data_1N8R
# 
_entry.id   1N8R 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1N8R         
NDB   RR0060       
RCSB  RCSB017660   
WWPDB D_1000017660 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1K73 'Ribosomal large subunit with anisomycin'    unspecified 
PDB 1KC8 'Ribosomal large subunit with blasticidin S' unspecified 
PDB 1FFK 'uncomplexed Ribosomal large subunit'        unspecified 
PDB 1JJ2 'uncomplexed Ribosomal large subunit'        unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1N8R 
_pdbx_database_status.recvd_initial_deposition_date   2002-11-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Hansen, J.L.' 1 
'Moore, P.B.'  2 
'Steitz, T.A.' 3 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of 
the Large Ribosomal Subunit
;
J.Mol.Biol. 330 1061 1075 2003 JMOBAK UK 0022-2836 0070 ? 12860128 '10.1016/S0022-2836(03)00668-5' 
1       'The complete atomic structure of the large ribosomal subunit at 2.4 A resolution'                        Science     289 
905  920  2000 SCIEAS US 0036-8075 0038 ? ?        10.1126/science.289.5481.905    
2       'The structural basis of ribosome activity in peptide bond synthesis'                                     Science     289 
920  930  2000 SCIEAS US 0036-8075 0038 ? ?        10.1126/science.289.5481.920    
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hansen, J.'   1  
primary 'Moore, P.B.'  2  
primary 'Steitz, T.A.' 3  
1       'Ban, N.'      4  
1       'Nissen, P.'   5  
1       'Hansen, J.'   6  
1       'Moore, P.B.'  7  
1       'Steitz, T.A.' 8  
2       'Nissen, P.'   9  
2       'Hansen, J.'   10 
2       'Ban, N.'      11 
2       'Moore, P.B.'  12 
2       'Steitz, T.A.' 13 
# 
_cell.entry_id           1N8R 
_cell.length_a           212.902 
_cell.length_b           300.474 
_cell.length_c           575.176 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1N8R 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.cell_setting                     orthorhombic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat '23S ribosomal RNA'                   946034.375 1    ? ?                       ? ? 
2  polymer     nat '5S ribosomal RNA'                    39318.414  1    ? ?                       ? ? 
3  polymer     nat '50S ribosomal protein L2P'           25237.475  1    ? ?                       ? ? 
4  polymer     nat '50S ribosomal protein L3P'           37265.195  1    ? 'R310P, 311F insertion' ? ? 
5  polymer     nat '50S ribosomal protein L4E'           26442.098  1    ? ?                       ? ? 
6  polymer     nat '50S ribosomal protein L5P'           19420.498  1    ? ?                       ? ? 
7  polymer     nat '50S ribosomal protein L6P'           19830.523  1    ? ?                       ? ? 
8  polymer     nat '50S ribosomal protein L7Ae'          12600.822  1    ? ?                       ? ? 
9  polymer     nat 'Acidic ribosomal protein P0 homolog' 37213.805  1    ? ?                       ? ? 
10 polymer     nat '50S ribosomal protein L10e'          18022.527  1    ? ?                       ? ? 
11 polymer     nat '50S ribosomal protein L13P'          16249.214  1    ? ?                       ? ? 
12 polymer     nat '50S ribosomal protein L14P'          14216.233  1    ? ?                       ? ? 
13 polymer     nat '50S ribosomal protein L15P'          17874.172  1    ? ?                       ? ? 
14 polymer     nat '50S ribosomal protein L15E'          22856.566  1    ? ?                       ? ? 
15 polymer     nat '50S ribosomal protein L18P'          20509.740  1    ? ?                       ? ? 
16 polymer     nat '50S ribosomal protein L18E'          12307.720  1    ? ?                       ? ? 
17 polymer     nat '50S ribosomal protein L19E'          16631.322  1    ? ?                       ? ? 
18 polymer     nat '50S ribosomal protein L21e'          10436.604  1    ? ?                       ? ? 
19 polymer     nat '50S ribosomal protein L22P'          16835.746  1    ? ?                       ? ? 
20 polymer     nat '50S ribosomal protein L23P'          9481.340   1    ? ?                       ? ? 
21 polymer     nat '50S ribosomal protein L24P'          13539.759  1    ? ?                       ? ? 
22 polymer     nat '50S ribosomal protein L24E'          7233.720   1    ? ?                       ? ? 
23 polymer     nat '50S ribosomal protein L29P'          7758.667   1    ? ?                       ? ? 
24 polymer     nat '50S ribosomal protein L30P'          17062.885  1    ? ?                       ? ? 
25 polymer     nat '50S ribosomal protein L31E'          10253.417  1    ? ?                       ? ? 
26 polymer     nat '50S ribosomal protein L32E'          26324.531  1    ? ?                       ? ? 
27 polymer     nat '50S ribosomal protein L37AE'         8097.830   1    ? ?                       ? ? 
28 polymer     nat '50S ribosomal protein L37e'          6199.007   1    ? ?                       ? ? 
29 polymer     nat '50S ribosomal protein L39e'          5844.700   1    ? ?                       ? ? 
30 polymer     nat '50S ribosomal protein L44E'          10815.245  1    ? ?                       ? ? 
31 non-polymer syn 'VIRGINIAMYCIN M1'                    525.593    1    ? ?                       ? ? 
32 non-polymer syn 'MAGNESIUM ION'                       24.305     117  ? ?                       ? ? 
33 non-polymer syn 'POTASSIUM ION'                       39.098     1    ? ?                       ? ? 
34 non-polymer syn 'SODIUM ION'                          22.990     86   ? ?                       ? ? 
35 non-polymer syn 'CHLORIDE ION'                        35.453     22   ? ?                       ? ? 
36 non-polymer syn 'CADMIUM ION'                         112.411    5    ? ?                       ? ? 
37 water       nat water                                 18.015     7882 ? ?                       ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3  'Hmal2, HL4'         
4  'Hmal3, HL1'         
5  'Hmal4, HL6'         
6  'Hmal5, HL13'        
7  'Hmal6, HL10'        
8  HS6                  
9  'L10E, HMaL10'       
11 Hmal13               
12 'Hmal14, HL27'       
13 'Hmal15, HL9'        
15 'Hmal18, HL12'       
16 'HL29, L19'          
17 'Hmal19, HL24'       
18 HL31                 
19 'Hmal22, HL23'       
20 'Hmal23, HL25, L21'  
21 'Hmal24, HL16, HL15' 
22 HL21/HL22            
23 'Hmal29, HL33'       
24 'Hmal30, HL20, HL16' 
25 'L34, HL30'          
26 HL5                  
28 L35e                 
29 'HL39e, HL46e'       
30 'LA, HLA'            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  polyribonucleotide no no 
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
A ? 
2  polyribonucleotide no no 
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
B ? 
3  'polypeptide(L)'   no no 
;GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDEL
QVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVG
GGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
;GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDEL
QVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVG
GGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
C ? 
4  'polypeptide(L)'   no no 
;PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMR
AVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPD
VMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLG
PWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQ
PRLDPEVRYVSNESNQG
;
;PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMR
AVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPD
VMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLG
PWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVRFRPAVRPNDQ
PRLDPEVRYVSNESNQG
;
D ? 
5  'polypeptide(L)'   no no 
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
E ? 
6  'polypeptide(L)'   no no 
;SSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMA
EEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPA
DAVAFIESTYDVEVSE
;
;SSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMA
EEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPA
DAVAFIESTYDVEVSE
;
F ? 
7  'polypeptide(L)'   no no 
;PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGW
EYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVR
VFQDGVYITRKPNRGDA
;
;PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGW
EYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVR
VFQDGVYITRKPNRGDA
;
G ? 
8  'polypeptide(L)'   no no 
;PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQ
DDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
;PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQ
DDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
H ? 
9  'polypeptide(L)'   no no 
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
I ? 
10 'polypeptide(L)'   no no 
;KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAAN
YKFRIRKFPFHVIRENKAAAAAAAAAAADGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINID
SSPAGNA
;
;KPGAMYRNSSKPAYTRREYISGIPGKKIAQFDMGNNGAGPTYPAQVELVVEKPVQIRHNALEAARVAANRYVQNSGAAAN
YKFRIRKFPFHVIRENKAAAAAAAAAAADGMRAPFGKPVGTAARVHGANHIFIAWVNPDPNVEEAWRRAKMKVTPTINID
SSPAGNA
;
J ? 
11 'polypeptide(L)'   no no 
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
K ? 
12 'polypeptide(L)'   no no 
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
L ? 
13 'polypeptide(L)'   no no 
;TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADD
VAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDAD
ADEE
;
;TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADD
VAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDAD
ADEE
;
M ? 
14 'polypeptide(L)'   no no 
;ARSAYSYIREAWKRPKEGQIAELMWHRMQEWRNEPAVVRIERPTRLDRARSLGYKAKQGIIVVRVAIRKGSSRRTRFNKG
RRSKRMMVNRITRKKNIQRIAEERANRKFPNLRVLNSYSVGEDGRHKWHEVILIDPDHPAIKSDDQLSWISRTRHRLRTF
RGLTSAGRRCRGLRGQGKGSEKVRPSLRVNGAKA
;
;ARSAYSYIREAWKRPKEGQIAELMWHRMQEWRNEPAVVRIERPTRLDRARSLGYKAKQGIIVVRVAIRKGSSRRTRFNKG
RRSKRMMVNRITRKKNIQRIAEERANRKFPNLRVLNSYSVGEDGRHKWHEVILIDPDHPAIKSDDQLSWISRTRHRLRTF
RGLTSAGRRCRGLRGQGKGSEKVRPSLRVNGAKA
;
N ? 
15 'polypeptide(L)'   no no 
;ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPS
AYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYS
GDFDAADLPEHFDELRETLLDGDIEL
;
;ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPS
AYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYS
GDFDAADLPEHFDELRETLLDGDIEL
;
O ? 
16 'polypeptide(L)'   no no 
;SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD
FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
;SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD
FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
P ? 
17 'polypeptide(L)'   no no 
;TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSR
KGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
;TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSR
KGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
Q ? 
18 'polypeptide(L)'   no no 
;PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGK
EKTIIVTAAHLRRQE
;
;PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGK
EKTIIVTAAHLRRQE
;
R ? 
19 'polypeptide(L)'   no no 
;GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRY
PEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
;GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRY
PEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
S ? 
20 'polypeptide(L)'   no no 
;SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASR
IGVF
;
;SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASR
IGVF
;
T ? 
21 'polypeptide(L)'   no no 
;SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLE
KTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
;SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLE
KTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
U ? 
22 'polypeptide(L)'   no no PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA 
PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA V ? 
23 'polypeptide(L)'   no no TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE 
TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE W ? 
24 'polypeptide(L)'   no no 
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
X ? 
25 'polypeptide(L)'   no no 
;SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEE
GEAIVEAETAE
;
;SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEE
GEAIVEAETAE
;
Y ? 
26 'polypeptide(L)'   no no 
;ADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEV
EEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGK
GDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE
;
;ADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEV
EEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGK
GDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE
;
Z ? 
27 'polypeptide(L)'   no no RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA 
RTGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFKKLKRAGTGIWMCGHCGYKIAGGCYQPETVAGKAVMKA 1 ? 
28 'polypeptide(L)'   no no TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 
TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE 2 ? 
29 'polypeptide(L)'   no no GKKSKATKKRLAKLDNQNSRVPAWVMLKTDEVQRNHKRRHWRRNDTDE GKKSKATKKRLAKLDNQNSRVPAWVMLKTDEVQRNHKRRHWRRNDTDE 3 ? 
30 'polypeptide(L)'   no no 
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
4 ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    U   n 
1  2    U   n 
1  3    G   n 
1  4    G   n 
1  5    C   n 
1  6    U   n 
1  7    A   n 
1  8    C   n 
1  9    U   n 
1  10   A   n 
1  11   U   n 
1  12   G   n 
1  13   C   n 
1  14   C   n 
1  15   A   n 
1  16   G   n 
1  17   C   n 
1  18   U   n 
1  19   G   n 
1  20   G   n 
1  21   U   n 
1  22   G   n 
1  23   G   n 
1  24   A   n 
1  25   U   n 
1  26   U   n 
1  27   G   n 
1  28   C   n 
1  29   U   n 
1  30   C   n 
1  31   G   n 
1  32   G   n 
1  33   C   n 
1  34   U   n 
1  35   C   n 
1  36   A   n 
1  37   G   n 
1  38   G   n 
1  39   C   n 
1  40   G   n 
1  41   C   n 
1  42   U   n 
1  43   G   n 
1  44   A   n 
1  45   U   n 
1  46   G   n 
1  47   A   n 
1  48   A   n 
1  49   G   n 
1  50   G   n 
1  51   A   n 
1  52   C   n 
1  53   G   n 
1  54   U   n 
1  55   G   n 
1  56   C   n 
1  57   C   n 
1  58   A   n 
1  59   A   n 
1  60   G   n 
1  61   C   n 
1  62   U   n 
1  63   G   n 
1  64   C   n 
1  65   G   n 
1  66   A   n 
1  67   U   n 
1  68   A   n 
1  69   A   n 
1  70   G   n 
1  71   C   n 
1  72   C   n 
1  73   A   n 
1  74   U   n 
1  75   G   n 
1  76   G   n 
1  77   G   n 
1  78   G   n 
1  79   A   n 
1  80   G   n 
1  81   C   n 
1  82   C   n 
1  83   G   n 
1  84   C   n 
1  85   A   n 
1  86   C   n 
1  87   G   n 
1  88   G   n 
1  89   A   n 
1  90   G   n 
1  91   G   n 
1  92   C   n 
1  93   G   n 
1  94   A   n 
1  95   A   n 
1  96   G   n 
1  97   A   n 
1  98   A   n 
1  99   C   n 
1  100  C   n 
1  101  A   n 
1  102  U   n 
1  103  G   n 
1  104  G   n 
1  105  A   n 
1  106  U   n 
1  107  U   n 
1  108  U   n 
1  109  C   n 
1  110  C   n 
1  111  G   n 
1  112  A   n 
1  113  A   n 
1  114  U   n 
1  115  G   n 
1  116  A   n 
1  117  G   n 
1  118  A   n 
1  119  A   n 
1  120  U   n 
1  121  C   n 
1  122  U   n 
1  123  C   n 
1  124  U   n 
1  125  C   n 
1  126  U   n 
1  127  A   n 
1  128  A   n 
1  129  C   n 
1  130  A   n 
1  131  A   n 
1  132  U   n 
1  133  U   n 
1  134  G   n 
1  135  C   n 
1  136  U   n 
1  137  U   n 
1  138  C   n 
1  139  G   n 
1  140  C   n 
1  141  G   n 
1  142  C   n 
1  143  A   n 
1  144  A   n 
1  145  U   n 
1  146  G   n 
1  147  A   n 
1  148  G   n 
1  149  G   n 
1  150  A   n 
1  151  A   n 
1  152  C   n 
1  153  C   n 
1  154  C   n 
1  155  C   n 
1  156  G   n 
1  157  A   n 
1  158  G   n 
1  159  A   n 
1  160  A   n 
1  161  C   n 
1  162  U   n 
1  163  G   n 
1  164  A   n 
1  165  A   n 
1  166  A   n 
1  167  C   n 
1  168  A   n 
1  169  U   n 
1  170  C   n 
1  171  U   n 
1  172  C   n 
1  173  A   n 
1  174  G   n 
1  175  U   n 
1  176  A   n 
1  177  U   n 
1  178  C   n 
1  179  G   n 
1  180  G   n 
1  181  G   n 
1  182  A   n 
1  183  G   n 
1  184  G   n 
1  185  A   n 
1  186  A   n 
1  187  C   n 
1  188  A   n 
1  189  G   n 
1  190  A   n 
1  191  A   n 
1  192  A   n 
1  193  A   n 
1  194  C   n 
1  195  G   n 
1  196  C   n 
1  197  A   n 
1  198  A   n 
1  199  U   n 
1  200  G   n 
1  201  U   n 
1  202  G   n 
1  203  A   n 
1  204  U   n 
1  205  G   n 
1  206  U   n 
1  207  C   n 
1  208  G   n 
1  209  U   n 
1  210  U   n 
1  211  A   n 
1  212  G   n 
1  213  U   n 
1  214  A   n 
1  215  A   n 
1  216  C   n 
1  217  C   n 
1  218  G   n 
1  219  C   n 
1  220  G   n 
1  221  A   n 
1  222  G   n 
1  223  U   n 
1  224  G   n 
1  225  A   n 
1  226  A   n 
1  227  C   n 
1  228  G   n 
1  229  C   n 
1  230  G   n 
1  231  A   n 
1  232  U   n 
1  233  A   n 
1  234  C   n 
1  235  A   n 
1  236  G   n 
1  237  C   n 
1  238  C   n 
1  239  C   n 
1  240  A   n 
1  241  A   n 
1  242  A   n 
1  243  C   n 
1  244  C   n 
1  245  G   n 
1  246  A   n 
1  247  A   n 
1  248  G   n 
1  249  C   n 
1  250  C   n 
1  251  C   n 
1  252  U   n 
1  253  C   n 
1  254  A   n 
1  255  C   n 
1  256  G   n 
1  257  G   n 
1  258  G   n 
1  259  C   n 
1  260  A   n 
1  261  A   n 
1  262  U   n 
1  263  G   n 
1  264  U   n 
1  265  G   n 
1  266  G   n 
1  267  U   n 
1  268  G   n 
1  269  U   n 
1  270  C   n 
1  271  A   n 
1  272  G   n 
1  273  G   n 
1  274  G   n 
1  275  C   n 
1  276  U   n 
1  277  A   n 
1  278  C   n 
1  279  C   n 
1  280  U   n 
1  281  C   n 
1  282  U   n 
1  283  C   n 
1  284  A   n 
1  285  U   n 
1  286  C   n 
1  287  A   n 
1  288  G   n 
1  289  C   n 
1  290  C   n 
1  291  G   n 
1  292  A   n 
1  293  C   n 
1  294  C   n 
1  295  G   n 
1  296  U   n 
1  297  C   n 
1  298  U   n 
1  299  C   n 
1  300  G   n 
1  301  A   n 
1  302  C   n 
1  303  G   n 
1  304  A   n 
1  305  A   n 
1  306  G   n 
1  307  U   n 
1  308  C   n 
1  309  U   n 
1  310  C   n 
1  311  U   n 
1  312  U   n 
1  313  G   n 
1  314  G   n 
1  315  A   n 
1  316  A   n 
1  317  C   n 
1  318  A   n 
1  319  G   n 
1  320  A   n 
1  321  G   n 
1  322  C   n 
1  323  G   n 
1  324  U   n 
1  325  G   n 
1  326  A   n 
1  327  U   n 
1  328  A   n 
1  329  C   n 
1  330  A   n 
1  331  G   n 
1  332  G   n 
1  333  G   n 
1  334  U   n 
1  335  G   n 
1  336  A   n 
1  337  C   n 
1  338  A   n 
1  339  A   n 
1  340  C   n 
1  341  C   n 
1  342  C   n 
1  343  C   n 
1  344  G   n 
1  345  U   n 
1  346  A   n 
1  347  C   n 
1  348  U   n 
1  349  C   n 
1  350  G   n 
1  351  A   n 
1  352  G   n 
1  353  A   n 
1  354  C   n 
1  355  C   n 
1  356  A   n 
1  357  G   n 
1  358  U   n 
1  359  A   n 
1  360  C   n 
1  361  G   n 
1  362  A   n 
1  363  C   n 
1  364  G   n 
1  365  U   n 
1  366  G   n 
1  367  C   n 
1  368  G   n 
1  369  G   n 
1  370  U   n 
1  371  A   n 
1  372  G   n 
1  373  U   n 
1  374  G   n 
1  375  C   n 
1  376  C   n 
1  377  A   n 
1  378  G   n 
1  379  A   n 
1  380  G   n 
1  381  U   n 
1  382  A   n 
1  383  G   n 
1  384  C   n 
1  385  G   n 
1  386  G   n 
1  387  G   n 
1  388  G   n 
1  389  G   n 
1  390  U   n 
1  391  U   n 
1  392  G   n 
1  393  G   n 
1  394  A   n 
1  395  U   n 
1  396  A   n 
1  397  U   n 
1  398  C   n 
1  399  C   n 
1  400  C   n 
1  401  U   n 
1  402  C   n 
1  403  G   n 
1  404  C   n 
1  405  G   n 
1  406  A   n 
1  407  A   n 
1  408  U   n 
1  409  A   n 
1  410  A   n 
1  411  C   n 
1  412  G   n 
1  413  C   n 
1  414  A   n 
1  415  G   n 
1  416  G   n 
1  417  C   n 
1  418  A   n 
1  419  U   n 
1  420  C   n 
1  421  G   n 
1  422  A   n 
1  423  C   n 
1  424  U   n 
1  425  G   n 
1  426  C   n 
1  427  G   n 
1  428  A   n 
1  429  A   n 
1  430  G   n 
1  431  G   n 
1  432  C   n 
1  433  U   n 
1  434  A   n 
1  435  A   n 
1  436  A   n 
1  437  C   n 
1  438  A   n 
1  439  C   n 
1  440  A   n 
1  441  A   n 
1  442  C   n 
1  443  C   n 
1  444  U   n 
1  445  G   n 
1  446  A   n 
1  447  G   n 
1  448  A   n 
1  449  C   n 
1  450  C   n 
1  451  G   n 
1  452  A   n 
1  453  U   n 
1  454  A   n 
1  455  G   n 
1  456  U   n 
1  457  G   n 
1  458  A   n 
1  459  A   n 
1  460  C   n 
1  461  A   n 
1  462  A   n 
1  463  G   n 
1  464  U   n 
1  465  A   n 
1  466  G   n 
1  467  U   n 
1  468  G   n 
1  469  U   n 
1  470  G   n 
1  471  A   n 
1  472  A   n 
1  473  C   n 
1  474  G   n 
1  475  A   n 
1  476  A   n 
1  477  C   n 
1  478  G   n 
1  479  C   n 
1  480  U   n 
1  481  G   n 
1  482  C   n 
1  483  A   n 
1  484  A   n 
1  485  A   n 
1  486  G   n 
1  487  U   n 
1  488  A   n 
1  489  C   n 
1  490  C   n 
1  491  C   n 
1  492  U   n 
1  493  C   n 
1  494  A   n 
1  495  G   n 
1  496  A   n 
1  497  A   n 
1  498  G   n 
1  499  G   n 
1  500  G   n 
1  501  A   n 
1  502  G   n 
1  503  G   n 
1  504  C   n 
1  505  G   n 
1  506  A   n 
1  507  A   n 
1  508  A   n 
1  509  U   n 
1  510  A   n 
1  511  G   n 
1  512  A   n 
1  513  G   n 
1  514  C   n 
1  515  A   n 
1  516  U   n 
1  517  G   n 
1  518  A   n 
1  519  A   n 
1  520  A   n 
1  521  U   n 
1  522  C   n 
1  523  A   n 
1  524  G   n 
1  525  U   n 
1  526  U   n 
1  527  G   n 
1  528  G   n 
1  529  C   n 
1  530  G   n 
1  531  A   n 
1  532  U   n 
1  533  C   n 
1  534  G   n 
1  535  A   n 
1  536  G   n 
1  537  C   n 
1  538  G   n 
1  539  A   n 
1  540  C   n 
1  541  A   n 
1  542  G   n 
1  543  G   n 
1  544  G   n 
1  545  C   n 
1  546  A   n 
1  547  U   n 
1  548  A   n 
1  549  C   n 
1  550  A   n 
1  551  A   n 
1  552  G   n 
1  553  G   n 
1  554  U   n 
1  555  C   n 
1  556  C   n 
1  557  C   n 
1  558  U   n 
1  559  C   n 
1  560  G   n 
1  561  A   n 
1  562  C   n 
1  563  G   n 
1  564  A   n 
1  565  A   n 
1  566  U   n 
1  567  G   n 
1  568  A   n 
1  569  C   n 
1  570  C   n 
1  571  G   n 
1  572  A   n 
1  573  C   n 
1  574  G   n 
1  575  C   n 
1  576  G   n 
1  577  C   n 
1  578  G   n 
1  579  A   n 
1  580  G   n 
1  581  C   n 
1  582  G   n 
1  583  U   n 
1  584  C   n 
1  585  C   n 
1  586  A   n 
1  587  G   n 
1  588  U   n 
1  589  A   n 
1  590  A   n 
1  591  G   n 
1  592  A   n 
1  593  C   n 
1  594  U   n 
1  595  C   n 
1  596  A   n 
1  597  C   n 
1  598  G   n 
1  599  G   n 
1  600  G   n 
1  601  A   n 
1  602  A   n 
1  603  G   n 
1  604  C   n 
1  605  C   n 
1  606  G   n 
1  607  A   n 
1  608  U   n 
1  609  G   n 
1  610  U   n 
1  611  U   n 
1  612  C   n 
1  613  U   n 
1  614  G   n 
1  615  U   n 
1  616  C   n 
1  617  G   n 
1  618  U   n 
1  619  A   n 
1  620  C   n 
1  621  G   n 
1  622  U   n 
1  623  U   n 
1  624  U   n 
1  625  U   n 
1  626  G   n 
1  627  A   n 
1  628  A   n 
1  629  A   n 
1  630  A   n 
1  631  A   n 
1  632  C   n 
1  633  G   n 
1  634  A   n 
1  635  G   n 
1  636  C   n 
1  637  C   n 
1  638  A   n 
1  639  G   n 
1  640  G   n 
1  641  G   n 
1  642  A   n 
1  643  G   n 
1  644  U   n 
1  645  G   n 
1  646  U   n 
1  647  G   n 
1  648  U   n 
1  649  C   n 
1  650  U   n 
1  651  G   n 
1  652  C   n 
1  653  A   n 
1  654  U   n 
1  655  G   n 
1  656  G   n 
1  657  C   n 
1  658  A   n 
1  659  A   n 
1  660  G   n 
1  661  U   n 
1  662  C   n 
1  663  U   n 
1  664  A   n 
1  665  A   n 
1  666  C   n 
1  667  C   n 
1  668  G   n 
1  669  G   n 
1  670  A   n 
1  671  G   n 
1  672  U   n 
1  673  A   n 
1  674  U   n 
1  675  C   n 
1  676  C   n 
1  677  G   n 
1  678  G   n 
1  679  G   n 
1  680  G   n 
1  681  A   n 
1  682  G   n 
1  683  G   n 
1  684  C   n 
1  685  A   n 
1  686  C   n 
1  687  A   n 
1  688  G   n 
1  689  G   n 
1  690  G   n 
1  691  A   n 
1  692  A   n 
1  693  A   n 
1  694  C   n 
1  695  C   n 
1  696  G   n 
1  697  A   n 
1  698  C   n 
1  699  A   n 
1  700  U   n 
1  701  G   n 
1  702  G   n 
1  703  C   n 
1  704  C   n 
1  705  G   n 
1  706  C   n 
1  707  A   n 
1  708  G   n 
1  709  G   n 
1  710  G   n 
1  711  C   n 
1  712  U   n 
1  713  U   n 
1  714  U   n 
1  715  G   n 
1  716  C   n 
1  717  C   n 
1  718  C   n 
1  719  G   n 
1  720  A   n 
1  721  G   n 
1  722  G   n 
1  723  G   n 
1  724  C   n 
1  725  C   n 
1  726  G   n 
1  727  C   n 
1  728  C   n 
1  729  G   n 
1  730  U   n 
1  731  C   n 
1  732  U   n 
1  733  U   n 
1  734  C   n 
1  735  A   n 
1  736  A   n 
1  737  G   n 
1  738  G   n 
1  739  G   n 
1  740  C   n 
1  741  G   n 
1  742  G   n 
1  743  G   n 
1  744  G   n 
1  745  A   n 
1  746  G   n 
1  747  C   n 
1  748  C   n 
1  749  A   n 
1  750  U   n 
1  751  G   n 
1  752  U   n 
1  753  G   n 
1  754  G   n 
1  755  A   n 
1  756  C   n 
1  757  A   n 
1  758  C   n 
1  759  G   n 
1  760  A   n 
1  761  C   n 
1  762  C   n 
1  763  C   n 
1  764  G   n 
1  765  A   n 
1  766  A   n 
1  767  U   n 
1  768  C   n 
1  769  C   n 
1  770  G   n 
1  771  G   n 
1  772  A   n 
1  773  C   n 
1  774  G   n 
1  775  A   n 
1  776  U   n 
1  777  C   n 
1  778  U   n 
1  779  A   n 
1  780  C   n 
1  781  G   n 
1  782  C   n 
1  783  A   n 
1  784  U   n 
1  785  G   n 
1  786  G   n 
1  787  A   n 
1  788  C   n 
1  789  A   n 
1  790  A   n 
1  791  G   n 
1  792  A   n 
1  793  U   n 
1  794  G   n 
1  795  A   n 
1  796  A   n 
1  797  G   n 
1  798  C   n 
1  799  G   n 
1  800  U   n 
1  801  G   n 
1  802  C   n 
1  803  C   n 
1  804  G   n 
1  805  A   n 
1  806  A   n 
1  807  A   n 
1  808  G   n 
1  809  G   n 
1  810  C   n 
1  811  A   n 
1  812  C   n 
1  813  G   n 
1  814  U   n 
1  815  G   n 
1  816  G   n 
1  817  A   n 
1  818  A   n 
1  819  G   n 
1  820  U   n 
1  821  C   n 
1  822  U   n 
1  823  G   n 
1  824  U   n 
1  825  U   n 
1  826  A   n 
1  827  G   n 
1  828  A   n 
1  829  G   n 
1  830  U   n 
1  831  U   n 
1  832  G   n 
1  833  G   n 
1  834  U   n 
1  835  G   n 
1  836  U   n 
1  837  C   n 
1  838  C   n 
1  839  U   n 
1  840  A   n 
1  841  C   n 
1  842  A   n 
1  843  A   n 
1  844  U   n 
1  845  A   n 
1  846  C   n 
1  847  C   n 
1  848  C   n 
1  849  U   n 
1  850  C   n 
1  851  U   n 
1  852  C   n 
1  853  G   n 
1  854  U   n 
1  855  G   n 
1  856  A   n 
1  857  U   n 
1  858  C   n 
1  859  U   n 
1  860  A   n 
1  861  U   n 
1  862  G   n 
1  863  U   n 
1  864  G   n 
1  865  U   n 
1  866  A   n 
1  867  G   n 
1  868  G   n 
1  869  G   n 
1  870  G   n 
1  871  U   n 
1  872  G   n 
1  873  A   n 
1  874  A   n 
1  875  A   n 
1  876  G   n 
1  877  G   n 
1  878  C   n 
1  879  C   n 
1  880  C   n 
1  881  A   n 
1  882  U   n 
1  883  C   n 
1  884  G   n 
1  885  A   n 
1  886  G   n 
1  887  U   n 
1  888  C   n 
1  889  C   n 
1  890  G   n 
1  891  G   n 
1  892  C   n 
1  893  A   n 
1  894  A   n 
1  895  C   n 
1  896  A   n 
1  897  G   n 
1  898  C   n 
1  899  U   n 
1  900  G   n 
1  901  G   n 
1  902  U   n 
1  903  U   n 
1  904  C   n 
1  905  C   n 
1  906  A   n 
1  907  A   n 
1  908  U   n 
1  909  C   n 
1  910  G   n 
1  911  A   n 
1  912  A   n 
1  913  A   n 
1  914  C   n 
1  915  A   n 
1  916  U   n 
1  917  G   n 
1  918  U   n 
1  919  C   n 
1  920  G   n 
1  921  A   n 
1  922  A   n 
1  923  G   n 
1  924  C   n 
1  925  A   n 
1  926  U   n 
1  927  G   n 
1  928  A   n 
1  929  C   n 
1  930  C   n 
1  931  U   n 
1  932  C   n 
1  933  C   n 
1  934  G   n 
1  935  C   n 
1  936  C   n 
1  937  G   n 
1  938  A   n 
1  939  G   n 
1  940  G   n 
1  941  U   n 
1  942  A   n 
1  943  G   n 
1  944  U   n 
1  945  C   n 
1  946  U   n 
1  947  G   n 
1  948  U   n 
1  949  G   n 
1  950  A   n 
1  951  G   n 
1  952  G   n 
1  953  U   n 
1  954  A   n 
1  955  G   n 
1  956  A   n 
1  957  G   n 
1  958  C   n 
1  959  G   n 
1  960  A   n 
1  961  C   n 
1  962  C   n 
1  963  G   n 
1  964  A   n 
1  965  U   n 
1  966  U   n 
1  967  G   n 
1  968  G   n 
1  969  U   n 
1  970  G   n 
1  971  U   n 
1  972  G   n 
1  973  U   n 
1  974  C   n 
1  975  C   n 
1  976  G   n 
1  977  C   n 
1  978  C   n 
1  979  U   n 
1  980  C   n 
1  981  C   n 
1  982  G   n 
1  983  A   n 
1  984  G   n 
1  985  A   n 
1  986  G   n 
1  987  G   n 
1  988  A   n 
1  989  G   n 
1  990  U   n 
1  991  C   n 
1  992  G   n 
1  993  G   n 
1  994  C   n 
1  995  A   n 
1  996  C   n 
1  997  A   n 
1  998  C   n 
1  999  C   n 
1  1000 U   n 
1  1001 G   n 
1  1002 U   n 
1  1003 C   n 
1  1004 A   n 
1  1005 A   n 
1  1006 A   n 
1  1007 C   n 
1  1008 U   n 
1  1009 C   n 
1  1010 C   n 
1  1011 A   n 
1  1012 A   n 
1  1013 A   n 
1  1014 C   n 
1  1015 U   n 
1  1016 U   n 
1  1017 A   n 
1  1018 C   n 
1  1019 A   n 
1  1020 G   n 
1  1021 A   n 
1  1022 C   n 
1  1023 G   n 
1  1024 C   n 
1  1025 C   n 
1  1026 G   n 
1  1027 U   n 
1  1028 U   n 
1  1029 U   n 
1  1030 G   n 
1  1031 A   n 
1  1032 C   n 
1  1033 G   n 
1  1034 C   n 
1  1035 G   n 
1  1036 G   n 
1  1037 G   n 
1  1038 G   n 
1  1039 A   n 
1  1040 U   n 
1  1041 U   n 
1  1042 C   n 
1  1043 C   n 
1  1044 G   n 
1  1045 G   n 
1  1046 U   n 
1  1047 G   n 
1  1048 C   n 
1  1049 G   n 
1  1050 C   n 
1  1051 G   n 
1  1052 G   n 
1  1053 G   n 
1  1054 G   n 
1  1055 U   n 
1  1056 A   n 
1  1057 A   n 
1  1058 G   n 
1  1059 C   n 
1  1060 C   n 
1  1061 U   n 
1  1062 G   n 
1  1063 U   n 
1  1064 G   n 
1  1065 U   n 
1  1066 A   n 
1  1067 C   n 
1  1068 C   n 
1  1069 A   n 
1  1070 G   n 
1  1071 G   n 
1  1072 A   n 
1  1073 G   n 
1  1074 G   n 
1  1075 G   n 
1  1076 G   n 
1  1077 A   n 
1  1078 A   n 
1  1079 C   n 
1  1080 A   n 
1  1081 A   n 
1  1082 C   n 
1  1083 C   n 
1  1084 C   n 
1  1085 A   n 
1  1086 G   n 
1  1087 A   n 
1  1088 G   n 
1  1089 A   n 
1  1090 U   n 
1  1091 A   n 
1  1092 G   n 
1  1093 G   n 
1  1094 U   n 
1  1095 U   n 
1  1096 A   n 
1  1097 A   n 
1  1098 G   n 
1  1099 G   n 
1  1100 U   n 
1  1101 C   n 
1  1102 C   n 
1  1103 C   n 
1  1104 C   n 
1  1105 A   n 
1  1106 A   n 
1  1107 G   n 
1  1108 U   n 
1  1109 G   n 
1  1110 U   n 
1  1111 G   n 
1  1112 G   n 
1  1113 A   n 
1  1114 U   n 
1  1115 U   n 
1  1116 A   n 
1  1117 A   n 
1  1118 G   n 
1  1119 U   n 
1  1120 G   n 
1  1121 U   n 
1  1122 A   n 
1  1123 A   n 
1  1124 U   n 
1  1125 C   n 
1  1126 C   n 
1  1127 U   n 
1  1128 C   n 
1  1129 U   n 
1  1130 G   n 
1  1131 A   n 
1  1132 A   n 
1  1133 G   n 
1  1134 G   n 
1  1135 U   n 
1  1136 G   n 
1  1137 G   n 
1  1138 U   n 
1  1139 C   n 
1  1140 U   n 
1  1141 C   n 
1  1142 G   n 
1  1143 A   n 
1  1144 G   n 
1  1145 C   n 
1  1146 C   n 
1  1147 C   n 
1  1148 U   n 
1  1149 A   n 
1  1150 G   n 
1  1151 A   n 
1  1152 C   n 
1  1153 A   n 
1  1154 G   n 
1  1155 C   n 
1  1156 C   n 
1  1157 G   n 
1  1158 G   n 
1  1159 G   n 
1  1160 A   n 
1  1161 G   n 
1  1162 G   n 
1  1163 U   n 
1  1164 G   n 
1  1165 A   n 
1  1166 G   n 
1  1167 C   n 
1  1168 U   n 
1  1169 U   n 
1  1170 A   n 
1  1171 G   n 
1  1172 A   n 
1  1173 A   n 
1  1174 G   n 
1  1175 C   n 
1  1176 A   n 
1  1177 G   n 
1  1178 C   n 
1  1179 U   n 
1  1180 A   n 
1  1181 C   n 
1  1182 C   n 
1  1183 C   n 
1  1184 U   n 
1  1185 C   n 
1  1186 U   n 
1  1187 A   n 
1  1188 A   n 
1  1189 G   n 
1  1190 A   n 
1  1191 A   n 
1  1192 A   n 
1  1193 A   n 
1  1194 G   n 
1  1195 C   n 
1  1196 G   n 
1  1197 U   n 
1  1198 A   n 
1  1199 A   n 
1  1200 C   n 
1  1201 A   n 
1  1202 G   n 
1  1203 C   n 
1  1204 U   n 
1  1205 U   n 
1  1206 A   n 
1  1207 C   n 
1  1208 C   n 
1  1209 G   n 
1  1210 G   n 
1  1211 C   n 
1  1212 C   n 
1  1213 G   n 
1  1214 A   n 
1  1215 G   n 
1  1216 G   n 
1  1217 U   n 
1  1218 U   n 
1  1219 U   n 
1  1220 G   n 
1  1221 A   n 
1  1222 G   n 
1  1223 G   n 
1  1224 C   n 
1  1225 G   n 
1  1226 C   n 
1  1227 C   n 
1  1228 C   n 
1  1229 A   n 
1  1230 A   n 
1  1231 A   n 
1  1232 A   n 
1  1233 U   n 
1  1234 G   n 
1  1235 A   n 
1  1236 U   n 
1  1237 C   n 
1  1238 G   n 
1  1239 G   n 
1  1240 G   n 
1  1241 A   n 
1  1242 C   n 
1  1243 U   n 
1  1244 C   n 
1  1245 A   n 
1  1246 A   n 
1  1247 A   n 
1  1248 U   n 
1  1249 C   n 
1  1250 C   n 
1  1251 A   n 
1  1252 C   n 
1  1253 C   n 
1  1254 A   n 
1  1255 C   n 
1  1256 C   n 
1  1257 G   n 
1  1258 A   n 
1  1259 G   n 
1  1260 A   n 
1  1261 C   n 
1  1262 C   n 
1  1263 U   n 
1  1264 G   n 
1  1265 U   n 
1  1266 C   n 
1  1267 C   n 
1  1268 G   n 
1  1269 U   n 
1  1270 A   n 
1  1271 C   n 
1  1272 C   n 
1  1273 A   n 
1  1274 C   n 
1  1275 U   n 
1  1276 C   n 
1  1277 A   n 
1  1278 U   n 
1  1279 A   n 
1  1280 C   n 
1  1281 U   n 
1  1282 G   n 
1  1283 G   n 
1  1284 U   n 
1  1285 A   n 
1  1286 A   n 
1  1287 U   n 
1  1288 C   n 
1  1289 G   n 
1  1290 A   n 
1  1291 G   n 
1  1292 U   n 
1  1293 A   n 
1  1294 G   n 
1  1295 A   n 
1  1296 U   n 
1  1297 U   n 
1  1298 G   n 
1  1299 G   n 
1  1300 C   n 
1  1301 G   n 
1  1302 C   n 
1  1303 U   n 
1  1304 C   n 
1  1305 U   n 
1  1306 A   n 
1  1307 A   n 
1  1308 U   n 
1  1309 U   n 
1  1310 G   n 
1  1311 G   n 
1  1312 A   n 
1  1313 U   n 
1  1314 G   n 
1  1315 G   n 
1  1316 A   n 
1  1317 A   n 
1  1318 G   n 
1  1319 U   n 
1  1320 A   n 
1  1321 G   n 
1  1322 G   n 
1  1323 G   n 
1  1324 G   n 
1  1325 U   n 
1  1326 G   n 
1  1327 A   n 
1  1328 A   n 
1  1329 A   n 
1  1330 A   n 
1  1331 C   n 
1  1332 U   n 
1  1333 C   n 
1  1334 C   n 
1  1335 U   n 
1  1336 A   n 
1  1337 U   n 
1  1338 G   n 
1  1339 G   n 
1  1340 A   n 
1  1341 C   n 
1  1342 C   n 
1  1343 G   n 
1  1344 A   n 
1  1345 U   n 
1  1346 U   n 
1  1347 A   n 
1  1348 G   n 
1  1349 U   n 
1  1350 G   n 
1  1351 A   n 
1  1352 C   n 
1  1353 G   n 
1  1354 A   n 
1  1355 A   n 
1  1356 A   n 
1  1357 A   n 
1  1358 U   n 
1  1359 C   n 
1  1360 C   n 
1  1361 U   n 
1  1362 G   n 
1  1363 G   n 
1  1364 C   n 
1  1365 C   n 
1  1366 A   n 
1  1367 U   n 
1  1368 A   n 
1  1369 G   n 
1  1370 U   n 
1  1371 A   n 
1  1372 G   n 
1  1373 C   n 
1  1374 A   n 
1  1375 G   n 
1  1376 C   n 
1  1377 G   n 
1  1378 A   n 
1  1379 U   n 
1  1380 A   n 
1  1381 G   n 
1  1382 U   n 
1  1383 C   n 
1  1384 G   n 
1  1385 G   n 
1  1386 G   n 
1  1387 U   n 
1  1388 G   n 
1  1389 A   n 
1  1390 G   n 
1  1391 A   n 
1  1392 A   n 
1  1393 C   n 
1  1394 C   n 
1  1395 C   n 
1  1396 C   n 
1  1397 G   n 
1  1398 A   n 
1  1399 C   n 
1  1400 G   n 
1  1401 G   n 
1  1402 C   n 
1  1403 C   n 
1  1404 U   n 
1  1405 A   n 
1  1406 A   n 
1  1407 U   n 
1  1408 G   n 
1  1409 G   n 
1  1410 A   n 
1  1411 U   n 
1  1412 A   n 
1  1413 A   n 
1  1414 G   n 
1  1415 G   n 
1  1416 G   n 
1  1417 U   n 
1  1418 U   n 
1  1419 C   n 
1  1420 C   n 
1  1421 U   n 
1  1422 C   n 
1  1423 A   n 
1  1424 G   n 
1  1425 C   n 
1  1426 A   n 
1  1427 C   n 
1  1428 U   n 
1  1429 G   n 
1  1430 C   n 
1  1431 U   n 
1  1432 G   n 
1  1433 A   n 
1  1434 U   n 
1  1435 C   n 
1  1436 A   n 
1  1437 G   n 
1  1438 C   n 
1  1439 U   n 
1  1440 G   n 
1  1441 A   n 
1  1442 G   n 
1  1443 G   n 
1  1444 G   n 
1  1445 U   n 
1  1446 U   n 
1  1447 A   n 
1  1448 G   n 
1  1449 C   n 
1  1450 C   n 
1  1451 G   n 
1  1452 G   n 
1  1453 U   n 
1  1454 C   n 
1  1455 C   n 
1  1456 U   n 
1  1457 A   n 
1  1458 A   n 
1  1459 G   n 
1  1460 U   n 
1  1461 C   n 
1  1462 A   n 
1  1463 U   n 
1  1464 A   n 
1  1465 C   n 
1  1466 C   n 
1  1467 G   n 
1  1468 C   n 
1  1469 A   n 
1  1470 A   n 
1  1471 C   n 
1  1472 U   n 
1  1473 C   n 
1  1474 G   n 
1  1475 A   n 
1  1476 C   n 
1  1477 U   n 
1  1478 A   n 
1  1479 U   n 
1  1480 G   n 
1  1481 A   n 
1  1482 C   n 
1  1483 G   n 
1  1484 A   n 
1  1485 A   n 
1  1486 A   n 
1  1487 U   n 
1  1488 G   n 
1  1489 G   n 
1  1490 G   n 
1  1491 A   n 
1  1492 A   n 
1  1493 A   n 
1  1494 C   n 
1  1495 G   n 
1  1496 G   n 
1  1497 G   n 
1  1498 U   n 
1  1499 U   n 
1  1500 A   n 
1  1501 A   n 
1  1502 U   n 
1  1503 A   n 
1  1504 U   n 
1  1505 U   n 
1  1506 C   n 
1  1507 C   n 
1  1508 C   n 
1  1509 G   n 
1  1510 U   n 
1  1511 G   n 
1  1512 C   n 
1  1513 C   n 
1  1514 A   n 
1  1515 C   n 
1  1516 U   n 
1  1517 A   n 
1  1518 U   n 
1  1519 G   n 
1  1520 C   n 
1  1521 A   n 
1  1522 G   n 
1  1523 U   n 
1  1524 G   n 
1  1525 A   n 
1  1526 A   n 
1  1527 A   n 
1  1528 G   n 
1  1529 U   n 
1  1530 U   n 
1  1531 G   n 
1  1532 A   n 
1  1533 C   n 
1  1534 G   n 
1  1535 C   n 
1  1536 C   n 
1  1537 C   n 
1  1538 U   n 
1  1539 G   n 
1  1540 G   n 
1  1541 G   n 
1  1542 G   n 
1  1543 U   n 
1  1544 C   n 
1  1545 G   n 
1  1546 A   n 
1  1547 U   n 
1  1548 C   n 
1  1549 A   n 
1  1550 C   n 
1  1551 G   n 
1  1552 C   n 
1  1553 U   n 
1  1554 G   n 
1  1555 G   n 
1  1556 G   n 
1  1557 C   n 
1  1558 A   n 
1  1559 U   n 
1  1560 U   n 
1  1561 C   n 
1  1562 G   n 
1  1563 C   n 
1  1564 C   n 
1  1565 C   n 
1  1566 A   n 
1  1567 G   n 
1  1568 U   n 
1  1569 C   n 
1  1570 G   n 
1  1571 A   n 
1  1572 A   n 
1  1573 C   n 
1  1574 C   n 
1  1575 G   n 
1  1576 U   n 
1  1577 C   n 
1  1578 C   n 
1  1579 A   n 
1  1580 A   n 
1  1581 C   n 
1  1582 U   n 
1  1583 C   n 
1  1584 C   n 
1  1585 G   n 
1  1586 U   n 
1  1587 G   n 
1  1588 G   n 
1  1589 A   n 
1  1590 A   n 
1  1591 G   n 
1  1592 C   n 
1  1593 C   n 
1  1594 G   n 
1  1595 U   n 
1  1596 A   n 
1  1597 A   n 
1  1598 U   n 
1  1599 G   n 
1  1600 G   n 
1  1601 C   n 
1  1602 A   n 
1  1603 G   n 
1  1604 G   n 
1  1605 A   n 
1  1606 A   n 
1  1607 G   n 
1  1608 C   n 
1  1609 G   n 
1  1610 G   n 
1  1611 A   n 
1  1612 C   n 
1  1613 G   n 
1  1614 A   n 
1  1615 A   n 
1  1616 C   n 
1  1617 G   n 
1  1618 G   n 
1  1619 C   n 
1  1620 G   n 
1  1621 G   n 
1  1622 C   n 
1  1623 A   n 
1  1624 U   n 
1  1625 A   n 
1  1626 G   n 
1  1627 G   n 
1  1628 G   n 
1  1629 A   n 
1  1630 A   n 
1  1631 A   n 
1  1632 C   n 
1  1633 G   n 
1  1634 U   n 
1  1635 G   n 
1  1636 A   n 
1  1637 U   n 
1  1638 U   n 
1  1639 C   n 
1  1640 A   n 
1  1641 A   n 
1  1642 C   n 
1  1643 C   n 
1  1644 U   n 
1  1645 G   n 
1  1646 G   n 
1  1647 G   n 
1  1648 G   n 
1  1649 C   n 
1  1650 C   n 
1  1651 C   n 
1  1652 A   n 
1  1653 U   n 
1  1654 G   n 
1  1655 A   n 
1  1656 A   n 
1  1657 A   n 
1  1658 A   n 
1  1659 G   n 
1  1660 A   n 
1  1661 C   n 
1  1662 G   n 
1  1663 A   n 
1  1664 G   n 
1  1665 C   n 
1  1666 A   n 
1  1667 U   n 
1  1668 A   n 
1  1669 G   n 
1  1670 U   n 
1  1671 G   n 
1  1672 U   n 
1  1673 C   n 
1  1674 C   n 
1  1675 G   n 
1  1676 U   n 
1  1677 A   n 
1  1678 C   n 
1  1679 C   n 
1  1680 G   n 
1  1681 A   n 
1  1682 G   n 
1  1683 A   n 
1  1684 A   n 
1  1685 C   n 
1  1686 C   n 
1  1687 G   n 
1  1688 A   n 
1  1689 C   n 
1  1690 A   n 
1  1691 C   n 
1  1692 A   n 
1  1693 G   n 
1  1694 G   n 
1  1695 U   n 
1  1696 G   n 
1  1697 U   n 
1  1698 C   n 
1  1699 C   n 
1  1700 A   n 
1  1701 U   n 
1  1702 G   n 
1  1703 G   n 
1  1704 C   n 
1  1705 G   n 
1  1706 G   n 
1  1707 C   n 
1  1708 G   n 
1  1709 A   n 
1  1710 A   n 
1  1711 A   n 
1  1712 G   n 
1  1713 C   n 
1  1714 C   n 
1  1715 A   n 
1  1716 A   n 
1  1717 G   n 
1  1718 G   n 
1  1719 C   n 
1  1720 C   n 
1  1721 U   n 
1  1722 G   n 
1  1723 U   n 
1  1724 C   n 
1  1725 G   n 
1  1726 G   n 
1  1727 G   n 
1  1728 A   n 
1  1729 G   n 
1  1730 C   n 
1  1731 A   n 
1  1732 A   n 
1  1733 C   n 
1  1734 C   n 
1  1735 A   n 
1  1736 A   n 
1  1737 C   n 
1  1738 G   n 
1  1739 U   n 
1  1740 U   n 
1  1741 A   n 
1  1742 G   n 
1  1743 G   n 
1  1744 G   n 
1  1745 A   n 
1  1746 A   n 
1  1747 U   n 
1  1748 U   n 
1  1749 C   n 
1  1750 G   n 
1  1751 G   n 
1  1752 C   n 
1  1753 A   n 
1  1754 A   n 
1  1755 G   n 
1  1756 U   n 
1  1757 U   n 
1  1758 A   n 
1  1759 G   n 
1  1760 U   n 
1  1761 C   n 
1  1762 C   n 
1  1763 C   n 
1  1764 G   n 
1  1765 U   n 
1  1766 A   n 
1  1767 C   n 
1  1768 C   n 
1  1769 U   n 
1  1770 U   n 
1  1771 C   n 
1  1772 G   n 
1  1773 G   n 
1  1774 A   n 
1  1775 A   n 
1  1776 G   n 
1  1777 A   n 
1  1778 A   n 
1  1779 G   n 
1  1780 G   n 
1  1781 G   n 
1  1782 A   n 
1  1783 U   n 
1  1784 G   n 
1  1785 C   n 
1  1786 C   n 
1  1787 U   n 
1  1788 G   n 
1  1789 C   n 
1  1790 U   n 
1  1791 C   n 
1  1792 C   n 
1  1793 G   n 
1  1794 G   n 
1  1795 A   n 
1  1796 A   n 
1  1797 C   n 
1  1798 G   n 
1  1799 G   n 
1  1800 A   n 
1  1801 G   n 
1  1802 C   n 
1  1803 A   n 
1  1804 G   n 
1  1805 G   n 
1  1806 U   n 
1  1807 C   n 
1  1808 G   n 
1  1809 C   n 
1  1810 A   n 
1  1811 G   n 
1  1812 U   n 
1  1813 G   n 
1  1814 A   n 
1  1815 C   n 
1  1816 U   n 
1  1817 C   n 
1  1818 G   n 
1  1819 G   n 
1  1820 A   n 
1  1821 A   n 
1  1822 G   n 
1  1823 C   n 
1  1824 U   n 
1  1825 C   n 
1  1826 G   n 
1  1827 G   n 
1  1828 A   n 
1  1829 C   n 
1  1830 U   n 
1  1831 G   n 
1  1832 U   n 
1  1833 C   n 
1  1834 U   n 
1  1835 A   n 
1  1836 G   n 
1  1837 U   n 
1  1838 A   n 
1  1839 A   n 
1  1840 C   n 
1  1841 A   n 
1  1842 A   n 
1  1843 C   n 
1  1844 A   n 
1  1845 U   n 
1  1846 A   n 
1  1847 G   n 
1  1848 G   n 
1  1849 U   n 
1  1850 G   n 
1  1851 A   n 
1  1852 C   n 
1  1853 C   n 
1  1854 G   n 
1  1855 C   n 
1  1856 A   n 
1  1857 A   n 
1  1858 A   n 
1  1859 U   n 
1  1860 C   n 
1  1861 C   n 
1  1862 G   n 
1  1863 C   n 
1  1864 A   n 
1  1865 A   n 
1  1866 G   n 
1  1867 G   n 
1  1868 A   n 
1  1869 C   n 
1  1870 U   n 
1  1871 C   n 
1  1872 G   n 
1  1873 U   n 
1  1874 A   n 
1  1875 C   n 
1  1876 G   n 
1  1877 G   n 
1  1878 U   n 
1  1879 C   n 
1  1880 A   n 
1  1881 C   n 
1  1882 U   n 
1  1883 G   n 
1  1884 A   n 
1  1885 A   n 
1  1886 U   n 
1  1887 C   n 
1  1888 C   n 
1  1889 U   n 
1  1890 G   n 
1  1891 C   n 
1  1892 C   n 
1  1893 C   n 
1  1894 A   n 
1  1895 G   n 
1  1896 U   n 
1  1897 G   n 
1  1898 C   n 
1  1899 A   n 
1  1900 G   n 
1  1901 G   n 
1  1902 U   n 
1  1903 A   n 
1  1904 U   n 
1  1905 C   n 
1  1906 U   n 
1  1907 G   n 
1  1908 A   n 
1  1909 A   n 
1  1910 C   n 
1  1911 A   n 
1  1912 C   n 
1  1913 C   n 
1  1914 U   n 
1  1915 C   n 
1  1916 G   n 
1  1917 U   n 
1  1918 A   n 
1  1919 C   n 
1  1920 A   n 
1  1921 A   n 
1  1922 G   n 
1  1923 A   n 
1  1924 G   n 
1  1925 G   n 
1  1926 A   n 
1  1927 C   n 
1  1928 G   n 
1  1929 A   n 
1  1930 A   n 
1  1931 G   n 
1  1932 G   n 
1  1933 A   n 
1  1934 C   n 
1  1935 C   n 
1  1936 U   n 
1  1937 G   n 
1  1938 U   n 
1  1939 C   n 
1  1940 A   n 
1  1941 A   n 
1  1942 C   n 
1  1943 G   n 
1  1944 G   n 
1  1945 C   n 
1  1946 G   n 
1  1947 G   n 
1  1948 G   n 
1  1949 G   n 
1  1950 G   n 
1  1951 U   n 
1  1952 A   n 
1  1953 A   n 
1  1954 C   n 
1  1955 U   n 
1  1956 A   n 
1  1957 U   n 
1  1958 G   n 
1  1959 A   n 
1  1960 C   n 
1  1961 C   n 
1  1962 C   n 
1  1963 U   n 
1  1964 C   n 
1  1965 U   n 
1  1966 U   n 
1  1967 A   n 
1  1968 A   n 
1  1969 G   n 
1  1970 G   n 
1  1971 U   n 
1  1972 A   n 
1  1973 G   n 
1  1974 C   n 
1  1975 G   n 
1  1976 U   n 
1  1977 A   n 
1  1978 G   n 
1  1979 U   n 
1  1980 A   n 
1  1981 C   n 
1  1982 C   n 
1  1983 U   n 
1  1984 U   n 
1  1985 G   n 
1  1986 C   n 
1  1987 C   n 
1  1988 G   n 
1  1989 C   n 
1  1990 A   n 
1  1991 U   n 
1  1992 C   n 
1  1993 A   n 
1  1994 G   n 
1  1995 U   n 
1  1996 A   n 
1  1997 G   n 
1  1998 C   n 
1  1999 G   n 
1  2000 G   n 
1  2001 C   n 
1  2002 U   n 
1  2003 U   n 
1  2004 G   n 
1  2005 C   n 
1  2006 A   n 
1  2007 U   n 
1  2008 G   n 
1  2009 A   n 
1  2010 A   n 
1  2011 U   n 
1  2012 G   n 
1  2013 G   n 
1  2014 A   n 
1  2015 U   n 
1  2016 U   n 
1  2017 A   n 
1  2018 A   n 
1  2019 C   n 
1  2020 C   n 
1  2021 A   n 
1  2022 G   n 
1  2023 A   n 
1  2024 G   n 
1  2025 C   n 
1  2026 U   n 
1  2027 U   n 
1  2028 C   n 
1  2029 A   n 
1  2030 C   n 
1  2031 U   n 
1  2032 G   n 
1  2033 U   n 
1  2034 C   n 
1  2035 C   n 
1  2036 C   n 
1  2037 A   n 
1  2038 A   n 
1  2039 C   n 
1  2040 G   n 
1  2041 U   n 
1  2042 U   n 
1  2043 G   n 
1  2044 G   n 
1  2045 G   n 
1  2046 C   n 
1  2047 C   n 
1  2048 C   n 
1  2049 G   n 
1  2050 G   n 
1  2051 U   n 
1  2052 G   n 
1  2053 A   n 
1  2054 A   n 
1  2055 C   n 
1  2056 U   n 
1  2057 G   n 
1  2058 U   n 
1  2059 A   n 
1  2060 C   n 
1  2061 A   n 
1  2062 U   n 
1  2063 U   n 
1  2064 C   n 
1  2065 C   n 
1  2066 A   n 
1  2067 G   n 
1  2068 U   n 
1  2069 G   n 
1  2070 C   n 
1  2071 G   n 
1  2072 G   n 
1  2073 A   n 
1  2074 G   n 
1  2075 U   n 
1  2076 C   n 
1  2077 U   n 
1  2078 G   n 
1  2079 G   n 
1  2080 A   n 
1  2081 G   n 
1  2082 A   n 
1  2083 C   n 
1  2084 A   n 
1  2085 C   n 
1  2086 C   n 
1  2087 C   n 
1  2088 A   n 
1  2089 G   n 
1  2090 G   n 
1  2091 G   n 
1  2092 G   n 
1  2093 G   n 
1  2094 A   n 
1  2095 A   n 
1  2096 G   n 
1  2097 C   n 
1  2098 G   n 
1  2099 A   n 
1  2100 A   n 
1  2101 G   n 
1  2102 A   n 
1  2103 C   n 
1  2104 C   n 
1  2105 C   n 
1  2106 U   n 
1  2107 A   n 
1  2108 U   n 
1  2109 G   n 
1  2110 G   n 
1  2111 A   n 
1  2112 G   n 
1  2113 C   n 
1  2114 U   n 
1  2115 U   n 
1  2116 U   n 
1  2117 A   n 
1  2118 C   n 
1  2119 U   n 
1  2120 G   n 
1  2121 C   n 
1  2122 A   n 
1  2123 G   n 
1  2124 G   n 
1  2125 C   n 
1  2126 U   n 
1  2127 G   n 
1  2128 U   n 
1  2129 C   n 
1  2130 G   n 
1  2131 C   n 
1  2132 U   n 
1  2133 G   n 
1  2134 A   n 
1  2135 G   n 
1  2136 A   n 
1  2137 C   n 
1  2138 G   n 
1  2139 U   n 
1  2140 G   n 
1  2141 G   n 
1  2142 U   n 
1  2143 C   n 
1  2144 G   n 
1  2145 C   n 
1  2146 C   n 
1  2147 G   n 
1  2148 A   n 
1  2149 U   n 
1  2150 G   n 
1  2151 U   n 
1  2152 G   n 
1  2153 C   n 
1  2154 A   n 
1  2155 G   n 
1  2156 C   n 
1  2157 A   n 
1  2158 U   n 
1  2159 A   n 
1  2160 G   n 
1  2161 G   n 
1  2162 U   n 
1  2163 A   n 
1  2164 G   n 
1  2165 G   n 
1  2166 A   n 
1  2167 G   n 
1  2168 A   n 
1  2169 C   n 
1  2170 A   n 
1  2171 C   n 
1  2172 U   n 
1  2173 A   n 
1  2174 C   n 
1  2175 A   n 
1  2176 C   n 
1  2177 A   n 
1  2178 G   n 
1  2179 G   n 
1  2180 U   n 
1  2181 A   n 
1  2182 C   n 
1  2183 C   n 
1  2184 C   n 
1  2185 G   n 
1  2186 C   n 
1  2187 G   n 
1  2188 C   n 
1  2189 U   n 
1  2190 A   n 
1  2191 G   n 
1  2192 C   n 
1  2193 G   n 
1  2194 G   n 
1  2195 G   n 
1  2196 C   n 
1  2197 C   n 
1  2198 A   n 
1  2199 C   n 
1  2200 C   n 
1  2201 G   n 
1  2202 A   n 
1  2203 G   n 
1  2204 U   n 
1  2205 C   n 
1  2206 A   n 
1  2207 A   n 
1  2208 C   n 
1  2209 A   n 
1  2210 G   n 
1  2211 U   n 
1  2212 G   n 
1  2213 A   n 
1  2214 A   n 
1  2215 A   n 
1  2216 U   n 
1  2217 A   n 
1  2218 C   n 
1  2219 U   n 
1  2220 A   n 
1  2221 C   n 
1  2222 C   n 
1  2223 C   n 
1  2224 G   n 
1  2225 U   n 
1  2226 C   n 
1  2227 G   n 
1  2228 G   n 
1  2229 U   n 
1  2230 G   n 
1  2231 A   n 
1  2232 C   n 
1  2233 U   n 
1  2234 G   n 
1  2235 C   n 
1  2236 G   n 
1  2237 A   n 
1  2238 C   n 
1  2239 U   n 
1  2240 C   n 
1  2241 U   n 
1  2242 C   n 
1  2243 A   n 
1  2244 C   n 
1  2245 U   n 
1  2246 C   n 
1  2247 C   n 
1  2248 G   n 
1  2249 G   n 
1  2250 G   n 
1  2251 A   n 
1  2252 G   n 
1  2253 G   n 
1  2254 A   n 
1  2255 G   n 
1  2256 G   n 
1  2257 A   n 
1  2258 C   n 
1  2259 A   n 
1  2260 C   n 
1  2261 C   n 
1  2262 G   n 
1  2263 A   n 
1  2264 U   n 
1  2265 A   n 
1  2266 G   n 
1  2267 C   n 
1  2268 C   n 
1  2269 G   n 
1  2270 G   n 
1  2271 G   n 
1  2272 C   n 
1  2273 A   n 
1  2274 G   n 
1  2275 U   n 
1  2276 U   n 
1  2277 U   n 
1  2278 G   n 
1  2279 A   n 
1  2280 C   n 
1  2281 U   n 
1  2282 G   n 
1  2283 G   n 
1  2284 G   n 
1  2285 G   n 
1  2286 C   n 
1  2287 G   n 
1  2288 G   n 
1  2289 U   n 
1  2290 A   n 
1  2291 C   n 
1  2292 G   n 
1  2293 C   n 
1  2294 G   n 
1  2295 C   n 
1  2296 U   n 
1  2297 C   n 
1  2298 G   n 
1  2299 A   n 
1  2300 A   n 
1  2301 A   n 
1  2302 A   n 
1  2303 G   n 
1  2304 A   n 
1  2305 U   n 
1  2306 A   n 
1  2307 U   n 
1  2308 C   n 
1  2309 G   n 
1  2310 A   n 
1  2311 G   n 
1  2312 C   n 
1  2313 G   n 
1  2314 C   n 
1  2315 G   n 
1  2316 C   n 
1  2317 C   n 
1  2318 C   n 
1  2319 U   n 
1  2320 A   n 
1  2321 U   n 
1  2322 G   n 
1  2323 G   n 
1  2324 C   n 
1  2325 U   n 
1  2326 A   n 
1  2327 U   n 
1  2328 C   n 
1  2329 U   n 
1  2330 C   n 
1  2331 A   n 
1  2332 G   n 
1  2333 C   n 
1  2334 C   n 
1  2335 G   n 
1  2336 G   n 
1  2337 G   n 
1  2338 A   n 
1  2339 C   n 
1  2340 A   n 
1  2341 G   n 
1  2342 A   n 
1  2343 G   n 
1  2344 A   n 
1  2345 C   n 
1  2346 C   n 
1  2347 C   n 
1  2348 G   n 
1  2349 G   n 
1  2350 C   n 
1  2351 G   n 
1  2352 A   n 
1  2353 A   n 
1  2354 G   n 
1  2355 A   n 
1  2356 G   n 
1  2357 U   n 
1  2358 G   n 
1  2359 C   n 
1  2360 A   n 
1  2361 A   n 
1  2362 G   n 
1  2363 A   n 
1  2364 G   n 
1  2365 C   n 
1  2366 A   n 
1  2367 A   n 
1  2368 A   n 
1  2369 A   n 
1  2370 G   n 
1  2371 A   n 
1  2372 U   n 
1  2373 A   n 
1  2374 G   n 
1  2375 C   n 
1  2376 U   n 
1  2377 U   n 
1  2378 G   n 
1  2379 A   n 
1  2380 C   n 
1  2381 A   n 
1  2382 G   n 
1  2383 U   n 
1  2384 G   n 
1  2385 U   n 
1  2386 U   n 
1  2387 C   n 
1  2388 U   n 
1  2389 U   n 
1  2390 C   n 
1  2391 C   n 
1  2392 C   n 
1  2393 A   n 
1  2394 A   n 
1  2395 C   n 
1  2396 G   n 
1  2397 A   n 
1  2398 G   n 
1  2399 G   n 
1  2400 A   n 
1  2401 A   n 
1  2402 C   n 
1  2403 G   n 
1  2404 C   n 
1  2405 U   n 
1  2406 G   n 
1  2407 A   n 
1  2408 C   n 
1  2409 G   n 
1  2410 C   n 
1  2411 G   n 
1  2412 A   n 
1  2413 A   n 
1  2414 A   n 
1  2415 G   n 
1  2416 C   n 
1  2417 G   n 
1  2418 U   n 
1  2419 G   n 
1  2420 G   n 
1  2421 U   n 
1  2422 C   n 
1  2423 U   n 
1  2424 A   n 
1  2425 G   n 
1  2426 C   n 
1  2427 G   n 
1  2428 A   n 
1  2429 A   n 
1  2430 C   n 
1  2431 C   n 
1  2432 A   n 
1  2433 A   n 
1  2434 U   n 
1  2435 U   n 
1  2436 A   n 
1  2437 G   n 
1  2438 C   n 
1  2439 C   n 
1  2440 U   n 
1  2441 G   n 
1  2442 C   n 
1  2443 U   n 
1  2444 U   n 
1  2445 G   n 
1  2446 A   n 
1  2447 U   n 
1  2448 G   n 
1  2449 C   n 
1  2450 G   n 
1  2451 G   n 
1  2452 G   n 
1  2453 C   n 
1  2454 A   n 
1  2455 A   n 
1  2456 U   n 
1  2457 U   n 
1  2458 G   n 
1  2459 A   n 
1  2460 U   n 
1  2461 G   n 
1  2462 A   n 
1  2463 C   n 
1  2464 A   n 
1  2465 G   n 
1  2466 A   n 
1  2467 A   n 
1  2468 A   n 
1  2469 A   n 
1  2470 G   n 
1  2471 C   n 
1  2472 U   n 
1  2473 A   n 
1  2474 C   n 
1  2475 C   n 
1  2476 C   n 
1  2477 U   n 
1  2478 A   n 
1  2479 G   n 
1  2480 G   n 
1  2481 G   n 
1  2482 A   n 
1  2483 U   n 
1  2484 A   n 
1  2485 A   n 
1  2486 C   n 
1  2487 A   n 
1  2488 G   n 
1  2489 A   n 
1  2490 G   n 
1  2491 U   n 
1  2492 C   n 
1  2493 G   n 
1  2494 U   n 
1  2495 C   n 
1  2496 A   n 
1  2497 C   n 
1  2498 U   n 
1  2499 C   n 
1  2500 G   n 
1  2501 C   n 
1  2502 A   n 
1  2503 A   n 
1  2504 G   n 
1  2505 A   n 
1  2506 G   n 
1  2507 C   n 
1  2508 A   n 
1  2509 C   n 
1  2510 A   n 
1  2511 U   n 
1  2512 A   n 
1  2513 U   n 
1  2514 C   n 
1  2515 G   n 
1  2516 A   n 
1  2517 C   n 
1  2518 C   n 
1  2519 G   n 
1  2520 A   n 
1  2521 G   n 
1  2522 U   n 
1  2523 G   n 
1  2524 G   n 
1  2525 C   n 
1  2526 U   n 
1  2527 U   n 
1  2528 G   n 
1  2529 C   n 
1  2530 U   n 
1  2531 A   n 
1  2532 C   n 
1  2533 C   n 
1  2534 U   n 
1  2535 C   n 
1  2536 G   n 
1  2537 A   n 
1  2538 U   n 
1  2539 G   n 
1  2540 U   n 
1  2541 C   n 
1  2542 G   n 
1  2543 G   n 
1  2544 U   n 
1  2545 U   n 
1  2546 C   n 
1  2547 C   n 
1  2548 C   n 
1  2549 U   n 
1  2550 C   n 
1  2551 C   n 
1  2552 A   n 
1  2553 U   n 
1  2554 C   n 
1  2555 C   n 
1  2556 U   n 
1  2557 G   n 
1  2558 C   n 
1  2559 C   n 
1  2560 C   n 
1  2561 G   n 
1  2562 U   n 
1  2563 G   n 
1  2564 C   n 
1  2565 A   n 
1  2566 G   n 
1  2567 A   n 
1  2568 A   n 
1  2569 G   n 
1  2570 C   n 
1  2571 G   n 
1  2572 G   n 
1  2573 G   n 
1  2574 C   n 
1  2575 A   n 
1  2576 A   n 
1  2577 G   n 
1  2578 G   n 
1  2579 G   n 
1  2580 U   n 
1  2581 G   n 
1  2582 A   n 
1  2583 G   n 
1  2584 G   n 
1  2585 U   n 
1  2586 U   n 
1  2587 G   n 
1  2588 U   n 
1  2589 U   n 
1  2590 C   n 
1  2591 G   n 
1  2592 C   n 
1  2593 C   n 
1  2594 U   n 
1  2595 A   n 
1  2596 U   n 
1  2597 U   n 
1  2598 A   n 
1  2599 A   n 
1  2600 A   n 
1  2601 G   n 
1  2602 G   n 
1  2603 A   n 
1  2604 G   n 
1  2605 G   n 
1  2606 U   n 
1  2607 C   n 
1  2608 G   n 
1  2609 U   n 
1  2610 G   n 
1  2611 A   n 
1  2612 G   n 
1  2613 C   n 
1  2614 U   n 
1  2615 G   n 
1  2616 G   n 
1  2617 G   n 
1  2618 U   n 
1  2619 U   n 
1  2620 U   n 
1  2621 A   n 
1  2622 G   n 
1  2623 A   n 
1  2624 C   n 
1  2625 C   n 
1  2626 G   n 
1  2627 U   n 
1  2628 C   n 
1  2629 G   n 
1  2630 U   n 
1  2631 G   n 
1  2632 A   n 
1  2633 G   n 
1  2634 A   n 
1  2635 C   n 
1  2636 A   n 
1  2637 G   n 
1  2638 G   n 
1  2639 U   n 
1  2640 C   n 
1  2641 G   n 
1  2642 G   n 
1  2643 C   n 
1  2644 U   n 
1  2645 G   n 
1  2646 C   n 
1  2647 U   n 
1  2648 A   n 
1  2649 U   n 
1  2650 C   n 
1  2651 U   n 
1  2652 A   n 
1  2653 C   n 
1  2654 U   n 
1  2655 G   n 
1  2656 G   n 
1  2657 G   n 
1  2658 U   n 
1  2659 G   n 
1  2660 U   n 
1  2661 G   n 
1  2662 U   n 
1  2663 A   n 
1  2664 A   n 
1  2665 U   n 
1  2666 G   n 
1  2667 G   n 
1  2668 U   n 
1  2669 G   n 
1  2670 U   n 
1  2671 C   n 
1  2672 U   n 
1  2673 G   n 
1  2674 A   n 
1  2675 C   n 
1  2676 A   n 
1  2677 A   n 
1  2678 G   n 
1  2679 A   n 
1  2680 A   n 
1  2681 C   n 
1  2682 G   n 
1  2683 A   n 
1  2684 C   n 
1  2685 C   n 
1  2686 G   n 
1  2687 U   n 
1  2688 A   n 
1  2689 U   n 
1  2690 A   n 
1  2691 G   n 
1  2692 U   n 
1  2693 A   n 
1  2694 C   n 
1  2695 G   n 
1  2696 A   n 
1  2697 G   n 
1  2698 A   n 
1  2699 G   n 
1  2700 G   n 
1  2701 A   n 
1  2702 A   n 
1  2703 C   n 
1  2704 U   n 
1  2705 A   n 
1  2706 C   n 
1  2707 G   n 
1  2708 G   n 
1  2709 U   n 
1  2710 U   n 
1  2711 G   n 
1  2712 G   n 
1  2713 U   n 
1  2714 G   n 
1  2715 G   n 
1  2716 C   n 
1  2717 C   n 
1  2718 A   n 
1  2719 C   n 
1  2720 U   n 
1  2721 G   n 
1  2722 G   n 
1  2723 U   n 
1  2724 G   n 
1  2725 U   n 
1  2726 A   n 
1  2727 C   n 
1  2728 C   n 
1  2729 G   n 
1  2730 G   n 
1  2731 U   n 
1  2732 U   n 
1  2733 G   n 
1  2734 U   n 
1  2735 U   n 
1  2736 C   n 
1  2737 G   n 
1  2738 A   n 
1  2739 G   n 
1  2740 A   n 
1  2741 G   n 
1  2742 A   n 
1  2743 G   n 
1  2744 C   n 
1  2745 A   n 
1  2746 C   n 
1  2747 G   n 
1  2748 U   n 
1  2749 G   n 
1  2750 C   n 
1  2751 C   n 
1  2752 G   n 
1  2753 G   n 
1  2754 G   n 
1  2755 U   n 
1  2756 A   n 
1  2757 G   n 
1  2758 C   n 
1  2759 C   n 
1  2760 A   n 
1  2761 C   n 
1  2762 G   n 
1  2763 C   n 
1  2764 C   n 
1  2765 A   n 
1  2766 C   n 
1  2767 A   n 
1  2768 C   n 
1  2769 G   n 
1  2770 G   n 
1  2771 G   n 
1  2772 G   n 
1  2773 U   n 
1  2774 A   n 
1  2775 A   n 
1  2776 G   n 
1  2777 A   n 
1  2778 G   n 
1  2779 C   n 
1  2780 U   n 
1  2781 G   n 
1  2782 A   n 
1  2783 A   n 
1  2784 C   n 
1  2785 G   n 
1  2786 C   n 
1  2787 A   n 
1  2788 U   n 
1  2789 C   n 
1  2790 U   n 
1  2791 A   n 
1  2792 A   n 
1  2793 G   n 
1  2794 C   n 
1  2795 U   n 
1  2796 C   n 
1  2797 G   n 
1  2798 A   n 
1  2799 A   n 
1  2800 A   n 
1  2801 C   n 
1  2802 C   n 
1  2803 C   n 
1  2804 A   n 
1  2805 C   n 
1  2806 U   n 
1  2807 U   n 
1  2808 G   n 
1  2809 G   n 
1  2810 A   n 
1  2811 A   n 
1  2812 A   n 
1  2813 A   n 
1  2814 G   n 
1  2815 A   n 
1  2816 G   n 
1  2817 A   n 
1  2818 C   n 
1  2819 A   n 
1  2820 C   n 
1  2821 C   n 
1  2822 G   n 
1  2823 C   n 
1  2824 C   n 
1  2825 G   n 
1  2826 A   n 
1  2827 G   n 
1  2828 G   n 
1  2829 U   n 
1  2830 C   n 
1  2831 C   n 
1  2832 C   n 
1  2833 G   n 
1  2834 C   n 
1  2835 G   n 
1  2836 U   n 
1  2837 A   n 
1  2838 C   n 
1  2839 A   n 
1  2840 A   n 
1  2841 G   n 
1  2842 A   n 
1  2843 C   n 
1  2844 G   n 
1  2845 C   n 
1  2846 G   n 
1  2847 G   n 
1  2848 U   n 
1  2849 C   n 
1  2850 G   n 
1  2851 A   n 
1  2852 U   n 
1  2853 A   n 
1  2854 G   n 
1  2855 A   n 
1  2856 C   n 
1  2857 U   n 
1  2858 C   n 
1  2859 G   n 
1  2860 G   n 
1  2861 G   n 
1  2862 G   n 
1  2863 U   n 
1  2864 G   n 
1  2865 U   n 
1  2866 G   n 
1  2867 C   n 
1  2868 G   n 
1  2869 C   n 
1  2870 G   n 
1  2871 U   n 
1  2872 C   n 
1  2873 G   n 
1  2874 A   n 
1  2875 G   n 
1  2876 G   n 
1  2877 U   n 
1  2878 A   n 
1  2879 A   n 
1  2880 C   n 
1  2881 G   n 
1  2882 A   n 
1  2883 G   n 
1  2884 A   n 
1  2885 C   n 
1  2886 G   n 
1  2887 U   n 
1  2888 U   n 
1  2889 A   n 
1  2890 A   n 
1  2891 G   n 
1  2892 C   n 
1  2893 C   n 
1  2894 C   n 
1  2895 A   n 
1  2896 C   n 
1  2897 G   n 
1  2898 A   n 
1  2899 G   n 
1  2900 C   n 
1  2901 A   n 
1  2902 C   n 
1  2903 U   n 
1  2904 A   n 
1  2905 A   n 
1  2906 C   n 
1  2907 A   n 
1  2908 G   n 
1  2909 A   n 
1  2910 C   n 
1  2911 C   n 
1  2912 A   n 
1  2913 A   n 
1  2914 A   n 
1  2915 G   n 
1  2916 C   n 
1  2917 C   n 
1  2918 A   n 
1  2919 U   n 
1  2920 C   n 
1  2921 A   n 
1  2922 U   n 
2  1    U   n 
2  2    U   n 
2  3    A   n 
2  4    G   n 
2  5    G   n 
2  6    C   n 
2  7    G   n 
2  8    G   n 
2  9    C   n 
2  10   C   n 
2  11   A   n 
2  12   C   n 
2  13   A   n 
2  14   G   n 
2  15   C   n 
2  16   G   n 
2  17   G   n 
2  18   U   n 
2  19   G   n 
2  20   G   n 
2  21   G   n 
2  22   G   n 
2  23   U   n 
2  24   U   n 
2  25   G   n 
2  26   C   n 
2  27   C   n 
2  28   U   n 
2  29   C   n 
2  30   C   n 
2  31   C   n 
2  32   G   n 
2  33   U   n 
2  34   A   n 
2  35   C   n 
2  36   C   n 
2  37   C   n 
2  38   A   n 
2  39   U   n 
2  40   C   n 
2  41   C   n 
2  42   C   n 
2  43   G   n 
2  44   A   n 
2  45   A   n 
2  46   C   n 
2  47   A   n 
2  48   C   n 
2  49   G   n 
2  50   G   n 
2  51   A   n 
2  52   A   n 
2  53   G   n 
2  54   A   n 
2  55   U   n 
2  56   A   n 
2  57   A   n 
2  58   G   n 
2  59   C   n 
2  60   C   n 
2  61   C   n 
2  62   A   n 
2  63   C   n 
2  64   C   n 
2  65   A   n 
2  66   G   n 
2  67   C   n 
2  68   G   n 
2  69   U   n 
2  70   U   n 
2  71   C   n 
2  72   C   n 
2  73   G   n 
2  74   G   n 
2  75   G   n 
2  76   G   n 
2  77   A   n 
2  78   G   n 
2  79   U   n 
2  80   A   n 
2  81   C   n 
2  82   U   n 
2  83   G   n 
2  84   G   n 
2  85   A   n 
2  86   G   n 
2  87   U   n 
2  88   G   n 
2  89   C   n 
2  90   G   n 
2  91   C   n 
2  92   G   n 
2  93   A   n 
2  94   G   n 
2  95   C   n 
2  96   C   n 
2  97   U   n 
2  98   C   n 
2  99   U   n 
2  100  G   n 
2  101  G   n 
2  102  G   n 
2  103  A   n 
2  104  A   n 
2  105  A   n 
2  106  C   n 
2  107  C   n 
2  108  C   n 
2  109  G   n 
2  110  G   n 
2  111  U   n 
2  112  U   n 
2  113  C   n 
2  114  G   n 
2  115  C   n 
2  116  C   n 
2  117  G   n 
2  118  C   n 
2  119  C   n 
2  120  A   n 
2  121  C   n 
2  122  C   n 
3  1    GLY n 
3  2    ARG n 
3  3    ARG n 
3  4    ILE n 
3  5    GLN n 
3  6    GLY n 
3  7    GLN n 
3  8    ARG n 
3  9    ARG n 
3  10   GLY n 
3  11   ARG n 
3  12   GLY n 
3  13   THR n 
3  14   SER n 
3  15   THR n 
3  16   PHE n 
3  17   ARG n 
3  18   ALA n 
3  19   PRO n 
3  20   SER n 
3  21   HIS n 
3  22   ARG n 
3  23   TYR n 
3  24   LYS n 
3  25   ALA n 
3  26   ASP n 
3  27   LEU n 
3  28   GLU n 
3  29   HIS n 
3  30   ARG n 
3  31   LYS n 
3  32   VAL n 
3  33   GLU n 
3  34   ASP n 
3  35   GLY n 
3  36   ASP n 
3  37   VAL n 
3  38   ILE n 
3  39   ALA n 
3  40   GLY n 
3  41   THR n 
3  42   VAL n 
3  43   VAL n 
3  44   ASP n 
3  45   ILE n 
3  46   GLU n 
3  47   HIS n 
3  48   ASP n 
3  49   PRO n 
3  50   ALA n 
3  51   ARG n 
3  52   SER n 
3  53   ALA n 
3  54   PRO n 
3  55   VAL n 
3  56   ALA n 
3  57   ALA n 
3  58   VAL n 
3  59   GLU n 
3  60   PHE n 
3  61   GLU n 
3  62   ASP n 
3  63   GLY n 
3  64   ASP n 
3  65   ARG n 
3  66   ARG n 
3  67   LEU n 
3  68   ILE n 
3  69   LEU n 
3  70   ALA n 
3  71   PRO n 
3  72   GLU n 
3  73   GLY n 
3  74   VAL n 
3  75   GLY n 
3  76   VAL n 
3  77   GLY n 
3  78   ASP n 
3  79   GLU n 
3  80   LEU n 
3  81   GLN n 
3  82   VAL n 
3  83   GLY n 
3  84   VAL n 
3  85   ASP n 
3  86   ALA n 
3  87   GLU n 
3  88   ILE n 
3  89   ALA n 
3  90   PRO n 
3  91   GLY n 
3  92   ASN n 
3  93   THR n 
3  94   LEU n 
3  95   PRO n 
3  96   LEU n 
3  97   ALA n 
3  98   GLU n 
3  99   ILE n 
3  100  PRO n 
3  101  GLU n 
3  102  GLY n 
3  103  VAL n 
3  104  PRO n 
3  105  VAL n 
3  106  CYS n 
3  107  ASN n 
3  108  VAL n 
3  109  GLU n 
3  110  SER n 
3  111  SER n 
3  112  PRO n 
3  113  GLY n 
3  114  ASP n 
3  115  GLY n 
3  116  GLY n 
3  117  LYS n 
3  118  PHE n 
3  119  ALA n 
3  120  ARG n 
3  121  ALA n 
3  122  SER n 
3  123  GLY n 
3  124  VAL n 
3  125  ASN n 
3  126  ALA n 
3  127  GLN n 
3  128  LEU n 
3  129  LEU n 
3  130  THR n 
3  131  HIS n 
3  132  ASP n 
3  133  ARG n 
3  134  ASN n 
3  135  VAL n 
3  136  ALA n 
3  137  VAL n 
3  138  VAL n 
3  139  LYS n 
3  140  LEU n 
3  141  PRO n 
3  142  SER n 
3  143  GLY n 
3  144  GLU n 
3  145  MET n 
3  146  LYS n 
3  147  ARG n 
3  148  LEU n 
3  149  ASP n 
3  150  PRO n 
3  151  GLN n 
3  152  CYS n 
3  153  ARG n 
3  154  ALA n 
3  155  THR n 
3  156  ILE n 
3  157  GLY n 
3  158  VAL n 
3  159  VAL n 
3  160  GLY n 
3  161  GLY n 
3  162  GLY n 
3  163  GLY n 
3  164  ARG n 
3  165  THR n 
3  166  ASP n 
3  167  LYS n 
3  168  PRO n 
3  169  PHE n 
3  170  VAL n 
3  171  LYS n 
3  172  ALA n 
3  173  GLY n 
3  174  ASN n 
3  175  LYS n 
3  176  HIS n 
3  177  HIS n 
3  178  LYS n 
3  179  MET n 
3  180  LYS n 
3  181  ALA n 
3  182  ARG n 
3  183  GLY n 
3  184  THR n 
3  185  LYS n 
3  186  TRP n 
3  187  PRO n 
3  188  ASN n 
3  189  VAL n 
3  190  ARG n 
3  191  GLY n 
3  192  VAL n 
3  193  ALA n 
3  194  MET n 
3  195  ASN n 
3  196  ALA n 
3  197  VAL n 
3  198  ASP n 
3  199  HIS n 
3  200  PRO n 
3  201  PHE n 
3  202  GLY n 
3  203  GLY n 
3  204  GLY n 
3  205  GLY n 
3  206  ARG n 
3  207  GLN n 
3  208  HIS n 
3  209  PRO n 
3  210  GLY n 
3  211  LYS n 
3  212  PRO n 
3  213  LYS n 
3  214  SER n 
3  215  ILE n 
3  216  SER n 
3  217  ARG n 
3  218  ASN n 
3  219  ALA n 
3  220  PRO n 
3  221  PRO n 
3  222  GLY n 
3  223  ARG n 
3  224  LYS n 
3  225  VAL n 
3  226  GLY n 
3  227  ASP n 
3  228  ILE n 
3  229  ALA n 
3  230  SER n 
3  231  LYS n 
3  232  ARG n 
3  233  THR n 
3  234  GLY n 
3  235  ARG n 
3  236  GLY n 
3  237  GLY n 
3  238  ASN n 
3  239  GLU n 
4  1    PRO n 
4  2    GLN n 
4  3    PRO n 
4  4    SER n 
4  5    ARG n 
4  6    PRO n 
4  7    ARG n 
4  8    LYS n 
4  9    GLY n 
4  10   SER n 
4  11   LEU n 
4  12   GLY n 
4  13   PHE n 
4  14   GLY n 
4  15   PRO n 
4  16   ARG n 
4  17   LYS n 
4  18   ARG n 
4  19   SER n 
4  20   THR n 
4  21   SER n 
4  22   GLU n 
4  23   THR n 
4  24   PRO n 
4  25   ARG n 
4  26   PHE n 
4  27   ASN n 
4  28   SER n 
4  29   TRP n 
4  30   PRO n 
4  31   SER n 
4  32   ASP n 
4  33   ASP n 
4  34   GLY n 
4  35   GLN n 
4  36   PRO n 
4  37   GLY n 
4  38   VAL n 
4  39   GLN n 
4  40   GLY n 
4  41   PHE n 
4  42   ALA n 
4  43   GLY n 
4  44   TYR n 
4  45   LYS n 
4  46   ALA n 
4  47   GLY n 
4  48   MET n 
4  49   THR n 
4  50   HIS n 
4  51   VAL n 
4  52   VAL n 
4  53   LEU n 
4  54   VAL n 
4  55   ASN n 
4  56   ASP n 
4  57   GLU n 
4  58   PRO n 
4  59   ASN n 
4  60   SER n 
4  61   PRO n 
4  62   ARG n 
4  63   GLU n 
4  64   GLY n 
4  65   MET n 
4  66   GLU n 
4  67   GLU n 
4  68   THR n 
4  69   VAL n 
4  70   PRO n 
4  71   VAL n 
4  72   THR n 
4  73   VAL n 
4  74   ILE n 
4  75   GLU n 
4  76   THR n 
4  77   PRO n 
4  78   PRO n 
4  79   MET n 
4  80   ARG n 
4  81   ALA n 
4  82   VAL n 
4  83   ALA n 
4  84   LEU n 
4  85   ARG n 
4  86   ALA n 
4  87   TYR n 
4  88   GLU n 
4  89   ASP n 
4  90   THR n 
4  91   PRO n 
4  92   TYR n 
4  93   GLY n 
4  94   GLN n 
4  95   ARG n 
4  96   PRO n 
4  97   LEU n 
4  98   THR n 
4  99   GLU n 
4  100  VAL n 
4  101  TRP n 
4  102  THR n 
4  103  ASP n 
4  104  GLU n 
4  105  PHE n 
4  106  HIS n 
4  107  SER n 
4  108  GLU n 
4  109  LEU n 
4  110  ASP n 
4  111  ARG n 
4  112  THR n 
4  113  LEU n 
4  114  ASP n 
4  115  VAL n 
4  116  PRO n 
4  117  GLU n 
4  118  ASP n 
4  119  HIS n 
4  120  ASP n 
4  121  PRO n 
4  122  ASP n 
4  123  ALA n 
4  124  ALA n 
4  125  GLU n 
4  126  GLU n 
4  127  GLN n 
4  128  ILE n 
4  129  ARG n 
4  130  ASP n 
4  131  ALA n 
4  132  HIS n 
4  133  GLU n 
4  134  ALA n 
4  135  GLY n 
4  136  ASP n 
4  137  LEU n 
4  138  GLY n 
4  139  ASP n 
4  140  LEU n 
4  141  ARG n 
4  142  LEU n 
4  143  ILE n 
4  144  THR n 
4  145  HIS n 
4  146  THR n 
4  147  VAL n 
4  148  PRO n 
4  149  ASP n 
4  150  ALA n 
4  151  VAL n 
4  152  PRO n 
4  153  SER n 
4  154  VAL n 
4  155  PRO n 
4  156  LYS n 
4  157  LYS n 
4  158  LYS n 
4  159  PRO n 
4  160  ASP n 
4  161  VAL n 
4  162  MET n 
4  163  GLU n 
4  164  THR n 
4  165  ARG n 
4  166  VAL n 
4  167  GLY n 
4  168  GLY n 
4  169  GLY n 
4  170  SER n 
4  171  VAL n 
4  172  SER n 
4  173  ASP n 
4  174  ARG n 
4  175  LEU n 
4  176  ASP n 
4  177  HIS n 
4  178  ALA n 
4  179  LEU n 
4  180  ASP n 
4  181  ILE n 
4  182  VAL n 
4  183  GLU n 
4  184  ASP n 
4  185  GLY n 
4  186  GLY n 
4  187  GLU n 
4  188  HIS n 
4  189  ALA n 
4  190  MET n 
4  191  ASN n 
4  192  ASP n 
4  193  ILE n 
4  194  PHE n 
4  195  ARG n 
4  196  ALA n 
4  197  GLY n 
4  198  GLU n 
4  199  TYR n 
4  200  ALA n 
4  201  ASP n 
4  202  VAL n 
4  203  ALA n 
4  204  GLY n 
4  205  VAL n 
4  206  THR n 
4  207  LYS n 
4  208  GLY n 
4  209  LYS n 
4  210  GLY n 
4  211  THR n 
4  212  GLN n 
4  213  GLY n 
4  214  PRO n 
4  215  VAL n 
4  216  LYS n 
4  217  ARG n 
4  218  TRP n 
4  219  GLY n 
4  220  VAL n 
4  221  GLN n 
4  222  LYS n 
4  223  ARG n 
4  224  LYS n 
4  225  GLY n 
4  226  LYS n 
4  227  HIS n 
4  228  ALA n 
4  229  ARG n 
4  230  GLN n 
4  231  GLY n 
4  232  TRP n 
4  233  ARG n 
4  234  ARG n 
4  235  ARG n 
4  236  ILE n 
4  237  GLY n 
4  238  ASN n 
4  239  LEU n 
4  240  GLY n 
4  241  PRO n 
4  242  TRP n 
4  243  ASN n 
4  244  PRO n 
4  245  SER n 
4  246  ARG n 
4  247  VAL n 
4  248  ARG n 
4  249  SER n 
4  250  THR n 
4  251  VAL n 
4  252  PRO n 
4  253  GLN n 
4  254  GLN n 
4  255  GLY n 
4  256  GLN n 
4  257  THR n 
4  258  GLY n 
4  259  TYR n 
4  260  HIS n 
4  261  GLN n 
4  262  ARG n 
4  263  THR n 
4  264  GLU n 
4  265  LEU n 
4  266  ASN n 
4  267  LYS n 
4  268  ARG n 
4  269  LEU n 
4  270  ILE n 
4  271  ASP n 
4  272  ILE n 
4  273  GLY n 
4  274  GLU n 
4  275  GLY n 
4  276  ASP n 
4  277  GLU n 
4  278  PRO n 
4  279  THR n 
4  280  VAL n 
4  281  ASP n 
4  282  GLY n 
4  283  GLY n 
4  284  PHE n 
4  285  VAL n 
4  286  ASN n 
4  287  TYR n 
4  288  GLY n 
4  289  GLU n 
4  290  VAL n 
4  291  ASP n 
4  292  GLY n 
4  293  PRO n 
4  294  TYR n 
4  295  THR n 
4  296  LEU n 
4  297  VAL n 
4  298  LYS n 
4  299  GLY n 
4  300  SER n 
4  301  VAL n 
4  302  PRO n 
4  303  GLY n 
4  304  PRO n 
4  305  ASP n 
4  306  LYS n 
4  307  ARG n 
4  308  LEU n 
4  309  VAL n 
4  310  ARG n 
4  311  PHE n 
4  312  ARG n 
4  313  PRO n 
4  314  ALA n 
4  315  VAL n 
4  316  ARG n 
4  317  PRO n 
4  318  ASN n 
4  319  ASP n 
4  320  GLN n 
4  321  PRO n 
4  322  ARG n 
4  323  LEU n 
4  324  ASP n 
4  325  PRO n 
4  326  GLU n 
4  327  VAL n 
4  328  ARG n 
4  329  TYR n 
4  330  VAL n 
4  331  SER n 
4  332  ASN n 
4  333  GLU n 
4  334  SER n 
4  335  ASN n 
4  336  GLN n 
4  337  GLY n 
5  1    MET n 
5  2    GLN n 
5  3    ALA n 
5  4    THR n 
5  5    ILE n 
5  6    TYR n 
5  7    ASP n 
5  8    LEU n 
5  9    ASP n 
5  10   GLY n 
5  11   ASN n 
5  12   THR n 
5  13   ASP n 
5  14   GLY n 
5  15   GLU n 
5  16   VAL n 
5  17   ASP n 
5  18   LEU n 
5  19   PRO n 
5  20   ASP n 
5  21   VAL n 
5  22   PHE n 
5  23   GLU n 
5  24   THR n 
5  25   PRO n 
5  26   VAL n 
5  27   ARG n 
5  28   SER n 
5  29   ASP n 
5  30   LEU n 
5  31   ILE n 
5  32   GLY n 
5  33   LYS n 
5  34   ALA n 
5  35   VAL n 
5  36   ARG n 
5  37   ALA n 
5  38   ALA n 
5  39   GLN n 
5  40   ALA n 
5  41   ASN n 
5  42   ARG n 
5  43   LYS n 
5  44   GLN n 
5  45   ASP n 
5  46   TYR n 
5  47   GLY n 
5  48   SER n 
5  49   ASP n 
5  50   GLU n 
5  51   TYR n 
5  52   ALA n 
5  53   GLY n 
5  54   LEU n 
5  55   ARG n 
5  56   THR n 
5  57   PRO n 
5  58   ALA n 
5  59   GLU n 
5  60   SER n 
5  61   PHE n 
5  62   GLY n 
5  63   SER n 
5  64   GLY n 
5  65   ARG n 
5  66   GLY n 
5  67   GLN n 
5  68   ALA n 
5  69   HIS n 
5  70   VAL n 
5  71   PRO n 
5  72   LYS n 
5  73   LEU n 
5  74   ASP n 
5  75   GLY n 
5  76   ARG n 
5  77   ALA n 
5  78   ARG n 
5  79   ARG n 
5  80   VAL n 
5  81   PRO n 
5  82   GLN n 
5  83   ALA n 
5  84   VAL n 
5  85   LYS n 
5  86   GLY n 
5  87   ARG n 
5  88   SER n 
5  89   ALA n 
5  90   HIS n 
5  91   PRO n 
5  92   PRO n 
5  93   LYS n 
5  94   THR n 
5  95   GLU n 
5  96   LYS n 
5  97   ASP n 
5  98   ARG n 
5  99   SER n 
5  100  LEU n 
5  101  ASP n 
5  102  LEU n 
5  103  ASN n 
5  104  ASP n 
5  105  LYS n 
5  106  GLU n 
5  107  ARG n 
5  108  GLN n 
5  109  LEU n 
5  110  ALA n 
5  111  VAL n 
5  112  ARG n 
5  113  SER n 
5  114  ALA n 
5  115  LEU n 
5  116  ALA n 
5  117  ALA n 
5  118  THR n 
5  119  ALA n 
5  120  ASP n 
5  121  ALA n 
5  122  ASP n 
5  123  LEU n 
5  124  VAL n 
5  125  ALA n 
5  126  ASP n 
5  127  ARG n 
5  128  GLY n 
5  129  HIS n 
5  130  GLU n 
5  131  PHE n 
5  132  ASP n 
5  133  ARG n 
5  134  ASP n 
5  135  GLU n 
5  136  VAL n 
5  137  PRO n 
5  138  VAL n 
5  139  VAL n 
5  140  VAL n 
5  141  SER n 
5  142  ASP n 
5  143  ASP n 
5  144  PHE n 
5  145  GLU n 
5  146  ASP n 
5  147  LEU n 
5  148  VAL n 
5  149  LYS n 
5  150  THR n 
5  151  GLN n 
5  152  GLU n 
5  153  VAL n 
5  154  VAL n 
5  155  SER n 
5  156  LEU n 
5  157  LEU n 
5  158  GLU n 
5  159  ALA n 
5  160  LEU n 
5  161  ASP n 
5  162  VAL n 
5  163  HIS n 
5  164  ALA n 
5  165  ASP n 
5  166  ILE n 
5  167  ASP n 
5  168  ARG n 
5  169  ALA n 
5  170  ASP n 
5  171  GLU n 
5  172  THR n 
5  173  LYS n 
5  174  ILE n 
5  175  LYS n 
5  176  ALA n 
5  177  GLY n 
5  178  GLN n 
5  179  GLY n 
5  180  SER n 
5  181  ALA n 
5  182  ARG n 
5  183  GLY n 
5  184  ARG n 
5  185  LYS n 
5  186  TYR n 
5  187  ARG n 
5  188  ARG n 
5  189  PRO n 
5  190  ALA n 
5  191  SER n 
5  192  ILE n 
5  193  LEU n 
5  194  PHE n 
5  195  VAL n 
5  196  THR n 
5  197  SER n 
5  198  ASP n 
5  199  GLU n 
5  200  PRO n 
5  201  SER n 
5  202  THR n 
5  203  ALA n 
5  204  ALA n 
5  205  ARG n 
5  206  ASN n 
5  207  LEU n 
5  208  ALA n 
5  209  GLY n 
5  210  ALA n 
5  211  ASP n 
5  212  VAL n 
5  213  ALA n 
5  214  THR n 
5  215  ALA n 
5  216  SER n 
5  217  GLU n 
5  218  VAL n 
5  219  ASN n 
5  220  THR n 
5  221  GLU n 
5  222  ASP n 
5  223  LEU n 
5  224  ALA n 
5  225  PRO n 
5  226  GLY n 
5  227  GLY n 
5  228  ALA n 
5  229  PRO n 
5  230  GLY n 
5  231  ARG n 
5  232  LEU n 
5  233  THR n 
5  234  VAL n 
5  235  PHE n 
5  236  THR n 
5  237  GLU n 
5  238  SER n 
5  239  ALA n 
5  240  LEU n 
5  241  ALA n 
5  242  GLU n 
5  243  VAL n 
5  244  ALA n 
5  245  GLU n 
5  246  ARG n 
6  1    SER n 
6  2    SER n 
6  3    GLU n 
6  4    SER n 
6  5    GLU n 
6  6    SER n 
6  7    GLY n 
6  8    GLY n 
6  9    ASP n 
6  10   PHE n 
6  11   HIS n 
6  12   GLU n 
6  13   MET n 
6  14   ARG n 
6  15   GLU n 
6  16   PRO n 
6  17   ARG n 
6  18   ILE n 
6  19   GLU n 
6  20   LYS n 
6  21   VAL n 
6  22   VAL n 
6  23   VAL n 
6  24   HIS n 
6  25   MET n 
6  26   GLY n 
6  27   ILE n 
6  28   GLY n 
6  29   HIS n 
6  30   GLY n 
6  31   GLY n 
6  32   ARG n 
6  33   ASP n 
6  34   LEU n 
6  35   ALA n 
6  36   ASN n 
6  37   ALA n 
6  38   GLU n 
6  39   ASP n 
6  40   ILE n 
6  41   LEU n 
6  42   GLY n 
6  43   GLU n 
6  44   ILE n 
6  45   THR n 
6  46   GLY n 
6  47   GLN n 
6  48   MET n 
6  49   PRO n 
6  50   VAL n 
6  51   ARG n 
6  52   THR n 
6  53   LYS n 
6  54   ALA n 
6  55   LYS n 
6  56   ARG n 
6  57   THR n 
6  58   VAL n 
6  59   GLY n 
6  60   GLU n 
6  61   PHE n 
6  62   ASP n 
6  63   ILE n 
6  64   ARG n 
6  65   GLU n 
6  66   GLY n 
6  67   ASP n 
6  68   PRO n 
6  69   ILE n 
6  70   GLY n 
6  71   ALA n 
6  72   LYS n 
6  73   VAL n 
6  74   THR n 
6  75   LEU n 
6  76   ARG n 
6  77   ASP n 
6  78   GLU n 
6  79   MET n 
6  80   ALA n 
6  81   GLU n 
6  82   GLU n 
6  83   PHE n 
6  84   LEU n 
6  85   GLN n 
6  86   THR n 
6  87   ALA n 
6  88   LEU n 
6  89   PRO n 
6  90   LEU n 
6  91   ALA n 
6  92   GLU n 
6  93   LEU n 
6  94   ALA n 
6  95   THR n 
6  96   SER n 
6  97   GLN n 
6  98   PHE n 
6  99   ASP n 
6  100  ASP n 
6  101  THR n 
6  102  GLY n 
6  103  ASN n 
6  104  PHE n 
6  105  SER n 
6  106  PHE n 
6  107  GLY n 
6  108  VAL n 
6  109  GLU n 
6  110  GLU n 
6  111  HIS n 
6  112  THR n 
6  113  GLU n 
6  114  PHE n 
6  115  PRO n 
6  116  SER n 
6  117  GLN n 
6  118  GLU n 
6  119  TYR n 
6  120  ASP n 
6  121  PRO n 
6  122  SER n 
6  123  ILE n 
6  124  GLY n 
6  125  ILE n 
6  126  TYR n 
6  127  GLY n 
6  128  LEU n 
6  129  ASP n 
6  130  VAL n 
6  131  THR n 
6  132  VAL n 
6  133  ASN n 
6  134  LEU n 
6  135  VAL n 
6  136  ARG n 
6  137  PRO n 
6  138  GLY n 
6  139  TYR n 
6  140  ARG n 
6  141  VAL n 
6  142  ALA n 
6  143  LYS n 
6  144  ARG n 
6  145  ASP n 
6  146  LYS n 
6  147  ALA n 
6  148  SER n 
6  149  ARG n 
6  150  SER n 
6  151  ILE n 
6  152  PRO n 
6  153  THR n 
6  154  LYS n 
6  155  HIS n 
6  156  ARG n 
6  157  LEU n 
6  158  ASN n 
6  159  PRO n 
6  160  ALA n 
6  161  ASP n 
6  162  ALA n 
6  163  VAL n 
6  164  ALA n 
6  165  PHE n 
6  166  ILE n 
6  167  GLU n 
6  168  SER n 
6  169  THR n 
6  170  TYR n 
6  171  ASP n 
6  172  VAL n 
6  173  GLU n 
6  174  VAL n 
6  175  SER n 
6  176  GLU n 
7  1    PRO n 
7  2    ARG n 
7  3    VAL n 
7  4    GLU n 
7  5    LEU n 
7  6    GLU n 
7  7    ILE n 
7  8    PRO n 
7  9    GLU n 
7  10   ASP n 
7  11   VAL n 
7  12   ASP n 
7  13   ALA n 
7  14   GLU n 
7  15   GLN n 
7  16   ASP n 
7  17   HIS n 
7  18   LEU n 
7  19   ASP n 
7  20   ILE n 
7  21   THR n 
7  22   VAL n 
7  23   GLU n 
7  24   GLY n 
7  25   ASP n 
7  26   ASN n 
7  27   GLY n 
7  28   SER n 
7  29   VAL n 
7  30   THR n 
7  31   ARG n 
7  32   ARG n 
7  33   LEU n 
7  34   TRP n 
7  35   TYR n 
7  36   PRO n 
7  37   ASP n 
7  38   ILE n 
7  39   ASP n 
7  40   VAL n 
7  41   SER n 
7  42   VAL n 
7  43   ASP n 
7  44   GLY n 
7  45   ASP n 
7  46   THR n 
7  47   VAL n 
7  48   VAL n 
7  49   ILE n 
7  50   GLU n 
7  51   SER n 
7  52   ASP n 
7  53   GLU n 
7  54   ASP n 
7  55   ASN n 
7  56   ALA n 
7  57   LYS n 
7  58   THR n 
7  59   MET n 
7  60   SER n 
7  61   THR n 
7  62   ILE n 
7  63   GLY n 
7  64   THR n 
7  65   PHE n 
7  66   GLN n 
7  67   SER n 
7  68   HIS n 
7  69   ILE n 
7  70   GLU n 
7  71   ASN n 
7  72   MET n 
7  73   PHE n 
7  74   HIS n 
7  75   GLY n 
7  76   VAL n 
7  77   THR n 
7  78   GLU n 
7  79   GLY n 
7  80   TRP n 
7  81   GLU n 
7  82   TYR n 
7  83   GLY n 
7  84   MET n 
7  85   GLU n 
7  86   VAL n 
7  87   PHE n 
7  88   TYR n 
7  89   SER n 
7  90   HIS n 
7  91   PHE n 
7  92   PRO n 
7  93   MET n 
7  94   GLN n 
7  95   VAL n 
7  96   ASN n 
7  97   VAL n 
7  98   GLU n 
7  99   GLY n 
7  100  ASP n 
7  101  GLU n 
7  102  VAL n 
7  103  VAL n 
7  104  ILE n 
7  105  GLU n 
7  106  ASN n 
7  107  PHE n 
7  108  LEU n 
7  109  GLY n 
7  110  GLU n 
7  111  LYS n 
7  112  ALA n 
7  113  PRO n 
7  114  ARG n 
7  115  ARG n 
7  116  THR n 
7  117  THR n 
7  118  ILE n 
7  119  HIS n 
7  120  GLY n 
7  121  ASP n 
7  122  THR n 
7  123  ASP n 
7  124  VAL n 
7  125  GLU n 
7  126  ILE n 
7  127  ASP n 
7  128  GLY n 
7  129  GLU n 
7  130  GLU n 
7  131  LEU n 
7  132  THR n 
7  133  VAL n 
7  134  SER n 
7  135  GLY n 
7  136  PRO n 
7  137  ASP n 
7  138  ILE n 
7  139  GLU n 
7  140  ALA n 
7  141  VAL n 
7  142  GLY n 
7  143  GLN n 
7  144  THR n 
7  145  ALA n 
7  146  ALA n 
7  147  ASP n 
7  148  ILE n 
7  149  GLU n 
7  150  GLN n 
7  151  LEU n 
7  152  THR n 
7  153  ARG n 
7  154  ILE n 
7  155  ASN n 
7  156  ASP n 
7  157  LYS n 
7  158  ASP n 
7  159  VAL n 
7  160  ARG n 
7  161  VAL n 
7  162  PHE n 
7  163  GLN n 
7  164  ASP n 
7  165  GLY n 
7  166  VAL n 
7  167  TYR n 
7  168  ILE n 
7  169  THR n 
7  170  ARG n 
7  171  LYS n 
7  172  PRO n 
7  173  ASN n 
7  174  ARG n 
7  175  GLY n 
7  176  ASP n 
7  177  ALA n 
8  1    PRO n 
8  2    VAL n 
8  3    TYR n 
8  4    VAL n 
8  5    ASP n 
8  6    PHE n 
8  7    ASP n 
8  8    VAL n 
8  9    PRO n 
8  10   ALA n 
8  11   ASP n 
8  12   LEU n 
8  13   GLU n 
8  14   ASP n 
8  15   ASP n 
8  16   ALA n 
8  17   LEU n 
8  18   GLU n 
8  19   ALA n 
8  20   LEU n 
8  21   GLU n 
8  22   VAL n 
8  23   ALA n 
8  24   ARG n 
8  25   ASP n 
8  26   THR n 
8  27   GLY n 
8  28   ALA n 
8  29   VAL n 
8  30   LYS n 
8  31   LYS n 
8  32   GLY n 
8  33   THR n 
8  34   ASN n 
8  35   GLU n 
8  36   THR n 
8  37   THR n 
8  38   LYS n 
8  39   SER n 
8  40   ILE n 
8  41   GLU n 
8  42   ARG n 
8  43   GLY n 
8  44   SER n 
8  45   ALA n 
8  46   GLU n 
8  47   LEU n 
8  48   VAL n 
8  49   PHE n 
8  50   VAL n 
8  51   ALA n 
8  52   GLU n 
8  53   ASP n 
8  54   VAL n 
8  55   GLN n 
8  56   PRO n 
8  57   GLU n 
8  58   GLU n 
8  59   ILE n 
8  60   VAL n 
8  61   MET n 
8  62   HIS n 
8  63   ILE n 
8  64   PRO n 
8  65   GLU n 
8  66   LEU n 
8  67   ALA n 
8  68   ASP n 
8  69   GLU n 
8  70   LYS n 
8  71   GLY n 
8  72   VAL n 
8  73   PRO n 
8  74   PHE n 
8  75   ILE n 
8  76   PHE n 
8  77   VAL n 
8  78   GLU n 
8  79   GLN n 
8  80   GLN n 
8  81   ASP n 
8  82   ASP n 
8  83   LEU n 
8  84   GLY n 
8  85   HIS n 
8  86   ALA n 
8  87   ALA n 
8  88   GLY n 
8  89   LEU n 
8  90   GLU n 
8  91   VAL n 
8  92   GLY n 
8  93   SER n 
8  94   ALA n 
8  95   ALA n 
8  96   ALA n 
8  97   ALA n 
8  98   VAL n 
8  99   THR n 
8  100  ASP n 
8  101  ALA n 
8  102  GLY n 
8  103  ALA n 
8  104  ALA n 
8  105  ALA n 
8  106  THR n 
8  107  VAL n 
8  108  LEU n 
8  109  GLU n 
8  110  GLU n 
8  111  ILE n 
8  112  ALA n 
8  113  ASP n 
8  114  LYS n 
8  115  VAL n 
8  116  GLU n 
8  117  GLU n 
8  118  LEU n 
8  119  ARG n 
9  1    MET n 
9  2    SER n 
9  3    ALA n 
9  4    GLU n 
9  5    SER n 
9  6    GLU n 
9  7    ARG n 
9  8    LYS n 
9  9    THR n 
9  10   GLU n 
9  11   THR n 
9  12   ILE n 
9  13   PRO n 
9  14   GLU n 
9  15   TRP n 
9  16   LYS n 
9  17   GLN n 
9  18   GLU n 
9  19   GLU n 
9  20   VAL n 
9  21   ASP n 
9  22   ALA n 
9  23   ILE n 
9  24   VAL n 
9  25   GLU n 
9  26   MET n 
9  27   ILE n 
9  28   GLU n 
9  29   SER n 
9  30   TYR n 
9  31   GLU n 
9  32   SER n 
9  33   VAL n 
9  34   GLY n 
9  35   VAL n 
9  36   VAL n 
9  37   ASN n 
9  38   ILE n 
9  39   ALA n 
9  40   GLY n 
9  41   ILE n 
9  42   PRO n 
9  43   SER n 
9  44   ARG n 
9  45   GLN n 
9  46   LEU n 
9  47   GLN n 
9  48   ASP n 
9  49   MET n 
9  50   ARG n 
9  51   ARG n 
9  52   ASP n 
9  53   LEU n 
9  54   HIS n 
9  55   GLY n 
9  56   THR n 
9  57   ALA n 
9  58   GLU n 
9  59   LEU n 
9  60   ARG n 
9  61   VAL n 
9  62   SER n 
9  63   ARG n 
9  64   ASN n 
9  65   THR n 
9  66   LEU n 
9  67   LEU n 
9  68   GLU n 
9  69   ARG n 
9  70   ALA n 
9  71   LEU n 
9  72   ASP n 
9  73   ASP n 
9  74   VAL n 
9  75   ASP n 
9  76   ASP n 
9  77   GLY n 
9  78   LEU n 
9  79   GLU n 
9  80   ASP n 
9  81   LEU n 
9  82   ASN n 
9  83   GLY n 
9  84   TYR n 
9  85   ILE n 
9  86   THR n 
9  87   GLY n 
9  88   GLN n 
9  89   VAL n 
9  90   GLY n 
9  91   LEU n 
9  92   ILE n 
9  93   GLY n 
9  94   THR n 
9  95   ASP n 
9  96   ASP n 
9  97   ASN n 
9  98   PRO n 
9  99   PHE n 
9  100  SER n 
9  101  LEU n 
9  102  PHE n 
9  103  GLN n 
9  104  GLU n 
9  105  LEU n 
9  106  GLU n 
9  107  ALA n 
9  108  SER n 
9  109  LYS n 
9  110  THR n 
9  111  PRO n 
9  112  ALA n 
9  113  PRO n 
9  114  ILE n 
9  115  GLY n 
9  116  ALA n 
9  117  GLY n 
9  118  GLU n 
9  119  VAL n 
9  120  ALA n 
9  121  PRO n 
9  122  ASN n 
9  123  ASP n 
9  124  ILE n 
9  125  VAL n 
9  126  ILE n 
9  127  PRO n 
9  128  GLU n 
9  129  GLY n 
9  130  ASP n 
9  131  THR n 
9  132  GLY n 
9  133  VAL n 
9  134  ASP n 
9  135  PRO n 
9  136  GLY n 
9  137  PRO n 
9  138  PHE n 
9  139  VAL n 
9  140  GLY n 
9  141  GLU n 
9  142  LEU n 
9  143  GLN n 
9  144  SER n 
9  145  VAL n 
9  146  GLY n 
9  147  ALA n 
9  148  ASP n 
9  149  ALA n 
9  150  ARG n 
9  151  ILE n 
9  152  GLN n 
9  153  GLU n 
9  154  GLY n 
9  155  SER n 
9  156  ILE n 
9  157  GLN n 
9  158  VAL n 
9  159  LEU n 
9  160  SER n 
9  161  ASP n 
9  162  SER n 
9  163  THR n 
9  164  VAL n 
9  165  LEU n 
9  166  ASP n 
9  167  THR n 
9  168  GLY n 
9  169  GLU n 
9  170  GLU n 
9  171  VAL n 
9  172  SER n 
9  173  GLN n 
9  174  GLU n 
9  175  LEU n 
9  176  SER n 
9  177  ASN n 
9  178  VAL n 
9  179  LEU n 
9  180  ASN n 
9  181  GLU n 
9  182  LEU n 
9  183  GLY n 
9  184  ILE n 
9  185  GLU n 
9  186  PRO n 
9  187  LYS n 
9  188  GLU n 
9  189  VAL n 
9  190  GLY n 
9  191  LEU n 
9  192  ASP n 
9  193  LEU n 
9  194  ARG n 
9  195  ALA n 
9  196  VAL n 
9  197  PHE n 
9  198  ALA n 
9  199  ASP n 
9  200  GLY n 
9  201  VAL n 
9  202  LEU n 
9  203  PHE n 
9  204  GLU n 
9  205  PRO n 
9  206  GLU n 
9  207  GLU n 
9  208  LEU n 
9  209  GLU n 
9  210  LEU n 
9  211  ASP n 
9  212  ILE n 
9  213  ASP n 
9  214  GLU n 
9  215  TYR n 
9  216  ARG n 
9  217  SER n 
9  218  ASP n 
9  219  ILE n 
9  220  GLN n 
9  221  ALA n 
9  222  ALA n 
9  223  ALA n 
9  224  GLY n 
9  225  ARG n 
9  226  ALA n 
9  227  PHE n 
9  228  ASN n 
9  229  LEU n 
9  230  SER n 
9  231  VAL n 
9  232  ASN n 
9  233  ALA n 
9  234  ASP n 
9  235  TYR n 
9  236  PRO n 
9  237  THR n 
9  238  ALA n 
9  239  THR n 
9  240  THR n 
9  241  ALA n 
9  242  PRO n 
9  243  THR n 
9  244  MET n 
9  245  LEU n 
9  246  GLN n 
9  247  SER n 
9  248  ASP n 
9  249  ARG n 
9  250  GLY n 
9  251  ASN n 
9  252  ALA n 
9  253  LYS n 
9  254  SER n 
9  255  LEU n 
9  256  ALA n 
9  257  LEU n 
9  258  GLN n 
9  259  ALA n 
9  260  ALA n 
9  261  ILE n 
9  262  GLU n 
9  263  ASP n 
9  264  PRO n 
9  265  GLU n 
9  266  VAL n 
9  267  VAL n 
9  268  PRO n 
9  269  ASP n 
9  270  LEU n 
9  271  VAL n 
9  272  SER n 
9  273  LYS n 
9  274  ALA n 
9  275  ASP n 
9  276  ALA n 
9  277  GLN n 
9  278  VAL n 
9  279  ARG n 
9  280  ALA n 
9  281  LEU n 
9  282  ALA n 
9  283  SER n 
9  284  GLN n 
9  285  ILE n 
9  286  ASP n 
9  287  ASP n 
9  288  GLU n 
9  289  GLU n 
9  290  ALA n 
9  291  LEU n 
9  292  PRO n 
9  293  GLU n 
9  294  GLU n 
9  295  LEU n 
9  296  GLN n 
9  297  GLY n 
9  298  VAL n 
9  299  GLU n 
9  300  ALA n 
9  301  ASP n 
9  302  VAL n 
9  303  ALA n 
9  304  THR n 
9  305  GLU n 
9  306  GLU n 
9  307  PRO n 
9  308  THR n 
9  309  ASP n 
9  310  ASP n 
9  311  GLN n 
9  312  ASP n 
9  313  ASP n 
9  314  ASP n 
9  315  THR n 
9  316  ALA n 
9  317  SER n 
9  318  GLU n 
9  319  ASP n 
9  320  ASP n 
9  321  ALA n 
9  322  ASP n 
9  323  ALA n 
9  324  ASP n 
9  325  ASP n 
9  326  ALA n 
9  327  ALA n 
9  328  GLU n 
9  329  GLU n 
9  330  ALA n 
9  331  ASP n 
9  332  ASP n 
9  333  ASP n 
9  334  ASP n 
9  335  ASP n 
9  336  ASP n 
9  337  ASP n 
9  338  GLU n 
9  339  ASP n 
9  340  ALA n 
9  341  GLY n 
9  342  ASP n 
9  343  ALA n 
9  344  LEU n 
9  345  GLY n 
9  346  ALA n 
9  347  MET n 
9  348  PHE n 
10 1    LYS n 
10 2    PRO n 
10 3    GLY n 
10 4    ALA n 
10 5    MET n 
10 6    TYR n 
10 7    ARG n 
10 8    ASN n 
10 9    SER n 
10 10   SER n 
10 11   LYS n 
10 12   PRO n 
10 13   ALA n 
10 14   TYR n 
10 15   THR n 
10 16   ARG n 
10 17   ARG n 
10 18   GLU n 
10 19   TYR n 
10 20   ILE n 
10 21   SER n 
10 22   GLY n 
10 23   ILE n 
10 24   PRO n 
10 25   GLY n 
10 26   LYS n 
10 27   LYS n 
10 28   ILE n 
10 29   ALA n 
10 30   GLN n 
10 31   PHE n 
10 32   ASP n 
10 33   MET n 
10 34   GLY n 
10 35   ASN n 
10 36   ASN n 
10 37   GLY n 
10 38   ALA n 
10 39   GLY n 
10 40   PRO n 
10 41   THR n 
10 42   TYR n 
10 43   PRO n 
10 44   ALA n 
10 45   GLN n 
10 46   VAL n 
10 47   GLU n 
10 48   LEU n 
10 49   VAL n 
10 50   VAL n 
10 51   GLU n 
10 52   LYS n 
10 53   PRO n 
10 54   VAL n 
10 55   GLN n 
10 56   ILE n 
10 57   ARG n 
10 58   HIS n 
10 59   ASN n 
10 60   ALA n 
10 61   LEU n 
10 62   GLU n 
10 63   ALA n 
10 64   ALA n 
10 65   ARG n 
10 66   VAL n 
10 67   ALA n 
10 68   ALA n 
10 69   ASN n 
10 70   ARG n 
10 71   TYR n 
10 72   VAL n 
10 73   GLN n 
10 74   ASN n 
10 75   SER n 
10 76   GLY n 
10 77   ALA n 
10 78   ALA n 
10 79   ALA n 
10 80   ASN n 
10 81   TYR n 
10 82   LYS n 
10 83   PHE n 
10 84   ARG n 
10 85   ILE n 
10 86   ARG n 
10 87   LYS n 
10 88   PHE n 
10 89   PRO n 
10 90   PHE n 
10 91   HIS n 
10 92   VAL n 
10 93   ILE n 
10 94   ARG n 
10 95   GLU n 
10 96   ASN n 
10 97   LYS n 
10 98   ALA n 
10 99   ALA n 
10 100  ALA n 
10 101  ALA n 
10 102  ALA n 
10 103  ALA n 
10 104  ALA n 
10 105  ALA n 
10 106  ALA n 
10 107  ALA n 
10 108  ALA n 
10 109  ASP n 
10 110  GLY n 
10 111  MET n 
10 112  ARG n 
10 113  ALA n 
10 114  PRO n 
10 115  PHE n 
10 116  GLY n 
10 117  LYS n 
10 118  PRO n 
10 119  VAL n 
10 120  GLY n 
10 121  THR n 
10 122  ALA n 
10 123  ALA n 
10 124  ARG n 
10 125  VAL n 
10 126  HIS n 
10 127  GLY n 
10 128  ALA n 
10 129  ASN n 
10 130  HIS n 
10 131  ILE n 
10 132  PHE n 
10 133  ILE n 
10 134  ALA n 
10 135  TRP n 
10 136  VAL n 
10 137  ASN n 
10 138  PRO n 
10 139  ASP n 
10 140  PRO n 
10 141  ASN n 
10 142  VAL n 
10 143  GLU n 
10 144  GLU n 
10 145  ALA n 
10 146  TRP n 
10 147  ARG n 
10 148  ARG n 
10 149  ALA n 
10 150  LYS n 
10 151  MET n 
10 152  LYS n 
10 153  VAL n 
10 154  THR n 
10 155  PRO n 
10 156  THR n 
10 157  ILE n 
10 158  ASN n 
10 159  ILE n 
10 160  ASP n 
10 161  SER n 
10 162  SER n 
10 163  PRO n 
10 164  ALA n 
10 165  GLY n 
10 166  ASN n 
10 167  ALA n 
11 1    MET n 
11 2    SER n 
11 3    VAL n 
11 4    ALA n 
11 5    GLU n 
11 6    PHE n 
11 7    ASP n 
11 8    ALA n 
11 9    ASP n 
11 10   VAL n 
11 11   ILE n 
11 12   VAL n 
11 13   ASP n 
11 14   ALA n 
11 15   ARG n 
11 16   ASP n 
11 17   CYS n 
11 18   ILE n 
11 19   MET n 
11 20   GLY n 
11 21   ARG n 
11 22   VAL n 
11 23   ALA n 
11 24   SER n 
11 25   GLN n 
11 26   VAL n 
11 27   ALA n 
11 28   GLU n 
11 29   GLN n 
11 30   ALA n 
11 31   LEU n 
11 32   ASP n 
11 33   GLY n 
11 34   GLU n 
11 35   THR n 
11 36   VAL n 
11 37   ALA n 
11 38   VAL n 
11 39   VAL n 
11 40   ASN n 
11 41   ALA n 
11 42   GLU n 
11 43   ARG n 
11 44   ALA n 
11 45   VAL n 
11 46   ILE n 
11 47   THR n 
11 48   GLY n 
11 49   ARG n 
11 50   GLU n 
11 51   GLU n 
11 52   GLN n 
11 53   ILE n 
11 54   VAL n 
11 55   GLU n 
11 56   LYS n 
11 57   TYR n 
11 58   GLU n 
11 59   LYS n 
11 60   ARG n 
11 61   VAL n 
11 62   ASP n 
11 63   ILE n 
11 64   GLY n 
11 65   ASN n 
11 66   ASP n 
11 67   ASN n 
11 68   GLY n 
11 69   TYR n 
11 70   PHE n 
11 71   TYR n 
11 72   PRO n 
11 73   LYS n 
11 74   ARG n 
11 75   PRO n 
11 76   ASP n 
11 77   GLY n 
11 78   ILE n 
11 79   PHE n 
11 80   LYS n 
11 81   ARG n 
11 82   THR n 
11 83   ILE n 
11 84   ARG n 
11 85   GLY n 
11 86   MET n 
11 87   LEU n 
11 88   PRO n 
11 89   HIS n 
11 90   LYS n 
11 91   LYS n 
11 92   GLN n 
11 93   ARG n 
11 94   GLY n 
11 95   ARG n 
11 96   GLU n 
11 97   ALA n 
11 98   PHE n 
11 99   GLU n 
11 100  SER n 
11 101  VAL n 
11 102  ARG n 
11 103  VAL n 
11 104  TYR n 
11 105  LEU n 
11 106  GLY n 
11 107  ASN n 
11 108  PRO n 
11 109  TYR n 
11 110  ASP n 
11 111  GLU n 
11 112  ASP n 
11 113  GLY n 
11 114  GLU n 
11 115  VAL n 
11 116  LEU n 
11 117  ASP n 
11 118  GLY n 
11 119  THR n 
11 120  SER n 
11 121  LEU n 
11 122  ASP n 
11 123  ARG n 
11 124  LEU n 
11 125  SER n 
11 126  ASN n 
11 127  ILE n 
11 128  LYS n 
11 129  PHE n 
11 130  VAL n 
11 131  THR n 
11 132  LEU n 
11 133  GLY n 
11 134  GLU n 
11 135  ILE n 
11 136  SER n 
11 137  GLU n 
11 138  THR n 
11 139  LEU n 
11 140  GLY n 
11 141  ALA n 
11 142  ASN n 
11 143  LYS n 
11 144  THR n 
11 145  TRP n 
12 1    MET n 
12 2    GLU n 
12 3    ALA n 
12 4    LEU n 
12 5    GLY n 
12 6    ALA n 
12 7    ASP n 
12 8    VAL n 
12 9    THR n 
12 10   GLN n 
12 11   GLY n 
12 12   LEU n 
12 13   GLU n 
12 14   LYS n 
12 15   GLY n 
12 16   SER n 
12 17   LEU n 
12 18   ILE n 
12 19   THR n 
12 20   CYS n 
12 21   ALA n 
12 22   ASP n 
12 23   ASN n 
12 24   THR n 
12 25   GLY n 
12 26   ALA n 
12 27   ARG n 
12 28   GLU n 
12 29   LEU n 
12 30   LYS n 
12 31   VAL n 
12 32   ILE n 
12 33   SER n 
12 34   VAL n 
12 35   HIS n 
12 36   GLY n 
12 37   TYR n 
12 38   SER n 
12 39   GLY n 
12 40   THR n 
12 41   LYS n 
12 42   ASN n 
12 43   ARG n 
12 44   HIS n 
12 45   PRO n 
12 46   LYS n 
12 47   ALA n 
12 48   GLY n 
12 49   LEU n 
12 50   GLY n 
12 51   ASP n 
12 52   LYS n 
12 53   ILE n 
12 54   THR n 
12 55   VAL n 
12 56   SER n 
12 57   VAL n 
12 58   THR n 
12 59   LYS n 
12 60   GLY n 
12 61   THR n 
12 62   PRO n 
12 63   GLU n 
12 64   MET n 
12 65   ARG n 
12 66   ARG n 
12 67   GLN n 
12 68   VAL n 
12 69   LEU n 
12 70   GLU n 
12 71   ALA n 
12 72   VAL n 
12 73   VAL n 
12 74   VAL n 
12 75   ARG n 
12 76   GLN n 
12 77   ARG n 
12 78   LYS n 
12 79   PRO n 
12 80   ILE n 
12 81   ARG n 
12 82   ARG n 
12 83   PRO n 
12 84   ASP n 
12 85   GLY n 
12 86   THR n 
12 87   ARG n 
12 88   VAL n 
12 89   LYS n 
12 90   PHE n 
12 91   GLU n 
12 92   ASP n 
12 93   ASN n 
12 94   ALA n 
12 95   ALA n 
12 96   VAL n 
12 97   ILE n 
12 98   VAL n 
12 99   ASP n 
12 100  GLU n 
12 101  ASN n 
12 102  GLU n 
12 103  ASP n 
12 104  PRO n 
12 105  ARG n 
12 106  GLY n 
12 107  THR n 
12 108  GLU n 
12 109  LEU n 
12 110  LYS n 
12 111  GLY n 
12 112  PRO n 
12 113  ILE n 
12 114  ALA n 
12 115  ARG n 
12 116  GLU n 
12 117  VAL n 
12 118  ALA n 
12 119  GLN n 
12 120  ARG n 
12 121  PHE n 
12 122  GLY n 
12 123  SER n 
12 124  VAL n 
12 125  ALA n 
12 126  SER n 
12 127  ALA n 
12 128  ALA n 
12 129  THR n 
12 130  MET n 
12 131  ILE n 
12 132  VAL n 
13 1    THR n 
13 2    SER n 
13 3    LYS n 
13 4    LYS n 
13 5    LYS n 
13 6    ARG n 
13 7    GLN n 
13 8    ARG n 
13 9    GLY n 
13 10   SER n 
13 11   ARG n 
13 12   THR n 
13 13   HIS n 
13 14   GLY n 
13 15   GLY n 
13 16   GLY n 
13 17   SER n 
13 18   HIS n 
13 19   LYS n 
13 20   ASN n 
13 21   ARG n 
13 22   ARG n 
13 23   GLY n 
13 24   ALA n 
13 25   GLY n 
13 26   HIS n 
13 27   ARG n 
13 28   GLY n 
13 29   GLY n 
13 30   ARG n 
13 31   GLY n 
13 32   ASP n 
13 33   ALA n 
13 34   GLY n 
13 35   ARG n 
13 36   ASP n 
13 37   LYS n 
13 38   HIS n 
13 39   GLU n 
13 40   PHE n 
13 41   HIS n 
13 42   ASN n 
13 43   HIS n 
13 44   GLU n 
13 45   PRO n 
13 46   LEU n 
13 47   GLY n 
13 48   LYS n 
13 49   SER n 
13 50   GLY n 
13 51   PHE n 
13 52   LYS n 
13 53   ARG n 
13 54   PRO n 
13 55   GLN n 
13 56   LYS n 
13 57   VAL n 
13 58   GLN n 
13 59   GLU n 
13 60   GLU n 
13 61   ALA n 
13 62   ALA n 
13 63   THR n 
13 64   ILE n 
13 65   ASP n 
13 66   VAL n 
13 67   ARG n 
13 68   GLU n 
13 69   ILE n 
13 70   ASP n 
13 71   GLU n 
13 72   ASN n 
13 73   VAL n 
13 74   THR n 
13 75   LEU n 
13 76   LEU n 
13 77   ALA n 
13 78   ALA n 
13 79   ASP n 
13 80   ASP n 
13 81   VAL n 
13 82   ALA n 
13 83   GLU n 
13 84   VAL n 
13 85   GLU n 
13 86   ASP n 
13 87   GLY n 
13 88   GLY n 
13 89   PHE n 
13 90   ARG n 
13 91   VAL n 
13 92   ASP n 
13 93   VAL n 
13 94   ARG n 
13 95   ASP n 
13 96   VAL n 
13 97   VAL n 
13 98   GLU n 
13 99   GLU n 
13 100  ALA n 
13 101  ASP n 
13 102  ASP n 
13 103  ALA n 
13 104  ASP n 
13 105  TYR n 
13 106  VAL n 
13 107  LYS n 
13 108  VAL n 
13 109  LEU n 
13 110  GLY n 
13 111  ALA n 
13 112  GLY n 
13 113  GLN n 
13 114  VAL n 
13 115  ARG n 
13 116  HIS n 
13 117  GLU n 
13 118  LEU n 
13 119  THR n 
13 120  LEU n 
13 121  ILE n 
13 122  ALA n 
13 123  ASP n 
13 124  ASP n 
13 125  PHE n 
13 126  SER n 
13 127  GLU n 
13 128  GLY n 
13 129  ALA n 
13 130  ARG n 
13 131  GLU n 
13 132  LYS n 
13 133  VAL n 
13 134  GLU n 
13 135  GLY n 
13 136  ALA n 
13 137  GLY n 
13 138  GLY n 
13 139  SER n 
13 140  VAL n 
13 141  GLU n 
13 142  LEU n 
13 143  THR n 
13 144  ASP n 
13 145  LEU n 
13 146  GLY n 
13 147  GLU n 
13 148  GLU n 
13 149  ARG n 
13 150  GLN n 
13 151  ALA n 
13 152  GLU n 
13 153  ALA n 
13 154  GLU n 
13 155  GLU n 
13 156  THR n 
13 157  GLU n 
13 158  ASP n 
13 159  ALA n 
13 160  ASP n 
13 161  ALA n 
13 162  ASP n 
13 163  GLU n 
13 164  GLU n 
14 1    ALA n 
14 2    ARG n 
14 3    SER n 
14 4    ALA n 
14 5    TYR n 
14 6    SER n 
14 7    TYR n 
14 8    ILE n 
14 9    ARG n 
14 10   GLU n 
14 11   ALA n 
14 12   TRP n 
14 13   LYS n 
14 14   ARG n 
14 15   PRO n 
14 16   LYS n 
14 17   GLU n 
14 18   GLY n 
14 19   GLN n 
14 20   ILE n 
14 21   ALA n 
14 22   GLU n 
14 23   LEU n 
14 24   MET n 
14 25   TRP n 
14 26   HIS n 
14 27   ARG n 
14 28   MET n 
14 29   GLN n 
14 30   GLU n 
14 31   TRP n 
14 32   ARG n 
14 33   ASN n 
14 34   GLU n 
14 35   PRO n 
14 36   ALA n 
14 37   VAL n 
14 38   VAL n 
14 39   ARG n 
14 40   ILE n 
14 41   GLU n 
14 42   ARG n 
14 43   PRO n 
14 44   THR n 
14 45   ARG n 
14 46   LEU n 
14 47   ASP n 
14 48   ARG n 
14 49   ALA n 
14 50   ARG n 
14 51   SER n 
14 52   LEU n 
14 53   GLY n 
14 54   TYR n 
14 55   LYS n 
14 56   ALA n 
14 57   LYS n 
14 58   GLN n 
14 59   GLY n 
14 60   ILE n 
14 61   ILE n 
14 62   VAL n 
14 63   VAL n 
14 64   ARG n 
14 65   VAL n 
14 66   ALA n 
14 67   ILE n 
14 68   ARG n 
14 69   LYS n 
14 70   GLY n 
14 71   SER n 
14 72   SER n 
14 73   ARG n 
14 74   ARG n 
14 75   THR n 
14 76   ARG n 
14 77   PHE n 
14 78   ASN n 
14 79   LYS n 
14 80   GLY n 
14 81   ARG n 
14 82   ARG n 
14 83   SER n 
14 84   LYS n 
14 85   ARG n 
14 86   MET n 
14 87   MET n 
14 88   VAL n 
14 89   ASN n 
14 90   ARG n 
14 91   ILE n 
14 92   THR n 
14 93   ARG n 
14 94   LYS n 
14 95   LYS n 
14 96   ASN n 
14 97   ILE n 
14 98   GLN n 
14 99   ARG n 
14 100  ILE n 
14 101  ALA n 
14 102  GLU n 
14 103  GLU n 
14 104  ARG n 
14 105  ALA n 
14 106  ASN n 
14 107  ARG n 
14 108  LYS n 
14 109  PHE n 
14 110  PRO n 
14 111  ASN n 
14 112  LEU n 
14 113  ARG n 
14 114  VAL n 
14 115  LEU n 
14 116  ASN n 
14 117  SER n 
14 118  TYR n 
14 119  SER n 
14 120  VAL n 
14 121  GLY n 
14 122  GLU n 
14 123  ASP n 
14 124  GLY n 
14 125  ARG n 
14 126  HIS n 
14 127  LYS n 
14 128  TRP n 
14 129  HIS n 
14 130  GLU n 
14 131  VAL n 
14 132  ILE n 
14 133  LEU n 
14 134  ILE n 
14 135  ASP n 
14 136  PRO n 
14 137  ASP n 
14 138  HIS n 
14 139  PRO n 
14 140  ALA n 
14 141  ILE n 
14 142  LYS n 
14 143  SER n 
14 144  ASP n 
14 145  ASP n 
14 146  GLN n 
14 147  LEU n 
14 148  SER n 
14 149  TRP n 
14 150  ILE n 
14 151  SER n 
14 152  ARG n 
14 153  THR n 
14 154  ARG n 
14 155  HIS n 
14 156  ARG n 
14 157  LEU n 
14 158  ARG n 
14 159  THR n 
14 160  PHE n 
14 161  ARG n 
14 162  GLY n 
14 163  LEU n 
14 164  THR n 
14 165  SER n 
14 166  ALA n 
14 167  GLY n 
14 168  ARG n 
14 169  ARG n 
14 170  CYS n 
14 171  ARG n 
14 172  GLY n 
14 173  LEU n 
14 174  ARG n 
14 175  GLY n 
14 176  GLN n 
14 177  GLY n 
14 178  LYS n 
14 179  GLY n 
14 180  SER n 
14 181  GLU n 
14 182  LYS n 
14 183  VAL n 
14 184  ARG n 
14 185  PRO n 
14 186  SER n 
14 187  LEU n 
14 188  ARG n 
14 189  VAL n 
14 190  ASN n 
14 191  GLY n 
14 192  ALA n 
14 193  LYS n 
14 194  ALA n 
15 1    ALA n 
15 2    THR n 
15 3    GLY n 
15 4    PRO n 
15 5    ARG n 
15 6    TYR n 
15 7    LYS n 
15 8    VAL n 
15 9    PRO n 
15 10   MET n 
15 11   ARG n 
15 12   ARG n 
15 13   ARG n 
15 14   ARG n 
15 15   GLU n 
15 16   ALA n 
15 17   ARG n 
15 18   THR n 
15 19   ASP n 
15 20   TYR n 
15 21   HIS n 
15 22   GLN n 
15 23   ARG n 
15 24   LEU n 
15 25   ARG n 
15 26   LEU n 
15 27   LEU n 
15 28   LYS n 
15 29   SER n 
15 30   GLY n 
15 31   LYS n 
15 32   PRO n 
15 33   ARG n 
15 34   LEU n 
15 35   VAL n 
15 36   ALA n 
15 37   ARG n 
15 38   LYS n 
15 39   SER n 
15 40   ASN n 
15 41   LYS n 
15 42   HIS n 
15 43   VAL n 
15 44   ARG n 
15 45   ALA n 
15 46   GLN n 
15 47   LEU n 
15 48   VAL n 
15 49   THR n 
15 50   LEU n 
15 51   GLY n 
15 52   PRO n 
15 53   ASN n 
15 54   GLY n 
15 55   ASP n 
15 56   ASP n 
15 57   THR n 
15 58   LEU n 
15 59   ALA n 
15 60   SER n 
15 61   ALA n 
15 62   HIS n 
15 63   SER n 
15 64   SER n 
15 65   ASP n 
15 66   LEU n 
15 67   ALA n 
15 68   GLU n 
15 69   TYR n 
15 70   GLY n 
15 71   TRP n 
15 72   GLU n 
15 73   ALA n 
15 74   PRO n 
15 75   THR n 
15 76   GLY n 
15 77   ASN n 
15 78   MET n 
15 79   PRO n 
15 80   SER n 
15 81   ALA n 
15 82   TYR n 
15 83   LEU n 
15 84   THR n 
15 85   GLY n 
15 86   LEU n 
15 87   LEU n 
15 88   ALA n 
15 89   GLY n 
15 90   LEU n 
15 91   ARG n 
15 92   ALA n 
15 93   GLN n 
15 94   GLU n 
15 95   ALA n 
15 96   GLY n 
15 97   VAL n 
15 98   GLU n 
15 99   GLU n 
15 100  ALA n 
15 101  VAL n 
15 102  LEU n 
15 103  ASP n 
15 104  ILE n 
15 105  GLY n 
15 106  LEU n 
15 107  ASN n 
15 108  SER n 
15 109  PRO n 
15 110  THR n 
15 111  PRO n 
15 112  GLY n 
15 113  SER n 
15 114  LYS n 
15 115  VAL n 
15 116  PHE n 
15 117  ALA n 
15 118  ILE n 
15 119  GLN n 
15 120  GLU n 
15 121  GLY n 
15 122  ALA n 
15 123  ILE n 
15 124  ASP n 
15 125  ALA n 
15 126  GLY n 
15 127  LEU n 
15 128  ASP n 
15 129  ILE n 
15 130  PRO n 
15 131  HIS n 
15 132  ASN n 
15 133  ASP n 
15 134  ASP n 
15 135  VAL n 
15 136  LEU n 
15 137  ALA n 
15 138  ASP n 
15 139  TRP n 
15 140  GLN n 
15 141  ARG n 
15 142  THR n 
15 143  ARG n 
15 144  GLY n 
15 145  ALA n 
15 146  HIS n 
15 147  ILE n 
15 148  ALA n 
15 149  GLU n 
15 150  TYR n 
15 151  ASP n 
15 152  GLU n 
15 153  GLN n 
15 154  LEU n 
15 155  GLU n 
15 156  GLU n 
15 157  PRO n 
15 158  LEU n 
15 159  TYR n 
15 160  SER n 
15 161  GLY n 
15 162  ASP n 
15 163  PHE n 
15 164  ASP n 
15 165  ALA n 
15 166  ALA n 
15 167  ASP n 
15 168  LEU n 
15 169  PRO n 
15 170  GLU n 
15 171  HIS n 
15 172  PHE n 
15 173  ASP n 
15 174  GLU n 
15 175  LEU n 
15 176  ARG n 
15 177  GLU n 
15 178  THR n 
15 179  LEU n 
15 180  LEU n 
15 181  ASP n 
15 182  GLY n 
15 183  ASP n 
15 184  ILE n 
15 185  GLU n 
15 186  LEU n 
16 1    SER n 
16 2    LYS n 
16 3    THR n 
16 4    ASN n 
16 5    PRO n 
16 6    ARG n 
16 7    LEU n 
16 8    SER n 
16 9    SER n 
16 10   LEU n 
16 11   ILE n 
16 12   ALA n 
16 13   ASP n 
16 14   LEU n 
16 15   LYS n 
16 16   SER n 
16 17   ALA n 
16 18   ALA n 
16 19   ARG n 
16 20   SER n 
16 21   SER n 
16 22   GLY n 
16 23   GLY n 
16 24   ALA n 
16 25   VAL n 
16 26   TRP n 
16 27   GLY n 
16 28   ASP n 
16 29   VAL n 
16 30   ALA n 
16 31   GLU n 
16 32   ARG n 
16 33   LEU n 
16 34   GLU n 
16 35   LYS n 
16 36   PRO n 
16 37   ARG n 
16 38   ARG n 
16 39   THR n 
16 40   HIS n 
16 41   ALA n 
16 42   GLU n 
16 43   VAL n 
16 44   ASN n 
16 45   LEU n 
16 46   GLY n 
16 47   ARG n 
16 48   ILE n 
16 49   GLU n 
16 50   ARG n 
16 51   TYR n 
16 52   ALA n 
16 53   GLN n 
16 54   GLU n 
16 55   ASP n 
16 56   GLU n 
16 57   THR n 
16 58   VAL n 
16 59   VAL n 
16 60   VAL n 
16 61   PRO n 
16 62   GLY n 
16 63   LYS n 
16 64   VAL n 
16 65   LEU n 
16 66   GLY n 
16 67   SER n 
16 68   GLY n 
16 69   VAL n 
16 70   LEU n 
16 71   GLN n 
16 72   LYS n 
16 73   ASP n 
16 74   VAL n 
16 75   THR n 
16 76   VAL n 
16 77   ALA n 
16 78   ALA n 
16 79   VAL n 
16 80   ASP n 
16 81   PHE n 
16 82   SER n 
16 83   GLY n 
16 84   THR n 
16 85   ALA n 
16 86   GLU n 
16 87   THR n 
16 88   LYS n 
16 89   ILE n 
16 90   ASP n 
16 91   GLN n 
16 92   VAL n 
16 93   GLY n 
16 94   GLU n 
16 95   ALA n 
16 96   VAL n 
16 97   SER n 
16 98   LEU n 
16 99   GLU n 
16 100  GLN n 
16 101  ALA n 
16 102  ILE n 
16 103  GLU n 
16 104  ASN n 
16 105  ASN n 
16 106  PRO n 
16 107  GLU n 
16 108  GLY n 
16 109  SER n 
16 110  HIS n 
16 111  VAL n 
16 112  ARG n 
16 113  VAL n 
16 114  ILE n 
16 115  ARG n 
17 1    THR n 
17 2    ASP n 
17 3    LEU n 
17 4    SER n 
17 5    ALA n 
17 6    GLN n 
17 7    LYS n 
17 8    ARG n 
17 9    LEU n 
17 10   ALA n 
17 11   ALA n 
17 12   ASP n 
17 13   VAL n 
17 14   LEU n 
17 15   ASP n 
17 16   VAL n 
17 17   GLY n 
17 18   LYS n 
17 19   ASN n 
17 20   ARG n 
17 21   VAL n 
17 22   TRP n 
17 23   PHE n 
17 24   ASN n 
17 25   PRO n 
17 26   GLU n 
17 27   ARG n 
17 28   GLN n 
17 29   GLY n 
17 30   ASP n 
17 31   ILE n 
17 32   ALA n 
17 33   ASP n 
17 34   ALA n 
17 35   ILE n 
17 36   THR n 
17 37   ARG n 
17 38   GLU n 
17 39   ASP n 
17 40   VAL n 
17 41   ARG n 
17 42   GLU n 
17 43   LEU n 
17 44   VAL n 
17 45   ASP n 
17 46   GLU n 
17 47   GLY n 
17 48   ALA n 
17 49   ILE n 
17 50   GLN n 
17 51   ALA n 
17 52   LYS n 
17 53   ASP n 
17 54   LYS n 
17 55   LYS n 
17 56   GLY n 
17 57   ASN n 
17 58   SER n 
17 59   ARG n 
17 60   GLY n 
17 61   ARG n 
17 62   ALA n 
17 63   ARG n 
17 64   GLU n 
17 65   ARG n 
17 66   GLN n 
17 67   LYS n 
17 68   LYS n 
17 69   ARG n 
17 70   ALA n 
17 71   LYS n 
17 72   GLY n 
17 73   HIS n 
17 74   GLN n 
17 75   LYS n 
17 76   GLY n 
17 77   ALA n 
17 78   GLY n 
17 79   SER n 
17 80   ARG n 
17 81   LYS n 
17 82   GLY n 
17 83   LYS n 
17 84   ALA n 
17 85   GLY n 
17 86   ALA n 
17 87   ARG n 
17 88   GLN n 
17 89   ASN n 
17 90   SER n 
17 91   LYS n 
17 92   GLU n 
17 93   ASP n 
17 94   TRP n 
17 95   GLU n 
17 96   SER n 
17 97   ARG n 
17 98   ILE n 
17 99   ARG n 
17 100  ALA n 
17 101  GLN n 
17 102  ARG n 
17 103  THR n 
17 104  LYS n 
17 105  LEU n 
17 106  ARG n 
17 107  GLU n 
17 108  LEU n 
17 109  ARG n 
17 110  ASP n 
17 111  GLU n 
17 112  GLY n 
17 113  THR n 
17 114  LEU n 
17 115  SER n 
17 116  SER n 
17 117  SER n 
17 118  GLN n 
17 119  TYR n 
17 120  ARG n 
17 121  ASP n 
17 122  LEU n 
17 123  TYR n 
17 124  ASP n 
17 125  LYS n 
17 126  ALA n 
17 127  GLY n 
17 128  GLY n 
17 129  GLY n 
17 130  GLU n 
17 131  PHE n 
17 132  ASP n 
17 133  SER n 
17 134  VAL n 
17 135  ALA n 
17 136  ASP n 
17 137  LEU n 
17 138  GLU n 
17 139  ARG n 
17 140  TYR n 
17 141  ILE n 
17 142  ASP n 
17 143  ALA n 
17 144  ASN n 
17 145  HIS n 
17 146  GLY n 
17 147  ASP n 
17 148  ALA n 
18 1    PRO n 
18 2    SER n 
18 3    SER n 
18 4    ASN n 
18 5    GLY n 
18 6    PRO n 
18 7    LEU n 
18 8    GLU n 
18 9    GLY n 
18 10   THR n 
18 11   ARG n 
18 12   GLY n 
18 13   LYS n 
18 14   LEU n 
18 15   LYS n 
18 16   ASN n 
18 17   LYS n 
18 18   PRO n 
18 19   ARG n 
18 20   ASP n 
18 21   ARG n 
18 22   GLY n 
18 23   THR n 
18 24   SER n 
18 25   PRO n 
18 26   PRO n 
18 27   GLN n 
18 28   ARG n 
18 29   ALA n 
18 30   VAL n 
18 31   GLU n 
18 32   GLU n 
18 33   PHE n 
18 34   ASP n 
18 35   ASP n 
18 36   GLY n 
18 37   GLU n 
18 38   LYS n 
18 39   VAL n 
18 40   HIS n 
18 41   LEU n 
18 42   LYS n 
18 43   ILE n 
18 44   ASP n 
18 45   PRO n 
18 46   SER n 
18 47   VAL n 
18 48   PRO n 
18 49   ASN n 
18 50   GLY n 
18 51   ARG n 
18 52   PHE n 
18 53   HIS n 
18 54   PRO n 
18 55   ARG n 
18 56   PHE n 
18 57   ASP n 
18 58   GLY n 
18 59   GLN n 
18 60   THR n 
18 61   GLY n 
18 62   THR n 
18 63   VAL n 
18 64   GLU n 
18 65   GLY n 
18 66   LYS n 
18 67   GLN n 
18 68   GLY n 
18 69   ASP n 
18 70   ALA n 
18 71   TYR n 
18 72   LYS n 
18 73   VAL n 
18 74   ASP n 
18 75   ILE n 
18 76   VAL n 
18 77   ASP n 
18 78   GLY n 
18 79   GLY n 
18 80   LYS n 
18 81   GLU n 
18 82   LYS n 
18 83   THR n 
18 84   ILE n 
18 85   ILE n 
18 86   VAL n 
18 87   THR n 
18 88   ALA n 
18 89   ALA n 
18 90   HIS n 
18 91   LEU n 
18 92   ARG n 
18 93   ARG n 
18 94   GLN n 
18 95   GLU n 
19 1    GLY n 
19 2    ILE n 
19 3    SER n 
19 4    TYR n 
19 5    SER n 
19 6    VAL n 
19 7    GLU n 
19 8    ALA n 
19 9    ASP n 
19 10   PRO n 
19 11   ASP n 
19 12   THR n 
19 13   THR n 
19 14   ALA n 
19 15   LYS n 
19 16   ALA n 
19 17   MET n 
19 18   LEU n 
19 19   ARG n 
19 20   GLU n 
19 21   ARG n 
19 22   GLN n 
19 23   MET n 
19 24   SER n 
19 25   PHE n 
19 26   LYS n 
19 27   HIS n 
19 28   SER n 
19 29   LYS n 
19 30   ALA n 
19 31   ILE n 
19 32   ALA n 
19 33   ARG n 
19 34   GLU n 
19 35   ILE n 
19 36   LYS n 
19 37   GLY n 
19 38   LYS n 
19 39   THR n 
19 40   ALA n 
19 41   GLY n 
19 42   GLU n 
19 43   ALA n 
19 44   VAL n 
19 45   ASP n 
19 46   TYR n 
19 47   LEU n 
19 48   GLU n 
19 49   ALA n 
19 50   VAL n 
19 51   ILE n 
19 52   GLU n 
19 53   GLY n 
19 54   ASP n 
19 55   GLN n 
19 56   PRO n 
19 57   VAL n 
19 58   PRO n 
19 59   PHE n 
19 60   LYS n 
19 61   GLN n 
19 62   HIS n 
19 63   ASN n 
19 64   SER n 
19 65   GLY n 
19 66   VAL n 
19 67   GLY n 
19 68   HIS n 
19 69   LYS n 
19 70   SER n 
19 71   LYS n 
19 72   VAL n 
19 73   ASP n 
19 74   GLY n 
19 75   TRP n 
19 76   ASP n 
19 77   ALA n 
19 78   GLY n 
19 79   ARG n 
19 80   TYR n 
19 81   PRO n 
19 82   GLU n 
19 83   LYS n 
19 84   ALA n 
19 85   SER n 
19 86   LYS n 
19 87   ALA n 
19 88   PHE n 
19 89   LEU n 
19 90   ASP n 
19 91   LEU n 
19 92   LEU n 
19 93   GLU n 
19 94   ASN n 
19 95   ALA n 
19 96   VAL n 
19 97   GLY n 
19 98   ASN n 
19 99   ALA n 
19 100  ASP n 
19 101  HIS n 
19 102  GLN n 
19 103  GLY n 
19 104  PHE n 
19 105  ASP n 
19 106  GLY n 
19 107  GLU n 
19 108  ALA n 
19 109  MET n 
19 110  THR n 
19 111  ILE n 
19 112  LYS n 
19 113  HIS n 
19 114  VAL n 
19 115  ALA n 
19 116  ALA n 
19 117  HIS n 
19 118  LYS n 
19 119  VAL n 
19 120  GLY n 
19 121  GLU n 
19 122  GLN n 
19 123  GLN n 
19 124  GLY n 
19 125  ARG n 
19 126  LYS n 
19 127  PRO n 
19 128  ARG n 
19 129  ALA n 
19 130  MET n 
19 131  GLY n 
19 132  ARG n 
19 133  ALA n 
19 134  SER n 
19 135  ALA n 
19 136  TRP n 
19 137  ASN n 
19 138  SER n 
19 139  PRO n 
19 140  GLN n 
19 141  VAL n 
19 142  ASP n 
19 143  VAL n 
19 144  GLU n 
19 145  LEU n 
19 146  ILE n 
19 147  LEU n 
19 148  GLU n 
19 149  GLU n 
19 150  PRO n 
19 151  GLU n 
19 152  VAL n 
19 153  GLU n 
19 154  ASP n 
20 1    SER n 
20 2    TRP n 
20 3    ASP n 
20 4    VAL n 
20 5    ILE n 
20 6    LYS n 
20 7    HIS n 
20 8    PRO n 
20 9    HIS n 
20 10   VAL n 
20 11   THR n 
20 12   GLU n 
20 13   LYS n 
20 14   ALA n 
20 15   MET n 
20 16   ASN n 
20 17   ASP n 
20 18   MET n 
20 19   ASP n 
20 20   PHE n 
20 21   GLN n 
20 22   ASN n 
20 23   LYS n 
20 24   LEU n 
20 25   GLN n 
20 26   PHE n 
20 27   ALA n 
20 28   VAL n 
20 29   ASP n 
20 30   ASP n 
20 31   ARG n 
20 32   ALA n 
20 33   SER n 
20 34   LYS n 
20 35   GLY n 
20 36   GLU n 
20 37   VAL n 
20 38   ALA n 
20 39   ASP n 
20 40   ALA n 
20 41   VAL n 
20 42   GLU n 
20 43   GLU n 
20 44   GLN n 
20 45   TYR n 
20 46   ASP n 
20 47   VAL n 
20 48   THR n 
20 49   VAL n 
20 50   GLU n 
20 51   GLN n 
20 52   VAL n 
20 53   ASN n 
20 54   THR n 
20 55   GLN n 
20 56   ASN n 
20 57   THR n 
20 58   MET n 
20 59   ASP n 
20 60   GLY n 
20 61   GLU n 
20 62   LYS n 
20 63   LYS n 
20 64   ALA n 
20 65   VAL n 
20 66   VAL n 
20 67   ARG n 
20 68   LEU n 
20 69   SER n 
20 70   GLU n 
20 71   ASP n 
20 72   ASP n 
20 73   ASP n 
20 74   ALA n 
20 75   GLN n 
20 76   GLU n 
20 77   VAL n 
20 78   ALA n 
20 79   SER n 
20 80   ARG n 
20 81   ILE n 
20 82   GLY n 
20 83   VAL n 
20 84   PHE n 
21 1    SER n 
21 2    LYS n 
21 3    GLN n 
21 4    PRO n 
21 5    ASP n 
21 6    LYS n 
21 7    GLN n 
21 8    ARG n 
21 9    LYS n 
21 10   SER n 
21 11   GLN n 
21 12   ARG n 
21 13   ARG n 
21 14   ALA n 
21 15   PRO n 
21 16   LEU n 
21 17   HIS n 
21 18   GLU n 
21 19   ARG n 
21 20   HIS n 
21 21   LYS n 
21 22   GLN n 
21 23   VAL n 
21 24   ARG n 
21 25   ALA n 
21 26   THR n 
21 27   LEU n 
21 28   SER n 
21 29   ALA n 
21 30   ASP n 
21 31   LEU n 
21 32   ARG n 
21 33   GLU n 
21 34   GLU n 
21 35   TYR n 
21 36   GLY n 
21 37   GLN n 
21 38   ARG n 
21 39   ASN n 
21 40   VAL n 
21 41   ARG n 
21 42   VAL n 
21 43   ASN n 
21 44   ALA n 
21 45   GLY n 
21 46   ASP n 
21 47   THR n 
21 48   VAL n 
21 49   GLU n 
21 50   VAL n 
21 51   LEU n 
21 52   ARG n 
21 53   GLY n 
21 54   ASP n 
21 55   PHE n 
21 56   ALA n 
21 57   GLY n 
21 58   GLU n 
21 59   GLU n 
21 60   GLY n 
21 61   GLU n 
21 62   VAL n 
21 63   ILE n 
21 64   ASN n 
21 65   VAL n 
21 66   ASP n 
21 67   LEU n 
21 68   ASP n 
21 69   LYS n 
21 70   ALA n 
21 71   VAL n 
21 72   ILE n 
21 73   HIS n 
21 74   VAL n 
21 75   GLU n 
21 76   ASP n 
21 77   VAL n 
21 78   THR n 
21 79   LEU n 
21 80   GLU n 
21 81   LYS n 
21 82   THR n 
21 83   ASP n 
21 84   GLY n 
21 85   GLU n 
21 86   GLU n 
21 87   VAL n 
21 88   PRO n 
21 89   ARG n 
21 90   PRO n 
21 91   LEU n 
21 92   ASP n 
21 93   THR n 
21 94   SER n 
21 95   ASN n 
21 96   VAL n 
21 97   ARG n 
21 98   VAL n 
21 99   THR n 
21 100  ASP n 
21 101  LEU n 
21 102  ASP n 
21 103  LEU n 
21 104  GLU n 
21 105  ASP n 
21 106  GLU n 
21 107  LYS n 
21 108  ARG n 
21 109  GLU n 
21 110  ALA n 
21 111  ARG n 
21 112  LEU n 
21 113  GLU n 
21 114  SER n 
21 115  GLU n 
21 116  ASP n 
21 117  ASP n 
21 118  SER n 
21 119  ALA n 
22 1    PRO n 
22 2    ARG n 
22 3    THR n 
22 4    ARG n 
22 5    GLU n 
22 6    CYS n 
22 7    ASP n 
22 8    TYR n 
22 9    CYS n 
22 10   GLY n 
22 11   THR n 
22 12   ASP n 
22 13   ILE n 
22 14   GLU n 
22 15   PRO n 
22 16   GLY n 
22 17   THR n 
22 18   GLY n 
22 19   THR n 
22 20   MET n 
22 21   PHE n 
22 22   VAL n 
22 23   HIS n 
22 24   LYS n 
22 25   ASP n 
22 26   GLY n 
22 27   ALA n 
22 28   THR n 
22 29   THR n 
22 30   HIS n 
22 31   PHE n 
22 32   CYS n 
22 33   SER n 
22 34   SER n 
22 35   LYS n 
22 36   CYS n 
22 37   GLU n 
22 38   ASN n 
22 39   ASN n 
22 40   ALA n 
22 41   ASP n 
22 42   LEU n 
22 43   GLY n 
22 44   ARG n 
22 45   GLU n 
22 46   ALA n 
22 47   ARG n 
22 48   ASN n 
22 49   LEU n 
22 50   GLU n 
22 51   TRP n 
22 52   THR n 
22 53   ASP n 
22 54   THR n 
22 55   ALA n 
22 56   ARG n 
22 57   GLY n 
22 58   GLU n 
22 59   ALA n 
22 60   GLY n 
22 61   GLU n 
22 62   ALA n 
22 63   GLU n 
22 64   ASP n 
22 65   GLU n 
22 66   ALA n 
23 1    THR n 
23 2    VAL n 
23 3    LEU n 
23 4    HIS n 
23 5    VAL n 
23 6    GLN n 
23 7    GLU n 
23 8    ILE n 
23 9    ARG n 
23 10   ASP n 
23 11   MET n 
23 12   THR n 
23 13   PRO n 
23 14   ALA n 
23 15   GLU n 
23 16   ARG n 
23 17   GLU n 
23 18   ALA n 
23 19   GLU n 
23 20   LEU n 
23 21   ASP n 
23 22   ASP n 
23 23   LEU n 
23 24   LYS n 
23 25   THR n 
23 26   GLU n 
23 27   LEU n 
23 28   LEU n 
23 29   ASN n 
23 30   ALA n 
23 31   ARG n 
23 32   ALA n 
23 33   VAL n 
23 34   GLN n 
23 35   ALA n 
23 36   ALA n 
23 37   GLY n 
23 38   GLY n 
23 39   ALA n 
23 40   PRO n 
23 41   GLU n 
23 42   ASN n 
23 43   PRO n 
23 44   GLY n 
23 45   ARG n 
23 46   ILE n 
23 47   LYS n 
23 48   GLU n 
23 49   LEU n 
23 50   ARG n 
23 51   LYS n 
23 52   ALA n 
23 53   ILE n 
23 54   ALA n 
23 55   ARG n 
23 56   ILE n 
23 57   LYS n 
23 58   THR n 
23 59   ILE n 
23 60   GLN n 
23 61   GLY n 
23 62   GLU n 
23 63   GLU n 
23 64   GLY n 
23 65   ASP n 
23 66   LEU n 
23 67   GLN n 
23 68   GLU n 
23 69   ASN n 
23 70   GLU n 
24 1    MET n 
24 2    HIS n 
24 3    ALA n 
24 4    LEU n 
24 5    VAL n 
24 6    GLN n 
24 7    LEU n 
24 8    ARG n 
24 9    GLY n 
24 10   GLU n 
24 11   VAL n 
24 12   ASN n 
24 13   MET n 
24 14   HIS n 
24 15   THR n 
24 16   ASP n 
24 17   ILE n 
24 18   GLN n 
24 19   ASP n 
24 20   THR n 
24 21   LEU n 
24 22   GLU n 
24 23   MET n 
24 24   LEU n 
24 25   ASN n 
24 26   ILE n 
24 27   HIS n 
24 28   HIS n 
24 29   VAL n 
24 30   ASN n 
24 31   HIS n 
24 32   CYS n 
24 33   THR n 
24 34   LEU n 
24 35   VAL n 
24 36   PRO n 
24 37   GLU n 
24 38   THR n 
24 39   ASP n 
24 40   ALA n 
24 41   TYR n 
24 42   ARG n 
24 43   GLY n 
24 44   MET n 
24 45   VAL n 
24 46   ALA n 
24 47   LYS n 
24 48   VAL n 
24 49   ASN n 
24 50   ASP n 
24 51   PHE n 
24 52   VAL n 
24 53   ALA n 
24 54   PHE n 
24 55   GLY n 
24 56   GLU n 
24 57   PRO n 
24 58   SER n 
24 59   GLN n 
24 60   GLU n 
24 61   THR n 
24 62   LEU n 
24 63   GLU n 
24 64   THR n 
24 65   VAL n 
24 66   LEU n 
24 67   ALA n 
24 68   THR n 
24 69   ARG n 
24 70   ALA n 
24 71   GLU n 
24 72   PRO n 
24 73   LEU n 
24 74   GLU n 
24 75   GLY n 
24 76   ASP n 
24 77   ALA n 
24 78   ASP n 
24 79   VAL n 
24 80   ASP n 
24 81   ASP n 
24 82   GLU n 
24 83   TRP n 
24 84   VAL n 
24 85   ALA n 
24 86   GLU n 
24 87   HIS n 
24 88   THR n 
24 89   ASP n 
24 90   TYR n 
24 91   ASP n 
24 92   ASP n 
24 93   ILE n 
24 94   SER n 
24 95   GLY n 
24 96   LEU n 
24 97   ALA n 
24 98   PHE n 
24 99   ALA n 
24 100  LEU n 
24 101  LEU n 
24 102  SER n 
24 103  GLU n 
24 104  GLU n 
24 105  THR n 
24 106  THR n 
24 107  LEU n 
24 108  ARG n 
24 109  GLU n 
24 110  GLN n 
24 111  GLY n 
24 112  LEU n 
24 113  SER n 
24 114  PRO n 
24 115  THR n 
24 116  LEU n 
24 117  ARG n 
24 118  LEU n 
24 119  HIS n 
24 120  PRO n 
24 121  PRO n 
24 122  ARG n 
24 123  GLY n 
24 124  GLY n 
24 125  HIS n 
24 126  ASP n 
24 127  GLY n 
24 128  VAL n 
24 129  LYS n 
24 130  HIS n 
24 131  PRO n 
24 132  VAL n 
24 133  LYS n 
24 134  GLU n 
24 135  GLY n 
24 136  GLY n 
24 137  GLN n 
24 138  LEU n 
24 139  GLY n 
24 140  LYS n 
24 141  HIS n 
24 142  ASP n 
24 143  THR n 
24 144  GLU n 
24 145  GLY n 
24 146  ILE n 
24 147  ASP n 
24 148  ASP n 
24 149  LEU n 
24 150  LEU n 
24 151  GLU n 
24 152  ALA n 
24 153  MET n 
24 154  ARG n 
25 1    SER n 
25 2    ALA n 
25 3    SER n 
25 4    ASP n 
25 5    PHE n 
25 6    GLU n 
25 7    GLU n 
25 8    ARG n 
25 9    VAL n 
25 10   VAL n 
25 11   THR n 
25 12   ILE n 
25 13   PRO n 
25 14   LEU n 
25 15   ARG n 
25 16   ASP n 
25 17   ALA n 
25 18   ARG n 
25 19   ALA n 
25 20   GLU n 
25 21   PRO n 
25 22   ASN n 
25 23   HIS n 
25 24   LYS n 
25 25   ARG n 
25 26   ALA n 
25 27   ASP n 
25 28   LYS n 
25 29   ALA n 
25 30   MET n 
25 31   ILE n 
25 32   LEU n 
25 33   ILE n 
25 34   ARG n 
25 35   GLU n 
25 36   HIS n 
25 37   LEU n 
25 38   ALA n 
25 39   LYS n 
25 40   HIS n 
25 41   PHE n 
25 42   SER n 
25 43   VAL n 
25 44   ASP n 
25 45   GLU n 
25 46   ASP n 
25 47   ALA n 
25 48   VAL n 
25 49   ARG n 
25 50   LEU n 
25 51   ASP n 
25 52   PRO n 
25 53   SER n 
25 54   ILE n 
25 55   ASN n 
25 56   GLU n 
25 57   ALA n 
25 58   ALA n 
25 59   TRP n 
25 60   ALA n 
25 61   ARG n 
25 62   GLY n 
25 63   ARG n 
25 64   ALA n 
25 65   ASN n 
25 66   THR n 
25 67   PRO n 
25 68   SER n 
25 69   LYS n 
25 70   ILE n 
25 71   ARG n 
25 72   VAL n 
25 73   ARG n 
25 74   ALA n 
25 75   ALA n 
25 76   ARG n 
25 77   PHE n 
25 78   GLU n 
25 79   GLU n 
25 80   GLU n 
25 81   GLY n 
25 82   GLU n 
25 83   ALA n 
25 84   ILE n 
25 85   VAL n 
25 86   GLU n 
25 87   ALA n 
25 88   GLU n 
25 89   THR n 
25 90   ALA n 
25 91   GLU n 
26 1    ALA n 
26 2    ASP n 
26 3    ASN n 
26 4    GLU n 
26 5    GLU n 
26 6    ASP n 
26 7    VAL n 
26 8    GLU n 
26 9    ALA n 
26 10   GLU n 
26 11   GLU n 
26 12   GLU n 
26 13   TYR n 
26 14   THR n 
26 15   GLU n 
26 16   LEU n 
26 17   THR n 
26 18   ASP n 
26 19   ILE n 
26 20   SER n 
26 21   GLY n 
26 22   VAL n 
26 23   GLY n 
26 24   PRO n 
26 25   SER n 
26 26   LYS n 
26 27   ALA n 
26 28   GLU n 
26 29   SER n 
26 30   LEU n 
26 31   ARG n 
26 32   GLU n 
26 33   ALA n 
26 34   GLY n 
26 35   PHE n 
26 36   GLU n 
26 37   SER n 
26 38   VAL n 
26 39   GLU n 
26 40   ASP n 
26 41   VAL n 
26 42   ARG n 
26 43   GLY n 
26 44   ALA n 
26 45   ASP n 
26 46   GLN n 
26 47   SER n 
26 48   ALA n 
26 49   LEU n 
26 50   ALA n 
26 51   ASP n 
26 52   VAL n 
26 53   SER n 
26 54   GLY n 
26 55   ILE n 
26 56   GLY n 
26 57   ASN n 
26 58   ALA n 
26 59   LEU n 
26 60   ALA n 
26 61   ALA n 
26 62   ARG n 
26 63   ILE n 
26 64   LYS n 
26 65   ALA n 
26 66   ASP n 
26 67   VAL n 
26 68   GLY n 
26 69   GLY n 
26 70   LEU n 
26 71   GLU n 
26 72   VAL n 
26 73   GLU n 
26 74   SER n 
26 75   GLU n 
26 76   THR n 
26 77   GLU n 
26 78   ALA n 
26 79   GLU n 
26 80   VAL n 
26 81   GLU n 
26 82   GLU n 
26 83   GLU n 
26 84   GLY n 
26 85   GLY n 
26 86   GLU n 
26 87   GLU n 
26 88   ALA n 
26 89   PRO n 
26 90   ASP n 
26 91   GLU n 
26 92   ASP n 
26 93   VAL n 
26 94   GLU n 
26 95   THR n 
26 96   GLU n 
26 97   LEU n 
26 98   GLN n 
26 99   ALA n 
26 100  ARG n 
26 101  GLY n 
26 102  LEU n 
26 103  THR n 
26 104  GLU n 
26 105  LYS n 
26 106  THR n 
26 107  PRO n 
26 108  ASP n 
26 109  LEU n 
26 110  SER n 
26 111  ASP n 
26 112  GLU n 
26 113  ASP n 
26 114  ALA n 
26 115  ARG n 
26 116  LEU n 
26 117  LEU n 
26 118  THR n 
26 119  GLN n 
26 120  ARG n 
26 121  HIS n 
26 122  ARG n 
26 123  VAL n 
26 124  GLY n 
26 125  LYS n 
26 126  PRO n 
26 127  GLN n 
26 128  PHE n 
26 129  ASN n 
26 130  ARG n 
26 131  GLN n 
26 132  ASP n 
26 133  HIS n 
26 134  HIS n 
26 135  LYS n 
26 136  LYS n 
26 137  LYS n 
26 138  ARG n 
26 139  VAL n 
26 140  SER n 
26 141  THR n 
26 142  SER n 
26 143  TRP n 
26 144  ARG n 
26 145  LYS n 
26 146  PRO n 
26 147  ARG n 
26 148  GLY n 
26 149  GLN n 
26 150  LEU n 
26 151  SER n 
26 152  LYS n 
26 153  GLN n 
26 154  ARG n 
26 155  ARG n 
26 156  GLY n 
26 157  ILE n 
26 158  LYS n 
26 159  GLY n 
26 160  LYS n 
26 161  GLY n 
26 162  ASP n 
26 163  THR n 
26 164  VAL n 
26 165  GLU n 
26 166  ALA n 
26 167  GLY n 
26 168  PHE n 
26 169  ARG n 
26 170  SER n 
26 171  PRO n 
26 172  THR n 
26 173  ALA n 
26 174  VAL n 
26 175  ARG n 
26 176  GLY n 
26 177  LYS n 
26 178  HIS n 
26 179  PRO n 
26 180  SER n 
26 181  GLY n 
26 182  PHE n 
26 183  GLU n 
26 184  GLU n 
26 185  VAL n 
26 186  ARG n 
26 187  VAL n 
26 188  HIS n 
26 189  ASN n 
26 190  VAL n 
26 191  ASP n 
26 192  ASP n 
26 193  LEU n 
26 194  GLU n 
26 195  GLY n 
26 196  VAL n 
26 197  ASP n 
26 198  GLY n 
26 199  ASP n 
26 200  THR n 
26 201  GLU n 
26 202  ALA n 
26 203  VAL n 
26 204  ARG n 
26 205  ILE n 
26 206  ALA n 
26 207  SER n 
26 208  LYS n 
26 209  VAL n 
26 210  GLY n 
26 211  ALA n 
26 212  ARG n 
26 213  LYS n 
26 214  ARG n 
26 215  GLU n 
26 216  ARG n 
26 217  ILE n 
26 218  GLU n 
26 219  GLU n 
26 220  GLU n 
26 221  ALA n 
26 222  GLU n 
26 223  ASP n 
26 224  ALA n 
26 225  GLY n 
26 226  ILE n 
26 227  ARG n 
26 228  VAL n 
26 229  LEU n 
26 230  ASN n 
26 231  PRO n 
26 232  THR n 
26 233  TYR n 
26 234  VAL n 
26 235  GLU n 
26 236  VAL n 
26 237  GLU n 
26 238  VAL n 
26 239  SER n 
26 240  GLU n 
27 1    ARG n 
27 2    THR n 
27 3    GLY n 
27 4    ARG n 
27 5    PHE n 
27 6    GLY n 
27 7    PRO n 
27 8    ARG n 
27 9    TYR n 
27 10   GLY n 
27 11   LEU n 
27 12   LYS n 
27 13   ILE n 
27 14   ARG n 
27 15   VAL n 
27 16   ARG n 
27 17   VAL n 
27 18   ALA n 
27 19   ASP n 
27 20   VAL n 
27 21   GLU n 
27 22   ILE n 
27 23   LYS n 
27 24   HIS n 
27 25   LYS n 
27 26   LYS n 
27 27   LYS n 
27 28   HIS n 
27 29   LYS n 
27 30   CYS n 
27 31   PRO n 
27 32   VAL n 
27 33   CYS n 
27 34   GLY n 
27 35   PHE n 
27 36   LYS n 
27 37   LYS n 
27 38   LEU n 
27 39   LYS n 
27 40   ARG n 
27 41   ALA n 
27 42   GLY n 
27 43   THR n 
27 44   GLY n 
27 45   ILE n 
27 46   TRP n 
27 47   MET n 
27 48   CYS n 
27 49   GLY n 
27 50   HIS n 
27 51   CYS n 
27 52   GLY n 
27 53   TYR n 
27 54   LYS n 
27 55   ILE n 
27 56   ALA n 
27 57   GLY n 
27 58   GLY n 
27 59   CYS n 
27 60   TYR n 
27 61   GLN n 
27 62   PRO n 
27 63   GLU n 
27 64   THR n 
27 65   VAL n 
27 66   ALA n 
27 67   GLY n 
27 68   LYS n 
27 69   ALA n 
27 70   VAL n 
27 71   MET n 
27 72   LYS n 
27 73   ALA n 
28 1    THR n 
28 2    GLY n 
28 3    ALA n 
28 4    GLY n 
28 5    THR n 
28 6    PRO n 
28 7    SER n 
28 8    GLN n 
28 9    GLY n 
28 10   LYS n 
28 11   LYS n 
28 12   ASN n 
28 13   THR n 
28 14   THR n 
28 15   THR n 
28 16   HIS n 
28 17   THR n 
28 18   LYS n 
28 19   CYS n 
28 20   ARG n 
28 21   ARG n 
28 22   CYS n 
28 23   GLY n 
28 24   GLU n 
28 25   LYS n 
28 26   SER n 
28 27   TYR n 
28 28   HIS n 
28 29   THR n 
28 30   LYS n 
28 31   LYS n 
28 32   LYS n 
28 33   VAL n 
28 34   CYS n 
28 35   SER n 
28 36   SER n 
28 37   CYS n 
28 38   GLY n 
28 39   PHE n 
28 40   GLY n 
28 41   LYS n 
28 42   SER n 
28 43   ALA n 
28 44   LYS n 
28 45   ARG n 
28 46   ARG n 
28 47   ASP n 
28 48   TYR n 
28 49   GLU n 
28 50   TRP n 
28 51   GLN n 
28 52   SER n 
28 53   LYS n 
28 54   ALA n 
28 55   GLY n 
28 56   GLU n 
29 1    GLY n 
29 2    LYS n 
29 3    LYS n 
29 4    SER n 
29 5    LYS n 
29 6    ALA n 
29 7    THR n 
29 8    LYS n 
29 9    LYS n 
29 10   ARG n 
29 11   LEU n 
29 12   ALA n 
29 13   LYS n 
29 14   LEU n 
29 15   ASP n 
29 16   ASN n 
29 17   GLN n 
29 18   ASN n 
29 19   SER n 
29 20   ARG n 
29 21   VAL n 
29 22   PRO n 
29 23   ALA n 
29 24   TRP n 
29 25   VAL n 
29 26   MET n 
29 27   LEU n 
29 28   LYS n 
29 29   THR n 
29 30   ASP n 
29 31   GLU n 
29 32   VAL n 
29 33   GLN n 
29 34   ARG n 
29 35   ASN n 
29 36   HIS n 
29 37   LYS n 
29 38   ARG n 
29 39   ARG n 
29 40   HIS n 
29 41   TRP n 
29 42   ARG n 
29 43   ARG n 
29 44   ASN n 
29 45   ASP n 
29 46   THR n 
29 47   ASP n 
29 48   GLU n 
30 1    MET n 
30 2    GLN n 
30 3    MET n 
30 4    PRO n 
30 5    ARG n 
30 6    ARG n 
30 7    PHE n 
30 8    ASN n 
30 9    THR n 
30 10   TYR n 
30 11   CYS n 
30 12   PRO n 
30 13   HIS n 
30 14   CYS n 
30 15   ASN n 
30 16   GLU n 
30 17   HIS n 
30 18   GLN n 
30 19   GLU n 
30 20   HIS n 
30 21   GLU n 
30 22   VAL n 
30 23   GLU n 
30 24   LYS n 
30 25   VAL n 
30 26   ARG n 
30 27   SER n 
30 28   GLY n 
30 29   ARG n 
30 30   GLN n 
30 31   THR n 
30 32   GLY n 
30 33   MET n 
30 34   LYS n 
30 35   TRP n 
30 36   ILE n 
30 37   ASP n 
30 38   ARG n 
30 39   GLN n 
30 40   ARG n 
30 41   GLU n 
30 42   ARG n 
30 43   ASN n 
30 44   SER n 
30 45   GLY n 
30 46   ILE n 
30 47   GLY n 
30 48   ASN n 
30 49   ASP n 
30 50   GLY n 
30 51   LYS n 
30 52   PHE n 
30 53   SER n 
30 54   LYS n 
30 55   VAL n 
30 56   PRO n 
30 57   GLY n 
30 58   GLY n 
30 59   ASP n 
30 60   LYS n 
30 61   PRO n 
30 62   THR n 
30 63   LYS n 
30 64   LYS n 
30 65   THR n 
30 66   ASP n 
30 67   LEU n 
30 68   LYS n 
30 69   TYR n 
30 70   ARG n 
30 71   CYS n 
30 72   GLY n 
30 73   GLU n 
30 74   CYS n 
30 75   GLY n 
30 76   LYS n 
30 77   ALA n 
30 78   HIS n 
30 79   LEU n 
30 80   ARG n 
30 81   GLU n 
30 82   GLY n 
30 83   TRP n 
30 84   ARG n 
30 85   ALA n 
30 86   GLY n 
30 87   ARG n 
30 88   LEU n 
30 89   GLU n 
30 90   PHE n 
30 91   GLN n 
30 92   GLU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
2  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
3  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
4  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
5  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
6  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
7  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
8  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
9  1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
10 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
11 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
12 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
13 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
14 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
15 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
16 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
17 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
18 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
19 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
20 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
21 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
22 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
23 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
24 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
25 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
26 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
27 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
28 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
29 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
30 1 sample ? ? ? 'Haloarcula marismortui' 2238 Haloarcula   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'cultured cells' 
31 1 sample ? ? ? 'Streptomyces virginiae' 1961 Streptomyces ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ?                
