42 ? 0.092   13.749  8.224   1.00 0.00 ? 42 PRO A HB3  7 
ATOM   6422 H HG2  . PRO A 1 42 ? 1.932   14.074  5.892   1.00 0.00 ? 42 PRO A HG2  7 
ATOM   6423 H HG3  . PRO A 1 42 ? 2.248   14.329  7.617   1.00 0.00 ? 42 PRO A HG3  7 
ATOM   6424 H HD2  . PRO A 1 42 ? 3.052   12.104  6.306   1.00 0.00 ? 42 PRO A HD2  7 
ATOM   6425 H HD3  . PRO A 1 42 ? 2.583   12.086  8.018   1.00 0.00 ? 42 PRO A HD3  7 
ATOM   6426 N N    . THR A 1 43 ? -0.059  12.926  4.342   1.00 0.00 ? 43 THR A N    7 
ATOM   6427 C CA   . THR A 1 43 ? -0.560  13.094  2.980   1.00 0.00 ? 43 THR A CA   7 
ATOM   6428 C C    . THR A 1 43 ? -1.084  11.776  2.414   1.00 0.00 ? 43 THR A C    7 
ATOM   6429 O O    . THR A 1 43 ? -1.960  11.767  1.549   1.00 0.00 ? 43 THR A O    7 
ATOM   6430 C CB   . THR A 1 43 ? 0.542   13.648  2.075   1.00 0.00 ? 43 THR A CB   7 
ATOM   6431 O OG1  . THR A 1 43 ? 1.820   13.259  2.545   1.00 0.00 ? 43 THR A OG1  7 
ATOM   6432 C CG2  . THR A 1 43 ? 0.529   15.158  1.975   1.00 0.00 ? 43 THR A CG2  7 
ATOM   6433 H H    . THR A 1 43 ? 0.849   13.225  4.555   1.00 0.00 ? 43 THR A H    7 
ATOM   6434 H HA   . THR A 1 43 ? -1.373  13.803  3.013   1.00 0.00 ? 43 THR A HA   7 
ATOM   6435 H HB   . THR A 1 43 ? 0.411   13.250  1.079   1.00 0.00 ? 43 THR A HB   7 
ATOM   6436 H HG1  . THR A 1 43 ? 2.056   12.410  2.165   1.00 0.00 ? 43 THR A HG1  7 
ATOM   6437 H HG21 . THR A 1 43 ? 1.396   15.490  1.423   1.00 0.00 ? 43 THR A HG21 7 
ATOM   6438 H HG22 . THR A 1 43 ? 0.550   15.585  2.967   1.00 0.00 ? 43 THR A HG22 7 
ATOM   6439 H HG23 . THR A 1 43 ? -0.367  15.478  1.464   1.00 0.00 ? 43 THR A HG23 7 
ATOM   6440 N N    . TYR A 1 44 ? -0.542  10.666  2.904   1.00 0.00 ? 44 TYR A N    7 
ATOM   6441 C CA   . TYR A 1 44 ? -0.957  9.346   2.442   1.00 0.00 ? 44 TYR A CA   7 
ATOM   6442 C C    . TYR A 1 44 ? -1.981  8.724   3.390   1.00 0.00 ? 44 TYR A C    7 
ATOM   6443 O O    . TYR A 1 44 ? -2.237  7.521   3.337   1.00 0.00 ? 44 TYR A O    7 
ATOM   6444 C CB   . TYR A 1 44 ? 0.259   8.427   2.318   1.00 0.00 ? 44 TYR A CB   7 
ATOM   6445 C CG   . TYR A 1 44 ? 1.078   8.651   1.063   1.00 0.00 ? 44 TYR A CG   7 
ATOM   6446 C CD1  . TYR A 1 44 ? 1.141   9.902   0.458   1.00 0.00 ? 44 TYR A CD1  7 
ATOM   6447 C CD2  . TYR A 1 44 ? 1.791   7.608   0.484   1.00 0.00 ? 44 TYR A CD2  7 
ATOM   6448 C CE1  . TYR A 1 44 ? 1.890   10.106  -0.685  1.00 0.00 ? 44 TYR A CE1  7 
ATOM   6449 C CE2  . TYR A 1 44 ? 2.543   7.805   -0.659  1.00 0.00 ? 44 TYR A CE2  7 
ATOM   6450 C CZ   . TYR A 1 44 ? 2.588   9.055   -1.239  1.00 0.00 ? 44 TYR A CZ   7 
ATOM   6451 O OH   . TYR A 1 44 ? 3.336   9.254   -2.378  1.00 0.00 ? 44 TYR A OH   7 
ATOM   6452 H H    . TYR A 1 44 ? 0.154   10.735  3.590   1.00 0.00 ? 44 TYR A H    7 
ATOM   6453 H HA   . TYR A 1 44 ? -1.410  9.462   1.468   1.00 0.00 ? 44 TYR A HA   7 
ATOM   6454 H HB2  . TYR A 1 44 ? 0.905   8.586   3.166   1.00 0.00 ? 44 TYR A HB2  7 
ATOM   6455 H HB3  . TYR A 1 44 ? -0.077  7.400   2.317   1.00 0.00 ? 44 TYR A HB3  7 
ATOM   6456 H HD1  . TYR A 1 44 ? 0.593   10.724  0.893   1.00 0.00 ? 44 TYR A HD1  7 
ATOM   6457 H HD2  . TYR A 1 44 ? 1.754   6.630   0.941   1.00 0.00 ? 44 TYR A HD2  7 
ATOM   6458 H HE1  . TYR A 1 44 ? 1.926   11.085  -1.140  1.00 0.00 ? 44 TYR A HE1  7 
ATOM   6459 H HE2  . TYR A 1 44 ? 3.090   6.982   -1.093  1.00 0.00 ? 44 TYR A HE2  7 
ATOM   6460 H HH   . TYR A 1 44 ? 3.250   8.491   -2.955  1.00 0.00 ? 44 TYR A HH   7 
ATOM   6461 N N    . GLY A 1 45 ? -2.563  9.548   4.256   1.00 0.00 ? 45 GLY A N    7 
ATOM   6462 C CA   . GLY A 1 45 ? -3.549  9.055   5.201   1.00 0.00 ? 45 GLY A CA   7 
ATOM   6463 C C    . GLY A 1 45 ? -4.759  8.449   4.518   1.00 0.00 ? 45 GLY A C    7 
ATOM   6464 O O    . GLY A 1 45 ? -5.343  7.486   5.015   1.00 0.00 ? 45 GLY A O    7 
ATOM   6465 H H    . GLY A 1 45 ? -2.322  10.496  4.256   1.00 0.00 ? 45 GLY A H    7 
ATOM   6466 H HA2  . GLY A 1 45 ? -3.089  8.304   5.825   1.00 0.00 ? 45 GLY A HA2  7 
ATOM   6467 H HA3  . GLY A 1 45 ? -3.875  9.875   5.824   1.00 0.00 ? 45 GLY A HA3  7 
ATOM   6468 N N    . GLN A 1 46 ? -5.138  9.014   3.376   1.00 0.00 ? 46 GLN A N    7 
ATOM   6469 C CA   . GLN A 1 46 ? -6.286  8.524   2.625   1.00 0.00 ? 46 GLN A CA   7 
ATOM   6470 C C    . GLN A 1 46 ? -5.969  7.193   1.951   1.00 0.00 ? 46 GLN A C    7 
ATOM   6471 O O    . GLN A 1 46 ? -6.863  6.388   1.694   1.00 0.00 ? 46 GLN A O    7 
ATOM   6472 C CB   . GLN A 1 46 ? -6.712  9.553   1.576   1.00 0.00 ? 46 GLN A CB   7 
ATOM   6473 C CG   . GLN A 1 46 ? -6.852  10.963  2.127   1.00 0.00 ? 46 GLN A CG   7 
ATOM   6474 C CD   . GLN A 1 46 ? -8.273  11.287  2.545   1.00 0.00 ? 46 GLN A CD   7 
ATOM   6475 O OE1  . GLN A 1 46 ? -9.223  10.630  2.118   1.00 0.00 ? 46 GLN A OE1  7 
ATOM   6476 N NE2  . GLN A 1 46 ? -8.425  12.305  3.384   1.00 0.00 ? 46 GLN A NE2  7 
ATOM   6477 H H    . GLN A 1 46 ? -4.635  9.777   3.030   1.00 0.00 ? 46 GLN A H    7 
ATOM   6478 H HA   . GLN A 1 46 ? -7.095  8.379   3.322   1.00 0.00 ? 46 GLN A HA   7 
ATOM   6479 H HB2  . GLN A 1 46 ? -5.976  9.570   0.785   1.00 0.00 ? 46 GLN A HB2  7 
ATOM   6480 H HB3  . GLN A 1 46 ? -7.664  9.255   1.162   1.00 0.00 ? 46 GLN A HB3  7 
ATOM   6481 H HG2  . GLN A 1 46 ? -6.208  11.065  2.987   1.00 0.00 ? 46 GLN A HG2  7 
ATOM   6482 H HG3  . GLN A 1 46 ? -6.547  11.665  1.365   1.00 0.00 ? 46 GLN A HG3  7 
ATOM   6483 H HE21 . GLN A 1 46 ? -7.619  12.784  3.683   1.00 0.00 ? 46 GLN A HE21 7 
ATOM   6484 H HE22 . GLN A 1 46 ? -9.338  12.536  3.671   1.00 0.00 ? 46 GLN A HE22 7 
ATOM   6485 N N    . TYR A 1 47 ? -4.690  6.971   1.667   1.00 0.00 ? 47 TYR A N    7 
ATOM   6486 C CA   . TYR A 1 47 ? -4.252  5.740   1.021   1.00 0.00 ? 47 TYR A CA   7 
ATOM   6487 C C    . TYR A 1 47 ? -4.262  4.579   2.007   1.00 0.00 ? 47 TYR A C    7 
ATOM   6488 O O    . TYR A 1 47 ? -4.748  3.490   1.700   1.00 0.00 ? 47 TYR A O    7 
ATOM   6489 C CB   . TYR A 1 47 ? -2.853  5.917   0.456   1.00 0.00 ? 47 TYR A CB   7 
ATOM   6490 C CG   . TYR A 1 47 ? -2.540  5.011   -0.711  1.00 0.00 ? 47 TYR A CG   7 
ATOM   6491 C CD1  . TYR A 1 47 ? -2.855  5.390   -2.008  1.00 0.00 ? 47 TYR A CD1  7 
ATOM   6492 C CD2  . TYR A 1 47 ? -1.921  3.783   -0.517  1.00 0.00 ? 47 TYR A CD2  7 
ATOM   6493 C CE1  . TYR A 1 47 ? -2.565  4.570   -3.080  1.00 0.00 ? 47 TYR A CE1  7 
ATOM   6494 C CE2  . TYR A 1 47 ? -1.625  2.957   -1.585  1.00 0.00 ? 47 TYR A CE2  7 
ATOM   6495 C CZ   . TYR A 1 47 ? -1.949  3.355   -2.864  1.00 0.00 ? 47 TYR A CZ   7 
ATOM   6496 O OH   . TYR A 1 47 ? -1.656  2.538   -3.931  1.00 0.00 ? 47 TYR A OH   7 
ATOM   6497 H H    . TYR A 1 47 ? -4.024  7.652   1.895   1.00 0.00 ? 47 TYR A H    7 
ATOM   6498 H HA   . TYR A 1 47 ? -4.924  5.524   0.218   1.00 0.00 ? 47 TYR A HA   7 
ATOM   6499 H HB2  . TYR A 1 47 ? -2.725  6.940   0.128   1.00 0.00 ? 47 TYR A HB2  7 
ATOM   6500 H HB3  . TYR A 1 47 ? -2.149  5.699   1.234   1.00 0.00 ? 47 TYR A HB3  7 
ATOM   6501 H HD1  . TYR A 1 47 ? -3.337  6.343   -2.173  1.00 0.00 ? 47 TYR A HD1  7 
ATOM   6502 H HD2  . TYR A 1 47 ? -1.670  3.474   0.487   1.00 0.00 ? 47 TYR A HD2  7 
ATOM   6503 H HE1  . TYR A 1 47 ? -2.819  4.883   -4.081  1.00 0.00 ? 47 TYR A HE1  7 
ATOM   6504 H HE2  . TYR A 1 47 ? -1.143  2.005   -1.414  1.00 0.00 ? 47 TYR A HE2  7 
ATOM   6505 H HH   . TYR A 1 47 ? -0.718  2.592   -4.128  1.00 0.00 ? 47 TYR A HH   7 
ATOM   6506 N N    . ILE A 1 48 ? -3.713  4.820   3.193   1.00 0.00 ? 48 ILE A N    7 
ATOM   6507 C CA   . ILE A 1 48 ? -3.645  3.802   4.230   1.00 0.00 ? 48 ILE A CA   7 
ATOM   6508 C C    . ILE A 1 48 ? -5.023  3.496   4.807   1.00 0.00 ? 48 ILE A C    7 
ATOM   6509 O O    . ILE A 1 48 ? -5.326  2.348   5.131   1.00 0.00 ? 48 ILE A O    7 
ATOM   6510 C CB   . ILE A 1 48 ? -2.704  4.231   5.373   1.00 0.00 ? 48 ILE A CB   7 
ATOM   6511 C CG1  . ILE A 1 48 ? -1.340  4.640   4.812   1.00 0.00 ? 48 ILE A CG1  7 
ATOM   6512 C CG2  . ILE A 1 48 ? -2.553  3.109   6.391   1.00 0.00 ? 48 ILE A CG2  7 
ATOM   6513 C CD1  . ILE A 1 48 ? -0.557  3.486   4.222   1.00 0.00 ? 48 ILE A CD1  7 
ATOM   6514 H H    . ILE A 1 48 ? -3.338  5.706   3.372   1.00 0.00 ? 48 ILE A H    7 
ATOM   6515 H HA   . ILE A 1 48 ? -3.245  2.905   3.784   1.00 0.00 ? 48 ILE A HA   7 
ATOM   6516 H HB   . ILE A 1 48 ? -3.147  5.079   5.874   1.00 0.00 ? 48 ILE A HB   7 
ATOM   6517 H HG12 . ILE A 1 48 ? -1.484  5.374   4.034   1.00 0.00 ? 48 ILE A HG12 7 
ATOM   6518 H HG13 . ILE A 1 48 ? -0.748  5.074   5.604   1.00 0.00 ? 48 ILE A HG13 7 
ATOM   6519 H HG21 . ILE A 1 48 ? -2.006  3.473   7.249   1.00 0.00 ? 48 ILE A HG21 7 
ATOM   6520 H HG22 . ILE A 1 48 ? -2.015  2.287   5.944   1.00 0.00 ? 48 ILE A HG22 7 
ATOM   6521 H HG23 . ILE A 1 48 ? -3.530  2.772   6.704   1.00 0.00 ? 48 ILE A HG23 7 
ATOM   6522 H HD11 . ILE A 1 48 ? -1.052  3.135   3.328   1.00 0.00 ? 48 ILE A HD11 7 
ATOM   6523 H HD12 . ILE A 1 48 ? -0.501  2.682   4.941   1.00 0.00 ? 48 ILE A HD12 7 
ATOM   6524 H HD13 . ILE A 1 48 ? 0.440   3.818   3.974   1.00 0.00 ? 48 ILE A HD13 7 
ATOM   6525 N N    . ARG A 1 49 ? -5.857  4.525   4.940   1.00 0.00 ? 49 ARG A N    7 
ATOM   6526 C CA   . ARG A 1 49 ? -7.199  4.346   5.488   1.00 0.00 ? 49 ARG A CA   7 
ATOM   6527 C C    . ARG A 1 49 ? -8.180  3.822   4.445   1.00 0.00 ? 49 ARG A C    7 
ATOM   6528 O O    . ARG A 1 49 ? -9.391  4.008   4.568   1.00 0.00 ? 49 ARG A O    7 
ATOM   6529 C CB   . ARG A 1 49 ? -7.715  5.656   6.087   1.00 0.00 ? 49 ARG A CB   7 
ATOM   6530 C CG   . ARG A 1 49 ? -6.867  6.173   7.238   1.00 0.00 ? 49 ARG A CG   7 
ATOM   6531 C CD   . ARG A 1 49 ? -7.150  5.413   8.524   1.00 0.00 ? 49 ARG A CD   7 
ATOM   6532 N NE   . ARG A 1 49 ? -6.773  6.180   9.708   1.00 0.00 ? 49 ARG A NE   7 
ATOM   6533 C CZ   . ARG A 1 49 ? -7.512  7.159   10.223  1.00 0.00 ? 49 ARG A CZ   7 
ATOM   6534 N NH1  . ARG A 1 49 ? -8.666  7.496   9.660   1.00 0.00 ? 49 ARG A NH1  7 
ATOM   6535 N NH2  . ARG A 1 49 ? -7.097  7.804   11.305  1.00 0.00 ? 49 ARG A NH2  7 
ATOM   6536 H H    . ARG A 1 49 ? -5.563  5.420   4.670   1.00 0.00 ? 49 ARG A H    7 
ATOM   6537 H HA   . ARG A 1 49 ? -7.125  3.611   6.265   1.00 0.00 ? 49 ARG A HA   7 
ATOM   6538 H HB2  . ARG A 1 49 ? -7.733  6.410   5.314   1.00 0.00 ? 49 ARG A HB2  7 
ATOM   6539 H HB3  . ARG A 1 49 ? -8.720  5.501   6.450   1.00 0.00 ? 49 ARG A HB3  7 
ATOM   6540 H HG2  . ARG A 1 49 ? -5.824  6.057   6.985   1.00 0.00 ? 49 ARG A HG2  7 
ATOM   6541 H HG3  . ARG A 1 49 ? -7.088  7.220   7.393   1.00 0.00 ? 49 ARG A HG3  7 
ATOM   6542 H HD2  . ARG A 1 49 ? -8.206  5.192   8.571   1.00 0.00 ? 49 ARG A HD2  7 
ATOM   6543 H HD3  . ARG A 1 49 ? -6.590  4.489   8.511   1.00 0.00 ? 49 ARG A HD3  7 
ATOM   6544 H HE   . ARG A 1 49 ? -5.925  5.952   10.144  1.00 0.00 ? 49 ARG A HE   7 
ATOM   6545 H HH11 . ARG A 1 49 ? -8.985  7.014   8.845   1.00 0.00 ? 49 ARG A HH11 7 
ATOM   6546 H HH12 . ARG A 1 49 ? -9.217  8.233   10.053  1.00 0.00 ? 49 ARG A HH12 7 
ATOM   6547 H HH21 . ARG A 1 49 ? -6.228  7.555   11.733  1.00 0.00 ? 49 ARG A HH21 7 
ATOM   6548 H HH22 . ARG A 1 49 ? -7.652  8.541   11.692  1.00 0.00 ? 49 ARG A HH22 7 
ATOM   6549 N N    . SER A 1 50 ? -7.653  3.154   3.434   1.00 0.00 ? 50 SER A N    7 
ATOM   6550 C CA   . SER A 1 50 ? -8.476  2.583   2.380   1.00 0.00 ? 50 SER A CA   7 
ATOM   6551 C C    . SER A 1 50 ? -9.068  1.249   2.828   1.00 0.00 ? 50 SER A C    7 
ATOM   6552 O O    . SER A 1 50 ? -8.492  0.561   3.670   1.00 0.00 ? 50 SER A O    7 
ATOM   6553 C CB   . SER A 1 50 ? -7.655  2.395   1.115   1.00 0.00 ? 50 SER A CB   7 
ATOM   6554 O OG   . SER A 1 50 ? -8.458  2.539   -0.043  1.00 0.00 ? 50 SER A OG   7 
ATOM   6555 H H    . SER A 1 50 ? -6.689  3.026   3.406   1.00 0.00 ? 50 SER A H    7 
ATOM   6556 H HA   . SER A 1 50 ? -9.274  3.265   2.173   1.00 0.00 ? 50 SER A HA   7 
ATOM   6557 H HB2  . SER A 1 50 ? -6.864  3.134   1.086   1.00 0.00 ? 50 SER A HB2  7 
ATOM   6558 H HB3  . SER A 1 50 ? -7.233  1.412   1.126   1.00 0.00 ? 50 SER A HB3  7 
ATOM   6559 H HG   . SER A 1 50 ? -8.726  3.456   -0.136  1.00 0.00 ? 50 SER A HG   7 
ATOM   6560 N N    . PRO A 1 51 ? -10.221 0.854   2.264   1.00 0.00 ? 51 PRO A N    7 
ATOM   6561 C CA   . PRO A 1 51 ? -10.864 -0.406  2.606   1.00 0.00 ? 51 PRO A CA   7 
ATOM   6562 C C    . PRO A 1 51 ? -10.242 -1.585  1.867   1.00 0.00 ? 51 PRO A C    7 
ATOM   6563 O O    . PRO A 1 51 ? -10.030 -2.655  2.438   1.00 0.00 ? 51 PRO A O    7 
ATOM   6564 C CB   . PRO A 1 51 ? -12.322 -0.206  2.176   1.00 0.00 ? 51 PRO A CB   7 
ATOM   6565 C CG   . PRO A 1 51 ? -12.350 0.992   1.271   1.00 0.00 ? 51 PRO A CG   7 
ATOM   6566 C CD   . PRO A 1 51 ? -10.966 1.588   1.232   1.00 0.00 ? 51 PRO A CD   7 
ATOM   6567 H HA   . PRO A 1 51 ? -10.823 -0.591  3.670   1.00 0.00 ? 51 PRO A HA   7 
ATOM   6568 H HB2  . PRO A 1 51 ? -12.666 -1.090  1.660   1.00 0.00 ? 51 PRO A HB2  7 
ATOM   6569 H HB3  . PRO A 1 51 ? -12.932 -0.044  3.053   1.00 0.00 ? 51 PRO A HB3  7 
ATOM   6570 H HG2  . PRO A 1 51 ? -12.644 0.688   0.276   1.00 0.00 ? 51 PRO A HG2  7 
ATOM   6571 H HG3  . PRO A 1 51 ? -13.054 1.716   1.655   1.00 0.00 ? 51 PRO A HG3  7 
ATOM   6572 H HD2  . PRO A 1 51 ? -10.523 1.431   0.260   1.00 0.00 ? 51 PRO A HD2  7 
ATOM   6573 H HD3  . PRO A 1 51 ? -11.006 2.642   1.462   1.00 0.00 ? 51 PRO A HD3  7 
ATOM   6574 N N    . HIS A 1 52 ? -9.969  -1.374  0.587   1.00 0.00 ? 52 HIS A N    7 
ATOM   6575 C CA   . HIS A 1 52 ? -9.387  -2.404  -0.270  1.00 0.00 ? 52 HIS A CA   7 
ATOM   6576 C C    . HIS A 1 52 ? -7.875  -2.511  -0.080  1.00 0.00 ? 52 HIS A C    7 
ATOM   6577 O O    . HIS A 1 52 ? -7.265  -3.512  -0.457  1.00 0.00 ? 52 HIS A O    7 
ATOM   6578 C CB   . HIS A 1 52 ? -9.714  -2.110  -1.739  1.00 0.00 ? 52 HIS A CB   7 
ATOM   6579 C CG   . HIS A 1 52 ? -10.955 -1.284  -1.922  1.00 0.00 ? 52 HIS A CG   7 
ATOM   6580 N ND1  . HIS A 1 52 ? -11.109 -0.359  -2.932  1.00 0.00 ? 52 HIS A ND1  7 
ATOM   6581 C CD2  . HIS A 1 52 ? -12.098 -1.237  -1.197  1.00 0.00 ? 52 HIS A CD2  7 
ATOM   6582 C CE1  . HIS A 1 52 ? -12.291 0.222   -2.816  1.00 0.00 ? 52 HIS A CE1  7 
ATOM   6583 N NE2  . HIS A 1 52 ? -12.910 -0.296  -1.774  1.00 0.00 ? 52 HIS A NE2  7 
ATOM   6584 H H    . HIS A 1 52 ? -10.174 -0.499  0.200   1.00 0.00 ? 52 HIS A H    7 
ATOM   6585 H HA   . HIS A 1 52 ? -9.834  -3.346  0.003   1.00 0.00 ? 52 HIS A HA   7 
ATOM   6586 H HB2  . HIS A 1 52 ? -8.890  -1.572  -2.184  1.00 0.00 ? 52 HIS A HB2  7 
ATOM   6587 H HB3  . HIS A 1 52 ? -9.854  -3.043  -2.264  1.00 0.00 ? 52 HIS A HB3  7 
ATOM   6588 H HD1  . HIS A 1 52 ? -10.450 -0.155  -3.628  1.00 0.00 ? 52 HIS A HD1  7 
ATOM   6589 H HD2  . HIS A 1 52 ? -12.318 -1.816  -0.312  1.00 0.00 ? 52 HIS A HD2  7 
ATOM   6590 H HE1  . HIS A 1 52 ? -12.680 0.998   -3.454  1.00 0.00 ? 52 HIS A HE1  7 
ATOM   6591 H HE2  . HIS A 1 52 ? -13.759 0.025   -1.406  1.00 0.00 ? 52 HIS A HE2  7 
ATOM   6592 N N    . ALA A 1 53 ? -7.271  -1.477  0.497   1.00 0.00 ? 53 ALA A N    7 
ATOM   6593 C CA   . ALA A 1 53 ? -5.834  -1.462  0.721   1.00 0.00 ? 53 ALA A CA   7 
ATOM   6594 C C    . ALA A 1 53 ? -5.392  -2.649  1.559   1.00 0.00 ? 53 ALA A C    7 
ATOM   6595 O O    . ALA A 1 53 ? -4.495  -3.401  1.179   1.00 0.00 ? 53 ALA A O    7 
ATOM   6596 C CB   . ALA A 1 53 ? -5.413  -0.161  1.388   1.00 0.00 ? 53 ALA A CB   7 
ATOM   6597 H H    . ALA A 1 53 ? -7.801  -0.706  0.772   1.00 0.00 ? 53 ALA A H    7 
ATOM   6598 H HA   . ALA A 1 53 ? -5.356  -1.516  -0.233  1.00 0.00 ? 53 ALA A HA   7 
ATOM   6599 H HB1  . ALA A 1 53 ? -5.453  0.642   0.667   1.00 0.00 ? 53 ALA A HB1  7 
ATOM   6600 H HB2  . ALA A 1 53 ? -4.405  -0.258  1.762   1.00 0.00 ? 53 ALA A HB2  7 
ATOM   6601 H HB3  . ALA A 1 53 ? -6.082  0.057   2.207   1.00 0.00 ? 53 ALA A HB3  7 
ATOM   6602 N N    . ARG A 1 54 ? -6.029  -2.800  2.705   1.00 0.00 ? 54 ARG A N    7 
ATOM   6603 C CA   . ARG A 1 54 ? -5.717  -3.882  3.623   1.00 0.00 ? 54 ARG A CA   7 
ATOM   6604 C C    . ARG A 1 54 ? -5.901  -5.238  2.957   1.00 0.00 ? 54 ARG A C    7 
ATOM   6605 O O    . ARG A 1 54 ? -5.175  -6.190  3.245   1.00 0.00 ? 54 ARG A O    7 
ATOM   6606 C CB   . ARG A 1 54 ? -6.592  -3.785  4.873   1.00 0.00 ? 54 ARG A CB   7 
ATOM   6607 C CG   . ARG A 1 54 ? -5.808  -3.868  6.172   1.00 0.00 ? 54 ARG A CG   7 
ATOM   6608 C CD   . ARG A 1 54 ? -6.614  -3.340  7.347   1.00 0.00 ? 54 ARG A CD   7 
ATOM   6609 N NE   . ARG A 1 54 ? -7.977  -3.870  7.362   1.00 0.00 ? 54 ARG A NE   7 
ATOM   6610 C CZ   . ARG A 1 54 ? -8.728  -3.958  8.458   1.00 0.00 ? 54 ARG A CZ   7 
ATOM   6611 N NH1  . ARG A 1 54 ? -8.260  -3.545  9.630   1.00 0.00 ? 54 ARG A NH1  7 
ATOM   6612 N NH2  . ARG A 1 54 ? -9.954  -4.458  8.382   1.00 0.00 ? 54 ARG A NH2  7 
ATOM   6613 H H    . ARG A 1 54 ? -6.723  -2.160  2.942   1.00 0.00 ? 54 ARG A H    7 
ATOM   6614 H HA   . ARG A 1 54 ? -4.690  -3.776  3.905   1.00 0.00 ? 54 ARG A HA   7 
ATOM   6615 H HB2  . ARG A 1 54 ? -7.120  -2.843  4.857   1.00 0.00 ? 54 ARG A HB2  7 
ATOM   6616 H HB3  . ARG A 1 54 ? -7.312  -4.590  4.861   1.00 0.00 ? 54 ARG A HB3  7 
ATOM   6617 H HG2  . ARG A 1 54 ? -5.550  -4.900  6.360   1.00 0.00 ? 54 ARG A HG2  7 
ATOM   6618 H HG3  . ARG A 1 54 ? -4.906  -3.282  6.073   1.00 0.00 ? 54 ARG A HG3  7 
ATOM   6619 H HD2  . ARG A 1 54 ? -6.118  -3.625  8.263   1.00 0.00 ? 54 ARG A HD2  7 
ATOM   6620 H HD3  . ARG A 1 54 ? -6.657  -2.263  7.282   1.00 0.00 ? 54 ARG A HD3  7 
ATOM   6621 H HE   . ARG A 1 54 ? -8.352  -4.178  6.511   1.00 0.00 ? 54 ARG A HE   7 
ATOM   6622 H HH11 . ARG A 1 54 ? -7.338  -3.165  9.696   1.00 0.00 ? 54 ARG A HH11 7 
ATOM   6623 H HH12 . ARG A 1 54 ? -8.831  -3.614  10.448  1.00 0.00 ? 54 ARG A HH12 7 
ATOM   6624 H HH21 . ARG A 1 54 ? -10.313 -4.770  7.502   1.00 0.00 ? 54 ARG A HH21 7 
ATOM   6625 H HH22 . ARG A 1 54 ? -10.519 -4.525  9.204   1.00 0.00 ? 54 ARG A HH22 7 
ATOM   6626 N N    . ASP A 1 55 ? -6.873  -5.315  2.063   1.00 0.00 ? 55 ASP A N    7 
ATOM   6627 C CA   . ASP A 1 55 ? -7.157  -6.551  1.350   1.00 0.00 ? 55 ASP A CA   7 
ATOM   6628 C C    . ASP A 1 55 ? -6.042  -6.874  0.370   1.00 0.00 ? 55 ASP A C    7 
ATOM   6629 O O    . ASP A 1 55 ? -5.621  -8.023  0.242   1.00 0.00 ? 55 ASP A O    7 
ATOM   6630 C CB   . ASP A 1 55 ? -8.484  -6.452  0.614   1.00 0.00 ? 55 ASP A CB   7 
ATOM   6631 C CG   . ASP A 1 55 ? -9.120  -7.809  0.383   1.00 0.00 ? 55 ASP A CG   7 
ATOM   6632 O OD1  . ASP A 1 55 ? -8.756  -8.473  -0.611  1.00 0.00 ? 55 ASP A OD1  7 
ATOM   6633 O OD2  . ASP A 1 55 ? -9.981  -8.208  1.195   1.00 0.00 ? 55 ASP A OD2  7 
ATOM   6634 H H    . ASP A 1 55 ? -7.411  -4.521  1.880   1.00 0.00 ? 55 ASP A H    7 
ATOM   6635 H HA   . ASP A 1 55 ? -7.218  -7.334  2.064   1.00 0.00 ? 55 ASP A HA   7 
ATOM   6636 H HB2  . ASP A 1 55 ? -9.169  -5.845  1.191   1.00 0.00 ? 55 ASP A HB2  7 
ATOM   6637 H HB3  . ASP A 1 55 ? -8.310  -5.991  -0.338  1.00 0.00 ? 55 ASP A HB3  7 
ATOM   6638 N N    . THR A 1 56 ? -5.567  -5.846  -0.313  1.00 0.00 ? 56 THR A N    7 
ATOM   6639 C CA   . THR A 1 56 ? -4.498  -5.997  -1.280  1.00 0.00 ? 56 THR A CA   7 
ATOM   6640 C C    . THR A 1 56 ? -3.238  -6.537  -0.616  1.00 0.00 ? 56 THR A C    7 
ATOM   6641 O O    . THR A 1 56 ? -2.627  -7.489  -1.101  1.00 0.00 ? 56 THR A O    7 
ATOM   6642 C CB   . THR A 1 56 ? -4.206  -4.666  -1.953  1.00 0.00 ? 56 THR A CB   7 
ATOM   6643 O OG1  . THR A 1 56 ? -5.387  -3.894  -2.080  1.00 0.00 ? 56 THR A OG1  7 
ATOM   6644 C CG2  . THR A 1 56 ? -3.597  -4.809  -3.331  1.00 0.00 ? 56 THR A CG2  7 
ATOM   6645 H H    . THR A 1 56 ? -5.945  -4.964  -0.158  1.00 0.00 ? 56 THR A H    7 
ATOM   6646 H HA   . THR A 1 56 ? -4.825  -6.690  -2.022  1.00 0.00 ? 56 THR A HA   7 
ATOM   6647 H HB   . THR A 1 56 ? -3.514  -4.127  -1.341  1.00 0.00 ? 56 THR A HB   7 
ATOM   6648 H HG1  . THR A 1 56 ? -5.158  -2.994  -2.322  1.00 0.00 ? 56 THR A HG1  7 
ATOM   6649 H HG21 . THR A 1 56 ? -3.809  -3.924  -3.912  1.00 0.00 ? 56 THR A HG21 7 
ATOM   6650 H HG22 . THR A 1 56 ? -4.019  -5.673  -3.823  1.00 0.00 ? 56 THR A HG22 7 
ATOM   6651 H HG23 . THR A 1 56 ? -2.528  -4.932  -3.241  1.00 0.00 ? 56 THR A HG23 7 
ATOM   6652 N N    . LEU A 1 57 ? -2.855  -5.922  0.499   1.00 0.00 ? 57 LEU A N    7 
ATOM   6653 C CA   . LEU A 1 57 ? -1.673  -6.338  1.230   1.00 0.00 ? 57 LEU A CA   7 
ATOM   6654 C C    . LEU A 1 57 ? -1.814  -7.771  1.718   1.00 0.00 ? 57 LEU A C    7 
ATOM   6655 O O    . LEU A 1 57 ? -0.915  -8.595  1.542   1.00 0.00 ? 57 LEU A O    7 
ATOM   6656 C CB   . LEU A 1 57 ? -1.418  -5.397  2.403   1.00 0.00 ? 57 LEU A CB   7 
ATOM   6657 C CG   . LEU A 1 57 ? -0.324  -4.356  2.168   1.00 0.00 ? 57 LEU A CG   7 
ATOM   6658 C CD1  . LEU A 1 57 ? -0.900  -2.949  2.212   1.00 0.00 ? 57 LEU A CD1  7 
ATOM   6659 C CD2  . LEU A 1 57 ? 0.792   -4.508  3.192   1.00 0.00 ? 57 LEU A CD2  7 
ATOM   6660 H H    . LEU A 1 57 ? -3.380  -5.171  0.835   1.00 0.00 ? 57 LEU A H    7 
ATOM   6661 H HA   . LEU A 1 57 ? -0.849  -6.284  0.561   1.00 0.00 ? 57 LEU A HA   7 
ATOM   6662 H HB2  . LEU A 1 57 ? -2.337  -4.878  2.611   1.00 0.00 ? 57 LEU A HB2  7 
ATOM   6663 H HB3  . LEU A 1 57 ? -1.145  -5.988  3.265   1.00 0.00 ? 57 LEU A HB3  7 
ATOM   6664 H HG   . LEU A 1 57 ? 0.096   -4.512  1.190   1.00 0.00 ? 57 LEU A HG   7 
ATOM   6665 H HD11 . LEU A 1 57 ? -0.160  -2.245  1.861   1.00 0.00 ? 57 LEU A HD11 7 
ATOM   6666 H HD12 . LEU A 1 57 ? -1.176  -2.704  3.227   1.00 0.00 ? 57 LEU A HD12 7 
ATOM   6667 H HD13 . LEU A 1 57 ? -1.774  -2.898  1.579   1.00 0.00 ? 57 LEU A HD13 7 
ATOM   6668 H HD21 . LEU A 1 57 ? 1.746   -4.353  2.710   1.00 0.00 ? 57 LEU A HD21 7 
ATOM   6669 H HD22 . LEU A 1 57 ? 0.759   -5.501  3.613   1.00 0.00 ? 57 LEU A HD22 7 
ATOM   6670 H HD23 . LEU A 1 57 ? 0.662   -3.779  3.977   1.00 0.00 ? 57 LEU A HD23 7 
ATOM   6671 N N    . THR A 1 58 ? -2.953  -8.060  2.325   1.00 0.00 ? 58 THR A N    7 
ATOM   6672 C CA   . THR A 1 58 ? -3.231  -9.390  2.837   1.00 0.00 ? 58 THR A CA   7 
ATOM   6673 C C    . THR A 1 58 ? -3.225  -10.407 1.706   1.00 0.00 ? 58 THR A C    7 
ATOM   6674 O O    . THR A 1 58 ? -2.651  -11.488 1.833   1.00 0.00 ? 58 THR A O    7 
ATOM   6675 C CB   . THR A 1 58 ? -4.575  -9.416  3.567   1.00 0.00 ? 58 THR A CB   7 
ATOM   6676 O OG1  . THR A 1 58 ? -4.588  -8.475  4.626   1.00 0.00 ? 58 THR A OG1  7 
ATOM   6677 C CG2  . THR A 1 58 ? -4.914  -10.771 4.151   1.00 0.00 ? 58 THR A CG2  7 
ATOM   6678 H H    . THR A 1 58 ? -3.621  -7.361  2.427   1.00 0.00 ? 58 THR A H    7 
ATOM   6679 H HA   . THR A 1 58 ? -2.446  -9.640  3.529   1.00 0.00 ? 58 THR A HA   7 
ATOM   6680 H HB   . THR A 1 58 ? -5.356  -9.151  2.869   1.00 0.00 ? 58 THR A HB   7 
ATOM   6681 H HG1  . THR A 1 58 ? -4.911  -7.632  4.302   1.00 0.00 ? 58 THR A HG1  7 
ATOM   6682 H HG21 . THR A 1 58 ? -4.007  -11.338 4.297   1.00 0.00 ? 58 THR A HG21 7 
ATOM   6683 H HG22 . THR A 1 58 ? -5.565  -11.302 3.472   1.00 0.00 ? 58 THR A HG22 7 
ATOM   6684 H HG23 . THR A 1 58 ? -5.414  -10.639 5.099   1.00 0.00 ? 58 THR A HG23 7 
ATOM   6685 N N    . SER A 1 59 ? -3.849  -10.045 0.589   1.00 0.00 ? 59 SER A N    7 
ATOM   6686 C CA   . SER A 1 59 ? -3.894  -10.916 -0.571  1.00 0.00 ? 59 SER A CA   7 
ATOM   6687 C C    . SER A 1 59 ? -2.490  -11.370 -0.929  1.00 0.00 ? 59 SER A C    7 
ATOM   6688 O O    . SER A 1 59 ? -2.278  -12.477 -1.422  1.00 0.00 ? 59 SER A O    7 
ATOM   6689 C CB   . SER A 1 59 ? -4.514  -10.181 -1.742  1.00 0.00 ? 59 SER A CB   7 
ATOM   6690 O OG   . SER A 1 59 ? -5.098  -11.081 -2.667  1.00 0.00 ? 59 SER A OG   7 
ATOM   6691 H H    . SER A 1 59 ? -4.274  -9.168  0.536   1.00 0.00 ? 59 SER A H    7 
ATOM   6692 H HA   . SER A 1 59 ? -4.491  -11.764 -0.333  1.00 0.00 ? 59 SER A HA   7 
ATOM   6693 H HB2  . SER A 1 59 ? -5.273  -9.506  -1.377  1.00 0.00 ? 59 SER A HB2  7 
ATOM   6694 H HB3  . SER A 1 59 ? -3.745  -9.623  -2.236  1.00 0.00 ? 59 SER A HB3  7 
ATOM   6695 H HG   . SER A 1 59 ? -4.413  -11.632 -3.054  1.00 0.00 ? 59 SER A HG   7 
ATOM   6696 N N    . CYS A 1 60 ? -1.536  -10.492 -0.657  1.00 0.00 ? 60 CYS A N    7 
ATOM   6697 C CA   . CYS A 1 60 ? -0.140  -10.760 -0.919  1.00 0.00 ? 60 CYS A CA   7 
ATOM   6698 C C    . CYS A 1 60 ? 0.441   -11.657 0.167   1.00 0.00 ? 60 CYS A C    7 
ATOM   6699 O O    . CYS A 1 60 ? 1.311   -12.487 -0.096  1.00 0.00 ? 60 CYS A O    7 
ATOM   6700 C CB   . CYS A 1 60 ? 0.624   -9.441  -0.972  1.00 0.00 ? 60 CYS A CB   7 
ATOM   6701 S SG   . CYS A 1 60 ? 1.898   -9.368  -2.274  1.00 0.00 ? 60 CYS A SG   7 
ATOM   6702 H H    . CYS A 1 60 ? -1.782  -9.634  -0.257  1.00 0.00 ? 60 CYS A H    7 
ATOM   6703 H HA   . CYS A 1 60 ? -0.062  -11.257 -1.873  1.00 0.00 ? 60 CYS A HA   7 
ATOM   6704 H HB2  . CYS A 1 60 ? -0.075  -8.637  -1.151  1.00 0.00 ? 60 CYS A HB2  7 
ATOM   6705 H HB3  . CYS A 1 60 ? 1.104   -9.280  -0.021  1.00 0.00 ? 60 CYS A HB3  7 
ATOM   6706 N N    . GLY A 1 61 ? -0.052  -11.485 1.392   1.00 0.00 ? 61 GLY A N    7 
ATOM   6707 C CA   . GLY A 1 61 ? 0.427   -12.287 2.500   1.00 0.00 ? 61 GLY A CA   7 
ATOM   6708 C C    . GLY A 1 61 ? 1.847   -11.939 2.900   1.00 0.00 ? 61 GLY A C    7 
ATOM   6709 O O    . GLY A 1 61 ? 2.725   -12.802 2.906   1.00 0.00 ? 61 GLY A O    7 
ATOM   6710 H H    . GLY A 1 61 ? -0.748  -10.807 1.545   1.00 0.00 ? 61 GLY A H    7 
ATOM   6711 H HA2  . GLY A 1 61 ? -0.222  -12.131 3.349   1.00 0.00 ? 61 GLY A HA2  7 
ATOM   6712 H HA3  . GLY A 1 61 ? 0.389   -13.329 2.218   1.00 0.00 ? 61 GLY A HA3  7 
ATOM   6713 N N    . LEU A 1 62 ? 2.073   -10.675 3.245   1.00 0.00 ? 62 LEU A N    7 
ATOM   6714 C CA   . LEU A 1 62 ? 3.398   -10.225 3.658   1.00 0.00 ? 62 LEU A CA   7 
ATOM   6715 C C    . LEU A 1 62 ? 3.364   -9.692  5.087   1.00 0.00 ? 62 LEU A C    7 
ATOM   6716 O O    . LEU A 1 62 ? 3.727   -10.395 6.030   1.00 0.00 ? 62 LEU A O    7 
ATOM   6717 C CB   . LEU A 1 62 ? 3.958   -9.151  2.708   1.00 0.00 ? 62 LEU A CB   7 
ATOM   6718 C CG   . LEU A 1 62 ? 2.943   -8.428  1.806   1.00 0.00 ? 62 LEU A CG   7 
ATOM   6719 C CD1  . LEU A 1 62 ? 2.765   -6.982  2.244   1.00 0.00 ? 62 LEU A CD1  7 
ATOM   6720 C CD2  . LEU A 1 62 ? 3.394   -8.485  0.355   1.00 0.00 ? 62 LEU A CD2  7 
ATOM   6721 H H    . LEU A 1 62 ? 1.332   -10.034 3.229   1.00 0.00 ? 62 LEU A H    7 
ATOM   6722 H HA   . LEU A 1 62 ? 4.053   -11.084 3.632   1.00 0.00 ? 62 LEU A HA   7 
ATOM   6723 H HB2  . LEU A 1 62 ? 4.462   -8.407  3.307   1.00 0.00 ? 62 LEU A HB2  7 
ATOM   6724 H HB3  . LEU A 1 62 ? 4.693   -9.624  2.072   1.00 0.00 ? 62 LEU A HB3  7 
ATOM   6725 H HG   . LEU A 1 62 ? 1.983   -8.915  1.875   1.00 0.00 ? 62 LEU A HG   7 
ATOM   6726 H HD11 . LEU A 1 62 ? 1.939   -6.916  2.937   1.00 0.00 ? 62 LEU A HD11 7 
ATOM   6727 H HD12 . LEU A 1 62 ? 2.560   -6.367  1.381   1.00 0.00 ? 62 LEU A HD12 7 
ATOM   6728 H HD13 . LEU A 1 62 ? 3.668   -6.637  2.726   1.00 0.00 ? 62 LEU A HD13 7 
