data_1N99
# 
_entry.id   1N99 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1N99         
RCSB  RCSB017677   
WWPDB D_1000017677 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1N99 
_pdbx_database_status.recvd_initial_deposition_date   2002-11-22 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kang, B.S.'      1 
'Cooper, D.R.'    2 
'Jelen, F.'       3 
'Devedjiev, Y.'   4 
'Derewenda, U.'   5 
'Dauter, Z.'      6 
'Otlewski, J.'    7 
'Derewenda, Z.S.' 8 
# 
_citation.id                        primary 
_citation.title                     'PDZ Tandem of Human Syntenin: Crystal Structure and Functional Properties' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            11 
_citation.page_first                459 
_citation.page_last                 468 
_citation.year                      2003 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12679023 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(03)00052-2' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kang, B.S.'      1 
primary 'Cooper, D.R.'    2 
primary 'Jelen, F.'       3 
primary 'Devedjiev, Y.'   4 
primary 'Derewenda, U.'   5 
primary 'Dauter, Z.'      6 
primary 'Otlewski, J.'    7 
primary 'Derewenda, Z.S.' 8 
# 
_cell.entry_id           1N99 
_cell.length_a           100.727 
_cell.length_b           48.678 
_cell.length_c           74.690 
_cell.angle_alpha        90.00 
_cell.angle_beta         120.82 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1N99 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Syntenin 1' 18206.270 2   ? ? 'PDZ Tandem' ? 
2 water   nat water        18.015    254 ? ? ?            ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Syndecan binding protein 1, Melanoma differentiation associated protein-9, Mda-9, Scaffold protein Pbp1, Pro-TGF-alpha cytoplasmic domain-interacting protein 18, TACIP18
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GA(MSE)DPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFG
EKIT(MSE)TIRDRPFERTIT(MSE)HKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIA
DILSTSGTVVTITI(MSE)PAF
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMDPREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKIT
MTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTI
TIMPAF
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MSE n 
1 4   ASP n 
1 5   PRO n 
1 6   ARG n 
1 7   GLU n 
1 8   VAL n 
1 9   ILE n 
1 10  LEU n 
1 11  CYS n 
1 12  LYS n 
1 13  ASP n 
1 14  GLN n 
1 15  ASP n 
1 16  GLY n 
1 17  LYS n 
1 18  ILE n 
1 19  GLY n 
1 20  LEU n 
1 21  ARG n 
1 22  LEU n 
1 23  LYS n 
1 24  SER n 
1 25  ILE n 
1 26  ASP n 
1 27  ASN n 
1 28  GLY n 
1 29  ILE n 
1 30  PHE n 
1 31  VAL n 
1 32  GLN n 
1 33  LEU n 
1 34  VAL n 
1 35  GLN n 
1 36  ALA n 
1 37  ASN n 
1 38  SER n 
1 39  PRO n 
1 40  ALA n 
1 41  SER n 
1 42  LEU n 
1 43  VAL n 
1 44  GLY n 
1 45  LEU n 
1 46  ARG n 
1 47  PHE n 
1 48  GLY n 
1 49  ASP n 
1 50  GLN n 
1 51  VAL n 
1 52  LEU n 
1 53  GLN n 
1 54  ILE n 
1 55  ASN n 
1 56  GLY n 
1 57  GLU n 
1 58  ASN n 
1 59  CYS n 
1 60  ALA n 
1 61  GLY n 
1 62  TRP n 
1 63  SER n 
1 64  SER n 
1 65  ASP n 
1 66  LYS n 
1 67  ALA n 
1 68  HIS n 
1 69  LYS n 
1 70  VAL n 
1 71  LEU n 
1 72  LYS n 
1 73  GLN n 
1 74  ALA n 
1 75  PHE n 
1 76  GLY n 
1 77  GLU n 
1 78  LYS n 
1 79  ILE n 
1 80  THR n 
1 81  MSE n 
1 82  THR n 
1 83  ILE n 
1 84  ARG n 
1 85  ASP n 
1 86  ARG n 
1 87  PRO n 
1 88  PHE n 
1 89  GLU n 
1 90  ARG n 
1 91  THR n 
1 92  ILE n 
1 93  THR n 
1 94  MSE n 
1 95  HIS n 
1 96  LYS n 
1 97  ASP n 
1 98  SER n 
1 99  THR n 
1 100 GLY n 
1 101 HIS n 
1 102 VAL n 
1 103 GLY n 
1 104 PHE n 
1 105 ILE n 
1 106 PHE n 
1 107 LYS n 
1 108 ASN n 
1 109 GLY n 
1 110 LYS n 
1 111 ILE n 
1 112 THR n 
1 113 SER n 
1 114 ILE n 
1 115 VAL n 
1 116 LYS n 
1 117 ASP n 
1 118 SER n 
1 119 SER n 
1 120 ALA n 
1 121 ALA n 
1 122 ARG n 
1 123 ASN n 
1 124 GLY n 
1 125 LEU n 
1 126 LEU n 
1 127 THR n 
1 128 GLU n 
1 129 HIS n 
1 130 ASN n 
1 131 ILE n 
1 132 CYS n 
1 133 GLU n 
1 134 ILE n 
1 135 ASN n 
1 136 GLY n 
1 137 GLN n 
1 138 ASN n 
1 139 VAL n 
1 140 ILE n 
1 141 GLY n 
1 142 LEU n 
1 143 LYS n 
1 144 ASP n 
1 145 SER n 
1 146 GLN n 
1 147 ILE n 
1 148 ALA n 
1 149 ASP n 
1 150 ILE n 
1 151 LEU n 
1 152 SER n 
1 153 THR n 
1 154 SER n 
1 155 GLY n 
1 156 THR n 
1 157 VAL n 
1 158 VAL n 
1 159 THR n 
1 160 ILE n 
1 161 THR n 
1 162 ILE n 
1 163 MSE n 
1 164 PRO n 
1 165 ALA n 
1 166 PHE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'SDCBP OR MDA9 OR SYCL' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               D834 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGST-parallel1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SDCB1_HUMAN 
_struct_ref.pdbx_db_accession          O00560 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;REVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRD
RPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPA
F
;
_struct_ref.pdbx_align_begin           113 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1N99 A 6 ? 166 ? O00560 113 ? 273 ? 113 273 
2 1 1N99 B 6 ? 166 ? O00560 113 ? 273 ? 113 273 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1N99 GLY A 1   ? UNP O00560 ?   ?   'CLONING ARTIFACT'              108 1  
1 1N99 ALA A 2   ? UNP O00560 ?   ?   'CLONING ARTIFACT'              109 2  
1 1N99 MSE A 3   ? UNP O00560 ?   ?   'MOD. RESIDUE/CLONING ARTIFACT' 110 3  
1 1N99 ASP A 4   ? UNP O00560 ?   ?   'CLONING ARTIFACT'              111 4  
1 1N99 PRO A 5   ? UNP O00560 ?   ?   'CLONING ARTIFACT'              112 5  
1 1N99 MSE A 81  ? UNP O00560 MET 188 'MODIFIED RESIDUE'              188 6  
1 1N99 MSE A 94  ? UNP O00560 MET 201 'MODIFIED RESIDUE'              201 7  
1 1N99 MSE A 163 ? UNP O00560 MET 270 'MODIFIED RESIDUE'              270 8  
2 1N99 GLY B 1   ? UNP O00560 ?   ?   'CLONING ARTIFACT'              108 9  
2 1N99 ALA B 2   ? UNP O00560 ?   ?   'CLONING ARTIFACT'              109 10 
2 1N99 MSE B 3   ? UNP O00560 ?   ?   'MOD. RESIDUE/CLONING ARTIFACT' 110 11 
2 1N99 ASP B 4   ? UNP O00560 ?   ?   'CLONING ARTIFACT'              111 12 
2 1N99 PRO B 5   ? UNP O00560 ?   ?   'CLONING ARTIFACT'              112 13 
2 1N99 MSE B 81  ? UNP O00560 MET 188 'MODIFIED RESIDUE'              188 14 
2 1N99 MSE B 94  ? UNP O00560 MET 201 'MODIFIED RESIDUE'              201 15 
2 1N99 MSE B 163 ? UNP O00560 MET 270 'MODIFIED RESIDUE'              270 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1N99 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.07 
_exptl_crystal.density_percent_sol   40.23 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              4.6 
_exptl_crystal_grow.pdbx_details    
'sodium acetate, PEG4000, ammonium acetate, pH 4.6, VAPOR DIFFUSION, SITTING DROP, temperature 294K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2001-10-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.97946 1.0 
2 0.97133 1.0 
3 0.97900 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X9B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X9B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.97946, 0.97133, 0.97900' 
# 
_reflns.entry_id                     1N99 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   -3.00 
_reflns.d_resolution_high            1.94 
_reflns.d_resolution_low             30.00 
_reflns.number_all                   ? 
_reflns.number_obs                   23111 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.073 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        21.29 
_reflns.B_iso_Wilson_estimate        28.0 
_reflns.pdbx_redundancy              11.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.94 
_reflns_shell.d_res_low              2.01 
_reflns_shell.percent_possible_all   94.8 
_reflns_shell.Rmerge_I_obs           0.342 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    5.8 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2170 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1N99 
_refine.ls_number_reflns_obs                     21926 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             30.00 
_refine.ls_d_res_high                            1.94 
_refine.ls_percent_reflns_obs                    99.700 
_refine.ls_R_factor_obs                          0.18641 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18424 
_refine.ls_R_factor_R_free                       0.2268 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1182 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.959 
_refine.correlation_coeff_Fo_to_Fc_free          0.930 
_refine.B_iso_mean                               21.106 
_refine.aniso_B[1][1]                            -1.58 
_refine.aniso_B[2][2]                            0.05 
_refine.aniso_B[3][3]                            2.16 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.62 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             TLS 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.157 
_refine.overall_SU_B                             3.308 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            0.094 
_refine.pdbx_overall_ESU_R                       0.178 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1N99 
_refine_analyze.Luzzati_coordinate_error_obs    0.246 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2454 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             254 
_refine_hist.number_atoms_total               2708 
_refine_hist.d_res_high                       1.94 
_refine_hist.d_res_low                        30.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.015 0.021 ? 2454 'X-RAY DIFFRACTION' ? 
r_bond_other_d           0.001 0.020 ? 2280 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.803 1.945 ? 3315 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        0.874 3.000 ? 5303 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   7.542 5.000 ? 323  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.127 0.200 ? 397  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.008 0.020 ? 2745 'X-RAY DIFFRACTION' ? 
r_gen_planes_other       0.004 0.020 ? 454  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.247 0.300 ? 452  'X-RAY DIFFRACTION' ? 
r_nbd_other              0.267 0.300 ? 2743 'X-RAY DIFFRACTION' ? 
r_nbtor_other            0.094 0.500 ? 1630 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.212 0.500 ? 310  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.134 0.300 ? 18   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     0.328 0.300 ? 53   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.300 0.500 ? 26   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.902 1.500 ? 1599 'X-RAY DIFFRACTION' ? 
r_mcangle_it             3.060 2.000 ? 2575 'X-RAY DIFFRACTION' ? 
r_scbond_it              5.018 3.000 ? 855  'X-RAY DIFFRACTION' ? 
r_scangle_it             7.528 4.500 ? 740  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.94 
_refine_ls_shell.d_res_low                        1.99 
_refine_ls_shell.number_reflns_R_work             1560 
_refine_ls_shell.R_factor_R_work                  0.24 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.252 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             79 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1N99 
_struct.title                     'CRYSTAL STRUCTURE OF THE PDZ TANDEM OF HUMAN SYNTENIN' 
_struct.pdbx_descriptor           'Syntenin 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1N99 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            'PDZ domain, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
_struct_biol.pdbx_parent_biol_id 
1 'Each monomer is a biological assembly' ? 
2 ?                                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 38  ? VAL A 43  ? SER A 145 VAL A 150 1 ? 6  
HELX_P HELX_P2 2 SER A 63  ? GLN A 73  ? SER A 170 GLN A 180 1 ? 11 
HELX_P HELX_P3 3 SER A 118 ? ASN A 123 ? SER A 225 ASN A 230 1 ? 6  
HELX_P HELX_P4 4 LYS A 143 ? SER A 154 ? LYS A 250 SER A 261 1 ? 12 
HELX_P HELX_P5 5 ALA B 40  ? GLY B 44  ? ALA B 147 GLY B 151 5 ? 5  
HELX_P HELX_P6 6 SER B 63  ? ALA B 74  ? SER B 170 ALA B 181 1 ? 12 
HELX_P HELX_P7 7 SER B 118 ? ASN B 123 ? SER B 225 ASN B 230 1 ? 6  
HELX_P HELX_P8 8 LYS B 143 ? SER B 154 ? LYS B 250 SER B 261 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A THR 80  C ? ? ? 1_555 A MSE 81  N ? ? A THR 187 A MSE 188 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale2  covale ? ? A MSE 81  C ? ? ? 1_555 A THR 82  N ? ? A MSE 188 A THR 189 1_555 ? ? ? ? ? ? ? 1.341 ? 
covale3  covale ? ? A THR 93  C ? ? ? 1_555 A MSE 94  N ? ? A THR 200 A MSE 201 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale4  covale ? ? A MSE 94  C ? ? ? 1_555 A HIS 95  N ? ? A MSE 201 A HIS 202 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale5  covale ? ? A ILE 162 C ? ? ? 1_555 A MSE 163 N ? ? A ILE 269 A MSE 270 1_555 ? ? ? ? ? ? ? 1.312 ? 
covale6  covale ? ? A MSE 163 C ? ? ? 1_555 A PRO 164 N ? ? A MSE 270 A PRO 271 1_555 ? ? ? ? ? ? ? 1.320 ? 
covale7  covale ? ? B MSE 3   C ? ? ? 1_555 B ASP 4   N ? ? B MSE 110 B ASP 111 1_555 ? ? ? ? ? ? ? 1.317 ? 
covale8  covale ? ? B THR 80  C ? ? ? 1_555 B MSE 81  N ? ? B THR 187 B MSE 188 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale9  covale ? ? B MSE 81  C ? ? ? 1_555 B THR 82  N ? ? B MSE 188 B THR 189 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale10 covale ? ? B THR 93  C ? ? ? 1_555 B MSE 94  N ? ? B THR 200 B MSE 201 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale11 covale ? ? B MSE 94  C ? ? ? 1_555 B HIS 95  N ? ? B MSE 201 B HIS 202 1_555 ? ? ? ? ? ? ? 1.323 ? 
covale12 covale ? ? B ILE 162 C ? ? ? 1_555 B MSE 163 N ? ? B ILE 269 B MSE 270 1_555 ? ? ? ? ? ? ? 1.311 ? 
covale13 covale ? ? B MSE 163 C ? ? ? 1_555 B PRO 164 N ? ? B MSE 270 B PRO 271 1_555 ? ? ? ? ? ? ? 1.323 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 4 ? 
C ? 4 ? 
D ? 2 ? 
E ? 4 ? 
F ? 2 ? 
G ? 5 ? 
H ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
H 1 2 ? anti-parallel 
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ARG A 6   ? CYS A 11  ? ARG A 113 CYS A 118 
A 2 LYS A 78  ? ARG A 84  ? LYS A 185 ARG A 191 
A 3 GLN A 50  ? ILE A 54  ? GLN A 157 ILE A 161 
A 4 GLY A 28  ? VAL A 34  ? GLY A 135 VAL A 141 
A 5 LEU A 20  ? ILE A 25  ? LEU A 127 ILE A 132 
B 1 ARG A 6   ? CYS A 11  ? ARG A 113 CYS A 118 
B 2 LYS A 78  ? ARG A 84  ? LYS A 185 ARG A 191 
B 3 GLN A 50  ? ILE A 54  ? GLN A 157 ILE A 161 
B 4 GLU A 57  ? ASN A 58  ? GLU A 164 ASN A 165 
C 1 ARG A 90  ? HIS A 95  ? ARG A 197 HIS A 202 
C 2 VAL A 157 ? PRO A 164 ? VAL A 264 PRO A 271 
C 3 HIS A 129 ? ILE A 134 ? HIS A 236 ILE A 241 
C 4 GLN A 137 ? ASN A 138 ? GLN A 244 ASN A 245 
D 1 PHE A 104 ? LYS A 107 ? PHE A 211 LYS A 214 
D 2 LYS A 110 ? ILE A 114 ? LYS A 217 ILE A 221 
E 1 ARG B 6   ? LEU B 10  ? ARG B 113 LEU B 117 
E 2 ILE B 79  ? ARG B 84  ? ILE B 186 ARG B 191 
E 3 GLN B 50  ? ILE B 54  ? GLN B 157 ILE B 161 
E 4 GLU B 57  ? ASN B 58  ? GLU B 164 ASN B 165 
F 1 LEU B 20  ? ILE B 25  ? LEU B 127 ILE B 132 
F 2 GLY B 28  ? VAL B 34  ? GLY B 135 VAL B 141 
G 1 ARG B 90  ? HIS B 95  ? ARG B 197 HIS B 202 
G 2 VAL B 157 ? PRO B 164 ? VAL B 264 PRO B 271 
G 3 HIS B 129 ? ILE B 134 ? HIS B 236 ILE B 241 
G 4 LYS B 110 ? ILE B 114 ? LYS B 217 ILE B 221 
G 5 PHE B 104 ? LYS B 107 ? PHE B 211 LYS B 214 
H 1 ARG B 90  ? HIS B 95  ? ARG B 197 HIS B 202 
H 2 VAL B 157 ? PRO B 164 ? VAL B 264 PRO B 271 
H 3 HIS B 129 ? ILE B 134 ? HIS B 236 ILE B 241 
H 4 GLN B 137 ? ASN B 138 ? GLN B 244 ASN B 245 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 10  ? N LEU A 117 O ILE A 79  ? O ILE A 186 
A 2 3 O ARG A 84  ? O ARG A 191 N GLN A 50  ? N GLN A 157 
A 3 4 O VAL A 51  ? O VAL A 158 N ILE A 29  ? N ILE A 136 
A 4 5 O GLN A 32  ? O GLN A 139 N ARG A 21  ? N ARG A 128 
B 1 2 N LEU A 10  ? N LEU A 117 O ILE A 79  ? O ILE A 186 
B 2 3 O ARG A 84  ? O ARG A 191 N GLN A 50  ? N GLN A 157 
B 3 4 N ILE A 54  ? N ILE A 161 O GLU A 57  ? O GLU A 164 
C 1 2 N MSE A 94  ? N MSE A 201 O VAL A 158 ? O VAL A 265 
C 2 3 O MSE A 163 ? O MSE A 270 N ASN A 130 ? N ASN A 237 
C 3 4 N ILE A 134 ? N ILE A 241 O GLN A 137 ? O GLN A 244 
D 1 2 N ILE A 105 ? N ILE A 212 O THR A 112 ? O THR A 219 
E 1 2 N ARG B 6   ? N ARG B 113 O ILE B 83  ? O ILE B 190 
E 2 3 O ARG B 84  ? O ARG B 191 N GLN B 50  ? N GLN B 157 
E 3 4 N ILE B 54  ? N ILE B 161 O GLU B 57  ? O GLU B 164 
F 1 2 N ARG B 21  ? N ARG B 128 O GLN B 32  ? O GLN B 139 
G 1 2 N MSE B 94  ? N MSE B 201 O VAL B 158 ? O VAL B 265 
G 2 3 O MSE B 163 ? O MSE B 270 N ASN B 130 ? N ASN B 237 
G 3 4 O HIS B 129 ? O HIS B 236 N ILE B 111 ? N ILE B 218 
G 4 5 O LYS B 110 ? O LYS B 217 N LYS B 107 ? N LYS B 214 
H 1 2 N MSE B 94  ? N MSE B 201 O VAL B 158 ? O VAL B 265 
H 2 3 O MSE B 163 ? O MSE B 270 N ASN B 130 ? N ASN B 237 
H 3 4 N ILE B 134 ? N ILE B 241 O GLN B 137 ? O GLN B 244 
# 
_database_PDB_matrix.entry_id          1N99 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1N99 
_atom_sites.fract_transf_matrix[1][1]   0.009928 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005922 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020543 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015590 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 5   ? 30.747  -9.125  23.620 1.00 28.84 ? 112 PRO A N   1 
ATOM   2    C  CA  . PRO A 1 5   ? 30.830  -9.904  22.338 1.00 27.67 ? 112 PRO A CA  1 
ATOM   3    C  C   . PRO A 1 5   ? 30.841  -11.377 22.643 1.00 24.13 ? 112 PRO A C   1 
ATOM   4    O  O   . PRO A 1 5   ? 31.337  -11.748 23.686 1.00 25.24 ? 112 PRO A O   1 
ATOM   5    C  CB  . PRO A 1 5   ? 32.174  -9.519  21.708 1.00 28.42 ? 112 PRO A CB  1 
ATOM   6    C  CG  . PRO A 1 5   ? 32.907  -8.692  22.762 1.00 31.90 ? 112 PRO A CG  1 
ATOM   7    C  CD  . PRO A 1 5   ? 31.986  -8.384  23.900 1.00 30.75 ? 112 PRO A CD  1 
ATOM   8    N  N   . ARG A 1 6   ? 30.263  -12.192 21.778 1.00 21.84 ? 113 ARG A N   1 
ATOM   9    C  CA  . ARG A 1 6   ? 30.160  -13.608 22.056 1.00 21.16 ? 113 ARG A CA  1 
ATOM   10   C  C   . ARG A 1 6   ? 30.764  -14.391 20.903 1.00 20.94 ? 113 ARG A C   1 
ATOM   11   O  O   . ARG A 1 6   ? 30.756  -13.918 19.774 1.00 20.76 ? 113 ARG A O   1 
ATOM   12   C  CB  . ARG A 1 6   ? 28.711  -13.975 22.376 1.00 20.42 ? 113 ARG A CB  1 
ATOM   13   C  CG  . ARG A 1 6   ? 27.668  -13.809 21.289 1.00 22.71 ? 113 ARG A CG  1 
ATOM   14   C  CD  . ARG A 1 6   ? 26.285  -14.239 21.698 1.00 24.58 ? 113 ARG A CD  1 
ATOM   15   N  NE  . ARG A 1 6   ? 25.364  -14.212 20.580 1.00 21.71 ? 113 ARG A NE  1 
ATOM   16   C  CZ  . ARG A 1 6   ? 24.938  -15.270 19.910 1.00 27.46 ? 113 ARG A CZ  1 
ATOM   17   N  NH1 . ARG A 1 6   ? 25.316  -16.506 20.230 1.00 28.42 ? 113 ARG A NH1 1 
ATOM   18   N  NH2 . ARG A 1 6   ? 24.108  -15.090 18.888 1.00 27.68 ? 113 ARG A NH2 1 
ATOM   19   N  N   . GLU A 1 7   ? 31.320  -15.558 21.205 1.00 20.85 ? 114 GLU A N   1 
ATOM   20   C  CA  . GLU A 1 7   ? 31.821  -16.487 20.198 1.00 19.86 ? 114 GLU A CA  1 
ATOM   21   C  C   . GLU A 1 7   ? 30.703  -17.403 19.720 1.00 20.14 ? 114 GLU A C   1 
ATOM   22   O  O   . GLU A 1 7   ? 29.950  -17.937 20.528 1.00 17.88 ? 114 GLU A O   1 
ATOM   23   C  CB  . GLU A 1 7   ? 33.003  -17.323 20.694 1.00 19.86 ? 114 GLU A CB  1 
ATOM   24   C  CG  . GLU A 1 7   ? 33.811  -17.983 19.575 1.00 26.31 ? 114 GLU A CG  1 
ATOM   25   C  CD  . GLU A 1 7   ? 34.880  -19.015 20.020 1.00 34.49 ? 114 GLU A CD  1 
ATOM   26   O  OE1 . GLU A 1 7   ? 34.552  -20.170 20.362 1.00 32.07 ? 114 GLU A OE1 1 
ATOM   27   O  OE2 . GLU A 1 7   ? 36.091  -18.710 19.982 1.00 33.82 ? 114 GLU A OE2 1 
ATOM   28   N  N   . VAL A 1 8   ? 30.572  -17.573 18.406 1.00 17.83 ? 115 VAL A N   1 
ATOM   29   C  CA  . VAL A 1 8   ? 29.668  -18.587 17.891 1.00 18.80 ? 115 VAL A CA  1 
ATOM   30   C  C   . VAL A 1 8   ? 30.435  -19.467 16.912 1.00 18.96 ? 115 VAL A C   1 
ATOM   31   O  O   . VAL A 1 8   ? 31.346  -19.011 16.206 1.00 18.22 ? 115 VAL A O   1 
ATOM   32   C  CB  . VAL A 1 8   ? 28.403  -18.001 17.190 1.00 20.29 ? 115 VAL A CB  1 
ATOM   33   C  CG1 . VAL A 1 8   ? 27.518  -17.222 18.172 1.00 24.42 ? 115 VAL A CG1 1 
ATOM   34   C  CG2 . VAL A 1 8   ? 28.741  -17.110 16.052 1.00 23.77 ? 115 VAL A CG2 1 
ATOM   35   N  N   . ILE A 1 9   ? 30.040  -20.729 16.852 1.00 15.52 ? 116 ILE A N   1 
ATOM   36   C  CA  . ILE A 1 9   ? 30.616  -21.646 15.885 1.00 18.91 ? 116 ILE A CA  1 
ATOM   37   C  C   . ILE A 1 9   ? 29.498  -22.140 15.000 1.00 17.91 ? 116 ILE A C   1 
ATOM   38   O  O   . ILE A 1 9   ? 28.625  -22.833 15.460 1.00 17.89 ? 116 ILE A O   1 
ATOM   39   C  CB  . ILE A 1 9   ? 31.284  -22.831 16.581 1.00 16.77 ? 116 ILE A CB  1 
ATOM   40   C  CG1 . ILE A 1 9   ? 32.337  -22.398 17.589 1.00 26.59 ? 116 ILE A CG1 1 
ATOM   41   C  CG2 . ILE A 1 9   ? 31.870  -23.780 15.569 1.00 21.66 ? 116 ILE A CG2 1 
ATOM   42   C  CD1 . ILE A 1 9   ? 33.490  -21.646 16.981 1.00 34.19 ? 116 ILE A CD1 1 
ATOM   43   N  N   . LEU A 1 10  ? 29.520  -21.765 13.730 1.00 18.63 ? 117 LEU A N   1 
ATOM   44   C  CA  . LEU A 1 10  ? 28.534  -22.234 12.784 1.00 18.68 ? 117 LEU A CA  1 
ATOM   45   C  C   . LEU A 1 10  ? 29.055  -23.504 12.149 1.00 18.61 ? 117 LEU A C   1 
ATOM   46   O  O   . LEU A 1 10  ? 30.227  -23.590 11.833 1.00 19.15 ? 117 LEU A O   1 
ATOM   47   C  CB  . LEU A 1 10  ? 28.281  -21.204 11.706 1.00 17.18 ? 117 LEU A CB  1 
ATOM   48   C  CG  . LEU A 1 10  ? 27.456  -20.011 12.181 1.00 23.09 ? 117 LEU A CG  1 
ATOM   49   C  CD1 . LEU A 1 10  ? 28.368  -19.118 12.904 1.00 21.68 ? 117 LEU A CD1 1 
ATOM   50   C  CD2 . LEU A 1 10  ? 26.780  -19.312 11.033 1.00 21.21 ? 117 LEU A CD2 1 
ATOM   51   N  N   . CYS A 1 11  ? 28.174  -24.477 12.005 1.00 20.59 ? 118 CYS A N   1 
ATOM   52   C  CA  . CYS A 1 11  ? 28.450  -25.690 11.253 1.00 23.57 ? 118 CYS A CA  1 
ATOM   53   C  C   . CYS A 1 11  ? 27.773  -25.643 9.887  1.00 21.35 ? 118 CYS A C   1 
ATOM   54   O  O   . CYS A 1 11  ? 26.569  -25.508 9.792  1.00 22.84 ? 118 CYS A O   1 
ATOM   55   C  CB  . CYS A 1 11  ? 27.974  -26.911 12.036 1.00 25.00 ? 118 CYS A CB  1 
ATOM   56   S  SG  . CYS A 1 11  ? 28.595  -26.933 13.752 1.00 43.14 ? 118 CYS A SG  1 
ATOM   57   N  N   . LYS A 1 12  ? 28.552  -25.717 8.826  1.00 21.61 ? 119 LYS A N   1 
ATOM   58   C  CA  . LYS A 1 12  ? 28.001  -25.638 7.471  1.00 24.31 ? 119 LYS A CA  1 
ATOM   59   C  C   . LYS A 1 12  ? 27.012  -26.775 7.203  1.00 26.03 ? 119 LYS A C   1 
ATOM   60   O  O   . LYS A 1 12  ? 27.209  -27.910 7.650  1.00 27.94 ? 119 LYS A O   1 
ATOM   61   C  CB  . LYS A 1 12  ? 29.119  -25.755 6.435  1.00 23.74 ? 119 LYS A CB  1 
ATOM   62   C  CG  . LYS A 1 12  ? 30.187  -24.705 6.490  1.00 25.35 ? 119 LYS A CG  1 
ATOM   63   C  CD  . LYS A 1 12  ? 31.193  -24.895 5.370  1.00 29.47 ? 119 LYS A CD  1 
ATOM   64   C  CE  . LYS A 1 12  ? 32.208  -23.782 5.313  1.00 30.74 ? 119 LYS A CE  1 
ATOM   65   N  NZ  . LYS A 1 12  ? 33.296  -24.094 4.348  1.00 30.70 ? 119 LYS A NZ  1 
ATOM   66   N  N   . ASP A 1 13  ? 25.941  -26.493 6.470  1.00 26.46 ? 120 ASP A N   1 
ATOM   67   C  CA  . ASP A 1 13  ? 25.037  -27.563 6.078  1.00 25.86 ? 120 ASP A CA  1 
ATOM   68   C  C   . ASP A 1 13  ? 25.628  -28.480 4.982  1.00 25.68 ? 120 ASP A C   1 
ATOM   69   O  O   . ASP A 1 13  ? 26.783  -28.337 4.570  1.00 19.21 ? 120 ASP A O   1 
ATOM   70   C  CB  . ASP A 1 13  ? 23.603  -27.044 5.848  1.00 26.47 ? 120 ASP A CB  1 
ATOM   71   C  CG  . ASP A 1 13  ? 23.459  -26.159 4.613  1.00 29.26 ? 120 ASP A CG  1 
ATOM   72   O  OD1 . ASP A 1 13  ? 24.318  -26.154 3.704  1.00 23.62 ? 120 ASP A OD1 1 
ATOM   73   O  OD2 . ASP A 1 13  ? 22.474  -25.414 4.485  1.00 32.13 ? 120 ASP A OD2 1 
ATOM   74   N  N   . GLN A 1 14  ? 24.896  -29.508 4.570  1.00 27.79 ? 121 GLN A N   1 
ATOM   75   C  CA  . GLN A 1 14  ? 25.476  -30.430 3.590  1.00 29.05 ? 121 GLN A CA  1 
ATOM   76   C  C   . GLN A 1 14  ? 25.876  -29.666 2.307  1.00 29.95 ? 121 GLN A C   1 
ATOM   77   O  O   . GLN A 1 14  ? 26.896  -29.955 1.677  1.00 30.55 ? 121 GLN A O   1 
ATOM   78   C  CB  . GLN A 1 14  ? 24.529  -31.593 3.310  1.00 30.05 ? 121 GLN A CB  1 
ATOM   79   C  CG  . GLN A 1 14  ? 24.085  -32.449 4.485  0.00 82.51 ? 121 GLN A CG  1 
ATOM   80   C  CD  . GLN A 1 14  ? 25.290  -33.273 4.891  0.00 88.91 ? 121 GLN A CD  1 
ATOM   81   O  OE1 . GLN A 1 14  ? 26.046  -33.743 4.042  0.00 88.71 ? 121 GLN A OE1 1 
ATOM   82   N  NE2 . GLN A 1 14  ? 25.659  -33.573 6.130  0.00 82.43 ? 121 GLN A NE2 1 
ATOM   83   N  N   . ASP A 1 15  ? 25.139  -28.603 1.987  1.00 29.18 ? 122 ASP A N   1 
ATOM   84   C  CA  . ASP A 1 15  ? 25.432  -27.819 0.792  1.00 26.86 ? 122 ASP A CA  1 
ATOM   85   C  C   . ASP A 1 15  ? 26.669  -26.938 0.891  1.00 26.68 ? 122 ASP A C   1 
ATOM   86   O  O   . ASP A 1 15  ? 27.003  -26.286 -0.087 1.00 27.84 ? 122 ASP A O   1 
ATOM   87   C  CB  . ASP A 1 15  ? 24.242  -26.924 0.442  1.00 25.60 ? 122 ASP A CB  1 
ATOM   88   C  CG  . ASP A 1 15  ? 23.025  -27.705 0.020  1.00 25.26 ? 122 ASP A CG  1 
ATOM   89   O  OD1 . ASP A 1 15  ? 23.175  -28.877 -0.389 1.00 24.35 ? 122 ASP A OD1 1 
ATOM   90   O  OD2 . ASP A 1 15  ? 21.864  -27.234 0.076  1.00 28.54 ? 122 ASP A OD2 1 
ATOM   91   N  N   . GLY A 1 16  ? 27.327  -26.854 2.047  1.00 23.82 ? 123 GLY A N   1 
ATOM   92   C  CA  . GLY A 1 16  ? 28.390  -25.881 2.214  1.00 22.91 ? 123 GLY A CA  1 
ATOM   93   C  C   . GLY A 1 16  ? 27.947  -24.493 2.691  1.00 21.60 ? 123 GLY A C   1 
ATOM   94   O  O   . GLY A 1 16  ? 28.743  -23.560 2.676  1.00 23.18 ? 123 GLY A O   1 
ATOM   95   N  N   . LYS A 1 17  ? 26.691  -24.356 3.116  1.00 22.24 ? 124 LYS A N   1 
ATOM   96   C  CA  . LYS A 1 17  ? 26.039  -23.065 3.342  1.00 19.70 ? 124 LYS A CA  1 
ATOM   97   C  C   . LYS A 1 17  ? 25.779  -22.904 4.817  1.00 18.64 ? 124 LYS A C   1 
ATOM   98   O  O   . LYS A 1 17  ? 25.650  -23.919 5.501  1.00 20.39 ? 124 LYS A O   1 
ATOM   99   C  CB  . LYS A 1 17  ? 24.731  -23.022 2.554  1.00 23.27 ? 124 LYS A CB  1 
ATOM   100  C  CG  . LYS A 1 17  ? 24.960  -22.947 1.014  1.00 25.64 ? 124 LYS A CG  1 
ATOM   101  C  CD  . LYS A 1 17  ? 25.606  -21.584 0.566  0.00 46.42 ? 124 LYS A CD  1 
ATOM   102  C  CE  . LYS A 1 17  ? 25.758  -21.581 -0.945 0.00 59.77 ? 124 LYS A CE  1 