# 
loop_
_struct_ref.id 
_struct_ref.entity_id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1  1  GB  AF034620   3377779 2597 
;UUGGCUACUAUGCCAGCUGGUGGAUUGCUCGGCUCAGGCGCUGAUGAAGGACGUGCCAAGCUGCGAUAAGCCAUGGGGAG
CCGCACGGAGGCGAAGAACCAUGGAUUUCCGAAUGAGAAUCUCUCUAACAAUUGCUUCGCGCAAUGAGGAACCCCGAGAA
CUGAAACAUCUCAGUAUCGGGAGGAACAGAAAACGCAAUGUGAUGUCGUUAGUAACCGCGAGUGAACGCGAUACAGCCCA
AACCGAAGCCCUCACGGGCAAUGUGGUGUCAGGGCUACCUCUCAUCAGCCGACCGUCUCGACGAAGUCUCUUGGAACAGA
GCGUGAUACAGGGUGACAACCCCGUACUCGAGACCAGUACGACGUGCGGUAGUGCCAGAGUAGCGGGGGUUGGAUAUCCC
UCGCGAAUAACGCAGGCAUCGACUGCGAAGGCUAAACACAACCUGAGACCGAUAGUGAACAAGUAGUGUGAACGAACGCU
GCAAAGUACCCUCAGAAGGGAGGCGAAAUAGAGCAUGAAAUCAGUUGGCGAUCGAGCGACAGGGCAUACAAGGUCCCUCG
ACGAAUGACCGACGCGCGAGCGUCCAGUAAGACUCACGGGAAGCCGAUGUUCUGUCGUACGUUUUGAAAAACGAGCCAGG
GAGUGUGUCUGCAUGGCAAGUCUAACCGGAGUAUCCGGGGAGGCACAGGGAAACCGACAUGGCCGCAGGGCUUUGCCCGA
GGGCCGCCGUCUUCAAGGGCGGGGAGCCAUGUGGACACGACCCGAAUCCGGACGAUCUACGCAUGGACAAGAUGAAGCGU
GCCGAAAGGCACGUGGAAGUCUGUUAGAGUUGGUGUCCUACAAUACCCUCUCGUGAUCUAUGUGUAGGGGUGAAAGGCCC
AUCGAGUCCGGCAACAGCUGGUUCCAAUCGAAACAUGUCGAAGCAUGACCUCCGCCGAGGUAGUCUGUGAGGUAGAGCGA
CCGAUUGGUGUGUCCGCCUCCGAGAGGAGUCGGCACACCUGUCAAACUCCAAACUUACAGACGCCGUUUGACGCGGGGAU
UCCGGUGCGCGGGGUAAGCCUGUGUACCAGGAGGGGAACAACCCAGAGAUAGGUUAAGGUCCCCAAGUGUGGAUUAAGUG
UAAUCCUCUGAAGGUGGUCUCGAGCCCUAGACAGCCGGGAGGUGAGCUUAGAAGCAGCUACCCUCUAAGAAAAGCGUAAC
AGCUUACCGGCCGAGGUUUGAGGCGCCCAAAAUGAUCGGGACUCAAAUCCACCACCGAGACCUGUCCGUACCACUCAUAC
UGGUAAUCGAGUAGAUUGGCGCUCUAAUUGGAUGGAAGUAGGGGUGAAAACUCCUAUGGACCGAUUAGUGACGAAAAUCC
UGGCCAUAGUAGCAGCGAUAGUCGGGUGAGAACCCCGACGGCCUAAUGGAUAAGGGUUCCUCAGCACUGCUGAUCAGCUG
AGGGUUAGCCGGUCCUAAGUCAUACCGCAACUCGACUAUGACGAAAUGGGAAACGGGUUAAUAUUCCCGUGCCACUAUGC
AGUGAAAGUUGACGCCCUGGGGUCGAUCACGCUGGGCAUUCGCCCAGUCGAACCGUCCAACUCCGUGGAAGCCGUAAUGG
CAGGAAGCGGACGAACGGCGGCAUAGGGAAACGUGAUUCAACCUGGGGCCCAUGAAAAGACGAGCAUAGUGUCCGUACCG
AGAACCGACACAGGUGUCCAUGGCGGCGAAAGCCAAGGCCUGUCGGGAGCAACCAACGUUAGGGAAUUCGGCAAGUUAGU
CCCGUACCUUCGGAAGAAGGGAUGCCUGCUCCGGAACGGAGCAGGUCGCAGUGACUCGGAAGCUCGGACUGUCUAGUAAC
AACAUAGGUGACCGCAAAUCCGCAAGGACUCGUACGGUCACUGAAUCCUGCCCAGUGCAGGUAUCUGAACACCUCGUACA
AGAGGACGAAGGACCUGUCAACGGCGGGGGUAACUAUGACCCUCUUAAGGUAGCGUAGUACCUUGCCGCAUCAGUAGCGG
CUUGCAUGAAUGGAUUAACCAGAGCUUCACUGUCCCAACGUUGGGCCCGGUGAACUGUACAUUCCAGUGCGGAGUCUGGA
GACACCCAGGGGGAAGCGAAGACCCUAUGGAGCUUUACUGCAGGCUGUCGCUGAGACGUGGUCGCCGAUGUGCAGCAUAG
GUAGGAGACACUACACAGGUACCCGCGCUAGCGGGCCACCGAGUCAACAGUGAAAUACUACCCGUCGGUGACUGCGACUC
UCACUCCGGGAGGAGGACACCGAUAGCCGGGCAGUUUGACUGGGGCGGUACGCGCUCGAAAAGAUAUCGAGCGCGCCCUA
UGGCUAUCUCAGCCGGGACAGAGACCCGGCGAAGAGUGCAAGAGCAAAAGAUAGCUUGACAGUGUUCUUCCCAACGAGGA
ACGCUGACGCGAAAGCGUGGUCUAGCGAACCAAUUAGCCUGCUUGAUGCGGGCAAUUGAUGACAGAAAAGCUACCCUAGG
GAUAACAGAGUCGUCACUCGCAAGAGCACAUAUCGACCGAGUGGCUUGCUACCUCGAUGUCGGUUCCCUCCAUCCUGCCC
GUGCAGAAGCGGGCAAGGGUGAGGUUGUUCGCCUAUUAAAGGAGGUCGUGAGCUGGGUUUAGACCGUCGUGAGACAGGUC
GGCUGCUAUCUACUGGGUGUGUAAUGGUGUCUGACAAGAACGACCGUAUAGUACGAGAGGAACUACGGUUGGUGGCCACU
GGUGUACCGGUUGUUCGAGAGAGCACGUGCCGGGUAGCCACGCCACACGGGGUAAGAGCUGAACGCAUCUAAGCUCGAAA
CCCACUUGGAAAAGAGACACCGCCGAGGUCCCGCGUACAAGACGCGGUCGAUAGACUCGGGGUGUGCGCGUCGAGGUAAC
GAGACGUUAAGCCCACGAGCACUAACAGACCAAAGCCAUCAU
;
? 
2  2  GB  AF034620   3377779 5658 
;UUAGGCGGCCACAGCGGUGGGGUUGCCUCCCGUACCCAUCCCGAACACGGAAGAUAAGCCCACCAGCGUUCCGGGGAGUA
CUGGAGUGCGCGAGCCUCUGGGAAACCCGGUUCGCCGCCACC
;
? 
3  3  UNP RL2_HALMA  P20276  1    
;GRRIQGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHDPARSAPVAAVEFEDGDRRLILAPEGVGVGDEL
QVGVDAEIAPGNTLPLAEIPEGVPVCNVESSPGDGGKFARASGVNAQLLTHDRNVAVVKLPSGEMKRLDPQCRATIGVVG
GGGRTDKPFVKAGNKHHKMKARGTKWPNVRGVAMNAVDHPFGGGGRQHPGKPKSISRNAPPGRKVGDIASKRTGRGGNE
;
? 
4  4  UNP RL3_HALMA  P20279  1    
;PQPSRPRKGSLGFGPRKRSTSETPRFNSWPSDDGQPGVQGFAGYKAGMTHVVLVNDEPNSPREGMEETVPVTVIETPPMR
AVALRAYEDTPYGQRPLTEVWTDEFHSELDRTLDVPEDHDPDAAEEQIRDAHEAGDLGDLRLITHTVPDAVPSVPKKKPD
VMETRVGGGSVSDRLDHALDIVEDGGEHAMNDIFRAGEYADVAGVTKGKGTQGPVKRWGVQKRKGKHARQGWRRRIGNLG
PWNPSRVRSTVPQQGQTGYHQRTELNKRLIDIGEGDEPTVDGGFVNYGEVDGPYTLVKGSVPGPDKRLVPFFRPAVRPND
QPRLDPEVRYVSNESNQG
;
? 
5  5  UNP RL4_HALMA  P12735  1    
;MQATIYDLDGNTDGEVDLPDVFETPVRSDLIGKAVRAAQANRKQDYGSDEYAGLRTPAESFGSGRGQAHVPKLDGRARRV
PQAVKGRSAHPPKTEKDRSLDLNDKERQLAVRSALAATADADLVADRGHEFDRDEVPVVVSDDFEDLVKTQEVVSLLEAL
DVHADIDRADETKIKAGQGSARGRKYRRPASILFVTSDEPSTAARNLAGADVATASEVNTEDLAPGGAPGRLTVFTESAL
AEVAER
;
? 
6  6  UNP RL5_HALMA  P14124  1    
;SSESESGGDFHEMREPRIEKVVVHMGIGHGGRDLANAEDILGEITGQMPVRTKAKRTVGEFDIREGDPIGAKVTLRDEMA
EEFLQTALPLAELATSQFDDTGNFSFGVEEHTEFPSQEYDPSIGIYGLDVTVNLVRPGYRVAKRDKASRSIPTKHRLNPA
DAVAFIESTYDVEVSE
;
? 
7  7  UNP RL6_HALMA  P14135  1    
;PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIESDEDNAKTMSTIGTFQSHIENMFHGVTEGW
EYGMEVFYSHFPMQVNVEGDEVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQLTRINDKDVR
VFQDGVYITRKPNRGDA
;
? 
8  8  UNP RL7A_HALMA P12743  1    
;PVYVDFDVPADLEDDALEALEVARDTGAVKKGTNETTKSIERGSAELVFVAEDVQPEEIVMHIPELADEKGVPFIFVEQQ
DDLGHAAGLEVGSAAAAVTDAGAAATVLEEIADKVEELR
;
? 
9  9  UNP RLA0_HALMA P15825  1    
;MSAESERKTETIPEWKQEEVDAIVEMIESYESVGVVNIAGIPSRQLQDMRRDLHGTAELRVSRNTLLERALDDVDDGLED
LNGYITGQVGLIGTDDNPFSLFQELEASKTPAPIGAGEVAPNDIVIPEGDTGVDPGPFVGELQSVGADARIQEGSIQVLS
DSTVLDTGEEVSQELSNVLNELGIEPKEVGLDLRAVFADGVLFEPEELELDIDEYRSDIQAAAGRAFNLSVNADYPTATT
APTMLQSDRGNAKSLALQAAIEDPEVVPDLVSKADAQVRALASQIDDEEALPEELQGVEADVATEEPTDDQDDDTASEDD
ADADDAAEEADDDDDDDEDAGDALGAMF
;
? 
10 11 UNP RL13_HALMA P29198  1    
;MSVAEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQIVEKYEKRVDIGNDNGYFYPKRPDGIFK
RTIRGMLPHKKQRGREAFESVRVYLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
;
? 
11 12 UNP RL14_HALMA P22450  1    
;MEALGADVTQGLEKGSLITCADNTGARELKVISVHGYSGTKNRHPKAGLGDKITVSVTKGTPEMRRQVLEAVVVRQRKPI
RRPDGTRVKFEDNAAVIVDENEDPRGTELKGPIAREVAQRFGSVASAATMIV
;
? 
12 13 UNP RL15_HALMA P12737  1    
;TSKKKRQRGSRTHGGGSHKNRRGAGHRGGRGDAGRDKHEFHNHEPLGKSGFKRPQKVQEEAATIDVREIDENVTLLAADD
VAEVEDGGFRVDVRDVVEEADDADYVKVLGAGQVRHELTLIADDFSEGAREKVEGAGGSVELTDLGEERQAEAEETEDAD
ADEE
;
? 
13 15 UNP RL18_HALMA P14123  1    
;ATGPRYKVPMRRRREARTDYHQRLRLLKSGKPRLVARKSNKHVRAQLVTLGPNGDDTLASAHSSDLAEYGWEAPTGNMPS
AYLTGLLAGLRAQEAGVEEAVLDIGLNSPTPGSKVFAIQEGAIDAGLDIPHNDDVLADWQRTRGAHIAEYDEQLEEPLYS
GDFDAADLPEHFDELRETLLDGDIEL
;
? 
14 16 UNP R18E_HALMA P12733  1    
;SKTNPRLSSLIADLKSAARSSGGAVWGDVAERLEKPRRTHAEVNLGRIERYAQEDETVVVPGKVLGSGVLQKDVTVAAVD
FSGTAETKIDQVGEAVSLEQAIENNPEGSHVRVIR
;
? 
15 17 UNP RL19_HALMA P14119  1    
;TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQAKDKKGNSRGRARERQKKRAKGHQKGAGSR
KGKAGARQNSKEDWESRIRAQRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDANHGDA
;
? 
16 18 UNP RL21_HALMA P12734  1    
;PSSNGPLEGTRGKLKNKPRDRGTSPPQRAVEEFDDGEKVHLKIDPSVPNGRFHPRFDGQTGTVEGKQGDAYKVDIVDGGK
EKTIIVTAAHLRRQE
;
? 
17 19 UNP RL22_HALMA P10970  1    
;GISYSVEADPDTTAKAMLRERQMSFKHSKAIAREIKGKTAGEAVDYLEAVIEGDQPVPFKQHNSGVGHKSKVDGWDAGRY
PEKASKAFLDLLENAVGNADHQGFDGEAMTIKHVAAHKVGEQQGRKPRAMGRASAWNSPQVDVELILEEPEVED
;
? 
18 20 UNP RL23_HALMA P12732  1    
;SWDVIKHPHVTEKAMNDMDFQNKLQFAVDDRASKGEVADAVEEQYDVTVEQVNTQNTMDGEKKAVVRLSEDDDAQEVASR
IGVF
;
? 
19 21 UNP RL24_HALMA P10972  1    
;SKQPDKQRKSQRRAPLHERHKQVRATLSADLREEYGQRNVRVNAGDTVEVLRGDFAGEEGEVINVDLDKAVIHVEDVTLE
KTDGEEVPRPLDTSNVRVTDLDLEDEKREARLESEDDSA
;
? 
20 22 UNP R24E_HALMA P14116  1    PRTRECDYCGTDIEPGTGTMFVHKDGATTHFCSSKCENNADLGREARNLEWTDTARGEAGEAEDEA ? 
21 23 UNP RL29_HALMA P10971  1    TVLHVQEIRDMTPAEREAELDDLKTELLNARAVQAAGGAPENPGRIKELRKAIARIKTIQGEEGDLQENE ? 
22 24 UNP RL30_HALMA P14121  1    
;MHALVQLRGEVNMHTDIQDTLEMLNIHHVNHCTLVPETDAYRGMVAKVNDFVAFGEPSQETLETVLATRAEPLEGDADVD
DEWVAEHTDYDDISGLAFALLSEETTLREQGLSPTLRLHPPRGGHDGVKHPVKEGGQLGKHDTEGIDDLLEAMR
;
? 
23 25 UNP RL31_HALMA P18138  1    
;SASDFEERVVTIPLRDARAEPNHKRADKAMILIREHLAKHFSVDEDAVRLDPSINEAAWARGRANTPSKIRVRAARFEEE
GEAIVEAETAE
;
? 
24 26 UNP RL32_HALMA P12736  1    
;ADNEEDVEAEEEYTELTDISGVGPSKAESLREAGFESVEDVRGADQSALADVSGIGNALAARIKADVGGLEVESETEAEV
EEEGGEEAPDEDVETELQARGLTEKTPDLSDEDARLLTQRHRVGKPQFNRQDHHKKKRVSTSWRKPRGQLSKQRRGIKGK
GDTVEAGFRSPTAVRGKHPSGFEEVRVHNVDDLEGVDGDTEAVRIASKVGARKRERIEEEAEDAGIRVLNPTYVEVEVSE

;
? 
25 28 UNP RL37_HALMA P32410  1    TGAGTPSQGKKNTTTHTKCRRCGEKSYHTKKKVCSSCGFGKSAKRRDYEWQSKAGE ? 
26 29 UNP RL39_HALMA P22452  1    GKKSKATKKRLAKLDNQNSRVPAWVMLKTDEVQRNHKRRHWRRNDTDE ? 
27 30 UNP RL44_HALMA P32411  1    
;MQMPRRFNTYCPHCNEHQEHEVEKVRSGRQTGMKWIDRQRERNSGIGNDGKFSKVPGGDKPTKKTDLKYRCGECGKAHLR
EGWRAGRLEFQE
;
? 
28 10 PDB 1N8R       1N8R    ?    ? ? 
29 14 PDB 1N8R       1N8R    ?    ? ? 
30 27 PDB 1N8R       1N8R    ?    ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  1N8R A 1 ? 2922 ? 3377779 2597 ? 5518 ? 2    2923 
2  2  1N8R B 1 ? 122  ? 3377779 5658 ? 5779 ? 3001 3122 
3  3  1N8R C 1 ? 239  ? P20276  1    ? 239  ? 1    239  
4  4  1N8R D 1 ? 337  ? P20279  1    ? 338  ? 1    337  
5  5  1N8R E 1 ? 246  ? P12735  1    ? 246  ? 1    246  
6  6  1N8R F 1 ? 176  ? P14124  1    ? 176  ? 1    176  
7  7  1N8R G 1 ? 177  ? P14135  1    ? 177  ? 1    177  
8  8  1N8R H 1 ? 119  ? P12743  1    ? 119  ? 1    119  
9  9  1N8R I 1 ? 348  ? P15825  1    ? 348  ? 1    348  
10 10 1N8R K 1 ? 145  ? P29198  1    ? 145  ? 1    145  
11 11 1N8R L 1 ? 132  ? P22450  1    ? 132  ? 1    132  
12 12 1N8R M 1 ? 164  ? P12737  1    ? 164  ? 1    164  
13 13 1N8R O 1 ? 186  ? P14123  1    ? 186  ? 1    186  
14 14 1N8R P 1 ? 115  ? P12733  1    ? 115  ? 1    115  
15 15 1N8R Q 1 ? 148  ? P14119  1    ? 148  ? 1    148  
16 16 1N8R R 1 ? 95   ? P12734  1    ? 95   ? 1    95   
17 17 1N8R S 1 ? 154  ? P10970  1    ? 154  ? 1    154  
18 18 1N8R T 1 ? 84   ? P12732  1    ? 84   ? 1    84   
19 19 1N8R U 1 ? 119  ? P10972  1    ? 119  ? 1    119  
20 20 1N8R V 1 ? 66   ? P14116  1    ? 66   ? 1    66   
21 21 1N8R W 1 ? 70   ? P10971  1    ? 70   ? 1    70   
22 22 1N8R X 1 ? 154  ? P14121  1    ? 154  ? 1    154  
23 23 1N8R Y 1 ? 91   ? P18138  1    ? 91   ? 1    91   
24 24 1N8R Z 1 ? 240  ? P12736  1    ? 240  ? 1    240  
25 25 1N8R 2 1 ? 56   ? P32410  1    ? 56   ? 1    56   
26 26 1N8R 3 1 ? 47   ? P22452  1    ? 48   ? 1    48   
27 27 1N8R 4 1 ? 92   ? P32411  1    ? 92   ? 1    92   
28 28 1N8R J 1 ? 167  ? 1N8R    1    ? 167  ? 1    167  
29 29 1N8R N 1 ? 194  ? 1N8R    1    ? 194  ? 1    194  
30 30 1N8R 1 1 ? 73   ? 1N8R    10   ? 82   ? 10   82   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
4 1N8R ?   D ?   ? UNP P20279 PRO 310 DELETION ?   1 
4 1N8R ARG D 310 ? UNP P20279 PHE 311 CONFLICT 310 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CD  non-polymer         . 'CADMIUM ION'                ? 'Cd 2'            112.411 
CL  non-polymer         . 'CHLORIDE ION'               ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                        ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
K   non-polymer         . 'POTASSIUM ION'              ? 'K 1'             39.098  
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'            24.305  
NA  non-polymer         . 'SODIUM ION'                 ? 'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
VIR non-polymer         . 'VIRGINIAMYCIN M1'           ? 'C28 H35 N3 O7'   525.593 
# 
_exptl.entry_id          1N8R 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   61.17 
_exptl_crystal.density_Matthews      3.17 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_details    
;1.2M KCl, 0.5M (NH4)Cl, 30mM MgCl2, 8% PEG, pH 5.80, 
VAPOR DIFFUSION, SITTING DROP at 292K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1 1 KCl        ? ? ? 
1 2 1 NH4Cl      ? ? ? 
1 3 1 MgCl2      ? ? ? 
1 4 1 'PEG 6000' ? ? ? 
1 5 2 KCl        ? ? ? 
1 6 2 NH4Cl      ? ? ? 
1 7 2 MgCl2      ? ? ? 
1 8 2 'PEG 6000' ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-12-05 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si 111' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0332 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0332 
# 
_reflns.entry_id                     1N8R 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            3.00 
_reflns.number_obs                   339727 
_reflns.number_all                   344322 
_reflns.percent_possible_obs         98.7 
_reflns.pdbx_Rmerge_I_obs            0.144 
_reflns.pdbx_Rsym_value              0.144 
_reflns.pdbx_netI_over_sigmaI        7.7 
_reflns.B_iso_Wilson_estimate        33.1 
_reflns.pdbx_redundancy              3.6 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.00 
_reflns_shell.d_res_low              3.05 
_reflns_shell.percent_possible_all   97.7 
_reflns_shell.Rmerge_I_obs           0.49 
_reflns_shell.pdbx_Rsym_value        0.49 
_reflns_shell.meanI_over_sigI_obs    1.7 
_reflns_shell.pdbx_redundancy        2.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      16729 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1N8R 
_refine.ls_number_reflns_obs                     327972 
_refine.ls_number_reflns_all                     346861 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            3.00 
_refine.ls_percent_reflns_obs                    94.6 
_refine.ls_R_factor_obs                          0.2011 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.201 
_refine.ls_R_factor_R_free                       0.242 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.0 
_refine.ls_number_reflns_R_free                  3203 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               43.9 
_refine.aniso_B[1][1]                            5.14 
_refine.aniso_B[2][2]                            1.70 
_refine.aniso_B[3][3]                            -6.84 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.329291 
_refine.solvent_model_param_bsol                 31.7669 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1JJ2 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'same reflections as 1JJ2' 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1N8R 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.54 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28801 
_refine_hist.pdbx_number_atoms_nucleic_acid   61617 
_refine_hist.pdbx_number_atoms_ligand         269 
_refine_hist.number_atoms_solvent             7882 
_refine_hist.number_atoms_total               98569 
_refine_hist.d_res_high                       3.00 
_refine_hist.d_res_low                        20.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.30  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 15.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.57  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.12  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.84  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.30  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       2.02  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       3.00 
_refine_ls_shell.d_res_low                        3.11 
_refine_ls_shell.number_reflns_R_work             13488 
_refine_ls_shell.R_factor_R_work                  0.338 
_refine_ls_shell.percent_reflns_obs               37.7 
_refine_ls_shell.R_factor_R_free                  0.346 
_refine_ls_shell.R_factor_R_free_error            0.030 
_refine_ls_shell.percent_reflns_R_free            1.0 
_refine_ls_shell.number_reflns_R_free             131 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 RNA.PAR  RNA.TOP  'X-RAY DIFFRACTION' 
2 PROT.PAR PROT.TOP 'X-RAY DIFFRACTION' 
3 ION.PAR  ION.TOP  'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1N8R 
_struct.title                     'Structure of large ribosomal subunit in complex with virginiamycin M' 
_struct.pdbx_descriptor           'large ribosomal subunit 50S' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1N8R 
_struct_keywords.pdbx_keywords   Ribosome/Antibiotic 
_struct_keywords.text            'ribosome-antibiotic complex, virginiamycin M, streptogramin, antibiotic' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 26 ? 
AA N N 27 ? 
BA N N 28 ? 
CA N N 29 ? 
DA N N 30 ? 
EA N N 31 ? 
FA N N 32 ? 
GA N N 32 ? 
HA N N 32 ? 
IA N N 32 ? 
JA N N 32 ? 
KA N N 32 ? 
LA N N 32 ? 
MA N N 32 ? 
NA N N 32 ? 
OA N N 32 ? 
PA N N 32 ? 
QA N N 32 ? 
RA N N 32 ? 
SA N N 32 ? 
TA N N 32 ? 
UA N N 32 ? 
VA N N 32 ? 
WA N N 32 ? 
XA N N 32 ? 
YA N N 32 ? 
ZA N N 32 ? 
AB N N 32 ? 
BB N N 32 ? 
CB N N 32 ? 
DB N N 32 ? 
EB N N 32 ? 
FB N N 32 ? 
GB N N 32 ? 
HB N N 32 ? 
IB N N 32 ? 
JB N N 32 ? 
KB N N 32 ? 
LB N N 32 ? 
MB N N 32 ? 
NB N N 32 ? 
OB N N 32 ? 
PB N N 32 ? 
QB N N 32 ? 
RB N N 32 ? 
SB N N 32 ? 
TB N N 32 ? 
UB N N 32 ? 
VB N N 32 ? 
WB N N 32 ? 
XB N N 32 ? 
YB N N 32 ? 
ZB N N 32 ? 
AC N N 32 ? 
BC N N 32 ? 
CC N N 32 ? 
DC N N 32 ? 
EC N N 32 ? 
FC N N 32 ? 
GC N N 32 ? 
HC N N 32 ? 
IC N N 32 ? 
JC N N 32 ? 
KC N N 32 ? 
LC N N 32 ? 
MC N N 32 ? 
NC N N 32 ? 
OC N N 32 ? 
PC N N 32 ? 
QC N N 32 ? 
RC N N 32 ? 
SC N N 32 ? 
TC N N 32 ? 
UC N N 32 ? 
VC N N 32 ? 
WC N N 32 ? 
XC N N 32 ? 
YC N N 32 ? 
ZC N N 32 ? 
AD N N 32 ? 
BD N N 32 ? 
CD N N 32 ? 
DD N N 32 ? 
ED N N 32 ? 
FD N N 32 ? 
GD N N 32 ? 
HD N N 32 ? 
ID N N 32 ? 
JD N N 32 ? 
KD N N 32 ? 
LD N N 32 ? 
MD N N 32 ? 
ND N N 32 ? 
OD N N 32 ? 
PD N N 32 ? 
QD N N 32 ? 
RD N N 32 ? 
SD N N 32 ? 
TD N N 32 ? 
UD N N 32 ? 
VD N N 32 ? 
WD N N 32 ? 
XD N N 32 ? 
YD N N 32 ? 
ZD N N 32 ? 
AE N N 32 ? 
BE N N 32 ? 
CE N N 32 ? 
DE N N 32 ? 
EE N N 32 ? 
FE N N 32 ? 
GE N N 32 ? 
HE N N 32 ? 
IE N N 32 ? 
JE N N 32 ? 
KE N N 33 ? 
LE N N 34 ? 
ME N N 34 ? 
NE N N 34 ? 
OE N N 34 ? 
PE N N 34 ? 
QE N N 34 ? 
RE N N 34 ? 
SE N N 34 ? 
TE N N 34 ? 
UE N N 34 ? 
VE N N 34 ? 
WE N N 34 ? 
XE N N 34 ? 
YE N N 34 ? 
ZE N N 34 ? 
AF N N 34 ? 
BF N N 34 ? 
CF N N 34 ? 
DF N N 34 ? 
EF N N 34 ? 
FF N N 34 ? 
GF N N 34 ? 
HF N N 34 ? 
IF N N 34 ? 
JF N N 34 ? 
KF N N 34 ? 
LF N N 34 ? 
MF N N 34 ? 
NF N N 34 ? 
OF N N 34 ? 
PF N N 34 ? 
QF N N 34 ? 
RF N N 34 ? 
SF N N 34 ? 
TF N N 34 ? 
UF N N 34 ? 
VF N N 34 ? 
WF N N 34 ? 
XF N N 34 ? 
YF N N 34 ? 
ZF N N 34 ? 
AG N N 34 ? 
BG N N 34 ? 
CG N N 34 ? 
DG N N 34 ? 
EG N N 34 ? 
FG N N 34 ? 
GG N N 34 ? 
HG N N 34 ? 
IG N N 34 ? 
JG N N 34 ? 
KG N N 34 ? 
LG N N 34 ? 
MG N N 34 ? 
NG N N 34 ? 
OG N N 34 ? 
PG N N 34 ? 
QG N N 34 ? 
RG N N 34 ? 
SG N N 34 ? 
TG N N 34 ? 
UG N N 34 ? 
VG N N 34 ? 
WG N N 34 ? 
XG N N 34 ? 
YG N N 34 ? 
ZG N N 34 ? 
AH N N 34 ? 
BH N N 34 ? 
CH N N 34 ? 
DH N N 34 ? 
EH N N 35 ? 
FH N N 35 ? 
GH N N 35 ? 
HH N N 35 ? 
IH N N 35 ? 
JH N N 35 ? 
KH N N 35 ? 
LH N N 35 ? 
MH N N 32 ? 
NH N N 34 ? 
OH N N 34 ? 
PH N N 32 ? 
QH N N 32 ? 
RH N N 34 ? 
SH N N 35 ? 
TH N N 32 ? 
UH N N 35 ? 
VH N N 34 ? 
WH N N 34 ? 
XH N N 34 ? 
YH N N 34 ? 
ZH N N 35 ? 
AI N N 35 ? 
BI N N 35 ? 
CI N N 32 ? 
DI N N 35 ? 
EI N N 34 ? 
FI N N 35 ? 
GI N N 34 ? 
HI N N 35 ? 
II N N 35 ? 
JI N N 36 ? 
KI N N 35 ? 
LI N N 34 ? 
MI N N 34 ? 
NI N N 34 ? 
OI N N 35 ? 
PI N N 34 ? 
QI N N 32 ? 
RI N N 34 ? 
SI N N 36 ? 
TI N N 32 ? 
UI N N 35 ? 
VI N N 35 ? 
WI N N 36 ? 
XI N N 36 ? 
YI N N 32 ? 
ZI N N 34 ? 
AJ N N 36 ? 
BJ N N 35 ? 
CJ N N 37 ? 
DJ N N 37 ? 
EJ N N 37 ? 
FJ N N 37 ? 
GJ N N 37 ? 
HJ N N 37 ? 
IJ N N 37 ? 
JJ N N 37 ? 
KJ N N 37 ? 
LJ N N 37 ? 
MJ N N 37 ? 
NJ N N 37 ? 
OJ N N 37 ? 
PJ N N 37 ? 
QJ N N 37 ? 
RJ N N 37 ? 
SJ N N 37 ? 
TJ N N 37 ? 
UJ N N 37 ? 
VJ N N 37 ? 
WJ N N 37 ? 
XJ N N 37 ? 
YJ N N 37 ? 
ZJ N N 37 ? 
AK N N 37 ? 
BK N N 37 ? 
CK N N 37 ? 
DK N N 37 ? 
EK N N 37 ? 
FK N N 37 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   ILE C  4   ? GLY C  10  ? ILE C 4   GLY C 10  1 ? 7  
HELX_P HELX_P2   2   ARG C  11  ? GLY C  12  ? ARG C 11  GLY C 12  5 ? 2  
HELX_P HELX_P3   3   THR C  13  ? ARG C  17  ? THR C 13  ARG C 17  5 ? 5  
HELX_P HELX_P4   4   PRO C  19  ? TYR C  23  ? PRO C 19  TYR C 23  5 ? 5  
HELX_P HELX_P5   5   ALA C  97  ? ILE C  99  ? ALA C 97  ILE C 99  5 ? 3  
HELX_P HELX_P6   6   GLY C  163 ? LYS C  167 ? GLY C 163 LYS C 167 5 ? 5  
HELX_P HELX_P7   7   LYS C  171 ? LYS C  180 ? LYS C 171 LYS C 180 1 ? 10 
HELX_P HELX_P8   8   ARG C  190 ? MET C  194 ? ARG C 190 MET C 194 5 ? 5  
HELX_P HELX_P9   9   ASN C  195 ? HIS C  199 ? ASN C 195 HIS C 199 5 ? 5  
HELX_P HELX_P10  10  GLU D  108 ? THR D  112 ? GLU D 108 THR D 112 5 ? 5  
HELX_P HELX_P11  11  ASP D  120 ? GLY D  135 ? ASP D 120 GLY D 135 1 ? 16 
HELX_P HELX_P12  12  VAL D  147 ? VAL D  151 ? VAL D 147 VAL D 151 5 ? 5  
HELX_P HELX_P13  13  SER D  170 ? GLY D  185 ? SER D 170 GLY D 185 1 ? 16 
HELX_P HELX_P14  14  ALA D  189 ? ILE D  193 ? ALA D 189 ILE D 193 5 ? 5  
HELX_P HELX_P15  15  GLY D  213 ? TRP D  218 ? GLY D 213 TRP D 218 1 ? 6  
HELX_P HELX_P16  16  LYS D  224 ? ARG D  229 ? LYS D 224 ARG D 229 5 ? 6  
HELX_P HELX_P17  17  PRO E  19  ? THR E  24  ? PRO E 19  THR E 24  5 ? 6  
HELX_P HELX_P18  18  ARG E  27  ? ARG E  42  ? ARG E 27  ARG E 42  1 ? 16 
HELX_P HELX_P19  19  ASN E  103 ? THR E  118 ? ASN E 103 THR E 118 1 ? 16 
HELX_P HELX_P20  20  ASP E  120 ? GLY E  128 ? ASP E 120 GLY E 128 1 ? 9  
HELX_P HELX_P21  21  ASP E  142 ? LEU E  147 ? ASP E 142 LEU E 147 5 ? 6  
HELX_P HELX_P22  22  LYS E  149 ? LEU E  160 ? LYS E 149 LEU E 160 1 ? 12 
HELX_P HELX_P23  23  VAL E  162 ? ALA E  169 ? VAL E 162 ALA E 169 1 ? 8  
HELX_P HELX_P24  24  GLY E  177 ? GLY E  183 ? GLY E 177 GLY E 183 5 ? 7  
HELX_P HELX_P25  25  SER E  201 ? ASN E  206 ? SER E 201 ASN E 206 1 ? 6  
HELX_P HELX_P26  26  ASN E  219 ? ALA E  224 ? ASN E 219 ALA E 224 1 ? 6  
HELX_P HELX_P27  27  PRO E  225 ? ALA E  228 ? PRO E 225 ALA E 228 5 ? 4  
HELX_P HELX_P28  28  GLU E  237 ? ALA E  244 ? GLU E 237 ALA E 244 1 ? 8  
HELX_P HELX_P29  29  ALA F  37  ? GLY F  46  ? ALA F 37  GLY F 46  1 ? 10 
HELX_P HELX_P30  30  ASP F  77  ? LEU F  88  ? ASP F 77  LEU F 88  1 ? 12 
HELX_P HELX_P31  31  PRO F  89  ? ALA F  91  ? PRO F 89  ALA F 91  5 ? 3  
HELX_P HELX_P32  32  TYR F  139 ? ARG F  144 ? TYR F 139 ARG F 144 1 ? 6  
HELX_P HELX_P33  33  PRO F  152 ? ARG F  156 ? PRO F 152 ARG F 156 5 ? 5  
HELX_P HELX_P34  34  ASN F  158 ? SER F  168 ? ASN F 158 SER F 168 1 ? 11 
HELX_P HELX_P35  35  ASN G  55  ? THR G  77  ? ASN G 55  THR G 77  1 ? 23 
HELX_P HELX_P36  36  ASN G  106 ? GLU G  110 ? ASN G 106 GLU G 110 5 ? 5  
HELX_P HELX_P37  37  ASP G  137 ? LEU G  151 ? ASP G 137 LEU G 151 1 ? 15 
HELX_P HELX_P38  38  PRO H  9   ? GLY H  27  ? PRO H 9   GLY H 27  1 ? 19 
HELX_P HELX_P39  39  GLY H  32  ? GLY H  43  ? GLY H 32  GLY H 43  1 ? 12 
HELX_P HELX_P40  40  GLU H  57  ? HIS H  62  ? GLU H 57  HIS H 62  1 ? 6  
HELX_P HELX_P41  41  HIS H  62  ? GLU H  69  ? HIS H 62  GLU H 69  1 ? 8  
HELX_P HELX_P42  42  GLN H  79  ? ALA H  87  ? GLN H 79  ALA H 87  1 ? 9  
HELX_P HELX_P43  43  ALA H  104 ? LEU H  118 ? ALA H 104 LEU H 118 1 ? 15 
HELX_P HELX_P44  44  PRO I  13  ? SER I  29  ? PRO I 13  SER I 29  1 ? 17 
HELX_P HELX_P45  45  ARG I  63  ? ASP I  72  ? ARG I 63  ASP I 72  1 ? 10 
HELX_P HELX_P46  46  PRO J  2   ? TYR J  6   ? PRO J 2   TYR J 6   5 ? 5  
HELX_P HELX_P47  47  HIS J  58  ? ARG J  70  ? HIS J 58  ARG J 70  1 ? 13 
HELX_P HELX_P48  48  ASN J  141 ? LYS J  150 ? ASN J 141 LYS J 150 1 ? 10 
HELX_P HELX_P49  49  ILE K  18  ? LEU K  31  ? ILE K 18  LEU K 31  1 ? 14 
HELX_P HELX_P50  50  ASN K  40  ? ARG K  43  ? ASN K 40  ARG K 43  5 ? 4  
HELX_P HELX_P51  51  ARG K  49  ? ILE K  63  ? ARG K 49  ILE K 63  1 ? 15 
HELX_P HELX_P52  52  ARG K  74  ? GLY K  85  ? ARG K 74  GLY K 85  1 ? 12 
HELX_P HELX_P53  53  LYS K  91  ? SER K  100 ? LYS K 91  SER K 100 1 ? 10 
HELX_P HELX_P54  54  ASP K  122 ? ASN K  126 ? ASP K 122 ASN K 126 5 ? 5  
HELX_P HELX_P55  55  LEU K  132 ? GLY K  140 ? LEU K 132 GLY K 140 1 ? 9  
HELX_P HELX_P56  56  GLU L  116 ? ALA L  118 ? GLU L 116 ALA L 118 5 ? 3  
HELX_P HELX_P57  57  PHE L  121 ? SER L  126 ? PHE L 121 SER L 126 1 ? 6  
HELX_P HELX_P58  58  LYS M  3   ? GLN M  7   ? LYS M 3   GLN M 7   5 ? 5  
HELX_P HELX_P59  59  GLY M  23  ? GLY M  28  ? GLY M 23  GLY M 28  5 ? 6  
HELX_P HELX_P60  60  PRO M  54  ? GLN M  58  ? PRO M 54  GLN M 58  5 ? 5  
HELX_P HELX_P61  61  VAL M  66  ? ASN M  72  ? VAL M 66  ASN M 72  1 ? 7  
HELX_P HELX_P62  62  ARG M  94  ? VAL M  96  ? ARG M 94  VAL M 96  5 ? 3  
HELX_P HELX_P63  63  SER M  126 ? ALA M  136 ? SER M 126 ALA M 136 1 ? 11 
HELX_P HELX_P64  64  SER N  3   ? LYS N  13  ? SER N 3   LYS N 13  1 ? 11 
HELX_P HELX_P65  65  GLU N  17  ? ARG N  32  ? GLU N 17  ARG N 32  1 ? 16 
HELX_P HELX_P66  66  ARG N  45  ? GLY N  53  ? ARG N 45  GLY N 53  1 ? 9  
HELX_P HELX_P67  67  ARG N  82  ? MET N  86  ? ARG N 82  MET N 86  5 ? 5  
HELX_P HELX_P68  68  ASN N  96  ? PHE N  109 ? ASN N 96  PHE N 109 1 ? 14 
HELX_P HELX_P69  69  LEU N  147 ? ARG N  156 ? LEU N 147 ARG N 156 5 ? 10 
HELX_P HELX_P70  70  ARG N  158 ? GLY N  162 ? ARG N 158 GLY N 162 5 ? 5  
HELX_P HELX_P71  71  THR N  164 ? ARG N  171 ? THR N 164 ARG N 171 1 ? 8  
HELX_P HELX_P72  72  LEU N  187 ? GLY N  191 ? LEU N 187 GLY N 191 5 ? 5  
HELX_P HELX_P73  73  MET O  10  ? GLU O  15  ? MET O 10  GLU O 15  1 ? 6  
HELX_P HELX_P74  74  ASP O  19  ? SER O  29  ? ASP O 19  SER O 29  1 ? 11 
HELX_P HELX_P75  75  SER O  64  ? GLY O  70  ? SER O 64  GLY O 70  5 ? 7  
HELX_P HELX_P76  76  ASN O  77  ? ALA O  95  ? ASN O 77  ALA O 95  1 ? 19 
HELX_P HELX_P77  77  SER O  113 ? GLY O  126 ? SER O 113 GLY O 126 1 ? 14 
HELX_P HELX_P78  78  ASN O  132 ? LEU O  136 ? ASN O 132 LEU O 136 5 ? 5  
HELX_P HELX_P79  79  TRP O  139 ? GLY O  144 ? TRP O 139 GLY O 144 1 ? 6  
HELX_P HELX_P80  80  GLY O  144 ? GLN O  153 ? GLY O 144 GLN O 153 1 ? 10 
HELX_P HELX_P81  81  LEU O  168 ? LEU O  180 ? LEU O 168 LEU O 180 1 ? 13 
HELX_P HELX_P82  82  ASN P  4   ? SER P  21  ? ASN P 4   SER P 21  1 ? 18 
HELX_P HELX_P83  83  ALA P  24  ? LYS P  35  ? ALA P 24  LYS P 35  1 ? 12 
HELX_P HELX_P84  84  PRO P  36  ? HIS P  40  ? PRO P 36  HIS P 40  5 ? 5  
HELX_P HELX_P85  85  LEU P  45  ? ALA P  52  ? LEU P 45  ALA P 52  1 ? 8  
HELX_P HELX_P86  86  SER P  82  ? GLY P  93  ? SER P 82  GLY P 93  1 ? 12 
HELX_P HELX_P87  87  LEU P  98  ? ASN P  105 ? LEU P 98  ASN P 105 1 ? 8  
HELX_P HELX_P88  88  LEU Q  3   ? LEU Q  14  ? LEU Q 3   LEU Q 14  1 ? 12 
HELX_P HELX_P89  89  GLY Q  17  ? ASN Q  19  ? GLY Q 17  ASN Q 19  5 ? 3  
HELX_P HELX_P90  90  ARG Q  27  ? ALA Q  34  ? ARG Q 27  ALA Q 34  1 ? 8  
HELX_P HELX_P91  91  THR Q  36  ? GLU Q  46  ? THR Q 36  GLU Q 46  1 ? 11 
HELX_P HELX_P92  92  ARG Q  59  ? LYS Q  71  ? ARG Q 59  LYS Q 71  1 ? 13 
HELX_P HELX_P93  93  GLY Q  76  ? ARG Q  80  ? GLY Q 76  ARG Q 80  5 ? 5  
HELX_P HELX_P94  94  LYS Q  83  ? GLN Q  88  ? LYS Q 83  GLN Q 88  1 ? 6  
HELX_P HELX_P95  95  ASN Q  89  ? GLU Q  111 ? ASN Q 89  GLU Q 111 1 ? 23 
HELX_P HELX_P96  96  SER Q  117 ? GLY Q  128 ? SER Q 117 GLY Q 128 1 ? 12 
HELX_P HELX_P97  97  SER Q  133 ? ASP Q  142 ? SER Q 133 ASP Q 142 1 ? 10 
HELX_P HELX_P98  98  LYS R  17  ? ARG R  21  ? LYS R 17  ARG R 21  5 ? 5  
HELX_P HELX_P99  99  PRO R  26  ? GLU R  31  ? PRO R 26  GLU R 31  1 ? 6  
HELX_P HELX_P100 100 HIS R  53  ? ASP R  57  ? HIS R 53  ASP R 57  5 ? 5  
HELX_P HELX_P101 101 THR R  87  ? ALA R  89  ? THR R 87  ALA R 89  5 ? 3  
HELX_P HELX_P102 102 SER S  24  ? LYS S  36  ? SER S 24  LYS S 36  1 ? 13 
HELX_P HELX_P103 103 THR S  39  ? GLY S  53  ? THR S 39  GLY S 53  1 ? 15 
HELX_P HELX_P104 104 PRO S  81  ? HIS S  101 ? PRO S 81  HIS S 101 1 ? 21 
HELX_P HELX_P105 105 THR T  11  ? ASN T  22  ? THR T 11  ASN T 22  1 ? 12 
HELX_P HELX_P106 106 SER T  33  ? ASP T  46  ? SER T 33  ASP T 46  1 ? 14 
HELX_P HELX_P107 107 ASP T  73  ? ARG T  80  ? ASP T 73  ARG T 80  1 ? 8  
HELX_P HELX_P108 108 GLN U  3   ? ARG U  13  ? GLN U 3   ARG U 13  1 ? 11 
HELX_P HELX_P109 109 PRO U  15  ? GLN U  22  ? PRO U 15  GLN U 22  5 ? 8  
HELX_P HELX_P110 110 SER U  28  ? GLY U  36  ? SER U 28  GLY U 36  1 ? 9  
HELX_P HELX_P111 111 ASP U  92  ? SER U  94  ? ASP U 92  SER U 94  5 ? 3  
HELX_P HELX_P112 112 ASP U  105 ? SER U  114 ? ASP U 105 SER U 114 1 ? 10 
HELX_P HELX_P113 113 SER V  33  ? ASP V  41  ? SER V 33  ASP V 41  1 ? 9  
HELX_P HELX_P114 114 GLU V  45  ? LEU V  49  ? GLU V 45  LEU V 49  5 ? 5  
HELX_P HELX_P115 115 HIS W  4   ? ASP W  10  ? HIS W 4   ASP W 10  1 ? 7  
HELX_P HELX_P116 116 THR W  12  ? ALA W  36  ? THR W 12  ALA W 36  1 ? 25 
HELX_P HELX_P117 117 PRO W  43  ? GLY W  64  ? PRO W 43  GLY W 64  1 ? 22 
HELX_P HELX_P118 118 HIS X  14  ? LEU X  24  ? HIS X 14  LEU X 24  1 ? 11 
HELX_P HELX_P119 119 THR X  38  ? ASN X  49  ? THR X 38  ASN X 49  1 ? 12 
HELX_P HELX_P120 120 SER X  58  ? ALA X  70  ? SER X 58  ALA X 70  1 ? 13 
HELX_P HELX_P121 121 ASP X  80  ? THR X  88  ? ASP X 80  THR X 88  1 ? 9  
HELX_P HELX_P122 122 ASP X  92  ? SER X  102 ? ASP X 92  SER X 102 1 ? 11 
HELX_P HELX_P123 123 PRO X  131 ? GLY X  135 ? PRO X 131 GLY X 135 5 ? 5  
HELX_P HELX_P124 124 ASP X  142 ? MET X  153 ? ASP X 142 MET X 153 1 ? 12 
HELX_P HELX_P125 125 ARG Y  15  ? GLU Y  20  ? ARG Y 15  GLU Y 20  5 ? 6  
HELX_P HELX_P126 126 PRO Y  21  ? HIS Y  23  ? PRO Y 21  HIS Y 23  5 ? 3  
HELX_P HELX_P127 127 LYS Y  24  ? PHE Y  41  ? LYS Y 24  PHE Y 41  1 ? 18 
HELX_P HELX_P128 128 ASP Y  51  ? ALA Y  60  ? ASP Y 51  ALA Y 60  1 ? 10 
HELX_P HELX_P129 129 SER Z  110 ? GLY Z  124 ? SER Z 110 GLY Z 124 1 ? 15 
HELX_P HELX_P130 130 GLU Z  165 ? ARG Z  169 ? GLU Z 165 ARG Z 169 5 ? 5  
HELX_P HELX_P131 131 VAL Z  190 ? GLU Z  194 ? VAL Z 190 GLU Z 194 5 ? 5  
HELX_P HELX_P132 132 GLY Z  210 ? ALA Z  224 ? GLY Z 210 ALA Z 224 1 ? 15 
HELX_P HELX_P133 133 ARG AA 1   ? GLY AA 6   ? ARG 1 10  GLY 1 15  5 ? 6  
HELX_P HELX_P134 134 GLY AA 10  ? LYS AA 25  ? GLY 1 19  LYS 1 34  1 ? 16 
HELX_P HELX_P135 135 THR AA 64  ? ALA AA 73  ? THR 1 73  ALA 1 82  1 ? 10 
HELX_P HELX_P136 136 GLY BA 4   ? GLN BA 8   ? GLY 2 4   GLN 2 8   5 ? 5  
HELX_P HELX_P137 137 TYR BA 48  ? SER BA 52  ? TYR 2 48  SER 2 52  5 ? 5  
HELX_P HELX_P138 138 SER CA 4   ? GLN CA 17  ? SER 3 4   GLN 3 17  1 ? 14 
HELX_P HELX_P139 139 PRO CA 22  ? THR CA 29  ? PRO 3 22  THR 3 29  1 ? 8  
HELX_P HELX_P140 140 LYS DA 34  ? SER DA 44  ? LYS 4 34  SER 4 44  1 ? 11 
HELX_P HELX_P141 141 ASP DA 49  ? LYS DA 54  ? ASP 4 49  LYS 4 54  5 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1    metalc ? ? XI CD  .    CD    ? ? ? 1_555 BA CYS 22   SG    ? ? 2 CD  8402 2 CYS 22   1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc2    metalc ? ? XI CD  .    CD    ? ? ? 1_555 BA CYS 37   SG    ? ? 2 CD  8402 2 CYS 37   1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc3    metalc ? ? XI CD  .    CD    ? ? ? 1_555 BA CYS 19   SG    ? ? 2 CD  8402 2 CYS 19   1_555 ? ? ? ? ? ? ? 2.661 ? 
metalc4    metalc ? ? XI CD  .    CD    ? ? ? 1_555 BA CYS 34   SG    ? ? 2 CD  8402 2 CYS 34   1_555 ? ? ? ? ? ? ? 2.471 ? 
metalc5    metalc ? ? YI MG  .    MG    ? ? ? 1_555 DA ASP 49   OD2   ? ? 4 MG  8078 4 ASP 49   1_555 ? ? ? ? ? ? ? 2.794 ? 
metalc6    metalc ? ? YI MG  .    MG    ? ? ? 1_555 DA GLY 45   O     ? ? 4 MG  8078 4 GLY 45   1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc7    metalc ? ? YI MG  .    MG    ? ? ? 1_555 DA GLY 47   O     ? ? 4 MG  8078 4 GLY 47   1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc8    metalc ? ? YI MG  .    MG    ? ? ? 1_555 FK HOH .    O     ? ? 4 MG  8078 4 HOH 8576 1_555 ? ? ? ? ? ? ? 2.434 ? 
metalc9    metalc ? ? AJ CD  .    CD    ? ? ? 1_555 DA CYS 14   N     ? ? 4 CD  8404 4 CYS 14   1_555 ? ? ? ? ? ? ? 2.688 ? 
metalc10   metalc ? ? FA MG  .    MG    ? ? ? 1_555 A  C   2533 OP2   ? ? A MG  8001 A C   2534 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc11   metalc ? ? FA MG  .    MG    ? ? ? 1_555 A  C   2532 OP2   ? ? A MG  8001 A C   2533 1_555 ? ? ? ? ? ? ? 2.140 ? 
metalc12   metalc ? ? FA MG  .    MG    ? ? ? 1_555 A  A   2482 OP2   ? ? A MG  8001 A A   2483 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc13   metalc ? ? FA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8001 A HOH 9577 1_555 ? ? ? ? ? ? ? 1.692 ? 
metalc14   metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  C   2533 OP1   ? ? A MG  8002 A C   2534 1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc15   metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  G   626  O6    ? ? A MG  8002 A G   627  1_555 ? ? ? ? ? ? ? 1.920 ? 
metalc16   metalc ? ? GA MG  .    MG    ? ? ? 1_555 A  A   2482 OP1   ? ? A MG  8002 A A   2483 1_555 ? ? ? ? ? ? ? 2.037 ? 
metalc17   metalc ? ? HA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8003 A HOH 9424 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc18   metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  A   2623 OP1   ? ? A MG  8003 A A   2624 1_555 ? ? ? ? ? ? ? 1.742 ? 
metalc19   metalc ? ? HA MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8003 C HOH 8537 1_555 ? ? ? ? ? ? ? 2.638 ? 
metalc20   metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  G   876  OP2   ? ? A MG  8003 A G   877  1_555 ? ? ? ? ? ? ? 2.060 ? 
metalc21   metalc ? ? HA MG  .    MG    ? ? ? 1_555 A  A   875  OP2   ? ? A MG  8003 A A   876  1_555 ? ? ? ? ? ? ? 2.051 ? 
metalc22   metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  G   455  O6    ? ? A MG  8004 A G   456  1_555 ? ? ? ? ? ? ? 1.750 ? 
metalc23   metalc ? ? IA MG  .    MG    ? ? ? 1_555 A  A   458  OP1   ? ? A MG  8004 A A   459  1_555 ? ? ? ? ? ? ? 1.803 ? 
metalc24   metalc ? ? IA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8004 A HOH 9451 1_555 ? ? ? ? ? ? ? 1.831 ? 
metalc25   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  U   1837 OP1   ? ? A MG  8005 A U   1838 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc26   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  A   1835 OP1   ? ? A MG  8005 A A   1836 1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc27   metalc ? ? JA MG  .    MG    ? ? ? 1_555 A  A   1838 OP2   ? ? A MG  8005 A A   1839 1_555 ? ? ? ? ? ? ? 1.796 ? 
metalc28   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  C   821  OP2   ? ? A MG  8006 A C   822  1_555 ? ? ? ? ? ? ? 1.732 ? 
metalc29   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  U   820  OP2   ? ? A MG  8006 A U   821  1_555 ? ? ? ? ? ? ? 1.815 ? 
metalc30   metalc ? ? KA MG  .    MG    ? ? ? 1_555 A  G   853  OP1   ? ? A MG  8006 A G   854  1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc31   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  A   1838 OP1   ? ? A MG  8007 A A   1839 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc32   metalc ? ? LA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8007 A HOH 9410 1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc33   metalc ? ? LA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8007 A HOH 9503 1_555 ? ? ? ? ? ? ? 3.127 ? 
metalc34   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  U   831  OP2   ? ? A MG  8007 A U   832  1_555 ? ? ? ? ? ? ? 1.933 ? 
metalc35   metalc ? ? LA MG  .    MG    ? ? ? 1_555 A  A   1839 OP2   ? ? A MG  8007 A A   1840 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc36   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  C   2463 OP1   ? ? A MG  8008 A C   2464 1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc37   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  U   918  OP1   ? ? A MG  8008 A U   919  1_555 ? ? ? ? ? ? ? 1.948 ? 
metalc38   metalc ? ? MA MG  .    MG    ? ? ? 1_555 A  A   2464 OP1   ? ? A MG  8008 A A   2465 1_555 ? ? ? ? ? ? ? 1.999 ? 
metalc39   metalc ? ? NA MG  .    MG    ? ? ? 1_555 A  G   2610 OP1   ? ? A MG  8009 A G   2611 1_555 ? ? ? ? ? ? ? 2.185 ? 
metalc40   metalc ? ? NA MG  .    MG    ? ? ? 1_555 A  A   2611 OP1   ? ? A MG  8009 A A   2612 1_555 ? ? ? ? ? ? ? 1.751 ? 
metalc41   metalc ? ? OA MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8010 D HOH 8526 1_555 ? ? ? ? ? ? ? 1.750 ? 
metalc42   metalc ? ? OA MG  .    MG    ? ? ? 1_555 A  G   835  OP1   ? ? A MG  8010 A G   836  1_555 ? ? ? ? ? ? ? 1.607 ? 
metalc43   metalc ? ? OA MG  .    MG    ? ? ? 1_555 A  U   2614 OP1   ? ? A MG  8010 A U   2615 1_555 ? ? ? ? ? ? ? 2.611 ? 
metalc44   metalc ? ? OA MG  .    MG    ? ? ? 1_555 D  GLN 230  OE1   ? ? A MG  8010 D GLN 230  1_555 ? ? ? ? ? ? ? 2.333 ? 
metalc45   metalc ? ? OA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8010 A HOH 9757 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc46   metalc ? ? PA MG  .    MG    ? ? ? 1_555 A  G   823  N7    ? ? A MG  8011 A G   824  1_555 ? ? ? ? ? ? ? 1.908 ? 
metalc47   metalc ? ? PA MG  .    MG    ? ? ? 1_555 A  G   853  N7    ? ? A MG  8011 A G   854  1_555 ? ? ? ? ? ? ? 1.842 ? 
metalc48   metalc ? ? QA MG  .    MG    ? ? ? 1_555 A  G   27   OP1   ? ? A MG  8012 A G   28   1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc49   metalc ? ? QA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8012 A HOH 9443 1_555 ? ? ? ? ? ? ? 1.901 ? 
metalc50   metalc ? ? RA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8013 A HOH 9423 1_555 ? ? ? ? ? ? ? 1.923 ? 
metalc51   metalc ? ? RA MG  .    MG    ? ? ? 1_555 A  G   2622 OP1   ? ? A MG  8013 A G   2623 1_555 ? ? ? ? ? ? ? 1.490 ? 
metalc52   metalc ? ? RA MG  .    MG    ? ? ? 1_555 A  G   876  OP1   ? ? A MG  8013 A G   877  1_555 ? ? ? ? ? ? ? 1.901 ? 
metalc53   metalc ? ? SA MG  .    MG    ? ? ? 1_555 A  G   2101 OP2   ? ? A MG  8014 A G   2102 1_555 ? ? ? ? ? ? ? 2.577 ? 
metalc54   metalc ? ? SA MG  .    MG    ? ? ? 1_555 A  G   2536 OP2   ? ? A MG  8014 A G   2537 1_555 ? ? ? ? ? ? ? 1.887 ? 
metalc55   metalc ? ? SA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8014 A HOH 9436 1_555 ? ? ? ? ? ? ? 1.979 ? 
metalc56   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  A   1688 OP1   ? ? A MG  8015 A A   1689 1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc57   metalc ? ? TA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8015 A HOH 9408 1_555 ? ? ? ? ? ? ? 1.934 ? 
metalc58   metalc ? ? TA MG  .    MG    ? ? ? 1_555 A  A   843  OP1   ? ? A MG  8015 A A   844  1_555 ? ? ? ? ? ? ? 1.948 ? 
metalc59   metalc ? ? TA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8015 A HOH 9427 1_555 ? ? ? ? ? ? ? 1.985 ? 
metalc60   metalc ? ? UA MG  .    MG    ? ? ? 1_555 A  A   1503 OP1   ? ? A MG  8016 A A   1504 1_555 ? ? ? ? ? ? ? 2.083 ? 
metalc61   metalc ? ? UA MG  .    MG    ? ? ? 1_555 A  A   1677 OP1   ? ? A MG  8016 A A   1678 1_555 ? ? ? ? ? ? ? 2.061 ? 
metalc62   metalc ? ? UA MG  .    MG    ? ? ? 1_555 A  C   1678 OP2   ? ? A MG  8016 A C   1679 1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc63   metalc ? ? VA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? A MG  8017 E HOH 8363 1_555 ? ? ? ? ? ? ? 2.049 ? 
metalc64   metalc ? ? VA MG  .    MG    ? ? ? 1_555 A  G   455  OP2   ? ? A MG  8017 A G   456  1_555 ? ? ? ? ? ? ? 2.006 ? 
metalc65   metalc ? ? VA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8017 A HOH 9809 1_555 ? ? ? ? ? ? ? 1.931 ? 
metalc66   metalc ? ? VA MG  .    MG    ? ? ? 1_555 GJ HOH .    O     ? ? A MG  8017 E HOH 8359 1_555 ? ? ? ? ? ? ? 1.875 ? 
metalc67   metalc ? ? WA MG  .    MG    ? ? ? 1_555 A  G   1291 OP2   ? ? A MG  8018 A G   1292 1_555 ? ? ? ? ? ? ? 1.886 ? 
metalc68   metalc ? ? WA MG  .    MG    ? ? ? 1_555 A  A   1290 OP1   ? ? A MG  8018 A A   1291 1_555 ? ? ? ? ? ? ? 2.034 ? 
metalc69   metalc ? ? WA MG  .    MG    ? ? ? 1_555 A  A   1290 OP2   ? ? A MG  8018 A A   1291 1_555 ? ? ? ? ? ? ? 3.114 ? 
metalc70   metalc ? ? XA MG  .    MG    ? ? ? 1_555 A  A   2010 OP1   ? ? A MG  8019 A A   2011 1_555 ? ? ? ? ? ? ? 3.142 ? 
metalc71   metalc ? ? XA MG  .    MG    ? ? ? 1_555 A  A   2010 OP2   ? ? A MG  8019 A A   2011 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc72   metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8020 A HOH 9526 1_555 ? ? ? ? ? ? ? 2.199 ? 
metalc73   metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8020 A HOH 9523 1_555 ? ? ? ? ? ? ? 1.979 ? 
metalc74   metalc ? ? YA MG  .    MG    ? ? ? 1_555 A  C   1829 OP1   ? ? A MG  8020 A C   1830 1_555 ? ? ? ? ? ? ? 1.762 ? 
metalc75   metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8020 A HOH 9598 1_555 ? ? ? ? ? ? ? 1.665 ? 
metalc76   metalc ? ? ZA MG  .    MG    ? ? ? 1_555 A  G   2303 OP2   ? ? A MG  8021 A G   2304 1_555 ? ? ? ? ? ? ? 1.671 ? 
metalc77   metalc ? ? AB MG  .    MG    ? ? ? 1_555 A  G   2539 OP1   ? ? A MG  8022 A G   2540 1_555 ? ? ? ? ? ? ? 2.910 ? 
metalc78   metalc ? ? AB MG  .    MG    ? ? ? 1_555 A  G   2096 OP2   ? ? A MG  8022 A G   2097 1_555 ? ? ? ? ? ? ? 2.204 ? 
metalc79   metalc ? ? AB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8022 A HOH 9853 1_555 ? ? ? ? ? ? ? 1.968 ? 
metalc80   metalc ? ? AB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8022 A HOH 9512 1_555 ? ? ? ? ? ? ? 1.964 ? 
metalc81   metalc ? ? BB MG  .    MG    ? ? ? 1_555 A  G   2617 OP2   ? ? A MG  8023 A G   2618 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc82   metalc ? ? BB MG  .    MG    ? ? ? 1_555 A  G   2616 OP2   ? ? A MG  8023 A G   2617 1_555 ? ? ? ? ? ? ? 2.399 ? 
metalc83   metalc ? ? CB MG  .    MG    ? ? ? 1_555 AK HOH .    O     ? ? A MG  8024 Y HOH 7830 1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc84   metalc ? ? CB MG  .    MG    ? ? ? 1_555 A  A   1380 N7    ? ? A MG  8024 A A   1381 1_555 ? ? ? ? ? ? ? 2.864 ? 
metalc85   metalc ? ? DB MG  .    MG    ? ? ? 1_555 A  U   1119 OP2   ? ? A MG  8025 A U   1120 1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc86   metalc ? ? DB MG  .    MG    ? ? ? 1_555 A  G   1120 OP2   ? ? A MG  8025 A G   1121 1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc87   metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  U   2609 OP2   ? ? A MG  8026 A U   2610 1_555 ? ? ? ? ? ? ? 1.864 ? 
metalc88   metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  G   2608 OP1   ? ? A MG  8026 A G   2609 1_555 ? ? ? ? ? ? ? 1.787 ? 
metalc89   metalc ? ? EB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8026 A HOH 9787 1_555 ? ? ? ? ? ? ? 2.206 ? 
metalc90   metalc ? ? EB MG  .    MG    ? ? ? 1_555 A  C   2607 OP1   ? ? A MG  8026 A C   2608 1_555 ? ? ? ? ? ? ? 2.067 ? 
metalc91   metalc ? ? FB MG  .    MG    ? ? ? 1_555 A  G   268  O6    ? ? A MG  8027 A G   269  1_555 ? ? ? ? ? ? ? 2.000 ? 
metalc92   metalc ? ? FB MG  .    MG    ? ? ? 1_555 PJ HOH .    O     ? ? A MG  8027 N HOH 8656 1_555 ? ? ? ? ? ? ? 2.500 ? 
metalc93   metalc ? ? FB MG  .    MG    ? ? ? 1_555 A  C   239  OP1   ? ? A MG  8027 A C   240  1_555 ? ? ? ? ? ? ? 1.943 ? 
metalc94   metalc ? ? GB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8028 A HOH 9967 1_555 ? ? ? ? ? ? ? 2.430 ? 
metalc95   metalc ? ? GB MG  .    MG    ? ? ? 1_555 A  A   1447 OP2   ? ? A MG  8028 A A   1448 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc96   metalc ? ? GB MG  .    MG    ? ? ? 1_555 A  U   1676 O4    ? ? A MG  8028 A U   1677 1_555 ? ? ? ? ? ? ? 1.997 ? 
metalc97   metalc ? ? HB MG  .    MG    ? ? ? 1_555 A  C   1678 OP1   ? ? A MG  8029 A C   1679 1_555 ? ? ? ? ? ? ? 2.217 ? 
metalc98   metalc ? ? HB MG  .    MG    ? ? ? 1_555 A  U   1502 OP1   ? ? A MG  8029 A U   1503 1_555 ? ? ? ? ? ? ? 1.760 ? 
metalc99   metalc ? ? IB MG  .    MG    ? ? ? 1_555 A  U   1747 OP1   ? ? A MG  8030 A U   1748 1_555 ? ? ? ? ? ? ? 2.227 ? 
metalc100  metalc ? ? IB MG  .    MG    ? ? ? 1_555 A  U   1748 OP2   ? ? A MG  8030 A U   1749 1_555 ? ? ? ? ? ? ? 2.001 ? 
metalc101  metalc ? ? JB MG  .    MG    ? ? ? 1_555 A  C   777  OP2   ? ? A MG  8031 A C   778  1_555 ? ? ? ? ? ? ? 2.207 ? 
metalc102  metalc ? ? JB MG  .    MG    ? ? ? 1_555 A  U   776  OP2   ? ? A MG  8031 A U   777  1_555 ? ? ? ? ? ? ? 1.903 ? 
metalc103  metalc ? ? KB MG  .    MG    ? ? ? 1_555 A  U   2114 OP1   ? ? A MG  8032 A U   2115 1_555 ? ? ? ? ? ? ? 2.200 ? 
metalc104  metalc ? ? KB MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8032 C HOH 8640 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc105  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  A   1746 OP2   ? ? A MG  8033 A A   1747 1_555 ? ? ? ? ? ? ? 2.108 ? 
metalc106  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  U   1747 OP2   ? ? A MG  8033 A U   1748 1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc107  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  U   1748 O4    ? ? A MG  8033 A U   1749 1_555 ? ? ? ? ? ? ? 2.268 ? 
metalc108  metalc ? ? LB MG  .    MG    ? ? ? 1_555 A  G   2584 OP1   ? ? A MG  8033 A G   2585 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc109  metalc ? ? MB MG  .    MG    ? ? ? 1_555 A  A   2301 OP1   ? ? A MG  8034 A A   2302 1_555 ? ? ? ? ? ? ? 1.962 ? 
metalc110  metalc ? ? MB MG  .    MG    ? ? ? 1_555 A  A   2302 OP1   ? ? A MG  8034 A A   2303 1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc111  metalc ? ? NB MG  .    MG    ? ? ? 1_555 A  G   1483 OP2   ? ? A MG  8035 A G   1484 1_555 ? ? ? ? ? ? ? 1.874 ? 
metalc112  metalc ? ? OB MG  .    MG    ? ? ? 1_555 A  G   955  OP2   ? ? A MG  8036 A G   956  1_555 ? ? ? ? ? ? ? 1.678 ? 
metalc113  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8036 A HOH 9762 1_555 ? ? ? ? ? ? ? 1.731 ? 
metalc114  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8037 A HOH 9481 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc115  metalc ? ? PB MG  .    MG    ? ? ? 1_555 A  A   2552 OP2   ? ? A MG  8037 A A   2553 1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc116  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8038 A HOH 9678 1_555 ? ? ? ? ? ? ? 2.058 ? 
metalc117  metalc ? ? RB MG  .    MG    ? ? ? 1_555 A  U   114  OP2   ? ? A MG  8039 A U   115  1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc118  metalc ? ? SB MG  .    MG    ? ? ? 1_555 PJ HOH .    O     ? ? A MG  8040 N HOH 8657 1_555 ? ? ? ? ? ? ? 2.646 ? 
metalc119  metalc ? ? SB MG  .    MG    ? ? ? 1_555 A  U   391  OP2   ? ? A MG  8040 A U   392  1_555 ? ? ? ? ? ? ? 1.857 ? 
metalc120  metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  G   195  OP1   ? ? A MG  8041 A G   196  1_555 ? ? ? ? ? ? ? 2.562 ? 
metalc121  metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  A   226  "O2'" ? ? A MG  8041 A A   227  1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc122  metalc ? ? TB MG  .    MG    ? ? ? 1_555 A  C   227  "O4'" ? ? A MG  8041 A C   228  1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc123  metalc ? ? UB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8042 A HOH 9832 1_555 ? ? ? ? ? ? ? 2.763 ? 
metalc124  metalc ? ? UB MG  .    MG    ? ? ? 1_555 A  U   1345 O2    ? ? A MG  8042 A U   1346 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc125  metalc ? ? UB MG  .    MG    ? ? ? 1_555 A  U   1308 O2    ? ? A MG  8042 A U   1309 1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc126  metalc ? ? VB MG  .    MG    ? ? ? 1_555 A  G   815  O6    ? ? A MG  8043 A G   816  1_555 ? ? ? ? ? ? ? 2.577 ? 
metalc127  metalc ? ? VB MG  .    MG    ? ? ? 1_555 A  G   816  O6    ? ? A MG  8043 A G   817  1_555 ? ? ? ? ? ? ? 2.559 ? 
metalc128  metalc ? ? WB MG  .    MG    ? ? ? 1_555 A  A   2088 OP1   ? ? A MG  8044 A A   2089 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc129  metalc ? ? WB MG  .    MG    ? ? ? 1_555 S  GLY 65   O     ? ? A MG  8044 S GLY 65   1_555 ? ? ? ? ? ? ? 2.033 ? 
metalc130  metalc ? ? WB MG  .    MG    ? ? ? 1_555 A  C   2047 OP1   ? ? A MG  8044 A C   2048 1_555 ? ? ? ? ? ? ? 2.501 ? 
metalc131  metalc ? ? WB MG  .    MG    ? ? ? 1_555 UJ HOH .    O     ? ? A MG  8044 S HOH 8593 1_555 ? ? ? ? ? ? ? 2.742 ? 
metalc132  metalc ? ? XB MG  .    MG    ? ? ? 1_555 A  G   1978 OP2   ? ? A MG  8045 A G   1979 1_555 ? ? ? ? ? ? ? 1.983 ? 
metalc133  metalc ? ? YB MG  .    MG    ? ? ? 1_555 A  G   1793 N7    ? ? A MG  8046 A G   1794 1_555 ? ? ? ? ? ? ? 2.652 ? 
metalc134  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 A  A   1097 OP2   ? ? A MG  8047 A A   1098 1_555 ? ? ? ? ? ? ? 1.939 ? 
metalc135  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 A  A   1097 OP1   ? ? A MG  8047 A A   1098 1_555 ? ? ? ? ? ? ? 3.148 ? 
metalc136  metalc ? ? AC MG  .    MG    ? ? ? 1_555 A  U   2748 OP2   ? ? A MG  8048 A U   2749 1_555 ? ? ? ? ? ? ? 3.012 ? 
metalc137  metalc ? ? AC MG  .    MG    ? ? ? 1_555 A  A   2745 OP2   ? ? A MG  8048 A A   2746 1_555 ? ? ? ? ? ? ? 2.663 ? 
metalc138  metalc ? ? AC MG  .    MG    ? ? ? 1_555 A  G   2749 OP2   ? ? A MG  8048 A G   2750 1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc139  metalc ? ? BC MG  .    MG    ? ? ? 1_555 A  G   2420 OP1   ? ? A MG  8049 A G   2421 1_555 ? ? ? ? ? ? ? 2.624 ? 
metalc140  metalc ? ? CC MG  .    MG    ? ? ? 1_555 A  C   2247 OP2   ? ? A MG  8050 A C   2248 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc141  metalc ? ? CC MG  .    MG    ? ? ? 1_555 A  C   2247 OP1   ? ? A MG  8050 A C   2248 1_555 ? ? ? ? ? ? ? 3.140 ? 
metalc142  metalc ? ? DC MG  .    MG    ? ? ? 1_555 A  G   640  OP2   ? ? A MG  8051 A G   641  1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc143  metalc ? ? EC MG  .    MG    ? ? ? 1_555 B  G   92   OP1   ? ? A MG  8052 B G   3092 1_555 ? ? ? ? ? ? ? 2.970 ? 
metalc144  metalc ? ? EC MG  .    MG    ? ? ? 1_555 A  U   1124 OP1   ? ? A MG  8052 A U   1125 1_555 ? ? ? ? ? ? ? 2.007 ? 
metalc145  metalc ? ? EC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8052 A HOH 9983 1_555 ? ? ? ? ? ? ? 2.667 ? 
metalc146  metalc ? ? FC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8053 A HOH 9639 1_555 ? ? ? ? ? ? ? 2.362 ? 
metalc147  metalc ? ? FC MG  .    MG    ? ? ? 1_555 A  G   470  O6    ? ? A MG  8053 A G   471  1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc148  metalc ? ? FC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8053 A HOH 9601 1_555 ? ? ? ? ? ? ? 2.815 ? 
metalc149  metalc ? ? GC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8054 A HOH 9828 1_555 ? ? ? ? ? ? ? 2.027 ? 
metalc150  metalc ? ? GC MG  .    MG    ? ? ? 1_555 A  U   2275 OP1   ? ? A MG  8054 A U   2276 1_555 ? ? ? ? ? ? ? 2.258 ? 
metalc151  metalc ? ? GC MG  .    MG    ? ? ? 1_555 A  C   161  OP1   ? ? A MG  8054 A C   162  1_555 ? ? ? ? ? ? ? 1.901 ? 
metalc152  metalc ? ? HC MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? A MG  8056 D HOH 8659 1_555 ? ? ? ? ? ? ? 1.907 ? 
metalc153  metalc ? ? HC MG  .    MG    ? ? ? 1_555 D  ASN 335  O     ? ? A MG  8056 D ASN 335  1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc154  metalc ? ? HC MG  .    MG    ? ? ? 1_555 A  A   2756 OP1   ? ? A MG  8056 A A   2757 1_555 ? ? ? ? ? ? ? 1.923 ? 
metalc155  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  G   2012 OP2   ? ? A MG  8057 A G   2013 1_555 ? ? ? ? ? ? ? 3.046 ? 
metalc156  metalc ? ? IC MG  .    MG    ? ? ? 1_555 C  GLN 207  O     ? ? A MG  8057 C GLN 207  1_555 ? ? ? ? ? ? ? 2.832 ? 
metalc157  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  U   2011 "O2'" ? ? A MG  8057 A U   2012 1_555 ? ? ? ? ? ? ? 2.236 ? 
metalc158  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  U   2011 "O3'" ? ? A MG  8057 A U   2012 1_555 ? ? ? ? ? ? ? 2.883 ? 
metalc159  metalc ? ? IC MG  .    MG    ? ? ? 1_555 A  U   1882 OP1   ? ? A MG  8057 A U   1883 1_555 ? ? ? ? ? ? ? 2.475 ? 
metalc160  metalc ? ? JC MG  .    MG    ? ? ? 1_555 A  G   2012 OP2   ? ? A MG  8058 A G   2013 1_555 ? ? ? ? ? ? ? 2.126 ? 
metalc161  metalc ? ? JC MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8058 C HOH 8643 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc162  metalc ? ? JC MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8058 C HOH 8641 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc163  metalc ? ? KC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8059 A HOH 9446 1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc164  metalc ? ? KC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8059 A HOH 9442 1_555 ? ? ? ? ? ? ? 1.950 ? 
metalc165  metalc ? ? KC MG  .    MG    ? ? ? 1_555 A  G   2617 OP1   ? ? A MG  8059 A G   2618 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc166  metalc ? ? LC MG  .    MG    ? ? ? 1_555 A  U   223  "O2'" ? ? A MG  8060 A U   224  1_555 ? ? ? ? ? ? ? 3.086 ? 
metalc167  metalc ? ? LC MG  .    MG    ? ? ? 1_555 A  G   174  OP2   ? ? A MG  8060 A G   175  1_555 ? ? ? ? ? ? ? 2.987 ? 
metalc168  metalc ? ? LC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8060 A HOH 9570 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc169  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  U   2649 OP2   ? ? A MG  8061 A U   2650 1_555 ? ? ? ? ? ? ? 3.144 ? 
metalc170  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  A   1368 OP2   ? ? A MG  8061 A A   1369 1_555 ? ? ? ? ? ? ? 2.499 ? 
metalc171  metalc ? ? MC MG  .    MG    ? ? ? 1_555 A  U   2649 OP1   ? ? A MG  8061 A U   2650 1_555 ? ? ? ? ? ? ? 1.916 ? 
metalc172  metalc ? ? NC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8062 A HOH 9790 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc173  metalc ? ? NC MG  .    MG    ? ? ? 1_555 A  G   1490 O6    ? ? A MG  8062 A G   1491 1_555 ? ? ? ? ? ? ? 2.049 ? 
metalc174  metalc ? ? NC MG  .    MG    ? ? ? 1_555 A  G   1488 OP2   ? ? A MG  8062 A G   1489 1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc175  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  G   2470 O6    ? ? A MG  8064 A G   2471 1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc176  metalc ? ? PC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8064 A HOH 9982 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc177  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  U   2277 O4    ? ? A MG  8064 A U   2278 1_555 ? ? ? ? ? ? ? 2.498 ? 
metalc178  metalc ? ? PC MG  .    MG    ? ? ? 1_555 A  U   2276 O4    ? ? A MG  8064 A U   2277 1_555 ? ? ? ? ? ? ? 2.759 ? 
metalc179  metalc ? ? QC MG  .    MG    ? ? ? 1_555 A  C   1871 "O3'" ? ? A MG  8066 A C   1872 1_555 ? ? ? ? ? ? ? 2.642 ? 
metalc180  metalc ? ? QC MG  .    MG    ? ? ? 1_555 C  ASP 26   OD2   ? ? A MG  8066 C ASP 26   1_555 ? ? ? ? ? ? ? 2.374 ? 
metalc181  metalc ? ? QC MG  .    MG    ? ? ? 1_555 C  ASP 26   OD1   ? ? A MG  8066 C ASP 26   1_555 ? ? ? ? ? ? ? 2.702 ? 
metalc182  metalc ? ? QC MG  .    MG    ? ? ? 1_555 A  G   1872 OP2   ? ? A MG  8066 A G   1873 1_555 ? ? ? ? ? ? ? 1.711 ? 
metalc183  metalc ? ? QC MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8066 C HOH 8554 1_555 ? ? ? ? ? ? ? 3.076 ? 
metalc184  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  U   1845 OP2   ? ? A MG  8067 A U   1846 1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc185  metalc ? ? RC MG  .    MG    ? ? ? 1_555 C  ASN 188  O     ? ? A MG  8067 C ASN 188  1_555 ? ? ? ? ? ? ? 2.416 ? 
metalc186  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  G   1883 O6    ? ? A MG  8067 A G   1884 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc187  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  A   1844 "O5'" ? ? A MG  8067 A A   1845 1_555 ? ? ? ? ? ? ? 3.056 ? 
metalc188  metalc ? ? RC MG  .    MG    ? ? ? 1_555 A  A   1844 OP1   ? ? A MG  8067 A A   1845 1_555 ? ? ? ? ? ? ? 2.379 ? 
metalc189  metalc ? ? SC MG  .    MG    ? ? ? 1_555 A  A   2567 OP2   ? ? A MG  8068 A A   2568 1_555 ? ? ? ? ? ? ? 2.343 ? 
metalc190  metalc ? ? TC MG  .    MG    ? ? ? 1_555 A  G   218  O6    ? ? A MG  8070 A G   219  1_555 ? ? ? ? ? ? ? 2.448 ? 
metalc191  metalc ? ? TC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8070 A HOH 9524 1_555 ? ? ? ? ? ? ? 2.458 ? 
metalc192  metalc ? ? TC MG  .    MG    ? ? ? 1_555 A  A   165  OP1   ? ? A MG  8070 A A   166  1_555 ? ? ? ? ? ? ? 1.998 ? 
metalc193  metalc ? ? VC MG  .    MG    ? ? ? 1_555 A  U   953  OP1   ? ? A MG  8072 A U   954  1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc194  metalc ? ? WC MG  .    MG    ? ? ? 1_555 A  A   1286 OP1   ? ? A MG  8074 A A   1287 1_555 ? ? ? ? ? ? ? 2.505 ? 
metalc195  metalc ? ? WC MG  .    MG    ? ? ? 1_555 ZJ HOH .    O     ? ? A MG  8074 X HOH 7874 1_555 ? ? ? ? ? ? ? 1.966 ? 
metalc196  metalc ? ? WC MG  .    MG    ? ? ? 1_555 A  A   1285 OP1   ? ? A MG  8074 A A   1286 1_555 ? ? ? ? ? ? ? 1.845 ? 
metalc197  metalc ? ? XC MG  .    MG    ? ? ? 1_555 A  A   907  "O4'" ? ? A MG  8075 A A   908  1_555 ? ? ? ? ? ? ? 2.654 ? 
metalc198  metalc ? ? XC MG  .    MG    ? ? ? 1_555 A  A   906  "O2'" ? ? A MG  8075 A A   907  1_555 ? ? ? ? ? ? ? 2.781 ? 
metalc199  metalc ? ? YC MG  .    MG    ? ? ? 1_555 EK HOH .    O     ? ? A MG  8076 3 HOH 7875 1_555 ? ? ? ? ? ? ? 1.994 ? 
metalc200  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8077 A HOH 9638 1_555 ? ? ? ? ? ? ? 1.880 ? 
metalc201  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  U   882  OP2   ? ? A MG  8077 A U   883  1_555 ? ? ? ? ? ? ? 2.009 ? 
metalc202  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 A  C   879  OP1   ? ? A MG  8077 A C   880  1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc203  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  C   167  OP2   ? ? A MG  8079 A C   168  1_555 ? ? ? ? ? ? ? 1.991 ? 
metalc204  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  A   166  OP1   ? ? A MG  8079 A A   167  1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc205  metalc ? ? AD MG  .    MG    ? ? ? 1_555 A  A   164  N7    ? ? A MG  8079 A A   165  1_555 ? ? ? ? ? ? ? 2.119 ? 
metalc206  metalc ? ? BD MG  .    MG    ? ? ? 1_555 A  A   1683 OP2   ? ? A MG  8080 A A   1684 1_555 ? ? ? ? ? ? ? 2.191 ? 
metalc207  metalc ? ? BD MG  .    MG    ? ? ? 1_555 A  U   1723 OP2   ? ? A MG  8080 A U   1724 1_555 ? ? ? ? ? ? ? 1.857 ? 
metalc208  metalc ? ? CD MG  .    MG    ? ? ? 1_555 A  C   1420 OP2   ? ? A MG  8081 A C   1421 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc209  metalc ? ? CD MG  .    MG    ? ? ? 1_555 A  G   1437 OP1   ? ? A MG  8081 A G   1438 1_555 ? ? ? ? ? ? ? 2.446 ? 
metalc210  metalc ? ? CD MG  .    MG    ? ? ? 1_555 A  C   1419 OP1   ? ? A MG  8081 A C   1420 1_555 ? ? ? ? ? ? ? 2.706 ? 
metalc211  metalc ? ? DD MG  .    MG    ? ? ? 1_555 SJ HOH .    O     ? ? A MG  8082 Q HOH 220  1_555 ? ? ? ? ? ? ? 2.717 ? 
metalc212  metalc ? ? DD MG  .    MG    ? ? ? 1_555 A  A   1436 OP2   ? ? A MG  8082 A A   1437 1_555 ? ? ? ? ? ? ? 2.758 ? 
metalc213  metalc ? ? ED MG  .    MG    ? ? ? 1_555 A  A   1753 OP2   ? ? A MG  8083 A A   1754 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc214  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8084 A HOH 9768 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc215  metalc ? ? FD MG  .    MG    ? ? ? 1_555 A  A   1741 OP2   ? ? A MG  8084 A A   1742 1_555 ? ? ? ? ? ? ? 2.126 ? 
metalc216  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8084 A HOH 9647 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc217  metalc ? ? GD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8085 A HOH 9994 1_555 ? ? ? ? ? ? ? 2.531 ? 
metalc218  metalc ? ? GD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8085 A HOH 9442 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc219  metalc ? ? GD MG  .    MG    ? ? ? 1_555 A  G   2617 OP1   ? ? A MG  8085 A G   2618 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc220  metalc ? ? GD MG  .    MG    ? ? ? 1_555 A  G   2616 "O3'" ? ? A MG  8085 A G   2617 1_555 ? ? ? ? ? ? ? 3.040 ? 
metalc221  metalc ? ? HD MG  .    MG    ? ? ? 1_555 A  U   532  OP1   ? ? A MG  8086 A U   533  1_555 ? ? ? ? ? ? ? 2.045 ? 
metalc222  metalc ? ? HD MG  .    MG    ? ? ? 1_555 A  A   531  OP1   ? ? A MG  8086 A A   532  1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc223  metalc ? ? ID MG  .    MG    ? ? ? 1_555 A  G   682  OP2   ? ? A MG  8087 A G   683  1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc224  metalc ? ? ID MG  .    MG    ? ? ? 1_555 A  A   681  OP2   ? ? A MG  8087 A A   682  1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc225  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  G   2610 "O2'" ? ? A MG  8088 A G   2611 1_555 ? ? ? ? ? ? ? 2.751 ? 
metalc226  metalc ? ? JD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8088 A HOH 9692 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc227  metalc ? ? JD MG  .    MG    ? ? ? 1_555 A  G   2539 O6    ? ? A MG  8088 A G   2540 1_555 ? ? ? ? ? ? ? 2.809 ? 
metalc228  metalc ? ? JD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8088 A HOH 9468 1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc229  metalc ? ? KD MG  .    MG    ? ? ? 1_555 A  U   516  OP2   ? ? A MG  8089 A U   517  1_555 ? ? ? ? ? ? ? 2.239 ? 
metalc230  metalc ? ? KD MG  .    MG    ? ? ? 1_555 A  A   515  OP1   ? ? A MG  8089 A A   516  1_555 ? ? ? ? ? ? ? 1.985 ? 
metalc231  metalc ? ? KD MG  .    MG    ? ? ? 1_555 A  C   514  "O3'" ? ? A MG  8089 A C   515  1_555 ? ? ? ? ? ? ? 3.081 ? 
metalc232  metalc ? ? KD MG  .    MG    ? ? ? 1_555 A  G   517  N7    ? ? A MG  8089 A G   518  1_555 ? ? ? ? ? ? ? 3.144 ? 
metalc233  metalc ? ? LD MG  .    MG    ? ? ? 1_555 A  A   2102 OP2   ? ? A MG  8090 A A   2103 1_555 ? ? ? ? ? ? ? 2.646 ? 
metalc234  metalc ? ? MD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8091 A HOH 9937 1_555 ? ? ? ? ? ? ? 2.712 ? 
metalc235  metalc ? ? MD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8091 A HOH 9495 1_555 ? ? ? ? ? ? ? 2.410 ? 
metalc236  metalc ? ? MD MG  .    MG    ? ? ? 1_555 A  G   917  OP1   ? ? A MG  8091 A G   918  1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc237  metalc ? ? ND MG  .    MG    ? ? ? 1_555 A  C   1843 OP2   ? ? A MG  8092 A C   1844 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc238  metalc ? ? OD MG  .    MG    ? ? ? 1_555 A  A   1069 "O2'" ? ? A MG  8093 A A   1070 1_555 ? ? ? ? ? ? ? 2.846 ? 
metalc239  metalc ? ? OD MG  .    MG    ? ? ? 1_555 A  G   1070 OP1   ? ? A MG  8093 A G   1071 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc240  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  U   1095 OP2   ? ? A MG  8094 A U   1096 1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc241  metalc ? ? PD MG  .    MG    ? ? ? 1_555 A  C   1256 OP2   ? ? A MG  8094 A C   1257 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc242  metalc ? ? QD MG  .    MG    ? ? ? 1_555 IE MG  .    MG    ? ? A MG  8096 A MG  8116 1_555 ? ? ? ? ? ? ? 3.140 ? 
metalc243  metalc ? ? QD MG  .    MG    ? ? ? 1_555 A  G   1848 O6    ? ? A MG  8096 A G   1849 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc244  metalc ? ? QD MG  .    MG    ? ? ? 1_555 A  G   1848 N7    ? ? A MG  8096 A G   1849 1_555 ? ? ? ? ? ? ? 3.063 ? 
metalc245  metalc ? ? QD MG  .    MG    ? ? ? 1_555 A  G   1847 O6    ? ? A MG  8096 A G   1848 1_555 ? ? ? ? ? ? ? 2.208 ? 
metalc246  metalc ? ? RD MG  .    MG    ? ? ? 1_555 A  U   863  O4    ? ? A MG  8097 A U   864  1_555 ? ? ? ? ? ? ? 2.426 ? 
metalc247  metalc ? ? RD MG  .    MG    ? ? ? 1_555 A  G   862  O6    ? ? A MG  8097 A G   863  1_555 ? ? ? ? ? ? ? 2.514 ? 
metalc248  metalc ? ? SD MG  .    MG    ? ? ? 1_555 BK HOH .    O     ? ? A MG  8098 Z HOH 8573 1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc249  metalc ? ? SD MG  .    MG    ? ? ? 1_555 A  A   906  N7    ? ? A MG  8098 A A   907  1_555 ? ? ? ? ? ? ? 2.635 ? 
metalc250  metalc ? ? TD MG  .    MG    ? ? ? 1_555 A  A   2611 "O2'" ? ? A MG  8099 A A   2612 1_555 ? ? ? ? ? ? ? 2.679 ? 
metalc251  metalc ? ? UD MG  .    MG    ? ? ? 1_555 A  G   2079 O6    ? ? A MG  8100 A G   2080 1_555 ? ? ? ? ? ? ? 3.045 ? 
metalc252  metalc ? ? VD MG  .    MG    ? ? ? 1_555 A  U   2281 O4    ? ? A MG  8101 A U   2282 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc253  metalc ? ? VD MG  .    MG    ? ? ? 1_555 A  C   2280 OP2   ? ? A MG  8101 A C   2281 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc254  metalc ? ? WD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8102 A HOH 9650 1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc255  metalc ? ? WD MG  .    MG    ? ? ? 1_555 FK HOH .    O     ? ? A MG  8102 4 HOH 8522 1_555 ? ? ? ? ? ? ? 3.141 ? 
metalc256  metalc ? ? WD MG  .    MG    ? ? ? 1_555 A  A   2433 N3    ? ? A MG  8102 A A   2434 1_555 ? ? ? ? ? ? ? 2.224 ? 
metalc257  metalc ? ? XD MG  .    MG    ? ? ? 1_555 A  G   2578 OP2   ? ? A MG  8103 A G   2579 1_555 ? ? ? ? ? ? ? 2.870 ? 
metalc258  metalc ? ? XD MG  .    MG    ? ? ? 1_555 A  G   2577 OP2   ? ? A MG  8103 A G   2578 1_555 ? ? ? ? ? ? ? 2.580 ? 
metalc259  metalc ? ? YD MG  .    MG    ? ? ? 1_555 A  C   2103 OP1   ? ? A MG  8104 A C   2104 1_555 ? ? ? ? ? ? ? 2.573 ? 
metalc260  metalc ? ? YD MG  .    MG    ? ? ? 1_555 A  C   2104 OP2   ? ? A MG  8104 A C   2105 1_555 ? ? ? ? ? ? ? 2.727 ? 
metalc261  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 SJ HOH .    O     ? ? A MG  8106 Q HOH 192  1_555 ? ? ? ? ? ? ? 2.772 ? 
metalc262  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 SJ HOH .    O     ? ? A MG  8106 Q HOH 214  1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc263  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 A  G   816  O6    ? ? A MG  8106 A G   817  1_555 ? ? ? ? ? ? ? 2.191 ? 
metalc264  metalc ? ? AE MG  .    MG    ? ? ? 1_555 A  A   1106 OP2   ? ? A MG  8107 A A   1107 1_555 ? ? ? ? ? ? ? 1.930 ? 
metalc265  metalc ? ? AE MG  .    MG    ? ? ? 1_555 A  A   1105 OP2   ? ? A MG  8107 A A   1106 1_555 ? ? ? ? ? ? ? 2.048 ? 
metalc266  metalc ? ? CE MG  .    MG    ? ? ? 1_555 A  U   902  OP1   ? ? A MG  8110 A U   903  1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc267  metalc ? ? CE MG  .    MG    ? ? ? 1_555 A  A   1356 N7    ? ? A MG  8110 A A   1357 1_555 ? ? ? ? ? ? ? 2.740 ? 
metalc268  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8110 A HOH 9900 1_555 ? ? ? ? ? ? ? 3.002 ? 
metalc269  metalc ? ? DE MG  .    MG    ? ? ? 1_555 A  G   2608 N7    ? ? A MG  8111 A G   2609 1_555 ? ? ? ? ? ? ? 2.389 ? 
metalc270  metalc ? ? EE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8112 A HOH 9959 1_555 ? ? ? ? ? ? ? 2.435 ? 
metalc271  metalc ? ? EE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8112 A HOH 9728 1_555 ? ? ? ? ? ? ? 2.547 ? 
metalc272  metalc ? ? EE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8112 A HOH 9529 1_555 ? ? ? ? ? ? ? 1.921 ? 
metalc273  metalc ? ? EE MG  .    MG    ? ? ? 1_555 A  A   186  N1    ? ? A MG  8112 A A   187  1_555 ? ? ? ? ? ? ? 3.015 ? 
metalc274  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8113 A HOH 9982 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc275  metalc ? ? FE MG  .    MG    ? ? ? 1_555 A  A   2111 N7    ? ? A MG  8113 A A   2112 1_555 ? ? ? ? ? ? ? 2.782 ? 
metalc276  metalc ? ? GE MG  .    MG    ? ? ? 1_555 FK HOH .    O     ? ? A MG  8114 4 HOH 8534 1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc277  metalc ? ? GE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8114 A HOH 9846 1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc278  metalc ? ? GE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8114 A HOH 9745 1_555 ? ? ? ? ? ? ? 2.471 ? 
metalc279  metalc ? ? HE MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8115 C HOH 8644 1_555 ? ? ? ? ? ? ? 2.482 ? 
metalc280  metalc ? ? HE MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8115 C HOH 8558 1_555 ? ? ? ? ? ? ? 2.974 ? 
metalc281  metalc ? ? IE MG  .    MG    ? ? ? 1_555 A  U   1849 O4    ? ? A MG  8116 A U   1850 1_555 ? ? ? ? ? ? ? 2.880 ? 
metalc282  metalc ? ? IE MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? A MG  8116 C HOH 8558 1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc283  metalc ? ? JE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8117 A HOH 9622 1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc284  metalc ? ? JE MG  .    MG    ? ? ? 1_555 A  A   2021 N7    ? ? A MG  8117 A A   2022 1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc285  metalc ? ? JE MG  .    MG    ? ? ? 1_555 A  C   1840 OP2   ? ? A MG  8117 A C   1841 1_555 ? ? ? ? ? ? ? 2.738 ? 
metalc286  metalc ? ? JE MG  .    MG    ? ? ? 1_555 A  A   1839 "O2'" ? ? A MG  8117 A A   1840 1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc287  metalc ? ? JE MG  .    MG    ? ? ? 1_555 A  A   1839 "O3'" ? ? A MG  8117 A A   1840 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc288  metalc ? ? KE K   .    K     ? ? ? 1_555 A  U   171  O4    ? ? A K   8202 A U   172  1_555 ? ? ? ? ? ? ? 3.288 ? 
metalc289  metalc ? ? KE K   .    K     ? ? ? 1_555 CJ HOH .    O     ? ? A K   8202 A HOH 9513 1_555 ? ? ? ? ? ? ? 3.189 ? 
metalc290  metalc ? ? KE K   .    K     ? ? ? 1_555 CJ HOH .    O     ? ? A K   8202 A HOH 9548 1_555 ? ? ? ? ? ? ? 3.219 ? 
metalc291  metalc ? ? KE K   .    K     ? ? ? 1_555 A  C   161  OP2   ? ? A K   8202 A C   162  1_555 ? ? ? ? ? ? ? 2.871 ? 
metalc292  metalc ? ? KE K   .    K     ? ? ? 1_555 CJ HOH .    O     ? ? A K   8202 A HOH 9417 1_555 ? ? ? ? ? ? ? 3.394 ? 
metalc293  metalc ? ? KE K   .    K     ? ? ? 1_555 A  U   162  O4    ? ? A K   8202 A U   163  1_555 ? ? ? ? ? ? ? 3.339 ? 
metalc294  metalc ? ? KE K   .    K     ? ? ? 1_555 CJ HOH .    O     ? ? A K   8202 A HOH 9721 1_555 ? ? ? ? ? ? ? 3.525 ? 
metalc295  metalc ? ? LE NA  .    NA    ? ? ? 1_555 A  G   1071 N7    ? ? A NA  8301 A G   1072 1_555 ? ? ? ? ? ? ? 2.530 ? 
metalc296  metalc ? ? LE NA  .    NA    ? ? ? 1_555 A  C   1068 OP2   ? ? A NA  8301 A C   1069 1_555 ? ? ? ? ? ? ? 2.452 ? 
metalc297  metalc ? ? OE NA  .    NA    ? ? ? 1_555 A  A   629  "O2'" ? ? A NA  8305 A A   630  1_555 ? ? ? ? ? ? ? 2.558 ? 
metalc298  metalc ? ? QE NA  .    NA    ? ? ? 1_555 A  C   39   O2    ? ? A NA  8307 A C   40   1_555 ? ? ? ? ? ? ? 2.518 ? 
metalc299  metalc ? ? RE NA  .    NA    ? ? ? 1_555 A  U   1723 O2    ? ? A NA  8308 A U   1724 1_555 ? ? ? ? ? ? ? 2.117 ? 
metalc300  metalc ? ? RE NA  .    NA    ? ? ? 1_555 A  C   1393 O2    ? ? A NA  8308 A C   1394 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc301  metalc ? ? TE NA  .    NA    ? ? ? 1_555 A  G   2524 O6    ? ? A NA  8311 A G   2525 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc302  metalc ? ? UE NA  .    NA    ? ? ? 1_555 A  G   2398 O6    ? ? A NA  8313 A G   2399 1_555 ? ? ? ? ? ? ? 2.424 ? 
metalc303  metalc ? ? VE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8314 A HOH 9729 1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc304  metalc ? ? VE NA  .    NA    ? ? ? 1_555 A  U   2606 "O2'" ? ? A NA  8314 A U   2607 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc305  metalc ? ? WE NA  .    NA    ? ? ? 1_555 A  A   165  "O3'" ? ? A NA  8315 A A   166  1_555 ? ? ? ? ? ? ? 2.561 ? 
metalc306  metalc ? ? XE NA  .    NA    ? ? ? 1_555 A  C   895  "O2'" ? ? A NA  8316 A C   896  1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc307  metalc ? ? YE NA  .    NA    ? ? ? 1_555 EK HOH .    O     ? ? A NA  8317 3 HOH 4135 1_555 ? ? ? ? ? ? ? 2.532 ? 
metalc308  metalc ? ? YE NA  .    NA    ? ? ? 1_555 CA TRP 41   O     ? ? A NA  8317 3 TRP 42   1_555 ? ? ? ? ? ? ? 2.168 ? 
metalc309  metalc ? ? BF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8320 A HOH 9490 1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc310  metalc ? ? CF NA  .    NA    ? ? ? 1_555 D  ARG 229  O     ? ? A NA  8321 D ARG 229  1_555 ? ? ? ? ? ? ? 2.504 ? 
metalc311  metalc ? ? DF NA  .    NA    ? ? ? 1_555 A  C   2474 N4    ? ? A NA  8323 A C   2475 1_555 ? ? ? ? ? ? ? 2.322 ? 
metalc312  metalc ? ? FF NA  .    NA    ? ? ? 1_555 A  A   775  "O3'" ? ? A NA  8325 A A   776  1_555 ? ? ? ? ? ? ? 2.316 ? 
metalc313  metalc ? ? FF NA  .    NA    ? ? ? 1_555 A  U   778  O4    ? ? A NA  8325 A U   779  1_555 ? ? ? ? ? ? ? 2.414 ? 
metalc314  metalc ? ? GF NA  .    NA    ? ? ? 1_555 A  U   2011 O4    ? ? A NA  8326 A U   2012 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc315  metalc ? ? HF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8327 A HOH 9440 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc316  metalc ? ? HF NA  .    NA    ? ? ? 1_555 A  G   853  OP1   ? ? A NA  8327 A G   854  1_555 ? ? ? ? ? ? ? 2.546 ? 
metalc317  metalc ? ? KF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8330 A HOH 9632 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc318  metalc ? ? LF NA  .    NA    ? ? ? 1_555 A  C   217  "O2'" ? ? A NA  8331 A C   218  1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc319  metalc ? ? MF NA  .    NA    ? ? ? 1_555 A  G   386  O6    ? ? A NA  8332 A G   387  1_555 ? ? ? ? ? ? ? 2.588 ? 
metalc320  metalc ? ? NF NA  .    NA    ? ? ? 1_555 A  U   1896 O4    ? ? A NA  8333 A U   1897 1_555 ? ? ? ? ? ? ? 2.462 ? 
metalc321  metalc ? ? NF NA  .    NA    ? ? ? 1_555 A  C   1893 O2    ? ? A NA  8333 A C   1894 1_555 ? ? ? ? ? ? ? 2.541 ? 
metalc322  metalc ? ? QF NA  .    NA    ? ? ? 1_555 A  G   1705 O6    ? ? A NA  8336 A G   1706 1_555 ? ? ? ? ? ? ? 2.440 ? 
metalc323  metalc ? ? QF NA  .    NA    ? ? ? 1_555 A  G   1706 O6    ? ? A NA  8336 A G   1707 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc324  metalc ? ? RF NA  .    NA    ? ? ? 1_555 S  VAL 72   O     ? ? A NA  8338 S VAL 72   1_555 ? ? ? ? ? ? ? 2.472 ? 
metalc325  metalc ? ? RF NA  .    NA    ? ? ? 1_555 UJ HOH .    O     ? ? A NA  8338 S HOH 8516 1_555 ? ? ? ? ? ? ? 2.595 ? 
metalc326  metalc ? ? RF NA  .    NA    ? ? ? 1_555 UJ HOH .    O     ? ? A NA  8338 S HOH 8527 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc327  metalc ? ? RF NA  .    NA    ? ? ? 1_555 A  U   2658 "O3'" ? ? A NA  8338 A U   2659 1_555 ? ? ? ? ? ? ? 2.250 ? 
metalc328  metalc ? ? RF NA  .    NA    ? ? ? 1_555 A  G   2659 OP1   ? ? A NA  8338 A G   2660 1_555 ? ? ? ? ? ? ? 2.204 ? 
metalc329  metalc ? ? RF NA  .    NA    ? ? ? 1_555 S  TRP 75   O     ? ? A NA  8338 S TRP 75   1_555 ? ? ? ? ? ? ? 2.401 ? 
metalc330  metalc ? ? SF NA  .    NA    ? ? ? 1_555 A  G   2539 O6    ? ? A NA  8339 A G   2540 1_555 ? ? ? ? ? ? ? 2.508 ? 
metalc331  metalc ? ? SF NA  .    NA    ? ? ? 1_555 A  U   2644 O2    ? ? A NA  8339 A U   2645 1_555 ? ? ? ? ? ? ? 2.556 ? 
metalc332  metalc ? ? WF NA  .    NA    ? ? ? 1_555 A  U   2662 O2    ? ? A NA  8344 A U   2663 1_555 ? ? ? ? ? ? ? 2.520 ? 
metalc333  metalc ? ? WF NA  .    NA    ? ? ? 1_555 A  G   2816 OP2   ? ? A NA  8344 A G   2817 1_555 ? ? ? ? ? ? ? 2.579 ? 
metalc334  metalc ? ? XF NA  .    NA    ? ? ? 1_555 A  G   1044 OP2   ? ? A NA  8349 A G   1045 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc335  metalc ? ? XF NA  .    NA    ? ? ? 1_555 A  A   913  "O3'" ? ? A NA  8349 A A   914  1_555 ? ? ? ? ? ? ? 2.575 ? 
metalc336  metalc ? ? YF NA  .    NA    ? ? ? 1_555 A  G   900  OP1   ? ? A NA  8350 A G   901  1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc337  metalc ? ? AG NA  .    NA    ? ? ? 1_555 OJ HOH .    O     ? ? A NA  8353 M HOH 8515 1_555 ? ? ? ? ? ? ? 2.595 ? 
metalc338  metalc ? ? EG NA  .    NA    ? ? ? 1_555 A  U   941  O4    ? ? A NA  8357 A U   942  1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc339  metalc ? ? EG NA  .    NA    ? ? ? 1_555 A  G   1023 O6    ? ? A NA  8357 A G   1024 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc340  metalc ? ? GG NA  .    NA    ? ? ? 1_555 A  A   922  "O2'" ? ? A NA  8359 A A   923  1_555 ? ? ? ? ? ? ? 2.538 ? 
metalc341  metalc ? ? JG NA  .    NA    ? ? ? 1_555 A  G   2109 OP2   ? ? A NA  8362 A G   2110 1_555 ? ? ? ? ? ? ? 2.502 ? 
metalc342  metalc ? ? KG NA  .    NA    ? ? ? 1_555 A  C   1359 OP1   ? ? A NA  8363 A C   1360 1_555 ? ? ? ? ? ? ? 2.557 ? 
metalc343  metalc ? ? LG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8364 A HOH 9986 1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc344  metalc ? ? NG NA  .    NA    ? ? ? 1_555 A  G   544  O6    ? ? A NA  8366 A G   545  1_555 ? ? ? ? ? ? ? 2.516 ? 
metalc345  metalc ? ? OG NA  .    NA    ? ? ? 1_555 A  G   463  O6    ? ? A NA  8367 A G   464  1_555 ? ? ? ? ? ? ? 2.445 ? 
metalc346  metalc ? ? PG NA  .    NA    ? ? ? 1_555 A  U   814  O4    ? ? A NA  8368 A U   815  1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc347  metalc ? ? QG NA  .    NA    ? ? ? 1_555 A  G   1831 OP2   ? ? A NA  8370 A G   1832 1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc348  metalc ? ? TG NA  .    NA    ? ? ? 1_555 A  G   1618 O6    ? ? A NA  8373 A G   1619 1_555 ? ? ? ? ? ? ? 2.479 ? 
metalc349  metalc ? ? WG NA  .    NA    ? ? ? 1_555 A  C   632  OP1   ? ? A NA  8376 A C   633  1_555 ? ? ? ? ? ? ? 2.254 ? 
metalc350  metalc ? ? AH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8381 A HOH 9727 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc351  metalc ? ? BH NA  .    NA    ? ? ? 1_555 A  G   2772 O6    ? ? A NA  8382 A G   2773 1_555 ? ? ? ? ? ? ? 2.467 ? 
metalc352  metalc ? ? CH NA  .    NA    ? ? ? 1_555 A  C   196  N3    ? ? A NA  8384 A C   197  1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc353  metalc ? ? DH NA  .    NA    ? ? ? 1_555 A  G   1076 N7    ? ? A NA  8385 A G   1077 1_555 ? ? ? ? ? ? ? 2.506 ? 
metalc354  metalc ? ? DH NA  .    NA    ? ? ? 1_555 A  A   1078 OP1   ? ? A NA  8385 A A   1079 1_555 ? ? ? ? ? ? ? 2.191 ? 
metalc355  metalc ? ? MH MG  .    MG    ? ? ? 1_555 B  A   57   OP2   ? ? B MG  8095 B A   3057 1_555 ? ? ? ? ? ? ? 2.798 ? 
metalc356  metalc ? ? MH MG  .    MG    ? ? ? 1_555 B  A   56   OP2   ? ? B MG  8095 B A   3056 1_555 ? ? ? ? ? ? ? 1.819 ? 
metalc357  metalc ? ? MH MG  .    MG    ? ? ? 1_555 DJ HOH .    O     ? ? B MG  8095 B HOH 7361 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc358  metalc ? ? MH MG  .    MG    ? ? ? 1_555 B  G   21   O6    ? ? B MG  8095 B G   3021 1_555 ? ? ? ? ? ? ? 3.094 ? 
metalc359  metalc ? ? NH NA  .    NA    ? ? ? 1_555 B  C   40   N3    ? ? B NA  8351 B C   3040 1_555 ? ? ? ? ? ? ? 2.206 ? 
metalc360  metalc ? ? OH NA  .    NA    ? ? ? 1_555 DJ HOH .    O     ? ? B NA  8383 B HOH 7361 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc361  metalc ? ? PH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? C MG  8065 C HOH 8642 1_555 ? ? ? ? ? ? ? 2.400 ? 
metalc362  metalc ? ? PH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? C MG  8065 C HOH 8541 1_555 ? ? ? ? ? ? ? 2.507 ? 
metalc363  metalc ? ? PH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? C MG  8065 C HOH 8522 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc364  metalc ? ? PH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? C MG  8065 C HOH 8609 1_555 ? ? ? ? ? ? ? 2.232 ? 
metalc365  metalc ? ? PH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? C MG  8065 C HOH 8555 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc366  metalc ? ? QH MG  .    MG    ? ? ? 1_555 EJ HOH .    O     ? ? C MG  8105 C HOH 8639 1_555 ? ? ? ? ? ? ? 3.041 ? 
metalc367  metalc ? ? QH MG  .    MG    ? ? ? 1_555 C  ASN 174  ND2   ? ? C MG  8105 C ASN 174  1_555 ? ? ? ? ? ? ? 2.838 ? 
metalc368  metalc ? ? RH NA  .    NA    ? ? ? 1_555 C  PHE 201  O     ? ? C NA  8345 C PHE 201  1_555 ? ? ? ? ? ? ? 2.158 ? 
metalc369  metalc ? ? RH NA  .    NA    ? ? ? 1_555 C  HIS 208  O     ? ? C NA  8345 C HIS 208  1_555 ? ? ? ? ? ? ? 2.378 ? 
metalc370  metalc ? ? RH NA  .    NA    ? ? ? 1_555 EJ HOH .    O     ? ? C NA  8345 C HOH 8561 1_555 ? ? ? ? ? ? ? 2.186 ? 
metalc371  metalc ? ? RH NA  .    NA    ? ? ? 1_555 EJ HOH .    O     ? ? C NA  8345 C HOH 8608 1_555 ? ? ? ? ? ? ? 2.042 ? 
metalc372  metalc ? ? TH MG  .    MG    ? ? ? 1_555 FJ HOH .    O     ? ? D MG  8055 D HOH 8658 1_555 ? ? ? ? ? ? ? 2.800 ? 
metalc373  metalc ? ? VH NA  .    NA    ? ? ? 1_555 E  LYS 96   O     ? ? E NA  8304 E LYS 96   1_555 ? ? ? ? ? ? ? 2.569 ? 
metalc374  metalc ? ? VH NA  .    NA    ? ? ? 1_555 E  ASP 45   OD1   ? ? E NA  8304 E ASP 45   1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc375  metalc ? ? WH NA  .    NA    ? ? ? 1_555 J  VAL 153  O     ? ? J NA  8309 J VAL 153  1_555 ? ? ? ? ? ? ? 2.510 ? 
metalc376  metalc ? ? WH NA  .    NA    ? ? ? 1_555 J  PRO 155  O     ? ? J NA  8309 J PRO 155  1_555 ? ? ? ? ? ? ? 2.425 ? 
metalc377  metalc ? ? YH NA  .    NA    ? ? ? 1_555 K  TYR 69   O     ? ? K NA  8346 K TYR 69   1_555 ? ? ? ? ? ? ? 2.351 ? 
metalc378  metalc ? ? YH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? K NA  8346 A HOH 9879 1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc379  metalc ? ? CI MG  .    MG    ? ? ? 1_555 NJ HOH .    O     ? ? L MG  8069 L HOH 7871 1_555 ? ? ? ? ? ? ? 1.807 ? 
metalc380  metalc ? ? CI MG  .    MG    ? ? ? 1_555 NJ HOH .    O     ? ? L MG  8069 L HOH 2121 1_555 ? ? ? ? ? ? ? 1.639 ? 
metalc381  metalc ? ? CI MG  .    MG    ? ? ? 1_555 NJ HOH .    O     ? ? L MG  8069 L HOH 1797 1_555 ? ? ? ? ? ? ? 2.304 ? 
metalc382  metalc ? ? CI MG  .    MG    ? ? ? 1_555 L  ASN 42   OD1   ? ? L MG  8069 L ASN 42   1_555 ? ? ? ? ? ? ? 2.660 ? 
metalc383  metalc ? ? EI NA  .    NA    ? ? ? 1_555 M  GLU 39   OE1   ? ? M NA  8380 M GLU 39   1_555 ? ? ? ? ? ? ? 2.406 ? 
metalc384  metalc ? ? EI NA  .    NA    ? ? ? 1_555 OJ HOH .    O     ? ? M NA  8380 M HOH 8594 1_555 ? ? ? ? ? ? ? 1.994 ? 
metalc385  metalc ? ? GI NA  .    NA    ? ? ? 1_555 N  LEU 112  O     ? ? N NA  8347 N LEU 112  1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc386  metalc ? ? JI CD  .    CD    ? ? ? 1_555 RJ HOH .    O     ? ? P CD  8405 P HOH 5650 1_555 ? ? ? ? ? ? ? 3.121 ? 
metalc387  metalc ? ? JI CD  .    CD    ? ? ? 1_555 P  HIS 40   ND1   ? ? P CD  8405 P HIS 40   1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc388  metalc ? ? JI CD  .    CD    ? ? ? 1_555 RJ HOH .    O     ? ? P CD  8405 P HOH 5322 1_555 ? ? ? ? ? ? ? 2.914 ? 
metalc389  metalc ? ? LI NA  .    NA    ? ? ? 1_555 TJ HOH .    O     ? ? R NA  8348 R HOH 5427 1_555 ? ? ? ? ? ? ? 2.238 ? 
metalc390  metalc ? ? MI NA  .    NA    ? ? ? 1_555 UJ HOH .    O     ? ? S NA  8337 S HOH 8525 1_555 ? ? ? ? ? ? ? 2.567 ? 
metalc391  metalc ? ? MI NA  .    NA    ? ? ? 1_555 S  SER 70   O     ? ? S NA  8337 S SER 70   1_555 ? ? ? ? ? ? ? 2.563 ? 
metalc392  metalc ? ? PI NA  .    NA    ? ? ? 1_555 T  HIS 7    NE2   ? ? T NA  8312 T HIS 7    1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc393  metalc ? ? PI NA  .    NA    ? ? ? 1_555 T  GLU 61   OE2   ? ? T NA  8312 T GLU 61   1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc394  metalc ? ? QI MG  .    MG    ? ? ? 1_555 U  ASP 117  O     ? ? U MG  8073 U ASP 117  1_555 ? ? ? ? ? ? ? 2.191 ? 
metalc395  metalc ? ? QI MG  .    MG    ? ? ? 1_555 U  SER 114  O     ? ? U MG  8073 U SER 114  1_555 ? ? ? ? ? ? ? 2.174 ? 
metalc396  metalc ? ? QI MG  .    MG    ? ? ? 1_555 U  LEU 112  O     ? ? U MG  8073 U LEU 112  1_555 ? ? ? ? ? ? ? 2.725 ? 
metalc397  metalc ? ? QI MG  .    MG    ? ? ? 1_555 U  ARG 111  O     ? ? U MG  8073 U ARG 111  1_555 ? ? ? ? ? ? ? 2.664 ? 
metalc398  metalc ? ? QI MG  .    MG    ? ? ? 1_555 U  GLN 37   OE1   ? ? U MG  8073 U GLN 37   1_555 ? ? ? ? ? ? ? 2.832 ? 
metalc399  metalc ? ? RI NA  .    NA    ? ? ? 1_555 U  SER 94   OG    ? ? U NA  8343 U SER 94   1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc400  metalc ? ? TI MG  .    MG    ? ? ? 1_555 Z  LYS 136  O     ? ? Z MG  8109 Z LYS 136  1_555 ? ? ? ? ? ? ? 2.440 ? 
metalc401  metalc ? ? TI MG  .    MG    ? ? ? 1_555 BK HOH .    O     ? ? Z MG  8109 Z HOH 8564 1_555 ? ? ? ? ? ? ? 2.600 ? 
metalc402  metalc ? ? TI MG  .    MG    ? ? ? 1_555 BK HOH .    O     ? ? Z MG  8109 Z HOH 8620 1_555 ? ? ? ? ? ? ? 2.515 ? 
metalc403  metalc ? ? TI MG  .    MG    ? ? ? 1_555 Z  HIS 133  O     ? ? Z MG  8109 Z HIS 133  1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc404  metalc ? ? TI MG  .    MG    ? ? ? 1_555 BK HOH .    O     ? ? Z MG  8109 Z HOH 8586 1_555 ? ? ? ? ? ? ? 2.848 ? 
metalc405  metalc ? ? TI MG  .    MG    ? ? ? 1_555 Z  VAL 139  O     ? ? Z MG  8109 Z VAL 139  1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc406  metalc ? ? A  C   39   "O2'" ? ? ? 1_555 QE NA  .    NA    ? ? A C   40   A NA  8307 1_555 ? ? ? ? ? ? ? 2.823 ? 
metalc407  metalc ? ? A  G   40   "O4'" ? ? ? 1_555 QE NA  .    NA    ? ? A G   41   A NA  8307 1_555 ? ? ? ? ? ? ? 2.871 ? 
metalc408  metalc ? ? A  G   55   O6    ? ? ? 1_555 IF NA  .    NA    ? ? A G   56   A NA  8328 1_555 ? ? ? ? ? ? ? 2.673 ? 
metalc409  metalc ? ? A  A   58   N3    ? ? ? 1_555 IF NA  .    NA    ? ? A A   59   A NA  8328 1_555 ? ? ? ? ? ? ? 2.855 ? 
metalc410  metalc ? ? A  G   60   N7    ? ? ? 1_555 IF NA  .    NA    ? ? A G   61   A NA  8328 1_555 ? ? ? ? ? ? ? 2.713 ? 
metalc411  metalc ? ? A  G   60   O6    ? ? ? 1_555 IF NA  .    NA    ? ? A G   61   A NA  8328 1_555 ? ? ? ? ? ? ? 2.997 ? 
metalc412  metalc ? ? A  U   107  O2    ? ? ? 1_555 JF NA  .    NA    ? ? A U   108  A NA  8329 1_555 ? ? ? ? ? ? ? 2.744 ? 
metalc413  metalc ? ? A  C   140  "O4'" ? ? ? 1_555 KF NA  .    NA    ? ? A C   141  A NA  8330 1_555 ? ? ? ? ? ? ? 2.708 ? 
metalc414  metalc ? ? A  C   140  O2    ? ? ? 1_555 KF NA  .    NA    ? ? A C   141  A NA  8330 1_555 ? ? ? ? ? ? ? 2.775 ? 
metalc415  metalc ? ? A  G   141  N7    ? ? ? 1_555 KF NA  .    NA    ? ? A G   142  A NA  8330 1_555 ? ? ? ? ? ? ? 2.918 ? 
metalc416  metalc ? ? A  G   141  O6    ? ? ? 1_555 KF NA  .    NA    ? ? A G   142  A NA  8330 1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc417  metalc ? ? A  U   145  O4    ? ? ? 1_555 EF NA  .    NA    ? ? A U   146  A NA  8324 1_555 ? ? ? ? ? ? ? 2.661 ? 
metalc418  metalc ? ? A  A   164  OP2   ? ? ? 1_555 WE NA  .    NA    ? ? A A   165  A NA  8315 1_555 ? ? ? ? ? ? ? 2.743 ? 
metalc419  metalc ? ? A  A   165  "O2'" ? ? ? 1_555 WE NA  .    NA    ? ? A A   166  A NA  8315 1_555 ? ? ? ? ? ? ? 2.886 ? 
metalc420  metalc ? ? A  A   166  OP1   ? ? ? 1_555 WE NA  .    NA    ? ? A A   167  A NA  8315 1_555 ? ? ? ? ? ? ? 2.831 ? 
metalc421  metalc ? ? A  A   166  "O3'" ? ? ? 1_555 JG NA  .    NA    ? ? A A   167  A NA  8362 1_555 ? ? ? ? ? ? ? 2.958 ? 
metalc422  metalc ? ? A  U   169  O2    ? ? ? 1_555 LF NA  .    NA    ? ? A U   170  A NA  8331 1_555 ? ? ? ? ? ? ? 2.801 ? 
metalc423  metalc ? ? A  G   195  N7    ? ? ? 1_555 UG NA  .    NA    ? ? A G   196  A NA  8374 1_555 ? ? ? ? ? ? ? 2.918 ? 
metalc424  metalc ? ? A  C   217  "O3'" ? ? ? 1_555 LF NA  .    NA    ? ? A C   218  A NA  8331 1_555 ? ? ? ? ? ? ? 2.952 ? 
metalc425  metalc ? ? A  G   220  O6    ? ? ? 1_555 LF NA  .    NA    ? ? A G   221  A NA  8331 1_555 ? ? ? ? ? ? ? 2.963 ? 
metalc426  metalc ? ? A  U   307  O4    ? ? ? 1_555 RI NA  .    NA    ? ? A U   308  U NA  8343 1_555 ? ? ? ? ? ? ? 2.873 ? 
metalc427  metalc ? ? A  U   334  O2    ? ? ? 1_555 RI NA  .    NA    ? ? A U   335  U NA  8343 1_555 ? ? ? ? ? ? ? 2.970 ? 
metalc428  metalc ? ? A  C   341  O2    ? ? ? 1_555 RI NA  .    NA    ? ? A C   342  U NA  8343 1_555 ? ? ? ? ? ? ? 2.746 ? 
metalc429  metalc ? ? A  U   401  O4    ? ? ? 1_555 MF NA  .    NA    ? ? A U   402  A NA  8332 1_555 ? ? ? ? ? ? ? 2.805 ? 
metalc430  metalc ? ? A  A   452  "O2'" ? ? ? 1_555 HG NA  .    NA    ? ? A A   453  A NA  8360 1_555 ? ? ? ? ? ? ? 2.851 ? 
metalc431  metalc ? ? A  G   474  OP2   ? ? ? 1_555 OG NA  .    NA    ? ? A G   475  A NA  8367 1_555 ? ? ? ? ? ? ? 2.636 ? 
metalc432  metalc ? ? A  G   478  OP2   ? ? ? 1_555 HG NA  .    NA    ? ? A G   479  A NA  8360 1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc433  metalc ? ? A  G   543  O6    ? ? ? 1_555 NG NA  .    NA    ? ? A G   544  A NA  8366 1_555 ? ? ? ? ? ? ? 2.930 ? 
metalc434  metalc ? ? A  G   621  O6    ? ? ? 1_555 PF NA  .    NA    ? ? A G   622  A NA  8335 1_555 ? ? ? ? ? ? ? 2.968 ? 
metalc435  metalc ? ? A  U   622  O4    ? ? ? 1_555 PF NA  .    NA    ? ? A U   623  A NA  8335 1_555 ? ? ? ? ? ? ? 2.616 ? 
metalc436  metalc ? ? A  U   623  "O4'" ? ? ? 1_555 YF NA  .    NA    ? ? A U   624  A NA  8350 1_555 ? ? ? ? ? ? ? 2.984 ? 
metalc437  metalc ? ? A  A   629  N3    ? ? ? 1_555 OE NA  .    NA    ? ? A A   630  A NA  8305 1_555 ? ? ? ? ? ? ? 2.691 ? 
metalc438  metalc ? ? A  G   680  "O3'" ? ? ? 1_555 UF NA  .    NA    ? ? A G   681  A NA  8341 1_555 ? ? ? ? ? ? ? 2.770 ? 
metalc439  metalc ? ? A  G   680  "O2'" ? ? ? 1_555 UF NA  .    NA    ? ? A G   681  A NA  8341 1_555 ? ? ? ? ? ? ? 2.604 ? 
metalc440  metalc ? ? A  G   682  O6    ? ? ? 1_555 UF NA  .    NA    ? ? A G   683  A NA  8341 1_555 ? ? ? ? ? ? ? 2.857 ? 
metalc441  metalc ? ? A  U   767  "O2'" ? ? ? 1_555 BG NA  .    NA    ? ? A U   768  A NA  8354 1_555 ? ? ? ? ? ? ? 2.648 ? 
metalc442  metalc ? ? A  A   775  "O2'" ? ? ? 1_555 FF NA  .    NA    ? ? A A   776  A NA  8325 1_555 ? ? ? ? ? ? ? 2.684 ? 
metalc443  metalc ? ? A  U   776  OP2   ? ? ? 1_555 FF NA  .    NA    ? ? A U   777  A NA  8325 1_555 ? ? ? ? ? ? ? 2.704 ? 
metalc444  metalc ? ? A  G   797  O6    ? ? ? 1_555 PG NA  .    NA    ? ? A G   798  A NA  8368 1_555 ? ? ? ? ? ? ? 2.760 ? 
metalc445  metalc ? ? A  G   813  O6    ? ? ? 1_555 PG NA  .    NA    ? ? A G   814  A NA  8368 1_555 ? ? ? ? ? ? ? 2.783 ? 
metalc446  metalc ? ? A  U   820  OP2   ? ? ? 1_555 HF NA  .    NA    ? ? A U   821  A NA  8327 1_555 ? ? ? ? ? ? ? 2.990 ? 
metalc447  metalc ? ? A  G   835  "O3'" ? ? ? 1_555 CF NA  .    NA    ? ? A G   836  A NA  8321 1_555 ? ? ? ? ? ? ? 2.749 ? 
metalc448  metalc ? ? A  C   852  "O3'" ? ? ? 1_555 HF NA  .    NA    ? ? A C   853  A NA  8327 1_555 ? ? ? ? ? ? ? 2.957 ? 
metalc449  metalc ? ? A  G   868  OP2   ? ? ? 1_555 VG NA  .    NA    ? ? A G   869  A NA  8375 1_555 ? ? ? ? ? ? ? 2.695 ? 
metalc450  metalc ? ? A  G   868  N7    ? ? ? 1_555 VG NA  .    NA    ? ? A G   869  A NA  8375 1_555 ? ? ? ? ? ? ? 2.918 ? 
metalc451  metalc ? ? A  G   891  N7    ? ? ? 1_555 VF NA  .    NA    ? ? A G   892  A NA  8342 1_555 ? ? ? ? ? ? ? 2.797 ? 
metalc452  metalc ? ? A  C   892  O2    ? ? ? 1_555 VF NA  .    NA    ? ? A C   893  A NA  8342 1_555 ? ? ? ? ? ? ? 2.947 ? 
metalc453  metalc ? ? A  C   895  O2    ? ? ? 1_555 XE NA  .    NA    ? ? A C   896  A NA  8316 1_555 ? ? ? ? ? ? ? 2.888 ? 
metalc454  metalc ? ? A  A   896  "O4'" ? ? ? 1_555 XE NA  .    NA    ? ? A A   897  A NA  8316 1_555 ? ? ? ? ? ? ? 2.902 ? 
metalc455  metalc ? ? A  G   901  O6    ? ? ? 1_555 YG NA  .    NA    ? ? A G   902  A NA  8378 1_555 ? ? ? ? ? ? ? 2.899 ? 
metalc456  metalc ? ? A  U   902  O4    ? ? ? 1_555 YG NA  .    NA    ? ? A U   903  A NA  8378 1_555 ? ? ? ? ? ? ? 2.719 ? 
metalc457  metalc ? ? A  U   903  O4    ? ? ? 1_555 NE NA  .    NA    ? ? A U   904  A NA  8303 1_555 ? ? ? ? ? ? ? 2.920 ? 
metalc458  metalc ? ? A  C   914  OP2   ? ? ? 1_555 XF NA  .    NA    ? ? A C   915  A NA  8349 1_555 ? ? ? ? ? ? ? 2.651 ? 
metalc459  metalc ? ? A  U   918  O4    ? ? ? 1_555 SG NA  .    NA    ? ? A U   919  A NA  8372 1_555 ? ? ? ? ? ? ? 2.835 ? 
metalc460  metalc ? ? A  A   921  OP1   ? ? ? 1_555 GG NA  .    NA    ? ? A A   922  A NA  8359 1_555 ? ? ? ? ? ? ? 2.874 ? 
metalc461  metalc ? ? A  G   923  "O4'" ? ? ? 1_555 GG NA  .    NA    ? ? A G   924  A NA  8359 1_555 ? ? ? ? ? ? ? 2.859 ? 
metalc462  metalc ? ? A  G   923  O6    ? ? ? 1_555 SG NA  .    NA    ? ? A G   924  A NA  8372 1_555 ? ? ? ? ? ? ? 2.962 ? 
metalc463  metalc ? ? A  G   940  O6    ? ? ? 1_555 EG NA  .    NA    ? ? A G   941  A NA  8357 1_555 ? ? ? ? ? ? ? 2.714 ? 
metalc464  metalc ? ? A  A   954  "O2'" ? ? ? 1_555 ZF NA  .    NA    ? ? A A   955  A NA  8352 1_555 ? ? ? ? ? ? ? 2.775 ? 
metalc465  metalc ? ? A  A   1039 "O2'" ? ? ? 1_555 AG NA  .    NA    ? ? A A   1040 A NA  8353 1_555 ? ? ? ? ? ? ? 2.839 ? 
metalc466  metalc ? ? A  G   1118 "O2'" ? ? ? 1_555 ME NA  .    NA    ? ? A G   1119 A NA  8302 1_555 ? ? ? ? ? ? ? 2.803 ? 
metalc467  metalc ? ? A  G   1118 O6    ? ? ? 1_555 CG NA  .    NA    ? ? A G   1119 A NA  8355 1_555 ? ? ? ? ? ? ? 2.695 ? 
metalc468  metalc ? ? A  U   1119 OP2   ? ? ? 1_555 ME NA  .    NA    ? ? A U   1120 A NA  8302 1_555 ? ? ? ? ? ? ? 2.907 ? 
metalc469  metalc ? ? A  U   1292 OP2   ? ? ? 1_555 XG NA  .    NA    ? ? A U   1293 A NA  8377 1_555 ? ? ? ? ? ? ? 2.777 ? 
metalc470  metalc ? ? A  A   1295 OP1   ? ? ? 1_555 AG NA  .    NA    ? ? A A   1296 A NA  8353 1_555 ? ? ? ? ? ? ? 2.780 ? 
metalc471  metalc ? ? A  G   1353 OP1   ? ? ? 1_555 NE NA  .    NA    ? ? A G   1354 A NA  8303 1_555 ? ? ? ? ? ? ? 2.953 ? 
metalc472  metalc ? ? A  G   1415 "O3'" ? ? ? 1_555 YE NA  .    NA    ? ? A G   1416 A NA  8317 1_555 ? ? ? ? ? ? ? 2.717 ? 
metalc473  metalc ? ? A  G   1416 OP1   ? ? ? 1_555 YE NA  .    NA    ? ? A G   1417 A NA  8317 1_555 ? ? ? ? ? ? ? 2.778 ? 
metalc474  metalc ? ? A  U   1431 O4    ? ? ? 1_555 RE NA  .    NA    ? ? A U   1432 A NA  8308 1_555 ? ? ? ? ? ? ? 2.731 ? 
metalc475  metalc ? ? A  G   1575 O6    ? ? ? 1_555 TG NA  .    NA    ? ? A G   1576 A NA  8373 1_555 ? ? ? ? ? ? ? 2.813 ? 
metalc476  metalc ? ? A  U   1576 O4    ? ? ? 1_555 TG NA  .    NA    ? ? A U   1577 A NA  8373 1_555 ? ? ? ? ? ? ? 2.697 ? 
metalc477  metalc ? ? A  G   1617 O6    ? ? ? 1_555 TG NA  .    NA    ? ? A G   1618 A NA  8373 1_555 ? ? ? ? ? ? ? 2.690 ? 
metalc478  metalc ? ? A  A   1735 OP1   ? ? ? 1_555 CF NA  .    NA    ? ? A A   1736 A NA  8321 1_555 ? ? ? ? ? ? ? 2.822 ? 
metalc479  metalc ? ? A  U   1830 "O2'" ? ? ? 1_555 HF NA  .    NA    ? ? A U   1831 A NA  8327 1_555 ? ? ? ? ? ? ? 2.923 ? 
metalc480  metalc ? ? A  C   1893 O2    ? ? ? 1_555 OF NA  .    NA    ? ? A C   1894 A NA  8334 1_555 ? ? ? ? ? ? ? 2.971 ? 
metalc481  metalc ? ? A  G   1895 N7    ? ? ? 1_555 OF NA  .    NA    ? ? A G   1896 A NA  8334 1_555 ? ? ? ? ? ? ? 2.692 ? 
metalc482  metalc ? ? A  G   1895 O6    ? ? ? 1_555 OF NA  .    NA    ? ? A G   1896 A NA  8334 1_555 ? ? ? ? ? ? ? 2.601 ? 
metalc483  metalc ? ? A  U   1896 O4    ? ? ? 1_555 OF NA  .    NA    ? ? A U   1897 A NA  8334 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc484  metalc ? ? A  G   1897 O6    ? ? ? 1_555 NF NA  .    NA    ? ? A G   1898 A NA  8333 1_555 ? ? ? ? ? ? ? 2.721 ? 
metalc485  metalc ? ? A  A   2009 OP2   ? ? ? 1_555 GF NA  .    NA    ? ? A A   2010 A NA  8326 1_555 ? ? ? ? ? ? ? 2.854 ? 
metalc486  metalc ? ? A  G   2032 "O2'" ? ? ? 1_555 TF NA  .    NA    ? ? A G   2033 A NA  8340 1_555 ? ? ? ? ? ? ? 2.954 ? 
metalc487  metalc ? ? A  U   2056 O4    ? ? ? 1_555 LG NA  .    NA    ? ? A U   2057 A NA  8364 1_555 ? ? ? ? ? ? ? 2.788 ? 
metalc488  metalc ? ? A  G   2057 O6    ? ? ? 1_555 LG NA  .    NA    ? ? A G   2058 A NA  8364 1_555 ? ? ? ? ? ? ? 2.857 ? 
metalc489  metalc ? ? A  G   2093 N7    ? ? ? 1_555 PE NA  .    NA    ? ? A G   2094 A NA  8306 1_555 ? ? ? ? ? ? ? 2.944 ? 
metalc490  metalc ? ? A  A   2111 OP1   ? ? ? 1_555 BG NA  .    NA    ? ? A A   2112 A NA  8354 1_555 ? ? ? ? ? ? ? 2.881 ? 
metalc491  metalc ? ? A  A   2111 N3    ? ? ? 1_555 DF NA  .    NA    ? ? A A   2112 A NA  8323 1_555 ? ? ? ? ? ? ? 2.879 ? 
metalc492  metalc ? ? A  U   2277 OP1   ? ? ? 1_555 DG NA  .    NA    ? ? A U   2278 A NA  8356 1_555 ? ? ? ? ? ? ? 2.720 ? 
metalc493  metalc ? ? A  A   2464 "O3'" ? ? ? 1_555 AF NA  .    NA    ? ? A A   2465 A NA  8319 1_555 ? ? ? ? ? ? ? 2.958 ? 
metalc494  metalc ? ? A  G   2465 OP2   ? ? ? 1_555 AF NA  .    NA    ? ? A G   2466 A NA  8319 1_555 ? ? ? ? ? ? ? 2.807 ? 
metalc495  metalc ? ? A  G   2523 N7    ? ? ? 1_555 TE NA  .    NA    ? ? A G   2524 A NA  8311 1_555 ? ? ? ? ? ? ? 2.945 ? 
metalc496  metalc ? ? A  G   2542 O6    ? ? ? 1_555 BF NA  .    NA    ? ? A G   2543 A NA  8320 1_555 ? ? ? ? ? ? ? 2.835 ? 
metalc497  metalc ? ? A  G   2543 N7    ? ? ? 1_555 ZE NA  .    NA    ? ? A G   2544 A NA  8318 1_555 ? ? ? ? ? ? ? 2.856 ? 
metalc498  metalc ? ? A  A   2576 "O4'" ? ? ? 1_555 SE NA  .    NA    ? ? A A   2577 A NA  8310 1_555 ? ? ? ? ? ? ? 2.955 ? 
metalc499  metalc ? ? A  A   2576 N3    ? ? ? 1_555 SE NA  .    NA    ? ? A A   2577 A NA  8310 1_555 ? ? ? ? ? ? ? 2.691 ? 
metalc500  metalc ? ? A  G   2578 O6    ? ? ? 1_555 SE NA  .    NA    ? ? A G   2579 A NA  8310 1_555 ? ? ? ? ? ? ? 2.814 ? 
metalc501  metalc ? ? A  U   2585 O4    ? ? ? 1_555 AH NA  .    NA    ? ? A U   2586 A NA  8381 1_555 ? ? ? ? ? ? ? 2.615 ? 
metalc502  metalc ? ? A  G   2591 O6    ? ? ? 1_555 AH NA  .    NA    ? ? A G   2592 A NA  8381 1_555 ? ? ? ? ? ? ? 2.605 ? 
metalc503  metalc ? ? A  G   2610 OP1   ? ? ? 1_555 FG NA  .    NA    ? ? A G   2611 A NA  8358 1_555 ? ? ? ? ? ? ? 2.989 ? 
metalc504  metalc ? ? A  U   2614 O4    ? ? ? 1_555 BF NA  .    NA    ? ? A U   2615 A NA  8320 1_555 ? ? ? ? ? ? ? 2.879 ? 
metalc505  metalc ? ? A  A   2648 N1    ? ? ? 1_555 PE NA  .    NA    ? ? A A   2649 A NA  8306 1_555 ? ? ? ? ? ? ? 2.837 ? 
metalc506  metalc ? ? A  G   2771 O6    ? ? ? 1_555 BH NA  .    NA    ? ? A G   2772 A NA  8382 1_555 ? ? ? ? ? ? ? 2.867 ? 
metalc507  metalc ? ? A  A   2810 "O3'" ? ? ? 1_555 WF NA  .    NA    ? ? A A   2811 A NA  8344 1_555 ? ? ? ? ? ? ? 2.821 ? 
metalc508  metalc ? ? A  A   2810 "O2'" ? ? ? 1_555 WF NA  .    NA    ? ? A A   2811 A NA  8344 1_555 ? ? ? ? ? ? ? 2.679 ? 
metalc509  metalc ? ? A  A   2815 "O2'" ? ? ? 1_555 WF NA  .    NA    ? ? A A   2816 A NA  8344 1_555 ? ? ? ? ? ? ? 2.802 ? 
metalc510  metalc ? ? B  G   21   O6    ? ? ? 1_555 OH NA  .    NA    ? ? B G   3021 B NA  8383 1_555 ? ? ? ? ? ? ? 2.962 ? 
metalc511  metalc ? ? B  C   40   O2    ? ? ? 1_555 NH NA  .    NA    ? ? B C   3040 B NA  8351 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc512  metalc ? ? E  ASP 45   OD2   ? ? ? 1_555 VH NA  .    NA    ? ? E ASP 45   E NA  8304 1_555 ? ? ? ? ? ? ? 2.996 ? 
metalc513  metalc ? ? E  THR 94   O     ? ? ? 1_555 VH NA  .    NA    ? ? E THR 94   E NA  8304 1_555 ? ? ? ? ? ? ? 2.944 ? 
metalc514  metalc ? ? J  LYS 150  O     ? ? ? 1_555 WH NA  .    NA    ? ? J LYS 150  J NA  8309 1_555 ? ? ? ? ? ? ? 2.816 ? 
metalc515  metalc ? ? K  VAL 61   O     ? ? ? 1_555 YH NA  .    NA    ? ? K VAL 61   K NA  8346 1_555 ? ? ? ? ? ? ? 2.648 ? 
metalc516  metalc ? ? K  ILE 63   O     ? ? ? 1_555 YH NA  .    NA    ? ? K ILE 63   K NA  8346 1_555 ? ? ? ? ? ? ? 2.671 ? 
metalc517  metalc ? ? M  GLY 14   O     ? ? ? 1_555 AG NA  .    NA    ? ? M GLY 14   A NA  8353 1_555 ? ? ? ? ? ? ? 2.852 ? 
metalc518  metalc ? ? M  HIS 18   O     ? ? ? 1_555 YG NA  .    NA    ? ? M HIS 18   A NA  8378 1_555 ? ? ? ? ? ? ? 2.928 ? 
metalc519  metalc ? ? M  ALA 33   O     ? ? ? 1_555 EI NA  .    NA    ? ? M ALA 33   M NA  8380 1_555 ? ? ? ? ? ? ? 2.758 ? 
metalc520  metalc ? ? N  ASN 106  OD1   ? ? ? 1_555 GI NA  .    NA    ? ? N ASN 106  N NA  8347 1_555 ? ? ? ? ? ? ? 2.894 ? 
metalc521  metalc ? ? N  PHE 109  O     ? ? ? 1_555 GI NA  .    NA    ? ? N PHE 109  N NA  8347 1_555 ? ? ? ? ? ? ? 2.645 ? 
metalc522  metalc ? ? N  PRO 110  O     ? ? ? 1_555 GI NA  .    NA    ? ? N PRO 110  N NA  8347 1_555 ? ? ? ? ? ? ? 2.663 ? 
metalc523  metalc ? ? N  LYS 193  O     ? ? ? 1_555 MG NA  .    NA    ? ? N LYS 193  A NA  8365 1_555 ? ? ? ? ? ? ? 2.652 ? 
metalc524  metalc ? ? R  ASP 20   O     ? ? ? 1_555 LI NA  .    NA    ? ? R ASP 20   R NA  8348 1_555 ? ? ? ? ? ? ? 2.608 ? 
metalc525  metalc ? ? R  GLY 22   O     ? ? ? 1_555 LI NA  .    NA    ? ? R GLY 22   R NA  8348 1_555 ? ? ? ? ? ? ? 2.636 ? 
metalc526  metalc ? ? R  SER 24   OG    ? ? ? 1_555 LI NA  .    NA    ? ? R SER 24   R NA  8348 1_555 ? ? ? ? ? ? ? 2.826 ? 
metalc527  metalc ? ? R  SER 46   OG    ? ? ? 1_555 LI NA  .    NA    ? ? R SER 46   R NA  8348 1_555 ? ? ? ? ? ? ? 2.980 ? 
metalc528  metalc ? ? S  VAL 72   O     ? ? ? 1_555 MI NA  .    NA    ? ? S VAL 72   S NA  8337 1_555 ? ? ? ? ? ? ? 2.786 ? 
metalc529  metalc ? ? U  SER 94   O     ? ? ? 1_555 RI NA  .    NA    ? ? U SER 94   U NA  8343 1_555 ? ? ? ? ? ? ? 2.923 ? 
metalc530  metalc ? ? U  ASN 95   OD1   ? ? ? 1_555 RI NA  .    NA    ? ? U ASN 95   U NA  8343 1_555 ? ? ? ? ? ? ? 2.655 ? 
metalc531  metalc ? ? CA ASN 44   O     ? ? ? 1_555 YE NA  .    NA    ? ? 3 ASN 45   A NA  8317 1_555 ? ? ? ? ? ? ? 2.756 ? 