ATOM   6729 H HD21 . LEU A 1 62 ? 4.413   -8.135  0.282   1.00 0.00 ? 62 LEU A HD21 7 
ATOM   6730 H HD22 . LEU A 1 62 ? 2.754   -7.857  -0.245  1.00 0.00 ? 62 LEU A HD22 7 
ATOM   6731 H HD23 . LEU A 1 62 ? 3.337   -9.503  -0.001  1.00 0.00 ? 62 LEU A HD23 7 
ATOM   6732 N N    . ALA A 1 63 ? 2.927   -8.448  5.240   1.00 0.00 ? 63 ALA A N    7 
ATOM   6733 C CA   . ALA A 1 63 ? 2.845   -7.826  6.551   1.00 0.00 ? 63 ALA A CA   7 
ATOM   6734 C C    . ALA A 1 63 ? 1.726   -6.791  6.607   1.00 0.00 ? 63 ALA A C    7 
ATOM   6735 O O    . ALA A 1 63 ? 1.170   -6.407  5.579   1.00 0.00 ? 63 ALA A O    7 
ATOM   6736 C CB   . ALA A 1 63 ? 4.177   -7.190  6.918   1.00 0.00 ? 63 ALA A CB   7 
ATOM   6737 H H    . ALA A 1 63 ? 2.649   -7.941  4.457   1.00 0.00 ? 63 ALA A H    7 
ATOM   6738 H HA   . ALA A 1 63 ? 2.636   -8.602  7.264   1.00 0.00 ? 63 ALA A HA   7 
ATOM   6739 H HB1  . ALA A 1 63 ? 4.965   -7.923  6.825   1.00 0.00 ? 63 ALA A HB1  7 
ATOM   6740 H HB2  . ALA A 1 63 ? 4.137   -6.833  7.937   1.00 0.00 ? 63 ALA A HB2  7 
ATOM   6741 H HB3  . ALA A 1 63 ? 4.376   -6.361  6.255   1.00 0.00 ? 63 ALA A HB3  7 
ATOM   6742 N N    . VAL A 1 64 ? 1.403   -6.345  7.816   1.00 0.00 ? 64 VAL A N    7 
ATOM   6743 C CA   . VAL A 1 64 ? 0.359   -5.360  8.017   1.00 0.00 ? 64 VAL A CA   7 
ATOM   6744 C C    . VAL A 1 64 ? 0.949   -4.017  8.450   1.00 0.00 ? 64 VAL A C    7 
ATOM   6745 O O    . VAL A 1 64 ? 1.852   -3.973  9.285   1.00 0.00 ? 64 VAL A O    7 
ATOM   6746 C CB   . VAL A 1 64 ? -0.657  -5.841  9.074   1.00 0.00 ? 64 VAL A CB   7 
ATOM   6747 C CG1  . VAL A 1 64 ? -0.032  -5.854  10.462  1.00 0.00 ? 64 VAL A CG1  7 
ATOM   6748 C CG2  . VAL A 1 64 ? -1.908  -4.976  9.051   1.00 0.00 ? 64 VAL A CG2  7 
ATOM   6749 H H    . VAL A 1 64 ? 1.877   -6.689  8.591   1.00 0.00 ? 64 VAL A H    7 
ATOM   6750 H HA   . VAL A 1 64 ? -0.155  -5.236  7.083   1.00 0.00 ? 64 VAL A HA   7 
ATOM   6751 H HB   . VAL A 1 64 ? -0.941  -6.853  8.827   1.00 0.00 ? 64 VAL A HB   7 
ATOM   6752 H HG11 . VAL A 1 64 ? -0.435  -6.680  11.030  1.00 0.00 ? 64 VAL A HG11 7 
ATOM   6753 H HG12 . VAL A 1 64 ? -0.256  -4.926  10.967  1.00 0.00 ? 64 VAL A HG12 7 
ATOM   6754 H HG13 . VAL A 1 64 ? 1.039   -5.966  10.374  1.00 0.00 ? 64 VAL A HG13 7 
ATOM   6755 H HG21 . VAL A 1 64 ? -2.436  -5.131  8.122   1.00 0.00 ? 64 VAL A HG21 7 
ATOM   6756 H HG22 . VAL A 1 64 ? -1.628  -3.936  9.138   1.00 0.00 ? 64 VAL A HG22 7 
ATOM   6757 H HG23 . VAL A 1 64 ? -2.547  -5.247  9.878   1.00 0.00 ? 64 VAL A HG23 7 
ATOM   6758 N N    . PRO A 1 65 ? 0.449   -2.899  7.892   1.00 0.00 ? 65 PRO A N    7 
ATOM   6759 C CA   . PRO A 1 65 ? 0.942   -1.561  8.237   1.00 0.00 ? 65 PRO A CA   7 
ATOM   6760 C C    . PRO A 1 65 ? 0.701   -1.221  9.703   1.00 0.00 ? 65 PRO A C    7 
ATOM   6761 O O    . PRO A 1 65 ? 0.442   -2.103  10.521  1.00 0.00 ? 65 PRO A O    7 
ATOM   6762 C CB   . PRO A 1 65 ? 0.133   -0.629  7.328   1.00 0.00 ? 65 PRO A CB   7 
ATOM   6763 C CG   . PRO A 1 65 ? -1.079  -1.411  6.964   1.00 0.00 ? 65 PRO A CG   7 
ATOM   6764 C CD   . PRO A 1 65 ? -0.629  -2.842  6.889   1.00 0.00 ? 65 PRO A CD   7 
ATOM   6765 H HA   . PRO A 1 65 ? 1.995   -1.459  8.015   1.00 0.00 ? 65 PRO A HA   7 
ATOM   6766 H HB2  . PRO A 1 65 ? -0.126  0.271   7.866   1.00 0.00 ? 65 PRO A HB2  7 
ATOM   6767 H HB3  . PRO A 1 65 ? 0.715   -0.377  6.454   1.00 0.00 ? 65 PRO A HB3  7 
ATOM   6768 H HG2  . PRO A 1 65 ? -1.834  -1.292  7.727   1.00 0.00 ? 65 PRO A HG2  7 
ATOM   6769 H HG3  . PRO A 1 65 ? -1.454  -1.085  6.007   1.00 0.00 ? 65 PRO A HG3  7 
ATOM   6770 H HD2  . PRO A 1 65 ? -1.438  -3.507  7.150   1.00 0.00 ? 65 PRO A HD2  7 
ATOM   6771 H HD3  . PRO A 1 65 ? -0.252  -3.068  5.903   1.00 0.00 ? 65 PRO A HD3  7 
ATOM   6772 N N    . HIS A 1 66 ? 0.790   0.064   10.030  1.00 0.00 ? 66 HIS A N    7 
ATOM   6773 C CA   . HIS A 1 66 ? 0.583   0.522   11.399  1.00 0.00 ? 66 HIS A CA   7 
ATOM   6774 C C    . HIS A 1 66 ? 1.533   -0.186  12.360  1.00 0.00 ? 66 HIS A C    7 
ATOM   6775 O O    . HIS A 1 66 ? 1.175   -0.477  13.501  1.00 0.00 ? 66 HIS A O    7 
ATOM   6776 C CB   . HIS A 1 66 ? -0.867  0.282   11.824  1.00 0.00 ? 66 HIS A CB   7 
ATOM   6777 C CG   . HIS A 1 66 ? -1.847  1.161   11.116  1.00 0.00 ? 66 HIS A CG   7 
ATOM   6778 N ND1  . HIS A 1 66 ? -2.406  0.834   9.901   1.00 0.00 ? 66 HIS A ND1  7 
ATOM   6779 C CD2  . HIS A 1 66 ? -2.369  2.363   11.457  1.00 0.00 ? 66 HIS A CD2  7 
ATOM   6780 C CE1  . HIS A 1 66 ? -3.228  1.795   9.526   1.00 0.00 ? 66 HIS A CE1  7 
ATOM   6781 N NE2  . HIS A 1 66 ? -3.225  2.734   10.452  1.00 0.00 ? 66 HIS A NE2  7 
ATOM   6782 H H    . HIS A 1 66 ? 0.999   0.719   9.334   1.00 0.00 ? 66 HIS A H    7 
ATOM   6783 H HA   . HIS A 1 66 ? 0.786   1.582   11.427  1.00 0.00 ? 66 HIS A HA   7 
ATOM   6784 H HB2  . HIS A 1 66 ? -1.132  -0.743  11.613  1.00 0.00 ? 66 HIS A HB2  7 
ATOM   6785 H HB3  . HIS A 1 66 ? -0.960  0.464   12.884  1.00 0.00 ? 66 HIS A HB3  7 
ATOM   6786 H HD1  . HIS A 1 66 ? -2.226  0.018   9.389   1.00 0.00 ? 66 HIS A HD1  7 
ATOM   6787 H HD2  . HIS A 1 66 ? -2.154  2.924   12.353  1.00 0.00 ? 66 HIS A HD2  7 
ATOM   6788 H HE1  . HIS A 1 66 ? -3.806  1.809   8.619   1.00 0.00 ? 66 HIS A HE1  7 
ATOM   6789 H HE2  . HIS A 1 66 ? -3.673  3.602   10.378  1.00 0.00 ? 66 HIS A HE2  7 
ATOM   6790 N N    . CYS A 1 67 ? 2.745   -0.460  11.889  1.00 0.00 ? 67 CYS A N    7 
ATOM   6791 C CA   . CYS A 1 67 ? 3.748   -1.135  12.704  1.00 0.00 ? 67 CYS A CA   7 
ATOM   6792 C C    . CYS A 1 67 ? 4.512   -0.134  13.565  1.00 0.00 ? 67 CYS A C    7 
ATOM   6793 O O    . CYS A 1 67 ? 5.031   0.853   13.004  1.00 0.00 ? 67 CYS A O    7 
ATOM   6794 C CB   . CYS A 1 67 ? 4.723   -1.907  11.813  1.00 0.00 ? 67 CYS A CB   7 
ATOM   6795 S SG   . CYS A 1 67 ? 5.582   -0.874  10.581  1.00 0.00 ? 67 CYS A SG   7 
ATOM   6796 O OXT  . CYS A 1 67 ? 4.585   -0.347  14.794  1.00 0.00 ? 67 CYS A OXT  7 
ATOM   6797 H H    . CYS A 1 67 ? 2.970   -0.203  10.970  1.00 0.00 ? 67 CYS A H    7 
ATOM   6798 H HA   . CYS A 1 67 ? 3.236   -1.832  13.350  1.00 0.00 ? 67 CYS A HA   7 
ATOM   6799 H HB2  . CYS A 1 67 ? 5.476   -2.371  12.433  1.00 0.00 ? 67 CYS A HB2  7 
ATOM   6800 H HB3  . CYS A 1 67 ? 4.181   -2.674  11.279  1.00 0.00 ? 67 CYS A HB3  7 
HETATM 6801 C C1   . PGM B 2 .  ? -6.959  -0.548  19.401  1.00 0.00 ? 68 PGM A C1   7 
HETATM 6802 O O1   . PGM B 2 .  ? -5.963  -0.237  20.343  1.00 0.00 ? 68 PGM A O1   7 
HETATM 6803 C C2   . PGM B 2 .  ? -6.528  -0.090  18.078  1.00 0.00 ? 68 PGM A C2   7 
HETATM 6804 O O2   . PGM B 2 .  ? -6.642  1.310   18.017  1.00 0.00 ? 68 PGM A O2   7 
HETATM 6805 C C3   . PGM B 2 .  ? -7.328  -0.683  17.004  1.00 0.00 ? 68 PGM A C3   7 
HETATM 6806 O O4   . PGM B 2 .  ? -6.436  -1.206  16.011  1.00 0.00 ? 68 PGM A O4   7 
HETATM 6807 P P5   . PGM B 2 .  ? -6.932  -1.247  14.486  1.00 0.00 ? 68 PGM A P5   7 
HETATM 6808 O O5A  . PGM B 2 .  ? -8.038  -2.224  14.358  1.00 0.00 ? 68 PGM A O5A  7 
HETATM 6809 O O5B  . PGM B 2 .  ? -7.182  0.141   14.038  1.00 0.00 ? 68 PGM A O5B  7 
HETATM 6810 O O6   . PGM B 2 .  ? -5.681  -1.810  13.663  1.00 0.00 ? 68 PGM A O6   7 
HETATM 6811 C C7   . PGM B 2 .  ? -5.732  -1.803  12.176  1.00 0.00 ? 68 PGM A C7   7 
HETATM 6812 C C8   . PGM B 2 .  ? -4.432  -1.619  11.525  1.00 0.00 ? 68 PGM A C8   7 
HETATM 6813 O O8   . PGM B 2 .  ? -3.417  -2.535  11.850  1.00 0.00 ? 68 PGM A O8   7 
HETATM 6814 C C9   . PGM B 2 .  ? -4.554  -1.539  10.091  1.00 0.00 ? 68 PGM A C9   7 
HETATM 6815 O OQ1  . PGM B 2 .  ? -7.136  -0.567  8.979   1.00 0.00 ? 68 PGM A OQ1  7 
HETATM 6816 O OQ2  . PGM B 2 .  ? -5.125  -0.221  9.677   1.00 0.00 ? 68 PGM A OQ2  7 
HETATM 6817 C CA   . PGM B 2 .  ? -5.928  -0.188  8.795   1.00 0.00 ? 68 PGM A CA   7 
HETATM 6818 C CB   . PGM B 2 .  ? -5.590  0.214   7.424   1.00 0.00 ? 68 PGM A CB   7 
HETATM 6819 C CC   . PGM B 2 .  ? -4.371  -0.439  6.826   1.00 0.00 ? 68 PGM A CC   7 
HETATM 6820 C CD   . PGM B 2 .  ? -4.367  -0.508  5.324   1.00 0.00 ? 68 PGM A CD   7 
HETATM 6821 C CE   . PGM B 2 .  ? -3.293  0.313   4.676   1.00 0.00 ? 68 PGM A CE   7 
HETATM 6822 C CF   . PGM B 2 .  ? -2.499  -0.417  3.636   1.00 0.00 ? 68 PGM A CF   7 
HETATM 6823 C CG   . PGM B 2 .  ? -1.585  0.452   2.823   1.00 0.00 ? 68 PGM A CG   7 
HETATM 6824 C CH   . PGM B 2 .  ? -0.164  0.478   3.277   1.00 0.00 ? 68 PGM A CH   7 
HETATM 6825 C CI   . PGM B 2 .  ? 0.844   0.693   2.196   1.00 0.00 ? 68 PGM A CI   7 
HETATM 6826 C CJ   . PGM B 2 .  ? 1.186   2.122   1.936   1.00 0.00 ? 68 PGM A CJ   7 
HETATM 6827 C CK   . PGM B 2 .  ? 0.861   2.621   0.566   1.00 0.00 ? 68 PGM A CK   7 
HETATM 6828 C CL   . PGM B 2 .  ? 1.127   4.077   0.337   1.00 0.00 ? 68 PGM A CL   7 
HETATM 6829 C CM   . PGM B 2 .  ? 1.334   4.470   -1.090  1.00 0.00 ? 68 PGM A CM   7 
HETATM 6830 C CN   . PGM B 2 .  ? 0.464   5.585   -1.577  1.00 0.00 ? 68 PGM A CN   7 
HETATM 6831 C CO   . PGM B 2 .  ? 0.896   6.214   -2.862  1.00 0.00 ? 68 PGM A CO   7 
HETATM 6832 C CP   . PGM B 2 .  ? 0.393   7.613   -3.065  1.00 0.00 ? 68 PGM A CP   7 
ATOM   6833 N N    . ALA A 1 1  ? 10.909  5.997   1.844   1.00 0.00 ? 1  ALA A N    8 
ATOM   6834 C CA   . ALA A 1 1  ? 12.282  6.265   1.342   1.00 0.00 ? 1  ALA A CA   8 
ATOM   6835 C C    . ALA A 1 1  ? 12.811  5.083   0.537   1.00 0.00 ? 1  ALA A C    8 
ATOM   6836 O O    . ALA A 1 1  ? 13.584  4.270   1.044   1.00 0.00 ? 1  ALA A O    8 
ATOM   6837 C CB   . ALA A 1 1  ? 13.217  6.573   2.503   1.00 0.00 ? 1  ALA A CB   8 
ATOM   6838 H H1   . ALA A 1 1  ? 10.932  5.097   2.363   1.00 0.00 ? 1  ALA A H1   8 
ATOM   6839 H H2   . ALA A 1 1  ? 10.277  5.939   1.019   1.00 0.00 ? 1  ALA A H2   8 
ATOM   6840 H H3   . ALA A 1 1  ? 10.640  6.783   2.469   1.00 0.00 ? 1  ALA A H3   8 
ATOM   6841 H HA   . ALA A 1 1  ? 12.246  7.135   0.702   1.00 0.00 ? 1  ALA A HA   8 
ATOM   6842 H HB1  . ALA A 1 1  ? 13.216  5.745   3.195   1.00 0.00 ? 1  ALA A HB1  8 
ATOM   6843 H HB2  . ALA A 1 1  ? 12.880  7.466   3.009   1.00 0.00 ? 1  ALA A HB2  8 
ATOM   6844 H HB3  . ALA A 1 1  ? 14.217  6.728   2.128   1.00 0.00 ? 1  ALA A HB3  8 
ATOM   6845 N N    . CYS A 1 2  ? 12.389  4.995   -0.720  1.00 0.00 ? 2  CYS A N    8 
ATOM   6846 C CA   . CYS A 1 2  ? 12.819  3.912   -1.598  1.00 0.00 ? 2  CYS A CA   8 
ATOM   6847 C C    . CYS A 1 2  ? 12.675  4.310   -3.065  1.00 0.00 ? 2  CYS A C    8 
ATOM   6848 O O    . CYS A 1 2  ? 13.656  4.343   -3.808  1.00 0.00 ? 2  CYS A O    8 
ATOM   6849 C CB   . CYS A 1 2  ? 12.012  2.638   -1.321  1.00 0.00 ? 2  CYS A CB   8 
ATOM   6850 S SG   . CYS A 1 2  ? 10.291  2.931   -0.796  1.00 0.00 ? 2  CYS A SG   8 
ATOM   6851 H H    . CYS A 1 2  ? 11.773  5.675   -1.066  1.00 0.00 ? 2  CYS A H    8 
ATOM   6852 H HA   . CYS A 1 2  ? 13.861  3.717   -1.394  1.00 0.00 ? 2  CYS A HA   8 
ATOM   6853 H HB2  . CYS A 1 2  ? 11.980  2.039   -2.218  1.00 0.00 ? 2  CYS A HB2  8 
ATOM   6854 H HB3  . CYS A 1 2  ? 12.501  2.075   -0.538  1.00 0.00 ? 2  CYS A HB3  8 
ATOM   6855 N N    . GLN A 1 3  ? 11.446  4.609   -3.476  1.00 0.00 ? 3  GLN A N    8 
ATOM   6856 C CA   . GLN A 1 3  ? 11.176  5.001   -4.853  1.00 0.00 ? 3  GLN A CA   8 
ATOM   6857 C C    . GLN A 1 3  ? 9.834   5.720   -4.964  1.00 0.00 ? 3  GLN A C    8 
ATOM   6858 O O    . GLN A 1 3  ? 9.716   6.728   -5.660  1.00 0.00 ? 3  GLN A O    8 
ATOM   6859 C CB   . GLN A 1 3  ? 11.182  3.770   -5.757  1.00 0.00 ? 3  GLN A CB   8 
ATOM   6860 C CG   . GLN A 1 3  ? 11.543  4.076   -7.201  1.00 0.00 ? 3  GLN A CG   8 
ATOM   6861 C CD   . GLN A 1 3  ? 13.025  3.916   -7.477  1.00 0.00 ? 3  GLN A CD   8 
ATOM   6862 O OE1  . GLN A 1 3  ? 13.453  2.935   -8.086  1.00 0.00 ? 3  GLN A OE1  8 
ATOM   6863 N NE2  . GLN A 1 3  ? 13.819  4.882   -7.028  1.00 0.00 ? 3  GLN A NE2  8 
ATOM   6864 H H    . GLN A 1 3  ? 10.705  4.562   -2.840  1.00 0.00 ? 3  GLN A H    8 
ATOM   6865 H HA   . GLN A 1 3  ? 11.960  5.672   -5.168  1.00 0.00 ? 3  GLN A HA   8 
ATOM   6866 H HB2  . GLN A 1 3  ? 11.897  3.060   -5.371  1.00 0.00 ? 3  GLN A HB2  8 
ATOM   6867 H HB3  . GLN A 1 3  ? 10.199  3.322   -5.740  1.00 0.00 ? 3  GLN A HB3  8 
ATOM   6868 H HG2  . GLN A 1 3  ? 10.998  3.403   -7.846  1.00 0.00 ? 3  GLN A HG2  8 
ATOM   6869 H HG3  . GLN A 1 3  ? 11.258  5.094   -7.422  1.00 0.00 ? 3  GLN A HG3  8 
ATOM   6870 H HE21 . GLN A 1 3  ? 13.408  5.633   -6.551  1.00 0.00 ? 3  GLN A HE21 8 
ATOM   6871 H HE22 . GLN A 1 3  ? 14.782  4.804   -7.192  1.00 0.00 ? 3  GLN A HE22 8 
ATOM   6872 N N    . ALA A 1 4  ? 8.824   5.193   -4.276  1.00 0.00 ? 4  ALA A N    8 
ATOM   6873 C CA   . ALA A 1 4  ? 7.487   5.780   -4.298  1.00 0.00 ? 4  ALA A CA   8 
ATOM   6874 C C    . ALA A 1 4  ? 6.817   5.577   -5.654  1.00 0.00 ? 4  ALA A C    8 
ATOM   6875 O O    . ALA A 1 4  ? 5.901   6.313   -6.020  1.00 0.00 ? 4  ALA A O    8 
ATOM   6876 C CB   . ALA A 1 4  ? 7.550   7.262   -3.955  1.00 0.00 ? 4  ALA A CB   8 
ATOM   6877 H H    . ALA A 1 4  ? 8.981   4.386   -3.742  1.00 0.00 ? 4  ALA A H    8 
ATOM   6878 H HA   . ALA A 1 4  ? 6.897   5.285   -3.540  1.00 0.00 ? 4  ALA A HA   8 
ATOM   6879 H HB1  . ALA A 1 4  ? 7.540   7.843   -4.866  1.00 0.00 ? 4  ALA A HB1  8 
ATOM   6880 H HB2  . ALA A 1 4  ? 8.457   7.467   -3.407  1.00 0.00 ? 4  ALA A HB2  8 
ATOM   6881 H HB3  . ALA A 1 4  ? 6.696   7.527   -3.349  1.00 0.00 ? 4  ALA A HB3  8 
ATOM   6882 N N    . SER A 1 5  ? 7.279   4.575   -6.397  1.00 0.00 ? 5  SER A N    8 
ATOM   6883 C CA   . SER A 1 5  ? 6.723   4.278   -7.713  1.00 0.00 ? 5  SER A CA   8 
ATOM   6884 C C    . SER A 1 5  ? 6.190   2.848   -7.784  1.00 0.00 ? 5  SER A C    8 
ATOM   6885 O O    . SER A 1 5  ? 5.382   2.522   -8.653  1.00 0.00 ? 5  SER A O    8 
ATOM   6886 C CB   . SER A 1 5  ? 7.785   4.491   -8.794  1.00 0.00 ? 5  SER A CB   8 
ATOM   6887 O OG   . SER A 1 5  ? 7.223   5.081   -9.953  1.00 0.00 ? 5  SER A OG   8 
ATOM   6888 H H    . SER A 1 5  ? 8.013   4.024   -6.053  1.00 0.00 ? 5  SER A H    8 
ATOM   6889 H HA   . SER A 1 5  ? 5.906   4.962   -7.888  1.00 0.00 ? 5  SER A HA   8 
ATOM   6890 H HB2  . SER A 1 5  ? 8.558   5.141   -8.414  1.00 0.00 ? 5  SER A HB2  8 
ATOM   6891 H HB3  . SER A 1 5  ? 8.217   3.538   -9.064  1.00 0.00 ? 5  SER A HB3  8 
ATOM   6892 H HG   . SER A 1 5  ? 7.909   5.538   -10.445 1.00 0.00 ? 5  SER A HG   8 
ATOM   6893 N N    . GLN A 1 6  ? 6.649   1.994   -6.871  1.00 0.00 ? 6  GLN A N    8 
ATOM   6894 C CA   . GLN A 1 6  ? 6.223   0.607   -6.839  1.00 0.00 ? 6  GLN A CA   8 
ATOM   6895 C C    . GLN A 1 6  ? 4.810   0.466   -6.276  1.00 0.00 ? 6  GLN A C    8 
ATOM   6896 O O    . GLN A 1 6  ? 4.240   -0.625  -6.280  1.00 0.00 ? 6  GLN A O    8 
ATOM   6897 C CB   . GLN A 1 6  ? 7.200   -0.225  -6.006  1.00 0.00 ? 6  GLN A CB   8 
ATOM   6898 C CG   . GLN A 1 6  ? 8.599   -0.289  -6.596  1.00 0.00 ? 6  GLN A CG   8 
ATOM   6899 C CD   . GLN A 1 6  ? 8.828   -1.542  -7.419  1.00 0.00 ? 6  GLN A CD   8 
ATOM   6900 O OE1  . GLN A 1 6  ? 9.091   -2.615  -6.877  1.00 0.00 ? 6  GLN A OE1  8 
ATOM   6901 N NE2  . GLN A 1 6  ? 8.729   -1.411  -8.737  1.00 0.00 ? 6  GLN A NE2  8 
ATOM   6902 H H    . GLN A 1 6  ? 7.290   2.299   -6.210  1.00 0.00 ? 6  GLN A H    8 
ATOM   6903 H HA   . GLN A 1 6  ? 6.234   0.248   -7.849  1.00 0.00 ? 6  GLN A HA   8 
ATOM   6904 H HB2  . GLN A 1 6  ? 7.268   0.204   -5.016  1.00 0.00 ? 6  GLN A HB2  8 
ATOM   6905 H HB3  . GLN A 1 6  ? 6.819   -1.232  -5.927  1.00 0.00 ? 6  GLN A HB3  8 
ATOM   6906 H HG2  . GLN A 1 6  ? 8.749   0.572   -7.231  1.00 0.00 ? 6  GLN A HG2  8 
ATOM   6907 H HG3  . GLN A 1 6  ? 9.317   -0.269  -5.790  1.00 0.00 ? 6  GLN A HG3  8 
ATOM   6908 H HE21 . GLN A 1 6  ? 8.517   -0.526  -9.100  1.00 0.00 ? 6  GLN A HE21 8 
ATOM   6909 H HE22 . GLN A 1 6  ? 8.873   -2.205  -9.293  1.00 0.00 ? 6  GLN A HE22 8 
ATOM   6910 N N    . LEU A 1 7  ? 4.253   1.567   -5.780  1.00 0.00 ? 7  LEU A N    8 
ATOM   6911 C CA   . LEU A 1 7  ? 2.913   1.547   -5.203  1.00 0.00 ? 7  LEU A CA   8 
ATOM   6912 C C    . LEU A 1 7  ? 1.944   2.416   -6.003  1.00 0.00 ? 7  LEU A C    8 
ATOM   6913 O O    . LEU A 1 7  ? 0.728   2.244   -5.911  1.00 0.00 ? 7  LEU A O    8 
ATOM   6914 C CB   . LEU A 1 7  ? 2.964   2.019   -3.749  1.00 0.00 ? 7  LEU A CB   8 
ATOM   6915 C CG   . LEU A 1 7  ? 4.239   1.638   -2.991  1.00 0.00 ? 7  LEU A CG   8 
ATOM   6916 C CD1  . LEU A 1 7  ? 4.341   2.419   -1.690  1.00 0.00 ? 7  LEU A CD1  8 
ATOM   6917 C CD2  . LEU A 1 7  ? 4.269   0.140   -2.720  1.00 0.00 ? 7  LEU A CD2  8 
ATOM   6918 H H    . LEU A 1 7  ? 4.755   2.407   -5.792  1.00 0.00 ? 7  LEU A H    8 
ATOM   6919 H HA   . LEU A 1 7  ? 2.561   0.527   -5.225  1.00 0.00 ? 7  LEU A HA   8 
ATOM   6920 H HB2  . LEU A 1 7  ? 2.871   3.095   -3.738  1.00 0.00 ? 7  LEU A HB2  8 
ATOM   6921 H HB3  . LEU A 1 7  ? 2.121   1.596   -3.224  1.00 0.00 ? 7  LEU A HB3  8 
ATOM   6922 H HG   . LEU A 1 7  ? 5.100   1.886   -3.599  1.00 0.00 ? 7  LEU A HG   8 
ATOM   6923 H HD11 . LEU A 1 7  ? 3.835   3.366   -1.799  1.00 0.00 ? 7  LEU A HD11 8 
ATOM   6924 H HD12 . LEU A 1 7  ? 5.381   2.590   -1.454  1.00 0.00 ? 7  LEU A HD12 8 
ATOM   6925 H HD13 . LEU A 1 7  ? 3.880   1.854   -0.894  1.00 0.00 ? 7  LEU A HD13 8 
ATOM   6926 H HD21 . LEU A 1 7  ? 4.791   -0.048  -1.794  1.00 0.00 ? 7  LEU A HD21 8 
ATOM   6927 H HD22 . LEU A 1 7  ? 4.779   -0.363  -3.529  1.00 0.00 ? 7  LEU A HD22 8 
ATOM   6928 H HD23 . LEU A 1 7  ? 3.258   -0.233  -2.645  1.00 0.00 ? 7  LEU A HD23 8 
ATOM   6929 N N    . ALA A 1 8  ? 2.482   3.349   -6.786  1.00 0.00 ? 8  ALA A N    8 
ATOM   6930 C CA   . ALA A 1 8  ? 1.656   4.238   -7.595  1.00 0.00 ? 8  ALA A CA   8 
ATOM   6931 C C    . ALA A 1 8  ? 0.617   3.460   -8.390  1.00 0.00 ? 8  ALA A C    8 
ATOM   6932 O O    . ALA A 1 8  ? -0.571  3.780   -8.370  1.00 0.00 ? 8  ALA A O    8 
ATOM   6933 C CB   . ALA A 1 8  ? 2.527   5.066   -8.528  1.00 0.00 ? 8  ALA A CB   8 
ATOM   6934 H H    . ALA A 1 8  ? 3.455   3.444   -6.820  1.00 0.00 ? 8  ALA A H    8 
ATOM   6935 H HA   . ALA A 1 8  ? 1.150   4.907   -6.930  1.00 0.00 ? 8  ALA A HA   8 
ATOM   6936 H HB1  . ALA A 1 8  ? 3.476   5.265   -8.053  1.00 0.00 ? 8  ALA A HB1  8 
ATOM   6937 H HB2  . ALA A 1 8  ? 2.032   6.000   -8.749  1.00 0.00 ? 8  ALA A HB2  8 
ATOM   6938 H HB3  . ALA A 1 8  ? 2.691   4.520   -9.446  1.00 0.00 ? 8  ALA A HB3  8 
ATOM   6939 N N    . VAL A 1 9  ? 1.082   2.439   -9.087  1.00 0.00 ? 9  VAL A N    8 
ATOM   6940 C CA   . VAL A 1 9  ? 0.215   1.598   -9.898  1.00 0.00 ? 9  VAL A CA   8 
ATOM   6941 C C    . VAL A 1 9  ? -0.902  0.979   -9.061  1.00 0.00 ? 9  VAL A C    8 
ATOM   6942 O O    . VAL A 1 9  ? -1.947  0.595   -9.586  1.00 0.00 ? 9  VAL A O    8 
ATOM   6943 C CB   . VAL A 1 9  ? 1.013   0.473   -10.588 1.00 0.00 ? 9  VAL A CB   8 
ATOM   6944 C CG1  . VAL A 1 9  ? 1.661   -0.438  -9.557  1.00 0.00 ? 9  VAL A CG1  8 
ATOM   6945 C CG2  . VAL A 1 9  ? 0.118   -0.322  -11.527 1.00 0.00 ? 9  VAL A CG2  8 
ATOM   6946 H H    . VAL A 1 9  ? 2.035   2.248   -9.055  1.00 0.00 ? 9  VAL A H    8 
ATOM   6947 H HA   . VAL A 1 9  ? -0.221  2.219   -10.658 1.00 0.00 ? 9  VAL A HA   8 
ATOM   6948 H HB   . VAL A 1 9  ? 1.798   0.927   -11.175 1.00 0.00 ? 9  VAL A HB   8 
ATOM   6949 H HG11 . VAL A 1 9  ? 0.920   -0.748  -8.834  1.00 0.00 ? 9  VAL A HG11 8 
ATOM   6950 H HG12 . VAL A 1 9  ? 2.454   0.095   -9.053  1.00 0.00 ? 9  VAL A HG12 8 
ATOM   6951 H HG13 . VAL A 1 9  ? 2.069   -1.308  -10.050 1.00 0.00 ? 9  VAL A HG13 8 
ATOM   6952 H HG21 . VAL A 1 9  ? 0.725   -0.816  -12.271 1.00 0.00 ? 9  VAL A HG21 8 
ATOM   6953 H HG22 . VAL A 1 9  ? -0.577  0.345   -12.014 1.00 0.00 ? 9  VAL A HG22 8 
ATOM   6954 H HG23 . VAL A 1 9  ? -0.430  -1.062  -10.961 1.00 0.00 ? 9  VAL A HG23 8 
ATOM   6955 N N    . CYS A 1 10 ? -0.671  0.885   -7.757  1.00 0.00 ? 10 CYS A N    8 
ATOM   6956 C CA   . CYS A 1 10 ? -1.651  0.311   -6.842  1.00 0.00 ? 10 CYS A CA   8 
ATOM   6957 C C    . CYS A 1 10 ? -2.705  1.343   -6.469  1.00 0.00 ? 10 CYS A C    8 
ATOM   6958 O O    . CYS A 1 10 ? -3.870  1.012   -6.249  1.00 0.00 ? 10 CYS A O    8 
ATOM   6959 C CB   . CYS A 1 10 ? -0.957  -0.183  -5.577  1.00 0.00 ? 10 CYS A CB   8 
ATOM   6960 S SG   . CYS A 1 10 ? -1.845  -1.520  -4.715  1.00 0.00 ? 10 CYS A SG   8 
ATOM   6961 H H    . CYS A 1 10 ? 0.182   1.207   -7.401  1.00 0.00 ? 10 CYS A H    8 
ATOM   6962 H HA   . CYS A 1 10 ? -2.128  -0.522  -7.335  1.00 0.00 ? 10 CYS A HA   8 
ATOM   6963 H HB2  . CYS A 1 10 ? 0.024   -0.547  -5.835  1.00 0.00 ? 10 CYS A HB2  8 
ATOM   6964 H HB3  . CYS A 1 10 ? -0.859  0.644   -4.885  1.00 0.00 ? 10 CYS A HB3  8 
ATOM   6965 N N    . ALA A 1 11 ? -2.277  2.598   -6.395  1.00 0.00 ? 11 ALA A N    8 
ATOM   6966 C CA   . ALA A 1 11 ? -3.165  3.702   -6.044  1.00 0.00 ? 11 ALA A CA   8 
ATOM   6967 C C    . ALA A 1 11 ? -4.487  3.613   -6.795  1.00 0.00 ? 11 ALA A C    8 
ATOM   6968 O O    . ALA A 1 11 ? -5.525  4.063   -6.309  1.00 0.00 ? 11 ALA A O    8 
ATOM   6969 C CB   . ALA A 1 11 ? -2.486  5.035   -6.323  1.00 0.00 ? 11 ALA A CB   8 
ATOM   6970 H H    . ALA A 1 11 ? -1.335  2.784   -6.579  1.00 0.00 ? 11 ALA A H    8 
ATOM   6971 H HA   . ALA A 1 11 ? -3.362  3.641   -4.989  1.00 0.00 ? 11 ALA A HA   8 
ATOM   6972 H HB1  . ALA A 1 11 ? -2.828  5.421   -7.272  1.00 0.00 ? 11 ALA A HB1  8 
ATOM   6973 H HB2  . ALA A 1 11 ? -1.416  4.893   -6.357  1.00 0.00 ? 11 ALA A HB2  8 
ATOM   6974 H HB3  . ALA A 1 11 ? -2.733  5.736   -5.540  1.00 0.00 ? 11 ALA A HB3  8 
ATOM   6975 N N    . SER A 1 12 ? -4.438  3.024   -7.981  1.00 0.00 ? 12 SER A N    8 
ATOM   6976 C CA   . SER A 1 12 ? -5.624  2.865   -8.809  1.00 0.00 ? 12 SER A CA   8 
ATOM   6977 C C    . SER A 1 12 ? -6.731  2.147   -8.042  1.00 0.00 ? 12 SER A C    8 
ATOM   6978 O O    . SER A 1 12 ? -7.890  2.560   -8.072  1.00 0.00 ? 12 SER A O    8 
ATOM   6979 C CB   . SER A 1 12 ? -5.282  2.088   -10.082 1.00 0.00 ? 12 SER A CB   8 
ATOM   6980 O OG   . SER A 1 12 ? -4.973  2.967   -11.150 1.00 0.00 ? 12 SER A OG   8 
ATOM   6981 H H    . SER A 1 12 ? -3.582  2.690   -8.306  1.00 0.00 ? 12 SER A H    8 
ATOM   6982 H HA   . SER A 1 12 ? -5.966  3.849   -9.081  1.00 0.00 ? 12 SER A HA   8 
ATOM   6983 H HB2  . SER A 1 12 ? -4.428  1.454   -9.896  1.00 0.00 ? 12 SER A HB2  8 
ATOM   6984 H HB3  . SER A 1 12 ? -6.127  1.478   -10.367 1.00 0.00 ? 12 SER A HB3  8 
ATOM   6985 H HG   . SER A 1 12 ? -4.062  3.259   -11.071 1.00 0.00 ? 12 SER A HG   8 
ATOM   6986 N N    . ALA A 1 13 ? -6.363  1.069   -7.356  1.00 0.00 ? 13 ALA A N    8 
ATOM   6987 C CA   . ALA A 1 13 ? -7.317  0.291   -6.582  1.00 0.00 ? 13 ALA A CA   8 
ATOM   6988 C C    . ALA A 1 13 ? -7.620  0.957   -5.243  1.00 0.00 ? 13 ALA A C    8 
ATOM   6989 O O    . ALA A 1 13 ? -8.704  0.788   -4.687  1.00 0.00 ? 13 ALA A O    8 
ATOM   6990 C CB   . ALA A 1 13 ? -6.792  -1.121  -6.365  1.00 0.00 ? 13 ALA A CB   8 
ATOM   6991 H H    . ALA A 1 13 ? -5.428  0.791   -7.374  1.00 0.00 ? 13 ALA A H    8 
ATOM   6992 H HA   . ALA A 1 13 ? -8.227  0.226   -7.156  1.00 0.00 ? 13 ALA A HA   8 
ATOM   6993 H HB1  . ALA A 1 13 ? -7.165  -1.767  -7.147  1.00 0.00 ? 13 ALA A HB1  8 
ATOM   6994 H HB2  . ALA A 1 13 ? -7.128  -1.486  -5.406  1.00 0.00 ? 13 ALA A HB2  8 
ATOM   6995 H HB3  . ALA A 1 13 ? -5.713  -1.111  -6.390  1.00 0.00 ? 13 ALA A HB3  8 
ATOM   6996 N N    . ILE A 1 14 ? -6.656  1.715   -4.728  1.00 0.00 ? 14 ILE A N    8 
ATOM   6997 C CA   . ILE A 1 14 ? -6.826  2.404   -3.455  1.00 0.00 ? 14 ILE A CA   8 
ATOM   6998 C C    . ILE A 1 14 ? -7.832  3.547   -3.588  1.00 0.00 ? 14 ILE A C    8 
ATOM   6999 O O    . ILE A 1 14 ? -8.885  3.539   -2.950  1.00 0.00 ? 14 ILE A O    8 
ATOM   7000 C CB   . ILE A 1 14 ? -5.477  2.957   -2.932  1.00 0.00 ? 14 ILE A CB   8 
ATOM   7001 C CG1  . ILE A 1 14 ? -4.647  1.838   -2.296  1.00 0.00 ? 14 ILE A CG1  8 
ATOM   7002 C CG2  . ILE A 1 14 ? -5.694  4.083   -1.929  1.00 0.00 ? 14 ILE A CG2  8 
ATOM   7003 C CD1  . ILE A 1 14 ? -3.736  1.130   -3.276  1.00 0.00 ? 14 ILE A CD1  8 
ATOM   7004 H H    . ILE A 1 14 ? -5.812  1.814   -5.217  1.00 0.00 ? 14 ILE A H    8 
ATOM   7005 H HA   . ILE A 1 14 ? -7.201  1.689   -2.737  1.00 0.00 ? 14 ILE A HA   8 
ATOM   7006 H HB   . ILE A 1 14 ? -4.932  3.361   -3.772  1.00 0.00 ? 14 ILE A HB   8 
ATOM   7007 H HG12 . ILE A 1 14 ? -4.030  2.258   -1.514  1.00 0.00 ? 14 ILE A HG12 8 
ATOM   7008 H HG13 . ILE A 1 14 ? -5.313  1.101   -1.867  1.00 0.00 ? 14 ILE A HG13 8 
ATOM   7009 H HG21 . ILE A 1 14 ? -6.158  4.924   -2.423  1.00 0.00 ? 14 ILE A HG21 8 
ATOM   7010 H HG22 . ILE A 1 14 ? -4.743  4.387   -1.520  1.00 0.00 ? 14 ILE A HG22 8 
ATOM   7011 H HG23 . ILE A 1 14 ? -6.334  3.736   -1.131  1.00 0.00 ? 14 ILE A HG23 8 
ATOM   7012 H HD11 . ILE A 1 14 ? -3.335  1.846   -3.978  1.00 0.00 ? 14 ILE A HD11 8 
ATOM   7013 H HD12 . ILE A 1 14 ? -4.296  0.377   -3.811  1.00 0.00 ? 14 ILE A HD12 8 
ATOM   7014 H HD13 . ILE A 1 14 ? -2.925  0.660   -2.739  1.00 0.00 ? 14 ILE A HD13 8 
ATOM   7015 N N    . LEU A 1 15 ? -7.493  4.531   -4.414  1.00 0.00 ? 15 LEU A N    8 
ATOM   7016 C CA   . LEU A 1 15 ? -8.358  5.687   -4.625  1.00 0.00 ? 15 LEU A CA   8 
ATOM   7017 C C    . LEU A 1 15 ? -9.618  5.304   -5.397  1.00 0.00 ? 15 LEU A C    8 
ATOM   7018 O O    . LEU A 1 15 ? -10.704 5.213   -4.824  1.00 0.00 ? 15 LEU A O    8 
ATOM   7019 C CB   . LEU A 1 15 ? -7.600  6.783   -5.375  1.00 0.00 ? 15 LEU A CB   8 
ATOM   7020 C CG   . LEU A 1 15 ? -6.422  7.393   -4.613  1.00 0.00 ? 15 LEU A CG   8 
ATOM   7021 C CD1  . LEU A 1 15 ? -5.281  7.721   -5.564  1.00 0.00 ? 15 LEU A CD1  8 
ATOM   7022 C CD2  . LEU A 1 15 ? -6.864  8.638   -3.858  1.00 0.00 ? 15 LEU A CD2  8 
ATOM   7023 H H    . LEU A 1 15 ? -6.637  4.481   -4.889  1.00 0.00 ? 15 LEU A H    8 
ATOM   7024 H HA   . LEU A 1 15 ? -8.647  6.063   -3.656  1.00 0.00 ? 15 LEU A HA   8 
ATOM   7025 H HB2  . LEU A 1 15 ? -7.227  6.366   -6.300  1.00 0.00 ? 15 LEU A HB2  8 
ATOM   7026 H HB3  . LEU A 1 15 ? -8.295  7.575   -5.612  1.00 0.00 ? 15 LEU A HB3  8 
ATOM   7027 H HG   . LEU A 1 15 ? -6.059  6.675   -3.891  1.00 0.00 ? 15 LEU A HG   8 
ATOM   7028 H HD11 . LEU A 1 15 ? -4.516  8.267   -5.033  1.00 0.00 ? 15 LEU A HD11 8 
ATOM   7029 H HD12 . LEU A 1 15 ? -5.654  8.323   -6.379  1.00 0.00 ? 15 LEU A HD12 8 
ATOM   7030 H HD13 . LEU A 1 15 ? -4.864  6.804   -5.954  1.00 0.00 ? 15 LEU A HD13 8 
ATOM   7031 H HD21 . LEU A 1 15 ? -6.349  8.686   -2.910  1.00 0.00 ? 15 LEU A HD21 8 
ATOM   7032 H HD22 . LEU A 1 15 ? -7.930  8.595   -3.687  1.00 0.00 ? 15 LEU A HD22 8 
ATOM   7033 H HD23 . LEU A 1 15 ? -6.628  9.515   -4.441  1.00 0.00 ? 15 LEU A HD23 8 
ATOM   7034 N N    . SER A 1 16 ? -9.468  5.087   -6.700  1.00 0.00 ? 16 SER A N    8 
ATOM   7035 C CA   . SER A 1 16 ? -10.595 4.721   -7.552  1.00 0.00 ? 16 SER A CA   8 