ATOM   103  N  NZ  . LYS A 1 17  ? 24.443  -21.489 -1.635 0.00 36.40 ? 124 LYS A NZ  1 
ATOM   104  N  N   . ILE A 1 18  ? 25.786  -21.661 5.301  1.00 17.54 ? 125 ILE A N   1 
ATOM   105  C  CA  . ILE A 1 18  ? 25.404  -21.329 6.642  1.00 18.05 ? 125 ILE A CA  1 
ATOM   106  C  C   . ILE A 1 18  ? 24.173  -20.458 6.648  1.00 18.30 ? 125 ILE A C   1 
ATOM   107  O  O   . ILE A 1 18  ? 23.658  -20.184 7.706  1.00 17.45 ? 125 ILE A O   1 
ATOM   108  C  CB  . ILE A 1 18  ? 26.573  -20.638 7.398  1.00 21.31 ? 125 ILE A CB  1 
ATOM   109  C  CG1 . ILE A 1 18  ? 27.202  -19.504 6.561  1.00 24.17 ? 125 ILE A CG1 1 
ATOM   110  C  CG2 . ILE A 1 18  ? 27.638  -21.634 7.664  1.00 18.44 ? 125 ILE A CG2 1 
ATOM   111  C  CD1 . ILE A 1 18  ? 27.791  -18.464 7.443  1.00 26.40 ? 125 ILE A CD1 1 
ATOM   112  N  N   . GLY A 1 19  ? 23.710  -19.965 5.507  1.00 16.91 ? 126 GLY A N   1 
ATOM   113  C  CA  . GLY A 1 19  ? 22.474  -19.195 5.513  1.00 17.96 ? 126 GLY A CA  1 
ATOM   114  C  C   . GLY A 1 19  ? 22.513  -17.767 6.012  1.00 16.14 ? 126 GLY A C   1 
ATOM   115  O  O   . GLY A 1 19  ? 21.595  -17.270 6.661  1.00 17.26 ? 126 GLY A O   1 
ATOM   116  N  N   . LEU A 1 20  ? 23.572  -17.081 5.624  1.00 18.69 ? 127 LEU A N   1 
ATOM   117  C  CA  . LEU A 1 20  ? 23.964  -15.801 6.165  1.00 19.30 ? 127 LEU A CA  1 
ATOM   118  C  C   . LEU A 1 20  ? 24.419  -14.929 5.021  1.00 18.36 ? 127 LEU A C   1 
ATOM   119  O  O   . LEU A 1 20  ? 25.207  -15.410 4.201  1.00 18.77 ? 127 LEU A O   1 
ATOM   120  C  CB  . LEU A 1 20  ? 25.182  -15.991 7.075  1.00 22.29 ? 127 LEU A CB  1 
ATOM   121  C  CG  . LEU A 1 20  ? 25.598  -14.918 8.064  1.00 23.38 ? 127 LEU A CG  1 
ATOM   122  C  CD1 . LEU A 1 20  ? 24.454  -14.476 8.890  1.00 28.39 ? 127 LEU A CD1 1 
ATOM   123  C  CD2 . LEU A 1 20  ? 26.656  -15.488 8.952  1.00 28.56 ? 127 LEU A CD2 1 
ATOM   124  N  N   . ARG A 1 21  ? 23.948  -13.677 4.947  1.00 16.86 ? 128 ARG A N   1 
ATOM   125  C  CA  . ARG A 1 21  ? 24.598  -12.663 4.113  1.00 17.52 ? 128 ARG A CA  1 
ATOM   126  C  C   . ARG A 1 21  ? 25.113  -11.540 5.005  1.00 18.31 ? 128 ARG A C   1 
ATOM   127  O  O   . ARG A 1 21  ? 24.429  -11.078 5.918  1.00 17.35 ? 128 ARG A O   1 
ATOM   128  C  CB  . ARG A 1 21  ? 23.690  -12.102 3.031  1.00 19.32 ? 128 ARG A CB  1 
ATOM   129  C  CG  . ARG A 1 21  ? 24.306  -11.177 2.012  0.00 25.55 ? 128 ARG A CG  1 
ATOM   130  C  CD  . ARG A 1 21  ? 25.455  -11.800 1.238  0.00 58.43 ? 128 ARG A CD  1 
ATOM   131  N  NE  . ARG A 1 21  ? 25.002  -12.874 0.359  0.00 31.55 ? 128 ARG A NE  1 
ATOM   132  C  CZ  . ARG A 1 21  ? 24.531  -12.686 -0.869 0.00 32.95 ? 128 ARG A CZ  1 
ATOM   133  N  NH1 . ARG A 1 21  ? 24.448  -11.460 -1.365 0.00 33.49 ? 128 ARG A NH1 1 
ATOM   134  N  NH2 . ARG A 1 21  ? 24.143  -13.723 -1.596 0.00 33.97 ? 128 ARG A NH2 1 
ATOM   135  N  N   . LEU A 1 22  ? 26.339  -11.138 4.726  1.00 19.74 ? 129 LEU A N   1 
ATOM   136  C  CA  . LEU A 1 22  ? 27.002  -10.073 5.468  1.00 19.44 ? 129 LEU A CA  1 
ATOM   137  C  C   . LEU A 1 22  ? 27.119  -8.829  4.617  1.00 19.18 ? 129 LEU A C   1 
ATOM   138  O  O   . LEU A 1 22  ? 27.139  -8.903  3.414  1.00 18.91 ? 129 LEU A O   1 
ATOM   139  C  CB  . LEU A 1 22  ? 28.354  -10.558 5.956  1.00 17.83 ? 129 LEU A CB  1 
ATOM   140  C  CG  . LEU A 1 22  ? 28.344  -11.817 6.842  1.00 17.62 ? 129 LEU A CG  1 
ATOM   141  C  CD1 . LEU A 1 22  ? 29.790  -12.281 7.084  1.00 25.71 ? 129 LEU A CD1 1 
ATOM   142  C  CD2 . LEU A 1 22  ? 27.614  -11.585 8.126  1.00 21.37 ? 129 LEU A CD2 1 
ATOM   143  N  N   . LYS A 1 23  ? 27.146  -7.665  5.257  1.00 20.53 ? 130 LYS A N   1 
ATOM   144  C  CA  . LYS A 1 23  ? 27.220  -6.387  4.586  1.00 18.57 ? 130 LYS A CA  1 
ATOM   145  C  C   . LYS A 1 23  ? 28.220  -5.462  5.275  1.00 17.12 ? 130 LYS A C   1 
ATOM   146  O  O   . LYS A 1 23  ? 28.251  -5.351  6.504  1.00 16.95 ? 130 LYS A O   1 
ATOM   147  C  CB  . LYS A 1 23  ? 25.818  -5.774  4.591  1.00 19.69 ? 130 LYS A CB  1 
ATOM   148  C  CG  . LYS A 1 23  ? 25.709  -4.455  3.886  1.00 24.70 ? 130 LYS A CG  1 
ATOM   149  C  CD  . LYS A 1 23  ? 24.248  -4.096  3.650  1.00 30.63 ? 130 LYS A CD  1 
ATOM   150  C  CE  . LYS A 1 23  ? 24.090  -2.660  3.178  1.00 33.14 ? 130 LYS A CE  1 
ATOM   151  N  NZ  . LYS A 1 23  ? 22.719  -2.113  3.400  1.00 36.07 ? 130 LYS A NZ  1 
ATOM   152  N  N   . SER A 1 24  ? 28.999  -4.754  4.465  1.00 16.26 ? 131 SER A N   1 
ATOM   153  C  CA  . SER A 1 24  ? 29.829  -3.655  4.915  1.00 18.49 ? 131 SER A CA  1 
ATOM   154  C  C   . SER A 1 24  ? 29.090  -2.383  5.235  1.00 17.38 ? 131 SER A C   1 
ATOM   155  O  O   . SER A 1 24  ? 28.381  -1.829  4.383  1.00 19.97 ? 131 SER A O   1 
ATOM   156  C  CB  . SER A 1 24  ? 30.893  -3.351  3.872  1.00 19.45 ? 131 SER A CB  1 
ATOM   157  O  OG  . SER A 1 24  ? 31.737  -2.312  4.342  1.00 22.19 ? 131 SER A OG  1 
ATOM   158  N  N   . ILE A 1 25  ? 29.210  -1.935  6.484  1.00 16.84 ? 132 ILE A N   1 
ATOM   159  C  CA  . ILE A 1 25  ? 28.592  -0.678  6.931  1.00 17.61 ? 132 ILE A CA  1 
ATOM   160  C  C   . ILE A 1 25  ? 29.569  0.014   7.862  1.00 15.20 ? 132 ILE A C   1 
ATOM   161  O  O   . ILE A 1 25  ? 30.007  -0.603  8.826  1.00 13.55 ? 132 ILE A O   1 
ATOM   162  C  CB  . ILE A 1 25  ? 27.283  -0.949  7.730  1.00 17.51 ? 132 ILE A CB  1 
ATOM   163  C  CG1 . ILE A 1 25  ? 26.266  -1.729  6.904  1.00 20.78 ? 132 ILE A CG1 1 
ATOM   164  C  CG2 . ILE A 1 25  ? 26.592  0.329   8.134  1.00 23.08 ? 132 ILE A CG2 1 
ATOM   165  C  CD1 . ILE A 1 25  ? 24.978  -1.988  7.630  1.00 24.34 ? 132 ILE A CD1 1 
ATOM   166  N  N   . ASP A 1 26  ? 29.879  1.279   7.607  1.00 15.97 ? 133 ASP A N   1 
ATOM   167  C  CA  . ASP A 1 26  ? 30.726  2.084   8.467  1.00 15.96 ? 133 ASP A CA  1 
ATOM   168  C  C   . ASP A 1 26  ? 31.998  1.360   8.867  1.00 14.31 ? 133 ASP A C   1 
ATOM   169  O  O   . ASP A 1 26  ? 32.437  1.493   10.003 1.00 15.66 ? 133 ASP A O   1 
ATOM   170  C  CB  . ASP A 1 26  ? 29.949  2.475   9.729  1.00 16.56 ? 133 ASP A CB  1 
ATOM   171  C  CG  . ASP A 1 26  ? 28.730  3.354   9.435  1.00 18.70 ? 133 ASP A CG  1 
ATOM   172  O  OD1 . ASP A 1 26  ? 28.583  3.909   8.312  1.00 18.36 ? 133 ASP A OD1 1 
ATOM   173  O  OD2 . ASP A 1 26  ? 27.899  3.574   10.325 1.00 24.00 ? 133 ASP A OD2 1 
ATOM   174  N  N   . ASN A 1 27  ? 32.577  0.617   7.929  1.00 12.93 ? 134 ASN A N   1 
ATOM   175  C  CA  . ASN A 1 27  ? 33.863  -0.026  8.070  1.00 15.13 ? 134 ASN A CA  1 
ATOM   176  C  C   . ASN A 1 27  ? 33.826  -1.157  9.092  1.00 14.25 ? 134 ASN A C   1 
ATOM   177  O  O   . ASN A 1 27  ? 34.832  -1.617  9.601  1.00 17.32 ? 134 ASN A O   1 
ATOM   178  C  CB  . ASN A 1 27  ? 34.986  0.983   8.317  1.00 16.34 ? 134 ASN A CB  1 
ATOM   179  C  CG  . ASN A 1 27  ? 35.391  1.685   7.022  1.00 22.55 ? 134 ASN A CG  1 
ATOM   180  O  OD1 . ASN A 1 27  ? 35.983  1.053   6.159  1.00 24.66 ? 134 ASN A OD1 1 
ATOM   181  N  ND2 . ASN A 1 27  ? 34.980  2.954   6.841  1.00 17.54 ? 134 ASN A ND2 1 
ATOM   182  N  N   . GLY A 1 28  ? 32.617  -1.610  9.386  1.00 18.19 ? 135 GLY A N   1 
ATOM   183  C  CA  . GLY A 1 28  ? 32.387  -2.892  10.006 1.00 14.36 ? 135 GLY A CA  1 
ATOM   184  C  C   . GLY A 1 28  ? 31.609  -3.821  9.113  1.00 15.46 ? 135 GLY A C   1 
ATOM   185  O  O   . GLY A 1 28  ? 31.308  -3.513  7.997  1.00 14.79 ? 135 GLY A O   1 
ATOM   186  N  N   . ILE A 1 29  ? 31.316  -4.995  9.644  1.00 16.09 ? 136 ILE A N   1 
ATOM   187  C  CA  . ILE A 1 29  ? 30.574  -6.039  8.952  1.00 14.59 ? 136 ILE A CA  1 
ATOM   188  C  C   . ILE A 1 29  ? 29.384  -6.424  9.785  1.00 14.06 ? 136 ILE A C   1 
ATOM   189  O  O   . ILE A 1 29  ? 29.494  -6.584  10.997 1.00 16.14 ? 136 ILE A O   1 
ATOM   190  C  CB  . ILE A 1 29  ? 31.474  -7.249  8.656  1.00 14.26 ? 136 ILE A CB  1 
ATOM   191  C  CG1 . ILE A 1 29  ? 32.465  -6.894  7.571  1.00 16.39 ? 136 ILE A CG1 1 
ATOM   192  C  CG2 . ILE A 1 29  ? 30.637  -8.449  8.225  1.00 14.82 ? 136 ILE A CG2 1 
ATOM   193  C  CD1 . ILE A 1 29  ? 31.844  -6.668  6.245  1.00 17.97 ? 136 ILE A CD1 1 
ATOM   194  N  N   . PHE A 1 30  ? 28.222  -6.432  9.130  1.00 14.92 ? 137 PHE A N   1 
ATOM   195  C  CA  . PHE A 1 30  ? 26.936  -6.658  9.773  1.00 15.01 ? 137 PHE A CA  1 
ATOM   196  C  C   . PHE A 1 30  ? 26.138  -7.766  9.084  1.00 15.69 ? 137 PHE A C   1 
ATOM   197  O  O   . PHE A 1 30  ? 26.159  -7.958  7.869  1.00 16.03 ? 137 PHE A O   1 
ATOM   198  C  CB  . PHE A 1 30  ? 26.048  -5.396  9.906  1.00 13.50 ? 137 PHE A CB  1 
ATOM   199  C  CG  . PHE A 1 30  ? 26.636  -4.326  10.812 1.00 14.08 ? 137 PHE A CG  1 
ATOM   200  C  CD1 . PHE A 1 30  ? 26.168  -4.161  12.086 1.00 17.24 ? 137 PHE A CD1 1 
ATOM   201  C  CD2 . PHE A 1 30  ? 27.688  -3.525  10.399 1.00 17.36 ? 137 PHE A CD2 1 
ATOM   202  C  CE1 . PHE A 1 30  ? 26.654  -3.199  12.888 1.00 13.71 ? 137 PHE A CE1 1 
ATOM   203  C  CE2 . PHE A 1 30  ? 28.269  -2.589  11.261 1.00 16.14 ? 137 PHE A CE2 1 
ATOM   204  C  CZ  . PHE A 1 30  ? 27.757  -2.414  12.491 1.00 14.59 ? 137 PHE A CZ  1 
ATOM   205  N  N   . VAL A 1 31  ? 25.426  -8.497  9.912  1.00 15.87 ? 138 VAL A N   1 
ATOM   206  C  CA  . VAL A 1 31  ? 24.484  -9.512  9.438  1.00 17.07 ? 138 VAL A CA  1 
ATOM   207  C  C   . VAL A 1 31  ? 23.321  -8.849  8.713  1.00 16.41 ? 138 VAL A C   1 
ATOM   208  O  O   . VAL A 1 31  ? 22.659  -7.995  9.241  1.00 18.82 ? 138 VAL A O   1 
ATOM   209  C  CB  . VAL A 1 31  ? 23.955  -10.406 10.569 1.00 18.39 ? 138 VAL A CB  1 
ATOM   210  C  CG1 . VAL A 1 31  ? 22.955  -11.447 9.982  1.00 19.08 ? 138 VAL A CG1 1 
ATOM   211  C  CG2 . VAL A 1 31  ? 25.066  -11.096 11.300 1.00 16.51 ? 138 VAL A CG2 1 
ATOM   212  N  N   . GLN A 1 32  ? 23.069  -9.250  7.482  1.00 16.47 ? 139 GLN A N   1 
ATOM   213  C  CA  . GLN A 1 32  ? 22.083  -8.587  6.625  1.00 20.23 ? 139 GLN A CA  1 
ATOM   214  C  C   . GLN A 1 32  ? 20.848  -9.435  6.301  1.00 21.89 ? 139 GLN A C   1 
ATOM   215  O  O   . GLN A 1 32  ? 19.747  -8.922  6.057  1.00 22.99 ? 139 GLN A O   1 
ATOM   216  C  CB  . GLN A 1 32  ? 22.777  -8.249  5.312  1.00 22.13 ? 139 GLN A CB  1 
ATOM   217  C  CG  . GLN A 1 32  ? 21.883  -7.634  4.260  1.00 27.32 ? 139 GLN A CG  1 
ATOM   218  C  CD  . GLN A 1 32  ? 21.482  -6.220  4.600  1.00 35.95 ? 139 GLN A CD  1 
ATOM   219  O  OE1 . GLN A 1 32  ? 21.950  -5.648  5.599  1.00 34.58 ? 139 GLN A OE1 1 
ATOM   220  N  NE2 . GLN A 1 32  ? 20.619  -5.640  3.760  1.00 36.73 ? 139 GLN A NE2 1 
ATOM   221  N  N   . LEU A 1 33  ? 21.032  -10.741 6.314  1.00 19.13 ? 140 LEU A N   1 
ATOM   222  C  CA  . LEU A 1 33  ? 19.946  -11.660 6.081  1.00 20.80 ? 140 LEU A CA  1 
ATOM   223  C  C   . LEU A 1 33  ? 20.331  -13.003 6.697  1.00 17.09 ? 140 LEU A C   1 
ATOM   224  O  O   . LEU A 1 33  ? 21.407  -13.539 6.428  1.00 22.67 ? 140 LEU A O   1 
ATOM   225  C  CB  . LEU A 1 33  ? 19.639  -11.817 4.596  1.00 22.00 ? 140 LEU A CB  1 
ATOM   226  C  CG  . LEU A 1 33  ? 18.303  -12.477 4.296  1.00 26.47 ? 140 LEU A CG  1 
ATOM   227  C  CD1 . LEU A 1 33  ? 17.167  -11.648 4.901  1.00 26.59 ? 140 LEU A CD1 1 
ATOM   228  C  CD2 . LEU A 1 33  ? 18.109  -12.674 2.783  1.00 34.02 ? 140 LEU A CD2 1 
ATOM   229  N  N   . VAL A 1 34  ? 19.472  -13.524 7.553  1.00 15.81 ? 141 VAL A N   1 
ATOM   230  C  CA  . VAL A 1 34  ? 19.615  -14.847 8.135  1.00 11.94 ? 141 VAL A CA  1 
ATOM   231  C  C   . VAL A 1 34  ? 18.483  -15.750 7.655  1.00 15.50 ? 141 VAL A C   1 
ATOM   232  O  O   . VAL A 1 34  ? 17.306  -15.466 7.850  1.00 14.94 ? 141 VAL A O   1 
ATOM   233  C  CB  . VAL A 1 34  ? 19.610  -14.782 9.667  1.00 14.87 ? 141 VAL A CB  1 
ATOM   234  C  CG1 . VAL A 1 34  ? 19.645  -16.149 10.268 1.00 14.17 ? 141 VAL A CG1 1 
ATOM   235  C  CG2 . VAL A 1 34  ? 20.722  -13.875 10.166 1.00 14.30 ? 141 VAL A CG2 1 
ATOM   236  N  N   . GLN A 1 35  ? 18.830  -16.831 6.967  1.00 13.68 ? 142 GLN A N   1 
ATOM   237  C  CA  . GLN A 1 35  ? 17.844  -17.705 6.391  1.00 15.87 ? 142 GLN A CA  1 
ATOM   238  C  C   . GLN A 1 35  ? 17.175  -18.530 7.498  1.00 15.79 ? 142 GLN A C   1 
ATOM   239  O  O   . GLN A 1 35  ? 17.811  -18.893 8.509  1.00 18.95 ? 142 GLN A O   1 
ATOM   240  C  CB  . GLN A 1 35  ? 18.487  -18.666 5.399  1.00 16.67 ? 142 GLN A CB  1 
ATOM   241  C  CG  . GLN A 1 35  ? 19.134  -18.009 4.192  1.00 22.97 ? 142 GLN A CG  1 