metalc532  metalc ? ? VH NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? E NA  8304 E HOH 8310 1_555 ? ? ? ? ? ? ? 2.929 ? 
metalc533  metalc ? ? TE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8311 A HOH 9584 1_555 ? ? ? ? ? ? ? 2.655 ? 
metalc534  metalc ? ? XE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8316 A HOH 9433 1_555 ? ? ? ? ? ? ? 2.728 ? 
metalc535  metalc ? ? YE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8317 A HOH 9674 1_555 ? ? ? ? ? ? ? 2.755 ? 
metalc536  metalc ? ? AF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8319 A HOH 9464 1_555 ? ? ? ? ? ? ? 2.769 ? 
metalc537  metalc ? ? BF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8320 A HOH 9461 1_555 ? ? ? ? ? ? ? 2.866 ? 
metalc538  metalc ? ? EF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8324 A HOH 9886 1_555 ? ? ? ? ? ? ? 2.944 ? 
metalc539  metalc ? ? LF NA  .    NA    ? ? ? 1_555 FK HOH .    O     ? ? A NA  8331 4 HOH 8506 1_555 ? ? ? ? ? ? ? 2.997 ? 
metalc540  metalc ? ? MI NA  .    NA    ? ? ? 1_555 UJ HOH .    O     ? ? S NA  8337 S HOH 8527 1_555 ? ? ? ? ? ? ? 2.815 ? 
metalc541  metalc ? ? RI NA  .    NA    ? ? ? 1_555 WJ HOH .    O     ? ? U NA  8343 U HOH 1124 1_555 ? ? ? ? ? ? ? 2.681 ? 
metalc542  metalc ? ? WF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8344 A HOH 9621 1_555 ? ? ? ? ? ? ? 2.954 ? 
metalc543  metalc ? ? GI NA  .    NA    ? ? ? 1_555 PJ HOH .    O     ? ? N NA  8347 N HOH 8633 1_555 ? ? ? ? ? ? ? 2.719 ? 
metalc544  metalc ? ? LI NA  .    NA    ? ? ? 1_555 TJ HOH .    O     ? ? R NA  8348 R HOH 1795 1_555 ? ? ? ? ? ? ? 2.730 ? 
metalc545  metalc ? ? NH NA  .    NA    ? ? ? 1_555 DJ HOH .    O     ? ? B NA  8351 B HOH 1982 1_555 ? ? ? ? ? ? ? 2.841 ? 
metalc546  metalc ? ? DG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8356 A HOH 9850 1_555 ? ? ? ? ? ? ? 2.732 ? 
metalc547  metalc ? ? FG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8358 A HOH 9880 1_555 ? ? ? ? ? ? ? 2.667 ? 
metalc548  metalc ? ? OG NA  .    NA    ? ? ? 1_555 GJ HOH .    O     ? ? A NA  8367 E HOH 8388 1_555 ? ? ? ? ? ? ? 2.957 ? 
metalc549  metalc ? ? ZI NA  .    NA    ? ? ? 1_555 FK HOH .    O     ? ? 4 NA  8369 4 HOH 8544 1_555 ? ? ? ? ? ? ? 2.760 ? 
metalc550  metalc ? ? QG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8370 A HOH 9506 1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc551  metalc ? ? SG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8372 A HOH 9670 1_555 ? ? ? ? ? ? ? 2.973 ? 
metalc552  metalc ? ? YG NA  .    NA    ? ? ? 1_555 OJ HOH .    O     ? ? A NA  8378 M HOH 8555 1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc553  metalc ? ? YG NA  .    NA    ? ? ? 1_555 OJ HOH .    O     ? ? A NA  8378 M HOH 8533 1_555 ? ? ? ? ? ? ? 2.757 ? 
metalc554  metalc ? ? FA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8001 A HOH 8262 1_555 ? ? ? ? ? ? ? 1.888 ? 
metalc555  metalc ? ? FA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8001 A HOH 4011 1_555 ? ? ? ? ? ? ? 2.098 ? 
metalc556  metalc ? ? GA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8002 A HOH 4714 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc557  metalc ? ? GA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8002 A HOH 8240 1_555 ? ? ? ? ? ? ? 1.962 ? 
metalc558  metalc ? ? GA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8002 A HOH 8241 1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc559  metalc ? ? HA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8003 A HOH 4061 1_555 ? ? ? ? ? ? ? 2.384 ? 
metalc560  metalc ? ? IA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8004 A HOH 8247 1_555 ? ? ? ? ? ? ? 1.920 ? 
metalc561  metalc ? ? IA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8004 A HOH 4178 1_555 ? ? ? ? ? ? ? 1.975 ? 
metalc562  metalc ? ? IA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8004 A HOH 3171 1_555 ? ? ? ? ? ? ? 1.878 ? 
metalc563  metalc ? ? JA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8005 A HOH 4007 1_555 ? ? ? ? ? ? ? 2.134 ? 
metalc564  metalc ? ? JA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8005 A HOH 8263 1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc565  metalc ? ? JA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8005 A HOH 8264 1_555 ? ? ? ? ? ? ? 1.820 ? 
metalc566  metalc ? ? KA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8006 A HOH 4013 1_555 ? ? ? ? ? ? ? 2.149 ? 
metalc567  metalc ? ? KA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8006 A HOH 3202 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc568  metalc ? ? KA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8006 A HOH 4149 1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc569  metalc ? ? LA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8007 A HOH 3748 1_555 ? ? ? ? ? ? ? 2.163 ? 
metalc570  metalc ? ? LA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8007 A HOH 8252 1_555 ? ? ? ? ? ? ? 2.132 ? 
metalc571  metalc ? ? MA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8008 A HOH 4025 1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc572  metalc ? ? MA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8008 A HOH 8411 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc573  metalc ? ? MA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8008 A HOH 8256 1_555 ? ? ? ? ? ? ? 2.277 ? 
metalc574  metalc ? ? NA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8009 A HOH 4136 1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc575  metalc ? ? NA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8009 A HOH 7808 1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc576  metalc ? ? NA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8009 A HOH 8257 1_555 ? ? ? ? ? ? ? 1.807 ? 
metalc577  metalc ? ? OA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8010 A HOH 4236 1_555 ? ? ? ? ? ? ? 1.839 ? 
metalc578  metalc ? ? PA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8011 A HOH 4918 1_555 ? ? ? ? ? ? ? 2.077 ? 
metalc579  metalc ? ? PA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8011 A HOH 4812 1_555 ? ? ? ? ? ? ? 1.928 ? 
metalc580  metalc ? ? QA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8012 A HOH 4043 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc581  metalc ? ? QA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8012 A HOH 3617 1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc582  metalc ? ? QA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8012 A HOH 8412 1_555 ? ? ? ? ? ? ? 1.814 ? 
metalc583  metalc ? ? RA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8013 A HOH 4050 1_555 ? ? ? ? ? ? ? 1.897 ? 
metalc584  metalc ? ? RA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8013 A HOH 4037 1_555 ? ? ? ? ? ? ? 2.492 ? 
metalc585  metalc ? ? RA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8013 A HOH 8271 1_555 ? ? ? ? ? ? ? 2.176 ? 
metalc586  metalc ? ? SA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8014 A HOH 4556 1_555 ? ? ? ? ? ? ? 1.901 ? 
metalc587  metalc ? ? SA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8014 A HOH 8238 1_555 ? ? ? ? ? ? ? 1.792 ? 
metalc588  metalc ? ? TA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8015 A HOH 8273 1_555 ? ? ? ? ? ? ? 1.952 ? 
metalc589  metalc ? ? UA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8016 A HOH 8265 1_555 ? ? ? ? ? ? ? 2.025 ? 
metalc590  metalc ? ? UA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8016 A HOH 8266 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc591  metalc ? ? VA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8017 A HOH 7772 1_555 ? ? ? ? ? ? ? 1.916 ? 
metalc592  metalc ? ? VA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8017 A HOH 8248 1_555 ? ? ? ? ? ? ? 1.929 ? 
metalc593  metalc ? ? WA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8018 A HOH 7844 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc594  metalc ? ? WA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8018 A HOH 3610 1_555 ? ? ? ? ? ? ? 2.261 ? 
metalc595  metalc ? ? WA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8018 A HOH 4009 1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc596  metalc ? ? WA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8018 A HOH 8413 1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc597  metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8019 A HOH 7617 1_555 ? ? ? ? ? ? ? 1.917 ? 
metalc598  metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8019 A HOH 8268 1_555 ? ? ? ? ? ? ? 1.892 ? 
metalc599  metalc ? ? XA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8019 A HOH 8267 1_555 ? ? ? ? ? ? ? 1.871 ? 
metalc600  metalc ? ? YA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8020 A HOH 8251 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc601  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8021 A HOH 4033 1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc602  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8021 A HOH 8254 1_555 ? ? ? ? ? ? ? 2.331 ? 
metalc603  metalc ? ? ZA MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8021 A HOH 4034 1_555 ? ? ? ? ? ? ? 2.087 ? 
metalc604  metalc ? ? AB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8022 A HOH 4267 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc605  metalc ? ? BB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8023 A HOH 4023 1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc606  metalc ? ? BB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8023 A HOH 8276 1_555 ? ? ? ? ? ? ? 2.202 ? 
metalc607  metalc ? ? BB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8023 A HOH 8275 1_555 ? ? ? ? ? ? ? 1.891 ? 
metalc608  metalc ? ? BB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8023 A HOH 4216 1_555 ? ? ? ? ? ? ? 2.300 ? 
metalc609  metalc ? ? CB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8024 A HOH 5514 1_555 ? ? ? ? ? ? ? 2.306 ? 
metalc610  metalc ? ? DB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8025 A HOH 8415 1_555 ? ? ? ? ? ? ? 2.266 ? 
metalc611  metalc ? ? DB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8025 A HOH 8278 1_555 ? ? ? ? ? ? ? 1.820 ? 
metalc612  metalc ? ? DB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8025 A HOH 4561 1_555 ? ? ? ? ? ? ? 2.009 ? 
metalc613  metalc ? ? EB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8026 A HOH 8280 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc614  metalc ? ? FB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8027 A HOH 4409 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc615  metalc ? ? GB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8028 A HOH 8283 1_555 ? ? ? ? ? ? ? 1.808 ? 
metalc616  metalc ? ? GB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8028 A HOH 4073 1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc617  metalc ? ? GB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8028 A HOH 4094 1_555 ? ? ? ? ? ? ? 1.939 ? 
metalc618  metalc ? ? HB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8029 A HOH 8284 1_555 ? ? ? ? ? ? ? 2.402 ? 
metalc619  metalc ? ? HB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8029 A HOH 8285 1_555 ? ? ? ? ? ? ? 2.017 ? 
metalc620  metalc ? ? HB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8029 A HOH 8286 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc621  metalc ? ? IB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8030 A HOH 8260 1_555 ? ? ? ? ? ? ? 1.881 ? 
metalc622  metalc ? ? IB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8030 A HOH 8249 1_555 ? ? ? ? ? ? ? 2.205 ? 
metalc623  metalc ? ? IB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8030 A HOH 4035 1_555 ? ? ? ? ? ? ? 1.893 ? 
metalc624  metalc ? ? IB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8030 A HOH 8250 1_555 ? ? ? ? ? ? ? 2.059 ? 
metalc625  metalc ? ? JB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8031 A HOH 3666 1_555 ? ? ? ? ? ? ? 1.942 ? 
metalc626  metalc ? ? JB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8031 A HOH 8289 1_555 ? ? ? ? ? ? ? 1.967 ? 
metalc627  metalc ? ? KB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8032 A HOH 3380 1_555 ? ? ? ? ? ? ? 2.169 ? 
metalc628  metalc ? ? KB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8032 A HOH 4582 1_555 ? ? ? ? ? ? ? 1.775 ? 
metalc629  metalc ? ? KB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8032 A HOH 4184 1_555 ? ? ? ? ? ? ? 2.052 ? 
metalc630  metalc ? ? KB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8032 A HOH 4121 1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc631  metalc ? ? LB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8033 A HOH 3070 1_555 ? ? ? ? ? ? ? 2.085 ? 
metalc632  metalc ? ? MB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8034 A HOH 5255 1_555 ? ? ? ? ? ? ? 1.846 ? 
metalc633  metalc ? ? MB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8034 A HOH 4038 1_555 ? ? ? ? ? ? ? 2.145 ? 
metalc634  metalc ? ? MB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8034 A HOH 8292 1_555 ? ? ? ? ? ? ? 2.259 ? 
metalc635  metalc ? ? MB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8034 A HOH 4165 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc636  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8035 A HOH 4111 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc637  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8035 A HOH 8294 1_555 ? ? ? ? ? ? ? 2.029 ? 
metalc638  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8035 A HOH 8293 1_555 ? ? ? ? ? ? ? 2.112 ? 
metalc639  metalc ? ? NB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8035 A HOH 8418 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc640  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8036 A HOH 8296 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc641  metalc ? ? OB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8036 A HOH 8297 1_555 ? ? ? ? ? ? ? 2.178 ? 
metalc642  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8037 A HOH 3524 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc643  metalc ? ? PB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8037 A HOH 8419 1_555 ? ? ? ? ? ? ? 2.321 ? 
metalc644  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8038 A HOH 4021 1_555 ? ? ? ? ? ? ? 1.966 ? 
metalc645  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8038 A HOH 8299 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc646  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8038 A HOH 4066 1_555 ? ? ? ? ? ? ? 1.823 ? 
metalc647  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8038 A HOH 4068 1_555 ? ? ? ? ? ? ? 2.188 ? 
metalc648  metalc ? ? QB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8038 A HOH 4045 1_555 ? ? ? ? ? ? ? 1.764 ? 
metalc649  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8039 A HOH 4363 1_555 ? ? ? ? ? ? ? 2.177 ? 
metalc650  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8039 A HOH 8300 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc651  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8039 A HOH 3300 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc652  metalc ? ? RB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8039 A HOH 8304 1_555 ? ? ? ? ? ? ? 1.959 ? 
metalc653  metalc ? ? SB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8040 A HOH 3083 1_555 ? ? ? ? ? ? ? 2.057 ? 
metalc654  metalc ? ? SB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8040 A HOH 4185 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc655  metalc ? ? TB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8041 A HOH 4593 1_555 ? ? ? ? ? ? ? 2.162 ? 
metalc656  metalc ? ? VB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8043 A HOH 3206 1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc657  metalc ? ? VB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8043 A HOH 8422 1_555 ? ? ? ? ? ? ? 2.490 ? 
metalc658  metalc ? ? VB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8043 A HOH 7797 1_555 ? ? ? ? ? ? ? 1.791 ? 
metalc659  metalc ? ? XB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8045 A HOH 8312 1_555 ? ? ? ? ? ? ? 2.028 ? 
metalc660  metalc ? ? XB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8045 A HOH 8423 1_555 ? ? ? ? ? ? ? 2.282 ? 
metalc661  metalc ? ? YB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8046 A HOH 8426 1_555 ? ? ? ? ? ? ? 2.166 ? 
metalc662  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8047 A HOH 6658 1_555 ? ? ? ? ? ? ? 2.347 ? 
metalc663  metalc ? ? ZB MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8047 A HOH 8441 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc664  metalc ? ? AC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8048 A HOH 6649 1_555 ? ? ? ? ? ? ? 1.762 ? 
metalc665  metalc ? ? AC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8048 A HOH 8464 1_555 ? ? ? ? ? ? ? 1.859 ? 
metalc666  metalc ? ? AC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8048 A HOH 8428 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc667  metalc ? ? DC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8051 A HOH 8322 1_555 ? ? ? ? ? ? ? 1.765 ? 
metalc668  metalc ? ? DC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8051 A HOH 8337 1_555 ? ? ? ? ? ? ? 1.774 ? 
metalc669  metalc ? ? EC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8052 A HOH 4254 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc670  metalc ? ? EC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8052 A HOH 4019 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc671  metalc ? ? EC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8052 A HOH 8443 1_555 ? ? ? ? ? ? ? 2.491 ? 
metalc672  metalc ? ? FC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8053 A HOH 6001 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc673  metalc ? ? GC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8054 A HOH 8343 1_555 ? ? ? ? ? ? ? 1.860 ? 
metalc674  metalc ? ? GC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8054 A HOH 8345 1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc675  metalc ? ? TH MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? D MG  8055 A HOH 8444 1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc676  metalc ? ? TH MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? D MG  8055 A HOH 4190 1_555 ? ? ? ? ? ? ? 2.171 ? 
metalc677  metalc ? ? HC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8056 A HOH 4063 1_555 ? ? ? ? ? ? ? 2.116 ? 
metalc678  metalc ? ? HC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8056 A HOH 3372 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc679  metalc ? ? IC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8057 A HOH 5400 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc680  metalc ? ? JC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8058 A HOH 8346 1_555 ? ? ? ? ? ? ? 1.881 ? 
metalc681  metalc ? ? JC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8058 A HOH 8347 1_555 ? ? ? ? ? ? ? 1.852 ? 
metalc682  metalc ? ? JC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8058 A HOH 4159 1_555 ? ? ? ? ? ? ? 1.958 ? 
metalc683  metalc ? ? KC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8059 A HOH 4446 1_555 ? ? ? ? ? ? ? 2.041 ? 
metalc684  metalc ? ? KC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8059 A HOH 8261 1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc685  metalc ? ? LC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8060 A HOH 8351 1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc686  metalc ? ? MC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8061 A HOH 8380 1_555 ? ? ? ? ? ? ? 2.129 ? 
metalc687  metalc ? ? MC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8061 A HOH 8383 1_555 ? ? ? ? ? ? ? 1.842 ? 
metalc688  metalc ? ? NC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8062 A HOH 4355 1_555 ? ? ? ? ? ? ? 1.943 ? 
metalc689  metalc ? ? NC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8062 A HOH 4028 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc690  metalc ? ? NC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8062 A HOH 6562 1_555 ? ? ? ? ? ? ? 2.427 ? 
metalc691  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8063 A HOH 7389 1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc692  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8063 A HOH 8395 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc693  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8063 A HOH 7814 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc694  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8063 A HOH 4573 1_555 ? ? ? ? ? ? ? 1.919 ? 
metalc695  metalc ? ? OC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8063 A HOH 8445 1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc696  metalc ? ? PH MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? C MG  8065 A HOH 4367 1_555 ? ? ? ? ? ? ? 1.875 ? 
metalc697  metalc ? ? SC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8068 A HOH 3127 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc698  metalc ? ? SC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8068 A HOH 4147 1_555 ? ? ? ? ? ? ? 1.960 ? 
metalc699  metalc ? ? SC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8068 A HOH 5208 1_555 ? ? ? ? ? ? ? 1.973 ? 
metalc700  metalc ? ? SC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8068 A HOH 8446 1_555 ? ? ? ? ? ? ? 1.949 ? 
metalc701  metalc ? ? CI MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? L MG  8069 A HOH 4631 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc702  metalc ? ? CI MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? L MG  8069 A HOH 6431 1_555 ? ? ? ? ? ? ? 1.979 ? 
metalc703  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8071 A HOH 7936 1_555 ? ? ? ? ? ? ? 2.096 ? 
metalc704  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8071 A HOH 4507 1_555 ? ? ? ? ? ? ? 1.758 ? 
metalc705  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8071 A HOH 8393 1_555 ? ? ? ? ? ? ? 2.005 ? 
metalc706  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8071 A HOH 7800 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc707  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8071 A HOH 8394 1_555 ? ? ? ? ? ? ? 2.239 ? 
metalc708  metalc ? ? UC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8071 A HOH 6440 1_555 ? ? ? ? ? ? ? 1.926 ? 
metalc709  metalc ? ? VC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8072 A HOH 8447 1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc710  metalc ? ? VC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8072 A HOH 4392 1_555 ? ? ? ? ? ? ? 2.457 ? 
metalc711  metalc ? ? WC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8074 A HOH 8448 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc712  metalc ? ? WC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8074 A HOH 8389 1_555 ? ? ? ? ? ? ? 1.935 ? 
metalc713  metalc ? ? XC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8075 A HOH 4032 1_555 ? ? ? ? ? ? ? 2.128 ? 
metalc714  metalc ? ? XC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8075 A HOH 4314 1_555 ? ? ? ? ? ? ? 2.441 ? 
metalc715  metalc ? ? XC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8075 A HOH 5325 1_555 ? ? ? ? ? ? ? 1.982 ? 
metalc716  metalc ? ? YC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8076 A HOH 8449 1_555 ? ? ? ? ? ? ? 2.420 ? 
metalc717  metalc ? ? YC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8076 A HOH 8450 1_555 ? ? ? ? ? ? ? 1.766 ? 
metalc718  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8077 A HOH 4018 1_555 ? ? ? ? ? ? ? 1.953 ? 
metalc719  metalc ? ? ZC MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8077 A HOH 8399 1_555 ? ? ? ? ? ? ? 1.908 ? 
metalc720  metalc ? ? AD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8079 A HOH 4006 1_555 ? ? ? ? ? ? ? 2.381 ? 
metalc721  metalc ? ? AD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8079 A HOH 4012 1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc722  metalc ? ? BD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8080 A HOH 8400 1_555 ? ? ? ? ? ? ? 2.078 ? 
metalc723  metalc ? ? BD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8080 A HOH 4881 1_555 ? ? ? ? ? ? ? 2.447 ? 
metalc724  metalc ? ? BD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8080 A HOH 8452 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc725  metalc ? ? CD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8081 A HOH 4493 1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc726  metalc ? ? DD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8082 A HOH 5549 1_555 ? ? ? ? ? ? ? 2.373 ? 
metalc727  metalc ? ? DD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8082 A HOH 5633 1_555 ? ? ? ? ? ? ? 1.955 ? 
metalc728  metalc ? ? DD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8082 A HOH 8460 1_555 ? ? ? ? ? ? ? 2.466 ? 
metalc729  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8083 A HOH 4102 1_555 ? ? ? ? ? ? ? 2.124 ? 
metalc730  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8083 A HOH 4544 1_555 ? ? ? ? ? ? ? 2.067 ? 
metalc731  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8083 A HOH 6744 1_555 ? ? ? ? ? ? ? 1.878 ? 
metalc732  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8083 A HOH 8401 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc733  metalc ? ? ED MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8083 A HOH 8453 1_555 ? ? ? ? ? ? ? 1.880 ? 
metalc734  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8084 A HOH 4030 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc735  metalc ? ? FD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8084 A HOH 3146 1_555 ? ? ? ? ? ? ? 2.294 ? 
metalc736  metalc ? ? HD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8086 A HOH 8403 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc737  metalc ? ? HD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8086 A HOH 4129 1_555 ? ? ? ? ? ? ? 1.954 ? 
metalc738  metalc ? ? HD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8086 A HOH 4372 1_555 ? ? ? ? ? ? ? 2.113 ? 
metalc739  metalc ? ? HD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8086 A HOH 8404 1_555 ? ? ? ? ? ? ? 2.307 ? 
metalc740  metalc ? ? ID MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8087 A HOH 4072 1_555 ? ? ? ? ? ? ? 2.148 ? 
metalc741  metalc ? ? ID MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8087 A HOH 8461 1_555 ? ? ? ? ? ? ? 2.279 ? 
metalc742  metalc ? ? KD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8089 A HOH 8455 1_555 ? ? ? ? ? ? ? 1.786 ? 
metalc743  metalc ? ? KD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8089 A HOH 8405 1_555 ? ? ? ? ? ? ? 2.156 ? 
metalc744  metalc ? ? LD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8090 A HOH 4010 1_555 ? ? ? ? ? ? ? 2.318 ? 
metalc745  metalc ? ? MD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8091 A HOH 6870 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc746  metalc ? ? MD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8091 A HOH 3714 1_555 ? ? ? ? ? ? ? 1.772 ? 
metalc747  metalc ? ? ND MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8092 A HOH 4040 1_555 ? ? ? ? ? ? ? 1.868 ? 
metalc748  metalc ? ? ND MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8092 A HOH 8456 1_555 ? ? ? ? ? ? ? 1.770 ? 
metalc749  metalc ? ? OD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8093 A HOH 4077 1_555 ? ? ? ? ? ? ? 1.877 ? 
metalc750  metalc ? ? OD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8093 A HOH 4046 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc751  metalc ? ? PD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8094 A HOH 8407 1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc752  metalc ? ? QD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8096 A HOH 4262 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc753  metalc ? ? QD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8096 A HOH 4095 1_555 ? ? ? ? ? ? ? 2.323 ? 
metalc754  metalc ? ? RD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8097 A HOH 3732 1_555 ? ? ? ? ? ? ? 2.167 ? 
metalc755  metalc ? ? RD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8097 A HOH 4067 1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc756  metalc ? ? SD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8098 A HOH 4144 1_555 ? ? ? ? ? ? ? 2.207 ? 
metalc757  metalc ? ? SD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8098 A HOH 3332 1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc758  metalc ? ? TD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8099 A HOH 4062 1_555 ? ? ? ? ? ? ? 2.332 ? 
metalc759  metalc ? ? TD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8099 A HOH 3406 1_555 ? ? ? ? ? ? ? 2.310 ? 
metalc760  metalc ? ? TD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8099 A HOH 4074 1_555 ? ? ? ? ? ? ? 2.397 ? 
metalc761  metalc ? ? UD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8100 A HOH 4640 1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc762  metalc ? ? UD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8100 A HOH 5893 1_555 ? ? ? ? ? ? ? 1.888 ? 
metalc763  metalc ? ? UD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8100 A HOH 8408 1_555 ? ? ? ? ? ? ? 2.355 ? 
metalc764  metalc ? ? VD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8101 A HOH 4143 1_555 ? ? ? ? ? ? ? 2.390 ? 
metalc765  metalc ? ? VD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8101 A HOH 5013 1_555 ? ? ? ? ? ? ? 2.186 ? 
metalc766  metalc ? ? XD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8103 A HOH 8458 1_555 ? ? ? ? ? ? ? 2.405 ? 
metalc767  metalc ? ? YD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8104 A HOH 8243 1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc768  metalc ? ? ZD MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8106 A HOH 8422 1_555 ? ? ? ? ? ? ? 1.903 ? 
metalc769  metalc ? ? AE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8107 A HOH 8434 1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc770  metalc ? ? AE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8107 A HOH 8433 1_555 ? ? ? ? ? ? ? 1.919 ? 
metalc771  metalc ? ? AE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8107 A HOH 8431 1_555 ? ? ? ? ? ? ? 2.190 ? 
metalc772  metalc ? ? BE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8108 A HOH 8437 1_555 ? ? ? ? ? ? ? 2.274 ? 
metalc773  metalc ? ? BE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8108 A HOH 8438 1_555 ? ? ? ? ? ? ? 2.301 ? 
metalc774  metalc ? ? BE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8108 A HOH 7872 1_555 ? ? ? ? ? ? ? 2.046 ? 
metalc775  metalc ? ? BE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8108 A HOH 8436 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc776  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8110 A HOH 5788 1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc777  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8110 A HOH 6418 1_555 ? ? ? ? ? ? ? 1.930 ? 
metalc778  metalc ? ? CE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8110 A HOH 4324 1_555 ? ? ? ? ? ? ? 1.874 ? 
metalc779  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8111 A HOH 4092 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc780  metalc ? ? DE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8111 A HOH 4116 1_555 ? ? ? ? ? ? ? 2.411 ? 
metalc781  metalc ? ? EE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8112 A HOH 4163 1_555 ? ? ? ? ? ? ? 1.852 ? 
metalc782  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8113 A HOH 4148 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc783  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8113 A HOH 6517 1_555 ? ? ? ? ? ? ? 1.947 ? 
metalc784  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8113 A HOH 4322 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc785  metalc ? ? FE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8113 A HOH 6788 1_555 ? ? ? ? ? ? ? 2.438 ? 
metalc786  metalc ? ? HE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8115 A HOH 4676 1_555 ? ? ? ? ? ? ? 1.822 ? 
metalc787  metalc ? ? HE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8115 A HOH 4693 1_555 ? ? ? ? ? ? ? 2.223 ? 
metalc788  metalc ? ? HE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8115 A HOH 6988 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc789  metalc ? ? IE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8116 A HOH 4058 1_555 ? ? ? ? ? ? ? 2.324 ? 
metalc790  metalc ? ? IE MG  .    MG    ? ? ? 1_555 CJ HOH .    O     ? ? A MG  8116 A HOH 4262 1_555 ? ? ? ? ? ? ? 1.795 ? 
metalc791  metalc ? ? KE K   .    K     ? ? ? 1_555 CJ HOH .    O     ? ? A K   8202 A HOH 8345 1_555 ? ? ? ? ? ? ? 2.872 ? 
metalc792  metalc ? ? LE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8301 A HOH 5360 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc793  metalc ? ? LE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8301 A HOH 3590 1_555 ? ? ? ? ? ? ? 2.773 ? 
metalc794  metalc ? ? LE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8301 A HOH 3558 1_555 ? ? ? ? ? ? ? 2.622 ? 
metalc795  metalc ? ? ME NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8302 A HOH 6070 1_555 ? ? ? ? ? ? ? 2.906 ? 
metalc796  metalc ? ? OE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8305 A HOH 4484 1_555 ? ? ? ? ? ? ? 2.458 ? 
metalc797  metalc ? ? OE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8305 A HOH 5090 1_555 ? ? ? ? ? ? ? 2.474 ? 
metalc798  metalc ? ? OE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8305 A HOH 6173 1_555 ? ? ? ? ? ? ? 2.408 ? 
metalc799  metalc ? ? RE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8308 A HOH 3802 1_555 ? ? ? ? ? ? ? 2.754 ? 
metalc800  metalc ? ? SE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8310 A HOH 4894 1_555 ? ? ? ? ? ? ? 2.919 ? 
metalc801  metalc ? ? TE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8311 A HOH 5043 1_555 ? ? ? ? ? ? ? 2.702 ? 
metalc802  metalc ? ? TE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8311 A HOH 3970 1_555 ? ? ? ? ? ? ? 2.340 ? 
metalc803  metalc ? ? UE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8313 A HOH 5512 1_555 ? ? ? ? ? ? ? 2.056 ? 
metalc804  metalc ? ? UE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8313 A HOH 4231 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc805  metalc ? ? UE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8313 A HOH 3341 1_555 ? ? ? ? ? ? ? 2.431 ? 
metalc806  metalc ? ? XE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8316 A HOH 6702 1_555 ? ? ? ? ? ? ? 2.119 ? 
metalc807  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8318 A HOH 3854 1_555 ? ? ? ? ? ? ? 2.775 ? 
metalc808  metalc ? ? ZE NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8318 A HOH 4328 1_555 ? ? ? ? ? ? ? 2.197 ? 
metalc809  metalc ? ? AF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8319 A HOH 4650 1_555 ? ? ? ? ? ? ? 2.518 ? 
metalc810  metalc ? ? AF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8319 A HOH 6433 1_555 ? ? ? ? ? ? ? 2.404 ? 
metalc811  metalc ? ? BF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8320 A HOH 3137 1_555 ? ? ? ? ? ? ? 2.769 ? 
metalc812  metalc ? ? DF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8323 A HOH 4868 1_555 ? ? ? ? ? ? ? 2.486 ? 
metalc813  metalc ? ? EF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8324 A HOH 4523 1_555 ? ? ? ? ? ? ? 2.931 ? 
metalc814  metalc ? ? FF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8325 A HOH 8152 1_555 ? ? ? ? ? ? ? 2.573 ? 
metalc815  metalc ? ? FF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8325 A HOH 3666 1_555 ? ? ? ? ? ? ? 2.367 ? 
metalc816  metalc ? ? FF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8325 A HOH 3019 1_555 ? ? ? ? ? ? ? 2.441 ? 
metalc817  metalc ? ? HF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8327 A HOH 3594 1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc818  metalc ? ? IF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8328 A HOH 5605 1_555 ? ? ? ? ? ? ? 2.926 ? 
metalc819  metalc ? ? IF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8328 A HOH 6865 1_555 ? ? ? ? ? ? ? 2.993 ? 
metalc820  metalc ? ? MF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8332 A HOH 7456 1_555 ? ? ? ? ? ? ? 2.744 ? 
metalc821  metalc ? ? OF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8334 A HOH 5639 1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc822  metalc ? ? PF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8335 A HOH 3264 1_555 ? ? ? ? ? ? ? 2.876 ? 
metalc823  metalc ? ? QF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8336 A HOH 7730 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc824  metalc ? ? QF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8336 A HOH 8179 1_555 ? ? ? ? ? ? ? 2.854 ? 
metalc825  metalc ? ? QF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8336 A HOH 3315 1_555 ? ? ? ? ? ? ? 2.794 ? 
metalc826  metalc ? ? QF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8336 A HOH 5727 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc827  metalc ? ? MI NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? S NA  8337 A HOH 6306 1_555 ? ? ? ? ? ? ? 2.222 ? 
metalc828  metalc ? ? SF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8339 A HOH 3419 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc829  metalc ? ? SF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8339 A HOH 4684 1_555 ? ? ? ? ? ? ? 2.989 ? 
metalc830  metalc ? ? TF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8340 A HOH 7204 1_555 ? ? ? ? ? ? ? 2.621 ? 
metalc831  metalc ? ? VF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8342 A HOH 6012 1_555 ? ? ? ? ? ? ? 2.743 ? 
metalc832  metalc ? ? YH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? K NA  8346 A HOH 6145 1_555 ? ? ? ? ? ? ? 2.580 ? 
metalc833  metalc ? ? YF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8350 A HOH 8239 1_555 ? ? ? ? ? ? ? 2.718 ? 
metalc834  metalc ? ? YF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8350 A HOH 7342 1_555 ? ? ? ? ? ? ? 2.398 ? 
metalc835  metalc ? ? ZF NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8352 A HOH 6992 1_555 ? ? ? ? ? ? ? 2.910 ? 
metalc836  metalc ? ? AG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8353 A HOH 5264 1_555 ? ? ? ? ? ? ? 2.528 ? 
metalc837  metalc ? ? BG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8354 A HOH 5205 1_555 ? ? ? ? ? ? ? 2.548 ? 
metalc838  metalc ? ? CG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8355 A HOH 5198 1_555 ? ? ? ? ? ? ? 2.509 ? 
metalc839  metalc ? ? EG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8357 A HOH 6661 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc840  metalc ? ? FG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8358 A HOH 4267 1_555 ? ? ? ? ? ? ? 2.878 ? 
metalc841  metalc ? ? FG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8358 A HOH 8274 1_555 ? ? ? ? ? ? ? 2.617 ? 
metalc842  metalc ? ? FG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8358 A HOH 7808 1_555 ? ? ? ? ? ? ? 2.715 ? 
metalc843  metalc ? ? HG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8360 A HOH 6344 1_555 ? ? ? ? ? ? ? 2.825 ? 
metalc844  metalc ? ? IG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8361 A HOH 7719 1_555 ? ? ? ? ? ? ? 2.547 ? 
metalc845  metalc ? ? IG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8361 A HOH 5294 1_555 ? ? ? ? ? ? ? 2.587 ? 
metalc846  metalc ? ? IG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8361 A HOH 4979 1_555 ? ? ? ? ? ? ? 2.871 ? 
metalc847  metalc ? ? LG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8364 A HOH 3209 1_555 ? ? ? ? ? ? ? 2.678 ? 
metalc848  metalc ? ? NG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8366 A HOH 4278 1_555 ? ? ? ? ? ? ? 2.690 ? 
metalc849  metalc ? ? NG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8366 A HOH 4217 1_555 ? ? ? ? ? ? ? 2.789 ? 
metalc850  metalc ? ? OG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8367 A HOH 4993 1_555 ? ? ? ? ? ? ? 2.835 ? 
metalc851  metalc ? ? OG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8367 A HOH 3221 1_555 ? ? ? ? ? ? ? 2.600 ? 
metalc852  metalc ? ? PG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8368 A HOH 4282 1_555 ? ? ? ? ? ? ? 2.774 ? 
metalc853  metalc ? ? ZI NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? 4 NA  8369 A HOH 6961 1_555 ? ? ? ? ? ? ? 2.781 ? 
metalc854  metalc ? ? QG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8370 A HOH 4497 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc855  metalc ? ? TG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8373 A HOH 4075 1_555 ? ? ? ? ? ? ? 2.560 ? 
metalc856  metalc ? ? VG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8375 A HOH 4299 1_555 ? ? ? ? ? ? ? 2.335 ? 
metalc857  metalc ? ? WG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8376 A HOH 5244 1_555 ? ? ? ? ? ? ? 2.476 ? 
metalc858  metalc ? ? WG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8376 A HOH 4042 1_555 ? ? ? ? ? ? ? 2.912 ? 
metalc859  metalc ? ? XG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8377 A HOH 6731 1_555 ? ? ? ? ? ? ? 2.170 ? 
metalc860  metalc ? ? YG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8378 A HOH 3598 1_555 ? ? ? ? ? ? ? 2.871 ? 
metalc861  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8379 A HOH 4816 1_555 ? ? ? ? ? ? ? 2.434 ? 
metalc862  metalc ? ? ZG NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8379 A HOH 4109 1_555 ? ? ? ? ? ? ? 2.658 ? 
metalc863  metalc ? ? AH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8381 A HOH 4086 1_555 ? ? ? ? ? ? ? 2.413 ? 
metalc864  metalc ? ? AH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8381 A HOH 7458 1_555 ? ? ? ? ? ? ? 2.700 ? 
metalc865  metalc ? ? DH NA  .    NA    ? ? ? 1_555 CJ HOH .    O     ? ? A NA  8385 A HOH 8172 1_555 ? ? ? ? ? ? ? 2.514 ? 
hydrog1    hydrog ? ? A  U   11   O4    ? ? ? 1_555 A  G   530  N2    ? ? A U   12   A G   531  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2    hydrog ? ? A  G   12   N1    ? ? ? 1_555 A  C   529  N3    ? ? A G   13   A C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3    hydrog ? ? A  G   12   N2    ? ? ? 1_555 A  C   529  O2    ? ? A G   13   A C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4    hydrog ? ? A  G   12   O6    ? ? ? 1_555 A  C   529  N4    ? ? A G   13   A C   530  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5    hydrog ? ? A  C   13   N3    ? ? ? 1_555 A  G   528  N1    ? ? A C   14   A G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6    hydrog ? ? A  C   13   N4    ? ? ? 1_555 A  G   528  O6    ? ? A C   14   A G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7    hydrog ? ? A  C   13   O2    ? ? ? 1_555 A  G   528  N2    ? ? A C   14   A G   529  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8    hydrog ? ? A  C   14   N3    ? ? ? 1_555 A  G   527  N1    ? ? A C   15   A G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9    hydrog ? ? A  C   14   N4    ? ? ? 1_555 A  G   527  O6    ? ? A C   15   A G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10   hydrog ? ? A  C   14   O2    ? ? ? 1_555 A  G   527  N2    ? ? A C   15   A G   528  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11   hydrog ? ? A  A   15   N1    ? ? ? 1_555 A  U   526  N3    ? ? A A   16   A U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12   hydrog ? ? A  A   15   N6    ? ? ? 1_555 A  U   526  O4    ? ? A A   16   A U   527  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13   hydrog ? ? A  G   16   N1    ? ? ? 1_555 A  U   525  O2    ? ? A G   17   A U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog14   hydrog ? ? A  G   16   O6    ? ? ? 1_555 A  U   525  N3    ? ? A G   17   A U   526  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog15   hydrog ? ? A  C   17   N3    ? ? ? 1_555 A  G   524  N1    ? ? A C   18   A G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16   hydrog ? ? A  C   17   N4    ? ? ? 1_555 A  G   524  O6    ? ? A C   18   A G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17   hydrog ? ? A  C   17   O2    ? ? ? 1_555 A  G   524  N2    ? ? A C   18   A G   525  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18   hydrog ? ? A  U   18   N3    ? ? ? 1_555 A  A   523  N1    ? ? A U   19   A A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19   hydrog ? ? A  U   18   O4    ? ? ? 1_555 A  A   523  N6    ? ? A U   19   A A   524  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20   hydrog ? ? A  G   19   N1    ? ? ? 1_555 A  C   522  N3    ? ? A G   20   A C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21   hydrog ? ? A  G   19   N2    ? ? ? 1_555 A  C   522  O2    ? ? A G   20   A C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22   hydrog ? ? A  G   19   O6    ? ? ? 1_555 A  C   522  N4    ? ? A G   20   A C   523  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23   hydrog ? ? A  G   20   N1    ? ? ? 1_555 A  U   521  O2    ? ? A G   21   A U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog24   hydrog ? ? A  G   20   O6    ? ? ? 1_555 A  U   521  N3    ? ? A G   21   A U   522  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog25   hydrog ? ? A  U   21   O2    ? ? ? 1_555 A  A   520  N6    ? ? A U   22   A A   521  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog26   hydrog ? ? A  G   22   N2    ? ? ? 1_555 A  A   519  N7    ? ? A G   23   A A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog27   hydrog ? ? A  G   22   N3    ? ? ? 1_555 A  A   519  N6    ? ? A G   23   A A   520  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog28   hydrog ? ? A  G   23   N2    ? ? ? 1_555 A  A   518  N7    ? ? A G   24   A A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog29   hydrog ? ? A  G   23   N3    ? ? ? 1_555 A  A   518  N6    ? ? A G   24   A A   519  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog30   hydrog ? ? A  A   24   N6    ? ? ? 1_555 A  G   517  N3    ? ? A A   25   A G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog31   hydrog ? ? A  A   24   N7    ? ? ? 1_555 A  G   517  N2    ? ? A A   25   A G   518  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog32   hydrog ? ? A  U   25   N3    ? ? ? 1_555 A  U   516  O2    ? ? A U   26   A U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog33   hydrog ? ? A  U   25   O4    ? ? ? 1_555 A  U   516  N3    ? ? A U   26   A U   517  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog34   hydrog ? ? A  U   26   N3    ? ? ? 1_555 A  A   515  N1    ? ? A U   27   A A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35   hydrog ? ? A  U   26   O4    ? ? ? 1_555 A  A   515  N6    ? ? A U   27   A A   516  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36   hydrog ? ? A  G   27   N1    ? ? ? 1_555 A  C   479  N3    ? ? A G   28   A C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37   hydrog ? ? A  G   27   N2    ? ? ? 1_555 A  C   479  O2    ? ? A G   28   A C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38   hydrog ? ? A  G   27   O6    ? ? ? 1_555 A  C   479  N4    ? ? A G   28   A C   480  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39   hydrog ? ? A  C   28   N3    ? ? ? 1_555 A  G   478  N1    ? ? A C   29   A G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40   hydrog ? ? A  C   28   N4    ? ? ? 1_555 A  G   478  O6    ? ? A C   29   A G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41   hydrog ? ? A  C   28   O2    ? ? ? 1_555 A  G   478  N2    ? ? A C   29   A G   479  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42   hydrog ? ? A  U   29   N3    ? ? ? 1_555 A  A   452  N7    ? ? A U   30   A A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog43   hydrog ? ? A  U   29   O2    ? ? ? 1_555 A  A   452  N6    ? ? A U   30   A A   453  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog44   hydrog ? ? A  G   31   N1    ? ? ? 1_555 A  C   450  N3    ? ? A G   32   A C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  C   450  O2    ? ? A G   32   A C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46   hydrog ? ? A  G   31   O6    ? ? ? 1_555 A  C   450  N4    ? ? A G   32   A C   451  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  A   454  N1    ? ? A G   32   A A   455  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog48   hydrog ? ? A  G   31   N2    ? ? ? 1_555 A  G   455  N3    ? ? A G   32   A G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog49   hydrog ? ? A  G   31   N3    ? ? ? 1_555 A  G   455  N2    ? ? A G   32   A G   456  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog50   hydrog ? ? A  G   32   N1    ? ? ? 1_555 A  C   449  N3    ? ? A G   33   A C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51   hydrog ? ? A  G   32   N2    ? ? ? 1_555 A  C   449  O2    ? ? A G   33   A C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52   hydrog ? ? A  G   32   O6    ? ? ? 1_555 A  C   449  N4    ? ? A G   33   A C   450  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53   hydrog ? ? A  C   33   N3    ? ? ? 1_555 A  G   447  N1    ? ? A C   34   A G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54   hydrog ? ? A  C   33   N4    ? ? ? 1_555 A  G   447  O6    ? ? A C   34   A G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55   hydrog ? ? A  C   33   O2    ? ? ? 1_555 A  G   447  N2    ? ? A C   34   A G   448  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56   hydrog ? ? A  U   34   N3    ? ? ? 1_555 A  A   446  N1    ? ? A U   35   A A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57   hydrog ? ? A  U   34   O4    ? ? ? 1_555 A  A   446  N6    ? ? A U   35   A A   447  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58   hydrog ? ? A  C   35   N3    ? ? ? 1_555 A  G   445  N1    ? ? A C   36   A G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59   hydrog ? ? A  C   35   N4    ? ? ? 1_555 A  G   445  O6    ? ? A C   36   A G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  G   445  N2    ? ? A C   36   A G   446  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61   hydrog ? ? A  C   35   O2    ? ? ? 1_555 A  A   673  N6    ? ? A C   36   A A   674  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog62   hydrog ? ? A  A   36   N1    ? ? ? 1_555 A  U   444  N3    ? ? A A   37   A U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63   hydrog ? ? A  A   36   N6    ? ? ? 1_555 A  U   444  O4    ? ? A A   37   A U   445  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64   hydrog ? ? A  G   37   N1    ? ? ? 1_555 A  C   443  N3    ? ? A G   38   A C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65   hydrog ? ? A  G   37   N2    ? ? ? 1_555 A  C   443  O2    ? ? A G   38   A C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66   hydrog ? ? A  G   37   O6    ? ? ? 1_555 A  C   443  N4    ? ? A G   38   A C   444  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67   hydrog ? ? A  G   38   N1    ? ? ? 1_555 A  C   442  N3    ? ? A G   39   A C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68   hydrog ? ? A  G   38   N2    ? ? ? 1_555 A  C   442  O2    ? ? A G   39   A C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69   hydrog ? ? A  G   38   O6    ? ? ? 1_555 A  C   442  N4    ? ? A G   39   A C   443  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70   hydrog ? ? A  C   39   N4    ? ? ? 1_555 A  A   440  N1    ? ? A C   40   A A   441  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog71   hydrog ? ? A  C   39   O2    ? ? ? 1_555 A  A   441  N6    ? ? A C   40   A A   442  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog72   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  A   150  N1    ? ? A G   41   A A   151  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog73   hydrog ? ? A  G   40   N1    ? ? ? 1_555 A  C   439  N3    ? ? A G   41   A C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74   hydrog ? ? A  G   40   N2    ? ? ? 1_555 A  C   439  O2    ? ? A G   41   A C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75   hydrog ? ? A  G   40   O6    ? ? ? 1_555 A  C   439  N4    ? ? A G   41   A C   440  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76   hydrog ? ? A  C   41   N3    ? ? ? 1_555 A  G   148  N1    ? ? A C   42   A G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77   hydrog ? ? A  C   41   N4    ? ? ? 1_555 A  G   148  O6    ? ? A C   42   A G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78   hydrog ? ? A  C   41   O2    ? ? ? 1_555 A  G   148  N2    ? ? A C   42   A G   149  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79   hydrog ? ? A  U   42   N3    ? ? ? 1_555 A  A   147  N1    ? ? A U   43   A A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80   hydrog ? ? A  U   42   O4    ? ? ? 1_555 A  A   147  N6    ? ? A U   43   A A   148  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81   hydrog ? ? A  G   43   N2    ? ? ? 1_555 A  A   44   N1    ? ? A G   44   A A   45   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog82   hydrog ? ? A  A   44   N6    ? ? ? 1_555 A  U   114  O4    ? ? A A   45   A U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog83   hydrog ? ? A  A   44   N7    ? ? ? 1_555 A  U   114  N3    ? ? A A   45   A U   115  1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog84   hydrog ? ? A  G   46   N2    ? ? ? 1_555 A  A   112  N7    ? ? A G   47   A A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog85   hydrog ? ? A  G   46   N3    ? ? ? 1_555 A  A   112  N6    ? ? A G   47   A A   113  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog86   hydrog ? ? A  A   47   N7    ? ? ? 1_555 A  A   113  N6    ? ? A A   48   A A   114  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog87   hydrog ? ? A  A   48   N6    ? ? ? 1_555 A  G   111  N3    ? ? A A   49   A G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog88   hydrog ? ? A  A   48   N7    ? ? ? 1_555 A  G   111  N2    ? ? A A   49   A G   112  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog89   hydrog ? ? A  G   49   N1    ? ? ? 1_555 A  C   110  N3    ? ? A G   50   A C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90   hydrog ? ? A  G   49   N2    ? ? ? 1_555 A  C   110  O2    ? ? A G   50   A C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91   hydrog ? ? A  G   49   O6    ? ? ? 1_555 A  C   110  N4    ? ? A G   50   A C   111  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92   hydrog ? ? A  G   50   N1    ? ? ? 1_555 A  C   109  N3    ? ? A G   51   A C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  C   109  O2    ? ? A G   51   A C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94   hydrog ? ? A  G   50   O6    ? ? ? 1_555 A  C   109  N4    ? ? A G   51   A C   110  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95   hydrog ? ? A  G   50   N2    ? ? ? 1_555 A  U   120  O2    ? ? A G   51   A U   121  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog96   hydrog ? ? A  A   51   N1    ? ? ? 1_555 A  U   108  N3    ? ? A A   52   A U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97   hydrog ? ? A  A   51   N6    ? ? ? 1_555 A  U   108  O4    ? ? A A   52   A U   109  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98   hydrog ? ? A  C   52   N3    ? ? ? 1_555 A  G   65   N1    ? ? A C   53   A G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99   hydrog ? ? A  C   52   N4    ? ? ? 1_555 A  G   65   O6    ? ? A C   53   A G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100  hydrog ? ? A  C   52   O2    ? ? ? 1_555 A  G   65   N2    ? ? A C   53   A G   66   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101  hydrog ? ? A  G   53   N1    ? ? ? 1_555 A  C   64   N3    ? ? A G   54   A C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  C   64   O2    ? ? A G   54   A C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103  hydrog ? ? A  G   53   O6    ? ? ? 1_555 A  C   64   N4    ? ? A G   54   A C   65   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104  hydrog ? ? A  G   53   N2    ? ? ? 1_555 A  A   68   N3    ? ? A G   54   A A   69   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog105  hydrog ? ? A  U   54   N3    ? ? ? 1_555 A  G   63   O6    ? ? A U   55   A G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog106  hydrog ? ? A  U   54   O2    ? ? ? 1_555 A  G   63   N1    ? ? A U   55   A G   64   1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog107  hydrog ? ? A  G   55   O6    ? ? ? 1_555 A  C   61   N4    ? ? A G   56   A C   62   1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog108  hydrog ? ? A  G   55   N1    ? ? ? 1_555 A  G   83   O6    ? ? A G   56   A G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog109  hydrog ? ? A  G   55   N2    ? ? ? 1_555 A  G   83   N7    ? ? A G   56   A G   84   1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog110  hydrog ? ? A  C   56   N3    ? ? ? 1_555 A  G   88   N1    ? ? A C   57   A G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog111  hydrog ? ? A  C   56   N4    ? ? ? 1_555 A  G   88   O6    ? ? A C   57   A G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112  hydrog ? ? A  C   56   O2    ? ? ? 1_555 A  G   88   N2    ? ? A C   57   A G   89   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113  hydrog ? ? A  C   57   N3    ? ? ? 1_555 A  G   87   N1    ? ? A C   58   A G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114  hydrog ? ? A  C   57   N4    ? ? ? 1_555 A  G   87   O6    ? ? A C   58   A G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115  hydrog ? ? A  C   57   O2    ? ? ? 1_555 A  G   87   N2    ? ? A C   58   A G   88   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116  hydrog ? ? A  A   58   N3    ? ? ? 1_555 A  A   59   N6    ? ? A A   59   A A   60   1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog117  hydrog ? ? A  A   58   N1    ? ? ? 1_555 A  C   84   N4    ? ? A A   59   A C   85   1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog118  hydrog ? ? A  A   59   N1    ? ? ? 1_555 A  A   85   N6    ? ? A A   60   A A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog119  hydrog ? ? A  A   59   N6    ? ? ? 1_555 A  A   85   N1    ? ? A A   60   A A   86   1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog120  hydrog ? ? A  G   60   N1    ? ? ? 1_555 A  C   84   N3    ? ? A G   61   A C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog121  hydrog ? ? A  G   60   N2    ? ? ? 1_555 A  C   84   O2    ? ? A G   61   A C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122  hydrog ? ? A  G   60   O6    ? ? ? 1_555 A  C   84   N4    ? ? A G   61   A C   85   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123  hydrog ? ? A  C   61   N3    ? ? ? 1_555 A  G   83   N1    ? ? A C   62   A G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124  hydrog ? ? A  C   61   N4    ? ? ? 1_555 A  G   83   O6    ? ? A C   62   A G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125  hydrog ? ? A  C   61   O2    ? ? ? 1_555 A  G   83   N2    ? ? A C   62   A G   84   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126  hydrog ? ? A  U   62   N3    ? ? ? 1_555 A  A   69   N7    ? ? A U   63   A A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog127  hydrog ? ? A  U   62   O4    ? ? ? 1_555 A  A   69   N6    ? ? A U   63   A A   70   1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog128  hydrog ? ? A  G   65   N2    ? ? ? 1_555 A  A   66   N1    ? ? A G   66   A A   67   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog129  hydrog ? ? A  G   70   N1    ? ? ? 1_555 A  A   105  N1    ? ? A G   71   A A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog130  hydrog ? ? A  G   70   O6    ? ? ? 1_555 A  A   105  N6    ? ? A G   71   A A   106  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog131  hydrog ? ? A  C   71   N3    ? ? ? 1_555 A  G   104  N1    ? ? A C   72   A G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog132  hydrog ? ? A  C   71   N4    ? ? ? 1_555 A  G   104  O6    ? ? A C   72   A G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog133  hydrog ? ? A  C   71   O2    ? ? ? 1_555 A  G   104  N2    ? ? A C   72   A G   105  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134  hydrog ? ? A  C   72   N3    ? ? ? 1_555 A  G   103  N1    ? ? A C   73   A G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135  hydrog ? ? A  C   72   N4    ? ? ? 1_555 A  G   103  O6    ? ? A C   73   A G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136  hydrog ? ? A  C   72   O2    ? ? ? 1_555 A  G   103  N2    ? ? A C   73   A G   104  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137  hydrog ? ? A  A   73   N1    ? ? ? 1_555 A  U   102  N3    ? ? A A   74   A U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138  hydrog ? ? A  A   73   N6    ? ? ? 1_555 A  U   102  O4    ? ? A A   74   A U   103  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139  hydrog ? ? A  U   74   N3    ? ? ? 1_555 A  A   101  N1    ? ? A U   75   A A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140  hydrog ? ? A  U   74   O4    ? ? ? 1_555 A  A   101  N6    ? ? A U   75   A A   102  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141  hydrog ? ? A  G   75   N1    ? ? ? 1_555 A  C   100  N3    ? ? A G   76   A C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142  hydrog ? ? A  G   75   N2    ? ? ? 1_555 A  C   100  O2    ? ? A G   76   A C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143  hydrog ? ? A  G   75   O6    ? ? ? 1_555 A  C   100  N4    ? ? A G   76   A C   101  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144  hydrog ? ? A  G   76   N1    ? ? ? 1_555 A  C   99   N3    ? ? A G   77   A C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145  hydrog ? ? A  G   76   N2    ? ? ? 1_555 A  C   99   O2    ? ? A G   77   A C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146  hydrog ? ? A  G   76   O6    ? ? ? 1_555 A  C   99   N4    ? ? A G   77   A C   100  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147  hydrog ? ? A  G   77   N2    ? ? ? 1_555 A  A   98   N7    ? ? A G   78   A A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog148  hydrog ? ? A  G   77   N3    ? ? ? 1_555 A  A   98   N6    ? ? A G   78   A A   99   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog149  hydrog ? ? A  G   78   N2    ? ? ? 1_555 A  A   97   N7    ? ? A G   79   A A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog150  hydrog ? ? A  A   79   N3    ? ? ? 1_555 A  G   93   N2    ? ? A A   80   A G   94   1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog151  hydrog ? ? A  A   79   N6    ? ? ? 1_555 A  G   96   N3    ? ? A A   80   A G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog152  hydrog ? ? A  A   79   N7    ? ? ? 1_555 A  G   96   N2    ? ? A A   80   A G   97   1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog153  hydrog ? ? A  G   80   N1    ? ? ? 1_555 A  C   92   N3    ? ? A G   81   A C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog154  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  C   92   O2    ? ? A G   81   A C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog155  hydrog ? ? A  G   80   O6    ? ? ? 1_555 A  C   92   N4    ? ? A G   81   A C   93   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156  hydrog ? ? A  G   80   N2    ? ? ? 1_555 A  A   97   N3    ? ? A G   81   A A   98   1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog157  hydrog ? ? A  C   81   N3    ? ? ? 1_555 A  G   91   N1    ? ? A C   82   A G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158  hydrog ? ? A  C   81   N4    ? ? ? 1_555 A  G   91   O6    ? ? A C   82   A G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog159  hydrog ? ? A  C   81   O2    ? ? ? 1_555 A  G   91   N2    ? ? A C   82   A G   92   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160  hydrog ? ? A  C   82   N3    ? ? ? 1_555 A  G   90   N1    ? ? A C   83   A G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161  hydrog ? ? A  C   82   N4    ? ? ? 1_555 A  G   90   O6    ? ? A C   83   A G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162  hydrog ? ? A  C   82   O2    ? ? ? 1_555 A  G   90   N2    ? ? A C   83   A G   91   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163  hydrog ? ? A  G   115  N1    ? ? ? 1_555 A  C   123  N3    ? ? A G   116  A C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164  hydrog ? ? A  G   115  N2    ? ? ? 1_555 A  C   123  O2    ? ? A G   116  A C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165  hydrog ? ? A  G   115  O6    ? ? ? 1_555 A  C   123  N4    ? ? A G   116  A C   124  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166  hydrog ? ? A  A   116  N1    ? ? ? 1_555 A  U   122  N3    ? ? A A   117  A U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167  hydrog ? ? A  A   116  N6    ? ? ? 1_555 A  U   122  O4    ? ? A A   117  A U   123  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168  hydrog ? ? A  G   117  N1    ? ? ? 1_555 A  C   121  N3    ? ? A G   118  A C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169  hydrog ? ? A  G   117  N2    ? ? ? 1_555 A  C   121  O2    ? ? A G   118  A C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170  hydrog ? ? A  G   117  O6    ? ? ? 1_555 A  C   121  N4    ? ? A G   118  A C   122  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171  hydrog ? ? A  U   124  N3    ? ? ? 1_555 A  A   128  N1    ? ? A U   125  A A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172  hydrog ? ? A  U   124  O4    ? ? ? 1_555 A  A   128  N6    ? ? A U   125  A A   129  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173  hydrog ? ? A  C   129  N4    ? ? ? 1_555 A  A   143  N7    ? ? A C   130  A A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog174  hydrog ? ? A  A   130  N6    ? ? ? 1_555 A  G   146  N7    ? ? A A   131  A G   147  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog175  hydrog ? ? A  A   131  N1    ? ? ? 1_555 A  U   145  N3    ? ? A A   132  A U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog176  hydrog ? ? A  A   131  N6    ? ? ? 1_555 A  U   145  O4    ? ? A A   132  A U   146  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog177  hydrog ? ? A  U   132  N3    ? ? ? 1_555 A  A   144  N1    ? ? A U   133  A A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog178  hydrog ? ? A  U   132  O4    ? ? ? 1_555 A  A   144  N6    ? ? A U   133  A A   145  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179  hydrog ? ? A  U   133  O4    ? ? ? 1_555 A  C   140  N4    ? ? A U   134  A C   141  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog180  hydrog ? ? A  U   133  N3    ? ? ? 1_555 A  A   143  N1    ? ? A U   134  A A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181  hydrog ? ? A  U   133  O4    ? ? ? 1_555 A  A   143  N6    ? ? A U   134  A A   144  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog182  hydrog ? ? A  G   134  N1    ? ? ? 1_555 A  C   142  N3    ? ? A G   135  A C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183  hydrog ? ? A  G   134  N2    ? ? ? 1_555 A  C   142  O2    ? ? A G   135  A C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184  hydrog ? ? A  G   134  O6    ? ? ? 1_555 A  C   142  N4    ? ? A G   135  A C   143  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185  hydrog ? ? A  C   135  N3    ? ? ? 1_555 A  G   141  N1    ? ? A C   136  A G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186  hydrog ? ? A  C   135  N4    ? ? ? 1_555 A  G   141  O6    ? ? A C   136  A G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187  hydrog ? ? A  C   135  O2    ? ? ? 1_555 A  G   141  N2    ? ? A C   136  A G   142  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188  hydrog ? ? A  U   136  O2    ? ? ? 1_555 A  G   139  N1    ? ? A U   137  A G   140  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog189  hydrog ? ? A  C   140  O2    ? ? ? 1_555 A  C   142  N4    ? ? A C   141  A C   143  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog190  hydrog ? ? A  C   140  N3    ? ? ? 1_555 A  A   143  N6    ? ? A C   141  A A   144  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog191  hydrog ? ? A  A   151  N1    ? ? ? 1_555 A  G   184  N1    ? ? A A   152  A G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog192  hydrog ? ? A  A   151  N6    ? ? ? 1_555 A  G   184  O6    ? ? A A   152  A G   185  1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog193  hydrog ? ? A  C   152  N3    ? ? ? 1_555 A  G   183  N1    ? ? A C   153  A G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog194  hydrog ? ? A  C   152  N4    ? ? ? 1_555 A  G   183  O6    ? ? A C   153  A G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog195  hydrog ? ? A  C   152  O2    ? ? ? 1_555 A  G   183  N2    ? ? A C   153  A G   184  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196  hydrog ? ? A  C   153  N3    ? ? ? 1_555 A  G   181  N1    ? ? A C   154  A G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197  hydrog ? ? A  C   153  N4    ? ? ? 1_555 A  G   181  O6    ? ? A C   154  A G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198  hydrog ? ? A  C   153  O2    ? ? ? 1_555 A  G   181  N2    ? ? A C   154  A G   182  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199  hydrog ? ? A  C   154  N3    ? ? ? 1_555 A  G   180  N1    ? ? A C   155  A G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200  hydrog ? ? A  C   154  N4    ? ? ? 1_555 A  G   180  O6    ? ? A C   155  A G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201  hydrog ? ? A  C   154  O2    ? ? ? 1_555 A  G   180  N2    ? ? A C   155  A G   181  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202  hydrog ? ? A  C   155  N3    ? ? ? 1_555 A  G   179  N1    ? ? A C   156  A G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203  hydrog ? ? A  C   155  N4    ? ? ? 1_555 A  G   179  O6    ? ? A C   156  A G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204  hydrog ? ? A  C   155  O2    ? ? ? 1_555 A  G   179  N2    ? ? A C   156  A G   180  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205  hydrog ? ? A  G   156  N1    ? ? ? 1_555 A  C   178  N3    ? ? A G   157  A C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  C   178  O2    ? ? A G   157  A C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207  hydrog ? ? A  G   156  O6    ? ? ? 1_555 A  C   178  N4    ? ? A G   157  A C   179  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208  hydrog ? ? A  G   156  N2    ? ? ? 1_555 A  A   1469 N1    ? ? A G   157  A A   1470 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog209  hydrog ? ? A  A   157  N1    ? ? ? 1_555 A  U   177  N3    ? ? A A   158  A U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog210  hydrog ? ? A  A   157  N6    ? ? ? 1_555 A  U   177  O4    ? ? A A   158  A U   178  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog211  hydrog ? ? A  G   158  N2    ? ? ? 1_555 A  A   176  N7    ? ? A G   159  A A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog212  hydrog ? ? A  G   158  N3    ? ? ? 1_555 A  A   176  N6    ? ? A G   159  A A   177  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog213  hydrog ? ? A  A   159  N6    ? ? ? 1_555 A  U   175  O2    ? ? A A   160  A U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog214  hydrog ? ? A  A   159  N7    ? ? ? 1_555 A  U   175  N3    ? ? A A   160  A U   176  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog215  hydrog ? ? A  A   160  N6    ? ? ? 1_555 A  A   173  N7    ? ? A A   161  A A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog216  hydrog ? ? A  A   160  N7    ? ? ? 1_555 A  A   173  N6    ? ? A A   161  A A   174  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog217  hydrog ? ? A  A   160  N6    ? ? ? 1_555 A  U   175  O2    ? ? A A   161  A U   176  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog218  hydrog ? ? A  A   160  N3    ? ? ? 1_555 A  G   891  N2    ? ? A A   161  A G   892  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog219  hydrog ? ? A  C   161  N4    ? ? ? 1_555 A  C   172  O2    ? ? A C   162  A C   173  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog220  hydrog ? ? A  C   161  O2    ? ? ? 1_555 A  C   892  N4    ? ? A C   162  A C   893  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog221  hydrog ? ? A  U   162  N3    ? ? ? 1_555 A  U   171  O2    ? ? A U   163  A U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog222  hydrog ? ? A  U   162  O4    ? ? ? 1_555 A  U   171  N3    ? ? A U   163  A U   172  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog223  hydrog ? ? A  G   163  N1    ? ? ? 1_555 A  C   170  N3    ? ? A G   164  A C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog224  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  C   170  O2    ? ? A G   164  A C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225  hydrog ? ? A  G   163  O6    ? ? ? 1_555 A  C   170  N4    ? ? A G   164  A C   171  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226  hydrog ? ? A  G   163  N2    ? ? ? 1_555 A  A   221  N3    ? ? A G   164  A A   222  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog227  hydrog ? ? A  A   164  N3    ? ? ? 1_555 A  G   220  N2    ? ? A A   165  A G   221  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog228  hydrog ? ? A  A   165  N1    ? ? ? 1_555 A  G   923  N2    ? ? A A   166  A G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog229  hydrog ? ? A  A   165  N6    ? ? ? 1_555 A  G   923  N3    ? ? A A   166  A G   924  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog230  hydrog ? ? A  C   167  N3    ? ? ? 1_555 A  G   218  N1    ? ? A C   168  A G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog231  hydrog ? ? A  C   167  N4    ? ? ? 1_555 A  G   218  O6    ? ? A C   168  A G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232  hydrog ? ? A  C   167  O2    ? ? ? 1_555 A  G   218  N2    ? ? A C   168  A G   219  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233  hydrog ? ? A  U   169  O4    ? ? ? 1_555 A  G   220  N1    ? ? A U   170  A G   221  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog234  hydrog ? ? A  C   170  O2    ? ? ? 1_555 A  G   220  N1    ? ? A C   171  A G   221  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog235  hydrog ? ? A  G   174  N2    ? ? ? 1_555 A  U   175  O4    ? ? A G   175  A U   176  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog236  hydrog ? ? A  G   184  N2    ? ? ? 1_555 A  A   438  N1    ? ? A G   185  A A   439  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog237  hydrog ? ? A  G   189  N2    ? ? ? 1_555 A  A   434  N7    ? ? A G   190  A A   435  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog238  hydrog ? ? A  A   190  N6    ? ? ? 1_555 A  U   433  O2    ? ? A A   191  A U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog239  hydrog ? ? A  A   190  N7    ? ? ? 1_555 A  U   433  N3    ? ? A A   191  A U   434  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog240  hydrog ? ? A  A   191  N6    ? ? ? 1_555 A  G   202  N3    ? ? A A   192  A G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog241  hydrog ? ? A  A   191  N7    ? ? ? 1_555 A  G   202  N2    ? ? A A   192  A G   203  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog242  hydrog ? ? A  A   192  N3    ? ? ? 1_555 A  G   412  N2    ? ? A A   193  A G   413  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog243  hydrog ? ? A  A   193  N1    ? ? ? 1_555 A  U   201  N3    ? ? A A   194  A U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog244  hydrog ? ? A  A   193  N6    ? ? ? 1_555 A  U   201  O4    ? ? A A   194  A U   202  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog245  hydrog ? ? A  C   194  N3    ? ? ? 1_555 A  G   200  N1    ? ? A C   195  A G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog246  hydrog ? ? A  C   194  N4    ? ? ? 1_555 A  G   200  O6    ? ? A C   195  A G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog247  hydrog ? ? A  C   194  O2    ? ? ? 1_555 A  G   200  N2    ? ? A C   195  A G   201  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog248  hydrog ? ? A  C   194  O2    ? ? ? 1_555 A  U   201  N3    ? ? A C   195  A U   202  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog249  hydrog ? ? A  G   195  N2    ? ? ? 1_555 A  A   198  N7    ? ? A G   196  A A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog250  hydrog ? ? A  G   195  N3    ? ? ? 1_555 A  A   198  N6    ? ? A G   196  A A   199  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog251  hydrog ? ? A  G   195  N1    ? ? ? 1_555 A  U   424  O2    ? ? A G   196  A U   425  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog252  hydrog ? ? A  A   197  N1    ? ? ? 1_555 A  G   415  N2    ? ? A A   198  A G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog253  hydrog ? ? A  A   197  N6    ? ? ? 1_555 A  G   415  N3    ? ? A A   198  A G   416  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog254  hydrog ? ? A  A   203  N1    ? ? ? 1_555 A  A   435  N6    ? ? A A   204  A A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog255  hydrog ? ? A  A   203  N6    ? ? ? 1_555 A  A   435  N1    ? ? A A   204  A A   436  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog256  hydrog ? ? A  U   204  N3    ? ? ? 1_555 A  A   436  N1    ? ? A U   205  A A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog257  hydrog ? ? A  U   204  O2    ? ? ? 1_555 A  A   436  N6    ? ? A U   205  A A   437  1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog258  hydrog ? ? A  G   205  N1    ? ? ? 1_555 A  U   232  O2    ? ? A G   206  A U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog259  hydrog ? ? A  G   205  O6    ? ? ? 1_555 A  U   232  N3    ? ? A G   206  A U   233  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog260  hydrog ? ? A  U   206  N3    ? ? ? 1_555 A  A   231  N1    ? ? A U   207  A A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog261  hydrog ? ? A  U   206  O4    ? ? ? 1_555 A  A   231  N6    ? ? A U   207  A A   232  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog262  hydrog ? ? A  C   207  N3    ? ? ? 1_555 A  G   230  N1    ? ? A C   208  A G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog263  hydrog ? ? A  C   207  N4    ? ? ? 1_555 A  G   230  O6    ? ? A C   208  A G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog264  hydrog ? ? A  C   207  O2    ? ? ? 1_555 A  G   230  N2    ? ? A C   208  A G   231  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog265  hydrog ? ? A  G   208  N1    ? ? ? 1_555 A  C   229  N3    ? ? A G   209  A C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266  hydrog ? ? A  G   208  N2    ? ? ? 1_555 A  C   229  O2    ? ? A G   209  A C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267  hydrog ? ? A  G   208  O6    ? ? ? 1_555 A  C   229  N4    ? ? A G   209  A C   230  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog268  hydrog ? ? A  U   209  N3    ? ? ? 1_555 A  G   228  O6    ? ? A U   210  A G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog269  hydrog ? ? A  U   209  O2    ? ? ? 1_555 A  G   228  N1    ? ? A U   210  A G   229  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog270  hydrog ? ? A  U   210  O2    ? ? ? 1_555 A  C   227  N4    ? ? A U   211  A C   228  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog271  hydrog ? ? A  A   211  N6    ? ? ? 1_555 A  A   226  N7    ? ? A A   212  A A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog272  hydrog ? ? A  A   211  N7    ? ? ? 1_555 A  A   226  N6    ? ? A A   212  A A   227  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog273  hydrog ? ? A  G   212  N2    ? ? ? 1_555 A  U   213  O4    ? ? A G   213  A U   214  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog274  hydrog ? ? A  U   213  N3    ? ? ? 1_555 A  A   225  N7    ? ? A U   214  A A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog275  hydrog ? ? A  U   213  O2    ? ? ? 1_555 A  A   225  N6    ? ? A U   214  A A   226  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog276  hydrog ? ? A  A   214  N6    ? ? ? 1_555 A  G   224  N3    ? ? A A   215  A G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog277  hydrog ? ? A  A   214  N7    ? ? ? 1_555 A  G   224  N2    ? ? A A   215  A G   225  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog278  hydrog ? ? A  A   215  N1    ? ? ? 1_555 A  U   223  N3    ? ? A A   216  A U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog279  hydrog ? ? A  A   215  N6    ? ? ? 1_555 A  U   223  O4    ? ? A A   216  A U   224  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog280  hydrog ? ? A  C   216  N3    ? ? ? 1_555 A  G   222  N1    ? ? A C   217  A G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog281  hydrog ? ? A  C   216  N4    ? ? ? 1_555 A  G   222  O6    ? ? A C   217  A G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog282  hydrog ? ? A  C   216  O2    ? ? ? 1_555 A  G   222  N2    ? ? A C   217  A G   223  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog283  hydrog ? ? A  C   217  O2    ? ? ? 1_555 A  A   221  N6    ? ? A C   218  A A   222  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog284  hydrog ? ? A  G   230  N2    ? ? ? 1_555 A  A   665  N3    ? ? A G   231  A A   666  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog285  hydrog ? ? A  G   236  N1    ? ? ? 1_555 A  C   432  N3    ? ? A G   237  A C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog286  hydrog ? ? A  G   236  N2    ? ? ? 1_555 A  C   432  O2    ? ? A G   237  A C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog287  hydrog ? ? A  G   236  O6    ? ? ? 1_555 A  C   432  N4    ? ? A G   237  A C   433  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288  hydrog ? ? A  C   237  N3    ? ? ? 1_555 A  G   431  N1    ? ? A C   238  A G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog289  hydrog ? ? A  C   237  N4    ? ? ? 1_555 A  G   431  O6    ? ? A C   238  A G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog290  hydrog ? ? A  C   237  O2    ? ? ? 1_555 A  G   431  N2    ? ? A C   238  A G   432  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291  hydrog ? ? A  C   238  N3    ? ? ? 1_555 A  G   430  N1    ? ? A C   239  A G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292  hydrog ? ? A  C   238  N4    ? ? ? 1_555 A  G   430  O6    ? ? A C   239  A G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293  hydrog ? ? A  C   238  O2    ? ? ? 1_555 A  G   430  N2    ? ? A C   239  A G   431  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294  hydrog ? ? A  C   239  N3    ? ? ? 1_555 A  G   378  N1    ? ? A C   240  A G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295  hydrog ? ? A  C   239  N4    ? ? ? 1_555 A  G   378  O6    ? ? A C   240  A G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog296  hydrog ? ? A  C   239  O2    ? ? ? 1_555 A  G   378  N2    ? ? A C   240  A G   379  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog297  hydrog ? ? A  A   240  N6    ? ? ? 1_555 A  U   269  O2    ? ? A A   241  A U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog298  hydrog ? ? A  A   240  N7    ? ? ? 1_555 A  U   269  N3    ? ? A A   241  A U   270  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog299  hydrog ? ? A  A   241  N6    ? ? ? 1_555 A  G   268  N3    ? ? A A   242  A G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog300  hydrog ? ? A  A   241  N7    ? ? ? 1_555 A  G   268  N2    ? ? A A   242  A G   269  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog301  hydrog ? ? A  A   242  N6    ? ? ? 1_555 A  U   267  O2    ? ? A A   243  A U   268  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog302  hydrog ? ? A  A   242  N3    ? ? ? 1_555 A  G   273  N2    ? ? A A   243  A G   274  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog303  hydrog ? ? A  C   243  N3    ? ? ? 1_555 A  G   266  N1    ? ? A C   244  A G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog304  hydrog ? ? A  C   243  N4    ? ? ? 1_555 A  G   266  O6    ? ? A C   244  A G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog305  hydrog ? ? A  C   243  O2    ? ? ? 1_555 A  G   266  N2    ? ? A C   244  A G   267  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog306  hydrog ? ? A  C   244  N3    ? ? ? 1_555 A  G   265  N1    ? ? A C   245  A G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog307  hydrog ? ? A  C   244  N4    ? ? ? 1_555 A  G   265  O6    ? ? A C   245  A G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog308  hydrog ? ? A  C   244  O2    ? ? ? 1_555 A  G   265  N2    ? ? A C   245  A G   266  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog309  hydrog ? ? A  G   245  N2    ? ? ? 1_555 A  U   264  O4    ? ? A G   246  A U   265  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog310  hydrog ? ? A  A   246  N6    ? ? ? 1_555 A  G   263  N3    ? ? A A   247  A G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog311  hydrog ? ? A  A   246  N7    ? ? ? 1_555 A  G   263  N2    ? ? A A   247  A G   264  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog312  hydrog ? ? A  A   247  N1    ? ? ? 1_555 A  U   264  N3    ? ? A A   248  A U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog313  hydrog ? ? A  A   247  N6    ? ? ? 1_555 A  U   264  O4    ? ? A A   248  A U   265  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog314  hydrog ? ? A  G   248  N1    ? ? ? 1_555 A  C   259  N3    ? ? A G   249  A C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog315  hydrog ? ? A  G   248  N2    ? ? ? 1_555 A  C   259  O2    ? ? A G   249  A C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog316  hydrog ? ? A  G   248  O6    ? ? ? 1_555 A  C   259  N4    ? ? A G   249  A C   260  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog317  hydrog ? ? A  C   249  N3    ? ? ? 1_555 A  G   258  N1    ? ? A C   250  A G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318  hydrog ? ? A  C   249  N4    ? ? ? 1_555 A  G   258  O6    ? ? A C   250  A G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319  hydrog ? ? A  C   249  O2    ? ? ? 1_555 A  G   258  N2    ? ? A C   250  A G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog320  hydrog ? ? A  C   250  N3    ? ? ? 1_555 A  G   257  N1    ? ? A C   251  A G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321  hydrog ? ? A  C   250  N4    ? ? ? 1_555 A  G   257  O6    ? ? A C   251  A G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322  hydrog ? ? A  C   250  O2    ? ? ? 1_555 A  G   257  N2    ? ? A C   251  A G   258  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323  hydrog ? ? A  C   250  N3    ? ? ? 1_555 A  G   258  N1    ? ? A C   251  A G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog324  hydrog ? ? A  C   250  N4    ? ? ? 1_555 A  G   258  O6    ? ? A C   251  A G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog325  hydrog ? ? A  C   250  O2    ? ? ? 1_555 A  G   258  N2    ? ? A C   251  A G   259  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog326  hydrog ? ? A  C   251  N3    ? ? ? 1_555 A  G   256  N1    ? ? A C   252  A G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog327  hydrog ? ? A  C   251  N4    ? ? ? 1_555 A  G   256  O6    ? ? A C   252  A G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog328  hydrog ? ? A  C   251  O2    ? ? ? 1_555 A  G   256  N2    ? ? A C   252  A G   257  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog329  hydrog ? ? A  U   252  O2    ? ? ? 1_555 A  C   255  N4    ? ? A U   253  A C   256  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog330  hydrog ? ? A  C   270  N4    ? ? ? 1_555 A  A   377  N1    ? ? A C   271  A A   378  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog331  hydrog ? ? A  G   272  N1    ? ? ? 1_555 A  C   376  N3    ? ? A G   273  A C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog332  hydrog ? ? A  G   272  N2    ? ? ? 1_555 A  C   376  O2    ? ? A G   273  A C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog333  hydrog ? ? A  G   272  O6    ? ? ? 1_555 A  C   376  N4    ? ? A G   273  A C   377  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog334  hydrog ? ? A  G   273  N1    ? ? ? 1_555 A  C   375  N3    ? ? A G   274  A C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog335  hydrog ? ? A  G   273  N2    ? ? ? 1_555 A  C   375  O2    ? ? A G   274  A C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog336  hydrog ? ? A  G   273  O6    ? ? ? 1_555 A  C   375  N4    ? ? A G   274  A C   376  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog337  hydrog ? ? A  G   274  N1    ? ? ? 1_555 A  U   373  O2    ? ? A G   275  A U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog338  hydrog ? ? A  G   274  O6    ? ? ? 1_555 A  U   373  N3    ? ? A G   275  A U   374  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog339  hydrog ? ? A  C   275  N3    ? ? ? 1_555 A  G   372  N1    ? ? A C   276  A G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog340  hydrog ? ? A  C   275  N4    ? ? ? 1_555 A  G   372  O6    ? ? A C   276  A G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog341  hydrog ? ? A  C   275  O2    ? ? ? 1_555 A  G   372  N2    ? ? A C   276  A G   373  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog342  hydrog ? ? A  U   276  N3    ? ? ? 1_555 A  A   371  N1    ? ? A U   277  A A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog343  hydrog ? ? A  U   276  O4    ? ? ? 1_555 A  A   371  N6    ? ? A U   277  A A   372  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog344  hydrog ? ? A  A   277  N1    ? ? ? 1_555 A  U   370  N3    ? ? A A   278  A U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog345  hydrog ? ? A  A   277  N6    ? ? ? 1_555 A  U   370  O4    ? ? A A   278  A U   371  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog346  hydrog ? ? A  C   278  N3    ? ? ? 1_555 A  G   369  N1    ? ? A C   279  A G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog347  hydrog ? ? A  C   278  N4    ? ? ? 1_555 A  G   369  O6    ? ? A C   279  A G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog348  hydrog ? ? A  C   278  O2    ? ? ? 1_555 A  G   369  N2    ? ? A C   279  A G   370  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog349  hydrog ? ? A  C   279  N3    ? ? ? 1_555 A  G   368  N1    ? ? A C   280  A G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog350  hydrog ? ? A  C   279  N4    ? ? ? 1_555 A  G   368  O6    ? ? A C   280  A G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog351  hydrog ? ? A  C   279  O2    ? ? ? 1_555 A  G   368  N2    ? ? A C   280  A G   369  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog352  hydrog ? ? A  U   280  O2    ? ? ? 1_555 A  C   367  N4    ? ? A U   281  A C   368  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog353  hydrog ? ? A  C   281  O2    ? ? ? 1_555 A  C   367  N4    ? ? A C   282  A C   368  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog354  hydrog ? ? A  A   284  N6    ? ? ? 1_555 A  G   366  N3    ? ? A A   285  A G   367  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog355  hydrog ? ? A  U   285  N3    ? ? ? 1_555 A  U   365  O2    ? ? A U   286  A U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog356  hydrog ? ? A  U   285  O4    ? ? ? 1_555 A  U   365  N3    ? ? A U   286  A U   366  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog357  hydrog ? ? A  C   286  N3    ? ? ? 1_555 A  G   364  N1    ? ? A C   287  A G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog358  hydrog ? ? A  C   286  N4    ? ? ? 1_555 A  G   364  O6    ? ? A C   287  A G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog359  hydrog ? ? A  C   286  O2    ? ? ? 1_555 A  G   364  N2    ? ? A C   287  A G   365  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog360  hydrog ? ? A  G   288  N1    ? ? ? 1_555 A  A   362  N1    ? ? A G   289  A A   363  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog361  hydrog ? ? A  C   289  N3    ? ? ? 1_555 A  G   361  N1    ? ? A C   290  A G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog362  hydrog ? ? A  C   289  N4    ? ? ? 1_555 A  G   361  O6    ? ? A C   290  A G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog363  hydrog ? ? A  C   289  O2    ? ? ? 1_555 A  G   361  N2    ? ? A C   290  A G   362  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog364  hydrog ? ? A  C   290  N3    ? ? ? 1_555 A  C   360  N4    ? ? A C   291  A C   361  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog365  hydrog ? ? A  G   291  N2    ? ? ? 1_555 A  A   359  N7    ? ? A G   292  A A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog366  hydrog ? ? A  G   291  N3    ? ? ? 1_555 A  A   359  N6    ? ? A G   292  A A   360  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog367  hydrog ? ? A  A   292  N6    ? ? ? 1_555 A  U   358  O2    ? ? A A   293  A U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog368  hydrog ? ? A  A   292  N7    ? ? ? 1_555 A  U   358  N3    ? ? A A   293  A U   359  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog369  hydrog ? ? A  C   294  N4    ? ? ? 1_555 A  C   355  O2    ? ? A C   295  A C   356  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog370  hydrog ? ? A  G   295  N1    ? ? ? 1_555 A  C   354  N3    ? ? A G   296  A C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog371  hydrog ? ? A  G   295  N2    ? ? ? 1_555 A  C   354  O2    ? ? A G   296  A C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog372  hydrog ? ? A  G   295  O6    ? ? ? 1_555 A  C   354  N4    ? ? A G   296  A C   355  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog373  hydrog ? ? A  U   296  N3    ? ? ? 1_555 A  A   353  N1    ? ? A U   297  A A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog374  hydrog ? ? A  U   296  O4    ? ? ? 1_555 A  A   353  N6    ? ? A U   297  A A   354  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog375  hydrog ? ? A  C   297  N3    ? ? ? 1_555 A  G   352  N1    ? ? A C   298  A G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog376  hydrog ? ? A  C   297  N4    ? ? ? 1_555 A  G   352  O6    ? ? A C   298  A G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog377  hydrog ? ? A  C   297  O2    ? ? ? 1_555 A  G   352  N2    ? ? A C   298  A G   353  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog378  hydrog ? ? A  U   298  N3    ? ? ? 1_555 A  A   351  N1    ? ? A U   299  A A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog379  hydrog ? ? A  U   298  O4    ? ? ? 1_555 A  A   351  N6    ? ? A U   299  A A   352  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog380  hydrog ? ? A  C   299  N3    ? ? ? 1_555 A  G   350  N1    ? ? A C   300  A G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog381  hydrog ? ? A  C   299  N4    ? ? ? 1_555 A  G   350  O6    ? ? A C   300  A G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog382  hydrog ? ? A  C   299  O2    ? ? ? 1_555 A  G   350  N2    ? ? A C   300  A G   351  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog383  hydrog ? ? A  G   300  N1    ? ? ? 1_555 A  C   349  N3    ? ? A G   301  A C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog384  hydrog ? ? A  G   300  N2    ? ? ? 1_555 A  C   349  O2    ? ? A G   301  A C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog385  hydrog ? ? A  G   300  O6    ? ? ? 1_555 A  C   349  N4    ? ? A G   301  A C   350  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog386  hydrog ? ? A  A   301  N1    ? ? ? 1_555 A  U   348  N3    ? ? A A   302  A U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog387  hydrog ? ? A  A   301  N6    ? ? ? 1_555 A  U   348  O4    ? ? A A   302  A U   349  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog388  hydrog ? ? A  C   302  N3    ? ? ? 1_555 A  C   347  N4    ? ? A C   303  A C   348  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog389  hydrog ? ? A  G   303  N2    ? ? ? 1_555 A  A   346  N7    ? ? A G   304  A A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog390  hydrog ? ? A  G   303  N3    ? ? ? 1_555 A  A   346  N6    ? ? A G   304  A A   347  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog391  hydrog ? ? A  A   304  N6    ? ? ? 1_555 A  G   344  O6    ? ? A A   305  A G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog392  hydrog ? ? A  A   305  N6    ? ? ? 1_555 A  G   344  O6    ? ? A A   306  A G   345  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog393  hydrog ? ? A  G   306  N1    ? ? ? 1_555 A  C   322  N3    ? ? A G   307  A C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog394  hydrog ? ? A  G   306  N2    ? ? ? 1_555 A  C   322  O2    ? ? A G   307  A C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog395  hydrog ? ? A  G   306  O6    ? ? ? 1_555 A  C   322  N4    ? ? A G   307  A C   323  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog396  hydrog ? ? A  U   307  N3    ? ? ? 1_555 A  A   338  N1    ? ? A U   308  A A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog397  hydrog ? ? A  U   307  O4    ? ? ? 1_555 A  A   338  N6    ? ? A U   308  A A   339  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog398  hydrog ? ? A  C   308  N3    ? ? ? 1_555 A  G   321  N1    ? ? A C   309  A G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog399  hydrog ? ? A  C   308  N4    ? ? ? 1_555 A  G   321  O6    ? ? A C   309  A G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog400  hydrog ? ? A  C   308  O2    ? ? ? 1_555 A  G   321  N2    ? ? A C   309  A G   322  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog401  hydrog ? ? A  U   309  N3    ? ? ? 1_555 A  A   320  N1    ? ? A U   310  A A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog402  hydrog ? ? A  U   309  O4    ? ? ? 1_555 A  A   320  N6    ? ? A U   310  A A   321  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog403  hydrog ? ? A  C   310  N3    ? ? ? 1_555 A  G   319  N1    ? ? A C   311  A G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog404  hydrog ? ? A  C   310  N4    ? ? ? 1_555 A  G   319  O6    ? ? A C   311  A G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog405  hydrog ? ? A  C   310  O2    ? ? ? 1_555 A  G   319  N2    ? ? A C   311  A G   320  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog406  hydrog ? ? A  U   311  N3    ? ? ? 1_555 A  A   318  N1    ? ? A U   312  A A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog407  hydrog ? ? A  U   311  O4    ? ? ? 1_555 A  A   318  N6    ? ? A U   312  A A   319  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog408  hydrog ? ? A  U   312  N3    ? ? ? 1_555 A  A   316  N7    ? ? A U   313  A A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog409  hydrog ? ? A  U   312  O2    ? ? ? 1_555 A  A   316  N6    ? ? A U   313  A A   317  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog410  hydrog ? ? A  G   313  N2    ? ? ? 1_555 A  A   336  N1    ? ? A G   314  A A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog411  hydrog ? ? A  G   313  N3    ? ? ? 1_555 A  A   336  N6    ? ? A G   314  A A   337  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog412  hydrog ? ? A  G   314  N2    ? ? ? 1_555 A  G   335  N3    ? ? A G   315  A G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog413  hydrog ? ? A  G   314  N3    ? ? ? 1_555 A  G   335  N2    ? ? A G   315  A G   336  1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog414  hydrog ? ? A  A   315  N6    ? ? ? 1_555 A  U   1313 O2    ? ? A A   316  A U   1314 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog415  hydrog ? ? A  G   323  N1    ? ? ? 1_555 A  C   340  N3    ? ? A G   324  A C   341  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog416  hydrog ? ? A  U   324  N3    ? ? ? 1_555 A  A   339  N1    ? ? A U   325  A A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog417  hydrog ? ? A  U   324  O4    ? ? ? 1_555 A  A   339  N6    ? ? A U   325  A A   340  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog418  hydrog ? ? A  G   325  N1    ? ? ? 1_555 A  C   329  N3    ? ? A G   326  A C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog419  hydrog ? ? A  G   325  N2    ? ? ? 1_555 A  C   329  O2    ? ? A G   326  A C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog420  hydrog ? ? A  G   325  O6    ? ? ? 1_555 A  C   329  N4    ? ? A G   326  A C   330  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog421  hydrog ? ? A  A   328  N3    ? ? ? 1_555 A  U   345  N3    ? ? A A   329  A U   346  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog422  hydrog ? ? A  A   330  N6    ? ? ? 1_555 A  G   344  N3    ? ? A A   331  A G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog423  hydrog ? ? A  A   330  N7    ? ? ? 1_555 A  G   344  N2    ? ? A A   331  A G   345  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog424  hydrog ? ? A  G   331  N1    ? ? ? 1_555 A  C   343  N3    ? ? A G   332  A C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog425  hydrog ? ? A  G   331  N2    ? ? ? 1_555 A  C   343  O2    ? ? A G   332  A C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog426  hydrog ? ? A  G   331  O6    ? ? ? 1_555 A  C   343  N4    ? ? A G   332  A C   344  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog427  hydrog ? ? A  G   332  N1    ? ? ? 1_555 A  C   342  N3    ? ? A G   333  A C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog428  hydrog ? ? A  G   332  N2    ? ? ? 1_555 A  C   342  O2    ? ? A G   333  A C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog429  hydrog ? ? A  G   332  O6    ? ? ? 1_555 A  C   342  N4    ? ? A G   333  A C   343  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog430  hydrog ? ? A  G   333  N1    ? ? ? 1_555 A  C   341  N3    ? ? A G   334  A C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog431  hydrog ? ? A  G   333  N2    ? ? ? 1_555 A  C   341  O2    ? ? A G   334  A C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog432  hydrog ? ? A  G   333  O6    ? ? ? 1_555 A  C   341  N4    ? ? A G   334  A C   342  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog433  hydrog ? ? A  U   334  N3    ? ? ? 1_555 A  A   338  N7    ? ? A U   335  A A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog434  hydrog ? ? A  U   334  O2    ? ? ? 1_555 A  A   338  N6    ? ? A U   335  A A   339  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog435  hydrog ? ? A  G   357  N2    ? ? ? 1_555 A  U   358  O4    ? ? A G   358  A U   359  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog436  hydrog ? ? A  A   379  N6    ? ? ? 1_555 A  A   407  N7    ? ? A A   380  A A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog437  hydrog ? ? A  A   379  N7    ? ? ? 1_555 A  A   407  N6    ? ? A A   380  A A   408  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog438  hydrog ? ? A  A   379  N6    ? ? ? 1_555 A  U   408  O4    ? ? A A   380  A U   409  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog439  hydrog ? ? A  G   380  N2    ? ? ? 1_555 A  U   381  O4    ? ? A G   381  A U   382  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog440  hydrog ? ? A  U   381  N3    ? ? ? 1_555 A  A   406  N7    ? ? A U   382  A A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog441  hydrog ? ? A  U   381  O2    ? ? ? 1_555 A  A   406  N6    ? ? A U   382  A A   407  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog442  hydrog ? ? A  A   382  N6    ? ? ? 1_555 A  G   405  N3    ? ? A A   383  A G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog443  hydrog ? ? A  A   382  N7    ? ? ? 1_555 A  G   405  N2    ? ? A A   383  A G   406  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog444  hydrog ? ? A  G   383  N1    ? ? ? 1_555 A  C   404  N3    ? ? A G   384  A C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog445  hydrog ? ? A  G   383  N2    ? ? ? 1_555 A  C   404  O2    ? ? A G   384  A C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog446  hydrog ? ? A  G   383  O6    ? ? ? 1_555 A  C   404  N4    ? ? A G   384  A C   405  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog447  hydrog ? ? A  C   384  N3    ? ? ? 1_555 A  G   403  N1    ? ? A C   385  A G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog448  hydrog ? ? A  C   384  N4    ? ? ? 1_555 A  G   403  O6    ? ? A C   385  A G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog449  hydrog ? ? A  C   384  O2    ? ? ? 1_555 A  G   403  N2    ? ? A C   385  A G   404  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog450  hydrog ? ? A  G   385  N1    ? ? ? 1_555 A  C   402  N3    ? ? A G   386  A C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog451  hydrog ? ? A  G   385  N2    ? ? ? 1_555 A  C   402  O2    ? ? A G   386  A C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog452  hydrog ? ? A  G   385  O6    ? ? ? 1_555 A  C   402  N4    ? ? A G   386  A C   403  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog453  hydrog ? ? A  G   386  N1    ? ? ? 1_555 A  U   401  O2    ? ? A G   387  A U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog454  hydrog ? ? A  G   386  O6    ? ? ? 1_555 A  U   401  N3    ? ? A G   387  A U   402  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog455  hydrog ? ? A  G   387  N1    ? ? ? 1_555 A  C   400  N3    ? ? A G   388  A C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog456  hydrog ? ? A  G   387  N2    ? ? ? 1_555 A  C   400  O2    ? ? A G   388  A C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog457  hydrog ? ? A  G   387  O6    ? ? ? 1_555 A  C   400  N4    ? ? A G   388  A C   401  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog458  hydrog ? ? A  G   388  N1    ? ? ? 1_555 A  C   399  N3    ? ? A G   389  A C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog459  hydrog ? ? A  G   388  N2    ? ? ? 1_555 A  C   399  O2    ? ? A G   389  A C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog460  hydrog ? ? A  G   388  O6    ? ? ? 1_555 A  C   399  N4    ? ? A G   389  A C   400  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog461  hydrog ? ? A  G   389  N1    ? ? ? 1_555 A  C   398  N3    ? ? A G   390  A C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog462  hydrog ? ? A  G   389  N2    ? ? ? 1_555 A  C   398  O2    ? ? A G   390  A C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog463  hydrog ? ? A  G   389  O6    ? ? ? 1_555 A  C   398  N4    ? ? A G   390  A C   399  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog464  hydrog ? ? A  U   390  N3    ? ? ? 1_555 A  U   397  O4    ? ? A U   391  A U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog465  hydrog ? ? A  U   390  O2    ? ? ? 1_555 A  U   397  N3    ? ? A U   391  A U   398  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog466  hydrog ? ? A  G   393  N3    ? ? ? 1_555 A  G   416  N2    ? ? A G   394  A G   417  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog467  hydrog ? ? A  A   394  N1    ? ? ? 1_555 A  C   2442 N4    ? ? A A   395  A C   2443 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog468  hydrog ? ? A  U   395  O4    ? ? ? 1_555 A  G   2441 N2    ? ? A U   396  A G   2442 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog469  hydrog ? ? A  A   406  N6    ? ? ? 1_555 A  A   428  N1    ? ? A A   407  A A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog470  hydrog ? ? A  A   407  N1    ? ? ? 1_555 A  A   428  N6    ? ? A A   408  A A   429  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog471  hydrog ? ? A  A   407  N6    ? ? ? 1_555 A  A   429  N1    ? ? A A   408  A A   430  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog472  hydrog ? ? A  C   411  N3    ? ? ? 1_555 A  G   427  N1    ? ? A C   412  A G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog473  hydrog ? ? A  C   411  N4    ? ? ? 1_555 A  G   427  O6    ? ? A C   412  A G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog474  hydrog ? ? A  C   411  O2    ? ? ? 1_555 A  G   427  N2    ? ? A C   412  A G   428  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog475  hydrog ? ? A  G   412  N1    ? ? ? 1_555 A  C   426  N3    ? ? A G   413  A C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog476  hydrog ? ? A  G   412  N2    ? ? ? 1_555 A  C   426  O2    ? ? A G   413  A C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog477  hydrog ? ? A  G   412  O6    ? ? ? 1_555 A  C   426  N4    ? ? A G   413  A C   427  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog478  hydrog ? ? A  C   413  N3    ? ? ? 1_555 A  G   425  N1    ? ? A C   414  A G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog479  hydrog ? ? A  C   413  N4    ? ? ? 1_555 A  G   425  O6    ? ? A C   414  A G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog480  hydrog ? ? A  C   413  O2    ? ? ? 1_555 A  G   425  N2    ? ? A C   414  A G   426  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog481  hydrog ? ? A  A   414  N1    ? ? ? 1_555 A  U   424  N3    ? ? A A   415  A U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog482  hydrog ? ? A  A   414  N6    ? ? ? 1_555 A  U   424  O4    ? ? A A   415  A U   425  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog483  hydrog ? ? A  G   415  N1    ? ? ? 1_555 A  C   423  N3    ? ? A G   416  A C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog484  hydrog ? ? A  G   415  N2    ? ? ? 1_555 A  C   423  O2    ? ? A G   416  A C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog485  hydrog ? ? A  G   415  O6    ? ? ? 1_555 A  C   423  N4    ? ? A G   416  A C   424  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog486  hydrog ? ? A  C   417  N3    ? ? ? 1_555 A  G   2448 N1    ? ? A C   418  A G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog487  hydrog ? ? A  C   417  N4    ? ? ? 1_555 A  G   2448 O6    ? ? A C   418  A G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog488  hydrog ? ? A  C   417  O2    ? ? ? 1_555 A  G   2448 N2    ? ? A C   418  A G   2449 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog489  hydrog ? ? A  A   418  N3    ? ? ? 1_555 A  C   1919 N4    ? ? A A   419  A C   1920 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog490  hydrog ? ? A  A   418  N1    ? ? ? 1_555 A  U   2447 N3    ? ? A A   419  A U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog491  hydrog ? ? A  A   418  N6    ? ? ? 1_555 A  U   2447 O4    ? ? A A   419  A U   2448 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog492  hydrog ? ? A  U   419  N3    ? ? ? 1_555 A  A   2446 N1    ? ? A U   420  A A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog493  hydrog ? ? A  U   419  O4    ? ? ? 1_555 A  A   2446 N6    ? ? A U   420  A A   2447 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog494  hydrog ? ? A  C   420  N3    ? ? ? 1_555 A  G   2445 N1    ? ? A C   421  A G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog495  hydrog ? ? A  C   420  N4    ? ? ? 1_555 A  G   2445 O6    ? ? A C   421  A G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog496  hydrog ? ? A  C   420  O2    ? ? ? 1_555 A  G   2445 N2    ? ? A C   421  A G   2446 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog497  hydrog ? ? A  G   421  N1    ? ? ? 1_555 A  U   2444 O2    ? ? A G   422  A U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog498  hydrog ? ? A  G   421  O6    ? ? ? 1_555 A  U   2444 N3    ? ? A G   422  A U   2445 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog499  hydrog ? ? A  A   422  N1    ? ? ? 1_555 A  U   2443 N3    ? ? A A   423  A U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog500  hydrog ? ? A  A   422  N6    ? ? ? 1_555 A  U   2443 O4    ? ? A A   423  A U   2444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog501  hydrog ? ? A  A   440  N3    ? ? ? 1_555 A  A   441  N6    ? ? A A   441  A A   442  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog502  hydrog ? ? A  A   448  N3    ? ? ? 1_555 A  G   1348 N2    ? ? A A   449  A G   1349 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog503  hydrog ? ? A  G   451  N2    ? ? ? 1_555 A  A   459  N1    ? ? A G   452  A A   460  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog504  hydrog ? ? A  U   453  N3    ? ? ? 1_555 A  U   1361 O2    ? ? A U   454  A U   1362 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog505  hydrog ? ? A  A   454  N1    ? ? ? 1_555 A  A   459  N6    ? ? A A   455  A A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog506  hydrog ? ? A  A   454  N6    ? ? ? 1_555 A  A   459  N7    ? ? A A   455  A A   460  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog507  hydrog ? ? A  G   457  N2    ? ? ? 1_555 A  A   462  N3    ? ? A G   458  A A   463  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog508  hydrog ? ? A  A   462  N6    ? ? ? 1_555 A  A   476  N7    ? ? A A   463  A A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog509  hydrog ? ? A  A   462  N7    ? ? ? 1_555 A  A   476  N6    ? ? A A   463  A A   477  1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog510  hydrog ? ? A  G   463  N2    ? ? ? 1_555 A  U   464  O4    ? ? A G   464  A U   465  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog511  hydrog ? ? A  U   464  N3    ? ? ? 1_555 A  A   475  N7    ? ? A U   465  A A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog512  hydrog ? ? A  U   464  O2    ? ? ? 1_555 A  A   475  N6    ? ? A U   465  A A   476  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog513  hydrog ? ? A  A   465  N6    ? ? ? 1_555 A  G   474  N3    ? ? A A   466  A G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog514  hydrog ? ? A  A   465  N7    ? ? ? 1_555 A  G   474  N2    ? ? A A   466  A G   475  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog515  hydrog ? ? A  G   466  N1    ? ? ? 1_555 A  C   473  N3    ? ? A G   467  A C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog516  hydrog ? ? A  G   466  N2    ? ? ? 1_555 A  C   473  O2    ? ? A G   467  A C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog517  hydrog ? ? A  G   466  O6    ? ? ? 1_555 A  C   473  N4    ? ? A G   467  A C   474  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog518  hydrog ? ? A  U   467  N3    ? ? ? 1_555 A  A   472  N1    ? ? A U   468  A A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog519  hydrog ? ? A  U   467  O4    ? ? ? 1_555 A  A   472  N6    ? ? A U   468  A A   473  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog520  hydrog ? ? A  G   468  N2    ? ? ? 1_555 A  A   471  N7    ? ? A G   469  A A   472  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog521  hydrog ? ? A  G   470  N2    ? ? ? 1_555 A  C   773  O2    ? ? A G   471  A C   774  1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog522  hydrog ? ? A  U   480  N3    ? ? ? 1_555 A  A   484  N7    ? ? A U   481  A A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog523  hydrog ? ? A  U   480  O2    ? ? ? 1_555 A  A   484  N6    ? ? A U   481  A A   485  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog524  hydrog ? ? A  G   481  N2    ? ? ? 1_555 A  A   485  N7    ? ? A G   482  A A   486  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog525  hydrog ? ? A  A   484  N1    ? ? ? 1_555 A  A   508  N6    ? ? A A   485  A A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog526  hydrog ? ? A  A   484  N6    ? ? ? 1_555 A  A   508  N1    ? ? A A   485  A A   509  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog527  hydrog ? ? A  A   485  N1    ? ? ? 1_555 A  A   510  N6    ? ? A A   486  A A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog528  hydrog ? ? A  A   485  N6    ? ? ? 1_555 A  A   510  N1    ? ? A A   486  A A   511  1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog529  hydrog ? ? A  G   486  N3    ? ? ? 1_555 A  G   511  N2    ? ? A G   487  A G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog530  hydrog ? ? A  G   486  N1    ? ? ? 1_555 A  C   514  N3    ? ? A G   487  A C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog531  hydrog ? ? A  G   486  N2    ? ? ? 1_555 A  C   514  O2    ? ? A G   487  A C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog532  hydrog ? ? A  G   486  O6    ? ? ? 1_555 A  C   514  N4    ? ? A G   487  A C   515  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog533  hydrog ? ? A  U   487  O2    ? ? ? 1_555 A  G   502  N1    ? ? A U   488  A G   503  1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog534  hydrog ? ? A  A   488  N6    ? ? ? 1_555 A  G   502  N3    ? ? A A   489  A G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog535  hydrog ? ? A  A   488  N7    ? ? ? 1_555 A  G   502  N2    ? ? A A   489  A G   503  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog536  hydrog ? ? A  C   489  N4    ? ? ? 1_555 A  A   501  N1    ? ? A C   490  A A   502  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog537  hydrog ? ? A  C   490  N3    ? ? ? 1_555 A  G   500  N1    ? ? A C   491  A G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog538  hydrog ? ? A  C   490  N4    ? ? ? 1_555 A  G   500  O6    ? ? A C   491  A G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog539  hydrog ? ? A  C   490  O2    ? ? ? 1_555 A  G   500  N2    ? ? A C   491  A G   501  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog540  hydrog ? ? A  C   491  N3    ? ? ? 1_555 A  G   499  N1    ? ? A C   492  A G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog541  hydrog ? ? A  C   491  N4    ? ? ? 1_555 A  G   499  O6    ? ? A C   492  A G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog542  hydrog ? ? A  C   491  O2    ? ? ? 1_555 A  G   499  N2    ? ? A C   492  A G   500  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog543  hydrog ? ? A  U   492  N3    ? ? ? 1_555 A  G   498  O6    ? ? A U   493  A G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog544  hydrog ? ? A  U   492  O2    ? ? ? 1_555 A  G   498  N1    ? ? A U   493  A G   499  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog545  hydrog ? ? A  C   493  O2    ? ? ? 1_555 A  A   497  N6    ? ? A C   494  A A   498  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog546  hydrog ? ? A  G   503  N1    ? ? ? 1_555 A  G   511  O6    ? ? A G   504  A G   512  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog547  hydrog ? ? A  C   504  O2    ? ? ? 1_555 A  A   508  N6    ? ? A C   505  A A   509  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog548  hydrog ? ? A  G   505  N2    ? ? ? 1_555 A  A   510  N7    ? ? A G   506  A A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog549  hydrog ? ? A  G   505  N3    ? ? ? 1_555 A  A   510  N6    ? ? A G   506  A A   511  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog550  hydrog ? ? A  A   520  N3    ? ? ? 1_555 A  G   1363 N2    ? ? A A   521  A G   1364 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog551  hydrog ? ? A  A   531  N3    ? ? ? 1_555 A  G   2659 N2    ? ? A A   532  A G   2660 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog552  hydrog ? ? A  G   534  N7    ? ? ? 1_555 A  G   2081 N1    ? ? A G   535  A G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog553  hydrog ? ? A  G   534  O6    ? ? ? 1_555 A  G   2081 N2    ? ? A G   535  A G   2082 1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog554  hydrog ? ? A  A   535  N3    ? ? ? 1_555 A  G   2074 N2    ? ? A A   536  A G   2075 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog555  hydrog ? ? A  G   536  N1    ? ? ? 1_555 A  U   2058 O2    ? ? A G   537  A U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog556  hydrog ? ? A  G   536  O6    ? ? ? 1_555 A  U   2058 N3    ? ? A G   537  A U   2059 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog557  hydrog ? ? A  C   537  N4    ? ? ? 1_555 A  A   2059 N3    ? ? A C   538  A A   2060 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog558  hydrog ? ? A  G   538  N1    ? ? ? 1_555 A  C   616  N3    ? ? A G   539  A C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog559  hydrog ? ? A  G   538  N2    ? ? ? 1_555 A  C   616  O2    ? ? A G   539  A C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog560  hydrog ? ? A  G   538  O6    ? ? ? 1_555 A  C   616  N4    ? ? A G   539  A C   617  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog561  hydrog ? ? A  A   539  N1    ? ? ? 1_555 A  U   615  N3    ? ? A A   540  A U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog562  hydrog ? ? A  A   539  N6    ? ? ? 1_555 A  U   615  O4    ? ? A A   540  A U   616  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog563  hydrog ? ? A  C   540  N3    ? ? ? 1_555 A  G   614  N1    ? ? A C   541  A G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog564  hydrog ? ? A  C   540  N4    ? ? ? 1_555 A  G   614  O6    ? ? A C   541  A G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog565  hydrog ? ? A  C   540  O2    ? ? ? 1_555 A  G   614  N2    ? ? A C   541  A G   615  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog566  hydrog ? ? A  A   541  N1    ? ? ? 1_555 A  U   613  N3    ? ? A A   542  A U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog567  hydrog ? ? A  A   541  N6    ? ? ? 1_555 A  U   613  O4    ? ? A A   542  A U   614  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog568  hydrog ? ? A  G   542  N1    ? ? ? 1_555 A  C   612  N3    ? ? A G   543  A C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog569  hydrog ? ? A  G   542  N2    ? ? ? 1_555 A  C   612  O2    ? ? A G   543  A C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog570  hydrog ? ? A  G   542  O6    ? ? ? 1_555 A  C   612  N4    ? ? A G   543  A C   613  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog571  hydrog ? ? A  G   543  N1    ? ? ? 1_555 A  U   611  O2    ? ? A G   544  A U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog572  hydrog ? ? A  G   543  O6    ? ? ? 1_555 A  U   611  N3    ? ? A G   544  A U   612  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog573  hydrog ? ? A  G   544  N1    ? ? ? 1_555 A  U   610  O2    ? ? A G   545  A U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog574  hydrog ? ? A  G   544  O6    ? ? ? 1_555 A  U   610  N3    ? ? A G   545  A U   611  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog575  hydrog ? ? A  C   545  N3    ? ? ? 1_555 A  G   609  N1    ? ? A C   546  A G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog576  hydrog ? ? A  C   545  N4    ? ? ? 1_555 A  G   609  O6    ? ? A C   546  A G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog577  hydrog ? ? A  C   545  O2    ? ? ? 1_555 A  G   609  N2    ? ? A C   546  A G   610  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog578  hydrog ? ? A  A   546  N1    ? ? ? 1_555 A  U   608  N3    ? ? A A   547  A U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog579  hydrog ? ? A  A   546  N6    ? ? ? 1_555 A  U   608  O4    ? ? A A   547  A U   609  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog580  hydrog ? ? A  U   547  N3    ? ? ? 1_555 A  A   607  N1    ? ? A U   548  A A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog581  hydrog ? ? A  U   547  O4    ? ? ? 1_555 A  A   607  N6    ? ? A U   548  A A   608  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog582  hydrog ? ? A  A   551  N3    ? ? ? 1_555 A  G   1322 N2    ? ? A A   552  A G   1323 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog583  hydrog ? ? A  G   552  N1    ? ? ? 1_555 A  C   605  N3    ? ? A G   553  A C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog584  hydrog ? ? A  G   552  N2    ? ? ? 1_555 A  C   605  O2    ? ? A G   553  A C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog585  hydrog ? ? A  G   552  O6    ? ? ? 1_555 A  C   605  N4    ? ? A G   553  A C   606  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog586  hydrog ? ? A  G   553  N1    ? ? ? 1_555 A  C   604  N3    ? ? A G   554  A C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog587  hydrog ? ? A  G   553  N2    ? ? ? 1_555 A  C   604  O2    ? ? A G   554  A C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog588  hydrog ? ? A  G   553  O6    ? ? ? 1_555 A  C   604  N4    ? ? A G   554  A C   605  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog589  hydrog ? ? A  U   554  N3    ? ? ? 1_555 A  A   601  N1    ? ? A U   555  A A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog590  hydrog ? ? A  U   554  O4    ? ? ? 1_555 A  A   601  N6    ? ? A U   555  A A   602  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog591  hydrog ? ? A  C   555  N3    ? ? ? 1_555 A  G   600  N1    ? ? A C   556  A G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog592  hydrog ? ? A  C   555  N4    ? ? ? 1_555 A  G   600  O6    ? ? A C   556  A G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog593  hydrog ? ? A  C   555  O2    ? ? ? 1_555 A  G   600  N2    ? ? A C   556  A G   601  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog594  hydrog ? ? A  C   556  N3    ? ? ? 1_555 A  G   599  N1    ? ? A C   557  A G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog595  hydrog ? ? A  C   556  N4    ? ? ? 1_555 A  G   599  O6    ? ? A C   557  A G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog596  hydrog ? ? A  C   556  O2    ? ? ? 1_555 A  G   599  N2    ? ? A C   557  A G   600  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog597  hydrog ? ? A  C   557  N3    ? ? ? 1_555 A  G   598  N1    ? ? A C   558  A G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog598  hydrog ? ? A  C   557  N4    ? ? ? 1_555 A  G   598  O6    ? ? A C   558  A G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog599  hydrog ? ? A  C   557  O2    ? ? ? 1_555 A  G   598  N2    ? ? A C   558  A G   599  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog600  hydrog ? ? A  U   558  O4    ? ? ? 1_555 A  C   597  N4    ? ? A U   559  A C   598  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog601  hydrog ? ? A  G   560  N1    ? ? ? 1_555 A  C   595  N3    ? ? A G   561  A C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog602  hydrog ? ? A  G   560  N2    ? ? ? 1_555 A  C   595  O2    ? ? A G   561  A C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog603  hydrog ? ? A  G   560  O6    ? ? ? 1_555 A  C   595  N4    ? ? A G   561  A C   596  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog604  hydrog ? ? A  A   561  N1    ? ? ? 1_555 A  U   594  N3    ? ? A A   562  A U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog605  hydrog ? ? A  A   561  N6    ? ? ? 1_555 A  U   594  O4    ? ? A A   562  A U   595  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog606  hydrog ? ? A  C   562  O2    ? ? ? 1_555 A  C   593  N4    ? ? A C   563  A C   594  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog607  hydrog ? ? A  A   565  N6    ? ? ? 1_555 A  G   591  N3    ? ? A A   566  A G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog608  hydrog ? ? A  A   565  N7    ? ? ? 1_555 A  G   591  N2    ? ? A A   566  A G   592  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog609  hydrog ? ? A  A   565  N3    ? ? ? 1_555 A  G   1092 N2    ? ? A A   566  A G   1093 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog610  hydrog ? ? A  U   566  N3    ? ? ? 1_555 A  A   590  N1    ? ? A U   567  A A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog611  hydrog ? ? A  U   566  O4    ? ? ? 1_555 A  A   590  N6    ? ? A U   567  A A   591  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog612  hydrog ? ? A  G   567  N2    ? ? ? 1_555 A  A   589  N7    ? ? A G   568  A A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog613  hydrog ? ? A  G   567  N3    ? ? ? 1_555 A  A   589  N6    ? ? A G   568  A A   590  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog614  hydrog ? ? A  A   568  N6    ? ? ? 1_555 A  U   588  O2    ? ? A A   569  A U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog615  hydrog ? ? A  A   568  N7    ? ? ? 1_555 A  U   588  N3    ? ? A A   569  A U   589  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog616  hydrog ? ? A  C   570  N4    ? ? ? 1_555 A  C   585  O2    ? ? A C   571  A C   586  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog617  hydrog ? ? A  G   571  N1    ? ? ? 1_555 A  C   584  N3    ? ? A G   572  A C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog618  hydrog ? ? A  G   571  N2    ? ? ? 1_555 A  C   584  O2    ? ? A G   572  A C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog619  hydrog ? ? A  G   571  O6    ? ? ? 1_555 A  C   584  N4    ? ? A G   572  A C   585  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog620  hydrog ? ? A  A   572  N1    ? ? ? 1_555 A  U   583  N3    ? ? A A   573  A U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog621  hydrog ? ? A  A   572  N6    ? ? ? 1_555 A  U   583  O4    ? ? A A   573  A U   584  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog622  hydrog ? ? A  C   573  N3    ? ? ? 1_555 A  G   582  N1    ? ? A C   574  A G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog623  hydrog ? ? A  C   573  N4    ? ? ? 1_555 A  G   582  O6    ? ? A C   574  A G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog624  hydrog ? ? A  C   573  O2    ? ? ? 1_555 A  G   582  N2    ? ? A C   574  A G   583  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog625  hydrog ? ? A  G   574  N1    ? ? ? 1_555 A  C   581  N3    ? ? A G   575  A C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog626  hydrog ? ? A  G   574  N2    ? ? ? 1_555 A  C   581  O2    ? ? A G   575  A C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog627  hydrog ? ? A  G   574  O6    ? ? ? 1_555 A  C   581  N4    ? ? A G   575  A C   582  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog628  hydrog ? ? A  C   575  N3    ? ? ? 1_555 A  G   580  N1    ? ? A C   576  A G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog629  hydrog ? ? A  C   575  N4    ? ? ? 1_555 A  G   580  O6    ? ? A C   576  A G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog630  hydrog ? ? A  C   575  O2    ? ? ? 1_555 A  G   580  N2    ? ? A C   576  A G   581  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog631  hydrog ? ? A  G   576  N2    ? ? ? 1_555 A  A   579  N7    ? ? A G   577  A A   580  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog632  hydrog ? ? A  G   578  N2    ? ? ? 1_555 A  U   1110 O2    ? ? A G   579  A U   1111 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog633  hydrog ? ? A  A   579  N3    ? ? ? 1_555 A  G   1109 N2    ? ? A A   580  A G   1110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog634  hydrog ? ? A  G   587  N2    ? ? ? 1_555 A  U   588  O4    ? ? A G   588  A U   589  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog635  hydrog ? ? A  G   603  N1    ? ? ? 1_555 A  G   606  O6    ? ? A G   604  A G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog636  hydrog ? ? A  G   603  N2    ? ? ? 1_555 A  G   606  N7    ? ? A G   604  A G   607  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog637  hydrog ? ? A  U   618  N3    ? ? ? 1_555 A  A   2073 N1    ? ? A U   619  A A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog638  hydrog ? ? A  U   618  O4    ? ? ? 1_555 A  A   2073 N6    ? ? A U   619  A A   2074 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog639  hydrog ? ? A  A   619  N6    ? ? ? 1_555 A  A   634  N1    ? ? A A   620  A A   635  1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog640  hydrog ? ? A  C   620  N3    ? ? ? 1_555 A  G   633  N1    ? ? A C   621  A G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog641  hydrog ? ? A  C   620  N4    ? ? ? 1_555 A  G   633  O6    ? ? A C   621  A G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog642  hydrog ? ? A  C   620  O2    ? ? ? 1_555 A  G   633  N2    ? ? A C   621  A G   634  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog643  hydrog ? ? A  G   621  N1    ? ? ? 1_555 A  C   632  N3    ? ? A G   622  A C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog644  hydrog ? ? A  G   621  N2    ? ? ? 1_555 A  C   632  O2    ? ? A G   622  A C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog645  hydrog ? ? A  G   621  O6    ? ? ? 1_555 A  C   632  N4    ? ? A G   622  A C   633  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog646  hydrog ? ? A  U   622  N3    ? ? ? 1_555 A  A   631  N1    ? ? A U   623  A A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog647  hydrog ? ? A  U   622  O4    ? ? ? 1_555 A  A   631  N6    ? ? A U   623  A A   632  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog648  hydrog ? ? A  U   623  N3    ? ? ? 1_555 A  A   627  N7    ? ? A U   624  A A   628  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog649  hydrog ? ? A  U   624  O2    ? ? ? 1_555 A  C   2070 N4    ? ? A U   625  A C   2071 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog650  hydrog ? ? A  U   625  O2    ? ? ? 1_555 A  A   1080 N6    ? ? A U   626  A A   1081 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog651  hydrog ? ? A  A   628  N1    ? ? ? 1_555 A  G   2069 N2    ? ? A A   629  A G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog652  hydrog ? ? A  A   628  N6    ? ? ? 1_555 A  G   2069 N3    ? ? A A   629  A G   2070 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog653  hydrog ? ? A  G   635  N1    ? ? ? 1_555 A  C   1364 N3    ? ? A G   636  A C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog654  hydrog ? ? A  G   635  N2    ? ? ? 1_555 A  C   1364 O2    ? ? A G   636  A C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog655  hydrog ? ? A  G   635  O6    ? ? ? 1_555 A  C   1364 N4    ? ? A G   636  A C   1365 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog656  hydrog ? ? A  C   636  N3    ? ? ? 1_555 A  G   1363 N1    ? ? A C   637  A G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog657  hydrog ? ? A  C   636  N4    ? ? ? 1_555 A  G   1363 O6    ? ? A C   637  A G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog658  hydrog ? ? A  C   636  O2    ? ? ? 1_555 A  G   1363 N2    ? ? A C   637  A G   1364 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog659  hydrog ? ? A  C   637  N3    ? ? ? 1_555 A  G   1362 N1    ? ? A C   638  A G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog660  hydrog ? ? A  C   637  N4    ? ? ? 1_555 A  G   1362 O6    ? ? A C   638  A G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog661  hydrog ? ? A  C   637  O2    ? ? ? 1_555 A  G   1362 N2    ? ? A C   638  A G   1363 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog662  hydrog ? ? A  A   638  N1    ? ? ? 1_555 A  U   1361 N3    ? ? A A   639  A U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog663  hydrog ? ? A  A   638  N6    ? ? ? 1_555 A  U   1361 O4    ? ? A A   639  A U   1362 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog664  hydrog ? ? A  G   639  N1    ? ? ? 1_555 A  C   1360 N3    ? ? A G   640  A C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog665  hydrog ? ? A  G   639  N2    ? ? ? 1_555 A  C   1360 O2    ? ? A G   640  A C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog666  hydrog ? ? A  G   639  O6    ? ? ? 1_555 A  C   1360 N4    ? ? A G   640  A C   1361 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog667  hydrog ? ? A  G   640  N1    ? ? ? 1_555 A  C   1359 N3    ? ? A G   641  A C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog668  hydrog ? ? A  G   640  N2    ? ? ? 1_555 A  C   1359 O2    ? ? A G   641  A C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog669  hydrog ? ? A  G   640  O6    ? ? ? 1_555 A  C   1359 N4    ? ? A G   641  A C   1360 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog670  hydrog ? ? A  G   641  N2    ? ? ? 1_555 A  A   1357 N7    ? ? A G   642  A A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog671  hydrog ? ? A  G   641  N3    ? ? ? 1_555 A  A   1357 N6    ? ? A G   642  A A   1358 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog672  hydrog ? ? A  A   642  N3    ? ? ? 1_555 A  G   901  N2    ? ? A A   643  A G   902  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog673  hydrog ? ? A  A   642  N6    ? ? ? 1_555 A  A   1354 N7    ? ? A A   643  A A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog674  hydrog ? ? A  A   642  N7    ? ? ? 1_555 A  A   1354 N6    ? ? A A   643  A A   1355 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog675  hydrog ? ? A  G   643  N1    ? ? ? 1_555 A  U   902  O2    ? ? A G   644  A U   903  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog676  hydrog ? ? A  U   644  N3    ? ? ? 1_555 A  A   760  N3    ? ? A U   645  A A   761  1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog677  hydrog ? ? A  G   645  N1    ? ? ? 1_555 A  C   758  N3    ? ? A G   646  A C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog678  hydrog ? ? A  G   645  N2    ? ? ? 1_555 A  C   758  O2    ? ? A G   646  A C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog679  hydrog ? ? A  G   645  O6    ? ? ? 1_555 A  C   758  N4    ? ? A G   646  A C   759  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog680  hydrog ? ? A  U   646  N3    ? ? ? 1_555 A  A   757  N1    ? ? A U   647  A A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog681  hydrog ? ? A  U   646  O4    ? ? ? 1_555 A  A   757  N6    ? ? A U   647  A A   758  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog682  hydrog ? ? A  G   647  N1    ? ? ? 1_555 A  C   756  N3    ? ? A G   648  A C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog683  hydrog ? ? A  G   647  N2    ? ? ? 1_555 A  C   756  O2    ? ? A G   648  A C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog684  hydrog ? ? A  G   647  O6    ? ? ? 1_555 A  C   756  N4    ? ? A G   648  A C   757  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog685  hydrog ? ? A  U   648  N3    ? ? ? 1_555 A  A   755  N1    ? ? A U   649  A A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog686  hydrog ? ? A  U   648  O4    ? ? ? 1_555 A  A   755  N6    ? ? A U   649  A A   756  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog687  hydrog ? ? A  C   649  N3    ? ? ? 1_555 A  G   754  N1    ? ? A C   650  A G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog688  hydrog ? ? A  C   649  N4    ? ? ? 1_555 A  G   754  O6    ? ? A C   650  A G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog689  hydrog ? ? A  C   649  O2    ? ? ? 1_555 A  G   754  N2    ? ? A C   650  A G   755  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog690  hydrog ? ? A  U   650  N3    ? ? ? 1_555 A  G   753  O6    ? ? A U   651  A G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog691  hydrog ? ? A  U   650  O2    ? ? ? 1_555 A  G   753  N1    ? ? A U   651  A G   754  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog692  hydrog ? ? A  G   651  N1    ? ? ? 1_555 A  U   752  O2    ? ? A G   652  A U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog693  hydrog ? ? A  G   651  O6    ? ? ? 1_555 A  U   752  N3    ? ? A G   652  A U   753  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog694  hydrog ? ? A  C   652  N3    ? ? ? 1_555 A  G   751  N1    ? ? A C   653  A G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog695  hydrog ? ? A  C   652  N4    ? ? ? 1_555 A  G   751  O6    ? ? A C   653  A G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog696  hydrog ? ? A  C   652  O2    ? ? ? 1_555 A  G   751  N2    ? ? A C   653  A G   752  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog697  hydrog ? ? A  A   653  N1    ? ? ? 1_555 A  U   750  N3    ? ? A A   654  A U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog698  hydrog ? ? A  A   653  N6    ? ? ? 1_555 A  U   750  O4    ? ? A A   654  A U   751  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog699  hydrog ? ? A  U   654  N3    ? ? ? 1_555 A  A   749  N1    ? ? A U   655  A A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog700  hydrog ? ? A  U   654  O4    ? ? ? 1_555 A  A   749  N6    ? ? A U   655  A A   750  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog701  hydrog ? ? A  G   655  N1    ? ? ? 1_555 A  C   748  N3    ? ? A G   656  A C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog702  hydrog ? ? A  G   655  N2    ? ? ? 1_555 A  C   748  O2    ? ? A G   656  A C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog703  hydrog ? ? A  G   655  O6    ? ? ? 1_555 A  C   748  N4    ? ? A G   656  A C   749  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog704  hydrog ? ? A  G   656  N1    ? ? ? 1_555 A  C   747  N3    ? ? A G   657  A C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog705  hydrog ? ? A  G   656  N2    ? ? ? 1_555 A  C   747  O2    ? ? A G   657  A C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog706  hydrog ? ? A  G   656  O6    ? ? ? 1_555 A  C   747  N4    ? ? A G   657  A C   748  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog707  hydrog ? ? A  C   657  N3    ? ? ? 1_555 A  G   746  N1    ? ? A C   658  A G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog708  hydrog ? ? A  C   657  N4    ? ? ? 1_555 A  G   746  O6    ? ? A C   658  A G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog709  hydrog ? ? A  C   657  O2    ? ? ? 1_555 A  G   746  N2    ? ? A C   658  A G   747  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog710  hydrog ? ? A  G   660  N1    ? ? ? 1_555 A  C   684  N3    ? ? A G   661  A C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog711  hydrog ? ? A  G   660  N2    ? ? ? 1_555 A  C   684  O2    ? ? A G   661  A C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog712  hydrog ? ? A  G   660  O6    ? ? ? 1_555 A  C   684  N4    ? ? A G   661  A C   685  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog713  hydrog ? ? A  U   661  N3    ? ? ? 1_555 A  G   683  O6    ? ? A U   662  A G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog714  hydrog ? ? A  U   661  O2    ? ? ? 1_555 A  G   683  N1    ? ? A U   662  A G   684  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog715  hydrog ? ? A  C   662  N3    ? ? ? 1_555 A  G   682  N1    ? ? A C   663  A G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog716  hydrog ? ? A  C   662  N4    ? ? ? 1_555 A  G   682  O6    ? ? A C   663  A G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog717  hydrog ? ? A  C   662  O2    ? ? ? 1_555 A  G   682  N2    ? ? A C   663  A G   683  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog718  hydrog ? ? A  U   663  N3    ? ? ? 1_555 A  A   681  N7    ? ? A U   664  A A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog719  hydrog ? ? A  U   663  O2    ? ? ? 1_555 A  A   681  N6    ? ? A U   664  A A   682  1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog720  hydrog ? ? A  A   665  N6    ? ? ? 1_555 A  G   679  N3    ? ? A A   666  A G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog721  hydrog ? ? A  A   665  N7    ? ? ? 1_555 A  G   679  N2    ? ? A A   666  A G   680  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog722  hydrog ? ? A  C   666  N3    ? ? ? 1_555 A  G   678  N1    ? ? A C   667  A G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog723  hydrog ? ? A  C   666  N4    ? ? ? 1_555 A  G   678  O6    ? ? A C   667  A G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog724  hydrog ? ? A  C   666  O2    ? ? ? 1_555 A  G   678  N2    ? ? A C   667  A G   679  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog725  hydrog ? ? A  C   667  N3    ? ? ? 1_555 A  G   677  N1    ? ? A C   668  A G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog726  hydrog ? ? A  C   667  N4    ? ? ? 1_555 A  G   677  O6    ? ? A C   668  A G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog727  hydrog ? ? A  C   667  O2    ? ? ? 1_555 A  G   677  N2    ? ? A C   668  A G   678  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog728  hydrog ? ? A  G   668  N1    ? ? ? 1_555 A  C   676  N3    ? ? A G   669  A C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog729  hydrog ? ? A  G   668  N2    ? ? ? 1_555 A  C   676  O2    ? ? A G   669  A C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog730  hydrog ? ? A  G   668  O6    ? ? ? 1_555 A  C   676  N4    ? ? A G   669  A C   677  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog731  hydrog ? ? A  G   669  N1    ? ? ? 1_555 A  C   675  N3    ? ? A G   670  A C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog732  hydrog ? ? A  G   669  N2    ? ? ? 1_555 A  C   675  O2    ? ? A G   670  A C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog733  hydrog ? ? A  G   669  O6    ? ? ? 1_555 A  C   675  N4    ? ? A G   670  A C   676  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog734  hydrog ? ? A  G   688  N1    ? ? ? 1_555 A  C   695  N3    ? ? A G   689  A C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog735  hydrog ? ? A  G   688  N2    ? ? ? 1_555 A  C   695  O2    ? ? A G   689  A C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog736  hydrog ? ? A  G   688  O6    ? ? ? 1_555 A  C   695  N4    ? ? A G   689  A C   696  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog737  hydrog ? ? A  G   689  N1    ? ? ? 1_555 A  C   694  N3    ? ? A G   690  A C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog738  hydrog ? ? A  G   689  N2    ? ? ? 1_555 A  C   694  O2    ? ? A G   690  A C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog739  hydrog ? ? A  G   689  O6    ? ? ? 1_555 A  C   694  N4    ? ? A G   690  A C   695  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog740  hydrog ? ? A  G   690  N2    ? ? ? 1_555 A  A   693  N7    ? ? A G   691  A A   694  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog741  hydrog ? ? A  A   691  N1    ? ? ? 1_555 A  G   2452 N2    ? ? A A   692  A G   2453 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog742  hydrog ? ? A  A   697  N3    ? ? ? 1_555 A  G   741  N2    ? ? A A   698  A G   742  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog743  hydrog ? ? A  C   698  N3    ? ? ? 1_555 A  G   726  N1    ? ? A C   699  A G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog744  hydrog ? ? A  C   698  N4    ? ? ? 1_555 A  G   726  O6    ? ? A C   699  A G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog745  hydrog ? ? A  C   698  O2    ? ? ? 1_555 A  G   726  N2    ? ? A C   699  A G   727  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog746  hydrog ? ? A  G   701  N1    ? ? ? 1_555 A  C   725  N3    ? ? A G   702  A C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog747  hydrog ? ? A  G   701  N2    ? ? ? 1_555 A  C   725  O2    ? ? A G   702  A C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog748  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  C   725  N4    ? ? A G   702  A C   726  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog749  hydrog ? ? A  G   701  N7    ? ? ? 1_555 A  G   743  N2    ? ? A G   702  A G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog750  hydrog ? ? A  G   701  O6    ? ? ? 1_555 A  G   743  N1    ? ? A G   702  A G   744  1_555 ? ? ? ? ? ? TYPE_6_PAIR ? ? 
hydrog751  hydrog ? ? A  G   702  N1    ? ? ? 1_555 A  C   724  N3    ? ? A G   703  A C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog752  hydrog ? ? A  G   702  N2    ? ? ? 1_555 A  C   724  O2    ? ? A G   703  A C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog753  hydrog ? ? A  G   702  O6    ? ? ? 1_555 A  C   724  N4    ? ? A G   703  A C   725  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog754  hydrog ? ? A  C   703  N3    ? ? ? 1_555 A  G   723  N1    ? ? A C   704  A G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog755  hydrog ? ? A  C   703  N4    ? ? ? 1_555 A  G   723  O6    ? ? A C   704  A G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog756  hydrog ? ? A  C   703  O2    ? ? ? 1_555 A  G   723  N2    ? ? A C   704  A G   724  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog757  hydrog ? ? A  C   704  N3    ? ? ? 1_555 A  G   722  N1    ? ? A C   705  A G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog758  hydrog ? ? A  C   704  N4    ? ? ? 1_555 A  G   722  O6    ? ? A C   705  A G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog759  hydrog ? ? A  C   704  O2    ? ? ? 1_555 A  G   722  N2    ? ? A C   705  A G   723  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog760  hydrog ? ? A  G   705  N2    ? ? ? 1_555 A  G   721  O6    ? ? A G   706  A G   722  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog761  hydrog ? ? A  C   706  N3    ? ? ? 1_555 A  A   720  N6    ? ? A C   707  A A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog762  hydrog ? ? A  C   706  N4    ? ? ? 1_555 A  A   720  N7    ? ? A C   707  A A   721  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog763  hydrog ? ? A  A   707  N6    ? ? ? 1_555 A  G   719  N3    ? ? A A   708  A G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog764  hydrog ? ? A  A   707  N7    ? ? ? 1_555 A  G   719  N2    ? ? A A   708  A G   720  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog765  hydrog ? ? A  G   708  N1    ? ? ? 1_555 A  C   718  N3    ? ? A G   709  A C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog766  hydrog ? ? A  G   708  N2    ? ? ? 1_555 A  C   718  O2    ? ? A G   709  A C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog767  hydrog ? ? A  G   708  O6    ? ? ? 1_555 A  C   718  N4    ? ? A G   709  A C   719  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog768  hydrog ? ? A  G   708  O6    ? ? ? 1_555 A  G   719  N2    ? ? A G   709  A G   720  1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog769  hydrog ? ? A  G   709  N1    ? ? ? 1_555 A  C   717  N3    ? ? A G   710  A C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog770  hydrog ? ? A  G   709  N2    ? ? ? 1_555 A  C   717  O2    ? ? A G   710  A C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog771  hydrog ? ? A  G   709  O6    ? ? ? 1_555 A  C   717  N4    ? ? A G   710  A C   718  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog772  hydrog ? ? A  G   710  N1    ? ? ? 1_555 A  C   716  N3    ? ? A G   711  A C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog773  hydrog ? ? A  G   710  N2    ? ? ? 1_555 A  C   716  O2    ? ? A G   711  A C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog774  hydrog ? ? A  G   710  O6    ? ? ? 1_555 A  C   716  N4    ? ? A G   711  A C   717  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog775  hydrog ? ? A  C   711  N3    ? ? ? 1_555 A  G   715  N1    ? ? A C   712  A G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog776  hydrog ? ? A  C   711  N4    ? ? ? 1_555 A  G   715  O6    ? ? A C   712  A G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog777  hydrog ? ? A  C   711  O2    ? ? ? 1_555 A  G   715  N2    ? ? A C   712  A G   716  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog778  hydrog ? ? A  C   725  N4    ? ? ? 1_555 A  G   743  O6    ? ? A C   726  A G   744  1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog779  hydrog ? ? A  C   727  N3    ? ? ? 1_555 A  G   742  N1    ? ? A C   728  A G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog780  hydrog ? ? A  C   727  N4    ? ? ? 1_555 A  G   742  O6    ? ? A C   728  A G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog781  hydrog ? ? A  C   727  O2    ? ? ? 1_555 A  G   742  N2    ? ? A C   728  A G   743  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog782  hydrog ? ? A  C   728  N3    ? ? ? 1_555 A  G   741  N1    ? ? A C   729  A G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog783  hydrog ? ? A  C   728  N4    ? ? ? 1_555 A  G   741  O6    ? ? A C   729  A G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog784  hydrog ? ? A  C   728  O2    ? ? ? 1_555 A  G   741  N2    ? ? A C   729  A G   742  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog785  hydrog ? ? A  G   729  N1    ? ? ? 1_555 A  C   740  N3    ? ? A G   730  A C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog786  hydrog ? ? A  G   729  N2    ? ? ? 1_555 A  C   740  O2    ? ? A G   730  A C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog787  hydrog ? ? A  G   729  O6    ? ? ? 1_555 A  C   740  N4    ? ? A G   730  A C   741  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog788  hydrog ? ? A  U   730  N3    ? ? ? 1_555 A  G   739  O6    ? ? A U   731  A G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog789  hydrog ? ? A  U   730  O2    ? ? ? 1_555 A  G   739  N1    ? ? A U   731  A G   740  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog790  hydrog ? ? A  C   731  N3    ? ? ? 1_555 A  G   738  N1    ? ? A C   732  A G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog791  hydrog ? ? A  C   731  N4    ? ? ? 1_555 A  G   738  O6    ? ? A C   732  A G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog792  hydrog ? ? A  C   731  O2    ? ? ? 1_555 A  G   738  N2    ? ? A C   732  A G   739  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog793  hydrog ? ? A  U   732  N3    ? ? ? 1_555 A  G   737  O6    ? ? A U   733  A G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog794  hydrog ? ? A  U   732  O2    ? ? ? 1_555 A  G   737  N1    ? ? A U   733  A G   738  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog795  hydrog ? ? A  C   761  N3    ? ? ? 1_555 A  G   901  N1    ? ? A C   762  A G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog796  hydrog ? ? A  C   761  N4    ? ? ? 1_555 A  G   901  O6    ? ? A C   762  A G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog797  hydrog ? ? A  C   761  O2    ? ? ? 1_555 A  G   901  N2    ? ? A C   762  A G   902  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog798  hydrog ? ? A  C   762  N3    ? ? ? 1_555 A  G   900  N1    ? ? A C   763  A G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog799  hydrog ? ? A  C   762  N4    ? ? ? 1_555 A  G   900  O6    ? ? A C   763  A G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog800  hydrog ? ? A  C   762  O2    ? ? ? 1_555 A  G   900  N2    ? ? A C   763  A G   901  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog801  hydrog ? ? A  C   763  N4    ? ? ? 1_555 A  U   899  O4    ? ? A C   764  A U   900  1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog802  hydrog ? ? A  G   764  N1    ? ? ? 1_555 A  C   898  N3    ? ? A G   765  A C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog803  hydrog ? ? A  G   764  N2    ? ? ? 1_555 A  C   898  O2    ? ? A G   765  A C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog804  hydrog ? ? A  G   764  O6    ? ? ? 1_555 A  C   898  N4    ? ? A G   765  A C   899  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog805  hydrog ? ? A  A   765  N6    ? ? ? 1_555 A  C   895  N3    ? ? A A   766  A C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog806  hydrog ? ? A  A   765  N7    ? ? ? 1_555 A  C   895  N4    ? ? A A   766  A C   896  1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog807  hydrog ? ? A  A   766  N6    ? ? ? 1_555 A  A   894  N1    ? ? A A   767  A A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog808  hydrog ? ? A  A   766  N7    ? ? ? 1_555 A  A   894  N6    ? ? A A   767  A A   895  1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog809  hydrog ? ? A  A   766  N3    ? ? ? 1_555 A  G   2109 N2    ? ? A A   767  A G   2110 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog810  hydrog ? ? A  U   767  O4    ? ? ? 1_555 A  C   892  N4    ? ? A U   768  A C   893  1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog811  hydrog ? ? A  C   768  N3    ? ? ? 1_555 A  G   891  N1    ? ? A C   769  A G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog812  hydrog ? ? A  C   768  N4    ? ? ? 1_555 A  G   891  O6    ? ? A C   769  A G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog813  hydrog ? ? A  C   768  O2    ? ? ? 1_555 A  G   891  N2    ? ? A C   769  A G   892  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog814  hydrog ? ? A  C   769  N3    ? ? ? 1_555 A  G   890  N1    ? ? A C   770  A G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog815  hydrog ? ? A  C   769  N4    ? ? ? 1_555 A  G   890  O6    ? ? A C   770  A G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog816  hydrog ? ? A  C   769  O2    ? ? ? 1_555 A  G   890  N2    ? ? A C   770  A G   891  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog817  hydrog ? ? A  G   770  N1    ? ? ? 1_555 A  C   889  N3    ? ? A G   771  A C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog818  hydrog ? ? A  G   770  N2    ? ? ? 1_555 A  C   889  O2    ? ? A G   771  A C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog819  hydrog ? ? A  G   770  O6    ? ? ? 1_555 A  C   889  N4    ? ? A G   771  A C   890  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog820  hydrog ? ? A  G   771  N1    ? ? ? 1_555 A  C   888  N3    ? ? A G   772  A C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog821  hydrog ? ? A  G   771  N2    ? ? ? 1_555 A  C   888  O2    ? ? A G   772  A C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog822  hydrog ? ? A  G   771  O6    ? ? ? 1_555 A  C   888  N4    ? ? A G   772  A C   889  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog823  hydrog ? ? A  A   772  N1    ? ? ? 1_555 A  U   887  N3    ? ? A A   773  A U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog824  hydrog ? ? A  A   772  N6    ? ? ? 1_555 A  U   887  O4    ? ? A A   773  A U   888  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog825  hydrog ? ? A  C   773  N3    ? ? ? 1_555 A  G   886  N1    ? ? A C   774  A G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog826  hydrog ? ? A  C   773  N4    ? ? ? 1_555 A  G   886  O6    ? ? A C   774  A G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog827  hydrog ? ? A  C   773  O2    ? ? ? 1_555 A  G   886  N2    ? ? A C   774  A G   887  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog828  hydrog ? ? A  G   774  N1    ? ? ? 1_555 A  G   867  N7    ? ? A G   775  A G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog829  hydrog ? ? A  G   774  N2    ? ? ? 1_555 A  G   867  O6    ? ? A G   775  A G   868  1_555 ? ? ? ? ? ? TYPE_7_PAIR ? ? 