ATOM   7036 C C    . SER A 1 16 ? -11.343 3.514   -6.991  1.00 0.00 ? 16 SER A C    8 
ATOM   7037 O O    . SER A 1 16 ? -12.513 3.614   -6.621  1.00 0.00 ? 16 SER A O    8 
ATOM   7038 C CB   . SER A 1 16 ? -10.110 4.422   -8.973  1.00 0.00 ? 16 SER A CB   8 
ATOM   7039 O OG   . SER A 1 16 ? -10.388 5.504   -9.845  1.00 0.00 ? 16 SER A OG   8 
ATOM   7040 H H    . SER A 1 16 ? -8.578  5.179   -7.100  1.00 0.00 ? 16 SER A H    8 
ATOM   7041 H HA   . SER A 1 16 ? -11.271 5.562   -7.584  1.00 0.00 ? 16 SER A HA   8 
ATOM   7042 H HB2  . SER A 1 16 ? -9.043  4.254   -8.959  1.00 0.00 ? 16 SER A HB2  8 
ATOM   7043 H HB3  . SER A 1 16 ? -10.608 3.538   -9.345  1.00 0.00 ? 16 SER A HB3  8 
ATOM   7044 H HG   . SER A 1 16 ? -11.111 5.265   -10.430 1.00 0.00 ? 16 SER A HG   8 
ATOM   7045 N N    . GLY A 1 17 ? -10.662 2.374   -6.936  1.00 0.00 ? 17 GLY A N    8 
ATOM   7046 C CA   . GLY A 1 17 ? -11.282 1.167   -6.422  1.00 0.00 ? 17 GLY A CA   8 
ATOM   7047 C C    . GLY A 1 17 ? -11.863 0.304   -7.525  1.00 0.00 ? 17 GLY A C    8 
ATOM   7048 O O    . GLY A 1 17 ? -12.876 -0.367  -7.330  1.00 0.00 ? 17 GLY A O    8 
ATOM   7049 H H    . GLY A 1 17 ? -9.734  2.353   -7.247  1.00 0.00 ? 17 GLY A H    8 
ATOM   7050 H HA2  . GLY A 1 17 ? -10.541 0.595   -5.885  1.00 0.00 ? 17 GLY A HA2  8 
ATOM   7051 H HA3  . GLY A 1 17 ? -12.073 1.442   -5.741  1.00 0.00 ? 17 GLY A HA3  8 
ATOM   7052 N N    . ALA A 1 18 ? -11.219 0.325   -8.687  1.00 0.00 ? 18 ALA A N    8 
ATOM   7053 C CA   . ALA A 1 18 ? -11.675 -0.458  -9.827  1.00 0.00 ? 18 ALA A CA   8 
ATOM   7054 C C    . ALA A 1 18 ? -11.564 -1.948  -9.549  1.00 0.00 ? 18 ALA A C    8 
ATOM   7055 O O    . ALA A 1 18 ? -12.532 -2.696  -9.685  1.00 0.00 ? 18 ALA A O    8 
ATOM   7056 C CB   . ALA A 1 18 ? -10.878 -0.091  -11.070 1.00 0.00 ? 18 ALA A CB   8 
ATOM   7057 H H    . ALA A 1 18 ? -10.418 0.880   -8.780  1.00 0.00 ? 18 ALA A H    8 
ATOM   7058 H HA   . ALA A 1 18 ? -12.703 -0.216  -10.004 1.00 0.00 ? 18 ALA A HA   8 
ATOM   7059 H HB1  . ALA A 1 18 ? -11.306 0.790   -11.525 1.00 0.00 ? 18 ALA A HB1  8 
ATOM   7060 H HB2  . ALA A 1 18 ? -10.907 -0.911  -11.772 1.00 0.00 ? 18 ALA A HB2  8 
ATOM   7061 H HB3  . ALA A 1 18 ? -9.853  0.110   -10.793 1.00 0.00 ? 18 ALA A HB3  8 
ATOM   7062 N N    . LYS A 1 19 ? -10.373 -2.365  -9.159  1.00 0.00 ? 19 LYS A N    8 
ATOM   7063 C CA   . LYS A 1 19 ? -10.104 -3.766  -8.853  1.00 0.00 ? 19 LYS A CA   8 
ATOM   7064 C C    . LYS A 1 19 ? -8.641  -3.964  -8.465  1.00 0.00 ? 19 LYS A C    8 
ATOM   7065 O O    . LYS A 1 19 ? -7.783  -3.154  -8.816  1.00 0.00 ? 19 LYS A O    8 
ATOM   7066 C CB   . LYS A 1 19 ? -10.449 -4.655  -10.053 1.00 0.00 ? 19 LYS A CB   8 
ATOM   7067 C CG   . LYS A 1 19 ? -10.120 -4.028  -11.399 1.00 0.00 ? 19 LYS A CG   8 
ATOM   7068 C CD   . LYS A 1 19 ? -8.676  -3.556  -11.459 1.00 0.00 ? 19 LYS A CD   8 
ATOM   7069 C CE   . LYS A 1 19 ? -8.253  -3.234  -12.883 1.00 0.00 ? 19 LYS A CE   8 
ATOM   7070 N NZ   . LYS A 1 19 ? -9.071  -2.138  -13.471 1.00 0.00 ? 19 LYS A NZ   8 
ATOM   7071 H H    . LYS A 1 19 ? -9.655  -1.709  -9.074  1.00 0.00 ? 19 LYS A H    8 
ATOM   7072 H HA   . LYS A 1 19 ? -10.727 -4.048  -8.017  1.00 0.00 ? 19 LYS A HA   8 
ATOM   7073 H HB2  . LYS A 1 19 ? -9.900  -5.581  -9.969  1.00 0.00 ? 19 LYS A HB2  8 
ATOM   7074 H HB3  . LYS A 1 19 ? -11.507 -4.873  -10.031 1.00 0.00 ? 19 LYS A HB3  8 
ATOM   7075 H HG2  . LYS A 1 19 ? -10.279 -4.761  -12.176 1.00 0.00 ? 19 LYS A HG2  8 
ATOM   7076 H HG3  . LYS A 1 19 ? -10.772 -3.182  -11.561 1.00 0.00 ? 19 LYS A HG3  8 
ATOM   7077 H HD2  . LYS A 1 19 ? -8.572  -2.667  -10.854 1.00 0.00 ? 19 LYS A HD2  8 
ATOM   7078 H HD3  . LYS A 1 19 ? -8.036  -4.335  -11.070 1.00 0.00 ? 19 LYS A HD3  8 
ATOM   7079 H HE2  . LYS A 1 19 ? -7.216  -2.933  -12.878 1.00 0.00 ? 19 LYS A HE2  8 
ATOM   7080 H HE3  . LYS A 1 19 ? -8.367  -4.122  -13.488 1.00 0.00 ? 19 LYS A HE3  8 
ATOM   7081 H HZ1  . LYS A 1 19 ? -9.128  -1.338  -12.808 1.00 0.00 ? 19 LYS A HZ1  8 
ATOM   7082 H HZ2  . LYS A 1 19 ? -10.033 -2.477  -13.670 1.00 0.00 ? 19 LYS A HZ2  8 
ATOM   7083 H HZ3  . LYS A 1 19 ? -8.641  -1.808  -14.359 1.00 0.00 ? 19 LYS A HZ3  8 
ATOM   7084 N N    . PRO A 1 20 ? -8.334  -5.050  -7.735  1.00 0.00 ? 20 PRO A N    8 
ATOM   7085 C CA   . PRO A 1 20 ? -6.965  -5.348  -7.304  1.00 0.00 ? 20 PRO A CA   8 
ATOM   7086 C C    . PRO A 1 20 ? -6.067  -5.740  -8.472  1.00 0.00 ? 20 PRO A C    8 
ATOM   7087 O O    . PRO A 1 20 ? -6.505  -5.768  -9.622  1.00 0.00 ? 20 PRO A O    8 
ATOM   7088 C CB   . PRO A 1 20 ? -7.140  -6.527  -6.344  1.00 0.00 ? 20 PRO A CB   8 
ATOM   7089 C CG   . PRO A 1 20 ? -8.410  -7.178  -6.771  1.00 0.00 ? 20 PRO A CG   8 
ATOM   7090 C CD   . PRO A 1 20 ? -9.294  -6.070  -7.273  1.00 0.00 ? 20 PRO A CD   8 
ATOM   7091 H HA   . PRO A 1 20 ? -6.525  -4.513  -6.777  1.00 0.00 ? 20 PRO A HA   8 
ATOM   7092 H HB2  . PRO A 1 20 ? -6.300  -7.199  -6.439  1.00 0.00 ? 20 PRO A HB2  8 
ATOM   7093 H HB3  . PRO A 1 20 ? -7.206  -6.163  -5.330  1.00 0.00 ? 20 PRO A HB3  8 
ATOM   7094 H HG2  . PRO A 1 20 ? -8.212  -7.887  -7.561  1.00 0.00 ? 20 PRO A HG2  8 
ATOM   7095 H HG3  . PRO A 1 20 ? -8.871  -7.672  -5.929  1.00 0.00 ? 20 PRO A HG3  8 
ATOM   7096 H HD2  . PRO A 1 20 ? -9.909  -6.419  -8.090  1.00 0.00 ? 20 PRO A HD2  8 
ATOM   7097 H HD3  . PRO A 1 20 ? -9.910  -5.686  -6.473  1.00 0.00 ? 20 PRO A HD3  8 
ATOM   7098 N N    . SER A 1 21 ? -4.809  -6.044  -8.170  1.00 0.00 ? 21 SER A N    8 
ATOM   7099 C CA   . SER A 1 21 ? -3.853  -6.436  -9.195  1.00 0.00 ? 21 SER A CA   8 
ATOM   7100 C C    . SER A 1 21 ? -2.641  -7.123  -8.575  1.00 0.00 ? 21 SER A C    8 
ATOM   7101 O O    . SER A 1 21 ? -2.038  -6.611  -7.632  1.00 0.00 ? 21 SER A O    8 
ATOM   7102 C CB   . SER A 1 21 ? -3.405  -5.216  -10.002 1.00 0.00 ? 21 SER A CB   8 
ATOM   7103 O OG   . SER A 1 21 ? -4.340  -4.157  -9.889  1.00 0.00 ? 21 SER A OG   8 
ATOM   7104 H H    . SER A 1 21 ? -4.517  -6.006  -7.238  1.00 0.00 ? 21 SER A H    8 
ATOM   7105 H HA   . SER A 1 21 ? -4.347  -7.130  -9.852  1.00 0.00 ? 21 SER A HA   8 
ATOM   7106 H HB2  . SER A 1 21 ? -2.449  -4.874  -9.635  1.00 0.00 ? 21 SER A HB2  8 
ATOM   7107 H HB3  . SER A 1 21 ? -3.314  -5.490  -11.043 1.00 0.00 ? 21 SER A HB3  8 
ATOM   7108 H HG   . SER A 1 21 ? -4.032  -3.402  -10.396 1.00 0.00 ? 21 SER A HG   8 
ATOM   7109 N N    . GLY A 1 22 ? -2.290  -8.288  -9.112  1.00 0.00 ? 22 GLY A N    8 
ATOM   7110 C CA   . GLY A 1 22 ? -1.151  -9.027  -8.600  1.00 0.00 ? 22 GLY A CA   8 
ATOM   7111 C C    . GLY A 1 22 ? 0.129   -8.216  -8.636  1.00 0.00 ? 22 GLY A C    8 
ATOM   7112 O O    . GLY A 1 22 ? 1.025   -8.421  -7.819  1.00 0.00 ? 22 GLY A O    8 
ATOM   7113 H H    . GLY A 1 22 ? -2.808  -8.647  -9.862  1.00 0.00 ? 22 GLY A H    8 
ATOM   7114 H HA2  . GLY A 1 22 ? -1.353  -9.316  -7.579  1.00 0.00 ? 22 GLY A HA2  8 
ATOM   7115 H HA3  . GLY A 1 22 ? -1.017  -9.918  -9.196  1.00 0.00 ? 22 GLY A HA3  8 
ATOM   7116 N N    . GLU A 1 23 ? 0.215   -7.292  -9.590  1.00 0.00 ? 23 GLU A N    8 
ATOM   7117 C CA   . GLU A 1 23 ? 1.383   -6.448  -9.739  1.00 0.00 ? 23 GLU A CA   8 
ATOM   7118 C C    . GLU A 1 23 ? 1.697   -5.717  -8.438  1.00 0.00 ? 23 GLU A C    8 
ATOM   7119 O O    . GLU A 1 23 ? 2.844   -5.685  -7.991  1.00 0.00 ? 23 GLU A O    8 
ATOM   7120 C CB   . GLU A 1 23 ? 1.139   -5.443  -10.859 1.00 0.00 ? 23 GLU A CB   8 
ATOM   7121 C CG   . GLU A 1 23 ? 2.412   -4.962  -11.513 1.00 0.00 ? 23 GLU A CG   8 
ATOM   7122 C CD   . GLU A 1 23 ? 2.382   -3.483  -11.844 1.00 0.00 ? 23 GLU A CD   8 
ATOM   7123 O OE1  . GLU A 1 23 ? 1.305   -2.984  -12.235 1.00 0.00 ? 23 GLU A OE1  8 
ATOM   7124 O OE2  . GLU A 1 23 ? 3.434   -2.823  -11.713 1.00 0.00 ? 23 GLU A OE2  8 
ATOM   7125 H H    . GLU A 1 23 ? -0.526  -7.176  -10.214 1.00 0.00 ? 23 GLU A H    8 
ATOM   7126 H HA   . GLU A 1 23 ? 2.221   -7.076  -10.003 1.00 0.00 ? 23 GLU A HA   8 
ATOM   7127 H HB2  . GLU A 1 23 ? 0.521   -5.906  -11.617 1.00 0.00 ? 23 GLU A HB2  8 
ATOM   7128 H HB3  . GLU A 1 23 ? 0.620   -4.585  -10.452 1.00 0.00 ? 23 GLU A HB3  8 
ATOM   7129 H HG2  . GLU A 1 23 ? 3.233   -5.152  -10.841 1.00 0.00 ? 23 GLU A HG2  8 
ATOM   7130 H HG3  . GLU A 1 23 ? 2.555   -5.520  -12.423 1.00 0.00 ? 23 GLU A HG3  8 
ATOM   7131 N N    . CYS A 1 24 ? 0.667   -5.129  -7.835  1.00 0.00 ? 24 CYS A N    8 
ATOM   7132 C CA   . CYS A 1 24 ? 0.827   -4.395  -6.586  1.00 0.00 ? 24 CYS A CA   8 
ATOM   7133 C C    . CYS A 1 24 ? 1.488   -5.264  -5.522  1.00 0.00 ? 24 CYS A C    8 
ATOM   7134 O O    . CYS A 1 24 ? 2.197   -4.766  -4.648  1.00 0.00 ? 24 CYS A O    8 
ATOM   7135 C CB   . CYS A 1 24 ? -0.529  -3.891  -6.084  1.00 0.00 ? 24 CYS A CB   8 
ATOM   7136 S SG   . CYS A 1 24 ? -0.445  -2.976  -4.510  1.00 0.00 ? 24 CYS A SG   8 
ATOM   7137 H H    . CYS A 1 24 ? -0.219  -5.187  -8.241  1.00 0.00 ? 24 CYS A H    8 
ATOM   7138 H HA   . CYS A 1 24 ? 1.461   -3.553  -6.786  1.00 0.00 ? 24 CYS A HA   8 
ATOM   7139 H HB2  . CYS A 1 24 ? -0.956  -3.231  -6.825  1.00 0.00 ? 24 CYS A HB2  8 
ATOM   7140 H HB3  . CYS A 1 24 ? -1.188  -4.736  -5.940  1.00 0.00 ? 24 CYS A HB3  8 
ATOM   7141 N N    . CYS A 1 25 ? 1.249   -6.564  -5.608  1.00 0.00 ? 25 CYS A N    8 
ATOM   7142 C CA   . CYS A 1 25 ? 1.817   -7.514  -4.660  1.00 0.00 ? 25 CYS A CA   8 
ATOM   7143 C C    . CYS A 1 25 ? 3.289   -7.767  -4.973  1.00 0.00 ? 25 CYS A C    8 
ATOM   7144 O O    . CYS A 1 25 ? 4.106   -7.937  -4.068  1.00 0.00 ? 25 CYS A O    8 
ATOM   7145 C CB   . CYS A 1 25 ? 1.029   -8.828  -4.698  1.00 0.00 ? 25 CYS A CB   8 
ATOM   7146 S SG   . CYS A 1 25 ? 1.759   -10.183 -3.721  1.00 0.00 ? 25 CYS A SG   8 
ATOM   7147 H H    . CYS A 1 25 ? 0.677   -6.892  -6.331  1.00 0.00 ? 25 CYS A H    8 
ATOM   7148 H HA   . CYS A 1 25 ? 1.739   -7.085  -3.673  1.00 0.00 ? 25 CYS A HA   8 
ATOM   7149 H HB2  . CYS A 1 25 ? 0.035   -8.651  -4.315  1.00 0.00 ? 25 CYS A HB2  8 
ATOM   7150 H HB3  . CYS A 1 25 ? 0.957   -9.164  -5.722  1.00 0.00 ? 25 CYS A HB3  8 
ATOM   7151 N N    . GLY A 1 26 ? 3.618   -7.788  -6.260  1.00 0.00 ? 26 GLY A N    8 
ATOM   7152 C CA   . GLY A 1 26 ? 4.990   -8.016  -6.672  1.00 0.00 ? 26 GLY A CA   8 
ATOM   7153 C C    . GLY A 1 26 ? 5.845   -6.768  -6.568  1.00 0.00 ? 26 GLY A C    8 
ATOM   7154 O O    . GLY A 1 26 ? 7.044   -6.848  -6.305  1.00 0.00 ? 26 GLY A O    8 
ATOM   7155 H H    . GLY A 1 26 ? 2.924   -7.644  -6.936  1.00 0.00 ? 26 GLY A H    8 
ATOM   7156 H HA2  . GLY A 1 26 ? 5.419   -8.785  -6.046  1.00 0.00 ? 26 GLY A HA2  8 
ATOM   7157 H HA3  . GLY A 1 26 ? 4.995   -8.358  -7.696  1.00 0.00 ? 26 GLY A HA3  8 
ATOM   7158 N N    . ASN A 1 27 ? 5.227   -5.610  -6.781  1.00 0.00 ? 27 ASN A N    8 
ATOM   7159 C CA   . ASN A 1 27 ? 5.937   -4.344  -6.716  1.00 0.00 ? 27 ASN A CA   8 
ATOM   7160 C C    . ASN A 1 27 ? 6.422   -4.064  -5.307  1.00 0.00 ? 27 ASN A C    8 
ATOM   7161 O O    . ASN A 1 27 ? 7.622   -3.944  -5.062  1.00 0.00 ? 27 ASN A O    8 
ATOM   7162 C CB   . ASN A 1 27 ? 5.041   -3.204  -7.202  1.00 0.00 ? 27 ASN A CB   8 
ATOM   7163 C CG   . ASN A 1 27 ? 4.711   -3.319  -8.677  1.00 0.00 ? 27 ASN A CG   8 
ATOM   7164 O OD1  . ASN A 1 27 ? 3.561   -3.550  -9.052  1.00 0.00 ? 27 ASN A OD1  8 
ATOM   7165 N ND2  . ASN A 1 27 ? 5.721   -3.157  -9.522  1.00 0.00 ? 27 ASN A ND2  8 
ATOM   7166 H H    . ASN A 1 27 ? 4.277   -5.606  -6.993  1.00 0.00 ? 27 ASN A H    8 
ATOM   7167 H HA   . ASN A 1 27 ? 6.784   -4.420  -7.355  1.00 0.00 ? 27 ASN A HA   8 
ATOM   7168 H HB2  . ASN A 1 27 ? 4.117   -3.216  -6.643  1.00 0.00 ? 27 ASN A HB2  8 
ATOM   7169 H HB3  . ASN A 1 27 ? 5.545   -2.263  -7.037  1.00 0.00 ? 27 ASN A HB3  8 
ATOM   7170 H HD21 . ASN A 1 27 ? 6.610   -2.975  -9.152  1.00 0.00 ? 27 ASN A HD21 8 
ATOM   7171 H HD22 . ASN A 1 27 ? 5.537   -3.227  -10.482 1.00 0.00 ? 27 ASN A HD22 8 
ATOM   7172 N N    . LEU A 1 28 ? 5.482   -3.965  -4.385  1.00 0.00 ? 28 LEU A N    8 
ATOM   7173 C CA   . LEU A 1 28 ? 5.810   -3.704  -2.991  1.00 0.00 ? 28 LEU A CA   8 
ATOM   7174 C C    . LEU A 1 28 ? 6.880   -4.673  -2.504  1.00 0.00 ? 28 LEU A C    8 
ATOM   7175 O O    . LEU A 1 28 ? 7.654   -4.360  -1.599  1.00 0.00 ? 28 LEU A O    8 
ATOM   7176 C CB   . LEU A 1 28 ? 4.566   -3.805  -2.109  1.00 0.00 ? 28 LEU A CB   8 
ATOM   7177 C CG   . LEU A 1 28 ? 4.003   -5.214  -1.958  1.00 0.00 ? 28 LEU A CG   8 
ATOM   7178 C CD1  . LEU A 1 28 ? 4.677   -5.942  -0.803  1.00 0.00 ? 28 LEU A CD1  8 
ATOM   7179 C CD2  . LEU A 1 28 ? 2.495   -5.168  -1.759  1.00 0.00 ? 28 LEU A CD2  8 
ATOM   7180 H H    . LEU A 1 28 ? 4.551   -4.073  -4.649  1.00 0.00 ? 28 LEU A H    8 
ATOM   7181 H HA   . LEU A 1 28 ? 6.198   -2.707  -2.934  1.00 0.00 ? 28 LEU A HA   8 
ATOM   7182 H HB2  . LEU A 1 28 ? 4.815   -3.431  -1.126  1.00 0.00 ? 28 LEU A HB2  8 
ATOM   7183 H HB3  . LEU A 1 28 ? 3.797   -3.177  -2.532  1.00 0.00 ? 28 LEU A HB3  8 
ATOM   7184 H HG   . LEU A 1 28 ? 4.206   -5.764  -2.863  1.00 0.00 ? 28 LEU A HG   8 
ATOM   7185 H HD11 . LEU A 1 28 ? 5.575   -5.413  -0.518  1.00 0.00 ? 28 LEU A HD11 8 
ATOM   7186 H HD12 . LEU A 1 28 ? 4.933   -6.946  -1.109  1.00 0.00 ? 28 LEU A HD12 8 
ATOM   7187 H HD13 . LEU A 1 28 ? 4.002   -5.983  0.039   1.00 0.00 ? 28 LEU A HD13 8 
ATOM   7188 H HD21 . LEU A 1 28 ? 2.076   -6.144  -1.955  1.00 0.00 ? 28 LEU A HD21 8 
ATOM   7189 H HD22 . LEU A 1 28 ? 2.064   -4.448  -2.439  1.00 0.00 ? 28 LEU A HD22 8 
ATOM   7190 H HD23 . LEU A 1 28 ? 2.275   -4.880  -0.742  1.00 0.00 ? 28 LEU A HD23 8 
ATOM   7191 N N    . ARG A 1 29 ? 6.918   -5.851  -3.120  1.00 0.00 ? 29 ARG A N    8 
ATOM   7192 C CA   . ARG A 1 29 ? 7.891   -6.869  -2.765  1.00 0.00 ? 29 ARG A CA   8 
ATOM   7193 C C    . ARG A 1 29 ? 9.296   -6.305  -2.808  1.00 0.00 ? 29 ARG A C    8 
ATOM   7194 O O    . ARG A 1 29 ? 10.099  -6.533  -1.903  1.00 0.00 ? 29 ARG A O    8 
ATOM   7195 C CB   . ARG A 1 29 ? 7.769   -8.073  -3.698  1.00 0.00 ? 29 ARG A CB   8 
ATOM   7196 C CG   . ARG A 1 29 ? 7.534   -9.378  -2.960  1.00 0.00 ? 29 ARG A CG   8 
ATOM   7197 C CD   . ARG A 1 29 ? 6.307   -10.109 -3.478  1.00 0.00 ? 29 ARG A CD   8 
ATOM   7198 N NE   . ARG A 1 29 ? 5.438   -10.544 -2.389  1.00 0.00 ? 29 ARG A NE   8 
ATOM   7199 C CZ   . ARG A 1 29 ? 4.570   -11.550 -2.486  1.00 0.00 ? 29 ARG A CZ   8 
ATOM   7200 N NH1  . ARG A 1 29 ? 4.441   -12.218 -3.626  1.00 0.00 ? 29 ARG A NH1  8 
ATOM   7201 N NH2  . ARG A 1 29 ? 3.828   -11.886 -1.440  1.00 0.00 ? 29 ARG A NH2  8 
ATOM   7202 H H    . ARG A 1 29 ? 6.278   -6.037  -3.830  1.00 0.00 ? 29 ARG A H    8 
ATOM   7203 H HA   . ARG A 1 29 ? 7.681   -7.177  -1.765  1.00 0.00 ? 29 ARG A HA   8 
ATOM   7204 H HB2  . ARG A 1 29 ? 6.943   -7.909  -4.373  1.00 0.00 ? 29 ARG A HB2  8 
ATOM   7205 H HB3  . ARG A 1 29 ? 8.679   -8.167  -4.273  1.00 0.00 ? 29 ARG A HB3  8 
ATOM   7206 H HG2  . ARG A 1 29 ? 8.398   -10.012 -3.085  1.00 0.00 ? 29 ARG A HG2  8 
ATOM   7207 H HG3  . ARG A 1 29 ? 7.394   -9.160  -1.913  1.00 0.00 ? 29 ARG A HG3  8 
ATOM   7208 H HD2  . ARG A 1 29 ? 5.753   -9.445  -4.125  1.00 0.00 ? 29 ARG A HD2  8 
ATOM   7209 H HD3  . ARG A 1 29 ? 6.629   -10.973 -4.039  1.00 0.00 ? 29 ARG A HD3  8 
ATOM   7210 H HE   . ARG A 1 29 ? 5.507   -10.063 -1.537  1.00 0.00 ? 29 ARG A HE   8 
ATOM   7211 H HH11 . ARG A 1 29 ? 4.995   -11.969 -4.419  1.00 0.00 ? 29 ARG A HH11 8 
ATOM   7212 H HH12 . ARG A 1 29 ? 3.787   -12.973 -3.691  1.00 0.00 ? 29 ARG A HH12 8 
ATOM   7213 H HH21 . ARG A 1 29 ? 3.920   -11.385 -0.580  1.00 0.00 ? 29 ARG A HH21 8 
ATOM   7214 H HH22 . ARG A 1 29 ? 3.175   -12.641 -1.512  1.00 0.00 ? 29 ARG A HH22 8 
ATOM   7215 N N    . ALA A 1 30 ? 9.580   -5.549  -3.854  1.00 0.00 ? 30 ALA A N    8 
ATOM   7216 C CA   . ALA A 1 30 ? 10.882  -4.927  -4.003  1.00 0.00 ? 30 ALA A CA   8 
ATOM   7217 C C    . ALA A 1 30 ? 11.203  -4.083  -2.774  1.00 0.00 ? 30 ALA A C    8 
ATOM   7218 O O    . ALA A 1 30 ? 12.366  -3.830  -2.460  1.00 0.00 ? 30 ALA A O    8 
ATOM   7219 C CB   . ALA A 1 30 ? 10.928  -4.077  -5.264  1.00 0.00 ? 30 ALA A CB   8 
ATOM   7220 H H    . ALA A 1 30 ? 8.892   -5.394  -4.530  1.00 0.00 ? 30 ALA A H    8 
ATOM   7221 H HA   . ALA A 1 30 ? 11.612  -5.711  -4.094  1.00 0.00 ? 30 ALA A HA   8 
ATOM   7222 H HB1  . ALA A 1 30 ? 11.954  -3.842  -5.502  1.00 0.00 ? 30 ALA A HB1  8 
ATOM   7223 H HB2  . ALA A 1 30 ? 10.377  -3.162  -5.101  1.00 0.00 ? 30 ALA A HB2  8 
ATOM   7224 H HB3  . ALA A 1 30 ? 10.484  -4.623  -6.083  1.00 0.00 ? 30 ALA A HB3  8 
ATOM   7225 N N    . GLN A 1 31 ? 10.150  -3.660  -2.078  1.00 0.00 ? 31 GLN A N    8 
ATOM   7226 C CA   . GLN A 1 31 ? 10.290  -2.853  -0.873  1.00 0.00 ? 31 GLN A CA   8 
ATOM   7227 C C    . GLN A 1 31 ? 10.606  -3.733  0.329   1.00 0.00 ? 31 GLN A C    8 
ATOM   7228 O O    . GLN A 1 31 ? 11.727  -3.728  0.839   1.00 0.00 ? 31 GLN A O    8 
ATOM   7229 C CB   . GLN A 1 31 ? 9.014   -2.042  -0.619  1.00 0.00 ? 31 GLN A CB   8 
ATOM   7230 C CG   . GLN A 1 31 ? 8.394   -1.463  -1.881  1.00 0.00 ? 31 GLN A CG   8 
ATOM   7231 C CD   . GLN A 1 31 ? 8.766   -0.011  -2.091  1.00 0.00 ? 31 GLN A CD   8 
ATOM   7232 O OE1  . GLN A 1 31 ? 9.849   0.300   -2.587  1.00 0.00 ? 31 GLN A OE1  8 
ATOM   7233 N NE2  . GLN A 1 31 ? 7.867   0.887   -1.714  1.00 0.00 ? 31 GLN A NE2  8 
ATOM   7234 H H    . GLN A 1 31 ? 9.250   -3.910  -2.379  1.00 0.00 ? 31 GLN A H    8 
ATOM   7235 H HA   . GLN A 1 31 ? 11.112  -2.172  -1.023  1.00 0.00 ? 31 GLN A HA   8 
ATOM   7236 H HB2  . GLN A 1 31 ? 8.283   -2.677  -0.145  1.00 0.00 ? 31 GLN A HB2  8 
ATOM   7237 H HB3  . GLN A 1 31 ? 9.250   -1.221  0.044   1.00 0.00 ? 31 GLN A HB3  8 
ATOM   7238 H HG2  . GLN A 1 31 ? 8.732   -2.033  -2.733  1.00 0.00 ? 31 GLN A HG2  8 
ATOM   7239 H HG3  . GLN A 1 31 ? 7.319   -1.536  -1.803  1.00 0.00 ? 31 GLN A HG3  8 
ATOM   7240 H HE21 . GLN A 1 31 ? 7.022   0.563   -1.327  1.00 0.00 ? 31 GLN A HE21 8 
ATOM   7241 H HE22 . GLN A 1 31 ? 8.086   1.836   -1.832  1.00 0.00 ? 31 GLN A HE22 8 
ATOM   7242 N N    . GLN A 1 32 ? 9.608   -4.491  0.778   1.00 0.00 ? 32 GLN A N    8 
ATOM   7243 C CA   . GLN A 1 32 ? 9.766   -5.382  1.918   1.00 0.00 ? 32 GLN A CA   8 
ATOM   7244 C C    . GLN A 1 32 ? 10.392  -4.670  3.115   1.00 0.00 ? 32 GLN A C    8 
ATOM   7245 O O    . GLN A 1 32 ? 10.913  -5.309  4.029   1.00 0.00 ? 32 GLN A O    8 
ATOM   7246 C CB   . GLN A 1 32 ? 10.605  -6.580  1.514   1.00 0.00 ? 32 GLN A CB   8 
ATOM   7247 C CG   . GLN A 1 32 ? 10.110  -7.881  2.116   1.00 0.00 ? 32 GLN A CG   8 
ATOM   7248 C CD   . GLN A 1 32 ? 9.713   -8.899  1.066   1.00 0.00 ? 32 GLN A CD   8 
ATOM   7249 O OE1  . GLN A 1 32 ? 10.444  -9.853  0.801   1.00 0.00 ? 32 GLN A OE1  8 
ATOM   7250 N NE2  . GLN A 1 32 ? 8.548   -8.698  0.462   1.00 0.00 ? 32 GLN A NE2  8 
ATOM   7251 H H    . GLN A 1 32 ? 8.743   -4.455  0.326   1.00 0.00 ? 32 GLN A H    8 
ATOM   7252 H HA   . GLN A 1 32 ? 8.787   -5.731  2.203   1.00 0.00 ? 32 GLN A HA   8 
ATOM   7253 H HB2  . GLN A 1 32 ? 10.578  -6.667  0.438   1.00 0.00 ? 32 GLN A HB2  8 
ATOM   7254 H HB3  . GLN A 1 32 ? 11.622  -6.417  1.834   1.00 0.00 ? 32 GLN A HB3  8 
ATOM   7255 H HG2  . GLN A 1 32 ? 10.891  -8.302  2.729   1.00 0.00 ? 32 GLN A HG2  8 
ATOM   7256 H HG3  . GLN A 1 32 ? 9.247   -7.664  2.728   1.00 0.00 ? 32 GLN A HG3  8 
ATOM   7257 H HE21 . GLN A 1 32 ? 8.020   -7.915  0.725   1.00 0.00 ? 32 GLN A HE21 8 
ATOM   7258 H HE22 . GLN A 1 32 ? 8.262   -9.341  -0.218  1.00 0.00 ? 32 GLN A HE22 8 
ATOM   7259 N N    . GLY A 1 33 ? 10.330  -3.345  3.102   1.00 0.00 ? 33 GLY A N    8 
ATOM   7260 C CA   . GLY A 1 33 ? 10.885  -2.561  4.190   1.00 0.00 ? 33 GLY A CA   8 
ATOM   7261 C C    . GLY A 1 33 ? 10.724  -1.072  3.962   1.00 0.00 ? 33 GLY A C    8 
ATOM   7262 O O    . GLY A 1 33 ? 11.529  -0.273  4.441   1.00 0.00 ? 33 GLY A O    8 
ATOM   7263 H H    . GLY A 1 33 ? 9.901   -2.894  2.348   1.00 0.00 ? 33 GLY A H    8 
ATOM   7264 H HA2  . GLY A 1 33 ? 10.384  -2.831  5.107   1.00 0.00 ? 33 GLY A HA2  8 
ATOM   7265 H HA3  . GLY A 1 33 ? 11.936  -2.789  4.284   1.00 0.00 ? 33 GLY A HA3  8 
ATOM   7266 N N    . CYS A 1 34 ? 9.689   -0.697  3.215   1.00 0.00 ? 34 CYS A N    8 
ATOM   7267 C CA   . CYS A 1 34 ? 9.434   0.690   2.911   1.00 0.00 ? 34 CYS A CA   8 
ATOM   7268 C C    . CYS A 1 34 ? 7.954   1.029   3.027   1.00 0.00 ? 34 CYS A C    8 
ATOM   7269 O O    . CYS A 1 34 ? 7.588   2.138   3.414   1.00 0.00 ? 34 CYS A O    8 
ATOM   7270 C CB   . CYS A 1 34 ? 9.915   0.996   1.508   1.00 0.00 ? 34 CYS A CB   8 
ATOM   7271 S SG   . CYS A 1 34 ? 10.370  2.737   1.222   1.00 0.00 ? 34 CYS A SG   8 
ATOM   7272 H H    . CYS A 1 34 ? 9.099   -1.366  2.854   1.00 0.00 ? 34 CYS A H    8 
ATOM   7273 H HA   . CYS A 1 34 ? 9.978   1.272   3.598   1.00 0.00 ? 34 CYS A HA   8 
ATOM   7274 H HB2  . CYS A 1 34 ? 10.771  0.380   1.291   1.00 0.00 ? 34 CYS A HB2  8 
ATOM   7275 H HB3  . CYS A 1 34 ? 9.124   0.756   0.827   1.00 0.00 ? 34 CYS A HB3  8 
ATOM   7276 N N    . PHE A 1 35 ? 7.108   0.071   2.672   1.00 0.00 ? 35 PHE A N    8 
ATOM   7277 C CA   . PHE A 1 35 ? 5.663   0.274   2.719   1.00 0.00 ? 35 PHE A CA   8 
ATOM   7278 C C    . PHE A 1 35 ? 5.217   0.762   4.086   1.00 0.00 ? 35 PHE A C    8 
ATOM   7279 O O    . PHE A 1 35 ? 4.516   1.766   4.211   1.00 0.00 ? 35 PHE A O    8 
ATOM   7280 C CB   . PHE A 1 35 ? 4.896   -1.007  2.363   1.00 0.00 ? 35 PHE A CB   8 
ATOM   7281 C CG   . PHE A 1 35 ? 5.556   -2.301  2.766   1.00 0.00 ? 35 PHE A CG   8 
ATOM   7282 C CD1  . PHE A 1 35 ? 5.434   -2.778  4.062   1.00 0.00 ? 35 PHE A CD1  8 
ATOM   7283 C CD2  . PHE A 1 35 ? 6.266   -3.060  1.845   1.00 0.00 ? 35 PHE A CD2  8 
ATOM   7284 C CE1  . PHE A 1 35 ? 6.011   -3.976  4.435   1.00 0.00 ? 35 PHE A CE1  8 
ATOM   7285 C CE2  . PHE A 1 35 ? 6.838   -4.260  2.213   1.00 0.00 ? 35 PHE A CE2  8 
ATOM   7286 C CZ   . PHE A 1 35 ? 6.714   -4.719  3.508   1.00 0.00 ? 35 PHE A CZ   8 
ATOM   7287 H H    . PHE A 1 35 ? 7.466   -0.782  2.363   1.00 0.00 ? 35 PHE A H    8 
ATOM   7288 H HA   . PHE A 1 35 ? 5.421   1.030   1.998   1.00 0.00 ? 35 PHE A HA   8 
ATOM   7289 H HB2  . PHE A 1 35 ? 3.943   -0.975  2.863   1.00 0.00 ? 35 PHE A HB2  8 
ATOM   7290 H HB3  . PHE A 1 35 ? 4.735   -1.034  1.297   1.00 0.00 ? 35 PHE A HB3  8 
ATOM   7291 H HD1  . PHE A 1 35 ? 4.883   -2.200  4.789   1.00 0.00 ? 35 PHE A HD1  8 
ATOM   7292 H HD2  . PHE A 1 35 ? 6.376   -2.707  0.831   1.00 0.00 ? 35 PHE A HD2  8 
ATOM   7293 H HE1  . PHE A 1 35 ? 5.911   -4.333  5.449   1.00 0.00 ? 35 PHE A HE1  8 
ATOM   7294 H HE2  . PHE A 1 35 ? 7.380   -4.842  1.486   1.00 0.00 ? 35 PHE A HE2  8 
ATOM   7295 H HZ   . PHE A 1 35 ? 7.162   -5.658  3.796   1.00 0.00 ? 35 PHE A HZ   8 
ATOM   7296 N N    . CYS A 1 36 ? 5.628   0.032   5.098   1.00 0.00 ? 36 CYS A N    8 
ATOM   7297 C CA   . CYS A 1 36 ? 5.284   0.352   6.481   1.00 0.00 ? 36 CYS A CA   8 
ATOM   7298 C C    . CYS A 1 36 ? 5.612   1.806   6.810   1.00 0.00 ? 36 CYS A C    8 
ATOM   7299 O O    . CYS A 1 36 ? 4.863   2.475   7.521   1.00 0.00 ? 36 CYS A O    8 
ATOM   7300 C CB   . CYS A 1 36 ? 6.025   -0.578  7.443   1.00 0.00 ? 36 CYS A CB   8 
ATOM   7301 S SG   . CYS A 1 36 ? 5.137   -0.893  9.002   1.00 0.00 ? 36 CYS A SG   8 
ATOM   7302 H H    . CYS A 1 36 ? 6.176   -0.750  4.906   1.00 0.00 ? 36 CYS A H    8 
ATOM   7303 H HA   . CYS A 1 36 ? 4.222   0.202   6.600   1.00 0.00 ? 36 CYS A HA   8 
ATOM   7304 H HB2  . CYS A 1 36 ? 6.186   -1.530  6.959   1.00 0.00 ? 36 CYS A HB2  8 
ATOM   7305 H HB3  . CYS A 1 36 ? 6.981   -0.140  7.690   1.00 0.00 ? 36 CYS A HB3  8 
ATOM   7306 N N    . GLN A 1 37 ? 6.736   2.286   6.291   1.00 0.00 ? 37 GLN A N    8 
ATOM   7307 C CA   . GLN A 1 37 ? 7.164   3.657   6.533   1.00 0.00 ? 37 GLN A CA   8 
ATOM   7308 C C    . GLN A 1 37 ? 6.093   4.654   6.106   1.00 0.00 ? 37 GLN A C    8 
ATOM   7309 O O    . GLN A 1 37 ? 5.998   5.753   6.652   1.00 0.00 ? 37 GLN A O    8 
ATOM   7310 C CB   . GLN A 1 37 ? 8.469   3.948   5.792   1.00 0.00 ? 37 GLN A CB   8 
ATOM   7311 C CG   . GLN A 1 37 ? 9.634   3.084   6.245   1.00 0.00 ? 37 GLN A CG   8 
ATOM   7312 C CD   . GLN A 1 37 ? 10.893  3.340   5.441   1.00 0.00 ? 37 GLN A CD   8 
ATOM   7313 O OE1  . GLN A 1 37 ? 11.971  3.538   6.001   1.00 0.00 ? 37 GLN A OE1  8 
ATOM   7314 N NE2  . GLN A 1 37 ? 10.761  3.337   4.120   1.00 0.00 ? 37 GLN A NE2  8 
ATOM   7315 H H    . GLN A 1 37 ? 7.293   1.705   5.738   1.00 0.00 ? 37 GLN A H    8 
ATOM   7316 H HA   . GLN A 1 37 ? 7.331   3.760   7.587   1.00 0.00 ? 37 GLN A HA   8 
ATOM   7317 H HB2  . GLN A 1 37 ? 8.314   3.783   4.737   1.00 0.00 ? 37 GLN A HB2  8 
ATOM   7318 H HB3  . GLN A 1 37 ? 8.735   4.983   5.949   1.00 0.00 ? 37 GLN A HB3  8 
ATOM   7319 H HG2  . GLN A 1 37 ? 9.839   3.293   7.284   1.00 0.00 ? 37 GLN A HG2  8 
ATOM   7320 H HG3  . GLN A 1 37 ? 9.358   2.045   6.135   1.00 0.00 ? 37 GLN A HG3  8 
ATOM   7321 H HE21 . GLN A 1 37 ? 9.871   3.172   3.743   1.00 0.00 ? 37 GLN A HE21 8 
ATOM   7322 H HE22 . GLN A 1 37 ? 11.559  3.498   3.574   1.00 0.00 ? 37 GLN A HE22 8 
ATOM   7323 N N    . TYR A 1 38 ? 5.292   4.263   5.125   1.00 0.00 ? 38 TYR A N    8 
ATOM   7324 C CA   . TYR A 1 38 ? 4.227   5.120   4.618   1.00 0.00 ? 38 TYR A CA   8 
ATOM   7325 C C    . TYR A 1 38 ? 3.032   5.127   5.567   1.00 0.00 ? 38 TYR A C    8 
ATOM   7326 O O    . TYR A 1 38 ? 2.286   6.103   5.633   1.00 0.00 ? 38 TYR A O    8 
ATOM   7327 C CB   . TYR A 1 38 ? 3.788   4.655   3.228   1.00 0.00 ? 38 TYR A CB   8 
ATOM   7328 C CG   . TYR A 1 38 ? 4.790   4.972   2.140   1.00 0.00 ? 38 TYR A CG   8 
ATOM   7329 C CD1  . TYR A 1 38 ? 5.143   6.285   1.855   1.00 0.00 ? 38 TYR A CD1  8 
ATOM   7330 C CD2  . TYR A 1 38 ? 5.385   3.957   1.401   1.00 0.00 ? 38 TYR A CD2  8 
ATOM   7331 C CE1  . TYR A 1 38 ? 6.060   6.578   0.863   1.00 0.00 ? 38 TYR A CE1  8 
ATOM   7332 C CE2  . TYR A 1 38 ? 6.303   4.242   0.408   1.00 0.00 ? 38 TYR A CE2  8 
ATOM   7333 C CZ   . TYR A 1 38 ? 6.637   5.553   0.143   1.00 0.00 ? 38 TYR A CZ   8 
ATOM   7334 O OH   . TYR A 1 38 ? 7.550   5.841   -0.846  1.00 0.00 ? 38 TYR A OH   8 
ATOM   7335 H H    . TYR A 1 38 ? 5.422   3.376   4.732   1.00 0.00 ? 38 TYR A H    8 
ATOM   7336 H HA   . TYR A 1 38 ? 4.617   6.124   4.544   1.00 0.00 ? 38 TYR A HA   8 
ATOM   7337 H HB2  . TYR A 1 38 ? 3.642   3.586   3.243   1.00 0.00 ? 38 TYR A HB2  8 
ATOM   7338 H HB3  . TYR A 1 38 ? 2.856   5.138   2.972   1.00 0.00 ? 38 TYR A HB3  8 
ATOM   7339 H HD1  . TYR A 1 38 ? 4.690   7.085   2.421   1.00 0.00 ? 38 TYR A HD1  8 
ATOM   7340 H HD2  . TYR A 1 38 ? 5.120   2.932   1.610   1.00 0.00 ? 38 TYR A HD2  8 
ATOM   7341 H HE1  . TYR A 1 38 ? 6.321   7.605   0.656   1.00 0.00 ? 38 TYR A HE1  8 
ATOM   7342 H HE2  . TYR A 1 38 ? 6.754   3.439   -0.156  1.00 0.00 ? 38 TYR A HE2  8 