ATOM   242  C  CD  . GLN A 1 35  ? 18.138  -17.339 3.267  1.00 30.93 ? 142 GLN A CD  1 
ATOM   243  O  OE1 . GLN A 1 35  ? 17.054  -17.870 3.036  1.00 38.45 ? 142 GLN A OE1 1 
ATOM   244  N  NE2 . GLN A 1 35  ? 18.490  -16.157 2.766  1.00 35.89 ? 142 GLN A NE2 1 
ATOM   245  N  N   . ALA A 1 36  ? 15.892  -18.793 7.314  1.00 14.58 ? 143 ALA A N   1 
ATOM   246  C  CA  . ALA A 1 36  ? 15.147  -19.653 8.217  1.00 15.85 ? 143 ALA A CA  1 
ATOM   247  C  C   . ALA A 1 36  ? 15.772  -21.048 8.361  1.00 15.26 ? 143 ALA A C   1 
ATOM   248  O  O   . ALA A 1 36  ? 16.277  -21.614 7.405  1.00 12.90 ? 143 ALA A O   1 
ATOM   249  C  CB  . ALA A 1 36  ? 13.715  -19.749 7.787  1.00 16.49 ? 143 ALA A CB  1 
ATOM   250  N  N   . ASN A 1 37  ? 15.818  -21.548 9.593  1.00 14.09 ? 144 ASN A N   1 
ATOM   251  C  CA  . ASN A 1 37  ? 16.249  -22.911 9.877  1.00 14.25 ? 144 ASN A CA  1 
ATOM   252  C  C   . ASN A 1 37  ? 17.604  -23.220 9.257  1.00 14.97 ? 144 ASN A C   1 
ATOM   253  O  O   . ASN A 1 37  ? 17.805  -24.244 8.627  1.00 16.21 ? 144 ASN A O   1 
ATOM   254  C  CB  . ASN A 1 37  ? 15.179  -23.924 9.421  1.00 14.71 ? 144 ASN A CB  1 
ATOM   255  C  CG  . ASN A 1 37  ? 13.851  -23.679 10.120 1.00 13.51 ? 144 ASN A CG  1 
ATOM   256  O  OD1 . ASN A 1 37  ? 13.803  -23.546 11.344 1.00 13.17 ? 144 ASN A OD1 1 
ATOM   257  N  ND2 . ASN A 1 37  ? 12.786  -23.562 9.347  1.00 14.51 ? 144 ASN A ND2 1 
ATOM   258  N  N   . SER A 1 38  ? 18.540  -22.326 9.492  1.00 14.57 ? 145 SER A N   1 
ATOM   259  C  CA  . SER A 1 38  ? 19.874  -22.432 8.940  1.00 15.49 ? 145 SER A CA  1 
ATOM   260  C  C   . SER A 1 38  ? 20.895  -22.586 10.054 1.00 14.70 ? 145 SER A C   1 
ATOM   261  O  O   . SER A 1 38  ? 20.615  -22.332 11.241 1.00 11.69 ? 145 SER A O   1 
ATOM   262  C  CB  . SER A 1 38  ? 20.165  -21.158 8.135  1.00 15.07 ? 145 SER A CB  1 
ATOM   263  O  OG  . SER A 1 38  ? 20.239  -20.057 8.989  1.00 14.19 ? 145 SER A OG  1 
ATOM   264  N  N   . PRO A 1 39  ? 22.126  -22.907 9.684  1.00 14.58 ? 146 PRO A N   1 
ATOM   265  C  CA  . PRO A 1 39  ? 23.232  -22.845 10.651 1.00 16.42 ? 146 PRO A CA  1 
ATOM   266  C  C   . PRO A 1 39  ? 23.310  -21.506 11.381 1.00 16.29 ? 146 PRO A C   1 
ATOM   267  O  O   . PRO A 1 39  ? 23.554  -21.452 12.583 1.00 13.42 ? 146 PRO A O   1 
ATOM   268  C  CB  . PRO A 1 39  ? 24.445  -23.056 9.745  1.00 16.68 ? 146 PRO A CB  1 
ATOM   269  C  CG  . PRO A 1 39  ? 23.873  -24.023 8.740  1.00 18.11 ? 146 PRO A CG  1 
ATOM   270  C  CD  . PRO A 1 39  ? 22.581  -23.372 8.376  1.00 16.00 ? 146 PRO A CD  1 
ATOM   271  N  N   . ALA A 1 40  ? 23.092  -20.417 10.643 1.00 16.54 ? 147 ALA A N   1 
ATOM   272  C  CA  . ALA A 1 40  ? 23.167  -19.076 11.237 1.00 15.47 ? 147 ALA A CA  1 
ATOM   273  C  C   . ALA A 1 40  ? 22.021  -18.817 12.205 1.00 16.04 ? 147 ALA A C   1 
ATOM   274  O  O   . ALA A 1 40  ? 22.213  -18.233 13.281 1.00 17.29 ? 147 ALA A O   1 
ATOM   275  C  CB  . ALA A 1 40  ? 23.178  -18.075 10.136 1.00 16.78 ? 147 ALA A CB  1 
ATOM   276  N  N   . SER A 1 41  ? 20.819  -19.283 11.853 1.00 15.53 ? 148 SER A N   1 
ATOM   277  C  CA  . SER A 1 41  ? 19.700  -19.120 12.752 1.00 14.77 ? 148 SER A CA  1 
ATOM   278  C  C   . SER A 1 41  ? 19.826  -19.980 13.999 1.00 17.25 ? 148 SER A C   1 
ATOM   279  O  O   . SER A 1 41  ? 19.467  -19.538 15.086 1.00 12.55 ? 148 SER A O   1 
ATOM   280  C  CB  . SER A 1 41  ? 18.330  -19.226 12.069 1.00 13.82 ? 148 SER A CB  1 
ATOM   281  O  OG  . SER A 1 41  ? 17.959  -20.559 11.793 1.00 16.17 ? 148 SER A OG  1 
ATOM   282  N  N   . LEU A 1 42  ? 20.440  -21.147 13.846 1.00 15.82 ? 149 LEU A N   1 
ATOM   283  C  CA  . LEU A 1 42  ? 20.614  -22.055 14.959 1.00 17.85 ? 149 LEU A CA  1 
ATOM   284  C  C   . LEU A 1 42  ? 21.419  -21.415 16.073 1.00 17.00 ? 149 LEU A C   1 
ATOM   285  O  O   . LEU A 1 42  ? 21.114  -21.634 17.239 1.00 16.36 ? 149 LEU A O   1 
ATOM   286  C  CB  . LEU A 1 42  ? 21.272  -23.362 14.492 1.00 17.44 ? 149 LEU A CB  1 
ATOM   287  C  CG  . LEU A 1 42  ? 21.390  -24.477 15.542 1.00 18.79 ? 149 LEU A CG  1 
ATOM   288  C  CD1 . LEU A 1 42  ? 20.061  -25.035 15.948 1.00 13.86 ? 149 LEU A CD1 1 
ATOM   289  C  CD2 . LEU A 1 42  ? 22.214  -25.631 15.031 1.00 21.33 ? 149 LEU A CD2 1 
ATOM   290  N  N   . VAL A 1 43  ? 22.455  -20.650 15.734 1.00 14.37 ? 150 VAL A N   1 
ATOM   291  C  CA  . VAL A 1 43  ? 23.311  -20.085 16.749 1.00 16.59 ? 150 VAL A CA  1 
ATOM   292  C  C   . VAL A 1 43  ? 22.779  -18.709 17.154 1.00 18.51 ? 150 VAL A C   1 
ATOM   293  O  O   . VAL A 1 43  ? 23.417  -18.020 17.944 1.00 20.57 ? 150 VAL A O   1 
ATOM   294  C  CB  . VAL A 1 43  ? 24.799  -20.032 16.340 1.00 17.40 ? 150 VAL A CB  1 
ATOM   295  C  CG1 . VAL A 1 43  ? 25.322  -21.422 15.990 1.00 18.76 ? 150 VAL A CG1 1 
ATOM   296  C  CG2 . VAL A 1 43  ? 25.027  -19.070 15.220 1.00 19.87 ? 150 VAL A CG2 1 
ATOM   297  N  N   . GLY A 1 44  ? 21.619  -18.310 16.624 1.00 18.93 ? 151 GLY A N   1 
ATOM   298  C  CA  . GLY A 1 44  ? 20.964  -17.107 17.107 1.00 17.54 ? 151 GLY A CA  1 
ATOM   299  C  C   . GLY A 1 44  ? 21.384  -15.797 16.467 1.00 15.54 ? 151 GLY A C   1 
ATOM   300  O  O   . GLY A 1 44  ? 21.035  -14.750 16.981 1.00 17.67 ? 151 GLY A O   1 
ATOM   301  N  N   . LEU A 1 45  ? 21.938  -15.859 15.274 1.00 13.52 ? 152 LEU A N   1 
ATOM   302  C  CA  . LEU A 1 45  ? 22.266  -14.674 14.508 1.00 14.07 ? 152 LEU A CA  1 
ATOM   303  C  C   . LEU A 1 45  ? 21.028  -13.979 14.013 1.00 13.71 ? 152 LEU A C   1 
ATOM   304  O  O   . LEU A 1 45  ? 20.061  -14.634 13.686 1.00 13.83 ? 152 LEU A O   1 
ATOM   305  C  CB  . LEU A 1 45  ? 23.219  -14.983 13.381 1.00 16.32 ? 152 LEU A CB  1 
ATOM   306  C  CG  . LEU A 1 45  ? 24.624  -15.483 13.781 1.00 20.24 ? 152 LEU A CG  1 
ATOM   307  C  CD1 . LEU A 1 45  ? 25.490  -15.628 12.584 1.00 23.19 ? 152 LEU A CD1 1 
ATOM   308  C  CD2 . LEU A 1 45  ? 25.312  -14.632 14.784 1.00 22.80 ? 152 LEU A CD2 1 
ATOM   309  N  N   . ARG A 1 46  ? 21.044  -12.650 14.016 1.00 14.40 ? 153 ARG A N   1 
ATOM   310  C  CA  . ARG A 1 46  ? 19.927  -11.821 13.597 1.00 15.27 ? 153 ARG A CA  1 
ATOM   311  C  C   . ARG A 1 46  ? 20.465  -10.689 12.748 1.00 16.39 ? 153 ARG A C   1 
ATOM   312  O  O   . ARG A 1 46  ? 21.593  -10.227 12.933 1.00 15.89 ? 153 ARG A O   1 
ATOM   313  C  CB  . ARG A 1 46  ? 19.185  -11.193 14.794 1.00 16.97 ? 153 ARG A CB  1 
ATOM   314  C  CG  . ARG A 1 46  ? 18.473  -12.181 15.712 1.00 22.31 ? 153 ARG A CG  1 
ATOM   315  C  CD  . ARG A 1 46  ? 17.522  -11.601 16.748 1.00 20.84 ? 153 ARG A CD  1 
ATOM   316  N  NE  . ARG A 1 46  ? 18.148  -10.546 17.537 1.00 32.24 ? 153 ARG A NE  1 
ATOM   317  C  CZ  . ARG A 1 46  ? 17.482  -9.619  18.222 1.00 31.42 ? 153 ARG A CZ  1 
ATOM   318  N  NH1 . ARG A 1 46  ? 16.153  -9.614  18.283 1.00 29.86 ? 153 ARG A NH1 1 
ATOM   319  N  NH2 . ARG A 1 46  ? 18.172  -8.687  18.852 1.00 42.65 ? 153 ARG A NH2 1 
ATOM   320  N  N   . PHE A 1 47  ? 19.613  -10.215 11.840 1.00 16.48 ? 154 PHE A N   1 
ATOM   321  C  CA  . PHE A 1 47  ? 19.796  -8.936  11.189 1.00 15.06 ? 154 PHE A CA  1 
ATOM   322  C  C   . PHE A 1 47  ? 20.294  -7.849  12.106 1.00 12.91 ? 154 PHE A C   1 
ATOM   323  O  O   . PHE A 1 47  ? 19.723  -7.619  13.173 1.00 13.74 ? 154 PHE A O   1 
ATOM   324  C  CB  . PHE A 1 47  ? 18.495  -8.486  10.539 1.00 14.89 ? 154 PHE A CB  1 
ATOM   325  C  CG  . PHE A 1 47  ? 18.614  -7.174  9.800  1.00 14.29 ? 154 PHE A CG  1 
ATOM   326  C  CD1 . PHE A 1 47  ? 19.059  -7.154  8.496  1.00 16.60 ? 154 PHE A CD1 1 
ATOM   327  C  CD2 . PHE A 1 47  ? 18.295  -5.962  10.405 1.00 22.61 ? 154 PHE A CD2 1 
ATOM   328  C  CE1 . PHE A 1 47  ? 19.154  -5.965  7.807  1.00 18.40 ? 154 PHE A CE1 1 
ATOM   329  C  CE2 . PHE A 1 47  ? 18.372  -4.751  9.707  1.00 19.17 ? 154 PHE A CE2 1 
ATOM   330  C  CZ  . PHE A 1 47  ? 18.809  -4.757  8.413  1.00 18.99 ? 154 PHE A CZ  1 
ATOM   331  N  N   . GLY A 1 48  ? 21.361  -7.167  11.678 1.00 13.42 ? 155 GLY A N   1 
ATOM   332  C  CA  . GLY A 1 48  ? 21.994  -6.116  12.462 1.00 14.21 ? 155 GLY A CA  1 
ATOM   333  C  C   . GLY A 1 48  ? 23.059  -6.517  13.474 1.00 14.57 ? 155 GLY A C   1 
ATOM   334  O  O   . GLY A 1 48  ? 23.683  -5.664  14.075 1.00 14.58 ? 155 GLY A O   1 
ATOM   335  N  N   . ASP A 1 49  ? 23.281  -7.814  13.700 1.00 15.09 ? 156 ASP A N   1 
ATOM   336  C  CA  . ASP A 1 49  ? 24.368  -8.213  14.539 1.00 13.33 ? 156 ASP A CA  1 
ATOM   337  C  C   . ASP A 1 49  ? 25.655  -7.724  13.889 1.00 12.79 ? 156 ASP A C   1 
ATOM   338  O  O   . ASP A 1 49  ? 25.756  -7.691  12.646 1.00 14.43 ? 156 ASP A O   1 
ATOM   339  C  CB  . ASP A 1 49  ? 24.420  -9.731  14.657 1.00 13.38 ? 156 ASP A CB  1 
ATOM   340  C  CG  . ASP A 1 49  ? 23.417  -10.300 15.642 1.00 16.11 ? 156 ASP A CG  1 
ATOM   341  O  OD1 . ASP A 1 49  ? 22.834  -9.560  16.444 1.00 15.43 ? 156 ASP A OD1 1 
ATOM   342  O  OD2 . ASP A 1 49  ? 23.124  -11.506 15.603 1.00 14.48 ? 156 ASP A OD2 1 
ATOM   343  N  N   . GLN A 1 50  ? 26.642  -7.363  14.698 1.00 13.36 ? 157 GLN A N   1 
ATOM   344  C  CA  . GLN A 1 50  ? 27.942  -6.945  14.135 1.00 12.39 ? 157 GLN A CA  1 
ATOM   345  C  C   . GLN A 1 50  ? 28.942  -8.123  14.237 1.00 11.82 ? 157 GLN A C   1 
ATOM   346  O  O   . GLN A 1 50  ? 29.002  -8.749  15.237 1.00 13.21 ? 157 GLN A O   1 
ATOM   347  C  CB  . GLN A 1 50  ? 28.506  -5.757  14.899 1.00 12.47 ? 157 GLN A CB  1 
ATOM   348  C  CG  . GLN A 1 50  ? 29.723  -5.132  14.264 1.00 12.44 ? 157 GLN A CG  1 
ATOM   349  C  CD  . GLN A 1 50  ? 30.295  -3.914  14.986 1.00 16.30 ? 157 GLN A CD  1 
ATOM   350  O  OE1 . GLN A 1 50  ? 29.717  -3.451  15.950 1.00 17.62 ? 157 GLN A OE1 1 
ATOM   351  N  NE2 . GLN A 1 50  ? 31.478  -3.419  14.526 1.00 12.45 ? 157 GLN A NE2 1 
ATOM   352  N  N   . VAL A 1 51  ? 29.678  -8.420  13.188 1.00 12.86 ? 158 VAL A N   1 
ATOM   353  C  CA  . VAL A 1 51  ? 30.670  -9.462  13.199 1.00 12.53 ? 158 VAL A CA  1 
ATOM   354  C  C   . VAL A 1 51  ? 32.030  -8.799  13.336 1.00 12.94 ? 158 VAL A C   1 
ATOM   355  O  O   . VAL A 1 51  ? 32.419  -7.989  12.507 1.00 15.64 ? 158 VAL A O   1 
ATOM   356  C  CB  . VAL A 1 51  ? 30.627  -10.265 11.944 1.00 12.39 ? 158 VAL A CB  1 
ATOM   357  C  CG1 . VAL A 1 51  ? 31.581  -11.458 11.996 1.00 15.42 ? 158 VAL A CG1 1 
ATOM   358  C  CG2 . VAL A 1 51  ? 29.195  -10.654 11.635 1.00 13.12 ? 158 VAL A CG2 1 
ATOM   359  N  N   . LEU A 1 52  ? 32.668  -9.057  14.459 1.00 12.82 ? 159 LEU A N   1 
ATOM   360  C  CA  . LEU A 1 52  ? 33.961  -8.471  14.730 1.00 16.41 ? 159 LEU A CA  1 
ATOM   361  C  C   . LEU A 1 52  ? 35.135  -9.226  14.134 1.00 13.64 ? 159 LEU A C   1 
ATOM   362  O  O   . LEU A 1 52  ? 36.109  -8.626  13.651 1.00 16.42 ? 159 LEU A O   1 
ATOM   363  C  CB  . LEU A 1 52  ? 34.181  -8.305  16.203 1.00 15.73 ? 159 LEU A CB  1 
ATOM   364  C  CG  . LEU A 1 52  ? 33.189  -7.408  16.974 1.00 20.67 ? 159 LEU A CG  1 
ATOM   365  C  CD1 . LEU A 1 52  ? 33.672  -7.275  18.390 1.00 25.22 ? 159 LEU A CD1 1 
ATOM   366  C  CD2 . LEU A 1 52  ? 33.126  -6.076  16.378 1.00 25.23 ? 159 LEU A CD2 1 
ATOM   367  N  N   . GLN A 1 53  ? 35.069  -10.546 14.242 1.00 15.47 ? 160 GLN A N   1 
ATOM   368  C  CA  . GLN A 1 53  ? 36.082  -11.436 13.679 1.00 13.30 ? 160 GLN A CA  1 
ATOM   369  C  C   . GLN A 1 53  ? 35.393  -12.650 13.036 1.00 16.06 ? 160 GLN A C   1 
ATOM   370  O  O   . GLN A 1 53  ? 34.318  -13.072 13.449 1.00 14.31 ? 160 GLN A O   1 
ATOM   371  C  CB  . GLN A 1 53  ? 37.043  -11.900 14.777 1.00 14.96 ? 160 GLN A CB  1 
ATOM   372  C  CG  . GLN A 1 53  ? 38.068  -10.911 15.173 1.00 18.13 ? 160 GLN A CG  1 
ATOM   373  C  CD  . GLN A 1 53  ? 37.586  -9.952  16.249 1.00 19.99 ? 160 GLN A CD  1 
ATOM   374  O  OE1 . GLN A 1 53  ? 36.876  -10.363 17.153 1.00 23.82 ? 160 GLN A OE1 1 
ATOM   375  N  NE2 . GLN A 1 53  ? 38.065  -8.700  16.214 1.00 17.97 ? 160 GLN A NE2 1 
ATOM   376  N  N   . ILE A 1 54  ? 35.987  -13.151 11.965 1.00 16.45 ? 161 ILE A N   1 
ATOM   377  C  CA  . ILE A 1 54  ? 35.670  -14.465 11.408 1.00 17.22 ? 161 ILE A CA  1 
ATOM   378  C  C   . ILE A 1 54  ? 36.956  -15.277 11.312 1.00 15.25 ? 161 ILE A C   1 
ATOM   379  O  O   . ILE A 1 54  ? 37.933  -14.808 10.731 1.00 15.49 ? 161 ILE A O   1 
ATOM   380  C  CB  . ILE A 1 54  ? 35.125  -14.322 9.998  1.00 14.99 ? 161 ILE A CB  1 