hydrog830  hydrog ? ? A  A   775  N3    ? ? ? 1_555 A  U   778  N3    ? ? A A   776  A U   779  1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog831  hydrog ? ? A  A   775  N1    ? ? ? 1_555 A  G   870  N2    ? ? A A   776  A G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog832  hydrog ? ? A  A   775  N6    ? ? ? 1_555 A  G   870  N3    ? ? A A   776  A G   871  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog833  hydrog ? ? A  C   777  O2    ? ? ? 1_555 A  A   1835 N6    ? ? A C   778  A A   1836 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog834  hydrog ? ? A  A   779  N1    ? ? ? 1_555 A  U   865  N3    ? ? A A   780  A U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog835  hydrog ? ? A  A   779  N6    ? ? ? 1_555 A  U   865  O4    ? ? A A   780  A U   866  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog836  hydrog ? ? A  C   780  N3    ? ? ? 1_555 A  G   864  N1    ? ? A C   781  A G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog837  hydrog ? ? A  C   780  N4    ? ? ? 1_555 A  G   864  O6    ? ? A C   781  A G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog838  hydrog ? ? A  C   780  O2    ? ? ? 1_555 A  G   864  N2    ? ? A C   781  A G   865  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog839  hydrog ? ? A  G   781  N1    ? ? ? 1_555 A  U   863  O2    ? ? A G   782  A U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog840  hydrog ? ? A  G   781  O6    ? ? ? 1_555 A  U   863  N3    ? ? A G   782  A U   864  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog841  hydrog ? ? A  C   782  N3    ? ? ? 1_555 A  G   862  N1    ? ? A C   783  A G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog842  hydrog ? ? A  C   782  N4    ? ? ? 1_555 A  G   862  O6    ? ? A C   783  A G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog843  hydrog ? ? A  C   782  O2    ? ? ? 1_555 A  G   862  N2    ? ? A C   783  A G   863  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog844  hydrog ? ? A  A   783  N1    ? ? ? 1_555 A  U   861  N3    ? ? A A   784  A U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog845  hydrog ? ? A  A   783  N6    ? ? ? 1_555 A  U   861  O4    ? ? A A   784  A U   862  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog846  hydrog ? ? A  U   784  N3    ? ? ? 1_555 A  A   860  N1    ? ? A U   785  A A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog847  hydrog ? ? A  U   784  O4    ? ? ? 1_555 A  A   860  N6    ? ? A U   785  A A   861  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog848  hydrog ? ? A  G   785  N1    ? ? ? 1_555 A  U   859  O2    ? ? A G   786  A U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog849  hydrog ? ? A  G   785  O6    ? ? ? 1_555 A  U   859  N3    ? ? A G   786  A U   860  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog850  hydrog ? ? A  G   786  N1    ? ? ? 1_555 A  C   858  N3    ? ? A G   787  A C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog851  hydrog ? ? A  G   786  N2    ? ? ? 1_555 A  C   858  O2    ? ? A G   787  A C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog852  hydrog ? ? A  G   786  O6    ? ? ? 1_555 A  C   858  N4    ? ? A G   787  A C   859  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog853  hydrog ? ? A  A   787  N1    ? ? ? 1_555 A  U   857  N3    ? ? A A   788  A U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog854  hydrog ? ? A  A   787  N6    ? ? ? 1_555 A  U   857  O4    ? ? A A   788  A U   858  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog855  hydrog ? ? A  C   788  N3    ? ? ? 1_555 A  G   855  N1    ? ? A C   789  A G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog856  hydrog ? ? A  C   788  N4    ? ? ? 1_555 A  G   855  O6    ? ? A C   789  A G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog857  hydrog ? ? A  C   788  O2    ? ? ? 1_555 A  G   855  N2    ? ? A C   789  A G   856  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog858  hydrog ? ? A  A   789  N6    ? ? ? 1_555 A  G   823  N3    ? ? A A   790  A G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog859  hydrog ? ? A  A   789  N7    ? ? ? 1_555 A  G   823  N2    ? ? A A   790  A G   824  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog860  hydrog ? ? A  A   789  N1    ? ? ? 1_555 A  G   1708 N2    ? ? A A   790  A G   1709 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog861  hydrog ? ? A  A   790  N1    ? ? ? 1_555 A  U   822  N3    ? ? A A   791  A U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog862  hydrog ? ? A  A   790  N6    ? ? ? 1_555 A  U   822  O4    ? ? A A   791  A U   823  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog863  hydrog ? ? A  G   791  N1    ? ? ? 1_555 A  C   821  N3    ? ? A G   792  A C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog864  hydrog ? ? A  G   791  N2    ? ? ? 1_555 A  C   821  O2    ? ? A G   792  A C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog865  hydrog ? ? A  G   791  O6    ? ? ? 1_555 A  C   821  N4    ? ? A G   792  A C   822  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog866  hydrog ? ? A  A   792  N1    ? ? ? 1_555 A  U   820  N3    ? ? A A   793  A U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog867  hydrog ? ? A  A   792  N6    ? ? ? 1_555 A  U   820  O4    ? ? A A   793  A U   821  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog868  hydrog ? ? A  U   793  N3    ? ? ? 1_555 A  A   818  N1    ? ? A U   794  A A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog869  hydrog ? ? A  U   793  O4    ? ? ? 1_555 A  A   818  N6    ? ? A U   794  A A   819  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog870  hydrog ? ? A  G   794  N2    ? ? ? 1_555 A  A   817  N7    ? ? A G   795  A A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog871  hydrog ? ? A  G   794  N3    ? ? ? 1_555 A  A   817  N6    ? ? A G   795  A A   818  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog872  hydrog ? ? A  A   795  N6    ? ? ? 1_555 A  G   816  N3    ? ? A A   796  A G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog873  hydrog ? ? A  A   795  N7    ? ? ? 1_555 A  G   816  N2    ? ? A A   796  A G   817  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog874  hydrog ? ? A  A   796  N6    ? ? ? 1_555 A  G   815  N3    ? ? A A   797  A G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog875  hydrog ? ? A  A   796  N7    ? ? ? 1_555 A  G   815  N2    ? ? A A   797  A G   816  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog876  hydrog ? ? A  G   797  N1    ? ? ? 1_555 A  U   814  O2    ? ? A G   798  A U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog877  hydrog ? ? A  G   797  O6    ? ? ? 1_555 A  U   814  N3    ? ? A G   798  A U   815  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog878  hydrog ? ? A  C   798  N3    ? ? ? 1_555 A  G   813  N1    ? ? A C   799  A G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog879  hydrog ? ? A  C   798  N4    ? ? ? 1_555 A  G   813  O6    ? ? A C   799  A G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog880  hydrog ? ? A  C   798  O2    ? ? ? 1_555 A  G   813  N2    ? ? A C   799  A G   814  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog881  hydrog ? ? A  G   799  N1    ? ? ? 1_555 A  C   812  N3    ? ? A G   800  A C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog882  hydrog ? ? A  G   799  N2    ? ? ? 1_555 A  C   812  O2    ? ? A G   800  A C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog883  hydrog ? ? A  G   799  O6    ? ? ? 1_555 A  C   812  N4    ? ? A G   800  A C   813  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog884  hydrog ? ? A  U   800  N3    ? ? ? 1_555 A  A   811  N1    ? ? A U   801  A A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog885  hydrog ? ? A  U   800  O4    ? ? ? 1_555 A  A   811  N6    ? ? A U   801  A A   812  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog886  hydrog ? ? A  G   801  N1    ? ? ? 1_555 A  C   810  N3    ? ? A G   802  A C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog887  hydrog ? ? A  G   801  N2    ? ? ? 1_555 A  C   810  O2    ? ? A G   802  A C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog888  hydrog ? ? A  G   801  O6    ? ? ? 1_555 A  C   810  N4    ? ? A G   802  A C   811  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog889  hydrog ? ? A  C   802  N3    ? ? ? 1_555 A  G   809  N1    ? ? A C   803  A G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog890  hydrog ? ? A  C   802  N4    ? ? ? 1_555 A  G   809  O6    ? ? A C   803  A G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog891  hydrog ? ? A  C   802  O2    ? ? ? 1_555 A  G   809  N2    ? ? A C   803  A G   810  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog892  hydrog ? ? A  C   803  N3    ? ? ? 1_555 A  G   808  N1    ? ? A C   804  A G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog893  hydrog ? ? A  C   803  N4    ? ? ? 1_555 A  G   808  O6    ? ? A C   804  A G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog894  hydrog ? ? A  C   803  O2    ? ? ? 1_555 A  G   808  N2    ? ? A C   804  A G   809  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog895  hydrog ? ? A  G   804  N2    ? ? ? 1_555 A  A   807  N7    ? ? A G   805  A A   808  1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog896  hydrog ? ? A  G   819  N1    ? ? ? 1_555 A  C   1829 N3    ? ? A G   820  A C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog897  hydrog ? ? A  G   819  N2    ? ? ? 1_555 A  C   1829 O2    ? ? A G   820  A C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog898  hydrog ? ? A  G   819  O6    ? ? ? 1_555 A  C   1829 N4    ? ? A G   820  A C   1830 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog899  hydrog ? ? A  G   823  N1    ? ? ? 1_555 A  U   825  O4    ? ? A G   824  A U   826  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog900  hydrog ? ? A  A   826  N6    ? ? ? 1_555 A  G   853  N3    ? ? A A   827  A G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog901  hydrog ? ? A  A   826  N7    ? ? ? 1_555 A  G   853  N2    ? ? A A   827  A G   854  1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog902  hydrog ? ? A  G   827  N1    ? ? ? 1_555 A  C   852  N3    ? ? A G   828  A C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog903  hydrog ? ? A  G   827  N2    ? ? ? 1_555 A  C   852  O2    ? ? A G   828  A C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog904  hydrog ? ? A  G   827  O6    ? ? ? 1_555 A  C   852  N4    ? ? A G   828  A C   853  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog905  hydrog ? ? A  A   828  N1    ? ? ? 1_555 A  U   851  N3    ? ? A A   829  A U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog906  hydrog ? ? A  A   828  N6    ? ? ? 1_555 A  U   851  O4    ? ? A A   829  A U   852  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog907  hydrog ? ? A  G   829  N1    ? ? ? 1_555 A  C   850  N3    ? ? A G   830  A C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog908  hydrog ? ? A  G   829  N2    ? ? ? 1_555 A  C   850  O2    ? ? A G   830  A C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog909  hydrog ? ? A  G   829  O6    ? ? ? 1_555 A  C   850  N4    ? ? A G   830  A C   851  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog910  hydrog ? ? A  G   829  N2    ? ? ? 1_555 A  A   2021 N1    ? ? A G   830  A A   2022 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog911  hydrog ? ? A  U   831  N3    ? ? ? 1_555 A  U   849  O2    ? ? A U   832  A U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog912  hydrog ? ? A  U   831  O4    ? ? ? 1_555 A  U   849  N3    ? ? A U   832  A U   850  1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog913  hydrog ? ? A  G   832  N1    ? ? ? 1_555 A  C   848  N3    ? ? A G   833  A C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog914  hydrog ? ? A  G   832  N2    ? ? ? 1_555 A  C   848  O2    ? ? A G   833  A C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog915  hydrog ? ? A  G   832  O6    ? ? ? 1_555 A  C   848  N4    ? ? A G   833  A C   849  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog916  hydrog ? ? A  G   833  N1    ? ? ? 1_555 A  C   847  N3    ? ? A G   834  A C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog917  hydrog ? ? A  G   833  N2    ? ? ? 1_555 A  C   847  O2    ? ? A G   834  A C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog918  hydrog ? ? A  G   833  O6    ? ? ? 1_555 A  C   847  N4    ? ? A G   834  A C   848  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog919  hydrog ? ? A  G   835  N1    ? ? ? 1_555 A  C   846  N3    ? ? A G   836  A C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog920  hydrog ? ? A  G   835  N2    ? ? ? 1_555 A  C   846  O2    ? ? A G   836  A C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog921  hydrog ? ? A  G   835  O6    ? ? ? 1_555 A  C   846  N4    ? ? A G   836  A C   847  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog922  hydrog ? ? A  U   836  N3    ? ? ? 1_555 A  A   845  N1    ? ? A U   837  A A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog923  hydrog ? ? A  U   836  O4    ? ? ? 1_555 A  A   845  N6    ? ? A U   837  A A   846  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog924  hydrog ? ? A  C   837  O2    ? ? ? 1_555 A  A   842  N6    ? ? A C   838  A A   843  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog925  hydrog ? ? A  U   839  N3    ? ? ? 1_555 A  A   2054 N3    ? ? A U   840  A A   2055 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog926  hydrog ? ? A  C   841  N4    ? ? ? 1_555 A  A   845  N3    ? ? A C   842  A A   846  1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog927  hydrog ? ? A  A   856  N6    ? ? ? 1_555 A  U   1830 O4    ? ? A A   857  A U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog928  hydrog ? ? A  A   856  N7    ? ? ? 1_555 A  U   1830 N3    ? ? A A   857  A U   1831 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog929  hydrog ? ? A  A   856  N6    ? ? ? 1_555 A  A   1844 N3    ? ? A A   857  A A   1845 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog930  hydrog ? ? A  A   860  N3    ? ? ? 1_555 A  U   1487 N3    ? ? A A   861  A U   1488 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog931  hydrog ? ? A  G   862  N2    ? ? ? 1_555 A  A   1458 N3    ? ? A G   863  A A   1459 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog932  hydrog ? ? A  A   866  N3    ? ? ? 1_555 A  G   869  N2    ? ? A A   867  A G   870  1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog933  hydrog ? ? A  G   867  N1    ? ? ? 1_555 A  C   883  N3    ? ? A G   868  A C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog934  hydrog ? ? A  G   867  N2    ? ? ? 1_555 A  C   883  O2    ? ? A G   868  A C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog935  hydrog ? ? A  G   867  O6    ? ? ? 1_555 A  C   883  N4    ? ? A G   868  A C   884  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog936  hydrog ? ? A  G   869  N1    ? ? ? 1_555 A  C   879  N3    ? ? A G   870  A C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog937  hydrog ? ? A  G   869  N2    ? ? ? 1_555 A  C   879  O2    ? ? A G   870  A C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog938  hydrog ? ? A  G   869  O6    ? ? ? 1_555 A  C   879  N4    ? ? A G   870  A C   880  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog939  hydrog ? ? A  G   870  N1    ? ? ? 1_555 A  C   878  N3    ? ? A G   871  A C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog940  hydrog ? ? A  G   870  N2    ? ? ? 1_555 A  C   878  O2    ? ? A G   871  A C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog941  hydrog ? ? A  G   870  O6    ? ? ? 1_555 A  C   878  N4    ? ? A G   871  A C   879  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog942  hydrog ? ? A  U   871  N3    ? ? ? 1_555 A  G   877  O6    ? ? A U   872  A G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog943  hydrog ? ? A  U   871  O2    ? ? ? 1_555 A  G   877  N1    ? ? A U   872  A G   878  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog944  hydrog ? ? A  G   872  N2    ? ? ? 1_555 A  A   875  N1    ? ? A G   873  A A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog945  hydrog ? ? A  G   872  N3    ? ? ? 1_555 A  A   875  N6    ? ? A G   873  A A   876  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog946  hydrog ? ? A  A   873  N3    ? ? ? 1_555 A  G   1831 N2    ? ? A A   874  A G   1832 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog947  hydrog ? ? A  G   884  N2    ? ? ? 1_555 A  G   2112 N3    ? ? A G   885  A G   2113 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog948  hydrog ? ? A  U   899  O2    ? ? ? 1_555 A  A   2100 N6    ? ? A U   900  A A   2101 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog949  hydrog ? ? A  C   904  N3    ? ? ? 1_555 A  G   1299 N1    ? ? A C   905  A G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog950  hydrog ? ? A  C   904  N4    ? ? ? 1_555 A  G   1299 O6    ? ? A C   905  A G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog951  hydrog ? ? A  C   904  O2    ? ? ? 1_555 A  G   1299 N2    ? ? A C   905  A G   1300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog952  hydrog ? ? A  C   905  N3    ? ? ? 1_555 A  G   1298 N1    ? ? A C   906  A G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog953  hydrog ? ? A  C   905  N4    ? ? ? 1_555 A  G   1298 O6    ? ? A C   906  A G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog954  hydrog ? ? A  C   905  O2    ? ? ? 1_555 A  G   1298 N2    ? ? A C   906  A G   1299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog955  hydrog ? ? A  A   906  N1    ? ? ? 1_555 A  U   1297 N3    ? ? A A   907  A U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog956  hydrog ? ? A  A   906  N6    ? ? ? 1_555 A  U   1297 O4    ? ? A A   907  A U   1298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog957  hydrog ? ? A  A   907  N1    ? ? ? 1_555 A  U   1296 N3    ? ? A A   908  A U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog958  hydrog ? ? A  A   907  N6    ? ? ? 1_555 A  U   1296 O4    ? ? A A   908  A U   1297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog959  hydrog ? ? A  U   908  N3    ? ? ? 1_555 A  A   1295 N1    ? ? A U   909  A A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog960  hydrog ? ? A  U   908  O4    ? ? ? 1_555 A  A   1295 N6    ? ? A U   909  A A   1296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog961  hydrog ? ? A  C   909  N3    ? ? ? 1_555 A  G   1294 N1    ? ? A C   910  A G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog962  hydrog ? ? A  C   909  N4    ? ? ? 1_555 A  G   1294 O6    ? ? A C   910  A G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog963  hydrog ? ? A  C   909  O2    ? ? ? 1_555 A  G   1294 N2    ? ? A C   910  A G   1295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog964  hydrog ? ? A  G   910  N2    ? ? ? 1_555 A  A   1293 N7    ? ? A G   911  A A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog965  hydrog ? ? A  G   910  N3    ? ? ? 1_555 A  A   1293 N6    ? ? A G   911  A A   1294 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog966  hydrog ? ? A  A   911  N6    ? ? ? 1_555 A  U   1292 O2    ? ? A A   912  A U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog967  hydrog ? ? A  A   911  N7    ? ? ? 1_555 A  U   1292 N3    ? ? A A   912  A U   1293 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog968  hydrog ? ? A  A   912  N6    ? ? ? 1_555 A  G   1070 O6    ? ? A A   913  A G   1071 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog969  hydrog ? ? A  A   913  N6    ? ? ? 1_555 A  A   1069 N3    ? ? A A   914  A A   1070 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog970  hydrog ? ? A  C   914  N3    ? ? ? 1_555 A  G   927  N1    ? ? A C   915  A G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog971  hydrog ? ? A  C   914  N4    ? ? ? 1_555 A  G   927  O6    ? ? A C   915  A G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog972  hydrog ? ? A  C   914  O2    ? ? ? 1_555 A  G   927  N2    ? ? A C   915  A G   928  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog973  hydrog ? ? A  C   914  N4    ? ? ? 1_555 A  U   1041 O2    ? ? A C   915  A U   1042 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog974  hydrog ? ? A  A   915  N1    ? ? ? 1_555 A  U   926  N3    ? ? A A   916  A U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog975  hydrog ? ? A  A   915  N6    ? ? ? 1_555 A  U   926  O4    ? ? A A   916  A U   927  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog976  hydrog ? ? A  A   915  N6    ? ? ? 1_555 A  C   1042 O2    ? ? A A   916  A C   1043 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog977  hydrog ? ? A  U   916  N3    ? ? ? 1_555 A  A   925  N1    ? ? A U   917  A A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog978  hydrog ? ? A  U   916  O4    ? ? ? 1_555 A  A   925  N6    ? ? A U   917  A A   926  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog979  hydrog ? ? A  G   917  N1    ? ? ? 1_555 A  C   924  N3    ? ? A G   918  A C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog980  hydrog ? ? A  G   917  N2    ? ? ? 1_555 A  C   924  O2    ? ? A G   918  A C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog981  hydrog ? ? A  G   917  O6    ? ? ? 1_555 A  C   924  N4    ? ? A G   918  A C   925  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog982  hydrog ? ? A  U   918  N3    ? ? ? 1_555 A  G   923  O6    ? ? A U   919  A G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog983  hydrog ? ? A  U   918  O2    ? ? ? 1_555 A  G   923  N1    ? ? A U   919  A G   924  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog984  hydrog ? ? A  G   920  O6    ? ? ? 1_555 A  G   2278 N2    ? ? A G   921  A G   2279 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog985  hydrog ? ? A  A   922  N6    ? ? ? 1_555 A  U   2106 O2    ? ? A A   923  A U   2107 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog986  hydrog ? ? A  A   922  N6    ? ? ? 1_555 A  G   2479 N3    ? ? A A   923  A G   2480 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog987  hydrog ? ? A  A   925  N6    ? ? ? 1_555 A  C   1042 N3    ? ? A A   926  A C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog988  hydrog ? ? A  A   925  N7    ? ? ? 1_555 A  C   1042 N4    ? ? A A   926  A C   1043 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog989  hydrog ? ? A  G   927  N2    ? ? ? 1_555 A  A   2393 N1    ? ? A G   928  A A   2394 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog990  hydrog ? ? A  A   928  N6    ? ? ? 1_555 A  U   1040 O4    ? ? A A   929  A U   1041 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog991  hydrog ? ? A  C   929  O2    ? ? ? 1_555 A  A   1039 N6    ? ? A C   930  A A   1040 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog992  hydrog ? ? A  C   930  N3    ? ? ? 1_555 A  G   1038 N1    ? ? A C   931  A G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog993  hydrog ? ? A  C   930  N4    ? ? ? 1_555 A  G   1038 O6    ? ? A C   931  A G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog994  hydrog ? ? A  C   930  O2    ? ? ? 1_555 A  G   1038 N2    ? ? A C   931  A G   1039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog995  hydrog ? ? A  U   931  N3    ? ? ? 1_555 A  G   1037 O6    ? ? A U   932  A G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog996  hydrog ? ? A  U   931  O2    ? ? ? 1_555 A  G   1037 N1    ? ? A U   932  A G   1038 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog997  hydrog ? ? A  C   932  N3    ? ? ? 1_555 A  G   1036 N1    ? ? A C   933  A G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog998  hydrog ? ? A  C   932  N4    ? ? ? 1_555 A  G   1036 O6    ? ? A C   933  A G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog999  hydrog ? ? A  C   932  O2    ? ? ? 1_555 A  G   1036 N2    ? ? A C   933  A G   1037 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1000 hydrog ? ? A  C   933  N3    ? ? ? 1_555 A  G   1035 N1    ? ? A C   934  A G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1001 hydrog ? ? A  C   933  N4    ? ? ? 1_555 A  G   1035 O6    ? ? A C   934  A G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1002 hydrog ? ? A  C   933  O2    ? ? ? 1_555 A  G   1035 N2    ? ? A C   934  A G   1036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1003 hydrog ? ? A  G   934  N1    ? ? ? 1_555 A  C   1034 N3    ? ? A G   935  A C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1004 hydrog ? ? A  G   934  N2    ? ? ? 1_555 A  C   1034 O2    ? ? A G   935  A C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1005 hydrog ? ? A  G   934  O6    ? ? ? 1_555 A  C   1034 N4    ? ? A G   935  A C   1035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1006 hydrog ? ? A  C   935  N3    ? ? ? 1_555 A  G   1033 N1    ? ? A C   936  A G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1007 hydrog ? ? A  C   935  N4    ? ? ? 1_555 A  G   1033 O6    ? ? A C   936  A G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1008 hydrog ? ? A  C   935  O2    ? ? ? 1_555 A  G   1033 N2    ? ? A C   936  A G   1034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1009 hydrog ? ? A  C   936  O2    ? ? ? 1_555 A  C   1032 N4    ? ? A C   937  A C   1033 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1010 hydrog ? ? A  G   937  N2    ? ? ? 1_555 A  A   1031 N7    ? ? A G   938  A A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1011 hydrog ? ? A  A   938  N3    ? ? ? 1_555 A  G   1026 N2    ? ? A A   939  A G   1027 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1012 hydrog ? ? A  A   938  N6    ? ? ? 1_555 A  G   1030 N3    ? ? A A   939  A G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1013 hydrog ? ? A  A   938  N7    ? ? ? 1_555 A  G   1030 N2    ? ? A A   939  A G   1031 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1014 hydrog ? ? A  G   939  N1    ? ? ? 1_555 A  C   1025 O2    ? ? A G   940  A C   1026 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1015 hydrog ? ? A  G   939  N2    ? ? ? 1_555 A  A   1031 N3    ? ? A G   940  A A   1032 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1016 hydrog ? ? A  G   940  N1    ? ? ? 1_555 A  C   1024 N3    ? ? A G   941  A C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1017 hydrog ? ? A  G   940  N2    ? ? ? 1_555 A  C   1024 O2    ? ? A G   941  A C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1018 hydrog ? ? A  G   940  O6    ? ? ? 1_555 A  C   1024 N4    ? ? A G   941  A C   1025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1019 hydrog ? ? A  U   941  N3    ? ? ? 1_555 A  G   1023 O6    ? ? A U   942  A G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1020 hydrog ? ? A  U   941  O2    ? ? ? 1_555 A  G   1023 N1    ? ? A U   942  A G   1024 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1021 hydrog ? ? A  A   942  N6    ? ? ? 1_555 A  C   1024 O2    ? ? A A   943  A C   1025 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1022 hydrog ? ? A  G   943  N1    ? ? ? 1_555 A  C   1022 N3    ? ? A G   944  A C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1023 hydrog ? ? A  G   943  N2    ? ? ? 1_555 A  C   1022 O2    ? ? A G   944  A C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1024 hydrog ? ? A  G   943  O6    ? ? ? 1_555 A  C   1022 N4    ? ? A G   944  A C   1023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1025 hydrog ? ? A  U   944  N3    ? ? ? 1_555 A  A   1021 N1    ? ? A U   945  A A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1026 hydrog ? ? A  U   944  O4    ? ? ? 1_555 A  A   1021 N6    ? ? A U   945  A A   1022 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1027 hydrog ? ? A  C   945  N3    ? ? ? 1_555 A  G   1020 N1    ? ? A C   946  A G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1028 hydrog ? ? A  C   945  N4    ? ? ? 1_555 A  G   1020 O6    ? ? A C   946  A G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1029 hydrog ? ? A  C   945  O2    ? ? ? 1_555 A  G   1020 N2    ? ? A C   946  A G   1021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1030 hydrog ? ? A  U   946  N3    ? ? ? 1_555 A  A   1019 N1    ? ? A U   947  A A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1031 hydrog ? ? A  U   946  O4    ? ? ? 1_555 A  A   1019 N6    ? ? A U   947  A A   1020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1032 hydrog ? ? A  G   947  N1    ? ? ? 1_555 A  C   1018 N3    ? ? A G   948  A C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1033 hydrog ? ? A  G   947  N2    ? ? ? 1_555 A  C   1018 O2    ? ? A G   948  A C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1034 hydrog ? ? A  G   947  O6    ? ? ? 1_555 A  C   1018 N4    ? ? A G   948  A C   1019 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1035 hydrog ? ? A  U   948  N3    ? ? ? 1_555 A  A   1017 N1    ? ? A U   949  A A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1036 hydrog ? ? A  U   948  O4    ? ? ? 1_555 A  A   1017 N6    ? ? A U   949  A A   1018 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1037 hydrog ? ? A  G   949  N1    ? ? ? 1_555 A  U   1016 O2    ? ? A G   950  A U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1038 hydrog ? ? A  G   949  O6    ? ? ? 1_555 A  U   1016 N3    ? ? A G   950  A U   1017 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1039 hydrog ? ? A  A   950  N1    ? ? ? 1_555 A  U   1015 N3    ? ? A A   951  A U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1040 hydrog ? ? A  A   950  N6    ? ? ? 1_555 A  U   1015 O4    ? ? A A   951  A U   1016 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1041 hydrog ? ? A  G   951  N1    ? ? ? 1_555 A  C   1014 N3    ? ? A G   952  A C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1042 hydrog ? ? A  G   951  N2    ? ? ? 1_555 A  C   1014 O2    ? ? A G   952  A C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1043 hydrog ? ? A  G   951  O6    ? ? ? 1_555 A  C   1014 N4    ? ? A G   952  A C   1015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1044 hydrog ? ? A  G   952  N2    ? ? ? 1_555 A  U   953  O4    ? ? A G   953  A U   954  1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1045 hydrog ? ? A  U   953  N3    ? ? ? 1_555 A  A   1012 N7    ? ? A U   954  A A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1046 hydrog ? ? A  U   953  O2    ? ? ? 1_555 A  A   1012 N6    ? ? A U   954  A A   1013 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1047 hydrog ? ? A  A   954  N6    ? ? ? 1_555 A  A   1011 N3    ? ? A A   955  A A   1012 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1048 hydrog ? ? A  G   955  N1    ? ? ? 1_555 A  C   1010 N3    ? ? A G   956  A C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1049 hydrog ? ? A  G   955  N2    ? ? ? 1_555 A  C   1010 O2    ? ? A G   956  A C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1050 hydrog ? ? A  G   955  O6    ? ? ? 1_555 A  C   1010 N4    ? ? A G   956  A C   1011 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1051 hydrog ? ? A  A   956  N1    ? ? ? 1_555 A  U   1008 N3    ? ? A A   957  A U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1052 hydrog ? ? A  A   956  N6    ? ? ? 1_555 A  U   1008 O4    ? ? A A   957  A U   1009 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1053 hydrog ? ? A  G   957  N2    ? ? ? 1_555 A  A   960  N1    ? ? A G   958  A A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1054 hydrog ? ? A  G   957  N3    ? ? ? 1_555 A  A   960  N6    ? ? A G   958  A A   961  1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1055 hydrog ? ? A  G   957  N1    ? ? ? 1_555 A  C   1007 N3    ? ? A G   958  A C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1056 hydrog ? ? A  G   957  N2    ? ? ? 1_555 A  C   1007 O2    ? ? A G   958  A C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1057 hydrog ? ? A  G   957  O6    ? ? ? 1_555 A  C   1007 N4    ? ? A G   958  A C   1008 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1058 hydrog ? ? A  C   958  O2    ? ? ? 1_555 A  C   961  N4    ? ? A C   959  A C   962  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1059 hydrog ? ? A  C   958  O2    ? ? ? 1_555 A  C   962  N4    ? ? A C   959  A C   963  1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1060 hydrog ? ? A  C   958  N3    ? ? ? 1_555 A  A   1004 N6    ? ? A C   959  A A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1061 hydrog ? ? A  C   958  N4    ? ? ? 1_555 A  A   1004 N7    ? ? A C   959  A A   1005 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1062 hydrog ? ? A  C   961  N4    ? ? ? 1_555 A  C   1007 O2    ? ? A C   962  A C   1008 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1063 hydrog ? ? A  C   962  O2    ? ? ? 1_555 A  A   1004 N6    ? ? A C   963  A A   1005 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1064 hydrog ? ? A  G   963  N1    ? ? ? 1_555 A  C   1003 N3    ? ? A G   964  A C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1065 hydrog ? ? A  G   963  N2    ? ? ? 1_555 A  C   1003 O2    ? ? A G   964  A C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1066 hydrog ? ? A  G   963  O6    ? ? ? 1_555 A  C   1003 N4    ? ? A G   964  A C   1004 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1067 hydrog ? ? A  A   964  N1    ? ? ? 1_555 A  U   1002 N3    ? ? A A   965  A U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1068 hydrog ? ? A  A   964  N6    ? ? ? 1_555 A  U   1002 O4    ? ? A A   965  A U   1003 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1069 hydrog ? ? A  U   965  O2    ? ? ? 1_555 A  G   1001 N1    ? ? A U   966  A G   1002 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1070 hydrog ? ? A  U   966  N3    ? ? ? 1_555 A  U   1000 O2    ? ? A U   967  A U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1071 hydrog ? ? A  U   966  O4    ? ? ? 1_555 A  U   1000 N3    ? ? A U   967  A U   1001 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1072 hydrog ? ? A  G   967  N1    ? ? ? 1_555 A  C   999  N3    ? ? A G   968  A C   1000 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1073 hydrog ? ? A  G   968  N1    ? ? ? 1_555 A  C   998  N3    ? ? A G   969  A C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1074 hydrog ? ? A  G   968  N2    ? ? ? 1_555 A  C   998  O2    ? ? A G   969  A C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1075 hydrog ? ? A  G   968  O6    ? ? ? 1_555 A  C   998  N4    ? ? A G   969  A C   999  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1076 hydrog ? ? A  G   968  N1    ? ? ? 1_555 A  C   999  N3    ? ? A G   969  A C   1000 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1077 hydrog ? ? A  U   1008 O2    ? ? ? 1_555 A  C   1009 N4    ? ? A U   1009 A C   1010 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1078 hydrog ? ? A  A   1013 N6    ? ? ? 1_555 A  A   2301 N7    ? ? A A   1014 A A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1079 hydrog ? ? A  A   1013 N7    ? ? ? 1_555 A  A   2301 N6    ? ? A A   1014 A A   2302 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1080 hydrog ? ? A  G   1044 N1    ? ? ? 1_555 A  C   1068 N3    ? ? A G   1045 A C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1081 hydrog ? ? A  G   1044 N2    ? ? ? 1_555 A  C   1068 O2    ? ? A G   1045 A C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1082 hydrog ? ? A  G   1044 O6    ? ? ? 1_555 A  C   1068 N4    ? ? A G   1045 A C   1069 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1083 hydrog ? ? A  G   1045 N1    ? ? ? 1_555 A  C   1067 N3    ? ? A G   1046 A C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1084 hydrog ? ? A  G   1045 N2    ? ? ? 1_555 A  C   1067 O2    ? ? A G   1046 A C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1085 hydrog ? ? A  G   1045 O6    ? ? ? 1_555 A  C   1067 N4    ? ? A G   1046 A C   1068 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1086 hydrog ? ? A  G   1045 N2    ? ? ? 1_555 A  A   1081 N3    ? ? A G   1046 A A   1082 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1087 hydrog ? ? A  U   1046 N3    ? ? ? 1_555 A  A   1066 N1    ? ? A U   1047 A A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1088 hydrog ? ? A  U   1046 O4    ? ? ? 1_555 A  A   1066 N6    ? ? A U   1047 A A   1067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1089 hydrog ? ? A  G   1047 N1    ? ? ? 1_555 A  U   1065 O2    ? ? A G   1048 A U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1090 hydrog ? ? A  G   1047 O6    ? ? ? 1_555 A  U   1065 N3    ? ? A G   1048 A U   1066 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1091 hydrog ? ? A  C   1048 N3    ? ? ? 1_555 A  G   1064 N1    ? ? A C   1049 A G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1092 hydrog ? ? A  C   1048 N4    ? ? ? 1_555 A  G   1064 O6    ? ? A C   1049 A G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1093 hydrog ? ? A  C   1048 O2    ? ? ? 1_555 A  G   1064 N2    ? ? A C   1049 A G   1065 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1094 hydrog ? ? A  G   1049 N1    ? ? ? 1_555 A  U   1063 O2    ? ? A G   1050 A U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1095 hydrog ? ? A  G   1049 O6    ? ? ? 1_555 A  U   1063 N3    ? ? A G   1050 A U   1064 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1096 hydrog ? ? A  C   1050 N3    ? ? ? 1_555 A  G   1062 N1    ? ? A C   1051 A G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1097 hydrog ? ? A  C   1050 N4    ? ? ? 1_555 A  G   1062 O6    ? ? A C   1051 A G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1098 hydrog ? ? A  C   1050 O2    ? ? ? 1_555 A  G   1062 N2    ? ? A C   1051 A G   1063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1099 hydrog ? ? A  G   1051 N1    ? ? ? 1_555 A  U   1061 O2    ? ? A G   1052 A U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1100 hydrog ? ? A  G   1051 O6    ? ? ? 1_555 A  U   1061 N3    ? ? A G   1052 A U   1062 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1101 hydrog ? ? A  G   1052 N1    ? ? ? 1_555 A  C   1060 N3    ? ? A G   1053 A C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1102 hydrog ? ? A  G   1052 N2    ? ? ? 1_555 A  C   1060 O2    ? ? A G   1053 A C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1103 hydrog ? ? A  G   1052 O6    ? ? ? 1_555 A  C   1060 N4    ? ? A G   1053 A C   1061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1104 hydrog ? ? A  G   1052 N2    ? ? ? 1_555 A  U   2307 O2    ? ? A G   1053 A U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1105 hydrog ? ? A  G   1053 N1    ? ? ? 1_555 A  C   1059 N3    ? ? A G   1054 A C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1106 hydrog ? ? A  G   1053 N2    ? ? ? 1_555 A  C   1059 O2    ? ? A G   1054 A C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1107 hydrog ? ? A  G   1053 O6    ? ? ? 1_555 A  C   1059 N4    ? ? A G   1054 A C   1060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1108 hydrog ? ? A  G   1053 N2    ? ? ? 1_555 A  G   2282 O6    ? ? A G   1054 A G   2283 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1109 hydrog ? ? A  G   1054 N2    ? ? ? 1_555 A  A   1057 N7    ? ? A G   1055 A A   1058 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1110 hydrog ? ? A  U   1055 O4    ? ? ? 1_555 A  G   2528 N2    ? ? A U   1056 A G   2529 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1111 hydrog ? ? A  A   1057 N3    ? ? ? 1_555 A  G   2490 N2    ? ? A A   1058 A G   2491 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1112 hydrog ? ? A  G   1062 N2    ? ? ? 1_555 A  A   2300 N7    ? ? A G   1063 A A   2301 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1113 hydrog ? ? A  G   1071 N2    ? ? ? 1_555 A  A   1087 N7    ? ? A G   1072 A A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1114 hydrog ? ? A  G   1071 N3    ? ? ? 1_555 A  A   1087 N6    ? ? A G   1072 A A   1088 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1115 hydrog ? ? A  A   1072 N6    ? ? ? 1_555 A  A   1085 N3    ? ? A A   1073 A A   1086 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1116 hydrog ? ? A  A   1072 N7    ? ? ? 1_555 A  G   1086 N2    ? ? A A   1073 A G   1087 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1117 hydrog ? ? A  G   1073 N1    ? ? ? 1_555 A  C   1084 N3    ? ? A G   1074 A C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1118 hydrog ? ? A  G   1073 N2    ? ? ? 1_555 A  C   1084 O2    ? ? A G   1074 A C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1119 hydrog ? ? A  G   1073 O6    ? ? ? 1_555 A  C   1084 N4    ? ? A G   1074 A C   1085 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1120 hydrog ? ? A  G   1074 N1    ? ? ? 1_555 A  C   1083 N3    ? ? A G   1075 A C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1121 hydrog ? ? A  G   1074 N2    ? ? ? 1_555 A  C   1083 O2    ? ? A G   1075 A C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1122 hydrog ? ? A  G   1074 O6    ? ? ? 1_555 A  C   1083 N4    ? ? A G   1075 A C   1084 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1123 hydrog ? ? A  G   1074 N2    ? ? ? 1_555 A  A   1097 N3    ? ? A G   1075 A A   1098 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1124 hydrog ? ? A  G   1075 N1    ? ? ? 1_555 A  C   1082 N3    ? ? A G   1076 A C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1125 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 A  C   1082 O2    ? ? A G   1076 A C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1126 hydrog ? ? A  G   1075 O6    ? ? ? 1_555 A  C   1082 N4    ? ? A G   1076 A C   1083 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1127 hydrog ? ? A  G   1075 N2    ? ? ? 1_555 B  U   87   O4    ? ? A G   1076 B U   3087 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1128 hydrog ? ? A  G   1076 N2    ? ? ? 1_555 A  C   1082 N3    ? ? A G   1077 A C   1083 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1129 hydrog ? ? A  A   1078 N3    ? ? ? 1_555 A  G   2067 N2    ? ? A A   1079 A G   2068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1130 hydrog ? ? A  C   1082 O2    ? ? ? 1_555 A  A   1123 N6    ? ? A C   1083 A A   1124 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1131 hydrog ? ? A  G   1088 N1    ? ? ? 1_555 A  C   1266 N3    ? ? A G   1089 A C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1132 hydrog ? ? A  G   1088 N2    ? ? ? 1_555 A  C   1266 O2    ? ? A G   1089 A C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1133 hydrog ? ? A  G   1088 O6    ? ? ? 1_555 A  C   1266 N4    ? ? A G   1089 A C   1267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1134 hydrog ? ? A  A   1089 N1    ? ? ? 1_555 A  U   1265 N3    ? ? A A   1090 A U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1135 hydrog ? ? A  A   1089 N6    ? ? ? 1_555 A  U   1265 O4    ? ? A A   1090 A U   1266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1136 hydrog ? ? A  U   1090 N3    ? ? ? 1_555 A  G   1264 O6    ? ? A U   1091 A G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1137 hydrog ? ? A  U   1090 O2    ? ? ? 1_555 A  G   1264 N1    ? ? A U   1091 A G   1265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1138 hydrog ? ? A  A   1091 N1    ? ? ? 1_555 A  U   1263 N3    ? ? A A   1092 A U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1139 hydrog ? ? A  A   1091 N6    ? ? ? 1_555 A  U   1263 O4    ? ? A A   1092 A U   1264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1140 hydrog ? ? A  G   1092 N1    ? ? ? 1_555 A  C   1262 N3    ? ? A G   1093 A C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1141 hydrog ? ? A  G   1092 N2    ? ? ? 1_555 A  C   1262 O2    ? ? A G   1093 A C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1142 hydrog ? ? A  G   1092 O6    ? ? ? 1_555 A  C   1262 N4    ? ? A G   1093 A C   1263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1143 hydrog ? ? A  G   1093 N1    ? ? ? 1_555 A  C   1261 N3    ? ? A G   1094 A C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1144 hydrog ? ? A  G   1093 N2    ? ? ? 1_555 A  C   1261 O2    ? ? A G   1094 A C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1145 hydrog ? ? A  G   1093 O6    ? ? ? 1_555 A  C   1261 N4    ? ? A G   1094 A C   1262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1146 hydrog ? ? A  U   1094 N3    ? ? ? 1_555 A  A   1260 N1    ? ? A U   1095 A A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1147 hydrog ? ? A  U   1094 O4    ? ? ? 1_555 A  A   1260 N6    ? ? A U   1095 A A   1261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1148 hydrog ? ? A  U   1095 N3    ? ? ? 1_555 A  A   1258 N7    ? ? A U   1096 A A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1149 hydrog ? ? A  U   1095 O2    ? ? ? 1_555 A  A   1258 N6    ? ? A U   1096 A A   1259 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1150 hydrog ? ? A  A   1097 N6    ? ? ? 1_555 A  G   1257 N3    ? ? A A   1098 A G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1151 hydrog ? ? A  A   1097 N7    ? ? ? 1_555 A  G   1257 N2    ? ? A A   1098 A G   1258 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1152 hydrog ? ? A  G   1098 N1    ? ? ? 1_555 A  C   1256 N3    ? ? A G   1099 A C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1153 hydrog ? ? A  G   1098 N2    ? ? ? 1_555 A  C   1256 O2    ? ? A G   1099 A C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1154 hydrog ? ? A  G   1098 O6    ? ? ? 1_555 A  C   1256 N4    ? ? A G   1099 A C   1257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1155 hydrog ? ? A  G   1099 N2    ? ? ? 1_555 A  A   1106 N3    ? ? A G   1100 A A   1107 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1156 hydrog ? ? A  G   1099 N1    ? ? ? 1_555 A  C   1255 N3    ? ? A G   1100 A C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1157 hydrog ? ? A  G   1099 N2    ? ? ? 1_555 A  C   1255 O2    ? ? A G   1100 A C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1158 hydrog ? ? A  G   1099 O6    ? ? ? 1_555 A  C   1255 N4    ? ? A G   1100 A C   1256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1159 hydrog ? ? A  U   1100 N3    ? ? ? 1_555 A  A   1254 N1    ? ? A U   1101 A A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1160 hydrog ? ? A  U   1100 O4    ? ? ? 1_555 A  A   1254 N6    ? ? A U   1101 A A   1255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1161 hydrog ? ? A  C   1101 N3    ? ? ? 1_555 A  G   1240 N1    ? ? A C   1102 A G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1162 hydrog ? ? A  C   1101 N4    ? ? ? 1_555 A  G   1240 O6    ? ? A C   1102 A G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1163 hydrog ? ? A  C   1101 O2    ? ? ? 1_555 A  G   1240 N2    ? ? A C   1102 A G   1241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1164 hydrog ? ? A  C   1102 N3    ? ? ? 1_555 A  G   1239 N1    ? ? A C   1103 A G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1165 hydrog ? ? A  C   1102 N4    ? ? ? 1_555 A  G   1239 O6    ? ? A C   1103 A G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1166 hydrog ? ? A  C   1102 O2    ? ? ? 1_555 A  G   1239 N2    ? ? A C   1103 A G   1240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1167 hydrog ? ? A  C   1103 N3    ? ? ? 1_555 A  G   1238 N1    ? ? A C   1104 A G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1168 hydrog ? ? A  C   1103 N4    ? ? ? 1_555 A  G   1238 O6    ? ? A C   1104 A G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1169 hydrog ? ? A  C   1103 O2    ? ? ? 1_555 A  G   1238 N2    ? ? A C   1104 A G   1239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1170 hydrog ? ? A  C   1104 O2    ? ? ? 1_555 A  A   1105 N6    ? ? A C   1105 A A   1106 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1171 hydrog ? ? A  G   1107 N1    ? ? ? 1_555 A  C   1253 N3    ? ? A G   1108 A C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1172 hydrog ? ? A  G   1107 N2    ? ? ? 1_555 A  C   1253 O2    ? ? A G   1108 A C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1173 hydrog ? ? A  G   1107 O6    ? ? ? 1_555 A  C   1253 N4    ? ? A G   1108 A C   1254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1174 hydrog ? ? A  U   1108 N3    ? ? ? 1_555 A  A   1246 N7    ? ? A U   1109 A A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1175 hydrog ? ? A  U   1108 O4    ? ? ? 1_555 A  A   1246 N6    ? ? A U   1109 A A   1247 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1176 hydrog ? ? A  G   1109 N1    ? ? ? 1_555 A  C   1252 N3    ? ? A G   1110 A C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1177 hydrog ? ? A  G   1109 N2    ? ? ? 1_555 A  C   1252 O2    ? ? A G   1110 A C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1178 hydrog ? ? A  G   1109 O6    ? ? ? 1_555 A  C   1252 N4    ? ? A G   1110 A C   1253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1179 hydrog ? ? A  U   1110 N3    ? ? ? 1_555 A  A   1251 N1    ? ? A U   1111 A A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1180 hydrog ? ? A  U   1110 O4    ? ? ? 1_555 A  A   1251 N6    ? ? A U   1111 A A   1252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1181 hydrog ? ? A  G   1111 N1    ? ? ? 1_555 A  C   1250 N3    ? ? A G   1112 A C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1182 hydrog ? ? A  G   1111 N2    ? ? ? 1_555 A  C   1250 O2    ? ? A G   1112 A C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1183 hydrog ? ? A  G   1111 O6    ? ? ? 1_555 A  C   1250 N4    ? ? A G   1112 A C   1251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1184 hydrog ? ? A  G   1112 N1    ? ? ? 1_555 A  C   1249 N3    ? ? A G   1113 A C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1185 hydrog ? ? A  G   1112 N2    ? ? ? 1_555 A  C   1249 O2    ? ? A G   1113 A C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1186 hydrog ? ? A  G   1112 O6    ? ? ? 1_555 A  C   1249 N4    ? ? A G   1113 A C   1250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1187 hydrog ? ? A  A   1113 N1    ? ? ? 1_555 A  U   1248 N3    ? ? A A   1114 A U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1188 hydrog ? ? A  A   1113 N6    ? ? ? 1_555 A  U   1248 O4    ? ? A A   1114 A U   1249 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1189 hydrog ? ? A  U   1114 N3    ? ? ? 1_555 A  A   1247 N1    ? ? A U   1115 A A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1190 hydrog ? ? A  U   1114 O4    ? ? ? 1_555 A  A   1247 N6    ? ? A U   1115 A A   1248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1191 hydrog ? ? A  U   1115 O2    ? ? ? 1_555 A  A   1245 N6    ? ? A U   1116 A A   1246 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1192 hydrog ? ? A  A   1117 N6    ? ? ? 1_555 A  U   1243 O2    ? ? A A   1118 A U   1244 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1193 hydrog ? ? A  G   1118 N2    ? ? ? 1_555 A  U   1119 O4    ? ? A G   1119 A U   1120 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1194 hydrog ? ? A  G   1120 N1    ? ? ? 1_555 A  C   1242 N3    ? ? A G   1121 A C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1195 hydrog ? ? A  G   1120 N2    ? ? ? 1_555 A  C   1242 O2    ? ? A G   1121 A C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1196 hydrog ? ? A  G   1120 O6    ? ? ? 1_555 A  C   1242 N4    ? ? A G   1121 A C   1243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1197 hydrog ? ? A  U   1121 N3    ? ? ? 1_555 A  A   1241 N1    ? ? A U   1122 A A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1198 hydrog ? ? A  U   1121 O4    ? ? ? 1_555 A  A   1241 N6    ? ? A U   1122 A A   1242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1199 hydrog ? ? A  A   1131 N6    ? ? ? 1_555 A  A   1229 N7    ? ? A A   1132 A A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1200 hydrog ? ? A  A   1131 N7    ? ? ? 1_555 A  A   1229 N6    ? ? A A   1132 A A   1230 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1201 hydrog ? ? A  A   1132 N6    ? ? ? 1_555 A  C   1228 O2    ? ? A A   1133 A C   1229 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1202 hydrog ? ? A  A   1132 N3    ? ? ? 1_555 A  G   2519 N2    ? ? A A   1133 A G   2520 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1203 hydrog ? ? A  G   1133 N1    ? ? ? 1_555 A  C   1227 N3    ? ? A G   1134 A C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1204 hydrog ? ? A  G   1133 N2    ? ? ? 1_555 A  C   1227 O2    ? ? A G   1134 A C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1205 hydrog ? ? A  G   1133 O6    ? ? ? 1_555 A  C   1227 N4    ? ? A G   1134 A C   1228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1206 hydrog ? ? A  G   1134 N1    ? ? ? 1_555 A  C   1226 N3    ? ? A G   1135 A C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1207 hydrog ? ? A  G   1134 N2    ? ? ? 1_555 A  C   1226 O2    ? ? A G   1135 A C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1208 hydrog ? ? A  G   1134 O6    ? ? ? 1_555 A  C   1226 N4    ? ? A G   1135 A C   1227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1209 hydrog ? ? A  U   1135 N3    ? ? ? 1_555 A  G   1225 O6    ? ? A U   1136 A G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1210 hydrog ? ? A  U   1135 O2    ? ? ? 1_555 A  G   1225 N1    ? ? A U   1136 A G   1226 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1211 hydrog ? ? A  G   1137 N1    ? ? ? 1_555 A  C   1224 N3    ? ? A G   1138 A C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1212 hydrog ? ? A  G   1137 N2    ? ? ? 1_555 A  C   1224 O2    ? ? A G   1138 A C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1213 hydrog ? ? A  G   1137 O6    ? ? ? 1_555 A  C   1224 N4    ? ? A G   1138 A C   1225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1214 hydrog ? ? A  U   1138 N3    ? ? ? 1_555 A  G   1223 O6    ? ? A U   1139 A G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1215 hydrog ? ? A  U   1138 O2    ? ? ? 1_555 A  G   1223 N1    ? ? A U   1139 A G   1224 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1216 hydrog ? ? A  C   1139 N3    ? ? ? 1_555 A  G   1222 N1    ? ? A C   1140 A G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1217 hydrog ? ? A  C   1139 N4    ? ? ? 1_555 A  G   1222 O6    ? ? A C   1140 A G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1218 hydrog ? ? A  C   1139 O2    ? ? ? 1_555 A  G   1222 N2    ? ? A C   1140 A G   1223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1219 hydrog ? ? A  U   1140 N3    ? ? ? 1_555 A  A   1221 N1    ? ? A U   1141 A A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1220 hydrog ? ? A  U   1140 O4    ? ? ? 1_555 A  A   1221 N6    ? ? A U   1141 A A   1222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1221 hydrog ? ? A  C   1141 N3    ? ? ? 1_555 A  G   1220 N1    ? ? A C   1142 A G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1222 hydrog ? ? A  C   1141 N4    ? ? ? 1_555 A  G   1220 O6    ? ? A C   1142 A G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1223 hydrog ? ? A  C   1141 O2    ? ? ? 1_555 A  G   1220 N2    ? ? A C   1142 A G   1221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1224 hydrog ? ? A  G   1142 N1    ? ? ? 1_555 A  U   1219 O2    ? ? A G   1143 A U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1225 hydrog ? ? A  G   1142 O6    ? ? ? 1_555 A  U   1219 N3    ? ? A G   1143 A U   1220 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1226 hydrog ? ? A  A   1143 N1    ? ? ? 1_555 A  U   1218 N3    ? ? A A   1144 A U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1227 hydrog ? ? A  A   1143 N6    ? ? ? 1_555 A  U   1218 O4    ? ? A A   1144 A U   1219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1228 hydrog ? ? A  G   1144 N1    ? ? ? 1_555 A  U   1217 O2    ? ? A G   1145 A U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1229 hydrog ? ? A  G   1144 O6    ? ? ? 1_555 A  U   1217 N3    ? ? A G   1145 A U   1218 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1230 hydrog ? ? A  C   1145 N3    ? ? ? 1_555 A  G   1216 N1    ? ? A C   1146 A G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1231 hydrog ? ? A  C   1145 N4    ? ? ? 1_555 A  G   1216 O6    ? ? A C   1146 A G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1232 hydrog ? ? A  C   1145 O2    ? ? ? 1_555 A  G   1216 N2    ? ? A C   1146 A G   1217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1233 hydrog ? ? A  C   1146 N3    ? ? ? 1_555 A  G   1215 N1    ? ? A C   1147 A G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1234 hydrog ? ? A  C   1146 N4    ? ? ? 1_555 A  G   1215 O6    ? ? A C   1147 A G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1235 hydrog ? ? A  C   1146 O2    ? ? ? 1_555 A  G   1215 N2    ? ? A C   1147 A G   1216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1236 hydrog ? ? A  G   1150 N2    ? ? ? 1_555 A  A   1214 N7    ? ? A G   1151 A A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1237 hydrog ? ? A  G   1150 N3    ? ? ? 1_555 A  A   1214 N6    ? ? A G   1151 A A   1215 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1238 hydrog ? ? A  A   1151 N7    ? ? ? 1_555 A  G   1213 N2    ? ? A A   1152 A G   1214 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1239 hydrog ? ? A  A   1151 N3    ? ? ? 1_555 A  G   1215 N2    ? ? A A   1152 A G   1216 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1240 hydrog ? ? A  C   1152 N4    ? ? ? 1_555 A  G   2785 O6    ? ? A C   1153 A G   2786 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1241 hydrog ? ? A  A   1153 N6    ? ? ? 1_555 A  C   1212 O2    ? ? A A   1154 A C   1213 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1242 hydrog ? ? A  G   1154 N1    ? ? ? 1_555 A  C   1211 N3    ? ? A G   1155 A C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1243 hydrog ? ? A  G   1154 N2    ? ? ? 1_555 A  C   1211 O2    ? ? A G   1155 A C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1244 hydrog ? ? A  G   1154 O6    ? ? ? 1_555 A  C   1211 N4    ? ? A G   1155 A C   1212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1245 hydrog ? ? A  C   1155 N3    ? ? ? 1_555 A  G   1210 N1    ? ? A C   1156 A G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1246 hydrog ? ? A  C   1155 N4    ? ? ? 1_555 A  G   1210 O6    ? ? A C   1156 A G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1247 hydrog ? ? A  C   1155 O2    ? ? ? 1_555 A  G   1210 N2    ? ? A C   1156 A G   1211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1248 hydrog ? ? A  C   1156 N3    ? ? ? 1_555 A  G   1209 N1    ? ? A C   1157 A G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1249 hydrog ? ? A  C   1156 N4    ? ? ? 1_555 A  G   1209 O6    ? ? A C   1157 A G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1250 hydrog ? ? A  C   1156 O2    ? ? ? 1_555 A  G   1209 N2    ? ? A C   1157 A G   1210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1251 hydrog ? ? A  G   1157 N1    ? ? ? 1_555 A  C   1208 N3    ? ? A G   1158 A C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1252 hydrog ? ? A  G   1157 N2    ? ? ? 1_555 A  C   1208 O2    ? ? A G   1158 A C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1253 hydrog ? ? A  G   1157 O6    ? ? ? 1_555 A  C   1208 N4    ? ? A G   1158 A C   1209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1254 hydrog ? ? A  G   1158 N1    ? ? ? 1_555 A  C   1207 N3    ? ? A G   1159 A C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1255 hydrog ? ? A  G   1158 N2    ? ? ? 1_555 A  C   1207 O2    ? ? A G   1159 A C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1256 hydrog ? ? A  G   1158 O6    ? ? ? 1_555 A  C   1207 N4    ? ? A G   1159 A C   1208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1257 hydrog ? ? A  A   1160 N1    ? ? ? 1_555 A  U   1184 N3    ? ? A A   1161 A U   1185 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1258 hydrog ? ? A  G   1161 N1    ? ? ? 1_555 A  C   1183 N3    ? ? A G   1162 A C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1259 hydrog ? ? A  G   1161 N2    ? ? ? 1_555 A  C   1183 O2    ? ? A G   1162 A C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1260 hydrog ? ? A  G   1161 O6    ? ? ? 1_555 A  C   1183 N4    ? ? A G   1162 A C   1184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1261 hydrog ? ? A  G   1162 N2    ? ? ? 1_555 A  C   1182 O2    ? ? A G   1163 A C   1183 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1262 hydrog ? ? A  A   1165 N6    ? ? ? 1_555 A  U   1179 O4    ? ? A A   1166 A U   1180 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1263 hydrog ? ? A  G   1166 N1    ? ? ? 1_555 A  C   1178 N3    ? ? A G   1167 A C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1264 hydrog ? ? A  G   1166 N2    ? ? ? 1_555 A  C   1178 O2    ? ? A G   1167 A C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1265 hydrog ? ? A  G   1166 O6    ? ? ? 1_555 A  C   1178 N4    ? ? A G   1167 A C   1179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1266 hydrog ? ? A  C   1167 O2    ? ? ? 1_555 A  G   1177 N1    ? ? A C   1168 A G   1178 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1267 hydrog ? ? A  A   1173 N6    ? ? ? 1_555 A  A   1199 N3    ? ? A A   1174 A A   1200 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1268 hydrog ? ? A  G   1174 O6    ? ? ? 1_555 A  C   1203 N4    ? ? A G   1175 A C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1269 hydrog ? ? A  C   1175 N3    ? ? ? 1_555 A  C   1195 N4    ? ? A C   1176 A C   1196 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1270 hydrog ? ? A  C   1175 N4    ? ? ? 1_555 A  G   1202 O6    ? ? A C   1176 A G   1203 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1271 hydrog ? ? A  C   1185 N3    ? ? ? 1_555 A  G   1189 N2    ? ? A C   1186 A G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1272 hydrog ? ? A  C   1185 O2    ? ? ? 1_555 A  G   1189 N1    ? ? A C   1186 A G   1190 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1273 hydrog ? ? A  A   1192 N3    ? ? ? 1_555 A  A   1193 N6    ? ? A A   1193 A A   1194 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1274 hydrog ? ? A  G   1194 N2    ? ? ? 1_555 A  C   1203 O2    ? ? A G   1195 A C   1204 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1275 hydrog ? ? A  C   1195 N3    ? ? ? 1_555 A  G   1202 N1    ? ? A C   1196 A G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1276 hydrog ? ? A  C   1195 N4    ? ? ? 1_555 A  G   1202 O6    ? ? A C   1196 A G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1277 hydrog ? ? A  C   1195 O2    ? ? ? 1_555 A  G   1202 N2    ? ? A C   1196 A G   1203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1278 hydrog ? ? A  G   1196 N2    ? ? ? 1_555 A  A   1201 N7    ? ? A G   1197 A A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1279 hydrog ? ? A  G   1196 N3    ? ? ? 1_555 A  A   1201 N6    ? ? A G   1197 A A   1202 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1280 hydrog ? ? A  A   1230 N6    ? ? ? 1_555 A  C   2497 O2    ? ? A A   1231 A C   2498 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1281 hydrog ? ? A  A   1230 N6    ? ? ? 1_555 A  U   2522 O2    ? ? A A   1231 A U   2523 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1282 hydrog ? ? A  G   1234 N2    ? ? ? 1_555 A  A   1235 N7    ? ? A G   1235 A A   1236 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1283 hydrog ? ? A  G   1234 O6    ? ? ? 1_555 A  G   2079 N2    ? ? A G   1235 A G   2080 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog1284 hydrog ? ? A  C   1237 N4    ? ? ? 1_555 A  G   1240 N7    ? ? A C   1238 A G   1241 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1285 hydrog ? ? A  C   1267 N3    ? ? ? 1_555 A  G   1289 N1    ? ? A C   1268 A G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1286 hydrog ? ? A  C   1267 N4    ? ? ? 1_555 A  G   1289 O6    ? ? A C   1268 A G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1287 hydrog ? ? A  C   1267 O2    ? ? ? 1_555 A  G   1289 N2    ? ? A C   1268 A G   1290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1288 hydrog ? ? A  G   1268 N1    ? ? ? 1_555 A  C   1288 N3    ? ? A G   1269 A C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1289 hydrog ? ? A  G   1268 N2    ? ? ? 1_555 A  C   1288 O2    ? ? A G   1269 A C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1290 hydrog ? ? A  G   1268 O6    ? ? ? 1_555 A  C   1288 N4    ? ? A G   1269 A C   1289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1291 hydrog ? ? A  U   1269 N3    ? ? ? 1_555 A  A   1285 N1    ? ? A U   1270 A A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1292 hydrog ? ? A  U   1269 O4    ? ? ? 1_555 A  A   1285 N6    ? ? A U   1270 A A   1286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1293 hydrog ? ? A  A   1270 N1    ? ? ? 1_555 A  U   1284 N3    ? ? A A   1271 A U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1294 hydrog ? ? A  A   1270 N6    ? ? ? 1_555 A  U   1284 O4    ? ? A A   1271 A U   1285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1295 hydrog ? ? A  C   1271 N3    ? ? ? 1_555 A  G   1283 N1    ? ? A C   1272 A G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1296 hydrog ? ? A  C   1271 N4    ? ? ? 1_555 A  G   1283 O6    ? ? A C   1272 A G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1297 hydrog ? ? A  C   1271 O2    ? ? ? 1_555 A  G   1283 N2    ? ? A C   1272 A G   1284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1298 hydrog ? ? A  C   1272 N3    ? ? ? 1_555 A  G   1282 N1    ? ? A C   1273 A G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1299 hydrog ? ? A  C   1272 N4    ? ? ? 1_555 A  G   1282 O6    ? ? A C   1273 A G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1300 hydrog ? ? A  C   1272 O2    ? ? ? 1_555 A  G   1282 N2    ? ? A C   1273 A G   1283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1301 hydrog ? ? A  A   1273 N1    ? ? ? 1_555 A  U   1281 N3    ? ? A A   1274 A U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1302 hydrog ? ? A  A   1273 N6    ? ? ? 1_555 A  U   1281 O4    ? ? A A   1274 A U   1282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1303 hydrog ? ? A  C   1274 O2    ? ? ? 1_555 A  C   1280 N4    ? ? A C   1275 A C   1281 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1304 hydrog ? ? A  U   1275 O2    ? ? ? 1_555 A  A   1279 N6    ? ? A U   1276 A A   1280 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1305 hydrog ? ? A  G   1291 N2    ? ? ? 1_555 A  U   1292 O4    ? ? A G   1292 A U   1293 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1306 hydrog ? ? A  G   1299 N2    ? ? ? 1_555 A  A   1329 N3    ? ? A G   1300 A A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1307 hydrog ? ? A  C   1300 N3    ? ? ? 1_555 A  G   1353 N1    ? ? A C   1301 A G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1308 hydrog ? ? A  C   1300 N4    ? ? ? 1_555 A  G   1353 O6    ? ? A C   1301 A G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1309 hydrog ? ? A  C   1300 O2    ? ? ? 1_555 A  G   1353 N2    ? ? A C   1301 A G   1354 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1310 hydrog ? ? A  G   1301 N1    ? ? ? 1_555 A  C   1352 O2    ? ? A G   1302 A C   1353 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1311 hydrog ? ? A  C   1302 N3    ? ? ? 1_555 A  G   1350 N1    ? ? A C   1303 A G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1312 hydrog ? ? A  C   1302 N4    ? ? ? 1_555 A  G   1350 O6    ? ? A C   1303 A G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1313 hydrog ? ? A  C   1302 O2    ? ? ? 1_555 A  G   1350 N2    ? ? A C   1303 A G   1351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1314 hydrog ? ? A  U   1303 N3    ? ? ? 1_555 A  U   1349 O2    ? ? A U   1304 A U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1315 hydrog ? ? A  U   1303 O4    ? ? ? 1_555 A  U   1349 N3    ? ? A U   1304 A U   1350 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1316 hydrog ? ? A  C   1304 N3    ? ? ? 1_555 A  G   1348 N1    ? ? A C   1305 A G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1317 hydrog ? ? A  C   1304 N4    ? ? ? 1_555 A  G   1348 O6    ? ? A C   1305 A G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1318 hydrog ? ? A  C   1304 O2    ? ? ? 1_555 A  G   1348 N2    ? ? A C   1305 A G   1349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1319 hydrog ? ? A  U   1305 N3    ? ? ? 1_555 A  A   1347 N1    ? ? A U   1306 A A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1320 hydrog ? ? A  U   1305 O4    ? ? ? 1_555 A  A   1347 N6    ? ? A U   1306 A A   1348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1321 hydrog ? ? A  A   1306 N1    ? ? ? 1_555 A  U   1346 N3    ? ? A A   1307 A U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1322 hydrog ? ? A  A   1306 N6    ? ? ? 1_555 A  U   1346 O4    ? ? A A   1307 A U   1347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1323 hydrog ? ? A  A   1307 N1    ? ? ? 1_555 A  U   1345 N3    ? ? A A   1308 A U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1324 hydrog ? ? A  A   1307 N6    ? ? ? 1_555 A  U   1345 O4    ? ? A A   1308 A U   1346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1325 hydrog ? ? A  U   1308 N3    ? ? ? 1_555 A  A   1344 N1    ? ? A U   1309 A A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1326 hydrog ? ? A  U   1308 O4    ? ? ? 1_555 A  A   1344 N6    ? ? A U   1309 A A   1345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1327 hydrog ? ? A  U   1309 N3    ? ? ? 1_555 A  G   1343 O6    ? ? A U   1310 A G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1328 hydrog ? ? A  U   1309 O2    ? ? ? 1_555 A  G   1343 N1    ? ? A U   1310 A G   1344 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1329 hydrog ? ? A  G   1310 N1    ? ? ? 1_555 A  C   1342 N3    ? ? A G   1311 A C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1330 hydrog ? ? A  G   1310 N2    ? ? ? 1_555 A  C   1342 O2    ? ? A G   1311 A C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1331 hydrog ? ? A  G   1310 O6    ? ? ? 1_555 A  C   1342 N4    ? ? A G   1311 A C   1343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1332 hydrog ? ? A  G   1311 N1    ? ? ? 1_555 A  C   1341 N3    ? ? A G   1312 A C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1333 hydrog ? ? A  G   1311 N2    ? ? ? 1_555 A  C   1341 O2    ? ? A G   1312 A C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1334 hydrog ? ? A  G   1311 O6    ? ? ? 1_555 A  C   1341 N4    ? ? A G   1312 A C   1342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1335 hydrog ? ? A  G   1315 N2    ? ? ? 1_555 A  A   1340 N7    ? ? A G   1316 A A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1336 hydrog ? ? A  G   1315 N3    ? ? ? 1_555 A  A   1340 N6    ? ? A G   1316 A A   1341 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1337 hydrog ? ? A  A   1316 N7    ? ? ? 1_555 A  G   1339 N2    ? ? A A   1317 A G   1340 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1338 hydrog ? ? A  A   1317 N6    ? ? ? 1_555 A  G   1338 N3    ? ? A A   1318 A G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1339 hydrog ? ? A  A   1317 N7    ? ? ? 1_555 A  G   1338 N2    ? ? A A   1318 A G   1339 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1340 hydrog ? ? A  G   1318 N1    ? ? ? 1_555 A  U   1337 O2    ? ? A G   1319 A U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1341 hydrog ? ? A  G   1318 O6    ? ? ? 1_555 A  U   1337 N3    ? ? A G   1319 A U   1338 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1342 hydrog ? ? A  U   1319 N3    ? ? ? 1_555 A  A   1336 N1    ? ? A U   1320 A A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1343 hydrog ? ? A  U   1319 O4    ? ? ? 1_555 A  A   1336 N6    ? ? A U   1320 A A   1337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1344 hydrog ? ? A  A   1320 N1    ? ? ? 1_555 A  U   1335 N3    ? ? A A   1321 A U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1345 hydrog ? ? A  A   1320 N6    ? ? ? 1_555 A  U   1335 O4    ? ? A A   1321 A U   1336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1346 hydrog ? ? A  G   1321 N1    ? ? ? 1_555 A  C   1334 N3    ? ? A G   1322 A C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1347 hydrog ? ? A  G   1321 N2    ? ? ? 1_555 A  C   1334 O2    ? ? A G   1322 A C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1348 hydrog ? ? A  G   1321 O6    ? ? ? 1_555 A  C   1334 N4    ? ? A G   1322 A C   1335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1349 hydrog ? ? A  G   1322 N1    ? ? ? 1_555 A  C   1333 N3    ? ? A G   1323 A C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1350 hydrog ? ? A  G   1322 N2    ? ? ? 1_555 A  C   1333 O2    ? ? A G   1323 A C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1351 hydrog ? ? A  G   1322 O6    ? ? ? 1_555 A  C   1333 N4    ? ? A G   1323 A C   1334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1352 hydrog ? ? A  G   1323 N1    ? ? ? 1_555 A  U   1332 O2    ? ? A G   1324 A U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1353 hydrog ? ? A  G   1323 O6    ? ? ? 1_555 A  U   1332 N3    ? ? A G   1324 A U   1333 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1354 hydrog ? ? A  G   1324 N1    ? ? ? 1_555 A  C   1331 N3    ? ? A G   1325 A C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1355 hydrog ? ? A  G   1324 N2    ? ? ? 1_555 A  C   1331 O2    ? ? A G   1325 A C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1356 hydrog ? ? A  G   1324 O6    ? ? ? 1_555 A  C   1331 N4    ? ? A G   1325 A C   1332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1357 hydrog ? ? A  U   1325 N3    ? ? ? 1_555 A  A   1330 N1    ? ? A U   1326 A A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1358 hydrog ? ? A  U   1325 O4    ? ? ? 1_555 A  A   1330 N6    ? ? A U   1326 A A   1331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1359 hydrog ? ? A  G   1326 N2    ? ? ? 1_555 A  A   1329 N7    ? ? A G   1327 A A   1330 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1360 hydrog ? ? A  C   1365 N3    ? ? ? 1_555 A  G   2057 N1    ? ? A C   1366 A G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1361 hydrog ? ? A  C   1365 N4    ? ? ? 1_555 A  G   2057 O6    ? ? A C   1366 A G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1362 hydrog ? ? A  C   1365 O2    ? ? ? 1_555 A  G   2057 N2    ? ? A C   1366 A G   2058 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1363 hydrog ? ? A  A   1366 N1    ? ? ? 1_555 A  U   2056 N3    ? ? A A   1367 A U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1364 hydrog ? ? A  A   1366 N6    ? ? ? 1_555 A  U   2056 O4    ? ? A A   1367 A U   2057 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1365 hydrog ? ? A  U   1367 O2    ? ? ? 1_555 A  C   2055 N4    ? ? A U   1368 A C   2056 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1366 hydrog ? ? A  A   1368 N6    ? ? ? 1_555 A  A   2054 N7    ? ? A A   1369 A A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1367 hydrog ? ? A  A   1368 N7    ? ? ? 1_555 A  A   2054 N6    ? ? A A   1369 A A   2055 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1368 hydrog ? ? A  G   1369 N2    ? ? ? 1_555 A  U   1370 O4    ? ? A G   1370 A U   1371 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1369 hydrog ? ? A  U   1370 N3    ? ? ? 1_555 A  A   2053 N7    ? ? A U   1371 A A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1370 hydrog ? ? A  U   1370 O2    ? ? ? 1_555 A  A   2053 N6    ? ? A U   1371 A A   2054 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1371 hydrog ? ? A  A   1371 N6    ? ? ? 1_555 A  G   2052 N3    ? ? A A   1372 A G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1372 hydrog ? ? A  A   1371 N7    ? ? ? 1_555 A  G   2052 N2    ? ? A A   1372 A G   2053 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1373 hydrog ? ? A  G   1372 N2    ? ? ? 1_555 A  C   1430 O2    ? ? A G   1373 A C   1431 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1374 hydrog ? ? A  G   1372 N1    ? ? ? 1_555 A  U   2051 O2    ? ? A G   1373 A U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1375 hydrog ? ? A  G   1372 O6    ? ? ? 1_555 A  U   2051 N3    ? ? A G   1373 A U   2052 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1376 hydrog ? ? A  C   1373 N3    ? ? ? 1_555 A  G   2050 N1    ? ? A C   1374 A G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1377 hydrog ? ? A  C   1373 N4    ? ? ? 1_555 A  G   2050 O6    ? ? A C   1374 A G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1378 hydrog ? ? A  C   1373 O2    ? ? ? 1_555 A  G   2050 N2    ? ? A C   1374 A G   2051 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1379 hydrog ? ? A  C   1376 N3    ? ? ? 1_555 A  G   1682 N2    ? ? A C   1377 A G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1380 hydrog ? ? A  C   1376 O2    ? ? ? 1_555 A  G   1682 N1    ? ? A C   1377 A G   1683 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1381 hydrog ? ? A  A   1380 N3    ? ? ? 1_555 A  G   1400 N2    ? ? A A   1381 A G   1401 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1382 hydrog ? ? A  G   1381 N1    ? ? ? 1_555 A  C   1399 N3    ? ? A G   1382 A C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1383 hydrog ? ? A  G   1381 N2    ? ? ? 1_555 A  C   1399 O2    ? ? A G   1382 A C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1384 hydrog ? ? A  G   1381 O6    ? ? ? 1_555 A  C   1399 N4    ? ? A G   1382 A C   1400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1385 hydrog ? ? A  U   1382 N3    ? ? ? 1_555 A  A   1398 N1    ? ? A U   1383 A A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1386 hydrog ? ? A  U   1382 O4    ? ? ? 1_555 A  A   1398 N6    ? ? A U   1383 A A   1399 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1387 hydrog ? ? A  C   1383 N3    ? ? ? 1_555 A  G   1397 N1    ? ? A C   1384 A G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1388 hydrog ? ? A  C   1383 N4    ? ? ? 1_555 A  G   1397 O6    ? ? A C   1384 A G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1389 hydrog ? ? A  C   1383 O2    ? ? ? 1_555 A  G   1397 N2    ? ? A C   1384 A G   1398 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1390 hydrog ? ? A  G   1384 N1    ? ? ? 1_555 A  C   1396 N3    ? ? A G   1385 A C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1391 hydrog ? ? A  G   1384 N2    ? ? ? 1_555 A  C   1396 O2    ? ? A G   1385 A C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1392 hydrog ? ? A  G   1384 O6    ? ? ? 1_555 A  C   1396 N4    ? ? A G   1385 A C   1397 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1393 hydrog ? ? A  G   1385 N1    ? ? ? 1_555 A  C   1395 N3    ? ? A G   1386 A C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1394 hydrog ? ? A  G   1385 N2    ? ? ? 1_555 A  C   1395 O2    ? ? A G   1386 A C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1395 hydrog ? ? A  G   1385 O6    ? ? ? 1_555 A  C   1395 N4    ? ? A G   1386 A C   1396 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1396 hydrog ? ? A  G   1386 N1    ? ? ? 1_555 A  C   1394 N3    ? ? A G   1387 A C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1397 hydrog ? ? A  G   1386 N2    ? ? ? 1_555 A  C   1394 O2    ? ? A G   1387 A C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1398 hydrog ? ? A  G   1386 O6    ? ? ? 1_555 A  C   1394 N4    ? ? A G   1387 A C   1395 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1399 hydrog ? ? A  U   1387 N3    ? ? ? 1_555 A  A   1391 N7    ? ? A U   1388 A A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1400 hydrog ? ? A  U   1387 O2    ? ? ? 1_555 A  A   1391 N6    ? ? A U   1388 A A   1392 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1401 hydrog ? ? A  G   1388 N2    ? ? ? 1_555 A  U   1434 O4    ? ? A G   1389 A U   1435 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1402 hydrog ? ? A  A   1392 N6    ? ? ? 1_555 A  C   1724 O2    ? ? A A   1393 A C   1725 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1403 hydrog ? ? A  C   1393 N3    ? ? ? 1_555 A  U   1431 N3    ? ? A C   1394 A U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1404 hydrog ? ? A  C   1393 N4    ? ? ? 1_555 A  U   1431 O2    ? ? A C   1394 A U   1432 1_555 ? ? ? ? ? ? TYPE_17_PAIR ? ? 
hydrog1405 hydrog ? ? A  G   1400 N1    ? ? ? 1_555 A  C   1720 N3    ? ? A G   1401 A C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1406 hydrog ? ? A  G   1400 N2    ? ? ? 1_555 A  C   1720 O2    ? ? A G   1401 A C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1407 hydrog ? ? A  G   1400 O6    ? ? ? 1_555 A  C   1720 N4    ? ? A G   1401 A C   1721 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1408 hydrog ? ? A  G   1401 N1    ? ? ? 1_555 A  C   1719 N3    ? ? A G   1402 A C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1409 hydrog ? ? A  G   1401 N2    ? ? ? 1_555 A  C   1719 O2    ? ? A G   1402 A C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1410 hydrog ? ? A  G   1401 O6    ? ? ? 1_555 A  C   1719 N4    ? ? A G   1402 A C   1720 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1411 hydrog ? ? A  C   1402 N3    ? ? ? 1_555 A  G   1718 N1    ? ? A C   1403 A G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1412 hydrog ? ? A  C   1402 N4    ? ? ? 1_555 A  G   1718 O6    ? ? A C   1403 A G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1413 hydrog ? ? A  C   1402 O2    ? ? ? 1_555 A  G   1718 N2    ? ? A C   1403 A G   1719 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1414 hydrog ? ? A  C   1403 N3    ? ? ? 1_555 A  G   1717 N1    ? ? A C   1404 A G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1415 hydrog ? ? A  C   1403 N4    ? ? ? 1_555 A  G   1717 O6    ? ? A C   1404 A G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1416 hydrog ? ? A  C   1403 O2    ? ? ? 1_555 A  G   1717 N2    ? ? A C   1404 A G   1718 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1417 hydrog ? ? A  U   1404 N3    ? ? ? 1_555 A  A   1715 N7    ? ? A U   1405 A A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1418 hydrog ? ? A  U   1404 O2    ? ? ? 1_555 A  A   1715 N6    ? ? A U   1405 A A   1716 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1419 hydrog ? ? A  A   1406 N1    ? ? ? 1_555 A  A   1716 N6    ? ? A A   1407 A A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1420 hydrog ? ? A  A   1406 N6    ? ? ? 1_555 A  A   1716 N1    ? ? A A   1407 A A   1717 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1421 hydrog ? ? A  G   1408 N1    ? ? ? 1_555 A  C   1699 N3    ? ? A G   1409 A C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1422 hydrog ? ? A  G   1408 N2    ? ? ? 1_555 A  C   1699 O2    ? ? A G   1409 A C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1423 hydrog ? ? A  G   1408 O6    ? ? ? 1_555 A  C   1699 N4    ? ? A G   1409 A C   1700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1424 hydrog ? ? A  G   1409 N1    ? ? ? 1_555 A  C   1698 N3    ? ? A G   1410 A C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1425 hydrog ? ? A  G   1409 N2    ? ? ? 1_555 A  C   1698 O2    ? ? A G   1410 A C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1426 hydrog ? ? A  G   1409 O6    ? ? ? 1_555 A  C   1698 N4    ? ? A G   1410 A C   1699 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1427 hydrog ? ? A  A   1410 N1    ? ? ? 1_555 A  U   1697 N3    ? ? A A   1411 A U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1428 hydrog ? ? A  A   1410 N6    ? ? ? 1_555 A  U   1697 O4    ? ? A A   1411 A U   1698 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1429 hydrog ? ? A  U   1411 N3    ? ? ? 1_555 A  G   1696 O6    ? ? A U   1412 A G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1430 hydrog ? ? A  U   1411 O2    ? ? ? 1_555 A  G   1696 N1    ? ? A U   1412 A G   1697 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1431 hydrog ? ? A  A   1413 N6    ? ? ? 1_555 A  G   1680 N3    ? ? A A   1414 A G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1432 hydrog ? ? A  A   1413 N7    ? ? ? 1_555 A  G   1680 N2    ? ? A A   1414 A G   1681 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1433 hydrog ? ? A  A   1413 N1    ? ? ? 1_555 A  A   1681 N6    ? ? A A   1414 A A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1434 hydrog ? ? A  A   1413 N6    ? ? ? 1_555 A  A   1681 N1    ? ? A A   1414 A A   1682 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog1435 hydrog ? ? A  G   1414 N1    ? ? ? 1_555 A  C   1679 N3    ? ? A G   1415 A C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1436 hydrog ? ? A  G   1414 N2    ? ? ? 1_555 A  C   1679 O2    ? ? A G   1415 A C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1437 hydrog ? ? A  G   1414 O6    ? ? ? 1_555 A  C   1679 N4    ? ? A G   1415 A C   1680 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1438 hydrog ? ? A  G   1415 N1    ? ? ? 1_555 A  C   1678 N3    ? ? A G   1416 A C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1439 hydrog ? ? A  G   1415 N2    ? ? ? 1_555 A  C   1678 O2    ? ? A G   1416 A C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1440 hydrog ? ? A  G   1415 O6    ? ? ? 1_555 A  C   1678 N4    ? ? A G   1416 A C   1679 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1441 hydrog ? ? A  G   1415 N2    ? ? ? 1_555 A  A   1684 N3    ? ? A G   1416 A A   1685 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1442 hydrog ? ? A  U   1417 N3    ? ? ? 1_555 A  U   1445 O4    ? ? A U   1418 A U   1446 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog1443 hydrog ? ? A  U   1418 N3    ? ? ? 1_555 A  A   1677 N1    ? ? A U   1419 A A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1444 hydrog ? ? A  U   1418 O4    ? ? ? 1_555 A  A   1677 N6    ? ? A U   1419 A A   1678 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1445 hydrog ? ? A  C   1419 N3    ? ? ? 1_555 A  G   1443 N1    ? ? A C   1420 A G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1446 hydrog ? ? A  C   1419 N4    ? ? ? 1_555 A  G   1443 O6    ? ? A C   1420 A G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1447 hydrog ? ? A  C   1419 O2    ? ? ? 1_555 A  G   1443 N2    ? ? A C   1420 A G   1444 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1448 hydrog ? ? A  C   1420 N3    ? ? ? 1_555 A  G   1442 N1    ? ? A C   1421 A G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1449 hydrog ? ? A  C   1420 N4    ? ? ? 1_555 A  G   1442 O6    ? ? A C   1421 A G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1450 hydrog ? ? A  C   1420 O2    ? ? ? 1_555 A  G   1442 N2    ? ? A C   1421 A G   1443 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1451 hydrog ? ? A  U   1421 N3    ? ? ? 1_555 A  A   1441 N1    ? ? A U   1422 A A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1452 hydrog ? ? A  U   1421 O4    ? ? ? 1_555 A  A   1441 N6    ? ? A U   1422 A A   1442 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1453 hydrog ? ? A  C   1422 N3    ? ? ? 1_555 A  G   1440 N1    ? ? A C   1423 A G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1454 hydrog ? ? A  C   1422 N4    ? ? ? 1_555 A  G   1440 O6    ? ? A C   1423 A G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1455 hydrog ? ? A  C   1422 O2    ? ? ? 1_555 A  G   1440 N2    ? ? A C   1423 A G   1441 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1456 hydrog ? ? A  A   1423 N1    ? ? ? 1_555 A  U   1439 N3    ? ? A A   1424 A U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1457 hydrog ? ? A  A   1423 N6    ? ? ? 1_555 A  U   1439 O4    ? ? A A   1424 A U   1440 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1458 hydrog ? ? A  G   1424 N1    ? ? ? 1_555 A  C   1438 N3    ? ? A G   1425 A C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1459 hydrog ? ? A  G   1424 N2    ? ? ? 1_555 A  C   1438 O2    ? ? A G   1425 A C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1460 hydrog ? ? A  G   1424 O6    ? ? ? 1_555 A  C   1438 N4    ? ? A G   1425 A C   1439 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1461 hydrog ? ? A  C   1425 N3    ? ? ? 1_555 A  A   1436 N6    ? ? A C   1426 A A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1462 hydrog ? ? A  C   1425 N4    ? ? ? 1_555 A  A   1436 N7    ? ? A C   1426 A A   1437 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1463 hydrog ? ? A  C   1427 N4    ? ? ? 1_555 A  C   1438 O2    ? ? A C   1428 A C   1439 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1464 hydrog ? ? A  U   1428 N3    ? ? ? 1_555 A  A   1436 N1    ? ? A U   1429 A A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1465 hydrog ? ? A  U   1428 O4    ? ? ? 1_555 A  A   1436 N6    ? ? A U   1429 A A   1437 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1466 hydrog ? ? A  G   1429 N1    ? ? ? 1_555 A  C   1435 N3    ? ? A G   1430 A C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1467 hydrog ? ? A  G   1429 N2    ? ? ? 1_555 A  C   1435 O2    ? ? A G   1430 A C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1468 hydrog ? ? A  G   1429 O6    ? ? ? 1_555 A  C   1435 N4    ? ? A G   1430 A C   1436 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1469 hydrog ? ? A  G   1429 N3    ? ? ? 1_555 A  A   1690 N6    ? ? A G   1430 A A   1691 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1470 hydrog ? ? A  G   1443 N2    ? ? ? 1_555 A  A   1501 N3    ? ? A G   1444 A A   1502 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1471 hydrog ? ? A  A   1447 N6    ? ? ? 1_555 A  U   1676 O2    ? ? A A   1448 A U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1472 hydrog ? ? A  A   1447 N7    ? ? ? 1_555 A  U   1676 N3    ? ? A A   1448 A U   1677 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1473 hydrog ? ? A  G   1448 N2    ? ? ? 1_555 A  A   1492 N3    ? ? A G   1449 A A   1493 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1474 hydrog ? ? A  G   1448 N1    ? ? ? 1_555 A  C   1512 N3    ? ? A G   1449 A C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1475 hydrog ? ? A  G   1448 N2    ? ? ? 1_555 A  C   1512 O2    ? ? A G   1449 A C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1476 hydrog ? ? A  G   1448 O6    ? ? ? 1_555 A  C   1512 N4    ? ? A G   1449 A C   1513 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1477 hydrog ? ? A  C   1449 N3    ? ? ? 1_555 A  G   1511 N1    ? ? A C   1450 A G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1478 hydrog ? ? A  C   1449 N4    ? ? ? 1_555 A  G   1511 O6    ? ? A C   1450 A G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1479 hydrog ? ? A  C   1449 O2    ? ? ? 1_555 A  G   1511 N2    ? ? A C   1450 A G   1512 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1480 hydrog ? ? A  C   1450 N3    ? ? ? 1_555 A  G   1675 N1    ? ? A C   1451 A G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1481 hydrog ? ? A  C   1450 N4    ? ? ? 1_555 A  G   1675 O6    ? ? A C   1451 A G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1482 hydrog ? ? A  C   1450 O2    ? ? ? 1_555 A  G   1675 N2    ? ? A C   1451 A G   1676 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1483 hydrog ? ? A  G   1451 N2    ? ? ? 1_555 A  A   1485 N1    ? ? A G   1452 A A   1486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1484 hydrog ? ? A  G   1451 N1    ? ? ? 1_555 A  C   1674 N3    ? ? A G   1452 A C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1485 hydrog ? ? A  G   1451 N2    ? ? ? 1_555 A  C   1674 O2    ? ? A G   1452 A C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1486 hydrog ? ? A  G   1451 O6    ? ? ? 1_555 A  C   1674 N4    ? ? A G   1452 A C   1675 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1487 hydrog ? ? A  G   1452 N1    ? ? ? 1_555 A  C   1673 N3    ? ? A G   1453 A C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1488 hydrog ? ? A  G   1452 N2    ? ? ? 1_555 A  C   1673 O2    ? ? A G   1453 A C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1489 hydrog ? ? A  G   1452 O6    ? ? ? 1_555 A  C   1673 N4    ? ? A G   1453 A C   1674 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1490 hydrog ? ? A  U   1453 O4    ? ? ? 1_555 A  G   1490 N2    ? ? A U   1454 A G   1491 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1491 hydrog ? ? A  C   1454 N3    ? ? ? 1_555 A  G   1489 N1    ? ? A C   1455 A G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1492 hydrog ? ? A  C   1454 N4    ? ? ? 1_555 A  G   1489 O6    ? ? A C   1455 A G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1493 hydrog ? ? A  C   1454 O2    ? ? ? 1_555 A  G   1489 N2    ? ? A C   1455 A G   1490 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1494 hydrog ? ? A  C   1455 N3    ? ? ? 1_555 A  G   1488 N1    ? ? A C   1456 A G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1495 hydrog ? ? A  C   1455 N4    ? ? ? 1_555 A  G   1488 O6    ? ? A C   1456 A G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1496 hydrog ? ? A  C   1455 O2    ? ? ? 1_555 A  G   1488 N2    ? ? A C   1456 A G   1489 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1497 hydrog ? ? A  U   1456 N3    ? ? ? 1_555 A  A   1484 N7    ? ? A U   1457 A A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1498 hydrog ? ? A  U   1456 O2    ? ? ? 1_555 A  A   1484 N6    ? ? A U   1457 A A   1485 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1499 hydrog ? ? A  A   1458 N6    ? ? ? 1_555 A  G   1483 N3    ? ? A A   1459 A G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1500 hydrog ? ? A  A   1458 N7    ? ? ? 1_555 A  G   1483 N2    ? ? A A   1459 A G   1484 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1501 hydrog ? ? A  G   1459 N1    ? ? ? 1_555 A  C   1482 N3    ? ? A G   1460 A C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1502 hydrog ? ? A  G   1459 N2    ? ? ? 1_555 A  C   1482 O2    ? ? A G   1460 A C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1503 hydrog ? ? A  G   1459 O6    ? ? ? 1_555 A  C   1482 N4    ? ? A G   1460 A C   1483 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1504 hydrog ? ? A  U   1460 N3    ? ? ? 1_555 A  A   1481 N1    ? ? A U   1461 A A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1505 hydrog ? ? A  U   1460 O4    ? ? ? 1_555 A  A   1481 N6    ? ? A U   1461 A A   1482 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1506 hydrog ? ? A  C   1461 N3    ? ? ? 1_555 A  G   1480 N1    ? ? A C   1462 A G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1507 hydrog ? ? A  C   1461 N4    ? ? ? 1_555 A  G   1480 O6    ? ? A C   1462 A G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1508 hydrog ? ? A  C   1461 O2    ? ? ? 1_555 A  G   1480 N2    ? ? A C   1462 A G   1481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1509 hydrog ? ? A  A   1462 N1    ? ? ? 1_555 A  U   1479 N3    ? ? A A   1463 A U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1510 hydrog ? ? A  A   1462 N6    ? ? ? 1_555 A  U   1479 O4    ? ? A A   1463 A U   1480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1511 hydrog ? ? A  U   1463 N3    ? ? ? 1_555 A  A   1478 N1    ? ? A U   1464 A A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1512 hydrog ? ? A  U   1463 O4    ? ? ? 1_555 A  A   1478 N6    ? ? A U   1464 A A   1479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1513 hydrog ? ? A  A   1464 N1    ? ? ? 1_555 A  U   1477 N3    ? ? A A   1465 A U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1514 hydrog ? ? A  A   1464 N6    ? ? ? 1_555 A  U   1477 O4    ? ? A A   1465 A U   1478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1515 hydrog ? ? A  C   1465 O2    ? ? ? 1_555 A  C   1476 N4    ? ? A C   1466 A C   1477 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1516 hydrog ? ? A  C   1466 N3    ? ? ? 1_555 A  G   1474 N1    ? ? A C   1467 A G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1517 hydrog ? ? A  C   1466 N4    ? ? ? 1_555 A  G   1474 O6    ? ? A C   1467 A G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1518 hydrog ? ? A  C   1466 O2    ? ? ? 1_555 A  G   1474 N2    ? ? A C   1467 A G   1475 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1519 hydrog ? ? A  C   1466 O2    ? ? ? 1_555 A  A   1475 N6    ? ? A C   1467 A A   1476 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1520 hydrog ? ? A  G   1467 N1    ? ? ? 1_555 A  C   1473 N3    ? ? A G   1468 A C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1521 hydrog ? ? A  G   1467 N2    ? ? ? 1_555 A  C   1473 O2    ? ? A G   1468 A C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1522 hydrog ? ? A  G   1467 O6    ? ? ? 1_555 A  C   1473 N4    ? ? A G   1468 A C   1474 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1523 hydrog ? ? A  G   1474 N2    ? ? ? 1_555 A  A   1865 N3    ? ? A G   1475 A A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1524 hydrog ? ? A  A   1486 N3    ? ? ? 1_555 A  G   1696 N2    ? ? A A   1487 A G   1697 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1525 hydrog ? ? A  G   1488 N3    ? ? ? 1_555 A  A   1655 N6    ? ? A G   1489 A A   1656 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1526 hydrog ? ? A  G   1488 N2    ? ? ? 1_555 A  A   1656 N1    ? ? A G   1489 A A   1657 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1527 hydrog ? ? A  A   1493 N1    ? ? ? 1_555 A  U   1510 N3    ? ? A A   1494 A U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1528 hydrog ? ? A  A   1493 N6    ? ? ? 1_555 A  U   1510 O4    ? ? A A   1494 A U   1511 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1529 hydrog ? ? A  C   1494 N3    ? ? ? 1_555 A  G   1509 N1    ? ? A C   1495 A G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1530 hydrog ? ? A  C   1494 N4    ? ? ? 1_555 A  G   1509 O6    ? ? A C   1495 A G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1531 hydrog ? ? A  C   1494 O2    ? ? ? 1_555 A  G   1509 N2    ? ? A C   1495 A G   1510 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1532 hydrog ? ? A  G   1495 N1    ? ? ? 1_555 A  C   1508 N3    ? ? A G   1496 A C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1533 hydrog ? ? A  G   1495 N2    ? ? ? 1_555 A  C   1508 O2    ? ? A G   1496 A C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1534 hydrog ? ? A  G   1495 O6    ? ? ? 1_555 A  C   1508 N4    ? ? A G   1496 A C   1509 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1535 hydrog ? ? A  G   1496 N1    ? ? ? 1_555 A  C   1507 N3    ? ? A G   1497 A C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1536 hydrog ? ? A  G   1496 N2    ? ? ? 1_555 A  C   1507 O2    ? ? A G   1497 A C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1537 hydrog ? ? A  G   1496 O6    ? ? ? 1_555 A  C   1507 N4    ? ? A G   1497 A C   1508 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1538 hydrog ? ? A  G   1497 N1    ? ? ? 1_555 A  C   1506 N3    ? ? A G   1498 A C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1539 hydrog ? ? A  G   1497 N2    ? ? ? 1_555 A  C   1506 O2    ? ? A G   1498 A C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1540 hydrog ? ? A  G   1497 O6    ? ? ? 1_555 A  C   1506 N4    ? ? A G   1498 A C   1507 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1541 hydrog ? ? A  U   1498 N3    ? ? ? 1_555 A  A   1503 N7    ? ? A U   1499 A A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1542 hydrog ? ? A  U   1498 O2    ? ? ? 1_555 A  A   1503 N6    ? ? A U   1499 A A   1504 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1543 hydrog ? ? A  C   1513 N3    ? ? ? 1_555 A  G   1671 N1    ? ? A C   1514 A G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1544 hydrog ? ? A  C   1513 N4    ? ? ? 1_555 A  G   1671 O6    ? ? A C   1514 A G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1545 hydrog ? ? A  C   1513 O2    ? ? ? 1_555 A  G   1671 N2    ? ? A C   1514 A G   1672 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1546 hydrog ? ? A  A   1514 N1    ? ? ? 1_555 A  U   1670 N3    ? ? A A   1515 A U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1547 hydrog ? ? A  A   1514 N6    ? ? ? 1_555 A  U   1670 O4    ? ? A A   1515 A U   1671 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1548 hydrog ? ? A  C   1515 N3    ? ? ? 1_555 A  G   1669 N1    ? ? A C   1516 A G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1549 hydrog ? ? A  C   1515 N4    ? ? ? 1_555 A  G   1669 O6    ? ? A C   1516 A G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1550 hydrog ? ? A  C   1515 O2    ? ? ? 1_555 A  G   1669 N2    ? ? A C   1516 A G   1670 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1551 hydrog ? ? A  U   1516 N3    ? ? ? 1_555 A  A   1668 N1    ? ? A U   1517 A A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1552 hydrog ? ? A  U   1516 O4    ? ? ? 1_555 A  A   1668 N6    ? ? A U   1517 A A   1669 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1553 hydrog ? ? A  A   1517 N1    ? ? ? 1_555 A  U   1667 N3    ? ? A A   1518 A U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1554 hydrog ? ? A  A   1517 N6    ? ? ? 1_555 A  U   1667 O4    ? ? A A   1518 A U   1668 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1555 hydrog ? ? A  U   1518 N3    ? ? ? 1_555 A  A   1666 N1    ? ? A U   1519 A A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1556 hydrog ? ? A  U   1518 O4    ? ? ? 1_555 A  A   1666 N6    ? ? A U   1519 A A   1667 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1557 hydrog ? ? A  G   1519 N1    ? ? ? 1_555 A  C   1665 N3    ? ? A G   1520 A C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1558 hydrog ? ? A  G   1519 N2    ? ? ? 1_555 A  C   1665 O2    ? ? A G   1520 A C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1559 hydrog ? ? A  G   1519 O6    ? ? ? 1_555 A  C   1665 N4    ? ? A G   1520 A C   1666 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1560 hydrog ? ? A  C   1520 N3    ? ? ? 1_555 A  G   1664 N1    ? ? A C   1521 A G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1561 hydrog ? ? A  C   1520 N4    ? ? ? 1_555 A  G   1664 O6    ? ? A C   1521 A G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1562 hydrog ? ? A  C   1520 O2    ? ? ? 1_555 A  G   1664 N2    ? ? A C   1521 A G   1665 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1563 hydrog ? ? A  A   1526 N6    ? ? ? 1_555 A  A   1663 N7    ? ? A A   1527 A A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1564 hydrog ? ? A  A   1526 N7    ? ? ? 1_555 A  A   1663 N6    ? ? A A   1527 A A   1664 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1565 hydrog ? ? A  A   1527 N6    ? ? ? 1_555 A  G   1662 N3    ? ? A A   1528 A G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1566 hydrog ? ? A  A   1527 N7    ? ? ? 1_555 A  G   1662 N2    ? ? A A   1528 A G   1663 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1567 hydrog ? ? A  G   1528 N1    ? ? ? 1_555 A  C   1661 N3    ? ? A G   1529 A C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1568 hydrog ? ? A  G   1528 N2    ? ? ? 1_555 A  C   1661 O2    ? ? A G   1529 A C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1569 hydrog ? ? A  G   1528 O6    ? ? ? 1_555 A  C   1661 N4    ? ? A G   1529 A C   1662 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1570 hydrog ? ? A  U   1529 N3    ? ? ? 1_555 A  A   1660 N1    ? ? A U   1530 A A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1571 hydrog ? ? A  U   1529 O4    ? ? ? 1_555 A  A   1660 N6    ? ? A U   1530 A A   1661 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1572 hydrog ? ? A  U   1530 N3    ? ? ? 1_555 A  G   1659 O6    ? ? A U   1531 A G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1573 hydrog ? ? A  U   1530 O2    ? ? ? 1_555 A  G   1659 N1    ? ? A U   1531 A G   1660 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1574 hydrog ? ? A  G   1531 N2    ? ? ? 1_555 A  A   1658 N7    ? ? A G   1532 A A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1575 hydrog ? ? A  G   1531 N3    ? ? ? 1_555 A  A   1658 N6    ? ? A G   1532 A A   1659 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1576 hydrog ? ? A  A   1532 N6    ? ? ? 1_555 A  A   1657 N7    ? ? A A   1533 A A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1577 hydrog ? ? A  A   1532 N7    ? ? ? 1_555 A  A   1657 N6    ? ? A A   1533 A A   1658 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1578 hydrog ? ? A  C   1533 N4    ? ? ? 1_555 A  A   1656 N7    ? ? A C   1534 A A   1657 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1579 hydrog ? ? A  G   1534 N1    ? ? ? 1_555 A  C   1649 N3    ? ? A G   1535 A C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1580 hydrog ? ? A  G   1534 N2    ? ? ? 1_555 A  C   1649 O2    ? ? A G   1535 A C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1581 hydrog ? ? A  G   1534 O6    ? ? ? 1_555 A  C   1649 N4    ? ? A G   1535 A C   1650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1582 hydrog ? ? A  C   1535 N3    ? ? ? 1_555 A  G   1648 N1    ? ? A C   1536 A G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1583 hydrog ? ? A  C   1535 N4    ? ? ? 1_555 A  G   1648 O6    ? ? A C   1536 A G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1584 hydrog ? ? A  C   1535 O2    ? ? ? 1_555 A  G   1648 N2    ? ? A C   1536 A G   1649 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1585 hydrog ? ? A  C   1536 N3    ? ? ? 1_555 A  G   1647 N1    ? ? A C   1537 A G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1586 hydrog ? ? A  C   1536 N4    ? ? ? 1_555 A  G   1647 O6    ? ? A C   1537 A G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1587 hydrog ? ? A  C   1536 O2    ? ? ? 1_555 A  G   1647 N2    ? ? A C   1537 A G   1648 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1588 hydrog ? ? A  C   1537 N3    ? ? ? 1_555 A  G   1646 N1    ? ? A C   1538 A G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1589 hydrog ? ? A  C   1537 N4    ? ? ? 1_555 A  G   1646 O6    ? ? A C   1538 A G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1590 hydrog ? ? A  C   1537 O2    ? ? ? 1_555 A  G   1646 N2    ? ? A C   1538 A G   1647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1591 hydrog ? ? A  U   1538 N3    ? ? ? 1_555 A  G   1645 O6    ? ? A U   1539 A G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1592 hydrog ? ? A  U   1538 O2    ? ? ? 1_555 A  G   1645 N1    ? ? A U   1539 A G   1646 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1593 hydrog ? ? A  G   1539 N1    ? ? ? 1_555 A  U   1644 O2    ? ? A G   1540 A U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1594 hydrog ? ? A  G   1539 O6    ? ? ? 1_555 A  U   1644 N3    ? ? A G   1540 A U   1645 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1595 hydrog ? ? A  G   1540 N1    ? ? ? 1_555 A  C   1643 N3    ? ? A G   1541 A C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1596 hydrog ? ? A  G   1540 N2    ? ? ? 1_555 A  C   1643 O2    ? ? A G   1541 A C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1597 hydrog ? ? A  G   1540 O6    ? ? ? 1_555 A  C   1643 N4    ? ? A G   1541 A C   1644 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1598 hydrog ? ? A  G   1541 N2    ? ? ? 1_555 A  A   1615 N3    ? ? A G   1542 A A   1616 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1599 hydrog ? ? A  G   1541 N1    ? ? ? 1_555 A  C   1642 N3    ? ? A G   1542 A C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1600 hydrog ? ? A  G   1541 N2    ? ? ? 1_555 A  C   1642 O2    ? ? A G   1542 A C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1601 hydrog ? ? A  G   1541 O6    ? ? ? 1_555 A  C   1642 N4    ? ? A G   1542 A C   1643 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1602 hydrog ? ? A  G   1542 N2    ? ? ? 1_555 A  A   1641 N7    ? ? A G   1543 A A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1603 hydrog ? ? A  G   1542 N3    ? ? ? 1_555 A  A   1641 N6    ? ? A G   1543 A A   1642 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1604 hydrog ? ? A  U   1543 N3    ? ? ? 1_555 A  A   1640 N7    ? ? A U   1544 A A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1605 hydrog ? ? A  U   1543 O2    ? ? ? 1_555 A  A   1640 N6    ? ? A U   1544 A A   1641 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1606 hydrog ? ? A  C   1544 N4    ? ? ? 1_555 A  C   1639 O2    ? ? A C   1545 A C   1640 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1607 hydrog ? ? A  C   1544 N3    ? ? ? 1_555 A  U   1701 N3    ? ? A C   1545 A U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1608 hydrog ? ? A  C   1544 N4    ? ? ? 1_555 A  U   1701 O4    ? ? A C   1545 A U   1702 1_555 ? ? ? ? ? ? TYPE_18_PAIR ? ? 
hydrog1609 hydrog ? ? A  G   1545 N1    ? ? ? 1_555 A  U   1638 O2    ? ? A G   1546 A U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1610 hydrog ? ? A  G   1545 O6    ? ? ? 1_555 A  U   1638 N3    ? ? A G   1546 A U   1639 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1611 hydrog ? ? A  A   1546 N1    ? ? ? 1_555 A  U   1637 N3    ? ? A A   1547 A U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1612 hydrog ? ? A  A   1546 N6    ? ? ? 1_555 A  U   1637 O4    ? ? A A   1547 A U   1638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1613 hydrog ? ? A  U   1547 N3    ? ? ? 1_555 A  A   1636 N1    ? ? A U   1548 A A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1614 hydrog ? ? A  U   1547 O4    ? ? ? 1_555 A  A   1636 N6    ? ? A U   1548 A A   1637 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1615 hydrog ? ? A  C   1548 N3    ? ? ? 1_555 A  G   1635 N1    ? ? A C   1549 A G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1616 hydrog ? ? A  C   1548 N4    ? ? ? 1_555 A  G   1635 O6    ? ? A C   1549 A G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1617 hydrog ? ? A  C   1548 O2    ? ? ? 1_555 A  G   1635 N2    ? ? A C   1549 A G   1636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1618 hydrog ? ? A  A   1549 N1    ? ? ? 1_555 A  U   1634 N3    ? ? A A   1550 A U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1619 hydrog ? ? A  A   1549 N6    ? ? ? 1_555 A  U   1634 O4    ? ? A A   1550 A U   1635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1620 hydrog ? ? A  C   1550 N3    ? ? ? 1_555 A  G   1633 N1    ? ? A C   1551 A G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1621 hydrog ? ? A  C   1550 N4    ? ? ? 1_555 A  G   1633 O6    ? ? A C   1551 A G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1622 hydrog ? ? A  C   1550 O2    ? ? ? 1_555 A  G   1633 N2    ? ? A C   1551 A G   1634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1623 hydrog ? ? A  G   1551 N1    ? ? ? 1_555 A  U   1568 O2    ? ? A G   1552 A U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1624 hydrog ? ? A  G   1551 O6    ? ? ? 1_555 A  U   1568 N3    ? ? A G   1552 A U   1569 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1625 hydrog ? ? A  C   1552 N3    ? ? ? 1_555 A  G   1567 N1    ? ? A C   1553 A G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1626 hydrog ? ? A  C   1552 N4    ? ? ? 1_555 A  G   1567 O6    ? ? A C   1553 A G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1627 hydrog ? ? A  C   1552 O2    ? ? ? 1_555 A  G   1567 N2    ? ? A C   1553 A G   1568 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1628 hydrog ? ? A  U   1553 N3    ? ? ? 1_555 A  A   1566 N1    ? ? A U   1554 A A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1629 hydrog ? ? A  U   1553 O4    ? ? ? 1_555 A  A   1566 N6    ? ? A U   1554 A A   1567 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1630 hydrog ? ? A  G   1554 N1    ? ? ? 1_555 A  C   1565 N3    ? ? A G   1555 A C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1631 hydrog ? ? A  G   1554 N2    ? ? ? 1_555 A  C   1565 O2    ? ? A G   1555 A C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1632 hydrog ? ? A  G   1554 O6    ? ? ? 1_555 A  C   1565 N4    ? ? A G   1555 A C   1566 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1633 hydrog ? ? A  G   1555 N1    ? ? ? 1_555 A  C   1564 N3    ? ? A G   1556 A C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1634 hydrog ? ? A  G   1555 N2    ? ? ? 1_555 A  C   1564 O2    ? ? A G   1556 A C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1635 hydrog ? ? A  G   1555 O6    ? ? ? 1_555 A  C   1564 N4    ? ? A G   1556 A C   1565 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1636 hydrog ? ? A  G   1556 N1    ? ? ? 1_555 A  C   1563 N3    ? ? A G   1557 A C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1637 hydrog ? ? A  G   1556 N2    ? ? ? 1_555 A  C   1563 O2    ? ? A G   1557 A C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1638 hydrog ? ? A  G   1556 O6    ? ? ? 1_555 A  C   1563 N4    ? ? A G   1557 A C   1564 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1639 hydrog ? ? A  U   1560 N3    ? ? ? 1_555 A  A   2738 N1    ? ? A U   1561 A A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1640 hydrog ? ? A  U   1560 O4    ? ? ? 1_555 A  A   2738 N6    ? ? A U   1561 A A   2739 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1641 hydrog ? ? A  C   1561 N3    ? ? ? 1_555 A  G   2737 N1    ? ? A C   1562 A G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1642 hydrog ? ? A  C   1561 N4    ? ? ? 1_555 A  G   2737 O6    ? ? A C   1562 A G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1643 hydrog ? ? A  C   1561 O2    ? ? ? 1_555 A  G   2737 N2    ? ? A C   1562 A G   2738 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1644 hydrog ? ? A  G   1567 N2    ? ? ? 1_555 A  A   1631 N3    ? ? A G   1568 A A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1645 hydrog ? ? A  C   1569 N3    ? ? ? 1_555 A  G   1626 N1    ? ? A C   1570 A G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1646 hydrog ? ? A  C   1569 N4    ? ? ? 1_555 A  G   1626 O6    ? ? A C   1570 A G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1647 hydrog ? ? A  C   1569 O2    ? ? ? 1_555 A  G   1626 N2    ? ? A C   1570 A G   1627 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1648 hydrog ? ? A  G   1570 N2    ? ? ? 1_555 A  A   1625 N7    ? ? A G   1571 A A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1649 hydrog ? ? A  G   1570 N3    ? ? ? 1_555 A  A   1625 N6    ? ? A G   1571 A A   1626 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1650 hydrog ? ? A  A   1571 N6    ? ? ? 1_555 A  A   1623 N7    ? ? A A   1572 A A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1651 hydrog ? ? A  A   1571 N7    ? ? ? 1_555 A  A   1623 N6    ? ? A A   1572 A A   1624 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1652 hydrog ? ? A  A   1572 N6    ? ? ? 1_555 A  C   1622 O2    ? ? A A   1573 A C   1623 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1653 hydrog ? ? A  C   1573 N3    ? ? ? 1_555 A  G   1621 N1    ? ? A C   1574 A G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1654 hydrog ? ? A  C   1573 N4    ? ? ? 1_555 A  G   1621 O6    ? ? A C   1574 A G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1655 hydrog ? ? A  C   1573 O2    ? ? ? 1_555 A  G   1621 N2    ? ? A C   1574 A G   1622 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1656 hydrog ? ? A  C   1574 N3    ? ? ? 1_555 A  G   1620 N1    ? ? A C   1575 A G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1657 hydrog ? ? A  C   1574 N4    ? ? ? 1_555 A  G   1620 O6    ? ? A C   1575 A G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1658 hydrog ? ? A  C   1574 O2    ? ? ? 1_555 A  G   1620 N2    ? ? A C   1575 A G   1621 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1659 hydrog ? ? A  G   1575 N1    ? ? ? 1_555 A  C   1619 N3    ? ? A G   1576 A C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1660 hydrog ? ? A  G   1575 N2    ? ? ? 1_555 A  C   1619 O2    ? ? A G   1576 A C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1661 hydrog ? ? A  G   1575 O6    ? ? ? 1_555 A  C   1619 N4    ? ? A G   1576 A C   1620 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1662 hydrog ? ? A  U   1576 N3    ? ? ? 1_555 A  G   1618 O6    ? ? A U   1577 A G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1663 hydrog ? ? A  U   1576 O2    ? ? ? 1_555 A  G   1618 N1    ? ? A U   1577 A G   1619 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1664 hydrog ? ? A  C   1577 N3    ? ? ? 1_555 A  G   1617 N1    ? ? A C   1578 A G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1665 hydrog ? ? A  C   1577 N4    ? ? ? 1_555 A  G   1617 O6    ? ? A C   1578 A G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1666 hydrog ? ? A  C   1577 O2    ? ? ? 1_555 A  G   1617 N2    ? ? A C   1578 A G   1618 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1667 hydrog ? ? A  C   1578 N3    ? ? ? 1_555 A  A   1615 N6    ? ? A C   1579 A A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1668 hydrog ? ? A  C   1578 N4    ? ? ? 1_555 A  A   1615 N7    ? ? A C   1579 A A   1616 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1669 hydrog ? ? A  C   1578 N4    ? ? ? 1_555 A  G   1617 O6    ? ? A C   1579 A G   1618 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1670 hydrog ? ? A  A   1580 N6    ? ? ? 1_555 A  G   1613 N3    ? ? A A   1581 A G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1671 hydrog ? ? A  A   1580 N7    ? ? ? 1_555 A  G   1613 N2    ? ? A A   1581 A G   1614 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1672 hydrog ? ? A  C   1581 N4    ? ? ? 1_555 A  C   1612 N3    ? ? A C   1582 A C   1613 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1673 hydrog ? ? A  U   1582 N3    ? ? ? 1_555 A  A   1611 N1    ? ? A U   1583 A A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1674 hydrog ? ? A  U   1582 O4    ? ? ? 1_555 A  A   1611 N6    ? ? A U   1583 A A   1612 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1675 hydrog ? ? A  C   1583 N3    ? ? ? 1_555 A  G   1610 N1    ? ? A C   1584 A G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1676 hydrog ? ? A  C   1583 N4    ? ? ? 1_555 A  G   1610 O6    ? ? A C   1584 A G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1677 hydrog ? ? A  C   1583 O2    ? ? ? 1_555 A  G   1610 N2    ? ? A C   1584 A G   1611 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1678 hydrog ? ? A  C   1584 N3    ? ? ? 1_555 A  G   1609 N1    ? ? A C   1585 A G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1679 hydrog ? ? A  C   1584 N4    ? ? ? 1_555 A  G   1609 O6    ? ? A C   1585 A G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1680 hydrog ? ? A  C   1584 O2    ? ? ? 1_555 A  G   1609 N2    ? ? A C   1585 A G   1610 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1681 hydrog ? ? A  G   1585 N1    ? ? ? 1_555 A  C   1608 N3    ? ? A G   1586 A C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1682 hydrog ? ? A  G   1585 N2    ? ? ? 1_555 A  C   1608 O2    ? ? A G   1586 A C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1683 hydrog ? ? A  G   1585 O6    ? ? ? 1_555 A  C   1608 N4    ? ? A G   1586 A C   1609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1684 hydrog ? ? A  U   1586 N3    ? ? ? 1_555 A  G   1607 O6    ? ? A U   1587 A G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1685 hydrog ? ? A  U   1586 O2    ? ? ? 1_555 A  G   1607 N1    ? ? A U   1587 A G   1608 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1686 hydrog ? ? A  G   1587 N2    ? ? ? 1_555 A  A   1606 N7    ? ? A G   1588 A A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1687 hydrog ? ? A  G   1587 N3    ? ? ? 1_555 A  A   1606 N6    ? ? A G   1588 A A   1607 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1688 hydrog ? ? A  G   1588 N2    ? ? ? 1_555 A  A   1605 N7    ? ? A G   1589 A A   1606 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1689 hydrog ? ? A  A   1589 N6    ? ? ? 1_555 A  G   1604 N3    ? ? A A   1590 A G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1690 hydrog ? ? A  A   1589 N7    ? ? ? 1_555 A  G   1604 N2    ? ? A A   1590 A G   1605 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1691 hydrog ? ? A  G   1591 N1    ? ? ? 1_555 A  C   1601 N3    ? ? A G   1592 A C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1692 hydrog ? ? A  G   1591 N2    ? ? ? 1_555 A  C   1601 O2    ? ? A G   1592 A C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1693 hydrog ? ? A  G   1591 O6    ? ? ? 1_555 A  C   1601 N4    ? ? A G   1592 A C   1602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1694 hydrog ? ? A  C   1592 N3    ? ? ? 1_555 A  G   1600 N1    ? ? A C   1593 A G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1695 hydrog ? ? A  C   1592 N4    ? ? ? 1_555 A  G   1600 O6    ? ? A C   1593 A G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1696 hydrog ? ? A  C   1592 O2    ? ? ? 1_555 A  G   1600 N2    ? ? A C   1593 A G   1601 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1697 hydrog ? ? A  C   1593 N3    ? ? ? 1_555 A  G   1599 N1    ? ? A C   1594 A G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1698 hydrog ? ? A  C   1593 N4    ? ? ? 1_555 A  G   1599 O6    ? ? A C   1594 A G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1699 hydrog ? ? A  C   1593 O2    ? ? ? 1_555 A  G   1599 N2    ? ? A C   1594 A G   1600 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1700 hydrog ? ? A  G   1627 N1    ? ? ? 1_555 A  C   1632 N3    ? ? A G   1628 A C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1701 hydrog ? ? A  G   1627 N2    ? ? ? 1_555 A  C   1632 O2    ? ? A G   1628 A C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1702 hydrog ? ? A  G   1627 O6    ? ? ? 1_555 A  C   1632 N4    ? ? A G   1628 A C   1633 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1703 hydrog ? ? A  G   1628 N2    ? ? ? 1_555 A  A   1631 N7    ? ? A G   1629 A A   1632 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1704 hydrog ? ? A  G   1628 N1    ? ? ? 1_555 A  C   1632 N3    ? ? A G   1629 A C   1633 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1705 hydrog ? ? A  C   1650 N3    ? ? ? 1_555 A  G   1654 N1    ? ? A C   1651 A G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1706 hydrog ? ? A  C   1650 N4    ? ? ? 1_555 A  G   1654 O6    ? ? A C   1651 A G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1707 hydrog ? ? A  C   1650 O2    ? ? ? 1_555 A  G   1654 N2    ? ? A C   1651 A G   1655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1708 hydrog ? ? A  A   1681 N6    ? ? ? 1_555 A  U   1695 O2    ? ? A A   1682 A U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1709 hydrog ? ? A  A   1681 N7    ? ? ? 1_555 A  U   1695 N3    ? ? A A   1682 A U   1696 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1710 hydrog ? ? A  A   1683 N6    ? ? ? 1_555 A  U   1721 O4    ? ? A A   1684 A U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1711 hydrog ? ? A  A   1683 N7    ? ? ? 1_555 A  U   1721 N3    ? ? A A   1684 A U   1722 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1712 hydrog ? ? A  C   1685 N3    ? ? ? 1_555 A  G   1694 N1    ? ? A C   1686 A G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1713 hydrog ? ? A  C   1685 N4    ? ? ? 1_555 A  G   1694 O6    ? ? A C   1686 A G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1714 hydrog ? ? A  C   1685 O2    ? ? ? 1_555 A  G   1694 N2    ? ? A C   1686 A G   1695 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1715 hydrog ? ? A  C   1686 N3    ? ? ? 1_555 A  G   1693 N1    ? ? A C   1687 A G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1716 hydrog ? ? A  C   1686 N4    ? ? ? 1_555 A  G   1693 O6    ? ? A C   1687 A G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1717 hydrog ? ? A  C   1686 O2    ? ? ? 1_555 A  G   1693 N2    ? ? A C   1687 A G   1694 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1718 hydrog ? ? A  G   1702 N1    ? ? ? 1_555 A  C   1714 N3    ? ? A G   1703 A C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1719 hydrog ? ? A  G   1702 N2    ? ? ? 1_555 A  C   1714 O2    ? ? A G   1703 A C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1720 hydrog ? ? A  G   1702 O6    ? ? ? 1_555 A  C   1714 N4    ? ? A G   1703 A C   1715 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1721 hydrog ? ? A  G   1703 N1    ? ? ? 1_555 A  C   1713 N3    ? ? A G   1704 A C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1722 hydrog ? ? A  G   1703 N2    ? ? ? 1_555 A  C   1713 O2    ? ? A G   1704 A C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1723 hydrog ? ? A  G   1703 O6    ? ? ? 1_555 A  C   1713 N4    ? ? A G   1704 A C   1714 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1724 hydrog ? ? A  C   1704 N3    ? ? ? 1_555 A  G   1712 N1    ? ? A C   1705 A G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1725 hydrog ? ? A  C   1704 N4    ? ? ? 1_555 A  G   1712 O6    ? ? A C   1705 A G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1726 hydrog ? ? A  C   1704 O2    ? ? ? 1_555 A  G   1712 N2    ? ? A C   1705 A G   1713 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1727 hydrog ? ? A  G   1705 N2    ? ? ? 1_555 A  A   1711 N7    ? ? A G   1706 A A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1728 hydrog ? ? A  G   1705 N3    ? ? ? 1_555 A  A   1711 N6    ? ? A G   1706 A A   1712 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1729 hydrog ? ? A  G   1706 N2    ? ? ? 1_555 A  A   1710 N7    ? ? A G   1707 A A   1711 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1730 hydrog ? ? A  C   1724 N3    ? ? ? 1_555 A  G   2049 N1    ? ? A C   1725 A G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1731 hydrog ? ? A  C   1724 N4    ? ? ? 1_555 A  G   2049 O6    ? ? A C   1725 A G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1732 hydrog ? ? A  C   1724 O2    ? ? ? 1_555 A  G   2049 N2    ? ? A C   1725 A G   2050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1733 hydrog ? ? A  G   1725 N1    ? ? ? 1_555 A  C   2048 N3    ? ? A G   1726 A C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1734 hydrog ? ? A  G   1725 N2    ? ? ? 1_555 A  C   2048 O2    ? ? A G   1726 A C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1735 hydrog ? ? A  G   1725 O6    ? ? ? 1_555 A  C   2048 N4    ? ? A G   1726 A C   2049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1736 hydrog ? ? A  G   1726 N1    ? ? ? 1_555 A  C   2047 N3    ? ? A G   1727 A C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1737 hydrog ? ? A  G   1726 N2    ? ? ? 1_555 A  C   2047 O2    ? ? A G   1727 A C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1738 hydrog ? ? A  G   1726 O6    ? ? ? 1_555 A  C   2047 N4    ? ? A G   1727 A C   2048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1739 hydrog ? ? A  G   1727 N1    ? ? ? 1_555 A  C   2046 N3    ? ? A G   1728 A C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1740 hydrog ? ? A  G   1727 N2    ? ? ? 1_555 A  C   2046 O2    ? ? A G   1728 A C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1741 hydrog ? ? A  G   1727 O6    ? ? ? 1_555 A  C   2046 N4    ? ? A G   1728 A C   2047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1742 hydrog ? ? A  A   1732 N6    ? ? ? 1_555 A  G   2045 N3    ? ? A A   1733 A G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1743 hydrog ? ? A  A   1732 N7    ? ? ? 1_555 A  G   2045 N2    ? ? A A   1733 A G   2046 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1744 hydrog ? ? A  C   1733 N3    ? ? ? 1_555 A  G   2044 N1    ? ? A C   1734 A G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1745 hydrog ? ? A  C   1733 N4    ? ? ? 1_555 A  G   2044 O6    ? ? A C   1734 A G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1746 hydrog ? ? A  C   1733 O2    ? ? ? 1_555 A  G   2044 N2    ? ? A C   1734 A G   2045 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1747 hydrog ? ? A  C   1734 N3    ? ? ? 1_555 A  G   2043 N1    ? ? A C   1735 A G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1748 hydrog ? ? A  C   1734 N4    ? ? ? 1_555 A  G   2043 O6    ? ? A C   1735 A G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1749 hydrog ? ? A  C   1734 O2    ? ? ? 1_555 A  G   2043 N2    ? ? A C   1735 A G   2044 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1750 hydrog ? ? A  A   1735 N1    ? ? ? 1_555 A  U   2042 N3    ? ? A A   1736 A U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1751 hydrog ? ? A  A   1735 N6    ? ? ? 1_555 A  U   2042 O4    ? ? A A   1736 A U   2043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1752 hydrog ? ? A  A   1736 N1    ? ? ? 1_555 A  U   2041 N3    ? ? A A   1737 A U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1753 hydrog ? ? A  A   1736 N6    ? ? ? 1_555 A  U   2041 O4    ? ? A A   1737 A U   2042 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1754 hydrog ? ? A  C   1737 N3    ? ? ? 1_555 A  G   2040 N1    ? ? A C   1738 A G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1755 hydrog ? ? A  C   1737 N4    ? ? ? 1_555 A  G   2040 O6    ? ? A C   1738 A G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1756 hydrog ? ? A  C   1737 O2    ? ? ? 1_555 A  G   2040 N2    ? ? A C   1738 A G   2041 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1757 hydrog ? ? A  G   1738 N1    ? ? ? 1_555 A  C   2039 N3    ? ? A G   1739 A C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1758 hydrog ? ? A  G   1738 N2    ? ? ? 1_555 A  C   2039 O2    ? ? A G   1739 A C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1759 hydrog ? ? A  G   1738 O6    ? ? ? 1_555 A  C   2039 N4    ? ? A G   1739 A C   2040 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1760 hydrog ? ? A  U   1739 N3    ? ? ? 1_555 A  A   2038 N1    ? ? A U   1740 A A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1761 hydrog ? ? A  U   1739 O4    ? ? ? 1_555 A  A   2038 N6    ? ? A U   1740 A A   2039 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1762 hydrog ? ? A  U   1740 N3    ? ? ? 1_555 A  A   2037 N1    ? ? A U   1741 A A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1763 hydrog ? ? A  U   1740 O4    ? ? ? 1_555 A  A   2037 N6    ? ? A U   1741 A A   2038 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1764 hydrog ? ? A  A   1741 N6    ? ? ? 1_555 A  G   2032 O6    ? ? A A   1742 A G   2033 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1765 hydrog ? ? A  A   1741 N1    ? ? ? 1_555 A  C   2036 N4    ? ? A A   1742 A C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1766 hydrog ? ? A  A   1741 N6    ? ? ? 1_555 A  C   2036 N3    ? ? A A   1742 A C   2037 1_555 ? ? ? ? ? ? TYPE_26_PAIR ? ? 
hydrog1767 hydrog ? ? A  G   1742 N1    ? ? ? 1_555 A  C   2035 N3    ? ? A G   1743 A C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1768 hydrog ? ? A  G   1742 N2    ? ? ? 1_555 A  C   2035 O2    ? ? A G   1743 A C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1769 hydrog ? ? A  G   1742 O6    ? ? ? 1_555 A  C   2035 N4    ? ? A G   1743 A C   2036 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1770 hydrog ? ? A  G   1743 N1    ? ? ? 1_555 A  C   2034 N3    ? ? A G   1744 A C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1771 hydrog ? ? A  G   1743 N2    ? ? ? 1_555 A  C   2034 O2    ? ? A G   1744 A C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1772 hydrog ? ? A  G   1743 O6    ? ? ? 1_555 A  C   2034 N4    ? ? A G   1744 A C   2035 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1773 hydrog ? ? A  G   1744 N2    ? ? ? 1_555 A  U   2033 O4    ? ? A G   1745 A U   2034 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1774 hydrog ? ? A  A   1745 N6    ? ? ? 1_555 A  U   2031 O2    ? ? A A   1746 A U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1775 hydrog ? ? A  A   1745 N7    ? ? ? 1_555 A  U   2031 N3    ? ? A A   1746 A U   2032 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog1776 hydrog ? ? A  A   1746 N1    ? ? ? 1_555 A  U   2033 N3    ? ? A A   1747 A U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1777 hydrog ? ? A  A   1746 N6    ? ? ? 1_555 A  U   2033 O4    ? ? A A   1747 A U   2034 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1778 hydrog ? ? A  G   1751 N1    ? ? ? 1_555 A  C   2030 N3    ? ? A G   1752 A C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1779 hydrog ? ? A  G   1751 N2    ? ? ? 1_555 A  C   2030 O2    ? ? A G   1752 A C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1780 hydrog ? ? A  G   1751 O6    ? ? ? 1_555 A  C   2030 N4    ? ? A G   1752 A C   2031 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1781 hydrog ? ? A  G   1759 N1    ? ? ? 1_555 A  U   1783 O2    ? ? A G   1760 A U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1782 hydrog ? ? A  G   1759 O6    ? ? ? 1_555 A  U   1783 N3    ? ? A G   1760 A U   1784 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1783 hydrog ? ? A  U   1760 N3    ? ? ? 1_555 A  A   1782 N1    ? ? A U   1761 A A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1784 hydrog ? ? A  U   1760 O4    ? ? ? 1_555 A  A   1782 N6    ? ? A U   1761 A A   1783 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1785 hydrog ? ? A  C   1761 N3    ? ? ? 1_555 A  G   1781 N1    ? ? A C   1762 A G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1786 hydrog ? ? A  C   1761 N4    ? ? ? 1_555 A  G   1781 O6    ? ? A C   1762 A G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1787 hydrog ? ? A  C   1761 O2    ? ? ? 1_555 A  G   1781 N2    ? ? A C   1762 A G   1782 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1788 hydrog ? ? A  C   1762 N3    ? ? ? 1_555 A  G   1780 N1    ? ? A C   1763 A G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1789 hydrog ? ? A  C   1762 N4    ? ? ? 1_555 A  G   1780 O6    ? ? A C   1763 A G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1790 hydrog ? ? A  C   1762 O2    ? ? ? 1_555 A  G   1780 N2    ? ? A C   1763 A G   1781 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1791 hydrog ? ? A  C   1763 N3    ? ? ? 1_555 A  G   1779 N1    ? ? A C   1764 A G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1792 hydrog ? ? A  C   1763 N4    ? ? ? 1_555 A  G   1779 O6    ? ? A C   1764 A G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1793 hydrog ? ? A  C   1763 O2    ? ? ? 1_555 A  G   1779 N2    ? ? A C   1764 A G   1780 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1794 hydrog ? ? A  G   1764 N2    ? ? ? 1_555 A  A   1778 N7    ? ? A G   1765 A A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1795 hydrog ? ? A  G   1764 N3    ? ? ? 1_555 A  A   1778 N6    ? ? A G   1765 A A   1779 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1796 hydrog ? ? A  A   1766 N6    ? ? ? 1_555 A  A   1775 N7    ? ? A A   1767 A A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1797 hydrog ? ? A  A   1766 N7    ? ? ? 1_555 A  A   1775 N6    ? ? A A   1767 A A   1776 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog1798 hydrog ? ? A  C   1767 N4    ? ? ? 1_555 A  A   1774 N3    ? ? A C   1768 A A   1775 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1799 hydrog ? ? A  C   1768 N3    ? ? ? 1_555 A  G   1773 N1    ? ? A C   1769 A G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1800 hydrog ? ? A  C   1768 N4    ? ? ? 1_555 A  G   1773 O6    ? ? A C   1769 A G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1801 hydrog ? ? A  C   1768 O2    ? ? ? 1_555 A  G   1773 N2    ? ? A C   1769 A G   1774 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1802 hydrog ? ? A  U   1769 O2    ? ? ? 1_555 A  G   1772 N1    ? ? A U   1770 A G   1773 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog1803 hydrog ? ? A  U   1770 N3    ? ? ? 1_555 A  A   1884 N1    ? ? A U   1771 A A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1804 hydrog ? ? A  U   1770 O4    ? ? ? 1_555 A  A   1884 N6    ? ? A U   1771 A A   1885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1805 hydrog ? ? A  G   1784 N1    ? ? ? 1_555 A  U   1806 O2    ? ? A G   1785 A U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1806 hydrog ? ? A  G   1784 O6    ? ? ? 1_555 A  U   1806 N3    ? ? A G   1785 A U   1807 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1807 hydrog ? ? A  C   1785 N3    ? ? ? 1_555 A  G   1805 N1    ? ? A C   1786 A G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1808 hydrog ? ? A  C   1785 N4    ? ? ? 1_555 A  G   1805 O6    ? ? A C   1786 A G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1809 hydrog ? ? A  C   1785 O2    ? ? ? 1_555 A  G   1805 N2    ? ? A C   1786 A G   1806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1810 hydrog ? ? A  C   1786 N3    ? ? ? 1_555 A  G   1804 N1    ? ? A C   1787 A G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1811 hydrog ? ? A  C   1786 N4    ? ? ? 1_555 A  G   1804 O6    ? ? A C   1787 A G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1812 hydrog ? ? A  C   1786 O2    ? ? ? 1_555 A  G   1804 N2    ? ? A C   1787 A G   1805 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1813 hydrog ? ? A  U   1787 N3    ? ? ? 1_555 A  A   1803 N1    ? ? A U   1788 A A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1814 hydrog ? ? A  U   1787 O4    ? ? ? 1_555 A  A   1803 N6    ? ? A U   1788 A A   1804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1815 hydrog ? ? A  G   1788 N1    ? ? ? 1_555 A  C   1802 N3    ? ? A G   1789 A C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1816 hydrog ? ? A  G   1788 N2    ? ? ? 1_555 A  C   1802 O2    ? ? A G   1789 A C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1817 hydrog ? ? A  G   1788 O6    ? ? ? 1_555 A  C   1802 N4    ? ? A G   1789 A C   1803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1818 hydrog ? ? A  C   1789 N3    ? ? ? 1_555 A  G   1801 N1    ? ? A C   1790 A G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1819 hydrog ? ? A  C   1789 N4    ? ? ? 1_555 A  G   1801 O6    ? ? A C   1790 A G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1820 hydrog ? ? A  C   1789 O2    ? ? ? 1_555 A  G   1801 N2    ? ? A C   1790 A G   1802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1821 hydrog ? ? A  U   1790 N3    ? ? ? 1_555 A  A   1800 N1    ? ? A U   1791 A A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1822 hydrog ? ? A  U   1790 O4    ? ? ? 1_555 A  A   1800 N6    ? ? A U   1791 A A   1801 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1823 hydrog ? ? A  C   1791 N3    ? ? ? 1_555 A  G   1799 N1    ? ? A C   1792 A G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1824 hydrog ? ? A  C   1791 N4    ? ? ? 1_555 A  G   1799 O6    ? ? A C   1792 A G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1825 hydrog ? ? A  C   1791 O2    ? ? ? 1_555 A  G   1799 N2    ? ? A C   1792 A G   1800 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1826 hydrog ? ? A  C   1792 N3    ? ? ? 1_555 A  G   1798 N1    ? ? A C   1793 A G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1827 hydrog ? ? A  C   1792 N4    ? ? ? 1_555 A  G   1798 O6    ? ? A C   1793 A G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1828 hydrog ? ? A  C   1792 O2    ? ? ? 1_555 A  G   1798 N2    ? ? A C   1793 A G   1799 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1829 hydrog ? ? A  G   1793 N2    ? ? ? 1_555 A  A   1796 N7    ? ? A G   1794 A A   1797 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1830 hydrog ? ? A  G   1805 N2    ? ? ? 1_555 A  A   2882 N3    ? ? A G   1806 A A   2883 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1831 hydrog ? ? A  C   1807 N3    ? ? ? 1_555 A  G   1811 N1    ? ? A C   1808 A G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1832 hydrog ? ? A  C   1807 N4    ? ? ? 1_555 A  G   1811 O6    ? ? A C   1808 A G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1833 hydrog ? ? A  C   1807 O2    ? ? ? 1_555 A  G   1811 N2    ? ? A C   1808 A G   1812 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1834 hydrog ? ? A  C   1809 N4    ? ? ? 1_555 A  C   2751 O2    ? ? A C   1810 A C   2752 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1835 hydrog ? ? A  A   1810 N1    ? ? ? 1_555 A  G   2730 N2    ? ? A A   1811 A G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1836 hydrog ? ? A  A   1810 N6    ? ? ? 1_555 A  G   2730 N3    ? ? A A   1811 A G   2731 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1837 hydrog ? ? A  U   1812 N3    ? ? ? 1_555 A  U   1816 O4    ? ? A U   1813 A U   1817 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1838 hydrog ? ? A  U   1812 O2    ? ? ? 1_555 A  U   1816 N3    ? ? A U   1813 A U   1817 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog1839 hydrog ? ? A  U   1812 N3    ? ? ? 1_555 A  C   1817 O2    ? ? A U   1813 A C   1818 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1840 hydrog ? ? A  G   1819 N1    ? ? ? 1_555 A  C   2028 N3    ? ? A G   1820 A C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1841 hydrog ? ? A  G   1819 N2    ? ? ? 1_555 A  C   2028 O2    ? ? A G   1820 A C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1842 hydrog ? ? A  G   1819 O6    ? ? ? 1_555 A  C   2028 N4    ? ? A G   1820 A C   2029 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1843 hydrog ? ? A  A   1820 N1    ? ? ? 1_555 A  U   2027 N3    ? ? A A   1821 A U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1844 hydrog ? ? A  A   1820 N6    ? ? ? 1_555 A  U   2027 O4    ? ? A A   1821 A U   2028 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1845 hydrog ? ? A  A   1821 N1    ? ? ? 1_555 A  U   2026 N3    ? ? A A   1822 A U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1846 hydrog ? ? A  A   1821 N6    ? ? ? 1_555 A  U   2026 O4    ? ? A A   1822 A U   2027 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1847 hydrog ? ? A  G   1822 N1    ? ? ? 1_555 A  C   2025 N3    ? ? A G   1823 A C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1848 hydrog ? ? A  G   1822 N2    ? ? ? 1_555 A  C   2025 O2    ? ? A G   1823 A C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1849 hydrog ? ? A  G   1822 O6    ? ? ? 1_555 A  C   2025 N4    ? ? A G   1823 A C   2026 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1850 hydrog ? ? A  C   1823 N3    ? ? ? 1_555 A  G   2024 N1    ? ? A C   1824 A G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1851 hydrog ? ? A  C   1823 N4    ? ? ? 1_555 A  G   2024 O6    ? ? A C   1824 A G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1852 hydrog ? ? A  C   1823 O2    ? ? ? 1_555 A  G   2024 N2    ? ? A C   1824 A G   2025 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1853 hydrog ? ? A  U   1824 N3    ? ? ? 1_555 A  A   2023 N1    ? ? A U   1825 A A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1854 hydrog ? ? A  U   1824 O4    ? ? ? 1_555 A  A   2023 N6    ? ? A U   1825 A A   2024 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1855 hydrog ? ? A  C   1825 N3    ? ? ? 1_555 A  G   2022 N1    ? ? A C   1826 A G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1856 hydrog ? ? A  C   1825 N4    ? ? ? 1_555 A  G   2022 O6    ? ? A C   1826 A G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1857 hydrog ? ? A  C   1825 O2    ? ? ? 1_555 A  G   2022 N2    ? ? A C   1826 A G   2023 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1858 hydrog ? ? A  G   1826 N1    ? ? ? 1_555 A  C   2020 N3    ? ? A G   1827 A C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1859 hydrog ? ? A  G   1826 N2    ? ? ? 1_555 A  C   2020 O2    ? ? A G   1827 A C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1860 hydrog ? ? A  G   1826 O6    ? ? ? 1_555 A  C   2020 N4    ? ? A G   1827 A C   2021 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1861 hydrog ? ? A  G   1827 N1    ? ? ? 1_555 A  C   2019 N3    ? ? A G   1828 A C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1862 hydrog ? ? A  G   1827 N2    ? ? ? 1_555 A  C   2019 O2    ? ? A G   1828 A C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1863 hydrog ? ? A  G   1827 O6    ? ? ? 1_555 A  C   2019 N4    ? ? A G   1828 A C   2020 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1864 hydrog ? ? A  G   1827 N1    ? ? ? 1_555 A  C   2020 N3    ? ? A G   1828 A C   2021 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog1865 hydrog ? ? A  A   1828 N3    ? ? ? 1_555 A  A   2017 N6    ? ? A A   1829 A A   2018 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1866 hydrog ? ? A  C   1829 N4    ? ? ? 1_555 A  U   1845 O2    ? ? A C   1830 A U   1846 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog1867 hydrog ? ? A  G   1831 N1    ? ? ? 1_555 A  C   1843 N3    ? ? A G   1832 A C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1868 hydrog ? ? A  G   1831 N2    ? ? ? 1_555 A  C   1843 O2    ? ? A G   1832 A C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1869 hydrog ? ? A  G   1831 O6    ? ? ? 1_555 A  C   1843 N4    ? ? A G   1832 A C   1844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1870 hydrog ? ? A  U   1832 N3    ? ? ? 1_555 A  A   1842 N1    ? ? A U   1833 A A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1871 hydrog ? ? A  U   1832 O4    ? ? ? 1_555 A  A   1842 N6    ? ? A U   1833 A A   1843 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1872 hydrog ? ? A  C   1833 O2    ? ? ? 1_555 A  C   1840 N4    ? ? A C   1834 A C   1841 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1873 hydrog ? ? A  U   1834 O4    ? ? ? 1_555 A  C   1840 N4    ? ? A U   1835 A C   1841 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog1874 hydrog ? ? A  U   1837 N3    ? ? ? 1_555 A  U   2620 O4    ? ? A U   1838 A U   2621 1_555 ? ? ? ? ? ? TYPE_12_PAIR ? ? 
hydrog1875 hydrog ? ? A  U   1837 O4    ? ? ? 1_555 A  U   2620 N3    ? ? A U   1838 A U   2621 1_555 ? ? ? ? ? ? TYPE_12_PAIR ? ? 
hydrog1876 hydrog ? ? A  A   1838 N3    ? ? ? 1_555 A  G   2641 N2    ? ? A A   1839 A G   2642 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1877 hydrog ? ? A  C   1840 O2    ? ? ? 1_555 A  G   2622 N2    ? ? A C   1841 A G   2623 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog1878 hydrog ? ? A  A   1846 N6    ? ? ? 1_555 A  G   1883 N3    ? ? A A   1847 A G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1879 hydrog ? ? A  A   1846 N7    ? ? ? 1_555 A  G   1883 N2    ? ? A A   1847 A G   1884 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1880 hydrog ? ? A  G   1847 N1    ? ? ? 1_555 A  U   1882 O2    ? ? A G   1848 A U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1881 hydrog ? ? A  G   1847 O6    ? ? ? 1_555 A  U   1882 N3    ? ? A G   1848 A U   1883 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1882 hydrog ? ? A  G   1848 N1    ? ? ? 1_555 A  C   1881 N3    ? ? A G   1849 A C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1883 hydrog ? ? A  G   1848 N2    ? ? ? 1_555 A  C   1881 O2    ? ? A G   1849 A C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1884 hydrog ? ? A  G   1848 O6    ? ? ? 1_555 A  C   1881 N4    ? ? A G   1849 A C   1882 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1885 hydrog ? ? A  U   1849 N3    ? ? ? 1_555 A  A   1880 N1    ? ? A U   1850 A A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1886 hydrog ? ? A  U   1849 O4    ? ? ? 1_555 A  A   1880 N6    ? ? A U   1850 A A   1881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1887 hydrog ? ? A  G   1850 N1    ? ? ? 1_555 A  C   1879 N3    ? ? A G   1851 A C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1888 hydrog ? ? A  G   1850 N2    ? ? ? 1_555 A  C   1879 O2    ? ? A G   1851 A C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1889 hydrog ? ? A  G   1850 O6    ? ? ? 1_555 A  C   1879 N4    ? ? A G   1851 A C   1880 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1890 hydrog ? ? A  A   1851 N1    ? ? ? 1_555 A  U   1878 N3    ? ? A A   1852 A U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1891 hydrog ? ? A  A   1851 N6    ? ? ? 1_555 A  U   1878 O4    ? ? A A   1852 A U   1879 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1892 hydrog ? ? A  C   1852 N3    ? ? ? 1_555 A  G   1877 N1    ? ? A C   1853 A G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1893 hydrog ? ? A  C   1852 N4    ? ? ? 1_555 A  G   1877 O6    ? ? A C   1853 A G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1894 hydrog ? ? A  C   1852 O2    ? ? ? 1_555 A  G   1877 N2    ? ? A C   1853 A G   1878 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1895 hydrog ? ? A  C   1853 N3    ? ? ? 1_555 A  G   1876 N1    ? ? A C   1854 A G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1896 hydrog ? ? A  C   1853 N4    ? ? ? 1_555 A  G   1876 O6    ? ? A C   1854 A G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1897 hydrog ? ? A  C   1853 O2    ? ? ? 1_555 A  G   1876 N2    ? ? A C   1854 A G   1877 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1898 hydrog ? ? A  G   1854 N2    ? ? ? 1_555 A  U   1873 O2    ? ? A G   1855 A U   1874 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1899 hydrog ? ? A  C   1855 N3    ? ? ? 1_555 A  G   1872 N2    ? ? A C   1856 A G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1900 hydrog ? ? A  C   1855 O2    ? ? ? 1_555 A  G   1872 N1    ? ? A C   1856 A G   1873 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog1901 hydrog ? ? A  C   1855 N4    ? ? ? 1_555 A  A   1874 N7    ? ? A C   1856 A A   1875 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog1902 hydrog ? ? A  A   1856 N6    ? ? ? 1_555 A  U   2245 O2    ? ? A A   1857 A U   2246 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1903 hydrog ? ? A  A   1857 N6    ? ? ? 1_555 A  U   1870 O4    ? ? A A   1858 A U   1871 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1904 hydrog ? ? A  A   1858 N6    ? ? ? 1_555 A  C   1869 O2    ? ? A A   1859 A C   1870 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog1905 hydrog ? ? A  A   1858 N3    ? ? ? 1_555 A  G   1877 N2    ? ? A A   1859 A G   1878 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1906 hydrog ? ? A  U   1859 N3    ? ? ? 1_555 A  A   1868 N1    ? ? A U   1860 A A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1907 hydrog ? ? A  U   1859 O4    ? ? ? 1_555 A  A   1868 N6    ? ? A U   1860 A A   1869 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1908 hydrog ? ? A  C   1860 N3    ? ? ? 1_555 A  G   1867 N1    ? ? A C   1861 A G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1909 hydrog ? ? A  C   1860 N4    ? ? ? 1_555 A  G   1867 O6    ? ? A C   1861 A G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1910 hydrog ? ? A  C   1860 O2    ? ? ? 1_555 A  G   1867 N2    ? ? A C   1861 A G   1868 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1911 hydrog ? ? A  C   1861 N3    ? ? ? 1_555 A  G   1866 N1    ? ? A C   1862 A G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1912 hydrog ? ? A  C   1861 N4    ? ? ? 1_555 A  G   1866 O6    ? ? A C   1862 A G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1913 hydrog ? ? A  C   1861 O2    ? ? ? 1_555 A  G   1866 N2    ? ? A C   1862 A G   1867 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1914 hydrog ? ? A  G   1862 N2    ? ? ? 1_555 A  A   1865 N7    ? ? A G   1863 A A   1866 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1915 hydrog ? ? A  A   1884 N6    ? ? ? 1_555 A  U   2016 O2    ? ? A A   1885 A U   2017 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1916 hydrog ? ? A  A   1885 N6    ? ? ? 1_555 A  U   2015 O2    ? ? A A   1886 A U   2016 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog1917 hydrog ? ? A  U   1886 N3    ? ? ? 1_555 A  A   2014 N1    ? ? A U   1887 A A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1918 hydrog ? ? A  U   1886 O4    ? ? ? 1_555 A  A   2014 N6    ? ? A U   1887 A A   2015 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1919 hydrog ? ? A  C   1887 N3    ? ? ? 1_555 A  G   2013 N1    ? ? A C   1888 A G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1920 hydrog ? ? A  C   1887 N4    ? ? ? 1_555 A  G   2013 O6    ? ? A C   1888 A G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1921 hydrog ? ? A  C   1887 O2    ? ? ? 1_555 A  G   2013 N2    ? ? A C   1888 A G   2014 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1922 hydrog ? ? A  C   1888 N3    ? ? ? 1_555 A  G   2012 N1    ? ? A C   1889 A G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1923 hydrog ? ? A  C   1888 N4    ? ? ? 1_555 A  G   2012 O6    ? ? A C   1889 A G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1924 hydrog ? ? A  C   1888 O2    ? ? ? 1_555 A  G   2012 N2    ? ? A C   1889 A G   2013 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1925 hydrog ? ? A  U   1889 O4    ? ? ? 1_555 A  A   1940 N6    ? ? A U   1890 A A   1941 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1926 hydrog ? ? A  U   1889 N3    ? ? ? 1_555 A  A   2010 N7    ? ? A U   1890 A A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1927 hydrog ? ? A  U   1889 O4    ? ? ? 1_555 A  A   2010 N6    ? ? A U   1890 A A   2011 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog1928 hydrog ? ? A  G   1890 N1    ? ? ? 1_555 A  C   1945 N3    ? ? A G   1891 A C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1929 hydrog ? ? A  G   1890 N2    ? ? ? 1_555 A  C   1945 O2    ? ? A G   1891 A C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1930 hydrog ? ? A  G   1890 O6    ? ? ? 1_555 A  C   1945 N4    ? ? A G   1891 A C   1946 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1931 hydrog ? ? A  C   1891 N3    ? ? ? 1_555 A  G   1944 N1    ? ? A C   1892 A G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1932 hydrog ? ? A  C   1891 N4    ? ? ? 1_555 A  G   1944 O6    ? ? A C   1892 A G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1933 hydrog ? ? A  C   1891 O2    ? ? ? 1_555 A  G   1944 N2    ? ? A C   1892 A G   1945 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1934 hydrog ? ? A  C   1892 N3    ? ? ? 1_555 A  G   1943 N1    ? ? A C   1893 A G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1935 hydrog ? ? A  C   1892 N4    ? ? ? 1_555 A  G   1943 O6    ? ? A C   1893 A G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1936 hydrog ? ? A  C   1892 O2    ? ? ? 1_555 A  G   1943 N2    ? ? A C   1893 A G   1944 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1937 hydrog ? ? A  C   1893 N3    ? ? ? 1_555 A  A   1941 N6    ? ? A C   1894 A A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1938 hydrog ? ? A  C   1893 N4    ? ? ? 1_555 A  A   1941 N7    ? ? A C   1894 A A   1942 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog1939 hydrog ? ? A  G   1895 N1    ? ? ? 1_555 A  C   1942 N3    ? ? A G   1896 A C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1940 hydrog ? ? A  G   1895 N2    ? ? ? 1_555 A  C   1942 O2    ? ? A G   1896 A C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1941 hydrog ? ? A  G   1895 O6    ? ? ? 1_555 A  C   1942 N4    ? ? A G   1896 A C   1943 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1942 hydrog ? ? A  U   1896 N3    ? ? ? 1_555 A  A   1941 N1    ? ? A U   1897 A A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1943 hydrog ? ? A  U   1896 O4    ? ? ? 1_555 A  A   1941 N6    ? ? A U   1897 A A   1942 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1944 hydrog ? ? A  G   1897 N1    ? ? ? 1_555 A  U   1938 O2    ? ? A G   1898 A U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1945 hydrog ? ? A  G   1897 O6    ? ? ? 1_555 A  U   1938 N3    ? ? A G   1898 A U   1939 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1946 hydrog ? ? A  C   1898 N3    ? ? ? 1_555 A  G   1937 N1    ? ? A C   1899 A G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1947 hydrog ? ? A  C   1898 N4    ? ? ? 1_555 A  G   1937 O6    ? ? A C   1899 A G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1948 hydrog ? ? A  C   1898 O2    ? ? ? 1_555 A  G   1937 N2    ? ? A C   1899 A G   1938 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1949 hydrog ? ? A  A   1899 N1    ? ? ? 1_555 A  U   1936 N3    ? ? A A   1900 A U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1950 hydrog ? ? A  A   1899 N6    ? ? ? 1_555 A  U   1936 O4    ? ? A A   1900 A U   1937 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1951 hydrog ? ? A  G   1900 N1    ? ? ? 1_555 A  C   1935 N3    ? ? A G   1901 A C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1952 hydrog ? ? A  G   1900 N2    ? ? ? 1_555 A  C   1935 O2    ? ? A G   1901 A C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1953 hydrog ? ? A  G   1900 O6    ? ? ? 1_555 A  C   1935 N4    ? ? A G   1901 A C   1936 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1954 hydrog ? ? A  G   1901 N1    ? ? ? 1_555 A  C   1934 N3    ? ? A G   1902 A C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1955 hydrog ? ? A  G   1901 N2    ? ? ? 1_555 A  C   1934 O2    ? ? A G   1902 A C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1956 hydrog ? ? A  G   1901 O6    ? ? ? 1_555 A  C   1934 N4    ? ? A G   1902 A C   1935 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1957 hydrog ? ? A  U   1902 O2    ? ? ? 1_555 A  A   1933 N6    ? ? A U   1903 A A   1934 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1958 hydrog ? ? A  U   1904 N3    ? ? ? 1_555 A  A   1933 N1    ? ? A U   1905 A A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1959 hydrog ? ? A  U   1904 O4    ? ? ? 1_555 A  A   1933 N6    ? ? A U   1905 A A   1934 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1960 hydrog ? ? A  C   1905 N3    ? ? ? 1_555 A  G   1932 N1    ? ? A C   1906 A G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1961 hydrog ? ? A  C   1905 N4    ? ? ? 1_555 A  G   1932 O6    ? ? A C   1906 A G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1962 hydrog ? ? A  C   1905 O2    ? ? ? 1_555 A  G   1932 N2    ? ? A C   1906 A G   1933 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1963 hydrog ? ? A  U   1906 N3    ? ? ? 1_555 A  G   1931 O6    ? ? A U   1907 A G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1964 hydrog ? ? A  U   1906 O2    ? ? ? 1_555 A  G   1931 N1    ? ? A U   1907 A G   1932 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1965 hydrog ? ? A  G   1907 N2    ? ? ? 1_555 A  A   1930 N7    ? ? A G   1908 A A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1966 hydrog ? ? A  G   1907 N3    ? ? ? 1_555 A  A   1930 N6    ? ? A G   1908 A A   1931 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1967 hydrog ? ? A  A   1909 N3    ? ? ? 1_555 A  G   2127 N2    ? ? A A   1910 A G   2128 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1968 hydrog ? ? A  A   1911 N6    ? ? ? 1_555 A  A   1926 N1    ? ? A A   1912 A A   1927 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog1969 hydrog ? ? A  C   1912 N3    ? ? ? 1_555 A  G   1925 N1    ? ? A C   1913 A G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1970 hydrog ? ? A  C   1912 N4    ? ? ? 1_555 A  G   1925 O6    ? ? A C   1913 A G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1971 hydrog ? ? A  C   1912 O2    ? ? ? 1_555 A  G   1925 N2    ? ? A C   1913 A G   1926 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1972 hydrog ? ? A  C   1913 N3    ? ? ? 1_555 A  G   1924 N1    ? ? A C   1914 A G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1973 hydrog ? ? A  C   1913 N4    ? ? ? 1_555 A  G   1924 O6    ? ? A C   1914 A G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1974 hydrog ? ? A  C   1913 O2    ? ? ? 1_555 A  G   1924 N2    ? ? A C   1914 A G   1925 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1975 hydrog ? ? A  U   1914 N3    ? ? ? 1_555 A  A   1923 N1    ? ? A U   1915 A A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1976 hydrog ? ? A  U   1914 O4    ? ? ? 1_555 A  A   1923 N6    ? ? A U   1915 A A   1924 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1977 hydrog ? ? A  C   1915 N3    ? ? ? 1_555 A  G   1922 N1    ? ? A C   1916 A G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1978 hydrog ? ? A  C   1915 N4    ? ? ? 1_555 A  G   1922 O6    ? ? A C   1916 A G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1979 hydrog ? ? A  C   1915 O2    ? ? ? 1_555 A  G   1922 N2    ? ? A C   1916 A G   1923 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1980 hydrog ? ? A  G   1916 N2    ? ? ? 1_555 A  A   1921 N7    ? ? A G   1917 A A   1922 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1981 hydrog ? ? A  A   1920 N1    ? ? ? 1_555 A  G   2448 N2    ? ? A A   1921 A G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1982 hydrog ? ? A  A   1920 N6    ? ? ? 1_555 A  G   2448 N3    ? ? A A   1921 A G   2449 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog1983 hydrog ? ? A  A   1930 N3    ? ? ? 1_555 A  G   2266 N2    ? ? A A   1931 A G   2267 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog1984 hydrog ? ? A  C   1939 O2    ? ? ? 1_555 A  C   1942 N4    ? ? A C   1940 A C   1943 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog1985 hydrog ? ? A  G   1944 N2    ? ? ? 1_555 A  A   1968 N3    ? ? A G   1945 A A   1969 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog1986 hydrog ? ? A  G   1946 N1    ? ? ? 1_555 A  C   1964 N3    ? ? A G   1947 A C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1987 hydrog ? ? A  G   1946 N2    ? ? ? 1_555 A  C   1964 O2    ? ? A G   1947 A C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1988 hydrog ? ? A  G   1946 O6    ? ? ? 1_555 A  C   1964 N4    ? ? A G   1947 A C   1965 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog1989 hydrog ? ? A  G   1947 N1    ? ? ? 1_555 A  U   1963 O2    ? ? A G   1948 A U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1990 hydrog ? ? A  G   1947 O6    ? ? ? 1_555 A  U   1963 N3    ? ? A G   1948 A U   1964 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1991 hydrog ? ? A  U   1965 N3    ? ? ? 1_555 A  G   1969 O6    ? ? A U   1966 A G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog1992 hydrog ? ? A  U   1965 O4    ? ? ? 1_555 A  G   1969 N1    ? ? A U   1966 A G   1970 1_555 ? ? ? ? ? ? TYPE_27_PAIR ? ? 