ATOM   7343 H HH   . TYR A 1 38 ? 7.164   6.462   -1.468  1.00 0.00 ? 38 TYR A HH   8 
ATOM   7344 N N    . ALA A 1 39 ? 2.856   4.030   6.300   1.00 0.00 ? 39 ALA A N    8 
ATOM   7345 C CA   . ALA A 1 39 ? 1.754   3.908   7.244   1.00 0.00 ? 39 ALA A CA   8 
ATOM   7346 C C    . ALA A 1 39 ? 1.708   5.090   8.207   1.00 0.00 ? 39 ALA A C    8 
ATOM   7347 O O    . ALA A 1 39 ? 0.656   5.413   8.760   1.00 0.00 ? 39 ALA A O    8 
ATOM   7348 C CB   . ALA A 1 39 ? 1.863   2.601   8.014   1.00 0.00 ? 39 ALA A CB   8 
ATOM   7349 H H    . ALA A 1 39 ? 3.480   3.285   6.202   1.00 0.00 ? 39 ALA A H    8 
ATOM   7350 H HA   . ALA A 1 39 ? 0.841   3.886   6.677   1.00 0.00 ? 39 ALA A HA   8 
ATOM   7351 H HB1  . ALA A 1 39 ? 2.714   2.643   8.677   1.00 0.00 ? 39 ALA A HB1  8 
ATOM   7352 H HB2  . ALA A 1 39 ? 1.988   1.783   7.319   1.00 0.00 ? 39 ALA A HB2  8 
ATOM   7353 H HB3  . ALA A 1 39 ? 0.964   2.447   8.592   1.00 0.00 ? 39 ALA A HB3  8 
ATOM   7354 N N    . LYS A 1 40 ? 2.854   5.729   8.404   1.00 0.00 ? 40 LYS A N    8 
ATOM   7355 C CA   . LYS A 1 40 ? 2.947   6.875   9.301   1.00 0.00 ? 40 LYS A CA   8 
ATOM   7356 C C    . LYS A 1 40 ? 3.021   8.182   8.519   1.00 0.00 ? 40 LYS A C    8 
ATOM   7357 O O    . LYS A 1 40 ? 2.676   9.245   9.034   1.00 0.00 ? 40 LYS A O    8 
ATOM   7358 C CB   . LYS A 1 40 ? 4.172   6.740   10.208  1.00 0.00 ? 40 LYS A CB   8 
ATOM   7359 C CG   . LYS A 1 40 ? 4.046   7.501   11.519  1.00 0.00 ? 40 LYS A CG   8 
ATOM   7360 C CD   . LYS A 1 40 ? 3.835   6.558   12.694  1.00 0.00 ? 40 LYS A CD   8 
ATOM   7361 C CE   . LYS A 1 40 ? 2.358   6.300   12.943  1.00 0.00 ? 40 LYS A CE   8 
ATOM   7362 N NZ   . LYS A 1 40 ? 2.128   4.987   13.606  1.00 0.00 ? 40 LYS A NZ   8 
ATOM   7363 H H    . LYS A 1 40 ? 3.656   5.422   7.936   1.00 0.00 ? 40 LYS A H    8 
ATOM   7364 H HA   . LYS A 1 40 ? 2.060   6.888   9.911   1.00 0.00 ? 40 LYS A HA   8 
ATOM   7365 H HB2  . LYS A 1 40 ? 4.324   5.695   10.434  1.00 0.00 ? 40 LYS A HB2  8 
ATOM   7366 H HB3  . LYS A 1 40 ? 5.037   7.115   9.682   1.00 0.00 ? 40 LYS A HB3  8 
ATOM   7367 H HG2  . LYS A 1 40 ? 4.949   8.068   11.684  1.00 0.00 ? 40 LYS A HG2  8 
ATOM   7368 H HG3  . LYS A 1 40 ? 3.203   8.174   11.453  1.00 0.00 ? 40 LYS A HG3  8 
ATOM   7369 H HD2  . LYS A 1 40 ? 4.324   5.619   12.481  1.00 0.00 ? 40 LYS A HD2  8 
ATOM   7370 H HD3  . LYS A 1 40 ? 4.270   7.000   13.579  1.00 0.00 ? 40 LYS A HD3  8 
ATOM   7371 H HE2  . LYS A 1 40 ? 1.971   7.085   13.576  1.00 0.00 ? 40 LYS A HE2  8 
ATOM   7372 H HE3  . LYS A 1 40 ? 1.839   6.312   11.996  1.00 0.00 ? 40 LYS A HE3  8 
ATOM   7373 H HZ1  . LYS A 1 40 ? 2.408   4.212   12.971  1.00 0.00 ? 40 LYS A HZ1  8 
ATOM   7374 H HZ2  . LYS A 1 40 ? 1.122   4.878   13.845  1.00 0.00 ? 40 LYS A HZ2  8 
ATOM   7375 H HZ3  . LYS A 1 40 ? 2.689   4.925   14.480  1.00 0.00 ? 40 LYS A HZ3  8 
ATOM   7376 N N    . ASP A 1 41 ? 3.474   8.095   7.273   1.00 0.00 ? 41 ASP A N    8 
ATOM   7377 C CA   . ASP A 1 41 ? 3.597   9.270   6.417   1.00 0.00 ? 41 ASP A CA   8 
ATOM   7378 C C    . ASP A 1 41 ? 2.250   9.976   6.257   1.00 0.00 ? 41 ASP A C    8 
ATOM   7379 O O    . ASP A 1 41 ? 1.348   9.461   5.595   1.00 0.00 ? 41 ASP A O    8 
ATOM   7380 C CB   . ASP A 1 41 ? 4.137   8.868   5.043   1.00 0.00 ? 41 ASP A CB   8 
ATOM   7381 C CG   . ASP A 1 41 ? 4.372   10.065  4.142   1.00 0.00 ? 41 ASP A CG   8 
ATOM   7382 O OD1  . ASP A 1 41 ? 5.085   10.998  4.568   1.00 0.00 ? 41 ASP A OD1  8 
ATOM   7383 O OD2  . ASP A 1 41 ? 3.841   10.070  3.012   1.00 0.00 ? 41 ASP A OD2  8 
ATOM   7384 H H    . ASP A 1 41 ? 3.733   7.219   6.922   1.00 0.00 ? 41 ASP A H    8 
ATOM   7385 H HA   . ASP A 1 41 ? 4.296   9.947   6.883   1.00 0.00 ? 41 ASP A HA   8 
ATOM   7386 H HB2  . ASP A 1 41 ? 5.077   8.348   5.171   1.00 0.00 ? 41 ASP A HB2  8 
ATOM   7387 H HB3  . ASP A 1 41 ? 3.425   8.211   4.561   1.00 0.00 ? 41 ASP A HB3  8 
ATOM   7388 N N    . PRO A 1 42 ? 2.092   11.168  6.862   1.00 0.00 ? 42 PRO A N    8 
ATOM   7389 C CA   . PRO A 1 42 ? 0.850   11.937  6.781   1.00 0.00 ? 42 PRO A CA   8 
ATOM   7390 C C    . PRO A 1 42 ? 0.771   12.779  5.513   1.00 0.00 ? 42 PRO A C    8 
ATOM   7391 O O    . PRO A 1 42 ? 1.330   13.874  5.447   1.00 0.00 ? 42 PRO A O    8 
ATOM   7392 C CB   . PRO A 1 42 ? 0.942   12.836  8.008   1.00 0.00 ? 42 PRO A CB   8 
ATOM   7393 C CG   . PRO A 1 42 ? 2.398   13.118  8.132   1.00 0.00 ? 42 PRO A CG   8 
ATOM   7394 C CD   . PRO A 1 42 ? 3.108   11.867  7.676   1.00 0.00 ? 42 PRO A CD   8 
ATOM   7395 H HA   . PRO A 1 42 ? -0.021  11.303  6.854   1.00 0.00 ? 42 PRO A HA   8 
ATOM   7396 H HB2  . PRO A 1 42 ? 0.372   13.739  7.842   1.00 0.00 ? 42 PRO A HB2  8 
ATOM   7397 H HB3  . PRO A 1 42 ? 0.565   12.313  8.874   1.00 0.00 ? 42 PRO A HB3  8 
ATOM   7398 H HG2  . PRO A 1 42 ? 2.663   13.950  7.497   1.00 0.00 ? 42 PRO A HG2  8 
ATOM   7399 H HG3  . PRO A 1 42 ? 2.644   13.335  9.161   1.00 0.00 ? 42 PRO A HG3  8 
ATOM   7400 H HD2  . PRO A 1 42 ? 3.972   12.121  7.078   1.00 0.00 ? 42 PRO A HD2  8 
ATOM   7401 H HD3  . PRO A 1 42 ? 3.400   11.268  8.525   1.00 0.00 ? 42 PRO A HD3  8 
ATOM   7402 N N    . THR A 1 43 ? 0.075   12.262  4.510   1.00 0.00 ? 43 THR A N    8 
ATOM   7403 C CA   . THR A 1 43 ? -0.080  12.963  3.245   1.00 0.00 ? 43 THR A CA   8 
ATOM   7404 C C    . THR A 1 43 ? -1.280  12.427  2.472   1.00 0.00 ? 43 THR A C    8 
ATOM   7405 O O    . THR A 1 43 ? -2.083  13.195  1.941   1.00 0.00 ? 43 THR A O    8 
ATOM   7406 C CB   . THR A 1 43 ? 1.191   12.832  2.402   1.00 0.00 ? 43 THR A CB   8 
ATOM   7407 O OG1  . THR A 1 43 ? 2.088   11.900  2.980   1.00 0.00 ? 43 THR A OG1  8 
ATOM   7408 C CG2  . THR A 1 43 ? 1.934   14.140  2.233   1.00 0.00 ? 43 THR A CG2  8 
ATOM   7409 H H    . THR A 1 43 ? -0.345  11.391  4.623   1.00 0.00 ? 43 THR A H    8 
ATOM   7410 H HA   . THR A 1 43 ? -0.248  14.002  3.467   1.00 0.00 ? 43 THR A HA   8 
ATOM   7411 H HB   . THR A 1 43 ? 0.922   12.477  1.418   1.00 0.00 ? 43 THR A HB   8 
ATOM   7412 H HG1  . THR A 1 43 ? 2.478   12.277  3.772   1.00 0.00 ? 43 THR A HG1  8 
ATOM   7413 H HG21 . THR A 1 43 ? 2.670   14.038  1.449   1.00 0.00 ? 43 THR A HG21 8 
ATOM   7414 H HG22 . THR A 1 43 ? 2.428   14.396  3.159   1.00 0.00 ? 43 THR A HG22 8 
ATOM   7415 H HG23 . THR A 1 43 ? 1.235   14.920  1.971   1.00 0.00 ? 43 THR A HG23 8 
ATOM   7416 N N    . TYR A 1 44 ? -1.397  11.105  2.414   1.00 0.00 ? 44 TYR A N    8 
ATOM   7417 C CA   . TYR A 1 44 ? -2.500  10.465  1.707   1.00 0.00 ? 44 TYR A CA   8 
ATOM   7418 C C    . TYR A 1 44 ? -3.685  10.241  2.640   1.00 0.00 ? 44 TYR A C    8 
ATOM   7419 O O    . TYR A 1 44 ? -4.766  10.792  2.431   1.00 0.00 ? 44 TYR A O    8 
ATOM   7420 C CB   . TYR A 1 44 ? -2.044  9.134   1.107   1.00 0.00 ? 44 TYR A CB   8 
ATOM   7421 C CG   . TYR A 1 44 ? -0.902  9.274   0.127   1.00 0.00 ? 44 TYR A CG   8 
ATOM   7422 C CD1  . TYR A 1 44 ? -1.141  9.556   -1.212  1.00 0.00 ? 44 TYR A CD1  8 
ATOM   7423 C CD2  . TYR A 1 44 ? 0.416   9.127   0.541   1.00 0.00 ? 44 TYR A CD2  8 
ATOM   7424 C CE1  . TYR A 1 44 ? -0.100  9.686   -2.111  1.00 0.00 ? 44 TYR A CE1  8 
ATOM   7425 C CE2  . TYR A 1 44 ? 1.463   9.256   -0.351  1.00 0.00 ? 44 TYR A CE2  8 
ATOM   7426 C CZ   . TYR A 1 44 ? 1.200   9.536   -1.676  1.00 0.00 ? 44 TYR A CZ   8 
ATOM   7427 O OH   . TYR A 1 44 ? 2.240   9.665   -2.568  1.00 0.00 ? 44 TYR A OH   8 
ATOM   7428 H H    . TYR A 1 44 ? -0.726  10.545  2.857   1.00 0.00 ? 44 TYR A H    8 
ATOM   7429 H HA   . TYR A 1 44 ? -2.807  11.123  0.907   1.00 0.00 ? 44 TYR A HA   8 
ATOM   7430 H HB2  . TYR A 1 44 ? -1.721  8.481   1.903   1.00 0.00 ? 44 TYR A HB2  8 
ATOM   7431 H HB3  . TYR A 1 44 ? -2.875  8.678   0.588   1.00 0.00 ? 44 TYR A HB3  8 
ATOM   7432 H HD1  . TYR A 1 44 ? -2.160  9.674   -1.550  1.00 0.00 ? 44 TYR A HD1  8 
ATOM   7433 H HD2  . TYR A 1 44 ? 0.619   8.908   1.579   1.00 0.00 ? 44 TYR A HD2  8 
ATOM   7434 H HE1  . TYR A 1 44 ? -0.306  9.905   -3.148  1.00 0.00 ? 44 TYR A HE1  8 
ATOM   7435 H HE2  . TYR A 1 44 ? 2.481   9.138   -0.010  1.00 0.00 ? 44 TYR A HE2  8 
ATOM   7436 H HH   . TYR A 1 44 ? 2.921   9.021   -2.362  1.00 0.00 ? 44 TYR A HH   8 
ATOM   7437 N N    . GLY A 1 45 ? -3.474  9.430   3.672   1.00 0.00 ? 45 GLY A N    8 
ATOM   7438 C CA   . GLY A 1 45 ? -4.533  9.150   4.625   1.00 0.00 ? 45 GLY A CA   8 
ATOM   7439 C C    . GLY A 1 45 ? -5.545  8.149   4.101   1.00 0.00 ? 45 GLY A C    8 
ATOM   7440 O O    . GLY A 1 45 ? -5.761  7.100   4.708   1.00 0.00 ? 45 GLY A O    8 
ATOM   7441 H H    . GLY A 1 45 ? -2.591  9.021   3.790   1.00 0.00 ? 45 GLY A H    8 
ATOM   7442 H HA2  . GLY A 1 45 ? -4.093  8.758   5.530   1.00 0.00 ? 45 GLY A HA2  8 
ATOM   7443 H HA3  . GLY A 1 45 ? -5.044  10.073  4.858   1.00 0.00 ? 45 GLY A HA3  8 
ATOM   7444 N N    . GLN A 1 46 ? -6.169  8.474   2.973   1.00 0.00 ? 46 GLN A N    8 
ATOM   7445 C CA   . GLN A 1 46 ? -7.165  7.598   2.370   1.00 0.00 ? 46 GLN A CA   8 
ATOM   7446 C C    . GLN A 1 46 ? -6.520  6.333   1.805   1.00 0.00 ? 46 GLN A C    8 
ATOM   7447 O O    . GLN A 1 46 ? -7.212  5.370   1.476   1.00 0.00 ? 46 GLN A O    8 
ATOM   7448 C CB   . GLN A 1 46 ? -7.919  8.340   1.264   1.00 0.00 ? 46 GLN A CB   8 
ATOM   7449 C CG   . GLN A 1 46 ? -9.423  8.124   1.302   1.00 0.00 ? 46 GLN A CG   8 
ATOM   7450 C CD   . GLN A 1 46 ? -10.179 9.145   0.475   1.00 0.00 ? 46 GLN A CD   8 
ATOM   7451 O OE1  . GLN A 1 46 ? -9.598  10.105  -0.030  1.00 0.00 ? 46 GLN A OE1  8 
ATOM   7452 N NE2  . GLN A 1 46 ? -11.484 8.942   0.332   1.00 0.00 ? 46 GLN A NE2  8 
ATOM   7453 H H    . GLN A 1 46 ? -5.957  9.321   2.536   1.00 0.00 ? 46 GLN A H    8 
ATOM   7454 H HA   . GLN A 1 46 ? -7.863  7.317   3.141   1.00 0.00 ? 46 GLN A HA   8 
ATOM   7455 H HB2  . GLN A 1 46 ? -7.727  9.398   1.362   1.00 0.00 ? 46 GLN A HB2  8 
ATOM   7456 H HB3  . GLN A 1 46 ? -7.553  8.004   0.305   1.00 0.00 ? 46 GLN A HB3  8 
ATOM   7457 H HG2  . GLN A 1 46 ? -9.643  7.139   0.919   1.00 0.00 ? 46 GLN A HG2  8 
ATOM   7458 H HG3  . GLN A 1 46 ? -9.758  8.193   2.327   1.00 0.00 ? 46 GLN A HG3  8 
ATOM   7459 H HE21 . GLN A 1 46 ? -11.881 8.152   0.765   1.00 0.00 ? 46 GLN A HE21 8 
ATOM   7460 H HE22 . GLN A 1 46 ? -11.998 9.591   -0.201  1.00 0.00 ? 46 GLN A HE22 8 
ATOM   7461 N N    . TYR A 1 47 ? -5.195  6.345   1.688   1.00 0.00 ? 47 TYR A N    8 
ATOM   7462 C CA   . TYR A 1 47 ? -4.465  5.201   1.157   1.00 0.00 ? 47 TYR A CA   8 
ATOM   7463 C C    . TYR A 1 47 ? -4.282  4.124   2.221   1.00 0.00 ? 47 TYR A C    8 
ATOM   7464 O O    . TYR A 1 47 ? -4.661  2.970   2.022   1.00 0.00 ? 47 TYR A O    8 
ATOM   7465 C CB   . TYR A 1 47 ? -3.107  5.644   0.637   1.00 0.00 ? 47 TYR A CB   8 
ATOM   7466 C CG   . TYR A 1 47 ? -2.539  4.750   -0.439  1.00 0.00 ? 47 TYR A CG   8 
ATOM   7467 C CD1  . TYR A 1 47 ? -2.131  3.454   -0.150  1.00 0.00 ? 47 TYR A CD1  8 
ATOM   7468 C CD2  . TYR A 1 47 ? -2.406  5.205   -1.743  1.00 0.00 ? 47 TYR A CD2  8 
ATOM   7469 C CE1  . TYR A 1 47 ? -1.607  2.636   -1.132  1.00 0.00 ? 47 TYR A CE1  8 
ATOM   7470 C CE2  . TYR A 1 47 ? -1.882  4.394   -2.732  1.00 0.00 ? 47 TYR A CE2  8 
ATOM   7471 C CZ   . TYR A 1 47 ? -1.485  3.111   -2.421  1.00 0.00 ? 47 TYR A CZ   8 
ATOM   7472 O OH   . TYR A 1 47 ? -0.962  2.300   -3.402  1.00 0.00 ? 47 TYR A OH   8 
ATOM   7473 H H    . TYR A 1 47 ? -4.697  7.142   1.962   1.00 0.00 ? 47 TYR A H    8 
ATOM   7474 H HA   . TYR A 1 47 ? -5.027  4.794   0.345   1.00 0.00 ? 47 TYR A HA   8 
ATOM   7475 H HB2  . TYR A 1 47 ? -3.187  6.644   0.232   1.00 0.00 ? 47 TYR A HB2  8 
ATOM   7476 H HB3  . TYR A 1 47 ? -2.419  5.644   1.458   1.00 0.00 ? 47 TYR A HB3  8 
ATOM   7477 H HD1  . TYR A 1 47 ? -2.229  3.086   0.861   1.00 0.00 ? 47 TYR A HD1  8 
ATOM   7478 H HD2  . TYR A 1 47 ? -2.720  6.212   -1.981  1.00 0.00 ? 47 TYR A HD2  8 
ATOM   7479 H HE1  . TYR A 1 47 ? -1.295  1.631   -0.889  1.00 0.00 ? 47 TYR A HE1  8 
ATOM   7480 H HE2  . TYR A 1 47 ? -1.787  4.767   -3.741  1.00 0.00 ? 47 TYR A HE2  8 
ATOM   7481 H HH   . TYR A 1 47 ? -1.438  2.444   -4.223  1.00 0.00 ? 47 TYR A HH   8 
ATOM   7482 N N    . ILE A 1 48 ? -3.692  4.508   3.348   1.00 0.00 ? 48 ILE A N    8 
ATOM   7483 C CA   . ILE A 1 48 ? -3.451  3.575   4.440   1.00 0.00 ? 48 ILE A CA   8 
ATOM   7484 C C    . ILE A 1 48 ? -4.757  3.104   5.065   1.00 0.00 ? 48 ILE A C    8 
ATOM   7485 O O    . ILE A 1 48 ? -5.020  1.904   5.142   1.00 0.00 ? 48 ILE A O    8 
ATOM   7486 C CB   . ILE A 1 48 ? -2.567  4.205   5.536   1.00 0.00 ? 48 ILE A CB   8 
ATOM   7487 C CG1  . ILE A 1 48 ? -1.300  4.800   4.920   1.00 0.00 ? 48 ILE A CG1  8 
ATOM   7488 C CG2  . ILE A 1 48 ? -2.211  3.169   6.593   1.00 0.00 ? 48 ILE A CG2  8 
ATOM   7489 C CD1  . ILE A 1 48 ? -0.439  3.781   4.207   1.00 0.00 ? 48 ILE A CD1  8 
ATOM   7490 H H    . ILE A 1 48 ? -3.407  5.439   3.445   1.00 0.00 ? 48 ILE A H    8 
ATOM   7491 H HA   . ILE A 1 48 ? -2.932  2.721   4.036   1.00 0.00 ? 48 ILE A HA   8 
ATOM   7492 H HB   . ILE A 1 48 ? -3.131  4.992   6.014   1.00 0.00 ? 48 ILE A HB   8 
ATOM   7493 H HG12 . ILE A 1 48 ? -1.577  5.559   4.204   1.00 0.00 ? 48 ILE A HG12 8 
ATOM   7494 H HG13 . ILE A 1 48 ? -0.705  5.249   5.702   1.00 0.00 ? 48 ILE A HG13 8 
ATOM   7495 H HG21 . ILE A 1 48 ? -1.256  3.417   7.032   1.00 0.00 ? 48 ILE A HG21 8 
ATOM   7496 H HG22 . ILE A 1 48 ? -2.154  2.193   6.135   1.00 0.00 ? 48 ILE A HG22 8 
ATOM   7497 H HG23 . ILE A 1 48 ? -2.970  3.163   7.360   1.00 0.00 ? 48 ILE A HG23 8 
ATOM   7498 H HD11 . ILE A 1 48 ? 0.393   4.280   3.733   1.00 0.00 ? 48 ILE A HD11 8 
ATOM   7499 H HD12 . ILE A 1 48 ? -1.028  3.273   3.457   1.00 0.00 ? 48 ILE A HD12 8 
ATOM   7500 H HD13 . ILE A 1 48 ? -0.067  3.061   4.921   1.00 0.00 ? 48 ILE A HD13 8 
ATOM   7501 N N    . ARG A 1 49 ? -5.576  4.051   5.512   1.00 0.00 ? 49 ARG A N    8 
ATOM   7502 C CA   . ARG A 1 49 ? -6.855  3.721   6.131   1.00 0.00 ? 49 ARG A CA   8 
ATOM   7503 C C    . ARG A 1 49 ? -7.926  3.424   5.087   1.00 0.00 ? 49 ARG A C    8 
ATOM   7504 O O    . ARG A 1 49 ? -9.112  3.660   5.316   1.00 0.00 ? 49 ARG A O    8 
ATOM   7505 C CB   . ARG A 1 49 ? -7.314  4.856   7.048   1.00 0.00 ? 49 ARG A CB   8 
ATOM   7506 C CG   . ARG A 1 49 ? -6.222  5.368   7.974   1.00 0.00 ? 49 ARG A CG   8 
ATOM   7507 C CD   . ARG A 1 49 ? -6.735  5.557   9.392   1.00 0.00 ? 49 ARG A CD   8 
ATOM   7508 N NE   . ARG A 1 49 ? -6.168  6.746   10.025  1.00 0.00 ? 49 ARG A NE   8 
ATOM   7509 C CZ   . ARG A 1 49 ? -6.604  7.984   9.802   1.00 0.00 ? 49 ARG A CZ   8 
ATOM   7510 N NH1  . ARG A 1 49 ? -7.608  8.201   8.962   1.00 0.00 ? 49 ARG A NH1  8 
ATOM   7511 N NH2  . ARG A 1 49 ? -6.032  9.008   10.420  1.00 0.00 ? 49 ARG A NH2  8 
ATOM   7512 H H    . ARG A 1 49 ? -5.314  4.991   5.425   1.00 0.00 ? 49 ARG A H    8 
ATOM   7513 H HA   . ARG A 1 49 ? -6.706  2.833   6.719   1.00 0.00 ? 49 ARG A HA   8 
ATOM   7514 H HB2  . ARG A 1 49 ? -7.655  5.680   6.438   1.00 0.00 ? 49 ARG A HB2  8 
ATOM   7515 H HB3  . ARG A 1 49 ? -8.135  4.503   7.654   1.00 0.00 ? 49 ARG A HB3  8 
ATOM   7516 H HG2  . ARG A 1 49 ? -5.412  4.654   7.988   1.00 0.00 ? 49 ARG A HG2  8 
ATOM   7517 H HG3  . ARG A 1 49 ? -5.862  6.316   7.600   1.00 0.00 ? 49 ARG A HG3  8 
ATOM   7518 H HD2  . ARG A 1 49 ? -7.810  5.655   9.362   1.00 0.00 ? 49 ARG A HD2  8 
ATOM   7519 H HD3  . ARG A 1 49 ? -6.470  4.688   9.976   1.00 0.00 ? 49 ARG A HD3  8 
ATOM   7520 H HE   . ARG A 1 49 ? -5.424  6.615   10.649  1.00 0.00 ? 49 ARG A HE   8 
ATOM   7521 H HH11 . ARG A 1 49 ? -8.043  7.433   8.492   1.00 0.00 ? 49 ARG A HH11 8 
ATOM   7522 H HH12 . ARG A 1 49 ? -7.930  9.133   8.799   1.00 0.00 ? 49 ARG A HH12 8 
ATOM   7523 H HH21 . ARG A 1 49 ? -5.275  8.851   11.054  1.00 0.00 ? 49 ARG A HH21 8 
ATOM   7524 H HH22 . ARG A 1 49 ? -6.359  9.939   10.253  1.00 0.00 ? 49 ARG A HH22 8 
ATOM   7525 N N    . SER A 1 50 ? -7.504  2.896   3.948   1.00 0.00 ? 50 SER A N    8 
ATOM   7526 C CA   . SER A 1 50 ? -8.423  2.554   2.876   1.00 0.00 ? 50 SER A CA   8 
ATOM   7527 C C    . SER A 1 50 ? -9.093  1.210   3.148   1.00 0.00 ? 50 SER A C    8 
ATOM   7528 O O    . SER A 1 50 ? -8.588  0.407   3.933   1.00 0.00 ? 50 SER A O    8 
ATOM   7529 C CB   . SER A 1 50 ? -7.685  2.512   1.549   1.00 0.00 ? 50 SER A CB   8 
ATOM   7530 O OG   . SER A 1 50 ? -8.525  2.913   0.481   1.00 0.00 ? 50 SER A OG   8 
ATOM   7531 H H    . SER A 1 50 ? -6.551  2.720   3.830   1.00 0.00 ? 50 SER A H    8 
ATOM   7532 H HA   . SER A 1 50 ? -9.177  3.313   2.826   1.00 0.00 ? 50 SER A HA   8 
ATOM   7533 H HB2  . SER A 1 50 ? -6.831  3.174   1.591   1.00 0.00 ? 50 SER A HB2  8 
ATOM   7534 H HB3  . SER A 1 50 ? -7.357  1.508   1.375   1.00 0.00 ? 50 SER A HB3  8 
ATOM   7535 H HG   . SER A 1 50 ? -8.075  3.577   -0.048  1.00 0.00 ? 50 SER A HG   8 
ATOM   7536 N N    . PRO A 1 51 ? -10.232 0.936   2.492   1.00 0.00 ? 51 PRO A N    8 
ATOM   7537 C CA   . PRO A 1 51 ? -10.947 -0.319  2.660   1.00 0.00 ? 51 PRO A CA   8 
ATOM   7538 C C    . PRO A 1 51 ? -10.337 -1.438  1.823   1.00 0.00 ? 51 PRO A C    8 
ATOM   7539 O O    . PRO A 1 51 ? -10.175 -2.566  2.288   1.00 0.00 ? 51 PRO A O    8 
ATOM   7540 C CB   . PRO A 1 51 ? -12.370 -0.002  2.184   1.00 0.00 ? 51 PRO A CB   8 
ATOM   7541 C CG   . PRO A 1 51 ? -12.304 1.303   1.445   1.00 0.00 ? 51 PRO A CG   8 
ATOM   7542 C CD   . PRO A 1 51 ? -10.889 1.815   1.517   1.00 0.00 ? 51 PRO A CD   8 
ATOM   7543 H HA   . PRO A 1 51 ? -10.970 -0.622  3.696   1.00 0.00 ? 51 PRO A HA   8 
ATOM   7544 H HB2  . PRO A 1 51 ? -12.716 -0.796  1.539   1.00 0.00 ? 51 PRO A HB2  8 
ATOM   7545 H HB3  . PRO A 1 51 ? -13.023 0.070   3.042   1.00 0.00 ? 51 PRO A HB3  8 
ATOM   7546 H HG2  . PRO A 1 51 ? -12.583 1.149   0.411   1.00 0.00 ? 51 PRO A HG2  8 
ATOM   7547 H HG3  . PRO A 1 51 ? -12.978 2.011   1.905   1.00 0.00 ? 51 PRO A HG3  8 
ATOM   7548 H HD2  . PRO A 1 51 ? -10.416 1.732   0.550   1.00 0.00 ? 51 PRO A HD2  8 
ATOM   7549 H HD3  . PRO A 1 51 ? -10.877 2.841   1.854   1.00 0.00 ? 51 PRO A HD3  8 
ATOM   7550 N N    . HIS A 1 52 ? -10.019 -1.108  0.578   1.00 0.00 ? 52 HIS A N    8 
ATOM   7551 C CA   . HIS A 1 52 ? -9.440  -2.064  -0.361  1.00 0.00 ? 52 HIS A CA   8 
ATOM   7552 C C    . HIS A 1 52 ? -7.939  -2.233  -0.141  1.00 0.00 ? 52 HIS A C    8 
ATOM   7553 O O    . HIS A 1 52 ? -7.363  -3.262  -0.495  1.00 0.00 ? 52 HIS A O    8 
ATOM   7554 C CB   . HIS A 1 52 ? -9.717  -1.620  -1.804  1.00 0.00 ? 52 HIS A CB   8 
ATOM   7555 C CG   . HIS A 1 52 ? -10.901 -0.706  -1.935  1.00 0.00 ? 52 HIS A CG   8 
ATOM   7556 N ND1  . HIS A 1 52 ? -10.961 0.330   -2.843  1.00 0.00 ? 52 HIS A ND1  8 
ATOM   7557 C CD2  . HIS A 1 52 ? -12.067 -0.666  -1.246  1.00 0.00 ? 52 HIS A CD2  8 
ATOM   7558 C CE1  . HIS A 1 52 ? -12.112 0.967   -2.703  1.00 0.00 ? 52 HIS A CE1  8 
ATOM   7559 N NE2  . HIS A 1 52 ? -12.799 0.380   -1.744  1.00 0.00 ? 52 HIS A NE2  8 
ATOM   7560 H H    . HIS A 1 52 ? -10.185 -0.192  0.278   1.00 0.00 ? 52 HIS A H    8 
ATOM   7561 H HA   . HIS A 1 52 ? -9.918  -3.014  -0.193  1.00 0.00 ? 52 HIS A HA   8 
ATOM   7562 H HB2  . HIS A 1 52 ? -8.852  -1.099  -2.185  1.00 0.00 ? 52 HIS A HB2  8 
ATOM   7563 H HB3  . HIS A 1 52 ? -9.901  -2.494  -2.413  1.00 0.00 ? 52 HIS A HB3  8 
ATOM   7564 H HD1  . HIS A 1 52 ? -10.266 0.564   -3.492  1.00 0.00 ? 52 HIS A HD1  8 
ATOM   7565 H HD2  . HIS A 1 52 ? -12.355 -1.321  -0.437  1.00 0.00 ? 52 HIS A HD2  8 
ATOM   7566 H HE1  . HIS A 1 52 ? -12.429 1.830   -3.264  1.00 0.00 ? 52 HIS A HE1  8 
ATOM   7567 H HE2  . HIS A 1 52 ? -13.661 0.690   -1.396  1.00 0.00 ? 52 HIS A HE2  8 
ATOM   7568 N N    . ALA A 1 53 ? -7.310  -1.217  0.436   1.00 0.00 ? 53 ALA A N    8 
ATOM   7569 C CA   . ALA A 1 53 ? -5.877  -1.250  0.692   1.00 0.00 ? 53 ALA A CA   8 
ATOM   7570 C C    . ALA A 1 53 ? -5.490  -2.467  1.520   1.00 0.00 ? 53 ALA A C    8 
ATOM   7571 O O    . ALA A 1 53 ? -4.567  -3.205  1.176   1.00 0.00 ? 53 ALA A O    8 
ATOM   7572 C CB   . ALA A 1 53 ? -5.431  0.025   1.391   1.00 0.00 ? 53 ALA A CB   8 
ATOM   7573 H H    . ALA A 1 53 ? -7.818  -0.425  0.689   1.00 0.00 ? 53 ALA A H    8 
ATOM   7574 H HA   . ALA A 1 53 ? -5.380  -1.302  -0.254  1.00 0.00 ? 53 ALA A HA   8 
ATOM   7575 H HB1  . ALA A 1 53 ? -4.388  -0.058  1.661   1.00 0.00 ? 53 ALA A HB1  8 
ATOM   7576 H HB2  . ALA A 1 53 ? -6.023  0.174   2.281   1.00 0.00 ? 53 ALA A HB2  8 
ATOM   7577 H HB3  . ALA A 1 53 ? -5.564  0.865   0.725   1.00 0.00 ? 53 ALA A HB3  8 
ATOM   7578 N N    . ARG A 1 54 ? -6.203  -2.657  2.615   1.00 0.00 ? 54 ARG A N    8 
ATOM   7579 C CA   . ARG A 1 54 ? -5.953  -3.772  3.518   1.00 0.00 ? 54 ARG A CA   8 
ATOM   7580 C C    . ARG A 1 54 ? -6.044  -5.104  2.787   1.00 0.00 ? 54 ARG A C    8 
ATOM   7581 O O    . ARG A 1 54 ? -5.343  -6.060  3.121   1.00 0.00 ? 54 ARG A O    8 
ATOM   7582 C CB   . ARG A 1 54 ? -6.946  -3.747  4.682   1.00 0.00 ? 54 ARG A CB   8 
ATOM   7583 C CG   . ARG A 1 54 ? -6.970  -2.427  5.434   1.00 0.00 ? 54 ARG A CG   8 
ATOM   7584 C CD   . ARG A 1 54 ? -7.975  -2.455  6.574   1.00 0.00 ? 54 ARG A CD   8 
ATOM   7585 N NE   . ARG A 1 54 ? -9.244  -1.834  6.201   1.00 0.00 ? 54 ARG A NE   8 
ATOM   7586 C CZ   . ARG A 1 54 ? -10.388 -2.040  6.848   1.00 0.00 ? 54 ARG A CZ   8 
ATOM   7587 N NH1  . ARG A 1 54 ? -10.427 -2.845  7.903   1.00 0.00 ? 54 ARG A NH1  8 
ATOM   7588 N NH2  . ARG A 1 54 ? -11.497 -1.436  6.442   1.00 0.00 ? 54 ARG A NH2  8 
ATOM   7589 H H    . ARG A 1 54 ? -6.914  -2.026  2.823   1.00 0.00 ? 54 ARG A H    8 
ATOM   7590 H HA   . ARG A 1 54 ? -4.959  -3.658  3.903   1.00 0.00 ? 54 ARG A HA   8 
ATOM   7591 H HB2  . ARG A 1 54 ? -7.938  -3.936  4.298   1.00 0.00 ? 54 ARG A HB2  8 
ATOM   7592 H HB3  . ARG A 1 54 ? -6.685  -4.530  5.379   1.00 0.00 ? 54 ARG A HB3  8 
ATOM   7593 H HG2  . ARG A 1 54 ? -5.988  -2.237  5.838   1.00 0.00 ? 54 ARG A HG2  8 
ATOM   7594 H HG3  . ARG A 1 54 ? -7.239  -1.638  4.748   1.00 0.00 ? 54 ARG A HG3  8 
ATOM   7595 H HD2  . ARG A 1 54 ? -8.156  -3.483  6.852   1.00 0.00 ? 54 ARG A HD2  8 
ATOM   7596 H HD3  . ARG A 1 54 ? -7.558  -1.923  7.417   1.00 0.00 ? 54 ARG A HD3  8 
ATOM   7597 H HE   . ARG A 1 54 ? -9.243  -1.234  5.427   1.00 0.00 ? 54 ARG A HE   8 
ATOM   7598 H HH11 . ARG A 1 54 ? -9.595  -3.302  8.216   1.00 0.00 ? 54 ARG A HH11 8 
ATOM   7599 H HH12 . ARG A 1 54 ? -11.291 -2.995  8.385   1.00 0.00 ? 54 ARG A HH12 8 
ATOM   7600 H HH21 . ARG A 1 54 ? -11.472 -0.827  5.649   1.00 0.00 ? 54 ARG A HH21 8 
ATOM   7601 H HH22 . ARG A 1 54 ? -12.357 -1.591  6.928   1.00 0.00 ? 54 ARG A HH22 8 
ATOM   7602 N N    . ASP A 1 55 ? -6.911  -5.157  1.789   1.00 0.00 ? 55 ASP A N    8 
ATOM   7603 C CA   . ASP A 1 55 ? -7.101  -6.369  1.005   1.00 0.00 ? 55 ASP A CA   8 
ATOM   7604 C C    . ASP A 1 55 ? -5.866  -6.672  0.173   1.00 0.00 ? 55 ASP A C    8 
ATOM   7605 O O    . ASP A 1 55 ? -5.455  -7.825  0.040   1.00 0.00 ? 55 ASP A O    8 
ATOM   7606 C CB   . ASP A 1 55 ? -8.316  -6.232  0.101   1.00 0.00 ? 55 ASP A CB   8 
ATOM   7607 C CG   . ASP A 1 55 ? -8.926  -7.573  -0.257  1.00 0.00 ? 55 ASP A CG   8 
ATOM   7608 O OD1  . ASP A 1 55 ? -8.856  -8.499  0.578   1.00 0.00 ? 55 ASP A OD1  8 
ATOM   7609 O OD2  . ASP A 1 55 ? -9.474  -7.698  -1.373  1.00 0.00 ? 55 ASP A OD2  8 
ATOM   7610 H H    . ASP A 1 55 ? -7.436  -4.362  1.576   1.00 0.00 ? 55 ASP A H    8 
ATOM   7611 H HA   . ASP A 1 55 ? -7.263  -7.175  1.679   1.00 0.00 ? 55 ASP A HA   8 
ATOM   7612 H HB2  . ASP A 1 55 ? -9.066  -5.634  0.599   1.00 0.00 ? 55 ASP A HB2  8 
ATOM   7613 H HB3  . ASP A 1 55 ? -8.011  -5.746  -0.805  1.00 0.00 ? 55 ASP A HB3  8 
ATOM   7614 N N    . THR A 1 56 ? -5.281  -5.624  -0.379  1.00 0.00 ? 56 THR A N    8 
ATOM   7615 C CA   . THR A 1 56 ? -4.091  -5.752  -1.198  1.00 0.00 ? 56 THR A CA   8 
ATOM   7616 C C    . THR A 1 56 ? -2.957  -6.398  -0.411  1.00 0.00 ? 56 THR A C    8 
ATOM   7617 O O    . THR A 1 56 ? -2.342  -7.363  -0.867  1.00 0.00 ? 56 THR A O    8 
ATOM   7618 C CB   . THR A 1 56 ? -3.660  -4.390  -1.712  1.00 0.00 ? 56 THR A CB   8 
ATOM   7619 O OG1  . THR A 1 56 ? -4.784  -3.562  -1.953  1.00 0.00 ? 56 THR A OG1  8 
ATOM   7620 C CG2  . THR A 1 56 ? -2.853  -4.459  -2.990  1.00 0.00 ? 56 THR A CG2  8 
ATOM   7621 H H    . THR A 1 56 ? -5.661  -4.740  -0.229  1.00 0.00 ? 56 THR A H    8 
ATOM   7622 H HA   . THR A 1 56 ? -4.333  -6.371  -2.032  1.00 0.00 ? 56 THR A HA   8 
ATOM   7623 H HB   . THR A 1 56 ? -3.053  -3.927  -0.963  1.00 0.00 ? 56 THR A HB   8 
ATOM   7624 H HG1  . THR A 1 56 ? -5.451  -4.058  -2.434  1.00 0.00 ? 56 THR A HG1  8 
ATOM   7625 H HG21 . THR A 1 56 ? -3.097  -5.367  -3.520  1.00 0.00 ? 56 THR A HG21 8 
ATOM   7626 H HG22 . THR A 1 56 ? -1.800  -4.453  -2.750  1.00 0.00 ? 56 THR A HG22 8 
ATOM   7627 H HG23 . THR A 1 56 ? -3.087  -3.606  -3.609  1.00 0.00 ? 56 THR A HG23 8 
ATOM   7628 N N    . LEU A 1 57 ? -2.686  -5.860  0.774   1.00 0.00 ? 57 LEU A N    8 
ATOM   7629 C CA   . LEU A 1 57 ? -1.631  -6.380  1.628   1.00 0.00 ? 57 LEU A CA   8 
ATOM   7630 C C    . LEU A 1 57 ? -1.848  -7.855  1.920   1.00 0.00 ? 57 LEU A C    8 
ATOM   7631 O O    . LEU A 1 57 ? -0.937  -8.672  1.780   1.00 0.00 ? 57 LEU A O    8 
ATOM   7632 C CB   . LEU A 1 57 ? -1.567  -5.583  2.929   1.00 0.00 ? 57 LEU A CB   8 
ATOM   7633 C CG   . LEU A 1 57 ? -0.431  -4.566  3.009   1.00 0.00 ? 57 LEU A CG   8 
ATOM   7634 C CD1  . LEU A 1 57 ? -0.977  -3.146  2.969   1.00 0.00 ? 57 LEU A CD1  8 
ATOM   7635 C CD2  . LEU A 1 57 ? 0.399   -4.782  4.266   1.00 0.00 ? 57 LEU A CD2  8 
ATOM   7636 H H    . LEU A 1 57 ? -3.209  -5.094  1.082   1.00 0.00 ? 57 LEU A H    8 
ATOM   7637 H HA   . LEU A 1 57 ? -0.710  -6.265  1.107   1.00 0.00 ? 57 LEU A HA   8 
ATOM   7638 H HB2  . LEU A 1 57 ? -2.496  -5.054  3.032   1.00 0.00 ? 57 LEU A HB2  8 
ATOM   7639 H HB3  . LEU A 1 57 ? -1.465  -6.277  3.753   1.00 0.00 ? 57 LEU A HB3  8 
ATOM   7640 H HG   . LEU A 1 57 ? 0.211   -4.697  2.156   1.00 0.00 ? 57 LEU A HG   8 
ATOM   7641 H HD11 . LEU A 1 57 ? -0.324  -2.493  3.529   1.00 0.00 ? 57 LEU A HD11 8 
ATOM   7642 H HD12 . LEU A 1 57 ? -1.964  -3.128  3.406   1.00 0.00 ? 57 LEU A HD12 8 
ATOM   7643 H HD13 . LEU A 1 57 ? -1.031  -2.810  1.944   1.00 0.00 ? 57 LEU A HD13 8 
ATOM   7644 H HD21 . LEU A 1 57 ? 0.908   -3.866  4.524   1.00 0.00 ? 57 LEU A HD21 8 
ATOM   7645 H HD22 . LEU A 1 57 ? 1.126   -5.560  4.088   1.00 0.00 ? 57 LEU A HD22 8 
ATOM   7646 H HD23 . LEU A 1 57 ? -0.249  -5.075  5.079   1.00 0.00 ? 57 LEU A HD23 8 
ATOM   7647 N N    . THR A 1 58 ? -3.063  -8.185  2.319   1.00 0.00 ? 58 THR A N    8 
ATOM   7648 C CA   . THR A 1 58 ? -3.419  -9.558  2.628   1.00 0.00 ? 58 THR A CA   8 
ATOM   7649 C C    . THR A 1 58 ? -3.298  -10.430 1.388   1.00 0.00 ? 58 THR A C    8 
ATOM   7650 O O    . THR A 1 58 ? -2.805  -11.556 1.455   1.00 0.00 ? 58 THR A O    8 