ATOM   381  C  CG1 . ILE A 1 54  ? 33.856  -13.454 9.993  1.00 17.09 ? 161 ILE A CG1 1 
ATOM   382  C  CG2 . ILE A 1 54  ? 34.963  -15.685 9.388  1.00 16.45 ? 161 ILE A CG2 1 
ATOM   383  C  CD1 . ILE A 1 54  ? 33.297  -13.247 8.611  1.00 17.28 ? 161 ILE A CD1 1 
ATOM   384  N  N   . ASN A 1 55  ? 36.926  -16.481 11.880 1.00 15.74 ? 162 ASN A N   1 
ATOM   385  C  CA  . ASN A 1 55  ? 38.097  -17.357 12.086 1.00 15.29 ? 162 ASN A CA  1 
ATOM   386  C  C   . ASN A 1 55  ? 39.340  -16.621 12.538 1.00 17.04 ? 162 ASN A C   1 
ATOM   387  O  O   . ASN A 1 55  ? 40.412  -16.837 11.994 1.00 15.17 ? 162 ASN A O   1 
ATOM   388  C  CB  . ASN A 1 55  ? 38.394  -18.191 10.827 1.00 15.76 ? 162 ASN A CB  1 
ATOM   389  C  CG  . ASN A 1 55  ? 37.284  -19.169 10.485 1.00 16.53 ? 162 ASN A CG  1 
ATOM   390  O  OD1 . ASN A 1 55  ? 36.604  -19.692 11.371 1.00 18.87 ? 162 ASN A OD1 1 
ATOM   391  N  ND2 . ASN A 1 55  ? 37.082  -19.412 9.192  1.00 15.15 ? 162 ASN A ND2 1 
ATOM   392  N  N   . GLY A 1 56  ? 39.177  -15.718 13.499 1.00 20.33 ? 163 GLY A N   1 
ATOM   393  C  CA  . GLY A 1 56  ? 40.307  -15.046 14.102 1.00 21.67 ? 163 GLY A CA  1 
ATOM   394  C  C   . GLY A 1 56  ? 40.757  -13.772 13.392 1.00 21.23 ? 163 GLY A C   1 
ATOM   395  O  O   . GLY A 1 56  ? 41.658  -13.122 13.869 1.00 25.08 ? 163 GLY A O   1 
ATOM   396  N  N   . GLU A 1 57  ? 40.162  -13.438 12.256 1.00 18.71 ? 164 GLU A N   1 
ATOM   397  C  CA  . GLU A 1 57  ? 40.566  -12.305 11.454 1.00 19.23 ? 164 GLU A CA  1 
ATOM   398  C  C   . GLU A 1 57  ? 39.581  -11.165 11.678 1.00 17.05 ? 164 GLU A C   1 
ATOM   399  O  O   . GLU A 1 57  ? 38.382  -11.357 11.579 1.00 16.27 ? 164 GLU A O   1 
ATOM   400  C  CB  . GLU A 1 57  ? 40.566  -12.674 9.975  1.00 18.70 ? 164 GLU A CB  1 
ATOM   401  C  CG  . GLU A 1 57  ? 41.647  -13.650 9.532  1.00 27.76 ? 164 GLU A CG  1 
ATOM   402  C  CD  . GLU A 1 57  ? 41.822  -13.597 8.023  1.00 35.99 ? 164 GLU A CD  1 
ATOM   403  O  OE1 . GLU A 1 57  ? 40.856  -13.901 7.277  1.00 37.03 ? 164 GLU A OE1 1 
ATOM   404  O  OE2 . GLU A 1 57  ? 42.925  -13.203 7.585  1.00 45.06 ? 164 GLU A OE2 1 
ATOM   405  N  N   . ASN A 1 58  ? 40.114  -9.980  11.911 1.00 16.03 ? 165 ASN A N   1 
ATOM   406  C  CA  . ASN A 1 58  ? 39.314  -8.778  12.011 1.00 18.96 ? 165 ASN A CA  1 
ATOM   407  C  C   . ASN A 1 58  ? 38.563  -8.494  10.743 1.00 15.06 ? 165 ASN A C   1 
ATOM   408  O  O   . ASN A 1 58  ? 39.172  -8.414  9.704  1.00 15.71 ? 165 ASN A O   1 
ATOM   409  C  CB  . ASN A 1 58  ? 40.196  -7.568  12.321 1.00 18.31 ? 165 ASN A CB  1 
ATOM   410  C  CG  . ASN A 1 58  ? 40.953  -7.708  13.630 1.00 22.34 ? 165 ASN A CG  1 
ATOM   411  O  OD1 . ASN A 1 58  ? 40.441  -8.226  14.612 1.00 15.62 ? 165 ASN A OD1 1 
ATOM   412  N  ND2 . ASN A 1 58  ? 42.172  -7.213  13.652 1.00 23.25 ? 165 ASN A ND2 1 
ATOM   413  N  N   . CYS A 1 59  ? 37.256  -8.264  10.875 1.00 15.12 ? 166 CYS A N   1 
ATOM   414  C  CA  . CYS A 1 59  ? 36.424  -7.821  9.774  1.00 15.40 ? 166 CYS A CA  1 
ATOM   415  C  C   . CYS A 1 59  ? 36.514  -6.361  9.429  1.00 12.70 ? 166 CYS A C   1 
ATOM   416  O  O   . CYS A 1 59  ? 36.000  -5.956  8.388  1.00 18.99 ? 166 CYS A O   1 
ATOM   417  C  CB  . CYS A 1 59  ? 34.947  -8.102  10.100 1.00 14.73 ? 166 CYS A CB  1 
ATOM   418  S  SG  . CYS A 1 59  ? 34.591  -9.834  10.366 1.00 20.29 ? 166 CYS A SG  1 
ATOM   419  N  N   . ALA A 1 60  ? 37.210  -5.569  10.230 1.00 15.14 ? 167 ALA A N   1 
ATOM   420  C  CA  . ALA A 1 60  ? 37.206  -4.117  10.055 1.00 12.79 ? 167 ALA A CA  1 
ATOM   421  C  C   . ALA A 1 60  ? 37.654  -3.725  8.665  1.00 16.33 ? 167 ALA A C   1 
ATOM   422  O  O   . ALA A 1 60  ? 38.710  -4.160  8.237  1.00 15.05 ? 167 ALA A O   1 
ATOM   423  C  CB  . ALA A 1 60  ? 38.110  -3.492  11.122 1.00 14.00 ? 167 ALA A CB  1 
ATOM   424  N  N   . GLY A 1 61  ? 36.864  -2.919  7.953  1.00 17.35 ? 168 GLY A N   1 
ATOM   425  C  CA  . GLY A 1 61  ? 37.218  -2.433  6.627  1.00 16.27 ? 168 GLY A CA  1 
ATOM   426  C  C   . GLY A 1 61  ? 36.946  -3.373  5.460  1.00 16.95 ? 168 GLY A C   1 
ATOM   427  O  O   . GLY A 1 61  ? 37.160  -3.016  4.293  1.00 17.83 ? 168 GLY A O   1 
ATOM   428  N  N   . TRP A 1 62  ? 36.531  -4.607  5.734  1.00 17.59 ? 169 TRP A N   1 
ATOM   429  C  CA  . TRP A 1 62  ? 36.154  -5.513  4.659  1.00 16.96 ? 169 TRP A CA  1 
ATOM   430  C  C   . TRP A 1 62  ? 34.968  -4.987  3.886  1.00 17.89 ? 169 TRP A C   1 
ATOM   431  O  O   . TRP A 1 62  ? 34.025  -4.446  4.446  1.00 18.58 ? 169 TRP A O   1 
ATOM   432  C  CB  . TRP A 1 62  ? 35.787  -6.907  5.141  1.00 19.91 ? 169 TRP A CB  1 
ATOM   433  C  CG  . TRP A 1 62  ? 36.926  -7.673  5.712  1.00 20.18 ? 169 TRP A CG  1 
ATOM   434  C  CD1 . TRP A 1 62  ? 38.202  -7.244  5.899  1.00 19.00 ? 169 TRP A CD1 1 
ATOM   435  C  CD2 . TRP A 1 62  ? 36.867  -8.992  6.219  1.00 16.59 ? 169 TRP A CD2 1 
ATOM   436  N  NE1 . TRP A 1 62  ? 38.951  -8.235  6.481  1.00 19.54 ? 169 TRP A NE1 1 
ATOM   437  C  CE2 . TRP A 1 62  ? 38.149  -9.315  6.702  1.00 18.59 ? 169 TRP A CE2 1 
ATOM   438  C  CE3 . TRP A 1 62  ? 35.847  -9.938  6.340  1.00 18.81 ? 169 TRP A CE3 1 
ATOM   439  C  CZ2 . TRP A 1 62  ? 38.446  -10.546 7.265  1.00 24.51 ? 169 TRP A CZ2 1 
ATOM   440  C  CZ3 . TRP A 1 62  ? 36.139  -11.136 6.923  1.00 23.84 ? 169 TRP A CZ3 1 
ATOM   441  C  CH2 . TRP A 1 62  ? 37.428  -11.432 7.379  1.00 23.02 ? 169 TRP A CH2 1 
ATOM   442  N  N   . SER A 1 63  ? 35.060  -5.112  2.569  1.00 16.72 ? 170 SER A N   1 
ATOM   443  C  CA  . SER A 1 63  ? 33.908  -4.977  1.701  1.00 18.46 ? 170 SER A CA  1 
ATOM   444  C  C   . SER A 1 63  ? 32.971  -6.167  1.824  1.00 17.54 ? 170 SER A C   1 
ATOM   445  O  O   . SER A 1 63  ? 33.327  -7.260  2.309  1.00 19.73 ? 170 SER A O   1 
ATOM   446  C  CB  . SER A 1 63  ? 34.378  -4.800  0.252  1.00 18.38 ? 170 SER A CB  1 
ATOM   447  O  OG  . SER A 1 63  ? 34.831  -6.048  -0.231 1.00 15.90 ? 170 SER A OG  1 
ATOM   448  N  N   . SER A 1 64  ? 31.726  -5.918  1.466  1.00 18.35 ? 171 SER A N   1 
ATOM   449  C  CA  . SER A 1 64  ? 30.726  -6.965  1.389  1.00 19.86 ? 171 SER A CA  1 
ATOM   450  C  C   . SER A 1 64  ? 31.190  -8.103  0.481  1.00 20.95 ? 171 SER A C   1 
ATOM   451  O  O   . SER A 1 64  ? 31.026  -9.279  0.790  1.00 22.13 ? 171 SER A O   1 
ATOM   452  C  CB  . SER A 1 64  ? 29.419  -6.416  0.836  1.00 21.35 ? 171 SER A CB  1 
ATOM   453  O  OG  . SER A 1 64  ? 28.818  -5.468  1.697  1.00 18.81 ? 171 SER A OG  1 
ATOM   454  N  N   . ASP A 1 65  ? 31.821  -7.723  -0.617 1.00 22.40 ? 172 ASP A N   1 
ATOM   455  C  CA  . ASP A 1 65  ? 32.401  -8.677  -1.524 1.00 23.41 ? 172 ASP A CA  1 
ATOM   456  C  C   . ASP A 1 65  ? 33.466  -9.488  -0.813 1.00 23.31 ? 172 ASP A C   1 
ATOM   457  O  O   . ASP A 1 65  ? 33.415  -10.714 -0.836 1.00 23.37 ? 172 ASP A O   1 
ATOM   458  C  CB  . ASP A 1 65  ? 32.924  -7.926  -2.741 1.00 26.27 ? 172 ASP A CB  1 
ATOM   459  C  CG  . ASP A 1 65  ? 33.186  -8.830  -3.899 1.00 27.71 ? 172 ASP A CG  1 
ATOM   460  O  OD1 . ASP A 1 65  ? 32.487  -9.861  -4.001 1.00 35.55 ? 172 ASP A OD1 1 
ATOM   461  O  OD2 . ASP A 1 65  ? 34.074  -8.575  -4.730 1.00 40.90 ? 172 ASP A OD2 1 
ATOM   462  N  N   . LYS A 1 66  ? 34.379  -8.836  -0.099 1.00 23.84 ? 173 LYS A N   1 
ATOM   463  C  CA  . LYS A 1 66  ? 35.362  -9.597  0.663  1.00 22.21 ? 173 LYS A CA  1 
ATOM   464  C  C   . LYS A 1 66  ? 34.799  -10.566 1.683  1.00 22.54 ? 173 LYS A C   1 
ATOM   465  O  O   . LYS A 1 66  ? 35.253  -11.695 1.831  1.00 22.13 ? 173 LYS A O   1 
ATOM   466  C  CB  . LYS A 1 66  ? 36.386  -8.690  1.337  1.00 20.34 ? 173 LYS A CB  1 
ATOM   467  C  CG  . LYS A 1 66  ? 37.679  -9.430  1.580  1.00 27.39 ? 173 LYS A CG  1 
ATOM   468  C  CD  . LYS A 1 66  ? 38.341  -9.166  2.902  1.00 33.92 ? 173 LYS A CD  1 
ATOM   469  C  CE  . LYS A 1 66  ? 39.660  -9.954  2.992  1.00 39.09 ? 173 LYS A CE  1 
ATOM   470  N  NZ  . LYS A 1 66  ? 40.752  -9.093  3.563  1.00 45.87 ? 173 LYS A NZ  1 
ATOM   471  N  N   . ALA A 1 67  ? 33.859  -10.093 2.481  1.00 24.15 ? 174 ALA A N   1 
ATOM   472  C  CA  . ALA A 1 67  ? 33.289  -10.915 3.528  1.00 22.76 ? 174 ALA A CA  1 
ATOM   473  C  C   . ALA A 1 67  ? 32.671  -12.185 2.953  1.00 24.25 ? 174 ALA A C   1 
ATOM   474  O  O   . ALA A 1 67  ? 32.834  -13.273 3.500  1.00 25.01 ? 174 ALA A O   1 
ATOM   475  C  CB  . ALA A 1 67  ? 32.260  -10.095 4.267  1.00 22.28 ? 174 ALA A CB  1 
ATOM   476  N  N   . HIS A 1 68  ? 31.987  -12.033 1.827  1.00 26.31 ? 175 HIS A N   1 
ATOM   477  C  CA  . HIS A 1 68  ? 31.356  -13.153 1.106  1.00 28.01 ? 175 HIS A CA  1 
ATOM   478  C  C   . HIS A 1 68  ? 32.480  -14.082 0.685  1.00 26.25 ? 175 HIS A C   1 
ATOM   479  O  O   . HIS A 1 68  ? 32.384  -15.277 0.879  1.00 26.53 ? 175 HIS A O   1 
ATOM   480  C  CB  . HIS A 1 68  ? 30.626  -12.563 -0.105 1.00 28.14 ? 175 HIS A CB  1 
ATOM   481  C  CG  . HIS A 1 68  ? 29.849  -13.536 -0.938 1.00 34.15 ? 175 HIS A CG  1 
ATOM   482  N  ND1 . HIS A 1 68  ? 28.483  -13.685 -0.822 1.00 38.34 ? 175 HIS A ND1 1 
ATOM   483  C  CD2 . HIS A 1 68  ? 30.221  -14.304 -1.990 1.00 41.37 ? 175 HIS A CD2 1 
ATOM   484  C  CE1 . HIS A 1 68  ? 28.055  -14.553 -1.720 1.00 43.39 ? 175 HIS A CE1 1 
ATOM   485  N  NE2 . HIS A 1 68  ? 29.090  -14.938 -2.447 1.00 48.21 ? 175 HIS A NE2 1 
ATOM   486  N  N   . LYS A 1 69  ? 33.556  -13.502 0.161  1.00 26.09 ? 176 LYS A N   1 
ATOM   487  C  CA  . LYS A 1 69  ? 34.735  -14.244 -0.297 1.00 25.19 ? 176 LYS A CA  1 
ATOM   488  C  C   . LYS A 1 69  ? 35.263  -15.066 0.869  1.00 25.49 ? 176 LYS A C   1 
ATOM   489  O  O   . LYS A 1 69  ? 35.433  -16.258 0.744  1.00 22.85 ? 176 LYS A O   1 
ATOM   490  C  CB  . LYS A 1 69  ? 35.763  -13.286 -0.927 0.00 30.47 ? 176 LYS A CB  1 
ATOM   491  C  CG  . LYS A 1 69  ? 35.315  -12.634 -2.224 0.00 29.25 ? 176 LYS A CG  1 
ATOM   492  C  CD  . LYS A 1 69  ? 36.389  -11.715 -2.780 0.00 29.09 ? 176 LYS A CD  1 
ATOM   493  C  CE  . LYS A 1 69  ? 35.941  -11.063 -4.077 0.00 75.82 ? 176 LYS A CE  1 
ATOM   494  N  NZ  . LYS A 1 69  ? 36.984  -10.159 -4.633 0.00 60.17 ? 176 LYS A NZ  1 
ATOM   495  N  N   . VAL A 1 70  ? 35.456  -14.448 2.033  1.00 25.51 ? 177 VAL A N   1 
ATOM   496  C  CA  . VAL A 1 70  ? 36.045  -15.146 3.171  1.00 25.78 ? 177 VAL A CA  1 
ATOM   497  C  C   . VAL A 1 70  ? 35.196  -16.307 3.685  1.00 26.13 ? 177 VAL A C   1 
ATOM   498  O  O   . VAL A 1 70  ? 35.720  -17.337 4.073  1.00 29.67 ? 177 VAL A O   1 
ATOM   499  C  CB  . VAL A 1 70  ? 36.268  -14.177 4.334  1.00 25.74 ? 177 VAL A CB  1 
ATOM   500  C  CG1 . VAL A 1 70  ? 36.627  -14.929 5.603  1.00 25.78 ? 177 VAL A CG1 1 
ATOM   501  C  CG2 . VAL A 1 70  ? 37.372  -13.208 3.976  1.00 29.24 ? 177 VAL A CG2 1 
ATOM   502  N  N   . LEU A 1 71  ? 33.884  -16.142 3.699  1.00 26.86 ? 178 LEU A N   1 
ATOM   503  C  CA  . LEU A 1 71  ? 32.982  -17.208 4.101  1.00 27.86 ? 178 LEU A CA  1 
ATOM   504  C  C   . LEU A 1 71  ? 32.998  -18.381 3.088  1.00 29.84 ? 178 LEU A C   1 
ATOM   505  O  O   . LEU A 1 71  ? 33.047  -19.537 3.462  1.00 28.94 ? 178 LEU A O   1 
ATOM   506  C  CB  . LEU A 1 71  ? 31.567  -16.647 4.208  1.00 27.20 ? 178 LEU A CB  1 
ATOM   507  C  CG  . LEU A 1 71  ? 31.191  -15.777 5.404  1.00 25.26 ? 178 LEU A CG  1 
ATOM   508  C  CD1 . LEU A 1 71  ? 29.724  -15.431 5.279  1.00 27.83 ? 178 LEU A CD1 1 
ATOM   509  C  CD2 . LEU A 1 71  ? 31.498  -16.471 6.715  1.00 25.45 ? 178 LEU A CD2 1 
ATOM   510  N  N   . LYS A 1 72  ? 32.935  -18.053 1.803  1.00 32.65 ? 179 LYS A N   1 
ATOM   511  C  CA  . LYS A 1 72  ? 33.006  -19.044 0.725  1.00 35.18 ? 179 LYS A CA  1 
ATOM   512  C  C   . LYS A 1 72  ? 34.329  -19.818 0.686  1.00 35.56 ? 179 LYS A C   1 
ATOM   513  O  O   . LYS A 1 72  ? 34.335  -21.032 0.470  1.00 37.37 ? 179 LYS A O   1 
ATOM   514  C  CB  . LYS A 1 72  ? 32.767  -18.362 -0.624 1.00 34.86 ? 179 LYS A CB  1 
ATOM   515  C  CG  . LYS A 1 72  ? 31.305  -18.383 -1.083 1.00 40.09 ? 179 LYS A CG  1 
ATOM   516  C  CD  . LYS A 1 72  ? 31.142  -17.890 -2.534 1.00 44.27 ? 179 LYS A CD  1 
ATOM   517  C  CE  . LYS A 1 72  ? 30.279  -18.831 -3.399 1.00 46.66 ? 179 LYS A CE  1 
ATOM   518  N  NZ  . LYS A 1 72  ? 30.438  -18.606 -4.871 1.00 44.89 ? 179 LYS A NZ  1 
ATOM   519  N  N   . GLN A 1 73  ? 35.440  -19.120 0.906  1.00 35.03 ? 180 GLN A N   1 