hydrog1993 hydrog ? ? A  G   1970 N2    ? ? ? 1_555 A  U   1971 O4    ? ? A G   1971 A U   1972 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog1994 hydrog ? ? A  U   1971 N3    ? ? ? 1_555 A  A   2009 N7    ? ? A U   1972 A A   2010 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog1995 hydrog ? ? A  A   1972 N6    ? ? ? 1_555 A  G   2008 N3    ? ? A A   1973 A G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1996 hydrog ? ? A  A   1972 N7    ? ? ? 1_555 A  G   2008 N2    ? ? A A   1973 A G   2009 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog1997 hydrog ? ? A  G   1973 N1    ? ? ? 1_555 A  U   2007 O2    ? ? A G   1974 A U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1998 hydrog ? ? A  G   1973 O6    ? ? ? 1_555 A  U   2007 N3    ? ? A G   1974 A U   2008 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog1999 hydrog ? ? A  C   1974 N3    ? ? ? 1_555 A  G   2004 N1    ? ? A C   1975 A G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2000 hydrog ? ? A  C   1974 N4    ? ? ? 1_555 A  G   2004 O6    ? ? A C   1975 A G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2001 hydrog ? ? A  C   1974 O2    ? ? ? 1_555 A  G   2004 N2    ? ? A C   1975 A G   2005 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2002 hydrog ? ? A  U   1976 N3    ? ? ? 1_555 A  U   1983 O4    ? ? A U   1977 A U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2003 hydrog ? ? A  U   1976 O2    ? ? ? 1_555 A  U   1983 N3    ? ? A U   1977 A U   1984 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2004 hydrog ? ? A  A   1977 N1    ? ? ? 1_555 A  G   2004 N2    ? ? A A   1978 A G   2005 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2005 hydrog ? ? A  G   1978 N2    ? ? ? 1_555 A  U   2639 O2    ? ? A G   1979 A U   2640 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2006 hydrog ? ? A  A   1980 N3    ? ? ? 1_555 A  C   1982 N4    ? ? A A   1981 A C   1983 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2007 hydrog ? ? A  G   1985 N1    ? ? ? 1_555 A  C   2001 N3    ? ? A G   1986 A C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2008 hydrog ? ? A  G   1985 N2    ? ? ? 1_555 A  C   2001 O2    ? ? A G   1986 A C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2009 hydrog ? ? A  G   1985 O6    ? ? ? 1_555 A  C   2001 N4    ? ? A G   1986 A C   2002 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2010 hydrog ? ? A  C   1986 N3    ? ? ? 1_555 A  G   2000 N1    ? ? A C   1987 A G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2011 hydrog ? ? A  C   1986 N4    ? ? ? 1_555 A  G   2000 O6    ? ? A C   1987 A G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2012 hydrog ? ? A  C   1986 O2    ? ? ? 1_555 A  G   2000 N2    ? ? A C   1987 A G   2001 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2013 hydrog ? ? A  C   1987 N3    ? ? ? 1_555 A  G   1999 N1    ? ? A C   1988 A G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2014 hydrog ? ? A  C   1987 N4    ? ? ? 1_555 A  G   1999 O6    ? ? A C   1988 A G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2015 hydrog ? ? A  C   1987 O2    ? ? ? 1_555 A  G   1999 N2    ? ? A C   1988 A G   2000 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2016 hydrog ? ? A  G   1988 N1    ? ? ? 1_555 A  C   1998 N3    ? ? A G   1989 A C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2017 hydrog ? ? A  G   1988 N2    ? ? ? 1_555 A  C   1998 O2    ? ? A G   1989 A C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2018 hydrog ? ? A  G   1988 O6    ? ? ? 1_555 A  C   1998 N4    ? ? A G   1989 A C   1999 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2019 hydrog ? ? A  C   1989 N3    ? ? ? 1_555 A  G   1997 N1    ? ? A C   1990 A G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2020 hydrog ? ? A  C   1989 N4    ? ? ? 1_555 A  G   1997 O6    ? ? A C   1990 A G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2021 hydrog ? ? A  C   1989 O2    ? ? ? 1_555 A  G   1997 N2    ? ? A C   1990 A G   1998 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2022 hydrog ? ? A  A   1993 N3    ? ? ? 1_555 A  G   2583 N2    ? ? A A   1994 A G   2584 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2023 hydrog ? ? A  U   1995 O4    ? ? ? 1_555 A  C   2590 N4    ? ? A U   1996 A C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2024 hydrog ? ? A  A   2009 N3    ? ? ? 1_555 A  G   2012 N2    ? ? A A   2010 A G   2013 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2025 hydrog ? ? A  G   2032 N1    ? ? ? 1_555 A  C   2036 O2    ? ? A G   2033 A C   2037 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2026 hydrog ? ? A  G   2040 N2    ? ? ? 1_555 A  U   2725 O4    ? ? A G   2041 A U   2726 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2027 hydrog ? ? A  A   2053 N1    ? ? ? 1_555 A  U   2647 N3    ? ? A A   2054 A U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2028 hydrog ? ? A  A   2053 N6    ? ? ? 1_555 A  U   2647 O2    ? ? A A   2054 A U   2648 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2029 hydrog ? ? A  A   2059 N1    ? ? ? 1_555 A  U   2075 N3    ? ? A A   2060 A U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2030 hydrog ? ? A  A   2059 N6    ? ? ? 1_555 A  U   2075 O4    ? ? A A   2060 A U   2076 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2031 hydrog ? ? A  C   2060 N3    ? ? ? 1_555 A  G   2074 N1    ? ? A C   2061 A G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2032 hydrog ? ? A  C   2060 N4    ? ? ? 1_555 A  G   2074 O6    ? ? A C   2061 A G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2033 hydrog ? ? A  C   2060 O2    ? ? ? 1_555 A  G   2074 N2    ? ? A C   2061 A G   2075 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2034 hydrog ? ? A  U   2062 N3    ? ? ? 1_555 A  A   2082 N3    ? ? A U   2063 A A   2083 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2035 hydrog ? ? A  U   2063 N3    ? ? ? 1_555 A  A   2080 N1    ? ? A U   2064 A A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2036 hydrog ? ? A  U   2063 O4    ? ? ? 1_555 A  A   2080 N6    ? ? A U   2064 A A   2081 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2037 hydrog ? ? A  C   2064 N3    ? ? ? 1_555 A  G   2079 N1    ? ? A C   2065 A G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2038 hydrog ? ? A  C   2064 N4    ? ? ? 1_555 A  G   2079 O6    ? ? A C   2065 A G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2039 hydrog ? ? A  C   2064 O2    ? ? ? 1_555 A  G   2079 N2    ? ? A C   2065 A G   2080 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2040 hydrog ? ? A  C   2065 N3    ? ? ? 1_555 A  G   2078 N1    ? ? A C   2066 A G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2041 hydrog ? ? A  C   2065 N4    ? ? ? 1_555 A  G   2078 O6    ? ? A C   2066 A G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2042 hydrog ? ? A  C   2065 O2    ? ? ? 1_555 A  G   2078 N2    ? ? A C   2066 A G   2079 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2043 hydrog ? ? A  A   2066 N1    ? ? ? 1_555 A  U   2077 N3    ? ? A A   2067 A U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2044 hydrog ? ? A  A   2066 N6    ? ? ? 1_555 A  U   2077 O4    ? ? A A   2067 A U   2078 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2045 hydrog ? ? A  G   2067 N1    ? ? ? 1_555 A  C   2076 N3    ? ? A G   2068 A C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2046 hydrog ? ? A  G   2067 N2    ? ? ? 1_555 A  C   2076 O2    ? ? A G   2068 A C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2047 hydrog ? ? A  G   2067 O6    ? ? ? 1_555 A  C   2076 N4    ? ? A G   2068 A C   2077 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2048 hydrog ? ? A  U   2068 N3    ? ? ? 1_555 A  A   2073 N7    ? ? A U   2069 A A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2049 hydrog ? ? A  U   2068 O2    ? ? ? 1_555 A  A   2073 N6    ? ? A U   2069 A A   2074 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2050 hydrog ? ? A  G   2071 N2    ? ? ? 1_555 A  A   2489 N3    ? ? A G   2072 A A   2490 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2051 hydrog ? ? A  C   2083 N3    ? ? ? 1_555 A  G   2659 N1    ? ? A C   2084 A G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2052 hydrog ? ? A  C   2083 N4    ? ? ? 1_555 A  G   2659 O6    ? ? A C   2084 A G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2053 hydrog ? ? A  C   2083 O2    ? ? ? 1_555 A  G   2659 N2    ? ? A C   2084 A G   2660 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2054 hydrog ? ? A  A   2084 N1    ? ? ? 1_555 A  U   2658 N3    ? ? A A   2085 A U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2055 hydrog ? ? A  A   2084 N6    ? ? ? 1_555 A  U   2658 O4    ? ? A A   2085 A U   2659 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2056 hydrog ? ? A  C   2085 N3    ? ? ? 1_555 A  G   2657 N1    ? ? A C   2086 A G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2057 hydrog ? ? A  C   2085 N4    ? ? ? 1_555 A  G   2657 O6    ? ? A C   2086 A G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2058 hydrog ? ? A  C   2085 O2    ? ? ? 1_555 A  G   2657 N2    ? ? A C   2086 A G   2658 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2059 hydrog ? ? A  C   2086 N3    ? ? ? 1_555 A  G   2656 N1    ? ? A C   2087 A G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2060 hydrog ? ? A  C   2086 N4    ? ? ? 1_555 A  G   2656 O6    ? ? A C   2087 A G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2061 hydrog ? ? A  C   2086 O2    ? ? ? 1_555 A  G   2656 N2    ? ? A C   2087 A G   2657 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2062 hydrog ? ? A  C   2087 N3    ? ? ? 1_555 A  G   2655 N1    ? ? A C   2088 A G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2063 hydrog ? ? A  C   2087 N4    ? ? ? 1_555 A  G   2655 O6    ? ? A C   2088 A G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2064 hydrog ? ? A  C   2087 O2    ? ? ? 1_555 A  G   2655 N2    ? ? A C   2088 A G   2656 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2065 hydrog ? ? A  C   2087 O2    ? ? ? 1_555 A  A   2839 N6    ? ? A C   2088 A A   2840 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2066 hydrog ? ? A  A   2088 N1    ? ? ? 1_555 A  U   2654 N3    ? ? A A   2089 A U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2067 hydrog ? ? A  A   2088 N6    ? ? ? 1_555 A  U   2654 O4    ? ? A A   2089 A U   2655 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2068 hydrog ? ? A  G   2089 N1    ? ? ? 1_555 A  C   2653 N3    ? ? A G   2090 A C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2069 hydrog ? ? A  G   2089 N2    ? ? ? 1_555 A  C   2653 O2    ? ? A G   2090 A C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2070 hydrog ? ? A  G   2089 O6    ? ? ? 1_555 A  C   2653 N4    ? ? A G   2090 A C   2654 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2071 hydrog ? ? A  G   2090 N1    ? ? ? 1_555 A  A   2652 N1    ? ? A G   2091 A A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2072 hydrog ? ? A  G   2090 O6    ? ? ? 1_555 A  A   2652 N6    ? ? A G   2091 A A   2653 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2073 hydrog ? ? A  G   2091 N2    ? ? ? 1_555 A  G   2092 O6    ? ? A G   2092 A G   2093 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2074 hydrog ? ? A  G   2091 N2    ? ? ? 1_555 A  U   2651 O4    ? ? A G   2092 A U   2652 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2075 hydrog ? ? A  G   2092 N1    ? ? ? 1_555 A  U   2651 O2    ? ? A G   2093 A U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2076 hydrog ? ? A  G   2092 O6    ? ? ? 1_555 A  U   2651 N3    ? ? A G   2093 A U   2652 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2077 hydrog ? ? A  G   2093 N1    ? ? ? 1_555 A  C   2650 N3    ? ? A G   2094 A C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2078 hydrog ? ? A  G   2093 N2    ? ? ? 1_555 A  C   2650 O2    ? ? A G   2094 A C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2079 hydrog ? ? A  G   2093 O6    ? ? ? 1_555 A  C   2650 N4    ? ? A G   2094 A C   2651 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2080 hydrog ? ? A  A   2094 N6    ? ? ? 1_555 A  A   2611 N1    ? ? A A   2095 A A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2081 hydrog ? ? A  A   2094 N7    ? ? ? 1_555 A  A   2611 N6    ? ? A A   2095 A A   2612 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2082 hydrog ? ? A  A   2094 N1    ? ? ? 1_555 A  U   2649 N3    ? ? A A   2095 A U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2083 hydrog ? ? A  A   2094 N6    ? ? ? 1_555 A  U   2649 O4    ? ? A A   2095 A U   2650 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2084 hydrog ? ? A  G   2096 N1    ? ? ? 1_555 A  C   2646 N3    ? ? A G   2097 A C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2085 hydrog ? ? A  G   2096 N2    ? ? ? 1_555 A  C   2646 O2    ? ? A G   2097 A C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2086 hydrog ? ? A  G   2096 O6    ? ? ? 1_555 A  C   2646 N4    ? ? A G   2097 A C   2647 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2087 hydrog ? ? A  C   2097 N3    ? ? ? 1_555 A  G   2645 N1    ? ? A C   2098 A G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2088 hydrog ? ? A  C   2097 N4    ? ? ? 1_555 A  G   2645 O6    ? ? A C   2098 A G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2089 hydrog ? ? A  C   2097 O2    ? ? ? 1_555 A  G   2645 N2    ? ? A C   2098 A G   2646 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2090 hydrog ? ? A  G   2101 N1    ? ? ? 1_555 A  A   2485 N1    ? ? A G   2102 A A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2091 hydrog ? ? A  G   2101 O6    ? ? ? 1_555 A  A   2485 N6    ? ? A G   2102 A A   2486 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2092 hydrog ? ? A  C   2103 N3    ? ? ? 1_555 A  A   2484 N6    ? ? A C   2104 A A   2485 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2093 hydrog ? ? A  C   2103 N4    ? ? ? 1_555 A  C   2535 O2    ? ? A C   2104 A C   2536 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2094 hydrog ? ? A  C   2104 N3    ? ? ? 1_555 A  G   2480 N1    ? ? A C   2105 A G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2095 hydrog ? ? A  C   2104 N4    ? ? ? 1_555 A  G   2480 O6    ? ? A C   2105 A G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2096 hydrog ? ? A  C   2104 O2    ? ? ? 1_555 A  G   2480 N2    ? ? A C   2105 A G   2481 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2097 hydrog ? ? A  C   2105 N3    ? ? ? 1_555 A  G   2479 N1    ? ? A C   2106 A G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2098 hydrog ? ? A  C   2105 N4    ? ? ? 1_555 A  G   2479 O6    ? ? A C   2106 A G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2099 hydrog ? ? A  C   2105 O2    ? ? ? 1_555 A  G   2479 N2    ? ? A C   2106 A G   2480 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2100 hydrog ? ? A  U   2106 N3    ? ? ? 1_555 A  A   2478 N1    ? ? A U   2107 A A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2101 hydrog ? ? A  U   2106 O4    ? ? ? 1_555 A  A   2478 N6    ? ? A U   2107 A A   2479 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2102 hydrog ? ? A  A   2107 N1    ? ? ? 1_555 A  U   2477 N3    ? ? A A   2108 A U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2103 hydrog ? ? A  A   2107 N6    ? ? ? 1_555 A  U   2477 O4    ? ? A A   2108 A U   2478 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2104 hydrog ? ? A  U   2108 N3    ? ? ? 1_555 A  A   2466 N1    ? ? A U   2109 A A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2105 hydrog ? ? A  U   2108 O2    ? ? ? 1_555 A  A   2466 N6    ? ? A U   2109 A A   2467 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2106 hydrog ? ? A  G   2109 N1    ? ? ? 1_555 A  C   2476 N3    ? ? A G   2110 A C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2107 hydrog ? ? A  G   2109 N2    ? ? ? 1_555 A  C   2476 O2    ? ? A G   2110 A C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2108 hydrog ? ? A  G   2109 O6    ? ? ? 1_555 A  C   2476 N4    ? ? A G   2110 A C   2477 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2109 hydrog ? ? A  G   2110 N1    ? ? ? 1_555 A  C   2475 N3    ? ? A G   2111 A C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2110 hydrog ? ? A  G   2110 N2    ? ? ? 1_555 A  C   2475 O2    ? ? A G   2111 A C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2111 hydrog ? ? A  G   2110 O6    ? ? ? 1_555 A  C   2475 N4    ? ? A G   2111 A C   2476 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2112 hydrog ? ? A  A   2111 N1    ? ? ? 1_555 A  U   2472 N3    ? ? A A   2112 A U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2113 hydrog ? ? A  A   2111 N6    ? ? ? 1_555 A  U   2472 O4    ? ? A A   2112 A U   2473 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2114 hydrog ? ? A  G   2112 N1    ? ? ? 1_555 A  C   2471 N3    ? ? A G   2113 A C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2115 hydrog ? ? A  G   2112 N2    ? ? ? 1_555 A  C   2471 O2    ? ? A G   2113 A C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2116 hydrog ? ? A  G   2112 O6    ? ? ? 1_555 A  C   2471 N4    ? ? A G   2113 A C   2472 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2117 hydrog ? ? A  G   2112 N3    ? ? ? 1_555 A  C   2474 N4    ? ? A G   2113 A C   2475 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2118 hydrog ? ? A  C   2113 N3    ? ? ? 1_555 A  G   2470 N1    ? ? A C   2114 A G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2119 hydrog ? ? A  C   2113 N4    ? ? ? 1_555 A  G   2470 O6    ? ? A C   2114 A G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2120 hydrog ? ? A  C   2113 O2    ? ? ? 1_555 A  G   2470 N2    ? ? A C   2114 A G   2471 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2121 hydrog ? ? A  U   2114 N3    ? ? ? 1_555 A  A   2469 N1    ? ? A U   2115 A A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2122 hydrog ? ? A  U   2114 O4    ? ? ? 1_555 A  A   2469 N6    ? ? A U   2115 A A   2470 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2123 hydrog ? ? A  U   2114 O2    ? ? ? 1_555 A  G   2631 N2    ? ? A U   2115 A G   2632 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2124 hydrog ? ? A  U   2115 N3    ? ? ? 1_555 A  A   2117 N7    ? ? A U   2116 A A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2125 hydrog ? ? A  U   2115 O4    ? ? ? 1_555 A  A   2117 N6    ? ? A U   2116 A A   2118 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2126 hydrog ? ? A  A   2117 N6    ? ? ? 1_555 A  G   2270 O6    ? ? A A   2118 A G   2271 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2127 hydrog ? ? A  A   2117 N1    ? ? ? 1_555 A  U   2275 N3    ? ? A A   2118 A U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2128 hydrog ? ? A  A   2117 N6    ? ? ? 1_555 A  U   2275 O4    ? ? A A   2118 A U   2276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2129 hydrog ? ? A  C   2118 N4    ? ? ? 1_555 A  G   2270 O6    ? ? A C   2119 A G   2271 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2130 hydrog ? ? A  C   2118 N3    ? ? ? 1_555 A  G   2274 N1    ? ? A C   2119 A G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2131 hydrog ? ? A  C   2118 N4    ? ? ? 1_555 A  G   2274 O6    ? ? A C   2119 A G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2132 hydrog ? ? A  C   2118 O2    ? ? ? 1_555 A  G   2274 N2    ? ? A C   2119 A G   2275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2133 hydrog ? ? A  U   2119 N3    ? ? ? 1_555 A  A   2273 N1    ? ? A U   2120 A A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2134 hydrog ? ? A  U   2119 O4    ? ? ? 1_555 A  A   2273 N6    ? ? A U   2120 A A   2274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2135 hydrog ? ? A  G   2120 N1    ? ? ? 1_555 A  C   2272 N3    ? ? A G   2121 A C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2136 hydrog ? ? A  G   2120 N2    ? ? ? 1_555 A  C   2272 O2    ? ? A G   2121 A C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2137 hydrog ? ? A  G   2120 O6    ? ? ? 1_555 A  C   2272 N4    ? ? A G   2121 A C   2273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2138 hydrog ? ? A  C   2121 N3    ? ? ? 1_555 A  G   2271 N1    ? ? A C   2122 A G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2139 hydrog ? ? A  C   2121 N4    ? ? ? 1_555 A  G   2271 O6    ? ? A C   2122 A G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2140 hydrog ? ? A  C   2121 O2    ? ? ? 1_555 A  G   2271 N2    ? ? A C   2122 A G   2272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2141 hydrog ? ? A  A   2122 N6    ? ? ? 1_555 A  G   2269 N3    ? ? A A   2123 A G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2142 hydrog ? ? A  A   2122 N7    ? ? ? 1_555 A  G   2269 N2    ? ? A A   2123 A G   2270 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2143 hydrog ? ? A  G   2123 N1    ? ? ? 1_555 A  C   2268 N3    ? ? A G   2124 A C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2144 hydrog ? ? A  G   2123 N2    ? ? ? 1_555 A  C   2268 O2    ? ? A G   2124 A C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2145 hydrog ? ? A  G   2123 O6    ? ? ? 1_555 A  C   2268 N4    ? ? A G   2124 A C   2269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2146 hydrog ? ? A  G   2124 N1    ? ? ? 1_555 A  C   2267 N3    ? ? A G   2125 A C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2147 hydrog ? ? A  G   2124 N2    ? ? ? 1_555 A  C   2267 O2    ? ? A G   2125 A C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2148 hydrog ? ? A  G   2124 O6    ? ? ? 1_555 A  C   2267 N4    ? ? A G   2125 A C   2268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2149 hydrog ? ? A  C   2125 N3    ? ? ? 1_555 A  G   2266 N1    ? ? A C   2126 A G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2150 hydrog ? ? A  C   2125 N4    ? ? ? 1_555 A  G   2266 O6    ? ? A C   2126 A G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2151 hydrog ? ? A  C   2125 O2    ? ? ? 1_555 A  G   2266 N2    ? ? A C   2126 A G   2267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2152 hydrog ? ? A  U   2126 N3    ? ? ? 1_555 A  A   2265 N1    ? ? A U   2127 A A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2153 hydrog ? ? A  U   2126 O4    ? ? ? 1_555 A  A   2265 N6    ? ? A U   2127 A A   2266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2154 hydrog ? ? A  G   2127 N1    ? ? ? 1_555 A  U   2264 O2    ? ? A G   2128 A U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2155 hydrog ? ? A  G   2127 O6    ? ? ? 1_555 A  U   2264 N3    ? ? A G   2128 A U   2265 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2156 hydrog ? ? A  U   2128 N3    ? ? ? 1_555 A  A   2263 N1    ? ? A U   2129 A A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2157 hydrog ? ? A  U   2128 O4    ? ? ? 1_555 A  A   2263 N6    ? ? A U   2129 A A   2264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2158 hydrog ? ? A  C   2129 N3    ? ? ? 1_555 A  G   2262 N1    ? ? A C   2130 A G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2159 hydrog ? ? A  C   2129 N4    ? ? ? 1_555 A  G   2262 O6    ? ? A C   2130 A G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2160 hydrog ? ? A  C   2129 O2    ? ? ? 1_555 A  G   2262 N2    ? ? A C   2130 A G   2263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2161 hydrog ? ? A  G   2130 N1    ? ? ? 1_555 A  C   2261 N3    ? ? A G   2131 A C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2162 hydrog ? ? A  G   2130 N2    ? ? ? 1_555 A  C   2261 O2    ? ? A G   2131 A C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2163 hydrog ? ? A  G   2130 O6    ? ? ? 1_555 A  C   2261 N4    ? ? A G   2131 A C   2262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2164 hydrog ? ? A  C   2131 O2    ? ? ? 1_555 A  C   2260 N4    ? ? A C   2132 A C   2261 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2165 hydrog ? ? A  U   2132 O4    ? ? ? 1_555 A  A   2259 N6    ? ? A U   2133 A A   2260 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2166 hydrog ? ? A  G   2133 N1    ? ? ? 1_555 A  C   2240 N3    ? ? A G   2134 A C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2167 hydrog ? ? A  G   2133 N2    ? ? ? 1_555 A  C   2240 O2    ? ? A G   2134 A C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2168 hydrog ? ? A  G   2133 O6    ? ? ? 1_555 A  C   2240 N4    ? ? A G   2134 A C   2241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2169 hydrog ? ? A  A   2134 N1    ? ? ? 1_555 A  U   2239 N3    ? ? A A   2135 A U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2170 hydrog ? ? A  A   2134 N6    ? ? ? 1_555 A  U   2239 O4    ? ? A A   2135 A U   2240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2171 hydrog ? ? A  G   2135 N1    ? ? ? 1_555 A  C   2238 N3    ? ? A G   2136 A C   2239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2172 hydrog ? ? A  G   2135 N2    ? ? ? 1_555 A  C   2238 O2    ? ? A G   2136 A C   2239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2173 hydrog ? ? A  G   2135 O6    ? ? ? 1_555 A  C   2238 N4    ? ? A G   2136 A C   2239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2174 hydrog ? ? A  U   2241 N3    ? ? ? 1_555 A  A   2257 N7    ? ? A U   2242 A A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2175 hydrog ? ? A  U   2241 O2    ? ? ? 1_555 A  A   2257 N6    ? ? A U   2242 A A   2258 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2176 hydrog ? ? A  A   2243 N6    ? ? ? 1_555 A  G   2256 N3    ? ? A A   2244 A G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2177 hydrog ? ? A  A   2243 N7    ? ? ? 1_555 A  G   2256 N2    ? ? A A   2244 A G   2257 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2178 hydrog ? ? A  C   2244 N3    ? ? ? 1_555 A  G   2255 N1    ? ? A C   2245 A G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2179 hydrog ? ? A  C   2244 N4    ? ? ? 1_555 A  G   2255 O6    ? ? A C   2245 A G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2180 hydrog ? ? A  C   2244 O2    ? ? ? 1_555 A  G   2255 N2    ? ? A C   2245 A G   2256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2181 hydrog ? ? A  U   2245 N3    ? ? ? 1_555 A  A   2254 N1    ? ? A U   2246 A A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2182 hydrog ? ? A  U   2245 O4    ? ? ? 1_555 A  A   2254 N6    ? ? A U   2246 A A   2255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2183 hydrog ? ? A  U   2245 N3    ? ? ? 1_555 A  G   2255 N3    ? ? A U   2246 A G   2256 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2184 hydrog ? ? A  C   2246 N3    ? ? ? 1_555 A  G   2253 N1    ? ? A C   2247 A G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2185 hydrog ? ? A  C   2246 N4    ? ? ? 1_555 A  G   2253 O6    ? ? A C   2247 A G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2186 hydrog ? ? A  C   2246 O2    ? ? ? 1_555 A  G   2253 N2    ? ? A C   2247 A G   2254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2187 hydrog ? ? A  C   2247 N3    ? ? ? 1_555 A  G   2252 N1    ? ? A C   2248 A G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2188 hydrog ? ? A  C   2247 N4    ? ? ? 1_555 A  G   2252 O6    ? ? A C   2248 A G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2189 hydrog ? ? A  C   2247 O2    ? ? ? 1_555 A  G   2252 N2    ? ? A C   2248 A G   2253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2190 hydrog ? ? A  G   2248 N2    ? ? ? 1_555 A  A   2251 N7    ? ? A G   2249 A A   2252 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2191 hydrog ? ? A  G   2270 N7    ? ? ? 1_555 A  A   2273 N6    ? ? A G   2271 A A   2274 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2192 hydrog ? ? A  U   2276 N3    ? ? ? 1_555 A  A   2469 N7    ? ? A U   2277 A A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2193 hydrog ? ? A  U   2276 O4    ? ? ? 1_555 A  A   2469 N6    ? ? A U   2277 A A   2470 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2194 hydrog ? ? A  U   2277 N3    ? ? ? 1_555 A  G   2470 N7    ? ? A U   2278 A G   2471 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2195 hydrog ? ? A  G   2278 N1    ? ? ? 1_555 A  C   2291 N3    ? ? A G   2279 A C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2196 hydrog ? ? A  G   2278 N2    ? ? ? 1_555 A  C   2291 O2    ? ? A G   2279 A C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2197 hydrog ? ? A  G   2278 O6    ? ? ? 1_555 A  C   2291 N4    ? ? A G   2279 A C   2292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2198 hydrog ? ? A  A   2279 N1    ? ? ? 1_555 A  U   2289 N3    ? ? A A   2280 A U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2199 hydrog ? ? A  A   2279 N6    ? ? ? 1_555 A  U   2289 O4    ? ? A A   2280 A U   2290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2200 hydrog ? ? A  C   2280 N3    ? ? ? 1_555 A  G   2288 N1    ? ? A C   2281 A G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2201 hydrog ? ? A  C   2280 N4    ? ? ? 1_555 A  G   2288 O6    ? ? A C   2281 A G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2202 hydrog ? ? A  C   2280 O2    ? ? ? 1_555 A  G   2288 N2    ? ? A C   2281 A G   2289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2203 hydrog ? ? A  G   2287 N1    ? ? ? 1_555 A  C   2308 N3    ? ? A G   2288 A C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2204 hydrog ? ? A  G   2287 N2    ? ? ? 1_555 A  C   2308 O2    ? ? A G   2288 A C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2205 hydrog ? ? A  G   2287 O6    ? ? ? 1_555 A  C   2308 N4    ? ? A G   2288 A C   2309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2206 hydrog ? ? A  G   2288 N2    ? ? ? 1_555 A  A   2290 N1    ? ? A G   2289 A A   2291 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2207 hydrog ? ? A  G   2292 N1    ? ? ? 1_555 A  C   2314 N3    ? ? A G   2293 A C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2208 hydrog ? ? A  G   2292 N2    ? ? ? 1_555 A  C   2314 O2    ? ? A G   2293 A C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2209 hydrog ? ? A  G   2292 O6    ? ? ? 1_555 A  C   2314 N4    ? ? A G   2293 A C   2315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2210 hydrog ? ? A  C   2293 N3    ? ? ? 1_555 A  G   2313 N1    ? ? A C   2294 A G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2211 hydrog ? ? A  C   2293 N4    ? ? ? 1_555 A  G   2313 O6    ? ? A C   2294 A G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2212 hydrog ? ? A  C   2293 O2    ? ? ? 1_555 A  G   2313 N2    ? ? A C   2294 A G   2314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2213 hydrog ? ? A  G   2294 N1    ? ? ? 1_555 A  C   2312 N3    ? ? A G   2295 A C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2214 hydrog ? ? A  G   2294 N2    ? ? ? 1_555 A  C   2312 O2    ? ? A G   2295 A C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2215 hydrog ? ? A  G   2294 O6    ? ? ? 1_555 A  C   2312 N4    ? ? A G   2295 A C   2313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2216 hydrog ? ? A  G   2294 N2    ? ? ? 1_555 A  A   2360 N3    ? ? A G   2295 A A   2361 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2217 hydrog ? ? A  C   2295 N3    ? ? ? 1_555 A  G   2311 N1    ? ? A C   2296 A G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2218 hydrog ? ? A  C   2295 N4    ? ? ? 1_555 A  G   2311 O6    ? ? A C   2296 A G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2219 hydrog ? ? A  C   2295 O2    ? ? ? 1_555 A  G   2311 N2    ? ? A C   2296 A G   2312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2220 hydrog ? ? A  U   2296 N3    ? ? ? 1_555 A  A   2310 N1    ? ? A U   2297 A A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2221 hydrog ? ? A  U   2296 O4    ? ? ? 1_555 A  A   2310 N6    ? ? A U   2297 A A   2311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2222 hydrog ? ? A  C   2297 N3    ? ? ? 1_555 A  G   2309 N1    ? ? A C   2298 A G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2223 hydrog ? ? A  C   2297 N4    ? ? ? 1_555 A  G   2309 O6    ? ? A C   2298 A G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2224 hydrog ? ? A  C   2297 O2    ? ? ? 1_555 A  G   2309 N2    ? ? A C   2298 A G   2310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2225 hydrog ? ? A  G   2298 N2    ? ? ? 1_555 A  U   2307 O4    ? ? A G   2299 A U   2308 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2226 hydrog ? ? A  A   2299 N6    ? ? ? 1_555 A  A   2306 N7    ? ? A A   2300 A A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2227 hydrog ? ? A  A   2299 N7    ? ? ? 1_555 A  A   2306 N6    ? ? A A   2300 A A   2307 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2228 hydrog ? ? A  A   2300 N1    ? ? ? 1_555 A  U   2305 N3    ? ? A A   2301 A U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2229 hydrog ? ? A  A   2300 N6    ? ? ? 1_555 A  U   2305 O2    ? ? A A   2301 A U   2306 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2230 hydrog ? ? A  G   2313 N2    ? ? ? 1_555 A  A   2424 N3    ? ? A G   2314 A A   2425 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2231 hydrog ? ? A  G   2315 N1    ? ? ? 1_555 A  C   2463 N3    ? ? A G   2316 A C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2232 hydrog ? ? A  G   2315 N2    ? ? ? 1_555 A  C   2463 O2    ? ? A G   2316 A C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2233 hydrog ? ? A  G   2315 O6    ? ? ? 1_555 A  C   2463 N4    ? ? A G   2316 A C   2464 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2234 hydrog ? ? A  C   2316 N3    ? ? ? 1_555 A  G   2358 N1    ? ? A C   2317 A G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2235 hydrog ? ? A  C   2316 N4    ? ? ? 1_555 A  G   2358 O6    ? ? A C   2317 A G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2236 hydrog ? ? A  C   2316 O2    ? ? ? 1_555 A  G   2358 N2    ? ? A C   2317 A G   2359 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2237 hydrog ? ? A  C   2317 N3    ? ? ? 1_555 A  G   2420 N1    ? ? A C   2318 A G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2238 hydrog ? ? A  C   2317 N4    ? ? ? 1_555 A  G   2420 O6    ? ? A C   2318 A G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2239 hydrog ? ? A  C   2317 O2    ? ? ? 1_555 A  G   2420 N2    ? ? A C   2318 A G   2421 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2240 hydrog ? ? A  C   2318 N3    ? ? ? 1_555 A  G   2419 N1    ? ? A C   2319 A G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2241 hydrog ? ? A  C   2318 N4    ? ? ? 1_555 A  G   2419 O6    ? ? A C   2319 A G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2242 hydrog ? ? A  C   2318 O2    ? ? ? 1_555 A  G   2419 N2    ? ? A C   2319 A G   2420 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2243 hydrog ? ? A  A   2320 N1    ? ? ? 1_555 A  U   2377 N3    ? ? A A   2321 A U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2244 hydrog ? ? A  A   2320 N6    ? ? ? 1_555 A  U   2377 O2    ? ? A A   2321 A U   2378 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2245 hydrog ? ? A  A   2320 N6    ? ? ? 1_555 A  A   2379 N7    ? ? A A   2321 A A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2246 hydrog ? ? A  A   2320 N7    ? ? ? 1_555 A  A   2379 N6    ? ? A A   2321 A A   2380 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2247 hydrog ? ? A  U   2321 O2    ? ? ? 1_555 A  G   2420 N2    ? ? A U   2322 A G   2421 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2248 hydrog ? ? A  G   2322 N1    ? ? ? 1_555 A  U   2376 O2    ? ? A G   2323 A U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2249 hydrog ? ? A  G   2322 O6    ? ? ? 1_555 A  U   2376 N3    ? ? A G   2323 A U   2377 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2250 hydrog ? ? A  G   2323 N1    ? ? ? 1_555 A  C   2375 N3    ? ? A G   2324 A C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2251 hydrog ? ? A  G   2323 N2    ? ? ? 1_555 A  C   2375 O2    ? ? A G   2324 A C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2252 hydrog ? ? A  G   2323 O6    ? ? ? 1_555 A  C   2375 N4    ? ? A G   2324 A C   2376 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2253 hydrog ? ? A  C   2324 N3    ? ? ? 1_555 A  G   2374 N1    ? ? A C   2325 A G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2254 hydrog ? ? A  C   2324 N4    ? ? ? 1_555 A  G   2374 O6    ? ? A C   2325 A G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2255 hydrog ? ? A  C   2324 O2    ? ? ? 1_555 A  G   2374 N2    ? ? A C   2325 A G   2375 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2256 hydrog ? ? A  U   2325 N3    ? ? ? 1_555 A  A   2373 N1    ? ? A U   2326 A A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2257 hydrog ? ? A  U   2325 O4    ? ? ? 1_555 A  A   2373 N6    ? ? A U   2326 A A   2374 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2258 hydrog ? ? A  A   2326 N1    ? ? ? 1_555 A  U   2372 N3    ? ? A A   2327 A U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2259 hydrog ? ? A  A   2326 N6    ? ? ? 1_555 A  U   2372 O4    ? ? A A   2327 A U   2373 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2260 hydrog ? ? A  U   2327 N3    ? ? ? 1_555 A  A   2371 N1    ? ? A U   2328 A A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2261 hydrog ? ? A  U   2327 O4    ? ? ? 1_555 A  A   2371 N6    ? ? A U   2328 A A   2372 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2262 hydrog ? ? A  C   2328 N3    ? ? ? 1_555 A  G   2370 N1    ? ? A C   2329 A G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2263 hydrog ? ? A  C   2328 N4    ? ? ? 1_555 A  G   2370 O6    ? ? A C   2329 A G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2264 hydrog ? ? A  C   2328 O2    ? ? ? 1_555 A  G   2370 N2    ? ? A C   2329 A G   2371 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2265 hydrog ? ? A  U   2329 N3    ? ? ? 1_555 A  A   2368 N7    ? ? A U   2330 A A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2266 hydrog ? ? A  U   2329 O2    ? ? ? 1_555 A  A   2368 N6    ? ? A U   2330 A A   2369 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2267 hydrog ? ? A  C   2330 N3    ? ? ? 1_555 A  G   2354 N1    ? ? A C   2331 A G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2268 hydrog ? ? A  C   2330 N4    ? ? ? 1_555 A  G   2354 O6    ? ? A C   2331 A G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2269 hydrog ? ? A  C   2330 O2    ? ? ? 1_555 A  G   2354 N2    ? ? A C   2331 A G   2355 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2270 hydrog ? ? A  A   2331 N6    ? ? ? 1_555 A  G   2351 N3    ? ? A A   2332 A G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2271 hydrog ? ? A  A   2331 N7    ? ? ? 1_555 A  G   2351 N2    ? ? A A   2332 A G   2352 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2272 hydrog ? ? A  G   2332 N1    ? ? ? 1_555 A  C   2350 N3    ? ? A G   2333 A C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2273 hydrog ? ? A  G   2332 N2    ? ? ? 1_555 A  C   2350 O2    ? ? A G   2333 A C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2274 hydrog ? ? A  G   2332 O6    ? ? ? 1_555 A  C   2350 N4    ? ? A G   2333 A C   2351 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2275 hydrog ? ? A  C   2333 N3    ? ? ? 1_555 A  G   2349 N1    ? ? A C   2334 A G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2276 hydrog ? ? A  C   2333 N4    ? ? ? 1_555 A  G   2349 O6    ? ? A C   2334 A G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2277 hydrog ? ? A  C   2333 O2    ? ? ? 1_555 A  G   2349 N2    ? ? A C   2334 A G   2350 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2278 hydrog ? ? A  C   2334 N3    ? ? ? 1_555 A  G   2348 N1    ? ? A C   2335 A G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2279 hydrog ? ? A  C   2334 N4    ? ? ? 1_555 A  G   2348 O6    ? ? A C   2335 A G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2280 hydrog ? ? A  C   2334 O2    ? ? ? 1_555 A  G   2348 N2    ? ? A C   2335 A G   2349 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2281 hydrog ? ? A  G   2335 N1    ? ? ? 1_555 A  C   2347 N3    ? ? A G   2336 A C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2282 hydrog ? ? A  G   2335 N2    ? ? ? 1_555 A  C   2347 O2    ? ? A G   2336 A C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2283 hydrog ? ? A  G   2335 O6    ? ? ? 1_555 A  C   2347 N4    ? ? A G   2336 A C   2348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2284 hydrog ? ? A  G   2336 N1    ? ? ? 1_555 A  C   2346 N3    ? ? A G   2337 A C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2285 hydrog ? ? A  G   2336 N2    ? ? ? 1_555 A  C   2346 O2    ? ? A G   2337 A C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2286 hydrog ? ? A  G   2336 O6    ? ? ? 1_555 A  C   2346 N4    ? ? A G   2337 A C   2347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2287 hydrog ? ? A  G   2337 N1    ? ? ? 1_555 A  C   2345 N3    ? ? A G   2338 A C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2288 hydrog ? ? A  G   2337 N2    ? ? ? 1_555 A  C   2345 O2    ? ? A G   2338 A C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2289 hydrog ? ? A  G   2337 O6    ? ? ? 1_555 A  C   2345 N4    ? ? A G   2338 A C   2346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2290 hydrog ? ? A  A   2355 N1    ? ? ? 1_555 A  A   2368 N6    ? ? A A   2356 A A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2291 hydrog ? ? A  A   2355 N6    ? ? ? 1_555 A  A   2368 N1    ? ? A A   2356 A A   2369 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2292 hydrog ? ? A  G   2356 N1    ? ? ? 1_555 A  C   2365 N3    ? ? A G   2357 A C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2293 hydrog ? ? A  G   2356 N2    ? ? ? 1_555 A  C   2365 O2    ? ? A G   2357 A C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2294 hydrog ? ? A  G   2356 O6    ? ? ? 1_555 A  C   2365 N4    ? ? A G   2357 A C   2366 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2295 hydrog ? ? A  U   2357 N3    ? ? ? 1_555 A  G   2364 O6    ? ? A U   2358 A G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2296 hydrog ? ? A  U   2357 O2    ? ? ? 1_555 A  G   2364 N1    ? ? A U   2358 A G   2365 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2297 hydrog ? ? A  C   2359 N3    ? ? ? 1_555 A  G   2425 N1    ? ? A C   2360 A G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2298 hydrog ? ? A  C   2359 N4    ? ? ? 1_555 A  G   2425 O6    ? ? A C   2360 A G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2299 hydrog ? ? A  C   2359 O2    ? ? ? 1_555 A  G   2425 N2    ? ? A C   2360 A G   2426 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2300 hydrog ? ? A  A   2361 N1    ? ? ? 1_555 A  U   2423 N3    ? ? A A   2362 A U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2301 hydrog ? ? A  A   2361 N6    ? ? ? 1_555 A  U   2423 O4    ? ? A A   2362 A U   2424 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2302 hydrog ? ? A  G   2362 N1    ? ? ? 1_555 A  C   2422 N3    ? ? A G   2363 A C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2303 hydrog ? ? A  G   2362 N2    ? ? ? 1_555 A  C   2422 O2    ? ? A G   2363 A C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2304 hydrog ? ? A  G   2362 O6    ? ? ? 1_555 A  C   2422 N4    ? ? A G   2363 A C   2423 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2305 hydrog ? ? A  A   2363 N1    ? ? ? 1_555 A  U   2421 N3    ? ? A A   2364 A U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2306 hydrog ? ? A  A   2363 N6    ? ? ? 1_555 A  U   2421 O4    ? ? A A   2364 A U   2422 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2307 hydrog ? ? A  G   2364 N2    ? ? ? 1_555 A  A   2369 N3    ? ? A G   2365 A A   2370 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2308 hydrog ? ? A  G   2378 O6    ? ? ? 1_555 A  A   2407 N6    ? ? A G   2379 A A   2408 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2309 hydrog ? ? A  C   2380 N3    ? ? ? 1_555 A  G   2406 N1    ? ? A C   2381 A G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2310 hydrog ? ? A  C   2380 N4    ? ? ? 1_555 A  G   2406 O6    ? ? A C   2381 A G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2311 hydrog ? ? A  C   2380 O2    ? ? ? 1_555 A  G   2406 N2    ? ? A C   2381 A G   2407 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2312 hydrog ? ? A  A   2381 N1    ? ? ? 1_555 A  U   2405 N3    ? ? A A   2382 A U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2313 hydrog ? ? A  A   2381 N6    ? ? ? 1_555 A  U   2405 O4    ? ? A A   2382 A U   2406 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2314 hydrog ? ? A  G   2382 N1    ? ? ? 1_555 A  C   2404 N3    ? ? A G   2383 A C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2315 hydrog ? ? A  G   2382 N2    ? ? ? 1_555 A  C   2404 O2    ? ? A G   2383 A C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2316 hydrog ? ? A  G   2382 O6    ? ? ? 1_555 A  C   2404 N4    ? ? A G   2383 A C   2405 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2317 hydrog ? ? A  U   2383 N3    ? ? ? 1_555 A  G   2403 O6    ? ? A U   2384 A G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2318 hydrog ? ? A  U   2383 O2    ? ? ? 1_555 A  G   2403 N1    ? ? A U   2384 A G   2404 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2319 hydrog ? ? A  G   2384 N1    ? ? ? 1_555 A  C   2402 N3    ? ? A G   2385 A C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2320 hydrog ? ? A  G   2384 N2    ? ? ? 1_555 A  C   2402 O2    ? ? A G   2385 A C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2321 hydrog ? ? A  G   2384 O6    ? ? ? 1_555 A  C   2402 N4    ? ? A G   2385 A C   2403 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2322 hydrog ? ? A  U   2385 N3    ? ? ? 1_555 A  A   2401 N1    ? ? A U   2386 A A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2323 hydrog ? ? A  U   2385 O4    ? ? ? 1_555 A  A   2401 N6    ? ? A U   2386 A A   2402 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2324 hydrog ? ? A  U   2386 N3    ? ? ? 1_555 A  A   2400 N1    ? ? A U   2387 A A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2325 hydrog ? ? A  U   2386 O4    ? ? ? 1_555 A  A   2400 N6    ? ? A U   2387 A A   2401 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2326 hydrog ? ? A  C   2387 N3    ? ? ? 1_555 A  G   2399 N1    ? ? A C   2388 A G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2327 hydrog ? ? A  C   2387 N4    ? ? ? 1_555 A  G   2399 O6    ? ? A C   2388 A G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2328 hydrog ? ? A  C   2387 O2    ? ? ? 1_555 A  G   2399 N2    ? ? A C   2388 A G   2400 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2329 hydrog ? ? A  U   2388 N3    ? ? ? 1_555 A  G   2398 O6    ? ? A U   2389 A G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2330 hydrog ? ? A  U   2388 O2    ? ? ? 1_555 A  G   2398 N1    ? ? A U   2389 A G   2399 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2331 hydrog ? ? A  U   2389 O2    ? ? ? 1_555 A  A   2397 N6    ? ? A U   2390 A A   2398 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2332 hydrog ? ? A  C   2390 N4    ? ? ? 1_555 A  G   2396 N7    ? ? A C   2391 A G   2397 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2333 hydrog ? ? A  C   2408 N3    ? ? ? 1_555 A  G   2417 N1    ? ? A C   2409 A G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2334 hydrog ? ? A  C   2408 N4    ? ? ? 1_555 A  G   2417 O6    ? ? A C   2409 A G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2335 hydrog ? ? A  C   2408 O2    ? ? ? 1_555 A  G   2417 N2    ? ? A C   2409 A G   2418 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2336 hydrog ? ? A  G   2409 N1    ? ? ? 1_555 A  C   2416 N3    ? ? A G   2410 A C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2337 hydrog ? ? A  G   2409 N2    ? ? ? 1_555 A  C   2416 O2    ? ? A G   2410 A C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2338 hydrog ? ? A  G   2409 O6    ? ? ? 1_555 A  C   2416 N4    ? ? A G   2410 A C   2417 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2339 hydrog ? ? A  C   2410 N3    ? ? ? 1_555 A  G   2415 N1    ? ? A C   2411 A G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2340 hydrog ? ? A  C   2410 N4    ? ? ? 1_555 A  G   2415 O6    ? ? A C   2411 A G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2341 hydrog ? ? A  C   2410 O2    ? ? ? 1_555 A  G   2415 N2    ? ? A C   2411 A G   2416 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2342 hydrog ? ? A  G   2411 N2    ? ? ? 1_555 A  A   2414 N7    ? ? A G   2412 A A   2415 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2343 hydrog ? ? A  C   2426 N4    ? ? ? 1_555 A  G   2461 O6    ? ? A C   2427 A G   2462 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2344 hydrog ? ? A  G   2427 N2    ? ? ? 1_555 A  G   2465 N3    ? ? A G   2428 A G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2345 hydrog ? ? A  G   2427 N3    ? ? ? 1_555 A  G   2465 N2    ? ? A G   2428 A G   2466 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2346 hydrog ? ? A  A   2428 N6    ? ? ? 1_555 A  U   2460 O2    ? ? A A   2429 A U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2347 hydrog ? ? A  A   2428 N7    ? ? ? 1_555 A  U   2460 N3    ? ? A A   2429 A U   2461 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2348 hydrog ? ? A  A   2429 N6    ? ? ? 1_555 A  A   2459 N1    ? ? A A   2430 A A   2460 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2349 hydrog ? ? A  C   2431 N3    ? ? ? 1_555 A  G   2458 N1    ? ? A C   2432 A G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2350 hydrog ? ? A  C   2431 N4    ? ? ? 1_555 A  G   2458 O6    ? ? A C   2432 A G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2351 hydrog ? ? A  C   2431 O2    ? ? ? 1_555 A  G   2458 N2    ? ? A C   2432 A G   2459 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2352 hydrog ? ? A  A   2432 N1    ? ? ? 1_555 A  U   2457 N3    ? ? A A   2433 A U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2353 hydrog ? ? A  A   2432 N6    ? ? ? 1_555 A  U   2457 O4    ? ? A A   2433 A U   2458 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2354 hydrog ? ? A  A   2433 N1    ? ? ? 1_555 A  U   2456 N3    ? ? A A   2434 A U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2355 hydrog ? ? A  A   2433 N6    ? ? ? 1_555 A  U   2456 O4    ? ? A A   2434 A U   2457 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2356 hydrog ? ? A  U   2434 N3    ? ? ? 1_555 A  A   2455 N1    ? ? A U   2435 A A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2357 hydrog ? ? A  U   2434 O4    ? ? ? 1_555 A  A   2455 N6    ? ? A U   2435 A A   2456 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2358 hydrog ? ? A  U   2435 N3    ? ? ? 1_555 A  A   2454 N1    ? ? A U   2436 A A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2359 hydrog ? ? A  U   2435 O4    ? ? ? 1_555 A  A   2454 N6    ? ? A U   2436 A A   2455 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2360 hydrog ? ? A  G   2437 N1    ? ? ? 1_555 A  C   2453 N3    ? ? A G   2438 A C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2361 hydrog ? ? A  G   2437 N2    ? ? ? 1_555 A  C   2453 O2    ? ? A G   2438 A C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2362 hydrog ? ? A  G   2437 O6    ? ? ? 1_555 A  C   2453 N4    ? ? A G   2438 A C   2454 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2363 hydrog ? ? A  C   2438 N3    ? ? ? 1_555 A  G   2452 N1    ? ? A C   2439 A G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2364 hydrog ? ? A  C   2438 N4    ? ? ? 1_555 A  G   2452 O6    ? ? A C   2439 A G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2365 hydrog ? ? A  C   2438 O2    ? ? ? 1_555 A  G   2452 N2    ? ? A C   2439 A G   2453 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2366 hydrog ? ? A  C   2439 N3    ? ? ? 1_555 A  G   2451 N1    ? ? A C   2440 A G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2367 hydrog ? ? A  C   2439 N4    ? ? ? 1_555 A  G   2451 O6    ? ? A C   2440 A G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2368 hydrog ? ? A  C   2439 O2    ? ? ? 1_555 A  G   2451 N2    ? ? A C   2440 A G   2452 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2369 hydrog ? ? A  U   2440 N3    ? ? ? 1_555 A  G   2450 O6    ? ? A U   2441 A G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2370 hydrog ? ? A  U   2440 O2    ? ? ? 1_555 A  G   2450 N1    ? ? A U   2441 A G   2451 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2371 hydrog ? ? A  G   2441 N1    ? ? ? 1_555 A  C   2449 N3    ? ? A G   2442 A C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2372 hydrog ? ? A  G   2441 N2    ? ? ? 1_555 A  C   2449 O2    ? ? A G   2442 A C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2373 hydrog ? ? A  G   2441 O6    ? ? ? 1_555 A  C   2449 N4    ? ? A G   2442 A C   2450 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2374 hydrog ? ? A  G   2470 N2    ? ? ? 1_555 A  A   2632 N3    ? ? A G   2471 A A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2375 hydrog ? ? A  U   2472 O2    ? ? ? 1_555 A  C   2474 N4    ? ? A U   2473 A C   2475 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2376 hydrog ? ? A  G   2481 O6    ? ? ? 1_555 A  A   2485 N6    ? ? A G   2482 A A   2486 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2377 hydrog ? ? A  A   2484 N6    ? ? ? 1_555 A  C   2535 N3    ? ? A A   2485 A C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2378 hydrog ? ? A  A   2484 N7    ? ? ? 1_555 A  C   2535 N4    ? ? A A   2485 A C   2536 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2379 hydrog ? ? A  A   2487 N6    ? ? ? 1_555 A  C   2533 N3    ? ? A A   2488 A C   2534 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2380 hydrog ? ? A  A   2487 N6    ? ? ? 1_555 A  U   2534 O4    ? ? A A   2488 A U   2535 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog2381 hydrog ? ? A  G   2488 N1    ? ? ? 1_555 A  C   2532 N3    ? ? A G   2489 A C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2382 hydrog ? ? A  G   2488 N2    ? ? ? 1_555 A  C   2532 O2    ? ? A G   2489 A C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2383 hydrog ? ? A  G   2488 O6    ? ? ? 1_555 A  C   2532 N4    ? ? A G   2489 A C   2533 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2384 hydrog ? ? A  A   2489 N1    ? ? ? 1_555 A  U   2530 N3    ? ? A A   2490 A U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2385 hydrog ? ? A  A   2489 N6    ? ? ? 1_555 A  U   2530 O4    ? ? A A   2490 A U   2531 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2386 hydrog ? ? A  A   2489 N1    ? ? ? 1_555 A  C   2532 N4    ? ? A A   2490 A C   2533 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2387 hydrog ? ? A  G   2490 N1    ? ? ? 1_555 A  C   2529 N3    ? ? A G   2491 A C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2388 hydrog ? ? A  G   2490 N2    ? ? ? 1_555 A  C   2529 O2    ? ? A G   2491 A C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2389 hydrog ? ? A  G   2490 O6    ? ? ? 1_555 A  C   2529 N4    ? ? A G   2491 A C   2530 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2390 hydrog ? ? A  U   2491 N3    ? ? ? 1_555 A  G   2528 O6    ? ? A U   2492 A G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2391 hydrog ? ? A  U   2491 O2    ? ? ? 1_555 A  G   2528 N1    ? ? A U   2492 A G   2529 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2392 hydrog ? ? A  G   2493 N1    ? ? ? 1_555 A  U   2527 O2    ? ? A G   2494 A U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2393 hydrog ? ? A  G   2493 O6    ? ? ? 1_555 A  U   2527 N3    ? ? A G   2494 A U   2528 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2394 hydrog ? ? A  U   2494 O4    ? ? ? 1_555 A  G   2524 N2    ? ? A U   2495 A G   2525 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2395 hydrog ? ? A  U   2494 N3    ? ? ? 1_555 A  U   2526 O4    ? ? A U   2495 A U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2396 hydrog ? ? A  U   2494 O2    ? ? ? 1_555 A  U   2526 N3    ? ? A U   2495 A U   2527 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2397 hydrog ? ? A  C   2495 N3    ? ? ? 1_555 A  G   2523 N1    ? ? A C   2496 A G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2398 hydrog ? ? A  C   2495 N4    ? ? ? 1_555 A  G   2523 O6    ? ? A C   2496 A G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2399 hydrog ? ? A  C   2495 O2    ? ? ? 1_555 A  G   2523 N2    ? ? A C   2496 A G   2524 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2400 hydrog ? ? A  A   2496 N1    ? ? ? 1_555 A  U   2522 N3    ? ? A A   2497 A U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2401 hydrog ? ? A  A   2496 N6    ? ? ? 1_555 A  U   2522 O4    ? ? A A   2497 A U   2523 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2402 hydrog ? ? A  C   2497 N3    ? ? ? 1_555 A  G   2521 N1    ? ? A C   2498 A G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2403 hydrog ? ? A  C   2497 N4    ? ? ? 1_555 A  G   2521 O6    ? ? A C   2498 A G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2404 hydrog ? ? A  C   2497 O2    ? ? ? 1_555 A  G   2521 N2    ? ? A C   2498 A G   2522 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2405 hydrog ? ? A  U   2498 N3    ? ? ? 1_555 A  A   2520 N1    ? ? A U   2499 A A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2406 hydrog ? ? A  U   2498 O4    ? ? ? 1_555 A  A   2520 N6    ? ? A U   2499 A A   2521 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2407 hydrog ? ? A  C   2499 N3    ? ? ? 1_555 A  G   2519 N1    ? ? A C   2500 A G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2408 hydrog ? ? A  C   2499 N4    ? ? ? 1_555 A  G   2519 O6    ? ? A C   2500 A G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2409 hydrog ? ? A  C   2499 O2    ? ? ? 1_555 A  G   2519 N2    ? ? A C   2500 A G   2520 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2410 hydrog ? ? A  G   2500 N1    ? ? ? 1_555 A  C   2518 N3    ? ? A G   2501 A C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2411 hydrog ? ? A  G   2500 N2    ? ? ? 1_555 A  C   2518 O2    ? ? A G   2501 A C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2412 hydrog ? ? A  G   2500 O6    ? ? ? 1_555 A  C   2518 N4    ? ? A G   2501 A C   2519 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2413 hydrog ? ? A  C   2501 O2    ? ? ? 1_555 A  C   2517 N4    ? ? A C   2502 A C   2518 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2414 hydrog ? ? A  A   2502 N3    ? ? ? 1_555 A  A   2516 N6    ? ? A A   2503 A A   2517 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2415 hydrog ? ? A  A   2503 N6    ? ? ? 1_555 A  G   2515 N3    ? ? A A   2504 A G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2416 hydrog ? ? A  A   2503 N7    ? ? ? 1_555 A  G   2515 N2    ? ? A A   2504 A G   2516 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2417 hydrog ? ? A  G   2504 N1    ? ? ? 1_555 A  C   2514 N3    ? ? A G   2505 A C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2418 hydrog ? ? A  G   2504 N2    ? ? ? 1_555 A  C   2514 O2    ? ? A G   2505 A C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2419 hydrog ? ? A  G   2504 O6    ? ? ? 1_555 A  C   2514 N4    ? ? A G   2505 A C   2515 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2420 hydrog ? ? A  A   2505 N1    ? ? ? 1_555 A  U   2513 N3    ? ? A A   2506 A U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2421 hydrog ? ? A  A   2505 N6    ? ? ? 1_555 A  U   2513 O4    ? ? A A   2506 A U   2514 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2422 hydrog ? ? A  G   2506 N2    ? ? ? 1_555 A  A   2512 N7    ? ? A G   2507 A A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2423 hydrog ? ? A  G   2506 N3    ? ? ? 1_555 A  A   2512 N6    ? ? A G   2507 A A   2513 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2424 hydrog ? ? A  G   2506 N2    ? ? ? 1_555 A  G   2563 O6    ? ? A G   2507 A G   2564 1_555 ? ? ? ? ? ? 'G-G MISPAIR' ? 
? 
hydrog2425 hydrog ? ? A  C   2509 N3    ? ? ? 1_555 A  G   2563 N2    ? ? A C   2510 A G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2426 hydrog ? ? A  C   2509 O2    ? ? ? 1_555 A  G   2563 N1    ? ? A C   2510 A G   2564 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog2427 hydrog ? ? A  G   2524 N2    ? ? ? 1_555 A  U   2526 O4    ? ? A G   2525 A U   2527 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2428 hydrog ? ? A  A   2531 N3    ? ? ? 1_555 A  C   2532 N4    ? ? A A   2532 A C   2533 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2429 hydrog ? ? A  G   2539 N1    ? ? ? 1_555 A  U   2644 O2    ? ? A G   2540 A U   2645 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2430 hydrog ? ? A  U   2540 N3    ? ? ? 1_555 A  G   2617 O6    ? ? A U   2541 A G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2431 hydrog ? ? A  U   2540 O2    ? ? ? 1_555 A  G   2617 N1    ? ? A U   2541 A G   2618 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2432 hydrog ? ? A  C   2541 O2    ? ? ? 1_555 A  G   2587 N2    ? ? A C   2542 A G   2588 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2433 hydrog ? ? A  C   2541 N3    ? ? ? 1_555 A  G   2616 N1    ? ? A C   2542 A G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2434 hydrog ? ? A  C   2541 N4    ? ? ? 1_555 A  G   2616 O6    ? ? A C   2542 A G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2435 hydrog ? ? A  C   2541 O2    ? ? ? 1_555 A  G   2616 N2    ? ? A C   2542 A G   2617 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2436 hydrog ? ? A  G   2542 N1    ? ? ? 1_555 A  U   2614 O2    ? ? A G   2543 A U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2437 hydrog ? ? A  G   2542 O6    ? ? ? 1_555 A  U   2614 N3    ? ? A G   2543 A U   2615 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2438 hydrog ? ? A  G   2543 N1    ? ? ? 1_555 A  C   2613 N3    ? ? A G   2544 A C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2439 hydrog ? ? A  G   2543 N2    ? ? ? 1_555 A  C   2613 O2    ? ? A G   2544 A C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2440 hydrog ? ? A  G   2543 O6    ? ? ? 1_555 A  C   2613 N4    ? ? A G   2544 A C   2614 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2441 hydrog ? ? A  U   2544 N3    ? ? ? 1_555 A  G   2612 O6    ? ? A U   2545 A G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2442 hydrog ? ? A  U   2544 O2    ? ? ? 1_555 A  G   2612 N1    ? ? A U   2545 A G   2613 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2443 hydrog ? ? A  U   2545 N3    ? ? ? 1_555 A  U   2609 O2    ? ? A U   2546 A U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2444 hydrog ? ? A  U   2545 O4    ? ? ? 1_555 A  U   2609 N3    ? ? A U   2546 A U   2610 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2445 hydrog ? ? A  C   2546 N3    ? ? ? 1_555 A  G   2608 N1    ? ? A C   2547 A G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2446 hydrog ? ? A  C   2546 N4    ? ? ? 1_555 A  G   2608 O6    ? ? A C   2547 A G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2447 hydrog ? ? A  C   2546 O2    ? ? ? 1_555 A  G   2608 N2    ? ? A C   2547 A G   2609 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2448 hydrog ? ? A  C   2547 N3    ? ? ? 1_555 A  G   2605 N1    ? ? A C   2548 A G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2449 hydrog ? ? A  C   2547 N4    ? ? ? 1_555 A  G   2605 O6    ? ? A C   2548 A G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2450 hydrog ? ? A  C   2547 O2    ? ? ? 1_555 A  G   2605 N2    ? ? A C   2548 A G   2606 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2451 hydrog ? ? A  C   2548 N3    ? ? ? 1_555 A  G   2604 N1    ? ? A C   2549 A G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2452 hydrog ? ? A  C   2548 N4    ? ? ? 1_555 A  G   2604 O6    ? ? A C   2549 A G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2453 hydrog ? ? A  C   2548 O2    ? ? ? 1_555 A  G   2604 N2    ? ? A C   2549 A G   2605 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2454 hydrog ? ? A  U   2549 N3    ? ? ? 1_555 A  A   2603 N1    ? ? A U   2550 A A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2455 hydrog ? ? A  U   2549 O4    ? ? ? 1_555 A  A   2603 N6    ? ? A U   2550 A A   2604 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2456 hydrog ? ? A  C   2550 N3    ? ? ? 1_555 A  G   2602 N1    ? ? A C   2551 A G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2457 hydrog ? ? A  C   2550 N4    ? ? ? 1_555 A  G   2602 O6    ? ? A C   2551 A G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2458 hydrog ? ? A  C   2550 O2    ? ? ? 1_555 A  G   2602 N2    ? ? A C   2551 A G   2603 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2459 hydrog ? ? A  C   2551 N3    ? ? ? 1_555 A  G   2601 N1    ? ? A C   2552 A G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2460 hydrog ? ? A  C   2551 N4    ? ? ? 1_555 A  G   2601 O6    ? ? A C   2552 A G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2461 hydrog ? ? A  C   2551 O2    ? ? ? 1_555 A  G   2601 N2    ? ? A C   2552 A G   2602 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2462 hydrog ? ? A  C   2551 O2    ? ? ? 1_555 A  G   2602 N2    ? ? A C   2552 A G   2603 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2463 hydrog ? ? A  U   2553 O2    ? ? ? 1_555 A  C   2555 N4    ? ? A U   2554 A C   2556 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2464 hydrog ? ? A  C   2554 N4    ? ? ? 1_555 A  A   2576 N1    ? ? A C   2555 A A   2577 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2465 hydrog ? ? A  C   2554 N3    ? ? ? 1_555 A  G   2579 N1    ? ? A C   2555 A G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2466 hydrog ? ? A  C   2554 N4    ? ? ? 1_555 A  G   2579 O6    ? ? A C   2555 A G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2467 hydrog ? ? A  C   2554 O2    ? ? ? 1_555 A  G   2579 N2    ? ? A C   2555 A G   2580 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2468 hydrog ? ? A  C   2555 N3    ? ? ? 1_555 A  G   2578 N1    ? ? A C   2556 A G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2469 hydrog ? ? A  C   2555 N4    ? ? ? 1_555 A  G   2578 O6    ? ? A C   2556 A G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2470 hydrog ? ? A  C   2555 O2    ? ? ? 1_555 A  G   2578 N2    ? ? A C   2556 A G   2579 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2471 hydrog ? ? A  U   2556 N3    ? ? ? 1_555 A  G   2577 O6    ? ? A U   2557 A G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2472 hydrog ? ? A  U   2556 O2    ? ? ? 1_555 A  G   2577 N1    ? ? A U   2557 A G   2578 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2473 hydrog ? ? A  G   2557 N1    ? ? ? 1_555 A  C   2574 N3    ? ? A G   2558 A C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2474 hydrog ? ? A  G   2557 N2    ? ? ? 1_555 A  C   2574 O2    ? ? A G   2558 A C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2475 hydrog ? ? A  G   2557 O6    ? ? ? 1_555 A  C   2574 N4    ? ? A G   2558 A C   2575 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2476 hydrog ? ? A  G   2557 N2    ? ? ? 1_555 A  A   2798 N3    ? ? A G   2558 A A   2799 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2477 hydrog ? ? A  C   2558 N3    ? ? ? 1_555 A  G   2573 N1    ? ? A C   2559 A G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2478 hydrog ? ? A  C   2558 N4    ? ? ? 1_555 A  G   2573 O6    ? ? A C   2559 A G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2479 hydrog ? ? A  C   2558 O2    ? ? ? 1_555 A  G   2573 N2    ? ? A C   2559 A G   2574 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2480 hydrog ? ? A  C   2559 N3    ? ? ? 1_555 A  G   2572 N1    ? ? A C   2560 A G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2481 hydrog ? ? A  C   2559 N4    ? ? ? 1_555 A  G   2572 O6    ? ? A C   2560 A G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2482 hydrog ? ? A  C   2559 O2    ? ? ? 1_555 A  G   2572 N2    ? ? A C   2560 A G   2573 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2483 hydrog ? ? A  C   2560 N3    ? ? ? 1_555 A  G   2571 N1    ? ? A C   2561 A G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2484 hydrog ? ? A  C   2560 N4    ? ? ? 1_555 A  G   2571 O6    ? ? A C   2561 A G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2485 hydrog ? ? A  C   2560 O2    ? ? ? 1_555 A  G   2571 N2    ? ? A C   2561 A G   2572 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2486 hydrog ? ? A  G   2561 N1    ? ? ? 1_555 A  C   2570 N3    ? ? A G   2562 A C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2487 hydrog ? ? A  G   2561 N2    ? ? ? 1_555 A  C   2570 O2    ? ? A G   2562 A C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2488 hydrog ? ? A  G   2561 O6    ? ? ? 1_555 A  C   2570 N4    ? ? A G   2562 A C   2571 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2489 hydrog ? ? A  U   2562 N3    ? ? ? 1_555 A  G   2569 O6    ? ? A U   2563 A G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2490 hydrog ? ? A  U   2562 O2    ? ? ? 1_555 A  G   2569 N1    ? ? A U   2563 A G   2570 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2491 hydrog ? ? A  A   2565 N1    ? ? ? 1_555 A  A   2698 N6    ? ? A A   2566 A A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2492 hydrog ? ? A  A   2565 N6    ? ? ? 1_555 A  A   2698 N1    ? ? A A   2566 A A   2699 1_555 ? ? ? ? ? ? TYPE_1_PAIR ? ? 
hydrog2493 hydrog ? ? A  G   2566 N2    ? ? ? 1_555 A  G   2699 N3    ? ? A G   2567 A G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2494 hydrog ? ? A  G   2566 N3    ? ? ? 1_555 A  G   2699 N2    ? ? A G   2567 A G   2700 1_555 ? ? ? ? ? ? TYPE_4_PAIR ? ? 
hydrog2495 hydrog ? ? A  G   2573 N2    ? ? ? 1_555 A  A   2775 N3    ? ? A G   2574 A A   2776 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2496 hydrog ? ? A  A   2575 N3    ? ? ? 1_555 A  A   2799 N6    ? ? A A   2576 A A   2800 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2497 hydrog ? ? A  G   2579 N2    ? ? ? 1_555 A  A   2599 N3    ? ? A G   2580 A A   2600 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2498 hydrog ? ? A  U   2580 N3    ? ? ? 1_555 A  G   2601 N7    ? ? A U   2581 A G   2602 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2499 hydrog ? ? A  G   2581 N1    ? ? ? 1_555 A  A   2595 N1    ? ? A G   2582 A A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2500 hydrog ? ? A  G   2581 O6    ? ? ? 1_555 A  A   2595 N6    ? ? A G   2582 A A   2596 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2501 hydrog ? ? A  A   2582 N1    ? ? ? 1_555 A  U   2594 N3    ? ? A A   2583 A U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2502 hydrog ? ? A  A   2582 N6    ? ? ? 1_555 A  U   2594 O4    ? ? A A   2583 A U   2595 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2503 hydrog ? ? A  G   2583 N1    ? ? ? 1_555 A  C   2593 N3    ? ? A G   2584 A C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2504 hydrog ? ? A  G   2583 N2    ? ? ? 1_555 A  C   2593 O2    ? ? A G   2584 A C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2505 hydrog ? ? A  G   2583 O6    ? ? ? 1_555 A  C   2593 N4    ? ? A G   2584 A C   2594 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2506 hydrog ? ? A  G   2584 N1    ? ? ? 1_555 A  C   2592 N3    ? ? A G   2585 A C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2507 hydrog ? ? A  G   2584 N2    ? ? ? 1_555 A  C   2592 O2    ? ? A G   2585 A C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2508 hydrog ? ? A  G   2584 O6    ? ? ? 1_555 A  C   2592 N4    ? ? A G   2585 A C   2593 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2509 hydrog ? ? A  U   2585 O4    ? ? ? 1_555 A  G   2591 N1    ? ? A U   2586 A G   2592 1_555 ? ? ? ? ? ? 'U-G MISPAIR' ? 
? 
hydrog2510 hydrog ? ? A  U   2586 O2    ? ? ? 1_555 A  C   2590 N4    ? ? A U   2587 A C   2591 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2511 hydrog ? ? A  U   2596 N3    ? ? ? 1_555 A  A   2600 N7    ? ? A U   2597 A A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2512 hydrog ? ? A  U   2596 O2    ? ? ? 1_555 A  A   2600 N6    ? ? A U   2597 A A   2601 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2513 hydrog ? ? A  A   2621 N6    ? ? ? 1_555 A  G   2642 N3    ? ? A A   2622 A G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2514 hydrog ? ? A  A   2621 N7    ? ? ? 1_555 A  G   2642 N2    ? ? A A   2622 A G   2643 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2515 hydrog ? ? A  G   2622 N1    ? ? ? 1_555 A  C   2640 N3    ? ? A G   2623 A C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2516 hydrog ? ? A  G   2622 N2    ? ? ? 1_555 A  C   2640 O2    ? ? A G   2623 A C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2517 hydrog ? ? A  G   2622 O6    ? ? ? 1_555 A  C   2640 N4    ? ? A G   2623 A C   2641 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2518 hydrog ? ? A  A   2623 N1    ? ? ? 1_555 A  U   2639 N3    ? ? A A   2624 A U   2640 1_555 ? ? ? ? ? ? 'A-U PAIR' ?     
? 
hydrog2519 hydrog ? ? A  C   2624 N3    ? ? ? 1_555 A  G   2638 N1    ? ? A C   2625 A G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2520 hydrog ? ? A  C   2624 N4    ? ? ? 1_555 A  G   2638 O6    ? ? A C   2625 A G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2521 hydrog ? ? A  C   2624 O2    ? ? ? 1_555 A  G   2638 N2    ? ? A C   2625 A G   2639 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2522 hydrog ? ? A  C   2625 N3    ? ? ? 1_555 A  G   2637 N1    ? ? A C   2626 A G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2523 hydrog ? ? A  C   2625 N4    ? ? ? 1_555 A  G   2637 O6    ? ? A C   2626 A G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2524 hydrog ? ? A  C   2625 O2    ? ? ? 1_555 A  G   2637 N2    ? ? A C   2626 A G   2638 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2525 hydrog ? ? A  G   2626 N1    ? ? ? 1_555 A  C   2635 N3    ? ? A G   2627 A C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2526 hydrog ? ? A  G   2626 N2    ? ? ? 1_555 A  C   2635 O2    ? ? A G   2627 A C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2527 hydrog ? ? A  G   2626 O6    ? ? ? 1_555 A  C   2635 N4    ? ? A G   2627 A C   2636 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2528 hydrog ? ? A  U   2627 N3    ? ? ? 1_555 A  A   2634 N1    ? ? A U   2628 A A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2529 hydrog ? ? A  U   2627 O4    ? ? ? 1_555 A  A   2634 N6    ? ? A U   2628 A A   2635 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2530 hydrog ? ? A  C   2628 N3    ? ? ? 1_555 A  G   2633 N1    ? ? A C   2629 A G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2531 hydrog ? ? A  C   2628 N4    ? ? ? 1_555 A  G   2633 O6    ? ? A C   2629 A G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2532 hydrog ? ? A  C   2628 O2    ? ? ? 1_555 A  G   2633 N2    ? ? A C   2629 A G   2634 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2533 hydrog ? ? A  G   2629 N2    ? ? ? 1_555 A  A   2632 N7    ? ? A G   2630 A A   2633 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2534 hydrog ? ? A  A   2648 N3    ? ? ? 1_555 A  C   2650 N4    ? ? A A   2649 A C   2651 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2535 hydrog ? ? A  G   2656 N2    ? ? ? 1_555 A  A   2840 N1    ? ? A G   2657 A A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2536 hydrog ? ? A  G   2656 N3    ? ? ? 1_555 A  A   2840 N6    ? ? A G   2657 A A   2841 1_555 ? ? ? ? ? ? TYPE_10_PAIR ? ? 
hydrog2537 hydrog ? ? A  U   2660 O2    ? ? ? 1_555 A  A   2811 N6    ? ? A U   2661 A A   2812 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2538 hydrog ? ? A  G   2661 N2    ? ? ? 1_555 A  A   2815 N3    ? ? A G   2662 A A   2816 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2539 hydrog ? ? A  G   2666 N1    ? ? ? 1_555 A  C   2821 N3    ? ? A G   2667 A C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2540 hydrog ? ? A  G   2666 N2    ? ? ? 1_555 A  C   2821 O2    ? ? A G   2667 A C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2541 hydrog ? ? A  G   2666 O6    ? ? ? 1_555 A  C   2821 N4    ? ? A G   2667 A C   2822 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2542 hydrog ? ? A  G   2666 N2    ? ? ? 1_555 A  A   2826 N3    ? ? A G   2667 A A   2827 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2543 hydrog ? ? A  G   2667 N1    ? ? ? 1_555 A  C   2820 N3    ? ? A G   2668 A C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2544 hydrog ? ? A  G   2667 N2    ? ? ? 1_555 A  C   2820 O2    ? ? A G   2668 A C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2545 hydrog ? ? A  G   2667 O6    ? ? ? 1_555 A  C   2820 N4    ? ? A G   2668 A C   2821 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2546 hydrog ? ? A  U   2668 N3    ? ? ? 1_555 A  A   2819 N1    ? ? A U   2669 A A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2547 hydrog ? ? A  U   2668 O4    ? ? ? 1_555 A  A   2819 N6    ? ? A U   2669 A A   2820 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2548 hydrog ? ? A  G   2669 N1    ? ? ? 1_555 A  C   2818 N3    ? ? A G   2670 A C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2549 hydrog ? ? A  G   2669 N2    ? ? ? 1_555 A  C   2818 O2    ? ? A G   2670 A C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2550 hydrog ? ? A  G   2669 O6    ? ? ? 1_555 A  C   2818 N4    ? ? A G   2670 A C   2819 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2551 hydrog ? ? A  U   2670 N3    ? ? ? 1_555 A  A   2817 N1    ? ? A U   2671 A A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2552 hydrog ? ? A  U   2670 O4    ? ? ? 1_555 A  A   2817 N6    ? ? A U   2671 A A   2818 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2553 hydrog ? ? A  C   2671 N3    ? ? ? 1_555 A  G   2816 N1    ? ? A C   2672 A G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2554 hydrog ? ? A  C   2671 N4    ? ? ? 1_555 A  G   2816 O6    ? ? A C   2672 A G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2555 hydrog ? ? A  C   2671 O2    ? ? ? 1_555 A  G   2816 N2    ? ? A C   2672 A G   2817 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2556 hydrog ? ? A  U   2672 N3    ? ? ? 1_555 A  A   2810 N7    ? ? A U   2673 A A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2557 hydrog ? ? A  U   2672 O2    ? ? ? 1_555 A  A   2810 N6    ? ? A U   2673 A A   2811 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2558 hydrog ? ? A  G   2673 N2    ? ? ? 1_555 A  A   2812 N7    ? ? A G   2674 A A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2559 hydrog ? ? A  G   2673 N3    ? ? ? 1_555 A  A   2812 N6    ? ? A G   2674 A A   2813 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2560 hydrog ? ? A  A   2674 N6    ? ? ? 1_555 A  G   2809 N3    ? ? A A   2675 A G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2561 hydrog ? ? A  A   2674 N7    ? ? ? 1_555 A  G   2809 N2    ? ? A A   2675 A G   2810 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2562 hydrog ? ? A  C   2675 N3    ? ? ? 1_555 A  G   2808 N1    ? ? A C   2676 A G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2563 hydrog ? ? A  C   2675 N4    ? ? ? 1_555 A  G   2808 O6    ? ? A C   2676 A G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2564 hydrog ? ? A  C   2675 O2    ? ? ? 1_555 A  G   2808 N2    ? ? A C   2676 A G   2809 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2565 hydrog ? ? A  A   2676 N1    ? ? ? 1_555 A  U   2807 N3    ? ? A A   2677 A U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2566 hydrog ? ? A  A   2676 N6    ? ? ? 1_555 A  U   2807 O4    ? ? A A   2677 A U   2808 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2567 hydrog ? ? A  A   2677 N1    ? ? ? 1_555 A  U   2806 N3    ? ? A A   2678 A U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2568 hydrog ? ? A  A   2677 N6    ? ? ? 1_555 A  U   2806 O4    ? ? A A   2678 A U   2807 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2569 hydrog ? ? A  G   2678 N1    ? ? ? 1_555 A  C   2805 N3    ? ? A G   2679 A C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2570 hydrog ? ? A  G   2678 N2    ? ? ? 1_555 A  C   2805 O2    ? ? A G   2679 A C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2571 hydrog ? ? A  G   2678 O6    ? ? ? 1_555 A  C   2805 N4    ? ? A G   2679 A C   2806 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2572 hydrog ? ? A  A   2679 N1    ? ? ? 1_555 A  G   2711 N2    ? ? A A   2680 A G   2712 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2573 hydrog ? ? A  A   2680 N3    ? ? ? 1_555 A  G   2712 N2    ? ? A A   2681 A G   2713 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2574 hydrog ? ? A  C   2681 N3    ? ? ? 1_555 A  G   2711 N1    ? ? A C   2682 A G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2575 hydrog ? ? A  C   2681 N4    ? ? ? 1_555 A  G   2711 O6    ? ? A C   2682 A G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2576 hydrog ? ? A  C   2681 O2    ? ? ? 1_555 A  G   2711 N2    ? ? A C   2682 A G   2712 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2577 hydrog ? ? A  G   2682 N1    ? ? ? 1_555 A  U   2710 O2    ? ? A G   2683 A U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2578 hydrog ? ? A  G   2682 O6    ? ? ? 1_555 A  U   2710 N3    ? ? A G   2683 A U   2711 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2579 hydrog ? ? A  A   2683 N1    ? ? ? 1_555 A  U   2709 N3    ? ? A A   2684 A U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2580 hydrog ? ? A  A   2683 N6    ? ? ? 1_555 A  U   2709 O4    ? ? A A   2684 A U   2710 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2581 hydrog ? ? A  C   2684 N3    ? ? ? 1_555 A  G   2708 N1    ? ? A C   2685 A G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2582 hydrog ? ? A  C   2684 N4    ? ? ? 1_555 A  G   2708 O6    ? ? A C   2685 A G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2583 hydrog ? ? A  C   2684 O2    ? ? ? 1_555 A  G   2708 N2    ? ? A C   2685 A G   2709 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2584 hydrog ? ? A  C   2685 N3    ? ? ? 1_555 A  G   2707 N1    ? ? A C   2686 A G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2585 hydrog ? ? A  C   2685 N4    ? ? ? 1_555 A  G   2707 O6    ? ? A C   2686 A G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2586 hydrog ? ? A  C   2685 O2    ? ? ? 1_555 A  G   2707 N2    ? ? A C   2686 A G   2708 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2587 hydrog ? ? A  G   2686 N1    ? ? ? 1_555 A  C   2706 N3    ? ? A G   2687 A C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2588 hydrog ? ? A  G   2686 N2    ? ? ? 1_555 A  C   2706 O2    ? ? A G   2687 A C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2589 hydrog ? ? A  G   2686 O6    ? ? ? 1_555 A  C   2706 N4    ? ? A G   2687 A C   2707 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2590 hydrog ? ? A  U   2687 N3    ? ? ? 1_555 A  A   2705 N1    ? ? A U   2688 A A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2591 hydrog ? ? A  U   2687 O4    ? ? ? 1_555 A  A   2705 N6    ? ? A U   2688 A A   2706 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2592 hydrog ? ? A  A   2688 N1    ? ? ? 1_555 A  U   2704 N3    ? ? A A   2689 A U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2593 hydrog ? ? A  A   2688 N6    ? ? ? 1_555 A  U   2704 O4    ? ? A A   2689 A U   2705 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2594 hydrog ? ? A  U   2689 O2    ? ? ? 1_555 A  C   2703 N4    ? ? A U   2690 A C   2704 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2595 hydrog ? ? A  A   2690 N6    ? ? ? 1_555 A  A   2702 N7    ? ? A A   2691 A A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2596 hydrog ? ? A  A   2690 N7    ? ? ? 1_555 A  A   2702 N6    ? ? A A   2691 A A   2703 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2597 hydrog ? ? A  G   2691 N2    ? ? ? 1_555 A  U   2692 O4    ? ? A G   2692 A U   2693 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2598 hydrog ? ? A  U   2692 N3    ? ? ? 1_555 A  A   2701 N7    ? ? A U   2693 A A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2599 hydrog ? ? A  U   2692 O2    ? ? ? 1_555 A  A   2701 N6    ? ? A U   2693 A A   2702 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2600 hydrog ? ? A  A   2693 N6    ? ? ? 1_555 A  G   2700 N3    ? ? A A   2694 A G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2601 hydrog ? ? A  A   2693 N7    ? ? ? 1_555 A  G   2700 N2    ? ? A A   2694 A G   2701 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2602 hydrog ? ? A  C   2694 N3    ? ? ? 1_555 A  G   2699 N1    ? ? A C   2695 A G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2603 hydrog ? ? A  C   2694 N4    ? ? ? 1_555 A  G   2699 O6    ? ? A C   2695 A G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2604 hydrog ? ? A  C   2694 O2    ? ? ? 1_555 A  G   2699 N2    ? ? A C   2695 A G   2700 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2605 hydrog ? ? A  G   2695 N2    ? ? ? 1_555 A  A   2698 N7    ? ? A G   2696 A A   2699 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2606 hydrog ? ? A  G   2712 N1    ? ? ? 1_555 A  C   2766 N3    ? ? A G   2713 A C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2607 hydrog ? ? A  G   2712 N2    ? ? ? 1_555 A  C   2766 O2    ? ? A G   2713 A C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2608 hydrog ? ? A  G   2712 O6    ? ? ? 1_555 A  C   2766 N4    ? ? A G   2713 A C   2767 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2609 hydrog ? ? A  U   2713 N3    ? ? ? 1_555 A  A   2765 N1    ? ? A U   2714 A A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2610 hydrog ? ? A  U   2713 O4    ? ? ? 1_555 A  A   2765 N6    ? ? A U   2714 A A   2766 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2611 hydrog ? ? A  G   2714 N1    ? ? ? 1_555 A  C   2764 N3    ? ? A G   2715 A C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2612 hydrog ? ? A  G   2714 N2    ? ? ? 1_555 A  C   2764 O2    ? ? A G   2715 A C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2613 hydrog ? ? A  G   2714 O6    ? ? ? 1_555 A  C   2764 N4    ? ? A G   2715 A C   2765 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2614 hydrog ? ? A  G   2715 N1    ? ? ? 1_555 A  C   2763 N3    ? ? A G   2716 A C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2615 hydrog ? ? A  G   2715 N2    ? ? ? 1_555 A  C   2763 O2    ? ? A G   2716 A C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2616 hydrog ? ? A  G   2715 O6    ? ? ? 1_555 A  C   2763 N4    ? ? A G   2716 A C   2764 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2617 hydrog ? ? A  C   2716 N3    ? ? ? 1_555 A  G   2762 N1    ? ? A C   2717 A G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2618 hydrog ? ? A  C   2716 N4    ? ? ? 1_555 A  G   2762 O6    ? ? A C   2717 A G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2619 hydrog ? ? A  C   2716 O2    ? ? ? 1_555 A  G   2762 N2    ? ? A C   2717 A G   2763 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2620 hydrog ? ? A  C   2717 O2    ? ? ? 1_555 A  C   2719 N4    ? ? A C   2718 A C   2720 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2621 hydrog ? ? A  C   2717 N3    ? ? ? 1_555 A  A   2760 N6    ? ? A C   2718 A A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2622 hydrog ? ? A  C   2717 N4    ? ? ? 1_555 A  A   2760 N7    ? ? A C   2718 A A   2761 1_555 ? ? ? ? ? ? TYPE_25_PAIR ? ? 
hydrog2623 hydrog ? ? A  C   2719 N4    ? ? ? 1_555 A  G   2762 N3    ? ? A C   2720 A G   2763 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2624 hydrog ? ? A  U   2720 N3    ? ? ? 1_555 A  A   2760 N1    ? ? A U   2721 A A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2625 hydrog ? ? A  U   2720 O4    ? ? ? 1_555 A  A   2760 N6    ? ? A U   2721 A A   2761 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2626 hydrog ? ? A  G   2721 N1    ? ? ? 1_555 A  C   2759 N3    ? ? A G   2722 A C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2627 hydrog ? ? A  G   2721 N2    ? ? ? 1_555 A  C   2759 O2    ? ? A G   2722 A C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2628 hydrog ? ? A  G   2721 O6    ? ? ? 1_555 A  C   2759 N4    ? ? A G   2722 A C   2760 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2629 hydrog ? ? A  G   2722 N1    ? ? ? 1_555 A  C   2758 N3    ? ? A G   2723 A C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2630 hydrog ? ? A  G   2722 N2    ? ? ? 1_555 A  C   2758 O2    ? ? A G   2723 A C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2631 hydrog ? ? A  G   2722 O6    ? ? ? 1_555 A  C   2758 N4    ? ? A G   2723 A C   2759 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2632 hydrog ? ? A  U   2723 N3    ? ? ? 1_555 A  G   2757 O6    ? ? A U   2724 A G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2633 hydrog ? ? A  U   2723 O2    ? ? ? 1_555 A  G   2757 N1    ? ? A U   2724 A G   2758 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2634 hydrog ? ? A  G   2724 N2    ? ? ? 1_555 A  A   2756 N7    ? ? A G   2725 A A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2635 hydrog ? ? A  G   2724 N3    ? ? ? 1_555 A  A   2756 N6    ? ? A G   2725 A A   2757 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2636 hydrog ? ? A  A   2726 N7    ? ? ? 1_555 A  G   2754 N2    ? ? A A   2727 A G   2755 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2637 hydrog ? ? A  C   2727 N3    ? ? ? 1_555 A  G   2753 N1    ? ? A C   2728 A G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2638 hydrog ? ? A  C   2727 N4    ? ? ? 1_555 A  G   2753 O6    ? ? A C   2728 A G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2639 hydrog ? ? A  C   2727 O2    ? ? ? 1_555 A  G   2753 N2    ? ? A C   2728 A G   2754 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2640 hydrog ? ? A  C   2728 N3    ? ? ? 1_555 A  G   2752 N1    ? ? A C   2729 A G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2641 hydrog ? ? A  C   2728 N4    ? ? ? 1_555 A  G   2752 O6    ? ? A C   2729 A G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2642 hydrog ? ? A  C   2728 O2    ? ? ? 1_555 A  G   2752 N2    ? ? A C   2729 A G   2753 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2643 hydrog ? ? A  G   2729 N1    ? ? ? 1_555 A  C   2751 N3    ? ? A G   2730 A C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2644 hydrog ? ? A  G   2729 N2    ? ? ? 1_555 A  C   2751 O2    ? ? A G   2730 A C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2645 hydrog ? ? A  G   2729 O6    ? ? ? 1_555 A  C   2751 N4    ? ? A G   2730 A C   2752 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2646 hydrog ? ? A  G   2730 N1    ? ? ? 1_555 A  C   2750 N3    ? ? A G   2731 A C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2647 hydrog ? ? A  G   2730 N2    ? ? ? 1_555 A  C   2750 O2    ? ? A G   2731 A C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2648 hydrog ? ? A  G   2730 O6    ? ? ? 1_555 A  C   2750 N4    ? ? A G   2731 A C   2751 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2649 hydrog ? ? A  U   2731 N3    ? ? ? 1_555 A  G   2749 O6    ? ? A U   2732 A G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2650 hydrog ? ? A  U   2731 O2    ? ? ? 1_555 A  G   2749 N1    ? ? A U   2732 A G   2750 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2651 hydrog ? ? A  U   2732 N3    ? ? ? 1_555 A  A   2745 N1    ? ? A U   2733 A A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2652 hydrog ? ? A  U   2732 O4    ? ? ? 1_555 A  A   2745 N6    ? ? A U   2733 A A   2746 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2653 hydrog ? ? A  G   2733 N1    ? ? ? 1_555 A  C   2744 N3    ? ? A G   2734 A C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2654 hydrog ? ? A  G   2733 N2    ? ? ? 1_555 A  C   2744 O2    ? ? A G   2734 A C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2655 hydrog ? ? A  G   2733 O6    ? ? ? 1_555 A  C   2744 N4    ? ? A G   2734 A C   2745 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2656 hydrog ? ? A  U   2734 N3    ? ? ? 1_555 A  G   2743 O6    ? ? A U   2735 A G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2657 hydrog ? ? A  U   2734 O2    ? ? ? 1_555 A  G   2743 N1    ? ? A U   2735 A G   2744 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2658 hydrog ? ? A  U   2735 N3    ? ? ? 1_555 A  A   2742 N1    ? ? A U   2736 A A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2659 hydrog ? ? A  U   2735 O4    ? ? ? 1_555 A  A   2742 N6    ? ? A U   2736 A A   2743 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2660 hydrog ? ? A  C   2736 N3    ? ? ? 1_555 A  G   2741 N1    ? ? A C   2737 A G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2661 hydrog ? ? A  C   2736 N4    ? ? ? 1_555 A  G   2741 O6    ? ? A C   2737 A G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2662 hydrog ? ? A  C   2736 O2    ? ? ? 1_555 A  G   2741 N2    ? ? A C   2737 A G   2742 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2663 hydrog ? ? A  U   2755 N3    ? ? ? 1_555 A  A   2895 N1    ? ? A U   2756 A A   2896 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2664 hydrog ? ? A  C   2768 N4    ? ? ? 1_555 A  A   2804 N3    ? ? A C   2769 A A   2805 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2665 hydrog ? ? A  G   2769 N1    ? ? ? 1_555 A  C   2803 N3    ? ? A G   2770 A C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2666 hydrog ? ? A  G   2769 N2    ? ? ? 1_555 A  C   2803 O2    ? ? A G   2770 A C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2667 hydrog ? ? A  G   2769 O6    ? ? ? 1_555 A  C   2803 N4    ? ? A G   2770 A C   2804 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2668 hydrog ? ? A  G   2770 N1    ? ? ? 1_555 A  C   2802 N3    ? ? A G   2771 A C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2669 hydrog ? ? A  G   2770 N2    ? ? ? 1_555 A  C   2802 O2    ? ? A G   2771 A C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2670 hydrog ? ? A  G   2770 O6    ? ? ? 1_555 A  C   2802 N4    ? ? A G   2771 A C   2803 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2671 hydrog ? ? A  G   2771 N1    ? ? ? 1_555 A  C   2801 N3    ? ? A G   2772 A C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2672 hydrog ? ? A  G   2771 N2    ? ? ? 1_555 A  C   2801 O2    ? ? A G   2772 A C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2673 hydrog ? ? A  G   2771 O6    ? ? ? 1_555 A  C   2801 N4    ? ? A G   2772 A C   2802 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2674 hydrog ? ? A  G   2772 N1    ? ? ? 1_555 A  A   2800 N1    ? ? A G   2773 A A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2675 hydrog ? ? A  G   2772 O6    ? ? ? 1_555 A  A   2800 N6    ? ? A G   2773 A A   2801 1_555 ? ? ? ? ? ? TYPE_8_PAIR ? ? 
hydrog2676 hydrog ? ? A  U   2773 N3    ? ? ? 1_555 A  A   2798 N7    ? ? A U   2774 A A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2677 hydrog ? ? A  U   2773 O2    ? ? ? 1_555 A  A   2798 N6    ? ? A U   2774 A A   2799 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2678 hydrog ? ? A  A   2775 N6    ? ? ? 1_555 A  G   2797 N3    ? ? A A   2776 A G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2679 hydrog ? ? A  A   2775 N7    ? ? ? 1_555 A  G   2797 N2    ? ? A A   2776 A G   2798 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2680 hydrog ? ? A  G   2776 N1    ? ? ? 1_555 A  C   2796 N3    ? ? A G   2777 A C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2681 hydrog ? ? A  G   2776 N2    ? ? ? 1_555 A  C   2796 O2    ? ? A G   2777 A C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2682 hydrog ? ? A  G   2776 O6    ? ? ? 1_555 A  C   2796 N4    ? ? A G   2777 A C   2797 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2683 hydrog ? ? A  A   2777 N1    ? ? ? 1_555 A  U   2795 N3    ? ? A A   2778 A U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2684 hydrog ? ? A  A   2777 N6    ? ? ? 1_555 A  U   2795 O4    ? ? A A   2778 A U   2796 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2685 hydrog ? ? A  G   2778 N1    ? ? ? 1_555 A  C   2794 N3    ? ? A G   2779 A C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2686 hydrog ? ? A  G   2778 N2    ? ? ? 1_555 A  C   2794 O2    ? ? A G   2779 A C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2687 hydrog ? ? A  G   2778 O6    ? ? ? 1_555 A  C   2794 N4    ? ? A G   2779 A C   2795 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2688 hydrog ? ? A  C   2779 N3    ? ? ? 1_555 A  G   2793 N1    ? ? A C   2780 A G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2689 hydrog ? ? A  C   2779 N4    ? ? ? 1_555 A  G   2793 O6    ? ? A C   2780 A G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2690 hydrog ? ? A  C   2779 O2    ? ? ? 1_555 A  G   2793 N2    ? ? A C   2780 A G   2794 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2691 hydrog ? ? A  U   2780 N3    ? ? ? 1_555 A  U   2790 O4    ? ? A U   2781 A U   2791 1_555 ? ? ? ? ? ? 'U-U MISPAIR' ? 
? 
hydrog2692 hydrog ? ? A  U   2780 O2    ? ? ? 1_555 A  A   2792 N6    ? ? A U   2781 A A   2793 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2693 hydrog ? ? A  G   2781 N2    ? ? ? 1_555 A  A   2791 N7    ? ? A G   2782 A A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2694 hydrog ? ? A  G   2781 N3    ? ? ? 1_555 A  A   2791 N6    ? ? A G   2782 A A   2792 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2695 hydrog ? ? A  A   2782 N6    ? ? ? 1_555 A  U   2788 O2    ? ? A A   2783 A U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2696 hydrog ? ? A  A   2782 N7    ? ? ? 1_555 A  U   2788 N3    ? ? A A   2783 A U   2789 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2697 hydrog ? ? A  A   2783 N6    ? ? ? 1_555 A  A   2787 N1    ? ? A A   2784 A A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2698 hydrog ? ? A  A   2783 N7    ? ? ? 1_555 A  A   2787 N6    ? ? A A   2784 A A   2788 1_555 ? ? ? ? ? ? TYPE_5_PAIR ? ? 
hydrog2699 hydrog ? ? A  C   2784 O2    ? ? ? 1_555 A  C   2786 N4    ? ? A C   2785 A C   2787 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2700 hydrog ? ? A  U   2790 N3    ? ? ? 1_555 A  A   2792 N7    ? ? A U   2791 A A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2701 hydrog ? ? A  U   2790 O4    ? ? ? 1_555 A  A   2792 N6    ? ? A U   2791 A A   2793 1_555 ? ? ? ? ? ? HOOGSTEEN ?     
? 
hydrog2702 hydrog ? ? A  A   2811 N1    ? ? ? 1_555 A  A   2813 N6    ? ? A A   2812 A A   2814 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2703 hydrog ? ? A  G   2822 N2    ? ? ? 1_555 A  A   2913 N3    ? ? A G   2823 A A   2914 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2704 hydrog ? ? A  G   2825 N2    ? ? ? 1_555 A  A   2913 N7    ? ? A G   2826 A A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2705 hydrog ? ? A  G   2825 N3    ? ? ? 1_555 A  A   2913 N6    ? ? A G   2826 A A   2914 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2706 hydrog ? ? A  A   2826 N6    ? ? ? 1_555 A  A   2912 N3    ? ? A A   2827 A A   2913 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2707 hydrog ? ? A  G   2827 N1    ? ? ? 1_555 A  C   2911 N3    ? ? A G   2828 A C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2708 hydrog ? ? A  G   2827 N2    ? ? ? 1_555 A  C   2911 O2    ? ? A G   2828 A C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2709 hydrog ? ? A  G   2827 O6    ? ? ? 1_555 A  C   2911 N4    ? ? A G   2828 A C   2912 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2710 hydrog ? ? A  G   2828 N1    ? ? ? 1_555 A  C   2910 N3    ? ? A G   2829 A C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2711 hydrog ? ? A  G   2828 N2    ? ? ? 1_555 A  C   2910 O2    ? ? A G   2829 A C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2712 hydrog ? ? A  G   2828 O6    ? ? ? 1_555 A  C   2910 N4    ? ? A G   2829 A C   2911 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2713 hydrog ? ? A  U   2829 N3    ? ? ? 1_555 A  A   2909 N1    ? ? A U   2830 A A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2714 hydrog ? ? A  U   2829 O4    ? ? ? 1_555 A  A   2909 N6    ? ? A U   2830 A A   2910 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2715 hydrog ? ? A  C   2830 O2    ? ? ? 1_555 A  G   2908 N2    ? ? A C   2831 A G   2909 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2716 hydrog ? ? A  C   2831 N3    ? ? ? 1_555 A  G   2847 N1    ? ? A C   2832 A G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2717 hydrog ? ? A  C   2831 N4    ? ? ? 1_555 A  G   2847 O6    ? ? A C   2832 A G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2718 hydrog ? ? A  C   2831 O2    ? ? ? 1_555 A  G   2847 N2    ? ? A C   2832 A G   2848 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2719 hydrog ? ? A  C   2831 O2    ? ? ? 1_555 A  A   2907 N6    ? ? A C   2832 A A   2908 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2720 hydrog ? ? A  C   2832 N3    ? ? ? 1_555 A  G   2846 N1    ? ? A C   2833 A G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2721 hydrog ? ? A  C   2832 N4    ? ? ? 1_555 A  G   2846 O6    ? ? A C   2833 A G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2722 hydrog ? ? A  C   2832 O2    ? ? ? 1_555 A  G   2846 N2    ? ? A C   2833 A G   2847 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2723 hydrog ? ? A  G   2833 N1    ? ? ? 1_555 A  C   2845 N3    ? ? A G   2834 A C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2724 hydrog ? ? A  G   2833 N2    ? ? ? 1_555 A  C   2845 O2    ? ? A G   2834 A C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2725 hydrog ? ? A  G   2833 O6    ? ? ? 1_555 A  C   2845 N4    ? ? A G   2834 A C   2846 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2726 hydrog ? ? A  C   2834 N3    ? ? ? 1_555 A  G   2844 N1    ? ? A C   2835 A G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2727 hydrog ? ? A  C   2834 N4    ? ? ? 1_555 A  G   2844 O6    ? ? A C   2835 A G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2728 hydrog ? ? A  C   2834 O2    ? ? ? 1_555 A  G   2844 N2    ? ? A C   2835 A G   2845 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2729 hydrog ? ? A  G   2835 N1    ? ? ? 1_555 A  C   2843 N3    ? ? A G   2836 A C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2730 hydrog ? ? A  G   2835 N2    ? ? ? 1_555 A  C   2843 O2    ? ? A G   2836 A C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2731 hydrog ? ? A  G   2835 O6    ? ? ? 1_555 A  C   2843 N4    ? ? A G   2836 A C   2844 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2732 hydrog ? ? A  A   2837 N3    ? ? ? 1_555 A  A   2842 N6    ? ? A A   2838 A A   2843 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2733 hydrog ? ? A  G   2846 N2    ? ? ? 1_555 A  A   2905 N3    ? ? A G   2847 A A   2906 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2734 hydrog ? ? A  G   2850 N2    ? ? ? 1_555 A  A   2905 N7    ? ? A G   2851 A A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2735 hydrog ? ? A  G   2850 N3    ? ? ? 1_555 A  A   2905 N6    ? ? A G   2851 A A   2906 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2736 hydrog ? ? A  A   2851 N1    ? ? ? 1_555 A  C   2902 N4    ? ? A A   2852 A C   2903 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2737 hydrog ? ? A  U   2852 O4    ? ? ? 1_555 A  A   2901 N6    ? ? A U   2853 A A   2902 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2738 hydrog ? ? A  U   2852 N3    ? ? ? 1_555 A  A   2904 N1    ? ? A U   2853 A A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2739 hydrog ? ? A  U   2852 O4    ? ? ? 1_555 A  A   2904 N6    ? ? A U   2853 A A   2905 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2740 hydrog ? ? A  A   2853 N1    ? ? ? 1_555 A  U   2903 N3    ? ? A A   2854 A U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2741 hydrog ? ? A  A   2853 N6    ? ? ? 1_555 A  U   2903 O4    ? ? A A   2854 A U   2904 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2742 hydrog ? ? A  G   2854 N1    ? ? ? 1_555 A  C   2902 N3    ? ? A G   2855 A C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2743 hydrog ? ? A  G   2854 N2    ? ? ? 1_555 A  C   2902 O2    ? ? A G   2855 A C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2744 hydrog ? ? A  G   2854 O6    ? ? ? 1_555 A  C   2902 N4    ? ? A G   2855 A C   2903 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2745 hydrog ? ? A  A   2855 N6    ? ? ? 1_555 A  C   2900 O2    ? ? A A   2856 A C   2901 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2746 hydrog ? ? A  C   2856 N3    ? ? ? 1_555 A  G   2899 N1    ? ? A C   2857 A G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2747 hydrog ? ? A  C   2856 N4    ? ? ? 1_555 A  G   2899 O6    ? ? A C   2857 A G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2748 hydrog ? ? A  C   2856 O2    ? ? ? 1_555 A  G   2899 N2    ? ? A C   2857 A G   2900 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2749 hydrog ? ? A  U   2857 N3    ? ? ? 1_555 A  A   2898 N1    ? ? A U   2858 A A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2750 hydrog ? ? A  U   2857 O4    ? ? ? 1_555 A  A   2898 N6    ? ? A U   2858 A A   2899 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2751 hydrog ? ? A  C   2858 N3    ? ? ? 1_555 A  G   2897 N1    ? ? A C   2859 A G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2752 hydrog ? ? A  C   2858 N4    ? ? ? 1_555 A  G   2897 O6    ? ? A C   2859 A G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2753 hydrog ? ? A  C   2858 O2    ? ? ? 1_555 A  G   2897 N2    ? ? A C   2859 A G   2898 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2754 hydrog ? ? A  G   2859 N1    ? ? ? 1_555 A  C   2896 N3    ? ? A G   2860 A C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2755 hydrog ? ? A  G   2859 N2    ? ? ? 1_555 A  C   2896 O2    ? ? A G   2860 A C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2756 hydrog ? ? A  G   2859 O6    ? ? ? 1_555 A  C   2896 N4    ? ? A G   2860 A C   2897 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2757 hydrog ? ? A  G   2860 N1    ? ? ? 1_555 A  C   2894 N3    ? ? A G   2861 A C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2758 hydrog ? ? A  G   2860 N2    ? ? ? 1_555 A  C   2894 O2    ? ? A G   2861 A C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2759 hydrog ? ? A  G   2860 O6    ? ? ? 1_555 A  C   2894 N4    ? ? A G   2861 A C   2895 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2760 hydrog ? ? A  G   2861 N1    ? ? ? 1_555 A  C   2893 N3    ? ? A G   2862 A C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2761 hydrog ? ? A  G   2861 N2    ? ? ? 1_555 A  C   2893 O2    ? ? A G   2862 A C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2762 hydrog ? ? A  G   2861 O6    ? ? ? 1_555 A  C   2893 N4    ? ? A G   2862 A C   2894 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2763 hydrog ? ? A  G   2862 N1    ? ? ? 1_555 A  C   2892 N3    ? ? A G   2863 A C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2764 hydrog ? ? A  G   2862 N2    ? ? ? 1_555 A  C   2892 O2    ? ? A G   2863 A C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2765 hydrog ? ? A  G   2862 O6    ? ? ? 1_555 A  C   2892 N4    ? ? A G   2863 A C   2893 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2766 hydrog ? ? A  U   2863 N3    ? ? ? 1_555 A  G   2891 O6    ? ? A U   2864 A G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2767 hydrog ? ? A  U   2863 O2    ? ? ? 1_555 A  G   2891 N1    ? ? A U   2864 A G   2892 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2768 hydrog ? ? A  G   2864 N2    ? ? ? 1_555 A  A   2890 N7    ? ? A G   2865 A A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2769 hydrog ? ? A  G   2864 N3    ? ? ? 1_555 A  A   2890 N6    ? ? A G   2865 A A   2891 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2770 hydrog ? ? A  C   2867 N4    ? ? ? 1_555 A  U   2888 O4    ? ? A C   2868 A U   2889 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2771 hydrog ? ? A  G   2868 N1    ? ? ? 1_555 A  U   2887 O2    ? ? A G   2869 A U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2772 hydrog ? ? A  G   2868 O6    ? ? ? 1_555 A  U   2887 N3    ? ? A G   2869 A U   2888 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2773 hydrog ? ? A  C   2869 N3    ? ? ? 1_555 A  G   2886 N1    ? ? A C   2870 A G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2774 hydrog ? ? A  C   2869 N4    ? ? ? 1_555 A  G   2886 O6    ? ? A C   2870 A G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2775 hydrog ? ? A  C   2869 O2    ? ? ? 1_555 A  G   2886 N2    ? ? A C   2870 A G   2887 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2776 hydrog ? ? A  G   2870 N1    ? ? ? 1_555 A  C   2885 N3    ? ? A G   2871 A C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2777 hydrog ? ? A  G   2870 N2    ? ? ? 1_555 A  C   2885 O2    ? ? A G   2871 A C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2778 hydrog ? ? A  G   2870 O6    ? ? ? 1_555 A  C   2885 N4    ? ? A G   2871 A C   2886 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2779 hydrog ? ? A  U   2871 N3    ? ? ? 1_555 A  A   2884 N1    ? ? A U   2872 A A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2780 hydrog ? ? A  U   2871 O4    ? ? ? 1_555 A  A   2884 N6    ? ? A U   2872 A A   2885 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2781 hydrog ? ? A  C   2872 O2    ? ? ? 1_555 A  G   2883 N2    ? ? A C   2873 A G   2884 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2782 hydrog ? ? A  G   2873 N2    ? ? ? 1_555 A  A   2882 N7    ? ? A G   2874 A A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2783 hydrog ? ? A  G   2873 N3    ? ? ? 1_555 A  A   2882 N6    ? ? A G   2874 A A   2883 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2784 hydrog ? ? A  A   2874 N6    ? ? ? 1_555 A  G   2881 N3    ? ? A A   2875 A G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2785 hydrog ? ? A  A   2874 N7    ? ? ? 1_555 A  G   2881 N2    ? ? A A   2875 A G   2882 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2786 hydrog ? ? A  G   2875 N1    ? ? ? 1_555 A  C   2880 N3    ? ? A G   2876 A C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2787 hydrog ? ? A  G   2875 N2    ? ? ? 1_555 A  C   2880 O2    ? ? A G   2876 A C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2788 hydrog ? ? A  G   2875 O6    ? ? ? 1_555 A  C   2880 N4    ? ? A G   2876 A C   2881 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2789 hydrog ? ? A  G   2876 N2    ? ? ? 1_555 A  A   2879 N7    ? ? A G   2877 A A   2880 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
hydrog2790 hydrog ? ? A  A   2901 N7    ? ? ? 1_555 A  A   2904 N6    ? ? A A   2902 A A   2905 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2791 hydrog ? ? B  A   3    N3    ? ? ? 1_555 B  G   21   N2    ? ? B A   3003 B G   3021 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2792 hydrog ? ? B  A   3    N6    ? ? ? 1_555 B  G   25   O6    ? ? B A   3003 B G   3025 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2793 hydrog ? ? B  G   4    N1    ? ? ? 1_555 B  C   119  N3    ? ? B G   3004 B C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2794 hydrog ? ? B  G   4    N2    ? ? ? 1_555 B  C   119  O2    ? ? B G   3004 B C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2795 hydrog ? ? B  G   4    O6    ? ? ? 1_555 B  C   119  N4    ? ? B G   3004 B C   3119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2796 hydrog ? ? B  G   5    N1    ? ? ? 1_555 B  C   118  N3    ? ? B G   3005 B C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2797 hydrog ? ? B  G   5    N2    ? ? ? 1_555 B  C   118  O2    ? ? B G   3005 B C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2798 hydrog ? ? B  G   5    O6    ? ? ? 1_555 B  C   118  N4    ? ? B G   3005 B C   3118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2799 hydrog ? ? B  C   6    N3    ? ? ? 1_555 B  G   117  N1    ? ? B C   3006 B G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2800 hydrog ? ? B  C   6    N4    ? ? ? 1_555 B  G   117  O6    ? ? B C   3006 B G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2801 hydrog ? ? B  C   6    O2    ? ? ? 1_555 B  G   117  N2    ? ? B C   3006 B G   3117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2802 hydrog ? ? B  G   7    N1    ? ? ? 1_555 B  C   116  N3    ? ? B G   3007 B C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2803 hydrog ? ? B  G   7    N2    ? ? ? 1_555 B  C   116  O2    ? ? B G   3007 B C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2804 hydrog ? ? B  G   7    O6    ? ? ? 1_555 B  C   116  N4    ? ? B G   3007 B C   3116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2805 hydrog ? ? B  G   8    N1    ? ? ? 1_555 B  C   115  N3    ? ? B G   3008 B C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2806 hydrog ? ? B  G   8    N2    ? ? ? 1_555 B  C   115  O2    ? ? B G   3008 B C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2807 hydrog ? ? B  G   8    O6    ? ? ? 1_555 B  C   115  N4    ? ? B G   3008 B C   3115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2808 hydrog ? ? B  C   9    N3    ? ? ? 1_555 B  G   114  N1    ? ? B C   3009 B G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2809 hydrog ? ? B  C   9    N4    ? ? ? 1_555 B  G   114  O6    ? ? B C   3009 B G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2810 hydrog ? ? B  C   9    O2    ? ? ? 1_555 B  G   114  N2    ? ? B C   3009 B G   3114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2811 hydrog ? ? B  A   11   N3    ? ? ? 1_555 B  G   68   N2    ? ? B A   3011 B G   3068 1_555 ? ? ? ? ? ? 'A-G MISPAIR' ? 
? 
hydrog2812 hydrog ? ? B  G   14   N1    ? ? ? 1_555 B  C   67   N3    ? ? B G   3014 B C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2813 hydrog ? ? B  G   14   N2    ? ? ? 1_555 B  C   67   O2    ? ? B G   3014 B C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2814 hydrog ? ? B  G   14   O6    ? ? ? 1_555 B  C   67   N4    ? ? B G   3014 B C   3067 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2815 hydrog ? ? B  C   15   N3    ? ? ? 1_555 B  G   66   N1    ? ? B C   3015 B G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2816 hydrog ? ? B  C   15   N4    ? ? ? 1_555 B  G   66   O6    ? ? B C   3015 B G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2817 hydrog ? ? B  C   15   O2    ? ? ? 1_555 B  G   66   N2    ? ? B C   3015 B G   3066 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2818 hydrog ? ? B  C   15   N4    ? ? ? 1_555 B  C   113  O2    ? ? B C   3015 B C   3113 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2819 hydrog ? ? B  G   16   N1    ? ? ? 1_555 B  C   64   N3    ? ? B G   3016 B C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2820 hydrog ? ? B  G   16   N2    ? ? ? 1_555 B  C   64   O2    ? ? B G   3016 B C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2821 hydrog ? ? B  G   16   O6    ? ? ? 1_555 B  C   64   N4    ? ? B G   3016 B C   3064 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2822 hydrog ? ? B  G   17   N1    ? ? ? 1_555 B  C   63   N3    ? ? B G   3017 B C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2823 hydrog ? ? B  G   17   N2    ? ? ? 1_555 B  C   63   O2    ? ? B G   3017 B C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2824 hydrog ? ? B  G   17   O6    ? ? ? 1_555 B  C   63   N4    ? ? B G   3017 B C   3063 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2825 hydrog ? ? B  U   18   N3    ? ? ? 1_555 B  A   62   N1    ? ? B U   3018 B A   3062 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2826 hydrog ? ? B  U   18   O4    ? ? ? 1_555 B  A   62   N6    ? ? B U   3018 B A   3062 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2827 hydrog ? ? B  G   19   N1    ? ? ? 1_555 B  C   61   N3    ? ? B G   3019 B C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2828 hydrog ? ? B  G   19   N2    ? ? ? 1_555 B  C   61   O2    ? ? B G   3019 B C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2829 hydrog ? ? B  G   19   O6    ? ? ? 1_555 B  C   61   N4    ? ? B G   3019 B C   3061 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2830 hydrog ? ? B  G   20   N1    ? ? ? 1_555 B  C   60   N3    ? ? B G   3020 B C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2831 hydrog ? ? B  G   20   N2    ? ? ? 1_555 B  C   60   O2    ? ? B G   3020 B C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2832 hydrog ? ? B  G   20   O6    ? ? ? 1_555 B  C   60   N4    ? ? B G   3020 B C   3060 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2833 hydrog ? ? B  G   21   N1    ? ? ? 1_555 B  C   59   N3    ? ? B G   3021 B C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2834 hydrog ? ? B  G   21   N2    ? ? ? 1_555 B  C   59   O2    ? ? B G   3021 B C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2835 hydrog ? ? B  G   21   O6    ? ? ? 1_555 B  C   59   N4    ? ? B G   3021 B C   3059 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2836 hydrog ? ? B  C   27   N4    ? ? ? 1_555 B  U   55   O4    ? ? B C   3027 B U   3055 1_555 ? ? ? ? ? ? 'C-U MISPAIR' ? 
? 
hydrog2837 hydrog ? ? B  C   27   O2    ? ? ? 1_555 B  G   58   N1    ? ? B C   3027 B G   3058 1_555 ? ? ? ? ? ? 'C-G PAIR' ?     
? 
hydrog2838 hydrog ? ? B  U   28   N3    ? ? ? 1_555 B  A   54   N1    ? ? B U   3028 B A   3054 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2839 hydrog ? ? B  U   28   O4    ? ? ? 1_555 B  A   54   N6    ? ? B U   3028 B A   3054 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2840 hydrog ? ? B  U   28   O2    ? ? ? 1_555 B  A   57   N6    ? ? B U   3028 B A   3057 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2841 hydrog ? ? B  C   29   N3    ? ? ? 1_555 B  G   53   N1    ? ? B C   3029 B G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2842 hydrog ? ? B  C   29   N4    ? ? ? 1_555 B  G   53   O6    ? ? B C   3029 B G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2843 hydrog ? ? B  C   29   O2    ? ? ? 1_555 B  G   53   N2    ? ? B C   3029 B G   3053 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2844 hydrog ? ? B  C   29   O2    ? ? ? 1_555 B  A   56   N6    ? ? B C   3029 B A   3056 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2845 hydrog ? ? B  C   30   N3    ? ? ? 1_555 B  G   50   N1    ? ? B C   3030 B G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2846 hydrog ? ? B  C   30   N4    ? ? ? 1_555 B  G   50   O6    ? ? B C   3030 B G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2847 hydrog ? ? B  C   30   O2    ? ? ? 1_555 B  G   50   N2    ? ? B C   3030 B G   3050 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2848 hydrog ? ? B  C   30   O2    ? ? ? 1_555 B  A   52   N6    ? ? B C   3030 B A   3052 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2849 hydrog ? ? B  C   31   N3    ? ? ? 1_555 B  G   49   N1    ? ? B C   3031 B G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2850 hydrog ? ? B  C   31   N4    ? ? ? 1_555 B  G   49   O6    ? ? B C   3031 B G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2851 hydrog ? ? B  C   31   O2    ? ? ? 1_555 B  G   49   N2    ? ? B C   3031 B G   3049 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2852 hydrog ? ? B  G   32   N1    ? ? ? 1_555 B  C   48   N3    ? ? B G   3032 B C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2853 hydrog ? ? B  G   32   N2    ? ? ? 1_555 B  C   48   O2    ? ? B G   3032 B C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2854 hydrog ? ? B  G   32   O6    ? ? ? 1_555 B  C   48   N4    ? ? B G   3032 B C   3048 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2855 hydrog ? ? B  U   33   O2    ? ? ? 1_555 B  C   35   N4    ? ? B U   3033 B C   3035 1_555 ? ? ? ? ? ? 'U-C MISPAIR' ? 
? 
hydrog2856 hydrog ? ? B  U   33   N3    ? ? ? 1_555 B  A   47   N1    ? ? B U   3033 B A   3047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2857 hydrog ? ? B  U   33   O4    ? ? ? 1_555 B  A   47   N6    ? ? B U   3033 B A   3047 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2858 hydrog ? ? B  C   35   N4    ? ? ? 1_555 B  C   48   O2    ? ? B C   3035 B C   3048 1_555 ? ? ? ? ? ? 'C-C MISPAIR' ? 
? 
hydrog2859 hydrog ? ? B  C   36   N4    ? ? ? 1_555 B  A   47   N3    ? ? B C   3036 B A   3047 1_555 ? ? ? ? ? ? 'C-A MISPAIR' ? 
? 
hydrog2860 hydrog ? ? B  C   37   N3    ? ? ? 1_555 B  G   43   N1    ? ? B C   3037 B G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2861 hydrog ? ? B  C   37   N4    ? ? ? 1_555 B  G   43   O6    ? ? B C   3037 B G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2862 hydrog ? ? B  C   37   O2    ? ? ? 1_555 B  G   43   N2    ? ? B C   3037 B G   3043 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2863 hydrog ? ? B  A   38   N3    ? ? ? 1_555 B  A   45   N6    ? ? B A   3038 B A   3045 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2864 hydrog ? ? B  U   39   O2    ? ? ? 1_555 B  A   44   N6    ? ? B U   3039 B A   3044 1_555 ? ? ? ? ? ? 'U-A PAIR' ?     
? 
hydrog2865 hydrog ? ? B  G   43   N2    ? ? ? 1_555 B  C   46   O2    ? ? B G   3043 B C   3046 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2866 hydrog ? ? B  A   51   N3    ? ? ? 1_555 B  A   52   N6    ? ? B A   3051 B A   3052 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2867 hydrog ? ? B  A   54   N3    ? ? ? 1_555 B  A   56   N6    ? ? B A   3054 B A   3056 1_555 ? ? ? ? ? ? 'A-A MISPAIR' ? 
? 
hydrog2868 hydrog ? ? B  A   65   N3    ? ? ? 1_555 B  C   67   N4    ? ? B A   3065 B C   3067 1_555 ? ? ? ? ? ? 'A-C MISPAIR' ? 
? 
hydrog2869 hydrog ? ? B  G   66   O6    ? ? ? 1_555 B  C   113  N4    ? ? B G   3066 B C   3113 1_555 ? ? ? ? ? ? 'G-C PAIR' ?     
? 
hydrog2870 hydrog ? ? B  U   69   N3    ? ? ? 1_555 B  U   112  O2    ? ? B U   3069 B U   3112 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2871 hydrog ? ? B  U   69   O4    ? ? ? 1_555 B  U   112  N3    ? ? B U   3069 B U   3112 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2872 hydrog ? ? B  U   70   N3    ? ? ? 1_555 B  U   111  O2    ? ? B U   3070 B U   3111 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2873 hydrog ? ? B  U   70   O4    ? ? ? 1_555 B  U   111  N3    ? ? B U   3070 B U   3111 1_555 ? ? ? ? ? ? TYPE_16_PAIR ? ? 
hydrog2874 hydrog ? ? B  C   71   N3    ? ? ? 1_555 B  G   110  N1    ? ? B C   3071 B G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2875 hydrog ? ? B  C   71   N4    ? ? ? 1_555 B  G   110  O6    ? ? B C   3071 B G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2876 hydrog ? ? B  C   71   O2    ? ? ? 1_555 B  G   110  N2    ? ? B C   3071 B G   3110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2877 hydrog ? ? B  C   72   N3    ? ? ? 1_555 B  G   109  N1    ? ? B C   3072 B G   3109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2878 hydrog ? ? B  C   72   N4    ? ? ? 1_555 B  G   109  O6    ? ? B C   3072 B G   3109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2879 hydrog ? ? B  C   72   O2    ? ? ? 1_555 B  G   109  N2    ? ? B C   3072 B G   3109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2880 hydrog ? ? B  G   73   N1    ? ? ? 1_555 B  C   108  N3    ? ? B G   3073 B C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2881 hydrog ? ? B  G   73   N2    ? ? ? 1_555 B  C   108  O2    ? ? B G   3073 B C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2882 hydrog ? ? B  G   73   O6    ? ? ? 1_555 B  C   108  N4    ? ? B G   3073 B C   3108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2883 hydrog ? ? B  G   74   N1    ? ? ? 1_555 B  C   107  N3    ? ? B G   3074 B C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2884 hydrog ? ? B  G   74   N2    ? ? ? 1_555 B  C   107  O2    ? ? B G   3074 B C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2885 hydrog ? ? B  G   74   O6    ? ? ? 1_555 B  C   107  N4    ? ? B G   3074 B C   3107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2886 hydrog ? ? B  G   75   N1    ? ? ? 1_555 B  C   106  N3    ? ? B G   3075 B C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2887 hydrog ? ? B  G   75   N2    ? ? ? 1_555 B  C   106  O2    ? ? B G   3075 B C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2888 hydrog ? ? B  G   75   O6    ? ? ? 1_555 B  C   106  N4    ? ? B G   3075 B C   3106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2889 hydrog ? ? B  G   76   N2    ? ? ? 1_555 B  A   105  N7    ? ? B G   3076 B A   3105 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2890 hydrog ? ? B  G   76   N3    ? ? ? 1_555 B  A   105  N6    ? ? B G   3076 B A   3105 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2891 hydrog ? ? B  A   77   N6    ? ? ? 1_555 B  A   104  N7    ? ? B A   3077 B A   3104 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2892 hydrog ? ? B  A   77   N7    ? ? ? 1_555 B  A   104  N6    ? ? B A   3077 B A   3104 1_555 ? ? ? ? ? ? TYPE_2_PAIR ? ? 
hydrog2893 hydrog ? ? B  G   78   N2    ? ? ? 1_555 B  U   79   O4    ? ? B G   3078 B U   3079 1_555 ? ? ? ? ? ? 'G-U MISPAIR' ? 
? 
hydrog2894 hydrog ? ? B  U   79   N3    ? ? ? 1_555 B  A   103  N7    ? ? B U   3079 B A   3103 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2895 hydrog ? ? B  U   79   O2    ? ? ? 1_555 B  A   103  N6    ? ? B U   3079 B A   3103 1_555 ? ? ? ? ? ? 
'REVERSED HOOGSTEEN'    ?     ? 
hydrog2896 hydrog ? ? B  A   80   N6    ? ? ? 1_555 B  G   102  N3    ? ? B A   3080 B G   3102 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2897 hydrog ? ? B  A   80   N7    ? ? ? 1_555 B  G   102  N2    ? ? B A   3080 B G   3102 1_555 ? ? ? ? ? ? TYPE_11_PAIR ? ? 
hydrog2898 hydrog ? ? B  C   81   N3    ? ? ? 1_555 B  G   101  N1    ? ? B C   3081 B G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2899 hydrog ? ? B  C   81   N4    ? ? ? 1_555 B  G   101  O6    ? ? B C   3081 B G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2900 hydrog ? ? B  C   81   O2    ? ? ? 1_555 B  G   101  N2    ? ? B C   3081 B G   3101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2901 hydrog ? ? B  U   82   N3    ? ? ? 1_555 B  G   100  O6    ? ? B U   3082 B G   3100 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2902 hydrog ? ? B  U   82   O2    ? ? ? 1_555 B  G   100  N1    ? ? B U   3082 B G   3100 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2903 hydrog ? ? B  G   83   N1    ? ? ? 1_555 B  U   99   O2    ? ? B G   3083 B U   3099 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2904 hydrog ? ? B  G   83   O6    ? ? ? 1_555 B  U   99   N3    ? ? B G   3083 B U   3099 1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog2905 hydrog ? ? B  G   84   N1    ? ? ? 1_555 B  C   98   N3    ? ? B G   3084 B C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2906 hydrog ? ? B  G   84   N2    ? ? ? 1_555 B  C   98   O2    ? ? B G   3084 B C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2907 hydrog ? ? B  G   84   O6    ? ? ? 1_555 B  C   98   N4    ? ? B G   3084 B C   3098 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2908 hydrog ? ? B  A   85   N1    ? ? ? 1_555 B  U   97   N3    ? ? B A   3085 B U   3097 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2909 hydrog ? ? B  A   85   N6    ? ? ? 1_555 B  U   97   O4    ? ? B A   3085 B U   3097 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2910 hydrog ? ? B  G   86   N1    ? ? ? 1_555 B  C   96   N3    ? ? B G   3086 B C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2911 hydrog ? ? B  G   86   N2    ? ? ? 1_555 B  C   96   O2    ? ? B G   3086 B C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2912 hydrog ? ? B  G   86   O6    ? ? ? 1_555 B  C   96   N4    ? ? B G   3086 B C   3096 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2913 hydrog ? ? B  G   88   N1    ? ? ? 1_555 B  C   95   N3    ? ? B G   3088 B C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2914 hydrog ? ? B  G   88   N2    ? ? ? 1_555 B  C   95   O2    ? ? B G   3088 B C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2915 hydrog ? ? B  G   88   O6    ? ? ? 1_555 B  C   95   N4    ? ? B G   3088 B C   3095 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2916 hydrog ? ? B  C   89   N3    ? ? ? 1_555 B  G   94   N1    ? ? B C   3089 B G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2917 hydrog ? ? B  C   89   N4    ? ? ? 1_555 B  G   94   O6    ? ? B C   3089 B G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2918 hydrog ? ? B  C   89   O2    ? ? ? 1_555 B  G   94   N2    ? ? B C   3089 B G   3094 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2919 hydrog ? ? B  G   90   N2    ? ? ? 1_555 B  A   93   N7    ? ? B G   3090 B A   3093 1_555 ? ? ? ? ? ? 'G-A MISPAIR' ? 
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TRP 186 C . ? TRP 186 C PRO 187 C ? PRO 187 C 1 4.80  
2 GLY 14  D . ? GLY 14  D PRO 15  D ? PRO 15  D 1 -0.27 
3 ASN 243 D . ? ASN 243 D PRO 244 D ? PRO 244 D 1 4.42  
4 VAL 136 E . ? VAL 136 E PRO 137 E ? PRO 137 E 1 0.67  
5 GLN 55  H . ? GLN 55  H PRO 56  H ? PRO 56  H 1 1.81  
6 ARG 184 N . ? ARG 184 N PRO 185 N ? PRO 185 N 1 -2.87 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 6 ? 
C  ? 2 ? 
D  ? 5 ? 
E  ? 5 ? 
F  ? 8 ? 
G  ? 2 ? 
H  ? 6 ? 
I  ? 3 ? 
J  ? 2 ? 
K  ? 5 ? 
L  ? 3 ? 
M  ? 3 ? 
N  ? 4 ? 
O  ? 3 ? 
P  ? 4 ? 
Q  ? 5 ? 
R  ? 3 ? 
S  ? 3 ? 
T  ? 2 ? 
U  ? 5 ? 
V  ? 2 ? 
W  ? 6 ? 
X  ? 2 ? 
Y  ? 3 ? 
Z  ? 3 ? 
AA ? 4 ? 
AB ? 4 ? 
AC ? 4 ? 
AD ? 3 ? 
AE ? 2 ? 
AF ? 5 ? 
AG ? 3 ? 
AH ? 2 ? 
AI ? 2 ? 
AJ ? 4 ? 
AK ? 6 ? 
AL ? 2 ? 
AM ? 5 ? 
AN ? 4 ? 
AO ? 2 ? 
AP ? 2 ? 
AQ ? 3 ? 
AR ? 2 ? 
AS ? 2 ? 
AT ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? anti-parallel 
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
C  1 2 ? parallel      
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
D  4 5 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? anti-parallel 
E  4 5 ? anti-parallel 
F  1 2 ? anti-parallel 
F  2 3 ? anti-parallel 
F  3 4 ? anti-parallel 
F  4 5 ? anti-parallel 
F  5 6 ? anti-parallel 
F  6 7 ? anti-parallel 
F  7 8 ? anti-parallel 
G  1 2 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? parallel      
H  3 4 ? parallel      
H  4 5 ? parallel      
H  5 6 ? parallel      
I  1 2 ? anti-parallel 
I  2 3 ? anti-parallel 
J  1 2 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? anti-parallel 
K  4 5 ? anti-parallel 
L  1 2 ? anti-parallel 
L  2 3 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? anti-parallel 
O  1 2 ? anti-parallel 
O  2 3 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? parallel      
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? anti-parallel 
Q  4 5 ? anti-parallel 
R  1 2 ? anti-parallel 
R  2 3 ? anti-parallel 
S  1 2 ? parallel      
S  2 3 ? parallel      
T  1 2 ? anti-parallel 
U  1 2 ? anti-parallel 
U  2 3 ? anti-parallel 
U  3 4 ? parallel      
U  4 5 ? anti-parallel 
V  1 2 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? anti-parallel 
W  4 5 ? anti-parallel 
W  5 6 ? parallel      
X  1 2 ? parallel      
Y  1 2 ? parallel      
Y  2 3 ? parallel      
Z  1 2 ? parallel      
Z  2 3 ? parallel      
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? parallel      
AC 1 2 ? parallel      
AC 2 3 ? parallel      
AC 3 4 ? parallel      
AD 1 2 ? parallel      
AD 2 3 ? parallel      
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? anti-parallel 
AF 4 5 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? parallel      
AK 3 4 ? anti-parallel 
AK 4 5 ? anti-parallel 
AK 5 6 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AM 3 4 ? anti-parallel 
AM 4 5 ? parallel      
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? parallel      
AO 1 2 ? anti-parallel 
AP 1 2 ? parallel      
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AR 1 2 ? anti-parallel 
AS 1 2 ? parallel      
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 ARG C  65  ? ILE C  68  ? ARG C 65  ILE C 68  
A  2 PRO C  54  ? PHE C  60  ? PRO C 54  PHE C 60  
A  3 ALA C  39  ? HIS C  47  ? ALA C 39  HIS C 47  
A  4 GLU C  79  ? GLN C  81  ? GLU C 79  GLN C 81  
B  1 THR C  93  ? PRO C  95  ? THR C 93  PRO C 95  
B  2 ARG C  153 ? ILE C  156 ? ARG C 153 ILE C 156 
B  3 PRO C  104 ? CYS C  106 ? PRO C 104 CYS C 106 
B  4 ALA C  126 ? THR C  130 ? ALA C 126 THR C 130 
B  5 ALA C  136 ? LYS C  139 ? ALA C 136 LYS C 139 
B  6 MET C  145 ? LEU C  148 ? MET C 145 LEU C 148 
C  1 SER C  214 ? ILE C  215 ? SER C 214 ILE C 215 
C  2 ASP C  227 ? ILE C  228 ? ASP C 227 ILE C 228 
D  1 GLY D  37  ? VAL D  38  ? GLY D 37  VAL D 38  
D  2 VAL D  161 ? GLY D  167 ? VAL D 161 GLY D 167 
D  3 LEU D  137 ? HIS D  145 ? LEU D 137 HIS D 145 
D  4 MET D  79  ? THR D  90  ? MET D 79  THR D 90  
D  5 GLY D  93  ? TRP D  101 ? GLY D 93  TRP D 101 
E  1 GLY D  37  ? VAL D  38  ? GLY D 37  VAL D 38  
E  2 VAL D  161 ? GLY D  167 ? VAL D 161 GLY D 167 
E  3 LEU D  137 ? HIS D  145 ? LEU D 137 HIS D 145 
E  4 MET D  79  ? THR D  90  ? MET D 79  THR D 90  
E  5 GLU D  187 ? HIS D  188 ? GLU D 187 HIS D 188 
F  1 VAL D  327 ? VAL D  330 ? VAL D 327 VAL D 330 
F  2 PHE D  41  ? LEU D  53  ? PHE D 41  LEU D 53  
F  3 LEU D  308 ? PRO D  313 ? LEU D 308 PRO D 313 
F  4 TYR D  199 ? VAL D  205 ? TYR D 199 VAL D 205 
F  5 GLN D  261 ? GLY D  275 ? GLN D 261 GLY D 275 
F  6 GLY D  292 ? LYS D  298 ? GLY D 292 LYS D 298 
F  7 THR D  68  ? GLU D  75  ? THR D 68  GLU D 75  
F  8 PHE D  41  ? LEU D  53  ? PHE D 41  LEU D 53  
G  1 THR D  211 ? GLN D  212 ? THR D 211 GLN D 212 
G  2 GLY D  255 ? GLN D  256 ? GLY D 255 GLN D 256 
H  1 THR E  12  ? ASP E  17  ? THR E 12  ASP E 17  
H  2 GLN E  2   ? TYR E  6   ? GLN E 2   TYR E 6   
H  3 VAL E  138 ? VAL E  140 ? VAL E 138 VAL E 140 
H  4 THR E  233 ? THR E  236 ? THR E 233 THR E 236 
H  5 LEU E  193 ? THR E  196 ? LEU E 193 THR E 196 
H  6 ASP E  211 ? THR E  214 ? ASP E 211 THR E 214 
I  1 GLU E  59  ? SER E  60  ? GLU E 59  SER E 60  
I  2 PRO E  71  ? LEU E  73  ? PRO E 71  LEU E 73  
I  3 ARG E  76  ? ALA E  77  ? ARG E 76  ALA E 77  
J  1 LYS E  173 ? ILE E  174 ? LYS E 173 ILE E 174 
J  2 TYR E  186 ? ARG E  187 ? TYR E 186 ARG E 187 
K  1 VAL F  50  ? ARG F  51  ? VAL F 50  ARG F 51  
K  2 ALA F  71  ? LEU F  75  ? ALA F 71  LEU F 75  
K  3 ARG F  17  ? MET F  25  ? ARG F 17  MET F 25  
K  4 ASP F  129 ? VAL F  135 ? ASP F 129 VAL F 135 
K  5 PHE F  104 ? PHE F  106 ? PHE F 104 PHE F 106 
L  1 ARG G  2   ? GLU G  6   ? ARG G 2   GLU G 6   
L  2 THR G  46  ? SER G  51  ? THR G 46  SER G 51  
L  3 ILE G  38  ? ASP G  43  ? ILE G 38  ASP G 43  
M  1 ASP G  12  ? ASP G  16  ? ASP G 12  ASP G 16  
M  2 ASP G  19  ? GLY G  24  ? ASP G 19  GLY G 24  
M  3 GLY G  27  ? ARG G  32  ? GLY G 27  ARG G 32  
N  1 ASP G  123 ? ASP G  127 ? ASP G 123 ASP G 127 
N  2 GLU G  130 ? GLY G  135 ? GLU G 130 GLY G 135 
N  3 TRP G  80  ? PHE G  87  ? TRP G 80  PHE G 87  
N  4 GLY G  165 ? ARG G  170 ? GLY G 165 ARG G 170 
O  1 GLN G  94  ? VAL G  97  ? GLN G 94  VAL G 97  
O  2 GLU G  101 ? GLU G  105 ? GLU G 101 GLU G 105 
O  3 ARG G  114 ? THR G  117 ? ARG G 114 THR G 117 
P  1 VAL H  29  ? LYS H  31  ? VAL H 29  LYS H 31  
P  2 ALA H  95  ? VAL H  98  ? ALA H 95  VAL H 98  
P  3 VAL H  48  ? ALA H  51  ? VAL H 48  ALA H 51  
P  4 PHE H  74  ? VAL H  77  ? PHE H 74  VAL H 77  
Q  1 ASP J  32  ? GLY J  34  ? ASP J 32  GLY J 34  
Q  2 LYS J  82  ? ILE J  85  ? LYS J 82  ILE J 85  
Q  3 HIS J  130 ? VAL J  136 ? HIS J 130 VAL J 136 
Q  4 ALA J  44  ? VAL J  50  ? ALA J 44  VAL J 50  
Q  5 ILE J  157 ? SER J  161 ? ILE J 157 SER J 161 
R  1 VAL J  54  ? ARG J  57  ? VAL J 54  ARG J 57  
R  2 LYS J  117 ? VAL J  125 ? LYS J 117 VAL J 125 
R  3 HIS J  91  ? GLU J  95  ? HIS J 91  GLU J 95  
S  1 VAL K  10  ? ASP K  13  ? VAL K 10  ASP K 13  
S  2 VAL K  36  ? VAL K  39  ? VAL K 36  VAL K 39  
S  3 VAL K  101 ? VAL K  103 ? VAL K 101 VAL K 103 
T  1 VAL K  45  ? THR K  47  ? VAL K 45  THR K 47  
T  2 PHE K  129 ? THR K  131 ? PHE K 129 THR K 131 
U  1 ASP L  7   ? VAL L  8   ? ASP L 7   VAL L 8   
U  2 ILE L  80  ? ARG L  81  ? ILE L 80  ARG L 81  
U  3 ARG L  87  ? PHE L  90  ? ARG L 87  PHE L 90  
U  4 THR V  19  ? VAL V  22  ? THR V 19  VAL V 22  
U  5 THR V  28  ? PHE V  31  ? THR V 28  PHE V 31  
V  1 LEU L  12  ? GLU L  13  ? LEU L 12  GLU L 13  
V  2 LYS L  46  ? ALA L  47  ? LYS L 46  ALA L 47  
W  1 LEU L  17  ? CYS L  20  ? LEU L 17  CYS L 20  
W  2 ALA L  26  ? VAL L  34  ? ALA L 26  VAL L 34  
W  3 LYS L  52  ? GLY L  60  ? LYS L 52  GLY L 60  
W  4 VAL L  68  ? ARG L  75  ? VAL L 68  ARG L 75  
W  5 ALA L  94  ? VAL L  98  ? ALA L 94  VAL L 98  
W  6 LEU L  17  ? CYS L  20  ? LEU L 17  CYS L 20  
X  1 PRO L  112 ? ALA L  114 ? PRO L 112 ALA L 114 
X  2 MET L  130 ? VAL L  132 ? MET L 130 VAL L 132 
Y  1 ALA M  61  ? ASP M  65  ? ALA M 61  ASP M 65  
Y  2 TYR M  105 ? LEU M  109 ? TYR M 105 LEU M 109 
Y  3 ASP M  124 ? PHE M  125 ? ASP M 124 PHE M 125 
Z  1 ARG M  90  ? ASP M  92  ? ARG M 90  ASP M 92  
Z  2 THR M  119 ? ALA M  122 ? THR M 119 ALA M 122 
Z  3 SER M  139 ? LEU M  142 ? SER M 139 LEU M 142 
AA 1 VAL N  37  ? ARG N  39  ? VAL N 37  ARG N 39  
AA 2 ILE N  60  ? ARG N  68  ? ILE N 60  ARG N 68  
AA 3 HIS N  126 ? ILE N  134 ? HIS N 126 ILE N 134 
AA 4 ARG N  113 ? GLU N  122 ? ARG N 113 GLU N 122 
AB 1 ASP O  56  ? HIS O  62  ? ASP O 56  HIS O 62  
AB 2 VAL O  43  ? THR O  49  ? VAL O 43  THR O 49  
AB 3 ARG O  33  ? LYS O  38  ? ARG O 33  LYS O 38  
AB 4 VAL O  101 ? ASP O  103 ? VAL O 101 ASP O 103 
AC 1 ALA P  41  ? ASN P  44  ? ALA P 41  ASN P 44  
AC 2 THR P  57  ? LEU P  65  ? THR P 57  LEU P 65  
AC 3 THR P  75  ? PHE P  81  ? THR P 75  PHE P 81  
AC 4 GLU P  94  ? SER P  97  ? GLU P 94  SER P 97  
AD 1 ALA P  41  ? ASN P  44  ? ALA P 41  ASN P 44  
AD 2 THR P  57  ? LEU P  65  ? THR P 57  LEU P 65  
AD 3 VAL P  111 ? VAL P  113 ? VAL P 111 VAL P 113 
AE 1 VAL Q  21  ? PHE Q  23  ? VAL Q 21  PHE Q 23  
AE 2 ILE Q  49  ? ALA Q  51  ? ILE Q 49  ALA Q 51  
AF 1 LYS R  80  ? VAL R  86  ? LYS R 80  VAL R 86  
AF 2 ALA R  70  ? ASP R  77  ? ALA R 70  ASP R 77  
AF 3 THR R  60  ? GLN R  67  ? THR R 60  GLN R 67  
AF 4 LYS R  38  ? LEU R  41  ? LYS R 38  LEU R 41  
AF 5 LEU R  91  ? ARG R  93  ? LEU R 91  ARG R 93  
AG 1 THR S  13  ? ARG S  21  ? THR S 13  ARG S 21  
AG 2 SER S  138 ? GLU S  148 ? SER S 138 GLU S 148 
AG 3 THR S  110 ? GLN S  122 ? THR S 110 GLN S 122 
AH 1 VAL S  57  ? PRO S  58  ? VAL S 57  PRO S 58  
AH 2 GLY S  78  ? ARG S  79  ? GLY S 78  ARG S 79  
AI 1 ARG S  125 ? PRO S  127 ? ARG S 125 PRO S 127 
AI 2 ALA S  133 ? ALA S  135 ? ALA S 133 ALA S 135 
AJ 1 ILE T  5   ? PRO T  8   ? ILE T 5   PRO T 8   
AJ 2 LYS T  23  ? VAL T  28  ? LYS T 23  VAL T 28  
AJ 3 LYS T  62  ? LEU T  68  ? LYS T 62  LEU T 68  
AJ 4 VAL T  49  ? ASN T  56  ? VAL T 49  ASN T 56  
AK 1 ASN U  39  ? ARG U  41  ? ASN U 39  ARG U 41  
AK 2 ARG U  24  ? LEU U  27  ? ARG U 24  LEU U 27  
AK 3 VAL U  96  ? ASP U  100 ? VAL U 96  ASP U 100 
AK 4 THR U  47  ? VAL U  50  ? THR U 47  VAL U 50  
AK 5 GLU U  59  ? ASP U  66  ? GLU U 59  ASP U 66  
AK 6 VAL U  71  ? VAL U  74  ? VAL U 71  VAL U 74  
AL 1 THR U  78  ? GLU U  80  ? THR U 78  GLU U 80  
AL 2 GLU U  86  ? PRO U  88  ? GLU U 86  PRO U 88  
AM 1 LEU X  116 ? ARG X  117 ? LEU X 116 ARG X 117 
AM 2 HIS X  31  ? VAL X  35  ? HIS X 31  VAL X 35  
AM 3 HIS X  2   ? GLN X  6   ? HIS X 2   GLN X 6   
AM 4 VAL X  52  ? GLY X  55  ? VAL X 52  GLY X 55  
AM 5 GLY X  139 ? LYS X  140 ? GLY X 139 LYS X 140 
AN 1 ARG Y  8   ? PRO Y  13  ? ARG Y 8   PRO Y 13  
AN 2 LYS Y  69  ? PHE Y  77  ? LYS Y 69  PHE Y 77  
AN 3 GLU Y  82  ? GLU Y  86  ? GLU Y 82  GLU Y 86  
AN 4 VAL Y  48  ? LEU Y  50  ? VAL Y 48  LEU Y 50  
AO 1 GLU Z  96  ? ALA Z  99  ? GLU Z 96  ALA Z 99  
AO 2 TYR Z  233 ? VAL Z  236 ? TYR Z 233 VAL Z 236 
AP 1 GLU Z  183 ? VAL Z  187 ? GLU Z 183 VAL Z 187 
AP 2 GLU Z  201 ? ILE Z  205 ? GLU Z 201 ILE Z 205 
AQ 1 LEU AA 38  ? GLY AA 42  ? LEU 1 47  GLY 1 51  
AQ 2 ILE AA 45  ? CYS AA 48  ? ILE 1 54  CYS 1 57  
AQ 3 LYS AA 54  ? ALA AA 56  ? LYS 1 63  ALA 1 65  
AR 1 HIS BA 16  ? LYS BA 18  ? HIS 2 16  LYS 2 18  
AR 2 LYS BA 25  ? HIS BA 28  ? LYS 2 25  HIS 2 28  
AS 1 GLN DA 2   ? PRO DA 4   ? GLN 4 2   PRO 4 4   
AS 2 GLU DA 89  ? GLN DA 91  ? GLU 4 89  GLN 4 91  
AT 1 ARG DA 6   ? CYS DA 11  ? ARG 4 6   CYS 4 11  
AT 2 GLU DA 16  ? LYS DA 24  ? GLU 4 16  LYS 4 24  
AT 3 LEU DA 67  ? CYS DA 71  ? LEU 4 67  CYS 4 71  
AT 4 ALA DA 77  ? HIS DA 78  ? ALA 4 77  HIS 4 78  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 O ILE C  68  ? O ILE C 68  N ALA C  56  ? N ALA C 56  
A  2 3 O VAL C  55  ? O VAL C 55  N GLU C  46  ? N GLU C 46  
A  3 4 N GLY C  40  ? N GLY C 40  O LEU C  80  ? O LEU C 80  
B  1 2 N LEU C  94  ? N LEU C 94  O ALA C  154 ? O ALA C 154 
B  2 3 O THR C  155 ? O THR C 155 N CYS C  106 ? N CYS C 106 
B  3 4 N VAL C  105 ? N VAL C 105 O ALA C  126 ? O ALA C 126 
B  4 5 N GLN C  127 ? N GLN C 127 O LYS C  139 ? O LYS C 139 
B  5 6 N ALA C  136 ? N ALA C 136 O LEU C  148 ? O LEU C 148 
C  1 2 N ILE C  215 ? N ILE C 215 O ASP C  227 ? O ASP C 227 
D  1 2 N GLY D  37  ? N GLY D 37  O GLY D  167 ? O GLY D 167 
D  2 3 O MET D  162 ? O MET D 162 N THR D  144 ? N THR D 144 
D  3 4 O GLY D  138 ? O GLY D 138 N TYR D  87  ? N TYR D 87  
D  4 5 N ALA D  86  ? N ALA D 86  O LEU D  97  ? O LEU D 97  
E  1 2 N GLY D  37  ? N GLY D 37  O GLY D  167 ? O GLY D 167 
E  2 3 O MET D  162 ? O MET D 162 N THR D  144 ? N THR D 144 
E  3 4 O GLY D  138 ? O GLY D 138 N TYR D  87  ? N TYR D 87  
E  4 5 N MET D  79  ? N MET D 79  O HIS D  188 ? O HIS D 188 
F  1 2 O TYR D  329 ? O TYR D 329 N VAL D  52  ? N VAL D 52  
F  2 3 N PHE D  41  ? N PHE D 41  O PHE D  311 ? O PHE D 311 
F  3 4 O ARG D  312 ? O ARG D 312 N ASP D  201 ? N ASP D 201 
F  4 5 N ALA D  200 ? N ALA D 200 O LYS D  267 ? O LYS D 267 
F  5 6 N ASP D  271 ? N ASP D 271 O LEU D  296 ? O LEU D 296 
F  6 7 O VAL D  297 ? O VAL D 297 N THR D  72  ? N THR D 72  
F  7 8 O VAL D  73  ? O VAL D 73  N GLY D  47  ? N GLY D 47  
G  1 2 N GLN D  212 ? N GLN D 212 O GLY D  255 ? O GLY D 255 
H  1 2 O VAL E  16  ? O VAL E 16  N ALA E  3   ? N ALA E 3   
H  2 3 N TYR E  6   ? N TYR E 6   O VAL E  139 ? O VAL E 139 
H  3 4 N VAL E  138 ? N VAL E 138 O THR E  233 ? O THR E 233 
H  4 5 O VAL E  234 ? O VAL E 234 N LEU E  193 ? N LEU E 193 
H  5 6 N THR E  196 ? N THR E 196 O ALA E  213 ? O ALA E 213 
I  1 2 N GLU E  59  ? N GLU E 59  O LYS E  72  ? O LYS E 72  
I  2 3 N LEU E  73  ? N LEU E 73  O ARG E  76  ? O ARG E 76  
J  1 2 N LYS E  173 ? N LYS E 173 O ARG E  187 ? O ARG E 187 
K  1 2 N VAL F  50  ? N VAL F 50  O LYS F  72  ? O LYS F 72  
K  2 3 O VAL F  73  ? O VAL F 73  N VAL F  23  ? N VAL F 23  
K  3 4 N VAL F  22  ? N VAL F 22  O THR F  131 ? O THR F 131 
K  4 5 O VAL F  130 ? O VAL F 130 N PHE F  106 ? N PHE F 106 
L  1 2 N VAL G  3   ? N VAL G 3   O ILE G  49  ? O ILE G 49  
L  2 3 O VAL G  48  ? O VAL G 48  N SER G  41  ? N SER G 41  
M  1 2 N GLU G  14  ? N GLU G 14  O THR G  21  ? O THR G 21  
M  2 3 N GLY G  24  ? N GLY G 24  O GLY G  27  ? O GLY G 27  
N  1 2 N ASP G  123 ? N ASP G 123 O SER G  134 ? O SER G 134 
N  2 3 O VAL G  133 ? O VAL G 133 N TYR G  82  ? N TYR G 82  
N  3 4 N GLY G  83  ? N GLY G 83  O THR G  169 ? O THR G 169 
O  1 2 N ASN G  96  ? N ASN G 96  O VAL G  103 ? O VAL G 103 
O  2 3 N ILE G  104 ? N ILE G 104 O ARG G  114 ? O ARG G 114 
P  1 2 N LYS H  30  ? N LYS H 30  O ALA H  97  ? O ALA H 97  
P  2 3 O ALA H  96  ? O ALA H 96  N PHE H  49  ? N PHE H 49  
P  3 4 N VAL H  48  ? N VAL H 48  O ILE H  75  ? O ILE H 75  
Q  1 2 N MET J  33  ? N MET J 33  O PHE J  83  ? O PHE J 83  
Q  2 3 N ARG J  84  ? N ARG J 84  O ILE J  133 ? O ILE J 133 
Q  3 4 O PHE J  132 ? O PHE J 132 N LEU J  48  ? N LEU J 48  
Q  4 5 N GLU J  47  ? N GLU J 47  O ASP J  160 ? O ASP J 160 
R  1 2 N VAL J  54  ? N VAL J 54  O VAL J  125 ? O VAL J 125 
R  2 3 O GLY J  120 ? O GLY J 120 N ILE J  93  ? N ILE J 93  
S  1 2 N VAL K  12  ? N VAL K 12  O VAL K  39  ? O VAL K 39  
S  2 3 N VAL K  38  ? N VAL K 38  O ARG K  102 ? O ARG K 102 
T  1 2 N ILE K  46  ? N ILE K 46  O VAL K  130 ? O VAL K 130 
U  1 2 N ASP L  7   ? N ASP L 7   O ARG L  81  ? O ARG L 81  
U  2 3 N ILE L  80  ? N ILE L 80  O VAL L  88  ? O VAL L 88  
U  3 4 N ARG L  87  ? N ARG L 87  O MET V  20  ? O MET V 20  
U  4 5 N PHE V  21  ? N PHE V 21  O THR V  29  ? O THR V 29  
V  1 2 N LEU L  12  ? N LEU L 12  O ALA L  47  ? O ALA L 47  
W  1 2 N ILE L  18  ? N ILE L 18  O LEU L  29  ? O LEU L 29  
W  2 3 N SER L  33  ? N SER L 33  O THR L  54  ? O THR L 54  
W  3 4 N VAL L  55  ? N VAL L 55  O LEU L  69  ? O LEU L 69  
W  4 5 N GLU L  70  ? N GLU L 70  O VAL L  98  ? O VAL L 98  
W  5 6 O ALA L  95  ? O ALA L 95  N THR L  19  ? N THR L 19  
X  1 2 N ILE L  113 ? N ILE L 113 O VAL L  132 ? O VAL L 132 
Y  1 2 N ALA M  62  ? N ALA M 62  O LYS M  107 ? O LYS M 107 
Y  2 3 N VAL M  108 ? N VAL M 108 O ASP M  124 ? O ASP M 124 
Z  1 2 N VAL M  91  ? N VAL M 91  O THR M  119 ? O THR M 119 
Z  2 3 N LEU M  120 ? N LEU M 120 O GLU M  141 ? O GLU M 141 
AA 1 2 N VAL N  38  ? N VAL N 38  O ARG N  64  ? O ARG N 64  
AA 2 3 N VAL N  63  ? N VAL N 63  O VAL N  131 ? O VAL N 131 
AA 3 4 O GLU N  130 ? O GLU N 130 N TYR N  118 ? N TYR N 118 
AB 1 2 O ASP O  56  ? O ASP O 56  N THR O  49  ? N THR O 49  
AB 2 3 O VAL O  48  ? O VAL O 48  N ARG O  33  ? N ARG O 33  
AB 3 4 N LEU O  34  ? N LEU O 34  O VAL O  101 ? O VAL O 101 
AC 1 2 N VAL P  43  ? N VAL P 43  O LEU P  65  ? O LEU P 65  
AC 2 3 N VAL P  58  ? N VAL P 58  O ALA P  77  ? O ALA P 77  
AC 3 4 N VAL P  76  ? N VAL P 76  O VAL P  96  ? O VAL P 96  
AD 1 2 N VAL P  43  ? N VAL P 43  O LEU P  65  ? O LEU P 65  
AD 2 3 N VAL P  59  ? N VAL P 59  O ARG P  112 ? O ARG P 112 
AE 1 2 N TRP Q  22  ? N TRP Q 22  O GLN Q  50  ? O GLN Q 50  
AF 1 2 O LYS R  80  ? O LYS R 80  N ASP R  77  ? N ASP R 77  
AF 2 3 O ALA R  70  ? O ALA R 70  N GLN R  67  ? N GLN R 67  
AF 3 4 O GLY R  61  ? O GLY R 61  N VAL R  39  ? N VAL R 39  
AF 4 5 N HIS R  40  ? N HIS R 40  O ARG R  92  ? O ARG R 92  
AG 1 2 N ALA S  14  ? N ALA S 14  O LEU S  147 ? O LEU S 147 
AG 2 3 O SER S  138 ? O SER S 138 N GLN S  122 ? N GLN S 122 
AH 1 2 N VAL S  57  ? N VAL S 57  O ARG S  79  ? O ARG S 79  
AI 1 2 N LYS S  126 ? N LYS S 126 O SER S  134 ? O SER S 134 
AJ 1 2 N HIS T  7   ? N HIS T 7   O ALA T  27  ? O ALA T 27  
AJ 2 3 N LEU T  24  ? N LEU T 24  O VAL T  66  ? O VAL T 66  
AJ 3 4 O LYS T  63  ? O LYS T 63  N GLN T  55  ? N GLN T 55  
AK 1 2 O VAL U  40  ? O VAL U 40  N ALA U  25  ? N ALA U 25  
AK 2 3 N THR U  26  ? N THR U 26  O VAL U  98  ? O VAL U 98  
AK 3 4 O ARG U  97  ? O ARG U 97  N GLU U  49  ? N GLU U 49  
AK 4 5 N VAL U  48  ? N VAL U 48  O GLY U  60  ? O GLY U 60  
AK 5 6 N ASP U  66  ? N ASP U 66  O VAL U  71  ? O VAL U 71  
AL 1 2 N LEU U  79  ? N LEU U 79  O VAL U  87  ? O VAL U 87  
AM 1 2 O LEU X  116 ? O LEU X 116 N CYS X  32  ? N CYS X 32  
AM 2 3 O THR X  33  ? O THR X 33  N LEU X  4   ? N LEU X 4   
AM 3 4 N ALA X  3   ? N ALA X 3   O GLY X  55  ? O GLY X 55  
AM 4 5 N PHE X  54  ? N PHE X 54  O GLY X  139 ? O GLY X 139 
AN 1 2 N VAL Y  10  ? N VAL Y 10  O VAL Y  72  ? O VAL Y 72  
AN 2 3 N ARG Y  73  ? N ARG Y 73  O GLU Y  86  ? O GLU Y 86  
AN 3 4 O ALA Y  83  ? O ALA Y 83  N ARG Y  49  ? N ARG Y 49  
AO 1 2 N GLU Z  96  ? N GLU Z 96  O VAL Z  236 ? O VAL Z 236 
AP 1 2 N VAL Z  185 ? N VAL Z 185 O ARG Z  204 ? O ARG Z 204 
AQ 1 2 N LYS AA 39  ? N LYS 1 48  O MET AA 47  ? O MET 1 56  
AQ 2 3 N TRP AA 46  ? N TRP 1 55  O ILE AA 55  ? O ILE 1 64  
AR 1 2 N THR BA 17  ? N THR 2 17  O TYR BA 27  ? O TYR 2 27  
AS 1 2 N MET DA 3   ? N MET 4 3   O GLU DA 89  ? O GLU 4 89  
AT 1 2 N PHE DA 7   ? N PHE 4 7   O HIS DA 20  ? O HIS 4 20  
AT 2 3 N GLU DA 21  ? N GLU 4 21  O ARG DA 70  ? O ARG 4 70  
AT 3 4 N TYR DA 69  ? N TYR 4 69  O HIS DA 78  ? O HIS 4 78  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE VIR A 9403' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8001'  
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8002'  
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8003'  
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8004'  
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8005'  
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8006'  
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8007'  
AC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8008'  
BC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8009'  
BC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8010'  
BC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8011'  
BC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8012'  
BC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8013'  
BC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8014'  
BC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8015'  
BC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8016'  
BC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8017'  
CC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8018'  
CC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8019'  
CC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8020'  
CC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8021'  
CC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8022'  
CC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8023'  
CC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8024'  
CC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8025'  
CC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8026'  
DC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8027'  
DC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8028'  
DC3 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG A 8029'  
DC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8030'  
DC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8031'  
DC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8032'  
DC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8033'  
DC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8034'  
DC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8035'  
EC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8036'  
EC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8037'  
EC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8038'  
EC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8039'  
EC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8040'  
EC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8041'  
EC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8042'  
EC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8043'  
EC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8044'  
FC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8045'  
FC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8046'  
FC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8047'  
FC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8048'  
FC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8049'  
FC6 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG A 8050'  
FC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8051'  
FC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8052'  
FC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8053'  
GC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8054'  
GC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8056'  
GC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8057'  
GC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8058'  
GC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8059'  
GC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8060'  
GC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8061'  
GC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8062'  
GC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8063'  
HC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8064'  
HC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8066'  
HC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8067'  
HC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8068'  
HC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8070'  
HC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8071'  
HC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8072'  
HC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8074'  
HC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8075'  
IC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8076'  
IC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8077'  
IC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8079'  
IC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8080'  
IC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8081'  
IC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8082'  
IC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8083'  
IC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8084'  
IC9 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG A 8085'  
JC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8086'  
JC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8087'  
JC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8088'  
JC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8089'  
JC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8090'  
JC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8091'  
JC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8092'  
JC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8093'  
JC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8094'  
KC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8096'  
KC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8097'  
KC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8098'  
KC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8099'  
KC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8100'  
KC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8101'  
KC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8102'  
KC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 8103'  
KC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG A 8104'  
LC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8106'  
LC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8107'  
LC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8108'  
LC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8110'  
LC5 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8111'  
LC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8112'  
LC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8113'  
LC8 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE MG A 8114'  
LC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8115'  
MC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG A 8116'  
MC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 8117'  
MC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE K A 8202'   
MC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8301'  
MC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8302'  
MC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8303'  
MC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8305'  
MC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8306'  
MC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8307'  
NC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8308'  
NC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8310'  
NC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8311'  
NC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8313'  
NC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8314'  
NC6 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8315'  
NC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8316'  
NC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8317'  
NC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8318'  
OC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8319'  
OC2 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA A 8320'  
OC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8321'  
OC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8323'  
OC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8324'  
OC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 8325'  
OC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8326'  
OC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8327'  
OC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8328'  
PC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8329'  
PC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8330'  
PC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8331'  
PC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8332'  
PC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8333'  
PC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8334'  
PC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8335'  
PC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8336'  
PC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8338'  
QC1 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 8339'  
QC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8340'  
QC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8341'  
QC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8342'  
QC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8344'  
QC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8349'  
QC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8350'  
QC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8352'  
QC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8353'  
RC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8354'  
RC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8355'  
RC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8356'  
RC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8357'  
RC5 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA A 8358'  
RC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8359'  
RC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8360'  
RC8 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8361'  
RC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8362'  
SC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8363'  
SC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8364'  
SC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8365'  
SC4 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA A 8366'  
SC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA A 8367'  
SC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8368'  
SC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8370'  
SC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8371'  
SC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8372'  
TC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8373'  
TC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA A 8374'  
TC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8375'  
TC4 Software ? ? ? ? 8 'BINDING SITE FOR RESIDUE NA A 8376'  
TC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8377'  
TC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 8378'  
TC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 8379'  
TC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA A 8381'  
TC9 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8382'  
UC1 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE NA A 8384'  
UC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE NA A 8385'  
UC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 8503'  
UC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 8505'  
UC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL A 8511'  
UC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A 8513'  
UC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 8514'  
UC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 8515'  
UC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL A 8516'  
VC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 8522'  
VC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG B 8095'  
VC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA B 8351'  
VC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA B 8383'  
VC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG C 8065'  
VC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG C 8105'  
VC7 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA C 8345'  
VC8 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL C 8509'  
VC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG D 8055'  
WC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL D 8519'  
WC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA E 8304'  
WC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA J 8309'  
WC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA J 8322'  
WC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA K 8346'  
WC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE CL K 8501'  
WC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL K 8502'  
WC8 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL K 8521'  
WC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG L 8069'  
XC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CL L 8512'  
XC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE NA M 8380'  
XC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL M 8510'  
XC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA N 8347'  
XC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CL N 8518'  
XC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL O 8507'  
XC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CD P 8405'  
XC8 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL P 8508'  
XC9 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA R 8348'  
YC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA S 8337'  
YC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE NA S 8386'  
YC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL S 8506'  
YC4 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE NA T 8312'  
YC5 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MG U 8073'  
YC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA U 8343'  
YC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CD V 8401'  
YC8 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MG Z 8109'  
YC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL Z 8517'  
ZC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL Z 8520'  
ZC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD 1 8403'  
ZC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD 2 8402'  
ZC4 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG 4 8078'  
ZC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE NA 4 8369'  
ZC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CD 4 8404'  
ZC7 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL 4 8504'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 7 G   A  2101 ? G   A 2102 . ? 1_555 ? 