ATOM   7651 C CB   . THR A 1 58 ? -4.839  -9.633  3.191   1.00 0.00 ? 58 THR A CB   8 
ATOM   7652 O OG1  . THR A 1 58 ? -5.019  -8.683  4.225   1.00 0.00 ? 58 THR A OG1  8 
ATOM   7653 C CG2  . THR A 1 58 ? -5.187  -10.995 3.753   1.00 0.00 ? 58 THR A CG2  8 
ATOM   7654 H H    . THR A 1 58 ? -3.735  -7.489  2.405   1.00 0.00 ? 58 THR A H    8 
ATOM   7655 H HA   . THR A 1 58 ? -2.725  -9.911  3.368   1.00 0.00 ? 58 THR A HA   8 
ATOM   7656 H HB   . THR A 1 58 ? -5.541  -9.412  2.400   1.00 0.00 ? 58 THR A HB   8 
ATOM   7657 H HG1  . THR A 1 58 ? -4.262  -8.702  4.814   1.00 0.00 ? 58 THR A HG1  8 
ATOM   7658 H HG21 . THR A 1 58 ? -4.309  -11.624 3.742   1.00 0.00 ? 58 THR A HG21 8 
ATOM   7659 H HG22 . THR A 1 58 ? -5.961  -11.446 3.149   1.00 0.00 ? 58 THR A HG22 8 
ATOM   7660 H HG23 . THR A 1 58 ? -5.540  -10.886 4.768   1.00 0.00 ? 58 THR A HG23 8 
ATOM   7661 N N    . SER A 1 59 ? -3.736  -9.898  0.251   1.00 0.00 ? 59 SER A N    8 
ATOM   7662 C CA   . SER A 1 59 ? -3.658  -10.620 -1.004  1.00 0.00 ? 59 SER A CA   8 
ATOM   7663 C C    . SER A 1 59 ? -2.237  -11.102 -1.236  1.00 0.00 ? 59 SER A C    8 
ATOM   7664 O O    . SER A 1 59 ? -2.007  -12.193 -1.758  1.00 0.00 ? 59 SER A O    8 
ATOM   7665 C CB   . SER A 1 59 ? -4.100  -9.726  -2.147  1.00 0.00 ? 59 SER A CB   8 
ATOM   7666 O OG   . SER A 1 59 ? -4.582  -10.488 -3.240  1.00 0.00 ? 59 SER A OG   8 
ATOM   7667 H H    . SER A 1 59 ? -4.106  -8.994  0.253   1.00 0.00 ? 59 SER A H    8 
ATOM   7668 H HA   . SER A 1 59 ? -4.308  -11.459 -0.946  1.00 0.00 ? 59 SER A HA   8 
ATOM   7669 H HB2  . SER A 1 59 ? -4.886  -9.068  -1.804  1.00 0.00 ? 59 SER A HB2  8 
ATOM   7670 H HB3  . SER A 1 59 ? -3.260  -9.147  -2.469  1.00 0.00 ? 59 SER A HB3  8 
ATOM   7671 H HG   . SER A 1 59 ? -3.843  -10.768 -3.786  1.00 0.00 ? 59 SER A HG   8 
ATOM   7672 N N    . CYS A 1 60 ? -1.291  -10.274 -0.821  1.00 0.00 ? 60 CYS A N    8 
ATOM   7673 C CA   . CYS A 1 60 ? 0.117   -10.587 -0.949  1.00 0.00 ? 60 CYS A CA   8 
ATOM   7674 C C    . CYS A 1 60 ? 0.550   -11.523 0.174   1.00 0.00 ? 60 CYS A C    8 
ATOM   7675 O O    . CYS A 1 60 ? 1.430   -12.365 -0.008  1.00 0.00 ? 60 CYS A O    8 
ATOM   7676 C CB   . CYS A 1 60 ? 0.936   -9.297  -0.911  1.00 0.00 ? 60 CYS A CB   8 
ATOM   7677 S SG   . CYS A 1 60 ? 2.392   -9.284  -2.013  1.00 0.00 ? 60 CYS A SG   8 
ATOM   7678 H H    . CYS A 1 60 ? -1.552  -9.429  -0.404  1.00 0.00 ? 60 CYS A H    8 
ATOM   7679 H HA   . CYS A 1 60 ? 0.266   -11.081 -1.894  1.00 0.00 ? 60 CYS A HA   8 
ATOM   7680 H HB2  . CYS A 1 60 ? 0.302   -8.472  -1.197  1.00 0.00 ? 60 CYS A HB2  8 
ATOM   7681 H HB3  . CYS A 1 60 ? 1.280   -9.136  0.100   1.00 0.00 ? 60 CYS A HB3  8 
ATOM   7682 N N    . GLY A 1 61 ? -0.083  -11.373 1.337   1.00 0.00 ? 61 GLY A N    8 
ATOM   7683 C CA   . GLY A 1 61 ? 0.242   -12.215 2.471   1.00 0.00 ? 61 GLY A CA   8 
ATOM   7684 C C    . GLY A 1 61 ? 1.650   -11.991 2.986   1.00 0.00 ? 61 GLY A C    8 
ATOM   7685 O O    . GLY A 1 61 ? 2.421   -12.939 3.127   1.00 0.00 ? 61 GLY A O    8 
ATOM   7686 H H    . GLY A 1 61 ? -0.781  -10.687 1.425   1.00 0.00 ? 61 GLY A H    8 
ATOM   7687 H HA2  . GLY A 1 61 ? -0.456  -12.009 3.268   1.00 0.00 ? 61 GLY A HA2  8 
ATOM   7688 H HA3  . GLY A 1 61 ? 0.140   -13.249 2.177   1.00 0.00 ? 61 GLY A HA3  8 
ATOM   7689 N N    . LEU A 1 62 ? 1.984   -10.738 3.283   1.00 0.00 ? 62 LEU A N    8 
ATOM   7690 C CA   . LEU A 1 62 ? 3.309   -10.413 3.802   1.00 0.00 ? 62 LEU A CA   8 
ATOM   7691 C C    . LEU A 1 62 ? 3.223   -9.946  5.251   1.00 0.00 ? 62 LEU A C    8 
ATOM   7692 O O    . LEU A 1 62 ? 3.504   -10.707 6.176   1.00 0.00 ? 62 LEU A O    8 
ATOM   7693 C CB   . LEU A 1 62 ? 4.019   -9.345  2.948   1.00 0.00 ? 62 LEU A CB   8 
ATOM   7694 C CG   . LEU A 1 62 ? 3.131   -8.473  2.043   1.00 0.00 ? 62 LEU A CG   8 
ATOM   7695 C CD1  . LEU A 1 62 ? 2.962   -7.079  2.629   1.00 0.00 ? 62 LEU A CD1  8 
ATOM   7696 C CD2  . LEU A 1 62 ? 3.732   -8.385  0.651   1.00 0.00 ? 62 LEU A CD2  8 
ATOM   7697 H H    . LEU A 1 62 ? 1.324   -10.024 3.164   1.00 0.00 ? 62 LEU A H    8 
ATOM   7698 H HA   . LEU A 1 62 ? 3.896   -11.320 3.775   1.00 0.00 ? 62 LEU A HA   8 
ATOM   7699 H HB2  . LEU A 1 62 ? 4.559   -8.690  3.615   1.00 0.00 ? 62 LEU A HB2  8 
ATOM   7700 H HB3  . LEU A 1 62 ? 4.739   -9.851  2.321   1.00 0.00 ? 62 LEU A HB3  8 
ATOM   7701 H HG   . LEU A 1 62 ? 2.151   -8.917  1.956   1.00 0.00 ? 62 LEU A HG   8 
ATOM   7702 H HD11 . LEU A 1 62 ? 3.766   -6.878  3.322   1.00 0.00 ? 62 LEU A HD11 8 
ATOM   7703 H HD12 . LEU A 1 62 ? 2.017   -7.019  3.147   1.00 0.00 ? 62 LEU A HD12 8 
ATOM   7704 H HD13 . LEU A 1 62 ? 2.982   -6.348  1.834   1.00 0.00 ? 62 LEU A HD13 8 
ATOM   7705 H HD21 . LEU A 1 62 ? 3.105   -7.766  0.027   1.00 0.00 ? 62 LEU A HD21 8 
ATOM   7706 H HD22 . LEU A 1 62 ? 3.801   -9.375  0.225   1.00 0.00 ? 62 LEU A HD22 8 
ATOM   7707 H HD23 . LEU A 1 62 ? 4.719   -7.951  0.712   1.00 0.00 ? 62 LEU A HD23 8 
ATOM   7708 N N    . ALA A 1 63 ? 2.833   -8.692  5.440   1.00 0.00 ? 63 ALA A N    8 
ATOM   7709 C CA   . ALA A 1 63 ? 2.709   -8.125  6.772   1.00 0.00 ? 63 ALA A CA   8 
ATOM   7710 C C    . ALA A 1 63 ? 1.636   -7.041  6.819   1.00 0.00 ? 63 ALA A C    8 
ATOM   7711 O O    . ALA A 1 63 ? 0.811   -6.929  5.912   1.00 0.00 ? 63 ALA A O    8 
ATOM   7712 C CB   . ALA A 1 63 ? 4.050   -7.573  7.236   1.00 0.00 ? 63 ALA A CB   8 
ATOM   7713 H H    . ALA A 1 63 ? 2.619   -8.140  4.668   1.00 0.00 ? 63 ALA A H    8 
ATOM   7714 H HA   . ALA A 1 63 ? 2.427   -8.922  7.437   1.00 0.00 ? 63 ALA A HA   8 
ATOM   7715 H HB1  . ALA A 1 63 ? 4.843   -8.009  6.647   1.00 0.00 ? 63 ALA A HB1  8 
ATOM   7716 H HB2  . ALA A 1 63 ? 4.199   -7.817  8.277   1.00 0.00 ? 63 ALA A HB2  8 
ATOM   7717 H HB3  . ALA A 1 63 ? 4.058   -6.500  7.113   1.00 0.00 ? 63 ALA A HB3  8 
ATOM   7718 N N    . VAL A 1 64 ? 1.660   -6.242  7.881   1.00 0.00 ? 64 VAL A N    8 
ATOM   7719 C CA   . VAL A 1 64 ? 0.704   -5.164  8.057   1.00 0.00 ? 64 VAL A CA   8 
ATOM   7720 C C    . VAL A 1 64 ? 1.398   -3.900  8.560   1.00 0.00 ? 64 VAL A C    8 
ATOM   7721 O O    . VAL A 1 64 ? 2.282   -3.972  9.413   1.00 0.00 ? 64 VAL A O    8 
ATOM   7722 C CB   . VAL A 1 64 ? -0.405  -5.559  9.037   1.00 0.00 ? 64 VAL A CB   8 
ATOM   7723 C CG1  . VAL A 1 64 ? -1.478  -4.483  9.106   1.00 0.00 ? 64 VAL A CG1  8 
ATOM   7724 C CG2  . VAL A 1 64 ? -1.006  -6.902  8.655   1.00 0.00 ? 64 VAL A CG2  8 
ATOM   7725 H H    . VAL A 1 64 ? 2.340   -6.379  8.563   1.00 0.00 ? 64 VAL A H    8 
ATOM   7726 H HA   . VAL A 1 64 ? 0.258   -4.968  7.112   1.00 0.00 ? 64 VAL A HA   8 
ATOM   7727 H HB   . VAL A 1 64 ? 0.039   -5.652  10.005  1.00 0.00 ? 64 VAL A HB   8 
ATOM   7728 H HG11 . VAL A 1 64 ? -1.015  -3.522  9.270   1.00 0.00 ? 64 VAL A HG11 8 
ATOM   7729 H HG12 . VAL A 1 64 ? -2.154  -4.701  9.920   1.00 0.00 ? 64 VAL A HG12 8 
ATOM   7730 H HG13 . VAL A 1 64 ? -2.029  -4.464  8.176   1.00 0.00 ? 64 VAL A HG13 8 
ATOM   7731 H HG21 . VAL A 1 64 ? -0.214  -7.596  8.416   1.00 0.00 ? 64 VAL A HG21 8 
ATOM   7732 H HG22 . VAL A 1 64 ? -1.648  -6.778  7.796   1.00 0.00 ? 64 VAL A HG22 8 
ATOM   7733 H HG23 . VAL A 1 64 ? -1.583  -7.287  9.483   1.00 0.00 ? 64 VAL A HG23 8 
ATOM   7734 N N    . PRO A 1 65 ? 1.014   -2.720  8.037   1.00 0.00 ? 65 PRO A N    8 
ATOM   7735 C CA   . PRO A 1 65 ? 1.615   -1.443  8.443   1.00 0.00 ? 65 PRO A CA   8 
ATOM   7736 C C    . PRO A 1 65 ? 1.505   -1.203  9.946   1.00 0.00 ? 65 PRO A C    8 
ATOM   7737 O O    . PRO A 1 65 ? 1.312   -2.139  10.723  1.00 0.00 ? 65 PRO A O    8 
ATOM   7738 C CB   . PRO A 1 65 ? 0.807   -0.393  7.666   1.00 0.00 ? 65 PRO A CB   8 
ATOM   7739 C CG   . PRO A 1 65 ? -0.428  -1.098  7.228   1.00 0.00 ? 65 PRO A CG   8 
ATOM   7740 C CD   . PRO A 1 65 ? -0.024  -2.527  7.013   1.00 0.00 ? 65 PRO A CD   8 
ATOM   7741 H HA   . PRO A 1 65 ? 2.653   -1.389  8.150   1.00 0.00 ? 65 PRO A HA   8 
ATOM   7742 H HB2  . PRO A 1 65 ? 0.574   0.440   8.312   1.00 0.00 ? 65 PRO A HB2  8 
ATOM   7743 H HB3  . PRO A 1 65 ? 1.382   -0.047  6.820   1.00 0.00 ? 65 PRO A HB3  8 
ATOM   7744 H HG2  . PRO A 1 65 ? -1.180  -1.031  8.000   1.00 0.00 ? 65 PRO A HG2  8 
ATOM   7745 H HG3  . PRO A 1 65 ? -0.792  -0.667  6.308   1.00 0.00 ? 65 PRO A HG3  8 
ATOM   7746 H HD2  . PRO A 1 65 ? -0.862  -3.187  7.175   1.00 0.00 ? 65 PRO A HD2  8 
ATOM   7747 H HD3  . PRO A 1 65 ? 0.381   -2.661  6.022   1.00 0.00 ? 65 PRO A HD3  8 
ATOM   7748 N N    . HIS A 1 66 ? 1.635   0.056   10.351  1.00 0.00 ? 66 HIS A N    8 
ATOM   7749 C CA   . HIS A 1 66 ? 1.557   0.421   11.762  1.00 0.00 ? 66 HIS A CA   8 
ATOM   7750 C C    . HIS A 1 66 ? 2.749   -0.140  12.531  1.00 0.00 ? 66 HIS A C    8 
ATOM   7751 O O    . HIS A 1 66 ? 2.599   -0.668  13.633  1.00 0.00 ? 66 HIS A O    8 
ATOM   7752 C CB   . HIS A 1 66 ? 0.250   -0.088  12.376  1.00 0.00 ? 66 HIS A CB   8 
ATOM   7753 C CG   . HIS A 1 66 ? -0.954  0.186   11.530  1.00 0.00 ? 66 HIS A CG   8 
ATOM   7754 N ND1  . HIS A 1 66 ? -1.829  -0.799  11.124  1.00 0.00 ? 66 HIS A ND1  8 
ATOM   7755 C CD2  . HIS A 1 66 ? -1.428  1.343   11.010  1.00 0.00 ? 66 HIS A CD2  8 
ATOM   7756 C CE1  . HIS A 1 66 ? -2.786  -0.259  10.392  1.00 0.00 ? 66 HIS A CE1  8 
ATOM   7757 N NE2  . HIS A 1 66 ? -2.566  1.038   10.308  1.00 0.00 ? 66 HIS A NE2  8 
ATOM   7758 H H    . HIS A 1 66 ? 1.790   0.757   9.685   1.00 0.00 ? 66 HIS A H    8 
ATOM   7759 H HA   . HIS A 1 66 ? 1.578   1.499   11.826  1.00 0.00 ? 66 HIS A HA   8 
ATOM   7760 H HB2  . HIS A 1 66 ? 0.319   -1.156  12.519  1.00 0.00 ? 66 HIS A HB2  8 
ATOM   7761 H HB3  . HIS A 1 66 ? 0.100   0.389   13.333  1.00 0.00 ? 66 HIS A HB3  8 
ATOM   7762 H HD1  . HIS A 1 66 ? -1.759  -1.752  11.340  1.00 0.00 ? 66 HIS A HD1  8 
ATOM   7763 H HD2  . HIS A 1 66 ? -0.992  2.322   11.126  1.00 0.00 ? 66 HIS A HD2  8 
ATOM   7764 H HE1  . HIS A 1 66 ? -3.609  -0.788  9.940   1.00 0.00 ? 66 HIS A HE1  8 
ATOM   7765 H HE2  . HIS A 1 66 ? -3.168  1.688   9.890   1.00 0.00 ? 66 HIS A HE2  8 
ATOM   7766 N N    . CYS A 1 67 ? 3.936   -0.022  11.941  1.00 0.00 ? 67 CYS A N    8 
ATOM   7767 C CA   . CYS A 1 67 ? 5.157   -0.518  12.568  1.00 0.00 ? 67 CYS A CA   8 
ATOM   7768 C C    . CYS A 1 67 ? 5.350   0.096   13.951  1.00 0.00 ? 67 CYS A C    8 
ATOM   7769 O O    . CYS A 1 67 ? 5.413   1.341   14.042  1.00 0.00 ? 67 CYS A O    8 
ATOM   7770 C CB   . CYS A 1 67 ? 6.369   -0.207  11.688  1.00 0.00 ? 67 CYS A CB   8 
ATOM   7771 S SG   . CYS A 1 67 ? 6.611   -1.377  10.312  1.00 0.00 ? 67 CYS A SG   8 
ATOM   7772 O OXT  . CYS A 1 67 ? 5.438   -0.672  14.932  1.00 0.00 ? 67 CYS A OXT  8 
ATOM   7773 H H    . CYS A 1 67 ? 3.991   0.408   11.062  1.00 0.00 ? 67 CYS A H    8 
ATOM   7774 H HA   . CYS A 1 67 ? 5.064   -1.588  12.672  1.00 0.00 ? 67 CYS A HA   8 
ATOM   7775 H HB2  . CYS A 1 67 ? 6.254   0.779   11.263  1.00 0.00 ? 67 CYS A HB2  8 
ATOM   7776 H HB3  . CYS A 1 67 ? 7.261   -0.228  12.298  1.00 0.00 ? 67 CYS A HB3  8 
HETATM 7777 C C1   . PGM B 2 .  ? -10.735 0.914   12.431  1.00 0.00 ? 68 PGM A C1   8 
HETATM 7778 O O1   . PGM B 2 .  ? -11.997 0.683   13.006  1.00 0.00 ? 68 PGM A O1   8 
HETATM 7779 C C2   . PGM B 2 .  ? -9.767  1.189   13.496  1.00 0.00 ? 68 PGM A C2   8 
HETATM 7780 O O2   . PGM B 2 .  ? -9.275  2.497   13.343  1.00 0.00 ? 68 PGM A O2   8 
HETATM 7781 C C3   . PGM B 2 .  ? -8.645  0.248   13.472  1.00 0.00 ? 68 PGM A C3   8 
HETATM 7782 O O4   . PGM B 2 .  ? -7.741  0.645   12.431  1.00 0.00 ? 68 PGM A O4   8 
HETATM 7783 P P5   . PGM B 2 .  ? -6.212  0.169   12.525  1.00 0.00 ? 68 PGM A P5   8 
HETATM 7784 O O5A  . PGM B 2 .  ? -5.509  0.987   13.540  1.00 0.00 ? 68 PGM A O5A  8 
HETATM 7785 O O5B  . PGM B 2 .  ? -6.189  -1.301  12.686  1.00 0.00 ? 68 PGM A O5B  8 
HETATM 7786 O O6   . PGM B 2 .  ? -5.587  0.515   11.094  1.00 0.00 ? 68 PGM A O6   8 
HETATM 7787 C C7   . PGM B 2 .  ? -6.203  -0.076  9.875   1.00 0.00 ? 68 PGM A C7   8 
HETATM 7788 C C8   . PGM B 2 .  ? -6.084  0.752   8.672   1.00 0.00 ? 68 PGM A C8   8 
HETATM 7789 O O8   . PGM B 2 .  ? -6.239  2.140   8.832   1.00 0.00 ? 68 PGM A O8   8 
HETATM 7790 C C9   . PGM B 2 .  ? -4.860  0.494   7.957   1.00 0.00 ? 68 PGM A C9   8 
HETATM 7791 O OQ1  . PGM B 2 .  ? -3.213  -2.056  8.091   1.00 0.00 ? 68 PGM A OQ1  8 
HETATM 7792 O OQ2  . PGM B 2 .  ? -4.866  -0.879  7.364   1.00 0.00 ? 68 PGM A OQ2  8 
HETATM 7793 C CA   . PGM B 2 .  ? -3.827  -1.428  7.161   1.00 0.00 ? 68 PGM A CA   8 
HETATM 7794 C CB   . PGM B 2 .  ? -3.257  -1.573  5.816   1.00 0.00 ? 68 PGM A CB   8 
HETATM 7795 C CC   . PGM B 2 .  ? -3.114  -0.303  5.020   1.00 0.00 ? 68 PGM A CC   8 
HETATM 7796 C CD   . PGM B 2 .  ? -2.607  -0.491  3.618   1.00 0.00 ? 68 PGM A CD   8 
HETATM 7797 C CE   . PGM B 2 .  ? -1.435  0.376   3.269   1.00 0.00 ? 68 PGM A CE   8 
HETATM 7798 C CF   . PGM B 2 .  ? -1.069  0.364   1.815   1.00 0.00 ? 68 PGM A CF   8 
HETATM 7799 C CG   . PGM B 2 .  ? 0.236   -0.310  1.505   1.00 0.00 ? 68 PGM A CG   8 
HETATM 7800 C CH   . PGM B 2 .  ? 1.103   0.407   0.524   1.00 0.00 ? 68 PGM A CH   8 
HETATM 7801 C CI   . PGM B 2 .  ? 2.055   1.391   1.119   1.00 0.00 ? 68 PGM A CI   8 
HETATM 7802 C CJ   . PGM B 2 .  ? 1.533   2.785   1.214   1.00 0.00 ? 68 PGM A CJ   8 
HETATM 7803 C CK   . PGM B 2 .  ? 2.179   3.777   0.302   1.00 0.00 ? 68 PGM A CK   8 
HETATM 7804 C CL   . PGM B 2 .  ? 1.260   4.429   -0.685  1.00 0.00 ? 68 PGM A CL   8 
HETATM 7805 C CM   . PGM B 2 .  ? 1.598   5.843   -1.032  1.00 0.00 ? 68 PGM A CM   8 
HETATM 7806 C CN   . PGM B 2 .  ? 0.831   6.417   -2.180  1.00 0.00 ? 68 PGM A CN   8 
HETATM 7807 C CO   . PGM B 2 .  ? 1.660   6.869   -3.338  1.00 0.00 ? 68 PGM A CO   8 
HETATM 7808 C CP   . PGM B 2 .  ? 1.641   5.938   -4.514  1.00 0.00 ? 68 PGM A CP   8 
ATOM   7809 N N    . ALA A 1 1  ? 15.435  3.090   -0.231  1.00 0.00 ? 1  ALA A N    9 
ATOM   7810 C CA   . ALA A 1 1  ? 14.818  3.805   -1.379  1.00 0.00 ? 1  ALA A CA   9 
ATOM   7811 C C    . ALA A 1 1  ? 13.298  3.817   -1.263  1.00 0.00 ? 1  ALA A C    9 
ATOM   7812 O O    . ALA A 1 1  ? 12.641  2.801   -1.486  1.00 0.00 ? 1  ALA A O    9 
ATOM   7813 C CB   . ALA A 1 1  ? 15.241  3.159   -2.690  1.00 0.00 ? 1  ALA A CB   9 
ATOM   7814 H H1   . ALA A 1 1  ? 15.171  2.087   -0.303  1.00 0.00 ? 1  ALA A H1   9 
ATOM   7815 H H2   . ALA A 1 1  ? 15.063  3.515   0.643   1.00 0.00 ? 1  ALA A H2   9 
ATOM   7816 H H3   . ALA A 1 1  ? 16.465  3.211   -0.299  1.00 0.00 ? 1  ALA A H3   9 
ATOM   7817 H HA   . ALA A 1 1  ? 15.177  4.824   -1.377  1.00 0.00 ? 1  ALA A HA   9 
ATOM   7818 H HB1  . ALA A 1 1  ? 16.157  2.607   -2.541  1.00 0.00 ? 1  ALA A HB1  9 
ATOM   7819 H HB2  . ALA A 1 1  ? 15.399  3.926   -3.434  1.00 0.00 ? 1  ALA A HB2  9 
ATOM   7820 H HB3  . ALA A 1 1  ? 14.465  2.487   -3.026  1.00 0.00 ? 1  ALA A HB3  9 
ATOM   7821 N N    . CYS A 1 2  ? 12.745  4.974   -0.913  1.00 0.00 ? 2  CYS A N    9 
ATOM   7822 C CA   . CYS A 1 2  ? 11.301  5.117   -0.769  1.00 0.00 ? 2  CYS A CA   9 
ATOM   7823 C C    . CYS A 1 2  ? 10.657  5.497   -2.100  1.00 0.00 ? 2  CYS A C    9 
ATOM   7824 O O    . CYS A 1 2  ? 10.078  6.575   -2.237  1.00 0.00 ? 2  CYS A O    9 
ATOM   7825 C CB   . CYS A 1 2  ? 10.974  6.172   0.291   1.00 0.00 ? 2  CYS A CB   9 
ATOM   7826 S SG   . CYS A 1 2  ? 11.477  5.710   1.981   1.00 0.00 ? 2  CYS A SG   9 
ATOM   7827 H H    . CYS A 1 2  ? 13.321  5.750   -0.749  1.00 0.00 ? 2  CYS A H    9 
ATOM   7828 H HA   . CYS A 1 2  ? 10.905  4.165   -0.450  1.00 0.00 ? 2  CYS A HA   9 
ATOM   7829 H HB2  . CYS A 1 2  ? 11.479  7.092   0.039   1.00 0.00 ? 2  CYS A HB2  9 
ATOM   7830 H HB3  . CYS A 1 2  ? 9.908   6.343   0.300   1.00 0.00 ? 2  CYS A HB3  9 
ATOM   7831 N N    . GLN A 1 3  ? 10.763  4.603   -3.078  1.00 0.00 ? 3  GLN A N    9 
ATOM   7832 C CA   . GLN A 1 3  ? 10.192  4.844   -4.398  1.00 0.00 ? 3  GLN A CA   9 
ATOM   7833 C C    . GLN A 1 3  ? 8.680   5.026   -4.311  1.00 0.00 ? 3  GLN A C    9 
ATOM   7834 O O    . GLN A 1 3  ? 7.941   4.068   -4.083  1.00 0.00 ? 3  GLN A O    9 
ATOM   7835 C CB   . GLN A 1 3  ? 10.524  3.684   -5.339  1.00 0.00 ? 3  GLN A CB   9 
ATOM   7836 C CG   . GLN A 1 3  ? 11.825  3.871   -6.101  1.00 0.00 ? 3  GLN A CG   9 
ATOM   7837 C CD   . GLN A 1 3  ? 12.289  2.598   -6.781  1.00 0.00 ? 3  GLN A CD   9 
ATOM   7838 O OE1  . GLN A 1 3  ? 12.019  1.494   -6.308  1.00 0.00 ? 3  GLN A OE1  9 
ATOM   7839 N NE2  . GLN A 1 3  ? 12.992  2.745   -7.898  1.00 0.00 ? 3  GLN A NE2  9 
ATOM   7840 H H    . GLN A 1 3  ? 11.237  3.762   -2.908  1.00 0.00 ? 3  GLN A H    9 
ATOM   7841 H HA   . GLN A 1 3  ? 10.630  5.750   -4.789  1.00 0.00 ? 3  GLN A HA   9 
ATOM   7842 H HB2  . GLN A 1 3  ? 10.598  2.776   -4.760  1.00 0.00 ? 3  GLN A HB2  9 
ATOM   7843 H HB3  . GLN A 1 3  ? 9.724   3.579   -6.057  1.00 0.00 ? 3  GLN A HB3  9 
ATOM   7844 H HG2  . GLN A 1 3  ? 11.681  4.631   -6.854  1.00 0.00 ? 3  GLN A HG2  9 
ATOM   7845 H HG3  . GLN A 1 3  ? 12.590  4.191   -5.409  1.00 0.00 ? 3  GLN A HG3  9 
ATOM   7846 H HE21 . GLN A 1 3  ? 13.169  3.655   -8.217  1.00 0.00 ? 3  GLN A HE21 9 
ATOM   7847 H HE22 . GLN A 1 3  ? 13.304  1.939   -8.359  1.00 0.00 ? 3  GLN A HE22 9 
ATOM   7848 N N    . ALA A 1 4  ? 8.227   6.263   -4.492  1.00 0.00 ? 4  ALA A N    9 
ATOM   7849 C CA   . ALA A 1 4  ? 6.807   6.573   -4.432  1.00 0.00 ? 4  ALA A CA   9 
ATOM   7850 C C    . ALA A 1 4  ? 6.133   6.406   -5.793  1.00 0.00 ? 4  ALA A C    9 
ATOM   7851 O O    . ALA A 1 4  ? 4.993   6.830   -5.983  1.00 0.00 ? 4  ALA A O    9 
ATOM   7852 C CB   . ALA A 1 4  ? 6.600   7.986   -3.910  1.00 0.00 ? 4  ALA A CB   9 
ATOM   7853 H H    . ALA A 1 4  ? 8.860   6.982   -4.666  1.00 0.00 ? 4  ALA A H    9 
ATOM   7854 H HA   . ALA A 1 4  ? 6.357   5.891   -3.734  1.00 0.00 ? 4  ALA A HA   9 
ATOM   7855 H HB1  . ALA A 1 4  ? 5.710   8.407   -4.353  1.00 0.00 ? 4  ALA A HB1  9 
ATOM   7856 H HB2  . ALA A 1 4  ? 7.454   8.595   -4.170  1.00 0.00 ? 4  ALA A HB2  9 
ATOM   7857 H HB3  . ALA A 1 4  ? 6.490   7.961   -2.836  1.00 0.00 ? 4  ALA A HB3  9 
ATOM   7858 N N    . SER A 1 5  ? 6.838   5.790   -6.739  1.00 0.00 ? 5  SER A N    9 
ATOM   7859 C CA   . SER A 1 5  ? 6.296   5.574   -8.076  1.00 0.00 ? 5  SER A CA   9 
ATOM   7860 C C    . SER A 1 5  ? 6.000   4.096   -8.316  1.00 0.00 ? 5  SER A C    9 
ATOM   7861 O O    . SER A 1 5  ? 5.178   3.748   -9.163  1.00 0.00 ? 5  SER A O    9 
ATOM   7862 C CB   . SER A 1 5  ? 7.274   6.089   -9.133  1.00 0.00 ? 5  SER A CB   9 
ATOM   7863 O OG   . SER A 1 5  ? 7.200   7.499   -9.253  1.00 0.00 ? 5  SER A OG   9 
ATOM   7864 H H    . SER A 1 5  ? 7.741   5.472   -6.535  1.00 0.00 ? 5  SER A H    9 
ATOM   7865 H HA   . SER A 1 5  ? 5.373   6.130   -8.152  1.00 0.00 ? 5  SER A HA   9 
ATOM   7866 H HB2  . SER A 1 5  ? 8.280   5.816   -8.853  1.00 0.00 ? 5  SER A HB2  9 
ATOM   7867 H HB3  . SER A 1 5  ? 7.034   5.646   -10.089 1.00 0.00 ? 5  SER A HB3  9 
ATOM   7868 H HG   . SER A 1 5  ? 7.005   7.734   -10.163 1.00 0.00 ? 5  SER A HG   9 
ATOM   7869 N N    . GLN A 1 6  ? 6.676   3.229   -7.566  1.00 0.00 ? 6  GLN A N    9 
ATOM   7870 C CA   . GLN A 1 6  ? 6.489   1.797   -7.697  1.00 0.00 ? 6  GLN A CA   9 
ATOM   7871 C C    . GLN A 1 6  ? 5.140   1.361   -7.128  1.00 0.00 ? 6  GLN A C    9 
ATOM   7872 O O    . GLN A 1 6  ? 4.715   0.222   -7.319  1.00 0.00 ? 6  GLN A O    9 
ATOM   7873 C CB   . GLN A 1 6  ? 7.620   1.050   -6.985  1.00 0.00 ? 6  GLN A CB   9 
ATOM   7874 C CG   . GLN A 1 6  ? 8.965   1.179   -7.681  1.00 0.00 ? 6  GLN A CG   9 
ATOM   7875 C CD   . GLN A 1 6  ? 9.239   0.035   -8.638  1.00 0.00 ? 6  GLN A CD   9 
ATOM   7876 O OE1  . GLN A 1 6  ? 8.467   -0.213  -9.564  1.00 0.00 ? 6  GLN A OE1  9 
ATOM   7877 N NE2  . GLN A 1 6  ? 10.343  -0.669  -8.418  1.00 0.00 ? 6  GLN A NE2  9 
ATOM   7878 H H    . GLN A 1 6  ? 7.314   3.559   -6.913  1.00 0.00 ? 6  GLN A H    9 
ATOM   7879 H HA   . GLN A 1 6  ? 6.521   1.563   -8.743  1.00 0.00 ? 6  GLN A HA   9 
ATOM   7880 H HB2  . GLN A 1 6  ? 7.719   1.441   -5.982  1.00 0.00 ? 6  GLN A HB2  9 
ATOM   7881 H HB3  . GLN A 1 6  ? 7.365   0.002   -6.930  1.00 0.00 ? 6  GLN A HB3  9 
ATOM   7882 H HG2  . GLN A 1 6  ? 8.981   2.104   -8.237  1.00 0.00 ? 6  GLN A HG2  9 
ATOM   7883 H HG3  . GLN A 1 6  ? 9.743   1.196   -6.932  1.00 0.00 ? 6  GLN A HG3  9 
ATOM   7884 H HE21 . GLN A 1 6  ? 10.910  -0.415  -7.661  1.00 0.00 ? 6  GLN A HE21 9 
ATOM   7885 H HE22 . GLN A 1 6  ? 10.544  -1.415  -9.021  1.00 0.00 ? 6  GLN A HE22 9 
ATOM   7886 N N    . LEU A 1 7  ? 4.478   2.270   -6.419  1.00 0.00 ? 7  LEU A N    9 
ATOM   7887 C CA   . LEU A 1 7  ? 3.187   1.974   -5.811  1.00 0.00 ? 7  LEU A CA   9 
ATOM   7888 C C    . LEU A 1 7  ? 2.052   2.700   -6.529  1.00 0.00 ? 7  LEU A C    9 
ATOM   7889 O O    . LEU A 1 7  ? 0.885   2.335   -6.384  1.00 0.00 ? 7  LEU A O    9 
ATOM   7890 C CB   . LEU A 1 7  ? 3.207   2.365   -4.332  1.00 0.00 ? 7  LEU A CB   9 
ATOM   7891 C CG   . LEU A 1 7  ? 4.556   2.172   -3.634  1.00 0.00 ? 7  LEU A CG   9 
ATOM   7892 C CD1  . LEU A 1 7  ? 4.634   3.020   -2.373  1.00 0.00 ? 7  LEU A CD1  9 
ATOM   7893 C CD2  . LEU A 1 7  ? 4.777   0.702   -3.307  1.00 0.00 ? 7  LEU A CD2  9 
ATOM   7894 H H    . LEU A 1 7  ? 4.870   3.158   -6.292  1.00 0.00 ? 7  LEU A H    9 
ATOM   7895 H HA   . LEU A 1 7  ? 3.022   0.910   -5.888  1.00 0.00 ? 7  LEU A HA   9 
ATOM   7896 H HB2  . LEU A 1 7  ? 2.928   3.406   -4.253  1.00 0.00 ? 7  LEU A HB2  9 
ATOM   7897 H HB3  . LEU A 1 7  ? 2.471   1.771   -3.814  1.00 0.00 ? 7  LEU A HB3  9 
ATOM   7898 H HG   . LEU A 1 7  ? 5.349   2.491   -4.299  1.00 0.00 ? 7  LEU A HG   9 
ATOM   7899 H HD11 . LEU A 1 7  ? 4.473   2.395   -1.508  1.00 0.00 ? 7  LEU A HD11 9 
ATOM   7900 H HD12 . LEU A 1 7  ? 3.876   3.789   -2.409  1.00 0.00 ? 7  LEU A HD12 9 
ATOM   7901 H HD13 . LEU A 1 7  ? 5.610   3.479   -2.308  1.00 0.00 ? 7  LEU A HD13 9 
ATOM   7902 H HD21 . LEU A 1 7  ? 5.802   0.435   -3.522  1.00 0.00 ? 7  LEU A HD21 9 
ATOM   7903 H HD22 . LEU A 1 7  ? 4.114   0.095   -3.906  1.00 0.00 ? 7  LEU A HD22 9 
ATOM   7904 H HD23 . LEU A 1 7  ? 4.573   0.531   -2.260  1.00 0.00 ? 7  LEU A HD23 9 
ATOM   7905 N N    . ALA A 1 8  ? 2.394   3.729   -7.302  1.00 0.00 ? 8  ALA A N    9 
ATOM   7906 C CA   . ALA A 1 8  ? 1.396   4.499   -8.035  1.00 0.00 ? 8  ALA A CA   9 
ATOM   7907 C C    . ALA A 1 8  ? 0.454   3.586   -8.809  1.00 0.00 ? 8  ALA A C    9 
ATOM   7908 O O    . ALA A 1 8  ? -0.737  3.866   -8.940  1.00 0.00 ? 8  ALA A O    9 
ATOM   7909 C CB   . ALA A 1 8  ? 2.073   5.484   -8.975  1.00 0.00 ? 8  ALA A CB   9 
ATOM   7910 H H    . ALA A 1 8  ? 3.336   3.978   -7.379  1.00 0.00 ? 8  ALA A H    9 
ATOM   7911 H HA   . ALA A 1 8  ? 0.825   5.057   -7.318  1.00 0.00 ? 8  ALA A HA   9 
ATOM   7912 H HB1  . ALA A 1 8  ? 2.880   5.981   -8.456  1.00 0.00 ? 8  ALA A HB1  9 
ATOM   7913 H HB2  . ALA A 1 8  ? 1.354   6.218   -9.307  1.00 0.00 ? 8  ALA A HB2  9 
ATOM   7914 H HB3  . ALA A 1 8  ? 2.468   4.954   -9.829  1.00 0.00 ? 8  ALA A HB3  9 
ATOM   7915 N N    . VAL A 1 9  ? 1.004   2.494   -9.316  1.00 0.00 ? 9  VAL A N    9 
ATOM   7916 C CA   . VAL A 1 9  ? 0.234   1.527   -10.077 1.00 0.00 ? 9  VAL A CA   9 
ATOM   7917 C C    . VAL A 1 9  ? -0.822  0.852   -9.207  1.00 0.00 ? 9  VAL A C    9 
ATOM   7918 O O    . VAL A 1 9  ? -1.834  0.361   -9.707  1.00 0.00 ? 9  VAL A O    9 
ATOM   7919 C CB   . VAL A 1 9  ? 1.145   0.452   -10.701 1.00 0.00 ? 9  VAL A CB   9 
ATOM   7920 C CG1  . VAL A 1 9  ? 1.898   -0.307  -9.619  1.00 0.00 ? 9  VAL A CG1  9 
ATOM   7921 C CG2  . VAL A 1 9  ? 0.336   -0.502  -11.569 1.00 0.00 ? 9  VAL A CG2  9 
ATOM   7922 H H    . VAL A 1 9  ? 1.952   2.338   -9.174  1.00 0.00 ? 9  VAL A H    9 
ATOM   7923 H HA   . VAL A 1 9  ? -0.254  2.058   -10.871 1.00 0.00 ? 9  VAL A HA   9 
ATOM   7924 H HB   . VAL A 1 9  ? 1.871   0.947   -11.330 1.00 0.00 ? 9  VAL A HB   9 
ATOM   7925 H HG11 . VAL A 1 9  ? 1.220   -0.974  -9.108  1.00 0.00 ? 9  VAL A HG11 9 
ATOM   7926 H HG12 . VAL A 1 9  ? 2.315   0.394   -8.911  1.00 0.00 ? 9  VAL A HG12 9 
ATOM   7927 H HG13 . VAL A 1 9  ? 2.696   -0.880  -10.069 1.00 0.00 ? 9  VAL A HG13 9 
ATOM   7928 H HG21 . VAL A 1 9  ? -0.116  -1.260  -10.946 1.00 0.00 ? 9  VAL A HG21 9 
ATOM   7929 H HG22 . VAL A 1 9  ? 0.987   -0.971  -12.292 1.00 0.00 ? 9  VAL A HG22 9 
ATOM   7930 H HG23 . VAL A 1 9  ? -0.437  0.049   -12.084 1.00 0.00 ? 9  VAL A HG23 9 
ATOM   7931 N N    . CYS A 1 10 ? -0.575  0.832   -7.903  1.00 0.00 ? 10 CYS A N    9 
ATOM   7932 C CA   . CYS A 1 10 ? -1.499  0.220   -6.954  1.00 0.00 ? 10 CYS A CA   9 
ATOM   7933 C C    . CYS A 1 10 ? -2.610  1.193   -6.592  1.00 0.00 ? 10 CYS A C    9 
ATOM   7934 O O    . CYS A 1 10 ? -3.742  0.794   -6.320  1.00 0.00 ? 10 CYS A O    9 
ATOM   7935 C CB   . CYS A 1 10 ? -0.753  -0.190  -5.688  1.00 0.00 ? 10 CYS A CB   9 
ATOM   7936 S SG   . CYS A 1 10 ? -1.530  -1.563  -4.776  1.00 0.00 ? 10 CYS A SG   9 
ATOM   7937 H H    . CYS A 1 10 ? 0.249   1.240   -7.570  1.00 0.00 ? 10 CYS A H    9 
ATOM   7938 H HA   . CYS A 1 10 ? -1.929  -0.657  -7.415  1.00 0.00 ? 10 CYS A HA   9 
ATOM   7939 H HB2  . CYS A 1 10 ? 0.247   -0.489  -5.952  1.00 0.00 ? 10 CYS A HB2  9 
ATOM   7940 H HB3  . CYS A 1 10 ? -0.704  0.661   -5.020  1.00 0.00 ? 10 CYS A HB3  9 
ATOM   7941 N N    . ALA A 1 11 ? -2.265  2.476   -6.588  1.00 0.00 ? 11 ALA A N    9 
ATOM   7942 C CA   . ALA A 1 11 ? -3.214  3.537   -6.259  1.00 0.00 ? 11 ALA A CA   9 
ATOM   7943 C C    . ALA A 1 11 ? -4.556  3.312   -6.940  1.00 0.00 ? 11 ALA A C    9 
ATOM   7944 O O    . ALA A 1 11 ? -5.603  3.699   -6.424  1.00 0.00 ? 11 ALA A O    9 
ATOM   7945 C CB   . ALA A 1 11 ? -2.646  4.893   -6.647  1.00 0.00 ? 11 ALA A CB   9 
ATOM   7946 H H    . ALA A 1 11 ? -1.344  2.715   -6.812  1.00 0.00 ? 11 ALA A H    9 
ATOM   7947 H HA   . ALA A 1 11 ? -3.362  3.527   -5.194  1.00 0.00 ? 11 ALA A HA   9 
ATOM   7948 H HB1  . ALA A 1 11 ? -2.857  5.087   -7.688  1.00 0.00 ? 11 ALA A HB1  9 
ATOM   7949 H HB2  . ALA A 1 11 ? -1.577  4.894   -6.490  1.00 0.00 ? 11 ALA A HB2  9 
ATOM   7950 H HB3  . ALA A 1 11 ? -3.100  5.661   -6.038  1.00 0.00 ? 11 ALA A HB3  9 
ATOM   7951 N N    . SER A 1 12 ? -4.511  2.676   -8.101  1.00 0.00 ? 12 SER A N    9 
ATOM   7952 C CA   . SER A 1 12 ? -5.716  2.386   -8.862  1.00 0.00 ? 12 SER A CA   9 
ATOM   7953 C C    . SER A 1 12 ? -6.739  1.657   -7.995  1.00 0.00 ? 12 SER A C    9 
ATOM   7954 O O    . SER A 1 12 ? -7.941  1.905   -8.090  1.00 0.00 ? 12 SER A O    9 
ATOM   7955 C CB   . SER A 1 12 ? -5.378  1.543   -10.093 1.00 0.00 ? 12 SER A CB   9 
ATOM   7956 O OG   . SER A 1 12 ? -6.308  1.770   -11.138 1.00 0.00 ? 12 SER A OG   9 
ATOM   7957 H H    . SER A 1 12 ? -3.644  2.394   -8.452  1.00 0.00 ? 12 SER A H    9 