ATOM   520  C  CA  . GLN A 1 73  ? 36.756  -19.742 0.988  1.00 36.20 ? 180 GLN A CA  1 
ATOM   521  C  C   . GLN A 1 73  ? 37.135  -20.310 2.363  1.00 37.24 ? 180 GLN A C   1 
ATOM   522  O  O   . GLN A 1 73  ? 38.299  -20.634 2.596  1.00 38.31 ? 180 GLN A O   1 
ATOM   523  C  CB  . GLN A 1 73  ? 37.823  -18.734 0.550  1.00 36.77 ? 180 GLN A CB  1 
ATOM   524  C  CG  . GLN A 1 73  ? 37.644  -18.219 -0.881 1.00 38.26 ? 180 GLN A CG  1 
ATOM   525  C  CD  . GLN A 1 73  ? 38.670  -17.168 -1.273 1.00 40.00 ? 180 GLN A CD  1 
ATOM   526  O  OE1 . GLN A 1 73  ? 39.646  -16.945 -0.556 1.00 42.80 ? 180 GLN A OE1 1 
ATOM   527  N  NE2 . GLN A 1 73  ? 38.451  -16.524 -2.417 1.00 41.21 ? 180 GLN A NE2 1 
ATOM   528  N  N   . ALA A 1 74  ? 36.191  -20.434 3.289  1.00 37.98 ? 181 ALA A N   1 
ATOM   529  C  CA  . ALA A 1 74  ? 36.537  -20.965 4.603  1.00 37.56 ? 181 ALA A CA  1 
ATOM   530  C  C   . ALA A 1 74  ? 36.819  -22.456 4.489  1.00 38.15 ? 181 ALA A C   1 
ATOM   531  O  O   . ALA A 1 74  ? 35.928  -23.211 4.115  1.00 36.78 ? 181 ALA A O   1 
ATOM   532  C  CB  . ALA A 1 74  ? 35.402  -20.710 5.577  1.00 38.11 ? 181 ALA A CB  1 
ATOM   533  N  N   . PHE A 1 75  ? 38.046  -22.884 4.787  1.00 38.42 ? 182 PHE A N   1 
ATOM   534  C  CA  . PHE A 1 75  ? 38.328  -24.321 4.875  1.00 38.15 ? 182 PHE A CA  1 
ATOM   535  C  C   . PHE A 1 75  ? 37.464  -24.957 5.962  1.00 37.95 ? 182 PHE A C   1 
ATOM   536  O  O   . PHE A 1 75  ? 37.224  -24.358 7.013  1.00 40.52 ? 182 PHE A O   1 
ATOM   537  C  CB  . PHE A 1 75  ? 39.801  -24.605 5.173  1.00 38.18 ? 182 PHE A CB  1 
ATOM   538  C  CG  . PHE A 1 75  ? 40.216  -25.848 5.039  0.00 43.19 ? 182 PHE A CG  1 
ATOM   539  C  CD1 . PHE A 1 75  ? 40.347  -26.466 3.809  0.00 45.00 ? 182 PHE A CD1 1 
ATOM   540  C  CD2 . PHE A 1 75  ? 40.485  -26.582 6.194  0.00 43.59 ? 182 PHE A CD2 1 
ATOM   541  C  CE1 . PHE A 1 75  ? 40.738  -27.787 3.722  0.00 47.19 ? 182 PHE A CE1 1 
ATOM   542  C  CE2 . PHE A 1 75  ? 40.876  -27.904 6.107  0.00 45.68 ? 182 PHE A CE2 1 
ATOM   543  C  CZ  . PHE A 1 75  ? 41.002  -28.506 4.871  0.00 47.48 ? 182 PHE A CZ  1 
ATOM   544  N  N   . GLY A 1 76  ? 36.975  -26.161 5.697  1.00 35.52 ? 183 GLY A N   1 
ATOM   545  C  CA  . GLY A 1 76  ? 36.436  -26.992 6.749  1.00 35.45 ? 183 GLY A CA  1 
ATOM   546  C  C   . GLY A 1 76  ? 34.962  -26.715 6.980  1.00 35.08 ? 183 GLY A C   1 
ATOM   547  O  O   . GLY A 1 76  ? 34.310  -25.978 6.234  1.00 36.81 ? 183 GLY A O   1 
ATOM   548  N  N   . GLU A 1 77  ? 34.403  -27.324 8.012  1.00 32.89 ? 184 GLU A N   1 
ATOM   549  C  CA  . GLU A 1 77  ? 32.952  -27.357 8.119  1.00 31.99 ? 184 GLU A CA  1 
ATOM   550  C  C   . GLU A 1 77  ? 32.446  -26.395 9.162  1.00 29.46 ? 184 GLU A C   1 
ATOM   551  O  O   . GLU A 1 77  ? 31.276  -26.040 9.160  1.00 30.39 ? 184 GLU A O   1 
ATOM   552  C  CB  . GLU A 1 77  ? 32.476  -28.772 8.413  1.00 32.93 ? 184 GLU A CB  1 
ATOM   553  C  CG  . GLU A 1 77  ? 32.830  -29.719 7.282  1.00 36.81 ? 184 GLU A CG  1 
ATOM   554  C  CD  . GLU A 1 77  ? 31.598  -30.243 6.583  1.00 43.42 ? 184 GLU A CD  1 
ATOM   555  O  OE1 . GLU A 1 77  ? 31.069  -29.514 5.710  1.00 46.89 ? 184 GLU A OE1 1 
ATOM   556  O  OE2 . GLU A 1 77  ? 31.175  -31.377 6.916  1.00 48.58 ? 184 GLU A OE2 1 
ATOM   557  N  N   . LYS A 1 78  ? 33.332  -25.979 10.053 1.00 26.94 ? 185 LYS A N   1 
ATOM   558  C  CA  . LYS A 1 78  ? 32.955  -25.071 11.113 1.00 27.49 ? 185 LYS A CA  1 
ATOM   559  C  C   . LYS A 1 78  ? 33.554  -23.713 10.772 1.00 26.36 ? 185 LYS A C   1 
ATOM   560  O  O   . LYS A 1 78  ? 34.687  -23.623 10.303 1.00 26.94 ? 185 LYS A O   1 
ATOM   561  C  CB  . LYS A 1 78  ? 33.405  -25.608 12.472 1.00 26.96 ? 185 LYS A CB  1 
ATOM   562  C  CG  . LYS A 1 78  ? 32.368  -26.594 13.011 1.00 32.39 ? 185 LYS A CG  1 
ATOM   563  C  CD  . LYS A 1 78  ? 32.856  -27.500 14.141 1.00 37.26 ? 185 LYS A CD  1 
ATOM   564  C  CE  . LYS A 1 78  ? 31.901  -28.686 14.329 1.00 38.96 ? 185 LYS A CE  1 
ATOM   565  N  NZ  . LYS A 1 78  ? 32.528  -29.722 15.195 1.00 39.24 ? 185 LYS A NZ  1 
ATOM   566  N  N   . ILE A 1 79  ? 32.752  -22.672 10.947 1.00 22.24 ? 186 ILE A N   1 
ATOM   567  C  CA  . ILE A 1 79  ? 33.249  -21.312 10.859 1.00 22.46 ? 186 ILE A CA  1 
ATOM   568  C  C   . ILE A 1 79  ? 33.025  -20.644 12.198 1.00 18.96 ? 186 ILE A C   1 
ATOM   569  O  O   . ILE A 1 79  ? 31.901  -20.632 12.688 1.00 21.95 ? 186 ILE A O   1 
ATOM   570  C  CB  . ILE A 1 79  ? 32.482  -20.532 9.807  1.00 20.66 ? 186 ILE A CB  1 
ATOM   571  C  CG1 . ILE A 1 79  ? 32.648  -21.172 8.443  1.00 23.02 ? 186 ILE A CG1 1 
ATOM   572  C  CG2 . ILE A 1 79  ? 32.986  -19.128 9.779  1.00 22.08 ? 186 ILE A CG2 1 
ATOM   573  C  CD1 . ILE A 1 79  ? 31.635  -20.726 7.458  1.00 24.04 ? 186 ILE A CD1 1 
ATOM   574  N  N   . THR A 1 80  ? 34.083  -20.105 12.781 1.00 18.21 ? 187 THR A N   1 
ATOM   575  C  CA  . THR A 1 80  ? 33.980  -19.386 14.041 1.00 20.92 ? 187 THR A CA  1 
ATOM   576  C  C   . THR A 1 80  ? 33.811  -17.859 13.850 1.00 19.51 ? 187 THR A C   1 
ATOM   577  O  O   . THR A 1 80  ? 34.471  -17.254 13.003 1.00 22.06 ? 187 THR A O   1 
ATOM   578  C  CB  . THR A 1 80  ? 35.267  -19.557 14.798 1.00 20.53 ? 187 THR A CB  1 
ATOM   579  O  OG1 . THR A 1 80  ? 35.590  -20.926 15.020 1.00 24.95 ? 187 THR A OG1 1 
ATOM   580  C  CG2 . THR A 1 80  ? 35.148  -18.931 16.130 1.00 25.88 ? 187 THR A CG2 1 
HETATM 581  N  N   . MSE A 1 81  ? 32.931  -17.238 14.626 1.00 20.93 ? 188 MSE A N   1 
HETATM 582  C  CA  . MSE A 1 81  ? 32.687  -15.817 14.528 1.00 17.79 ? 188 MSE A CA  1 
HETATM 583  C  C   . MSE A 1 81  ? 32.611  -15.164 15.898 1.00 17.43 ? 188 MSE A C   1 
HETATM 584  O  O   . MSE A 1 81  ? 32.115  -15.784 16.830 1.00 18.47 ? 188 MSE A O   1 
HETATM 585  C  CB  . MSE A 1 81  ? 31.413  -15.586 13.746 1.00 19.21 ? 188 MSE A CB  1 
HETATM 586  C  CG  . MSE A 1 81  ? 31.388  -16.142 12.355 1.00 20.53 ? 188 MSE A CG  1 
HETATM 587  SE SE  . MSE A 1 81  ? 29.770  -15.457 11.454 1.00 30.97 ? 188 MSE A SE  1 
HETATM 588  C  CE  . MSE A 1 81  ? 30.542  -14.483 10.056 1.00 42.74 ? 188 MSE A CE  1 
ATOM   589  N  N   . THR A 1 82  ? 33.137  -13.939 16.039 1.00 17.99 ? 189 THR A N   1 
ATOM   590  C  CA  . THR A 1 82  ? 32.919  -13.123 17.227 1.00 17.01 ? 189 THR A CA  1 
ATOM   591  C  C   . THR A 1 82  ? 31.909  -12.028 16.891 1.00 14.50 ? 189 THR A C   1 
ATOM   592  O  O   . THR A 1 82  ? 32.166  -11.252 16.014 1.00 19.58 ? 189 THR A O   1 
ATOM   593  C  CB  . THR A 1 82  ? 34.228  -12.459 17.662 1.00 21.27 ? 189 THR A CB  1 
ATOM   594  O  OG1 . THR A 1 82  ? 35.235  -13.463 17.859 1.00 21.33 ? 189 THR A OG1 1 
ATOM   595  C  CG2 . THR A 1 82  ? 34.076  -11.731 19.027 1.00 16.67 ? 189 THR A CG2 1 
ATOM   596  N  N   . ILE A 1 83  ? 30.787  -11.999 17.611 1.00 14.76 ? 190 ILE A N   1 
ATOM   597  C  CA  . ILE A 1 83  ? 29.555  -11.261 17.338 1.00 16.54 ? 190 ILE A CA  1 
ATOM   598  C  C   . ILE A 1 83  ? 29.292  -10.261 18.440 1.00 17.56 ? 190 ILE A C   1 
ATOM   599  O  O   . ILE A 1 83  ? 29.435  -10.564 19.591 1.00 17.90 ? 190 ILE A O   1 
ATOM   600  C  CB  . ILE A 1 83  ? 28.369  -12.255 17.345 1.00 17.96 ? 190 ILE A CB  1 
ATOM   601  C  CG1 . ILE A 1 83  ? 28.568  -13.311 16.256 1.00 19.16 ? 190 ILE A CG1 1 
ATOM   602  C  CG2 . ILE A 1 83  ? 27.005  -11.578 17.326 1.00 20.48 ? 190 ILE A CG2 1 
ATOM   603  C  CD1 . ILE A 1 83  ? 28.864  -12.763 14.942 1.00 14.60 ? 190 ILE A CD1 1 
ATOM   604  N  N   . ARG A 1 84  ? 28.906  -9.053  18.082 1.00 20.61 ? 191 ARG A N   1 
ATOM   605  C  CA  . ARG A 1 84  ? 28.329  -8.125  19.033 1.00 20.29 ? 191 ARG A CA  1 
ATOM   606  C  C   . ARG A 1 84  ? 26.861  -8.087  18.668 1.00 19.79 ? 191 ARG A C   1 
ATOM   607  O  O   . ARG A 1 84  ? 26.486  -7.682  17.593 1.00 19.14 ? 191 ARG A O   1 
ATOM   608  C  CB  . ARG A 1 84  ? 29.056  -6.761  18.900 1.00 19.27 ? 191 ARG A CB  1 
ATOM   609  C  CG  . ARG A 1 84  ? 28.510  -5.626  19.662 1.00 22.85 ? 191 ARG A CG  1 
ATOM   610  C  CD  . ARG A 1 84  ? 29.256  -4.311  19.398 1.00 23.34 ? 191 ARG A CD  1 
ATOM   611  N  NE  . ARG A 1 84  ? 30.557  -4.298  20.043 1.00 22.02 ? 191 ARG A NE  1 
ATOM   612  C  CZ  . ARG A 1 84  ? 31.642  -3.688  19.561 1.00 22.30 ? 191 ARG A CZ  1 
ATOM   613  N  NH1 . ARG A 1 84  ? 31.589  -2.991  18.433 1.00 21.22 ? 191 ARG A NH1 1 
ATOM   614  N  NH2 . ARG A 1 84  ? 32.794  -3.773  20.237 1.00 27.68 ? 191 ARG A NH2 1 
ATOM   615  N  N   . ASP A 1 85  ? 26.005  -8.502  19.583 1.00 19.77 ? 192 ASP A N   1 
ATOM   616  C  CA  . ASP A 1 85  ? 24.599  -8.618  19.289 1.00 22.79 ? 192 ASP A CA  1 
ATOM   617  C  C   . ASP A 1 85  ? 24.056  -7.213  18.990 1.00 25.42 ? 192 ASP A C   1 
ATOM   618  O  O   . ASP A 1 85  ? 24.468  -6.231  19.587 1.00 25.76 ? 192 ASP A O   1 
ATOM   619  C  CB  . ASP A 1 85  ? 23.808  -9.164  20.481 1.00 24.34 ? 192 ASP A CB  1 
ATOM   620  C  CG  . ASP A 1 85  ? 24.120  -10.611 20.812 1.00 24.84 ? 192 ASP A CG  1 
ATOM   621  O  OD1 . ASP A 1 85  ? 24.625  -11.423 20.005 1.00 21.03 ? 192 ASP A OD1 1 
ATOM   622  O  OD2 . ASP A 1 85  ? 23.840  -11.039 21.935 1.00 30.35 ? 192 ASP A OD2 1 
ATOM   623  N  N   . ARG A 1 86  ? 23.160  -7.176  18.011 1.00 23.40 ? 193 ARG A N   1 
ATOM   624  C  CA  . ARG A 1 86  ? 22.631  -5.984  17.397 1.00 24.02 ? 193 ARG A CA  1 
ATOM   625  C  C   . ARG A 1 86  ? 22.867  -4.707  18.157 1.00 22.09 ? 193 ARG A C   1 
ATOM   626  O  O   . ARG A 1 86  ? 22.093  -4.394  19.045 1.00 22.80 ? 193 ARG A O   1 
ATOM   627  C  CB  . ARG A 1 86  ? 21.133  -6.214  17.243 1.00 22.62 ? 193 ARG A CB  1 
ATOM   628  C  CG  . ARG A 1 86  ? 20.483  -5.070  16.484 1.00 31.37 ? 193 ARG A CG  1 
ATOM   629  C  CD  . ARG A 1 86  ? 18.988  -5.231  16.367 1.00 31.78 ? 193 ARG A CD  1 
ATOM   630  N  NE  . ARG A 1 86  ? 18.616  -6.311  15.455 1.00 28.79 ? 193 ARG A NE  1 
ATOM   631  C  CZ  . ARG A 1 86  ? 17.420  -6.873  15.440 1.00 29.03 ? 193 ARG A CZ  1 
ATOM   632  N  NH1 . ARG A 1 86  ? 16.556  -6.518  16.391 1.00 28.23 ? 193 ARG A NH1 1 
ATOM   633  N  NH2 . ARG A 1 86  ? 17.109  -7.802  14.512 1.00 21.65 ? 193 ARG A NH2 1 
ATOM   634  N  N   . PRO A 1 87  ? 23.962  -4.015  17.902 1.00 20.86 ? 194 PRO A N   1 
ATOM   635  C  CA  . PRO A 1 87  ? 24.314  -2.874  18.741 1.00 22.26 ? 194 PRO A CA  1 
ATOM   636  C  C   . PRO A 1 87  ? 23.424  -1.653  18.589 1.00 24.51 ? 194 PRO A C   1 
ATOM   637  O  O   . PRO A 1 87  ? 23.368  -0.861  19.486 1.00 23.83 ? 194 PRO A O   1 
ATOM   638  C  CB  . PRO A 1 87  ? 25.733  -2.549  18.319 1.00 24.04 ? 194 PRO A CB  1 
ATOM   639  C  CG  . PRO A 1 87  ? 25.925  -3.218  17.063 1.00 22.34 ? 194 PRO A CG  1 
ATOM   640  C  CD  . PRO A 1 87  ? 25.013  -4.372  16.935 1.00 20.98 ? 194 PRO A CD  1 
ATOM   641  N  N   . PHE A 1 88  ? 22.788  -1.491  17.443 1.00 29.07 ? 195 PHE A N   1 
ATOM   642  C  CA  . PHE A 1 88  ? 21.924  -0.366  17.198 1.00 35.42 ? 195 PHE A CA  1 
ATOM   643  C  C   . PHE A 1 88  ? 20.488  -0.870  17.116 1.00 36.39 ? 195 PHE A C   1 
ATOM   644  O  O   . PHE A 1 88  ? 20.113  -1.656  16.252 1.00 40.95 ? 195 PHE A O   1 
ATOM   645  C  CB  . PHE A 1 88  ? 22.443  0.370   15.980 1.00 37.47 ? 195 PHE A CB  1 
ATOM   646  C  CG  . PHE A 1 88  ? 23.812  0.923   16.231 1.00 41.90 ? 195 PHE A CG  1 
ATOM   647  C  CD1 . PHE A 1 88  ? 23.999  1.878   17.238 1.00 45.84 ? 195 PHE A CD1 1 
ATOM   648  C  CD2 . PHE A 1 88  ? 24.916  0.395   15.598 1.00 46.24 ? 195 PHE A CD2 1 
ATOM   649  C  CE1 . PHE A 1 88  ? 25.273  2.376   17.521 1.00 52.79 ? 195 PHE A CE1 1 
ATOM   650  C  CE2 . PHE A 1 88  ? 26.194  0.900   15.865 1.00 49.71 ? 195 PHE A CE2 1 
ATOM   651  C  CZ  . PHE A 1 88  ? 26.379  1.884   16.827 1.00 47.96 ? 195 PHE A CZ  1 
ATOM   652  N  N   . GLU A 1 89  ? 19.718  -0.539  18.141 1.00 37.76 ? 196 GLU A N   1 
ATOM   653  C  CA  . GLU A 1 89  ? 18.398  -1.139  18.269 1.00 36.57 ? 196 GLU A CA  1 
ATOM   654  C  C   . GLU A 1 89  ? 17.652  -0.299  19.269 1.00 37.03 ? 196 GLU A C   1 
ATOM   655  O  O   . GLU A 1 89  ? 18.159  0.038   20.343 1.00 40.51 ? 196 GLU A O   1 
ATOM   656  C  CB  . GLU A 1 89  ? 18.505  -2.559  18.794 1.00 39.19 ? 196 GLU A CB  1 
ATOM   657  C  CG  . GLU A 1 89  ? 17.170  -3.148  19.212 1.00 48.85 ? 196 GLU A CG  1 
ATOM   658  C  CD  . GLU A 1 89  ? 17.318  -4.553  19.753 1.00 50.20 ? 196 GLU A CD  1 