2    AC1 7 A   A  2102 ? A   A 2103 . ? 1_555 ? 
3    AC1 7 C   A  2103 ? C   A 2104 . ? 1_555 ? 
4    AC1 7 A   A  2485 ? A   A 2486 . ? 1_555 ? 
5    AC1 7 C   A  2486 ? C   A 2487 . ? 1_555 ? 
6    AC1 7 A   A  2537 ? A   A 2538 . ? 1_555 ? 
7    AC1 7 U   A  2619 ? U   A 2620 . ? 1_555 ? 
8    AC2 7 G   A  2481 ? G   A 2482 . ? 1_555 ? 
9    AC2 7 A   A  2482 ? A   A 2483 . ? 1_555 ? 
10   AC2 7 C   A  2532 ? C   A 2533 . ? 1_555 ? 
11   AC2 7 C   A  2533 ? C   A 2534 . ? 1_555 ? 
12   AC2 7 HOH CJ .    ? HOH A 4011 . ? 1_555 ? 
13   AC2 7 HOH CJ .    ? HOH A 8262 . ? 1_555 ? 
14   AC2 7 HOH CJ .    ? HOH A 9577 . ? 1_555 ? 
15   AC3 6 G   A  626  ? G   A 627  . ? 1_555 ? 
16   AC3 6 A   A  2482 ? A   A 2483 . ? 1_555 ? 
17   AC3 6 C   A  2533 ? C   A 2534 . ? 1_555 ? 
18   AC3 6 HOH CJ .    ? HOH A 4714 . ? 1_555 ? 
19   AC3 6 HOH CJ .    ? HOH A 8240 . ? 1_555 ? 
20   AC3 6 HOH CJ .    ? HOH A 8241 . ? 1_555 ? 
21   AC4 7 A   A  875  ? A   A 876  . ? 1_555 ? 
22   AC4 7 G   A  876  ? G   A 877  . ? 1_555 ? 
23   AC4 7 G   A  2622 ? G   A 2623 . ? 1_555 ? 
24   AC4 7 A   A  2623 ? A   A 2624 . ? 1_555 ? 
25   AC4 7 HOH CJ .    ? HOH A 4061 . ? 1_555 ? 
26   AC4 7 HOH CJ .    ? HOH A 9424 . ? 1_555 ? 
27   AC4 7 HOH EJ .    ? HOH C 8537 . ? 1_555 ? 
28   AC5 6 G   A  455  ? G   A 456  . ? 1_555 ? 
29   AC5 6 A   A  458  ? A   A 459  . ? 1_555 ? 
30   AC5 6 HOH CJ .    ? HOH A 3171 . ? 1_555 ? 
31   AC5 6 HOH CJ .    ? HOH A 4178 . ? 1_555 ? 
32   AC5 6 HOH CJ .    ? HOH A 8247 . ? 1_555 ? 
33   AC5 6 HOH CJ .    ? HOH A 9451 . ? 1_555 ? 
34   AC6 6 A   A  1835 ? A   A 1836 . ? 1_555 ? 
35   AC6 6 U   A  1837 ? U   A 1838 . ? 1_555 ? 
36   AC6 6 A   A  1838 ? A   A 1839 . ? 1_555 ? 
37   AC6 6 HOH CJ .    ? HOH A 4007 . ? 1_555 ? 
38   AC6 6 HOH CJ .    ? HOH A 8263 . ? 1_555 ? 
39   AC6 6 HOH CJ .    ? HOH A 8264 . ? 1_555 ? 
40   AC7 6 U   A  820  ? U   A 821  . ? 1_555 ? 
41   AC7 6 C   A  821  ? C   A 822  . ? 1_555 ? 
42   AC7 6 G   A  853  ? G   A 854  . ? 1_555 ? 
43   AC7 6 HOH CJ .    ? HOH A 3202 . ? 1_555 ? 
44   AC7 6 HOH CJ .    ? HOH A 4013 . ? 1_555 ? 
45   AC7 6 HOH CJ .    ? HOH A 4149 . ? 1_555 ? 
46   AC8 6 U   A  831  ? U   A 832  . ? 1_555 ? 
47   AC8 6 A   A  1838 ? A   A 1839 . ? 1_555 ? 
48   AC8 6 A   A  1839 ? A   A 1840 . ? 1_555 ? 
49   AC8 6 HOH CJ .    ? HOH A 3748 . ? 1_555 ? 
50   AC8 6 HOH CJ .    ? HOH A 8252 . ? 1_555 ? 
51   AC8 6 HOH CJ .    ? HOH A 9410 . ? 1_555 ? 
52   AC9 6 U   A  918  ? U   A 919  . ? 1_555 ? 
53   AC9 6 C   A  2463 ? C   A 2464 . ? 1_555 ? 
54   AC9 6 A   A  2464 ? A   A 2465 . ? 1_555 ? 
55   AC9 6 HOH CJ .    ? HOH A 4025 . ? 1_555 ? 
56   AC9 6 HOH CJ .    ? HOH A 8256 . ? 1_555 ? 
57   AC9 6 HOH CJ .    ? HOH A 8411 . ? 1_555 ? 
58   BC1 7 U   A  2609 ? U   A 2610 . ? 1_555 ? 
59   BC1 7 G   A  2610 ? G   A 2611 . ? 1_555 ? 
60   BC1 7 A   A  2611 ? A   A 2612 . ? 1_555 ? 
61   BC1 7 HOH CJ .    ? HOH A 4136 . ? 1_555 ? 
62   BC1 7 HOH CJ .    ? HOH A 7808 . ? 1_555 ? 
63   BC1 7 HOH CJ .    ? HOH A 8257 . ? 1_555 ? 
64   BC1 7 HOH CJ .    ? HOH A 8258 . ? 1_555 ? 
65   BC2 6 G   A  835  ? G   A 836  . ? 1_555 ? 
66   BC2 6 U   A  2614 ? U   A 2615 . ? 1_555 ? 
67   BC2 6 HOH CJ .    ? HOH A 4236 . ? 1_555 ? 
68   BC2 6 HOH CJ .    ? HOH A 9757 . ? 1_555 ? 
69   BC2 6 GLN D  230  ? GLN D 230  . ? 1_555 ? 
70   BC2 6 HOH FJ .    ? HOH D 8526 . ? 1_555 ? 
71   BC3 6 G   A  823  ? G   A 824  . ? 1_555 ? 
72   BC3 6 G   A  853  ? G   A 854  . ? 1_555 ? 
73   BC3 6 HOH CJ .    ? HOH A 4357 . ? 1_555 ? 
74   BC3 6 HOH CJ .    ? HOH A 4681 . ? 1_555 ? 
75   BC3 6 HOH CJ .    ? HOH A 4812 . ? 1_555 ? 
76   BC3 6 HOH CJ .    ? HOH A 4918 . ? 1_555 ? 
77   BC4 7 G   A  27   ? G   A 28   . ? 1_555 ? 
78   BC4 7 U   A  1303 ? U   A 1304 . ? 1_555 ? 
79   BC4 7 HOH CJ .    ? HOH A 3031 . ? 1_555 ? 
80   BC4 7 HOH CJ .    ? HOH A 3617 . ? 1_555 ? 
81   BC4 7 HOH CJ .    ? HOH A 4043 . ? 1_555 ? 
82   BC4 7 HOH CJ .    ? HOH A 8412 . ? 1_555 ? 
83   BC4 7 HOH CJ .    ? HOH A 9443 . ? 1_555 ? 
84   BC5 7 G   A  876  ? G   A 877  . ? 1_555 ? 
85   BC5 7 A   A  2621 ? A   A 2622 . ? 1_555 ? 
86   BC5 7 G   A  2622 ? G   A 2623 . ? 1_555 ? 
87   BC5 7 HOH CJ .    ? HOH A 4037 . ? 1_555 ? 
88   BC5 7 HOH CJ .    ? HOH A 4050 . ? 1_555 ? 
89   BC5 7 HOH CJ .    ? HOH A 8271 . ? 1_555 ? 
90   BC5 7 HOH CJ .    ? HOH A 9423 . ? 1_555 ? 
91   BC6 6 G   A  2101 ? G   A 2102 . ? 1_555 ? 
92   BC6 6 G   A  2536 ? G   A 2537 . ? 1_555 ? 
93   BC6 6 HOH CJ .    ? HOH A 4054 . ? 1_555 ? 
94   BC6 6 HOH CJ .    ? HOH A 4556 . ? 1_555 ? 
95   BC6 6 HOH CJ .    ? HOH A 8238 . ? 1_555 ? 
96   BC6 6 HOH CJ .    ? HOH A 9436 . ? 1_555 ? 
97   BC7 6 A   A  843  ? A   A 844  . ? 1_555 ? 
98   BC7 6 A   A  1688 ? A   A 1689 . ? 1_555 ? 
99   BC7 6 HOH CJ .    ? HOH A 4017 . ? 1_555 ? 
100  BC7 6 HOH CJ .    ? HOH A 8273 . ? 1_555 ? 
101  BC7 6 HOH CJ .    ? HOH A 9408 . ? 1_555 ? 
102  BC7 6 HOH CJ .    ? HOH A 9427 . ? 1_555 ? 
103  BC8 6 A   A  1503 ? A   A 1504 . ? 1_555 ? 
104  BC8 6 A   A  1677 ? A   A 1678 . ? 1_555 ? 
105  BC8 6 C   A  1678 ? C   A 1679 . ? 1_555 ? 
106  BC8 6 HOH CJ .    ? HOH A 4142 . ? 1_555 ? 
107  BC8 6 HOH CJ .    ? HOH A 8265 . ? 1_555 ? 
108  BC8 6 HOH CJ .    ? HOH A 8266 . ? 1_555 ? 
109  BC9 6 G   A  455  ? G   A 456  . ? 1_555 ? 
110  BC9 6 HOH CJ .    ? HOH A 7772 . ? 1_555 ? 
111  BC9 6 HOH CJ .    ? HOH A 8248 . ? 1_555 ? 
112  BC9 6 HOH CJ .    ? HOH A 9809 . ? 1_555 ? 
113  BC9 6 HOH GJ .    ? HOH E 8359 . ? 1_555 ? 
114  BC9 6 HOH GJ .    ? HOH E 8363 . ? 1_555 ? 
115  CC1 6 A   A  1290 ? A   A 1291 . ? 1_555 ? 
116  CC1 6 G   A  1291 ? G   A 1292 . ? 1_555 ? 
117  CC1 6 HOH CJ .    ? HOH A 3610 . ? 1_555 ? 
118  CC1 6 HOH CJ .    ? HOH A 4009 . ? 1_555 ? 
119  CC1 6 HOH CJ .    ? HOH A 7844 . ? 1_555 ? 
120  CC1 6 HOH CJ .    ? HOH A 8413 . ? 1_555 ? 
121  CC2 6 A   A  2010 ? A   A 2011 . ? 1_555 ? 
122  CC2 6 HOH CJ .    ? HOH A 4543 . ? 1_555 ? 
123  CC2 6 HOH CJ .    ? HOH A 7617 . ? 1_555 ? 
124  CC2 6 HOH CJ .    ? HOH A 8267 . ? 1_555 ? 
125  CC2 6 HOH CJ .    ? HOH A 8268 . ? 1_555 ? 
126  CC2 6 HOH CJ .    ? HOH A 8269 . ? 1_555 ? 
127  CC3 6 C   A  1829 ? C   A 1830 . ? 1_555 ? 
128  CC3 6 HOH CJ .    ? HOH A 8251 . ? 1_555 ? 
129  CC3 6 HOH CJ .    ? HOH A 8270 . ? 1_555 ? 
130  CC3 6 HOH CJ .    ? HOH A 9523 . ? 1_555 ? 
131  CC3 6 HOH CJ .    ? HOH A 9526 . ? 1_555 ? 
132  CC3 6 HOH CJ .    ? HOH A 9598 . ? 1_555 ? 
133  CC4 6 G   A  2303 ? G   A 2304 . ? 1_555 ? 
134  CC4 6 HOH CJ .    ? HOH A 3353 . ? 1_555 ? 
135  CC4 6 HOH CJ .    ? HOH A 4033 . ? 1_555 ? 
136  CC4 6 HOH CJ .    ? HOH A 4034 . ? 1_555 ? 
137  CC4 6 HOH CJ .    ? HOH A 8254 . ? 1_555 ? 
138  CC4 6 HOH CJ .    ? HOH A 8255 . ? 1_555 ? 
139  CC5 6 G   A  2096 ? G   A 2097 . ? 1_555 ? 
140  CC5 6 G   A  2539 ? G   A 2540 . ? 1_555 ? 
141  CC5 6 HOH CJ .    ? HOH A 4267 . ? 1_555 ? 
142  CC5 6 HOH CJ .    ? HOH A 8259 . ? 1_555 ? 
143  CC5 6 HOH CJ .    ? HOH A 9512 . ? 1_555 ? 
144  CC5 6 HOH CJ .    ? HOH A 9853 . ? 1_555 ? 
145  CC6 7 G   A  2615 ? G   A 2616 . ? 1_555 ? 
146  CC6 7 G   A  2616 ? G   A 2617 . ? 1_555 ? 
147  CC6 7 G   A  2617 ? G   A 2618 . ? 1_555 ? 
148  CC6 7 HOH CJ .    ? HOH A 4023 . ? 1_555 ? 
149  CC6 7 HOH CJ .    ? HOH A 4216 . ? 1_555 ? 
150  CC6 7 HOH CJ .    ? HOH A 8275 . ? 1_555 ? 
151  CC6 7 HOH CJ .    ? HOH A 8276 . ? 1_555 ? 
152  CC7 4 A   A  1380 ? A   A 1381 . ? 1_555 ? 
153  CC7 4 HOH CJ .    ? HOH A 5514 . ? 1_555 ? 
154  CC7 4 HOH CJ .    ? HOH A 8414 . ? 1_555 ? 
155  CC7 4 HOH AK .    ? HOH Y 7830 . ? 1_555 ? 
156  CC8 6 U   A  1119 ? U   A 1120 . ? 1_555 ? 
157  CC8 6 G   A  1120 ? G   A 1121 . ? 1_555 ? 
158  CC8 6 HOH CJ .    ? HOH A 4561 . ? 1_555 ? 
159  CC8 6 HOH CJ .    ? HOH A 8277 . ? 1_555 ? 
160  CC8 6 HOH CJ .    ? HOH A 8278 . ? 1_555 ? 
161  CC8 6 HOH CJ .    ? HOH A 8415 . ? 1_555 ? 
162  CC9 6 C   A  2607 ? C   A 2608 . ? 1_555 ? 
163  CC9 6 G   A  2608 ? G   A 2609 . ? 1_555 ? 
164  CC9 6 U   A  2609 ? U   A 2610 . ? 1_555 ? 
165  CC9 6 HOH CJ .    ? HOH A 8279 . ? 1_555 ? 
166  CC9 6 HOH CJ .    ? HOH A 8280 . ? 1_555 ? 
167  CC9 6 HOH CJ .    ? HOH A 9787 . ? 1_555 ? 
168  DC1 7 C   A  239  ? C   A 240  . ? 1_555 ? 
169  DC1 7 U   A  267  ? U   A 268  . ? 1_555 ? 
170  DC1 7 G   A  268  ? G   A 269  . ? 1_555 ? 
171  DC1 7 HOH CJ .    ? HOH A 4270 . ? 1_555 ? 
172  DC1 7 HOH CJ .    ? HOH A 4409 . ? 1_555 ? 
173  DC1 7 HOH CJ .    ? HOH A 4548 . ? 1_555 ? 
174  DC1 7 HOH PJ .    ? HOH N 8656 . ? 1_555 ? 
175  DC2 7 A   A  1447 ? A   A 1448 . ? 1_555 ? 
176  DC2 7 U   A  1676 ? U   A 1677 . ? 1_555 ? 
177  DC2 7 HOH CJ .    ? HOH A 4073 . ? 1_555 ? 
178  DC2 7 HOH CJ .    ? HOH A 4094 . ? 1_555 ? 
179  DC2 7 HOH CJ .    ? HOH A 4106 . ? 1_555 ? 
180  DC2 7 HOH CJ .    ? HOH A 8283 . ? 1_555 ? 
181  DC2 7 HOH CJ .    ? HOH A 9967 . ? 1_555 ? 
182  DC3 8 A   A  1501 ? A   A 1502 . ? 1_555 ? 
183  DC3 8 U   A  1502 ? U   A 1503 . ? 1_555 ? 
184  DC3 8 A   A  1503 ? A   A 1504 . ? 1_555 ? 
185  DC3 8 C   A  1678 ? C   A 1679 . ? 1_555 ? 
186  DC3 8 HOH CJ .    ? HOH A 8284 . ? 1_555 ? 
187  DC3 8 HOH CJ .    ? HOH A 8285 . ? 1_555 ? 
188  DC3 8 HOH CJ .    ? HOH A 8286 . ? 1_555 ? 
189  DC3 8 HOH CJ .    ? HOH A 8287 . ? 1_555 ? 
190  DC4 6 U   A  1747 ? U   A 1748 . ? 1_555 ? 
191  DC4 6 U   A  1748 ? U   A 1749 . ? 1_555 ? 
192  DC4 6 HOH CJ .    ? HOH A 4035 . ? 1_555 ? 
193  DC4 6 HOH CJ .    ? HOH A 8249 . ? 1_555 ? 
194  DC4 6 HOH CJ .    ? HOH A 8250 . ? 1_555 ? 
195  DC4 6 HOH CJ .    ? HOH A 8260 . ? 1_555 ? 
196  DC5 7 U   A  776  ? U   A 777  . ? 1_555 ? 
197  DC5 7 C   A  777  ? C   A 778  . ? 1_555 ? 
198  DC5 7 HOH CJ .    ? HOH A 3666 . ? 1_555 ? 
199  DC5 7 HOH CJ .    ? HOH A 8289 . ? 1_555 ? 
200  DC5 7 HOH CJ .    ? HOH A 8290 . ? 1_555 ? 
201  DC5 7 HOH CJ .    ? HOH A 8291 . ? 1_555 ? 
202  DC5 7 NA  FF .    ? NA  A 8325 . ? 1_555 ? 
203  DC6 7 U   A  2114 ? U   A 2115 . ? 1_555 ? 
204  DC6 7 G   A  2271 ? G   A 2272 . ? 1_555 ? 
205  DC6 7 HOH CJ .    ? HOH A 3380 . ? 1_555 ? 
206  DC6 7 HOH CJ .    ? HOH A 4121 . ? 1_555 ? 
207  DC6 7 HOH CJ .    ? HOH A 4184 . ? 1_555 ? 
208  DC6 7 HOH CJ .    ? HOH A 4582 . ? 1_555 ? 
209  DC6 7 HOH EJ .    ? HOH C 8640 . ? 1_555 ? 
210  DC7 6 A   A  1746 ? A   A 1747 . ? 1_555 ? 
211  DC7 6 U   A  1747 ? U   A 1748 . ? 1_555 ? 
212  DC7 6 U   A  1748 ? U   A 1749 . ? 1_555 ? 
213  DC7 6 G   A  2584 ? G   A 2585 . ? 1_555 ? 
214  DC7 6 HOH CJ .    ? HOH A 3070 . ? 1_555 ? 
215  DC7 6 HOH CJ .    ? HOH A 4212 . ? 1_555 ? 
216  DC8 6 A   A  2301 ? A   A 2302 . ? 1_555 ? 
217  DC8 6 A   A  2302 ? A   A 2303 . ? 1_555 ? 
218  DC8 6 HOH CJ .    ? HOH A 4038 . ? 1_555 ? 
219  DC8 6 HOH CJ .    ? HOH A 4165 . ? 1_555 ? 
220  DC8 6 HOH CJ .    ? HOH A 5255 . ? 1_555 ? 
221  DC8 6 HOH CJ .    ? HOH A 8292 . ? 1_555 ? 
222  DC9 6 G   A  1483 ? G   A 1484 . ? 1_555 ? 
223  DC9 6 HOH CJ .    ? HOH A 4111 . ? 1_555 ? 
224  DC9 6 HOH CJ .    ? HOH A 8293 . ? 1_555 ? 
225  DC9 6 HOH CJ .    ? HOH A 8294 . ? 1_555 ? 
226  DC9 6 HOH CJ .    ? HOH A 8417 . ? 1_555 ? 
227  DC9 6 HOH CJ .    ? HOH A 8418 . ? 1_555 ? 
228  EC1 6 G   A  955  ? G   A 956  . ? 1_555 ? 
229  EC1 6 HOH CJ .    ? HOH A 4065 . ? 1_555 ? 
230  EC1 6 HOH CJ .    ? HOH A 8295 . ? 1_555 ? 
231  EC1 6 HOH CJ .    ? HOH A 8296 . ? 1_555 ? 
232  EC1 6 HOH CJ .    ? HOH A 8297 . ? 1_555 ? 
233  EC1 6 HOH CJ .    ? HOH A 9762 . ? 1_555 ? 
234  EC2 7 A   A  2552 ? A   A 2553 . ? 1_555 ? 
235  EC2 7 A   A  2575 ? A   A 2576 . ? 1_555 ? 
236  EC2 7 HOH CJ .    ? HOH A 3524 . ? 1_555 ? 
237  EC2 7 HOH CJ .    ? HOH A 3600 . ? 1_555 ? 
238  EC2 7 HOH CJ .    ? HOH A 4044 . ? 1_555 ? 
239  EC2 7 HOH CJ .    ? HOH A 8419 . ? 1_555 ? 
240  EC2 7 HOH CJ .    ? HOH A 9481 . ? 1_555 ? 
241  EC3 6 HOH CJ .    ? HOH A 4021 . ? 1_555 ? 
242  EC3 6 HOH CJ .    ? HOH A 4045 . ? 1_555 ? 
243  EC3 6 HOH CJ .    ? HOH A 4066 . ? 1_555 ? 
244  EC3 6 HOH CJ .    ? HOH A 4068 . ? 1_555 ? 
245  EC3 6 HOH CJ .    ? HOH A 8299 . ? 1_555 ? 
246  EC3 6 HOH CJ .    ? HOH A 9678 . ? 1_555 ? 
247  EC4 7 A   A  113  ? A   A 114  . ? 1_555 ? 
248  EC4 7 U   A  114  ? U   A 115  . ? 1_555 ? 
249  EC4 7 HOH CJ .    ? HOH A 3300 . ? 1_555 ? 
250  EC4 7 HOH CJ .    ? HOH A 4363 . ? 1_555 ? 
251  EC4 7 HOH CJ .    ? HOH A 5493 . ? 1_555 ? 
252  EC4 7 HOH CJ .    ? HOH A 8300 . ? 1_555 ? 
253  EC4 7 HOH CJ .    ? HOH A 8304 . ? 1_555 ? 
254  EC5 6 U   A  391  ? U   A 392  . ? 1_555 ? 
255  EC5 6 HOH CJ .    ? HOH A 3083 . ? 1_555 ? 
256  EC5 6 HOH CJ .    ? HOH A 4185 . ? 1_555 ? 
257  EC5 6 HOH CJ .    ? HOH A 5034 . ? 1_555 ? 
258  EC5 6 HOH CJ .    ? HOH A 8421 . ? 1_555 ? 
259  EC5 6 HOH PJ .    ? HOH N 8657 . ? 1_555 ? 
260  EC6 5 G   A  195  ? G   A 196  . ? 1_555 ? 
261  EC6 5 A   A  226  ? A   A 227  . ? 1_555 ? 
262  EC6 5 C   A  227  ? C   A 228  . ? 1_555 ? 
263  EC6 5 HOH CJ .    ? HOH A 4503 . ? 1_555 ? 
264  EC6 5 HOH CJ .    ? HOH A 4593 . ? 1_555 ? 
265  EC7 6 U   A  1308 ? U   A 1309 . ? 1_555 ? 
266  EC7 6 U   A  1345 ? U   A 1346 . ? 1_555 ? 
267  EC7 6 HOH CJ .    ? HOH A 4053 . ? 1_555 ? 
268  EC7 6 HOH CJ .    ? HOH A 4808 . ? 1_555 ? 
269  EC7 6 HOH CJ .    ? HOH A 8309 . ? 1_555 ? 
270  EC7 6 HOH CJ .    ? HOH A 9832 . ? 1_555 ? 
271  EC8 6 G   A  815  ? G   A 816  . ? 1_555 ? 
272  EC8 6 G   A  816  ? G   A 817  . ? 1_555 ? 
273  EC8 6 HOH CJ .    ? HOH A 3206 . ? 1_555 ? 
274  EC8 6 HOH CJ .    ? HOH A 7797 . ? 1_555 ? 
275  EC8 6 MG  ZD .    ? MG  A 8106 . ? 1_555 ? 
276  EC8 6 HOH CJ .    ? HOH A 8422 . ? 1_555 ? 
277  EC9 6 C   A  2047 ? C   A 2048 . ? 1_555 ? 
278  EC9 6 C   A  2087 ? C   A 2088 . ? 1_555 ? 
279  EC9 6 A   A  2088 ? A   A 2089 . ? 1_555 ? 
280  EC9 6 HOH CJ .    ? HOH A 3685 . ? 1_555 ? 
281  EC9 6 GLY S  65   ? GLY S 65   . ? 1_555 ? 
282  EC9 6 HOH UJ .    ? HOH S 8593 . ? 1_555 ? 
283  FC1 5 G   A  1978 ? G   A 1979 . ? 1_555 ? 
284  FC1 5 HOH CJ .    ? HOH A 8312 . ? 1_555 ? 
285  FC1 5 HOH CJ .    ? HOH A 8423 . ? 1_555 ? 
286  FC1 5 HOH CJ .    ? HOH A 8424 . ? 1_555 ? 
287  FC1 5 HOH CJ .    ? HOH A 8425 . ? 1_555 ? 
288  FC2 4 G   A  1793 ? G   A 1794 . ? 1_555 ? 
289  FC2 4 HOH CJ .    ? HOH A 7681 . ? 1_555 ? 
290  FC2 4 HOH CJ .    ? HOH A 8426 . ? 1_555 ? 
291  FC2 4 HOH CJ .    ? HOH A 8427 . ? 1_555 ? 
292  FC3 4 A   A  1097 ? A   A 1098 . ? 1_555 ? 
293  FC3 4 HOH CJ .    ? HOH A 3518 . ? 1_555 ? 
294  FC3 4 HOH CJ .    ? HOH A 6658 . ? 1_555 ? 
295  FC3 4 HOH CJ .    ? HOH A 8441 . ? 1_555 ? 
296  FC4 7 A   A  2745 ? A   A 2746 . ? 1_555 ? 
297  FC4 7 U   A  2748 ? U   A 2749 . ? 1_555 ? 
298  FC4 7 G   A  2749 ? G   A 2750 . ? 1_555 ? 
299  FC4 7 HOH CJ .    ? HOH A 6263 . ? 1_555 ? 
300  FC4 7 HOH CJ .    ? HOH A 6649 . ? 1_555 ? 
301  FC4 7 HOH CJ .    ? HOH A 8428 . ? 1_555 ? 
302  FC4 7 HOH CJ .    ? HOH A 8464 . ? 1_555 ? 
303  FC5 4 G   A  2420 ? G   A 2421 . ? 1_555 ? 
304  FC5 4 U   A  2421 ? U   A 2422 . ? 1_555 ? 
305  FC5 4 C   A  2422 ? C   A 2423 . ? 1_555 ? 
306  FC5 4 HOH CJ .    ? HOH A 8429 . ? 1_555 ? 
307  FC6 2 C   A  2247 ? C   A 2248 . ? 1_555 ? 
308  FC6 2 HOH CJ .    ? HOH A 7702 . ? 1_555 ? 
309  FC7 4 G   A  640  ? G   A 641  . ? 1_555 ? 
310  FC7 4 HOH CJ .    ? HOH A 4498 . ? 1_555 ? 
311  FC7 4 HOH CJ .    ? HOH A 8322 . ? 1_555 ? 
312  FC7 4 HOH CJ .    ? HOH A 8337 . ? 1_555 ? 
313  FC8 7 U   A  1124 ? U   A 1125 . ? 1_555 ? 
314  FC8 7 C   A  1128 ? C   A 1129 . ? 1_555 ? 
315  FC8 7 HOH CJ .    ? HOH A 4019 . ? 1_555 ? 
316  FC8 7 HOH CJ .    ? HOH A 4254 . ? 1_555 ? 
317  FC8 7 HOH CJ .    ? HOH A 8443 . ? 1_555 ? 
318  FC8 7 HOH CJ .    ? HOH A 9983 . ? 1_555 ? 
319  FC8 7 G   B  92   ? G   B 3092 . ? 1_555 ? 
320  FC9 6 G   A  470  ? G   A 471  . ? 1_555 ? 
321  FC9 6 HOH CJ .    ? HOH A 3432 . ? 1_555 ? 
322  FC9 6 HOH CJ .    ? HOH A 4786 . ? 1_555 ? 
323  FC9 6 HOH CJ .    ? HOH A 6001 . ? 1_555 ? 
324  FC9 6 HOH CJ .    ? HOH A 9601 . ? 1_555 ? 
325  FC9 6 HOH CJ .    ? HOH A 9639 . ? 1_555 ? 
326  GC1 6 C   A  161  ? C   A 162  . ? 1_555 ? 
327  GC1 6 U   A  2275 ? U   A 2276 . ? 1_555 ? 
328  GC1 6 HOH CJ .    ? HOH A 8253 . ? 1_555 ? 
329  GC1 6 HOH CJ .    ? HOH A 8343 . ? 1_555 ? 
330  GC1 6 HOH CJ .    ? HOH A 8345 . ? 1_555 ? 
331  GC1 6 HOH CJ .    ? HOH A 9828 . ? 1_555 ? 
332  GC2 6 A   A  2756 ? A   A 2757 . ? 1_555 ? 
333  GC2 6 HOH CJ .    ? HOH A 3372 . ? 1_555 ? 
334  GC2 6 HOH CJ .    ? HOH A 4063 . ? 1_555 ? 
335  GC2 6 HOH CJ .    ? HOH A 4371 . ? 1_555 ? 
336  GC2 6 ASN D  335  ? ASN D 335  . ? 1_555 ? 
337  GC2 6 HOH FJ .    ? HOH D 8659 . ? 1_555 ? 
338  GC3 5 U   A  1882 ? U   A 1883 . ? 1_555 ? 
339  GC3 5 U   A  2011 ? U   A 2012 . ? 1_555 ? 
340  GC3 5 G   A  2012 ? G   A 2013 . ? 1_555 ? 
341  GC3 5 HOH CJ .    ? HOH A 5400 . ? 1_555 ? 
342  GC3 5 GLN C  207  ? GLN C 207  . ? 1_555 ? 
343  GC4 6 G   A  2012 ? G   A 2013 . ? 1_555 ? 
344  GC4 6 HOH CJ .    ? HOH A 4159 . ? 1_555 ? 
345  GC4 6 HOH CJ .    ? HOH A 8346 . ? 1_555 ? 
346  GC4 6 HOH CJ .    ? HOH A 8347 . ? 1_555 ? 
347  GC4 6 HOH EJ .    ? HOH C 8641 . ? 1_555 ? 
348  GC4 6 HOH EJ .    ? HOH C 8643 . ? 1_555 ? 
349  GC5 7 G   A  2617 ? G   A 2618 . ? 1_555 ? 
350  GC5 7 HOH CJ .    ? HOH A 4117 . ? 1_555 ? 
351  GC5 7 HOH CJ .    ? HOH A 4446 . ? 1_555 ? 
352  GC5 7 MG  GD .    ? MG  A 8085 . ? 1_555 ? 
353  GC5 7 HOH CJ .    ? HOH A 8261 . ? 1_555 ? 
354  GC5 7 HOH CJ .    ? HOH A 9442 . ? 1_555 ? 
355  GC5 7 HOH CJ .    ? HOH A 9446 . ? 1_555 ? 
356  GC6 7 G   A  174  ? G   A 175  . ? 1_555 ? 
357  GC6 7 U   A  223  ? U   A 224  . ? 1_555 ? 
358  GC6 7 G   A  392  ? G   A 393  . ? 1_555 ? 
359  GC6 7 HOH CJ .    ? HOH A 8348 . ? 1_555 ? 
360  GC6 7 HOH CJ .    ? HOH A 8351 . ? 1_555 ? 
361  GC6 7 HOH CJ .    ? HOH A 8369 . ? 1_555 ? 
362  GC6 7 HOH CJ .    ? HOH A 9570 . ? 1_555 ? 
363  GC7 6 A   A  1368 ? A   A 1369 . ? 1_555 ? 
364  GC7 6 U   A  2649 ? U   A 2650 . ? 1_555 ? 
365  GC7 6 HOH CJ .    ? HOH A 3211 . ? 1_555 ? 
366  GC7 6 HOH CJ .    ? HOH A 8380 . ? 1_555 ? 
367  GC7 6 HOH CJ .    ? HOH A 8383 . ? 1_555 ? 
368  GC7 6 HOH CJ .    ? HOH A 8386 . ? 1_555 ? 
369  GC8 6 G   A  1488 ? G   A 1489 . ? 1_555 ? 
370  GC8 6 G   A  1490 ? G   A 1491 . ? 1_555 ? 
371  GC8 6 HOH CJ .    ? HOH A 4028 . ? 1_555 ? 
372  GC8 6 HOH CJ .    ? HOH A 4355 . ? 1_555 ? 
373  GC8 6 HOH CJ .    ? HOH A 6562 . ? 1_555 ? 
374  GC8 6 HOH CJ .    ? HOH A 9790 . ? 1_555 ? 
375  GC9 6 HOH CJ .    ? HOH A 4573 . ? 1_555 ? 
376  GC9 6 HOH CJ .    ? HOH A 7389 . ? 1_555 ? 
377  GC9 6 HOH CJ .    ? HOH A 7814 . ? 1_555 ? 
378  GC9 6 HOH CJ .    ? HOH A 8246 . ? 1_555 ? 
379  GC9 6 HOH CJ .    ? HOH A 8395 . ? 1_555 ? 
380  GC9 6 HOH CJ .    ? HOH A 8445 . ? 1_555 ? 
381  HC1 6 U   A  2276 ? U   A 2277 . ? 1_555 ? 
382  HC1 6 U   A  2277 ? U   A 2278 . ? 1_555 ? 
383  HC1 6 G   A  2470 ? G   A 2471 . ? 1_555 ? 
384  HC1 6 HOH CJ .    ? HOH A 4148 . ? 1_555 ? 
385  HC1 6 HOH CJ .    ? HOH A 4156 . ? 1_555 ? 
386  HC1 6 HOH CJ .    ? HOH A 9982 . ? 1_555 ? 
387  HC2 5 C   A  1871 ? C   A 1872 . ? 1_555 ? 
388  HC2 5 G   A  1872 ? G   A 1873 . ? 1_555 ? 
389  HC2 5 HOH CJ .    ? HOH A 4740 . ? 1_555 ? 
390  HC2 5 ASP C  26   ? ASP C 26   . ? 1_555 ? 
391  HC2 5 HOH EJ .    ? HOH C 8554 . ? 1_555 ? 
392  HC3 5 A   A  1844 ? A   A 1845 . ? 1_555 ? 
393  HC3 5 U   A  1845 ? U   A 1846 . ? 1_555 ? 
394  HC3 5 G   A  1883 ? G   A 1884 . ? 1_555 ? 
395  HC3 5 HOH CJ .    ? HOH A 8388 . ? 1_555 ? 
396  HC3 5 ASN C  188  ? ASN C 188  . ? 1_555 ? 
397  HC4 6 A   A  2567 ? A   A 2568 . ? 1_555 ? 
398  HC4 6 HOH CJ .    ? HOH A 3127 . ? 1_555 ? 
399  HC4 6 HOH CJ .    ? HOH A 4147 . ? 1_555 ? 
400  HC4 6 HOH CJ .    ? HOH A 5208 . ? 1_555 ? 
401  HC4 6 HOH CJ .    ? HOH A 6612 . ? 1_555 ? 
402  HC4 6 HOH CJ .    ? HOH A 8446 . ? 1_555 ? 
403  HC5 5 A   A  165  ? A   A 166  . ? 1_555 ? 
404  HC5 5 G   A  218  ? G   A 219  . ? 1_555 ? 
405  HC5 5 HOH CJ .    ? HOH A 4213 . ? 1_555 ? 
406  HC5 5 HOH CJ .    ? HOH A 5347 . ? 1_555 ? 
407  HC5 5 HOH CJ .    ? HOH A 9524 . ? 1_555 ? 
408  HC6 6 HOH CJ .    ? HOH A 4507 . ? 1_555 ? 
409  HC6 6 HOH CJ .    ? HOH A 6440 . ? 1_555 ? 
410  HC6 6 HOH CJ .    ? HOH A 7800 . ? 1_555 ? 
411  HC6 6 HOH CJ .    ? HOH A 7936 . ? 1_555 ? 
412  HC6 6 HOH CJ .    ? HOH A 8393 . ? 1_555 ? 
413  HC6 6 HOH CJ .    ? HOH A 8394 . ? 1_555 ? 
414  HC7 6 U   A  953  ? U   A 954  . ? 1_555 ? 
415  HC7 6 HOH CJ .    ? HOH A 3622 . ? 1_555 ? 
416  HC7 6 HOH CJ .    ? HOH A 4392 . ? 1_555 ? 
417  HC7 6 HOH CJ .    ? HOH A 7796 . ? 1_555 ? 
418  HC7 6 HOH CJ .    ? HOH A 8392 . ? 1_555 ? 
419  HC7 6 HOH CJ .    ? HOH A 8447 . ? 1_555 ? 
420  HC8 6 A   A  1285 ? A   A 1286 . ? 1_555 ? 
421  HC8 6 A   A  1286 ? A   A 1287 . ? 1_555 ? 
422  HC8 6 HOH CJ .    ? HOH A 8389 . ? 1_555 ? 
423  HC8 6 HOH CJ .    ? HOH A 8390 . ? 1_555 ? 
424  HC8 6 HOH CJ .    ? HOH A 8448 . ? 1_555 ? 
425  HC8 6 HOH ZJ .    ? HOH X 7874 . ? 1_555 ? 
426  HC9 6 A   A  906  ? A   A 907  . ? 1_555 ? 
427  HC9 6 A   A  907  ? A   A 908  . ? 1_555 ? 
428  HC9 6 HOH CJ .    ? HOH A 4032 . ? 1_555 ? 
429  HC9 6 HOH CJ .    ? HOH A 4314 . ? 1_555 ? 
430  HC9 6 HOH CJ .    ? HOH A 5325 . ? 1_555 ? 
431  HC9 6 HOH CJ .    ? HOH A 8391 . ? 1_555 ? 
432  IC1 6 HOH EK .    ? HOH 3 7875 . ? 1_555 ? 
433  IC1 6 HOH CJ .    ? HOH A 7233 . ? 1_555 ? 
434  IC1 6 HOH CJ .    ? HOH A 8396 . ? 1_555 ? 
435  IC1 6 HOH CJ .    ? HOH A 8397 . ? 1_555 ? 
436  IC1 6 HOH CJ .    ? HOH A 8449 . ? 1_555 ? 
437  IC1 6 HOH CJ .    ? HOH A 8450 . ? 1_555 ? 
438  IC2 6 C   A  879  ? C   A 880  . ? 1_555 ? 
439  IC2 6 U   A  882  ? U   A 883  . ? 1_555 ? 
440  IC2 6 HOH CJ .    ? HOH A 4018 . ? 1_555 ? 
441  IC2 6 HOH CJ .    ? HOH A 8398 . ? 1_555 ? 
442  IC2 6 HOH CJ .    ? HOH A 8399 . ? 1_555 ? 
443  IC2 6 HOH CJ .    ? HOH A 9638 . ? 1_555 ? 
444  IC3 6 A   A  164  ? A   A 165  . ? 1_555 ? 
445  IC3 6 A   A  166  ? A   A 167  . ? 1_555 ? 
446  IC3 6 C   A  167  ? C   A 168  . ? 1_555 ? 
447  IC3 6 HOH CJ .    ? HOH A 4006 . ? 1_555 ? 
448  IC3 6 HOH CJ .    ? HOH A 4012 . ? 1_555 ? 
449  IC3 6 HOH CJ .    ? HOH A 4024 . ? 1_555 ? 
450  IC4 7 A   A  1683 ? A   A 1684 . ? 1_555 ? 
451  IC4 7 U   A  1723 ? U   A 1724 . ? 1_555 ? 
452  IC4 7 HOH CJ .    ? HOH A 4597 . ? 1_555 ? 
453  IC4 7 HOH CJ .    ? HOH A 4881 . ? 1_555 ? 
454  IC4 7 HOH CJ .    ? HOH A 7066 . ? 1_555 ? 
455  IC4 7 HOH CJ .    ? HOH A 8400 . ? 1_555 ? 
456  IC4 7 HOH CJ .    ? HOH A 8452 . ? 1_555 ? 
457  IC5 5 C   A  1419 ? C   A 1420 . ? 1_555 ? 
458  IC5 5 C   A  1420 ? C   A 1421 . ? 1_555 ? 
459  IC5 5 G   A  1437 ? G   A 1438 . ? 1_555 ? 
460  IC5 5 HOH CJ .    ? HOH A 3004 . ? 1_555 ? 
461  IC5 5 HOH CJ .    ? HOH A 4493 . ? 1_555 ? 
462  IC6 5 A   A  1436 ? A   A 1437 . ? 1_555 ? 
463  IC6 5 HOH CJ .    ? HOH A 5549 . ? 1_555 ? 
464  IC6 5 HOH CJ .    ? HOH A 5633 . ? 1_555 ? 
465  IC6 5 HOH CJ .    ? HOH A 8460 . ? 1_555 ? 
466  IC6 5 HOH SJ .    ? HOH Q 220  . ? 1_555 ? 
467  IC7 6 A   A  1753 ? A   A 1754 . ? 1_555 ? 
468  IC7 6 HOH CJ .    ? HOH A 4102 . ? 1_555 ? 
469  IC7 6 HOH CJ .    ? HOH A 4544 . ? 1_555 ? 
470  IC7 6 HOH CJ .    ? HOH A 6744 . ? 1_555 ? 
471  IC7 6 HOH CJ .    ? HOH A 8401 . ? 1_555 ? 
472  IC7 6 HOH CJ .    ? HOH A 8453 . ? 1_555 ? 
473  IC8 6 A   A  1741 ? A   A 1742 . ? 1_555 ? 
474  IC8 6 HOH CJ .    ? HOH A 3146 . ? 1_555 ? 
475  IC8 6 HOH CJ .    ? HOH A 4030 . ? 1_555 ? 
476  IC8 6 HOH CJ .    ? HOH A 8402 . ? 1_555 ? 
477  IC8 6 HOH CJ .    ? HOH A 9647 . ? 1_555 ? 
478  IC8 6 HOH CJ .    ? HOH A 9768 . ? 1_555 ? 
479  IC9 8 G   A  2616 ? G   A 2617 . ? 1_555 ? 
480  IC9 8 G   A  2617 ? G   A 2618 . ? 1_555 ? 
481  IC9 8 HOH CJ .    ? HOH A 4183 . ? 1_555 ? 
482  IC9 8 HOH CJ .    ? HOH A 4748 . ? 1_555 ? 
483  IC9 8 HOH CJ .    ? HOH A 4874 . ? 1_555 ? 
484  IC9 8 MG  KC .    ? MG  A 8059 . ? 1_555 ? 
485  IC9 8 HOH CJ .    ? HOH A 9442 . ? 1_555 ? 
486  IC9 8 HOH CJ .    ? HOH A 9994 . ? 1_555 ? 
487  JC1 6 A   A  531  ? A   A 532  . ? 1_555 ? 
488  JC1 6 U   A  532  ? U   A 533  . ? 1_555 ? 
489  JC1 6 HOH CJ .    ? HOH A 4129 . ? 1_555 ? 
490  JC1 6 HOH CJ .    ? HOH A 4372 . ? 1_555 ? 
491  JC1 6 HOH CJ .    ? HOH A 8403 . ? 1_555 ? 
492  JC1 6 HOH CJ .    ? HOH A 8404 . ? 1_555 ? 
493  JC2 4 A   A  681  ? A   A 682  . ? 1_555 ? 
494  JC2 4 G   A  682  ? G   A 683  . ? 1_555 ? 
495  JC2 4 HOH CJ .    ? HOH A 4072 . ? 1_555 ? 
496  JC2 4 HOH CJ .    ? HOH A 8461 . ? 1_555 ? 
497  JC3 7 G   A  2539 ? G   A 2540 . ? 1_555 ? 
498  JC3 7 G   A  2610 ? G   A 2611 . ? 1_555 ? 
499  JC3 7 HOH CJ .    ? HOH A 3436 . ? 1_555 ? 
500  JC3 7 HOH CJ .    ? HOH A 4684 . ? 1_555 ? 
501  JC3 7 NA  SF .    ? NA  A 8339 . ? 1_555 ? 
502  JC3 7 HOH CJ .    ? HOH A 9468 . ? 1_555 ? 
503  JC3 7 HOH CJ .    ? HOH A 9692 . ? 1_555 ? 
504  JC4 7 C   A  514  ? C   A 515  . ? 1_555 ? 
505  JC4 7 A   A  515  ? A   A 516  . ? 1_555 ? 
506  JC4 7 U   A  516  ? U   A 517  . ? 1_555 ? 
507  JC4 7 G   A  517  ? G   A 518  . ? 1_555 ? 
508  JC4 7 HOH CJ .    ? HOH A 8405 . ? 1_555 ? 
509  JC4 7 HOH CJ .    ? HOH A 8454 . ? 1_555 ? 
510  JC4 7 HOH CJ .    ? HOH A 8455 . ? 1_555 ? 
511  JC5 4 A   A  2102 ? A   A 2103 . ? 1_555 ? 
512  JC5 4 U   A  2477 ? U   A 2478 . ? 1_555 ? 
513  JC5 4 HOH CJ .    ? HOH A 4010 . ? 1_555 ? 
514  JC5 4 HOH CJ .    ? HOH A 4193 . ? 1_555 ? 
515  JC6 7 G   A  917  ? G   A 918  . ? 1_555 ? 
516  JC6 7 C   A  2293 ? C   A 2294 . ? 1_555 ? 
517  JC6 7 HOH CJ .    ? HOH A 3714 . ? 1_555 ? 
518  JC6 7 HOH CJ .    ? HOH A 6870 . ? 1_555 ? 
519  JC6 7 HOH CJ .    ? HOH A 8406 . ? 1_555 ? 
520  JC6 7 HOH CJ .    ? HOH A 9495 . ? 1_555 ? 
521  JC6 7 HOH CJ .    ? HOH A 9937 . ? 1_555 ? 
522  JC7 4 C   A  1843 ? C   A 1844 . ? 1_555 ? 
523  JC7 4 HOH CJ .    ? HOH A 4040 . ? 1_555 ? 
524  JC7 4 HOH CJ .    ? HOH A 4055 . ? 1_555 ? 
525  JC7 4 HOH CJ .    ? HOH A 8456 . ? 1_555 ? 
526  JC8 6 A   A  1069 ? A   A 1070 . ? 1_555 ? 
527  JC8 6 G   A  1070 ? G   A 1071 . ? 1_555 ? 
528  JC8 6 HOH CJ .    ? HOH A 3075 . ? 1_555 ? 
529  JC8 6 HOH CJ .    ? HOH A 4046 . ? 1_555 ? 
530  JC8 6 HOH CJ .    ? HOH A 4077 . ? 1_555 ? 
531  JC8 6 HOH CJ .    ? HOH A 4118 . ? 1_555 ? 
532  JC9 4 U   A  1095 ? U   A 1096 . ? 1_555 ? 
533  JC9 4 C   A  1256 ? C   A 1257 . ? 1_555 ? 
534  JC9 4 HOH CJ .    ? HOH A 8407 . ? 1_555 ? 
535  JC9 4 HOH CJ .    ? HOH A 8457 . ? 1_555 ? 
536  KC1 7 G   A  1847 ? G   A 1848 . ? 1_555 ? 
537  KC1 7 G   A  1848 ? G   A 1849 . ? 1_555 ? 
538  KC1 7 HOH CJ .    ? HOH A 4058 . ? 1_555 ? 
539  KC1 7 HOH CJ .    ? HOH A 4095 . ? 1_555 ? 
540  KC1 7 HOH CJ .    ? HOH A 4230 . ? 1_555 ? 
541  KC1 7 HOH CJ .    ? HOH A 4262 . ? 1_555 ? 
542  KC1 7 MG  IE .    ? MG  A 8116 . ? 1_555 ? 
543  KC2 6 G   A  862  ? G   A 863  . ? 1_555 ? 
544  KC2 6 U   A  863  ? U   A 864  . ? 1_555 ? 
545  KC2 6 HOH CJ .    ? HOH A 3732 . ? 1_555 ? 
546  KC2 6 HOH CJ .    ? HOH A 4067 . ? 1_555 ? 
547  KC2 6 HOH CJ .    ? HOH A 4071 . ? 1_555 ? 
548  KC2 6 HOH CJ .    ? HOH A 5939 . ? 1_555 ? 
549  KC3 7 A   A  906  ? A   A 907  . ? 1_555 ? 
550  KC3 7 HOH CJ .    ? HOH A 3332 . ? 1_555 ? 
551  KC3 7 HOH CJ .    ? HOH A 3761 . ? 1_555 ? 
552  KC3 7 HOH CJ .    ? HOH A 4079 . ? 1_555 ? 
553  KC3 7 HOH CJ .    ? HOH A 4144 . ? 1_555 ? 
554  KC3 7 LYS Z  145  ? LYS Z 145  . ? 1_555 ? 
555  KC3 7 HOH BK .    ? HOH Z 8573 . ? 1_555 ? 
556  KC4 4 A   A  2611 ? A   A 2612 . ? 1_555 ? 
557  KC4 4 HOH CJ .    ? HOH A 3406 . ? 1_555 ? 
558  KC4 4 HOH CJ .    ? HOH A 4062 . ? 1_555 ? 
559  KC4 4 HOH CJ .    ? HOH A 4074 . ? 1_555 ? 
560  KC5 6 G   A  2079 ? G   A 2080 . ? 1_555 ? 
561  KC5 6 HOH CJ .    ? HOH A 4162 . ? 1_555 ? 
562  KC5 6 HOH CJ .    ? HOH A 4640 . ? 1_555 ? 
563  KC5 6 HOH CJ .    ? HOH A 5893 . ? 1_555 ? 
564  KC5 6 HOH CJ .    ? HOH A 8408 . ? 1_555 ? 
565  KC5 6 HOH CJ .    ? HOH A 8409 . ? 1_555 ? 
566  KC6 4 C   A  2280 ? C   A 2281 . ? 1_555 ? 
567  KC6 4 U   A  2281 ? U   A 2282 . ? 1_555 ? 
568  KC6 4 HOH CJ .    ? HOH A 4143 . ? 1_555 ? 
569  KC6 4 HOH CJ .    ? HOH A 5013 . ? 1_555 ? 
570  KC7 4 A   A  2433 ? A   A 2434 . ? 1_555 ? 
571  KC7 4 U   A  2457 ? U   A 2458 . ? 1_555 ? 
572  KC7 4 HOH CJ .    ? HOH A 8465 . ? 1_555 ? 
573  KC7 4 HOH CJ .    ? HOH A 9650 . ? 1_555 ? 
574  KC8 4 A   A  2576 ? A   A 2577 . ? 1_555 ? 
575  KC8 4 G   A  2577 ? G   A 2578 . ? 1_555 ? 
576  KC8 4 G   A  2578 ? G   A 2579 . ? 1_555 ? 
577  KC8 4 HOH CJ .    ? HOH A 8458 . ? 1_555 ? 
578  KC9 5 C   A  2103 ? C   A 2104 . ? 1_555 ? 
579  KC9 5 C   A  2104 ? C   A 2105 . ? 1_555 ? 
580  KC9 5 HOH CJ .    ? HOH A 8242 . ? 1_555 ? 
581  KC9 5 HOH CJ .    ? HOH A 8243 . ? 1_555 ? 
582  KC9 5 HOH CJ .    ? HOH A 8244 . ? 1_555 ? 
583  LC1 7 G   A  816  ? G   A 817  . ? 1_555 ? 
584  LC1 7 HOH CJ .    ? HOH A 3995 . ? 1_555 ? 
585  LC1 7 HOH CJ .    ? HOH A 7797 . ? 1_555 ? 
586  LC1 7 MG  VB .    ? MG  A 8043 . ? 1_555 ? 
587  LC1 7 HOH CJ .    ? HOH A 8422 . ? 1_555 ? 
588  LC1 7 HOH SJ .    ? HOH Q 192  . ? 1_555 ? 
589  LC1 7 HOH SJ .    ? HOH Q 214  . ? 1_555 ? 
590  LC2 7 C   A  1104 ? C   A 1105 . ? 1_555 ? 
591  LC2 7 A   A  1105 ? A   A 1106 . ? 1_555 ? 
592  LC2 7 A   A  1106 ? A   A 1107 . ? 1_555 ? 
593  LC2 7 HOH CJ .    ? HOH A 8431 . ? 1_555 ? 
594  LC2 7 HOH CJ .    ? HOH A 8432 . ? 1_555 ? 
595  LC2 7 HOH CJ .    ? HOH A 8433 . ? 1_555 ? 
596  LC2 7 HOH CJ .    ? HOH A 8434 . ? 1_555 ? 
597  LC3 6 G   A  1999 ? G   A 2000 . ? 1_555 ? 
598  LC3 6 HOH CJ .    ? HOH A 6484 . ? 1_555 ? 
599  LC3 6 HOH CJ .    ? HOH A 7872 . ? 1_555 ? 
600  LC3 6 HOH CJ .    ? HOH A 8436 . ? 1_555 ? 
601  LC3 6 HOH CJ .    ? HOH A 8437 . ? 1_555 ? 
602  LC3 6 HOH CJ .    ? HOH A 8438 . ? 1_555 ? 
603  LC4 6 U   A  902  ? U   A 903  . ? 1_555 ? 
604  LC4 6 A   A  1356 ? A   A 1357 . ? 1_555 ? 
605  LC4 6 HOH CJ .    ? HOH A 4324 . ? 1_555 ? 
606  LC4 6 HOH CJ .    ? HOH A 5788 . ? 1_555 ? 
607  LC4 6 HOH CJ .    ? HOH A 6418 . ? 1_555 ? 
608  LC4 6 HOH CJ .    ? HOH A 9900 . ? 1_555 ? 
609  LC5 7 G   A  2608 ? G   A 2609 . ? 1_555 ? 
610  LC5 7 U   A  2609 ? U   A 2610 . ? 1_555 ? 
611  LC5 7 HOH CJ .    ? HOH A 3689 . ? 1_555 ? 
612  LC5 7 HOH CJ .    ? HOH A 4092 . ? 1_555 ? 
613  LC5 7 HOH CJ .    ? HOH A 4116 . ? 1_555 ? 
614  LC5 7 HOH CJ .    ? HOH A 5986 . ? 1_555 ? 
615  LC5 7 HOH CJ .    ? HOH A 6136 . ? 1_555 ? 
616  LC6 6 A   A  186  ? A   A 187  . ? 1_555 ? 
617  LC6 6 HOH CJ .    ? HOH A 4123 . ? 1_555 ? 
618  LC6 6 HOH CJ .    ? HOH A 4163 . ? 1_555 ? 
619  LC6 6 HOH CJ .    ? HOH A 9529 . ? 1_555 ? 
620  LC6 6 HOH CJ .    ? HOH A 9728 . ? 1_555 ? 
621  LC6 6 HOH CJ .    ? HOH A 9959 . ? 1_555 ? 
622  LC7 6 A   A  2111 ? A   A 2112 . ? 1_555 ? 
623  LC7 6 HOH CJ .    ? HOH A 4148 . ? 1_555 ? 
624  LC7 6 HOH CJ .    ? HOH A 4322 . ? 1_555 ? 
625  LC7 6 HOH CJ .    ? HOH A 6517 . ? 1_555 ? 
626  LC7 6 HOH CJ .    ? HOH A 6788 . ? 1_555 ? 
627  LC7 6 HOH CJ .    ? HOH A 9982 . ? 1_555 ? 
628  LC8 8 LYS DA 54   ? LYS 4 54   . ? 1_555 ? 
629  LC8 8 HOH FK .    ? HOH 4 8534 . ? 1_555 ? 
630  LC8 8 A   A  2429 ? A   A 2430 . ? 1_555 ? 
631  LC8 8 C   A  2430 ? C   A 2431 . ? 1_555 ? 
632  LC8 8 HOH CJ .    ? HOH A 4064 . ? 1_555 ? 
633  LC8 8 HOH CJ .    ? HOH A 4852 . ? 1_555 ? 
634  LC8 8 HOH CJ .    ? HOH A 9745 . ? 1_555 ? 
635  LC8 8 HOH CJ .    ? HOH A 9846 . ? 1_555 ? 
636  LC9 7 HOH CJ .    ? HOH A 4676 . ? 1_555 ? 
637  LC9 7 HOH CJ .    ? HOH A 4693 . ? 1_555 ? 
638  LC9 7 HOH CJ .    ? HOH A 6798 . ? 1_555 ? 
639  LC9 7 HOH CJ .    ? HOH A 6988 . ? 1_555 ? 
640  LC9 7 HOH CJ .    ? HOH A 7117 . ? 1_555 ? 
641  LC9 7 HOH EJ .    ? HOH C 8558 . ? 1_555 ? 
642  LC9 7 HOH EJ .    ? HOH C 8644 . ? 1_555 ? 
643  MC1 7 G   A  1848 ? G   A 1849 . ? 1_555 ? 
644  MC1 7 U   A  1849 ? U   A 1850 . ? 1_555 ? 
645  MC1 7 HOH CJ .    ? HOH A 4058 . ? 1_555 ? 
646  MC1 7 HOH CJ .    ? HOH A 4262 . ? 1_555 ? 
647  MC1 7 HOH CJ .    ? HOH A 7117 . ? 1_555 ? 
648  MC1 7 MG  QD .    ? MG  A 8096 . ? 1_555 ? 
649  MC1 7 HOH EJ .    ? HOH C 8558 . ? 1_555 ? 
650  MC2 6 A   A  1839 ? A   A 1840 . ? 1_555 ? 
651  MC2 6 C   A  1840 ? C   A 1841 . ? 1_555 ? 
652  MC2 6 A   A  2021 ? A   A 2022 . ? 1_555 ? 
653  MC2 6 HOH CJ .    ? HOH A 5027 . ? 1_555 ? 
654  MC2 6 HOH CJ .    ? HOH A 6948 . ? 1_555 ? 
655  MC2 6 HOH CJ .    ? HOH A 9622 . ? 1_555 ? 
656  MC3 5 C   A  161  ? C   A 162  . ? 1_555 ? 
657  MC3 5 U   A  162  ? U   A 163  . ? 1_555 ? 
658  MC3 5 U   A  171  ? U   A 172  . ? 1_555 ? 
659  MC3 5 HOH CJ .    ? HOH A 8345 . ? 1_555 ? 
660  MC3 5 ARG N  82   ? ARG N 82   . ? 1_555 ? 
661  MC4 6 C   A  1068 ? C   A 1069 . ? 1_555 ? 
662  MC4 6 G   A  1071 ? G   A 1072 . ? 1_555 ? 
663  MC4 6 G   A  1086 ? G   A 1087 . ? 1_555 ? 
664  MC4 6 HOH CJ .    ? HOH A 3558 . ? 1_555 ? 
665  MC4 6 HOH CJ .    ? HOH A 3590 . ? 1_555 ? 
666  MC4 6 HOH CJ .    ? HOH A 5360 . ? 1_555 ? 
667  MC5 6 G   A  1118 ? G   A 1119 . ? 1_555 ? 
668  MC5 6 U   A  1119 ? U   A 1120 . ? 1_555 ? 
669  MC5 6 G   A  1120 ? G   A 1121 . ? 1_555 ? 
670  MC5 6 U   A  1121 ? U   A 1122 . ? 1_555 ? 
671  MC5 6 HOH CJ .    ? HOH A 4933 . ? 1_555 ? 
672  MC5 6 HOH CJ .    ? HOH A 6070 . ? 1_555 ? 
673  MC6 5 A   A  642  ? A   A 643  . ? 1_555 ? 
674  MC6 5 G   A  643  ? G   A 644  . ? 1_555 ? 
675  MC6 5 U   A  903  ? U   A 904  . ? 1_555 ? 
676  MC6 5 G   A  1353 ? G   A 1354 . ? 1_555 ? 
677  MC6 5 ARG M  8    ? ARG M 8    . ? 1_555 ? 
678  MC7 5 A   A  629  ? A   A 630  . ? 1_555 ? 
679  MC7 5 A   A  630  ? A   A 631  . ? 1_555 ? 
680  MC7 5 HOH CJ .    ? HOH A 4484 . ? 1_555 ? 
681  MC7 5 HOH CJ .    ? HOH A 5090 . ? 1_555 ? 
682  MC7 5 HOH CJ .    ? HOH A 6173 . ? 1_555 ? 
683  MC8 4 G   A  2091 ? G   A 2092 . ? 1_555 ? 
684  MC8 4 G   A  2092 ? G   A 2093 . ? 1_555 ? 
685  MC8 4 G   A  2093 ? G   A 2094 . ? 1_555 ? 
686  MC8 4 A   A  2648 ? A   A 2649 . ? 1_555 ? 
687  MC9 4 C   A  39   ? C   A 40   . ? 1_555 ? 
688  MC9 4 G   A  40   ? G   A 41   . ? 1_555 ? 
689  MC9 4 A   A  441  ? A   A 442  . ? 1_555 ? 
690  MC9 4 C   A  442  ? C   A 443  . ? 1_555 ? 
691  NC1 5 C   A  1393 ? C   A 1394 . ? 1_555 ? 
692  NC1 5 U   A  1431 ? U   A 1432 . ? 1_555 ? 
693  NC1 5 G   A  1432 ? G   A 1433 . ? 1_555 ? 
694  NC1 5 U   A  1723 ? U   A 1724 . ? 1_555 ? 
695  NC1 5 HOH CJ .    ? HOH A 3802 . ? 1_555 ? 
696  NC2 4 A   A  2576 ? A   A 2577 . ? 1_555 ? 
697  NC2 4 G   A  2577 ? G   A 2578 . ? 1_555 ? 
698  NC2 4 G   A  2578 ? G   A 2579 . ? 1_555 ? 
699  NC2 4 HOH CJ .    ? HOH A 4894 . ? 1_555 ? 
700  NC3 5 G   A  2523 ? G   A 2524 . ? 1_555 ? 
701  NC3 5 G   A  2524 ? G   A 2525 . ? 1_555 ? 
702  NC3 5 HOH CJ .    ? HOH A 3970 . ? 1_555 ? 
703  NC3 5 HOH CJ .    ? HOH A 5043 . ? 1_555 ? 
704  NC3 5 HOH CJ .    ? HOH A 9584 . ? 1_555 ? 
705  NC4 4 G   A  2398 ? G   A 2399 . ? 1_555 ? 
706  NC4 4 HOH CJ .    ? HOH A 3341 . ? 1_555 ? 
707  NC4 4 HOH CJ .    ? HOH A 4231 . ? 1_555 ? 
708  NC4 4 HOH CJ .    ? HOH A 5512 . ? 1_555 ? 
709  NC5 5 U   A  2540 ? U   A 2541 . ? 1_555 ? 
710  NC5 5 U   A  2606 ? U   A 2607 . ? 1_555 ? 
711  NC5 5 C   A  2607 ? C   A 2608 . ? 1_555 ? 
712  NC5 5 HOH CJ .    ? HOH A 9729 . ? 1_555 ? 
713  NC5 5 TRP D  242  ? TRP D 242  . ? 1_555 ? 
714  NC6 3 A   A  164  ? A   A 165  . ? 1_555 ? 
715  NC6 3 A   A  165  ? A   A 166  . ? 1_555 ? 
716  NC6 3 A   A  166  ? A   A 167  . ? 1_555 ? 
717  NC7 4 C   A  895  ? C   A 896  . ? 1_555 ? 
718  NC7 4 A   A  896  ? A   A 897  . ? 1_555 ? 
719  NC7 4 HOH CJ .    ? HOH A 6702 . ? 1_555 ? 
720  NC7 4 HOH CJ .    ? HOH A 9433 . ? 1_555 ? 
721  NC8 6 TRP CA 41   ? TRP 3 42   . ? 1_555 ? 
722  NC8 6 ASN CA 44   ? ASN 3 45   . ? 1_555 ? 
723  NC8 6 HOH EK .    ? HOH 3 4135 . ? 1_555 ? 
724  NC8 6 G   A  1415 ? G   A 1416 . ? 1_555 ? 
725  NC8 6 G   A  1416 ? G   A 1417 . ? 1_555 ? 
726  NC8 6 HOH CJ .    ? HOH A 9674 . ? 1_555 ? 
727  NC9 5 G   A  2542 ? G   A 2543 . ? 1_555 ? 
728  NC9 5 G   A  2543 ? G   A 2544 . ? 1_555 ? 
729  NC9 5 HOH CJ .    ? HOH A 3854 . ? 1_555 ? 
730  NC9 5 HOH CJ .    ? HOH A 4328 . ? 1_555 ? 
731  NC9 5 NA  BF .    ? NA  A 8320 . ? 1_555 ? 
732  OC1 6 A   A  2464 ? A   A 2465 . ? 1_555 ? 
733  OC1 6 G   A  2465 ? G   A 2466 . ? 1_555 ? 
734  OC1 6 HOH CJ .    ? HOH A 4650 . ? 1_555 ? 
735  OC1 6 HOH CJ .    ? HOH A 6433 . ? 1_555 ? 
736  OC1 6 HOH CJ .    ? HOH A 9464 . ? 1_555 ? 
737  OC1 6 ASP M  36   ? ASP M 36   . ? 1_555 ? 
738  OC2 8 G   A  2542 ? G   A 2543 . ? 1_555 ? 
739  OC2 8 G   A  2543 ? G   A 2544 . ? 1_555 ? 
740  OC2 8 G   A  2610 ? G   A 2611 . ? 1_555 ? 
741  OC2 8 U   A  2614 ? U   A 2615 . ? 1_555 ? 
742  OC2 8 HOH CJ .    ? HOH A 3137 . ? 1_555 ? 
743  OC2 8 NA  ZE .    ? NA  A 8318 . ? 1_555 ? 
744  OC2 8 HOH CJ .    ? HOH A 9461 . ? 1_555 ? 
745  OC2 8 HOH CJ .    ? HOH A 9490 . ? 1_555 ? 
746  OC3 5 G   A  835  ? G   A 836  . ? 1_555 ? 
747  OC3 5 U   A  836  ? U   A 837  . ? 1_555 ? 
748  OC3 5 A   A  1735 ? A   A 1736 . ? 1_555 ? 
749  OC3 5 A   A  1736 ? A   A 1737 . ? 1_555 ? 
750  OC3 5 ARG D  229  ? ARG D 229  . ? 1_555 ? 
751  OC4 6 G   A  884  ? G   A 885  . ? 1_555 ? 
752  OC4 6 A   A  2111 ? A   A 2112 . ? 1_555 ? 
753  OC4 6 G   A  2112 ? G   A 2113 . ? 1_555 ? 
754  OC4 6 C   A  2474 ? C   A 2475 . ? 1_555 ? 
755  OC4 6 C   A  2475 ? C   A 2476 . ? 1_555 ? 
756  OC4 6 HOH CJ .    ? HOH A 4868 . ? 1_555 ? 
757  OC5 6 C   A  129  ? C   A 130  . ? 1_555 ? 
758  OC5 6 U   A  145  ? U   A 146  . ? 1_555 ? 
759  OC5 6 G   A  146  ? G   A 147  . ? 1_555 ? 
760  OC5 6 HOH CJ .    ? HOH A 4523 . ? 1_555 ? 
761  OC5 6 HOH CJ .    ? HOH A 7537 . ? 1_555 ? 
762  OC5 6 HOH CJ .    ? HOH A 9886 . ? 1_555 ? 
763  OC6 7 A   A  775  ? A   A 776  . ? 1_555 ? 
764  OC6 7 U   A  776  ? U   A 777  . ? 1_555 ? 
765  OC6 7 U   A  778  ? U   A 779  . ? 1_555 ? 
766  OC6 7 HOH CJ .    ? HOH A 3019 . ? 1_555 ? 
767  OC6 7 HOH CJ .    ? HOH A 3666 . ? 1_555 ? 
768  OC6 7 MG  JB .    ? MG  A 8031 . ? 1_555 ? 
769  OC6 7 HOH CJ .    ? HOH A 8152 . ? 1_555 ? 
770  OC7 4 G   A  1970 ? G   A 1971 . ? 1_555 ? 
771  OC7 4 G   A  2008 ? G   A 2009 . ? 1_555 ? 
772  OC7 4 A   A  2009 ? A   A 2010 . ? 1_555 ? 
773  OC7 4 U   A  2011 ? U   A 2012 . ? 1_555 ? 
774  OC8 6 U   A  820  ? U   A 821  . ? 1_555 ? 
775  OC8 6 C   A  852  ? C   A 853  . ? 1_555 ? 
776  OC8 6 G   A  853  ? G   A 854  . ? 1_555 ? 
777  OC8 6 U   A  1830 ? U   A 1831 . ? 1_555 ? 
778  OC8 6 HOH CJ .    ? HOH A 3594 . ? 1_555 ? 
779  OC8 6 HOH CJ .    ? HOH A 9440 . ? 1_555 ? 
780  OC9 6 G   A  55   ? G   A 56   . ? 1_555 ? 
781  OC9 6 A   A  58   ? A   A 59   . ? 1_555 ? 
782  OC9 6 A   A  59   ? A   A 60   . ? 1_555 ? 
783  OC9 6 G   A  60   ? G   A 61   . ? 1_555 ? 
784  OC9 6 HOH CJ .    ? HOH A 5605 . ? 1_555 ? 
785  OC9 6 HOH CJ .    ? HOH A 6865 . ? 1_555 ? 
786  PC1 3 G   A  65   ? G   A 66   . ? 1_555 ? 
787  PC1 3 U   A  106  ? U   A 107  . ? 1_555 ? 
788  PC1 3 U   A  107  ? U   A 108  . ? 1_555 ? 
789  PC2 4 G   A  139  ? G   A 140  . ? 1_555 ? 
790  PC2 4 C   A  140  ? C   A 141  . ? 1_555 ? 
791  PC2 4 G   A  141  ? G   A 142  . ? 1_555 ? 
792  PC2 4 HOH CJ .    ? HOH A 9632 . ? 1_555 ? 
793  PC3 6 HOH FK .    ? HOH 4 8506 . ? 1_555 ? 
794  PC3 6 U   A  169  ? U   A 170  . ? 1_555 ? 
795  PC3 6 C   A  170  ? C   A 171  . ? 1_555 ? 
796  PC3 6 C   A  217  ? C   A 218  . ? 1_555 ? 
797  PC3 6 G   A  218  ? G   A 219  . ? 1_555 ? 
798  PC3 6 G   A  220  ? G   A 221  . ? 1_555 ? 
799  PC4 6 G   A  385  ? G   A 386  . ? 1_555 ? 
800  PC4 6 G   A  386  ? G   A 387  . ? 1_555 ? 
801  PC4 6 G   A  387  ? G   A 388  . ? 1_555 ? 
802  PC4 6 C   A  400  ? C   A 401  . ? 1_555 ? 
803  PC4 6 U   A  401  ? U   A 402  . ? 1_555 ? 
804  PC4 6 HOH CJ .    ? HOH A 7456 . ? 1_555 ? 
805  PC5 4 C   A  1893 ? C   A 1894 . ? 1_555 ? 
806  PC5 4 U   A  1896 ? U   A 1897 . ? 1_555 ? 
807  PC5 4 G   A  1897 ? G   A 1898 . ? 1_555 ? 
808  PC5 4 U   A  1938 ? U   A 1939 . ? 1_555 ? 
809  PC6 5 C   A  1893 ? C   A 1894 . ? 1_555 ? 
810  PC6 5 A   A  1894 ? A   A 1895 . ? 1_555 ? 
811  PC6 5 G   A  1895 ? G   A 1896 . ? 1_555 ? 
812  PC6 5 U   A  1896 ? U   A 1897 . ? 1_555 ? 
813  PC6 5 HOH CJ .    ? HOH A 5639 . ? 1_555 ? 
814  PC7 5 G   A  621  ? G   A 622  . ? 1_555 ? 
815  PC7 5 U   A  622  ? U   A 623  . ? 1_555 ? 
816  PC7 5 A   A  627  ? A   A 628  . ? 1_555 ? 
817  PC7 5 A   A  629  ? A   A 630  . ? 1_555 ? 
818  PC7 5 HOH CJ .    ? HOH A 3264 . ? 1_555 ? 
819  PC8 6 G   A  1705 ? G   A 1706 . ? 1_555 ? 
820  PC8 6 G   A  1706 ? G   A 1707 . ? 1_555 ? 
821  PC8 6 HOH CJ .    ? HOH A 3315 . ? 1_555 ? 
822  PC8 6 HOH CJ .    ? HOH A 5727 . ? 1_555 ? 
823  PC8 6 HOH CJ .    ? HOH A 7730 . ? 1_555 ? 
824  PC8 6 HOH CJ .    ? HOH A 8179 . ? 1_555 ? 
825  PC9 6 U   A  2658 ? U   A 2659 . ? 1_555 ? 
826  PC9 6 G   A  2659 ? G   A 2660 . ? 1_555 ? 
827  PC9 6 VAL S  72   ? VAL S 72   . ? 1_555 ? 
828  PC9 6 TRP S  75   ? TRP S 75   . ? 1_555 ? 
829  PC9 6 HOH UJ .    ? HOH S 8516 . ? 1_555 ? 
830  PC9 6 HOH UJ .    ? HOH S 8527 . ? 1_555 ? 
831  QC1 7 G   A  2539 ? G   A 2540 . ? 1_555 ? 
832  QC1 7 G   A  2610 ? G   A 2611 . ? 1_555 ? 
833  QC1 7 G   A  2615 ? G   A 2616 . ? 1_555 ? 
834  QC1 7 U   A  2644 ? U   A 2645 . ? 1_555 ? 
835  QC1 7 HOH CJ .    ? HOH A 3419 . ? 1_555 ? 
836  QC1 7 HOH CJ .    ? HOH A 4684 . ? 1_555 ? 
837  QC1 7 MG  JD .    ? MG  A 8088 . ? 1_555 ? 
838  QC2 4 U   A  1739 ? U   A 1740 . ? 1_555 ? 
839  QC2 4 U   A  1740 ? U   A 1741 . ? 1_555 ? 
840  QC2 4 G   A  2032 ? G   A 2033 . ? 1_555 ? 
841  QC2 4 HOH CJ .    ? HOH A 7204 . ? 1_555 ? 
842  QC3 3 G   A  680  ? G   A 681  . ? 1_555 ? 
843  QC3 3 A   A  681  ? A   A 682  . ? 1_555 ? 
844  QC3 3 G   A  682  ? G   A 683  . ? 1_555 ? 
845  QC4 5 G   A  890  ? G   A 891  . ? 1_555 ? 
846  QC4 5 G   A  891  ? G   A 892  . ? 1_555 ? 
847  QC4 5 C   A  892  ? C   A 893  . ? 1_555 ? 
848  QC4 5 HOH CJ .    ? HOH A 6012 . ? 1_555 ? 
849  QC4 5 HOH CJ .    ? HOH A 6655 . ? 1_555 ? 
850  QC5 6 U   A  2662 ? U   A 2663 . ? 1_555 ? 
851  QC5 6 A   A  2810 ? A   A 2811 . ? 1_555 ? 
852  QC5 6 A   A  2811 ? A   A 2812 . ? 1_555 ? 
853  QC5 6 A   A  2815 ? A   A 2816 . ? 1_555 ? 
854  QC5 6 G   A  2816 ? G   A 2817 . ? 1_555 ? 
855  QC5 6 HOH CJ .    ? HOH A 9621 . ? 1_555 ? 
856  QC6 5 A   A  913  ? A   A 914  . ? 1_555 ? 
857  QC6 5 C   A  914  ? C   A 915  . ? 1_555 ? 
858  QC6 5 C   A  1042 ? C   A 1043 . ? 1_555 ? 
859  QC6 5 C   A  1043 ? C   A 1044 . ? 1_555 ? 
860  QC6 5 G   A  1044 ? G   A 1045 . ? 1_555 ? 
861  QC7 5 U   A  622  ? U   A 623  . ? 1_555 ? 
862  QC7 5 U   A  623  ? U   A 624  . ? 1_555 ? 
863  QC7 5 G   A  900  ? G   A 901  . ? 1_555 ? 
864  QC7 5 HOH CJ .    ? HOH A 7342 . ? 1_555 ? 
865  QC7 5 HOH CJ .    ? HOH A 8239 . ? 1_555 ? 
866  QC8 4 A   A  954  ? A   A 955  . ? 1_555 ? 
867  QC8 4 HOH CJ .    ? HOH A 6992 . ? 1_555 ? 
868  QC8 4 C   B  81   ? C   B 3081 . ? 1_555 ? 
869  QC8 4 U   B  82   ? U   B 3082 . ? 1_555 ? 
870  QC9 6 A   A  1039 ? A   A 1040 . ? 1_555 ? 
871  QC9 6 G   A  1294 ? G   A 1295 . ? 1_555 ? 
872  QC9 6 A   A  1295 ? A   A 1296 . ? 1_555 ? 
873  QC9 6 HOH CJ .    ? HOH A 5264 . ? 1_555 ? 
874  QC9 6 GLY M  14   ? GLY M 14   . ? 1_555 ? 
875  QC9 6 HOH OJ .    ? HOH M 8515 . ? 1_555 ? 
876  RC1 5 U   A  767  ? U   A 768  . ? 1_555 ? 
877  RC1 5 C   A  768  ? C   A 769  . ? 1_555 ? 
878  RC1 5 G   A  2110 ? G   A 2111 . ? 1_555 ? 
879  RC1 5 A   A  2111 ? A   A 2112 . ? 1_555 ? 
880  RC1 5 HOH CJ .    ? HOH A 5205 . ? 1_555 ? 
881  RC2 4 G   A  1118 ? G   A 1119 . ? 1_555 ? 
882  RC2 4 C   A  1242 ? C   A 1243 . ? 1_555 ? 
883  RC2 4 HOH CJ .    ? HOH A 5198 . ? 1_555 ? 
884  RC2 4 THR K  47   ? THR K 47   . ? 1_555 ? 
885  RC3 6 C   A  919  ? C   A 920  . ? 1_555 ? 
886  RC3 6 U   A  2277 ? U   A 2278 . ? 1_555 ? 
887  RC3 6 G   A  2278 ? G   A 2279 . ? 1_555 ? 
888  RC3 6 A   A  2462 ? A   A 2463 . ? 1_555 ? 
889  RC3 6 A   A  2466 ? A   A 2467 . ? 1_555 ? 
890  RC3 6 HOH CJ .    ? HOH A 9850 . ? 1_555 ? 
891  RC4 6 G   A  940  ? G   A 941  . ? 1_555 ? 
892  RC4 6 U   A  941  ? U   A 942  . ? 1_555 ? 
893  RC4 6 C   A  1022 ? C   A 1023 . ? 1_555 ? 
894  RC4 6 G   A  1023 ? G   A 1024 . ? 1_555 ? 
895  RC4 6 C   A  1024 ? C   A 1025 . ? 1_555 ? 
896  RC4 6 HOH CJ .    ? HOH A 6661 . ? 1_555 ? 
897  RC5 8 G   A  2093 ? G   A 2094 . ? 1_555 ? 
898  RC5 8 G   A  2610 ? G   A 2611 . ? 1_555 ? 
899  RC5 8 HOH CJ .    ? HOH A 4136 . ? 1_555 ? 
900  RC5 8 HOH CJ .    ? HOH A 4267 . ? 1_555 ? 
901  RC5 8 HOH CJ .    ? HOH A 7808 . ? 1_555 ? 
902  RC5 8 HOH CJ .    ? HOH A 8274 . ? 1_555 ? 
903  RC5 8 HOH CJ .    ? HOH A 9731 . ? 1_555 ? 
904  RC5 8 HOH CJ .    ? HOH A 9880 . ? 1_555 ? 
905  RC6 5 G   A  897  ? G   A 898  . ? 1_555 ? 
906  RC6 5 A   A  921  ? A   A 922  . ? 1_555 ? 
907  RC6 5 A   A  922  ? A   A 923  . ? 1_555 ? 
908  RC6 5 G   A  923  ? G   A 924  . ? 1_555 ? 
909  RC6 5 U   A  2108 ? U   A 2109 . ? 1_555 ? 
910  RC7 5 A   A  452  ? A   A 453  . ? 1_555 ? 
911  RC7 5 U   A  453  ? U   A 454  . ? 1_555 ? 
912  RC7 5 C   A  477  ? C   A 478  . ? 1_555 ? 
913  RC7 5 G   A  478  ? G   A 479  . ? 1_555 ? 
914  RC7 5 HOH CJ .    ? HOH A 6344 . ? 1_555 ? 
915  RC8 5 U   A  836  ? U   A 837  . ? 1_555 ? 
916  RC8 5 HOH CJ .    ? HOH A 4979 . ? 1_555 ? 
917  RC8 5 HOH CJ .    ? HOH A 5294 . ? 1_555 ? 
918  RC8 5 HOH CJ .    ? HOH A 7719 . ? 1_555 ? 
919  RC8 5 GLN D  230  ? GLN D 230  . ? 1_555 ? 
920  RC9 6 A   A  166  ? A   A 167  . ? 1_555 ? 
921  RC9 6 C   A  167  ? C   A 168  . ? 1_555 ? 
922  RC9 6 G   A  2109 ? G   A 2110 . ? 1_555 ? 
923  RC9 6 G   A  2110 ? G   A 2111 . ? 1_555 ? 
924  RC9 6 U   A  2276 ? U   A 2277 . ? 1_555 ? 
925  RC9 6 HOH CJ .    ? HOH A 5698 . ? 1_555 ? 
926  SC1 3 U   A  1358 ? U   A 1359 . ? 1_555 ? 
927  SC1 3 C   A  1359 ? C   A 1360 . ? 1_555 ? 
928  SC1 3 GLY E  66   ? GLY E 66   . ? 1_555 ? 
929  SC2 5 G   A  635  ? G   A 636  . ? 1_555 ? 
930  SC2 5 U   A  2056 ? U   A 2057 . ? 1_555 ? 
931  SC2 5 G   A  2057 ? G   A 2058 . ? 1_555 ? 
932  SC2 5 HOH CJ .    ? HOH A 3209 . ? 1_555 ? 
933  SC2 5 HOH CJ .    ? HOH A 9986 . ? 1_555 ? 
934  SC3 6 U   A  390  ? U   A 391  . ? 1_555 ? 
935  SC3 6 U   A  391  ? U   A 392  . ? 1_555 ? 
936  SC3 6 U   A  397  ? U   A 398  . ? 1_555 ? 
937  SC3 6 C   A  398  ? C   A 399  . ? 1_555 ? 
938  SC3 6 LYS N  193  ? LYS N 193  . ? 1_555 ? 
939  SC3 6 ALA N  194  ? ALA N 194  . ? 1_555 ? 
940  SC4 8 G   A  543  ? G   A 544  . ? 1_555 ? 
941  SC4 8 G   A  544  ? G   A 545  . ? 1_555 ? 
942  SC4 8 G   A  609  ? G   A 610  . ? 1_555 ? 
943  SC4 8 U   A  610  ? U   A 611  . ? 1_555 ? 
944  SC4 8 U   A  611  ? U   A 612  . ? 1_555 ? 
945  SC4 8 HOH CJ .    ? HOH A 3276 . ? 1_555 ? 
946  SC4 8 HOH CJ .    ? HOH A 4217 . ? 1_555 ? 
947  SC4 8 HOH CJ .    ? HOH A 4278 . ? 1_555 ? 
948  SC5 6 G   A  463  ? G   A 464  . ? 1_555 ? 
949  SC5 6 G   A  474  ? G   A 475  . ? 1_555 ? 
950  SC5 6 HOH CJ .    ? HOH A 3221 . ? 1_555 ? 
951  SC5 6 HOH CJ .    ? HOH A 4993 . ? 1_555 ? 
952  SC5 6 ARG E  55   ? ARG E 55   . ? 1_555 ? 
953  SC5 6 HOH GJ .    ? HOH E 8388 . ? 1_555 ? 
954  SC6 5 G   A  797  ? G   A 798  . ? 1_555 ? 
955  SC6 5 C   A  798  ? C   A 799  . ? 1_555 ? 
956  SC6 5 G   A  813  ? G   A 814  . ? 1_555 ? 
957  SC6 5 U   A  814  ? U   A 815  . ? 1_555 ? 
958  SC6 5 HOH CJ .    ? HOH A 4282 . ? 1_555 ? 
959  SC7 3 G   A  1831 ? G   A 1832 . ? 1_555 ? 
960  SC7 3 HOH CJ .    ? HOH A 4497 . ? 1_555 ? 
961  SC7 3 HOH CJ .    ? HOH A 9506 . ? 1_555 ? 
962  SC8 4 G   A  2490 ? G   A 2491 . ? 1_555 ? 
963  SC8 4 U   A  2491 ? U   A 2492 . ? 1_555 ? 
964  SC8 4 G   A  2528 ? G   A 2529 . ? 1_555 ? 
965  SC8 4 HOH CJ .    ? HOH A 3020 . ? 1_555 ? 
966  SC9 4 U   A  918  ? U   A 919  . ? 1_555 ? 
967  SC9 4 G   A  920  ? G   A 921  . ? 1_555 ? 
968  SC9 4 G   A  923  ? G   A 924  . ? 1_555 ? 
969  SC9 4 HOH CJ .    ? HOH A 9670 . ? 1_555 ? 
970  TC1 5 G   A  1575 ? G   A 1576 . ? 1_555 ? 
971  TC1 5 U   A  1576 ? U   A 1577 . ? 1_555 ? 
972  TC1 5 G   A  1617 ? G   A 1618 . ? 1_555 ? 
973  TC1 5 G   A  1618 ? G   A 1619 . ? 1_555 ? 
974  TC1 5 HOH CJ .    ? HOH A 4075 . ? 1_555 ? 
975  TC2 4 C   A  194  ? C   A 195  . ? 1_555 ? 
976  TC2 4 G   A  195  ? G   A 196  . ? 1_555 ? 
977  TC2 4 A   A  414  ? A   A 415  . ? 1_555 ? 
978  TC2 4 G   A  415  ? G   A 416  . ? 1_555 ? 
979  TC3 5 G   A  867  ? G   A 868  . ? 1_555 ? 
980  TC3 5 G   A  868  ? G   A 869  . ? 1_555 ? 
981  TC3 5 A   A  885  ? A   A 886  . ? 1_555 ? 
982  TC3 5 G   A  886  ? G   A 887  . ? 1_555 ? 
983  TC3 5 HOH CJ .    ? HOH A 4299 . ? 1_555 ? 
984  TC4 8 A   A  631  ? A   A 632  . ? 1_555 ? 
985  TC4 8 C   A  632  ? C   A 633  . ? 1_555 ? 
986  TC4 8 U   A  2534 ? U   A 2535 . ? 1_555 ? 
987  TC4 8 C   A  2535 ? C   A 2536 . ? 1_555 ? 
988  TC4 8 A   A  2537 ? A   A 2538 . ? 1_555 ? 
989  TC4 8 U   A  2538 ? U   A 2539 . ? 1_555 ? 
990  TC4 8 HOH CJ .    ? HOH A 4042 . ? 1_555 ? 
991  TC4 8 HOH CJ .    ? HOH A 5244 . ? 1_555 ? 
992  TC5 5 G   A  910  ? G   A 911  . ? 1_555 ? 
993  TC5 5 U   A  1292 ? U   A 1293 . ? 1_555 ? 
994  TC5 5 A   A  1293 ? A   A 1294 . ? 1_555 ? 
995  TC5 5 G   A  1294 ? G   A 1295 . ? 1_555 ? 
996  TC5 5 HOH CJ .    ? HOH A 6731 . ? 1_555 ? 
997  TC6 7 C   A  761  ? C   A 762  . ? 1_555 ? 
998  TC6 7 G   A  901  ? G   A 902  . ? 1_555 ? 
999  TC6 7 U   A  902  ? U   A 903  . ? 1_555 ? 
1000 TC6 7 HOH CJ .    ? HOH A 3598 . ? 1_555 ? 
1001 TC6 7 HIS M  18   ? HIS M 18   . ? 1_555 ? 
1002 TC6 7 HOH OJ .    ? HOH M 8533 . ? 1_555 ? 
1003 TC6 7 HOH OJ .    ? HOH M 8555 . ? 1_555 ? 
1004 TC7 5 U   A  830  ? U   A 831  . ? 1_555 ? 
1005 TC7 5 U   A  831  ? U   A 832  . ? 1_555 ? 
1006 TC7 5 G   A  832  ? G   A 833  . ? 1_555 ? 
1007 TC7 5 HOH CJ .    ? HOH A 4109 . ? 1_555 ? 
1008 TC7 5 HOH CJ .    ? HOH A 4816 . ? 1_555 ? 
1009 TC8 7 G   A  2584 ? G   A 2585 . ? 1_555 ? 
1010 TC8 7 U   A  2585 ? U   A 2586 . ? 1_555 ? 
1011 TC8 7 U   A  2586 ? U   A 2587 . ? 1_555 ? 
1012 TC8 7 G   A  2591 ? G   A 2592 . ? 1_555 ? 
1013 TC8 7 HOH CJ .    ? HOH A 4086 . ? 1_555 ? 
1014 TC8 7 HOH CJ .    ? HOH A 7458 . ? 1_555 ? 
1015 TC8 7 HOH CJ .    ? HOH A 9727 . ? 1_555 ? 
1016 TC9 3 G   A  2771 ? G   A 2772 . ? 1_555 ? 
1017 TC9 3 G   A  2772 ? G   A 2773 . ? 1_555 ? 
1018 TC9 3 HOH CJ .    ? HOH A 4759 . ? 1_555 ? 
1019 UC1 1 C   A  196  ? C   A 197  . ? 1_555 ? 
1020 UC2 3 G   A  1076 ? G   A 1077 . ? 1_555 ? 
1021 UC2 3 A   A  1078 ? A   A 1079 . ? 1_555 ? 
1022 UC2 3 HOH CJ .    ? HOH A 8172 . ? 1_555 ? 
1023 UC3 2 G   A  1451 ? G   A 1452 . ? 1_555 ? 
1024 UC3 2 G   A  1675 ? G   A 1676 . ? 1_555 ? 
1025 UC4 2 G   A  200  ? G   A 201  . ? 1_555 ? 
1026 UC4 2 HOH CJ .    ? HOH A 5297 . ? 1_555 ? 
1027 UC5 5 C   A  2387 ? C   A 2388 . ? 1_555 ? 
1028 UC5 5 HOH CJ .    ? HOH A 3551 . ? 1_555 ? 
1029 UC5 5 PHE R  52   ? PHE R 52   . ? 1_555 ? 
1030 UC5 5 HIS R  53   ? HIS R 53   . ? 1_555 ? 
1031 UC5 5 PHE R  56   ? PHE R 56   . ? 1_555 ? 
1032 UC6 4 G   A  1298 ? G   A 1299 . ? 1_555 ? 
1033 UC6 4 G   A  1299 ? G   A 1300 . ? 1_555 ? 
1034 UC6 4 A   A  1328 ? A   A 1329 . ? 1_555 ? 
1035 UC6 4 HOH CJ .    ? HOH A 5049 . ? 1_555 ? 
1036 UC7 2 G   A  643  ? G   A 644  . ? 1_555 ? 
1037 UC7 2 HIS M  13   ? HIS M 13   . ? 1_555 ? 
1038 UC8 3 A   A  1596 ? A   A 1597 . ? 1_555 ? 
1039 UC8 3 A   A  1597 ? A   A 1598 . ? 1_555 ? 
1040 UC8 3 G   A  1645 ? G   A 1646 . ? 1_555 ? 
1041 UC9 4 G   A  1118 ? G   A 1119 . ? 1_555 ? 
1042 UC9 4 C   A  1242 ? C   A 1243 . ? 1_555 ? 
1043 UC9 4 GLN K  52   ? GLN K 52   . ? 1_555 ? 
1044 UC9 4 LYS K  56   ? LYS K 56   . ? 1_555 ? 
1045 VC1 3 G   A  1071 ? G   A 1072 . ? 1_555 ? 
1046 VC1 3 G   A  1086 ? G   A 1087 . ? 1_555 ? 
1047 VC1 3 A   A  1290 ? A   A 1291 . ? 1_555 ? 
1048 VC2 5 G   B  21   ? G   B 3021 . ? 1_555 ? 
1049 VC2 5 U   B  55   ? U   B 3055 . ? 1_555 ? 
1050 VC2 5 A   B  56   ? A   B 3056 . ? 1_555 ? 
1051 VC2 5 A   B  57   ? A   B 3057 . ? 1_555 ? 
1052 VC2 5 HOH DJ .    ? HOH B 7361 . ? 1_555 ? 
1053 VC3 2 HOH DJ .    ? HOH B 1982 . ? 1_555 ? 
1054 VC3 2 C   B  40   ? C   B 3040 . ? 1_555 ? 
1055 VC4 6 G   B  21   ? G   B 3021 . ? 1_555 ? 
1056 VC4 6 G   B  22   ? G   B 3022 . ? 1_555 ? 
1057 VC4 6 U   B  55   ? U   B 3055 . ? 1_555 ? 
1058 VC4 6 A   B  57   ? A   B 3057 . ? 1_555 ? 
1059 VC4 6 G   B  58   ? G   B 3058 . ? 1_555 ? 
1060 VC4 6 HOH DJ .    ? HOH B 7361 . ? 1_555 ? 
1061 VC5 6 HOH CJ .    ? HOH A 4367 . ? 1_555 ? 
1062 VC5 6 HOH EJ .    ? HOH C 8522 . ? 1_555 ? 
1063 VC5 6 HOH EJ .    ? HOH C 8541 . ? 1_555 ? 
1064 VC5 6 HOH EJ .    ? HOH C 8555 . ? 1_555 ? 
1065 VC5 6 HOH EJ .    ? HOH C 8609 . ? 1_555 ? 
1066 VC5 6 HOH EJ .    ? HOH C 8642 . ? 1_555 ? 
1067 VC6 5 ARG AA 4    ? ARG 1 13   . ? 1_555 ? 
1068 VC6 5 PHE AA 5    ? PHE 1 14   . ? 1_555 ? 
1069 VC6 5 LYS C  171  ? LYS C 171  . ? 1_555 ? 
1070 VC6 5 ASN C  174  ? ASN C 174  . ? 1_555 ? 
1071 VC6 5 HOH EJ .    ? HOH C 8639 . ? 1_555 ? 
1072 VC7 7 A   A  2632 ? A   A 2633 . ? 1_555 ? 
1073 VC7 7 PHE C  201  ? PHE C 201  . ? 1_555 ? 
1074 VC7 7 GLY C  202  ? GLY C 202  . ? 1_555 ? 
1075 VC7 7 GLY C  203  ? GLY C 203  . ? 1_555 ? 
1076 VC7 7 HIS C  208  ? HIS C 208  . ? 1_555 ? 
1077 VC7 7 HOH EJ .    ? HOH C 8561 . ? 1_555 ? 
1078 VC7 7 HOH EJ .    ? HOH C 8608 . ? 1_555 ? 
1079 VC8 1 LYS C  178  ? LYS C 178  . ? 1_555 ? 
1080 VC9 5 HOH CJ .    ? HOH A 4153 . ? 1_555 ? 
1081 VC9 5 HOH CJ .    ? HOH A 4190 . ? 1_555 ? 
1082 VC9 5 HOH CJ .    ? HOH A 8204 . ? 1_555 ? 
1083 VC9 5 HOH CJ .    ? HOH A 8444 . ? 1_555 ? 
1084 VC9 5 HOH FJ .    ? HOH D 8658 . ? 1_555 ? 
1085 WC1 3 HOH CJ .    ? HOH A 3042 . ? 1_555 ? 
1086 WC1 3 ARG D  223  ? ARG D 223  . ? 1_555 ? 
1087 WC1 3 LYS D  224  ? LYS D 224  . ? 1_555 ? 
1088 WC2 4 ASP E  45   ? ASP E 45   . ? 1_555 ? 
1089 WC2 4 THR E  94   ? THR E 94   . ? 1_555 ? 
1090 WC2 4 LYS E  96   ? LYS E 96   . ? 1_555 ? 
1091 WC2 4 HOH GJ .    ? HOH E 8310 . ? 1_555 ? 
1092 WC3 6 A   A  1132 ? A   A 1133 . ? 1_555 ? 
1093 WC3 6 G   A  1133 ? G   A 1134 . ? 1_555 ? 
1094 WC3 6 LYS J  150  ? LYS J 150  . ? 1_555 ? 
1095 WC3 6 VAL J  153  ? VAL J 153  . ? 1_555 ? 
1096 WC3 6 THR J  154  ? THR J 154  . ? 1_555 ? 
1097 WC3 6 PRO J  155  ? PRO J 155  . ? 1_555 ? 
1098 WC4 2 ASP J  109  ? ASP J 109  . ? 1_555 ? 
1099 WC4 2 ARG J  112  ? ARG J 112  . ? 1_555 ? 
1100 WC5 6 HOH CJ .    ? HOH A 6145 . ? 1_555 ? 
1101 WC5 6 HOH CJ .    ? HOH A 9879 . ? 1_555 ? 
1102 WC5 6 ARG K  60   ? ARG K 60   . ? 1_555 ? 
1103 WC5 6 VAL K  61   ? VAL K 61   . ? 1_555 ? 
1104 WC5 6 ILE K  63   ? ILE K 63   . ? 1_555 ? 
1105 WC5 6 TYR K  69   ? TYR K 69   . ? 1_555 ? 
1106 WC6 5 ASN K  126  ? ASN K 126  . ? 1_555 ? 
1107 WC6 5 ILE K  127  ? ILE K 127  . ? 1_555 ? 
1108 WC6 5 LYS K  128  ? LYS K 128  . ? 1_555 ? 
1109 WC6 5 HOH MJ .    ? HOH K 4038 . ? 1_555 ? 
1110 WC6 5 HOH MJ .    ? HOH K 4193 . ? 1_555 ? 
1111 WC7 3 PRO K  88   ? PRO K 88   . ? 1_555 ? 
1112 WC7 3 HIS K  89   ? HIS K 89   . ? 1_555 ? 
1113 WC7 3 LYS K  90   ? LYS K 90   . ? 1_555 ? 
1114 WC8 3 HOH CJ .    ? HOH A 6145 . ? 1_555 ? 
1115 WC8 3 ASN K  65   ? ASN K 65   . ? 1_555 ? 
1116 WC8 3 TYR K  69   ? TYR K 69   . ? 1_555 ? 
1117 WC9 6 HOH CJ .    ? HOH A 4631 . ? 1_555 ? 
1118 WC9 6 HOH CJ .    ? HOH A 6431 . ? 1_555 ? 
1119 WC9 6 ASN L  42   ? ASN L 42   . ? 1_555 ? 
1120 WC9 6 HOH NJ .    ? HOH L 1797 . ? 1_555 ? 
1121 WC9 6 HOH NJ .    ? HOH L 2121 . ? 1_555 ? 
1122 WC9 6 HOH NJ .    ? HOH L 7871 . ? 1_555 ? 
1123 XC1 6 G   A  2581 ? G   A 2582 . ? 1_555 ? 
1124 XC1 6 A   A  2595 ? A   A 2596 . ? 1_555 ? 
1125 XC1 6 HOH CJ .    ? HOH A 5490 . ? 1_555 ? 
1126 XC1 6 LYS L  14   ? LYS L 14   . ? 1_555 ? 
1127 XC1 6 ILE L  32   ? ILE L 32   . ? 1_555 ? 
1128 XC1 6 SER L  33   ? SER L 33   . ? 1_555 ? 
1129 XC2 7 ARG M  27   ? ARG M 27   . ? 1_555 ? 
1130 XC2 7 GLY M  28   ? GLY M 28   . ? 1_555 ? 
1131 XC2 7 GLY M  29   ? GLY M 29   . ? 1_555 ? 
1132 XC2 7 GLY M  31   ? GLY M 31   . ? 1_555 ? 
1133 XC2 7 ALA M  33   ? ALA M 33   . ? 1_555 ? 
1134 XC2 7 GLU M  39   ? GLU M 39   . ? 1_555 ? 
1135 XC2 7 HOH OJ .    ? HOH M 8594 . ? 1_555 ? 
1136 XC3 3 A   A  692  ? A   A 693  . ? 1_555 ? 
1137 XC3 3 LYS M  52   ? LYS M 52   . ? 1_555 ? 
1138 XC3 3 ARG M  53   ? ARG M 53   . ? 1_555 ? 
1139 XC4 5 ASN N  106  ? ASN N 106  . ? 1_555 ? 
1140 XC4 5 PHE N  109  ? PHE N 109  . ? 1_555 ? 
1141 XC4 5 PRO N  110  ? PRO N 110  . ? 1_555 ? 
1142 XC4 5 LEU N  112  ? LEU N 112  . ? 1_555 ? 
1143 XC4 5 HOH PJ .    ? HOH N 8633 . ? 1_555 ? 
1144 XC5 6 ASN N  106  ? ASN N 106  . ? 1_555 ? 
1145 XC5 6 ARG N  113  ? ARG N 113  . ? 1_555 ? 
1146 XC5 6 VAL N  114  ? VAL N 114  . ? 1_555 ? 
1147 XC5 6 LEU N  157  ? LEU N 157  . ? 1_555 ? 
1148 XC5 6 ARG N  158  ? ARG N 158  . ? 1_555 ? 
1149 XC5 6 THR N  159  ? THR N 159  . ? 1_555 ? 
1150 XC6 4 LYS F  146  ? LYS F 146  . ? 1_555 ? 
1151 XC6 4 ARG O  37   ? ARG O 37   . ? 1_555 ? 
1152 XC6 4 LYS O  38   ? LYS O 38   . ? 1_555 ? 
1153 XC6 4 ASN O  107  ? ASN O 107  . ? 1_555 ? 
1154 XC7 2 HIS P  40   ? HIS P 40   . ? 1_555 ? 
1155 XC7 2 HOH RJ .    ? HOH P 5322 . ? 1_555 ? 
1156 XC8 2 HOH CJ .    ? HOH A 7412 . ? 1_555 ? 
1157 XC8 2 ASN P  44   ? ASN P 44   . ? 1_555 ? 
1158 XC9 6 ASP R  20   ? ASP R 20   . ? 1_555 ? 
1159 XC9 6 GLY R  22   ? GLY R 22   . ? 1_555 ? 
1160 XC9 6 SER R  24   ? SER R 24   . ? 1_555 ? 
1161 XC9 6 SER R  46   ? SER R 46   . ? 1_555 ? 
1162 XC9 6 HOH TJ .    ? HOH R 1795 . ? 1_555 ? 
1163 XC9 6 HOH TJ .    ? HOH R 5427 . ? 1_555 ? 
1164 YC1 5 HOH CJ .    ? HOH A 6306 . ? 1_555 ? 
1165 YC1 5 SER S  70   ? SER S 70   . ? 1_555 ? 
1166 YC1 5 VAL S  72   ? VAL S 72   . ? 1_555 ? 
1167 YC1 5 HOH UJ .    ? HOH S 8525 . ? 1_555 ? 
1168 YC1 5 HOH UJ .    ? HOH S 8527 . ? 1_555 ? 
1169 YC2 4 U   A  11   ? U   A 12   . ? 1_555 ? 
1170 YC2 4 LYS S  60   ? LYS S 60   . ? 1_555 ? 
1171 YC2 4 GLN S  61   ? GLN S 61   . ? 1_555 ? 
1172 YC2 4 ASN S  63   ? ASN S 63   . ? 1_555 ? 
1173 YC3 1 LYS S  118  ? LYS S 118  . ? 1_555 ? 
1174 YC4 2 HIS T  7    ? HIS T 7    . ? 1_555 ? 
1175 YC4 2 GLU T  61   ? GLU T 61   . ? 1_555 ? 
1176 YC5 5 GLN U  37   ? GLN U 37   . ? 1_555 ? 
1177 YC5 5 ARG U  111  ? ARG U 111  . ? 1_555 ? 
1178 YC5 5 LEU U  112  ? LEU U 112  . ? 1_555 ? 
1179 YC5 5 SER U  114  ? SER U 114  . ? 1_555 ? 
1180 YC5 5 ASP U  117  ? ASP U 117  . ? 1_555 ? 
1181 YC6 6 U   A  307  ? U   A 308  . ? 1_555 ? 
1182 YC6 6 U   A  334  ? U   A 335  . ? 1_555 ? 
1183 YC6 6 C   A  341  ? C   A 342  . ? 1_555 ? 
1184 YC6 6 SER U  94   ? SER U 94   . ? 1_555 ? 
1185 YC6 6 ASN U  95   ? ASN U 95   . ? 1_555 ? 
1186 YC6 6 HOH WJ .    ? HOH U 1124 . ? 1_555 ? 
1187 YC7 3 CYS V  6    ? CYS V 6    . ? 1_555 ? 
1188 YC7 3 CYS V  9    ? CYS V 9    . ? 1_555 ? 
1189 YC7 3 CYS V  36   ? CYS V 36   . ? 1_555 ? 
1190 YC8 7 HIS Z  133  ? HIS Z 133  . ? 1_555 ? 
1191 YC8 7 LYS Z  136  ? LYS Z 136  . ? 1_555 ? 
1192 YC8 7 LYS Z  137  ? LYS Z 137  . ? 1_555 ? 
1193 YC8 7 VAL Z  139  ? VAL Z 139  . ? 1_555 ? 
1194 YC8 7 HOH BK .    ? HOH Z 8564 . ? 1_555 ? 
1195 YC8 7 HOH BK .    ? HOH Z 8586 . ? 1_555 ? 
1196 YC8 7 HOH BK .    ? HOH Z 8620 . ? 1_555 ? 
1197 YC9 4 C   A  593  ? C   A 594  . ? 1_555 ? 
1198 YC9 4 U   A  594  ? U   A 595  . ? 1_555 ? 
1199 YC9 4 ARG Z  115  ? ARG Z 115  . ? 1_555 ? 
1200 YC9 4 HOH BK .    ? HOH Z 8559 . ? 1_555 ? 
1201 ZC1 3 G   A  1268 ? G   A 1269 . ? 1_555 ? 
1202 ZC1 3 HOH CJ .    ? HOH A 5325 . ? 1_555 ? 
1203 ZC1 3 ARG Z  169  ? ARG Z 169  . ? 1_555 ? 
1204 ZC2 4 CYS AA 30   ? CYS 1 39   . ? 1_555 ? 
1205 ZC2 4 CYS AA 33   ? CYS 1 42   . ? 1_555 ? 
1206 ZC2 4 CYS AA 48   ? CYS 1 57   . ? 1_555 ? 
1207 ZC2 4 CYS AA 51   ? CYS 1 60   . ? 1_555 ? 
1208 ZC3 4 CYS BA 19   ? CYS 2 19   . ? 1_555 ? 
1209 ZC3 4 CYS BA 22   ? CYS 2 22   . ? 1_555 ? 
1210 ZC3 4 CYS BA 34   ? CYS 2 34   . ? 1_555 ? 
1211 ZC3 4 CYS BA 37   ? CYS 2 37   . ? 1_555 ? 
1212 ZC4 6 GLY DA 45   ? GLY 4 45   . ? 1_555 ? 
1213 ZC4 6 GLY DA 47   ? GLY 4 47   . ? 1_555 ? 
1214 ZC4 6 ASP DA 49   ? ASP 4 49   . ? 1_555 ? 
1215 ZC4 6 HOH FK .    ? HOH 4 8576 . ? 1_555 ? 
1216 ZC4 6 HOH CJ .    ? HOH A 4356 . ? 1_555 ? 
1217 ZC4 6 HOH CJ .    ? HOH A 8451 . ? 1_555 ? 
1218 ZC5 6 ARG DA 42   ? ARG 4 42   . ? 1_555 ? 
1219 ZC5 6 HOH FK .    ? HOH 4 8544 . ? 1_555 ? 
1220 ZC5 6 U   A  390  ? U   A 391  . ? 1_555 ? 
1221 ZC5 6 U   A  391  ? U   A 392  . ? 1_555 ? 
1222 ZC5 6 A   A  394  ? A   A 395  . ? 1_555 ? 
1223 ZC5 6 HOH CJ .    ? HOH A 6961 . ? 1_555 ? 
1224 ZC6 4 CYS DA 11   ? CYS 4 11   . ? 1_555 ? 
1225 ZC6 4 CYS DA 14   ? CYS 4 14   . ? 1_555 ? 
1226 ZC6 4 CYS DA 71   ? CYS 4 71   . ? 1_555 ? 
1227 ZC6 4 CYS DA 74   ? CYS 4 74   . ? 1_555 ? 
1228 ZC7 3 LYS DA 24   ? LYS 4 24   . ? 1_555 ? 
1229 ZC7 3 ASP DA 66   ? ASP 4 66   . ? 1_555 ? 
1230 ZC7 3 LEU DA 67   ? LEU 4 67   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1N8R 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1N8R 
_atom_sites.fract_transf_matrix[1][1]   0.004697 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.003328 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.001739 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CD 
CL 
K  
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . U   A  1  9    ? 16.353  149.565 104.888 1.00 82.57  ? 10   U   A "O5'" 1 
ATOM   2     C  "C5'" . U   A  1  9    ? 17.392  150.533 104.656 1.00 82.03  ? 10   U   A "C5'" 1 
ATOM   3     C  "C4'" . U   A  1  9    ? 18.845  150.093 104.765 1.00 80.67  ? 10   U   A "C4'" 1 
ATOM   4     O  "O4'" . U   A  1  9    ? 19.090  149.458 106.048 1.00 81.92  ? 10   U   A "O4'" 1 
ATOM   5     C  "C3'" . U   A  1  9    ? 19.391  149.065 103.776 1.00 78.22  ? 10   U   A "C3'" 1 
ATOM   6     O  "O3'" . U   A  1  9    ? 19.616  149.687 102.487 1.00 72.19  ? 10   U   A "O3'" 1 
ATOM   7     C  "C2'" . U   A  1  9    ? 20.677  148.618 104.477 1.00 79.61  ? 10   U   A "C2'" 1 
ATOM   8     O  "O2'" . U   A  1  9    ? 21.705  149.568 104.298 1.00 80.21  ? 10   U   A "O2'" 1 
ATOM   9     C  "C1'" . U   A  1  9    ? 20.279  148.687 105.956 1.00 81.44  ? 10   U   A "C1'" 1 
ATOM   10    N  N1    . U   A  1  9    ? 20.141  147.433 106.727 1.00 82.45  ? 10   U   A N1    1 
ATOM   11    C  C2    . U   A  1  9    ? 19.918  147.550 108.106 1.00 83.47  ? 10   U   A C2    1 
ATOM   12    O  O2    . U   A  1  9    ? 19.767  148.624 108.675 1.00 84.89  ? 10   U   A O2    1 
ATOM   13    N  N3    . U   A  1  9    ? 19.877  146.365 108.794 1.00 82.86  ? 10   U   A N3    1 
ATOM   14    C  C4    . U   A  1  9    ? 20.011  145.102 108.281 1.00 82.23  ? 10   U   A C4    1 
ATOM   15    O  O4    . U   A  1  9    ? 19.993  144.150 109.054 1.00 83.26  ? 10   U   A O4    1 
ATOM   16    C  C5    . U   A  1  9    ? 20.203  145.042 106.856 1.00 81.87  ? 10   U   A C5    1 
ATOM   17    C  C6    . U   A  1  9    ? 20.257  146.180 106.143 1.00 81.45  ? 10   U   A C6    1 
ATOM   18    P  P     . A   A  1  10   ? 20.842  149.222 101.533 1.00 66.32  ? 11   A   A P     1 
ATOM   19    O  OP1   . A   A  1  10   ? 20.464  149.539 100.132 1.00 67.45  ? 11   A   A OP1   1 
ATOM   20    O  OP2   . A   A  1  10   ? 21.264  147.842 101.868 1.00 66.67  ? 11   A   A OP2   1 
ATOM   21    O  "O5'" . A   A  1  10   ? 22.007  150.231 101.938 1.00 61.52  ? 11   A   A "O5'" 1 
ATOM   22    C  "C5'" . A   A  1  10   ? 23.337  150.068 101.421 1.00 54.69  ? 11   A   A "C5'" 1 
ATOM   23    C  "C4'" . A   A  1  10   ? 24.342  150.776 102.302 1.00 49.88  ? 11   A   A "C4'" 1 
ATOM   24    O  "O4'" . A   A  1  10   ? 24.121  150.418 103.688 1.00 48.08  ? 11   A   A "O4'" 1 
ATOM   25    C  "C3'" . A   A  1  10   ? 25.780  150.397 102.026 1.00 47.66  ? 11   A   A "C3'" 1 
ATOM   26    O  "O3'" . A   A  1  10   ? 26.312  151.185 100.976 1.00 45.54  ? 11   A   A "O3'" 1 
ATOM   27    C  "C2'" . A   A  1  10   ? 26.443  150.663 103.367 1.00 46.58  ? 11   A   A "C2'" 1 
ATOM   28    O  "O2'" . A   A  1  10   ? 26.691  152.037 103.576 1.00 47.77  ? 11   A   A "O2'" 1 
ATOM   29    C  "C1'" . A   A  1  10   ? 25.356  150.196 104.341 1.00 45.57  ? 11   A   A "C1'" 1 
ATOM   30    N  N9    . A   A  1  10   ? 25.426  148.771 104.676 1.00 44.66  ? 11   A   A N9    1 
ATOM   31    C  C8    . A   A  1  10   ? 24.397  147.862 104.614 1.00 44.01  ? 11   A   A C8    1 
ATOM   32    N  N7    . A   A  1  10   ? 24.744  146.641 104.932 1.00 43.43  ? 11   A   A N7    1 
ATOM   33    C  C5    . A   A  1  10   ? 26.095  146.747 105.226 1.00 43.03  ? 11   A   A C5    1 
ATOM   34    C  C6    . A   A  1  10   ? 27.049  145.796 105.612 1.00 42.36  ? 11   A   A C6    1 
ATOM   35    N  N6    . A   A  1  10   ? 26.786  144.500 105.742 1.00 43.00  ? 11   A   A N6    1 
ATOM   36    N  N1    . A   A  1  10   ? 28.303  146.223 105.849 1.00 41.90  ? 11   A   A N1    1 
ATOM   37    C  C2    . A   A  1  10   ? 28.578  147.525 105.691 1.00 43.15  ? 11   A   A C2    1 
ATOM   38    N  N3    . A   A  1  10   ? 27.772  148.517 105.314 1.00 43.64  ? 11   A   A N3    1 
ATOM   39    C  C4    . A   A  1  10   ? 26.527  148.056 105.091 1.00 43.42  ? 11   A   A C4    1 
ATOM   40    P  P     . U   A  1  11   ? 26.525  150.533 99.518  1.00 46.50  ? 12   U   A P     1 
ATOM   41    O  OP1   . U   A  1  11   ? 26.885  151.656 98.616  1.00 47.70  ? 12   U   A OP1   1 
ATOM   42    O  OP2   . U   A  1  11   ? 25.367  149.652 99.162  1.00 45.49  ? 12   U   A OP2   1 
ATOM   43    O  "O5'" . U   A  1  11   ? 27.808  149.598 99.676  1.00 44.44  ? 12   U   A "O5'" 1 
ATOM   44    C  "C5'" . U   A  1  11   ? 29.075  150.148 100.066 1.00 41.71  ? 12   U   A "C5'" 1 
ATOM   45    C  "C4'" . U   A  1  11   ? 29.951  149.072 100.649 1.00 40.19  ? 12   U   A "C4'" 1 
ATOM   46    O  "O4'" . U   A  1  11   ? 29.372  148.594 101.895 1.00 40.90  ? 12   U   A "O4'" 1 
ATOM   47    C  "C3'" . U   A  1  11   ? 30.030  147.805 99.833  1.00 39.78  ? 12   U   A "C3'" 1 
ATOM   48    O  "O3'" . U   A  1  11   ? 30.864  147.890 98.702  1.00 38.15  ? 12   U   A "O3'" 1 
ATOM   49    C  "C2'" . U   A  1  11   ? 30.517  146.800 100.861 1.00 41.10  ? 12   U   A "C2'" 1 
ATOM   50    O  "O2'" . U   A  1  11   ? 31.902  146.860 101.131 1.00 41.47  ? 12   U   A "O2'" 1 
ATOM   51    C  "C1'" . U   A  1  11   ? 29.709  147.225 102.084 1.00 41.50  ? 12   U   A "C1'" 1 
ATOM   52    N  N1    . U   A  1  11   ? 28.486  146.409 102.209 1.00 43.04  ? 12   U   A N1    1 
ATOM   53    C  C2    . U   A  1  11   ? 28.642  145.115 102.689 1.00 43.68  ? 12   U   A C2    1 
ATOM   54    O  O2    . U   A  1  11   ? 29.721  144.659 103.043 1.00 45.17  ? 12   U   A O2    1 
ATOM   55    N  N3    . U   A  1  11   ? 27.494  144.374 102.738 1.00 43.57  ? 12   U   A N3    1 
ATOM   56    C  C4    . U   A  1  11   ? 26.232  144.776 102.373 1.00 43.82  ? 12   U   A C4    1 
ATOM   57    O  O4    . U   A  1  11   ? 25.317  143.945 102.366 1.00 44.96  ? 12   U   A O4    1 
ATOM   58    C  C5    . U   A  1  11   ? 26.144  146.132 101.921 1.00 42.96  ? 12   U   A C5    1 
ATOM   59    C  C6    . U   A  1  11   ? 27.243  146.881 101.855 1.00 42.77  ? 12   U   A C6    1 
ATOM   60    P  P     . G   A  1  12   ? 30.317  147.358 97.287  1.00 37.61  ? 13   G   A P     1 
ATOM   61    O  OP1   . G   A  1  12   ? 31.487  147.142 96.405  1.00 36.78  ? 13   G   A OP1   1 
ATOM   62    O  OP2   . G   A  1  12   ? 29.246  148.285 96.866  1.00 38.35  ? 13   G   A OP2   1 
ATOM   63    O  "O5'" . G   A  1  12   ? 29.660  145.941 97.614  1.00 34.76  ? 13   G   A "O5'" 1 
ATOM   64    C  "C5'" . G   A  1  12   ? 30.467  144.893 98.167  1.00 34.87  ? 13   G   A "C5'" 1 
ATOM   65    C  "C4'" . G   A  1  12   ? 29.639  143.670 98.491  1.00 34.59  ? 13   G   A "C4'" 1 
ATOM   66    O  "O4'" . G   A  1  12   ? 28.526  144.021 99.342  1.00 35.12  ? 13   G   A "O4'" 1 
ATOM   67    C  "C3'" . G   A  1  12   ? 28.918  142.943 97.370  1.00 33.64  ? 13   G   A "C3'" 1 
ATOM   68    O  "O3'" . G   A  1  12   ? 29.804  142.105 96.640  1.00 34.39  ? 13   G   A "O3'" 1 
ATOM   69    C  "C2'" . G   A  1  12   ? 27.971  142.047 98.157  1.00 33.89  ? 13   G   A "C2'" 1 
ATOM   70    O  "O2'" . G   A  1  12   ? 28.594  140.880 98.638  1.00 32.82  ? 13   G   A "O2'" 1 
ATOM   71    C  "C1'" . G   A  1  12   ? 27.601  142.944 99.336  1.00 34.50  ? 13   G   A "C1'" 1 
ATOM   72    N  N9    . G   A  1  12   ? 26.245  143.457 99.191  1.00 35.83  ? 13   G   A N9    1 
ATOM   73    C  C8    . G   A  1  12   ? 25.851  144.745 98.930  1.00 35.31  ? 13   G   A C8    1 
ATOM   74    N  N7    . G   A  1  12   ? 24.558  144.867 98.817  1.00 36.92  ? 13   G   A N7    1 
ATOM   75    C  C5    . G   A  1  12   ? 24.071  143.581 99.030  1.00 36.85  ? 13   G   A C5    1 
ATOM   76    C  C6    . G   A  1  12   ? 22.741  143.085 99.027  1.00 37.32  ? 13   G   A C6    1 
ATOM   77    O  O6    . G   A  1  12   ? 21.693  143.705 98.832  1.00 37.72  ? 13   G   A O6    1 
ATOM   78    N  N1    . G   A  1  12   ? 22.703  141.718 99.281  1.00 36.41  ? 13   G   A N1    1 
ATOM   79    C  C2    . G   A  1  12   ? 23.800  140.931 99.500  1.00 36.21  ? 13   G   A C2    1 
ATOM   80    N  N2    . G   A  1  12   ? 23.572  139.632 99.699  1.00 36.99  ? 13   G   A N2    1 
ATOM   81    N  N3    . G   A  1  12   ? 25.037  141.381 99.515  1.00 36.32  ? 13   G   A N3    1 
ATOM   82    C  C4    . G   A  1  12   ? 25.099  142.706 99.271  1.00 36.56  ? 13   G   A C4    1 
ATOM   83    P  P     . C   A  1  13   ? 29.307  141.386 95.291  1.00 35.20  ? 14   C   A P     1 
ATOM   84    O  OP1   . C   A  1  13   ? 30.511  140.773 94.669  1.00 34.23  ? 14   C   A OP1   1 
ATOM   85    O  OP2   . C   A  1  13   ? 28.513  142.384 94.535  1.00 33.71  ? 14   C   A OP2   1 
ATOM   86    O  "O5'" . C   A  1  13   ? 28.357  140.208 95.788  1.00 33.54  ? 14   C   A "O5'" 1 
ATOM   87    C  "C5'" . C   A  1  13   ? 28.929  138.984 96.311  1.00 32.37  ? 14   C   A "C5'" 1 
ATOM   88    C  "C4'" . C   A  1  13   ? 27.878  137.903 96.408  1.00 32.08  ? 14   C   A "C4'" 1 
ATOM   89    O  "O4'" . C   A  1  13   ? 26.881  138.253 97.399  1.00 32.30  ? 14   C   A "O4'" 1 
ATOM   90    C  "C3'" . C   A  1  13   ? 27.087  137.611 95.149  1.00 32.83  ? 14   C   A "C3'" 1 
ATOM   91    O  "O3'" . C   A  1  13   ? 27.817  136.734 94.315  1.00 35.73  ? 14   C   A "O3'" 1 
ATOM   92    C  "C2'" . C   A  1  13   ? 25.833  136.962 95.706  1.00 34.18  ? 14   C   A "C2'" 1 
ATOM   93    O  "O2'" . C   A  1  13   ? 25.998  135.608 96.040  1.00 36.54  ? 14   C   A "O2'" 1 
ATOM   94    C  "C1'" . C   A  1  13   ? 25.613  137.784 96.977  1.00 33.42  ? 14   C   A "C1'" 1 
ATOM   95    N  N1    . C   A  1  13   ? 24.747  138.950 96.738  1.00 33.87  ? 14   C   A N1    1 
ATOM   96    C  C2    . C   A  1  13   ? 23.358  138.763 96.660  1.00 34.02  ? 14   C   A C2    1 
ATOM   97    O  O2    . C   A  1  13   ? 22.886  137.618 96.819  1.00 35.35  ? 14   C   A O2    1 
ATOM   98    N  N3    . C   A  1  13   ? 22.565  139.830 96.409  1.00 34.78  ? 14   C   A N3    1 
ATOM   99    C  C4    . C   A  1  13   ? 23.105  141.040 96.242  1.00 33.45  ? 14   C   A C4    1 
ATOM   100   N  N4    . C   A  1  13   ? 22.282  142.061 95.978  1.00 32.29  ? 14   C   A N4    1 
ATOM   101   C  C5    . C   A  1  13   ? 24.510  141.257 96.335  1.00 32.81  ? 14   C   A C5    1 
ATOM   102   C  C6    . C   A  1  13   ? 25.284  140.197 96.582  1.00 33.28  ? 14   C   A C6    1 
ATOM   103   P  P     . C   A  1  14   ? 27.626  136.789 92.717  1.00 38.27  ? 15   C   A P     1 
ATOM   104   O  OP1   . C   A  1  14   ? 28.612  135.839 92.125  1.00 38.78  ? 15   C   A OP1   1 
ATOM   105   O  OP2   . C   A  1  14   ? 27.599  138.202 92.251  1.00 37.75  ? 15   C   A OP2   1 
ATOM   106   O  "O5'" . C   A  1  14   ? 26.187  136.156 92.507  1.00 39.86  ? 15   C   A "O5'" 1 
ATOM   107   C  "C5'" . C   A  1  14   ? 25.984  134.759 92.761  1.00 42.74  ? 15   C   A "C5'" 1 
ATOM   108   C  "C4'" . C   A  1  14   ? 24.560  134.391 92.482  1.00 44.75  ? 15   C   A "C4'" 1 
ATOM   109   O  "O4'" . C   A  1  14   ? 23.706  135.052 93.455  1.00 45.93  ? 15   C   A "O4'" 1 
ATOM   110   C  "C3'" . C   A  1  14   ? 23.999  134.850 91.142  1.00 45.65  ? 15   C   A "C3'" 1 
ATOM   111   O  "O3'" . C   A  1  14   ? 24.343  133.996 90.058  1.00 45.66  ? 15   C   A "O3'" 1 
ATOM   112   C  "C2'" . C   A  1  14   ? 22.508  134.832 91.417  1.00 45.76  ? 15   C   A "C2'" 1 
ATOM   113   O  "O2'" . C   A  1  14   ? 21.999  133.516 91.428  1.00 47.43  ? 15   C   A "O2'" 1 
ATOM   114   C  "C1'" . C   A  1  14   ? 22.475  135.397 92.837  1.00 45.69  ? 15   C   A "C1'" 1 
ATOM   115   N  N1    . C   A  1  14   ? 22.313  136.863 92.860  1.00 44.92  ? 15   C   A N1    1 
ATOM   116   C  C2    . C   A  1  14   ? 21.020  137.389 92.878  1.00 44.62  ? 15   C   A C2    1 
ATOM   117   O  O2    . C   A  1  14   ? 20.060  136.608 92.865  1.00 46.19  ? 15   C   A O2    1 
ATOM   118   N  N3    . C   A  1  14   ? 20.846  138.729 92.910  1.00 43.43  ? 15   C   A N3    1 
ATOM   119   C  C4    . C   A  1  14   ? 21.905  139.536 92.927  1.00 44.13  ? 15   C   A C4    1 
ATOM   120   N  N4    . C   A  1  14   ? 21.687  140.856 92.976  1.00 42.86  ? 15   C   A N4    1 
ATOM   121   C  C5    . C   A  1  14   ? 23.236  139.029 92.899  1.00 45.05  ? 15   C   A C5    1 
ATOM   122   C  C6    . C   A  1  14   ? 23.392  137.698 92.864  1.00 44.56  ? 15   C   A C6    1 
ATOM   123   P  P     . A   A  1  15   ? 24.454  134.609 88.575  1.00 48.48  ? 16   A   A P     1 
ATOM   124   O  OP1   . A   A  1  15   ? 25.043  133.541 87.721  1.00 46.90  ? 16   A   A OP1   1 
ATOM   125   O  OP2   . A   A  1  15   ? 25.159  135.914 88.707  1.00 47.67  ? 16   A   A OP2   1 
ATOM   126   O  "O5'" . A   A  1  15   ? 22.942  134.912 88.143  1.00 46.28  ? 16   A   A "O5'" 1 
ATOM   127   C  "C5'" . A   A  1  15   ? 22.049  133.845 87.762  1.00 46.02  ? 16   A   A "C5'" 1 
ATOM   128   C  "C4'" . A   A  1  15   ? 20.635  134.359 87.547  1.00 44.40  ? 16   A   A "C4'" 1 
ATOM   129   O  "O4'" . A   A  1  15   ? 20.133  134.946 88.776  1.00 43.78  ? 16   A   A "O4'" 1 
ATOM   130   C  "C3'" . A   A  1  15   ? 20.435  135.435 86.488  1.00 45.04  ? 16   A   A "C3'" 1 
ATOM   131   O  "O3'" . A   A  1  15   ? 20.334  134.874 85.185  1.00 46.46  ? 16   A   A "O3'" 1 
ATOM   132   C  "C2'" . A   A  1  15   ? 19.135  136.088 86.938  1.00 44.55  ? 16   A   A "C2'" 1 
ATOM   133   O  "O2'" . A   A  1  15   ? 17.962  135.422 86.520  1.00 46.17  ? 16   A   A "O2'" 1 
ATOM   134   C  "C1'" . A   A  1  15   ? 19.284  136.036 88.463  1.00 43.42  ? 16   A   A "C1'" 1 
ATOM   135   N  N9    . A   A  1  15   ? 19.929  137.266 88.910  1.00 41.96  ? 16   A   A N9    1 
ATOM   136   C  C8    . A   A  1  15   ? 21.262  137.519 89.128  1.00 42.04  ? 16   A   A C8    1 
ATOM   137   N  N7    . A   A  1  15   ? 21.517  138.766 89.447  1.00 41.56  ? 16   A   A N7    1 
ATOM   138   C  C5    . A   A  1  15   ? 20.263  139.369 89.454  1.00 39.18  ? 16   A   A C5    1 
ATOM   139   C  C6    . A   A  1  15   ? 19.838  140.691 89.695  1.00 38.28  ? 16   A   A C6    1 
ATOM   140   N  N6    . A   A  1  15   ? 20.664  141.709 89.961  1.00 36.14  ? 16   A   A N6    1 
ATOM   141   N  N1    . A   A  1  15   ? 18.514  140.940 89.635  1.00 36.04  ? 16   A   A N1    1 
ATOM   142   C  C2    . A   A  1  15   ? 17.687  139.943 89.332  1.00 35.99  ? 16   A   A C2    1 
ATOM   143   N  N3    . A   A  1  15   ? 17.958  138.675 89.064  1.00 36.61  ? 16   A   A N3    1 
ATOM   144   C  C4    . A   A  1  15   ? 19.278  138.449 89.145  1.00 39.65  ? 16   A   A C4    1 
ATOM   145   P  P     . G   A  1  16   ? 20.725  135.751 83.892  1.00 48.06  ? 17   G   A P     1 
ATOM   146   O  OP1   . G   A  1  16   ? 20.596  134.821 82.737  1.00 48.92  ? 17   G   A OP1   1 
ATOM   147   O  OP2   . G   A  1  16   ? 22.011  136.462 84.107  1.00 48.90  ? 17   G   A OP2   1 
ATOM   148   O  "O5'" . G   A  1  16   ? 19.581  136.851 83.785  1.00 44.40  ? 17   G   A "O5'" 1 
ATOM   149   C  "C5'" . G   A  1  16   ? 18.257  136.475 83.427  1.00 43.50  ? 17   G   A "C5'" 1 
ATOM   150   C  "C4'" . G   A  1  16   ? 17.303  137.603 83.682  1.00 42.60  ? 17   G   A "C4'" 1 
ATOM   151   O  "O4'" . G   A  1  16   ? 17.557  138.119 85.013  1.00 42.66  ? 17   G   A "O4'" 1 
ATOM   152   C  "C3'" . G   A  1  16   ? 17.450  138.847 82.834  1.00 41.41  ? 17   G   A "C3'" 1 
ATOM   153   O  "O3'" . G   A  1  16   ? 16.879  138.677 81.545  1.00 40.31  ? 17   G   A "O3'" 1 
ATOM   154   C  "C2'" . G   A  1  16   ? 16.652  139.838 83.666  1.00 41.79  ? 17   G   A "C2'" 1 
ATOM   155   O  "O2'" . G   A  1  16   ? 15.264  139.617 83.562  1.00 42.70  ? 17   G   A "O2'" 1 
ATOM   156   C  "C1'" . G   A  1  16   ? 17.081  139.452 85.083  1.00 41.45  ? 17   G   A "C1'" 1 
ATOM   157   N  N9    . G   A  1  16   ? 18.121  140.324 85.630  1.00 40.23  ? 17   G   A N9    1 
ATOM   158   C  C8    . G   A  1  16   ? 19.443  140.028 85.874  1.00 40.04  ? 17   G   A C8    1 
ATOM   159   N  N7    . G   A  1  16   ? 20.101  141.024 86.401  1.00 38.54  ? 17   G   A N7    1 
ATOM   160   C  C5    . G   A  1  16   ? 19.160  142.036 86.508  1.00 37.87  ? 17   G   A C5    1 
ATOM   161   C  C6    . G   A  1  16   ? 19.274  143.348 87.030  1.00 38.31  ? 17   G   A C6    1 
ATOM   162   O  O6    . G   A  1  16   ? 20.256  143.889 87.544  1.00 38.62  ? 17   G   A O6    1 
ATOM   163   N  N1    . G   A  1  16   ? 18.076  144.045 86.930  1.00 38.96  ? 17   G   A N1    1 
ATOM   164   C  C2    . G   A  1  16   ? 16.912  143.541 86.416  1.00 39.39  ? 17   G   A C2    1 
ATOM   165   N  N2    . G   A  1  16   ? 15.856  144.367 86.415  1.00 39.04  ? 17   G   A N2    1 
ATOM   166   N  N3    . G   A  1  16   ? 16.786  142.318 85.941  1.00 39.56  ? 17   G   A N3    1 
ATOM   167   C  C4    . G   A  1  16   ? 17.940  141.625 86.020  1.00 38.84  ? 17   G   A C4    1 
ATOM   168   P  P     . C   A  1  17   ? 17.251  139.705 80.360  1.00 39.88  ? 18   C   A P     1 
ATOM   169   O  OP1   . C   A  1  17   ? 16.572  139.230 79.130  1.00 40.35  ? 18   C   A OP1   1 
ATOM   170   O  OP2   . C   A  1  17   ? 18.716  139.936 80.343  1.00 40.71  ? 18   C   A OP2   1 
ATOM   171   O  "O5'" . C   A  1  17   ? 16.595  141.077 80.811  1.00 37.45  ? 18   C   A "O5'" 1 
ATOM   172   C  "C5'" . C   A  1  17   ? 15.190  141.290 80.756  1.00 36.10  ? 18   C   A "C5'" 1 
ATOM   173   C  "C4'" . C   A  1  17   ? 14.890  142.705 81.165  1.00 36.86  ? 18   C   A "C4'" 1 
ATOM   174   O  "O4'" . C   A  1  17   ? 15.365  142.900 82.526  1.00 36.68  ? 18   C   A "O4'" 1 
ATOM   175   C  "C3'" . C   A  1  17   ? 15.643  143.752 80.355  1.00 37.44  ? 18   C   A "C3'" 1 
ATOM   176   O  "O3'" . C   A  1  17   ? 14.994  144.039 79.115  1.00 37.84  ? 18   C   A "O3'" 1 
ATOM   177   C  "C2'" . C   A  1  17   ? 15.723  144.933 81.319  1.00 37.03  ? 18   C   A "C2'" 1 
ATOM   178   O  "O2'" . C   A  1  17   ? 14.569  145.746 81.397  1.00 37.75  ? 18   C   A "O2'" 1 
ATOM   179   C  "C1'" . C   A  1  17   ? 15.901  144.212 82.656  1.00 36.68  ? 18   C   A "C1'" 1 
ATOM   180   N  N1    . C   A  1  17   ? 17.313  144.134 83.074  1.00 36.35  ? 18   C   A N1    1 
ATOM   181   C  C2    . C   A  1  17   ? 17.884  145.241 83.716  1.00 36.91  ? 18   C   A C2    1 
ATOM   182   O  O2    . C   A  1  17   ? 17.192  146.250 83.909  1.00 38.32  ? 18   C   A O2    1 
ATOM   183   N  N3    . C   A  1  17   ? 19.175  145.182 84.107  1.00 36.40  ? 18   C   A N3    1 
ATOM   184   C  C4    . C   A  1  17   ? 19.891  144.080 83.878  1.00 35.20  ? 18   C   A C4    1 
ATOM   185   N  N4    . C   A  1  17   ? 21.157  144.063 84.278  1.00 34.44  ? 18   C   A N4    1 
ATOM   186   C  C5    . C   A  1  17   ? 19.337  142.945 83.229  1.00 36.03  ? 18   C   A C5    1 
ATOM   187   C  C6    . C   A  1  17   ? 18.058  143.013 82.846  1.00 35.80  ? 18   C   A C6    1 
ATOM   188   P  P     . U   A  1  18   ? 15.870  144.475 77.834  1.00 37.92  ? 19   U   A P     1 
ATOM   189   O  OP1   . U   A  1  18   ? 14.974  144.578 76.661  1.00 38.11  ? 19   U   A OP1   1 
ATOM   190   O  OP2   . U   A  1  18   ? 17.092  143.614 77.744  1.00 37.72  ? 19   U   A OP2   1 
ATOM   191   O  "O5'" . U   A  1  18   ? 16.325  145.954 78.206  1.00 36.05  ? 19   U   A "O5'" 1 
ATOM   192   C  "C5'" . U   A  1  18   ? 15.426  147.055 78.069  1.00 32.50  ? 19   U   A "C5'" 1 
ATOM   193   C  "C4'" . U   A  1  18   ? 16.133  148.336 78.400  1.00 30.82  ? 19   U   A "C4'" 1 
ATOM   194   O  "O4'" . U   A  1  18   ? 16.489  148.332 79.803  1.00 31.06  ? 19   U   A "O4'" 1 
ATOM   195   C  "C3'" . U   A  1  18   ? 17.451  148.592 77.691  1.00 30.55  ? 19   U   A "C3'" 1 
ATOM   196   O  "O3'" . U   A  1  18   ? 17.279  149.141 76.401  1.00 30.12  ? 19   U   A "O3'" 1 
ATOM   197   C  "C2'" . U   A  1  18   ? 18.089  149.605 78.616  1.00 30.41  ? 19   U   A "C2'" 1 
ATOM   198   O  "O2'" . U   A  1  18   ? 17.462  150.862 78.462  1.00 31.12  ? 19   U   A "O2'" 1 
ATOM   199   C  "C1'" . U   A  1  18   ? 17.719  149.023 79.980  1.00 31.12  ? 19   U   A "C1'" 1 
ATOM   200   N  N1    . U   A  1  18   ? 18.759  148.074 80.417  1.00 32.95  ? 19   U   A N1    1 
ATOM   201   C  C2    . U   A  1  18   ? 19.877  148.602 81.029  1.00 32.80  ? 19   U   A C2    1 
ATOM   202   O  O2    . U   A  1  18   ? 19.996  149.789 81.281  1.00 32.15  ? 19   U   A O2    1 
ATOM   203   N  N3    . U   A  1  18   ? 20.849  147.687 81.346  1.00 33.32  ? 19   U   A N3    1 
ATOM   204   C  C4    . U   A  1  18   ? 20.809  146.328 81.144  1.00 32.39  ? 19   U   A C4    1 
ATOM   205   O  O4    . U   A  1  18   ? 21.727  145.635 81.563  1.00 33.30  ? 19   U   A O4    1 
ATOM   206   C  C5    . U   A  1  18   ? 19.615  145.852 80.534  1.00 32.56  ? 19   U   A C5    1 
ATOM   207   C  C6    . U   A  1  18   ? 18.653  146.714 80.203  1.00 32.88  ? 19   U   A C6    1 
ATOM   208   P  P     . G   A  1  19   ? 18.403  148.906 75.277  1.00 30.33  ? 20   G   A P     1 
ATOM   209   O  OP1   . G   A  1  19   ? 17.900  149.529 74.024  1.00 29.05  ? 20   G   A OP1   1 
ATOM   210   O  OP2   . G   A  1  19   ? 18.763  147.454 75.269  1.00 30.02  ? 20   G   A OP2   1 
ATOM   211   O  "O5'" . G   A  1  19   ? 19.656  149.745 75.795  1.00 28.44  ? 20   G   A "O5'" 1 
ATOM   212   C  "C5'" . G   A  1  19   ? 19.670  151.182 75.722  1.00 30.65  ? 20   G   A "C5'" 1 
ATOM   213   C  "C4'" . G   A  1  19   ? 20.897  151.723 76.403  1.00 30.56  ? 20   G   A "C4'" 1 
ATOM   214   O  "O4'" . G   A  1  19   ? 20.945  151.184 77.746  1.00 30.61  ? 20   G   A "O4'" 1 
ATOM   215   C  "C3'" . G   A  1  19   ? 22.214  151.267 75.810  1.00 31.06  ? 20   G   A "C3'" 1 
ATOM   216   O  "O3'" . G   A  1  19   ? 22.621  152.023 74.691  1.00 31.32  ? 20   G   A "O3'" 1 
ATOM   217   C  "C2'" . G   A  1  19   ? 23.174  151.436 76.972  1.00 30.93  ? 20   G   A "C2'" 1 
ATOM   218   O  "O2'" . G   A  1  19   ? 23.541  152.790 77.150  1.00 31.86  ? 20   G   A "O2'" 1 
ATOM   219   C  "C1'" . G   A  1  19   ? 22.296  150.969 78.134  1.00 31.05  ? 20   G   A "C1'" 1 
ATOM   220   N  N9    . G   A  1  19   ? 22.497  149.550 78.454  1.00 31.83  ? 20   G   A N9    1 
ATOM   221   C  C8    . G   A  1  19   ? 21.713  148.462 78.121  1.00 32.07  ? 20   G   A C8    1 
ATOM   222   N  N7    . G   A  1  19   ? 22.213  147.318 78.531  1.00 29.99  ? 20   G   A N7    1 
ATOM   223   C  C5    . G   A  1  19   ? 23.389  147.673 79.176  1.00 31.61  ? 20   G   A C5    1 
ATOM   224   C  C6    . G   A  1  19   ? 24.374  146.868 79.820  1.00 31.66  ? 20   G   A C6    1 
ATOM   225   O  O6    . G   A  1  19   ? 24.402  145.634 79.945  1.00 32.48  ? 20   G   A O6    1 
ATOM   226   N  N1    . G   A  1  19   ? 25.403  147.654 80.348  1.00 31.52  ? 20   G   A N1    1 
ATOM   227   C  C2    . G   A  1  19   ? 25.471  149.030 80.264  1.00 30.57  ? 20   G   A C2    1 
ATOM   228   N  N2    . G   A  1  19   ? 26.515  149.605 80.843  1.00 29.67  ? 20   G   A N2    1 
ATOM   229   N  N3    . G   A  1  19   ? 24.574  149.780 79.663  1.00 30.43  ? 20   G   A N3    1 
ATOM   230   C  C4    . G   A  1  19   ? 23.569  149.049 79.149  1.00 31.57  ? 20   G   A C4    1 
ATOM   231   P  P     . G   A  1  20   ? 23.418  151.292 73.511  1.00 34.83  ? 21   G   A P     1 
ATOM   232   O  OP1   . G   A  1  20   ? 23.651  152.328 72.482  1.00 34.88  ? 21   G   A OP1   1 
ATOM   233   O  OP2   . G   A  1  20   ? 22.718  150.041 73.134  1.00 35.18  ? 21   G   A OP2   1 
ATOM   234   O  "O5'" . G   A  1  20   ? 24.815  150.916 74.191  1.00 34.02  ? 21   G   A "O5'" 1 
ATOM   235   C  "C5'" . G   A  1  20   ? 25.737  151.962 74.535  1.00 31.67  ? 21   G   A "C5'" 1 
ATOM   236   C  "C4'" . G   A  1  20   ? 26.779  151.520 75.552  1.00 30.30  ? 21   G   A "C4'" 1 
ATOM   237   O  "O4'" . G   A  1  20   ? 26.270  150.564 76.517  1.00 29.10  ? 21   G   A "O4'" 1 
ATOM   238   C  "C3'" . G   A  1  20   ? 28.004  150.776 75.066  1.00 27.52  ? 21   G   A "C3'" 1 
ATOM   239   O  "O3'" . G   A  1  20   ? 28.910  151.623 74.370  1.00 25.41  ? 21   G   A "O3'" 1 
ATOM   240   C  "C2'" . G   A  1  20   ? 28.623  150.356 76.398  1.00 27.93  ? 21   G   A "C2'" 1 
ATOM   241   O  "O2'" . G   A  1  20   ? 29.315  151.418 77.029  1.00 25.95  ? 21   G   A "O2'" 1 
ATOM   242   C  "C1'" . G   A  1  20   ? 27.379  150.016 77.222  1.00 27.46  ? 21   G   A "C1'" 1 
ATOM   243   N  N9    . G   A  1  20   ? 27.214  148.572 77.382  1.00 28.74  ? 21   G   A N9    1 
ATOM   244   C  C8    . G   A  1  20   ? 26.232  147.768 76.858  1.00 29.34  ? 21   G   A C8    1 
ATOM   245   N  N7    . G   A  1  20   ? 26.372  146.506 77.176  1.00 29.84  ? 21   G   A N7    1 
ATOM   246   C  C5    . G   A  1  20   ? 27.510  146.476 77.967  1.00 29.91  ? 21   G   A C5    1 
ATOM   247   C  C6    . G   A  1  20   ? 28.149  145.389 78.619  1.00 30.97  ? 21   G   A C6    1 
ATOM   248   O  O6    . G   A  1  20   ? 27.811  144.208 78.646  1.00 30.13  ? 21   G   A O6    1 
ATOM   249   N  N1    . G   A  1  20   ? 29.292  145.801 79.300  1.00 31.01  ? 21   G   A N1    1 
ATOM   250   C  C2    . G   A  1  20   ? 29.757  147.093 79.351  1.00 30.89  ? 21   G   A C2    1 
ATOM   251   N  N2    . G   A  1  20   ? 30.884  147.277 80.036  1.00 32.42  ? 21   G   A N2    1 
ATOM   252   N  N3    . G   A  1  20   ? 29.158  148.121 78.769  1.00 29.50  ? 21   G   A N3    1 
ATOM   253   C  C4    . G   A  1  20   ? 28.048  147.743 78.098  1.00 29.60  ? 21   G   A C4    1 
ATOM   254   P  P     . U   A  1  21   ? 29.853  151.006 73.226  1.00 25.87  ? 22   U   A P     1 
ATOM   255   O  OP1   . U   A  1  21   ? 30.638  152.112 72.627  1.00 26.40  ? 22   U   A OP1   1 
ATOM   256   O  OP2   . U   A  1  21   ? 28.982  150.189 72.376  1.00 26.17  ? 22   U   A OP2   1 
ATOM   257   O  "O5'" . U   A  1  21   ? 30.841  150.021 73.987  1.00 24.93  ? 22   U   A "O5'" 1 
ATOM   258   C  "C5'" . U   A  1  21   ? 31.923  150.530 74.788  1.00 27.69  ? 22   U   A "C5'" 1 
ATOM   259   C  "C4'" . U   A  1  21   ? 32.640  149.394 75.479  1.00 29.24  ? 22   U   A "C4'" 1 
ATOM   260   O  "O4'" . U   A  1  21   ? 31.706  148.659 76.317  1.00 31.39  ? 22   U   A "O4'" 1 
ATOM   261   C  "C3'" . U   A  1  21   ? 33.244  148.336 74.574  1.00 31.01  ? 22   U   A "C3'" 1 
ATOM   262   O  "O3'" . U   A  1  21   ? 34.508  148.772 74.095  1.00 30.86  ? 22   U   A "O3'" 1 
ATOM   263   C  "C2'" . U   A  1  21   ? 33.352  147.144 75.519  1.00 31.81  ? 22   U   A "C2'" 1 
ATOM   264   O  "O2'" . U   A  1  21   ? 34.438  147.302 76.411  1.00 33.76  ? 22   U   A "O2'" 1 
ATOM   265   C  "C1'" . U   A  1  21   ? 32.063  147.286 76.337  1.00 32.35  ? 22   U   A "C1'" 1 
ATOM   266   N  N1    . U   A  1  21   ? 30.897  146.481 75.919  1.00 32.93  ? 22   U   A N1    1 
ATOM   267   C  C2    . U   A  1  21   ? 30.815  145.176 76.371  1.00 32.57  ? 22   U   A C2    1 
ATOM   268   O  O2    . U   A  1  21   ? 31.685  144.652 77.030  1.00 33.32  ? 22   U   A O2    1 
ATOM   269   N  N3    . U   A  1  21   ? 29.667  144.508 76.020  1.00 32.68  ? 22   U   A N3    1 
ATOM   270   C  C4    . U   A  1  21   ? 28.620  144.992 75.278  1.00 32.83  ? 22   U   A C4    1 
ATOM   271   O  O4    . U   A  1  21   ? 27.583  144.330 75.195  1.00 32.27  ? 22   U   A O4    1 
ATOM   272   C  C5    . U   A  1  21   ? 28.800  146.327 74.809  1.00 33.89  ? 22   U   A C5    1 
ATOM   273   C  C6    . U   A  1  21   ? 29.901  147.007 75.135  1.00 33.21  ? 22   U   A C6    1 
ATOM   274   P  P     . G   A  1  22   ? 34.982  148.381 72.610  1.00 32.10  ? 23   G   A P     1 
ATOM   275   O  OP1   . G   A  1  22   ? 36.388  148.858 72.487  1.00 32.48  ? 23   G   A OP1   1 
ATOM   276   O  OP2   . G   A  1  22   ? 33.968  148.820 71.604  1.00 33.31  ? 23   G   A OP2   1 
ATOM   277   O  "O5'" . G   A  1  22   ? 34.995  146.790 72.607  1.00 30.56  ? 23   G   A "O5'" 1 
ATOM   278   C  "C5'" . G   A  1  22   ? 35.923  146.052 73.409  1.00 30.00  ? 23   G   A "C5'" 1 
ATOM   279   C  "C4'" . G   A  1  22   ? 35.592  144.580 73.353  1.00 28.66  ? 23   G   A "C4'" 1 
ATOM   280   O  "O4'" . G   A  1  22   ? 34.315  144.332 73.988  1.00 29.64  ? 23   G   A "O4'" 1 
ATOM   281   C  "C3'" . G   A  1  22   ? 35.416  144.063 71.939  1.00 26.48  ? 23   G   A "C3'" 1 
ATOM   282   O  "O3'" . G   A  1  22   ? 36.660  143.693 71.410  1.00 23.85  ? 23   G   A "O3'" 1 
ATOM   283   C  "C2'" . G   A  1  22   ? 34.485  142.881 72.106  1.00 27.56  ? 23   G   A "C2'" 1 
ATOM   284   O  "O2'" . G   A  1  22   ? 35.143  141.712 72.526  1.00 28.30  ? 23   G   A "O2'" 1 
ATOM   285   C  "C1'" . G   A  1  22   ? 33.580  143.396 73.217  1.00 28.81  ? 23   G   A "C1'" 1 
ATOM   286   N  N9    . G   A  1  22   ? 32.399  144.079 72.719  1.00 29.43  ? 23   G   A N9    1 
ATOM   287   C  C8    . G   A  1  22   ? 32.308  145.378 72.296  1.00 29.05  ? 23   G   A C8    1 
ATOM   288   N  N7    . G   A  1  22   ? 31.093  145.735 72.009  1.00 28.88  ? 23   G   A N7    1 
ATOM   289   C  C5    . G   A  1  22   ? 30.344  144.594 72.243  1.00 27.81  ? 23   G   A C5    1 
ATOM   290   C  C6    . G   A  1  22   ? 28.956  144.376 72.148  1.00 27.96  ? 23   G   A C6    1 
ATOM   291   O  O6    . G   A  1  22   ? 28.072  145.192 71.845  1.00 28.23  ? 23   G   A O6    1 
ATOM   292   N  N1    . G   A  1  22   ? 28.622  143.061 72.460  1.00 26.87  ? 23   G   A N1    1 
ATOM   293   C  C2    . G   A  1  22   ? 29.512  142.089 72.823  1.00 28.28  ? 23   G   A C2    1 
ATOM   294   N  N2    . G   A  1  22   ? 29.011  140.881 73.062  1.00 28.56  ? 23   G   A N2    1 
ATOM   295   N  N3    . G   A  1  22   ? 30.805  142.286 72.938  1.00 28.81  ? 23   G   A N3    1 
ATOM   296   C  C4    . G   A  1  22   ? 31.148  143.555 72.640  1.00 28.96  ? 23   G   A C4    1 
ATOM   297   P  P     . G   A  1  23   ? 36.929  143.875 69.856  1.00 24.07  ? 24   G   A P     1 
ATOM   298   O  OP1   . G   A  1  23   ? 38.373  143.697 69.653  1.00 23.80  ? 24   G   A OP1   1 
ATOM   299   O  OP2   . G   A  1  23   ? 36.274  145.144 69.465  1.00 24.92  ? 24   G   A OP2   1 
ATOM   300   O  "O5'" . G   A  1  23   ? 36.162  142.650 69.195  1.00 21.74  ? 24   G   A "O5'" 1 
ATOM   301   C  "C5'" . G   A  1  23   ? 36.375  141.308 69.671  1.00 19.38  ? 24   G   A "C5'" 1 
ATOM   302   C  "C4'" . G   A  1  23   ? 35.312  140.397 69.123  1.00 20.29  ? 24   G   A "C4'" 1 
ATOM   303   O  "O4'" . G   A  1  23   ? 34.020  141.004 69.401  1.00 21.84  ? 24   G   A "O4'" 1 
ATOM   304   C  "C3'" . G   A  1  23   ? 35.350  140.202 67.615  1.00 18.09  ? 24   G   A "C3'" 1 
ATOM   305   O  "O3'" . G   A  1  23   ? 34.741  138.956 67.330  1.00 17.91  ? 24   G   A "O3'" 1 
ATOM   306   C  "C2'" . G   A  1  23   ? 34.473  141.339 67.126  1.00 19.88  ? 24   G   A "C2'" 1 
ATOM   307   O  "O2'" . G   A  1  23   ? 33.917  141.126 65.851  1.00 20.97  ? 24   G   A "O2'" 1 
ATOM   308   C  "C1'" . G   A  1  23   ? 33.385  141.335 68.191  1.00 22.96  ? 24   G   A "C1'" 1 
ATOM   309   N  N9    . G   A  1  23   ? 32.722  142.619 68.366  1.00 25.72  ? 24   G   A N9    1 
ATOM   310   C  C8    . G   A  1  23   ? 33.244  143.871 68.153  1.00 25.90  ? 24   G   A C8    1 
ATOM   311   N  N7    . G   A  1  23   ? 32.377  144.824 68.353  1.00 28.01  ? 24   G   A N7    1 
ATOM   312   C  C5    . G   A  1  23   ? 31.218  144.161 68.731  1.00 27.88  ? 24   G   A C5    1 
ATOM   313   C  C6    . G   A  1  23   ? 29.939  144.665 69.068  1.00 26.73  ? 24   G   A C6    1 
ATOM   314   O  O6    . G   A  1  23   ? 29.555  145.841 69.103  1.00 27.64  ? 24   G   A O6    1 
ATOM   315   N  N1    . G   A  1  23   ? 29.058  143.647 69.393  1.00 25.32  ? 24   G   A N1    1 
ATOM   316   C  C2    . G   A  1  23   ? 29.358  142.318 69.399  1.00 27.32  ? 24   G   A C2    1 
ATOM   317   N  N2    . G   A  1  23   ? 28.368  141.487 69.746  1.00 29.40  ? 24   G   A N2    1 
ATOM   318   N  N3    . G   A  1  23   ? 30.543  141.831 69.085  1.00 27.79  ? 24   G   A N3    1 
ATOM   319   C  C4    . G   A  1  23   ? 31.420  142.804 68.761  1.00 26.74  ? 24   G   A C4    1 
ATOM   320   P  P     . A   A  1  24   ? 35.173  138.130 66.033  1.00 19.37  ? 25   A   A P     1 
ATOM   321   O  OP1   . A   A  1  24   ? 36.630  137.912 66.107  1.00 20.20  ? 25   A   A OP1   1 
ATOM   322   O  OP2   . A   A  1  24   ? 34.606  138.775 64.852  1.00 18.62  ? 25   A   A OP2   1 
ATOM   323   O  "O5'" . A   A  1  24   ? 34.426  136.741 66.243  1.00 18.11  ? 25   A   A "O5'" 1 
ATOM   324   C  "C5'" . A   A  1  24   ? 34.821  135.850 67.288  1.00 18.55  ? 25   A   A "C5'" 1 
ATOM   325   C  "C4'" . A   A  1  24   ? 33.618  135.216 67.937  1.00 19.78  ? 25   A   A "C4'" 1 
ATOM   326   O  "O4'" . A   A  1  24   ? 32.875  136.192 68.703  1.00 22.60  ? 25   A   A "O4'" 1 
ATOM   327   C  "C3'" . A   A  1  24   ? 32.591  134.594 67.019  1.00 20.49  ? 25   A   A "C3'" 1 
ATOM   328   O  "O3'" . A   A  1  24   ? 32.995  133.300 66.579  1.00 20.13  ? 25   A   A "O3'" 1 
ATOM   329   C  "C2'" . A   A  1  24   ? 31.367  134.539 67.915  1.00 22.38  ? 25   A   A "C2'" 1 
ATOM   330   O  "O2'" . A   A  1  24   ? 31.405  133.448 68.803  1.00 24.46  ? 25   A   A "O2'" 1 
ATOM   331   C  "C1'" . A   A  1  24   ? 31.504  135.842 68.708  1.00 24.69  ? 25   A   A "C1'" 1 
ATOM   332   N  N9    . A   A  1  24   ? 30.728  136.932 68.106  1.00 28.34  ? 25   A   A N9    1 
ATOM   333   C  C8    . A   A  1  24   ? 31.181  138.059 67.458  1.00 28.85  ? 25   A   A C8    1 
ATOM   334   N  N7    . A   A  1  24   ? 30.222  138.804 66.955  1.00 28.71  ? 25   A   A N7    1 
ATOM   335   C  C5    . A   A  1  24   ? 29.057  138.134 67.314  1.00 29.28  ? 25   A   A C5    1 
ATOM   336   C  C6    . A   A  1  24   ? 27.693  138.378 67.052  1.00 30.46  ? 25   A   A C6    1 
ATOM   337   N  N6    . A   A  1  24   ? 27.252  139.406 66.324  1.00 30.63  ? 25   A   A N6    1 
ATOM   338   N  N1    . A   A  1  24   ? 26.791  137.506 67.555  1.00 30.22  ? 25   A   A N1    1 
ATOM   339   C  C2    . A   A  1  24   ? 27.233  136.462 68.254  1.00 29.73  ? 25   A   A C2    1 
ATOM   340   N  N3    . A   A  1  24   ? 28.475  136.113 68.553  1.00 30.14  ? 25   A   A N3    1 
ATOM   341   C  C4    . A   A  1  24   ? 29.353  136.996 68.045  1.00 29.71  ? 25   A   A C4    1 
ATOM   342   P  P     . U   A  1  25   ? 32.593  132.787 65.102  1.00 23.30  ? 26   U   A P     1 
ATOM   343   O  OP1   . U   A  1  25   ? 33.052  131.367 64.969  1.00 22.37  ? 26   U   A OP1   1 
ATOM   344   O  OP2   . U   A  1  25   ? 33.014  133.789 64.080  1.00 22.23  ? 26   U   A OP2   1 
ATOM   345   O  "O5'" . U   A  1  25   ? 31.008  132.759 65.129  1.00 21.05  ? 26   U   A "O5'" 1 
ATOM   346   C  "C5'" . U   A  1  25   ? 30.309  131.916 66.042  1.00 21.14  ? 26   U   A "C5'" 1 
ATOM   347   C  "C4'" . U   A  1  25   ? 28.837  132.217 65.978  1.00 22.24  ? 26   U   A "C4'" 1 
ATOM   348   O  "O4'" . U   A  1  25   ? 28.560  133.540 66.505  1.00 24.40  ? 26   U   A "O4'" 1 
ATOM   349   C  "C3'" . U   A  1  25   ? 28.268  132.252 64.574  1.00 22.53  ? 26   U   A "C3'" 1 
ATOM   350   O  "O3'" . U   A  1  25   ? 27.918  130.948 64.183  1.00 21.93  ? 26   U   A "O3'" 1 
ATOM   351   C  "C2'" . U   A  1  25   ? 27.027  133.105 64.743  1.00 24.90  ? 26   U   A "C2'" 1 
ATOM   352   O  "O2'" . U   A  1  25   ? 25.981  132.342 65.306  1.00 27.34  ? 26   U   A "O2'" 1 
ATOM   353   C  "C1'" . U   A  1  25   ? 27.520  134.146 65.749  1.00 25.80  ? 26   U   A "C1'" 1 
ATOM   354   N  N1    . U   A  1  25   ? 28.069  135.361 65.126  1.00 27.68  ? 26   U   A N1    1 
ATOM   355   C  C2    . U   A  1  25   ? 27.186  136.297 64.626  1.00 28.01  ? 26   U   A C2    1 
ATOM   356   O  O2    . U   A  1  25   ? 25.987  136.119 64.582  1.00 30.58  ? 26   U   A O2    1 
ATOM   357   N  N3    . U   A  1  25   ? 27.771  137.450 64.164  1.00 29.92  ? 26   U   A N3    1 
ATOM   358   C  C4    . U   A  1  25   ? 29.122  137.741 64.131  1.00 29.10  ? 26   U   A C4    1 
ATOM   359   O  O4    . U   A  1  25   ? 29.478  138.904 63.948  1.00 30.48  ? 26   U   A O4    1 
ATOM   360   C  C5    . U   A  1  25   ? 29.965  136.689 64.593  1.00 28.73  ? 26   U   A C5    1 
ATOM   361   C  C6    . U   A  1  25   ? 29.429  135.573 65.068  1.00 27.90  ? 26   U   A C6    1 
ATOM   362   P  P     . U   A  1  26   ? 28.203  130.464 62.687  1.00 25.93  ? 27   U   A P     1 
ATOM   363   O  OP1   . U   A  1  26   ? 28.058  128.988 62.758  1.00 24.19  ? 27   U   A OP1   1 
ATOM   364   O  OP2   . U   A  1  26   ? 29.490  131.061 62.232  1.00 25.66  ? 27   U   A OP2   1 
ATOM   365   O  "O5'" . U   A  1  26   ? 27.031  131.115 61.823  1.00 23.91  ? 27   U   A "O5'" 1 
ATOM   366   C  "C5'" . U   A  1  26   ? 25.667  130.691 61.996  1.00 24.46  ? 27   U   A "C5'" 1 
ATOM   367   C  "C4'" . U   A  1  26   ? 24.722  131.657 61.326  1.00 23.85  ? 27   U   A "C4'" 1 
ATOM   368   O  "O4'" . U   A  1  26   ? 24.804  132.941 61.986  1.00 23.12  ? 27   U   A "O4'" 1 
ATOM   369   C  "C3'" . U   A  1  26   ? 24.993  131.986 59.869  1.00 23.68  ? 27   U   A "C3'" 1 
ATOM   370   O  "O3'" . U   A  1  26   ? 24.548  130.982 58.977  1.00 24.72  ? 27   U   A "O3'" 1 
ATOM   371   C  "C2'" . U   A  1  26   ? 24.256  133.300 59.703  1.00 23.76  ? 27   U   A "C2'" 1 
ATOM   372   O  "O2'" . U   A  1  26   ? 22.860  133.137 59.586  1.00 24.26  ? 27   U   A "O2'" 1 
ATOM   373   C  "C1'" . U   A  1  26   ? 24.565  133.971 61.040  1.00 24.94  ? 27   U   A "C1'" 1 
ATOM   374   N  N1    . U   A  1  26   ? 25.746  134.853 60.980  1.00 27.97  ? 27   U   A N1    1 
ATOM   375   C  C2    . U   A  1  26   ? 25.553  136.161 60.561  1.00 27.87  ? 27   U   A C2    1 
ATOM   376   O  O2    . U   A  1  26   ? 24.469  136.593 60.213  1.00 29.17  ? 27   U   A O2    1 
ATOM   377   N  N3    . U   A  1  26   ? 26.683  136.941 60.559  1.00 27.07  ? 27   U   A N3    1 
ATOM   378   C  C4    . U   A  1  26   ? 27.956  136.558 60.915  1.00 28.28  ? 27   U   A C4    1 
ATOM   379   O  O4    . U   A  1  26   ? 28.852  137.397 60.939  1.00 29.81  ? 27   U   A O4    1 
ATOM   380   C  C5    . U   A  1  26   ? 28.080  135.195 61.314  1.00 27.90  ? 27   U   A C5    1 
ATOM   381   C  C6    . U   A  1  26   ? 27.001  134.408 61.334  1.00 27.93  ? 27   U   A C6    1 
ATOM   382   P  P     . G   A  1  27   ? 25.428  130.650 57.682  1.00 27.61  ? 28   G   A P     1 
ATOM   383   O  OP1   . G   A  1  27   ? 24.949  129.406 57.032  1.00 25.50  ? 28   G   A OP1   1 
ATOM   384   O  OP2   . G   A  1  27   ? 26.840  130.738 58.125  1.00 29.00  ? 28   G   A OP2   1 
ATOM   385   O  "O5'" . G   A  1  27   ? 25.099  131.877 56.729  1.00 26.12  ? 28   G   A "O5'" 1 
ATOM   386   C  "C5'" . G   A  1  27   ? 23.731  132.207 56.416  1.00 25.73  ? 28   G   A "C5'" 1 
ATOM   387   C  "C4'" . G   A  1  27   ? 23.632  133.608 55.879  1.00 26.12  ? 28   G   A "C4'" 1 
ATOM   388   O  "O4'" . G   A  1  27   ? 23.843  134.585 56.925  1.00 27.17  ? 28   G   A "O4'" 1 
ATOM   389   C  "C3'" . G   A  1  27   ? 24.647  133.975 54.822  1.00 27.31  ? 28   G   A "C3'" 1 
ATOM   390   O  "O3'" . G   A  1  27   ? 24.267  133.469 53.562  1.00 26.68  ? 28   G   A "O3'" 1 
ATOM   391   C  "C2'" . G   A  1  27   ? 24.619  135.489 54.869  1.00 27.70  ? 28   G   A "C2'" 1 
ATOM   392   O  "O2'" . G   A  1  27   ? 23.549  136.037 54.150  1.00 28.71  ? 28   G   A "O2'" 1 
ATOM   393   C  "C1'" . G   A  1  27   ? 24.445  135.739 56.369  1.00 28.67  ? 28   G   A "C1'" 1 
ATOM   394   N  N9    . G   A  1  27   ? 25.750  135.939 56.996  1.00 29.92  ? 28   G   A N9    1 
ATOM   395   C  C8    . G   A  1  27   ? 26.528  135.027 57.683  1.00 31.84  ? 28   G   A C8    1 
ATOM   396   N  N7    . G   A  1  27   ? 27.694  135.507 58.025  1.00 32.57  ? 28   G   A N7    1 
ATOM   397   C  C5    . G   A  1  27   ? 27.675  136.814 57.554  1.00 32.91  ? 28   G   A C5    1 
ATOM   398   C  C6    . G   A  1  27   ? 28.666  137.821 57.604  1.00 33.53  ? 28   G   A C6    1 
ATOM   399   O  O6    . G   A  1  27   ? 29.805  137.750 58.061  1.00 33.66  ? 28   G   A O6    1 
ATOM   400   N  N1    . G   A  1  27   ? 28.218  139.011 57.031  1.00 33.32  ? 28   G   A N1    1 
ATOM   401   C  C2    . G   A  1  27   ? 26.976  139.203 56.477  1.00 32.14  ? 28   G   A C2    1 
ATOM   402   N  N2    . G   A  1  27   ? 26.700  140.428 56.012  1.00 31.76  ? 28   G   A N2    1 
ATOM   403   N  N3    . G   A  1  27   ? 26.061  138.262 56.396  1.00 32.00  ? 28   G   A N3    1 
ATOM   404   C  C4    . G   A  1  27   ? 26.472  137.102 56.950  1.00 31.46  ? 28   G   A C4    1 
ATOM   405   P  P     . C   A  1  28   ? 25.395  132.993 52.531  1.00 25.68  ? 29   C   A P     1 
ATOM   406   O  OP1   . C   A  1  28   ? 24.734  132.495 51.304  1.00 27.67  ? 29   C   A OP1   1 
ATOM   407   O  OP2   . C   A  1  28   ? 26.389  132.134 53.248  1.00 25.53  ? 29   C   A OP2   1 
ATOM   408   O  "O5'" . C   A  1  28   ? 26.058  134.362 52.115  1.00 25.97  ? 29   C   A "O5'" 1 
ATOM   409   C  "C5'" . C   A  1  28   ? 25.269  135.357 51.460  1.00 23.70  ? 29   C   A "C5'" 1 
ATOM   410   C  "C4'" . C   A  1  28   ? 26.114  136.558 51.182  1.00 25.49  ? 29   C   A "C4'" 1 
ATOM   411   O  "O4'" . C   A  1  28   ? 26.536  137.143 52.440  1.00 25.73  ? 29   C   A "O4'" 1 
ATOM   412   C  "C3'" . C   A  1  28   ? 27.421  136.268 50.470  1.00 24.67  ? 29   C   A "C3'" 1 
ATOM   413   O  "O3'" . C   A  1  28   ? 27.256  136.209 49.075  1.00 26.69  ? 29   C   A "O3'" 1 
ATOM   414   C  "C2'" . C   A  1  28   ? 28.263  137.472 50.838  1.00 25.20  ? 29   C   A "C2'" 1 
ATOM   415   O  "O2'" . C   A  1  28   ? 27.954  138.586 50.032  1.00 25.42  ? 29   C   A "O2'" 1 
ATOM   416   C  "C1'" . C   A  1  28   ? 27.819  137.715 52.277  1.00 26.11  ? 29   C   A "C1'" 1 
ATOM   417   N  N1    . C   A  1  28   ? 28.751  137.141 53.253  1.00 28.76  ? 29   C   A N1    1 
ATOM   418   C  C2    . C   A  1  28   ? 29.870  137.888 53.572  1.00 30.17  ? 29   C   A C2    1 
ATOM   419   O  O2    . C   A  1  28   ? 30.022  138.986 53.023  1.00 31.12  ? 29   C   A O2    1 
ATOM   420   N  N3    . C   A  1  28   ? 30.766  137.414 54.463  1.00 31.34  ? 29   C   A N3    1 
ATOM   421   C  C4    . C   A  1  28   ? 30.575  136.236 55.025  1.00 31.53  ? 29   C   A C4    1 
ATOM   422   N  N4    . C   A  1  28   ? 31.487  135.811 55.895  1.00 30.90  ? 29   C   A N4    1 
ATOM   423   C  C5    . C   A  1  28   ? 29.436  135.436 54.721  1.00 32.64  ? 29   C   A C5    1 
ATOM   424   C  C6    . C   A  1  28   ? 28.550  135.924 53.836  1.00 30.17  ? 29   C   A C6    1 
ATOM   425   P  P     . U   A  1  29   ? 28.247  135.312 48.207  1.00 30.77  ? 30   U   A P     1 
ATOM   426   O  OP1   . U   A  1  29   ? 27.640  135.220 46.857  1.00 30.68  ? 30   U   A OP1   1 
ATOM   427   O  OP2   . U   A  1  29   ? 28.518  134.075 48.986  1.00 29.50  ? 30   U   A OP2   1 
ATOM   428   O  "O5'" . U   A  1  29   ? 29.600  136.154 48.115  1.00 29.67  ? 30   U   A "O5'" 1 
ATOM   429   C  "C5'" . U   A  1  29   ? 29.613  137.552 47.745  1.00 28.99  ? 30   U   A "C5'" 1 
ATOM   430   C  "C4'" . U   A  1  29   ? 31.039  138.079 47.731  1.00 29.34  ? 30   U   A "C4'" 1 
ATOM   431   O  "O4'" . U   A  1  29   ? 31.599  137.992 49.074  1.00 27.68  ? 30   U   A "O4'" 1 
ATOM   432   C  "C3'" . U   A  1  29   ? 32.005  137.328 46.811  1.00 29.45  ? 30   U   A "C3'" 1 
ATOM   433   O  "O3'" . U   A  1  29   ? 32.966  138.209 46.214  1.00 31.01  ? 30   U   A "O3'" 1 
ATOM   434   C  "C2'" . U   A  1  29   ? 32.699  136.378 47.777  1.00 29.31  ? 30   U   A "C2'" 1 
ATOM   435   O  "O2'" . U   A  1  29   ? 33.972  135.981 47.314  1.00 28.09  ? 30   U   A "O2'" 1 
ATOM   436   C  "C1'" . U   A  1  29   ? 32.796  137.249 49.030  1.00 29.72  ? 30   U   A "C1'" 1 
ATOM   437   N  N1    . U   A  1  29   ? 32.993  136.564 50.321  1.00 33.03  ? 30   U   A N1    1 
ATOM   438   C  C2    . U   A  1  29   ? 33.909  137.125 51.199  1.00 34.71  ? 30   U   A C2    1 
ATOM   439   O  O2    . U   A  1  29   ? 34.487  138.176 50.975  1.00 35.73  ? 30   U   A O2    1 
ATOM   440   N  N3    . U   A  1  29   ? 34.122  136.415 52.352  1.00 35.67  ? 30   U   A N3    1 
ATOM   441   C  C4    . U   A  1  29   ? 33.528  135.235 52.723  1.00 34.73  ? 30   U   A C4    1 
ATOM   442   O  O4    . U   A  1  29   ? 33.942  134.640 53.719  1.00 34.70  ? 30   U   A O4    1 
ATOM   443   C  C5    . U   A  1  29   ? 32.560  134.743 51.793  1.00 35.44  ? 30   U   A C5    1 
ATOM   444   C  C6    . U   A  1  29   ? 32.330  135.407 50.651  1.00 34.14  ? 30   U   A C6    1 
ATOM   445   P  P     . C   A  1  30   ? 32.669  138.852 44.767  1.00 32.93  ? 31   C   A P     1 
ATOM   446   O  OP1   . C   A  1  30   ? 32.128  140.222 45.005  1.00 30.97  ? 31   C   A OP1   1 
ATOM   447   O  OP2   . C   A  1  30   ? 31.897  137.897 43.941  1.00 31.36  ? 31   C   A OP2   1 
ATOM   448   O  "O5'" . C   A  1  30   ? 34.090  138.987 44.068  1.00 33.97  ? 31   C   A "O5'" 1 
ATOM   449   C  "C5'" . C   A  1  30   ? 35.298  138.739 44.787  1.00 38.29  ? 31   C   A "C5'" 1 
ATOM   450   C  "C4'" . C   A  1  30   ? 36.400  139.628 44.270  1.00 41.21  ? 31   C   A "C4'" 1 
ATOM   451   O  "O4'" . C   A  1  30   ? 35.994  141.019 44.326  1.00 44.80  ? 31   C   A "O4'" 1 
ATOM   452   C  "C3'" . C   A  1  30   ? 37.693  139.552 45.058  1.00 41.47  ? 31   C   A "C3'" 1 
ATOM   453   O  "O3'" . C   A  1  30   ? 38.736  139.922 44.190  1.00 37.38  ? 31   C   A "O3'" 1 
ATOM   454   C  "C2'" . C   A  1  30   ? 37.521  140.671 46.066  1.00 44.44  ? 31   C   A "C2'" 1 
ATOM   455   O  "O2'" . C   A  1  30   ? 38.758  141.137 46.549  1.00 44.50  ? 31   C   A "O2'" 1 
ATOM   456   C  "C1'" . C   A  1  30   ? 36.858  141.731 45.193  1.00 48.52  ? 31   C   A "C1'" 1 
ATOM   457   N  N1    . C   A  1  30   ? 36.066  142.726 45.937  1.00 55.31  ? 31   C   A N1    1 
ATOM   458   C  C2    . C   A  1  30   ? 36.691  143.910 46.382  1.00 59.01  ? 31   C   A C2    1 
ATOM   459   O  O2    . C   A  1  30   ? 37.904  144.084 46.148  1.00 60.58  ? 31   C   A O2    1 
ATOM   460   N  N3    . C   A  1  30   ? 35.958  144.832 47.052  1.00 60.75  ? 31   C   A N3    1 
ATOM   461   C  C4    . C   A  1  30   ? 34.661  144.608 47.289  1.00 61.26  ? 31   C   A C4    1 
ATOM   462   N  N4    . C   A  1  30   ? 33.974  145.542 47.955  1.00 64.03  ? 31   C   A N4    1 
ATOM   463   C  C5    . C   A  1  30   ? 34.008  143.414 46.855  1.00 60.48  ? 31   C   A C5    1 
ATOM   464   C  C6    . C   A  1  30   ? 34.740  142.512 46.191  1.00 58.29  ? 31   C   A C6    1 
ATOM   465   P  P     . G   A  1  31   ? 39.730  138.806 43.622  1.00 35.60  ? 32   G   A P     1 
ATOM   466   O  OP1   . G   A  1  31   ? 40.656  139.513 42.712  1.00 36.46  ? 32   G   A OP1   1 
ATOM   467   O  OP2   . G   A  1  31   ? 38.897  137.692 43.096  1.00 35.28  ? 32   G   A OP2   1 
ATOM   468   O  "O5'" . G   A  1  31   ? 40.508  138.267 44.902  1.00 32.83  ? 32   G   A "O5'" 1 
ATOM   469   C  "C5'" . G   A  1  31   ? 41.320  139.125 45.707  1.00 27.86  ? 32   G   A "C5'" 1 
ATOM   470   C  "C4'" . G   A  1  31   ? 41.834  138.349 46.898  1.00 25.20  ? 32   G   A "C4'" 1 
ATOM   471   O  "O4'" . G   A  1  31   ? 40.706  137.935 47.726  1.00 27.39  ? 32   G   A "O4'" 1 
ATOM   472   C  "C3'" . G   A  1  31   ? 42.536  137.046 46.547  1.00 24.22  ? 32   G   A "C3'" 1 
ATOM   473   O  "O3'" . G   A  1  31   ? 43.885  137.318 46.194  1.00 21.49  ? 32   G   A "O3'" 1 
ATOM   474   C  "C2'" . G   A  1  31   ? 42.365  136.230 47.827  1.00 25.42  ? 32   G   A "C2'" 1 
ATOM   475   O  "O2'" . G   A  1  31   ? 43.287  136.564 48.832  1.00 26.69  ? 32   G   A "O2'" 1 
ATOM   476   C  "C1'" . G   A  1  31   ? 40.963  136.653 48.286  1.00 26.88  ? 32   G   A "C1'" 1 
ATOM   477   N  N9    . G   A  1  31   ? 39.938  135.709 47.837  1.00 30.04  ? 32   G   A N9    1 
ATOM   478   C  C8    . G   A  1  31   ? 39.199  135.776 46.683  1.00 29.97  ? 32   G   A C8    1 
ATOM   479   N  N7    . G   A  1  31   ? 38.463  134.713 46.480  1.00 30.52  ? 32   G   A N7    1 
ATOM   480   C  C5    . G   A  1  31   ? 38.703  133.907 47.585  1.00 31.32  ? 32   G   A C5    1 
ATOM   481   C  C6    . G   A  1  31   ? 38.203  132.611 47.914  1.00 31.96  ? 32   G   A C6    1 
ATOM   482   O  O6    . G   A  1  31   ? 37.456  131.885 47.251  1.00 31.19  ? 32   G   A O6    1 
ATOM   483   N  N1    . G   A  1  31   ? 38.684  132.178 49.146  1.00 32.17  ? 32   G   A N1    1 
ATOM   484   C  C2    . G   A  1  31   ? 39.539  132.886 49.950  1.00 31.92  ? 32   G   A C2    1 
ATOM   485   N  N2    . G   A  1  31   ? 39.872  132.309 51.101  1.00 33.64  ? 32   G   A N2    1 
ATOM   486   N  N3    . G   A  1  31   ? 40.030  134.075 49.647  1.00 31.54  ? 32   G   A N3    1 
ATOM   487   C  C4    . G   A  1  31   ? 39.577  134.523 48.457  1.00 30.72  ? 32   G   A C4    1 
ATOM   488   P  P     . G   A  1  32   ? 44.842  136.142 45.671  1.00 24.18  ? 33   G   A P     1 
ATOM   489   O  OP1   . G   A  1  32   ? 46.206  136.721 45.587  1.00 20.93  ? 33   G   A OP1   1 
ATOM   490   O  OP2   . G   A  1  32   ? 44.265  135.443 44.493  1.00 20.97  ? 33   G   A OP2   1 
ATOM   491   O  "O5'" . G   A  1  32   ? 44.862  135.137 46.898  1.00 23.73  ? 33   G   A "O5'" 1 
ATOM   492   C  "C5'" . G   A  1  32   ? 45.251  133.775 46.721  1.00 23.18  ? 33   G   A "C5'" 1 
ATOM   493   C  "C4'" . G   A  1  32   ? 44.893  132.983 47.945  1.00 23.39  ? 33   G   A "C4'" 1 
ATOM   494   O  "O4'" . G   A  1  32   ? 43.494  133.163 48.281  1.00 25.07  ? 33   G   A "O4'" 1 
ATOM   495   C  "C3'" . G   A  1  32   ? 45.086  131.489 47.804  1.00 23.08  ? 33   G   A "C3'" 1 
ATOM   496   O  "O3'" . G   A  1  32   ? 46.418  131.208 48.201  1.00 23.75  ? 33   G   A "O3'" 1 
ATOM   497   C  "C2'" . G   A  1  32   ? 44.141  130.959 48.867  1.00 24.68  ? 33   G   A "C2'" 1 
ATOM   498   O  "O2'" . G   A  1  32   ? 44.755  131.087 50.127  1.00 26.23  ? 33   G   A "O2'" 1 
ATOM   499   C  "C1'" . G   A  1  32   ? 42.967  131.948 48.784  1.00 26.64  ? 33   G   A "C1'" 1 
ATOM   500   N  N9    . G   A  1  32   ? 41.901  131.500 47.884  1.00 30.21  ? 33   G   A N9    1 
ATOM   501   C  C8    . G   A  1  32   ? 41.420  132.141 46.767  1.00 31.95  ? 33   G   A C8    1 
ATOM   502   N  N7    . G   A  1  32   ? 40.558  131.424 46.098  1.00 30.71  ? 33   G   A N7    1 
ATOM   503   C  C5    . G   A  1  32   ? 40.446  130.254 46.830  1.00 30.96  ? 33   G   A C5    1 
ATOM   504   C  C6    . G   A  1  32   ? 39.701  129.085 46.572  1.00 31.15  ? 33   G   A C6    1 
ATOM   505   O  O6    . G   A  1  32   ? 38.996  128.823 45.585  1.00 32.58  ? 33   G   A O6    1 
ATOM   506   N  N1    . G   A  1  32   ? 39.854  128.150 47.587  1.00 29.67  ? 33   G   A N1    1 
ATOM   507   C  C2    . G   A  1  32   ? 40.646  128.310 48.692  1.00 29.35  ? 33   G   A C2    1 
ATOM   508   N  N2    . G   A  1  32   ? 40.655  127.297 49.562  1.00 28.73  ? 33   G   A N2    1 
ATOM   509   N  N3    . G   A  1  32   ? 41.373  129.381 48.925  1.00 30.73  ? 33   G   A N3    1 
ATOM   510   C  C4    . G   A  1  32   ? 41.228  130.305 47.960  1.00 30.64  ? 33   G   A C4    1 
ATOM   511   P  P     . C   A  1  33   ? 47.409  130.399 47.238  1.00 24.16  ? 34   C   A P     1 
ATOM   512   O  OP1   . C   A  1  33   ? 48.733  130.489 47.876  1.00 24.33  ? 34   C   A OP1   1 
ATOM   513   O  OP2   . C   A  1  33   ? 47.246  130.876 45.856  1.00 24.59  ? 34   C   A OP2   1 
ATOM   514   O  "O5'" . C   A  1  33   ? 46.894  128.899 47.385  1.00 25.15  ? 34   C   A "O5'" 1 
ATOM   515   C  "C5'" . C   A  1  33   ? 46.755  128.296 48.710  1.00 23.70  ? 34   C   A "C5'" 1 
ATOM   516   C  "C4'" . C   A  1  33   ? 45.874  127.055 48.661  1.00 23.07  ? 34   C   A "C4'" 1 