ATOM   7958 H HA   . SER A 1 12 ? -6.134  3.324   -9.183  1.00 0.00 ? 12 SER A HA   9 
ATOM   7959 H HB2  . SER A 1 12 ? -4.391  1.803   -10.445 1.00 0.00 ? 12 SER A HB2  9 
ATOM   7960 H HB3  . SER A 1 12 ? -5.401  0.496   -9.828  1.00 0.00 ? 12 SER A HB3  9 
ATOM   7961 H HG   . SER A 1 12 ? -6.866  0.996   -11.244 1.00 0.00 ? 12 SER A HG   9 
ATOM   7962 N N    . ALA A 1 13 ? -6.247  0.757   -7.148  1.00 0.00 ? 13 ALA A N    9 
ATOM   7963 C CA   . ALA A 1 13 ? -7.105  -0.008  -6.260  1.00 0.00 ? 13 ALA A CA   9 
ATOM   7964 C C    . ALA A 1 13 ? -7.452  0.789   -5.007  1.00 0.00 ? 13 ALA A C    9 
ATOM   7965 O O    . ALA A 1 13 ? -8.586  0.751   -4.529  1.00 0.00 ? 13 ALA A O    9 
ATOM   7966 C CB   . ALA A 1 13 ? -6.436  -1.322  -5.884  1.00 0.00 ? 13 ALA A CB   9 
ATOM   7967 H H    . ALA A 1 13 ? -5.284  0.606   -7.120  1.00 0.00 ? 13 ALA A H    9 
ATOM   7968 H HA   . ALA A 1 13 ? -8.011  -0.234  -6.795  1.00 0.00 ? 13 ALA A HA   9 
ATOM   7969 H HB1  . ALA A 1 13 ? -6.312  -1.928  -6.769  1.00 0.00 ? 13 ALA A HB1  9 
ATOM   7970 H HB2  . ALA A 1 13 ? -7.053  -1.848  -5.170  1.00 0.00 ? 13 ALA A HB2  9 
ATOM   7971 H HB3  . ALA A 1 13 ? -5.470  -1.121  -5.446  1.00 0.00 ? 13 ALA A HB3  9 
ATOM   7972 N N    . ILE A 1 14 ? -6.469  1.513   -4.479  1.00 0.00 ? 14 ILE A N    9 
ATOM   7973 C CA   . ILE A 1 14 ? -6.674  2.320   -3.282  1.00 0.00 ? 14 ILE A CA   9 
ATOM   7974 C C    . ILE A 1 14 ? -7.648  3.464   -3.557  1.00 0.00 ? 14 ILE A C    9 
ATOM   7975 O O    . ILE A 1 14 ? -8.686  3.581   -2.904  1.00 0.00 ? 14 ILE A O    9 
ATOM   7976 C CB   . ILE A 1 14 ? -5.343  2.905   -2.756  1.00 0.00 ? 14 ILE A CB   9 
ATOM   7977 C CG1  . ILE A 1 14 ? -4.398  1.789   -2.304  1.00 0.00 ? 14 ILE A CG1  9 
ATOM   7978 C CG2  . ILE A 1 14 ? -5.598  3.871   -1.606  1.00 0.00 ? 14 ILE A CG2  9 
ATOM   7979 C CD1  . ILE A 1 14 ? -3.615  1.156   -3.437  1.00 0.00 ? 14 ILE A CD1  9 
ATOM   7980 H H    . ILE A 1 14 ? -5.587  1.505   -4.906  1.00 0.00 ? 14 ILE A H    9 
ATOM   7981 H HA   . ILE A 1 14 ? -7.091  1.681   -2.517  1.00 0.00 ? 14 ILE A HA   9 
ATOM   7982 H HB   . ILE A 1 14 ? -4.877  3.457   -3.559  1.00 0.00 ? 14 ILE A HB   9 
ATOM   7983 H HG12 . ILE A 1 14 ? -3.688  2.196   -1.596  1.00 0.00 ? 14 ILE A HG12 9 
ATOM   7984 H HG13 . ILE A 1 14 ? -4.974  1.012   -1.822  1.00 0.00 ? 14 ILE A HG13 9 
ATOM   7985 H HG21 . ILE A 1 14 ? -5.339  4.873   -1.914  1.00 0.00 ? 14 ILE A HG21 9 
ATOM   7986 H HG22 . ILE A 1 14 ? -4.994  3.588   -0.757  1.00 0.00 ? 14 ILE A HG22 9 
ATOM   7987 H HG23 . ILE A 1 14 ? -6.642  3.838   -1.331  1.00 0.00 ? 14 ILE A HG23 9 
ATOM   7988 H HD11 . ILE A 1 14 ? -2.591  1.003   -3.127  1.00 0.00 ? 14 ILE A HD11 9 
ATOM   7989 H HD12 . ILE A 1 14 ? -3.636  1.807   -4.298  1.00 0.00 ? 14 ILE A HD12 9 
ATOM   7990 H HD13 . ILE A 1 14 ? -4.058  0.206   -3.694  1.00 0.00 ? 14 ILE A HD13 9 
ATOM   7991 N N    . LEU A 1 15 ? -7.299  4.311   -4.520  1.00 0.00 ? 15 LEU A N    9 
ATOM   7992 C CA   . LEU A 1 15 ? -8.133  5.455   -4.878  1.00 0.00 ? 15 LEU A CA   9 
ATOM   7993 C C    . LEU A 1 15 ? -9.565  5.026   -5.193  1.00 0.00 ? 15 LEU A C    9 
ATOM   7994 O O    . LEU A 1 15 ? -10.452 5.129   -4.346  1.00 0.00 ? 15 LEU A O    9 
ATOM   7995 C CB   . LEU A 1 15 ? -7.530  6.195   -6.075  1.00 0.00 ? 15 LEU A CB   9 
ATOM   7996 C CG   . LEU A 1 15 ? -6.233  6.952   -5.782  1.00 0.00 ? 15 LEU A CG   9 
ATOM   7997 C CD1  . LEU A 1 15 ? -5.659  7.543   -7.060  1.00 0.00 ? 15 LEU A CD1  9 
ATOM   7998 C CD2  . LEU A 1 15 ? -6.476  8.042   -4.750  1.00 0.00 ? 15 LEU A CD2  9 
ATOM   7999 H H    . LEU A 1 15 ? -6.456  4.168   -4.999  1.00 0.00 ? 15 LEU A H    9 
ATOM   8000 H HA   . LEU A 1 15 ? -8.152  6.124   -4.031  1.00 0.00 ? 15 LEU A HA   9 
ATOM   8001 H HB2  . LEU A 1 15 ? -7.333  5.473   -6.855  1.00 0.00 ? 15 LEU A HB2  9 
ATOM   8002 H HB3  . LEU A 1 15 ? -8.259  6.903   -6.439  1.00 0.00 ? 15 LEU A HB3  9 
ATOM   8003 H HG   . LEU A 1 15 ? -5.506  6.263   -5.378  1.00 0.00 ? 15 LEU A HG   9 
ATOM   8004 H HD11 . LEU A 1 15 ? -4.897  8.267   -6.811  1.00 0.00 ? 15 LEU A HD11 9 
ATOM   8005 H HD12 . LEU A 1 15 ? -6.447  8.027   -7.619  1.00 0.00 ? 15 LEU A HD12 9 
ATOM   8006 H HD13 . LEU A 1 15 ? -5.226  6.755   -7.659  1.00 0.00 ? 15 LEU A HD13 9 
ATOM   8007 H HD21 . LEU A 1 15 ? -6.692  7.590   -3.793  1.00 0.00 ? 15 LEU A HD21 9 
ATOM   8008 H HD22 . LEU A 1 15 ? -7.313  8.650   -5.058  1.00 0.00 ? 15 LEU A HD22 9 
ATOM   8009 H HD23 . LEU A 1 15 ? -5.594  8.660   -4.665  1.00 0.00 ? 15 LEU A HD23 9 
ATOM   8010 N N    . SER A 1 16 ? -9.787  4.551   -6.415  1.00 0.00 ? 16 SER A N    9 
ATOM   8011 C CA   . SER A 1 16 ? -11.114 4.115   -6.836  1.00 0.00 ? 16 SER A CA   9 
ATOM   8012 C C    . SER A 1 16 ? -11.514 2.819   -6.136  1.00 0.00 ? 16 SER A C    9 
ATOM   8013 O O    . SER A 1 16 ? -12.272 2.834   -5.167  1.00 0.00 ? 16 SER A O    9 
ATOM   8014 C CB   . SER A 1 16 ? -11.154 3.927   -8.354  1.00 0.00 ? 16 SER A CB   9 
ATOM   8015 O OG   . SER A 1 16 ? -12.362 3.306   -8.760  1.00 0.00 ? 16 SER A OG   9 
ATOM   8016 H H    . SER A 1 16 ? -9.043  4.495   -7.050  1.00 0.00 ? 16 SER A H    9 
ATOM   8017 H HA   . SER A 1 16 ? -11.817 4.887   -6.561  1.00 0.00 ? 16 SER A HA   9 
ATOM   8018 H HB2  . SER A 1 16 ? -11.080 4.890   -8.836  1.00 0.00 ? 16 SER A HB2  9 
ATOM   8019 H HB3  . SER A 1 16 ? -10.324 3.306   -8.659  1.00 0.00 ? 16 SER A HB3  9 
ATOM   8020 H HG   . SER A 1 16 ? -12.377 2.399   -8.446  1.00 0.00 ? 16 SER A HG   9 
ATOM   8021 N N    . GLY A 1 17 ? -11.000 1.699   -6.635  1.00 0.00 ? 17 GLY A N    9 
ATOM   8022 C CA   . GLY A 1 17 ? -11.318 0.411   -6.046  1.00 0.00 ? 17 GLY A CA   9 
ATOM   8023 C C    . GLY A 1 17 ? -11.667 -0.632  -7.089  1.00 0.00 ? 17 GLY A C    9 
ATOM   8024 O O    . GLY A 1 17 ? -12.619 -1.394  -6.920  1.00 0.00 ? 17 GLY A O    9 
ATOM   8025 H H    . GLY A 1 17 ? -10.402 1.747   -7.410  1.00 0.00 ? 17 GLY A H    9 
ATOM   8026 H HA2  . GLY A 1 17 ? -10.466 0.066   -5.479  1.00 0.00 ? 17 GLY A HA2  9 
ATOM   8027 H HA3  . GLY A 1 17 ? -12.158 0.531   -5.377  1.00 0.00 ? 17 GLY A HA3  9 
ATOM   8028 N N    . ALA A 1 18 ? -10.895 -0.665  -8.170  1.00 0.00 ? 18 ALA A N    9 
ATOM   8029 C CA   . ALA A 1 18 ? -11.125 -1.622  -9.245  1.00 0.00 ? 18 ALA A CA   9 
ATOM   8030 C C    . ALA A 1 18 ? -11.021 -3.052  -8.736  1.00 0.00 ? 18 ALA A C    9 
ATOM   8031 O O    . ALA A 1 18 ? -12.029 -3.719  -8.502  1.00 0.00 ? 18 ALA A O    9 
ATOM   8032 C CB   . ALA A 1 18 ? -10.141 -1.385  -10.381 1.00 0.00 ? 18 ALA A CB   9 
ATOM   8033 H H    . ALA A 1 18 ? -10.152 -0.032  -8.246  1.00 0.00 ? 18 ALA A H    9 
ATOM   8034 H HA   . ALA A 1 18 ? -12.116 -1.464  -9.624  1.00 0.00 ? 18 ALA A HA   9 
ATOM   8035 H HB1  . ALA A 1 18 ? -10.463 -0.536  -10.965 1.00 0.00 ? 18 ALA A HB1  9 
ATOM   8036 H HB2  . ALA A 1 18 ? -10.101 -2.261  -11.011 1.00 0.00 ? 18 ALA A HB2  9 
ATOM   8037 H HB3  . ALA A 1 18 ? -9.160  -1.190  -9.973  1.00 0.00 ? 18 ALA A HB3  9 
ATOM   8038 N N    . LYS A 1 19 ? -9.793  -3.511  -8.567  1.00 0.00 ? 19 LYS A N    9 
ATOM   8039 C CA   . LYS A 1 19 ? -9.535  -4.861  -8.083  1.00 0.00 ? 19 LYS A CA   9 
ATOM   8040 C C    . LYS A 1 19 ? -8.040  -5.083  -7.859  1.00 0.00 ? 19 LYS A C    9 
ATOM   8041 O O    . LYS A 1 19 ? -7.212  -4.603  -8.633  1.00 0.00 ? 19 LYS A O    9 
ATOM   8042 C CB   . LYS A 1 19 ? -10.074 -5.895  -9.076  1.00 0.00 ? 19 LYS A CB   9 
ATOM   8043 C CG   . LYS A 1 19 ? -9.734  -5.586  -10.526 1.00 0.00 ? 19 LYS A CG   9 
ATOM   8044 C CD   . LYS A 1 19 ? -8.423  -6.234  -10.940 1.00 0.00 ? 19 LYS A CD   9 
ATOM   8045 C CE   . LYS A 1 19 ? -7.674  -5.379  -11.950 1.00 0.00 ? 19 LYS A CE   9 
ATOM   8046 N NZ   . LYS A 1 19 ? -8.486  -5.122  -13.171 1.00 0.00 ? 19 LYS A NZ   9 
ATOM   8047 H H    . LYS A 1 19 ? -9.041  -2.923  -8.772  1.00 0.00 ? 19 LYS A H    9 
ATOM   8048 H HA   . LYS A 1 19 ? -10.050 -4.977  -7.142  1.00 0.00 ? 19 LYS A HA   9 
ATOM   8049 H HB2  . LYS A 1 19 ? -9.661  -6.862  -8.830  1.00 0.00 ? 19 LYS A HB2  9 
ATOM   8050 H HB3  . LYS A 1 19 ? -11.149 -5.939  -8.983  1.00 0.00 ? 19 LYS A HB3  9 
ATOM   8051 H HG2  . LYS A 1 19 ? -10.524 -5.962  -11.158 1.00 0.00 ? 19 LYS A HG2  9 
ATOM   8052 H HG3  . LYS A 1 19 ? -9.652  -4.516  -10.647 1.00 0.00 ? 19 LYS A HG3  9 
ATOM   8053 H HD2  . LYS A 1 19 ? -7.804  -6.363  -10.065 1.00 0.00 ? 19 LYS A HD2  9 
ATOM   8054 H HD3  . LYS A 1 19 ? -8.632  -7.197  -11.381 1.00 0.00 ? 19 LYS A HD3  9 
ATOM   8055 H HE2  . LYS A 1 19 ? -7.426  -4.435  -11.489 1.00 0.00 ? 19 LYS A HE2  9 
ATOM   8056 H HE3  . LYS A 1 19 ? -6.766  -5.891  -12.232 1.00 0.00 ? 19 LYS A HE3  9 
ATOM   8057 H HZ1  . LYS A 1 19 ? -9.070  -5.954  -13.394 1.00 0.00 ? 19 LYS A HZ1  9 
ATOM   8058 H HZ2  . LYS A 1 19 ? -7.863  -4.924  -13.980 1.00 0.00 ? 19 LYS A HZ2  9 
ATOM   8059 H HZ3  . LYS A 1 19 ? -9.110  -4.304  -13.020 1.00 0.00 ? 19 LYS A HZ3  9 
ATOM   8060 N N    . PRO A 1 20 ? -7.673  -5.815  -6.791  1.00 0.00 ? 20 PRO A N    9 
ATOM   8061 C CA   . PRO A 1 20 ? -6.269  -6.094  -6.473  1.00 0.00 ? 20 PRO A CA   9 
ATOM   8062 C C    . PRO A 1 20 ? -5.510  -6.673  -7.663  1.00 0.00 ? 20 PRO A C    9 
ATOM   8063 O O    . PRO A 1 20 ? -6.075  -6.857  -8.741  1.00 0.00 ? 20 PRO A O    9 
ATOM   8064 C CB   . PRO A 1 20 ? -6.357  -7.124  -5.344  1.00 0.00 ? 20 PRO A CB   9 
ATOM   8065 C CG   . PRO A 1 20 ? -7.680  -6.876  -4.708  1.00 0.00 ? 20 PRO A CG   9 
ATOM   8066 C CD   . PRO A 1 20 ? -8.594  -6.426  -5.814  1.00 0.00 ? 20 PRO A CD   9 
ATOM   8067 H HA   . PRO A 1 20 ? -5.760  -5.210  -6.119  1.00 0.00 ? 20 PRO A HA   9 
ATOM   8068 H HB2  . PRO A 1 20 ? -6.297  -8.120  -5.757  1.00 0.00 ? 20 PRO A HB2  9 
ATOM   8069 H HB3  . PRO A 1 20 ? -5.548  -6.967  -4.646  1.00 0.00 ? 20 PRO A HB3  9 
ATOM   8070 H HG2  . PRO A 1 20 ? -8.050  -7.788  -4.263  1.00 0.00 ? 20 PRO A HG2  9 
ATOM   8071 H HG3  . PRO A 1 20 ? -7.589  -6.102  -3.960  1.00 0.00 ? 20 PRO A HG3  9 
ATOM   8072 H HD2  . PRO A 1 20 ? -9.108  -7.272  -6.246  1.00 0.00 ? 20 PRO A HD2  9 
ATOM   8073 H HD3  . PRO A 1 20 ? -9.302  -5.699  -5.446  1.00 0.00 ? 20 PRO A HD3  9 
ATOM   8074 N N    . SER A 1 21 ? -4.229  -6.958  -7.460  1.00 0.00 ? 21 SER A N    9 
ATOM   8075 C CA   . SER A 1 21 ? -3.395  -7.516  -8.517  1.00 0.00 ? 21 SER A CA   9 
ATOM   8076 C C    . SER A 1 21 ? -2.013  -7.881  -7.986  1.00 0.00 ? 21 SER A C    9 
ATOM   8077 O O    . SER A 1 21 ? -1.431  -7.148  -7.186  1.00 0.00 ? 21 SER A O    9 
ATOM   8078 C CB   . SER A 1 21 ? -3.265  -6.520  -9.672  1.00 0.00 ? 21 SER A CB   9 
ATOM   8079 O OG   . SER A 1 21 ? -3.267  -7.186  -10.922 1.00 0.00 ? 21 SER A OG   9 
ATOM   8080 H H    . SER A 1 21 ? -3.834  -6.790  -6.579  1.00 0.00 ? 21 SER A H    9 
ATOM   8081 H HA   . SER A 1 21 ? -3.876  -8.411  -8.878  1.00 0.00 ? 21 SER A HA   9 
ATOM   8082 H HB2  . SER A 1 21 ? -4.096  -5.831  -9.645  1.00 0.00 ? 21 SER A HB2  9 
ATOM   8083 H HB3  . SER A 1 21 ? -2.340  -5.973  -9.570  1.00 0.00 ? 21 SER A HB3  9 
ATOM   8084 H HG   . SER A 1 21 ? -3.631  -6.605  -11.594 1.00 0.00 ? 21 SER A HG   9 
ATOM   8085 N N    . GLY A 1 22 ? -1.494  -9.019  -8.435  1.00 0.00 ? 22 GLY A N    9 
ATOM   8086 C CA   . GLY A 1 22 ? -0.185  -9.463  -7.995  1.00 0.00 ? 22 GLY A CA   9 
ATOM   8087 C C    . GLY A 1 22 ? 0.904   -8.449  -8.290  1.00 0.00 ? 22 GLY A C    9 
ATOM   8088 O O    . GLY A 1 22 ? 1.936   -8.424  -7.619  1.00 0.00 ? 22 GLY A O    9 
ATOM   8089 H H    . GLY A 1 22 ? -2.005  -9.562  -9.072  1.00 0.00 ? 22 GLY A H    9 
ATOM   8090 H HA2  . GLY A 1 22 ? -0.216  -9.641  -6.930  1.00 0.00 ? 22 GLY A HA2  9 
ATOM   8091 H HA3  . GLY A 1 22 ? 0.056   -10.389 -8.496  1.00 0.00 ? 22 GLY A HA3  9 
ATOM   8092 N N    . GLU A 1 23 ? 0.675   -7.614  -9.298  1.00 0.00 ? 23 GLU A N    9 
ATOM   8093 C CA   . GLU A 1 23 ? 1.634   -6.599  -9.688  1.00 0.00 ? 23 GLU A CA   9 
ATOM   8094 C C    . GLU A 1 23 ? 1.996   -5.707  -8.505  1.00 0.00 ? 23 GLU A C    9 
ATOM   8095 O O    . GLU A 1 23 ? 3.171   -5.456  -8.238  1.00 0.00 ? 23 GLU A O    9 
ATOM   8096 C CB   . GLU A 1 23 ? 1.044   -5.756  -10.814 1.00 0.00 ? 23 GLU A CB   9 
ATOM   8097 C CG   . GLU A 1 23 ? 2.094   -5.124  -11.696 1.00 0.00 ? 23 GLU A CG   9 
ATOM   8098 C CD   . GLU A 1 23 ? 2.288   -3.647  -11.414 1.00 0.00 ? 23 GLU A CD   9 
ATOM   8099 O OE1  . GLU A 1 23 ? 1.315   -2.992  -10.984 1.00 0.00 ? 23 GLU A OE1  9 
ATOM   8100 O OE2  . GLU A 1 23 ? 3.413   -3.146  -11.621 1.00 0.00 ? 23 GLU A OE2  9 
ATOM   8101 H H    . GLU A 1 23 ? -0.159  -7.681  -9.800  1.00 0.00 ? 23 GLU A H    9 
ATOM   8102 H HA   . GLU A 1 23 ? 2.524   -7.094  -10.044 1.00 0.00 ? 23 GLU A HA   9 
ATOM   8103 H HB2  . GLU A 1 23 ? 0.417   -6.387  -11.431 1.00 0.00 ? 23 GLU A HB2  9 
ATOM   8104 H HB3  . GLU A 1 23 ? 0.442   -4.968  -10.383 1.00 0.00 ? 23 GLU A HB3  9 
ATOM   8105 H HG2  . GLU A 1 23 ? 3.027   -5.635  -11.531 1.00 0.00 ? 23 GLU A HG2  9 
ATOM   8106 H HG3  . GLU A 1 23 ? 1.793   -5.246  -12.724 1.00 0.00 ? 23 GLU A HG3  9 
ATOM   8107 N N    . CYS A 1 24 ? 0.974   -5.229  -7.801  1.00 0.00 ? 24 CYS A N    9 
ATOM   8108 C CA   . CYS A 1 24 ? 1.178   -4.363  -6.649  1.00 0.00 ? 24 CYS A CA   9 
ATOM   8109 C C    . CYS A 1 24 ? 2.060   -5.037  -5.607  1.00 0.00 ? 24 CYS A C    9 
ATOM   8110 O O    . CYS A 1 24 ? 2.871   -4.388  -4.946  1.00 0.00 ? 24 CYS A O    9 
ATOM   8111 C CB   . CYS A 1 24 ? -0.167  -3.974  -6.027  1.00 0.00 ? 24 CYS A CB   9 
ATOM   8112 S SG   . CYS A 1 24 ? -0.026  -2.909  -4.554  1.00 0.00 ? 24 CYS A SG   9 
ATOM   8113 H H    . CYS A 1 24 ? 0.063   -5.462  -8.065  1.00 0.00 ? 24 CYS A H    9 
ATOM   8114 H HA   . CYS A 1 24 ? 1.670   -3.479  -6.996  1.00 0.00 ? 24 CYS A HA   9 
ATOM   8115 H HB2  . CYS A 1 24 ? -0.754  -3.442  -6.761  1.00 0.00 ? 24 CYS A HB2  9 
ATOM   8116 H HB3  . CYS A 1 24 ? -0.693  -4.872  -5.736  1.00 0.00 ? 24 CYS A HB3  9 
ATOM   8117 N N    . CYS A 1 25 ? 1.895   -6.344  -5.472  1.00 0.00 ? 25 CYS A N    9 
ATOM   8118 C CA   . CYS A 1 25 ? 2.671   -7.123  -4.513  1.00 0.00 ? 25 CYS A CA   9 
ATOM   8119 C C    . CYS A 1 25 ? 4.150   -7.123  -4.882  1.00 0.00 ? 25 CYS A C    9 
ATOM   8120 O O    . CYS A 1 25 ? 5.017   -7.022  -4.014  1.00 0.00 ? 25 CYS A O    9 
ATOM   8121 C CB   . CYS A 1 25 ? 2.152   -8.561  -4.451  1.00 0.00 ? 25 CYS A CB   9 
ATOM   8122 S SG   . CYS A 1 25 ? 0.532   -8.735  -3.636  1.00 0.00 ? 25 CYS A SG   9 
ATOM   8123 H H    . CYS A 1 25 ? 1.233   -6.795  -6.033  1.00 0.00 ? 25 CYS A H    9 
ATOM   8124 H HA   . CYS A 1 25 ? 2.554   -6.666  -3.543  1.00 0.00 ? 25 CYS A HA   9 
ATOM   8125 H HB2  . CYS A 1 25 ? 2.056   -8.945  -5.455  1.00 0.00 ? 25 CYS A HB2  9 
ATOM   8126 H HB3  . CYS A 1 25 ? 2.861   -9.168  -3.907  1.00 0.00 ? 25 CYS A HB3  9 
ATOM   8127 N N    . GLY A 1 26 ? 4.431   -7.240  -6.175  1.00 0.00 ? 26 GLY A N    9 
ATOM   8128 C CA   . GLY A 1 26 ? 5.805   -7.255  -6.638  1.00 0.00 ? 26 GLY A CA   9 
ATOM   8129 C C    . GLY A 1 26 ? 6.533   -5.955  -6.356  1.00 0.00 ? 26 GLY A C    9 
ATOM   8130 O O    . GLY A 1 26 ? 7.693   -5.964  -5.943  1.00 0.00 ? 26 GLY A O    9 
ATOM   8131 H H    . GLY A 1 26 ? 3.698   -7.319  -6.821  1.00 0.00 ? 26 GLY A H    9 
ATOM   8132 H HA2  . GLY A 1 26 ? 6.329   -8.061  -6.145  1.00 0.00 ? 26 GLY A HA2  9 
ATOM   8133 H HA3  . GLY A 1 26 ? 5.812   -7.435  -7.703  1.00 0.00 ? 26 GLY A HA3  9 
ATOM   8134 N N    . ASN A 1 27 ? 5.857   -4.834  -6.586  1.00 0.00 ? 27 ASN A N    9 
ATOM   8135 C CA   . ASN A 1 27 ? 6.449   -3.527  -6.362  1.00 0.00 ? 27 ASN A CA   9 
ATOM   8136 C C    . ASN A 1 27 ? 6.746   -3.309  -4.891  1.00 0.00 ? 27 ASN A C    9 
ATOM   8137 O O    . ASN A 1 27 ? 7.898   -3.123  -4.497  1.00 0.00 ? 27 ASN A O    9 
ATOM   8138 C CB   . ASN A 1 27 ? 5.529   -2.423  -6.883  1.00 0.00 ? 27 ASN A CB   9 
ATOM   8139 C CG   . ASN A 1 27 ? 5.165   -2.614  -8.342  1.00 0.00 ? 27 ASN A CG   9 
ATOM   8140 O OD1  . ASN A 1 27 ? 4.115   -3.171  -8.665  1.00 0.00 ? 27 ASN A OD1  9 
ATOM   8141 N ND2  . ASN A 1 27 ? 6.033   -2.151  -9.234  1.00 0.00 ? 27 ASN A ND2  9 
ATOM   8142 H H    . ASN A 1 27 ? 4.943   -4.886  -6.919  1.00 0.00 ? 27 ASN A H    9 
ATOM   8143 H HA   . ASN A 1 27 ? 7.368   -3.498  -6.900  1.00 0.00 ? 27 ASN A HA   9 
ATOM   8144 H HB2  . ASN A 1 27 ? 4.618   -2.418  -6.302  1.00 0.00 ? 27 ASN A HB2  9 
ATOM   8145 H HB3  . ASN A 1 27 ? 6.025   -1.471  -6.775  1.00 0.00 ? 27 ASN A HB3  9 
ATOM   8146 H HD21 . ASN A 1 27 ? 6.849   -1.719  -8.905  1.00 0.00 ? 27 ASN A HD21 9 
ATOM   8147 H HD22 . ASN A 1 27 ? 5.822   -2.260  -10.185 1.00 0.00 ? 27 ASN A HD22 9 
ATOM   8148 N N    . LEU A 1 28 ? 5.701   -3.338  -4.082  1.00 0.00 ? 28 LEU A N    9 
ATOM   8149 C CA   . LEU A 1 28 ? 5.847   -3.150  -2.645  1.00 0.00 ? 28 LEU A CA   9 
ATOM   8150 C C    . LEU A 1 28 ? 6.914   -4.087  -2.091  1.00 0.00 ? 28 LEU A C    9 
ATOM   8151 O O    . LEU A 1 28 ? 7.532   -3.808  -1.064  1.00 0.00 ? 28 LEU A O    9 
ATOM   8152 C CB   . LEU A 1 28 ? 4.517   -3.378  -1.925  1.00 0.00 ? 28 LEU A CB   9 
ATOM   8153 C CG   . LEU A 1 28 ? 3.941   -4.783  -2.066  1.00 0.00 ? 28 LEU A CG   9 
ATOM   8154 C CD1  . LEU A 1 28 ? 4.517   -5.710  -1.006  1.00 0.00 ? 28 LEU A CD1  9 
ATOM   8155 C CD2  . LEU A 1 28 ? 2.421   -4.749  -1.978  1.00 0.00 ? 28 LEU A CD2  9 
ATOM   8156 H H    . LEU A 1 28 ? 4.818   -3.495  -4.463  1.00 0.00 ? 28 LEU A H    9 
ATOM   8157 H HA   . LEU A 1 28 ? 6.158   -2.139  -2.484  1.00 0.00 ? 28 LEU A HA   9 
ATOM   8158 H HB2  . LEU A 1 28 ? 4.661   -3.174  -0.874  1.00 0.00 ? 28 LEU A HB2  9 
ATOM   8159 H HB3  . LEU A 1 28 ? 3.795   -2.677  -2.315  1.00 0.00 ? 28 LEU A HB3  9 
ATOM   8160 H HG   . LEU A 1 28 ? 4.214   -5.172  -3.032  1.00 0.00 ? 28 LEU A HG   9 
ATOM   8161 H HD11 . LEU A 1 28 ? 5.536   -5.960  -1.261  1.00 0.00 ? 28 LEU A HD11 9 
ATOM   8162 H HD12 . LEU A 1 28 ? 3.927   -6.613  -0.961  1.00 0.00 ? 28 LEU A HD12 9 
ATOM   8163 H HD13 . LEU A 1 28 ? 4.497   -5.217  -0.046  1.00 0.00 ? 28 LEU A HD13 9 
ATOM   8164 H HD21 . LEU A 1 28 ? 2.106   -3.817  -1.531  1.00 0.00 ? 28 LEU A HD21 9 
ATOM   8165 H HD22 . LEU A 1 28 ? 2.075   -5.573  -1.372  1.00 0.00 ? 28 LEU A HD22 9 
ATOM   8166 H HD23 . LEU A 1 28 ? 2.001   -4.831  -2.969  1.00 0.00 ? 28 LEU A HD23 9 
ATOM   8167 N N    . ARG A 1 29 ? 7.121   -5.202  -2.786  1.00 0.00 ? 29 ARG A N    9 
ATOM   8168 C CA   . ARG A 1 29 ? 8.101   -6.187  -2.385  1.00 0.00 ? 29 ARG A CA   9 
ATOM   8169 C C    . ARG A 1 29 ? 9.487   -5.591  -2.330  1.00 0.00 ? 29 ARG A C    9 
ATOM   8170 O O    . ARG A 1 29 ? 10.156  -5.633  -1.297  1.00 0.00 ? 29 ARG A O    9 
ATOM   8171 C CB   . ARG A 1 29 ? 8.080   -7.370  -3.350  1.00 0.00 ? 29 ARG A CB   9 
ATOM   8172 C CG   . ARG A 1 29 ? 7.953   -8.703  -2.648  1.00 0.00 ? 29 ARG A CG   9 
ATOM   8173 C CD   . ARG A 1 29 ? 6.835   -9.544  -3.234  1.00 0.00 ? 29 ARG A CD   9 
ATOM   8174 N NE   . ARG A 1 29 ? 6.009   -10.135 -2.189  1.00 0.00 ? 29 ARG A NE   9 
ATOM   8175 C CZ   . ARG A 1 29 ? 5.289   -11.243 -2.348  1.00 0.00 ? 29 ARG A CZ   9 
ATOM   8176 N NH1  . ARG A 1 29 ? 5.263   -11.866 -3.520  1.00 0.00 ? 29 ARG A NH1  9 
ATOM   8177 N NH2  . ARG A 1 29 ? 4.588   -11.727 -1.333  1.00 0.00 ? 29 ARG A NH2  9 
ATOM   8178 H H    . ARG A 1 29 ? 6.597   -5.368  -3.587  1.00 0.00 ? 29 ARG A H    9 
ATOM   8179 H HA   . ARG A 1 29 ? 7.838   -6.520  -1.411  1.00 0.00 ? 29 ARG A HA   9 
ATOM   8180 H HB2  . ARG A 1 29 ? 7.244   -7.256  -4.024  1.00 0.00 ? 29 ARG A HB2  9 
ATOM   8181 H HB3  . ARG A 1 29 ? 8.996   -7.373  -3.923  1.00 0.00 ? 29 ARG A HB3  9 
ATOM   8182 H HG2  . ARG A 1 29 ? 8.883   -9.240  -2.743  1.00 0.00 ? 29 ARG A HG2  9 
ATOM   8183 H HG3  . ARG A 1 29 ? 7.743   -8.520  -1.606  1.00 0.00 ? 29 ARG A HG3  9 
ATOM   8184 H HD2  . ARG A 1 29 ? 6.216   -8.918  -3.860  1.00 0.00 ? 29 ARG A HD2  9 
ATOM   8185 H HD3  . ARG A 1 29 ? 7.269   -10.334 -3.829  1.00 0.00 ? 29 ARG A HD3  9 
ATOM   8186 H HE   . ARG A 1 29 ? 5.999   -9.684  -1.317  1.00 0.00 ? 29 ARG A HE   9 
ATOM   8187 H HH11 . ARG A 1 29 ? 5.786   -11.505 -4.291  1.00 0.00 ? 29 ARG A HH11 9 
ATOM   8188 H HH12 . ARG A 1 29 ? 4.721   -12.699 -3.631  1.00 0.00 ? 29 ARG A HH12 9 
ATOM   8189 H HH21 . ARG A 1 29 ? 4.602   -11.260 -0.450  1.00 0.00 ? 29 ARG A HH21 9 
ATOM   8190 H HH22 . ARG A 1 29 ? 4.046   -12.559 -1.451  1.00 0.00 ? 29 ARG A HH22 9 
ATOM   8191 N N    . ALA A 1 30 ? 9.909   -5.023  -3.444  1.00 0.00 ? 30 ALA A N    9 
ATOM   8192 C CA   . ALA A 1 30 ? 11.218  -4.399  -3.521  1.00 0.00 ? 30 ALA A CA   9 
ATOM   8193 C C    . ALA A 1 30 ? 11.418  -3.453  -2.345  1.00 0.00 ? 30 ALA A C    9 
ATOM   8194 O O    . ALA A 1 30 ? 12.544  -3.194  -1.920  1.00 0.00 ? 30 ALA A O    9 
ATOM   8195 C CB   . ALA A 1 30 ? 11.378  -3.657  -4.840  1.00 0.00 ? 30 ALA A CB   9 
ATOM   8196 H H    . ALA A 1 30 ? 9.321   -5.016  -4.224  1.00 0.00 ? 30 ALA A H    9 
ATOM   8197 H HA   . ALA A 1 30 ? 11.958  -5.178  -3.477  1.00 0.00 ? 30 ALA A HA   9 
ATOM   8198 H HB1  . ALA A 1 30 ? 11.143  -2.612  -4.696  1.00 0.00 ? 30 ALA A HB1  9 
ATOM   8199 H HB2  . ALA A 1 30 ? 10.708  -4.079  -5.574  1.00 0.00 ? 30 ALA A HB2  9 
ATOM   8200 H HB3  . ALA A 1 30 ? 12.397  -3.752  -5.185  1.00 0.00 ? 30 ALA A HB3  9 
ATOM   8201 N N    . GLN A 1 31 ? 10.305  -2.954  -1.818  1.00 0.00 ? 31 GLN A N    9 
ATOM   8202 C CA   . GLN A 1 31 ? 10.333  -2.049  -0.679  1.00 0.00 ? 31 GLN A CA   9 
ATOM   8203 C C    . GLN A 1 31 ? 10.469  -2.825  0.625   1.00 0.00 ? 31 GLN A C    9 
ATOM   8204 O O    . GLN A 1 31 ? 11.519  -2.801  1.268   1.00 0.00 ? 31 GLN A O    9 
ATOM   8205 C CB   . GLN A 1 31 ? 9.076   -1.175  -0.656  1.00 0.00 ? 31 GLN A CB   9 
ATOM   8206 C CG   . GLN A 1 31 ? 8.604   -0.756  -2.036  1.00 0.00 ? 31 GLN A CG   9 
ATOM   8207 C CD   . GLN A 1 31 ? 8.027   0.642   -2.041  1.00 0.00 ? 31 GLN A CD   9 
ATOM   8208 O OE1  . GLN A 1 31 ? 6.895   0.861   -1.612  1.00 0.00 ? 31 GLN A OE1  9 
ATOM   8209 N NE2  . GLN A 1 31 ? 8.807   1.598   -2.523  1.00 0.00 ? 31 GLN A NE2  9 
ATOM   8210 H H    . GLN A 1 31 ? 9.437   -3.222  -2.195  1.00 0.00 ? 31 GLN A H    9 
ATOM   8211 H HA   . GLN A 1 31 ? 11.196  -1.412  -0.787  1.00 0.00 ? 31 GLN A HA   9 
ATOM   8212 H HB2  . GLN A 1 31 ? 8.277   -1.717  -0.176  1.00 0.00 ? 31 GLN A HB2  9 
ATOM   8213 H HB3  . GLN A 1 31 ? 9.283   -0.278  -0.089  1.00 0.00 ? 31 GLN A HB3  9 
ATOM   8214 H HG2  . GLN A 1 31 ? 9.444   -0.785  -2.714  1.00 0.00 ? 31 GLN A HG2  9 
ATOM   8215 H HG3  . GLN A 1 31 ? 7.847   -1.446  -2.371  1.00 0.00 ? 31 GLN A HG3  9 
ATOM   8216 H HE21 . GLN A 1 31 ? 9.702   1.348   -2.847  1.00 0.00 ? 31 GLN A HE21 9 
ATOM   8217 H HE22 . GLN A 1 31 ? 8.460   2.515   -2.530  1.00 0.00 ? 31 GLN A HE22 9 
ATOM   8218 N N    . GLN A 1 32 ? 9.392   -3.508  1.015   1.00 0.00 ? 32 GLN A N    9 
ATOM   8219 C CA   . GLN A 1 32 ? 9.376   -4.290  2.248   1.00 0.00 ? 32 GLN A CA   9 
ATOM   8220 C C    . GLN A 1 32 ? 9.948   -3.497  3.422   1.00 0.00 ? 32 GLN A C    9 
ATOM   8221 O O    . GLN A 1 32 ? 10.364  -4.070  4.429   1.00 0.00 ? 32 GLN A O    9 
ATOM   8222 C CB   . GLN A 1 32 ? 10.161  -5.581  2.059   1.00 0.00 ? 32 GLN A CB   9 
ATOM   8223 C CG   . GLN A 1 32 ? 9.505   -6.787  2.710   1.00 0.00 ? 32 GLN A CG   9 
ATOM   8224 C CD   . GLN A 1 32 ? 9.383   -7.968  1.767   1.00 0.00 ? 32 GLN A CD   9 
ATOM   8225 O OE1  . GLN A 1 32 ? 10.191  -8.895  1.807   1.00 0.00 ? 32 GLN A OE1  9 
ATOM   8226 N NE2  . GLN A 1 32 ? 8.369   -7.937  0.911   1.00 0.00 ? 32 GLN A NE2  9 
ATOM   8227 H H    . GLN A 1 32 ? 8.586   -3.486  0.460   1.00 0.00 ? 32 GLN A H    9 
ATOM   8228 H HA   . GLN A 1 32 ? 8.347   -4.537  2.467   1.00 0.00 ? 32 GLN A HA   9 
ATOM   8229 H HB2  . GLN A 1 32 ? 10.255  -5.775  1.002   1.00 0.00 ? 32 GLN A HB2  9 
ATOM   8230 H HB3  . GLN A 1 32 ? 11.143  -5.455  2.484   1.00 0.00 ? 32 GLN A HB3  9 
ATOM   8231 H HG2  . GLN A 1 32 ? 10.097  -7.085  3.563   1.00 0.00 ? 32 GLN A HG2  9 
ATOM   8232 H HG3  . GLN A 1 32 ? 8.516   -6.504  3.040   1.00 0.00 ? 32 GLN A HG3  9 
ATOM   8233 H HE21 . GLN A 1 32 ? 7.765   -7.166  0.936   1.00 0.00 ? 32 GLN A HE21 9 
ATOM   8234 H HE22 . GLN A 1 32 ? 8.264   -8.688  0.291   1.00 0.00 ? 32 GLN A HE22 9 
ATOM   8235 N N    . GLY A 1 33 ? 9.960   -2.177  3.284   1.00 0.00 ? 33 GLY A N    9 
ATOM   8236 C CA   . GLY A 1 33 ? 10.476  -1.320  4.333   1.00 0.00 ? 33 GLY A CA   9 
ATOM   8237 C C    . GLY A 1 33 ? 9.711   -0.017  4.425   1.00 0.00 ? 33 GLY A C    9 
ATOM   8238 O O    . GLY A 1 33 ? 8.824   0.131   5.266   1.00 0.00 ? 33 GLY A O    9 
ATOM   8239 H H    . GLY A 1 33 ? 9.613   -1.780  2.460   1.00 0.00 ? 33 GLY A H    9 
ATOM   8240 H HA2  . GLY A 1 33 ? 10.402  -1.839  5.277   1.00 0.00 ? 33 GLY A HA2  9 
ATOM   8241 H HA3  . GLY A 1 33 ? 11.514  -1.104  4.130   1.00 0.00 ? 33 GLY A HA3  9 
ATOM   8242 N N    . CYS A 1 34 ? 10.048  0.928   3.553   1.00 0.00 ? 34 CYS A N    9 
ATOM   8243 C CA   . CYS A 1 34 ? 9.382   2.220   3.535   1.00 0.00 ? 34 CYS A CA   9 
ATOM   8244 C C    . CYS A 1 34 ? 7.892   2.048   3.300   1.00 0.00 ? 34 CYS A C    9 
ATOM   8245 O O    . CYS A 1 34 ? 7.069   2.743   3.894   1.00 0.00 ? 34 CYS A O    9 
ATOM   8246 C CB   . CYS A 1 34 ? 9.983   3.115   2.465   1.00 0.00 ? 34 CYS A CB   9 
ATOM   8247 S SG   . CYS A 1 34 ? 9.797   4.899   2.782   1.00 0.00 ? 34 CYS A SG   9 
ATOM   8248 H H    . CYS A 1 34 ? 10.756  0.751   2.906   1.00 0.00 ? 34 CYS A H    9 
ATOM   8249 H HA   . CYS A 1 34 ? 9.528   2.671   4.482   1.00 0.00 ? 34 CYS A HA   9 
ATOM   8250 H HB2  . CYS A 1 34 ? 11.039  2.901   2.375   1.00 0.00 ? 34 CYS A HB2  9 
ATOM   8251 H HB3  . CYS A 1 34 ? 9.497   2.898   1.539   1.00 0.00 ? 34 CYS A HB3  9 
ATOM   8252 N N    . PHE A 1 35 ? 7.557   1.095   2.445   1.00 0.00 ? 35 PHE A N    9 
ATOM   8253 C CA   . PHE A 1 35 ? 6.164   0.792   2.137   1.00 0.00 ? 35 PHE A CA   9 
ATOM   8254 C C    . PHE A 1 35 ? 5.393   0.620   3.434   1.00 0.00 ? 35 PHE A C    9 
ATOM   8255 O O    . PHE A 1 35 ? 4.276   1.115   3.589   1.00 0.00 ? 35 PHE A O    9 
ATOM   8256 C CB   . PHE A 1 35 ? 6.101   -0.465  1.251   1.00 0.00 ? 35 PHE A CB   9 
ATOM   8257 C CG   . PHE A 1 35 ? 5.073   -1.503  1.634   1.00 0.00 ? 35 PHE A CG   9 
ATOM   8258 C CD1  . PHE A 1 35 ? 3.766   -1.152  1.940   1.00 0.00 ? 35 PHE A CD1  9 
ATOM   8259 C CD2  . PHE A 1 35 ? 5.428   -2.842  1.675   1.00 0.00 ? 35 PHE A CD2  9 
ATOM   8260 C CE1  . PHE A 1 35 ? 2.837   -2.118  2.281   1.00 0.00 ? 35 PHE A CE1  9 
ATOM   8261 C CE2  . PHE A 1 35 ? 4.506   -3.810  2.016   1.00 0.00 ? 35 PHE A CE2  9 
ATOM   8262 C CZ   . PHE A 1 35 ? 3.208   -3.449  2.320   1.00 0.00 ? 35 PHE A CZ   9 
ATOM   8263 H H    . PHE A 1 35 ? 8.268   0.571   2.024   1.00 0.00 ? 35 PHE A H    9 
ATOM   8264 H HA   . PHE A 1 35 ? 5.754   1.629   1.602   1.00 0.00 ? 35 PHE A HA   9 