ATOM   659  O  OE1 . GLU A 1 89  ? 18.057  -4.713  20.751 1.00 53.82 ? 196 GLU A OE1 1 
ATOM   660  O  OE2 . GLU A 1 89  ? 16.708  -5.468  19.168 1.00 48.38 ? 196 GLU A OE2 1 
ATOM   661  N  N   . ARG A 1 90  ? 16.443  0.066   18.897 1.00 30.84 ? 197 ARG A N   1 
ATOM   662  C  CA  . ARG A 1 90  ? 15.597  0.809   19.780 1.00 29.81 ? 197 ARG A CA  1 
ATOM   663  C  C   . ARG A 1 90  ? 14.258  0.098   19.628 1.00 27.57 ? 197 ARG A C   1 
ATOM   664  O  O   . ARG A 1 90  ? 13.798  -0.144  18.518 1.00 26.09 ? 197 ARG A O   1 
ATOM   665  C  CB  . ARG A 1 90  ? 15.529  2.252   19.330 1.00 30.57 ? 197 ARG A CB  1 
ATOM   666  C  CG  . ARG A 1 90  ? 14.779  3.164   20.270 1.00 34.52 ? 197 ARG A CG  1 
ATOM   667  C  CD  . ARG A 1 90  ? 15.569  3.511   21.528 1.00 24.14 ? 197 ARG A CD  1 
ATOM   668  N  NE  . ARG A 1 90  ? 14.671  3.372   22.630 1.00 32.00 ? 197 ARG A NE  1 
ATOM   669  C  CZ  . ARG A 1 90  ? 15.072  3.502   23.876 1.00 33.77 ? 197 ARG A CZ  1 
ATOM   670  N  NH1 . ARG A 1 90  ? 16.349  3.721   24.153 1.00 33.56 ? 197 ARG A NH1 1 
ATOM   671  N  NH2 . ARG A 1 90  ? 14.183  3.400   24.835 1.00 31.62 ? 197 ARG A NH2 1 
ATOM   672  N  N   . THR A 1 91  ? 13.670  -0.258  20.751 1.00 24.39 ? 198 THR A N   1 
ATOM   673  C  CA  . THR A 1 91  ? 12.398  -0.943  20.762 1.00 25.19 ? 198 THR A CA  1 
ATOM   674  C  C   . THR A 1 91  ? 11.399  0.014   21.351 1.00 24.77 ? 198 THR A C   1 
ATOM   675  O  O   . THR A 1 91  ? 11.634  0.534   22.434 1.00 25.65 ? 198 THR A O   1 
ATOM   676  C  CB  . THR A 1 91  ? 12.556  -2.216  21.607 1.00 25.23 ? 198 THR A CB  1 
ATOM   677  O  OG1 . THR A 1 91  ? 13.234  -3.171  20.801 1.00 24.57 ? 198 THR A OG1 1 
ATOM   678  C  CG2 . THR A 1 91  ? 11.210  -2.865  21.900 1.00 26.74 ? 198 THR A CG2 1 
ATOM   679  N  N   . ILE A 1 92  ? 10.320  0.274   20.615 1.00 24.76 ? 199 ILE A N   1 
ATOM   680  C  CA  . ILE A 1 92  ? 9.298   1.226   21.061 1.00 24.49 ? 199 ILE A CA  1 
ATOM   681  C  C   . ILE A 1 92  ? 7.949   0.534   21.112 1.00 21.99 ? 199 ILE A C   1 
ATOM   682  O  O   . ILE A 1 92  ? 7.576   -0.123  20.167 1.00 22.25 ? 199 ILE A O   1 
ATOM   683  C  CB  . ILE A 1 92  ? 9.262   2.427   20.082 1.00 21.95 ? 199 ILE A CB  1 
ATOM   684  C  CG1 . ILE A 1 92  ? 10.555  3.228   20.163 1.00 27.74 ? 199 ILE A CG1 1 
ATOM   685  C  CG2 . ILE A 1 92  ? 8.083   3.305   20.374 1.00 26.38 ? 199 ILE A CG2 1 
ATOM   686  C  CD1 . ILE A 1 92  ? 10.833  4.072   18.977 1.00 24.15 ? 199 ILE A CD1 1 
ATOM   687  N  N   . THR A 1 93  ? 7.209   0.709   22.193 1.00 24.27 ? 200 THR A N   1 
ATOM   688  C  CA  . THR A 1 93  ? 5.871   0.149   22.340 1.00 22.28 ? 200 THR A CA  1 
ATOM   689  C  C   . THR A 1 93  ? 4.860   1.254   22.070 1.00 21.60 ? 200 THR A C   1 
ATOM   690  O  O   . THR A 1 93  ? 4.901   2.312   22.683 1.00 19.45 ? 200 THR A O   1 
ATOM   691  C  CB  . THR A 1 93  ? 5.685   -0.408  23.745 1.00 22.50 ? 200 THR A CB  1 
ATOM   692  O  OG1 . THR A 1 93  ? 6.419   -1.635  23.878 1.00 26.04 ? 200 THR A OG1 1 
ATOM   693  C  CG2 . THR A 1 93  ? 4.275   -0.878  23.993 1.00 24.91 ? 200 THR A CG2 1 
HETATM 694  N  N   . MSE A 1 94  ? 3.950   1.005   21.144 1.00 19.54 ? 201 MSE A N   1 
HETATM 695  C  CA  . MSE A 1 94  ? 2.922   1.992   20.886 1.00 18.67 ? 201 MSE A CA  1 
HETATM 696  C  C   . MSE A 1 94  ? 1.578   1.340   21.099 1.00 18.87 ? 201 MSE A C   1 
HETATM 697  O  O   . MSE A 1 94  ? 1.493   0.125   21.332 1.00 21.05 ? 201 MSE A O   1 
HETATM 698  C  CB  . MSE A 1 94  ? 3.010   2.531   19.447 1.00 20.46 ? 201 MSE A CB  1 
HETATM 699  C  CG  . MSE A 1 94  ? 4.144   3.504   19.229 1.00 19.39 ? 201 MSE A CG  1 
HETATM 700  SE SE  . MSE A 1 94  ? 4.803   3.202   17.301 1.00 23.01 ? 201 MSE A SE  1 
HETATM 701  C  CE  . MSE A 1 94  ? 5.737   1.524   17.487 1.00 26.45 ? 201 MSE A CE  1 
ATOM   702  N  N   . HIS A 1 95  ? 0.525   2.127   20.966 1.00 14.80 ? 202 HIS A N   1 
ATOM   703  C  CA  . HIS A 1 95  ? -0.803  1.566   21.013 1.00 17.99 ? 202 HIS A CA  1 
ATOM   704  C  C   . HIS A 1 95  ? -1.759  2.158   20.002 1.00 18.55 ? 202 HIS A C   1 
ATOM   705  O  O   . HIS A 1 95  ? -1.755  3.365   19.780 1.00 17.37 ? 202 HIS A O   1 
ATOM   706  C  CB  . HIS A 1 95  ? -1.335  1.499   22.454 1.00 21.48 ? 202 HIS A CB  1 
ATOM   707  C  CG  . HIS A 1 95  ? -1.936  2.738   23.009 1.00 31.89 ? 202 HIS A CG  1 
ATOM   708  N  ND1 . HIS A 1 95  ? -3.102  3.294   22.524 1.00 49.19 ? 202 HIS A ND1 1 
ATOM   709  C  CD2 . HIS A 1 95  ? -1.626  3.441   24.126 1.00 47.60 ? 202 HIS A CD2 1 
ATOM   710  C  CE1 . HIS A 1 95  ? -3.418  4.354   23.251 1.00 51.92 ? 202 HIS A CE1 1 
ATOM   711  N  NE2 . HIS A 1 95  ? -2.549  4.456   24.241 1.00 46.86 ? 202 HIS A NE2 1 
ATOM   712  N  N   . LYS A 1 96  ? -2.526  1.271   19.374 1.00 15.34 ? 203 LYS A N   1 
ATOM   713  C  CA  . LYS A 1 96  ? -3.489  1.659   18.369 1.00 18.21 ? 203 LYS A CA  1 
ATOM   714  C  C   . LYS A 1 96  ? -4.516  2.598   18.980 1.00 18.39 ? 203 LYS A C   1 
ATOM   715  O  O   . LYS A 1 96  ? -4.962  2.422   20.088 1.00 17.59 ? 203 LYS A O   1 
ATOM   716  C  CB  . LYS A 1 96  ? -4.184  0.463   17.721 1.00 16.51 ? 203 LYS A CB  1 
ATOM   717  C  CG  . LYS A 1 96  ? -3.247  -0.449  16.959 1.00 14.79 ? 203 LYS A CG  1 
ATOM   718  C  CD  . LYS A 1 96  ? -3.995  -1.575  16.281 1.00 13.82 ? 203 LYS A CD  1 
ATOM   719  C  CE  . LYS A 1 96  ? -3.094  -2.433  15.452 1.00 14.44 ? 203 LYS A CE  1 
ATOM   720  N  NZ  . LYS A 1 96  ? -3.856  -3.508  14.797 1.00 11.34 ? 203 LYS A NZ  1 
ATOM   721  N  N   . ASP A 1 97  ? -4.884  3.623   18.241 1.00 21.74 ? 204 ASP A N   1 
ATOM   722  C  CA  . ASP A 1 97  ? -6.070  4.398   18.638 1.00 25.63 ? 204 ASP A CA  1 
ATOM   723  C  C   . ASP A 1 97  ? -7.340  3.944   17.911 1.00 27.32 ? 204 ASP A C   1 
ATOM   724  O  O   . ASP A 1 97  ? -7.491  2.735   17.644 1.00 26.56 ? 204 ASP A O   1 
ATOM   725  C  CB  . ASP A 1 97  ? -5.774  5.889   18.512 1.00 24.31 ? 204 ASP A CB  1 
ATOM   726  C  CG  . ASP A 1 97  ? -5.575  6.333   17.091 1.00 25.41 ? 204 ASP A CG  1 
ATOM   727  O  OD1 . ASP A 1 97  ? -5.911  5.576   16.170 1.00 38.94 ? 204 ASP A OD1 1 
ATOM   728  O  OD2 . ASP A 1 97  ? -5.151  7.466   16.800 1.00 47.77 ? 204 ASP A OD2 1 
ATOM   729  N  N   . SER A 1 98  ? -8.259  4.890   17.667 1.00 31.57 ? 205 SER A N   1 
ATOM   730  C  CA  . SER A 1 98  ? -9.435  4.743   16.769 1.00 33.85 ? 205 SER A CA  1 
ATOM   731  C  C   . SER A 1 98  ? -9.220  5.127   15.269 1.00 34.63 ? 205 SER A C   1 
ATOM   732  O  O   . SER A 1 98  ? -10.113 4.990   14.441 1.00 34.79 ? 205 SER A O   1 
ATOM   733  C  CB  . SER A 1 98  ? -10.574 5.624   17.319 1.00 34.30 ? 205 SER A CB  1 
ATOM   734  O  OG  . SER A 1 98  ? -10.100 6.962   17.467 1.00 35.48 ? 205 SER A OG  1 
ATOM   735  N  N   . THR A 1 99  ? -8.028  5.551   14.863 1.00 34.86 ? 206 THR A N   1 
ATOM   736  C  CA  . THR A 1 99  ? -7.615  5.225   13.490 1.00 34.77 ? 206 THR A CA  1 
ATOM   737  C  C   . THR A 1 99  ? -7.504  3.703   13.207 1.00 35.93 ? 206 THR A C   1 
ATOM   738  O  O   . THR A 1 99  ? -7.131  3.368   12.069 1.00 38.74 ? 206 THR A O   1 
ATOM   739  C  CB  . THR A 1 99  ? -6.324  5.984   13.016 1.00 33.35 ? 206 THR A CB  1 
ATOM   740  O  OG1 . THR A 1 99  ? -5.150  5.550   13.726 1.00 28.52 ? 206 THR A OG1 1 
ATOM   741  C  CG2 . THR A 1 99  ? -6.424  7.505   13.303 1.00 34.70 ? 206 THR A CG2 1 
ATOM   742  N  N   . GLY A 1 100 ? -7.851  2.809   14.160 1.00 33.45 ? 207 GLY A N   1 
ATOM   743  C  CA  . GLY A 1 100 ? -7.122  1.550   14.374 1.00 29.67 ? 207 GLY A CA  1 
ATOM   744  C  C   . GLY A 1 100 ? -5.602  1.530   14.082 1.00 27.94 ? 207 GLY A C   1 
ATOM   745  O  O   . GLY A 1 100 ? -4.974  0.496   13.817 1.00 23.45 ? 207 GLY A O   1 
ATOM   746  N  N   . HIS A 1 101 ? -4.949  2.686   14.106 1.00 25.19 ? 208 HIS A N   1 
ATOM   747  C  CA  . HIS A 1 101 ? -3.565  2.689   13.640 1.00 26.05 ? 208 HIS A CA  1 
ATOM   748  C  C   . HIS A 1 101 ? -2.617  3.242   14.707 1.00 20.51 ? 208 HIS A C   1 
ATOM   749  O  O   . HIS A 1 101 ? -3.060  3.932   15.630 1.00 18.97 ? 208 HIS A O   1 
ATOM   750  C  CB  . HIS A 1 101 ? -3.406  3.486   12.332 1.00 29.52 ? 208 HIS A CB  1 
ATOM   751  C  CG  . HIS A 1 101 ? -3.776  2.729   11.089 1.00 39.74 ? 208 HIS A CG  1 
ATOM   752  N  ND1 . HIS A 1 101 ? -5.060  2.716   10.578 1.00 43.61 ? 208 HIS A ND1 1 
ATOM   753  C  CD2 . HIS A 1 101 ? -3.020  2.007   10.225 1.00 45.20 ? 208 HIS A CD2 1 
ATOM   754  C  CE1 . HIS A 1 101 ? -5.083  2.005   9.466  1.00 43.91 ? 208 HIS A CE1 1 
ATOM   755  N  NE2 . HIS A 1 101 ? -3.860  1.561   9.231  1.00 46.43 ? 208 HIS A NE2 1 
ATOM   756  N  N   . VAL A 1 102 ? -1.327  2.950   14.549 1.00 18.16 ? 209 VAL A N   1 
ATOM   757  C  CA  . VAL A 1 102 ? -0.331  3.492   15.459 1.00 19.74 ? 209 VAL A CA  1 
ATOM   758  C  C   . VAL A 1 102 ? 0.272   4.820   15.085 1.00 17.70 ? 209 VAL A C   1 
ATOM   759  O  O   . VAL A 1 102 ? 0.698   5.526   15.972 1.00 21.10 ? 209 VAL A O   1 
ATOM   760  C  CB  . VAL A 1 102 ? 0.737   2.482   15.977 1.00 21.75 ? 209 VAL A CB  1 
ATOM   761  C  CG1 . VAL A 1 102 ? 0.067   1.352   16.677 1.00 24.70 ? 209 VAL A CG1 1 
ATOM   762  C  CG2 . VAL A 1 102 ? 1.709   2.007   14.934 1.00 21.01 ? 209 VAL A CG2 1 
ATOM   763  N  N   . GLY A 1 103 ? 0.217   5.192   13.807 1.00 20.04 ? 210 GLY A N   1 
ATOM   764  C  CA  . GLY A 1 103 ? 0.588   6.527   13.365 1.00 20.23 ? 210 GLY A CA  1 
ATOM   765  C  C   . GLY A 1 103 ? 1.839   6.695   12.521 1.00 18.10 ? 210 GLY A C   1 
ATOM   766  O  O   . GLY A 1 103 ? 2.546   7.693   12.634 1.00 15.35 ? 210 GLY A O   1 
ATOM   767  N  N   . PHE A 1 104 ? 2.078   5.785   11.589 1.00 17.34 ? 211 PHE A N   1 
ATOM   768  C  CA  . PHE A 1 104 ? 3.245   5.921   10.748 1.00 18.04 ? 211 PHE A CA  1 
ATOM   769  C  C   . PHE A 1 104 ? 3.041   5.353   9.358  1.00 19.57 ? 211 PHE A C   1 
ATOM   770  O  O   . PHE A 1 104 ? 2.222   4.458   9.138  1.00 19.82 ? 211 PHE A O   1 
ATOM   771  C  CB  . PHE A 1 104 ? 4.514   5.394   11.435 1.00 17.95 ? 211 PHE A CB  1 
ATOM   772  C  CG  . PHE A 1 104 ? 4.632   3.882   11.511 1.00 16.47 ? 211 PHE A CG  1 
ATOM   773  C  CD1 . PHE A 1 104 ? 4.278   3.203   12.656 1.00 16.47 ? 211 PHE A CD1 1 
ATOM   774  C  CD2 . PHE A 1 104 ? 5.140   3.161   10.470 1.00 24.02 ? 211 PHE A CD2 1 
ATOM   775  C  CE1 . PHE A 1 104 ? 4.416   1.843   12.774 1.00 15.90 ? 211 PHE A CE1 1 
ATOM   776  C  CE2 . PHE A 1 104 ? 5.277   1.791   10.551 1.00 19.44 ? 211 PHE A CE2 1 
ATOM   777  C  CZ  . PHE A 1 104 ? 4.917   1.124   11.741 1.00 23.21 ? 211 PHE A CZ  1 
ATOM   778  N  N   . ILE A 1 105 ? 3.729   5.943   8.394  1.00 19.39 ? 212 ILE A N   1 
ATOM   779  C  CA  . ILE A 1 105 ? 3.838   5.334   7.074  1.00 18.47 ? 212 ILE A CA  1 
ATOM   780  C  C   . ILE A 1 105 ? 5.218   4.704   6.948  1.00 19.49 ? 212 ILE A C   1 
ATOM   781  O  O   . ILE A 1 105 ? 6.190   5.175   7.565  1.00 19.80 ? 212 ILE A O   1 
ATOM   782  C  CB  . ILE A 1 105 ? 3.635   6.404   6.009  1.00 19.48 ? 212 ILE A CB  1 
ATOM   783  C  CG1 . ILE A 1 105 ? 2.371   7.238   6.268  1.00 23.89 ? 212 ILE A CG1 1 
ATOM   784  C  CG2 . ILE A 1 105 ? 3.583   5.791   4.655  1.00 22.73 ? 212 ILE A CG2 1 
ATOM   785  C  CD1 . ILE A 1 105 ? 1.092   6.491   6.223  1.00 28.23 ? 212 ILE A CD1 1 
ATOM   786  N  N   . PHE A 1 106 ? 5.307   3.627   6.176  1.00 18.06 ? 213 PHE A N   1 
ATOM   787  C  CA  . PHE A 1 106 ? 6.582   3.049   5.791  1.00 18.50 ? 213 PHE A CA  1 
ATOM   788  C  C   . PHE A 1 106 ? 6.613   2.572   4.335  1.00 20.39 ? 213 PHE A C   1 
ATOM   789  O  O   . PHE A 1 106 ? 5.576   2.403   3.722  1.00 23.86 ? 213 PHE A O   1 
ATOM   790  C  CB  . PHE A 1 106 ? 6.913   1.871   6.699  1.00 20.03 ? 213 PHE A CB  1 
ATOM   791  C  CG  . PHE A 1 106 ? 5.960   0.717   6.544  1.00 17.38 ? 213 PHE A CG  1 
ATOM   792  C  CD1 . PHE A 1 106 ? 6.277   -0.355  5.725  1.00 20.47 ? 213 PHE A CD1 1 
ATOM   793  C  CD2 . PHE A 1 106 ? 4.747   0.725   7.184  1.00 24.03 ? 213 PHE A CD2 1 
ATOM   794  C  CE1 . PHE A 1 106 ? 5.413   -1.403  5.567  1.00 22.90 ? 213 PHE A CE1 1 
ATOM   795  C  CE2 . PHE A 1 106 ? 3.879   -0.361  7.056  1.00 23.65 ? 213 PHE A CE2 1 
ATOM   796  C  CZ  . PHE A 1 106 ? 4.211   -1.404  6.232  1.00 21.02 ? 213 PHE A CZ  1 
ATOM   797  N  N   . LYS A 1 107 ? 7.808   2.337   3.810  1.00 20.56 ? 214 LYS A N   1 