ATOM   517   O  "O4'" . C   A  1  33   ? 44.459  127.397 48.622  1.00 23.26  ? 34   C   A "O4'" 1 
ATOM   518   C  "C3'" . C   A  1  33   ? 46.059  126.094 47.500  1.00 21.62  ? 34   C   A "C3'" 1 
ATOM   519   O  "O3'" . C   A  1  33   ? 47.189  125.276 47.698  1.00 20.78  ? 34   C   A "O3'" 1 
ATOM   520   C  "C2'" . C   A  1  33   ? 44.758  125.308 47.561  1.00 23.22  ? 34   C   A "C2'" 1 
ATOM   521   O  "O2'" . C   A  1  33   ? 44.727  124.401 48.648  1.00 23.23  ? 34   C   A "O2'" 1 
ATOM   522   C  "C1'" . C   A  1  33   ? 43.758  126.427 47.857  1.00 24.49  ? 34   C   A "C1'" 1 
ATOM   523   N  N1    . C   A  1  33   ? 43.265  127.079 46.625  1.00 29.16  ? 34   C   A N1    1 
ATOM   524   C  C2    . C   A  1  33   ? 42.303  126.416 45.811  1.00 29.69  ? 34   C   A C2    1 
ATOM   525   O  O2    . C   A  1  33   ? 41.926  125.257 46.110  1.00 29.89  ? 34   C   A O2    1 
ATOM   526   N  N3    . C   A  1  33   ? 41.822  127.051 44.716  1.00 29.47  ? 34   C   A N3    1 
ATOM   527   C  C4    . C   A  1  33   ? 42.265  128.269 44.405  1.00 29.82  ? 34   C   A C4    1 
ATOM   528   N  N4    . C   A  1  33   ? 41.756  128.861 43.324  1.00 30.95  ? 34   C   A N4    1 
ATOM   529   C  C5    . C   A  1  33   ? 43.251  128.941 45.187  1.00 31.15  ? 34   C   A C5    1 
ATOM   530   C  C6    . C   A  1  33   ? 43.719  128.317 46.273  1.00 30.06  ? 34   C   A C6    1 
ATOM   531   P  P     . U   A  1  34   ? 48.031  124.768 46.435  1.00 22.03  ? 35   U   A P     1 
ATOM   532   O  OP1   . U   A  1  34   ? 49.191  123.988 46.939  1.00 19.93  ? 35   U   A OP1   1 
ATOM   533   O  OP2   . U   A  1  34   ? 48.257  125.926 45.539  1.00 21.45  ? 35   U   A OP2   1 
ATOM   534   O  "O5'" . U   A  1  34   ? 47.055  123.773 45.672  1.00 22.59  ? 35   U   A "O5'" 1 
ATOM   535   C  "C5'" . U   A  1  34   ? 46.773  122.467 46.200  1.00 22.26  ? 35   U   A "C5'" 1 
ATOM   536   C  "C4'" . U   A  1  34   ? 45.673  121.820 45.411  1.00 20.67  ? 35   U   A "C4'" 1 
ATOM   537   O  "O4'" . U   A  1  34   ? 44.495  122.660 45.466  1.00 19.79  ? 35   U   A "O4'" 1 
ATOM   538   C  "C3'" . U   A  1  34   ? 45.914  121.657 43.925  1.00 19.87  ? 35   U   A "C3'" 1 
ATOM   539   O  "O3'" . U   A  1  34   ? 46.703  120.505 43.651  1.00 19.99  ? 35   U   A "O3'" 1 
ATOM   540   C  "C2'" . U   A  1  34   ? 44.496  121.510 43.401  1.00 20.51  ? 35   U   A "C2'" 1 
ATOM   541   O  "O2'" . U   A  1  34   ? 43.991  120.222 43.689  1.00 20.89  ? 35   U   A "O2'" 1 
ATOM   542   C  "C1'" . U   A  1  34   ? 43.755  122.533 44.261  1.00 20.78  ? 35   U   A "C1'" 1 
ATOM   543   N  N1    . U   A  1  34   ? 43.673  123.850 43.607  1.00 22.20  ? 35   U   A N1    1 
ATOM   544   C  C2    . U   A  1  34   ? 42.669  124.032 42.659  1.00 23.09  ? 35   U   A C2    1 
ATOM   545   O  O2    . U   A  1  34   ? 41.807  123.197 42.430  1.00 23.42  ? 35   U   A O2    1 
ATOM   546   N  N3    . U   A  1  34   ? 42.698  125.232 41.996  1.00 23.91  ? 35   U   A N3    1 
ATOM   547   C  C4    . U   A  1  34   ? 43.589  126.257 42.185  1.00 22.49  ? 35   U   A C4    1 
ATOM   548   O  O4    . U   A  1  34   ? 43.568  127.224 41.428  1.00 24.22  ? 35   U   A O4    1 
ATOM   549   C  C5    . U   A  1  34   ? 44.552  126.025 43.226  1.00 22.63  ? 35   U   A C5    1 
ATOM   550   C  C6    . U   A  1  34   ? 44.562  124.861 43.886  1.00 21.37  ? 35   U   A C6    1 
ATOM   551   P  P     . C   A  1  35   ? 47.454  120.367 42.239  1.00 21.48  ? 36   C   A P     1 
ATOM   552   O  OP1   . C   A  1  35   ? 48.442  119.260 42.368  1.00 18.81  ? 36   C   A OP1   1 
ATOM   553   O  OP2   . C   A  1  35   ? 47.910  121.703 41.820  1.00 20.97  ? 36   C   A OP2   1 
ATOM   554   O  "O5'" . C   A  1  35   ? 46.306  119.922 41.227  1.00 21.77  ? 36   C   A "O5'" 1 
ATOM   555   C  "C5'" . C   A  1  35   ? 45.475  118.770 41.485  1.00 22.55  ? 36   C   A "C5'" 1 
ATOM   556   C  "C4'" . C   A  1  35   ? 44.322  118.734 40.509  1.00 24.81  ? 36   C   A "C4'" 1 
ATOM   557   O  "O4'" . C   A  1  35   ? 43.439  119.853 40.751  1.00 25.10  ? 36   C   A "O4'" 1 
ATOM   558   C  "C3'" . C   A  1  35   ? 44.693  118.893 39.047  1.00 26.56  ? 36   C   A "C3'" 1 
ATOM   559   O  "O3'" . C   A  1  35   ? 45.112  117.686 38.435  1.00 28.61  ? 36   C   A "O3'" 1 
ATOM   560   C  "C2'" . C   A  1  35   ? 43.405  119.391 38.421  1.00 26.39  ? 36   C   A "C2'" 1 
ATOM   561   O  "O2'" . C   A  1  35   ? 42.486  118.348 38.201  1.00 27.98  ? 36   C   A "O2'" 1 
ATOM   562   C  "C1'" . C   A  1  35   ? 42.872  120.294 39.527  1.00 26.38  ? 36   C   A "C1'" 1 
ATOM   563   N  N1    . C   A  1  35   ? 43.238  121.705 39.321  1.00 27.86  ? 36   C   A N1    1 
ATOM   564   C  C2    . C   A  1  35   ? 42.501  122.464 38.397  1.00 28.98  ? 36   C   A C2    1 
ATOM   565   O  O2    . C   A  1  35   ? 41.572  121.920 37.775  1.00 27.34  ? 36   C   A O2    1 
ATOM   566   N  N3    . C   A  1  35   ? 42.822  123.766 38.202  1.00 29.86  ? 36   C   A N3    1 
ATOM   567   C  C4    . C   A  1  35   ? 43.832  124.311 38.883  1.00 29.34  ? 36   C   A C4    1 
ATOM   568   N  N4    . C   A  1  35   ? 44.112  125.596 38.664  1.00 28.29  ? 36   C   A N4    1 
ATOM   569   C  C5    . C   A  1  35   ? 44.600  123.563 39.820  1.00 29.85  ? 36   C   A C5    1 
ATOM   570   C  C6    . C   A  1  35   ? 44.274  122.278 40.006  1.00 28.91  ? 36   C   A C6    1 
ATOM   571   P  P     . A   A  1  36   ? 46.129  117.759 37.197  1.00 31.34  ? 37   A   A P     1 
ATOM   572   O  OP1   . A   A  1  36   ? 46.515  116.363 36.858  1.00 30.30  ? 37   A   A OP1   1 
ATOM   573   O  OP2   . A   A  1  36   ? 47.187  118.741 37.584  1.00 28.96  ? 37   A   A OP2   1 
ATOM   574   O  "O5'" . A   A  1  36   ? 45.245  118.383 36.020  1.00 30.19  ? 37   A   A "O5'" 1 
ATOM   575   C  "C5'" . A   A  1  36   ? 44.108  117.671 35.488  1.00 31.09  ? 37   A   A "C5'" 1 
ATOM   576   C  "C4'" . A   A  1  36   ? 43.422  118.471 34.391  1.00 32.72  ? 37   A   A "C4'" 1 
ATOM   577   O  "O4'" . A   A  1  36   ? 42.759  119.633 34.959  1.00 34.78  ? 37   A   A "O4'" 1 
ATOM   578   C  "C3'" . A   A  1  36   ? 44.289  119.037 33.273  1.00 32.86  ? 37   A   A "C3'" 1 
ATOM   579   O  "O3'" . A   A  1  36   ? 44.564  118.086 32.250  1.00 31.82  ? 37   A   A "O3'" 1 
ATOM   580   C  "C2'" . A   A  1  36   ? 43.437  120.182 32.736  1.00 34.56  ? 37   A   A "C2'" 1 
ATOM   581   O  "O2'" . A   A  1  36   ? 42.482  119.808 31.766  1.00 34.30  ? 37   A   A "O2'" 1 
ATOM   582   C  "C1'" . A   A  1  36   ? 42.749  120.689 34.009  1.00 35.58  ? 37   A   A "C1'" 1 
ATOM   583   N  N9    . A   A  1  36   ? 43.471  121.827 34.571  1.00 37.66  ? 37   A   A N9    1 
ATOM   584   C  C8    . A   A  1  36   ? 44.417  121.818 35.568  1.00 38.09  ? 37   A   A C8    1 
ATOM   585   N  N7    . A   A  1  36   ? 44.943  122.992 35.805  1.00 40.13  ? 37   A   A N7    1 
ATOM   586   C  C5    . A   A  1  36   ? 44.291  123.836 34.914  1.00 39.09  ? 37   A   A C5    1 
ATOM   587   C  C6    . A   A  1  36   ? 44.415  125.212 34.650  1.00 39.11  ? 37   A   A C6    1 
ATOM   588   N  N6    . A   A  1  36   ? 45.292  126.005 35.266  1.00 39.43  ? 37   A   A N6    1 
ATOM   589   N  N1    . A   A  1  36   ? 43.607  125.749 33.706  1.00 39.31  ? 37   A   A N1    1 
ATOM   590   C  C2    . A   A  1  36   ? 42.753  124.945 33.069  1.00 39.83  ? 37   A   A C2    1 
ATOM   591   N  N3    . A   A  1  36   ? 42.553  123.637 33.219  1.00 39.95  ? 37   A   A N3    1 
ATOM   592   C  C4    . A   A  1  36   ? 43.366  123.136 34.165  1.00 38.42  ? 37   A   A C4    1 
ATOM   593   P  P     . G   A  1  37   ? 45.835  118.287 31.292  1.00 32.58  ? 38   G   A P     1 
ATOM   594   O  OP1   . G   A  1  37   ? 46.114  116.971 30.651  1.00 31.62  ? 38   G   A OP1   1 
ATOM   595   O  OP2   . G   A  1  37   ? 46.876  118.944 32.089  1.00 33.63  ? 38   G   A OP2   1 
ATOM   596   O  "O5'" . G   A  1  37   ? 45.365  119.327 30.183  1.00 32.40  ? 38   G   A "O5'" 1 
ATOM   597   C  "C5'" . G   A  1  37   ? 44.325  118.988 29.249  1.00 33.33  ? 38   G   A "C5'" 1 
ATOM   598   C  "C4'" . G   A  1  37   ? 43.877  120.213 28.489  1.00 33.89  ? 38   G   A "C4'" 1 
ATOM   599   O  "O4'" . G   A  1  37   ? 43.291  121.188 29.397  1.00 35.31  ? 38   G   A "O4'" 1 
ATOM   600   C  "C3'" . G   A  1  37   ? 44.974  121.006 27.804  1.00 33.77  ? 38   G   A "C3'" 1 
ATOM   601   O  "O3'" . G   A  1  37   ? 45.385  120.426 26.590  1.00 32.74  ? 38   G   A "O3'" 1 
ATOM   602   C  "C2'" . G   A  1  37   ? 44.292  122.341 27.589  1.00 34.79  ? 38   G   A "C2'" 1 
ATOM   603   O  "O2'" . G   A  1  37   ? 43.352  122.284 26.531  1.00 35.99  ? 38   G   A "O2'" 1 
ATOM   604   C  "C1'" . G   A  1  37   ? 43.580  122.504 28.930  1.00 35.93  ? 38   G   A "C1'" 1 
ATOM   605   N  N9    . G   A  1  37   ? 44.480  123.144 29.887  1.00 37.48  ? 38   G   A N9    1 
ATOM   606   C  C8    . G   A  1  37   ? 45.173  122.538 30.907  1.00 38.08  ? 38   G   A C8    1 
ATOM   607   N  N7    . G   A  1  37   ? 45.922  123.367 31.583  1.00 38.17  ? 38   G   A N7    1 
ATOM   608   C  C5    . G   A  1  37   ? 45.708  124.596 30.982  1.00 37.91  ? 38   G   A C5    1 
ATOM   609   C  C6    . G   A  1  37   ? 46.241  125.867 31.292  1.00 38.27  ? 38   G   A C6    1 
ATOM   610   O  O6    . G   A  1  37   ? 47.033  126.167 32.195  1.00 37.63  ? 38   G   A O6    1 
ATOM   611   N  N1    . G   A  1  37   ? 45.763  126.845 30.424  1.00 36.73  ? 38   G   A N1    1 
ATOM   612   C  C2    . G   A  1  37   ? 44.885  126.623 29.389  1.00 38.34  ? 38   G   A C2    1 
ATOM   613   N  N2    . G   A  1  37   ? 44.562  127.689 28.650  1.00 39.29  ? 38   G   A N2    1 
ATOM   614   N  N3    . G   A  1  37   ? 44.368  125.440 29.097  1.00 38.34  ? 38   G   A N3    1 
ATOM   615   C  C4    . G   A  1  37   ? 44.820  124.478 29.930  1.00 38.48  ? 38   G   A C4    1 
ATOM   616   P  P     . G   A  1  38   ? 46.852  120.730 26.040  1.00 33.67  ? 39   G   A P     1 
ATOM   617   O  OP1   . G   A  1  38   ? 46.958  120.069 24.729  1.00 33.40  ? 39   G   A OP1   1 
ATOM   618   O  OP2   . G   A  1  38   ? 47.850  120.436 27.106  1.00 33.42  ? 39   G   A OP2   1 
ATOM   619   O  "O5'" . G   A  1  38   ? 46.840  122.293 25.769  1.00 32.31  ? 39   G   A "O5'" 1 
ATOM   620   C  "C5'" . G   A  1  38   ? 46.193  122.815 24.600  1.00 32.67  ? 39   G   A "C5'" 1 
ATOM   621   C  "C4'" . G   A  1  38   ? 46.291  124.321 24.575  1.00 34.59  ? 39   G   A "C4'" 1 
ATOM   622   O  "O4'" . G   A  1  38   ? 45.938  124.828 25.891  1.00 34.68  ? 39   G   A "O4'" 1 
ATOM   623   C  "C3'" . G   A  1  38   ? 47.678  124.893 24.324  1.00 35.75  ? 39   G   A "C3'" 1 
ATOM   624   O  "O3'" . G   A  1  38   ? 47.938  124.957 22.930  1.00 36.78  ? 39   G   A "O3'" 1 
ATOM   625   C  "C2'" . G   A  1  38   ? 47.560  126.279 24.940  1.00 35.82  ? 39   G   A "C2'" 1 
ATOM   626   O  "O2'" . G   A  1  38   ? 46.838  127.164 24.103  1.00 36.85  ? 39   G   A "O2'" 1 
ATOM   627   C  "C1'" . G   A  1  38   ? 46.716  125.977 26.182  1.00 35.66  ? 39   G   A "C1'" 1 
ATOM   628   N  N9    . G   A  1  38   ? 47.489  125.709 27.395  1.00 37.01  ? 39   G   A N9    1 
ATOM   629   C  C8    . G   A  1  38   ? 47.701  124.488 28.001  1.00 37.53  ? 39   G   A C8    1 
ATOM   630   N  N7    . G   A  1  38   ? 48.412  124.571 29.093  1.00 37.20  ? 39   G   A N7    1 
ATOM   631   C  C5    . G   A  1  38   ? 48.697  125.922 29.211  1.00 37.98  ? 39   G   A C5    1 
ATOM   632   C  C6    . G   A  1  38   ? 49.439  126.619 30.201  1.00 38.20  ? 39   G   A C6    1 
ATOM   633   O  O6    . G   A  1  38   ? 50.017  126.165 31.198  1.00 37.73  ? 39   G   A O6    1 
ATOM   634   N  N1    . G   A  1  38   ? 49.474  127.986 29.944  1.00 38.67  ? 39   G   A N1    1 
ATOM   635   C  C2    . G   A  1  38   ? 48.879  128.606 28.870  1.00 37.94  ? 39   G   A C2    1 
ATOM   636   N  N2    . G   A  1  38   ? 49.020  129.939 28.799  1.00 38.01  ? 39   G   A N2    1 
ATOM   637   N  N3    . G   A  1  38   ? 48.190  127.966 27.936  1.00 37.70  ? 39   G   A N3    1 
ATOM   638   C  C4    . G   A  1  38   ? 48.137  126.638 28.168  1.00 37.24  ? 39   G   A C4    1 
ATOM   639   P  P     . C   A  1  39   ? 49.435  124.770 22.379  1.00 37.34  ? 40   C   A P     1 
ATOM   640   O  OP1   . C   A  1  39   ? 49.306  125.035 20.926  1.00 37.06  ? 40   C   A OP1   1 
ATOM   641   O  OP2   . C   A  1  39   ? 50.025  123.484 22.846  1.00 34.57  ? 40   C   A OP2   1 
ATOM   642   O  "O5'" . C   A  1  39   ? 50.240  125.979 23.035  1.00 38.32  ? 40   C   A "O5'" 1 
ATOM   643   C  "C5'" . C   A  1  39   ? 49.894  127.336 22.714  1.00 40.28  ? 40   C   A "C5'" 1 
ATOM   644   C  "C4'" . C   A  1  39   ? 50.595  128.302 23.641  1.00 40.81  ? 40   C   A "C4'" 1 
ATOM   645   O  "O4'" . C   A  1  39   ? 50.153  128.098 25.008  1.00 41.52  ? 40   C   A "O4'" 1 
ATOM   646   C  "C3'" . C   A  1  39   ? 52.107  128.195 23.704  1.00 40.83  ? 40   C   A "C3'" 1 
ATOM   647   O  "O3'" . C   A  1  39   ? 52.677  128.893 22.596  1.00 39.56  ? 40   C   A "O3'" 1 
ATOM   648   C  "C2'" . C   A  1  39   ? 52.404  128.834 25.055  1.00 41.42  ? 40   C   A "C2'" 1 
ATOM   649   O  "O2'" . C   A  1  39   ? 52.321  130.241 25.003  1.00 42.89  ? 40   C   A "O2'" 1 
ATOM   650   C  "C1'" . C   A  1  39   ? 51.237  128.311 25.899  1.00 41.97  ? 40   C   A "C1'" 1 
ATOM   651   N  N1    . C   A  1  39   ? 51.501  127.032 26.595  1.00 41.97  ? 40   C   A N1    1 
ATOM   652   C  C2    . C   A  1  39   ? 52.167  127.033 27.848  1.00 42.05  ? 40   C   A C2    1 
ATOM   653   O  O2    . C   A  1  39   ? 52.533  128.118 28.358  1.00 40.47  ? 40   C   A O2    1 
ATOM   654   N  N3    . C   A  1  39   ? 52.387  125.846 28.468  1.00 40.93  ? 40   C   A N3    1 
ATOM   655   C  C4    . C   A  1  39   ? 51.967  124.707 27.904  1.00 39.96  ? 40   C   A C4    1 
ATOM   656   N  N4    . C   A  1  39   ? 52.183  123.572 28.548  1.00 42.05  ? 40   C   A N4    1 
ATOM   657   C  C5    . C   A  1  39   ? 51.298  124.682 26.651  1.00 40.39  ? 40   C   A C5    1 
ATOM   658   C  C6    . C   A  1  39   ? 51.094  125.849 26.035  1.00 41.35  ? 40   C   A C6    1 
ATOM   659   P  P     . G   A  1  40   ? 54.251  128.757 22.273  1.00 39.41  ? 41   G   A P     1 
ATOM   660   O  OP1   . G   A  1  40   ? 54.583  129.812 21.268  1.00 39.96  ? 41   G   A OP1   1 
ATOM   661   O  OP2   . G   A  1  40   ? 54.580  127.327 21.976  1.00 37.46  ? 41   G   A OP2   1 
ATOM   662   O  "O5'" . G   A  1  40   ? 54.959  129.158 23.644  1.00 37.41  ? 41   G   A "O5'" 1 
ATOM   663   C  "C5'" . G   A  1  40   ? 55.237  130.529 23.971  1.00 35.52  ? 41   G   A "C5'" 1 
ATOM   664   C  "C4'" . G   A  1  40   ? 56.225  130.588 25.107  1.00 33.88  ? 41   G   A "C4'" 1 
ATOM   665   O  "O4'" . G   A  1  40   ? 55.610  130.014 26.293  1.00 33.70  ? 41   G   A "O4'" 1 
ATOM   666   C  "C3'" . G   A  1  40   ? 57.488  129.769 24.879  1.00 33.16  ? 41   G   A "C3'" 1 
ATOM   667   O  "O3'" . G   A  1  40   ? 58.477  130.541 24.195  1.00 32.13  ? 41   G   A "O3'" 1 
ATOM   668   C  "C2'" . G   A  1  40   ? 57.913  129.437 26.304  1.00 33.69  ? 41   G   A "C2'" 1 
ATOM   669   O  "O2'" . G   A  1  40   ? 58.541  130.535 26.918  1.00 35.08  ? 41   G   A "O2'" 1 
ATOM   670   C  "C1'" . G   A  1  40   ? 56.561  129.233 26.998  1.00 34.20  ? 41   G   A "C1'" 1 
ATOM   671   N  N9    . G   A  1  40   ? 56.103  127.843 27.003  1.00 35.51  ? 41   G   A N9    1 
ATOM   672   C  C8    . G   A  1  40   ? 55.485  127.184 25.967  1.00 35.60  ? 41   G   A C8    1 
ATOM   673   N  N7    . G   A  1  40   ? 55.210  125.939 26.243  1.00 35.82  ? 41   G   A N7    1 
ATOM   674   C  C5    . G   A  1  40   ? 55.666  125.761 27.542  1.00 36.20  ? 41   G   A C5    1 
ATOM   675   C  C6    . G   A  1  40   ? 55.649  124.611 28.367  1.00 35.95  ? 41   G   A C6    1 
ATOM   676   O  O6    . G   A  1  40   ? 55.211  123.486 28.106  1.00 36.50  ? 41   G   A O6    1 
ATOM   677   N  N1    . G   A  1  40   ? 56.217  124.863 29.607  1.00 36.36  ? 41   G   A N1    1 
ATOM   678   C  C2    . G   A  1  40   ? 56.734  126.065 30.006  1.00 36.37  ? 41   G   A C2    1 
ATOM   679   N  N2    . G   A  1  40   ? 57.240  126.102 31.241  1.00 35.90  ? 41   G   A N2    1 
ATOM   680   N  N3    . G   A  1  40   ? 56.756  127.148 29.252  1.00 37.02  ? 41   G   A N3    1 
ATOM   681   C  C4    . G   A  1  40   ? 56.213  126.926 28.035  1.00 36.18  ? 41   G   A C4    1 
ATOM   682   P  P     . C   A  1  41   ? 59.252  129.936 22.916  1.00 32.15  ? 42   C   A P     1 
ATOM   683   O  OP1   . C   A  1  41   ? 59.225  131.044 21.921  1.00 30.67  ? 42   C   A OP1   1 
ATOM   684   O  OP2   . C   A  1  41   ? 58.727  128.600 22.533  1.00 30.11  ? 42   C   A OP2   1 
ATOM   685   O  "O5'" . C   A  1  41   ? 60.755  129.755 23.441  1.00 30.24  ? 42   C   A "O5'" 1 
ATOM   686   C  "C5'" . C   A  1  41   ? 61.715  130.855 23.402  1.00 27.95  ? 42   C   A "C5'" 1 
ATOM   687   C  "C4'" . C   A  1  41   ? 61.517  131.777 24.585  1.00 28.50  ? 42   C   A "C4'" 1 
ATOM   688   O  "O4'" . C   A  1  41   ? 61.765  131.054 25.815  1.00 27.24  ? 42   C   A "O4'" 1 
ATOM   689   C  "C3'" . C   A  1  41   ? 62.441  132.980 24.669  1.00 29.10  ? 42   C   A "C3'" 1 
ATOM   690   O  "O3'" . C   A  1  41   ? 61.942  134.042 23.867  1.00 31.86  ? 42   C   A "O3'" 1 
ATOM   691   C  "C2'" . C   A  1  41   ? 62.370  133.329 26.147  1.00 28.65  ? 42   C   A "C2'" 1 
ATOM   692   O  "O2'" . C   A  1  41   ? 61.210  134.042 26.496  1.00 29.03  ? 42   C   A "O2'" 1 
ATOM   693   C  "C1'" . C   A  1  41   ? 62.307  131.937 26.778  1.00 28.07  ? 42   C   A "C1'" 1 
ATOM   694   N  N1    . C   A  1  41   ? 63.651  131.466 27.144  1.00 29.01  ? 42   C   A N1    1 
ATOM   695   C  C2    . C   A  1  41   ? 64.187  131.851 28.384  1.00 30.23  ? 42   C   A C2    1 
ATOM   696   O  O2    . C   A  1  41   ? 63.493  132.554 29.159  1.00 30.85  ? 42   C   A O2    1 
ATOM   697   N  N3    . C   A  1  41   ? 65.437  131.449 28.714  1.00 30.57  ? 42   C   A N3    1 
ATOM   698   C  C4    . C   A  1  41   ? 66.139  130.699 27.866  1.00 31.27  ? 42   C   A C4    1 
ATOM   699   N  N4    . C   A  1  41   ? 67.367  130.332 28.224  1.00 32.58  ? 42   C   A N4    1 
ATOM   700   C  C5    . C   A  1  41   ? 65.614  130.289 26.611  1.00 30.84  ? 42   C   A C5    1 
ATOM   701   C  C6    . C   A  1  41   ? 64.378  130.683 26.295  1.00 29.60  ? 42   C   A C6    1 
ATOM   702   P  P     . U   A  1  42   ? 62.955  135.104 23.202  1.00 33.30  ? 43   U   A P     1 
ATOM   703   O  OP1   . U   A  1  42   ? 62.123  135.896 22.246  1.00 31.37  ? 43   U   A OP1   1 
ATOM   704   O  OP2   . U   A  1  42   ? 64.162  134.372 22.692  1.00 32.40  ? 43   U   A OP2   1 
ATOM   705   O  "O5'" . U   A  1  42   ? 63.390  136.051 24.413  1.00 29.87  ? 43   U   A "O5'" 1 
ATOM   706   C  "C5'" . U   A  1  42   ? 62.470  137.018 24.947  1.00 29.12  ? 43   U   A "C5'" 1 
ATOM   707   C  "C4'" . U   A  1  42   ? 63.102  137.788 26.085  1.00 29.09  ? 43   U   A "C4'" 1 
ATOM   708   O  "O4'" . U   A  1  42   ? 63.432  136.882 27.168  1.00 28.35  ? 43   U   A "O4'" 1 
ATOM   709   C  "C3'" . U   A  1  42   ? 64.417  138.474 25.788  1.00 30.14  ? 43   U   A "C3'" 1 
ATOM   710   O  "O3'" . U   A  1  42   ? 64.249  139.699 25.115  1.00 31.06  ? 43   U   A "O3'" 1 
ATOM   711   C  "C2'" . U   A  1  42   ? 65.001  138.663 27.176  1.00 27.17  ? 43   U   A "C2'" 1 
ATOM   712   O  "O2'" . U   A  1  42   ? 64.424  139.747 27.874  1.00 29.47  ? 43   U   A "O2'" 1 
ATOM   713   C  "C1'" . U   A  1  42   ? 64.580  137.362 27.851  1.00 25.04  ? 43   U   A "C1'" 1 
ATOM   714   N  N1    . U   A  1  42   ? 65.635  136.341 27.810  1.00 21.74  ? 43   U   A N1    1 
ATOM   715   C  C2    . U   A  1  42   ? 66.534  136.340 28.849  1.00 20.21  ? 43   U   A C2    1 
ATOM   716   O  O2    . U   A  1  42   ? 66.487  137.149 29.756  1.00 21.49  ? 43   U   A O2    1 
ATOM   717   N  N3    . U   A  1  42   ? 67.487  135.361 28.794  1.00 19.06  ? 43   U   A N3    1 
ATOM   718   C  C4    . U   A  1  42   ? 67.626  134.402 27.819  1.00 20.08  ? 43   U   A C4    1 
ATOM   719   O  O4    . U   A  1  42   ? 68.537  133.575 27.903  1.00 18.73  ? 43   U   A O4    1 
ATOM   720   C  C5    . U   A  1  42   ? 66.663  134.480 26.766  1.00 20.06  ? 43   U   A C5    1 
ATOM   721   C  C6    . U   A  1  42   ? 65.725  135.425 26.796  1.00 20.97  ? 43   U   A C6    1 
ATOM   722   P  P     . G   A  1  43   ? 65.333  140.138 24.020  1.00 33.44  ? 44   G   A P     1 
ATOM   723   O  OP1   . G   A  1  43   ? 64.855  141.450 23.468  1.00 34.38  ? 44   G   A OP1   1 
ATOM   724   O  OP2   . G   A  1  43   ? 65.557  138.987 23.088  1.00 31.06  ? 44   G   A OP2   1 
ATOM   725   O  "O5'" . G   A  1  43   ? 66.644  140.401 24.900  1.00 32.14  ? 44   G   A "O5'" 1 
ATOM   726   C  "C5'" . G   A  1  43   ? 66.645  141.445 25.906  1.00 33.83  ? 44   G   A "C5'" 1 
ATOM   727   C  "C4'" . G   A  1  43   ? 67.997  141.566 26.560  1.00 31.83  ? 44   G   A "C4'" 1 
ATOM   728   O  "O4'" . G   A  1  43   ? 68.201  140.507 27.523  1.00 32.43  ? 44   G   A "O4'" 1 
ATOM   729   C  "C3'" . G   A  1  43   ? 69.170  141.443 25.620  1.00 32.98  ? 44   G   A "C3'" 1 
ATOM   730   O  "O3'" . G   A  1  43   ? 69.388  142.672 24.956  1.00 36.10  ? 44   G   A "O3'" 1 
ATOM   731   C  "C2'" . G   A  1  43   ? 70.308  141.044 26.550  1.00 31.44  ? 44   G   A "C2'" 1 
ATOM   732   O  "O2'" . G   A  1  43   ? 70.904  142.125 27.235  1.00 31.30  ? 44   G   A "O2'" 1 
ATOM   733   C  "C1'" . G   A  1  43   ? 69.577  140.145 27.554  1.00 31.04  ? 44   G   A "C1'" 1 
ATOM   734   N  N9    . G   A  1  43   ? 69.699  138.740 27.185  1.00 29.88  ? 44   G   A N9    1 
ATOM   735   C  C8    . G   A  1  43   ? 68.778  137.972 26.517  1.00 29.43  ? 44   G   A C8    1 
ATOM   736   N  N7    . G   A  1  43   ? 69.222  136.782 26.226  1.00 28.81  ? 44   G   A N7    1 
ATOM   737   C  C5    . G   A  1  43   ? 70.503  136.758 26.749  1.00 27.22  ? 44   G   A C5    1 
ATOM   738   C  C6    . G   A  1  43   ? 71.481  135.753 26.693  1.00 26.44  ? 44   G   A C6    1 
ATOM   739   O  O6    . G   A  1  43   ? 71.419  134.645 26.129  1.00 25.29  ? 44   G   A O6    1 
ATOM   740   N  N1    . G   A  1  43   ? 72.634  136.134 27.363  1.00 25.17  ? 44   G   A N1    1 
ATOM   741   C  C2    . G   A  1  43   ? 72.815  137.330 27.998  1.00 26.07  ? 44   G   A C2    1 
ATOM   742   N  N2    . G   A  1  43   ? 73.985  137.482 28.624  1.00 28.77  ? 44   G   A N2    1 
ATOM   743   N  N3    . G   A  1  43   ? 71.916  138.294 28.027  1.00 25.79  ? 44   G   A N3    1 
ATOM   744   C  C4    . G   A  1  43   ? 70.794  137.943 27.384  1.00 27.01  ? 44   G   A C4    1 
ATOM   745   P  P     . A   A  1  44   ? 70.066  142.682 23.503  1.00 38.95  ? 45   A   A P     1 
ATOM   746   O  OP1   . A   A  1  44   ? 69.003  143.000 22.506  1.00 38.11  ? 45   A   A OP1   1 
ATOM   747   O  OP2   . A   A  1  44   ? 70.856  141.412 23.379  1.00 38.35  ? 45   A   A OP2   1 
ATOM   748   O  "O5'" . A   A  1  44   ? 71.109  143.883 23.596  1.00 38.03  ? 45   A   A "O5'" 1 
ATOM   749   C  "C5'" . A   A  1  44   ? 72.112  143.882 24.638  1.00 36.89  ? 45   A   A "C5'" 1 
ATOM   750   C  "C4'" . A   A  1  44   ? 73.237  144.813 24.281  1.00 35.95  ? 45   A   A "C4'" 1 
ATOM   751   O  "O4'" . A   A  1  44   ? 74.135  144.924 25.413  1.00 35.63  ? 45   A   A "O4'" 1 
ATOM   752   C  "C3'" . A   A  1  44   ? 74.092  144.375 23.100  1.00 35.63  ? 45   A   A "C3'" 1 
ATOM   753   O  "O3'" . A   A  1  44   ? 74.596  145.543 22.475  1.00 35.70  ? 45   A   A "O3'" 1 
ATOM   754   C  "C2'" . A   A  1  44   ? 75.226  143.615 23.783  1.00 36.73  ? 45   A   A "C2'" 1 
ATOM   755   O  "O2'" . A   A  1  44   ? 76.426  143.544 23.035  1.00 34.85  ? 45   A   A "O2'" 1 
ATOM   756   C  "C1'" . A   A  1  44   ? 75.416  144.448 25.053  1.00 36.89  ? 45   A   A "C1'" 1 
ATOM   757   N  N9    . A   A  1  44   ? 75.954  143.710 26.198  1.00 37.73  ? 45   A   A N9    1 
ATOM   758   C  C8    . A   A  1  44   ? 76.998  144.066 27.011  1.00 35.70  ? 45   A   A C8    1 
ATOM   759   N  N7    . A   A  1  44   ? 77.222  143.216 27.978  1.00 36.69  ? 45   A   A N7    1 
ATOM   760   C  C5    . A   A  1  44   ? 76.266  142.227 27.787  1.00 37.69  ? 45   A   A C5    1 
ATOM   761   C  C6    . A   A  1  44   ? 75.961  141.047 28.499  1.00 37.71  ? 45   A   A C6    1 
ATOM   762   N  N6    . A   A  1  44   ? 76.617  140.647 29.595  1.00 35.94  ? 45   A   A N6    1 
ATOM   763   N  N1    . A   A  1  44   ? 74.941  140.286 28.046  1.00 36.78  ? 45   A   A N1    1 
ATOM   764   C  C2    . A   A  1  44   ? 74.279  140.688 26.967  1.00 37.49  ? 45   A   A C2    1 
ATOM   765   N  N3    . A   A  1  44   ? 74.463  141.771 26.222  1.00 37.69  ? 45   A   A N3    1 
ATOM   766   C  C4    . A   A  1  44   ? 75.486  142.511 26.691  1.00 37.78  ? 45   A   A C4    1 
ATOM   767   P  P     . U   A  1  45   ? 74.387  145.767 20.901  1.00 36.06  ? 46   U   A P     1 
ATOM   768   O  OP1   . U   A  1  45   ? 74.444  144.454 20.186  1.00 36.34  ? 46   U   A OP1   1 
ATOM   769   O  OP2   . U   A  1  45   ? 75.315  146.847 20.523  1.00 35.78  ? 46   U   A OP2   1 
ATOM   770   O  "O5'" . U   A  1  45   ? 72.913  146.335 20.757  1.00 35.59  ? 46   U   A "O5'" 1 
ATOM   771   C  "C5'" . U   A  1  45   ? 72.607  147.669 21.166  1.00 40.07  ? 46   U   A "C5'" 1 
ATOM   772   C  "C4'" . U   A  1  45   ? 71.122  147.895 21.102  1.00 43.45  ? 46   U   A "C4'" 1 
ATOM   773   O  "O4'" . U   A  1  45   ? 70.695  147.788 19.722  1.00 47.94  ? 46   U   A "O4'" 1 
ATOM   774   C  "C3'" . U   A  1  45   ? 70.266  146.897 21.870  1.00 44.18  ? 46   U   A "C3'" 1 
ATOM   775   O  "O3'" . U   A  1  45   ? 69.133  147.577 22.329  1.00 40.03  ? 46   U   A "O3'" 1 
ATOM   776   C  "C2'" . U   A  1  45   ? 69.867  145.897 20.807  1.00 46.64  ? 46   U   A "C2'" 1 
ATOM   777   O  "O2'" . U   A  1  45   ? 68.661  145.221 21.074  1.00 49.96  ? 46   U   A "O2'" 1 
ATOM   778   C  "C1'" . U   A  1  45   ? 69.681  146.820 19.620  1.00 48.29  ? 46   U   A "C1'" 1 
ATOM   779   N  N1    . U   A  1  45   ? 69.834  146.109 18.356  1.00 50.54  ? 46   U   A N1    1 
ATOM   780   C  C2    . U   A  1  45   ? 68.739  146.063 17.545  1.00 52.18  ? 46   U   A C2    1 
ATOM   781   O  O2    . U   A  1  45   ? 67.679  146.583 17.847  1.00 53.51  ? 46   U   A O2    1 
ATOM   782   N  N3    . U   A  1  45   ? 68.921  145.390 16.366  1.00 54.09  ? 46   U   A N3    1 
ATOM   783   C  C4    . U   A  1  45   ? 70.077  144.774 15.935  1.00 54.79  ? 46   U   A C4    1 
ATOM   784   O  O4    . U   A  1  45   ? 70.110  144.267 14.808  1.00 55.95  ? 46   U   A O4    1 
ATOM   785   C  C5    . U   A  1  45   ? 71.175  144.862 16.852  1.00 54.26  ? 46   U   A C5    1 
ATOM   786   C  C6    . U   A  1  45   ? 71.017  145.513 18.002  1.00 51.61  ? 46   U   A C6    1 
ATOM   787   P  P     . G   A  1  46   ? 69.214  148.302 23.740  1.00 39.51  ? 47   G   A P     1 
ATOM   788   O  OP1   . G   A  1  46   ? 67.836  148.453 24.260  1.00 38.98  ? 47   G   A OP1   1 
ATOM   789   O  OP2   . G   A  1  46   ? 70.099  149.502 23.599  1.00 39.06  ? 47   G   A OP2   1 
ATOM   790   O  "O5'" . G   A  1  46   ? 70.054  147.271 24.613  1.00 36.66  ? 47   G   A "O5'" 1 
ATOM   791   C  "C5'" . G   A  1  46   ? 69.444  146.182 25.265  1.00 32.98  ? 47   G   A "C5'" 1 
ATOM   792   C  "C4'" . G   A  1  46   ? 69.829  146.208 26.712  1.00 31.71  ? 47   G   A "C4'" 1 
ATOM   793   O  "O4'" . G   A  1  46   ? 71.271  146.081 26.798  1.00 32.30  ? 47   G   A "O4'" 1 
ATOM   794   C  "C3'" . G   A  1  46   ? 69.464  147.478 27.471  1.00 31.65  ? 47   G   A "C3'" 1 
ATOM   795   O  "O3'" . G   A  1  46   ? 69.088  147.120 28.784  1.00 32.23  ? 47   G   A "O3'" 1 
ATOM   796   C  "C2'" . G   A  1  46   ? 70.768  148.268 27.519  1.00 32.43  ? 47   G   A "C2'" 1 
ATOM   797   O  "O2'" . G   A  1  46   ? 70.874  149.049 28.695  1.00 31.58  ? 47   G   A "O2'" 1 
ATOM   798   C  "C1'" . G   A  1  46   ? 71.818  147.157 27.532  1.00 33.33  ? 47   G   A "C1'" 1 
ATOM   799   N  N9    . G   A  1  46   ? 73.064  147.550 26.872  1.00 36.47  ? 47   G   A N9    1 
ATOM   800   C  C8    . G   A  1  46   ? 73.174  148.195 25.664  1.00 37.04  ? 47   G   A C8    1 
ATOM   801   N  N7    . G   A  1  46   ? 74.407  148.449 25.321  1.00 37.90  ? 47   G   A N7    1 
ATOM   802   C  C5    . G   A  1  46   ? 75.167  147.939 26.359  1.00 38.50  ? 47   G   A C5    1 
ATOM   803   C  C6    . G   A  1  46   ? 76.574  147.937 26.546  1.00 39.88  ? 47   G   A C6    1 
ATOM   804   O  O6    . G   A  1  46   ? 77.449  148.418 25.817  1.00 40.68  ? 47   G   A O6    1 
ATOM   805   N  N1    . G   A  1  46   ? 76.931  147.308 27.731  1.00 40.22  ? 47   G   A N1    1 
ATOM   806   C  C2    . G   A  1  46   ? 76.053  146.766 28.632  1.00 40.08  ? 47   G   A C2    1 
ATOM   807   N  N2    . G   A  1  46   ? 76.612  146.232 29.729  1.00 40.51  ? 47   G   A N2    1 
ATOM   808   N  N3    . G   A  1  46   ? 74.730  146.759 28.473  1.00 38.90  ? 47   G   A N3    1 
ATOM   809   C  C4    . G   A  1  46   ? 74.359  147.365 27.324  1.00 38.12  ? 47   G   A C4    1 
ATOM   810   P  P     . A   A  1  47   ? 67.740  147.710 29.415  1.00 33.70  ? 48   A   A P     1 
ATOM   811   O  OP1   . A   A  1  47   ? 67.085  148.578 28.386  1.00 34.05  ? 48   A   A OP1   1 
ATOM   812   O  OP2   . A   A  1  47   ? 68.098  148.280 30.741  1.00 32.14  ? 48   A   A OP2   1 
ATOM   813   O  "O5'" . A   A  1  47   ? 66.855  146.395 29.608  1.00 33.53  ? 48   A   A "O5'" 1 
ATOM   814   C  "C5'" . A   A  1  47   ? 66.397  145.630 28.462  1.00 31.29  ? 48   A   A "C5'" 1 
ATOM   815   C  "C4'" . A   A  1  47   ? 66.205  144.175 28.833  1.00 30.61  ? 48   A   A "C4'" 1 
ATOM   816   O  "O4'" . A   A  1  47   ? 67.479  143.500 28.899  1.00 33.01  ? 48   A   A "O4'" 1 
ATOM   817   C  "C3'" . A   A  1  47   ? 65.555  143.915 30.173  1.00 29.47  ? 48   A   A "C3'" 1 
ATOM   818   O  "O3'" . A   A  1  47   ? 64.155  143.925 30.034  1.00 26.26  ? 48   A   A "O3'" 1 
ATOM   819   C  "C2'" . A   A  1  47   ? 66.044  142.522 30.522  1.00 32.19  ? 48   A   A "C2'" 1 
ATOM   820   O  "O2'" . A   A  1  47   ? 65.273  141.517 29.903  1.00 33.04  ? 48   A   A "O2'" 1 
ATOM   821   C  "C1'" . A   A  1  47   ? 67.455  142.544 29.941  1.00 34.12  ? 48   A   A "C1'" 1 
ATOM   822   N  N9    . A   A  1  47   ? 68.479  142.909 30.914  1.00 36.45  ? 48   A   A N9    1 
ATOM   823   C  C8    . A   A  1  47   ? 69.101  144.125 31.052  1.00 36.24  ? 48   A   A C8    1 
ATOM   824   N  N7    . A   A  1  47   ? 70.020  144.143 31.984  1.00 36.65  ? 48   A   A N7    1 
ATOM   825   C  C5    . A   A  1  47   ? 69.998  142.854 32.502  1.00 37.11  ? 48   A   A C5    1 
ATOM   826   C  C6    . A   A  1  47   ? 70.763  142.216 33.499  1.00 37.51  ? 48   A   A C6    1 
ATOM   827   N  N6    . A   A  1  47   ? 71.756  142.804 34.156  1.00 38.20  ? 48   A   A N6    1 
ATOM   828   N  N1    . A   A  1  47   ? 70.481  140.926 33.784  1.00 38.74  ? 48   A   A N1    1 
ATOM   829   C  C2    . A   A  1  47   ? 69.509  140.315 33.095  1.00 38.34  ? 48   A   A C2    1 
ATOM   830   N  N3    . A   A  1  47   ? 68.733  140.798 32.120  1.00 38.75  ? 48   A   A N3    1 
ATOM   831   C  C4    . A   A  1  47   ? 69.036  142.088 31.867  1.00 37.55  ? 48   A   A C4    1 
ATOM   832   P  P     . A   A  1  48   ? 63.253  144.600 31.166  1.00 28.67  ? 49   A   A P     1 
ATOM   833   O  OP1   . A   A  1  48   ? 61.858  144.564 30.684  1.00 28.71  ? 49   A   A OP1   1 
ATOM   834   O  OP2   . A   A  1  48   ? 63.899  145.902 31.464  1.00 29.68  ? 49   A   A OP2   1 
ATOM   835   O  "O5'" . A   A  1  48   ? 63.376  143.639 32.426  1.00 25.97  ? 49   A   A "O5'" 1 
ATOM   836   C  "C5'" . A   A  1  48   ? 62.767  142.347 32.414  1.00 25.45  ? 49   A   A "C5'" 1 
ATOM   837   C  "C4'" . A   A  1  48   ? 63.294  141.517 33.552  1.00 24.89  ? 49   A   A "C4'" 1 
ATOM   838   O  "O4'" . A   A  1  48   ? 64.704  141.264 33.362  1.00 26.17  ? 49   A   A "O4'" 1 
ATOM   839   C  "C3'" . A   A  1  48   ? 63.236  142.174 34.921  1.00 24.89  ? 49   A   A "C3'" 1 
ATOM   840   O  "O3'" . A   A  1  48   ? 61.962  142.034 35.518  1.00 23.93  ? 49   A   A "O3'" 1 
ATOM   841   C  "C2'" . A   A  1  48   ? 64.252  141.365 35.697  1.00 26.63  ? 49   A   A "C2'" 1 
ATOM   842   O  "O2'" . A   A  1  48   ? 63.719  140.130 36.117  1.00 26.53  ? 49   A   A "O2'" 1 
ATOM   843   C  "C1'" . A   A  1  48   ? 65.337  141.181 34.635  1.00 29.26  ? 49   A   A "C1'" 1 
ATOM   844   N  N9    . A   A  1  48   ? 66.310  142.265 34.761  1.00 32.84  ? 49   A   A N9    1 
ATOM   845   C  C8    . A   A  1  48   ? 66.309  143.502 34.162  1.00 34.86  ? 49   A   A C8    1 
ATOM   846   N  N7    . A   A  1  48   ? 67.275  144.286 34.570  1.00 35.88  ? 49   A   A N7    1 
ATOM   847   C  C5    . A   A  1  48   ? 67.970  143.511 35.485  1.00 36.11  ? 49   A   A C5    1 
ATOM   848   C  C6    . A   A  1  48   ? 69.092  143.777 36.283  1.00 37.27  ? 49   A   A C6    1 
ATOM   849   N  N6    . A   A  1  48   ? 69.728  144.943 36.287  1.00 38.24  ? 49   A   A N6    1 
ATOM   850   N  N1    . A   A  1  48   ? 69.542  142.790 37.088  1.00 38.23  ? 49   A   A N1    1 
ATOM   851   C  C2    . A   A  1  48   ? 68.895  141.611 37.075  1.00 38.80  ? 49   A   A C2    1 
ATOM   852   N  N3    . A   A  1  48   ? 67.823  141.242 36.368  1.00 37.39  ? 49   A   A N3    1 
ATOM   853   C  C4    . A   A  1  48   ? 67.405  142.253 35.589  1.00 35.21  ? 49   A   A C4    1 
ATOM   854   P  P     . G   A  1  49   ? 61.279  143.287 36.252  1.00 24.50  ? 50   G   A P     1 
ATOM   855   O  OP1   . G   A  1  49   ? 60.024  142.794 36.846  1.00 26.80  ? 50   G   A OP1   1 
ATOM   856   O  OP2   . G   A  1  49   ? 61.240  144.437 35.310  1.00 27.07  ? 50   G   A OP2   1 
ATOM   857   O  "O5'" . G   A  1  49   ? 62.269  143.623 37.446  1.00 23.71  ? 50   G   A "O5'" 1 
ATOM   858   C  "C5'" . G   A  1  49   ? 62.446  142.680 38.521  1.00 23.61  ? 50   G   A "C5'" 1 
ATOM   859   C  "C4'" . G   A  1  49   ? 63.561  143.123 39.436  1.00 24.66  ? 50   G   A "C4'" 1 
ATOM   860   O  "O4'" . G   A  1  49   ? 64.843  143.061 38.748  1.00 25.08  ? 50   G   A "O4'" 1 
ATOM   861   C  "C3'" . G   A  1  49   ? 63.498  144.530 39.990  1.00 24.47  ? 50   G   A "C3'" 1 
ATOM   862   O  "O3'" . G   A  1  49   ? 62.590  144.616 41.076  1.00 25.56  ? 50   G   A "O3'" 1 
ATOM   863   C  "C2'" . G   A  1  49   ? 64.948  144.744 40.393  1.00 24.40  ? 50   G   A "C2'" 1 
ATOM   864   O  "O2'" . G   A  1  49   ? 65.290  144.039 41.566  1.00 24.22  ? 50   G   A "O2'" 1 
ATOM   865   C  "C1'" . G   A  1  49   ? 65.678  144.110 39.207  1.00 26.09  ? 50   G   A "C1'" 1 
ATOM   866   N  N9    . G   A  1  49   ? 65.837  145.069 38.115  1.00 30.43  ? 50   G   A N9    1 
ATOM   867   C  C8    . G   A  1  49   ? 65.173  145.076 36.911  1.00 31.43  ? 50   G   A C8    1 
ATOM   868   N  N7    . G   A  1  49   ? 65.452  146.116 36.177  1.00 32.81  ? 50   G   A N7    1 
ATOM   869   C  C5    . G   A  1  49   ? 66.379  146.826 36.929  1.00 33.76  ? 50   G   A C5    1 
ATOM   870   C  C6    . G   A  1  49   ? 67.029  148.062 36.664  1.00 33.94  ? 50   G   A C6    1 
ATOM   871   O  O6    . G   A  1  49   ? 66.897  148.811 35.688  1.00 34.39  ? 50   G   A O6    1 
ATOM   872   N  N1    . G   A  1  49   ? 67.894  148.412 37.693  1.00 34.12  ? 50   G   A N1    1 
ATOM   873   C  C2    . G   A  1  49   ? 68.100  147.678 38.834  1.00 34.61  ? 50   G   A C2    1 
ATOM   874   N  N2    . G   A  1  49   ? 68.968  148.175 39.718  1.00 36.21  ? 50   G   A N2    1 
ATOM   875   N  N3    . G   A  1  49   ? 67.496  146.538 39.097  1.00 35.23  ? 50   G   A N3    1 
ATOM   876   C  C4    . G   A  1  49   ? 66.650  146.176 38.113  1.00 32.67  ? 50   G   A C4    1 
ATOM   877   P  P     . G   A  1  50   ? 61.833  146.004 41.376  1.00 27.36  ? 51   G   A P     1 
ATOM   878   O  OP1   . G   A  1  50   ? 61.021  145.827 42.622  1.00 28.29  ? 51   G   A OP1   1 
ATOM   879   O  OP2   . G   A  1  50   ? 61.175  146.452 40.134  1.00 27.63  ? 51   G   A OP2   1 
ATOM   880   O  "O5'" . G   A  1  50   ? 63.002  147.017 41.762  1.00 26.22  ? 51   G   A "O5'" 1 
ATOM   881   C  "C5'" . G   A  1  50   ? 63.659  146.892 43.038  1.00 25.91  ? 51   G   A "C5'" 1 
ATOM   882   C  "C4'" . G   A  1  50   ? 64.887  147.772 43.124  1.00 24.26  ? 51   G   A "C4'" 1 
ATOM   883   O  "O4'" . G   A  1  50   ? 65.756  147.531 41.987  1.00 24.79  ? 51   G   A "O4'" 1 
ATOM   884   C  "C3'" . G   A  1  50   ? 64.678  149.276 43.127  1.00 23.41  ? 51   G   A "C3'" 1 
ATOM   885   O  "O3'" . G   A  1  50   ? 64.309  149.737 44.427  1.00 22.83  ? 51   G   A "O3'" 1 
ATOM   886   C  "C2'" . G   A  1  50   ? 66.061  149.754 42.729  1.00 23.10  ? 51   G   A "C2'" 1 
ATOM   887   O  "O2'" . G   A  1  50   ? 66.967  149.639 43.803  1.00 25.38  ? 51   G   A "O2'" 1 
ATOM   888   C  "C1'" . G   A  1  50   ? 66.438  148.723 41.660  1.00 24.32  ? 51   G   A "C1'" 1 
ATOM   889   N  N9    . G   A  1  50   ? 65.980  149.173 40.353  1.00 27.68  ? 51   G   A N9    1 
ATOM   890   C  C8    . G   A  1  50   ? 65.034  148.604 39.534  1.00 28.10  ? 51   G   A C8    1 
ATOM   891   N  N7    . G   A  1  50   ? 64.787  149.320 38.470  1.00 30.28  ? 51   G   A N7    1 
ATOM   892   C  C5    . G   A  1  50   ? 65.633  150.416 38.591  1.00 28.91  ? 51   G   A C5    1 
ATOM   893   C  C6    . G   A  1  50   ? 65.795  151.560 37.765  1.00 29.08  ? 51   G   A C6    1 
ATOM   894   O  O6    . G   A  1  50   ? 65.177  151.870 36.749  1.00 29.70  ? 51   G   A O6    1 
ATOM   895   N  N1    . G   A  1  50   ? 66.784  152.404 38.251  1.00 28.85  ? 51   G   A N1    1 
ATOM   896   C  C2    . G   A  1  50   ? 67.505  152.194 39.396  1.00 29.48  ? 51   G   A C2    1 
ATOM   897   N  N2    . G   A  1  50   ? 68.426  153.110 39.703  1.00 29.44  ? 51   G   A N2    1 
ATOM   898   N  N3    . G   A  1  50   ? 67.340  151.159 40.187  1.00 29.93  ? 51   G   A N3    1 
ATOM   899   C  C4    . G   A  1  50   ? 66.397  150.316 39.728  1.00 28.54  ? 51   G   A C4    1 
ATOM   900   P  P     . A   A  1  51   ? 63.459  151.096 44.590  1.00 25.11  ? 52   A   A P     1 
ATOM   901   O  OP1   . A   A  1  51   ? 63.102  151.190 46.033  1.00 22.35  ? 52   A   A OP1   1 
ATOM   902   O  OP2   . A   A  1  51   ? 62.378  151.153 43.548  1.00 22.99  ? 52   A   A OP2   1 
ATOM   903   O  "O5'" . A   A  1  51   ? 64.513  152.239 44.249  1.00 23.11  ? 52   A   A "O5'" 1 
ATOM   904   C  "C5'" . A   A  1  51   ? 65.721  152.385 45.009  1.00 23.76  ? 52   A   A "C5'" 1 
ATOM   905   C  "C4'" . A   A  1  51   ? 66.539  153.510 44.441  1.00 26.13  ? 52   A   A "C4'" 1 
ATOM   906   O  "O4'" . A   A  1  51   ? 66.929  153.160 43.090  1.00 25.08  ? 52   A   A "O4'" 1 
ATOM   907   C  "C3'" . A   A  1  51   ? 65.773  154.815 44.311  1.00 27.25  ? 52   A   A "C3'" 1 
ATOM   908   O  "O3'" . A   A  1  51   ? 65.848  155.545 45.527  1.00 28.14  ? 52   A   A "O3'" 1 
ATOM   909   C  "C2'" . A   A  1  51   ? 66.495  155.504 43.162  1.00 29.26  ? 52   A   A "C2'" 1 
ATOM   910   O  "O2'" . A   A  1  51   ? 67.680  156.171 43.551  1.00 29.28  ? 52   A   A "O2'" 1 
ATOM   911   C  "C1'" . A   A  1  51   ? 66.845  154.307 42.265  1.00 29.13  ? 52   A   A "C1'" 1 
ATOM   912   N  N9    . A   A  1  51   ? 65.832  154.055 41.241  1.00 32.05  ? 52   A   A N9    1 
ATOM   913   C  C8    . A   A  1  51   ? 64.860  153.086 41.209  1.00 33.99  ? 52   A   A C8    1 
ATOM   914   N  N7    . A   A  1  51   ? 64.104  153.128 40.141  1.00 34.19  ? 52   A   A N7    1 
ATOM   915   C  C5    . A   A  1  51   ? 64.612  154.196 39.422  1.00 34.39  ? 52   A   A C5    1 
ATOM   916   C  C6    . A   A  1  51   ? 64.254  154.758 38.192  1.00 35.99  ? 52   A   A C6    1 
ATOM   917   N  N6    . A   A  1  51   ? 63.248  154.313 37.434  1.00 37.51  ? 52   A   A N6    1 
ATOM   918   N  N1    . A   A  1  51   ? 64.973  155.814 37.755  1.00 36.66  ? 52   A   A N1    1 
ATOM   919   C  C2    . A   A  1  51   ? 65.981  156.265 38.516  1.00 35.76  ? 52   A   A C2    1 
ATOM   920   N  N3    . A   A  1  51   ? 66.409  155.820 39.684  1.00 34.02  ? 52   A   A N3    1 
ATOM   921   C  C4    . A   A  1  51   ? 65.674  154.775 40.088  1.00 33.26  ? 52   A   A C4    1 
ATOM   922   P  P     . C   A  1  52   ? 64.621  156.471 45.980  1.00 28.23  ? 53   C   A P     1 
ATOM   923   O  OP1   . C   A  1  52   ? 65.012  157.079 47.270  1.00 26.69  ? 53   C   A OP1   1 
ATOM   924   O  OP2   . C   A  1  52   ? 63.352  155.702 45.894  1.00 27.32  ? 53   C   A OP2   1 
ATOM   925   O  "O5'" . C   A  1  52   ? 64.580  157.610 44.871  1.00 28.48  ? 53   C   A "O5'" 1 
ATOM   926   C  "C5'" . C   A  1  52   ? 65.635  158.564 44.783  1.00 27.64  ? 53   C   A "C5'" 1 
ATOM   927   C  "C4'" . C   A  1  52   ? 65.521  159.346 43.514  1.00 27.78  ? 53   C   A "C4'" 1 
ATOM   928   O  "O4'" . C   A  1  52   ? 65.618  158.443 42.382  1.00 28.52  ? 53   C   A "O4'" 1 
ATOM   929   C  "C3'" . C   A  1  52   ? 64.204  160.034 43.263  1.00 27.79  ? 53   C   A "C3'" 1 
ATOM   930   O  "O3'" . C   A  1  52   ? 64.034  161.222 44.017  1.00 28.22  ? 53   C   A "O3'" 1 
ATOM   931   C  "C2'" . C   A  1  52   ? 64.308  160.305 41.772  1.00 28.28  ? 53   C   A "C2'" 1 
ATOM   932   O  "O2'" . C   A  1  52   ? 65.238  161.335 41.513  1.00 28.05  ? 53   C   A "O2'" 1 
ATOM   933   C  "C1'" . C   A  1  52   ? 64.905  158.989 41.277  1.00 29.04  ? 53   C   A "C1'" 1 
ATOM   934   N  N1    . C   A  1  52   ? 63.863  158.028 40.840  1.00 32.01  ? 53   C   A N1    1 
ATOM   935   C  C2    . C   A  1  52   ? 63.339  158.135 39.531  1.00 31.72  ? 53   C   A C2    1 
ATOM   936   O  O2    . C   A  1  52   ? 63.764  159.014 38.784  1.00 33.33  ? 53   C   A O2    1 
ATOM   937   N  N3    . C   A  1  52   ? 62.382  157.271 39.123  1.00 31.78  ? 53   C   A N3    1 
ATOM   938   C  C4    . C   A  1  52   ? 61.929  156.332 39.958  1.00 32.52  ? 53   C   A C4    1 
ATOM   939   N  N4    . C   A  1  52   ? 60.966  155.512 39.522  1.00 33.59  ? 53   C   A N4    1 
ATOM   940   C  C5    . C   A  1  52   ? 62.438  156.190 41.285  1.00 33.48  ? 53   C   A C5    1 
ATOM   941   C  C6    . C   A  1  52   ? 63.399  157.049 41.683  1.00 32.93  ? 53   C   A C6    1 
ATOM   942   P  P     . G   A  1  53   ? 62.624  162.005 43.945  1.00 29.95  ? 54   G   A P     1 
ATOM   943   O  OP1   . G   A  1  53   ? 62.596  162.997 45.057  1.00 28.99  ? 54   G   A OP1   1 
ATOM   944   O  OP2   . G   A  1  53   ? 61.523  161.022 43.826  1.00 29.06  ? 54   G   A OP2   1 
ATOM   945   O  "O5'" . G   A  1  53   ? 62.750  162.781 42.561  1.00 30.44  ? 54   G   A "O5'" 1 
ATOM   946   C  "C5'" . G   A  1  53   ? 61.608  163.260 41.852  1.00 31.70  ? 54   G   A "C5'" 1 
ATOM   947   C  "C4'" . G   A  1  53   ? 61.856  163.177 40.362  1.00 33.49  ? 54   G   A "C4'" 1 
ATOM   948   O  "O4'" . G   A  1  53   ? 62.192  161.809 40.030  1.00 34.13  ? 54   G   A "O4'" 1 
ATOM   949   C  "C3'" . G   A  1  53   ? 60.645  163.524 39.515  1.00 33.97  ? 54   G   A "C3'" 1 
ATOM   950   O  "O3'" . G   A  1  53   ? 60.545  164.926 39.261  1.00 32.70  ? 54   G   A "O3'" 1 
ATOM   951   C  "C2'" . G   A  1  53   ? 60.807  162.639 38.280  1.00 35.37  ? 54   G   A "C2'" 1 
ATOM   952   O  "O2'" . G   A  1  53   ? 61.675  163.178 37.303  1.00 38.35  ? 54   G   A "O2'" 1 
ATOM   953   C  "C1'" . G   A  1  53   ? 61.483  161.402 38.878  1.00 36.27  ? 54   G   A "C1'" 1 
ATOM   954   N  N9    . G   A  1  53   ? 60.585  160.317 39.261  1.00 39.22  ? 54   G   A N9    1 
ATOM   955   C  C8    . G   A  1  53   ? 60.497  159.704 40.487  1.00 40.44  ? 54   G   A C8    1 
ATOM   956   N  N7    . G   A  1  53   ? 59.656  158.706 40.502  1.00 41.93  ? 54   G   A N7    1 
ATOM   957   C  C5    . G   A  1  53   ? 59.145  158.673 39.213  1.00 40.43  ? 54   G   A C5    1 
ATOM   958   C  C6    . G   A  1  53   ? 58.205  157.792 38.623  1.00 40.61  ? 54   G   A C6    1 
ATOM   959   O  O6    . G   A  1  53   ? 57.611  156.829 39.146  1.00 39.70  ? 54   G   A O6    1 
ATOM   960   N  N1    . G   A  1  53   ? 57.979  158.117 37.292  1.00 38.59  ? 54   G   A N1    1 
ATOM   961   C  C2    . G   A  1  53   ? 58.581  159.154 36.620  1.00 38.99  ? 54   G   A C2    1 
ATOM   962   N  N2    . G   A  1  53   ? 58.239  159.305 35.344  1.00 39.30  ? 54   G   A N2    1 
ATOM   963   N  N3    . G   A  1  53   ? 59.453  159.979 37.158  1.00 39.02  ? 54   G   A N3    1 
ATOM   964   C  C4    . G   A  1  53   ? 59.691  159.680 38.445  1.00 39.67  ? 54   G   A C4    1 
ATOM   965   P  P     . U   A  1  54   ? 59.168  165.669 39.586  1.00 33.69  ? 55   U   A P     1 
ATOM   966   O  OP1   . U   A  1  54   ? 59.248  167.110 39.270  1.00 32.32  ? 55   U   A OP1   1 
ATOM   967   O  OP2   . U   A  1  54   ? 58.786  165.249 40.954  1.00 32.85  ? 55   U   A OP2   1 
ATOM   968   O  "O5'" . U   A  1  54   ? 58.193  165.031 38.513  1.00 31.97  ? 55   U   A "O5'" 1 
ATOM   969   C  "C5'" . U   A  1  54   ? 58.435  165.272 37.120  1.00 34.46  ? 55   U   A "C5'" 1 
ATOM   970   C  "C4'" . U   A  1  54   ? 57.503  164.454 36.289  1.00 35.72  ? 55   U   A "C4'" 1 
ATOM   971   O  "O4'" . U   A  1  54   ? 57.799  163.051 36.507  1.00 36.39  ? 55   U   A "O4'" 1 
ATOM   972   C  "C3'" . U   A  1  54   ? 56.035  164.607 36.637  1.00 35.72  ? 55   U   A "C3'" 1 
ATOM   973   O  "O3'" . U   A  1  54   ? 55.496  165.758 35.973  1.00 35.78  ? 55   U   A "O3'" 1 
ATOM   974   C  "C2'" . U   A  1  54   ? 55.466  163.285 36.129  1.00 36.60  ? 55   U   A "C2'" 1 
ATOM   975   O  "O2'" . U   A  1  54   ? 55.336  163.307 34.720  1.00 38.52  ? 55   U   A "O2'" 1 
ATOM   976   C  "C1'" . U   A  1  54   ? 56.599  162.301 36.467  1.00 36.74  ? 55   U   A "C1'" 1 
ATOM   977   N  N1    . U   A  1  54   ? 56.472  161.508 37.711  1.00 37.09  ? 55   U   A N1    1 
ATOM   978   C  C2    . U   A  1  54   ? 55.770  160.322 37.639  1.00 35.69  ? 55   U   A C2    1 
ATOM   979   O  O2    . U   A  1  54   ? 55.326  159.885 36.603  1.00 36.00  ? 55   U   A O2    1 
ATOM   980   N  N3    . U   A  1  54   ? 55.616  159.658 38.829  1.00 36.39  ? 55   U   A N3    1 
ATOM   981   C  C4    . U   A  1  54   ? 56.093  160.037 40.063  1.00 35.46  ? 55   U   A C4    1 
ATOM   982   O  O4    . U   A  1  54   ? 55.688  159.455 41.076  1.00 35.11  ? 55   U   A O4    1 
ATOM   983   C  C5    . U   A  1  54   ? 56.859  161.239 40.048  1.00 35.35  ? 55   U   A C5    1 
ATOM   984   C  C6    . U   A  1  54   ? 57.014  161.921 38.907  1.00 35.51  ? 55   U   A C6    1 
ATOM   985   P  P     . G   A  1  55   ? 54.501  166.758 36.759  1.00 37.61  ? 56   G   A P     1 
ATOM   986   O  OP1   . G   A  1  55   ? 54.105  167.878 35.861  1.00 38.73  ? 56   G   A OP1   1 
ATOM   987   O  OP2   . G   A  1  55   ? 55.088  167.067 38.069  1.00 38.09  ? 56   G   A OP2   1 
ATOM   988   O  "O5'" . G   A  1  55   ? 53.189  165.890 36.975  1.00 38.34  ? 56   G   A "O5'" 1 
ATOM   989   C  "C5'" . G   A  1  55   ? 52.414  165.480 35.843  1.00 37.82  ? 56   G   A "C5'" 1 
ATOM   990   C  "C4'" . G   A  1  55   ? 50.942  165.592 36.144  1.00 37.46  ? 56   G   A "C4'" 1 
ATOM   991   O  "O4'" . G   A  1  55   ? 50.576  164.517 37.045  1.00 38.53  ? 56   G   A "O4'" 1 
ATOM   992   C  "C3'" . G   A  1  55   ? 50.461  166.884 36.801  1.00 37.27  ? 56   G   A "C3'" 1 
ATOM   993   O  "O3'" . G   A  1  55   ? 49.221  167.257 36.211  1.00 38.27  ? 56   G   A "O3'" 1 
ATOM   994   C  "C2'" . G   A  1  55   ? 50.270  166.472 38.262  1.00 36.84  ? 56   G   A "C2'" 1 
ATOM   995   O  "O2'" . G   A  1  55   ? 49.262  167.198 38.919  1.00 37.61  ? 56   G   A "O2'" 1 
ATOM   996   C  "C1'" . G   A  1  55   ? 49.813  165.031 38.108  1.00 38.54  ? 56   G   A "C1'" 1 
ATOM   997   N  N9    . G   A  1  55   ? 49.942  164.135 39.259  1.00 40.28  ? 56   G   A N9    1 
ATOM   998   C  C8    . G   A  1  55   ? 50.636  164.340 40.431  1.00 40.21  ? 56   G   A C8    1 
ATOM   999   N  N7    . G   A  1  55   ? 50.523  163.346 41.274  1.00 39.74  ? 56   G   A N7    1 
ATOM   1000  C  C5    . G   A  1  55   ? 49.713  162.427 40.619  1.00 39.90  ? 56   G   A C5    1 
ATOM   1001  C  C6    . G   A  1  55   ? 49.230  161.152 41.038  1.00 39.62  ? 56   G   A C6    1 
ATOM   1002  O  O6    . G   A  1  55   ? 49.402  160.572 42.122  1.00 39.41  ? 56   G   A O6    1 
ATOM   1003  N  N1    . G   A  1  55   ? 48.464  160.550 40.049  1.00 39.70  ? 56   G   A N1    1 
ATOM   1004  C  C2    . G   A  1  55   ? 48.178  161.098 38.829  1.00 38.78  ? 56   G   A C2    1 
ATOM   1005  N  N2    . G   A  1  55   ? 47.436  160.354 38.001  1.00 37.82  ? 56   G   A N2    1 
ATOM   1006  N  N3    . G   A  1  55   ? 48.592  162.287 38.440  1.00 39.65  ? 56   G   A N3    1 
ATOM   1007  C  C4    . G   A  1  55   ? 49.355  162.892 39.374  1.00 39.87  ? 56   G   A C4    1 
ATOM   1008  P  P     . C   A  1  56   ? 49.062  168.703 35.515  1.00 39.12  ? 57   C   A P     1 
ATOM   1009  O  OP1   . C   A  1  56   ? 47.695  168.745 34.929  1.00 40.02  ? 57   C   A OP1   1 
ATOM   1010  O  OP2   . C   A  1  56   ? 50.232  168.976 34.657  1.00 39.12  ? 57   C   A OP2   1 
ATOM   1011  O  "O5'" . C   A  1  56   ? 49.067  169.712 36.744  1.00 39.68  ? 57   C   A "O5'" 1 
ATOM   1012  C  "C5'" . C   A  1  56   ? 49.290  171.123 36.558  1.00 40.07  ? 57   C   A "C5'" 1 
ATOM   1013  C  "C4'" . C   A  1  56   ? 48.595  171.923 37.644  1.00 40.72  ? 57   C   A "C4'" 1 
ATOM   1014  O  "O4'" . C   A  1  56   ? 47.172  172.011 37.399  1.00 40.76  ? 57   C   A "O4'" 1 
ATOM   1015  C  "C3'" . C   A  1  56   ? 48.689  171.358 39.044  1.00 40.75  ? 57   C   A "C3'" 1 
ATOM   1016  O  "O3'" . C   A  1  56   ? 49.937  171.676 39.625  1.00 42.60  ? 57   C   A "O3'" 1 
ATOM   1017  C  "C2'" . C   A  1  56   ? 47.520  172.029 39.753  1.00 41.06  ? 57   C   A "C2'" 1 
ATOM   1018  O  "O2'" . C   A  1  56   ? 47.791  173.340 40.206  1.00 41.21  ? 57   C   A "O2'" 1 
ATOM   1019  C  "C1'" . C   A  1  56   ? 46.479  172.080 38.636  1.00 40.63  ? 57   C   A "C1'" 1 
ATOM   1020  N  N1    . C   A  1  56   ? 45.506  170.978 38.697  1.00 41.01  ? 57   C   A N1    1 
ATOM   1021  C  C2    . C   A  1  56   ? 44.481  171.037 39.644  1.00 41.78  ? 57   C   A C2    1 
ATOM   1022  O  O2    . C   A  1  56   ? 44.451  171.992 40.432  1.00 44.26  ? 57   C   A O2    1 
ATOM   1023  N  N3    . C   A  1  56   ? 43.554  170.053 39.681  1.00 40.94  ? 57   C   A N3    1 
ATOM   1024  C  C4    . C   A  1  56   ? 43.629  169.037 38.821  1.00 41.87  ? 57   C   A C4    1 
ATOM   1025  N  N4    . C   A  1  56   ? 42.676  168.103 38.873  1.00 41.51  ? 57   C   A N4    1 
ATOM   1026  C  C5    . C   A  1  56   ? 44.683  168.936 37.863  1.00 42.92  ? 57   C   A C5    1 
ATOM   1027  C  C6    . C   A  1  56   ? 45.590  169.919 37.838  1.00 41.87  ? 57   C   A C6    1 
ATOM   1028  P  P     . C   A  1  57   ? 50.650  170.621 40.593  1.00 45.16  ? 58   C   A P     1 
ATOM   1029  O  OP1   . C   A  1  57   ? 51.960  171.212 40.975  1.00 45.38  ? 58   C   A OP1   1 
ATOM   1030  O  OP2   . C   A  1  57   ? 50.602  169.287 39.954  1.00 44.84  ? 58   C   A OP2   1 
ATOM   1031  O  "O5'" . C   A  1  57   ? 49.720  170.629 41.878  1.00 45.11  ? 58   C   A "O5'" 1 
ATOM   1032  C  "C5'" . C   A  1  57   ? 49.614  171.827 42.666  1.00 48.63  ? 58   C   A "C5'" 1 
ATOM   1033  C  "C4'" . C   A  1  57   ? 48.546  171.664 43.704  1.00 50.72  ? 58   C   A "C4'" 1 
ATOM   1034  O  "O4'" . C   A  1  57   ? 47.261  171.526 43.055  1.00 52.32  ? 58   C   A "O4'" 1 
ATOM   1035  C  "C3'" . C   A  1  57   ? 48.666  170.372 44.477  1.00 52.19  ? 58   C   A "C3'" 1 
ATOM   1036  O  "O3'" . C   A  1  57   ? 49.635  170.503 45.486  1.00 53.33  ? 58   C   A "O3'" 1 
ATOM   1037  C  "C2'" . C   A  1  57   ? 47.264  170.180 45.021  1.00 52.63  ? 58   C   A "C2'" 1 
ATOM   1038  O  "O2'" . C   A  1  57   ? 47.041  170.945 46.180  1.00 53.31  ? 58   C   A "O2'" 1 
ATOM   1039  C  "C1'" . C   A  1  57   ? 46.418  170.736 43.871  1.00 53.40  ? 58   C   A "C1'" 1 
ATOM   1040  N  N1    . C   A  1  57   ? 45.773  169.700 43.050  1.00 53.91  ? 58   C   A N1    1 
ATOM   1041  C  C2    . C   A  1  57   ? 44.498  169.279 43.416  1.00 54.77  ? 58   C   A C2    1 
ATOM   1042  O  O2    . C   A  1  57   ? 43.942  169.835 44.369  1.00 54.55  ? 58   C   A O2    1 
ATOM   1043  N  N3    . C   A  1  57   ? 43.903  168.282 42.725  1.00 55.46  ? 58   C   A N3    1 
ATOM   1044  C  C4    . C   A  1  57   ? 44.536  167.717 41.696  1.00 55.98  ? 58   C   A C4    1 
ATOM   1045  N  N4    . C   A  1  57   ? 43.925  166.701 41.067  1.00 56.04  ? 58   C   A N4    1 
ATOM   1046  C  C5    . C   A  1  57   ? 45.827  168.157 41.273  1.00 55.77  ? 58   C   A C5    1 
ATOM   1047  C  C6    . C   A  1  57   ? 46.402  169.142 41.973  1.00 54.85  ? 58   C   A C6    1 
ATOM   1048  P  P     . A   A  1  58   ? 50.966  169.629 45.396  1.00 55.19  ? 59   A   A P     1 
ATOM   1049  O  OP1   . A   A  1  58   ? 51.676  169.824 46.701  1.00 53.88  ? 59   A   A OP1   1 
ATOM   1050  O  OP2   . A   A  1  58   ? 51.662  169.950 44.111  1.00 53.51  ? 59   A   A OP2   1 
ATOM   1051  O  "O5'" . A   A  1  58   ? 50.402  168.142 45.285  1.00 50.74  ? 59   A   A "O5'" 1 
ATOM   1052  C  "C5'" . A   A  1  58   ? 49.861  167.480 46.427  1.00 47.32  ? 59   A   A "C5'" 1 
ATOM   1053  C  "C4'" . A   A  1  58   ? 49.987  165.985 46.277  1.00 45.92  ? 59   A   A "C4'" 1 
ATOM   1054  O  "O4'" . A   A  1  58   ? 48.891  165.489 45.468  1.00 45.51  ? 59   A   A "O4'" 1 
ATOM   1055  C  "C3'" . A   A  1  58   ? 51.273  165.436 45.649  1.00 44.67  ? 59   A   A "C3'" 1 
ATOM   1056  O  "O3'" . A   A  1  58   ? 51.775  164.342 46.401  1.00 43.68  ? 59   A   A "O3'" 1 
ATOM   1057  C  "C2'" . A   A  1  58   ? 50.789  164.860 44.318  1.00 44.22  ? 59   A   A "C2'" 1 
ATOM   1058  O  "O2'" . A   A  1  58   ? 51.553  163.717 43.986  1.00 42.76  ? 59   A   A "O2'" 1 
ATOM   1059  C  "C1'" . A   A  1  58   ? 49.362  164.438 44.665  1.00 45.13  ? 59   A   A "C1'" 1 
ATOM   1060  N  N9    . A   A  1  58   ? 48.458  164.284 43.521  1.00 45.94  ? 59   A   A N9    1 
ATOM   1061  C  C8    . A   A  1  58   ? 48.299  165.161 42.477  1.00 46.98  ? 59   A   A C8    1 
ATOM   1062  N  N7    . A   A  1  58   ? 47.460  164.748 41.559  1.00 47.85  ? 59   A   A N7    1 
ATOM   1063  C  C5    . A   A  1  58   ? 47.021  163.522 42.034  1.00 47.49  ? 59   A   A C5    1 
ATOM   1064  C  C6    . A   A  1  58   ? 46.128  162.572 41.504  1.00 47.54  ? 59   A   A C6    1 
ATOM   1065  N  N6    . A   A  1  58   ? 45.514  162.711 40.321  1.00 46.25  ? 59   A   A N6    1 
ATOM   1066  N  N1    . A   A  1  58   ? 45.895  161.457 42.232  1.00 47.14  ? 59   A   A N1    1 
ATOM   1067  C  C2    . A   A  1  58   ? 46.535  161.309 43.396  1.00 45.82  ? 59   A   A C2    1 
ATOM   1068  N  N3    . A   A  1  58   ? 47.410  162.119 43.989  1.00 47.07  ? 59   A   A N3    1 
ATOM   1069  C  C4    . A   A  1  58   ? 47.615  163.226 43.250  1.00 47.04  ? 59   A   A C4    1 
ATOM   1070  P  P     . A   A  1  59   ? 53.241  164.417 47.065  1.00 43.14  ? 60   A   A P     1 
ATOM   1071  O  OP1   . A   A  1  59   ? 53.614  165.836 47.285  1.00 41.76  ? 60   A   A OP1   1 
ATOM   1072  O  OP2   . A   A  1  59   ? 54.175  163.525 46.331  1.00 44.40  ? 60   A   A OP2   1 
ATOM   1073  O  "O5'" . A   A  1  59   ? 52.955  163.763 48.481  1.00 40.63  ? 60   A   A "O5'" 1 
ATOM   1074  C  "C5'" . A   A  1  59   ? 53.988  163.182 49.265  1.00 38.70  ? 60   A   A "C5'" 1 
ATOM   1075  C  "C4'" . A   A  1  59   ? 53.428  162.032 50.072  1.00 37.34  ? 60   A   A "C4'" 1 
ATOM   1076  O  "O4'" . A   A  1  59   ? 52.101  162.367 50.559  1.00 37.21  ? 60   A   A "O4'" 1 
ATOM   1077  C  "C3'" . A   A  1  59   ? 53.210  160.745 49.309  1.00 35.95  ? 60   A   A "C3'" 1 
ATOM   1078  O  "O3'" . A   A  1  59   ? 54.403  160.020 49.284  1.00 35.00  ? 60   A   A "O3'" 1 
ATOM   1079  C  "C2'" . A   A  1  59   ? 52.168  160.043 50.154  1.00 36.36  ? 60   A   A "C2'" 1 
ATOM   1080  O  "O2'" . A   A  1  59   ? 52.726  159.492 51.330  1.00 36.30  ? 60   A   A "O2'" 1 
ATOM   1081  C  "C1'" . A   A  1  59   ? 51.264  161.220 50.504  1.00 37.65  ? 60   A   A "C1'" 1 
ATOM   1082  N  N9    . A   A  1  59   ? 50.270  161.433 49.451  1.00 39.00  ? 60   A   A N9    1 
ATOM   1083  C  C8    . A   A  1  59   ? 50.235  162.447 48.521  1.00 38.58  ? 60   A   A C8    1 
ATOM   1084  N  N7    . A   A  1  59   ? 49.243  162.356 47.676  1.00 38.78  ? 60   A   A N7    1 
ATOM   1085  C  C5    . A   A  1  59   ? 48.571  161.207 48.077  1.00 40.07  ? 60   A   A C5    1 
ATOM   1086  C  C6    . A   A  1  59   ? 47.429  160.549 47.573  1.00 41.62  ? 60   A   A C6    1 
ATOM   1087  N  N6    . A   A  1  59   ? 46.725  160.975 46.521  1.00 41.71  ? 60   A   A N6    1 
ATOM   1088  N  N1    . A   A  1  59   ? 47.030  159.422 48.197  1.00 42.45  ? 60   A   A N1    1 
ATOM   1089  C  C2    . A   A  1  59   ? 47.729  158.993 49.254  1.00 42.76  ? 60   A   A C2    1 
ATOM   1090  N  N3    . A   A  1  59   ? 48.813  159.517 49.821  1.00 41.32  ? 60   A   A N3    1 
ATOM   1091  C  C4    . A   A  1  59   ? 49.189  160.636 49.175  1.00 40.02  ? 60   A   A C4    1 
ATOM   1092  P  P     . G   A  1  60   ? 54.645  158.956 48.132  1.00 34.82  ? 61   G   A P     1 
ATOM   1093  O  OP1   . G   A  1  60   ? 56.002  158.423 48.368  1.00 34.79  ? 61   G   A OP1   1 
ATOM   1094  O  OP2   . G   A  1  60   ? 54.326  159.591 46.835  1.00 34.12  ? 61   G   A OP2   1 
ATOM   1095  O  "O5'" . G   A  1  60   ? 53.565  157.827 48.455  1.00 34.82  ? 61   G   A "O5'" 1 
ATOM   1096  C  "C5'" . G   A  1  60   ? 53.657  157.012 49.643  1.00 33.42  ? 61   G   A "C5'" 1 
ATOM   1097  C  "C4'" . G   A  1  60   ? 52.564  155.959 49.651  1.00 34.56  ? 61   G   A "C4'" 1 
ATOM   1098  O  "O4'" . G   A  1  60   ? 51.252  156.576 49.774  1.00 34.05  ? 61   G   A "O4'" 1 
ATOM   1099  C  "C3'" . G   A  1  60   ? 52.460  155.104 48.401  1.00 33.94  ? 61   G   A "C3'" 1 
ATOM   1100  O  "O3'" . G   A  1  60   ? 53.416  154.049 48.438  1.00 33.83  ? 61   G   A "O3'" 1 
ATOM   1101  C  "C2'" . G   A  1  60   ? 51.023  154.594 48.470  1.00 34.04  ? 61   G   A "C2'" 1 
ATOM   1102  O  "O2'" . G   A  1  60   ? 50.857  153.499 49.343  1.00 34.86  ? 61   G   A "O2'" 1 
ATOM   1103  C  "C1'" . G   A  1  60   ? 50.293  155.810 49.052  1.00 35.23  ? 61   G   A "C1'" 1 
ATOM   1104  N  N9    . G   A  1  60   ? 49.729  156.662 48.010  1.00 37.27  ? 61   G   A N9    1 
ATOM   1105  C  C8    . G   A  1  60   ? 50.117  157.947 47.703  1.00 38.27  ? 61   G   A C8    1 
ATOM   1106  N  N7    . G   A  1  60   ? 49.482  158.443 46.676  1.00 38.59  ? 61   G   A N7    1 
ATOM   1107  C  C5    . G   A  1  60   ? 48.623  157.429 46.281  1.00 38.20  ? 61   G   A C5    1 
ATOM   1108  C  C6    . G   A  1  60   ? 47.725  157.371 45.197  1.00 37.19  ? 61   G   A C6    1 
ATOM   1109  O  O6    . G   A  1  60   ? 47.523  158.215 44.326  1.00 37.83  ? 61   G   A O6    1 
ATOM   1110  N  N1    . G   A  1  60   ? 47.038  156.168 45.164  1.00 37.82  ? 61   G   A N1    1 
ATOM   1111  C  C2    . G   A  1  60   ? 47.211  155.139 46.048  1.00 38.29  ? 61   G   A C2    1 
ATOM   1112  N  N2    . G   A  1  60   ? 46.447  154.053 45.850  1.00 39.54  ? 61   G   A N2    1 
ATOM   1113  N  N3    . G   A  1  60   ? 48.068  155.166 47.053  1.00 38.10  ? 61   G   A N3    1 
ATOM   1114  C  C4    . G   A  1  60   ? 48.738  156.334 47.111  1.00 37.54  ? 61   G   A C4    1 
ATOM   1115  P  P     . C   A  1  61   ? 54.098  153.540 47.077  1.00 35.74  ? 62   C   A P     1 
ATOM   1116  O  OP1   . C   A  1  61   ? 55.078  152.483 47.440  1.00 34.34  ? 62   C   A OP1   1 
ATOM   1117  O  OP2   . C   A  1  61   ? 54.532  154.707 46.260  1.00 34.50  ? 62   C   A OP2   1 
ATOM   1118  O  "O5'" . C   A  1  61   ? 52.906  152.834 46.299  1.00 35.28  ? 62   C   A "O5'" 1 
ATOM   1119  C  "C5'" . C   A  1  61   ? 52.308  151.650 46.813  1.00 35.56  ? 62   C   A "C5'" 1 
ATOM   1120  C  "C4'" . C   A  1  61   ? 51.122  151.268 45.977  1.00 37.17  ? 62   C   A "C4'" 1 
ATOM   1121  O  "O4'" . C   A  1  61   ? 50.134  152.323 46.058  1.00 39.16  ? 62   C   A "O4'" 1 
ATOM   1122  C  "C3'" . C   A  1  61   ? 51.393  151.147 44.496  1.00 36.95  ? 62   C   A "C3'" 1 
ATOM   1123  O  "O3'" . C   A  1  61   ? 51.932  149.882 44.172  1.00 37.85  ? 62   C   A "O3'" 1 
ATOM   1124  C  "C2'" . C   A  1  61   ? 50.010  151.333 43.904  1.00 39.20  ? 62   C   A "C2'" 1 
ATOM   1125  O  "O2'" . C   A  1  61   ? 49.245  150.154 43.917  1.00 39.64  ? 62   C   A "O2'" 1 
ATOM   1126  C  "C1'" . C   A  1  61   ? 49.412  152.383 44.844  1.00 40.86  ? 62   C   A "C1'" 1 
ATOM   1127  N  N1    . C   A  1  61   ? 49.529  153.736 44.275  1.00 43.35  ? 62   C   A N1    1 
ATOM   1128  C  C2    . C   A  1  61   ? 48.572  154.154 43.338  1.00 44.53  ? 62   C   A C2    1 
ATOM   1129  O  O2    . C   A  1  61   ? 47.593  153.419 43.106  1.00 45.52  ? 62   C   A O2    1 
ATOM   1130  N  N3    . C   A  1  61   ? 48.732  155.351 42.716  1.00 45.57  ? 62   C   A N3    1 
ATOM   1131  C  C4    . C   A  1  61   ? 49.776  156.123 43.016  1.00 44.58  ? 62   C   A C4    1 
ATOM   1132  N  N4    . C   A  1  61   ? 49.923  157.269 42.342  1.00 44.36  ? 62   C   A N4    1 
ATOM   1133  C  C5    . C   A  1  61   ? 50.722  155.751 44.009  1.00 44.99  ? 62   C   A C5    1 
ATOM   1134  C  C6    . C   A  1  61   ? 50.564  154.560 44.609  1.00 43.77  ? 62   C   A C6    1 
ATOM   1135  P  P     . U   A  1  62   ? 52.825  149.718 42.849  1.00 40.32  ? 63   U   A P     1 
ATOM   1136  O  OP1   . U   A  1  62   ? 53.222  148.285 42.729  1.00 39.13  ? 63   U   A OP1   1 
ATOM   1137  O  OP2   . U   A  1  62   ? 53.870  150.765 42.898  1.00 37.90  ? 63   U   A OP2   1 
ATOM   1138  O  "O5'" . U   A  1  62   ? 51.829  150.064 41.653  1.00 39.05  ? 63   U   A "O5'" 1 
ATOM   1139  C  "C5'" . U   A  1  62   ? 50.773  149.165 41.269  1.00 37.46  ? 63   U   A "C5'" 1 
ATOM   1140  C  "C4'" . U   A  1  62   ? 49.969  149.756 40.128  1.00 37.80  ? 63   U   A "C4'" 1 
ATOM   1141  O  "O4'" . U   A  1  62   ? 49.305  150.972 40.563  1.00 36.94  ? 63   U   A "O4'" 1 
ATOM   1142  C  "C3'" . U   A  1  62   ? 50.764  150.200 38.912  1.00 36.26  ? 63   U   A "C3'" 1 
ATOM   1143  O  "O3'" . U   A  1  62   ? 51.089  149.111 38.059  1.00 35.57  ? 63   U   A "O3'" 1 
ATOM   1144  C  "C2'" . U   A  1  62   ? 49.819  151.188 38.253  1.00 36.77  ? 63   U   A "C2'" 1 
ATOM   1145  O  "O2'" . U   A  1  62   ? 48.788  150.544 37.534  1.00 37.55  ? 63   U   A "O2'" 1 
ATOM   1146  C  "C1'" . U   A  1  62   ? 49.231  151.888 39.478  1.00 37.58  ? 63   U   A "C1'" 1 
ATOM   1147  N  N1    . U   A  1  62   ? 49.990  153.102 39.826  1.00 38.74  ? 63   U   A N1    1 
ATOM   1148  C  C2    . U   A  1  62   ? 49.710  154.256 39.108  1.00 38.77  ? 63   U   A C2    1 
ATOM   1149  O  O2    . U   A  1  62   ? 48.859  154.302 38.232  1.00 39.61  ? 63   U   A O2    1 
ATOM   1150  N  N3    . U   A  1  62   ? 50.466  155.349 39.452  1.00 37.94  ? 63   U   A N3    1 
ATOM   1151  C  C4    . U   A  1  62   ? 51.446  155.403 40.413  1.00 37.17  ? 63   U   A C4    1 
ATOM   1152  O  O4    . U   A  1  62   ? 52.039  156.453 40.611  1.00 37.42  ? 63   U   A O4    1 
ATOM   1153  C  C5    . U   A  1  62   ? 51.665  154.185 41.114  1.00 37.63  ? 63   U   A C5    1 
ATOM   1154  C  C6    . U   A  1  62   ? 50.951  153.104 40.810  1.00 37.81  ? 63   U   A C6    1 
ATOM   1155  P  P     . G   A  1  63   ? 52.420  149.179 37.171  1.00 36.15  ? 64   G   A P     1 
ATOM   1156  O  OP1   . G   A  1  63   ? 52.471  147.933 36.367  1.00 36.82  ? 64   G   A OP1   1 
ATOM   1157  O  OP2   . G   A  1  63   ? 53.556  149.527 38.062  1.00 33.72  ? 64   G   A OP2   1 
ATOM   1158  O  "O5'" . G   A  1  63   ? 52.126  150.381 36.172  1.00 35.65  ? 64   G   A "O5'" 1 
ATOM   1159  C  "C5'" . G   A  1  63   ? 51.053  150.269 35.209  1.00 36.50  ? 64   G   A "C5'" 1 
ATOM   1160  C  "C4'" . G   A  1  63   ? 50.884  151.558 34.448  1.00 38.19  ? 64   G   A "C4'" 1 
ATOM   1161  O  "O4'" . G   A  1  63   ? 50.559  152.631 35.369  1.00 39.77  ? 64   G   A "O4'" 1 
ATOM   1162  C  "C3'" . G   A  1  63   ? 52.110  152.073 33.727  1.00 38.88  ? 64   G   A "C3'" 1 
ATOM   1163  O  "O3'" . G   A  1  63   ? 52.291  151.459 32.482  1.00 37.89  ? 64   G   A "O3'" 1 
ATOM   1164  C  "C2'" . G   A  1  63   ? 51.797  153.549 33.567  1.00 39.28  ? 64   G   A "C2'" 1 
ATOM   1165  O  "O2'" . G   A  1  63   ? 50.902  153.832 32.512  1.00 40.54  ? 64   G   A "O2'" 1 
ATOM   1166  C  "C1'" . G   A  1  63   ? 51.125  153.841 34.903  1.00 40.50  ? 64   G   A "C1'" 1 
ATOM   1167  N  N9    . G   A  1  63   ? 52.066  154.317 35.905  1.00 43.51  ? 64   G   A N9    1 
ATOM   1168  C  C8    . G   A  1  63   ? 52.606  153.624 36.962  1.00 43.74  ? 64   G   A C8    1 
ATOM   1169  N  N7    . G   A  1  63   ? 53.344  154.374 37.730  1.00 45.45  ? 64   G   A N7    1 
ATOM   1170  C  C5    . G   A  1  63   ? 53.299  155.625 37.131  1.00 45.36  ? 64   G   A C5    1 
ATOM   1171  C  C6    . G   A  1  63   ? 53.873  156.846 37.526  1.00 46.29  ? 64   G   A C6    1 
ATOM   1172  O  O6    . G   A  1  63   ? 54.548  157.088 38.532  1.00 47.95  ? 64   G   A O6    1 
ATOM   1173  N  N1    . G   A  1  63   ? 53.586  157.865 36.623  1.00 46.15  ? 64   G   A N1    1 
ATOM   1174  C  C2    . G   A  1  63   ? 52.840  157.724 35.483  1.00 45.96  ? 64   G   A C2    1 
ATOM   1175  N  N2    . G   A  1  63   ? 52.691  158.820 34.715  1.00 45.09  ? 64   G   A N2    1 
ATOM   1176  N  N3    . G   A  1  63   ? 52.283  156.592 35.116  1.00 45.76  ? 64   G   A N3    1 
ATOM   1177  C  C4    . G   A  1  63   ? 52.548  155.592 35.987  1.00 44.69  ? 64   G   A C4    1 
ATOM   1178  P  P     . C   A  1  64   ? 53.774  151.193 31.961  1.00 39.21  ? 65   C   A P     1 
ATOM   1179  O  OP1   . C   A  1  64   ? 53.679  150.374 30.719  1.00 41.26  ? 65   C   A OP1   1 
ATOM   1180  O  OP2   . C   A  1  64   ? 54.555  150.692 33.120  1.00 41.16  ? 65   C   A OP2   1 
ATOM   1181  O  "O5'" . C   A  1  64   ? 54.340  152.635 31.593  1.00 39.80  ? 65   C   A "O5'" 1 
ATOM   1182  C  "C5'" . C   A  1  64   ? 53.713  153.460 30.589  1.00 40.68  ? 65   C   A "C5'" 1 
ATOM   1183  C  "C4'" . C   A  1  64   ? 54.172  154.894 30.737  1.00 40.13  ? 65   C   A "C4'" 1 
ATOM   1184  O  "O4'" . C   A  1  64   ? 53.797  155.381 32.054  1.00 40.52  ? 65   C   A "O4'" 1 
ATOM   1185  C  "C3'" . C   A  1  64   ? 55.676  155.125 30.676  1.00 39.15  ? 65   C   A "C3'" 1 
ATOM   1186  O  "O3'" . C   A  1  64   ? 56.141  155.241 29.331  1.00 37.24  ? 65   C   A "O3'" 1 
ATOM   1187  C  "C2'" . C   A  1  64   ? 55.822  156.445 31.412  1.00 40.40  ? 65   C   A "C2'" 1 
ATOM   1188  O  "O2'" . C   A  1  64   ? 55.427  157.524 30.587  1.00 40.81  ? 65   C   A "O2'" 1 
ATOM   1189  C  "C1'" . C   A  1  64   ? 54.789  156.278 32.530  1.00 41.75  ? 65   C   A "C1'" 1 
ATOM   1190  N  N1    . C   A  1  64   ? 55.347  155.753 33.799  1.00 43.90  ? 65   C   A N1    1 
ATOM   1191  C  C2    . C   A  1  64   ? 55.968  156.651 34.687  1.00 44.52  ? 65   C   A C2    1 
ATOM   1192  O  O2    . C   A  1  64   ? 56.024  157.866 34.382  1.00 44.84  ? 65   C   A O2    1 
ATOM   1193  N  N3    . C   A  1  64   ? 56.489  156.182 35.850  1.00 44.69  ? 65   C   A N3    1 
ATOM   1194  C  C4    . C   A  1  64   ? 56.415  154.886 36.136  1.00 43.53  ? 65   C   A C4    1 
ATOM   1195  N  N4    . C   A  1  64   ? 56.954  154.461 37.280  1.00 43.94  ? 65   C   A N4    1 
ATOM   1196  C  C5    . C   A  1  64   ? 55.786  153.958 35.260  1.00 44.32  ? 65   C   A C5    1 
ATOM   1197  C  C6    . C   A  1  64   ? 55.269  154.426 34.116  1.00 44.04  ? 65   C   A C6    1 
ATOM   1198  P  P     . G   A  1  65   ? 57.686  154.952 28.983  1.00 36.78  ? 66   G   A P     1 
ATOM   1199  O  OP1   . G   A  1  65   ? 57.772  154.823 27.505  1.00 36.84  ? 66   G   A OP1   1 
ATOM   1200  O  OP2   . G   A  1  65   ? 58.143  153.840 29.840  1.00 35.88  ? 66   G   A OP2   1 
ATOM   1201  O  "O5'" . G   A  1  65   ? 58.472  156.266 29.430  1.00 34.51  ? 66   G   A "O5'" 1 
ATOM   1202  C  "C5'" . G   A  1  65   ? 58.057  157.578 29.000  1.00 33.98  ? 66   G   A "C5'" 1 
ATOM   1203  C  "C4'" . G   A  1  65   ? 58.916  158.642 29.656  1.00 32.77  ? 66   G   A "C4'" 1 
ATOM   1204  O  "O4'" . G   A  1  65   ? 58.893  158.452 31.100  1.00 34.16  ? 66   G   A "O4'" 1 
ATOM   1205  C  "C3'" . G   A  1  65   ? 60.388  158.640 29.262  1.00 31.98  ? 66   G   A "C3'" 1 
ATOM   1206  O  "O3'" . G   A  1  65   ? 60.866  159.988 29.325  1.00 32.50  ? 66   G   A "O3'" 1 
ATOM   1207  C  "C2'" . G   A  1  65   ? 61.009  157.761 30.348  1.00 33.19  ? 66   G   A "C2'" 1 
ATOM   1208  O  "O2'" . G   A  1  65   ? 62.388  157.980 30.534  1.00 32.86  ? 66   G   A "O2'" 1 
ATOM   1209  C  "C1'" . G   A  1  65   ? 60.201  158.189 31.575  1.00 35.16  ? 66   G   A "C1'" 1 
ATOM   1210  N  N9    . G   A  1  65   ? 60.105  157.258 32.709  1.00 36.98  ? 66   G   A N9    1 
ATOM   1211  C  C8    . G   A  1  65   ? 59.374  156.090 32.780  1.00 38.89  ? 66   G   A C8    1 
ATOM   1212  N  N7    . G   A  1  65   ? 59.447  155.506 33.950  1.00 40.14  ? 66   G   A N7    1 
ATOM   1213  C  C5    . G   A  1  65   ? 60.283  156.327 34.696  1.00 39.59  ? 66   G   A C5    1 
ATOM   1214  C  C6    . G   A  1  65   ? 60.725  156.208 36.047  1.00 39.72  ? 66   G   A C6    1 
ATOM   1215  O  O6    . G   A  1  65   ? 60.448  155.329 36.884  1.00 39.18  ? 66   G   A O6    1 
ATOM   1216  N  N1    . G   A  1  65   ? 61.568  157.252 36.397  1.00 39.72  ? 66   G   A N1    1 
ATOM   1217  C  C2    . G   A  1  65   ? 61.942  158.280 35.571  1.00 39.37  ? 66   G   A C2    1 
ATOM   1218  N  N2    . G   A  1  65   ? 62.782  159.182 36.111  1.00 39.40  ? 66   G   A N2    1 
ATOM   1219  N  N3    . G   A  1  65   ? 61.532  158.413 34.317  1.00 38.65  ? 66   G   A N3    1 
ATOM   1220  C  C4    . G   A  1  65   ? 60.709  157.406 33.946  1.00 37.97  ? 66   G   A C4    1 
ATOM   1221  P  P     . A   A  1  66   ? 60.788  160.945 28.023  1.00 33.49  ? 67   A   A P     1 
ATOM   1222  O  OP1   . A   A  1  66   ? 59.844  160.360 27.046  1.00 33.74  ? 67   A   A OP1   1 
ATOM   1223  O  OP2   . A   A  1  66   ? 62.157  161.301 27.585  1.00 32.20  ? 67   A   A OP2   1 
ATOM   1224  O  "O5'" . A   A  1  66   ? 60.091  162.270 28.566  1.00 34.42  ? 67   A   A "O5'" 1 
ATOM   1225  C  "C5'" . A   A  1  66   ? 60.439  162.825 29.846  1.00 36.37  ? 67   A   A "C5'" 1 
ATOM   1226  C  "C4'" . A   A  1  66   ? 60.855  164.269 29.700  1.00 37.84  ? 67   A   A "C4'" 1 
ATOM   1227  O  "O4'" . A   A  1  66   ? 61.327  164.769 30.991  1.00 38.46  ? 67   A   A "O4'" 1 
ATOM   1228  C  "C3'" . A   A  1  66   ? 62.007  164.478 28.728  1.00 38.15  ? 67   A   A "C3'" 1 
ATOM   1229  O  "O3'" . A   A  1  66   ? 61.893  165.762 28.084  1.00 36.15  ? 67   A   A "O3'" 1 
ATOM   1230  C  "C2'" . A   A  1  66   ? 63.212  164.382 29.659  1.00 39.43  ? 67   A   A "C2'" 1 
ATOM   1231  O  "O2'" . A   A  1  66   ? 64.405  164.925 29.132  1.00 42.18  ? 67   A   A "O2'" 1 
ATOM   1232  C  "C1'" . A   A  1  66   ? 62.694  165.132 30.890  1.00 39.54  ? 67   A   A "C1'" 1 
ATOM   1233  N  N9    . A   A  1  66   ? 63.347  164.790 32.156  1.00 41.05  ? 67   A   A N9    1 
ATOM   1234  C  C8    . A   A  1  66   ? 63.975  165.631 33.040  1.00 42.58  ? 67   A   A C8    1 
ATOM   1235  N  N7    . A   A  1  66   ? 64.435  165.030 34.113  1.00 43.07  ? 67   A   A N7    1 
ATOM   1236  C  C5    . A   A  1  66   ? 64.092  163.701 33.916  1.00 42.51  ? 67   A   A C5    1 
ATOM   1237  C  C6    . A   A  1  66   ? 64.294  162.544 34.683  1.00 42.32  ? 67   A   A C6    1 
ATOM   1238  N  N6    . A   A  1  66   ? 64.917  162.521 35.858  1.00 42.78  ? 67   A   A N6    1 
ATOM   1239  N  N1    . A   A  1  66   ? 63.827  161.381 34.191  1.00 43.17  ? 67   A   A N1    1 
ATOM   1240  C  C2    . A   A  1  66   ? 63.206  161.386 33.011  1.00 43.12  ? 67   A   A C2    1 
ATOM   1241  N  N3    . A   A  1  66   ? 62.955  162.397 32.203  1.00 42.13  ? 67   A   A N3    1 
ATOM   1242  C  C4    . A   A  1  66   ? 63.429  163.540 32.714  1.00 41.73  ? 67   A   A C4    1 
ATOM   1243  P  P     . U   A  1  67   ? 61.856  165.856 26.472  1.00 33.69  ? 68   U   A P     1 
ATOM   1244  O  OP1   . U   A  1  67   ? 62.731  164.784 25.913  1.00 32.78  ? 68   U   A OP1   1 
ATOM   1245  O  OP2   . U   A  1  67   ? 62.091  167.274 26.093  1.00 34.73  ? 68   U   A OP2   1 
ATOM   1246  O  "O5'" . U   A  1  67   ? 60.365  165.471 26.076  1.00 32.08  ? 68   U   A "O5'" 1 
ATOM   1247  C  "C5'" . U   A  1  67   ? 59.275  166.362 26.329  1.00 33.40  ? 68   U   A "C5'" 1 
ATOM   1248  C  "C4'" . U   A  1  67   ? 57.967  165.671 26.037  1.00 33.33  ? 68   U   A "C4'" 1 
ATOM   1249  O  "O4'" . U   A  1  67   ? 57.975  165.163 24.676  1.00 33.35  ? 68   U   A "O4'" 1 
ATOM   1250  C  "C3'" . U   A  1  67   ? 57.645  164.470 26.909  1.00 32.30  ? 68   U   A "C3'" 1 
ATOM   1251  O  "O3'" . U   A  1  67   ? 56.230  164.380 26.920  1.00 31.28  ? 68   U   A "O3'" 1 
ATOM   1252  C  "C2'" . U   A  1  67   ? 58.179  163.317 26.072  1.00 33.78  ? 68   U   A "C2'" 1 
ATOM   1253  O  "O2'" . U   A  1  67   ? 57.605  162.070 26.419  1.00 35.12  ? 68   U   A "O2'" 1 
ATOM   1254  C  "C1'" . U   A  1  67   ? 57.707  163.775 24.696  1.00 33.44  ? 68   U   A "C1'" 1 
ATOM   1255  N  N1    . U   A  1  67   ? 58.361  163.152 23.541  1.00 34.84  ? 68   U   A N1    1 
ATOM   1256  C  C2    . U   A  1  67   ? 57.601  162.283 22.756  1.00 35.75  ? 68   U   A C2    1 
ATOM   1257  O  O2    . U   A  1  67   ? 56.423  162.005 22.997  1.00 35.66  ? 68   U   A O2    1 
ATOM   1258  N  N3    . U   A  1  67   ? 58.271  161.744 21.683  1.00 36.66  ? 68   U   A N3    1 
ATOM   1259  C  C4    . U   A  1  67   ? 59.588  161.963 21.331  1.00 34.82  ? 68   U   A C4    1 
ATOM   1260  O  O4    . U   A  1  67   ? 60.058  161.363 20.366  1.00 35.89  ? 68   U   A O4    1 
ATOM   1261  C  C5    . U   A  1  67   ? 60.301  162.865 22.192  1.00 35.84  ? 68   U   A C5    1 
ATOM   1262  C  C6    . U   A  1  67   ? 59.677  163.417 23.239  1.00 34.10  ? 68   U   A C6    1 
ATOM   1263  P  P     . A   A  1  68   ? 55.411  164.799 28.222  1.00 32.44  ? 69   A   A P     1 
ATOM   1264  O  OP1   . A   A  1  68   ? 54.102  165.296 27.774  1.00 33.74  ? 69   A   A OP1   1 
ATOM   1265  O  OP2   . A   A  1  68   ? 56.282  165.669 29.045  1.00 31.30  ? 69   A   A OP2   1 
ATOM   1266  O  "O5'" . A   A  1  68   ? 55.155  163.412 28.952  1.00 33.35  ? 69   A   A "O5'" 1 
ATOM   1267  C  "C5'" . A   A  1  68   ? 56.260  162.590 29.313  1.00 33.19  ? 69   A   A "C5'" 1 
ATOM   1268  C  "C4'" . A   A  1  68   ? 55.833  161.465 30.220  1.00 32.86  ? 69   A   A "C4'" 1 
ATOM   1269  O  "O4'" . A   A  1  68   ? 57.088  160.887 30.658  1.00 32.60  ? 69   A   A "O4'" 1 
ATOM   1270  C  "C3'" . A   A  1  68   ? 55.053  161.817 31.502  1.00 32.96  ? 69   A   A "C3'" 1 
ATOM   1271  O  "O3'" . A   A  1  68   ? 53.663  161.446 31.376  1.00 34.96  ? 69   A   A "O3'" 1 
ATOM   1272  C  "C2'" . A   A  1  68   ? 55.753  160.966 32.554  1.00 32.56  ? 69   A   A "C2'" 1 
ATOM   1273  O  "O2'" . A   A  1  68   ? 55.319  159.624 32.502  1.00 30.53  ? 69   A   A "O2'" 1 
ATOM   1274  C  "C1'" . A   A  1  68   ? 57.196  161.016 32.053  1.00 34.29  ? 69   A   A "C1'" 1 
ATOM   1275  N  N9    . A   A  1  68   ? 57.916  162.260 32.358  1.00 36.43  ? 69   A   A N9    1 
ATOM   1276  C  C8    . A   A  1  68   ? 57.714  163.516 31.834  1.00 36.15  ? 69   A   A C8    1 
ATOM   1277  N  N7    . A   A  1  68   ? 58.481  164.437 32.354  1.00 37.28  ? 69   A   A N7    1 
ATOM   1278  C  C5    . A   A  1  68   ? 59.250  163.746 33.281  1.00 37.53  ? 69   A   A C5    1 
ATOM   1279  C  C6    . A   A  1  68   ? 60.243  164.162 34.187  1.00 37.27  ? 69   A   A C6    1 
ATOM   1280  N  N6    . A   A  1  68   ? 60.622  165.435 34.346  1.00 37.41  ? 69   A   A N6    1 
ATOM   1281  N  N1    . A   A  1  68   ? 60.829  163.217 34.950  1.00 38.50  ? 69   A   A N1    1 
ATOM   1282  C  C2    . A   A  1  68   ? 60.423  161.947 34.826  1.00 38.77  ? 69   A   A C2    1 
ATOM   1283  N  N3    . A   A  1  68   ? 59.488  161.437 34.033  1.00 38.47  ? 69   A   A N3    1 
ATOM   1284  C  C4    . A   A  1  68   ? 58.932  162.400 33.276  1.00 37.79  ? 69   A   A C4    1 
ATOM   1285  P  P     . A   A  1  69   ? 52.576  161.825 32.537  1.00 35.72  ? 70   A   A P     1 
ATOM   1286  O  OP1   . A   A  1  69   ? 51.851  163.060 32.128  1.00 36.77  ? 70   A   A OP1   1 
ATOM   1287  O  OP2   . A   A  1  69   ? 53.183  161.760 33.883  1.00 35.33  ? 70   A   A OP2   1 
ATOM   1288  O  "O5'" . A   A  1  69   ? 51.513  160.632 32.476  1.00 36.67  ? 70   A   A "O5'" 1 
ATOM   1289  C  "C5'" . A   A  1  69   ? 50.099  160.866 32.704  1.00 39.07  ? 70   A   A "C5'" 1 
ATOM   1290  C  "C4'" . A   A  1  69   ? 49.310  159.564 32.593  1.00 40.60  ? 70   A   A "C4'" 1 
ATOM   1291  O  "O4'" . A   A  1  69   ? 49.784  158.607 33.583  1.00 40.75  ? 70   A   A "O4'" 1 
ATOM   1292  C  "C3'" . A   A  1  69   ? 47.818  159.716 32.873  1.00 41.25  ? 70   A   A "C3'" 1 
ATOM   1293  O  "O3'" . A   A  1  69   ? 47.060  158.712 32.193  1.00 42.34  ? 70   A   A "O3'" 1 
ATOM   1294  C  "C2'" . A   A  1  69   ? 47.750  159.497 34.376  1.00 41.90  ? 70   A   A "C2'" 1 
ATOM   1295  O  "O2'" . A   A  1  69   ? 46.456  159.121 34.790  1.00 42.66  ? 70   A   A "O2'" 1 
ATOM   1296  C  "C1'" . A   A  1  69   ? 48.785  158.386 34.564  1.00 41.19  ? 70   A   A "C1'" 1 
ATOM   1297  N  N9    . A   A  1  69   ? 49.445  158.391 35.874  1.00 43.20  ? 70   A   A N9    1 
ATOM   1298  C  C8    . A   A  1  69   ? 49.544  157.344 36.754  1.00 43.40  ? 70   A   A C8    1 
ATOM   1299  N  N7    . A   A  1  69   ? 50.220  157.628 37.848  1.00 43.30  ? 70   A   A N7    1 
ATOM   1300  C  C5    . A   A  1  69   ? 50.584  158.957 37.677  1.00 43.37  ? 70   A   A C5    1 
ATOM   1301  C  C6    . A   A  1  69   ? 51.307  159.860 38.486  1.00 42.79  ? 70   A   A C6    1 
ATOM   1302  N  N6    . A   A  1  69   ? 51.810  159.549 39.679  1.00 43.30  ? 70   A   A N6    1 
ATOM   1303  N  N1    . A   A  1  69   ? 51.491  161.110 38.022  1.00 42.66  ? 70   A   A N1    1 
ATOM   1304  C  C2    . A   A  1  69   ? 50.981  161.428 36.835  1.00 43.31  ? 70   A   A C2    1 
ATOM   1305  N  N3    . A   A  1  69   ? 50.281  160.680 35.984  1.00 44.52  ? 70   A   A N3    1 
ATOM   1306  C  C4    . A   A  1  69   ? 50.112  159.439 36.468  1.00 43.81  ? 70   A   A C4    1 
ATOM   1307  P  P     . G   A  1  70   ? 46.590  158.953 30.674  1.00 44.08  ? 71   G   A P     1 
ATOM   1308  O  OP1   . G   A  1  70   ? 46.055  160.339 30.536  1.00 42.56  ? 71   G   A OP1   1 
ATOM   1309  O  OP2   . G   A  1  70   ? 45.757  157.795 30.244  1.00 43.53  ? 71   G   A OP2   1 
ATOM   1310  O  "O5'" . G   A  1  70   ? 47.968  158.868 29.891  1.00 42.68  ? 71   G   A "O5'" 1 
ATOM   1311  C  "C5'" . G   A  1  70   ? 48.094  159.342 28.546  1.00 40.84  ? 71   G   A "C5'" 1 
ATOM   1312  C  "C4'" . G   A  1  70   ? 49.306  160.222 28.444  1.00 39.12  ? 71   G   A "C4'" 1 
ATOM   1313  O  "O4'" . G   A  1  70   ? 50.376  159.669 29.252  1.00 36.83  ? 71   G   A "O4'" 1 
ATOM   1314  C  "C3'" . G   A  1  70   ? 49.890  160.393 27.057  1.00 40.04  ? 71   G   A "C3'" 1 
ATOM   1315  O  "O3'" . G   A  1  70   ? 49.180  161.422 26.363  1.00 43.19  ? 71   G   A "O3'" 1 
ATOM   1316  C  "C2'" . G   A  1  70   ? 51.339  160.736 27.390  1.00 38.10  ? 71   G   A "C2'" 1 
ATOM   1317  O  "O2'" . G   A  1  70   ? 51.480  162.058 27.872  1.00 39.46  ? 71   G   A "O2'" 1 
ATOM   1318  C  "C1'" . G   A  1  70   ? 51.597  159.789 28.565  1.00 36.61  ? 71   G   A "C1'" 1 
ATOM   1319  N  N9    . G   A  1  70   ? 52.006  158.447 28.160  1.00 35.23  ? 71   G   A N9    1 
ATOM   1320  C  C8    . G   A  1  70   ? 51.327  157.267 28.359  1.00 33.40  ? 71   G   A C8    1 
ATOM   1321  N  N7    . G   A  1  70   ? 51.962  156.231 27.890  1.00 32.98  ? 71   G   A N7    1 
ATOM   1322  C  C5    . G   A  1  70   ? 53.127  156.756 27.349  1.00 34.50  ? 71   G   A C5    1 
ATOM   1323  C  C6    . G   A  1  70   ? 54.214  156.114 26.710  1.00 35.66  ? 71   G   A C6    1 
ATOM   1324  O  O6    . G   A  1  70   ? 54.381  154.902 26.491  1.00 38.56  ? 71   G   A O6    1 
ATOM   1325  N  N1    . G   A  1  70   ? 55.182  157.023 26.311  1.00 34.00  ? 71   G   A N1    1 
ATOM   1326  C  C2    . G   A  1  70   ? 55.119  158.373 26.502  1.00 33.77  ? 71   G   A C2    1 
ATOM   1327  N  N2    . G   A  1  70   ? 56.146  159.099 26.030  1.00 34.75  ? 71   G   A N2    1 
ATOM   1328  N  N3    . G   A  1  70   ? 54.123  158.980 27.106  1.00 35.55  ? 71   G   A N3    1 
ATOM   1329  C  C4    . G   A  1  70   ? 53.167  158.118 27.501  1.00 34.48  ? 71   G   A C4    1 
ATOM   1330  P  P     . C   A  1  71   ? 48.638  161.179 24.858  1.00 45.14  ? 72   C   A P     1 
ATOM   1331  O  OP1   . C   A  1  71   ? 47.778  162.370 24.628  1.00 43.87  ? 72   C   A OP1   1 
ATOM   1332  O  OP2   . C   A  1  71   ? 48.067  159.815 24.650  1.00 45.29  ? 72   C   A OP2   1 
ATOM   1333  O  "O5'" . C   A  1  71   ? 49.936  161.303 23.949  1.00 41.99  ? 72   C   A "O5'" 1 
ATOM   1334  C  "C5'" . C   A  1  71   ? 50.519  162.586 23.683  1.00 40.68  ? 72   C   A "C5'" 1 
ATOM   1335  C  "C4'" . C   A  1  71   ? 51.512  162.482 22.558  1.00 40.02  ? 72   C   A "C4'" 1 
ATOM   1336  O  "O4'" . C   A  1  71   ? 52.675  161.725 22.978  1.00 40.50  ? 72   C   A "O4'" 1 
ATOM   1337  C  "C3'" . C   A  1  71   ? 51.002  161.714 21.364  1.00 37.92  ? 72   C   A "C3'" 1 
ATOM   1338  O  "O3'" . C   A  1  71   ? 50.174  162.505 20.554  1.00 36.82  ? 72   C   A "O3'" 1 
ATOM   1339  C  "C2'" . C   A  1  71   ? 52.282  161.283 20.684  1.00 37.83  ? 72   C   A "C2'" 1 
ATOM   1340  O  "O2'" . C   A  1  71   ? 52.878  162.330 19.956  1.00 37.35  ? 72   C   A "O2'" 1 
ATOM   1341  C  "C1'" . C   A  1  71   ? 53.136  160.925 21.900  1.00 38.76  ? 72   C   A "C1'" 1 
ATOM   1342  N  N1    . C   A  1  71   ? 52.955  159.509 22.271  1.00 40.23  ? 72   C   A N1    1 
ATOM   1343  C  C2    . C   A  1  71   ? 53.589  158.526 21.504  1.00 39.40  ? 72   C   A C2    1 
ATOM   1344  O  O2    . C   A  1  71   ? 54.299  158.874 20.549  1.00 40.66  ? 72   C   A O2    1 
ATOM   1345  N  N3    . C   A  1  71   ? 53.410  157.226 21.817  1.00 40.49  ? 72   C   A N3    1 
ATOM   1346  C  C4    . C   A  1  71   ? 52.634  156.888 22.846  1.00 40.33  ? 72   C   A C4    1 
ATOM   1347  N  N4    . C   A  1  71   ? 52.478  155.592 23.108  1.00 41.50  ? 72   C   A N4    1 
ATOM   1348  C  C5    . C   A  1  71   ? 51.981  157.865 23.652  1.00 40.74  ? 72   C   A C5    1 
ATOM   1349  C  C6    . C   A  1  71   ? 52.170  159.151 23.336  1.00 39.62  ? 72   C   A C6    1 
ATOM   1350  P  P     . C   A  1  72   ? 48.980  161.808 19.751  1.00 37.07  ? 73   C   A P     1 
ATOM   1351  O  OP1   . C   A  1  72   ? 48.164  162.903 19.200  1.00 35.14  ? 73   C   A OP1   1 
ATOM   1352  O  OP2   . C   A  1  72   ? 48.354  160.779 20.615  1.00 36.75  ? 73   C   A OP2   1 
ATOM   1353  O  "O5'" . C   A  1  72   ? 49.711  161.055 18.564  1.00 36.47  ? 73   C   A "O5'" 1 
ATOM   1354  C  "C5'" . C   A  1  72   ? 50.497  161.784 17.625  1.00 37.97  ? 73   C   A "C5'" 1 
ATOM   1355  C  "C4'" . C   A  1  72   ? 51.077  160.840 16.618  1.00 39.89  ? 73   C   A "C4'" 1 
ATOM   1356  O  "O4'" . C   A  1  72   ? 51.985  159.922 17.286  1.00 40.89  ? 73   C   A "O4'" 1 
ATOM   1357  C  "C3'" . C   A  1  72   ? 50.074  159.928 15.939  1.00 40.93  ? 73   C   A "C3'" 1 
ATOM   1358  O  "O3'" . C   A  1  72   ? 49.444  160.607 14.878  1.00 42.33  ? 73   C   A "O3'" 1 
ATOM   1359  C  "C2'" . C   A  1  72   ? 50.970  158.799 15.465  1.00 40.45  ? 73   C   A "C2'" 1 
ATOM   1360  O  "O2'" . C   A  1  72   ? 51.732  159.240 14.359  1.00 38.52  ? 73   C   A "O2'" 1 
ATOM   1361  C  "C1'" . C   A  1  72   ? 51.909  158.650 16.669  1.00 41.89  ? 73   C   A "C1'" 1 
ATOM   1362  N  N1    . C   A  1  72   ? 51.487  157.662 17.692  1.00 43.04  ? 73   C   A N1    1 
ATOM   1363  C  C2    . C   A  1  72   ? 51.562  156.299 17.388  1.00 44.23  ? 73   C   A C2    1 
ATOM   1364  O  O2    . C   A  1  72   ? 51.917  155.957 16.247  1.00 45.37  ? 73   C   A O2    1 
ATOM   1365  N  N3    . C   A  1  72   ? 51.249  155.385 18.341  1.00 44.09  ? 73   C   A N3    1 
ATOM   1366  C  C4    . C   A  1  72   ? 50.861  155.789 19.550  1.00 43.79  ? 73   C   A C4    1 
ATOM   1367  N  N4    . C   A  1  72   ? 50.600  154.862 20.467  1.00 45.10  ? 73   C   A N4    1 
ATOM   1368  C  C5    . C   A  1  72   ? 50.734  157.165 19.876  1.00 44.61  ? 73   C   A C5    1 
ATOM   1369  C  C6    . C   A  1  72   ? 51.057  158.062 18.928  1.00 44.60  ? 73   C   A C6    1 
ATOM   1370  P  P     . A   A  1  73   ? 48.040  160.081 14.324  1.00 43.34  ? 74   A   A P     1 
ATOM   1371  O  OP1   . A   A  1  73   ? 47.652  161.022 13.249  1.00 44.84  ? 74   A   A OP1   1 
ATOM   1372  O  OP2   . A   A  1  73   ? 47.103  159.839 15.447  1.00 43.74  ? 74   A   A OP2   1 
ATOM   1373  O  "O5'" . A   A  1  73   ? 48.417  158.696 13.643  1.00 41.97  ? 74   A   A "O5'" 1 
ATOM   1374  C  "C5'" . A   A  1  73   ? 49.192  158.656 12.437  1.00 40.44  ? 74   A   A "C5'" 1 
ATOM   1375  C  "C4'" . A   A  1  73   ? 49.332  157.234 11.976  1.00 41.23  ? 74   A   A "C4'" 1 
ATOM   1376  O  "O4'" . A   A  1  73   ? 50.003  156.470 13.013  1.00 42.65  ? 74   A   A "O4'" 1 
ATOM   1377  C  "C3'" . A   A  1  73   ? 48.021  156.497 11.800  1.00 39.73  ? 74   A   A "C3'" 1 
ATOM   1378  O  "O3'" . A   A  1  73   ? 47.438  156.758 10.532  1.00 39.53  ? 74   A   A "O3'" 1 
ATOM   1379  C  "C2'" . A   A  1  73   ? 48.447  155.047 11.930  1.00 40.38  ? 74   A   A "C2'" 1 
ATOM   1380  O  "O2'" . A   A  1  73   ? 49.053  154.603 10.732  1.00 38.78  ? 74   A   A "O2'" 1 
ATOM   1381  C  "C1'" . A   A  1  73   ? 49.507  155.140 13.029  1.00 41.51  ? 74   A   A "C1'" 1 
ATOM   1382  N  N9    . A   A  1  73   ? 49.043  154.829 14.385  1.00 41.97  ? 74   A   A N9    1 
ATOM   1383  C  C8    . A   A  1  73   ? 48.681  155.727 15.362  1.00 43.03  ? 74   A   A C8    1 
ATOM   1384  N  N7    . A   A  1  73   ? 48.333  155.168 16.494  1.00 44.06  ? 74   A   A N7    1 
ATOM   1385  C  C5    . A   A  1  73   ? 48.467  153.809 16.250  1.00 43.20  ? 74   A   A C5    1 
ATOM   1386  C  C6    . A   A  1  73   ? 48.252  152.686 17.063  1.00 43.31  ? 74   A   A C6    1 
ATOM   1387  N  N6    . A   A  1  73   ? 47.848  152.760 18.338  1.00 44.47  ? 74   A   A N6    1 
ATOM   1388  N  N1    . A   A  1  73   ? 48.472  151.468 16.518  1.00 44.85  ? 74   A   A N1    1 
ATOM   1389  C  C2    . A   A  1  73   ? 48.882  151.400 15.252  1.00 43.43  ? 74   A   A C2    1 
ATOM   1390  N  N3    . A   A  1  73   ? 49.122  152.383 14.388  1.00 43.12  ? 74   A   A N3    1 
ATOM   1391  C  C4    . A   A  1  73   ? 48.896  153.582 14.954  1.00 42.07  ? 74   A   A C4    1 
ATOM   1392  P  P     . U   A  1  74   ? 45.843  156.715 10.370  1.00 39.60  ? 75   U   A P     1 
ATOM   1393  O  OP1   . U   A  1  74   ? 45.525  157.269 9.032   1.00 38.67  ? 75   U   A OP1   1 
ATOM   1394  O  OP2   . U   A  1  74   ? 45.276  157.351 11.573  1.00 37.51  ? 75   U   A OP2   1 
ATOM   1395  O  "O5'" . U   A  1  74   ? 45.508  155.156 10.384  1.00 38.97  ? 75   U   A "O5'" 1 
ATOM   1396  C  "C5'" . U   A  1  74   ? 45.992  154.292 9.332   1.00 41.87  ? 75   U   A "C5'" 1 
ATOM   1397  C  "C4'" . U   A  1  74   ? 45.769  152.835 9.683   1.00 45.19  ? 75   U   A "C4'" 1 
ATOM   1398  O  "O4'" . U   A  1  74   ? 46.620  152.423 10.790  1.00 47.07  ? 75   U   A "O4'" 1 
ATOM   1399  C  "C3'" . U   A  1  74   ? 44.387  152.468 10.174  1.00 46.72  ? 75   U   A "C3'" 1 
ATOM   1400  O  "O3'" . U   A  1  74   ? 43.436  152.345 9.152   1.00 48.72  ? 75   U   A "O3'" 1 
ATOM   1401  C  "C2'" . U   A  1  74   ? 44.632  151.138 10.858  1.00 47.89  ? 75   U   A "C2'" 1 
ATOM   1402  O  "O2'" . U   A  1  74   ? 44.749  150.079 9.936   1.00 47.81  ? 75   U   A "O2'" 1 
ATOM   1403  C  "C1'" . U   A  1  74   ? 45.961  151.415 11.556  1.00 48.85  ? 75   U   A "C1'" 1 
ATOM   1404  N  N1    . U   A  1  74   ? 45.709  151.940 12.910  1.00 51.44  ? 75   U   A N1    1 
ATOM   1405  C  C2    . U   A  1  74   ? 45.661  151.033 13.976  1.00 52.94  ? 75   U   A C2    1 
ATOM   1406  O  O2    . U   A  1  74   ? 45.852  149.819 13.850  1.00 53.45  ? 75   U   A O2    1 
ATOM   1407  N  N3    . U   A  1  74   ? 45.379  151.597 15.200  1.00 52.95  ? 75   U   A N3    1 
ATOM   1408  C  C4    . U   A  1  74   ? 45.143  152.930 15.473  1.00 52.32  ? 75   U   A C4    1 
ATOM   1409  O  O4    . U   A  1  74   ? 44.822  153.265 16.613  1.00 49.98  ? 75   U   A O4    1 
ATOM   1410  C  C5    . U   A  1  74   ? 45.223  153.798 14.335  1.00 52.68  ? 75   U   A C5    1 
ATOM   1411  C  C6    . U   A  1  74   ? 45.500  153.290 13.126  1.00 52.47  ? 75   U   A C6    1 
ATOM   1412  P  P     . G   A  1  75   ? 41.900  152.629 9.495   1.00 52.47  ? 76   G   A P     1 
ATOM   1413  O  OP1   . G   A  1  75   ? 41.179  152.639 8.194   1.00 52.66  ? 76   G   A OP1   1 
ATOM   1414  O  OP2   . G   A  1  75   ? 41.862  153.839 10.368  1.00 51.69  ? 76   G   A OP2   1 
ATOM   1415  O  "O5'" . G   A  1  75   ? 41.458  151.372 10.383  1.00 51.84  ? 76   G   A "O5'" 1 
ATOM   1416  C  "C5'" . G   A  1  75   ? 41.322  150.062 9.802   1.00 52.04  ? 76   G   A "C5'" 1 
ATOM   1417  C  "C4'" . G   A  1  75   ? 41.112  149.009 10.879  1.00 53.17  ? 76   G   A "C4'" 1 
ATOM   1418  O  "O4'" . G   A  1  75   ? 42.215  149.063 11.824  1.00 52.96  ? 76   G   A "O4'" 1 
ATOM   1419  C  "C3'" . G   A  1  75   ? 39.891  149.146 11.779  1.00 53.21  ? 76   G   A "C3'" 1 
ATOM   1420  O  "O3'" . G   A  1  75   ? 38.684  148.674 11.205  1.00 54.78  ? 76   G   A "O3'" 1 
ATOM   1421  C  "C2'" . G   A  1  75   ? 40.284  148.301 12.978  1.00 53.28  ? 76   G   A "C2'" 1 
ATOM   1422  O  "O2'" . G   A  1  75   ? 40.141  146.915 12.750  1.00 53.05  ? 76   G   A "O2'" 1 
ATOM   1423  C  "C1'" . G   A  1  75   ? 41.760  148.670 13.115  1.00 53.00  ? 76   G   A "C1'" 1 
ATOM   1424  N  N9    . G   A  1  75   ? 41.921  149.790 14.040  1.00 52.66  ? 76   G   A N9    1 
ATOM   1425  C  C8    . G   A  1  75   ? 42.228  151.094 13.733  1.00 52.10  ? 76   G   A C8    1 
ATOM   1426  N  N7    . G   A  1  75   ? 42.268  151.873 14.781  1.00 52.58  ? 76   G   A N7    1 
ATOM   1427  C  C5    . G   A  1  75   ? 41.980  151.031 15.847  1.00 51.73  ? 76   G   A C5    1 
ATOM   1428  C  C6    . G   A  1  75   ? 41.886  151.305 17.232  1.00 50.75  ? 76   G   A C6    1 
ATOM   1429  O  O6    . G   A  1  75   ? 42.057  152.375 17.815  1.00 50.44  ? 76   G   A O6    1 
ATOM   1430  N  N1    . G   A  1  75   ? 41.558  150.165 17.958  1.00 50.38  ? 76   G   A N1    1 
ATOM   1431  C  C2    . G   A  1  75   ? 41.347  148.921 17.420  1.00 50.54  ? 76   G   A C2    1 
ATOM   1432  N  N2    . G   A  1  75   ? 41.008  147.952 18.269  1.00 50.36  ? 76   G   A N2    1 
ATOM   1433  N  N3    . G   A  1  75   ? 41.452  148.648 16.134  1.00 51.57  ? 76   G   A N3    1 
ATOM   1434  C  C4    . G   A  1  75   ? 41.766  149.743 15.409  1.00 51.96  ? 76   G   A C4    1 
ATOM   1435  P  P     . G   A  1  76   ? 37.293  149.379 11.608  1.00 57.56  ? 77   G   A P     1 
ATOM   1436  O  OP1   . G   A  1  76   ? 36.239  148.781 10.751  1.00 58.36  ? 77   G   A OP1   1 
ATOM   1437  O  OP2   . G   A  1  76   ? 37.468  150.864 11.646  1.00 56.98  ? 77   G   A OP2   1 
ATOM   1438  O  "O5'" . G   A  1  76   ? 37.023  148.906 13.102  1.00 57.87  ? 77   G   A "O5'" 1 
ATOM   1439  C  "C5'" . G   A  1  76   ? 36.820  147.521 13.408  1.00 57.00  ? 77   G   A "C5'" 1 
ATOM   1440  C  "C4'" . G   A  1  76   ? 36.812  147.317 14.902  1.00 56.79  ? 77   G   A "C4'" 1 
ATOM   1441  O  "O4'" . G   A  1  76   ? 38.012  147.917 15.465  1.00 56.37  ? 77   G   A "O4'" 1 
ATOM   1442  C  "C3'" . G   A  1  76   ? 35.715  148.027 15.677  1.00 55.89  ? 77   G   A "C3'" 1 
ATOM   1443  O  "O3'" . G   A  1  76   ? 34.466  147.355 15.611  1.00 54.84  ? 77   G   A "O3'" 1 
ATOM   1444  C  "C2'" . G   A  1  76   ? 36.282  148.006 17.090  1.00 56.18  ? 77   G   A "C2'" 1 
ATOM   1445  O  "O2'" . G   A  1  76   ? 36.177  146.738 17.711  1.00 58.13  ? 77   G   A "O2'" 1 
ATOM   1446  C  "C1'" . G   A  1  76   ? 37.759  148.292 16.815  1.00 55.34  ? 77   G   A "C1'" 1 
ATOM   1447  N  N9    . G   A  1  76   ? 38.138  149.691 17.028  1.00 52.89  ? 77   G   A N9    1 
ATOM   1448  C  C8    . G   A  1  76   ? 38.507  150.630 16.088  1.00 51.32  ? 77   G   A C8    1 
ATOM   1449  N  N7    . G   A  1  76   ? 38.811  151.790 16.613  1.00 49.97  ? 77   G   A N7    1 
ATOM   1450  C  C5    . G   A  1  76   ? 38.621  151.611 17.978  1.00 50.37  ? 77   G   A C5    1 
ATOM   1451  C  C6    . G   A  1  76   ? 38.783  152.521 19.067  1.00 49.24  ? 77   G   A C6    1 
ATOM   1452  O  O6    . G   A  1  76   ? 39.130  153.702 19.041  1.00 48.72  ? 77   G   A O6    1 
ATOM   1453  N  N1    . G   A  1  76   ? 38.486  151.919 20.283  1.00 49.09  ? 77   G   A N1    1 
ATOM   1454  C  C2    . G   A  1  76   ? 38.082  150.615 20.444  1.00 49.08  ? 77   G   A C2    1 
ATOM   1455  N  N2    . G   A  1  76   ? 37.863  150.220 21.704  1.00 48.46  ? 77   G   A N2    1 
ATOM   1456  N  N3    . G   A  1  76   ? 37.915  149.761 19.446  1.00 49.27  ? 77   G   A N3    1 
ATOM   1457  C  C4    . G   A  1  76   ? 38.204  150.321 18.250  1.00 50.81  ? 77   G   A C4    1 
ATOM   1458  P  P     . G   A  1  77   ? 33.115  148.169 15.909  1.00 54.93  ? 78   G   A P     1 
ATOM   1459  O  OP1   . G   A  1  77   ? 32.041  147.158 16.105  1.00 56.45  ? 78   G   A OP1   1 
ATOM   1460  O  OP2   . G   A  1  77   ? 32.957  149.221 14.866  1.00 54.76  ? 78   G   A OP2   1 
ATOM   1461  O  "O5'" . G   A  1  77   ? 33.401  148.922 17.289  1.00 52.86  ? 78   G   A "O5'" 1 
ATOM   1462  C  "C5'" . G   A  1  77   ? 33.309  148.252 18.560  1.00 47.11  ? 78   G   A "C5'" 1 
ATOM   1463  C  "C4'" . G   A  1  77   ? 33.452  149.254 19.686  1.00 44.34  ? 78   G   A "C4'" 1 
ATOM   1464  O  "O4'" . G   A  1  77   ? 34.760  149.871 19.634  1.00 44.59  ? 78   G   A "O4'" 1 
ATOM   1465  C  "C3'" . G   A  1  77   ? 32.495  150.425 19.618  1.00 42.87  ? 78   G   A "C3'" 1 
ATOM   1466  O  "O3'" . G   A  1  77   ? 31.252  150.064 20.175  1.00 42.28  ? 78   G   A "O3'" 1 
ATOM   1467  C  "C2'" . G   A  1  77   ? 33.214  151.506 20.410  1.00 43.05  ? 78   G   A "C2'" 1 
ATOM   1468  O  "O2'" . G   A  1  77   ? 33.063  151.402 21.807  1.00 41.98  ? 78   G   A "O2'" 1 
ATOM   1469  C  "C1'" . G   A  1  77   ? 34.665  151.238 20.016  1.00 45.04  ? 78   G   A "C1'" 1 
ATOM   1470  N  N9    . G   A  1  77   ? 35.095  152.051 18.883  1.00 48.50  ? 78   G   A N9    1 
ATOM   1471  C  C8    . G   A  1  77   ? 35.081  151.680 17.559  1.00 49.26  ? 78   G   A C8    1 
ATOM   1472  N  N7    . G   A  1  77   ? 35.518  152.614 16.759  1.00 50.84  ? 78   G   A N7    1 
ATOM   1473  C  C5    . G   A  1  77   ? 35.843  153.669 17.603  1.00 51.27  ? 78   G   A C5    1 
ATOM   1474  C  C6    . G   A  1  77   ? 36.366  154.955 17.304  1.00 52.12  ? 78   G   A C6    1 
ATOM   1475  O  O6    . G   A  1  77   ? 36.653  155.430 16.199  1.00 53.99  ? 78   G   A O6    1 
ATOM   1476  N  N1    . G   A  1  77   ? 36.544  155.720 18.452  1.00 52.10  ? 78   G   A N1    1 
ATOM   1477  C  C2    . G   A  1  77   ? 36.261  155.307 19.723  1.00 52.00  ? 78   G   A C2    1 
ATOM   1478  N  N2    . G   A  1  77   ? 36.496  156.204 20.695  1.00 51.00  ? 78   G   A N2    1 
ATOM   1479  N  N3    . G   A  1  77   ? 35.777  154.104 20.023  1.00 52.08  ? 78   G   A N3    1 
ATOM   1480  C  C4    . G   A  1  77   ? 35.590  153.342 18.918  1.00 50.44  ? 78   G   A C4    1 
ATOM   1481  P  P     . G   A  1  78   ? 29.900  150.582 19.497  1.00 43.50  ? 79   G   A P     1 
ATOM   1482  O  OP1   . G   A  1  78   ? 28.786  149.758 20.042  1.00 43.09  ? 79   G   A OP1   1 
ATOM   1483  O  OP2   . G   A  1  78   ? 30.125  150.652 18.033  1.00 44.51  ? 79   G   A OP2   1 
ATOM   1484  O  "O5'" . G   A  1  78   ? 29.736  152.043 20.097  1.00 41.07  ? 79   G   A "O5'" 1 
ATOM   1485  C  "C5'" . G   A  1  78   ? 29.686  152.226 21.517  1.00 38.57  ? 79   G   A "C5'" 1 
ATOM   1486  C  "C4'" . G   A  1  78   ? 30.035  153.638 21.871  1.00 37.96  ? 79   G   A "C4'" 1 
ATOM   1487  O  "O4'" . G   A  1  78   ? 31.377  153.947 21.432  1.00 37.10  ? 79   G   A "O4'" 1 
ATOM   1488  C  "C3'" . G   A  1  78   ? 29.158  154.667 21.196  1.00 37.19  ? 79   G   A "C3'" 1 
ATOM   1489  O  "O3'" . G   A  1  78   ? 27.994  154.826 21.990  1.00 37.14  ? 79   G   A "O3'" 1 
ATOM   1490  C  "C2'" . G   A  1  78   ? 30.043  155.895 21.199  1.00 37.41  ? 79   G   A "C2'" 1 
ATOM   1491  O  "O2'" . G   A  1  78   ? 30.026  156.527 22.456  1.00 36.39  ? 79   G   A "O2'" 1 
ATOM   1492  C  "C1'" . G   A  1  78   ? 31.415  155.272 20.944  1.00 38.76  ? 79   G   A "C1'" 1 
ATOM   1493  N  N9    . G   A  1  78   ? 31.776  155.206 19.535  1.00 40.75  ? 79   G   A N9    1 
ATOM   1494  C  C8    . G   A  1  78   ? 31.329  154.300 18.603  1.00 42.48  ? 79   G   A C8    1 
ATOM   1495  N  N7    . G   A  1  78   ? 31.862  154.473 17.426  1.00 42.73  ? 79   G   A N7    1 
ATOM   1496  C  C5    . G   A  1  78   ? 32.706  155.563 17.593  1.00 42.94  ? 79   G   A C5    1 
ATOM   1497  C  C6    . G   A  1  78   ? 33.567  156.218 16.666  1.00 42.67  ? 79   G   A C6    1 
ATOM   1498  O  O6    . G   A  1  78   ? 33.779  155.942 15.479  1.00 42.45  ? 79   G   A O6    1 
ATOM   1499  N  N1    . G   A  1  78   ? 34.229  157.290 17.253  1.00 43.29  ? 79   G   A N1    1 
ATOM   1500  C  C2    . G   A  1  78   ? 34.091  157.683 18.565  1.00 44.17  ? 79   G   A C2    1 
ATOM   1501  N  N2    . G   A  1  78   ? 34.802  158.757 18.948  1.00 44.09  ? 79   G   A N2    1 
ATOM   1502  N  N3    . G   A  1  78   ? 33.310  157.072 19.438  1.00 44.31  ? 79   G   A N3    1 
ATOM   1503  C  C4    . G   A  1  78   ? 32.653  156.030 18.888  1.00 42.30  ? 79   G   A C4    1 
ATOM   1504  P  P     . A   A  1  79   ? 26.937  155.977 21.648  1.00 37.04  ? 80   A   A P     1 
ATOM   1505  O  OP1   . A   A  1  79   ? 25.640  155.429 22.057  1.00 35.37  ? 80   A   A OP1   1 
ATOM   1506  O  OP2   . A   A  1  79   ? 27.156  156.379 20.235  1.00 38.41  ? 80   A   A OP2   1 
ATOM   1507  O  "O5'" . A   A  1  79   ? 27.350  157.206 22.585  1.00 35.78  ? 80   A   A "O5'" 1 
ATOM   1508  C  "C5'" . A   A  1  79   ? 27.445  157.058 24.022  1.00 36.63  ? 80   A   A "C5'" 1 
ATOM   1509  C  "C4'" . A   A  1  79   ? 27.961  158.334 24.658  1.00 38.23  ? 80   A   A "C4'" 1 
ATOM   1510  O  "O4'" . A   A  1  79   ? 29.231  158.686 24.041  1.00 38.97  ? 80   A   A "O4'" 1 
ATOM   1511  C  "C3'" . A   A  1  79   ? 27.071  159.575 24.520  1.00 38.67  ? 80   A   A "C3'" 1 
ATOM   1512  O  "O3'" . A   A  1  79   ? 27.277  160.466 25.608  1.00 38.91  ? 80   A   A "O3'" 1 
ATOM   1513  C  "C2'" . A   A  1  79   ? 27.667  160.274 23.311  1.00 39.88  ? 80   A   A "C2'" 1 
ATOM   1514  O  "O2'" . A   A  1  79   ? 27.437  161.669 23.322  1.00 40.83  ? 80   A   A "O2'" 1 
ATOM   1515  C  "C1'" . A   A  1  79   ? 29.147  160.002 23.540  1.00 39.92  ? 80   A   A "C1'" 1 
ATOM   1516  N  N9    . A   A  1  79   ? 29.995  160.129 22.359  1.00 40.61  ? 80   A   A N9    1 
ATOM   1517  C  C8    . A   A  1  79   ? 29.841  159.605 21.100  1.00 40.29  ? 80   A   A C8    1 
ATOM   1518  N  N7    . A   A  1  79   ? 30.833  159.893 20.288  1.00 40.28  ? 80   A   A N7    1 
ATOM   1519  C  C5    . A   A  1  79   ? 31.689  160.662 21.063  1.00 39.92  ? 80   A   A C5    1 
ATOM   1520  C  C6    . A   A  1  79   ? 32.929  161.264 20.793  1.00 40.21  ? 80   A   A C6    1 
ATOM   1521  N  N6    . A   A  1  79   ? 33.549  161.180 19.615  1.00 38.50  ? 80   A   A N6    1 
ATOM   1522  N  N1    . A   A  1  79   ? 33.517  161.963 21.788  1.00 41.05  ? 80   A   A N1    1 
ATOM   1523  C  C2    . A   A  1  79   ? 32.893  162.051 22.962  1.00 41.86  ? 80   A   A C2    1 
ATOM   1524  N  N3    . A   A  1  79   ? 31.732  161.531 23.338  1.00 42.23  ? 80   A   A N3    1 
ATOM   1525  C  C4    . A   A  1  79   ? 31.175  160.834 22.332  1.00 41.26  ? 80   A   A C4    1 
ATOM   1526  P  P     . G   A  1  80   ? 26.483  160.250 26.976  1.00 42.44  ? 81   G   A P     1 
ATOM   1527  O  OP1   . G   A  1  80   ? 25.158  159.640 26.687  1.00 43.52  ? 81   G   A OP1   1 
ATOM   1528  O  OP2   . G   A  1  80   ? 26.563  161.506 27.783  1.00 41.07  ? 81   G   A OP2   1 
ATOM   1529  O  "O5'" . G   A  1  80   ? 27.352  159.152 27.714  1.00 41.47  ? 81   G   A "O5'" 1 
ATOM   1530  C  "C5'" . G   A  1  80   ? 28.427  159.552 28.565  1.00 40.40  ? 81   G   A "C5'" 1 
ATOM   1531  C  "C4'" . G   A  1  80   ? 29.734  159.260 27.896  1.00 38.39  ? 81   G   A "C4'" 1 
ATOM   1532  O  "O4'" . G   A  1  80   ? 29.848  160.001 26.651  1.00 37.08  ? 81   G   A "O4'" 1 
ATOM   1533  C  "C3'" . G   A  1  80   ? 30.970  159.644 28.681  1.00 35.81  ? 81   G   A "C3'" 1 
ATOM   1534  O  "O3'" . G   A  1  80   ? 31.231  158.628 29.643  1.00 34.89  ? 81   G   A "O3'" 1 
ATOM   1535  C  "C2'" . G   A  1  80   ? 31.983  159.732 27.554  1.00 35.09  ? 81   G   A "C2'" 1 
ATOM   1536  O  "O2'" . G   A  1  80   ? 32.266  158.454 27.014  1.00 35.06  ? 81   G   A "O2'" 1 
ATOM   1537  C  "C1'" . G   A  1  80   ? 31.162  160.512 26.527  1.00 34.52  ? 81   G   A "C1'" 1 
ATOM   1538  N  N9    . G   A  1  80   ? 31.122  161.922 26.889  1.00 32.48  ? 81   G   A N9    1 
ATOM   1539  C  C8    . G   A  1  80   ? 30.030  162.649 27.289  1.00 32.12  ? 81   G   A C8    1 
ATOM   1540  N  N7    . G   A  1  80   ? 30.326  163.872 27.630  1.00 31.55  ? 81   G   A N7    1 
ATOM   1541  C  C5    . G   A  1  80   ? 31.694  163.961 27.430  1.00 30.81  ? 81   G   A C5    1 
ATOM   1542  C  C6    . G   A  1  80   ? 32.588  165.038 27.660  1.00 31.57  ? 81   G   A C6    1 
ATOM   1543  O  O6    . G   A  1  80   ? 32.343  166.159 28.128  1.00 33.66  ? 81   G   A O6    1 
ATOM   1544  N  N1    . G   A  1  80   ? 33.891  164.706 27.302  1.00 31.91  ? 81   G   A N1    1 
ATOM   1545  C  C2    . G   A  1  80   ? 34.288  163.485 26.800  1.00 32.28  ? 81   G   A C2    1 
ATOM   1546  N  N2    . G   A  1  80   ? 35.586  163.366 26.488  1.00 32.10  ? 81   G   A N2    1 
ATOM   1547  N  N3    . G   A  1  80   ? 33.468  162.462 26.611  1.00 31.73  ? 81   G   A N3    1 
ATOM   1548  C  C4    . G   A  1  80   ? 32.194  162.773 26.944  1.00 31.60  ? 81   G   A C4    1 
ATOM   1549  P  P     . C   A  1  81   ? 31.752  159.016 31.113  1.00 35.50  ? 82   C   A P     1 
ATOM   1550  O  OP1   . C   A  1  81   ? 31.740  157.768 31.918  1.00 35.26  ? 82   C   A OP1   1 
ATOM   1551  O  OP2   . C   A  1  81   ? 31.037  160.220 31.612  1.00 33.88  ? 82   C   A OP2   1 
ATOM   1552  O  "O5'" . C   A  1  81   ? 33.275  159.353 30.841  1.00 35.39  ? 82   C   A "O5'" 1 
ATOM   1553  C  "C5'" . C   A  1  81   ? 34.084  158.422 30.079  1.00 36.22  ? 82   C   A "C5'" 1 
ATOM   1554  C  "C4'" . C   A  1  81   ? 35.384  159.070 29.671  1.00 36.72  ? 82   C   A "C4'" 1 
ATOM   1555  O  "O4'" . C   A  1  81   ? 35.097  160.256 28.885  1.00 35.93  ? 82   C   A "O4'" 1 
ATOM   1556  C  "C3'" . C   A  1  81   ? 36.221  159.594 30.827  1.00 37.21  ? 82   C   A "C3'" 1 
ATOM   1557  O  "O3'" . C   A  1  81   ? 37.027  158.590 31.422  1.00 36.99  ? 82   C   A "O3'" 1 
ATOM   1558  C  "C2'" . C   A  1  81   ? 37.058  160.667 30.160  1.00 36.73  ? 82   C   A "C2'" 1 
ATOM   1559  O  "O2'" . C   A  1  81   ? 38.155  160.142 29.448  1.00 36.75  ? 82   C   A "O2'" 1 
ATOM   1560  C  "C1'" . C   A  1  81   ? 36.042  161.263 29.189  1.00 35.12  ? 82   C   A "C1'" 1 
ATOM   1561  N  N1    . C   A  1  81   ? 35.333  162.419 29.756  1.00 33.59  ? 82   C   A N1    1 
ATOM   1562  C  C2    . C   A  1  81   ? 36.013  163.643 29.842  1.00 32.94  ? 82   C   A C2    1 
ATOM   1563  O  O2    . C   A  1  81   ? 37.213  163.685 29.525  1.00 31.26  ? 82   C   A O2    1 
ATOM   1564  N  N3    . C   A  1  81   ? 35.349  164.743 30.278  1.00 32.18  ? 82   C   A N3    1 
ATOM   1565  C  C4    . C   A  1  81   ? 34.067  164.649 30.637  1.00 31.79  ? 82   C   A C4    1 
ATOM   1566  N  N4    . C   A  1  81   ? 33.435  165.770 31.014  1.00 29.47  ? 82   C   A N4    1 
ATOM   1567  C  C5    . C   A  1  81   ? 33.369  163.403 30.615  1.00 32.98  ? 82   C   A C5    1 
ATOM   1568  C  C6    . C   A  1  81   ? 34.034  162.324 30.172  1.00 32.50  ? 82   C   A C6    1 
ATOM   1569  P  P     . C   A  1  82   ? 37.507  158.766 32.943  1.00 37.47  ? 83   C   A P     1 
ATOM   1570  O  OP1   . C   A  1  82   ? 38.320  157.561 33.260  1.00 37.40  ? 83   C   A OP1   1 
ATOM   1571  O  OP2   . C   A  1  82   ? 36.333  159.118 33.792  1.00 37.17  ? 83   C   A OP2   1 
ATOM   1572  O  "O5'" . C   A  1  82   ? 38.476  160.023 32.890  1.00 35.39  ? 83   C   A "O5'" 1 
ATOM   1573  C  "C5'" . C   A  1  82   ? 39.811  159.870 32.382  1.00 35.35  ? 83   C   A "C5'" 1 
ATOM   1574  C  "C4'" . C   A  1  82   ? 40.588  161.139 32.578  1.00 34.09  ? 83   C   A "C4'" 1 
ATOM   1575  O  "O4'" . C   A  1  82   ? 39.908  162.223 31.895  1.00 33.88  ? 83   C   A "O4'" 1 
ATOM   1576  C  "C3'" . C   A  1  82   ? 40.712  161.637 34.004  1.00 33.50  ? 83   C   A "C3'" 1 
ATOM   1577  O  "O3'" . C   A  1  82   ? 41.765  160.947 34.662  1.00 33.44  ? 83   C   A "O3'" 1 
ATOM   1578  C  "C2'" . C   A  1  82   ? 41.056  163.102 33.777  1.00 33.41  ? 83   C   A "C2'" 1 
ATOM   1579  O  "O2'" . C   A  1  82   ? 42.390  163.236 33.355  1.00 32.48  ? 83   C   A "O2'" 1 
ATOM   1580  C  "C1'" . C   A  1  82   ? 40.180  163.440 32.568  1.00 33.51  ? 83   C   A "C1'" 1 
ATOM   1581  N  N1    . C   A  1  82   ? 38.911  164.123 32.896  1.00 33.58  ? 83   C   A N1    1 
ATOM   1582  C  C2    . C   A  1  82   ? 38.944  165.499 33.113  1.00 34.19  ? 83   C   A C2    1 
ATOM   1583  O  O2    . C   A  1  82   ? 40.025  166.093 33.012  1.00 35.46  ? 83   C   A O2    1 
ATOM   1584  N  N3    . C   A  1  82   ? 37.804  166.152 33.427  1.00 35.44  ? 83   C   A N3    1 
ATOM   1585  C  C4    . C   A  1  82   ? 36.658  165.481 33.530  1.00 34.78  ? 83   C   A C4    1 
ATOM   1586  N  N4    . C   A  1  82   ? 35.557  166.173 33.849  1.00 36.74  ? 83   C   A N4    1 
ATOM   1587  C  C5    . C   A  1  82   ? 36.588  164.074 33.311  1.00 33.92  ? 83   C   A C5    1 
ATOM   1588  C  C6    . C   A  1  82   ? 37.729  163.440 32.994  1.00 33.40  ? 83   C   A C6    1 
ATOM   1589  P  P     . G   A  1  83   ? 41.566  160.402 36.164  1.00 34.20  ? 84   G   A P     1 
ATOM   1590  O  OP1   . G   A  1  83   ? 40.139  160.439 36.538  1.00 33.46  ? 84   G   A OP1   1 
ATOM   1591  O  OP2   . G   A  1  83   ? 42.540  161.099 37.016  1.00 35.02  ? 84   G   A OP2   1 
ATOM   1592  O  "O5'" . G   A  1  83   ? 42.060  158.886 36.094  1.00 35.63  ? 84   G   A "O5'" 1 
ATOM   1593  C  "C5'" . G   A  1  83   ? 41.444  157.918 35.213  1.00 36.76  ? 84   G   A "C5'" 1 
ATOM   1594  C  "C4'" . G   A  1  83   ? 41.735  156.510 35.694  1.00 38.00  ? 84   G   A "C4'" 1 
ATOM   1595  O  "O4'" . G   A  1  83   ? 43.155  156.215 35.576  1.00 38.92  ? 84   G   A "O4'" 1 
ATOM   1596  C  "C3'" . G   A  1  83   ? 41.417  156.263 37.154  1.00 38.34  ? 84   G   A "C3'" 1 
ATOM   1597  O  "O3'" . G   A  1  83   ? 40.032  156.000 37.361  1.00 39.93  ? 84   G   A "O3'" 1 
ATOM   1598  C  "C2'" . G   A  1  83   ? 42.339  155.103 37.500  1.00 38.43  ? 84   G   A "C2'" 1 
ATOM   1599  O  "O2'" . G   A  1  83   ? 41.850  153.859 37.064  1.00 39.63  ? 84   G   A "O2'" 1 
ATOM   1600  C  "C1'" . G   A  1  83   ? 43.590  155.460 36.696  1.00 39.06  ? 84   G   A "C1'" 1 
ATOM   1601  N  N9    . G   A  1  83   ? 44.547  156.273 37.445  1.00 40.53  ? 84   G   A N9    1 
ATOM   1602  C  C8    . G   A  1  83   ? 44.826  157.604 37.241  1.00 40.93  ? 84   G   A C8    1 
ATOM   1603  N  N7    . G   A  1  83   ? 45.685  158.086 38.094  1.00 41.28  ? 84   G   A N7    1 
ATOM   1604  C  C5    . G   A  1  83   ? 46.005  157.008 38.907  1.00 41.53  ? 84   G   A C5    1 
ATOM   1605  C  C6    . G   A  1  83   ? 46.885  156.925 40.017  1.00 41.59  ? 84   G   A C6    1 
ATOM   1606  O  O6    . G   A  1  83   ? 47.563  157.823 40.533  1.00 42.98  ? 84   G   A O6    1 
ATOM   1607  N  N1    . G   A  1  83   ? 46.927  155.635 40.538  1.00 41.21  ? 84   G   A N1    1 
ATOM   1608  C  C2    . G   A  1  83   ? 46.209  154.568 40.060  1.00 40.27  ? 84   G   A C2    1 
ATOM   1609  N  N2    . G   A  1  83   ? 46.393  153.412 40.697  1.00 38.76  ? 84   G   A N2    1 
ATOM   1610  N  N3    . G   A  1  83   ? 45.377  154.632 39.037  1.00 40.61  ? 84   G   A N3    1 
ATOM   1611  C  C4    . G   A  1  83   ? 45.325  155.874 38.509  1.00 40.50  ? 84   G   A C4    1 
ATOM   1612  P  P     . C   A  1  84   ? 39.370  156.309 38.789  1.00 43.05  ? 85   C   A P     1 
ATOM   1613  O  OP1   . C   A  1  84   ? 37.948  155.897 38.752  1.00 44.72  ? 85   C   A OP1   1 
ATOM   1614  O  OP2   . C   A  1  84   ? 39.712  157.688 39.180  1.00 44.37  ? 85   C   A OP2   1 
ATOM   1615  O  "O5'" . C   A  1  84   ? 40.122  155.295 39.754  1.00 44.64  ? 85   C   A "O5'" 1 
ATOM   1616  C  "C5'" . C   A  1  84   ? 39.974  153.876 39.556  1.00 47.62  ? 85   C   A "C5'" 1 
ATOM   1617  C  "C4'" . C   A  1  84   ? 40.656  153.108 40.657  1.00 50.09  ? 85   C   A "C4'" 1 
ATOM   1618  O  "O4'" . C   A  1  84   ? 42.094  153.277 40.572  1.00 50.02  ? 85   C   A "O4'" 1 
ATOM   1619  C  "C3'" . C   A  1  84   ? 40.298  153.521 42.072  1.00 51.42  ? 85   C   A "C3'" 1 
ATOM   1620  O  "O3'" . C   A  1  84   ? 39.072  152.911 42.456  1.00 54.82  ? 85   C   A "O3'" 1 
ATOM   1621  C  "C2'" . C   A  1  84   ? 41.503  153.019 42.859  1.00 51.11  ? 85   C   A "C2'" 1 
ATOM   1622  O  "O2'" . C   A  1  84   ? 41.453  151.623 43.083  1.00 51.11  ? 85   C   A "O2'" 1 
ATOM   1623  C  "C1'" . C   A  1  84   ? 42.645  153.308 41.878  1.00 50.68  ? 85   C   A "C1'" 1 
ATOM   1624  N  N1    . C   A  1  84   ? 43.302  154.615 42.070  1.00 50.84  ? 85   C   A N1    1 
ATOM   1625  C  C2    . C   A  1  84   ? 44.305  154.747 43.047  1.00 51.17  ? 85   C   A C2    1 
ATOM   1626  O  O2    . C   A  1  84   ? 44.642  153.750 43.711  1.00 52.30  ? 85   C   A O2    1 
ATOM   1627  N  N3    . C   A  1  84   ? 44.884  155.961 43.237  1.00 50.31  ? 85   C   A N3    1 
ATOM   1628  C  C4    . C   A  1  84   ? 44.510  157.003 42.492  1.00 50.33  ? 85   C   A C4    1 
ATOM   1629  N  N4    . C   A  1  84   ? 45.097  158.178 42.720  1.00 48.97  ? 85   C   A N4    1 
ATOM   1630  C  C5    . C   A  1  84   ? 43.514  156.888 41.482  1.00 50.96  ? 85   C   A C5    1 
ATOM   1631  C  C6    . C   A  1  84   ? 42.940  155.692 41.309  1.00 51.35  ? 85   C   A C6    1 
ATOM   1632  P  P     . A   A  1  85   ? 38.117  153.640 43.522  1.00 57.21  ? 86   A   A P     1 
ATOM   1633  O  OP1   . A   A  1  85   ? 38.855  153.654 44.798  1.00 58.44  ? 86   A   A OP1   1 
ATOM   1634  O  OP2   . A   A  1  85   ? 36.776  153.005 43.456  1.00 58.41  ? 86   A   A OP2   1 
ATOM   1635  O  "O5'" . A   A  1  85   ? 38.006  155.149 43.017  1.00 57.45  ? 86   A   A "O5'" 1 
ATOM   1636  C  "C5'" . A   A  1  85   ? 37.117  156.088 43.654  1.00 56.46  ? 86   A   A "C5'" 1 
ATOM   1637  C  "C4'" . A   A  1  85   ? 37.676  157.494 43.560  1.00 57.80  ? 86   A   A "C4'" 1 
ATOM   1638  O  "O4'" . A   A  1  85   ? 38.726  157.706 44.547  1.00 56.66  ? 86   A   A "O4'" 1 
ATOM   1639  C  "C3'" . A   A  1  85   ? 38.290  157.873 42.219  1.00 59.13  ? 86   A   A "C3'" 1 
ATOM   1640  O  "O3'" . A   A  1  85   ? 38.066  159.262 42.006  1.00 64.05  ? 86   A   A "O3'" 1 
ATOM   1641  C  "C2'" . A   A  1  85   ? 39.778  157.640 42.469  1.00 57.74  ? 86   A   A "C2'" 1 
ATOM   1642  O  "O2'" . A   A  1  85   ? 40.631  158.352 41.597  1.00 56.37  ? 86   A   A "O2'" 1 
ATOM   1643  C  "C1'" . A   A  1  85   ? 39.900  158.158 43.899  1.00 56.77  ? 86   A   A "C1'" 1 