ATOM   8265 H HB2  . PHE A 1 35 ? 5.895   -0.166  0.237   1.00 0.00 ? 35 PHE A HB2  9 
ATOM   8266 H HB3  . PHE A 1 35 ? 7.070   -0.943  1.283   1.00 0.00 ? 35 PHE A HB3  9 
ATOM   8267 H HD1  . PHE A 1 35 ? 3.474   -0.113  1.912   1.00 0.00 ? 35 PHE A HD1  9 
ATOM   8268 H HD2  . PHE A 1 35 ? 6.440   -3.129  1.434   1.00 0.00 ? 35 PHE A HD2  9 
ATOM   8269 H HE1  . PHE A 1 35 ? 1.823   -1.833  2.517   1.00 0.00 ? 35 PHE A HE1  9 
ATOM   8270 H HE2  . PHE A 1 35 ? 4.801   -4.849  2.044   1.00 0.00 ? 35 PHE A HE2  9 
ATOM   8271 H HZ   . PHE A 1 35 ? 2.484   -4.204  2.587   1.00 0.00 ? 35 PHE A HZ   9 
ATOM   8272 N N    . CYS A 1 36 ? 6.027   -0.059  4.371   1.00 0.00 ? 36 CYS A N    9 
ATOM   8273 C CA   . CYS A 1 36 ? 5.443   -0.280  5.685   1.00 0.00 ? 36 CYS A CA   9 
ATOM   8274 C C    . CYS A 1 36 ? 5.535   1.001   6.508   1.00 0.00 ? 36 CYS A C    9 
ATOM   8275 O O    . CYS A 1 36 ? 4.663   1.296   7.324   1.00 0.00 ? 36 CYS A O    9 
ATOM   8276 C CB   . CYS A 1 36 ? 6.161   -1.423  6.406   1.00 0.00 ? 36 CYS A CB   9 
ATOM   8277 S SG   . CYS A 1 36 ? 5.144   -2.266  7.662   1.00 0.00 ? 36 CYS A SG   9 
ATOM   8278 H H    . CYS A 1 36 ? 6.924   -0.400  4.175   1.00 0.00 ? 36 CYS A H    9 
ATOM   8279 H HA   . CYS A 1 36 ? 4.403   -0.539  5.551   1.00 0.00 ? 36 CYS A HA   9 
ATOM   8280 H HB2  . CYS A 1 36 ? 6.464   -2.162  5.680   1.00 0.00 ? 36 CYS A HB2  9 
ATOM   8281 H HB3  . CYS A 1 36 ? 7.037   -1.031  6.901   1.00 0.00 ? 36 CYS A HB3  9 
ATOM   8282 N N    . GLN A 1 37 ? 6.605   1.763   6.276   1.00 0.00 ? 37 GLN A N    9 
ATOM   8283 C CA   . GLN A 1 37 ? 6.827   3.016   6.978   1.00 0.00 ? 37 GLN A CA   9 
ATOM   8284 C C    . GLN A 1 37 ? 5.716   4.013   6.675   1.00 0.00 ? 37 GLN A C    9 
ATOM   8285 O O    . GLN A 1 37 ? 5.353   4.834   7.518   1.00 0.00 ? 37 GLN A O    9 
ATOM   8286 C CB   . GLN A 1 37 ? 8.178   3.622   6.585   1.00 0.00 ? 37 GLN A CB   9 
ATOM   8287 C CG   . GLN A 1 37 ? 9.377   2.785   7.002   1.00 0.00 ? 37 GLN A CG   9 
ATOM   8288 C CD   . GLN A 1 37 ? 10.669  3.581   7.010   1.00 0.00 ? 37 GLN A CD   9 
ATOM   8289 O OE1  . GLN A 1 37 ? 11.261  3.810   8.065   1.00 0.00 ? 37 GLN A OE1  9 
ATOM   8290 N NE2  . GLN A 1 37 ? 11.114  4.012   5.832   1.00 0.00 ? 37 GLN A NE2  9 
ATOM   8291 H H    . GLN A 1 37 ? 7.259   1.473   5.615   1.00 0.00 ? 37 GLN A H    9 
ATOM   8292 H HA   . GLN A 1 37 ? 6.828   2.803   8.026   1.00 0.00 ? 37 GLN A HA   9 
ATOM   8293 H HB2  . GLN A 1 37 ? 8.207   3.741   5.513   1.00 0.00 ? 37 GLN A HB2  9 
ATOM   8294 H HB3  . GLN A 1 37 ? 8.269   4.594   7.047   1.00 0.00 ? 37 GLN A HB3  9 
ATOM   8295 H HG2  . GLN A 1 37 ? 9.203   2.400   7.995   1.00 0.00 ? 37 GLN A HG2  9 
ATOM   8296 H HG3  . GLN A 1 37 ? 9.483   1.961   6.312   1.00 0.00 ? 37 GLN A HG3  9 
ATOM   8297 H HE21 . GLN A 1 37 ? 10.594  3.796   5.030   1.00 0.00 ? 37 GLN A HE21 9 
ATOM   8298 H HE22 . GLN A 1 37 ? 11.946  4.529   5.814   1.00 0.00 ? 37 GLN A HE22 9 
ATOM   8299 N N    . TYR A 1 38 ? 5.187   3.936   5.462   1.00 0.00 ? 38 TYR A N    9 
ATOM   8300 C CA   . TYR A 1 38 ? 4.120   4.833   5.032   1.00 0.00 ? 38 TYR A CA   9 
ATOM   8301 C C    . TYR A 1 38 ? 2.893   4.710   5.932   1.00 0.00 ? 38 TYR A C    9 
ATOM   8302 O O    . TYR A 1 38 ? 2.050   5.607   5.971   1.00 0.00 ? 38 TYR A O    9 
ATOM   8303 C CB   . TYR A 1 38 ? 3.734   4.541   3.580   1.00 0.00 ? 38 TYR A CB   9 
ATOM   8304 C CG   . TYR A 1 38 ? 4.572   5.291   2.570   1.00 0.00 ? 38 TYR A CG   9 
ATOM   8305 C CD1  . TYR A 1 38 ? 4.394   6.655   2.367   1.00 0.00 ? 38 TYR A CD1  9 
ATOM   8306 C CD2  . TYR A 1 38 ? 5.540   4.638   1.819   1.00 0.00 ? 38 TYR A CD2  9 
ATOM   8307 C CE1  . TYR A 1 38 ? 5.158   7.344   1.445   1.00 0.00 ? 38 TYR A CE1  9 
ATOM   8308 C CE2  . TYR A 1 38 ? 6.308   5.320   0.895   1.00 0.00 ? 38 TYR A CE2  9 
ATOM   8309 C CZ   . TYR A 1 38 ? 6.114   6.673   0.712   1.00 0.00 ? 38 TYR A CZ   9 
ATOM   8310 O OH   . TYR A 1 38 ? 6.877   7.356   -0.207  1.00 0.00 ? 38 TYR A OH   9 
ATOM   8311 H H    . TYR A 1 38 ? 5.527   3.260   4.839   1.00 0.00 ? 38 TYR A H    9 
ATOM   8312 H HA   . TYR A 1 38 ? 4.495   5.843   5.095   1.00 0.00 ? 38 TYR A HA   9 
ATOM   8313 H HB2  . TYR A 1 38 ? 3.851   3.484   3.389   1.00 0.00 ? 38 TYR A HB2  9 
ATOM   8314 H HB3  . TYR A 1 38 ? 2.701   4.817   3.427   1.00 0.00 ? 38 TYR A HB3  9 
ATOM   8315 H HD1  . TYR A 1 38 ? 3.645   7.178   2.943   1.00 0.00 ? 38 TYR A HD1  9 
ATOM   8316 H HD2  . TYR A 1 38 ? 5.690   3.578   1.964   1.00 0.00 ? 38 TYR A HD2  9 
ATOM   8317 H HE1  . TYR A 1 38 ? 5.006   8.404   1.302   1.00 0.00 ? 38 TYR A HE1  9 
ATOM   8318 H HE2  . TYR A 1 38 ? 7.057   4.794   0.321   1.00 0.00 ? 38 TYR A HE2  9 
ATOM   8319 H HH   . TYR A 1 38 ? 7.797   7.343   0.067   1.00 0.00 ? 38 TYR A HH   9 
ATOM   8320 N N    . ALA A 1 39 ? 2.794   3.596   6.654   1.00 0.00 ? 39 ALA A N    9 
ATOM   8321 C CA   . ALA A 1 39 ? 1.668   3.360   7.550   1.00 0.00 ? 39 ALA A CA   9 
ATOM   8322 C C    . ALA A 1 39 ? 1.442   4.537   8.493   1.00 0.00 ? 39 ALA A C    9 
ATOM   8323 O O    . ALA A 1 39 ? 0.332   4.749   8.982   1.00 0.00 ? 39 ALA A O    9 
ATOM   8324 C CB   . ALA A 1 39 ? 1.887   2.083   8.345   1.00 0.00 ? 39 ALA A CB   9 
ATOM   8325 H H    . ALA A 1 39 ? 3.491   2.915   6.581   1.00 0.00 ? 39 ALA A H    9 
ATOM   8326 H HA   . ALA A 1 39 ? 0.792   3.229   6.942   1.00 0.00 ? 39 ALA A HA   9 
ATOM   8327 H HB1  . ALA A 1 39 ? 1.231   2.077   9.202   1.00 0.00 ? 39 ALA A HB1  9 
ATOM   8328 H HB2  . ALA A 1 39 ? 2.914   2.037   8.676   1.00 0.00 ? 39 ALA A HB2  9 
ATOM   8329 H HB3  . ALA A 1 39 ? 1.671   1.229   7.720   1.00 0.00 ? 39 ALA A HB3  9 
ATOM   8330 N N    . LYS A 1 40 ? 2.499   5.298   8.745   1.00 0.00 ? 40 LYS A N    9 
ATOM   8331 C CA   . LYS A 1 40 ? 2.418   6.454   9.632   1.00 0.00 ? 40 LYS A CA   9 
ATOM   8332 C C    . LYS A 1 40 ? 2.539   7.757   8.848   1.00 0.00 ? 40 LYS A C    9 
ATOM   8333 O O    . LYS A 1 40 ? 2.101   8.812   9.307   1.00 0.00 ? 40 LYS A O    9 
ATOM   8334 C CB   . LYS A 1 40 ? 3.511   6.380   10.701  1.00 0.00 ? 40 LYS A CB   9 
ATOM   8335 C CG   . LYS A 1 40 ? 2.997   5.960   12.069  1.00 0.00 ? 40 LYS A CG   9 
ATOM   8336 C CD   . LYS A 1 40 ? 2.572   4.501   12.080  1.00 0.00 ? 40 LYS A CD   9 
ATOM   8337 C CE   . LYS A 1 40 ? 3.758   3.575   12.297  1.00 0.00 ? 40 LYS A CE   9 
ATOM   8338 N NZ   . LYS A 1 40 ? 3.454   2.505   13.287  1.00 0.00 ? 40 LYS A NZ   9 
ATOM   8339 H H    . LYS A 1 40 ? 3.355   5.076   8.326   1.00 0.00 ? 40 LYS A H    9 
ATOM   8340 H HA   . LYS A 1 40 ? 1.455   6.430   10.115  1.00 0.00 ? 40 LYS A HA   9 
ATOM   8341 H HB2  . LYS A 1 40 ? 4.258   5.666   10.387  1.00 0.00 ? 40 LYS A HB2  9 
ATOM   8342 H HB3  . LYS A 1 40 ? 3.973   7.352   10.797  1.00 0.00 ? 40 LYS A HB3  9 
ATOM   8343 H HG2  . LYS A 1 40 ? 3.782   6.101   12.796  1.00 0.00 ? 40 LYS A HG2  9 
ATOM   8344 H HG3  . LYS A 1 40 ? 2.148   6.576   12.328  1.00 0.00 ? 40 LYS A HG3  9 
ATOM   8345 H HD2  . LYS A 1 40 ? 1.860   4.349   12.878  1.00 0.00 ? 40 LYS A HD2  9 
ATOM   8346 H HD3  . LYS A 1 40 ? 2.109   4.263   11.133  1.00 0.00 ? 40 LYS A HD3  9 
ATOM   8347 H HE2  . LYS A 1 40 ? 4.017   3.116   11.354  1.00 0.00 ? 40 LYS A HE2  9 
ATOM   8348 H HE3  . LYS A 1 40 ? 4.594   4.158   12.654  1.00 0.00 ? 40 LYS A HE3  9 
ATOM   8349 H HZ1  . LYS A 1 40 ? 4.304   2.280   13.843  1.00 0.00 ? 40 LYS A HZ1  9 
ATOM   8350 H HZ2  . LYS A 1 40 ? 3.136   1.644   12.798  1.00 0.00 ? 40 LYS A HZ2  9 
ATOM   8351 H HZ3  . LYS A 1 40 ? 2.703   2.820   13.934  1.00 0.00 ? 40 LYS A HZ3  9 
ATOM   8352 N N    . ASP A 1 41 ? 3.134   7.676   7.664   1.00 0.00 ? 41 ASP A N    9 
ATOM   8353 C CA   . ASP A 1 41 ? 3.312   8.848   6.815   1.00 0.00 ? 41 ASP A CA   9 
ATOM   8354 C C    . ASP A 1 41 ? 1.962   9.474   6.464   1.00 0.00 ? 41 ASP A C    9 
ATOM   8355 O O    . ASP A 1 41 ? 1.147   8.859   5.775   1.00 0.00 ? 41 ASP A O    9 
ATOM   8356 C CB   . ASP A 1 41 ? 4.057   8.461   5.536   1.00 0.00 ? 41 ASP A CB   9 
ATOM   8357 C CG   . ASP A 1 41 ? 4.512   9.670   4.741   1.00 0.00 ? 41 ASP A CG   9 
ATOM   8358 O OD1  . ASP A 1 41 ? 4.302   10.807  5.215   1.00 0.00 ? 41 ASP A OD1  9 
ATOM   8359 O OD2  . ASP A 1 41 ? 5.079   9.479   3.645   1.00 0.00 ? 41 ASP A OD2  9 
ATOM   8360 H H    . ASP A 1 41 ? 3.460   6.808   7.353   1.00 0.00 ? 41 ASP A H    9 
ATOM   8361 H HA   . ASP A 1 41 ? 3.903   9.566   7.361   1.00 0.00 ? 41 ASP A HA   9 
ATOM   8362 H HB2  . ASP A 1 41 ? 4.930   7.878   5.798   1.00 0.00 ? 41 ASP A HB2  9 
ATOM   8363 H HB3  . ASP A 1 41 ? 3.403   7.866   4.912   1.00 0.00 ? 41 ASP A HB3  9 
ATOM   8364 N N    . PRO A 1 42 ? 1.700   10.708  6.938   1.00 0.00 ? 42 PRO A N    9 
ATOM   8365 C CA   . PRO A 1 42 ? 0.438   11.403  6.672   1.00 0.00 ? 42 PRO A CA   9 
ATOM   8366 C C    . PRO A 1 42 ? 0.386   12.040  5.283   1.00 0.00 ? 42 PRO A C    9 
ATOM   8367 O O    . PRO A 1 42 ? -0.587  12.711  4.940   1.00 0.00 ? 42 PRO A O    9 
ATOM   8368 C CB   . PRO A 1 42 ? 0.411   12.481  7.752   1.00 0.00 ? 42 PRO A CB   9 
ATOM   8369 C CG   . PRO A 1 42 ? 1.846   12.800  7.997   1.00 0.00 ? 42 PRO A CG   9 
ATOM   8370 C CD   . PRO A 1 42 ? 2.607   11.518  7.776   1.00 0.00 ? 42 PRO A CD   9 
ATOM   8371 H HA   . PRO A 1 42 ? -0.409  10.745  6.796   1.00 0.00 ? 42 PRO A HA   9 
ATOM   8372 H HB2  . PRO A 1 42 ? -0.131  13.343  7.391   1.00 0.00 ? 42 PRO A HB2  9 
ATOM   8373 H HB3  . PRO A 1 42 ? -0.064  12.094  8.641   1.00 0.00 ? 42 PRO A HB3  9 
ATOM   8374 H HG2  . PRO A 1 42 ? 2.177   13.556  7.300   1.00 0.00 ? 42 PRO A HG2  9 
ATOM   8375 H HG3  . PRO A 1 42 ? 1.976   13.142  9.012   1.00 0.00 ? 42 PRO A HG3  9 
ATOM   8376 H HD2  . PRO A 1 42 ? 3.535   11.715  7.259   1.00 0.00 ? 42 PRO A HD2  9 
ATOM   8377 H HD3  . PRO A 1 42 ? 2.799   11.027  8.719   1.00 0.00 ? 42 PRO A HD3  9 
ATOM   8378 N N    . THR A 1 43 ? 1.433   11.831  4.486   1.00 0.00 ? 43 THR A N    9 
ATOM   8379 C CA   . THR A 1 43 ? 1.491   12.393  3.138   1.00 0.00 ? 43 THR A CA   9 
ATOM   8380 C C    . THR A 1 43 ? 0.224   12.066  2.352   1.00 0.00 ? 43 THR A C    9 
ATOM   8381 O O    . THR A 1 43 ? -0.307  12.911  1.632   1.00 0.00 ? 43 THR A O    9 
ATOM   8382 C CB   . THR A 1 43 ? 2.717   11.866  2.391   1.00 0.00 ? 43 THR A CB   9 
ATOM   8383 O OG1  . THR A 1 43 ? 2.742   10.449  2.399   1.00 0.00 ? 43 THR A OG1  9 
ATOM   8384 C CG2  . THR A 1 43 ? 4.026   12.354  2.970   1.00 0.00 ? 43 THR A CG2  9 
ATOM   8385 H H    . THR A 1 43 ? 2.183   11.291  4.810   1.00 0.00 ? 43 THR A H    9 
ATOM   8386 H HA   . THR A 1 43 ? 1.573   13.466  3.232   1.00 0.00 ? 43 THR A HA   9 
ATOM   8387 H HB   . THR A 1 43 ? 2.667   12.197  1.363   1.00 0.00 ? 43 THR A HB   9 
ATOM   8388 H HG1  . THR A 1 43 ? 2.539   10.129  3.280   1.00 0.00 ? 43 THR A HG1  9 
ATOM   8389 H HG21 . THR A 1 43 ? 3.880   12.637  4.002   1.00 0.00 ? 43 THR A HG21 9 
ATOM   8390 H HG22 . THR A 1 43 ? 4.372   13.208  2.408   1.00 0.00 ? 43 THR A HG22 9 
ATOM   8391 H HG23 . THR A 1 43 ? 4.761   11.565  2.915   1.00 0.00 ? 43 THR A HG23 9 
ATOM   8392 N N    . TYR A 1 44 ? -0.256  10.836  2.498   1.00 0.00 ? 44 TYR A N    9 
ATOM   8393 C CA   . TYR A 1 44 ? -1.461  10.398  1.804   1.00 0.00 ? 44 TYR A CA   9 
ATOM   8394 C C    . TYR A 1 44 ? -2.639  10.310  2.769   1.00 0.00 ? 44 TYR A C    9 
ATOM   8395 O O    . TYR A 1 44 ? -3.634  11.019  2.617   1.00 0.00 ? 44 TYR A O    9 
ATOM   8396 C CB   . TYR A 1 44 ? -1.227  9.041   1.138   1.00 0.00 ? 44 TYR A CB   9 
ATOM   8397 C CG   . TYR A 1 44 ? -0.037  9.021   0.205   1.00 0.00 ? 44 TYR A CG   9 
ATOM   8398 C CD1  . TYR A 1 44 ? 1.249   8.821   0.693   1.00 0.00 ? 44 TYR A CD1  9 
ATOM   8399 C CD2  . TYR A 1 44 ? -0.198  9.203   -1.163  1.00 0.00 ? 44 TYR A CD2  9 
ATOM   8400 C CE1  . TYR A 1 44 ? 2.339   8.803   -0.156  1.00 0.00 ? 44 TYR A CE1  9 
ATOM   8401 C CE2  . TYR A 1 44 ? 0.887   9.186   -2.018  1.00 0.00 ? 44 TYR A CE2  9 
ATOM   8402 C CZ   . TYR A 1 44 ? 2.153   8.986   -1.509  1.00 0.00 ? 44 TYR A CZ   9 
ATOM   8403 O OH   . TYR A 1 44 ? 3.237   8.969   -2.358  1.00 0.00 ? 44 TYR A OH   9 
ATOM   8404 H H    . TYR A 1 44 ? 0.211   10.207  3.088   1.00 0.00 ? 44 TYR A H    9 
ATOM   8405 H HA   . TYR A 1 44 ? -1.689  11.129  1.042   1.00 0.00 ? 44 TYR A HA   9 
ATOM   8406 H HB2  . TYR A 1 44 ? -1.061  8.297   1.902   1.00 0.00 ? 44 TYR A HB2  9 
ATOM   8407 H HB3  . TYR A 1 44 ? -2.103  8.773   0.565   1.00 0.00 ? 44 TYR A HB3  9 
ATOM   8408 H HD1  . TYR A 1 44 ? 1.391   8.678   1.754   1.00 0.00 ? 44 TYR A HD1  9 
ATOM   8409 H HD2  . TYR A 1 44 ? -1.191  9.360   -1.558  1.00 0.00 ? 44 TYR A HD2  9 
ATOM   8410 H HE1  . TYR A 1 44 ? 3.331   8.646   0.243   1.00 0.00 ? 44 TYR A HE1  9 
ATOM   8411 H HE2  . TYR A 1 44 ? 0.741   9.330   -3.078  1.00 0.00 ? 44 TYR A HE2  9 
ATOM   8412 H HH   . TYR A 1 44 ? 3.592   8.078   -2.405  1.00 0.00 ? 44 TYR A HH   9 
ATOM   8413 N N    . GLY A 1 45 ? -2.517  9.438   3.764   1.00 0.00 ? 45 GLY A N    9 
ATOM   8414 C CA   . GLY A 1 45 ? -3.577  9.275   4.742   1.00 0.00 ? 45 GLY A CA   9 
ATOM   8415 C C    . GLY A 1 45 ? -4.715  8.413   4.231   1.00 0.00 ? 45 GLY A C    9 
ATOM   8416 O O    . GLY A 1 45 ? -5.029  7.377   4.816   1.00 0.00 ? 45 GLY A O    9 
ATOM   8417 H H    . GLY A 1 45 ? -1.701  8.902   3.836   1.00 0.00 ? 45 GLY A H    9 
ATOM   8418 H HA2  . GLY A 1 45 ? -3.165  8.818   5.630   1.00 0.00 ? 45 GLY A HA2  9 
ATOM   8419 H HA3  . GLY A 1 45 ? -3.966  10.249  5.000   1.00 0.00 ? 45 GLY A HA3  9 
ATOM   8420 N N    . GLN A 1 46 ? -5.335  8.844   3.138   1.00 0.00 ? 46 GLN A N    9 
ATOM   8421 C CA   . GLN A 1 46 ? -6.445  8.109   2.548   1.00 0.00 ? 46 GLN A CA   9 
ATOM   8422 C C    . GLN A 1 46 ? -5.965  6.811   1.903   1.00 0.00 ? 46 GLN A C    9 
ATOM   8423 O O    . GLN A 1 46 ? -6.751  5.889   1.685   1.00 0.00 ? 46 GLN A O    9 
ATOM   8424 C CB   . GLN A 1 46 ? -7.160  8.974   1.508   1.00 0.00 ? 46 GLN A CB   9 
ATOM   8425 C CG   . GLN A 1 46 ? -8.586  8.531   1.224   1.00 0.00 ? 46 GLN A CG   9 
ATOM   8426 C CD   . GLN A 1 46 ? -9.520  9.698   0.972   1.00 0.00 ? 46 GLN A CD   9 
ATOM   8427 O OE1  . GLN A 1 46 ? -9.530  10.673  1.724   1.00 0.00 ? 46 GLN A OE1  9 
ATOM   8428 N NE2  . GLN A 1 46 ? -10.310 9.605   -0.090  1.00 0.00 ? 46 GLN A NE2  9 
ATOM   8429 H H    . GLN A 1 46 ? -5.040  9.676   2.718   1.00 0.00 ? 46 GLN A H    9 
ATOM   8430 H HA   . GLN A 1 46 ? -7.136  7.870   3.339   1.00 0.00 ? 46 GLN A HA   9 
ATOM   8431 H HB2  . GLN A 1 46 ? -7.186  9.994   1.862   1.00 0.00 ? 46 GLN A HB2  9 
ATOM   8432 H HB3  . GLN A 1 46 ? -6.604  8.937   0.583   1.00 0.00 ? 46 GLN A HB3  9 
ATOM   8433 H HG2  . GLN A 1 46 ? -8.585  7.896   0.351   1.00 0.00 ? 46 GLN A HG2  9 
ATOM   8434 H HG3  . GLN A 1 46 ? -8.952  7.973   2.074   1.00 0.00 ? 46 GLN A HG3  9 
ATOM   8435 H HE21 . GLN A 1 46 ? -10.247 8.795   -0.646  1.00 0.00 ? 46 GLN A HE21 9 
ATOM   8436 H HE22 . GLN A 1 46 ? -10.926 10.350  -0.277  1.00 0.00 ? 46 GLN A HE22 9 
ATOM   8437 N N    . TYR A 1 47 ? -4.673  6.746   1.593   1.00 0.00 ? 47 TYR A N    9 
ATOM   8438 C CA   . TYR A 1 47 ? -4.098  5.563   0.967   1.00 0.00 ? 47 TYR A CA   9 
ATOM   8439 C C    . TYR A 1 47 ? -3.947  4.432   1.979   1.00 0.00 ? 47 TYR A C    9 
ATOM   8440 O O    . TYR A 1 47 ? -4.360  3.300   1.729   1.00 0.00 ? 47 TYR A O    9 
ATOM   8441 C CB   . TYR A 1 47 ? -2.742  5.892   0.363   1.00 0.00 ? 47 TYR A CB   9 
ATOM   8442 C CG   . TYR A 1 47 ? -2.346  5.000   -0.791  1.00 0.00 ? 47 TYR A CG   9 
ATOM   8443 C CD1  . TYR A 1 47 ? -1.728  3.776   -0.570  1.00 0.00 ? 47 TYR A CD1  9 
ATOM   8444 C CD2  . TYR A 1 47 ? -2.582  5.389   -2.102  1.00 0.00 ? 47 TYR A CD2  9 
ATOM   8445 C CE1  . TYR A 1 47 ? -1.356  2.964   -1.625  1.00 0.00 ? 47 TYR A CE1  9 
ATOM   8446 C CE2  . TYR A 1 47 ? -2.216  4.583   -3.162  1.00 0.00 ? 47 TYR A CE2  9 
ATOM   8447 C CZ   . TYR A 1 47 ? -1.603  3.372   -2.919  1.00 0.00 ? 47 TYR A CZ   9 
ATOM   8448 O OH   . TYR A 1 47 ? -1.235  2.567   -3.973  1.00 0.00 ? 47 TYR A OH   9 
ATOM   8449 H H    . TYR A 1 47 ? -4.095  7.513   1.785   1.00 0.00 ? 47 TYR A H    9 
ATOM   8450 H HA   . TYR A 1 47 ? -4.754  5.247   0.187   1.00 0.00 ? 47 TYR A HA   9 
ATOM   8451 H HB2  . TYR A 1 47 ? -2.745  6.914   0.009   1.00 0.00 ? 47 TYR A HB2  9 
ATOM   8452 H HB3  . TYR A 1 47 ? -2.001  5.779   1.128   1.00 0.00 ? 47 TYR A HB3  9 
ATOM   8453 H HD1  . TYR A 1 47 ? -1.537  3.459   0.445   1.00 0.00 ? 47 TYR A HD1  9 
ATOM   8454 H HD2  . TYR A 1 47 ? -3.062  6.339   -2.289  1.00 0.00 ? 47 TYR A HD2  9 
ATOM   8455 H HE1  . TYR A 1 47 ? -0.877  2.015   -1.434  1.00 0.00 ? 47 TYR A HE1  9 
ATOM   8456 H HE2  . TYR A 1 47 ? -2.409  4.903   -4.175  1.00 0.00 ? 47 TYR A HE2  9 
ATOM   8457 H HH   . TYR A 1 47 ? -0.353  2.221   -3.818  1.00 0.00 ? 47 TYR A HH   9 
ATOM   8458 N N    . ILE A 1 48 ? -3.346  4.750   3.122   1.00 0.00 ? 48 ILE A N    9 
ATOM   8459 C CA   . ILE A 1 48 ? -3.131  3.766   4.174   1.00 0.00 ? 48 ILE A CA   9 
ATOM   8460 C C    . ILE A 1 48 ? -4.450  3.334   4.805   1.00 0.00 ? 48 ILE A C    9 
ATOM   8461 O O    . ILE A 1 48 ? -4.747  2.142   4.887   1.00 0.00 ? 48 ILE A O    9 
ATOM   8462 C CB   . ILE A 1 48 ? -2.197  4.314   5.272   1.00 0.00 ? 48 ILE A CB   9 
ATOM   8463 C CG1  . ILE A 1 48 ? -0.873  4.774   4.659   1.00 0.00 ? 48 ILE A CG1  9 
ATOM   8464 C CG2  . ILE A 1 48 ? -1.952  3.259   6.343   1.00 0.00 ? 48 ILE A CG2  9 
ATOM   8465 C CD1  . ILE A 1 48 ? -0.045  3.643   4.089   1.00 0.00 ? 48 ILE A CD1  9 
ATOM   8466 H H    . ILE A 1 48 ? -3.036  5.667   3.258   1.00 0.00 ? 48 ILE A H    9 
ATOM   8467 H HA   . ILE A 1 48 ? -2.660  2.905   3.728   1.00 0.00 ? 48 ILE A HA   9 
ATOM   8468 H HB   . ILE A 1 48 ? -2.682  5.158   5.738   1.00 0.00 ? 48 ILE A HB   9 
ATOM   8469 H HG12 . ILE A 1 48 ? -1.077  5.470   3.859   1.00 0.00 ? 48 ILE A HG12 9 
ATOM   8470 H HG13 . ILE A 1 48 ? -0.285  5.268   5.418   1.00 0.00 ? 48 ILE A HG13 9 
ATOM   8471 H HG21 . ILE A 1 48 ? -1.442  2.413   5.906   1.00 0.00 ? 48 ILE A HG21 9 
ATOM   8472 H HG22 . ILE A 1 48 ? -2.897  2.937   6.755   1.00 0.00 ? 48 ILE A HG22 9 
ATOM   8473 H HG23 . ILE A 1 48 ? -1.341  3.680   7.129   1.00 0.00 ? 48 ILE A HG23 9 
ATOM   8474 H HD11 . ILE A 1 48 ? -0.526  3.255   3.203   1.00 0.00 ? 48 ILE A HD11 9 
ATOM   8475 H HD12 . ILE A 1 48 ? 0.043   2.856   4.824   1.00 0.00 ? 48 ILE A HD12 9 
ATOM   8476 H HD13 . ILE A 1 48 ? 0.938   4.009   3.834   1.00 0.00 ? 48 ILE A HD13 9 
ATOM   8477 N N    . ARG A 1 49 ? -5.240  4.305   5.254   1.00 0.00 ? 49 ARG A N    9 
ATOM   8478 C CA   . ARG A 1 49 ? -6.526  4.013   5.880   1.00 0.00 ? 49 ARG A CA   9 
ATOM   8479 C C    . ARG A 1 49 ? -7.613  3.744   4.843   1.00 0.00 ? 49 ARG A C    9 
ATOM   8480 O O    . ARG A 1 49 ? -8.790  4.015   5.079   1.00 0.00 ? 49 ARG A O    9 
ATOM   8481 C CB   . ARG A 1 49 ? -6.949  5.162   6.796   1.00 0.00 ? 49 ARG A CB   9 
ATOM   8482 C CG   . ARG A 1 49 ? -5.826  5.685   7.677   1.00 0.00 ? 49 ARG A CG   9 
ATOM   8483 C CD   . ARG A 1 49 ? -6.348  6.651   8.728   1.00 0.00 ? 49 ARG A CD   9 
ATOM   8484 N NE   . ARG A 1 49 ? -5.266  7.261   9.498   1.00 0.00 ? 49 ARG A NE   9 
ATOM   8485 C CZ   . ARG A 1 49 ? -5.448  7.907   10.648  1.00 0.00 ? 49 ARG A CZ   9 
ATOM   8486 N NH1  . ARG A 1 49 ? -6.666  8.030   11.161  1.00 0.00 ? 49 ARG A NH1  9 
ATOM   8487 N NH2  . ARG A 1 49 ? -4.410  8.432   11.286  1.00 0.00 ? 49 ARG A NH2  9 
ATOM   8488 H H    . ARG A 1 49 ? -4.952  5.238   5.164   1.00 0.00 ? 49 ARG A H    9 
ATOM   8489 H HA   . ARG A 1 49 ? -6.399  3.123   6.470   1.00 0.00 ? 49 ARG A HA   9 
ATOM   8490 H HB2  . ARG A 1 49 ? -7.309  5.978   6.187   1.00 0.00 ? 49 ARG A HB2  9 
ATOM   8491 H HB3  . ARG A 1 49 ? -7.750  4.821   7.435   1.00 0.00 ? 49 ARG A HB3  9 
ATOM   8492 H HG2  . ARG A 1 49 ? -5.352  4.851   8.173   1.00 0.00 ? 49 ARG A HG2  9 
ATOM   8493 H HG3  . ARG A 1 49 ? -5.104  6.196   7.057   1.00 0.00 ? 49 ARG A HG3  9 
ATOM   8494 H HD2  . ARG A 1 49 ? -6.909  7.430   8.235   1.00 0.00 ? 49 ARG A HD2  9 
ATOM   8495 H HD3  . ARG A 1 49 ? -6.998  6.112   9.402   1.00 0.00 ? 49 ARG A HD3  9 
ATOM   8496 H HE   . ARG A 1 49 ? -4.357  7.184   9.141   1.00 0.00 ? 49 ARG A HE   9 
ATOM   8497 H HH11 . ARG A 1 49 ? -7.452  7.636   10.685  1.00 0.00 ? 49 ARG A HH11 9 
ATOM   8498 H HH12 . ARG A 1 49 ? -6.797  8.516   12.025  1.00 0.00 ? 49 ARG A HH12 9 
ATOM   8499 H HH21 . ARG A 1 49 ? -3.491  8.342   10.903  1.00 0.00 ? 49 ARG A HH21 9 
ATOM   8500 H HH22 . ARG A 1 49 ? -4.548  8.918   12.149  1.00 0.00 ? 49 ARG A HH22 9 
ATOM   8501 N N    . SER A 1 50 ? -7.213  3.201   3.703   1.00 0.00 ? 50 SER A N    9 
ATOM   8502 C CA   . SER A 1 50 ? -8.149  2.882   2.637   1.00 0.00 ? 50 SER A CA   9 
ATOM   8503 C C    . SER A 1 50 ? -8.856  1.558   2.916   1.00 0.00 ? 50 SER A C    9 
ATOM   8504 O O    . SER A 1 50 ? -8.277  0.653   3.515   1.00 0.00 ? 50 SER A O    9 
ATOM   8505 C CB   . SER A 1 50 ? -7.419  2.817   1.306   1.00 0.00 ? 50 SER A CB   9 
ATOM   8506 O OG   . SER A 1 50 ? -8.257  3.225   0.239   1.00 0.00 ? 50 SER A OG   9 
ATOM   8507 H H    . SER A 1 50 ? -6.268  2.997   3.580   1.00 0.00 ? 50 SER A H    9 
ATOM   8508 H HA   . SER A 1 50 ? -8.880  3.663   2.589   1.00 0.00 ? 50 SER A HA   9 
ATOM   8509 H HB2  . SER A 1 50 ? -6.553  3.464   1.337   1.00 0.00 ? 50 SER A HB2  9 
ATOM   8510 H HB3  . SER A 1 50 ? -7.109  1.806   1.137   1.00 0.00 ? 50 SER A HB3  9 
ATOM   8511 H HG   . SER A 1 50 ? -8.360  4.179   0.259   1.00 0.00 ? 50 SER A HG   9 
ATOM   8512 N N    . PRO A 1 51 ? -10.121 1.424   2.484   1.00 0.00 ? 51 PRO A N    9 
ATOM   8513 C CA   . PRO A 1 51 ? -10.897 0.198   2.695   1.00 0.00 ? 51 PRO A CA   9 
ATOM   8514 C C    . PRO A 1 51 ? -10.402 -0.956  1.829   1.00 0.00 ? 51 PRO A C    9 
ATOM   8515 O O    . PRO A 1 51 ? -10.306 -2.094  2.288   1.00 0.00 ? 51 PRO A O    9 
ATOM   8516 C CB   . PRO A 1 51 ? -12.315 0.601   2.287   1.00 0.00 ? 51 PRO A CB   9 
ATOM   8517 C CG   . PRO A 1 51 ? -12.126 1.713   1.313   1.00 0.00 ? 51 PRO A CG   9 
ATOM   8518 C CD   . PRO A 1 51 ? -10.894 2.451   1.759   1.00 0.00 ? 51 PRO A CD   9 
ATOM   8519 H HA   . PRO A 1 51 ? -10.888 -0.102  3.732   1.00 0.00 ? 51 PRO A HA   9 
ATOM   8520 H HB2  . PRO A 1 51 ? -12.816 -0.242  1.834   1.00 0.00 ? 51 PRO A HB2  9 
ATOM   8521 H HB3  . PRO A 1 51 ? -12.864 0.929   3.157   1.00 0.00 ? 51 PRO A HB3  9 
ATOM   8522 H HG2  . PRO A 1 51 ? -11.985 1.310   0.321   1.00 0.00 ? 51 PRO A HG2  9 
ATOM   8523 H HG3  . PRO A 1 51 ? -12.984 2.369   1.334   1.00 0.00 ? 51 PRO A HG3  9 
ATOM   8524 H HD2  . PRO A 1 51 ? -10.343 2.816   0.905   1.00 0.00 ? 51 PRO A HD2  9 
ATOM   8525 H HD3  . PRO A 1 51 ? -11.159 3.267   2.415   1.00 0.00 ? 51 PRO A HD3  9 
ATOM   8526 N N    . HIS A 1 52 ? -10.092 -0.653  0.573   1.00 0.00 ? 52 HIS A N    9 
ATOM   8527 C CA   . HIS A 1 52 ? -9.610  -1.664  -0.363  1.00 0.00 ? 52 HIS A CA   9 
ATOM   8528 C C    . HIS A 1 52 ? -8.125  -1.951  -0.156  1.00 0.00 ? 52 HIS A C    9 
ATOM   8529 O O    . HIS A 1 52 ? -7.618  -2.984  -0.593  1.00 0.00 ? 52 HIS A O    9 
ATOM   8530 C CB   . HIS A 1 52 ? -9.853  -1.215  -1.808  1.00 0.00 ? 52 HIS A CB   9 
ATOM   8531 C CG   . HIS A 1 52 ? -11.094 -0.396  -1.987  1.00 0.00 ? 52 HIS A CG   9 
ATOM   8532 N ND1  . HIS A 1 52 ? -12.358 -0.945  -2.043  1.00 0.00 ? 52 HIS A ND1  9 
ATOM   8533 C CD2  . HIS A 1 52 ? -11.262 0.942   -2.120  1.00 0.00 ? 52 HIS A CD2  9 
ATOM   8534 C CE1  . HIS A 1 52 ? -13.248 0.019   -2.204  1.00 0.00 ? 52 HIS A CE1  9 
ATOM   8535 N NE2  . HIS A 1 52 ? -12.609 1.172   -2.253  1.00 0.00 ? 52 HIS A NE2  9 
ATOM   8536 H H    . HIS A 1 52 ? -10.193 0.273   0.267   1.00 0.00 ? 52 HIS A H    9 
ATOM   8537 H HA   . HIS A 1 52 ? -10.165 -2.570  -0.182  1.00 0.00 ? 52 HIS A HA   9 
ATOM   8538 H HB2  . HIS A 1 52 ? -9.014  -0.621  -2.138  1.00 0.00 ? 52 HIS A HB2  9 
ATOM   8539 H HB3  . HIS A 1 52 ? -9.937  -2.089  -2.438  1.00 0.00 ? 52 HIS A HB3  9 
ATOM   8540 H HD1  . HIS A 1 52 ? -12.571 -1.899  -1.976  1.00 0.00 ? 52 HIS A HD1  9 
ATOM   8541 H HD2  . HIS A 1 52 ? -10.480 1.689   -2.122  1.00 0.00 ? 52 HIS A HD2  9 
ATOM   8542 H HE1  . HIS A 1 52 ? -14.317 -0.115  -2.279  1.00 0.00 ? 52 HIS A HE1  9 
ATOM   8543 H HE2  . HIS A 1 52 ? -13.022 2.040   -2.440  1.00 0.00 ? 52 HIS A HE2  9 
ATOM   8544 N N    . ALA A 1 53 ? -7.430  -1.032  0.505   1.00 0.00 ? 53 ALA A N    9 
ATOM   8545 C CA   . ALA A 1 53 ? -6.007  -1.188  0.759   1.00 0.00 ? 53 ALA A CA   9 
ATOM   8546 C C    . ALA A 1 53 ? -5.724  -2.450  1.554   1.00 0.00 ? 53 ALA A C    9 
ATOM   8547 O O    . ALA A 1 53 ? -4.938  -3.302  1.140   1.00 0.00 ? 53 ALA A O    9 
ATOM   8548 C CB   . ALA A 1 53 ? -5.461  0.030   1.488   1.00 0.00 ? 53 ALA A CB   9 
ATOM   8549 H H    . ALA A 1 53 ? -7.881  -0.230  0.825   1.00 0.00 ? 53 ALA A H    9 
ATOM   8550 H HA   . ALA A 1 53 ? -5.516  -1.258  -0.187  1.00 0.00 ? 53 ALA A HA   9 
ATOM   8551 H HB1  . ALA A 1 53 ? -4.488  -0.201  1.895   1.00 0.00 ? 53 ALA A HB1  9 
ATOM   8552 H HB2  . ALA A 1 53 ? -6.132  0.300   2.291   1.00 0.00 ? 53 ALA A HB2  9 
ATOM   8553 H HB3  . ALA A 1 53 ? -5.376  0.855   0.797   1.00 0.00 ? 53 ALA A HB3  9 
ATOM   8554 N N    . ARG A 1 54 ? -6.369  -2.554  2.701   1.00 0.00 ? 54 ARG A N    9 
ATOM   8555 C CA   . ARG A 1 54 ? -6.199  -3.702  3.577   1.00 0.00 ? 54 ARG A CA   9 
ATOM   8556 C C    . ARG A 1 54 ? -6.535  -4.998  2.854   1.00 0.00 ? 54 ARG A C    9 
ATOM   8557 O O    . ARG A 1 54 ? -5.928  -6.039  3.105   1.00 0.00 ? 54 ARG A O    9 
ATOM   8558 C CB   . ARG A 1 54 ? -7.070  -3.554  4.825   1.00 0.00 ? 54 ARG A CB   9 
ATOM   8559 C CG   . ARG A 1 54 ? -6.308  -3.747  6.126   1.00 0.00 ? 54 ARG A CG   9 
ATOM   8560 C CD   . ARG A 1 54 ? -7.014  -3.070  7.289   1.00 0.00 ? 54 ARG A CD   9 
ATOM   8561 N NE   . ARG A 1 54 ? -8.458  -3.288  7.253   1.00 0.00 ? 54 ARG A NE   9 
ATOM   8562 C CZ   . ARG A 1 54 ? -9.063  -4.350  7.783   1.00 0.00 ? 54 ARG A CZ   9 
ATOM   8563 N NH1  . ARG A 1 54 ? -8.355  -5.299  8.384   1.00 0.00 ? 54 ARG A NH1  9 
ATOM   8564 N NH2  . ARG A 1 54 ? -10.382 -4.465  7.708   1.00 0.00 ? 54 ARG A NH2  9 
ATOM   8565 H H    . ARG A 1 54 ? -6.972  -1.837  2.965   1.00 0.00 ? 54 ARG A H    9 
ATOM   8566 H HA   . ARG A 1 54 ? -5.169  -3.730  3.871   1.00 0.00 ? 54 ARG A HA   9 
ATOM   8567 H HB2  . ARG A 1 54 ? -7.505  -2.565  4.831   1.00 0.00 ? 54 ARG A HB2  9 
ATOM   8568 H HB3  . ARG A 1 54 ? -7.864  -4.286  4.787   1.00 0.00 ? 54 ARG A HB3  9 
ATOM   8569 H HG2  . ARG A 1 54 ? -6.228  -4.804  6.332   1.00 0.00 ? 54 ARG A HG2  9 
ATOM   8570 H HG3  . ARG A 1 54 ? -5.320  -3.323  6.019   1.00 0.00 ? 54 ARG A HG3  9 
ATOM   8571 H HD2  . ARG A 1 54 ? -6.621  -3.465  8.213   1.00 0.00 ? 54 ARG A HD2  9 
ATOM   8572 H HD3  . ARG A 1 54 ? -6.819  -2.008  7.242   1.00 0.00 ? 54 ARG A HD3  9 
ATOM   8573 H HE   . ARG A 1 54 ? -9.006  -2.607  6.810   1.00 0.00 ? 54 ARG A HE   9 
ATOM   8574 H HH11 . ARG A 1 54 ? -7.360  -5.222  8.441   1.00 0.00 ? 54 ARG A HH11 9 
ATOM   8575 H HH12 . ARG A 1 54 ? -8.818  -6.092  8.779   1.00 0.00 ? 54 ARG A HH12 9 
ATOM   8576 H HH21 . ARG A 1 54 ? -10.921 -3.755  7.254   1.00 0.00 ? 54 ARG A HH21 9 
ATOM   8577 H HH22 . ARG A 1 54 ? -10.838 -5.262  8.105   1.00 0.00 ? 54 ARG A HH22 9 
ATOM   8578 N N    . ASP A 1 55 ? -7.503  -4.923  1.955   1.00 0.00 ? 55 ASP A N    9 
ATOM   8579 C CA   . ASP A 1 55 ? -7.924  -6.087  1.190   1.00 0.00 ? 55 ASP A CA   9 
ATOM   8580 C C    . ASP A 1 55 ? -6.820  -6.543  0.253   1.00 0.00 ? 55 ASP A C    9 
ATOM   8581 O O    . ASP A 1 55 ? -6.465  -7.721  0.214   1.00 0.00 ? 55 ASP A O    9 
ATOM   8582 C CB   . ASP A 1 55 ? -9.187  -5.782  0.401   1.00 0.00 ? 55 ASP A CB   9 
ATOM   8583 C CG   . ASP A 1 55 ? -9.996  -7.028  0.098   1.00 0.00 ? 55 ASP A CG   9 
ATOM   8584 O OD1  . ASP A 1 55 ? -9.386  -8.102  -0.086  1.00 0.00 ? 55 ASP A OD1  9 
ATOM   8585 O OD2  . ASP A 1 55 ? -11.240 -6.930  0.045   1.00 0.00 ? 55 ASP A OD2  9 
ATOM   8586 H H    . ASP A 1 55 ? -7.942  -4.064  1.803   1.00 0.00 ? 55 ASP A H    9 
ATOM   8587 H HA   . ASP A 1 55 ? -8.129  -6.872  1.875   1.00 0.00 ? 55 ASP A HA   9 
ATOM   8588 H HB2  . ASP A 1 55 ? -9.806  -5.098  0.966   1.00 0.00 ? 55 ASP A HB2  9 
ATOM   8589 H HB3  . ASP A 1 55 ? -8.905  -5.327  -0.528  1.00 0.00 ? 55 ASP A HB3  9 
ATOM   8590 N N    . THR A 1 56 ? -6.276  -5.597  -0.491  1.00 0.00 ? 56 THR A N    9 
ATOM   8591 C CA   . THR A 1 56 ? -5.204  -5.882  -1.425  1.00 0.00 ? 56 THR A CA   9 
ATOM   8592 C C    . THR A 1 56 ? -4.003  -6.468  -0.696  1.00 0.00 ? 56 THR A C    9 
ATOM   8593 O O    . THR A 1 56 ? -3.447  -7.486  -1.109  1.00 0.00 ? 56 THR A O    9 
ATOM   8594 C CB   . THR A 1 56 ? -4.802  -4.618  -2.167  1.00 0.00 ? 56 THR A CB   9 
ATOM   8595 O OG1  . THR A 1 56 ? -5.922  -3.776  -2.375  1.00 0.00 ? 56 THR A OG1  9 
ATOM   8596 C CG2  . THR A 1 56 ? -4.168  -4.887  -3.515  1.00 0.00 ? 56 THR A CG2  9 
ATOM   8597 H H    . THR A 1 56 ? -6.601  -4.685  -0.405  1.00 0.00 ? 56 THR A H    9 
ATOM   8598 H HA   . THR A 1 56 ? -5.565  -6.594  -2.131  1.00 0.00 ? 56 THR A HA   9 
ATOM   8599 H HB   . THR A 1 56 ? -4.090  -4.091  -1.567  1.00 0.00 ? 56 THR A HB   9 
ATOM   8600 H HG1  . THR A 1 56 ? -5.623  -2.910  -2.662  1.00 0.00 ? 56 THR A HG1  9 
ATOM   8601 H HG21 . THR A 1 56 ? -3.911  -5.934  -3.589  1.00 0.00 ? 56 THR A HG21 9 
ATOM   8602 H HG22 . THR A 1 56 ? -3.274  -4.289  -3.618  1.00 0.00 ? 56 THR A HG22 9 
ATOM   8603 H HG23 . THR A 1 56 ? -4.865  -4.631  -4.298  1.00 0.00 ? 56 THR A HG23 9 
ATOM   8604 N N    . LEU A 1 57 ? -3.611  -5.820  0.396   1.00 0.00 ? 57 LEU A N    9 
ATOM   8605 C CA   . LEU A 1 57 ? -2.485  -6.274  1.189   1.00 0.00 ? 57 LEU A CA   9 
ATOM   8606 C C    . LEU A 1 57 ? -2.762  -7.647  1.777   1.00 0.00 ? 57 LEU A C    9 
ATOM   8607 O O    . LEU A 1 57 ? -1.934  -8.554  1.695   1.00 0.00 ? 57 LEU A O    9 
ATOM   8608 C CB   . LEU A 1 57 ? -2.181  -5.273  2.299   1.00 0.00 ? 57 LEU A CB   9 
ATOM   8609 C CG   . LEU A 1 57 ? -0.965  -4.384  2.049   1.00 0.00 ? 57 LEU A CG   9 
ATOM   8610 C CD1  . LEU A 1 57 ? -1.374  -2.921  1.971   1.00 0.00 ? 57 LEU A CD1  9 
ATOM   8611 C CD2  . LEU A 1 57 ? 0.085   -4.590  3.132   1.00 0.00 ? 57 LEU A CD2  9 
ATOM   8612 H H    . LEU A 1 57 ? -4.092  -5.019  0.675   1.00 0.00 ? 57 LEU A H    9 
ATOM   8613 H HA   . LEU A 1 57 ? -1.644  -6.338  0.542   1.00 0.00 ? 57 LEU A HA   9 
ATOM   8614 H HB2  . LEU A 1 57 ? -3.044  -4.641  2.416   1.00 0.00 ? 57 LEU A HB2  9 
ATOM   8615 H HB3  . LEU A 1 57 ? -2.019  -5.819  3.218   1.00 0.00 ? 57 LEU A HB3  9 
ATOM   8616 H HG   . LEU A 1 57 ? -0.528  -4.656  1.104   1.00 0.00 ? 57 LEU A HG   9 
ATOM   8617 H HD11 . LEU A 1 57 ? -1.618  -2.669  0.950   1.00 0.00 ? 57 LEU A HD11 9 
ATOM   8618 H HD12 . LEU A 1 57 ? -0.558  -2.300  2.310   1.00 0.00 ? 57 LEU A HD12 9 
ATOM   8619 H HD13 . LEU A 1 57 ? -2.237  -2.755  2.599   1.00 0.00 ? 57 LEU A HD13 9 
ATOM   8620 H HD21 . LEU A 1 57 ? 0.772   -5.364  2.824   1.00 0.00 ? 57 LEU A HD21 9 
ATOM   8621 H HD22 . LEU A 1 57 ? -0.400  -4.883  4.051   1.00 0.00 ? 57 LEU A HD22 9 
ATOM   8622 H HD23 . LEU A 1 57 ? 0.626   -3.669  3.287   1.00 0.00 ? 57 LEU A HD23 9 
ATOM   8623 N N    . THR A 1 58 ? -3.936  -7.786  2.369   1.00 0.00 ? 58 THR A N    9 
ATOM   8624 C CA   . THR A 1 58 ? -4.342  -9.041  2.976   1.00 0.00 ? 58 THR A CA   9 
ATOM   8625 C C    . THR A 1 58 ? -4.408  -10.143 1.930   1.00 0.00 ? 58 THR A C    9 
ATOM   8626 O O    . THR A 1 58 ? -3.952  -11.262 2.166   1.00 0.00 ? 58 THR A O    9 
ATOM   8627 C CB   . THR A 1 58 ? -5.695  -8.890  3.675   1.00 0.00 ? 58 THR A CB   9 
ATOM   8628 O OG1  . THR A 1 58 ? -5.625  -7.909  4.695   1.00 0.00 ? 58 THR A OG1  9 
ATOM   8629 C CG2  . THR A 1 58 ? -6.191  -10.173 4.308   1.00 0.00 ? 58 THR A CG2  9 
ATOM   8630 H H    . THR A 1 58 ? -4.542  -7.025  2.397   1.00 0.00 ? 58 THR A H    9 
ATOM   8631 H HA   . THR A 1 58 ? -3.594  -9.301  3.703   1.00 0.00 ? 58 THR A HA   9 
ATOM   8632 H HB   . THR A 1 58 ? -6.430  -8.573  2.950   1.00 0.00 ? 58 THR A HB   9 
ATOM   8633 H HG1  . THR A 1 58 ? -5.168  -7.133  4.362   1.00 0.00 ? 58 THR A HG1  9 
ATOM   8634 H HG21 . THR A 1 58 ? -7.196  -10.377 3.969   1.00 0.00 ? 58 THR A HG21 9 
ATOM   8635 H HG22 . THR A 1 58 ? -6.189  -10.068 5.383   1.00 0.00 ? 58 THR A HG22 9 
ATOM   8636 H HG23 . THR A 1 58 ? -5.543  -10.989 4.024   1.00 0.00 ? 58 THR A HG23 9 
ATOM   8637 N N    . SER A 1 59 ? -4.962  -9.821  0.764   1.00 0.00 ? 59 SER A N    9 
ATOM   8638 C CA   . SER A 1 59 ? -5.061  -10.785 -0.315  1.00 0.00 ? 59 SER A CA   9 
ATOM   8639 C C    . SER A 1 59 ? -3.702  -11.412 -0.567  1.00 0.00 ? 59 SER A C    9 
ATOM   8640 O O    . SER A 1 59 ? -3.586  -12.606 -0.840  1.00 0.00 ? 59 SER A O    9 
ATOM   8641 C CB   . SER A 1 59 ? -5.572  -10.108 -1.574  1.00 0.00 ? 59 SER A CB   9 
ATOM   8642 O OG   . SER A 1 59 ? -6.190  -11.040 -2.444  1.00 0.00 ? 59 SER A OG   9 
ATOM   8643 H H    . SER A 1 59 ? -5.296  -8.914  0.621   1.00 0.00 ? 59 SER A H    9 
ATOM   8644 H HA   . SER A 1 59 ? -5.747  -11.542 -0.023  1.00 0.00 ? 59 SER A HA   9 
ATOM   8645 H HB2  . SER A 1 59 ? -6.291  -9.348  -1.306  1.00 0.00 ? 59 SER A HB2  9 
ATOM   8646 H HB3  . SER A 1 59 ? -4.742  -9.658  -2.078  1.00 0.00 ? 59 SER A HB3  9 
ATOM   8647 H HG   . SER A 1 59 ? -5.886  -10.891 -3.342  1.00 0.00 ? 59 SER A HG   9 
ATOM   8648 N N    . CYS A 1 60 ? -2.677  -10.583 -0.448  1.00 0.00 ? 60 CYS A N    9 
ATOM   8649 C CA   . CYS A 1 60 ? -1.308  -11.015 -0.631  1.00 0.00 ? 60 CYS A CA   9 
ATOM   8650 C C    . CYS A 1 60 ? -0.797  -11.696 0.635   1.00 0.00 ? 60 CYS A C    9 
ATOM   8651 O O    . CYS A 1 60 ? -0.080  -12.694 0.571   1.00 0.00 ? 60 CYS A O    9 
ATOM   8652 C CB   . CYS A 1 60 ? -0.437  -9.811  -0.974  1.00 0.00 ? 60 CYS A CB   9 
ATOM   8653 S SG   . CYS A 1 60 ? 0.852   -10.150 -2.215  1.00 0.00 ? 60 CYS A SG   9 
ATOM   8654 H H    . CYS A 1 60 ? -2.848  -9.650  -0.212  1.00 0.00 ? 60 CYS A H    9 
ATOM   8655 H HA   . CYS A 1 60 ? -1.281  -11.719 -1.449  1.00 0.00 ? 60 CYS A HA   9 
ATOM   8656 H HB2  . CYS A 1 60 ? -1.066  -9.023  -1.364  1.00 0.00 ? 60 CYS A HB2  9 
ATOM   8657 H HB3  . CYS A 1 60 ? 0.045   -9.463  -0.074  1.00 0.00 ? 60 CYS A HB3  9 
ATOM   8658 N N    . GLY A 1 61 ? -1.177  -11.146 1.790   1.00 0.00 ? 61 GLY A N    9 
ATOM   8659 C CA   . GLY A 1 61 ? -0.754  -11.711 3.056   1.00 0.00 ? 61 GLY A CA   9 
ATOM   8660 C C    . GLY A 1 61 ? 0.753   -11.739 3.203   1.00 0.00 ? 61 GLY A C    9 
ATOM   8661 O O    . GLY A 1 61 ? 1.329   -12.771 3.545   1.00 0.00 ? 61 GLY A O    9 
ATOM   8662 H H    . GLY A 1 61 ? -1.752  -10.349 1.782   1.00 0.00 ? 61 GLY A H    9 
ATOM   8663 H HA2  . GLY A 1 61 ? -1.172  -11.121 3.858   1.00 0.00 ? 61 GLY A HA2  9 
ATOM   8664 H HA3  . GLY A 1 61 ? -1.130  -12.720 3.131   1.00 0.00 ? 61 GLY A HA3  9 
ATOM   8665 N N    . LEU A 1 62 ? 1.395   -10.604 2.945   1.00 0.00 ? 62 LEU A N    9 
ATOM   8666 C CA   . LEU A 1 62 ? 2.847   -10.516 3.054   1.00 0.00 ? 62 LEU A CA   9 
ATOM   8667 C C    . LEU A 1 62 ? 3.271   -9.554  4.161   1.00 0.00 ? 62 LEU A C    9 
ATOM   8668 O O    . LEU A 1 62 ? 4.214   -9.829  4.902   1.00 0.00 ? 62 LEU A O    9 
ATOM   8669 C CB   . LEU A 1 62 ? 3.471   -10.088 1.720   1.00 0.00 ? 62 LEU A CB   9 
ATOM   8670 C CG   . LEU A 1 62 ? 2.748   -8.964  0.974   1.00 0.00 ? 62 LEU A CG   9 
ATOM   8671 C CD1  . LEU A 1 62 ? 3.030   -7.615  1.622   1.00 0.00 ? 62 LEU A CD1  9 
ATOM   8672 C CD2  . LEU A 1 62 ? 3.171   -8.947  -0.487  1.00 0.00 ? 62 LEU A CD2  9 
ATOM   8673 H H    . LEU A 1 62 ? 0.881   -9.813  2.675   1.00 0.00 ? 62 LEU A H    9 
ATOM   8674 H HA   . LEU A 1 62 ? 3.212   -11.500 3.301   1.00 0.00 ? 62 LEU A HA   9 
ATOM   8675 H HB2  . LEU A 1 62 ? 4.485   -9.768  1.911   1.00 0.00 ? 62 LEU A HB2  9 
ATOM   8676 H HB3  . LEU A 1 62 ? 3.502   -10.953 1.075   1.00 0.00 ? 62 LEU A HB3  9 
ATOM   8677 H HG   . LEU A 1 62 ? 1.682   -9.140  1.012   1.00 0.00 ? 62 LEU A HG   9 
ATOM   8678 H HD11 . LEU A 1 62 ? 2.115   -7.214  2.032   1.00 0.00 ? 62 LEU A HD11 9 
ATOM   8679 H HD12 . LEU A 1 62 ? 3.420   -6.932  0.882   1.00 0.00 ? 62 LEU A HD12 9 
ATOM   8680 H HD13 . LEU A 1 62 ? 3.755   -7.738  2.412   1.00 0.00 ? 62 LEU A HD13 9 
ATOM   8681 H HD21 . LEU A 1 62 ? 2.488   -8.332  -1.053  1.00 0.00 ? 62 LEU A HD21 9 
ATOM   8682 H HD22 . LEU A 1 62 ? 3.156   -9.954  -0.877  1.00 0.00 ? 62 LEU A HD22 9 
ATOM   8683 H HD23 . LEU A 1 62 ? 4.170   -8.545  -0.569  1.00 0.00 ? 62 LEU A HD23 9 
ATOM   8684 N N    . ALA A 1 63 ? 2.577   -8.426  4.269   1.00 0.00 ? 63 ALA A N    9 
ATOM   8685 C CA   . ALA A 1 63 ? 2.897   -7.437  5.283   1.00 0.00 ? 63 ALA A CA   9 
ATOM   8686 C C    . ALA A 1 63 ? 1.664   -6.648  5.707   1.00 0.00 ? 63 ALA A C    9 
ATOM   8687 O O    . ALA A 1 63 ? 0.581   -6.812  5.144   1.00 0.00 ? 63 ALA A O    9 
ATOM   8688 C CB   . ALA A 1 63 ? 3.982   -6.497  4.780   1.00 0.00 ? 63 ALA A CB   9 
ATOM   8689 H H    . ALA A 1 63 ? 1.839   -8.257  3.657   1.00 0.00 ? 63 ALA A H    9 
ATOM   8690 H HA   . ALA A 1 63 ? 3.282   -7.964  6.137   1.00 0.00 ? 63 ALA A HA   9 
ATOM   8691 H HB1  . ALA A 1 63 ? 4.697   -7.054  4.193   1.00 0.00 ? 63 ALA A HB1  9 
ATOM   8692 H HB2  . ALA A 1 63 ? 4.482   -6.042  5.622   1.00 0.00 ? 63 ALA A HB2  9 
ATOM   8693 H HB3  . ALA A 1 63 ? 3.535   -5.727  4.167   1.00 0.00 ? 63 ALA A HB3  9 
ATOM   8694 N N    . VAL A 1 64 ? 1.841   -5.790  6.706   1.00 0.00 ? 64 VAL A N    9 
ATOM   8695 C CA   . VAL A 1 64 ? 0.760   -4.970  7.215   1.00 0.00 ? 64 VAL A CA   9 
ATOM   8696 C C    . VAL A 1 64 ? 1.285   -3.608  7.682   1.00 0.00 ? 64 VAL A C    9 
ATOM   8697 O O    . VAL A 1 64 ? 2.420   -3.501  8.146   1.00 0.00 ? 64 VAL A O    9 
ATOM   8698 C CB   . VAL A 1 64 ? 0.024   -5.697  8.368   1.00 0.00 ? 64 VAL A CB   9 
ATOM   8699 C CG1  . VAL A 1 64 ? 0.332   -5.072  9.724   1.00 0.00 ? 64 VAL A CG1  9 
ATOM   8700 C CG2  . VAL A 1 64 ? -1.476  -5.724  8.115   1.00 0.00 ? 64 VAL A CG2  9 
ATOM   8701 H H    . VAL A 1 64 ? 2.720   -5.708  7.110   1.00 0.00 ? 64 VAL A H    9 
ATOM   8702 H HA   . VAL A 1 64 ? 0.063   -4.816  6.410   1.00 0.00 ? 64 VAL A HA   9 
ATOM   8703 H HB   . VAL A 1 64 ? 0.378   -6.717  8.388   1.00 0.00 ? 64 VAL A HB   9 
ATOM   8704 H HG11 . VAL A 1 64 ? 1.400   -4.955  9.832   1.00 0.00 ? 64 VAL A HG11 9 
ATOM   8705 H HG12 . VAL A 1 64 ? -0.042  -5.712  10.509  1.00 0.00 ? 64 VAL A HG12 9 
ATOM   8706 H HG13 . VAL A 1 64 ? -0.145  -4.105  9.791   1.00 0.00 ? 64 VAL A HG13 9 
ATOM   8707 H HG21 . VAL A 1 64 ? -1.883  -6.661  8.464   1.00 0.00 ? 64 VAL A HG21 9 
ATOM   8708 H HG22 . VAL A 1 64 ? -1.664  -5.622  7.056   1.00 0.00 ? 64 VAL A HG22 9 
ATOM   8709 H HG23 . VAL A 1 64 ? -1.945  -4.908  8.644   1.00 0.00 ? 64 VAL A HG23 9 
ATOM   8710 N N    . PRO A 1 65 ? 0.467   -2.546  7.560   1.00 0.00 ? 65 PRO A N    9 
ATOM   8711 C CA   . PRO A 1 65 ? 0.851   -1.180  7.964   1.00 0.00 ? 65 PRO A CA   9 
ATOM   8712 C C    . PRO A 1 65 ? 0.827   -0.969  9.472   1.00 0.00 ? 65 PRO A C    9 
ATOM   8713 O O    . PRO A 1 65 ? 0.528   0.122   9.956   1.00 0.00 ? 65 PRO A O    9 
ATOM   8714 C CB   . PRO A 1 65 ? -0.229  -0.331  7.307   1.00 0.00 ? 65 PRO A CB   9 
ATOM   8715 C CG   . PRO A 1 65 ? -1.418  -1.217  7.374   1.00 0.00 ? 65 PRO A CG   9 
ATOM   8716 C CD   . PRO A 1 65 ? -0.899  -2.575  7.006   1.00 0.00 ? 65 PRO A CD   9 
ATOM   8717 H HA   . PRO A 1 65 ? 1.818   -0.913  7.582   1.00 0.00 ? 65 PRO A HA   9 
ATOM   8718 H HB2  . PRO A 1 65 ? -0.372  0.582   7.867   1.00 0.00 ? 65 PRO A HB2  9 
ATOM   8719 H HB3  . PRO A 1 65 ? 0.044   -0.107  6.288   1.00 0.00 ? 65 PRO A HB3  9 
ATOM   8720 H HG2  . PRO A 1 65 ? -1.807  -1.228  8.383   1.00 0.00 ? 65 PRO A HG2  9 
ATOM   8721 H HG3  . PRO A 1 65 ? -2.171  -0.893  6.673   1.00 0.00 ? 65 PRO A HG3  9 
ATOM   8722 H HD2  . PRO A 1 65 ? -1.494  -3.348  7.468   1.00 0.00 ? 65 PRO A HD2  9 
ATOM   8723 H HD3  . PRO A 1 65 ? -0.877  -2.696  5.932   1.00 0.00 ? 65 PRO A HD3  9 
ATOM   8724 N N    . HIS A 1 66 ? 1.148   -2.016  10.199  1.00 0.00 ? 66 HIS A N    9 
ATOM   8725 C CA   . HIS A 1 66 ? 1.178   -1.968  11.655  1.00 0.00 ? 66 HIS A CA   9 
ATOM   8726 C C    . HIS A 1 66 ? 2.505   -2.500  12.184  1.00 0.00 ? 66 HIS A C    9 
ATOM   8727 O O    . HIS A 1 66 ? 2.572   -3.052  13.282  1.00 0.00 ? 66 HIS A O    9 
ATOM   8728 C CB   . HIS A 1 66 ? 0.018   -2.777  12.240  1.00 0.00 ? 66 HIS A CB   9 
ATOM   8729 C CG   . HIS A 1 66 ? -1.314  -2.400  11.683  1.00 0.00 ? 66 HIS A CG   9 
ATOM   8730 N ND1  . HIS A 1 66 ? -1.925  -1.198  11.959  1.00 0.00 ? 66 HIS A ND1  9 
ATOM   8731 C CD2  . HIS A 1 66 ? -2.160  -3.072  10.868  1.00 0.00 ? 66 HIS A CD2  9 
ATOM   8732 C CE1  . HIS A 1 66 ? -3.087  -1.148  11.340  1.00 0.00 ? 66 HIS A CE1  9 
ATOM   8733 N NE2  . HIS A 1 66 ? -3.254  -2.271  10.669  1.00 0.00 ? 66 HIS A NE2  9 
ATOM   8734 H H    . HIS A 1 66 ? 1.376   -2.842  9.743   1.00 0.00 ? 66 HIS A H    9 
ATOM   8735 H HA   . HIS A 1 66 ? 1.072   -0.935  11.955  1.00 0.00 ? 66 HIS A HA   9 
ATOM   8736 H HB2  . HIS A 1 66 ? 0.177   -3.824  12.036  1.00 0.00 ? 66 HIS A HB2  9 
ATOM   8737 H HB3  . HIS A 1 66 ? -0.016  -2.623  13.308  1.00 0.00 ? 66 HIS A HB3  9 
ATOM   8738 H HD1  . HIS A 1 66 ? -1.561  -0.487  12.526  1.00 0.00 ? 66 HIS A HD1  9 
ATOM   8739 H HD2  . HIS A 1 66 ? -2.004  -4.056  10.453  1.00 0.00 ? 66 HIS A HD2  9 
ATOM   8740 H HE1  . HIS A 1 66 ? -3.781  -0.330  11.377  1.00 0.00 ? 66 HIS A HE1  9 
ATOM   8741 H HE2  . HIS A 1 66 ? -3.986  -2.451  10.043  1.00 0.00 ? 66 HIS A HE2  9 
ATOM   8742 N N    . CYS A 1 67 ? 3.560   -2.331  11.392  1.00 0.00 ? 67 CYS A N    9 
ATOM   8743 C CA   . CYS A 1 67 ? 4.889   -2.794  11.774  1.00 0.00 ? 67 CYS A CA   9 
ATOM   8744 C C    . CYS A 1 67 ? 5.594   -1.763  12.650  1.00 0.00 ? 67 CYS A C    9 
ATOM   8745 O O    . CYS A 1 67 ? 5.550   -0.564  12.303  1.00 0.00 ? 67 CYS A O    9 
ATOM   8746 C CB   . CYS A 1 67 ? 5.728   -3.081  10.528  1.00 0.00 ? 67 CYS A CB   9 
ATOM   8747 S SG   . CYS A 1 67 ? 5.938   -1.646  9.425   1.00 0.00 ? 67 CYS A SG   9 
ATOM   8748 O OXT  . CYS A 1 67 ? 6.183   -2.163  13.676  1.00 0.00 ? 67 CYS A OXT  9 
ATOM   8749 H H    . CYS A 1 67 ? 3.442   -1.884  10.528  1.00 0.00 ? 67 CYS A H    9 
ATOM   8750 H HA   . CYS A 1 67 ? 4.772   -3.708  12.337  1.00 0.00 ? 67 CYS A HA   9 
ATOM   8751 H HB2  . CYS A 1 67 ? 6.711   -3.407  10.832  1.00 0.00 ? 67 CYS A HB2  9 
ATOM   8752 H HB3  . CYS A 1 67 ? 5.255   -3.868  9.958   1.00 0.00 ? 67 CYS A HB3  9 
HETATM 8753 C C1   . PGM B 2 .  ? -11.764 4.765   9.909   1.00 0.00 ? 68 PGM A C1   9 
HETATM 8754 O O1   . PGM B 2 .  ? -11.711 5.264   8.595   1.00 0.00 ? 68 PGM A O1   9 
HETATM 8755 C C2   . PGM B 2 .  ? -10.997 3.519   9.980   1.00 0.00 ? 68 PGM A C2   9 
HETATM 8756 O O2   . PGM B 2 .  ? -11.874 2.453   10.241  1.00 0.00 ? 68 PGM A O2   9 
HETATM 8757 C C3   . PGM B 2 .  ? -9.974  3.566   11.028  1.00 0.00 ? 68 PGM A C3   9 
HETATM 8758 O O4   . PGM B 2 .  ? -8.690  3.383   10.417  1.00 0.00 ? 68 PGM A O4   9 
HETATM 8759 P P5   . PGM B 2 .  ? -7.927  1.991   10.645  1.00 0.00 ? 68 PGM A P5   9 
HETATM 8760 O O5A  . PGM B 2 .  ? -7.263  2.010   11.969  1.00 0.00 ? 68 PGM A O5A  9 
HETATM 8761 O O5B  . PGM B 2 .  ? -8.871  0.889   10.361  1.00 0.00 ? 68 PGM A O5B  9 
HETATM 8762 O O6   . PGM B 2 .  ? -6.786  1.961   9.523   1.00 0.00 ? 68 PGM A O6   9 
HETATM 8763 C C7   . PGM B 2 .  ? -6.179  0.656   9.146   1.00 0.00 ? 68 PGM A C7   9 
HETATM 8764 C C8   . PGM B 2 .  ? -4.721  0.682   9.006   1.00 0.00 ? 68 PGM A C8   9 
HETATM 8765 O O8   . PGM B 2 .  ? -4.027  1.684   9.707   1.00 0.00 ? 68 PGM A O8   9 
HETATM 8766 C C9   . PGM B 2 .  ? -4.312  0.705   7.624   1.00 0.00 ? 68 PGM A C9   9 
HETATM 8767 O OQ1  . PGM B 2 .  ? -6.080  -0.402  5.526   1.00 0.00 ? 68 PGM A OQ1  9 
HETATM 8768 O OQ2  . PGM B 2 .  ? -4.510  -0.633  6.987   1.00 0.00 ? 68 PGM A OQ2  9 
HETATM 8769 C CA   . PGM B 2 .  ? -4.876  -0.687  5.853   1.00 0.00 ? 68 PGM A CA   9 
HETATM 8770 C CB   . PGM B 2 .  ? -4.017  -1.162  4.762   1.00 0.00 ? 68 PGM A CB   9 
HETATM 8771 C CC   . PGM B 2 .  ? -3.083  -0.143  4.165   1.00 0.00 ? 68 PGM A CC   9 
HETATM 8772 C CD   . PGM B 2 .  ? -1.646  -0.577  4.082   1.00 0.00 ? 68 PGM A CD   9 
HETATM 8773 C CE   . PGM B 2 .  ? -0.692  0.528   3.742   1.00 0.00 ? 68 PGM A CE   9 
HETATM 8774 C CF   . PGM B 2 .  ? -0.420  0.679   2.276   1.00 0.00 ? 68 PGM A CF   9 
HETATM 8775 C CG   . PGM B 2 .  ? 1.016   0.947   1.932   1.00 0.00 ? 68 PGM A CG   9 
HETATM 8776 C CH   . PGM B 2 .  ? 1.358   0.817   0.486   1.00 0.00 ? 68 PGM A CH   9 
HETATM 8777 C CI   . PGM B 2 .  ? 2.327   1.828   -0.030  1.00 0.00 ? 68 PGM A CI   9 
HETATM 8778 C CJ   . PGM B 2 .  ? 1.761   2.783   -1.027  1.00 0.00 ? 68 PGM A CJ   9 
HETATM 8779 C CK   . PGM B 2 .  ? 1.888   4.230   -0.675  1.00 0.00 ? 68 PGM A CK   9 
HETATM 8780 C CL   . PGM B 2 .  ? 0.996   5.154   -1.446  1.00 0.00 ? 68 PGM A CL   9 
HETATM 8781 C CM   . PGM B 2 .  ? 1.569   5.673   -2.727  1.00 0.00 ? 68 PGM A CM   9 
HETATM 8782 C CN   . PGM B 2 .  ? 0.594   6.363   -3.626  1.00 0.00 ? 68 PGM A CN   9 
HETATM 8783 C CO   . PGM B 2 .  ? 1.024   6.492   -5.052  1.00 0.00 ? 68 PGM A CO   9 
HETATM 8784 C CP   . PGM B 2 .  ? 0.062   7.243   -5.924  1.00 0.00 ? 68 PGM A CP   9 
# 
_database_PDB_caveat.id     1 
_database_PDB_caveat.text   'PGM A 68 HAS WRONG CHIRALITY AT ATOM C8' 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  1  1  ALA ALA A . n 
A 1 2  CYS 2  2  2  CYS CYS A . n 
A 1 3  GLN 3  3  3  GLN GLN A . n 
A 1 4  ALA 4  4  4  ALA ALA A . n 
A 1 5  SER 5  5  5  SER SER A . n 
A 1 6  GLN 6  6  6  GLN GLN A . n 
A 1 7  LEU 7  7  7  LEU LEU A . n 
A 1 8  ALA 8  8  8  ALA ALA A . n 
A 1 9  VAL 9  9  9  VAL VAL A . n 
A 1 10 CYS 10 10 10 CYS CYS A . n 
A 1 11 ALA 11 11 11 ALA ALA A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 ALA 13 13 13 ALA ALA A . n 
A 1 14 ILE 14 14 14 ILE ILE A . n 
A 1 15 LEU 15 15 15 LEU LEU A . n 
A 1 16 SER 16 16 16 SER SER A . n 
A 1 17 GLY 17 17 17 GLY GLY A . n 
A 1 18 ALA 18 18 18 ALA ALA A . n 
A 1 19 LYS 19 19 19 LYS LYS A . n 
A 1 20 PRO 20 20 20 PRO PRO A . n 
A 1 21 SER 21 21 21 SER SER A . n 
A 1 22 GLY 22 22 22 GLY GLY A . n 
A 1 23 GLU 23 23 23 GLU GLU A . n 
A 1 24 CYS 24 24 24 CYS CYS A . n 
A 1 25 CYS 25 25 25 CYS CYS A . n 
A 1 26 GLY 26 26 26 GLY GLY A . n 
A 1 27 ASN 27 27 27 ASN ASN A . n 
A 1 28 LEU 28 28 28 LEU LEU A . n 
A 1 29 ARG 29 29 29 ARG ARG A . n 
A 1 30 ALA 30 30 30 ALA ALA A . n 
A 1 31 GLN 31 31 31 GLN GLN A . n 
A 1 32 GLN 32 32 32 GLN GLN A . n 
A 1 33 GLY 33 33 33 GLY GLY A . n 
A 1 34 CYS 34 34 34 CYS CYS A . n 
A 1 35 PHE 35 35 35 PHE PHE A . n 
A 1 36 CYS 36 36 36 CYS CYS A . n 
A 1 37 GLN 37 37 37 GLN GLN A . n 
A 1 38 TYR 38 38 38 TYR TYR A . n 
A 1 39 ALA 39 39 39 ALA ALA A . n 
A 1 40 LYS 40 40 40 LYS LYS A . n 
A 1 41 ASP 41 41 41 ASP ASP A . n 
A 1 42 PRO 42 42 42 PRO PRO A . n 
A 1 43 THR 43 43 43 THR THR A . n 
A 1 44 TYR 44 44 44 TYR TYR A . n 
A 1 45 GLY 45 45 45 GLY GLY A . n 
A 1 46 GLN 46 46 46 GLN GLN A . n 
A 1 47 TYR 47 47 47 TYR TYR A . n 
A 1 48 ILE 48 48 48 ILE ILE A . n 
A 1 49 ARG 49 49 49 ARG ARG A . n 
A 1 50 SER 50 50 50 SER SER A . n 
A 1 51 PRO 51 51 51 PRO PRO A . n 
A 1 52 HIS 52 52 52 HIS HIS A . n 
A 1 53 ALA 53 53 53 ALA ALA A . n 
A 1 54 ARG 54 54 54 ARG ARG A . n 
A 1 55 ASP 55 55 55 ASP ASP A . n 
A 1 56 THR 56 56 56 THR THR A . n 
A 1 57 LEU 57 57 57 LEU LEU A . n 
A 1 58 THR 58 58 58 THR THR A . n 
A 1 59 SER 59 59 59 SER SER A . n 
A 1 60 CYS 60 60 60 CYS CYS A . n 
A 1 61 GLY 61 61 61 GLY GLY A . n 
A 1 62 LEU 62 62 62 LEU LEU A . n 
A 1 63 ALA 63 63 63 ALA ALA A . n 
A 1 64 VAL 64 64 64 VAL VAL A . n 
A 1 65 PRO 65 65 65 PRO PRO A . n 
A 1 66 HIS 66 66 66 HIS HIS A . n 
A 1 67 CYS 67 67 67 CYS CYS A . n 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          PGM 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     68 
_pdbx_nonpoly_scheme.auth_seq_num    68 
_pdbx_nonpoly_scheme.pdb_mon_id      PGM 
_pdbx_nonpoly_scheme.auth_mon_id     PGM 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 860  ? 
1 MORE         -12  ? 
1 'SSA (A^2)'  4460 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-03-18 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2020-02-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' Advisory                    
4 4 'Structure model' 'Data collection'           
5 4 'Structure model' 'Database references'       
6 4 'Structure model' 'Derived calculations'      
7 4 'Structure model' Other                       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2                
2 4 'Structure model' database_PDB_caveat       
3 4 'Structure model' pdbx_database_status      
4 4 'Structure model' pdbx_nmr_software         
5 4 'Structure model' pdbx_struct_assembly      
6 4 'Structure model' pdbx_struct_assembly_prop 
7 4 'Structure model' pdbx_struct_oper_list     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_database_status.status_code_cs' 
2 4 'Structure model' '_pdbx_nmr_software.name'              
# 
_pdbx_database_remark.id     650 
_pdbx_database_remark.text   
;HELIX
Author determined the secondary structure. 
;
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1   1 CYS A 2  ? ? 59.94   93.88   
2   1 SER A 5  ? ? -149.17 -36.00  
3   1 LEU A 15 ? ? -73.70  -80.83  
4   1 SER A 16 ? ? -60.22  -75.32  
5   1 ALA A 18 ? ? -58.22  -76.94  
6   1 PRO A 20 ? ? -53.71  -171.99 
7   1 SER A 21 ? ? -174.39 140.99  
8   1 GLN A 31 ? ? -81.93  -74.17  
9   1 GLN A 32 ? ? 49.01   19.62   
10  1 LEU A 62 ? ? -109.78 -60.03  
11  1 PRO A 65 ? ? -57.19  -160.42 
12  2 LEU A 15 ? ? -74.06  -79.50  
13  2 ALA A 18 ? ? -57.63  -79.10  
14  2 PRO A 20 ? ? -69.08  -174.69 
15  2 SER A 21 ? ? -173.41 138.57  
16  2 GLN A 31 ? ? -81.36  -72.66  
17  2 GLN A 32 ? ? 47.30   20.68   
18  2 PRO A 42 ? ? -82.09  38.16   
19  2 ARG A 49 ? ? -80.45  31.06   
20  2 PRO A 65 ? ? -77.74  31.71   
21  3 GLN A 3  ? ? -156.64 -56.45  
22  3 LEU A 15 ? ? -68.11  -77.85  
23  3 SER A 16 ? ? -54.01  -70.20  
24  3 ALA A 18 ? ? -58.60  -77.83  
25  3 LYS A 19 ? ? -171.29 143.52  
26  3 SER A 21 ? ? -166.32 -162.61 
27  3 GLN A 31 ? ? -81.07  -71.86  
28  3 GLN A 32 ? ? 48.28   20.03   
29  3 TYR A 44 ? ? -89.71  -75.93  
30  3 ARG A 49 ? ? -80.67  31.00   
31  3 LEU A 62 ? ? -134.13 -92.32  
32  3 PRO A 65 ? ? -81.83  32.28   
33  4 CYS A 2  ? ? 59.99   99.35   
34  4 GLN A 6  ? ? -86.86  48.45   
35  4 LEU A 7  ? ? -151.99 -39.94  
36  4 LEU A 15 ? ? -65.16  -74.38  
37  4 ALA A 18 ? ? -61.75  -77.06  
38  4 PRO A 20 ? ? -63.50  -167.03 
39  4 SER A 21 ? ? -174.71 144.63  
40  4 GLN A 31 ? ? -81.41  -71.60  
41  4 GLN A 32 ? ? 48.76   19.25   
42  4 ASP A 41 ? ? -57.44  109.10  
43  4 LEU A 62 ? ? -123.48 -81.00  
44  4 PRO A 65 ? ? -57.73  -160.57 
45  5 LEU A 15 ? ? -74.61  -74.31  
46  5 ALA A 18 ? ? -67.89  -77.62  
47  5 PRO A 20 ? ? -55.44  -164.28 
48  5 SER A 21 ? ? -172.41 136.92  
49  5 GLN A 31 ? ? -81.09  -71.60  
50  5 GLN A 32 ? ? 46.39   21.72   
51  5 CYS A 34 ? ? -135.10 -37.08  
52  5 LEU A 62 ? ? -113.87 -83.57  
53  5 PRO A 65 ? ? -56.42  -160.21 
54  6 CYS A 2  ? ? -106.26 -67.40  
55  6 GLN A 3  ? ? -161.71 108.04  
56  6 ALA A 13 ? ? -140.58 21.27   
57  6 LYS A 19 ? ? -178.97 94.92   
58  6 PRO A 20 ? ? -67.00  -167.26 
59  6 SER A 21 ? ? -172.45 144.38  
60  6 GLN A 31 ? ? -80.89  -71.56  
61  6 GLN A 32 ? ? 48.66   19.80   
62  6 CYS A 34 ? ? -135.27 -38.08  
63  6 THR A 43 ? ? -170.75 -45.27  
64  6 GLN A 46 ? ? -164.16 -40.72  
65  6 LEU A 62 ? ? -116.99 -76.49  
66  6 PRO A 65 ? ? -58.02  -160.66 
67  7 CYS A 2  ? ? 61.37   104.44  
68  7 LEU A 15 ? ? -68.11  -77.26  
69  7 ALA A 18 ? ? -59.36  -78.70  
70  7 PRO A 20 ? ? -53.62  -177.92 
71  7 SER A 21 ? ? -174.76 135.64  
72  7 GLN A 31 ? ? -81.41  -71.31  
73  7 GLN A 32 ? ? 51.66   17.97   
74  7 CYS A 34 ? ? -137.53 -34.81  
75  7 LEU A 62 ? ? -119.04 -80.85  
76  7 PRO A 65 ? ? -62.92  -163.26 
77  8 CYS A 2  ? ? -157.42 -60.59  
78  8 GLN A 3  ? ? -161.25 -42.88  
79  8 LEU A 15 ? ? -69.85  -75.02  
80  8 LYS A 19 ? ? 178.52  157.85  
81  8 PRO A 20 ? ? -69.28  -179.20 
82  8 GLN A 31 ? ? -81.08  -71.73  
83  8 GLN A 32 ? ? 49.86   19.06   
84  8 CYS A 34 ? ? -137.40 -34.58  
85  8 ASP A 41 ? ? -57.94  109.27  
86  8 THR A 43 ? ? -159.96 -45.39  
87  8 TYR A 44 ? ? -90.10  -62.62  
88  8 ARG A 49 ? ? -80.64  30.55   
89  8 LEU A 62 ? ? -112.25 -78.84  
90  8 PRO A 65 ? ? -56.69  -160.10 
91  9 LEU A 15 ? ? -53.68  -81.54  
92  9 SER A 16 ? ? -70.69  -79.64  
93  9 ALA A 18 ? ? -59.95  -78.45  
94  9 LYS A 19 ? ? -174.75 141.79  
95  9 PRO A 20 ? ? -52.01  -179.86 
96  9 SER A 21 ? ? -174.22 139.64  
97  9 GLN A 31 ? ? -81.75  -71.90  
98  9 GLN A 32 ? ? 47.01   20.66   
99  9 TYR A 44 ? ? -105.75 -62.20  
100 9 ARG A 49 ? ? -80.64  30.56   
101 9 PRO A 65 ? ? -75.90  33.05   
# 
loop_
_pdbx_validate_chiral.id 
_pdbx_validate_chiral.PDB_model_num 
_pdbx_validate_chiral.auth_atom_id 
_pdbx_validate_chiral.label_alt_id 
_pdbx_validate_chiral.auth_asym_id 
_pdbx_validate_chiral.auth_comp_id 
_pdbx_validate_chiral.auth_seq_id 
_pdbx_validate_chiral.PDB_ins_code 
_pdbx_validate_chiral.details 
_pdbx_validate_chiral.omega 
1 3 C8 ? A PGM 68 ? 'WRONG HAND' . 
2 4 C8 ? A PGM 68 ? 'WRONG HAND' . 
3 5 C8 ? A PGM 68 ? 'WRONG HAND' . 
4 6 C8 ? A PGM 68 ? 'WRONG HAND' . 
5 9 C8 ? A PGM 68 ? 'WRONG HAND' . 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        '1-MYRISTOYL-2-HYDROXY-SN-GLYCERO-3-[PHOSPHO-RAC-(1-GLYCEROL)]' 
_pdbx_entity_nonpoly.comp_id     PGM 
#