ATOM   1644  N  N9    . A   A  1  85   ? 41.067  157.677 44.638  1.00 55.46  ? 86   A   A N9    1 
ATOM   1645  C  C8    . A   A  1  85   ? 41.299  156.400 45.084  1.00 55.78  ? 86   A   A C8    1 
ATOM   1646  N  N7    . A   A  1  85   ? 42.435  156.260 45.723  1.00 55.52  ? 86   A   A N7    1 
ATOM   1647  C  C5    . A   A  1  85   ? 42.990  157.532 45.698  1.00 55.32  ? 86   A   A C5    1 
ATOM   1648  C  C6    . A   A  1  85   ? 44.196  158.047 46.211  1.00 55.80  ? 86   A   A C6    1 
ATOM   1649  N  N6    . A   A  1  85   ? 45.097  157.313 46.875  1.00 55.55  ? 86   A   A N6    1 
ATOM   1650  N  N1    . A   A  1  85   ? 44.451  159.357 46.016  1.00 55.30  ? 86   A   A N1    1 
ATOM   1651  C  C2    . A   A  1  85   ? 43.554  160.087 45.353  1.00 55.80  ? 86   A   A C2    1 
ATOM   1652  N  N3    . A   A  1  85   ? 42.388  159.722 44.826  1.00 55.25  ? 86   A   A N3    1 
ATOM   1653  C  C4    . A   A  1  85   ? 42.159  158.415 45.033  1.00 55.18  ? 86   A   A C4    1 
ATOM   1654  P  P     . C   A  1  86   ? 36.900  159.741 41.016  1.00 68.58  ? 87   C   A P     1 
ATOM   1655  O  OP1   . C   A  1  86   ? 36.578  158.598 40.107  1.00 67.44  ? 87   C   A OP1   1 
ATOM   1656  O  OP2   . C   A  1  86   ? 37.328  161.056 40.438  1.00 66.81  ? 87   C   A OP2   1 
ATOM   1657  O  "O5'" . C   A  1  86   ? 35.644  159.983 41.974  1.00 69.84  ? 87   C   A "O5'" 1 
ATOM   1658  C  "C5'" . C   A  1  86   ? 34.450  160.600 41.448  1.00 72.72  ? 87   C   A "C5'" 1 
ATOM   1659  C  "C4'" . C   A  1  86   ? 33.408  160.838 42.526  1.00 73.50  ? 87   C   A "C4'" 1 
ATOM   1660  O  "O4'" . C   A  1  86   ? 32.974  159.573 43.102  1.00 75.36  ? 87   C   A "O4'" 1 
ATOM   1661  C  "C3'" . C   A  1  86   ? 33.748  161.754 43.699  1.00 73.08  ? 87   C   A "C3'" 1 
ATOM   1662  O  "O3'" . C   A  1  86   ? 32.635  162.612 43.935  1.00 71.20  ? 87   C   A "O3'" 1 
ATOM   1663  C  "C2'" . C   A  1  86   ? 33.905  160.770 44.859  1.00 74.33  ? 87   C   A "C2'" 1 
ATOM   1664  O  "O2'" . C   A  1  86   ? 33.630  161.322 46.132  1.00 73.63  ? 87   C   A "O2'" 1 
ATOM   1665  C  "C1'" . C   A  1  86   ? 32.863  159.714 44.503  1.00 76.16  ? 87   C   A "C1'" 1 
ATOM   1666  N  N1    . C   A  1  86   ? 33.062  158.388 45.125  1.00 78.68  ? 87   C   A N1    1 
ATOM   1667  C  C2    . C   A  1  86   ? 31.935  157.597 45.433  1.00 79.88  ? 87   C   A C2    1 
ATOM   1668  O  O2    . C   A  1  86   ? 30.793  158.042 45.205  1.00 79.61  ? 87   C   A O2    1 
ATOM   1669  N  N3    . C   A  1  86   ? 32.121  156.373 45.976  1.00 81.26  ? 87   C   A N3    1 
ATOM   1670  C  C4    . C   A  1  86   ? 33.357  155.932 46.222  1.00 81.63  ? 87   C   A C4    1 
ATOM   1671  N  N4    . C   A  1  86   ? 33.492  154.711 46.750  1.00 82.73  ? 87   C   A N4    1 
ATOM   1672  C  C5    . C   A  1  86   ? 34.511  156.719 45.936  1.00 81.09  ? 87   C   A C5    1 
ATOM   1673  C  C6    . C   A  1  86   ? 34.321  157.924 45.394  1.00 79.55  ? 87   C   A C6    1 
ATOM   1674  P  P     . G   A  1  87   ? 32.701  164.145 43.454  1.00 70.63  ? 88   G   A P     1 
ATOM   1675  O  OP1   . G   A  1  87   ? 31.342  164.561 43.007  1.00 71.00  ? 88   G   A OP1   1 
ATOM   1676  O  OP2   . G   A  1  87   ? 33.850  164.248 42.506  1.00 69.91  ? 88   G   A OP2   1 
ATOM   1677  O  "O5'" . G   A  1  87   ? 33.078  164.963 44.774  1.00 68.54  ? 88   G   A "O5'" 1 
ATOM   1678  C  "C5'" . G   A  1  87   ? 34.393  164.846 45.350  1.00 64.26  ? 88   G   A "C5'" 1 
ATOM   1679  C  "C4'" . G   A  1  87   ? 34.794  166.121 46.066  1.00 61.37  ? 88   G   A "C4'" 1 
ATOM   1680  O  "O4'" . G   A  1  87   ? 36.149  165.948 46.551  1.00 59.75  ? 88   G   A "O4'" 1 
ATOM   1681  C  "C3'" . G   A  1  87   ? 34.816  167.389 45.218  1.00 60.56  ? 88   G   A "C3'" 1 
ATOM   1682  O  "O3'" . G   A  1  87   ? 33.589  168.093 45.382  1.00 61.85  ? 88   G   A "O3'" 1 
ATOM   1683  C  "C2'" . G   A  1  87   ? 36.024  168.162 45.748  1.00 58.79  ? 88   G   A "C2'" 1 
ATOM   1684  O  "O2'" . G   A  1  87   ? 35.783  168.939 46.908  1.00 58.89  ? 88   G   A "O2'" 1 
ATOM   1685  C  "C1'" . G   A  1  87   ? 36.965  167.017 46.106  1.00 56.99  ? 88   G   A "C1'" 1 
ATOM   1686  N  N9    . G   A  1  87   ? 37.758  166.552 44.975  1.00 53.22  ? 88   G   A N9    1 
ATOM   1687  C  C8    . G   A  1  87   ? 37.455  165.533 44.108  1.00 51.23  ? 88   G   A C8    1 
ATOM   1688  N  N7    . G   A  1  87   ? 38.343  165.382 43.166  1.00 50.45  ? 88   G   A N7    1 
ATOM   1689  C  C5    . G   A  1  87   ? 39.296  166.354 43.436  1.00 50.93  ? 88   G   A C5    1 
ATOM   1690  C  C6    . G   A  1  87   ? 40.495  166.686 42.753  1.00 51.45  ? 88   G   A C6    1 
ATOM   1691  O  O6    . G   A  1  87   ? 40.959  166.191 41.729  1.00 52.15  ? 88   G   A O6    1 
ATOM   1692  N  N1    . G   A  1  87   ? 41.171  167.725 43.381  1.00 50.78  ? 88   G   A N1    1 
ATOM   1693  C  C2    . G   A  1  87   ? 40.750  168.372 44.513  1.00 50.91  ? 88   G   A C2    1 
ATOM   1694  N  N2    . G   A  1  87   ? 41.548  169.349 44.963  1.00 51.91  ? 88   G   A N2    1 
ATOM   1695  N  N3    . G   A  1  87   ? 39.629  168.083 45.154  1.00 51.93  ? 88   G   A N3    1 
ATOM   1696  C  C4    . G   A  1  87   ? 38.955  167.073 44.562  1.00 51.89  ? 88   G   A C4    1 
ATOM   1697  P  P     . G   A  1  88   ? 33.101  169.135 44.261  1.00 63.43  ? 89   G   A P     1 
ATOM   1698  O  OP1   . G   A  1  88   ? 31.849  169.740 44.809  1.00 63.23  ? 89   G   A OP1   1 
ATOM   1699  O  OP2   . G   A  1  88   ? 33.088  168.456 42.926  1.00 63.41  ? 89   G   A OP2   1 
ATOM   1700  O  "O5'" . G   A  1  88   ? 34.228  170.259 44.233  1.00 61.47  ? 89   G   A "O5'" 1 
ATOM   1701  C  "C5'" . G   A  1  88   ? 34.264  171.283 45.242  1.00 60.24  ? 89   G   A "C5'" 1 
ATOM   1702  C  "C4'" . G   A  1  88   ? 35.477  172.159 45.061  1.00 59.28  ? 89   G   A "C4'" 1 
ATOM   1703  O  "O4'" . G   A  1  88   ? 36.683  171.365 45.230  1.00 57.22  ? 89   G   A "O4'" 1 
ATOM   1704  C  "C3'" . G   A  1  88   ? 35.643  172.779 43.683  1.00 58.58  ? 89   G   A "C3'" 1 
ATOM   1705  O  "O3'" . G   A  1  88   ? 34.837  173.929 43.498  1.00 59.49  ? 89   G   A "O3'" 1 
ATOM   1706  C  "C2'" . G   A  1  88   ? 37.127  173.097 43.659  1.00 57.70  ? 89   G   A "C2'" 1 
ATOM   1707  O  "O2'" . G   A  1  88   ? 37.461  174.269 44.376  1.00 57.13  ? 89   G   A "O2'" 1 
ATOM   1708  C  "C1'" . G   A  1  88   ? 37.689  171.851 44.352  1.00 55.99  ? 89   G   A "C1'" 1 
ATOM   1709  N  N9    . G   A  1  88   ? 37.975  170.816 43.366  1.00 52.69  ? 89   G   A N9    1 
ATOM   1710  C  C8    . G   A  1  88   ? 37.186  169.746 42.994  1.00 52.15  ? 89   G   A C8    1 
ATOM   1711  N  N7    . G   A  1  88   ? 37.725  169.018 42.052  1.00 50.30  ? 89   G   A N7    1 
ATOM   1712  C  C5    . G   A  1  88   ? 38.941  169.640 41.797  1.00 49.50  ? 89   G   A C5    1 
ATOM   1713  C  C6    . G   A  1  88   ? 39.970  169.314 40.878  1.00 48.80  ? 89   G   A C6    1 
ATOM   1714  O  O6    . G   A  1  88   ? 40.019  168.380 40.070  1.00 47.88  ? 89   G   A O6    1 
ATOM   1715  N  N1    . G   A  1  88   ? 41.022  170.215 40.954  1.00 49.03  ? 89   G   A N1    1 
ATOM   1716  C  C2    . G   A  1  88   ? 41.076  171.299 41.799  1.00 50.28  ? 89   G   A C2    1 
ATOM   1717  N  N2    . G   A  1  88   ? 42.171  172.062 41.714  1.00 49.79  ? 89   G   A N2    1 
ATOM   1718  N  N3    . G   A  1  88   ? 40.130  171.612 42.658  1.00 49.67  ? 89   G   A N3    1 
ATOM   1719  C  C4    . G   A  1  88   ? 39.103  170.747 42.604  1.00 50.55  ? 89   G   A C4    1 
ATOM   1720  P  P     . A   A  1  89   ? 34.161  174.196 42.067  1.00 60.23  ? 90   A   A P     1 
ATOM   1721  O  OP1   . A   A  1  89   ? 33.213  175.339 42.238  1.00 59.71  ? 90   A   A OP1   1 
ATOM   1722  O  OP2   . A   A  1  89   ? 33.685  172.894 41.504  1.00 59.60  ? 90   A   A OP2   1 
ATOM   1723  O  "O5'" . A   A  1  89   ? 35.360  174.711 41.166  1.00 59.08  ? 90   A   A "O5'" 1 
ATOM   1724  C  "C5'" . A   A  1  89   ? 36.008  175.944 41.479  1.00 58.89  ? 90   A   A "C5'" 1 
ATOM   1725  C  "C4'" . A   A  1  89   ? 37.333  176.016 40.782  1.00 59.03  ? 90   A   A "C4'" 1 
ATOM   1726  O  "O4'" . A   A  1  89   ? 38.109  174.837 41.119  1.00 59.20  ? 90   A   A "O4'" 1 
ATOM   1727  C  "C3'" . A   A  1  89   ? 37.277  175.936 39.271  1.00 58.26  ? 90   A   A "C3'" 1 
ATOM   1728  O  "O3'" . A   A  1  89   ? 36.926  177.156 38.654  1.00 58.32  ? 90   A   A "O3'" 1 
ATOM   1729  C  "C2'" . A   A  1  89   ? 38.703  175.549 38.937  1.00 58.23  ? 90   A   A "C2'" 1 
ATOM   1730  O  "O2'" . A   A  1  89   ? 39.582  176.648 39.046  1.00 58.10  ? 90   A   A "O2'" 1 
ATOM   1731  C  "C1'" . A   A  1  89   ? 38.983  174.529 40.041  1.00 58.11  ? 90   A   A "C1'" 1 
ATOM   1732  N  N9    . A   A  1  89   ? 38.706  173.172 39.562  1.00 57.30  ? 90   A   A N9    1 
ATOM   1733  C  C8    . A   A  1  89   ? 37.574  172.400 39.704  1.00 57.46  ? 90   A   A C8    1 
ATOM   1734  N  N7    . A   A  1  89   ? 37.649  171.237 39.092  1.00 57.66  ? 90   A   A N7    1 
ATOM   1735  C  C5    . A   A  1  89   ? 38.917  171.240 38.521  1.00 57.97  ? 90   A   A C5    1 
ATOM   1736  C  C6    . A   A  1  89   ? 39.610  170.292 37.738  1.00 58.18  ? 90   A   A C6    1 
ATOM   1737  N  N6    . A   A  1  89   ? 39.096  169.105 37.384  1.00 59.26  ? 90   A   A N6    1 
ATOM   1738  N  N1    . A   A  1  89   ? 40.864  170.611 37.331  1.00 57.23  ? 90   A   A N1    1 
ATOM   1739  C  C2    . A   A  1  89   ? 41.375  171.798 37.697  1.00 56.17  ? 90   A   A C2    1 
ATOM   1740  N  N3    . A   A  1  89   ? 40.826  172.763 38.429  1.00 55.36  ? 90   A   A N3    1 
ATOM   1741  C  C4    . A   A  1  89   ? 39.582  172.420 38.813  1.00 57.04  ? 90   A   A C4    1 
ATOM   1742  P  P     . G   A  1  90   ? 36.183  177.123 37.233  1.00 59.21  ? 91   G   A P     1 
ATOM   1743  O  OP1   . G   A  1  90   ? 36.021  178.542 36.837  1.00 59.79  ? 91   G   A OP1   1 
ATOM   1744  O  OP2   . G   A  1  90   ? 34.983  176.252 37.371  1.00 58.97  ? 91   G   A OP2   1 
ATOM   1745  O  "O5'" . G   A  1  90   ? 37.211  176.396 36.244  1.00 56.27  ? 91   G   A "O5'" 1 
ATOM   1746  C  "C5'" . G   A  1  90   ? 38.335  177.111 35.682  1.00 52.26  ? 91   G   A "C5'" 1 
ATOM   1747  C  "C4'" . G   A  1  90   ? 39.305  176.157 35.016  1.00 51.02  ? 91   G   A "C4'" 1 
ATOM   1748  O  "O4'" . G   A  1  90   ? 39.458  174.991 35.871  1.00 50.64  ? 91   G   A "O4'" 1 
ATOM   1749  C  "C3'" . G   A  1  90   ? 38.909  175.546 33.679  1.00 49.65  ? 91   G   A "C3'" 1 
ATOM   1750  O  "O3'" . G   A  1  90   ? 39.169  176.386 32.572  1.00 49.47  ? 91   G   A "O3'" 1 
ATOM   1751  C  "C2'" . G   A  1  90   ? 39.795  174.314 33.623  1.00 49.18  ? 91   G   A "C2'" 1 
ATOM   1752  O  "O2'" . G   A  1  90   ? 41.136  174.602 33.283  1.00 48.73  ? 91   G   A "O2'" 1 
ATOM   1753  C  "C1'" . G   A  1  90   ? 39.713  173.842 35.070  1.00 49.19  ? 91   G   A "C1'" 1 
ATOM   1754  N  N9    . G   A  1  90   ? 38.611  172.897 35.215  1.00 47.69  ? 91   G   A N9    1 
ATOM   1755  C  C8    . G   A  1  90   ? 37.376  173.108 35.793  1.00 47.80  ? 91   G   A C8    1 
ATOM   1756  N  N7    . G   A  1  90   ? 36.596  172.061 35.729  1.00 46.80  ? 91   G   A N7    1 
ATOM   1757  C  C5    . G   A  1  90   ? 37.363  171.101 35.074  1.00 47.80  ? 91   G   A C5    1 
ATOM   1758  C  C6    . G   A  1  90   ? 37.055  169.759 34.703  1.00 48.56  ? 91   G   A C6    1 
ATOM   1759  O  O6    . G   A  1  90   ? 36.010  169.130 34.885  1.00 50.14  ? 91   G   A O6    1 
ATOM   1760  N  N1    . G   A  1  90   ? 38.129  169.150 34.058  1.00 47.40  ? 91   G   A N1    1 
ATOM   1761  C  C2    . G   A  1  90   ? 39.339  169.748 33.804  1.00 46.32  ? 91   G   A C2    1 
ATOM   1762  N  N2    . G   A  1  90   ? 40.240  168.984 33.189  1.00 45.36  ? 91   G   A N2    1 
ATOM   1763  N  N3    . G   A  1  90   ? 39.637  170.992 34.133  1.00 46.33  ? 91   G   A N3    1 
ATOM   1764  C  C4    . G   A  1  90   ? 38.611  171.604 34.761  1.00 47.34  ? 91   G   A C4    1 
ATOM   1765  P  P     . G   A  1  91   ? 38.338  176.187 31.214  1.00 49.50  ? 92   G   A P     1 
ATOM   1766  O  OP1   . G   A  1  91   ? 38.736  177.305 30.332  1.00 49.36  ? 92   G   A OP1   1 
ATOM   1767  O  OP2   . G   A  1  91   ? 36.903  176.004 31.557  1.00 48.37  ? 92   G   A OP2   1 
ATOM   1768  O  "O5'" . G   A  1  91   ? 38.874  174.819 30.590  1.00 47.34  ? 92   G   A "O5'" 1 
ATOM   1769  C  "C5'" . G   A  1  91   ? 40.250  174.678 30.206  1.00 45.70  ? 92   G   A "C5'" 1 
ATOM   1770  C  "C4'" . G   A  1  91   ? 40.597  173.228 29.947  1.00 44.93  ? 92   G   A "C4'" 1 
ATOM   1771  O  "O4'" . G   A  1  91   ? 40.139  172.406 31.057  1.00 44.37  ? 92   G   A "O4'" 1 
ATOM   1772  C  "C3'" . G   A  1  91   ? 39.968  172.537 28.751  1.00 44.44  ? 92   G   A "C3'" 1 
ATOM   1773  O  "O3'" . G   A  1  91   ? 40.590  172.911 27.523  1.00 45.42  ? 92   G   A "O3'" 1 
ATOM   1774  C  "C2'" . G   A  1  91   ? 40.206  171.070 29.103  1.00 42.73  ? 92   G   A "C2'" 1 
ATOM   1775  O  "O2'" . G   A  1  91   ? 41.553  170.660 28.961  1.00 42.12  ? 92   G   A "O2'" 1 
ATOM   1776  C  "C1'" . G   A  1  91   ? 39.904  171.081 30.598  1.00 41.28  ? 92   G   A "C1'" 1 
ATOM   1777  N  N9    . G   A  1  91   ? 38.526  170.700 30.890  1.00 38.28  ? 92   G   A N9    1 
ATOM   1778  C  C8    . G   A  1  91   ? 37.502  171.504 31.330  1.00 37.75  ? 92   G   A C8    1 
ATOM   1779  N  N7    . G   A  1  91   ? 36.380  170.858 31.490  1.00 37.23  ? 92   G   A N7    1 
ATOM   1780  C  C5    . G   A  1  91   ? 36.685  169.552 31.134  1.00 35.38  ? 92   G   A C5    1 
ATOM   1781  C  C6    . G   A  1  91   ? 35.872  168.398 31.103  1.00 34.62  ? 92   G   A C6    1 
ATOM   1782  O  O6    . G   A  1  91   ? 34.684  168.286 31.407  1.00 36.55  ? 92   G   A O6    1 
ATOM   1783  N  N1    . G   A  1  91   ? 36.580  167.286 30.672  1.00 34.33  ? 92   G   A N1    1 
ATOM   1784  C  C2    . G   A  1  91   ? 37.906  167.280 30.330  1.00 35.13  ? 92   G   A C2    1 
ATOM   1785  N  N2    . G   A  1  91   ? 38.415  166.102 29.950  1.00 34.47  ? 92   G   A N2    1 
ATOM   1786  N  N3    . G   A  1  91   ? 38.679  168.349 30.362  1.00 35.35  ? 92   G   A N3    1 
ATOM   1787  C  C4    . G   A  1  91   ? 38.007  169.441 30.767  1.00 35.32  ? 92   G   A C4    1 
ATOM   1788  P  P     . C   A  1  92   ? 39.800  172.705 26.126  1.00 47.68  ? 93   C   A P     1 
ATOM   1789  O  OP1   . C   A  1  92   ? 40.615  173.374 25.074  1.00 46.81  ? 93   C   A OP1   1 
ATOM   1790  O  OP2   . C   A  1  92   ? 38.365  173.068 26.290  1.00 46.18  ? 93   C   A OP2   1 
ATOM   1791  O  "O5'" . C   A  1  92   ? 39.851  171.133 25.874  1.00 45.48  ? 93   C   A "O5'" 1 
ATOM   1792  C  "C5'" . C   A  1  92   ? 41.104  170.448 25.788  1.00 45.16  ? 93   C   A "C5'" 1 
ATOM   1793  C  "C4'" . C   A  1  92   ? 40.879  168.961 25.660  1.00 45.67  ? 93   C   A "C4'" 1 
ATOM   1794  O  "O4'" . C   A  1  92   ? 40.238  168.453 26.867  1.00 45.25  ? 93   C   A "O4'" 1 
ATOM   1795  C  "C3'" . C   A  1  92   ? 39.920  168.537 24.563  1.00 46.17  ? 93   C   A "C3'" 1 
ATOM   1796  O  "O3'" . C   A  1  92   ? 40.497  168.553 23.265  1.00 47.23  ? 93   C   A "O3'" 1 
ATOM   1797  C  "C2'" . C   A  1  92   ? 39.529  167.141 25.026  1.00 45.79  ? 93   C   A "C2'" 1 
ATOM   1798  O  "O2'" . C   A  1  92   ? 40.569  166.208 24.788  1.00 45.78  ? 93   C   A "O2'" 1 
ATOM   1799  C  "C1'" . C   A  1  92   ? 39.375  167.370 26.533  1.00 44.72  ? 93   C   A "C1'" 1 
ATOM   1800  N  N1    . C   A  1  92   ? 37.992  167.704 26.953  1.00 43.86  ? 93   C   A N1    1 
ATOM   1801  C  C2    . C   A  1  92   ? 37.001  166.704 26.931  1.00 44.24  ? 93   C   A C2    1 
ATOM   1802  O  O2    . C   A  1  92   ? 37.294  165.571 26.548  1.00 44.98  ? 93   C   A O2    1 
ATOM   1803  N  N3    . C   A  1  92   ? 35.746  167.005 27.330  1.00 44.51  ? 93   C   A N3    1 
ATOM   1804  C  C4    . C   A  1  92   ? 35.455  168.238 27.740  1.00 45.59  ? 93   C   A C4    1 
ATOM   1805  N  N4    . C   A  1  92   ? 34.197  168.489 28.133  1.00 46.60  ? 93   C   A N4    1 
ATOM   1806  C  C5    . C   A  1  92   ? 36.434  169.270 27.767  1.00 45.57  ? 93   C   A C5    1 
ATOM   1807  C  C6    . C   A  1  92   ? 37.674  168.964 27.367  1.00 44.30  ? 93   C   A C6    1 
ATOM   1808  P  P     . G   A  1  93   ? 39.569  168.901 21.993  1.00 47.11  ? 94   G   A P     1 
ATOM   1809  O  OP1   . G   A  1  93   ? 40.398  168.779 20.769  1.00 46.77  ? 94   G   A OP1   1 
ATOM   1810  O  OP2   . G   A  1  93   ? 38.847  170.169 22.264  1.00 44.73  ? 94   G   A OP2   1 
ATOM   1811  O  "O5'" . G   A  1  93   ? 38.494  167.723 21.974  1.00 46.40  ? 94   G   A "O5'" 1 
ATOM   1812  C  "C5'" . G   A  1  93   ? 38.891  166.366 21.696  1.00 45.30  ? 94   G   A "C5'" 1 
ATOM   1813  C  "C4'" . G   A  1  93   ? 37.687  165.445 21.665  1.00 45.07  ? 94   G   A "C4'" 1 
ATOM   1814  O  "O4'" . G   A  1  93   ? 37.124  165.305 22.996  1.00 44.12  ? 94   G   A "O4'" 1 
ATOM   1815  C  "C3'" . G   A  1  93   ? 36.491  165.867 20.831  1.00 45.21  ? 94   G   A "C3'" 1 
ATOM   1816  O  "O3'" . G   A  1  93   ? 36.694  165.671 19.438  1.00 47.85  ? 94   G   A "O3'" 1 
ATOM   1817  C  "C2'" . G   A  1  93   ? 35.410  164.966 21.411  1.00 42.92  ? 94   G   A "C2'" 1 
ATOM   1818  O  "O2'" . G   A  1  93   ? 35.571  163.617 21.030  1.00 43.08  ? 94   G   A "O2'" 1 
ATOM   1819  C  "C1'" . G   A  1  93   ? 35.736  165.055 22.899  1.00 42.24  ? 94   G   A "C1'" 1 
ATOM   1820  N  N9    . G   A  1  93   ? 35.027  166.157 23.537  1.00 41.37  ? 94   G   A N9    1 
ATOM   1821  C  C8    . G   A  1  93   ? 35.517  167.398 23.879  1.00 41.67  ? 94   G   A C8    1 
ATOM   1822  N  N7    . G   A  1  93   ? 34.614  168.171 24.421  1.00 41.82  ? 94   G   A N7    1 
ATOM   1823  C  C5    . G   A  1  93   ? 33.464  167.393 24.442  1.00 41.69  ? 94   G   A C5    1 
ATOM   1824  C  C6    . G   A  1  93   ? 32.154  167.691 24.911  1.00 42.00  ? 94   G   A C6    1 
ATOM   1825  O  O6    . G   A  1  93   ? 31.727  168.749 25.416  1.00 43.86  ? 94   G   A O6    1 
ATOM   1826  N  N1    . G   A  1  93   ? 31.296  166.608 24.743  1.00 41.42  ? 94   G   A N1    1 
ATOM   1827  C  C2    . G   A  1  93   ? 31.644  165.401 24.193  1.00 41.09  ? 94   G   A C2    1 
ATOM   1828  N  N2    . G   A  1  93   ? 30.672  164.477 24.118  1.00 41.08  ? 94   G   A N2    1 
ATOM   1829  N  N3    . G   A  1  93   ? 32.853  165.115 23.748  1.00 41.01  ? 94   G   A N3    1 
ATOM   1830  C  C4    . G   A  1  93   ? 33.706  166.148 23.904  1.00 41.28  ? 94   G   A C4    1 
ATOM   1831  P  P     . A   A  1  94   ? 36.434  166.889 18.411  1.00 50.05  ? 95   A   A P     1 
ATOM   1832  O  OP1   . A   A  1  94   ? 37.782  167.428 18.079  1.00 48.58  ? 95   A   A OP1   1 
ATOM   1833  O  OP2   . A   A  1  94   ? 35.383  167.813 18.924  1.00 49.40  ? 95   A   A OP2   1 
ATOM   1834  O  "O5'" . A   A  1  94   ? 35.825  166.162 17.131  1.00 50.71  ? 95   A   A "O5'" 1 
ATOM   1835  C  "C5'" . A   A  1  94   ? 34.719  165.244 17.258  1.00 54.01  ? 95   A   A "C5'" 1 
ATOM   1836  C  "C4'" . A   A  1  94   ? 33.817  165.349 16.055  1.00 55.81  ? 95   A   A "C4'" 1 
ATOM   1837  O  "O4'" . A   A  1  94   ? 32.705  164.409 16.175  1.00 55.63  ? 95   A   A "O4'" 1 
ATOM   1838  C  "C3'" . A   A  1  94   ? 33.196  166.729 15.880  1.00 57.24  ? 95   A   A "C3'" 1 
ATOM   1839  O  "O3'" . A   A  1  94   ? 33.068  167.039 14.491  1.00 59.18  ? 95   A   A "O3'" 1 
ATOM   1840  C  "C2'" . A   A  1  94   ? 31.823  166.554 16.521  1.00 57.19  ? 95   A   A "C2'" 1 
ATOM   1841  O  "O2'" . A   A  1  94   ? 30.866  167.485 16.040  1.00 57.45  ? 95   A   A "O2'" 1 
ATOM   1842  C  "C1'" . A   A  1  94   ? 31.484  165.117 16.115  1.00 57.28  ? 95   A   A "C1'" 1 
ATOM   1843  N  N9    . A   A  1  94   ? 30.497  164.451 16.979  1.00 58.37  ? 95   A   A N9    1 
ATOM   1844  C  C8    . A   A  1  94   ? 29.317  163.863 16.587  1.00 58.23  ? 95   A   A C8    1 
ATOM   1845  N  N7    . A   A  1  94   ? 28.611  163.371 17.578  1.00 58.95  ? 95   A   A N7    1 
ATOM   1846  C  C5    . A   A  1  94   ? 29.378  163.645 18.701  1.00 59.29  ? 95   A   A C5    1 
ATOM   1847  C  C6    . A   A  1  94   ? 29.179  163.386 20.071  1.00 59.91  ? 95   A   A C6    1 
ATOM   1848  N  N6    . A   A  1  94   ? 28.103  162.760 20.564  1.00 59.39  ? 95   A   A N6    1 
ATOM   1849  N  N1    . A   A  1  94   ? 30.138  163.803 20.933  1.00 60.51  ? 95   A   A N1    1 
ATOM   1850  C  C2    . A   A  1  94   ? 31.218  164.428 20.441  1.00 59.35  ? 95   A   A C2    1 
ATOM   1851  N  N3    . A   A  1  94   ? 31.517  164.724 19.178  1.00 58.95  ? 95   A   A N3    1 
ATOM   1852  C  C4    . A   A  1  94   ? 30.545  164.305 18.348  1.00 58.93  ? 95   A   A C4    1 
ATOM   1853  P  P     . A   A  1  95   ? 33.859  168.301 13.876  1.00 59.99  ? 96   A   A P     1 
ATOM   1854  O  OP1   . A   A  1  95   ? 33.828  169.425 14.862  1.00 60.78  ? 96   A   A OP1   1 
ATOM   1855  O  OP2   . A   A  1  95   ? 33.331  168.508 12.512  1.00 61.52  ? 96   A   A OP2   1 
ATOM   1856  O  "O5'" . A   A  1  95   ? 35.359  167.792 13.728  1.00 57.59  ? 96   A   A "O5'" 1 
ATOM   1857  C  "C5'" . A   A  1  95   ? 35.711  166.849 12.705  1.00 54.79  ? 96   A   A "C5'" 1 
ATOM   1858  C  "C4'" . A   A  1  95   ? 37.158  166.471 12.825  1.00 53.81  ? 96   A   A "C4'" 1 
ATOM   1859  O  "O4'" . A   A  1  95   ? 37.977  167.650 12.591  1.00 54.41  ? 96   A   A "O4'" 1 
ATOM   1860  C  "C3'" . A   A  1  95   ? 37.565  165.942 14.198  1.00 53.63  ? 96   A   A "C3'" 1 
ATOM   1861  O  "O3'" . A   A  1  95   ? 38.591  164.986 14.015  1.00 52.41  ? 96   A   A "O3'" 1 
ATOM   1862  C  "C2'" . A   A  1  95   ? 38.149  167.182 14.866  1.00 54.57  ? 96   A   A "C2'" 1 
ATOM   1863  O  "O2'" . A   A  1  95   ? 39.084  166.945 15.898  1.00 54.42  ? 96   A   A "O2'" 1 
ATOM   1864  C  "C1'" . A   A  1  95   ? 38.858  167.810 13.680  1.00 54.83  ? 96   A   A "C1'" 1 
ATOM   1865  N  N9    . A   A  1  95   ? 39.204  169.214 13.853  1.00 55.79  ? 96   A   A N9    1 
ATOM   1866  C  C8    . A   A  1  95   ? 38.530  170.232 14.490  1.00 55.63  ? 96   A   A C8    1 
ATOM   1867  N  N7    . A   A  1  95   ? 39.195  171.360 14.522  1.00 56.52  ? 96   A   A N7    1 
ATOM   1868  C  C5    . A   A  1  95   ? 40.377  171.072 13.843  1.00 57.64  ? 96   A   A C5    1 
ATOM   1869  C  C6    . A   A  1  95   ? 41.521  171.848 13.544  1.00 58.91  ? 96   A   A C6    1 
ATOM   1870  N  N6    . A   A  1  95   ? 41.671  173.123 13.925  1.00 59.84  ? 96   A   A N6    1 
ATOM   1871  N  N1    . A   A  1  95   ? 42.521  171.254 12.841  1.00 58.51  ? 96   A   A N1    1 
ATOM   1872  C  C2    . A   A  1  95   ? 42.376  169.967 12.480  1.00 57.74  ? 96   A   A C2    1 
ATOM   1873  N  N3    . A   A  1  95   ? 41.357  169.137 12.713  1.00 57.11  ? 96   A   A N3    1 
ATOM   1874  C  C4    . A   A  1  95   ? 40.381  169.760 13.407  1.00 56.93  ? 96   A   A C4    1 
ATOM   1875  P  P     . G   A  1  96   ? 38.210  163.436 13.849  1.00 52.47  ? 97   G   A P     1 
ATOM   1876  O  OP1   . G   A  1  96   ? 39.452  162.638 14.052  1.00 51.75  ? 97   G   A OP1   1 
ATOM   1877  O  OP2   . G   A  1  96   ? 37.434  163.267 12.594  1.00 53.79  ? 97   G   A OP2   1 
ATOM   1878  O  "O5'" . G   A  1  96   ? 37.196  163.171 15.045  1.00 52.71  ? 97   G   A "O5'" 1 
ATOM   1879  C  "C5'" . G   A  1  96   ? 37.585  163.360 16.416  1.00 52.04  ? 97   G   A "C5'" 1 
ATOM   1880  C  "C4'" . G   A  1  96   ? 37.059  162.219 17.248  1.00 50.48  ? 97   G   A "C4'" 1 
ATOM   1881  O  "O4'" . G   A  1  96   ? 35.604  162.232 17.202  1.00 51.73  ? 97   G   A "O4'" 1 
ATOM   1882  C  "C3'" . G   A  1  96   ? 37.472  160.838 16.760  1.00 49.32  ? 97   G   A "C3'" 1 
ATOM   1883  O  "O3'" . G   A  1  96   ? 37.524  159.966 17.870  1.00 45.70  ? 97   G   A "O3'" 1 
ATOM   1884  C  "C2'" . G   A  1  96   ? 36.318  160.448 15.848  1.00 49.71  ? 97   G   A "C2'" 1 
ATOM   1885  O  "O2'" . G   A  1  96   ? 36.190  159.054 15.685  1.00 49.67  ? 97   G   A "O2'" 1 
ATOM   1886  C  "C1'" . G   A  1  96   ? 35.121  161.049 16.589  1.00 51.11  ? 97   G   A "C1'" 1 
ATOM   1887  N  N9    . G   A  1  96   ? 34.040  161.426 15.678  1.00 53.55  ? 97   G   A N9    1 
ATOM   1888  C  C8    . G   A  1  96   ? 34.193  162.083 14.483  1.00 54.13  ? 97   G   A C8    1 
ATOM   1889  N  N7    . G   A  1  96   ? 33.068  162.274 13.854  1.00 54.53  ? 97   G   A N7    1 
ATOM   1890  C  C5    . G   A  1  96   ? 32.106  161.716 14.683  1.00 55.04  ? 97   G   A C5    1 
ATOM   1891  C  C6    . G   A  1  96   ? 30.705  161.616 14.514  1.00 56.03  ? 97   G   A C6    1 
ATOM   1892  O  O6    . G   A  1  96   ? 30.014  162.008 13.563  1.00 56.97  ? 97   G   A O6    1 
ATOM   1893  N  N1    . G   A  1  96   ? 30.104  160.977 15.591  1.00 55.24  ? 97   G   A N1    1 
ATOM   1894  C  C2    . G   A  1  96   ? 30.766  160.490 16.685  1.00 54.87  ? 97   G   A C2    1 
ATOM   1895  N  N2    . G   A  1  96   ? 30.007  159.898 17.611  1.00 54.80  ? 97   G   A N2    1 
ATOM   1896  N  N3    . G   A  1  96   ? 32.076  160.574 16.857  1.00 54.52  ? 97   G   A N3    1 
ATOM   1897  C  C4    . G   A  1  96   ? 32.682  161.193 15.821  1.00 54.28  ? 97   G   A C4    1 
ATOM   1898  P  P     . A   A  1  97   ? 38.881  159.203 18.216  1.00 44.51  ? 98   A   A P     1 
ATOM   1899  O  OP1   . A   A  1  97   ? 39.916  159.696 17.284  1.00 45.29  ? 98   A   A OP1   1 
ATOM   1900  O  OP2   . A   A  1  97   ? 38.585  157.759 18.265  1.00 45.23  ? 98   A   A OP2   1 
ATOM   1901  O  "O5'" . A   A  1  97   ? 39.205  159.722 19.685  1.00 42.36  ? 98   A   A "O5'" 1 
ATOM   1902  C  "C5'" . A   A  1  97   ? 39.966  160.934 19.884  1.00 41.77  ? 98   A   A "C5'" 1 
ATOM   1903  C  "C4'" . A   A  1  97   ? 39.745  161.491 21.269  1.00 39.02  ? 98   A   A "C4'" 1 
ATOM   1904  O  "O4'" . A   A  1  97   ? 38.373  161.942 21.402  1.00 39.35  ? 98   A   A "O4'" 1 
ATOM   1905  C  "C3'" . A   A  1  97   ? 39.908  160.510 22.408  1.00 38.73  ? 98   A   A "C3'" 1 
ATOM   1906  O  "O3'" . A   A  1  97   ? 41.249  160.302 22.803  1.00 37.55  ? 98   A   A "O3'" 1 
ATOM   1907  C  "C2'" . A   A  1  97   ? 39.109  161.172 23.505  1.00 38.58  ? 98   A   A "C2'" 1 
ATOM   1908  O  "O2'" . A   A  1  97   ? 39.831  162.238 24.057  1.00 39.20  ? 98   A   A "O2'" 1 
ATOM   1909  C  "C1'" . A   A  1  97   ? 37.910  161.692 22.719  1.00 38.93  ? 98   A   A "C1'" 1 
ATOM   1910  N  N9    . A   A  1  97   ? 36.838  160.697 22.645  1.00 40.44  ? 98   A   A N9    1 
ATOM   1911  C  C8    . A   A  1  97   ? 36.470  159.944 21.555  1.00 40.70  ? 98   A   A C8    1 
ATOM   1912  N  N7    . A   A  1  97   ? 35.476  159.126 21.790  1.00 42.42  ? 98   A   A N7    1 
ATOM   1913  C  C5    . A   A  1  97   ? 35.159  159.354 23.125  1.00 42.78  ? 98   A   A C5    1 
ATOM   1914  C  C6    . A   A  1  97   ? 34.175  158.796 23.979  1.00 43.12  ? 98   A   A C6    1 
ATOM   1915  N  N6    . A   A  1  97   ? 33.286  157.865 23.591  1.00 43.20  ? 98   A   A N6    1 
ATOM   1916  N  N1    . A   A  1  97   ? 34.131  159.238 25.258  1.00 43.14  ? 98   A   A N1    1 
ATOM   1917  C  C2    . A   A  1  97   ? 35.010  160.176 25.644  1.00 42.36  ? 98   A   A C2    1 
ATOM   1918  N  N3    . A   A  1  97   ? 35.971  160.780 24.935  1.00 42.73  ? 98   A   A N3    1 
ATOM   1919  C  C4    . A   A  1  97   ? 35.992  160.318 23.667  1.00 42.14  ? 98   A   A C4    1 
ATOM   1920  P  P     . A   A  1  98   ? 41.730  158.813 23.162  1.00 38.75  ? 99   A   A P     1 
ATOM   1921  O  OP1   . A   A  1  98   ? 43.130  158.869 23.645  1.00 39.13  ? 99   A   A OP1   1 
ATOM   1922  O  OP2   . A   A  1  98   ? 41.408  157.987 21.970  1.00 38.06  ? 99   A   A OP2   1 
ATOM   1923  O  "O5'" . A   A  1  98   ? 40.798  158.405 24.398  1.00 39.76  ? 99   A   A "O5'" 1 
ATOM   1924  C  "C5'" . A   A  1  98   ? 40.871  159.141 25.653  1.00 39.07  ? 99   A   A "C5'" 1 
ATOM   1925  C  "C4'" . A   A  1  98   ? 39.822  158.653 26.655  1.00 39.09  ? 99   A   A "C4'" 1 
ATOM   1926  O  "O4'" . A   A  1  98   ? 38.486  158.771 26.091  1.00 40.34  ? 99   A   A "O4'" 1 
ATOM   1927  C  "C3'" . A   A  1  98   ? 39.891  157.211 27.140  1.00 39.13  ? 99   A   A "C3'" 1 
ATOM   1928  O  "O3'" . A   A  1  98   ? 40.829  157.064 28.200  1.00 38.60  ? 99   A   A "O3'" 1 
ATOM   1929  C  "C2'" . A   A  1  98   ? 38.473  156.967 27.646  1.00 40.69  ? 99   A   A "C2'" 1 
ATOM   1930  O  "O2'" . A   A  1  98   ? 38.248  157.478 28.944  1.00 40.88  ? 99   A   A "O2'" 1 
ATOM   1931  C  "C1'" . A   A  1  98   ? 37.645  157.764 26.633  1.00 40.77  ? 99   A   A "C1'" 1 
ATOM   1932  N  N9    . A   A  1  98   ? 37.148  156.936 25.536  1.00 40.39  ? 99   A   A N9    1 
ATOM   1933  C  C8    . A   A  1  98   ? 37.747  156.691 24.329  1.00 40.17  ? 99   A   A C8    1 
ATOM   1934  N  N7    . A   A  1  98   ? 37.092  155.843 23.578  1.00 40.98  ? 99   A   A N7    1 
ATOM   1935  C  C5    . A   A  1  98   ? 35.977  155.516 24.339  1.00 39.64  ? 99   A   A C5    1 
ATOM   1936  C  C6    . A   A  1  98   ? 34.891  154.649 24.112  1.00 39.39  ? 99   A   A C6    1 
ATOM   1937  N  N6    . A   A  1  98   ? 34.761  153.883 23.032  1.00 40.01  ? 99   A   A N6    1 
ATOM   1938  N  N1    . A   A  1  98   ? 33.932  154.586 25.055  1.00 40.08  ? 99   A   A N1    1 
ATOM   1939  C  C2    . A   A  1  98   ? 34.069  155.326 26.157  1.00 41.05  ? 99   A   A C2    1 
ATOM   1940  N  N3    . A   A  1  98   ? 35.053  156.154 26.499  1.00 40.00  ? 99   A   A N3    1 
ATOM   1941  C  C4    . A   A  1  98   ? 35.986  156.205 25.534  1.00 39.81  ? 99   A   A C4    1 
ATOM   1942  P  P     . C   A  1  99   ? 42.000  155.985 28.070  1.00 38.58  ? 100  C   A P     1 
ATOM   1943  O  OP1   . C   A  1  99   ? 42.747  155.928 29.350  1.00 38.69  ? 100  C   A OP1   1 
ATOM   1944  O  OP2   . C   A  1  99   ? 42.716  156.313 26.820  1.00 39.66  ? 100  C   A OP2   1 
ATOM   1945  O  "O5'" . C   A  1  99   ? 41.239  154.614 27.838  1.00 38.39  ? 100  C   A "O5'" 1 
ATOM   1946  C  "C5'" . C   A  1  99   ? 40.320  154.119 28.815  1.00 40.90  ? 100  C   A "C5'" 1 
ATOM   1947  C  "C4'" . C   A  1  99   ? 39.441  153.080 28.189  1.00 42.40  ? 100  C   A "C4'" 1 
ATOM   1948  O  "O4'" . C   A  1  99   ? 38.590  153.713 27.197  1.00 44.07  ? 100  C   A "O4'" 1 
ATOM   1949  C  "C3'" . C   A  1  99   ? 40.208  152.045 27.389  1.00 41.37  ? 100  C   A "C3'" 1 
ATOM   1950  O  "O3'" . C   A  1  99   ? 40.781  151.065 28.235  1.00 39.97  ? 100  C   A "O3'" 1 
ATOM   1951  C  "C2'" . C   A  1  99   ? 39.139  151.524 26.443  1.00 43.52  ? 100  C   A "C2'" 1 
ATOM   1952  O  "O2'" . C   A  1  99   ? 38.222  150.635 27.050  1.00 41.97  ? 100  C   A "O2'" 1 
ATOM   1953  C  "C1'" . C   A  1  99   ? 38.411  152.826 26.099  1.00 44.91  ? 100  C   A "C1'" 1 
ATOM   1954  N  N1    . C   A  1  99   ? 38.950  153.448 24.872  1.00 46.39  ? 100  C   A N1    1 
ATOM   1955  C  C2    . C   A  1  99   ? 38.459  153.012 23.630  1.00 46.99  ? 100  C   A C2    1 
ATOM   1956  O  O2    . C   A  1  99   ? 37.595  152.124 23.602  1.00 47.69  ? 100  C   A O2    1 
ATOM   1957  N  N3    . C   A  1  99   ? 38.939  153.564 22.496  1.00 46.69  ? 100  C   A N3    1 
ATOM   1958  C  C4    . C   A  1  99   ? 39.871  154.510 22.561  1.00 46.98  ? 100  C   A C4    1 
ATOM   1959  N  N4    . C   A  1  99   ? 40.309  155.024 21.418  1.00 47.96  ? 100  C   A N4    1 
ATOM   1960  C  C5    . C   A  1  99   ? 40.395  154.971 23.804  1.00 47.32  ? 100  C   A C5    1 
ATOM   1961  C  C6    . C   A  1  99   ? 39.911  154.420 24.925  1.00 46.83  ? 100  C   A C6    1 
ATOM   1962  P  P     . C   A  1  100  ? 42.185  150.405 27.842  1.00 38.57  ? 101  C   A P     1 
ATOM   1963  O  OP1   . C   A  1  100  ? 42.608  149.581 28.991  1.00 39.00  ? 101  C   A OP1   1 
ATOM   1964  O  OP2   . C   A  1  100  ? 43.092  151.441 27.325  1.00 39.96  ? 101  C   A OP2   1 
ATOM   1965  O  "O5'" . C   A  1  100  ? 41.797  149.435 26.644  1.00 38.92  ? 101  C   A "O5'" 1 
ATOM   1966  C  "C5'" . C   A  1  100  ? 41.091  148.210 26.903  1.00 39.77  ? 101  C   A "C5'" 1 
ATOM   1967  C  "C4'" . C   A  1  100  ? 40.986  147.380 25.650  1.00 41.28  ? 101  C   A "C4'" 1 
ATOM   1968  O  "O4'" . C   A  1  100  ? 40.149  148.073 24.693  1.00 41.35  ? 101  C   A "O4'" 1 
ATOM   1969  C  "C3'" . C   A  1  100  ? 42.290  147.128 24.915  1.00 41.62  ? 101  C   A "C3'" 1 
ATOM   1970  O  "O3'" . C   A  1  100  ? 42.975  146.004 25.434  1.00 42.88  ? 101  C   A "O3'" 1 
ATOM   1971  C  "C2'" . C   A  1  100  ? 41.822  146.872 23.496  1.00 41.30  ? 101  C   A "C2'" 1 
ATOM   1972  O  "O2'" . C   A  1  100  ? 41.400  145.547 23.304  1.00 42.89  ? 101  C   A "O2'" 1 
ATOM   1973  C  "C1'" . C   A  1  100  ? 40.633  147.829 23.388  1.00 42.17  ? 101  C   A "C1'" 1 
ATOM   1974  N  N1    . C   A  1  100  ? 41.032  149.107 22.780  1.00 42.76  ? 101  C   A N1    1 
ATOM   1975  C  C2    . C   A  1  100  ? 41.092  149.177 21.399  1.00 42.71  ? 101  C   A C2    1 
ATOM   1976  O  O2    . C   A  1  100  ? 40.804  148.170 20.746  1.00 43.04  ? 101  C   A O2    1 
ATOM   1977  N  N3    . C   A  1  100  ? 41.462  150.330 20.805  1.00 42.25  ? 101  C   A N3    1 
ATOM   1978  C  C4    . C   A  1  100  ? 41.765  151.390 21.549  1.00 42.67  ? 101  C   A C4    1 
ATOM   1979  N  N4    . C   A  1  100  ? 42.119  152.512 20.923  1.00 42.49  ? 101  C   A N4    1 
ATOM   1980  C  C5    . C   A  1  100  ? 41.716  151.349 22.969  1.00 43.00  ? 101  C   A C5    1 
ATOM   1981  C  C6    . C   A  1  100  ? 41.347  150.198 23.540  1.00 43.33  ? 101  C   A C6    1 
ATOM   1982  P  P     . A   A  1  101  ? 44.505  145.753 25.030  1.00 45.76  ? 102  A   A P     1 
ATOM   1983  O  OP1   . A   A  1  101  ? 44.923  144.566 25.823  1.00 46.39  ? 102  A   A OP1   1 
ATOM   1984  O  OP2   . A   A  1  101  ? 45.270  147.026 25.159  1.00 46.11  ? 102  A   A OP2   1 
ATOM   1985  O  "O5'" . A   A  1  101  ? 44.438  145.370 23.483  1.00 45.34  ? 102  A   A "O5'" 1 
ATOM   1986  C  "C5'" . A   A  1  101  ? 43.925  144.096 23.048  1.00 47.57  ? 102  A   A "C5'" 1 
ATOM   1987  C  "C4'" . A   A  1  101  ? 44.189  143.906 21.569  1.00 48.69  ? 102  A   A "C4'" 1 
ATOM   1988  O  "O4'" . A   A  1  101  ? 43.373  144.821 20.791  1.00 48.35  ? 102  A   A "O4'" 1 
ATOM   1989  C  "C3'" . A   A  1  101  ? 45.615  144.212 21.141  1.00 48.45  ? 102  A   A "C3'" 1 
ATOM   1990  O  "O3'" . A   A  1  101  ? 46.454  143.091 21.365  1.00 50.17  ? 102  A   A "O3'" 1 
ATOM   1991  C  "C2'" . A   A  1  101  ? 45.442  144.531 19.666  1.00 48.56  ? 102  A   A "C2'" 1 
ATOM   1992  O  "O2'" . A   A  1  101  ? 45.266  143.355 18.897  1.00 48.05  ? 102  A   A "O2'" 1 
ATOM   1993  C  "C1'" . A   A  1  101  ? 44.123  145.307 19.689  1.00 48.64  ? 102  A   A "C1'" 1 
ATOM   1994  N  N9    . A   A  1  101  ? 44.310  146.744 19.878  1.00 49.74  ? 102  A   A N9    1 
ATOM   1995  C  C8    . A   A  1  101  ? 44.269  147.462 21.048  1.00 50.93  ? 102  A   A C8    1 
ATOM   1996  N  N7    . A   A  1  101  ? 44.465  148.749 20.885  1.00 50.84  ? 102  A   A N7    1 
ATOM   1997  C  C5    . A   A  1  101  ? 44.649  148.884 19.518  1.00 50.28  ? 102  A   A C5    1 
ATOM   1998  C  C6    . A   A  1  101  ? 44.895  149.997 18.708  1.00 50.89  ? 102  A   A C6    1 
ATOM   1999  N  N6    . A   A  1  101  ? 44.992  151.248 19.173  1.00 51.53  ? 102  A   A N6    1 
ATOM   2000  N  N1    . A   A  1  101  ? 45.038  149.787 17.383  1.00 50.88  ? 102  A   A N1    1 
ATOM   2001  C  C2    . A   A  1  101  ? 44.925  148.541 16.915  1.00 50.98  ? 102  A   A C2    1 
ATOM   2002  N  N3    . A   A  1  101  ? 44.688  147.417 17.575  1.00 50.84  ? 102  A   A N3    1 
ATOM   2003  C  C4    . A   A  1  101  ? 44.561  147.659 18.889  1.00 50.12  ? 102  A   A C4    1 
ATOM   2004  P  P     . U   A  1  102  ? 48.013  143.310 21.670  1.00 51.00  ? 103  U   A P     1 
ATOM   2005  O  OP1   . U   A  1  102  ? 48.528  141.992 22.098  1.00 51.40  ? 103  U   A OP1   1 
ATOM   2006  O  OP2   . U   A  1  102  ? 48.191  144.493 22.562  1.00 49.82  ? 103  U   A OP2   1 
ATOM   2007  O  "O5'" . U   A  1  102  ? 48.614  143.629 20.232  1.00 49.67  ? 103  U   A "O5'" 1 
ATOM   2008  C  "C5'" . U   A  1  102  ? 48.377  142.736 19.129  1.00 49.32  ? 103  U   A "C5'" 1 
ATOM   2009  C  "C4'" . U   A  1  102  ? 48.674  143.421 17.816  1.00 50.09  ? 103  U   A "C4'" 1 
ATOM   2010  O  "O4'" . U   A  1  102  ? 47.701  144.465 17.556  1.00 49.12  ? 103  U   A "O4'" 1 
ATOM   2011  C  "C3'" . U   A  1  102  ? 49.997  144.148 17.756  1.00 50.20  ? 103  U   A "C3'" 1 
ATOM   2012  O  "O3'" . U   A  1  102  ? 51.066  143.270 17.487  1.00 51.69  ? 103  U   A "O3'" 1 
ATOM   2013  C  "C2'" . U   A  1  102  ? 49.781  145.119 16.613  1.00 50.95  ? 103  U   A "C2'" 1 
ATOM   2014  O  "O2'" . U   A  1  102  ? 49.961  144.494 15.359  1.00 52.99  ? 103  U   A "O2'" 1 
ATOM   2015  C  "C1'" . U   A  1  102  ? 48.318  145.521 16.832  1.00 49.95  ? 103  U   A "C1'" 1 
ATOM   2016  N  N1    . U   A  1  102  ? 48.189  146.769 17.606  1.00 51.14  ? 103  U   A N1    1 
ATOM   2017  C  C2    . U   A  1  102  ? 48.065  147.973 16.908  1.00 51.31  ? 103  U   A C2    1 
ATOM   2018  O  O2    . U   A  1  102  ? 48.013  148.043 15.689  1.00 52.58  ? 103  U   A O2    1 
ATOM   2019  N  N3    . U   A  1  102  ? 47.999  149.095 17.696  1.00 50.54  ? 103  U   A N3    1 
ATOM   2020  C  C4    . U   A  1  102  ? 48.036  149.149 19.071  1.00 50.71  ? 103  U   A C4    1 
ATOM   2021  O  O4    . U   A  1  102  ? 48.084  150.246 19.630  1.00 51.06  ? 103  U   A O4    1 
ATOM   2022  C  C5    . U   A  1  102  ? 48.132  147.875 19.717  1.00 51.55  ? 103  U   A C5    1 
ATOM   2023  C  C6    . U   A  1  102  ? 48.206  146.759 18.984  1.00 51.29  ? 103  U   A C6    1 
ATOM   2024  P  P     . G   A  1  103  ? 52.516  143.596 18.085  1.00 53.89  ? 104  G   A P     1 
ATOM   2025  O  OP1   . G   A  1  103  ? 53.401  142.436 17.781  1.00 53.33  ? 104  G   A OP1   1 
ATOM   2026  O  OP2   . G   A  1  103  ? 52.319  144.017 19.502  1.00 54.18  ? 104  G   A OP2   1 
ATOM   2027  O  "O5'" . G   A  1  103  ? 53.003  144.853 17.234  1.00 53.57  ? 104  G   A "O5'" 1 
ATOM   2028  C  "C5'" . G   A  1  103  ? 53.345  144.702 15.846  1.00 53.53  ? 104  G   A "C5'" 1 
ATOM   2029  C  "C4'" . G   A  1  103  ? 53.461  146.049 15.180  1.00 53.36  ? 104  G   A "C4'" 1 
ATOM   2030  O  "O4'" . G   A  1  103  ? 52.214  146.774 15.343  1.00 53.50  ? 104  G   A "O4'" 1 
ATOM   2031  C  "C3'" . G   A  1  103  ? 54.479  147.020 15.748  1.00 52.54  ? 104  G   A "C3'" 1 
ATOM   2032  O  "O3'" . G   A  1  103  ? 55.801  146.740 15.330  1.00 50.51  ? 104  G   A "O3'" 1 
ATOM   2033  C  "C2'" . G   A  1  103  ? 53.986  148.339 15.177  1.00 52.61  ? 104  G   A "C2'" 1 
ATOM   2034  O  "O2'" . G   A  1  103  ? 54.311  148.497 13.813  1.00 52.28  ? 104  G   A "O2'" 1 
ATOM   2035  C  "C1'" . G   A  1  103  ? 52.476  148.170 15.327  1.00 53.05  ? 104  G   A "C1'" 1 
ATOM   2036  N  N9    . G   A  1  103  ? 52.014  148.773 16.572  1.00 53.66  ? 104  G   A N9    1 
ATOM   2037  C  C8    . G   A  1  103  ? 51.689  148.148 17.750  1.00 53.56  ? 104  G   A C8    1 
ATOM   2038  N  N7    . G   A  1  103  ? 51.349  148.983 18.696  1.00 54.97  ? 104  G   A N7    1 
ATOM   2039  C  C5    . G   A  1  103  ? 51.448  150.234 18.102  1.00 54.33  ? 104  G   A C5    1 
ATOM   2040  C  C6    . G   A  1  103  ? 51.214  151.536 18.637  1.00 54.70  ? 104  G   A C6    1 
ATOM   2041  O  O6    . G   A  1  103  ? 50.858  151.849 19.783  1.00 53.69  ? 104  G   A O6    1 
ATOM   2042  N  N1    . G   A  1  103  ? 51.442  152.524 17.686  1.00 54.20  ? 104  G   A N1    1 
ATOM   2043  C  C2    . G   A  1  103  ? 51.846  152.296 16.393  1.00 54.70  ? 104  G   A C2    1 
ATOM   2044  N  N2    . G   A  1  103  ? 52.019  153.385 15.635  1.00 56.12  ? 104  G   A N2    1 
ATOM   2045  N  N3    . G   A  1  103  ? 52.066  151.095 15.884  1.00 54.70  ? 104  G   A N3    1 
ATOM   2046  C  C4    . G   A  1  103  ? 51.849  150.118 16.789  1.00 54.36  ? 104  G   A C4    1 
ATOM   2047  P  P     . G   A  1  104  ? 57.037  147.206 16.252  1.00 51.02  ? 105  G   A P     1 
ATOM   2048  O  OP1   . G   A  1  104  ? 58.256  146.728 15.546  1.00 51.91  ? 105  G   A OP1   1 
ATOM   2049  O  OP2   . G   A  1  104  ? 56.794  146.805 17.664  1.00 50.54  ? 105  G   A OP2   1 
ATOM   2050  O  "O5'" . G   A  1  104  ? 57.011  148.799 16.187  1.00 48.63  ? 105  G   A "O5'" 1 
ATOM   2051  C  "C5'" . G   A  1  104  ? 57.374  149.480 14.977  1.00 46.94  ? 105  G   A "C5'" 1 
ATOM   2052  C  "C4'" . G   A  1  104  ? 57.194  150.978 15.112  1.00 45.44  ? 105  G   A "C4'" 1 
ATOM   2053  O  "O4'" . G   A  1  104  ? 55.820  151.296 15.465  1.00 45.08  ? 105  G   A "O4'" 1 
ATOM   2054  C  "C3'" . G   A  1  104  ? 57.977  151.737 16.170  1.00 43.87  ? 105  G   A "C3'" 1 
ATOM   2055  O  "O3'" . G   A  1  104  ? 59.338  151.968 15.816  1.00 41.98  ? 105  G   A "O3'" 1 
ATOM   2056  C  "C2'" . G   A  1  104  ? 57.225  153.062 16.192  1.00 44.17  ? 105  G   A "C2'" 1 
ATOM   2057  O  "O2'" . G   A  1  104  ? 57.547  153.866 15.073  1.00 43.96  ? 105  G   A "O2'" 1 
ATOM   2058  C  "C1'" . G   A  1  104  ? 55.778  152.587 16.061  1.00 44.65  ? 105  G   A "C1'" 1 
ATOM   2059  N  N9    . G   A  1  104  ? 55.146  152.489 17.371  1.00 45.19  ? 105  G   A N9    1 
ATOM   2060  C  C8    . G   A  1  104  ? 54.777  151.349 18.038  1.00 45.38  ? 105  G   A C8    1 
ATOM   2061  N  N7    . G   A  1  104  ? 54.280  151.588 19.220  1.00 45.85  ? 105  G   A N7    1 
ATOM   2062  C  C5    . G   A  1  104  ? 54.317  152.971 19.336  1.00 45.88  ? 105  G   A C5    1 
ATOM   2063  C  C6    . G   A  1  104  ? 53.940  153.811 20.407  1.00 45.61  ? 105  G   A C6    1 
ATOM   2064  O  O6    . G   A  1  104  ? 53.500  153.493 21.508  1.00 45.96  ? 105  G   A O6    1 
ATOM   2065  N  N1    . G   A  1  104  ? 54.144  155.149 20.104  1.00 45.40  ? 105  G   A N1    1 
ATOM   2066  C  C2    . G   A  1  104  ? 54.663  155.622 18.927  1.00 45.96  ? 105  G   A C2    1 
ATOM   2067  N  N2    . G   A  1  104  ? 54.802  156.951 18.834  1.00 46.77  ? 105  G   A N2    1 
ATOM   2068  N  N3    . G   A  1  104  ? 55.028  154.849 17.921  1.00 46.15  ? 105  G   A N3    1 
ATOM   2069  C  C4    . G   A  1  104  ? 54.831  153.542 18.195  1.00 45.93  ? 105  G   A C4    1 
ATOM   2070  P  P     . A   A  1  105  ? 60.388  152.434 16.947  1.00 41.55  ? 106  A   A P     1 
ATOM   2071  O  OP1   . A   A  1  105  ? 61.678  152.613 16.260  1.00 40.42  ? 106  A   A OP1   1 
ATOM   2072  O  OP2   . A   A  1  105  ? 60.302  151.473 18.065  1.00 40.13  ? 106  A   A OP2   1 
ATOM   2073  O  "O5'" . A   A  1  105  ? 59.849  153.857 17.456  1.00 39.42  ? 106  A   A "O5'" 1 
ATOM   2074  C  "C5'" . A   A  1  105  ? 59.789  155.003 16.570  1.00 38.52  ? 106  A   A "C5'" 1 
ATOM   2075  C  "C4'" . A   A  1  105  ? 59.461  156.278 17.334  1.00 38.34  ? 106  A   A "C4'" 1 
ATOM   2076  O  "O4'" . A   A  1  105  ? 58.095  156.258 17.815  1.00 38.84  ? 106  A   A "O4'" 1 
ATOM   2077  C  "C3'" . A   A  1  105  ? 60.284  156.582 18.571  1.00 38.05  ? 106  A   A "C3'" 1 
ATOM   2078  O  "O3'" . A   A  1  105  ? 61.526  157.188 18.259  1.00 38.80  ? 106  A   A "O3'" 1 
ATOM   2079  C  "C2'" . A   A  1  105  ? 59.393  157.535 19.353  1.00 36.81  ? 106  A   A "C2'" 1 
ATOM   2080  O  "O2'" . A   A  1  105  ? 59.487  158.864 18.905  1.00 34.49  ? 106  A   A "O2'" 1 
ATOM   2081  C  "C1'" . A   A  1  105  ? 58.004  156.984 19.039  1.00 38.25  ? 106  A   A "C1'" 1 
ATOM   2082  N  N9    . A   A  1  105  ? 57.518  156.076 20.074  1.00 38.38  ? 106  A   A N9    1 
ATOM   2083  C  C8    . A   A  1  105  ? 57.453  154.709 19.982  1.00 38.98  ? 106  A   A C8    1 
ATOM   2084  N  N7    . A   A  1  105  ? 56.970  154.130 21.049  1.00 39.74  ? 106  A   A N7    1 
ATOM   2085  C  C5    . A   A  1  105  ? 56.702  155.186 21.912  1.00 39.91  ? 106  A   A C5    1 
ATOM   2086  C  C6    . A   A  1  105  ? 56.179  155.229 23.223  1.00 40.06  ? 106  A   A C6    1 
ATOM   2087  N  N6    . A   A  1  105  ? 55.811  154.143 23.913  1.00 39.18  ? 106  A   A N6    1 
ATOM   2088  N  N1    . A   A  1  105  ? 56.048  156.440 23.803  1.00 39.89  ? 106  A   A N1    1 
ATOM   2089  C  C2    . A   A  1  105  ? 56.417  157.524 23.108  1.00 40.22  ? 106  A   A C2    1 
ATOM   2090  N  N3    . A   A  1  105  ? 56.916  157.613 21.874  1.00 40.12  ? 106  A   A N3    1 
ATOM   2091  C  C4    . A   A  1  105  ? 57.037  156.393 21.324  1.00 39.39  ? 106  A   A C4    1 
ATOM   2092  P  P     . U   A  1  106  ? 62.816  156.842 19.153  1.00 39.65  ? 107  U   A P     1 
ATOM   2093  O  OP1   . U   A  1  106  ? 63.979  157.529 18.535  1.00 40.73  ? 107  U   A OP1   1 
ATOM   2094  O  OP2   . U   A  1  106  ? 62.844  155.356 19.281  1.00 40.05  ? 107  U   A OP2   1 
ATOM   2095  O  "O5'" . U   A  1  106  ? 62.478  157.517 20.566  1.00 37.97  ? 107  U   A "O5'" 1 
ATOM   2096  C  "C5'" . U   A  1  106  ? 62.114  158.914 20.652  1.00 37.27  ? 107  U   A "C5'" 1 
ATOM   2097  C  "C4'" . U   A  1  106  ? 61.558  159.266 22.032  1.00 36.74  ? 107  U   A "C4'" 1 
ATOM   2098  O  "O4'" . U   A  1  106  ? 60.261  158.642 22.246  1.00 37.53  ? 107  U   A "O4'" 1 
ATOM   2099  C  "C3'" . U   A  1  106  ? 62.338  158.859 23.273  1.00 34.96  ? 107  U   A "C3'" 1 
ATOM   2100  O  "O3'" . U   A  1  106  ? 63.462  159.681 23.550  1.00 33.96  ? 107  U   A "O3'" 1 
ATOM   2101  C  "C2'" . U   A  1  106  ? 61.281  158.996 24.359  1.00 36.17  ? 107  U   A "C2'" 1 
ATOM   2102  O  "O2'" . U   A  1  106  ? 61.061  160.349 24.726  1.00 35.30  ? 107  U   A "O2'" 1 
ATOM   2103  C  "C1'" . U   A  1  106  ? 60.047  158.441 23.642  1.00 36.86  ? 107  U   A "C1'" 1 
ATOM   2104  N  N1    . U   A  1  106  ? 59.810  157.005 23.891  1.00 37.68  ? 107  U   A N1    1 
ATOM   2105  C  C2    . U   A  1  106  ? 59.177  156.627 25.070  1.00 38.19  ? 107  U   A C2    1 
ATOM   2106  O  O2    . U   A  1  106  ? 58.804  157.419 25.912  1.00 38.75  ? 107  U   A O2    1 
ATOM   2107  N  N3    . U   A  1  106  ? 59.000  155.276 25.223  1.00 39.25  ? 107  U   A N3    1 
ATOM   2108  C  C4    . U   A  1  106  ? 59.380  154.283 24.347  1.00 39.41  ? 107  U   A C4    1 
ATOM   2109  O  O4    . U   A  1  106  ? 59.179  153.097 24.641  1.00 41.12  ? 107  U   A O4    1 
ATOM   2110  C  C5    . U   A  1  106  ? 60.019  154.754 23.161  1.00 38.99  ? 107  U   A C5    1 
ATOM   2111  C  C6    . U   A  1  106  ? 60.206  156.059 22.979  1.00 37.51  ? 107  U   A C6    1 
ATOM   2112  P  P     . U   A  1  107  ? 64.839  158.999 24.029  1.00 34.43  ? 108  U   A P     1 
ATOM   2113  O  OP1   . U   A  1  107  ? 65.758  160.066 24.488  1.00 32.31  ? 108  U   A OP1   1 
ATOM   2114  O  OP2   . U   A  1  107  ? 65.285  158.058 22.969  1.00 32.03  ? 108  U   A OP2   1 
ATOM   2115  O  "O5'" . U   A  1  107  ? 64.408  158.124 25.286  1.00 33.81  ? 108  U   A "O5'" 1 
ATOM   2116  C  "C5'" . U   A  1  107  ? 63.796  158.730 26.437  1.00 34.47  ? 108  U   A "C5'" 1 
ATOM   2117  C  "C4'" . U   A  1  107  ? 63.311  157.662 27.393  1.00 35.04  ? 108  U   A "C4'" 1 
ATOM   2118  O  "O4'" . U   A  1  107  ? 62.273  156.867 26.761  1.00 36.00  ? 108  U   A "O4'" 1 
ATOM   2119  C  "C3'" . U   A  1  107  ? 64.338  156.626 27.826  1.00 35.02  ? 108  U   A "C3'" 1 
ATOM   2120  O  "O3'" . U   A  1  107  ? 65.149  157.121 28.877  1.00 32.86  ? 108  U   A "O3'" 1 
ATOM   2121  C  "C2'" . U   A  1  107  ? 63.461  155.470 28.281  1.00 35.59  ? 108  U   A "C2'" 1 
ATOM   2122  O  "O2'" . U   A  1  107  ? 62.932  155.651 29.574  1.00 36.77  ? 108  U   A "O2'" 1 
ATOM   2123  C  "C1'" . U   A  1  107  ? 62.323  155.537 27.260  1.00 36.91  ? 108  U   A "C1'" 1 
ATOM   2124  N  N1    . U   A  1  107  ? 62.523  154.612 26.133  1.00 39.33  ? 108  U   A N1    1 
ATOM   2125  C  C2    . U   A  1  107  ? 62.069  153.307 26.270  1.00 40.46  ? 108  U   A C2    1 
ATOM   2126  O  O2    . U   A  1  107  ? 61.512  152.900 27.272  1.00 42.27  ? 108  U   A O2    1 
ATOM   2127  N  N3    . U   A  1  107  ? 62.298  152.495 25.182  1.00 41.89  ? 108  U   A N3    1 
ATOM   2128  C  C4    . U   A  1  107  ? 62.924  152.841 23.994  1.00 41.28  ? 108  U   A C4    1 
ATOM   2129  O  O4    . U   A  1  107  ? 63.029  152.004 23.089  1.00 42.50  ? 108  U   A O4    1 
ATOM   2130  C  C5    . U   A  1  107  ? 63.365  154.202 23.933  1.00 41.21  ? 108  U   A C5    1 
ATOM   2131  C  C6    . U   A  1  107  ? 63.152  155.020 24.975  1.00 40.31  ? 108  U   A C6    1 
ATOM   2132  P  P     . U   A  1  108  ? 66.691  156.702 28.954  1.00 31.66  ? 109  U   A P     1 
ATOM   2133  O  OP1   . U   A  1  108  ? 67.317  157.122 27.688  1.00 33.00  ? 109  U   A OP1   1 
ATOM   2134  O  OP2   . U   A  1  108  ? 66.736  155.282 29.338  1.00 30.74  ? 109  U   A OP2   1 
ATOM   2135  O  "O5'" . U   A  1  108  ? 67.269  157.628 30.118  1.00 30.99  ? 109  U   A "O5'" 1 
ATOM   2136  C  "C5'" . U   A  1  108  ? 67.547  159.036 29.875  1.00 30.09  ? 109  U   A "C5'" 1 
ATOM   2137  C  "C4'" . U   A  1  108  ? 67.748  159.793 31.175  1.00 29.97  ? 109  U   A "C4'" 1 
ATOM   2138  O  "O4'" . U   A  1  108  ? 66.484  159.998 31.845  1.00 31.59  ? 109  U   A "O4'" 1 
ATOM   2139  C  "C3'" . U   A  1  108  ? 68.664  159.148 32.199  1.00 29.56  ? 109  U   A "C3'" 1 
ATOM   2140  O  "O3'" . U   A  1  108  ? 70.018  159.500 31.961  1.00 27.52  ? 109  U   A "O3'" 1 
ATOM   2141  C  "C2'" . U   A  1  108  ? 68.148  159.705 33.516  1.00 32.02  ? 109  U   A "C2'" 1 
ATOM   2142  O  "O2'" . U   A  1  108  ? 68.650  161.000 33.781  1.00 33.38  ? 109  U   A "O2'" 1 
ATOM   2143  C  "C1'" . U   A  1  108  ? 66.641  159.790 33.241  1.00 33.29  ? 109  U   A "C1'" 1 
ATOM   2144  N  N1    . U   A  1  108  ? 65.838  158.608 33.620  1.00 35.65  ? 109  U   A N1    1 
ATOM   2145  C  C2    . U   A  1  108  ? 65.840  158.202 34.942  1.00 36.39  ? 109  U   A C2    1 
ATOM   2146  O  O2    . U   A  1  108  ? 66.512  158.742 35.802  1.00 38.38  ? 109  U   A O2    1 
ATOM   2147  N  N3    . U   A  1  108  ? 65.031  157.126 35.221  1.00 37.66  ? 109  U   A N3    1 
ATOM   2148  C  C4    . U   A  1  108  ? 64.251  156.415 34.333  1.00 36.44  ? 109  U   A C4    1 
ATOM   2149  O  O4    . U   A  1  108  ? 63.592  155.460 34.738  1.00 35.48  ? 109  U   A O4    1 
ATOM   2150  C  C5    . U   A  1  108  ? 64.316  156.878 32.981  1.00 37.01  ? 109  U   A C5    1 
ATOM   2151  C  C6    . U   A  1  108  ? 65.086  157.929 32.678  1.00 36.18  ? 109  U   A C6    1 
ATOM   2152  P  P     . C   A  1  109  ? 71.101  158.348 31.690  1.00 29.17  ? 110  C   A P     1 
ATOM   2153  O  OP1   . C   A  1  109  ? 72.325  158.968 31.139  1.00 28.60  ? 110  C   A OP1   1 
ATOM   2154  O  OP2   . C   A  1  109  ? 70.454  157.248 30.941  1.00 26.42  ? 110  C   A OP2   1 
ATOM   2155  O  "O5'" . C   A  1  109  ? 71.461  157.870 33.155  1.00 27.97  ? 110  C   A "O5'" 1 
ATOM   2156  C  "C5'" . C   A  1  109  ? 72.008  158.812 34.070  1.00 30.04  ? 110  C   A "C5'" 1 
ATOM   2157  C  "C4'" . C   A  1  109  ? 71.920  158.285 35.469  1.00 30.54  ? 110  C   A "C4'" 1 
ATOM   2158  O  "O4'" . C   A  1  109  ? 70.534  158.264 35.902  1.00 31.69  ? 110  C   A "O4'" 1 
ATOM   2159  C  "C3'" . C   A  1  109  ? 72.389  156.850 35.646  1.00 29.72  ? 110  C   A "C3'" 1 
ATOM   2160  O  "O3'" . C   A  1  109  ? 73.805  156.793 35.743  1.00 27.17  ? 110  C   A "O3'" 1 
ATOM   2161  C  "C2'" . C   A  1  109  ? 71.701  156.480 36.948  1.00 32.15  ? 110  C   A "C2'" 1 
ATOM   2162  O  "O2'" . C   A  1  109  ? 72.346  157.078 38.046  1.00 32.05  ? 110  C   A "O2'" 1 
ATOM   2163  C  "C1'" . C   A  1  109  ? 70.335  157.150 36.760  1.00 33.42  ? 110  C   A "C1'" 1 
ATOM   2164  N  N1    . C   A  1  109  ? 69.340  156.235 36.160  1.00 35.08  ? 110  C   A N1    1 
ATOM   2165  C  C2    . C   A  1  109  ? 68.682  155.312 36.996  1.00 35.24  ? 110  C   A C2    1 
ATOM   2166  O  O2    . C   A  1  109  ? 68.872  155.362 38.232  1.00 34.70  ? 110  C   A O2    1 
ATOM   2167  N  N3    . C   A  1  109  ? 67.849  154.398 36.440  1.00 36.14  ? 110  C   A N3    1 
ATOM   2168  C  C4    . C   A  1  109  ? 67.642  154.397 35.121  1.00 36.55  ? 110  C   A C4    1 
ATOM   2169  N  N4    . C   A  1  109  ? 66.861  153.441 34.613  1.00 35.47  ? 110  C   A N4    1 
ATOM   2170  C  C5    . C   A  1  109  ? 68.242  155.365 34.263  1.00 36.46  ? 110  C   A C5    1 
ATOM   2171  C  C6    . C   A  1  109  ? 69.077  156.254 34.817  1.00 36.06  ? 110  C   A C6    1 
ATOM   2172  P  P     . C   A  1  110  ? 74.593  155.498 35.222  1.00 27.79  ? 111  C   A P     1 
ATOM   2173  O  OP1   . C   A  1  110  ? 76.028  155.780 35.291  1.00 27.58  ? 111  C   A OP1   1 
ATOM   2174  O  OP2   . C   A  1  110  ? 74.003  155.071 33.943  1.00 29.46  ? 111  C   A OP2   1 
ATOM   2175  O  "O5'" . C   A  1  110  ? 74.283  154.396 36.321  1.00 27.48  ? 111  C   A "O5'" 1 
ATOM   2176  C  "C5'" . C   A  1  110  ? 74.801  154.560 37.645  1.00 25.74  ? 111  C   A "C5'" 1 
ATOM   2177  C  "C4'" . C   A  1  110  ? 74.235  153.510 38.589  1.00 25.29  ? 111  C   A "C4'" 1 
ATOM   2178  O  "O4'" . C   A  1  110  ? 72.798  153.676 38.741  1.00 25.12  ? 111  C   A "O4'" 1 
ATOM   2179  C  "C3'" . C   A  1  110  ? 74.433  152.037 38.240  1.00 22.67  ? 111  C   A "C3'" 1 
ATOM   2180  O  "O3'" . C   A  1  110  ? 75.726  151.638 38.695  1.00 21.03  ? 111  C   A "O3'" 1 
ATOM   2181  C  "C2'" . C   A  1  110  ? 73.329  151.372 39.059  1.00 24.35  ? 111  C   A "C2'" 1 
ATOM   2182  O  "O2'" . C   A  1  110  ? 73.679  151.198 40.409  1.00 24.14  ? 111  C   A "O2'" 1 
ATOM   2183  C  "C1'" . C   A  1  110  ? 72.200  152.411 38.984  1.00 27.27  ? 111  C   A "C1'" 1 
ATOM   2184  N  N1    . C   A  1  110  ? 71.227  152.151 37.904  1.00 30.82  ? 111  C   A N1    1 
ATOM   2185  C  C2    . C   A  1  110  ? 70.232  151.163 38.075  1.00 30.16  ? 111  C   A C2    1 
ATOM   2186  O  O2    . C   A  1  110  ? 70.126  150.595 39.166  1.00 30.96  ? 111  C   A O2    1 
ATOM   2187  N  N3    . C   A  1  110  ? 69.413  150.875 37.038  1.00 30.57  ? 111  C   A N3    1 
ATOM   2188  C  C4    . C   A  1  110  ? 69.538  151.545 35.885  1.00 30.32  ? 111  C   A C4    1 
ATOM   2189  N  N4    . C   A  1  110  ? 68.747  151.213 34.869  1.00 30.52  ? 111  C   A N4    1 
ATOM   2190  C  C5    . C   A  1  110  ? 70.494  152.585 35.714  1.00 31.42  ? 111  C   A C5    1 
ATOM   2191  C  C6    . C   A  1  110  ? 71.308  152.849 36.732  1.00 30.84  ? 111  C   A C6    1 
ATOM   2192  P  P     . G   A  1  111  ? 76.471  150.374 38.047  1.00 21.45  ? 112  G   A P     1 
ATOM   2193  O  OP1   . G   A  1  111  ? 77.502  149.963 39.007  1.00 20.68  ? 112  G   A OP1   1 
ATOM   2194  O  OP2   . G   A  1  111  ? 76.858  150.686 36.662  1.00 22.78  ? 112  G   A OP2   1 
ATOM   2195  O  "O5'" . G   A  1  111  ? 75.353  149.245 38.008  1.00 23.46  ? 112  G   A "O5'" 1 
ATOM   2196  C  "C5'" . G   A  1  111  ? 74.875  148.609 39.216  1.00 23.01  ? 112  G   A "C5'" 1 
ATOM   2197  C  "C4'" . G   A  1  111  ? 73.709  147.704 38.900  1.00 23.90  ? 112  G   A "C4'" 1 
ATOM   2198  O  "O4'" . G   A  1  111  ? 72.591  148.467 38.378  1.00 25.07  ? 112  G   A "O4'" 1 
ATOM   2199  C  "C3'" . G   A  1  111  ? 73.986  146.676 37.822  1.00 22.65  ? 112  G   A "C3'" 1 
ATOM   2200  O  "O3'" . G   A  1  111  ? 74.603  145.561 38.400  1.00 21.13  ? 112  G   A "O3'" 1 
ATOM   2201  C  "C2'" . G   A  1  111  ? 72.597  146.329 37.326  1.00 24.11  ? 112  G   A "C2'" 1 
ATOM   2202  O  "O2'" . G   A  1  111  ? 71.929  145.391 38.140  1.00 23.47  ? 112  G   A "O2'" 1 
ATOM   2203  C  "C1'" . G   A  1  111  ? 71.918  147.697 37.388  1.00 27.32  ? 112  G   A "C1'" 1 
ATOM   2204  N  N9    . G   A  1  111  ? 72.022  148.395 36.111  1.00 30.59  ? 112  G   A N9    1 
ATOM   2205  C  C8    . G   A  1  111  ? 73.018  149.260 35.733  1.00 31.61  ? 112  G   A C8    1 
ATOM   2206  N  N7    . G   A  1  111  ? 72.838  149.755 34.544  1.00 32.84  ? 112  G   A N7    1 
ATOM   2207  C  C5    . G   A  1  111  ? 71.653  149.183 34.105  1.00 31.18  ? 112  G   A C5    1 
ATOM   2208  C  C6    . G   A  1  111  ? 70.953  149.362 32.897  1.00 32.04  ? 112  G   A C6    1 
ATOM   2209  O  O6    . G   A  1  111  ? 71.234  150.106 31.952  1.00 32.21  ? 112  G   A O6    1 
ATOM   2210  N  N1    . G   A  1  111  ? 69.813  148.573 32.847  1.00 32.26  ? 112  G   A N1    1 
ATOM   2211  C  C2    . G   A  1  111  ? 69.400  147.729 33.838  1.00 31.41  ? 112  G   A C2    1 
ATOM   2212  N  N2    . G   A  1  111  ? 68.284  147.037 33.592  1.00 31.68  ? 112  G   A N2    1 
ATOM   2213  N  N3    . G   A  1  111  ? 70.034  147.570 34.982  1.00 30.92  ? 112  G   A N3    1 
ATOM   2214  C  C4    . G   A  1  111  ? 71.146  148.326 35.049  1.00 30.69  ? 112  G   A C4    1 
ATOM   2215  P  P     . A   A  1  112  ? 75.915  144.952 37.734  1.00 23.90  ? 113  A   A P     1 
ATOM   2216  O  OP1   . A   A  1  112  ? 76.453  144.059 38.772  1.00 23.02  ? 113  A   A OP1   1 
ATOM   2217  O  OP2   . A   A  1  112  ? 76.760  146.041 37.191  1.00 24.15  ? 113  A   A OP2   1 
ATOM   2218  O  "O5'" . A   A  1  112  ? 75.383  144.065 36.523  1.00 24.67  ? 113  A   A "O5'" 1 
ATOM   2219  C  "C5'" . A   A  1  112  ? 75.160  142.655 36.722  1.00 27.07  ? 113  A   A "C5'" 1 
ATOM   2220  C  "C4'" . A   A  1  112  ? 75.725  141.854 35.578  1.00 27.41  ? 113  A   A "C4'" 1 
ATOM   2221  O  "O4'" . A   A  1  112  ? 74.908  142.023 34.395  1.00 27.46  ? 113  A   A "O4'" 1 
ATOM   2222  C  "C3'" . A   A  1  112  ? 77.091  142.248 35.039  1.00 28.40  ? 113  A   A "C3'" 1 
ATOM   2223  O  "O3'" . A   A  1  112  ? 78.204  141.830 35.833  1.00 28.20  ? 113  A   A "O3'" 1 
ATOM   2224  C  "C2'" . A   A  1  112  ? 77.127  141.523 33.690  1.00 28.38  ? 113  A   A "C2'" 1 
ATOM   2225  O  "O2'" . A   A  1  112  ? 77.571  140.185 33.779  1.00 27.22  ? 113  A   A "O2'" 1 
ATOM   2226  C  "C1'" . A   A  1  112  ? 75.649  141.530 33.285  1.00 28.87  ? 113  A   A "C1'" 1 
ATOM   2227  N  N9    . A   A  1  112  ? 75.330  142.322 32.102  1.00 30.53  ? 113  A   A N9    1 
ATOM   2228  C  C8    . A   A  1  112  ? 76.017  143.379 31.561  1.00 31.62  ? 113  A   A C8    1 
ATOM   2229  N  N7    . A   A  1  112  ? 75.444  143.889 30.505  1.00 31.85  ? 113  A   A N7    1 
ATOM   2230  C  C5    . A   A  1  112  ? 74.305  143.117 30.336  1.00 31.42  ? 113  A   A C5    1 
ATOM   2231  C  C6    . A   A  1  112  ? 73.267  143.162 29.398  1.00 31.31  ? 113  A   A C6    1 
ATOM   2232  N  N6    . A   A  1  112  ? 73.173  144.084 28.441  1.00 31.70  ? 113  A   A N6    1 
ATOM   2233  N  N1    . A   A  1  112  ? 72.300  142.231 29.488  1.00 32.40  ? 113  A   A N1    1 
ATOM   2234  C  C2    . A   A  1  112  ? 72.365  141.337 30.474  1.00 33.19  ? 113  A   A C2    1 
ATOM   2235  N  N3    . A   A  1  112  ? 73.273  141.205 31.429  1.00 32.78  ? 113  A   A N3    1 
ATOM   2236  C  C4    . A   A  1  112  ? 74.229  142.140 31.302  1.00 31.51  ? 113  A   A C4    1 
ATOM   2237  P  P     . A   A  1  113  ? 79.688  142.248 35.380  1.00 28.49  ? 114  A   A P     1 
ATOM   2238  O  OP1   . A   A  1  113  ? 80.200  141.258 34.384  1.00 28.13  ? 114  A   A OP1   1 
ATOM   2239  O  OP2   . A   A  1  113  ? 80.472  142.546 36.592  1.00 28.03  ? 114  A   A OP2   1 
ATOM   2240  O  "O5'" . A   A  1  113  ? 79.457  143.611 34.589  1.00 28.37  ? 114  A   A "O5'" 1 
ATOM   2241  C  "C5'" . A   A  1  113  ? 78.903  144.790 35.248  1.00 27.07  ? 114  A   A "C5'" 1 
ATOM   2242  C  "C4'" . A   A  1  113  ? 78.959  145.973 34.308  1.00 26.71  ? 114  A   A "C4'" 1 
ATOM   2243  O  "O4'" . A   A  1  113  ? 77.869  145.854 33.351  1.00 26.25  ? 114  A   A "O4'" 1 
ATOM   2244  C  "C3'" . A   A  1  113  ? 78.830  147.366 34.930  1.00 26.47  ? 114  A   A "C3'" 1 
ATOM   2245  O  "O3'" . A   A  1  113  ? 79.514  148.329 34.105  1.00 24.90  ? 114  A   A "O3'" 1 
ATOM   2246  C  "C2'" . A   A  1  113  ? 77.335  147.630 34.773  1.00 27.66  ? 114  A   A "C2'" 1 
ATOM   2247  O  "O2'" . A   A  1  113  ? 76.982  148.997 34.760  1.00 28.72  ? 114  A   A "O2'" 1 
ATOM   2248  C  "C1'" . A   A  1  113  ? 77.084  147.024 33.395  1.00 28.15  ? 114  A   A "C1'" 1 
ATOM   2249  N  N9    . A   A  1  113  ? 75.697  146.675 33.100  1.00 28.73  ? 114  A   A N9    1 
ATOM   2250  C  C8    . A   A  1  113  ? 74.918  145.723 33.696  1.00 29.84  ? 114  A   A C8    1 
ATOM   2251  N  N7    . A   A  1  113  ? 73.701  145.654 33.208  1.00 30.72  ? 114  A   A N7    1 
ATOM   2252  C  C5    . A   A  1  113  ? 73.680  146.627 32.222  1.00 30.84  ? 114  A   A C5    1 
ATOM   2253  C  C6    . A   A  1  113  ? 72.673  147.063 31.339  1.00 31.72  ? 114  A   A C6    1 
ATOM   2254  N  N6    . A   A  1  113  ? 71.430  146.565 31.318  1.00 32.04  ? 114  A   A N6    1 
ATOM   2255  N  N1    . A   A  1  113  ? 72.986  148.049 30.474  1.00 31.25  ? 114  A   A N1    1 
ATOM   2256  C  C2    . A   A  1  113  ? 74.223  148.567 30.515  1.00 32.00  ? 114  A   A C2    1 
ATOM   2257  N  N3    . A   A  1  113  ? 75.247  148.251 31.298  1.00 31.28  ? 114  A   A N3    1 
ATOM   2258  C  C4    . A   A  1  113  ? 74.907  147.260 32.139  1.00 30.01  ? 114  A   A C4    1 
ATOM   2259  P  P     . U   A  1  114  ? 81.126  148.393 34.062  1.00 27.05  ? 115  U   A P     1 
ATOM   2260  O  OP1   . U   A  1  114  ? 81.735  147.127 34.585  1.00 26.49  ? 115  U   A OP1   1 
ATOM   2261  O  OP2   . U   A  1  114  ? 81.528  149.690 34.649  1.00 25.94  ? 115  U   A OP2   1 
ATOM   2262  O  "O5'" . U   A  1  114  ? 81.436  148.440 32.497  1.00 29.54  ? 115  U   A "O5'" 1 
ATOM   2263  C  "C5'" . U   A  1  114  ? 82.772  148.697 31.992  1.00 33.21  ? 115  U   A "C5'" 1 
ATOM   2264  C  "C4'" . U   A  1  114  ? 82.798  148.534 30.485  1.00 35.14  ? 115  U   A "C4'" 1 
ATOM   2265  O  "O4'" . U   A  1  114  ? 82.647  147.124 30.145  1.00 34.66  ? 115  U   A "O4'" 1 
ATOM   2266  C  "C3'" . U   A  1  114  ? 81.661  149.257 29.775  1.00 37.71  ? 115  U   A "C3'" 1 
ATOM   2267  O  "O3'" . U   A  1  114  ? 82.061  149.643 28.456  1.00 41.57  ? 115  U   A "O3'" 1 
ATOM   2268  C  "C2'" . U   A  1  114  ? 80.594  148.168 29.726  1.00 36.65  ? 115  U   A "C2'" 1 
ATOM   2269  O  "O2'" . U   A  1  114  ? 79.599  148.392 28.748  1.00 37.43  ? 115  U   A "O2'" 1 
ATOM   2270  C  "C1'" . U   A  1  114  ? 81.446  146.932 29.425  1.00 35.91  ? 115  U   A "C1'" 1 
ATOM   2271  N  N1    . U   A  1  114  ? 80.832  145.657 29.840  1.00 36.27  ? 115  U   A N1    1 
ATOM   2272  C  C2    . U   A  1  114  ? 79.991  145.043 28.933  1.00 36.18  ? 115  U   A C2    1 
ATOM   2273  O  O2    . U   A  1  114  ? 79.806  145.470 27.800  1.00 35.70  ? 115  U   A O2    1 
ATOM   2274  N  N3    . U   A  1  114  ? 79.377  143.907 29.388  1.00 37.42  ? 115  U   A N3    1 
ATOM   2275  C  C4    . U   A  1  114  ? 79.522  143.315 30.627  1.00 38.08  ? 115  U   A C4    1 
ATOM   2276  O  O4    . U   A  1  114  ? 78.771  142.374 30.950  1.00 36.99  ? 115  U   A O4    1 
ATOM   2277  C  C5    . U   A  1  114  ? 80.453  143.980 31.490  1.00 37.62  ? 115  U   A C5    1 
ATOM   2278  C  C6    . U   A  1  114  ? 81.056  145.098 31.082  1.00 36.31  ? 115  U   A C6    1 
ATOM   2279  P  P     . G   A  1  115  ? 82.186  151.205 28.066  1.00 42.03  ? 116  G   A P     1 
ATOM   2280  O  OP1   . G   A  1  115  ? 81.114  151.988 28.745  1.00 42.39  ? 116  G   A OP1   1 
ATOM   2281  O  OP2   . G   A  1  115  ? 82.289  151.255 26.581  1.00 42.64  ? 116  G   A OP2   1 
ATOM   2282  O  "O5'" . G   A  1  115  ? 83.600  151.617 28.690  1.00 39.62  ? 116  G   A "O5'" 1 
ATOM   2283  C  "C5'" . G   A  1  115  ? 84.821  151.017 28.202  1.00 37.72  ? 116  G   A "C5'" 1 
ATOM   2284  C  "C4'" . G   A  1  115  ? 86.019  151.817 28.641  1.00 36.14  ? 116  G   A "C4'" 1 
ATOM   2285  O  "O4'" . G   A  1  115  ? 85.806  153.193 28.258  1.00 35.05  ? 116  G   A "O4'" 1 
ATOM   2286  C  "C3'" . G   A  1  115  ? 86.243  151.855 30.139  1.00 35.17  ? 116  G   A "C3'" 1 
ATOM   2287  O  "O3'" . G   A  1  115  ? 87.051  150.756 30.549  1.00 36.76  ? 116  G   A "O3'" 1 
ATOM   2288  C  "C2'" . G   A  1  115  ? 86.933  153.197 30.349  1.00 33.79  ? 116  G   A "C2'" 1 
ATOM   2289  O  "O2'" . G   A  1  115  ? 88.316  153.165 30.071  1.00 33.09  ? 116  G   A "O2'" 1 
ATOM   2290  C  "C1'" . G   A  1  115  ? 86.245  154.055 29.291  1.00 32.39  ? 116  G   A "C1'" 1 
ATOM   2291  N  N9    . G   A  1  115  ? 85.085  154.797 29.759  1.00 29.69  ? 116  G   A N9    1 
ATOM   2292  C  C8    . G   A  1  115  ? 83.778  154.573 29.415  1.00 29.20  ? 116  G   A C8    1 
ATOM   2293  N  N7    . G   A  1  115  ? 82.958  155.437 29.937  1.00 29.13  ? 116  G   A N7    1 
ATOM   2294  C  C5    . G   A  1  115  ? 83.775  156.272 30.686  1.00 29.28  ? 116  G   A C5    1 
ATOM   2295  C  C6    . G   A  1  115  ? 83.454  157.394 31.469  1.00 30.19  ? 116  G   A C6    1 
ATOM   2296  O  O6    . G   A  1  115  ? 82.337  157.897 31.672  1.00 30.69  ? 116  G   A O6    1 
ATOM   2297  N  N1    . G   A  1  115  ? 84.588  157.945 32.055  1.00 28.20  ? 116  G   A N1    1 
ATOM   2298  C  C2    . G   A  1  115  ? 85.858  157.462 31.911  1.00 27.40  ? 116  G   A C2    1 
ATOM   2299  N  N2    . G   A  1  115  ? 86.810  158.115 32.574  1.00 29.42  ? 116  G   A N2    1 
ATOM   2300  N  N3    . G   A  1  115  ? 86.169  156.418 31.181  1.00 28.49  ? 116  G   A N3    1 
ATOM   2301  C  C4    . G   A  1  115  ? 85.087  155.877 30.598  1.00 28.97  ? 116  G   A C4    1 
ATOM   2302  P  P     . A   A  1  116  ? 86.907  150.174 32.043  1.00 37.99  ? 117  A   A P     1 
ATOM   2303  O  OP1   . A   A  1  116  ? 87.880  149.046 32.159  1.00 34.85  ? 117  A   A OP1   1 
ATOM   2304  O  OP2   . A   A  1  116  ? 85.462  149.922 32.249  1.00 38.74  ? 117  A   A OP2   1 
ATOM   2305  O  "O5'" . A   A  1  116  ? 87.338  151.379 33.008  1.00 35.37  ? 117  A   A "O5'" 1 
ATOM   2306  C  "C5'" . A   A  1  116  ? 88.725  151.768 33.151  1.00 33.01  ? 117  A   A "C5'" 1 
ATOM   2307  C  "C4'" . A   A  1  116  ? 88.861  152.928 34.117  1.00 30.37  ? 117  A   A "C4'" 1 
ATOM   2308  O  "O4'" . A   A  1  116  ? 88.264  154.119 33.553  1.00 30.02  ? 117  A   A "O4'" 1 
ATOM   2309  C  "C3'" . A   A  1  116  ? 88.127  152.757 35.430  1.00 30.48  ? 117  A   A "C3'" 1 
ATOM   2310  O  "O3'" . A   A  1  116  ? 88.813  151.934 36.361  1.00 32.17  ? 117  A   A "O3'" 1 
ATOM   2311  C  "C2'" . A   A  1  116  ? 87.941  154.187 35.905  1.00 29.53  ? 117  A   A "C2'" 1 
ATOM   2312  O  "O2'" . A   A  1  116  ? 89.068  154.719 36.563  1.00 31.21  ? 117  A   A "O2'" 1 
ATOM   2313  C  "C1'" . A   A  1  116  ? 87.678  154.896 34.580  1.00 28.61  ? 117  A   A "C1'" 1 
ATOM   2314  N  N9    . A   A  1  116  ? 86.249  155.013 34.313  1.00 27.11  ? 117  A   A N9    1 
ATOM   2315  C  C8    . A   A  1  116  ? 85.465  154.219 33.517  1.00 27.16  ? 117  A   A C8    1 
ATOM   2316  N  N7    . A   A  1  116  ? 84.193  154.554 33.527  1.00 26.29  ? 117  A   A N7    1 
ATOM   2317  C  C5    . A   A  1  116  ? 84.142  155.646 34.380  1.00 27.11  ? 117  A   A C5    1 
ATOM   2318  C  C6    . A   A  1  116  ? 83.079  156.453 34.826  1.00 28.50  ? 117  A   A C6    1 
ATOM   2319  N  N6    . A   A  1  116  ? 81.806  156.256 34.475  1.00 28.61  ? 117  A   A N6    1 
ATOM   2320  N  N1    . A   A  1  116  ? 83.370  157.471 35.663  1.00 27.54  ? 117  A   A N1    1 
ATOM   2321  C  C2    . A   A  1  116  ? 84.638  157.650 36.032  1.00 29.57  ? 117  A   A C2    1 
ATOM   2322  N  N3    . A   A  1  116  ? 85.721  156.955 35.696  1.00 29.13  ? 117  A   A N3    1 
ATOM   2323  C  C4    . A   A  1  116  ? 85.404  155.953 34.856  1.00 27.93  ? 117  A   A C4    1 
ATOM   2324  P  P     . G   A  1  117  ? 87.964  150.952 37.303  1.00 34.34  ? 118  G   A P     1 
ATOM   2325  O  OP1   . G   A  1  117  ? 88.881  149.996 37.968  1.00 33.19  ? 118  G   A OP1   1 
ATOM   2326  O  OP2   . G   A  1  117  ? 86.849  150.446 36.469  1.00 33.87  ? 118  G   A OP2   1 
ATOM   2327  O  "O5'" . G   A  1  117  ? 87.376  151.910 38.428  1.00 30.25  ? 118  G   A "O5'" 1 
ATOM   2328  C  "C5'" . G   A  1  117  ? 88.249  152.432 39.430  1.00 28.84  ? 118  G   A "C5'" 1 
ATOM   2329  C  "C4'" . G   A  1  117  ? 87.668  153.663 40.050  1.00 27.99  ? 118  G   A "C4'" 1 
ATOM   2330  O  "O4'" . G   A  1  117  ? 87.235  154.588 39.023  1.00 26.91  ? 118  G   A "O4'" 1 
ATOM   2331  C  "C3'" . G   A  1  117  ? 86.414  153.476 40.861  1.00 27.74  ? 118  G   A "C3'" 1 
ATOM   2332  O  "O3'" . G   A  1  117  ? 86.697  152.955 42.148  1.00 29.15  ? 118  G   A "O3'" 1 
ATOM   2333  C  "C2'" . G   A  1  117  ? 85.899  154.901 40.952  1.00 26.71  ? 118  G   A "C2'" 1 
ATOM   2334  O  "O2'" . G   A  1  117  ? 86.569  155.655 41.934  1.00 27.11  ? 118  G   A "O2'" 1 
ATOM   2335  C  "C1'" . G   A  1  117  ? 86.211  155.423 39.549  1.00 25.13  ? 118  G   A "C1'" 1 
ATOM   2336  N  N9    . G   A  1  117  ? 85.021  155.297 38.716  1.00 24.06  ? 118  G   A N9    1 
ATOM   2337  C  C8    . G   A  1  117  ? 84.816  154.436 37.662  1.00 24.59  ? 118  G   A C8    1 
ATOM   2338  N  N7    . G   A  1  117  ? 83.600  154.490 37.191  1.00 22.88  ? 118  G   A N7    1 
ATOM   2339  C  C5    . G   A  1  117  ? 82.976  155.459 37.962  1.00 22.86  ? 118  G   A C5    1 
ATOM   2340  C  C6    . G   A  1  117  ? 81.642  155.931 37.934  1.00 24.43  ? 118  G   A C6    1 
ATOM   2341  O  O6    . G   A  1  117  ? 80.708  155.560 37.214  1.00 25.17  ? 118  G   A O6    1 
ATOM   2342  N  N1    . G   A  1  117  ? 81.436  156.925 38.881  1.00 24.61  ? 118  G   A N1    1 
ATOM   2343  C  C2    . G   A  1  117  ? 82.391  157.396 39.754  1.00 24.08  ? 118  G   A C2    1 
ATOM   2344  N  N2    . G   A  1  117  ? 81.995  158.358 40.601  1.00 23.12  ? 118  G   A N2    1 
ATOM   2345  N  N3    . G   A  1  117  ? 83.632  156.956 39.795  1.00 22.33  ? 118  G   A N3    1 
ATOM   2346  C  C4    . G   A  1  117  ? 83.851  155.992 38.882  1.00 22.38  ? 118  G   A C4    1 
ATOM   2347  P  P     . A   A  1  118  ? 85.596  152.046 42.884  1.00 32.38  ? 119  A   A P     1 
ATOM   2348  O  OP1   . A   A  1  118  ? 86.190  151.522 44.142  1.00 33.17  ? 119  A   A OP1   1 
ATOM   2349  O  OP2   . A   A  1  118  ? 85.069  151.089 41.870  1.00 33.13  ? 119  A   A OP2   1 
ATOM   2350  O  "O5'" . A   A  1  118  ? 84.422  153.064 43.247  1.00 28.95  ? 119  A   A "O5'" 1 
ATOM   2351  C  "C5'" . A   A  1  118  ? 84.596  154.028 44.298  1.00 27.36  ? 119  A   A "C5'" 1 
ATOM   2352  C  "C4'" . A   A  1  118  ? 83.346  154.848 44.471  1.00 26.57  ? 119  A   A "C4'" 1 
ATOM   2353  O  "O4'" . A   A  1  118  ? 83.019  155.475 43.213  1.00 27.30  ? 119  A   A "O4'" 1 
ATOM   2354  C  "C3'" . A   A  1  118  ? 82.083  154.090 44.835  1.00 26.49  ? 119  A   A "C3'" 1 
ATOM   2355  O  "O3'" . A   A  1  118  ? 82.011  153.889 46.231  1.00 25.80  ? 119  A   A "O3'" 1 
ATOM   2356  C  "C2'" . A   A  1  118  ? 80.990  155.034 44.373  1.00 25.86  ? 119  A   A "C2'" 1 
ATOM   2357  O  "O2'" . A   A  1  118  ? 80.775  156.077 45.289  1.00 25.81  ? 119  A   A "O2'" 1 
ATOM   2358  C  "C1'" . A   A  1  118  ? 81.611  155.593 43.095  1.00 27.20  ? 119  A   A "C1'" 1 
ATOM   2359  N  N9    . A   A  1  118  ? 81.196  154.861 41.904  1.00 28.37  ? 119  A   A N9    1 
ATOM   2360  C  C8    . A   A  1  118  ? 81.911  153.962 41.151  1.00 29.34  ? 119  A   A C8    1 
ATOM   2361  N  N7    . A   A  1  118  ? 81.252  153.506 40.118  1.00 29.71  ? 119  A   A N7    1 
ATOM   2362  C  C5    . A   A  1  118  ? 80.021  154.140 40.201  1.00 28.94  ? 119  A   A C5    1 
ATOM   2363  C  C6    . A   A  1  118  ? 78.879  154.086 39.394  1.00 29.47  ? 119  A   A C6    1 
ATOM   2364  N  N6    . A   A  1  118  ? 78.803  153.372 38.258  1.00 27.67  ? 119  A   A N6    1 
ATOM   2365  N  N1    . A   A  1  118  ? 77.806  154.813 39.781  1.00 31.81  ? 119  A   A N1    1 
ATOM   2366  C  C2    . A   A  1  118  ? 77.902  155.562 40.888  1.00 30.55  ? 119  A   A C2    1 
ATOM   2367  N  N3    . A   A  1  118  ? 78.933  155.716 41.703  1.00 29.37  ? 119  A   A N3    1 
ATOM   2368  C  C4    . A   A  1  118  ? 79.969  154.966 41.302  1.00 28.28  ? 119  A   A C4    1 
ATOM   2369  P  P     . A   A  1  119  ? 80.946  152.855 46.834  1.00 24.81  ? 120  A   A P     1 
ATOM   2370  O  OP1   . A   A  1  119  ? 81.326  152.708 48.276  1.00 24.56  ? 120  A   A OP1   1 
ATOM   2371  O  OP2   . A   A  1  119  ? 80.912  151.666 45.939  1.00 20.36  ? 120  A   A OP2   1 
ATOM   2372  O  "O5'" . A   A  1  119  ? 79.556  153.635 46.767  1.00 23.65  ? 120  A   A "O5'" 1 
ATOM   2373  C  "C5'" . A   A  1  119  ? 78.530  153.253 45.848  1.00 23.40  ? 120  A   A "C5'" 1 
ATOM   2374  C  "C4'" . A   A  1  119  ? 77.188  153.252 46.542  1.00 23.62  ? 120  A   A "C4'" 1 
ATOM   2375  O  "O4'" . A   A  1  119  ? 77.388  152.638 47.843  1.00 23.25  ? 120  A   A "O4'" 1 
ATOM   2376  C  "C3'" . A   A  1  119  ? 76.550  154.595 46.902  1.00 21.49  ? 120  A   A "C3'" 1 
ATOM   2377  O  "O3'" . A   A  1  119  ? 75.858  155.211 45.817  1.00 22.51  ? 120  A   A "O3'" 1 
ATOM   2378  C  "C2'" . A   A  1  119  ? 75.583  154.172 47.993  1.00 21.78  ? 120  A   A "C2'" 1 
ATOM   2379  O  "O2'" . A   A  1  119  ? 74.462  153.477 47.489  1.00 20.08  ? 120  A   A "O2'" 1 
ATOM   2380  C  "C1'" . A   A  1  119  ? 76.432  153.156 48.757  1.00 22.55  ? 120  A   A "C1'" 1 
ATOM   2381  N  N9    . A   A  1  119  ? 77.122  153.730 49.919  1.00 22.34  ? 120  A   A N9    1 
ATOM   2382  C  C8    . A   A  1  119  ? 78.388  153.457 50.394  1.00 22.77  ? 120  A   A C8    1 
ATOM   2383  N  N7    . A   A  1  119  ? 78.692  154.108 51.491  1.00 21.39  ? 120  A   A N7    1 
ATOM   2384  C  C5    . A   A  1  119  ? 77.560  154.871 51.751  1.00 21.97  ? 120  A   A C5    1 
ATOM   2385  C  C6    . A   A  1  119  ? 77.247  155.782 52.777  1.00 22.29  ? 120  A   A C6    1 
ATOM   2386  N  N6    . A   A  1  119  ? 78.069  156.064 53.786  1.00 25.01  ? 120  A   A N6    1 
ATOM   2387  N  N1    . A   A  1  119  ? 76.041  156.394 52.736  1.00 23.38  ? 120  A   A N1    1 
ATOM   2388  C  C2    . A   A  1  119  ? 75.205  156.082 51.737  1.00 25.45  ? 120  A   A C2    1 
ATOM   2389  N  N3    . A   A  1  119  ? 75.379  155.229 50.726  1.00 24.03  ? 120  A   A N3    1 
ATOM   2390  C  C4    . A   A  1  119  ? 76.592  154.656 50.788  1.00 21.83  ? 120  A   A C4    1 
ATOM   2391  P  P     . U   A  1  120  ? 75.486  156.774 45.889  1.00 22.75  ? 121  U   A P     1 
ATOM   2392  O  OP1   . U   A  1  120  ? 76.729  157.544 45.689  1.00 23.30  ? 121  U   A OP1   1 
ATOM   2393  O  OP2   . U   A  1  120  ? 74.710  156.998 47.102  1.00 20.14  ? 121  U   A OP2   1 
ATOM   2394  O  "O5'" . U   A  1  120  ? 74.564  157.012 44.612  1.00 22.92  ? 121  U   A "O5'" 1 
ATOM   2395  C  "C5'" . U   A  1  120  ? 75.081  156.820 43.274  1.00 24.42  ? 121  U   A "C5'" 1 
ATOM   2396  C  "C4'" . U   A  1  120  ? 73.962  156.460 42.308  1.00 26.78  ? 121  U   A "C4'" 1 
ATOM   2397  O  "O4'" . U   A  1  120  ? 73.516  155.106 42.550  1.00 28.85  ? 121  U   A "O4'" 1 
ATOM   2398  C  "C3'" . U   A  1  120  ? 72.695  157.299 42.404  1.00 26.58  ? 121  U   A "C3'" 1 
ATOM   2399  O  "O3'" . U   A  1  120  ? 72.845  158.485 41.607  1.00 26.81  ? 121  U   A "O3'" 1 
ATOM   2400  C  "C2'" . U   A  1  120  ? 71.608  156.367 41.845  1.00 27.53  ? 121  U   A "C2'" 1 
ATOM   2401  O  "O2'" . U   A  1  120  ? 71.390  156.440 40.448  1.00 28.96  ? 121  U   A "O2'" 1 
ATOM   2402  C  "C1'" . U   A  1  120  ? 72.147  154.977 42.200  1.00 28.61  ? 121  U   A "C1'" 1 
ATOM   2403  N  N1    . U   A  1  120  ? 71.441  154.289 43.291  1.00 30.81  ? 121  U   A N1    1 
ATOM   2404  C  C2    . U   A  1  120  ? 70.387  153.445 42.957  1.00 32.74  ? 121  U   A C2    1 
ATOM   2405  O  O2    . U   A  1  120  ? 70.014  153.253 41.806  1.00 33.73  ? 121  U   A O2    1 
ATOM   2406  N  N3    . U   A  1  120  ? 69.782  152.833 44.023  1.00 33.01  ? 121  U   A N3    1 
ATOM   2407  C  C4    . U   A  1  120  ? 70.107  152.976 45.353  1.00 31.94  ? 121  U   A C4    1 
ATOM   2408  O  O4    . U   A  1  120  ? 69.435  152.395 46.209  1.00 31.88  ? 121  U   A O4    1 
ATOM   2409  C  C5    . U   A  1  120  ? 71.198  153.860 45.608  1.00 31.19  ? 121  U   A C5    1 
ATOM   2410  C  C6    . U   A  1  120  ? 71.811  154.469 44.599  1.00 30.85  ? 121  U   A C6    1 
ATOM   2411  P  P     . C   A  1  121  ? 71.892  159.760 41.844  1.00 29.00  ? 122  C   A P     1 
ATOM   2412  O  OP1   . C   A  1  121  ? 70.929  159.427 42.913  1.00 30.56  ? 122  C   A OP1   1 
ATOM   2413  O  OP2   . C   A  1  121  ? 71.381  160.226 40.538  1.00 27.61  ? 122  C   A OP2   1 
ATOM   2414  O  "O5'" . C   A  1  121  ? 72.902  160.853 42.396  1.00 27.22  ? 122  C   A "O5'" 1 
ATOM   2415  C  "C5'" . C   A  1  121  ? 73.854  161.474 41.515  1.00 29.39  ? 122  C   A "C5'" 1 
ATOM   2416  C  "C4'" . C   A  1  121  ? 75.243  161.389 42.102  1.00 28.36  ? 122  C   A "C4'" 1 
ATOM   2417  O  "O4'" . C   A  1  121  ? 75.640  159.993 42.139  1.00 27.00  ? 122  C   A "O4'" 1 
ATOM   2418  C  "C3'" . C   A  1  121  ? 76.350  162.040 41.281  1.00 30.26  ? 122  C   A "C3'" 1 
ATOM   2419  O  "O3'" . C   A  1  121  ? 76.446  163.428 41.499  1.00 34.27  ? 122  C   A "O3'" 1 
ATOM   2420  C  "C2'" . C   A  1  121  ? 77.581  161.328 41.803  1.00 27.18  ? 122  C   A "C2'" 1 
ATOM   2421  O  "O2'" . C   A  1  121  ? 78.032  161.766 43.068  1.00 27.18  ? 122  C   A "O2'" 1 
ATOM   2422  C  "C1'" . C   A  1  121  ? 77.042  159.910 41.932  1.00 26.04  ? 122  C   A "C1'" 1 
ATOM   2423  N  N1    . C   A  1  121  ? 77.325  159.158 40.701  1.00 24.57  ? 122  C   A N1    1 
ATOM   2424  C  C2    . C   A  1  121  ? 78.607  158.627 40.546  1.00 23.81  ? 122  C   A C2    1 
ATOM   2425  O  O2    . C   A  1  121  ? 79.474  158.886 41.404  1.00 25.63  ? 122  C   A O2    1 
ATOM   2426  N  N3    . C   A  1  121  ? 78.887  157.863 39.477  1.00 22.35  ? 122  C   A N3    1 
ATOM   2427  C  C4    . C   A  1  121  ? 77.952  157.634 38.569  1.00 22.76  ? 122  C   A C4    1 
ATOM   2428  N  N4    . C   A  1  121  ? 78.262  156.822 37.553  1.00 23.63  ? 122  C   A N4    1 
ATOM   2429  C  C5    . C   A  1  121  ? 76.650  158.209 38.666  1.00 23.67  ? 122  C   A C5    1 
ATOM   2430  C  C6    . C   A  1  121  ? 76.381  158.961 39.738  1.00 24.04  ? 122  C   A C6    1 
ATOM   2431  P  P     . U   A  1  122  ? 76.974  164.381 40.324  1.00 37.64  ? 123  U   A P     1 
ATOM   2432  O  OP1   . U   A  1  122  ? 77.037  165.730 40.936  1.00 35.72  ? 123  U   A OP1   1 
ATOM   2433  O  OP2   . U   A  1  122  ? 76.116  164.149 39.123  1.00 35.96  ? 123  U   A OP2   1 
ATOM   2434  O  "O5'" . U   A  1  122  ? 78.452  163.864 40.001  1.00 35.61  ? 123  U   A "O5'" 1 
ATOM   2435  C  "C5'" . U   A  1  122  ? 79.546  164.203 40.860  1.00 37.30  ? 123  U   A "C5'" 1 
ATOM   2436  C  "C4'" . U   A  1  122  ? 80.835  163.550 40.394  1.00 38.41  ? 123  U   A "C4'" 1 
ATOM   2437  O  "O4'" . U   A  1  122  ? 80.584  162.145 40.154  1.00 38.16  ? 123  U   A "O4'" 1 
ATOM   2438  C  "C3'" . U   A  1  122  ? 81.471  163.967 39.068  1.00 39.06  ? 123  U   A "C3'" 1 
ATOM   2439  O  "O3'" . U   A  1  122  ? 82.186  165.197 39.128  1.00 43.25  ? 123  U   A "O3'" 1 
ATOM   2440  C  "C2'" . U   A  1  122  ? 82.458  162.831 38.865  1.00 37.96  ? 123  U   A "C2'" 1 
ATOM   2441  O  "O2'" . U   A  1  122  ? 83.617  162.899 39.661  1.00 38.90  ? 123  U   A "O2'" 1 
ATOM   2442  C  "C1'" . U   A  1  122  ? 81.640  161.642 39.354  1.00 36.68  ? 123  U   A "C1'" 1 
ATOM   2443  N  N1    . U   A  1  122  ? 81.104  160.907 38.203  1.00 34.04  ? 123  U   A N1    1 
ATOM   2444  C  C2    . U   A  1  122  ? 81.966  160.008 37.626  1.00 32.96  ? 123  U   A C2    1 
ATOM   2445  O  O2    . U   A  1  122  ? 83.112  159.858 38.021  1.00 31.01  ? 123  U   A O2    1 
ATOM   2446  N  N3    . U   A  1  122  ? 81.457  159.299 36.576  1.00 33.66  ? 123  U   A N3    1 
ATOM   2447  C  C4    . U   A  1  122  ? 80.190  159.397 36.050  1.00 34.04  ? 123  U   A C4    1 
ATOM   2448  O  O4    . U   A  1  122  ? 79.827  158.579 35.212  1.00 36.55  ? 123  U   A O4    1 
ATOM   2449  C  C5    . U   A  1  122  ? 79.354  160.381 36.675  1.00 33.71  ? 123  U   A C5    1 
ATOM   2450  C  C6    . U   A  1  122  ? 79.829  161.088 37.711  1.00 33.98  ? 123  U   A C6    1 
ATOM   2451  P  P     . C   A  1  123  ? 82.725  165.886 37.770  1.00 45.71  ? 124  C   A P     1 
ATOM   2452  O  OP1   . C   A  1  123  ? 83.240  167.216 38.182  1.00 47.29  ? 124  C   A OP1   1 
ATOM   2453  O  OP2   . C   A  1  123  ? 81.679  165.799 36.712  1.00 42.35  ? 124  C   A OP2   1 
ATOM   2454  O  "O5'" . C   A  1  123  ? 83.964  164.986 37.330  1.00 44.36  ? 124  C   A "O5'" 1 
ATOM   2455  C  "C5'" . C   A  1  123  ? 85.140  164.875 38.157  1.00 44.63  ? 124  C   A "C5'" 1 
ATOM   2456  C  "C4'" . C   A  1  123  ? 86.173  163.988 37.485  1.00 46.15  ? 124  C   A "C4'" 1 
ATOM   2457  O  "O4'" . C   A  1  123  ? 85.671  162.627 37.388  1.00 45.38  ? 124  C   A "O4'" 1 
ATOM   2458  C  "C3'" . C   A  1  123  ? 86.530  164.359 36.050  1.00 47.38  ? 124  C   A "C3'" 1 
ATOM   2459  O  "O3'" . C   A  1  123  ? 87.475  165.412 35.985  1.00 51.71  ? 124  C   A "O3'" 1 
ATOM   2460  C  "C2'" . C   A  1  123  ? 87.070  163.048 35.505  1.00 45.02  ? 124  C   A "C2'" 1 
ATOM   2461  O  "O2'" . C   A  1  123  ? 88.407  162.771 35.868  1.00 44.83  ? 124  C   A "O2'" 1 
ATOM   2462  C  "C1'" . C   A  1  123  ? 86.125  162.047 36.174  1.00 43.73  ? 124  C   A "C1'" 1 
ATOM   2463  N  N1    . C   A  1  123  ? 84.960  161.764 35.318  1.00 41.17  ? 124  C   A N1    1 
ATOM   2464  C  C2    . C   A  1  123  ? 85.106  160.824 34.289  1.00 39.83  ? 124  C   A C2    1 
ATOM   2465  O  O2    . C   A  1  123  ? 86.218  160.269 34.125  1.00 37.34  ? 124  C   A O2    1 
ATOM   2466  N  N3    . C   A  1  123  ? 84.042  160.553 33.491  1.00 36.97  ? 124  C   A N3    1 
ATOM   2467  C  C4    . C   A  1  123  ? 82.881  161.184 33.685  1.00 35.20  ? 124  C   A C4    1 
ATOM   2468  N  N4    . C   A  1  123  ? 81.869  160.895 32.871  1.00 34.74  ? 124  C   A N4    1 
ATOM   2469  C  C5    . C   A  1  123  ? 82.708  162.142 34.721  1.00 36.17  ? 124  C   A C5    1 
ATOM   2470  C  C6    . C   A  1  123  ? 83.762  162.401 35.506  1.00 38.54  ? 124  C   A C6    1 
ATOM   2471  P  P     . U   A  1  124  ? 87.472  166.413 34.727  1.00 56.14  ? 125  U   A P     1 
ATOM   2472  O  OP1   . U   A  1  124  ? 88.473  167.457 35.083  1.00 56.68  ? 125  U   A OP1   1 
ATOM   2473  O  OP2   . U   A  1  124  ? 86.079  166.821 34.360  1.00 54.85  ? 125  U   A OP2   1 
ATOM   2474  O  "O5'" . U   A  1  124  ? 88.018  165.516 33.527  1.00 56.52  ? 125  U   A "O5'" 1 
ATOM   2475  C  "C5'" . U   A  1  124  ? 89.386  165.080 33.486  1.00 59.01  ? 125  U   A "C5'" 1 
ATOM   2476  C  "C4'" . U   A  1  124  ? 89.655  164.309 32.216  1.00 59.96  ? 125  U   A "C4'" 1 
ATOM   2477  O  "O4'" . U   A  1  124  ? 89.004  163.013 32.250  1.00 60.00  ? 125  U   A "O4'" 1 
ATOM   2478  C  "C3'" . U   A  1  124  ? 89.101  164.915 30.941  1.00 60.73  ? 125  U   A "C3'" 1 
ATOM   2479  O  "O3'" . U   A  1  124  ? 89.755  166.116 30.493  1.00 61.93  ? 125  U   A "O3'" 1 
ATOM   2480  C  "C2'" . U   A  1  124  ? 89.177  163.727 29.992  1.00 60.14  ? 125  U   A "C2'" 1 
ATOM   2481  O  "O2'" . U   A  1  124  ? 90.500  163.514 29.549  1.00 61.80  ? 125  U   A "O2'" 1 
ATOM   2482  C  "C1'" . U   A  1  124  ? 88.767  162.578 30.918  1.00 59.37  ? 125  U   A "C1'" 1 
ATOM   2483  N  N1    . U   A  1  124  ? 87.354  162.182 30.780  1.00 57.63  ? 125  U   A N1    1 
ATOM   2484  C  C2    . U   A  1  124  ? 87.077  161.033 30.045  1.00 57.25  ? 125  U   A C2    1 
ATOM   2485  O  O2    . U   A  1  124  ? 87.944  160.352 29.519  1.00 57.14  ? 125  U   A O2    1 
ATOM   2486  N  N3    . U   A  1  124  ? 85.746  160.706 29.952  1.00 55.73  ? 125  U   A N3    1 
ATOM   2487  C  C4    . U   A  1  124  ? 84.686  161.386 30.508  1.00 55.85  ? 125  U   A C4    1 
ATOM   2488  O  O4    . U   A  1  124  ? 83.544  160.935 30.382  1.00 54.49  ? 125  U   A O4    1 
ATOM   2489  C  C5    . U   A  1  124  ? 85.050  162.561 31.245  1.00 56.23  ? 125  U   A C5    1 
ATOM   2490  C  C6    . U   A  1  124  ? 86.337  162.911 31.352  1.00 56.99  ? 125  U   A C6    1 
ATOM   2491  O  "O5'" . A   A  1  127  ? 85.518  161.438 21.286  1.00 82.10  ? 128  A   A "O5'" 1 
ATOM   2492  C  "C5'" . A   A  1  127  ? 86.614  160.584 20.901  1.00 79.69  ? 128  A   A "C5'" 1 
ATOM   2493  C  "C4'" . A   A  1  127  ? 86.960  159.405 21.798  1.00 78.19  ? 128  A   A "C4'" 1 
ATOM   2494  O  "O4'" . A   A  1  127  ? 87.266  159.856 23.155  1.00 77.90  ? 128  A   A "O4'" 1 
ATOM   2495  C  "C3'" . A   A  1  127  ? 85.903  158.326 21.998  1.00 75.86  ? 128  A   A "C3'" 1 
ATOM   2496  O  "O3'" . A   A  1  127  ? 85.786  157.409 20.916  1.00 72.92  ? 128  A   A "O3'" 1 
ATOM   2497  C  "C2'" . A   A  1  127  ? 86.353  157.706 23.314  1.00 76.03  ? 128  A   A "C2'" 1 
ATOM   2498  O  "O2'" . A   A  1  127  ? 87.527  156.927 23.197  1.00 76.81  ? 128  A   A "O2'" 1 
ATOM   2499  C  "C1'" . A   A  1  127  ? 86.664  158.976 24.101  1.00 75.59  ? 128  A   A "C1'" 1 
ATOM   2500  N  N9    . A   A  1  127  ? 85.432  159.609 24.583  1.00 73.98  ? 128  A   A N9    1 
ATOM   2501  C  C8    . A   A  1  127  ? 84.141  159.408 24.137  1.00 73.42  ? 128  A   A C8    1 
ATOM   2502  N  N7    . A   A  1  127  ? 83.249  160.130 24.759  1.00 73.48  ? 128  A   A N7    1 
ATOM   2503  C  C5    . A   A  1  127  ? 83.992  160.857 25.681  1.00 73.30  ? 128  A   A C5    1 
ATOM   2504  C  C6    . A   A  1  127  ? 83.624  161.810 26.648  1.00 73.13  ? 128  A   A C6    1 
ATOM   2505  N  N6    . A   A  1  127  ? 82.359  162.201 26.860  1.00 72.82  ? 128  A   A N6    1 
ATOM   2506  N  N1    . A   A  1  127  ? 84.610  162.353 27.400  1.00 72.36  ? 128  A   A N1    1 
ATOM   2507  C  C2    . A   A  1  127  ? 85.870  161.955 27.189  1.00 71.57  ? 128  A   A C2    1 
ATOM   2508  N  N3    . A   A  1  127  ? 86.339  161.065 26.317  1.00 72.02  ? 128  A   A N3    1 
ATOM   2509  C  C4    . A   A  1  127  ? 85.338  160.546 25.583  1.00 73.26  ? 128  A   A C4    1 
ATOM   2510  P  P     . A   A  1  128  ? 84.500  156.441 20.834  1.00 70.16  ? 129  A   A P     1 
ATOM   2511  O  OP1   . A   A  1  128  ? 84.541  155.732 19.524  1.00 69.42  ? 129  A   A OP1   1 
ATOM   2512  O  OP2   . A   A  1  128  ? 83.278  157.193 21.233  1.00 69.87  ? 129  A   A OP2   1 
ATOM   2513  O  "O5'" . A   A  1  128  ? 84.822  155.377 21.965  1.00 66.14  ? 129  A   A "O5'" 1 
ATOM   2514  C  "C5'" . A   A  1  128  ? 86.056  154.640 21.912  1.00 59.23  ? 129  A   A "C5'" 1 
ATOM   2515  C  "C4'" . A   A  1  128  ? 86.147  153.688 23.066  1.00 53.64  ? 129  A   A "C4'" 1 
ATOM   2516  O  "O4'" . A   A  1  128  ? 86.554  154.393 24.275  1.00 50.59  ? 129  A   A "O4'" 1 
ATOM   2517  C  "C3'" . A   A  1  128  ? 84.841  153.020 23.443  1.00 50.82  ? 129  A   A "C3'" 1 
ATOM   2518  O  "O3'" . A   A  1  128  ? 84.309  152.120 22.449  1.00 49.63  ? 129  A   A "O3'" 1 
ATOM   2519  C  "C2'" . A   A  1  128  ? 85.099  152.616 24.891  1.00 49.14  ? 129  A   A "C2'" 1 
ATOM   2520  O  "O2'" . A   A  1  128  ? 85.891  151.460 25.058  1.00 48.26  ? 129  A   A "O2'" 1 
ATOM   2521  C  "C1'" . A   A  1  128  ? 85.863  153.854 25.394  1.00 47.72  ? 129  A   A "C1'" 1 
ATOM   2522  N  N9    . A   A  1  128  ? 85.007  154.918 25.940  1.00 44.31  ? 129  A   A N9    1 
ATOM   2523  C  C8    . A   A  1  128  ? 83.651  155.074 25.760  1.00 44.58  ? 129  A   A C8    1 
ATOM   2524  N  N7    . A   A  1  128  ? 83.145  156.108 26.385  1.00 42.97  ? 129  A   A N7    1 
ATOM   2525  C  C5    . A   A  1  128  ? 84.236  156.681 27.017  1.00 41.85  ? 129  A   A C5    1 
ATOM   2526  C  C6    . A   A  1  128  ? 84.354  157.802 27.856  1.00 40.29  ? 129  A   A C6    1 
ATOM   2527  N  N6    . A   A  1  128  ? 83.327  158.563 28.214  1.00 39.88  ? 129  A   A N6    1 
ATOM   2528  N  N1    . A   A  1  128  ? 85.579  158.112 28.325  1.00 41.53  ? 129  A   A N1    1 
ATOM   2529  C  C2    . A   A  1  128  ? 86.617  157.329 27.969  1.00 43.20  ? 129  A   A C2    1 
ATOM   2530  N  N3    . A   A  1  128  ? 86.631  156.243 27.193  1.00 43.34  ? 129  A   A N3    1 
ATOM   2531  C  C4    . A   A  1  128  ? 85.394  155.967 26.745  1.00 43.15  ? 129  A   A C4    1 
ATOM   2532  P  P     . C   A  1  129  ? 85.123  150.816 21.973  1.00 49.19  ? 130  C   A P     1 
ATOM   2533  O  OP1   . C   A  1  129  ? 86.424  150.722 22.696  1.00 49.61  ? 130  C   A OP1   1 
ATOM   2534  O  OP2   . C   A  1  129  ? 85.122  150.836 20.488  1.00 48.45  ? 130  C   A OP2   1 
ATOM   2535  O  "O5'" . C   A  1  129  ? 84.180  149.609 22.414  1.00 47.00  ? 130  C   A "O5'" 1 
ATOM   2536  C  "C5'" . C   A  1  129  ? 83.477  149.638 23.668  1.00 45.16  ? 130  C   A "C5'" 1 
ATOM   2537  C  "C4'" . C   A  1  129  ? 83.139  148.240 24.110  1.00 43.08  ? 130  C   A "C4'" 1 
ATOM   2538  O  "O4'" . C   A  1  129  ? 82.245  147.620 23.154  1.00 44.28  ? 130  C   A "O4'" 1 
ATOM   2539  C  "C3'" . C   A  1  129  ? 84.321  147.297 24.137  1.00 41.34  ? 130  C   A "C3'" 1 
ATOM   2540  O  "O3'" . C   A  1  129  ? 85.058  147.436 25.326  1.00 37.04  ? 130  C   A "O3'" 1 
ATOM   2541  C  "C2'" . C   A  1  129  ? 83.656  145.937 24.057  1.00 42.88  ? 130  C   A "C2'" 1 
ATOM   2542  O  "O2'" . C   A  1  129  ? 83.111  145.530 25.284  1.00 43.66  ? 130  C   A "O2'" 1 
ATOM   2543  C  "C1'" . C   A  1  129  ? 82.513  146.225 23.090  1.00 44.83  ? 130  C   A "C1'" 1 
ATOM   2544  N  N1    . C   A  1  129  ? 82.868  145.850 21.709  1.00 47.49  ? 130  C   A N1    1 
ATOM   2545  C  C2    . C   A  1  129  ? 83.058  144.487 21.414  1.00 48.78  ? 130  C   A C2    1 
ATOM   2546  O  O2    . C   A  1  129  ? 82.898  143.645 22.320  1.00 49.08  ? 130  C   A O2    1 
ATOM   2547  N  N3    . C   A  1  129  ? 83.407  144.117 20.156  1.00 49.33  ? 130  C   A N3    1 
ATOM   2548  C  C4    . C   A  1  129  ? 83.557  145.040 19.211  1.00 49.23  ? 130  C   A C4    1 
ATOM   2549  N  N4    . C   A  1  129  ? 83.901  144.623 17.981  1.00 47.08  ? 130  C   A N4    1 
ATOM   2550  C  C5    . C   A  1  129  ? 83.362  146.429 19.479  1.00 49.07  ? 130  C   A C5    1 
ATOM   2551  C  C6    . C   A  1  129  ? 83.021  146.786 20.729  1.00 48.65  ? 130  C   A C6    1 
ATOM   2552  P  P     . A   A  1  130  ? 86.644  147.555 25.253  1.00 34.73  ? 131  A   A P     1 
ATOM   2553  O  OP1   . A   A  1  130  ? 86.903  148.968 24.957  1.00 33.38  ? 131  A   A OP1   1 
ATOM   2554  O  OP2   . A   A  1  130  ? 87.166  146.519 24.338  1.00 33.45  ? 131  A   A OP2   1 
ATOM   2555  O  "O5'" . A   A  1  130  ? 87.097  147.229 26.745  1.00 32.97  ? 131  A   A "O5'" 1 
ATOM   2556  C  "C5'" . A   A  1  130  ? 87.483  148.285 27.649  1.00 31.28  ? 131  A   A "C5'" 1 
ATOM   2557  C  "C4'" . A   A  1  130  ? 87.478  147.785 29.071  1.00 31.72  ? 131  A   A "C4'" 1 
ATOM   2558  O  "O4'" . A   A  1  130  ? 86.131  147.738 29.594  1.00 32.07  ? 131  A   A "O4'" 1 
ATOM   2559  C  "C3'" . A   A  1  130  ? 88.022  146.379 29.233  1.00 31.05  ? 131  A   A "C3'" 1 
ATOM   2560  O  "O3'" . A   A  1  130  ? 89.413  146.416 29.374  1.00 30.93  ? 131  A   A "O3'" 1 
ATOM   2561  C  "C2'" . A   A  1  130  ? 87.286  145.850 30.448  1.00 32.59  ? 131  A   A "C2'" 1 
ATOM   2562  O  "O2'" . A   A  1  130  ? 87.853  146.250 31.678  1.00 33.74  ? 131  A   A "O2'" 1 
ATOM   2563  C  "C1'" . A   A  1  130  ? 85.918  146.496 30.240  1.00 33.02  ? 131  A   A "C1'" 1 
ATOM   2564  N  N9    . A   A  1  130  ? 85.017  145.708 29.402  1.00 31.96  ? 131  A   A N9    1 
ATOM   2565  C  C8    . A   A  1  130  ? 84.530  145.990 28.149  1.00 31.91  ? 131  A   A C8    1 
ATOM   2566  N  N7    . A   A  1  130  ? 83.654  145.121 27.720  1.00 30.71  ? 131  A   A N7    1 
ATOM   2567  C  C5    . A   A  1  130  ? 83.576  144.191 28.748  1.00 31.53  ? 131  A   A C5    1 
ATOM   2568  C  C6    . A   A  1  130  ? 82.800  143.037 28.925  1.00 30.59  ? 131  A   A C6    1 
ATOM   2569  N  N6    . A   A  1  130  ? 81.902  142.614 28.047  1.00 30.62  ? 131  A   A N6    1 
ATOM   2570  N  N1    . A   A  1  130  ? 82.972  142.331 30.060  1.00 30.47  ? 131  A   A N1    1 
ATOM   2571  C  C2    . A   A  1  130  ? 83.858  142.770 30.958  1.00 32.64  ? 131  A   A C2    1 
ATOM   2572  N  N3    . A   A  1  130  ? 84.635  143.845 30.917  1.00 33.07  ? 131  A   A N3    1 
ATOM   2573  C  C4    . A   A  1  130  ? 84.436  144.524 29.772  1.00 32.44  ? 131  A   A C4    1 
ATOM   2574  P  P     . A   A  1  131  ? 90.294  145.382 28.569  1.00 32.02  ? 132  A   A P     1 
ATOM   2575  O  OP1   . A   A  1  131  ? 91.693  145.556 28.991  1.00 33.89  ? 132  A   A OP1   1 
ATOM   2576  O  OP2   . A   A  1  131  ? 89.925  145.505 27.136  1.00 32.27  ? 132  A   A OP2   1 
ATOM   2577  O  "O5'" . A   A  1  131  ? 89.792  143.997 29.154  1.00 32.89  ? 132  A   A "O5'" 1 
ATOM   2578  C  "C5'" . A   A  1  131  ? 90.081  143.632 30.525  1.00 31.62  ? 132  A   A "C5'" 1 
ATOM   2579  C  "C4'" . A   A  1  131  ? 89.475  142.293 30.830  1.00 32.99  ? 132  A   A "C4'" 1 
ATOM   2580  O  "O4'" . A   A  1  131  ? 88.028  142.429 30.829  1.00 33.63  ? 132  A   A "O4'" 1 
ATOM   2581  C  "C3'" . A   A  1  131  ? 89.769  141.230 29.787  1.00 32.56  ? 132  A   A "C3'" 1 
ATOM   2582  O  "O3'" . A   A  1  131  ? 91.042  140.619 30.012  1.00 33.91  ? 132  A   A "O3'" 1 
ATOM   2583  C  "C2'" . A   A  1  131  ? 88.580  140.294 29.945  1.00 33.08  ? 132  A   A "C2'" 1 
ATOM   2584  O  "O2'" . A   A  1  131  ? 88.686  139.442 31.065  1.00 33.27  ? 132  A   A "O2'" 1 
ATOM   2585  C  "C1'" . A   A  1  131  ? 87.449  141.292 30.224  1.00 33.55  ? 132  A   A "C1'" 1 
ATOM   2586  N  N9    . A   A  1  131  ? 86.770  141.730 29.008  1.00 35.31  ? 132  A   A N9    1 
ATOM   2587  C  C8    . A   A  1  131  ? 87.002  142.865 28.268  1.00 36.53  ? 132  A   A C8    1 
ATOM   2588  N  N7    . A   A  1  131  ? 86.252  142.962 27.202  1.00 38.20  ? 132  A   A N7    1 
ATOM   2589  C  C5    . A   A  1  131  ? 85.468  141.815 27.246  1.00 36.84  ? 132  A   A C5    1 
ATOM   2590  C  C6    . A   A  1  131  ? 84.476  141.319 26.395  1.00 36.79  ? 132  A   A C6    1 
ATOM   2591  N  N6    . A   A  1  131  ? 84.088  141.931 25.286  1.00 38.66  ? 132  A   A N6    1 
ATOM   2592  N  N1    . A   A  1  131  ? 83.890  140.153 26.720  1.00 37.58  ? 132  A   A N1    1 
ATOM   2593  C  C2    . A   A  1  131  ? 84.282  139.532 27.831  1.00 38.48  ? 132  A   A C2    1 
ATOM   2594  N  N3    . A   A  1  131  ? 85.205  139.892 28.714  1.00 37.24  ? 132  A   A N3    1 
ATOM   2595  C  C4    . A   A  1  131  ? 85.770  141.057 28.357  1.00 36.58  ? 132  A   A C4    1 
ATOM   2596  P  P     . U   A  1  132  ? 91.897  140.073 28.759  1.00 34.93  ? 133  U   A P     1 
ATOM   2597  O  OP1   . U   A  1  132  ? 93.234  139.640 29.257  1.00 33.51  ? 133  U   A OP1   1 
ATOM   2598  O  OP2   . U   A  1  132  ? 91.808  141.052 27.621  1.00 35.99  ? 133  U   A OP2   1 
ATOM   2599  O  "O5'" . U   A  1  132  ? 91.101  138.779 28.300  1.00 32.94  ? 133  U   A "O5'" 1 
ATOM   2600  C  "C5'" . U   A  1  132  ? 90.940  137.672 29.180  1.00 32.33  ? 133  U   A "C5'" 1 
ATOM   2601  C  "C4'" . U   A  1  132  ? 90.064  136.638 28.534  1.00 32.12  ? 133  U   A "C4'" 1 
ATOM   2602  O  "O4'" . U   A  1  132  ? 88.717  137.164 28.422  1.00 31.72  ? 133  U   A "O4'" 1 
ATOM   2603  C  "C3'" . U   A  1  132  ? 90.437  136.312 27.098  1.00 30.79  ? 133  U   A "C3'" 1 
ATOM   2604  O  "O3'" . U   A  1  132  ? 91.543  135.403 27.022  1.00 30.51  ? 133  U   A "O3'" 1 
ATOM   2605  C  "C2'" . U   A  1  132  ? 89.130  135.739 26.560  1.00 31.23  ? 133  U   A "C2'" 1 
ATOM   2606  O  "O2'" . U   A  1  132  ? 88.906  134.407 26.983  1.00 30.65  ? 133  U   A "O2'" 1 
ATOM   2607  C  "C1'" . U   A  1  132  ? 88.104  136.645 27.251  1.00 31.78  ? 133  U   A "C1'" 1 
ATOM   2608  N  N1    . U   A  1  132  ? 87.645  137.768 26.419  1.00 33.55  ? 133  U   A N1    1 
ATOM   2609  C  C2    . U   A  1  132  ? 86.585  137.529 25.546  1.00 34.50  ? 133  U   A C2    1 
ATOM   2610  O  O2    . U   A  1  132  ? 86.044  136.437 25.443  1.00 34.99  ? 133  U   A O2    1 
ATOM   2611  N  N3    . U   A  1  132  ? 86.187  138.616 24.798  1.00 34.65  ? 133  U   A N3    1 
ATOM   2612  C  C4    . U   A  1  132  ? 86.725  139.884 24.823  1.00 34.01  ? 133  U   A C4    1 
ATOM   2613  O  O4    . U   A  1  132  ? 86.254  140.754 24.093  1.00 33.83  ? 133  U   A O4    1 
ATOM   2614  C  C5    . U   A  1  132  ? 87.813  140.056 25.737  1.00 33.87  ? 133  U   A C5    1 
ATOM   2615  C  C6    . U   A  1  132  ? 88.229  139.020 26.489  1.00 33.48  ? 133  U   A C6    1 
ATOM   2616  P  P     . U   A  1  133  ? 92.268  135.157 25.610  1.00 30.56  ? 134  U   A P     1 
ATOM   2617  O  OP1   . U   A  1  133  ? 93.441  134.273 25.816  1.00 29.11  ? 134  U   A OP1   1 
ATOM   2618  O  OP2   . U   A  1  133  ? 92.444  136.454 24.898  1.00 26.35  ? 134  U   A OP2   1 
ATOM   2619  O  "O5'" . U   A  1  133  ? 91.179  134.333 24.813  1.00 27.60  ? 134  U   A "O5'" 1 
ATOM   2620  C  "C5'" . U   A  1  133  ? 91.123  134.455 23.416  1.00 26.68  ? 134  U   A "C5'" 1 
ATOM   2621  C  "C4'" . U   A  1  133  ? 89.818  133.973 22.897  1.00 24.99  ? 134  U   A "C4'" 1 
ATOM   2622  O  "O4'" . U   A  1  133  ? 88.705  134.738 23.421  1.00 24.11  ? 134  U   A "O4'" 1 
ATOM   2623  C  "C3'" . U   A  1  133  ? 89.750  134.229 21.421  1.00 23.66  ? 134  U   A "C3'" 1 
ATOM   2624  O  "O3'" . U   A  1  133  ? 90.534  133.247 20.795  1.00 22.94  ? 134  U   A "O3'" 1 
ATOM   2625  C  "C2'" . U   A  1  133  ? 88.258  134.160 21.166  1.00 24.31  ? 134  U   A "C2'" 1 
ATOM   2626  O  "O2'" . U   A  1  133  ? 87.779  132.834 21.151  1.00 24.67  ? 134  U   A "O2'" 1 
ATOM   2627  C  "C1'" . U   A  1  133  ? 87.732  134.899 22.401  1.00 25.15  ? 134  U   A "C1'" 1 
ATOM   2628  N  N1    . U   A  1  133  ? 87.584  136.335 22.135  1.00 26.67  ? 134  U   A N1    1 
ATOM   2629  C  C2    . U   A  1  133  ? 86.632  136.705 21.209  1.00 27.87  ? 134  U   A C2    1 
ATOM   2630  O  O2    . U   A  1  133  ? 85.901  135.901 20.648  1.00 28.06  ? 134  U   A O2    1 
ATOM   2631  N  N3    . U   A  1  133  ? 86.552  138.048 20.960  1.00 28.70  ? 134  U   A N3    1 
ATOM   2632  C  C4    . U   A  1  133  ? 87.317  139.050 21.524  1.00 30.44  ? 134  U   A C4    1 
ATOM   2633  O  O4    . U   A  1  133  ? 87.250  140.199 21.062  1.00 31.60  ? 134  U   A O4    1 
ATOM   2634  C  C5    . U   A  1  133  ? 88.269  138.590 22.501  1.00 29.11  ? 134  U   A C5    1 
ATOM   2635  C  C6    . U   A  1  133  ? 88.366  137.282 22.767  1.00 28.24  ? 134  U   A C6    1 
ATOM   2636  P  P     . G   A  1  134  ? 91.246  133.570 19.414  1.00 25.52  ? 135  G   A P     1 
ATOM   2637  O  OP1   . G   A  1  134  ? 92.299  132.543 19.241  1.00 23.31  ? 135  G   A OP1   1 
ATOM   2638  O  OP2   . G   A  1  134  ? 91.604  134.995 19.369  1.00 25.85  ? 135  G   A OP2   1 
ATOM   2639  O  "O5'" . G   A  1  134  ? 90.090  133.338 18.355  1.00 23.39  ? 135  G   A "O5'" 1 
ATOM   2640  C  "C5'" . G   A  1  134  ? 89.497  132.052 18.178  1.00 23.64  ? 135  G   A "C5'" 1 
ATOM   2641  C  "C4'" . G   A  1  134  ? 88.340  132.181 17.244  1.00 26.91  ? 135  G   A "C4'" 1 
ATOM   2642  O  "O4'" . G   A  1  134  ? 87.375  133.108 17.811  1.00 27.51  ? 135  G   A "O4'" 1 
ATOM   2643  C  "C3'" . G   A  1  134  ? 88.744  132.867 15.966  1.00 28.26  ? 135  G   A "C3'" 1 
ATOM   2644  O  "O3'" . G   A  1  134  ? 89.366  131.970 15.073  1.00 30.08  ? 135  G   A "O3'" 1 
ATOM   2645  C  "C2'" . G   A  1  134  ? 87.421  133.419 15.467  1.00 28.62  ? 135  G   A "C2'" 1 
ATOM   2646  O  "O2'" . G   A  1  134  ? 86.654  132.370 14.903  1.00 30.36  ? 135  G   A "O2'" 1 
ATOM   2647  C  "C1'" . G   A  1  134  ? 86.794  133.895 16.781  1.00 27.99  ? 135  G   A "C1'" 1 
ATOM   2648  N  N9    . G   A  1  134  ? 87.074  135.304 17.057  1.00 29.36  ? 135  G   A N9    1 
ATOM   2649  C  C8    . G   A  1  134  ? 87.989  135.814 17.948  1.00 29.92  ? 135  G   A C8    1 
ATOM   2650  N  N7    . G   A  1  134  ? 88.041  137.121 17.938  1.00 31.66  ? 135  G   A N7    1 
ATOM   2651  C  C5    . G   A  1  134  ? 87.104  137.500 16.984  1.00 29.62  ? 135  G   A C5    1 
ATOM   2652  C  C6    . G   A  1  134  ? 86.727  138.801 16.515  1.00 29.54  ? 135  G   A C6    1 
ATOM   2653  O  O6    . G   A  1  134  ? 87.186  139.908 16.837  1.00 29.87  ? 135  G   A O6    1 
ATOM   2654  N  N1    . G   A  1  134  ? 85.718  138.731 15.568  1.00 27.59  ? 135  G   A N1    1 
ATOM   2655  C  C2    . G   A  1  134  ? 85.141  137.575 15.116  1.00 29.32  ? 135  G   A C2    1 
ATOM   2656  N  N2    . G   A  1  134  ? 84.151  137.716 14.228  1.00 29.60  ? 135  G   A N2    1 
ATOM   2657  N  N3    . G   A  1  134  ? 85.498  136.360 15.513  1.00 29.67  ? 135  G   A N3    1 
ATOM   2658  C  C4    . G   A  1  134  ? 86.481  136.396 16.444  1.00 29.99  ? 135  G   A C4    1 
ATOM   2659  P  P     . C   A  1  135  ? 90.501  132.516 14.088  1.00 30.42  ? 136  C   A P     1 
ATOM   2660  O  OP1   . C   A  1  135  ? 91.044  131.331 13.372  1.00 29.41  ? 136  C   A OP1   1 
ATOM   2661  O  OP2   . C   A  1  135  ? 91.421  133.386 14.866  1.00 30.14  ? 136  C   A OP2   1 
ATOM   2662  O  "O5'" . C   A  1  135  ? 89.710  133.442 13.063  1.00 28.46  ? 136  C   A "O5'" 1 
ATOM   2663  C  "C5'" . C   A  1  135  ? 88.728  132.888 12.187  1.00 31.85  ? 136  C   A "C5'" 1 
ATOM   2664  C  "C4'" . C   A  1  135  ? 88.009  133.987 11.453  1.00 35.76  ? 136  C   A "C4'" 1 
ATOM   2665  O  "O4'" . C   A  1  135  ? 87.367  134.863 12.413  1.00 36.57  ? 136  C   A "O4'" 1 
ATOM   2666  C  "C3'" . C   A  1  135  ? 88.873  134.938 10.650  1.00 38.11  ? 136  C   A "C3'" 1 
ATOM   2667  O  "O3'" . C   A  1  135  ? 89.226  134.416 9.375   1.00 42.68  ? 136  C   A "O3'" 1 
ATOM   2668  C  "C2'" . C   A  1  135  ? 87.954  136.137 10.511  1.00 35.79  ? 136  C   A "C2'" 1 
ATOM   2669  O  "O2'" . C   A  1  135  ? 86.927  135.867 9.583   1.00 36.64  ? 136  C   A "O2'" 1 
ATOM   2670  C  "C1'" . C   A  1  135  ? 87.328  136.187 11.901  1.00 35.42  ? 136  C   A "C1'" 1 
ATOM   2671  N  N1    . C   A  1  135  ? 88.032  137.094 12.836  1.00 35.76  ? 136  C   A N1    1 
ATOM   2672  C  C2    . C   A  1  135  ? 87.653  138.445 12.855  1.00 33.90  ? 136  C   A C2    1 
ATOM   2673  O  O2    . C   A  1  135  ? 86.742  138.816 12.101  1.00 33.86  ? 136  C   A O2    1 
ATOM   2674  N  N3    . C   A  1  135  ? 88.288  139.304 13.690  1.00 33.41  ? 136  C   A N3    1 
ATOM   2675  C  C4    . C   A  1  135  ? 89.266  138.860 14.492  1.00 32.65  ? 136  C   A C4    1 
ATOM   2676  N  N4    . C   A  1  135  ? 89.880  139.752 15.289  1.00 31.57  ? 136  C   A N4    1 
ATOM   2677  C  C5    . C   A  1  135  ? 89.665  137.481 14.510  1.00 32.98  ? 136  C   A C5    1 
ATOM   2678  C  C6    . C   A  1  135  ? 89.031  136.643 13.669  1.00 34.94  ? 136  C   A C6    1 
ATOM   2679  P  P     . U   A  1  136  ? 90.699  134.709 8.773   1.00 47.87  ? 137  U   A P     1 
ATOM   2680  O  OP1   . U   A  1  136  ? 90.661  134.247 7.354   1.00 48.21  ? 137  U   A OP1   1 
ATOM   2681  O  OP2   . U   A  1  136  ? 91.768  134.163 9.694   1.00 46.75  ? 137  U   A OP2   1 
ATOM   2682  O  "O5'" . U   A  1  136  ? 90.803  136.305 8.784   1.00 48.36  ? 137  U   A "O5'" 1 
ATOM   2683  C  "C5'" . U   A  1  136  ? 89.963  137.122 7.940   1.00 49.20  ? 137  U   A "C5'" 1 
ATOM   2684  C  "C4'" . U   A  1  136  ? 89.976  138.560 8.427   1.00 50.62  ? 137  U   A "C4'" 1 
ATOM   2685  O  "O4'" . U   A  1  136  ? 89.774  138.535 9.867   1.00 51.49  ? 137  U   A "O4'" 1 
ATOM   2686  C  "C3'" . U   A  1  136  ? 91.262  139.366 8.253   1.00 52.25  ? 137  U   A "C3'" 1 
ATOM   2687  O  "O3'" . U   A  1  136  ? 91.337  139.968 6.947   1.00 57.20  ? 137  U   A "O3'" 1 
ATOM   2688  C  "C2'" . U   A  1  136  ? 91.135  140.413 9.359   1.00 50.45  ? 137  U   A "C2'" 1 
ATOM   2689  O  "O2'" . U   A  1  136  ? 90.221  141.431 9.003   1.00 48.41  ? 137  U   A "O2'" 1 
ATOM   2690  C  "C1'" . U   A  1  136  ? 90.478  139.603 10.480  1.00 49.09  ? 137  U   A "C1'" 1 
ATOM   2691  N  N1    . U   A  1  136  ? 91.348  139.054 11.540  1.00 47.79  ? 137  U   A N1    1 
ATOM   2692  C  C2    . U   A  1  136  ? 91.723  139.887 12.586  1.00 46.54  ? 137  U   A C2    1 
ATOM   2693  O  O2    . U   A  1  136  ? 91.405  141.056 12.647  1.00 47.94  ? 137  U   A O2    1 
ATOM   2694  N  N3    . U   A  1  136  ? 92.489  139.294 13.562  1.00 45.52  ? 137  U   A N3    1 
ATOM   2695  C  C4    . U   A  1  136  ? 92.926  137.990 13.598  1.00 45.10  ? 137  U   A C4    1 
ATOM   2696  O  O4    . U   A  1  136  ? 93.625  137.604 14.545  1.00 43.48  ? 137  U   A O4    1 
ATOM   2697  C  C5    . U   A  1  136  ? 92.516  137.199 12.478  1.00 46.41  ? 137  U   A C5    1 
ATOM   2698  C  C6    . U   A  1  136  ? 91.764  137.743 11.513  1.00 46.83  ? 137  U   A C6    1 
ATOM   2699  P  P     . U   A  1  137  ? 92.776  140.346 6.300   1.00 61.54  ? 138  U   A P     1 
ATOM   2700  O  OP1   . U   A  1  137  ? 92.629  140.214 4.828   1.00 60.76  ? 138  U   A OP1   1 
ATOM   2701  O  OP2   . U   A  1  137  ? 93.831  139.561 7.001   1.00 60.35  ? 138  U   A OP2   1 
ATOM   2702  O  "O5'" . U   A  1  137  ? 92.986  141.900 6.635   1.00 64.56  ? 138  U   A "O5'" 1 
ATOM   2703  C  "C5'" . U   A  1  137  ? 93.872  142.745 5.843   1.00 70.48  ? 138  U   A "C5'" 1 
ATOM   2704  C  "C4'" . U   A  1  137  ? 93.251  144.122 5.617   1.00 74.46  ? 138  U   A "C4'" 1 
ATOM   2705  O  "O4'" . U   A  1  137  ? 91.981  143.954 4.945   1.00 77.31  ? 138  U   A "O4'" 1 
ATOM   2706  C  "C3'" . U   A  1  137  ? 92.948  144.956 6.860   1.00 75.77  ? 138  U   A "C3'" 1 
ATOM   2707  O  "O3'" . U   A  1  137  ? 93.989  145.892 7.120   1.00 73.52  ? 138  U   A "O3'" 1 
ATOM   2708  C  "C2'" . U   A  1  137  ? 91.745  145.801 6.447   1.00 78.04  ? 138  U   A "C2'" 1 
ATOM   2709  O  "O2'" . U   A  1  137  ? 92.088  147.021 5.829   1.00 79.88  ? 138  U   A "O2'" 1 
ATOM   2710  C  "C1'" . U   A  1  137  ? 91.044  144.899 5.430   1.00 80.41  ? 138  U   A "C1'" 1 
ATOM   2711  N  N1    . U   A  1  137  ? 89.879  144.162 5.934   1.00 85.16  ? 138  U   A N1    1 
ATOM   2712  C  C2    . U   A  1  137  ? 89.238  143.309 5.043   1.00 87.75  ? 138  U   A C2    1 
ATOM   2713  O  O2    . U   A  1  137  ? 89.567  143.204 3.857   1.00 87.12  ? 138  U   A O2    1 
ATOM   2714  N  N3    . U   A  1  137  ? 88.193  142.594 5.586   1.00 89.43  ? 138  U   A N3    1 
ATOM   2715  C  C4    . U   A  1  137  ? 87.725  142.654 6.891   1.00 89.28  ? 138  U   A C4    1 
ATOM   2716  O  O4    . U   A  1  137  ? 86.800  141.916 7.235   1.00 89.96  ? 138  U   A O4    1 
ATOM   2717  C  C5    . U   A  1  137  ? 88.417  143.583 7.736   1.00 88.70  ? 138  U   A C5    1 
ATOM   2718  C  C6    . U   A  1  137  ? 89.442  144.287 7.244   1.00 87.11  ? 138  U   A C6    1 
ATOM   2719  P  P     . C   A  1  138  ? 95.382  145.409 7.741   1.00 73.04  ? 139  C   A P     1 
ATOM   2720  O  OP1   . C   A  1  138  ? 96.149  146.653 7.965   1.00 73.14  ? 139  C   A OP1   1 
ATOM   2721  O  OP2   . C   A  1  138  ? 95.967  144.324 6.910   1.00 73.10  ? 139  C   A OP2   1 
ATOM   2722  O  "O5'" . C   A  1  138  ? 94.989  144.822 9.164   1.00 72.27  ? 139  C   A "O5'" 1 
ATOM   2723  C  "C5'" . C   A  1  138  ? 94.404  145.673 10.161  1.00 69.91  ? 139  C   A "C5'" 1 
ATOM   2724  C  "C4'" . C   A  1  138  ? 94.874  145.262 11.532  1.00 68.40  ? 139  C   A "C4'" 1 
ATOM   2725  O  "O4'" . C   A  1  138  ? 94.447  143.895 11.784  1.00 68.12  ? 139  C   A "O4'" 1 
ATOM   2726  C  "C3'" . C   A  1  138  ? 96.386  145.282 11.767  1.00 67.39  ? 139  C   A "C3'" 1 
ATOM   2727  O  "O3'" . C   A  1  138  ? 96.661  145.608 13.128  1.00 64.24  ? 139  C   A "O3'" 1 
ATOM   2728  C  "C2'" . C   A  1  138  ? 96.778  143.828 11.540  1.00 68.82  ? 139  C   A "C2'" 1 
ATOM   2729  O  "O2'" . C   A  1  138  ? 97.962  143.448 12.214  1.00 69.36  ? 139  C   A "O2'" 1 
ATOM   2730  C  "C1'" . C   A  1  138  ? 95.569  143.115 12.131  1.00 69.65  ? 139  C   A "C1'" 1 
ATOM   2731  N  N1    . C   A  1  138  ? 95.391  141.767 11.603  1.00 70.90  ? 139  C   A N1    1 
ATOM   2732  C  C2    . C   A  1  138  ? 95.805  140.684 12.389  1.00 72.13  ? 139  C   A C2    1 
ATOM   2733  O  O2    . C   A  1  138  ? 96.284  140.901 13.521  1.00 71.74  ? 139  C   A O2    1 
ATOM   2734  N  N3    . C   A  1  138  ? 95.677  139.434 11.901  1.00 72.86  ? 139  C   A N3    1 
ATOM   2735  C  C4    . C   A  1  138  ? 95.155  139.242 10.685  1.00 73.35  ? 139  C   A C4    1 
ATOM   2736  N  N4    . C   A  1  138  ? 95.051  137.989 10.240  1.00 74.44  ? 139  C   A N4    1 
ATOM   2737  C  C5    . C   A  1  138  ? 94.716  140.328 9.869   1.00 72.68  ? 139  C   A C5    1 
ATOM   2738  C  C6    . C   A  1  138  ? 94.848  141.561 10.365  1.00 71.67  ? 139  C   A C6    1 
ATOM   2739  P  P     . G   A  1  139  ? 96.931  147.127 13.531  1.00 61.59  ? 140  G   A P     1 
ATOM   2740  O  OP1   . G   A  1  139  ? 97.911  147.647 12.551  1.00 62.06  ? 140  G   A OP1   1 
ATOM   2741  O  OP2   . G   A  1  139  ? 97.235  147.190 14.970  1.00 62.16  ? 140  G   A OP2   1 
ATOM   2742  O  "O5'" . G   A  1  139  ? 95.516  147.802 13.264  1.00 58.31  ? 140  G   A "O5'" 1 
ATOM   2743  C  "C5'" . G   A  1  139  ? 95.316  149.198 13.481  1.00 54.26  ? 140  G   A "C5'" 1 
ATOM   2744  C  "C4'" . G   A  1  139  ? 93.843  149.499 13.645  1.00 51.73  ? 140  G   A "C4'" 1 
ATOM   2745  O  "O4'" . G   A  1  139  ? 93.123  149.147 12.441  1.00 50.97  ? 140  G   A "O4'" 1 
ATOM   2746  C  "C3'" . G   A  1  139  ? 93.084  148.712 14.695  1.00 49.82  ? 140  G   A "C3'" 1 
ATOM   2747  O  "O3'" . G   A  1  139  ? 93.362  149.228 15.989  1.00 47.26  ? 140  G   A "O3'" 1 
ATOM   2748  C  "C2'" . G   A  1  139  ? 91.633  148.971 14.286  1.00 49.94  ? 140  G   A "C2'" 1 
ATOM   2749  O  "O2'" . G   A  1  139  ? 91.142  150.213 14.762  1.00 50.34  ? 140  G   A "O2'" 1 
ATOM   2750  C  "C1'" . G   A  1  139  ? 91.749  149.038 12.757  1.00 50.22  ? 140  G   A "C1'" 1 
ATOM   2751  N  N9    . G   A  1  139  ? 91.179  147.942 11.975  1.00 50.43  ? 140  G   A N9    1 
ATOM   2752  C  C8    . G   A  1  139  ? 90.432  148.073 10.831  1.00 50.35  ? 140  G   A C8    1 
ATOM   2753  N  N7    . G   A  1  139  ? 90.087  146.930 10.309  1.00 50.48  ? 140  G   A N7    1 
ATOM   2754  C  C5    . G   A  1  139  ? 90.626  145.983 11.166  1.00 51.32  ? 140  G   A C5    1 
ATOM   2755  C  C6    . G   A  1  139  ? 90.571  144.572 11.115  1.00 51.76  ? 140  G   A C6    1 
ATOM   2756  O  O6    . G   A  1  139  ? 90.022  143.851 10.273  1.00 51.87  ? 140  G   A O6    1 
ATOM   2757  N  N1    . G   A  1  139  ? 91.243  143.994 12.183  1.00 52.27  ? 140  G   A N1    1 
ATOM   2758  C  C2    . G   A  1  139  ? 91.886  144.682 13.176  1.00 53.18  ? 140  G   A C2    1 
ATOM   2759  N  N2    . G   A  1  139  ? 92.489  143.930 14.118  1.00 53.55  ? 140  G   A N2    1 
ATOM   2760  N  N3    . G   A  1  139  ? 91.940  146.006 13.240  1.00 53.03  ? 140  G   A N3    1 
ATOM   2761  C  C4    . G   A  1  139  ? 91.294  146.588 12.206  1.00 51.11  ? 140  G   A C4    1 
ATOM   2762  P  P     . C   A  1  140  ? 92.756  148.503 17.285  1.00 45.81  ? 141  C   A P     1 
ATOM   2763  O  OP1   . C   A  1  140  ? 93.376  149.105 18.505  1.00 44.14  ? 141  C   A OP1   1 
ATOM   2764  O  OP2   . C   A  1  140  ? 92.830  147.028 17.060  1.00 45.43  ? 141  C   A OP2   1 
ATOM   2765  O  "O5'" . C   A  1  140  ? 91.220  148.920 17.270  1.00 43.60  ? 141  C   A "O5'" 1 
ATOM   2766  C  "C5'" . C   A  1  140  ? 90.274  148.167 18.024  1.00 42.02  ? 141  C   A "C5'" 1 
ATOM   2767  C  "C4'" . C   A  1  140  ? 89.069  147.843 17.185  1.00 42.36  ? 141  C   A "C4'" 1 
ATOM   2768  O  "O4'" . C   A  1  140  ? 88.522  146.576 17.623  1.00 43.67  ? 141  C   A "O4'" 1 
ATOM   2769  C  "C3'" . C   A  1  140  ? 87.921  148.835 17.259  1.00 41.31  ? 141  C   A "C3'" 1 
ATOM   2770  O  "O3'" . C   A  1  140  ? 87.171  148.698 16.062  1.00 41.48  ? 141  C   A "O3'" 1 
ATOM   2771  C  "C2'" . C   A  1  140  ? 87.126  148.278 18.436  1.00 42.51  ?