ATOM   798  C  CA  . LYS A 1 107 ? 8.014   1.938   2.432  1.00 22.52 ? 214 LYS A CA  1 
ATOM   799  C  C   . LYS A 1 107 ? 9.324   1.185   2.375  1.00 21.28 ? 214 LYS A C   1 
ATOM   800  O  O   . LYS A 1 107 ? 10.315  1.632   2.890  1.00 24.51 ? 214 LYS A O   1 
ATOM   801  C  CB  . LYS A 1 107 ? 8.055   3.167   1.498  1.00 23.05 ? 214 LYS A CB  1 
ATOM   802  N  N   . ASN A 1 108 ? 9.332   0.024   1.746  1.00 24.29 ? 215 ASN A N   1 
ATOM   803  C  CA  . ASN A 1 108 ? 10.514  -0.816  1.716  1.00 24.87 ? 215 ASN A CA  1 
ATOM   804  C  C   . ASN A 1 108 ? 11.017  -1.177  3.104  1.00 23.29 ? 215 ASN A C   1 
ATOM   805  O  O   . ASN A 1 108 ? 12.216  -1.297  3.298  1.00 24.45 ? 215 ASN A O   1 
ATOM   806  C  CB  . ASN A 1 108 ? 11.673  -0.105  1.004  1.00 27.41 ? 215 ASN A CB  1 
ATOM   807  C  CG  . ASN A 1 108 ? 11.599  -0.207  -0.479 1.00 34.02 ? 215 ASN A CG  1 
ATOM   808  O  OD1 . ASN A 1 108 ? 10.587  -0.632  -1.054 1.00 39.11 ? 215 ASN A OD1 1 
ATOM   809  N  ND2 . ASN A 1 108 ? 12.682  0.206   -1.132 1.00 45.07 ? 215 ASN A ND2 1 
ATOM   810  N  N   . GLY A 1 109 ? 10.122  -1.307  4.063  1.00 22.97 ? 216 GLY A N   1 
ATOM   811  C  CA  . GLY A 1 109 ? 10.481  -1.725  5.404  1.00 22.26 ? 216 GLY A CA  1 
ATOM   812  C  C   . GLY A 1 109 ? 11.065  -0.616  6.257  1.00 22.95 ? 216 GLY A C   1 
ATOM   813  O  O   . GLY A 1 109 ? 11.521  -0.898  7.386  1.00 22.18 ? 216 GLY A O   1 
ATOM   814  N  N   . LYS A 1 110 ? 10.991  0.617   5.756  1.00 19.71 ? 217 LYS A N   1 
ATOM   815  C  CA  . LYS A 1 110 ? 11.523  1.797   6.443  1.00 22.79 ? 217 LYS A CA  1 
ATOM   816  C  C   . LYS A 1 110 ? 10.443  2.836   6.713  1.00 19.75 ? 217 LYS A C   1 
ATOM   817  O  O   . LYS A 1 110 ? 9.679   3.206   5.820  1.00 22.72 ? 217 LYS A O   1 
ATOM   818  C  CB  . LYS A 1 110 ? 12.602  2.490   5.591  1.00 22.23 ? 217 LYS A CB  1 
ATOM   819  C  CG  . LYS A 1 110 ? 13.773  1.553   5.238  1.00 30.41 ? 217 LYS A CG  1 
ATOM   820  C  CD  . LYS A 1 110 ? 14.684  2.059   4.093  1.00 35.17 ? 217 LYS A CD  1 
ATOM   821  C  CE  . LYS A 1 110 ? 15.674  0.885   3.659  0.00 62.78 ? 217 LYS A CE  1 
ATOM   822  N  NZ  . LYS A 1 110 ? 16.750  1.476   2.818  0.00 60.54 ? 217 LYS A NZ  1 
ATOM   823  N  N   . ILE A 1 111 ? 10.439  3.344   7.935  1.00 17.56 ? 218 ILE A N   1 
ATOM   824  C  CA  . ILE A 1 111 ? 9.483   4.361   8.360  1.00 17.45 ? 218 ILE A CA  1 
ATOM   825  C  C   . ILE A 1 111 ? 9.755   5.662   7.614  1.00 16.64 ? 218 ILE A C   1 
ATOM   826  O  O   . ILE A 1 111 ? 10.903  6.085   7.510  1.00 21.35 ? 218 ILE A O   1 
ATOM   827  C  CB  . ILE A 1 111 ? 9.594   4.544   9.845  1.00 16.61 ? 218 ILE A CB  1 
ATOM   828  C  CG1 . ILE A 1 111 ? 9.337   3.190   10.508 1.00 25.32 ? 218 ILE A CG1 1 
ATOM   829  C  CG2 . ILE A 1 111 ? 8.613   5.626   10.311 1.00 20.61 ? 218 ILE A CG2 1 
ATOM   830  C  CD1 . ILE A 1 111 ? 9.705   3.141   11.915 1.00 22.69 ? 218 ILE A CD1 1 
ATOM   831  N  N   . THR A 1 112 ? 8.725   6.285   7.062  1.00 16.59 ? 219 THR A N   1 
ATOM   832  C  CA  . THR A 1 112 ? 8.862   7.455   6.207  1.00 17.61 ? 219 THR A CA  1 
ATOM   833  C  C   . THR A 1 112 ? 8.118   8.703   6.675  1.00 18.01 ? 219 THR A C   1 
ATOM   834  O  O   . THR A 1 112 ? 8.550   9.794   6.417  1.00 18.55 ? 219 THR A O   1 
ATOM   835  C  CB  . THR A 1 112 ? 8.446   7.162   4.783  1.00 19.76 ? 219 THR A CB  1 
ATOM   836  O  OG1 . THR A 1 112 ? 7.144   6.581   4.732  1.00 20.72 ? 219 THR A OG1 1 
ATOM   837  C  CG2 . THR A 1 112 ? 9.356   6.153   4.115  1.00 24.02 ? 219 THR A CG2 1 
ATOM   838  N  N   . SER A 1 113 ? 7.024   8.569   7.409  1.00 19.68 ? 220 SER A N   1 
ATOM   839  C  CA  . SER A 1 113 ? 6.440   9.741   8.075  1.00 20.24 ? 220 SER A CA  1 
ATOM   840  C  C   . SER A 1 113 ? 5.732   9.315   9.351  1.00 14.98 ? 220 SER A C   1 
ATOM   841  O  O   . SER A 1 113 ? 5.354   8.162   9.501  1.00 17.37 ? 220 SER A O   1 
ATOM   842  C  CB  . SER A 1 113 ? 5.457   10.477  7.179  1.00 18.82 ? 220 SER A CB  1 
ATOM   843  O  OG  . SER A 1 113 ? 4.381   9.610   6.944  1.00 27.16 ? 220 SER A OG  1 
ATOM   844  N  N   . ILE A 1 114 ? 5.602   10.249  10.278 1.00 17.54 ? 221 ILE A N   1 
ATOM   845  C  CA  . ILE A 1 114 ? 4.969   10.026  11.582 1.00 17.39 ? 221 ILE A CA  1 
ATOM   846  C  C   . ILE A 1 114 ? 3.700   10.898  11.586 1.00 17.93 ? 221 ILE A C   1 
ATOM   847  O  O   . ILE A 1 114 ? 3.778   12.086  11.368 1.00 17.21 ? 221 ILE A O   1 
ATOM   848  C  CB  . ILE A 1 114 ? 5.865   10.504  12.721 1.00 18.58 ? 221 ILE A CB  1 
ATOM   849  C  CG1 . ILE A 1 114 ? 7.286   9.918   12.693 1.00 16.21 ? 221 ILE A CG1 1 
ATOM   850  C  CG2 . ILE A 1 114 ? 5.148   10.382  14.058 1.00 21.17 ? 221 ILE A CG2 1 
ATOM   851  C  CD1 . ILE A 1 114 ? 7.351   8.442   12.902 1.00 14.56 ? 221 ILE A CD1 1 
ATOM   852  N  N   . VAL A 1 115 ? 2.544   10.315  11.877 1.00 17.36 ? 222 VAL A N   1 
ATOM   853  C  CA  . VAL A 1 115 ? 1.281   11.028  11.927 1.00 18.09 ? 222 VAL A CA  1 
ATOM   854  C  C   . VAL A 1 115 ? 1.179   11.851  13.192 1.00 19.61 ? 222 VAL A C   1 
ATOM   855  O  O   . VAL A 1 115 ? 1.469   11.381  14.304 1.00 15.98 ? 222 VAL A O   1 
ATOM   856  C  CB  . VAL A 1 115 ? 0.106   10.046  11.796 1.00 18.72 ? 222 VAL A CB  1 
ATOM   857  C  CG1 . VAL A 1 115 ? -1.269  10.699  12.017 1.00 18.05 ? 222 VAL A CG1 1 
ATOM   858  C  CG2 . VAL A 1 115 ? 0.196   9.272   10.487 1.00 22.51 ? 222 VAL A CG2 1 
ATOM   859  N  N   . LYS A 1 116 ? 0.771   13.102  13.002 1.00 18.70 ? 223 LYS A N   1 
ATOM   860  C  CA  . LYS A 1 116 ? 0.575   13.988  14.125 1.00 20.72 ? 223 LYS A CA  1 
ATOM   861  C  C   . LYS A 1 116 ? -0.437  13.446  15.132 1.00 20.28 ? 223 LYS A C   1 
ATOM   862  O  O   . LYS A 1 116 ? -1.498  12.861  14.801 1.00 22.34 ? 223 LYS A O   1 
ATOM   863  C  CB  . LYS A 1 116 ? 0.204   15.380  13.613 1.00 22.83 ? 223 LYS A CB  1 
ATOM   864  C  CG  . LYS A 1 116 ? -0.147  16.375  14.685 1.00 29.71 ? 223 LYS A CG  1 
ATOM   865  C  CD  . LYS A 1 116 ? -0.295  17.770  14.109 1.00 37.59 ? 223 LYS A CD  1 
ATOM   866  C  CE  . LYS A 1 116 ? 1.072   18.424  13.983 1.00 46.14 ? 223 LYS A CE  1 
ATOM   867  N  NZ  . LYS A 1 116 ? 2.119   17.573  14.619 1.00 51.00 ? 223 LYS A NZ  1 
ATOM   868  N  N   . ASP A 1 117 ? -0.083  13.585  16.390 1.00 18.44 ? 224 ASP A N   1 
ATOM   869  C  CA  . ASP A 1 117 ? -0.994  13.270  17.494 1.00 22.07 ? 224 ASP A CA  1 
ATOM   870  C  C   . ASP A 1 117 ? -1.301  11.784  17.638 1.00 20.47 ? 224 ASP A C   1 
ATOM   871  O  O   . ASP A 1 117 ? -2.341  11.353  18.124 1.00 24.54 ? 224 ASP A O   1 
ATOM   872  C  CB  . ASP A 1 117 ? -2.248  14.151  17.416 1.00 23.72 ? 224 ASP A CB  1 
ATOM   873  C  CG  . ASP A 1 117 ? -1.954  15.649  17.747 1.00 31.66 ? 224 ASP A CG  1 
ATOM   874  O  OD1 . ASP A 1 117 ? -0.797  16.032  18.092 1.00 38.18 ? 224 ASP A OD1 1 
ATOM   875  O  OD2 . ASP A 1 117 ? -2.847  16.532  17.692 1.00 39.61 ? 224 ASP A OD2 1 
ATOM   876  N  N   . SER A 1 118 ? -0.379  10.969  17.169 1.00 19.65 ? 225 SER A N   1 
ATOM   877  C  CA  . SER A 1 118 ? -0.550  9.538   17.100 1.00 17.12 ? 225 SER A CA  1 
ATOM   878  C  C   . SER A 1 118 ? 0.282   8.950   18.217 1.00 16.69 ? 225 SER A C   1 
ATOM   879  O  O   . SER A 1 118 ? 1.102   9.619   18.816 1.00 18.26 ? 225 SER A O   1 
ATOM   880  C  CB  . SER A 1 118 ? -0.059  9.057   15.736 1.00 18.00 ? 225 SER A CB  1 
ATOM   881  O  OG  . SER A 1 118 ? 1.357   9.111   15.553 1.00 17.61 ? 225 SER A OG  1 
ATOM   882  N  N   . SER A 1 119 ? 0.074   7.685   18.525 1.00 16.02 ? 226 SER A N   1 
ATOM   883  C  CA  . SER A 1 119 ? 0.934   6.971   19.466 1.00 15.10 ? 226 SER A CA  1 
ATOM   884  C  C   . SER A 1 119 ? 2.400   6.894   18.990 1.00 12.02 ? 226 SER A C   1 
ATOM   885  O  O   . SER A 1 119 ? 3.320   6.998   19.761 1.00 14.44 ? 226 SER A O   1 
ATOM   886  C  CB  . SER A 1 119 ? 0.392   5.545   19.647 1.00 16.25 ? 226 SER A CB  1 
ATOM   887  O  OG  . SER A 1 119 ? 1.140   4.824   20.604 1.00 17.19 ? 226 SER A OG  1 
ATOM   888  N  N   . ALA A 1 120 ? 2.631   6.805   17.697 1.00 13.44 ? 227 ALA A N   1 
ATOM   889  C  CA  . ALA A 1 120 ? 3.984   6.877   17.151 1.00 15.09 ? 227 ALA A CA  1 
ATOM   890  C  C   . ALA A 1 120 ? 4.633   8.236   17.398 1.00 12.73 ? 227 ALA A C   1 
ATOM   891  O  O   . ALA A 1 120 ? 5.791   8.278   17.785 1.00 13.54 ? 227 ALA A O   1 
ATOM   892  C  CB  . ALA A 1 120 ? 4.003   6.576   15.706 1.00 16.12 ? 227 ALA A CB  1 
ATOM   893  N  N   . ALA A 1 121 ? 3.894   9.322   17.232 1.00 14.99 ? 228 ALA A N   1 
ATOM   894  C  CA  . ALA A 1 121 ? 4.323   10.633  17.712 1.00 14.21 ? 228 ALA A CA  1 
ATOM   895  C  C   . ALA A 1 121 ? 4.614   10.708  19.212 1.00 13.93 ? 228 ALA A C   1 
ATOM   896  O  O   . ALA A 1 121 ? 5.695   11.157  19.604 1.00 16.66 ? 228 ALA A O   1 
ATOM   897  C  CB  . ALA A 1 121 ? 3.366   11.692  17.301 1.00 14.83 ? 228 ALA A CB  1 
ATOM   898  N  N   . ARG A 1 122 ? 3.695   10.234  20.041 1.00 15.88 ? 229 ARG A N   1 
ATOM   899  C  CA  . ARG A 1 122 ? 3.836   10.337  21.496 1.00 18.05 ? 229 ARG A CA  1 
ATOM   900  C  C   . ARG A 1 122 ? 5.058   9.561   21.950 1.00 16.38 ? 229 ARG A C   1 
ATOM   901  O  O   . ARG A 1 122 ? 5.743   9.968   22.868 1.00 17.26 ? 229 ARG A O   1 
ATOM   902  C  CB  . ARG A 1 122 ? 2.636   9.786   22.245 1.00 16.04 ? 229 ARG A CB  1 
ATOM   903  C  CG  . ARG A 1 122 ? 1.359   10.588  22.098 1.00 30.30 ? 229 ARG A CG  1 
ATOM   904  C  CD  . ARG A 1 122 ? 0.236   10.155  23.035 1.00 33.38 ? 229 ARG A CD  1 
ATOM   905  N  NE  . ARG A 1 122 ? -0.471  8.973   22.546 1.00 39.86 ? 229 ARG A NE  1 
ATOM   906  C  CZ  . ARG A 1 122 ? -1.432  8.942   21.605 1.00 41.44 ? 229 ARG A CZ  1 
ATOM   907  N  NH1 . ARG A 1 122 ? -1.875  10.033  20.978 1.00 39.84 ? 229 ARG A NH1 1 
ATOM   908  N  NH2 . ARG A 1 122 ? -1.984  7.774   21.302 1.00 39.91 ? 229 ARG A NH2 1 
ATOM   909  N  N   . ASN A 1 123 ? 5.358   8.482   21.242 1.00 15.85 ? 230 ASN A N   1 
ATOM   910  C  CA  . ASN A 1 123 ? 6.426   7.595   21.627 1.00 17.09 ? 230 ASN A CA  1 
ATOM   911  C  C   . ASN A 1 123 ? 7.741   7.789   20.859 1.00 16.99 ? 230 ASN A C   1 
ATOM   912  O  O   . ASN A 1 123 ? 8.676   7.021   21.042 1.00 18.69 ? 230 ASN A O   1 
ATOM   913  C  CB  . ASN A 1 123 ? 5.967   6.145   21.615 1.00 17.41 ? 230 ASN A CB  1 
ATOM   914  C  CG  . ASN A 1 123 ? 5.021   5.850   22.755 1.00 20.13 ? 230 ASN A CG  1 
ATOM   915  O  OD1 . ASN A 1 123 ? 5.430   5.805   23.914 1.00 20.34 ? 230 ASN A OD1 1 
ATOM   916  N  ND2 . ASN A 1 123 ? 3.743   5.753   22.451 1.00 14.89 ? 230 ASN A ND2 1 
ATOM   917  N  N   . GLY A 1 124 ? 7.845   8.876   20.113 1.00 15.53 ? 231 GLY A N   1 
ATOM   918  C  CA  . GLY A 1 124 ? 9.100   9.267   19.501 1.00 16.00 ? 231 GLY A CA  1 
ATOM   919  C  C   . GLY A 1 124 ? 9.637   8.304   18.461 1.00 14.65 ? 231 GLY A C   1 
ATOM   920  O  O   . GLY A 1 124 ? 10.835  8.100   18.326 1.00 16.96 ? 231 GLY A O   1 
ATOM   921  N  N   . LEU A 1 125 ? 8.749   7.694   17.692 1.00 17.51 ? 232 LEU A N   1 
ATOM   922  C  CA  . LEU A 1 125 ? 9.187   6.921   16.550 1.00 14.36 ? 232 LEU A CA  1 
ATOM   923  C  C   . LEU A 1 125 ? 9.869   7.836   15.521 1.00 13.56 ? 232 LEU A C   1 
ATOM   924  O  O   . LEU A 1 125 ? 9.548   9.013   15.373 1.00 16.89 ? 232 LEU A O   1 
ATOM   925  C  CB  . LEU A 1 125 ? 8.005   6.227   15.882 1.00 14.57 ? 232 LEU A CB  1 
ATOM   926  C  CG  . LEU A 1 125 ? 8.406   5.168   14.843 1.00 17.59 ? 232 LEU A CG  1 
ATOM   927  C  CD1 . LEU A 1 125 ? 8.976   3.977   15.583 1.00 21.46 ? 232 LEU A CD1 1 
ATOM   928  C  CD2 . LEU A 1 125 ? 7.195   4.700   14.080 1.00 15.50 ? 232 LEU A CD2 1 
ATOM   929  N  N   . LEU A 1 126 ? 10.842  7.277   14.827 1.00 16.56 ? 233 LEU A N   1 
ATOM   930  C  CA  . LEU A 1 126 ? 11.750  8.046   14.012 1.00 15.88 ? 233 LEU A CA  1 
ATOM   931  C  C   . LEU A 1 126 ? 11.652  7.587   12.586 1.00 14.57 ? 233 LEU A C   1 
ATOM   932  O  O   . LEU A 1 126 ? 11.505  6.420   12.339 1.00 18.21 ? 233 LEU A O   1 
ATOM   933  C  CB  . LEU A 1 126 ? 13.193  7.905   14.524 1.00 15.03 ? 233 LEU A CB  1 
ATOM   934  C  CG  . LEU A 1 126 ? 13.503  8.369   15.947 1.00 13.53 ? 233 LEU A CG  1 
ATOM   935  C  CD1 . LEU A 1 126 ? 14.931  8.133   16.363 1.00 15.69 ? 233 LEU A CD1 1 
ATOM   936  C  CD2 . LEU A 1 126 ? 13.207  9.778   16.049 1.00 12.58 ? 233 LEU A CD2 1 
ATOM   937  N  N   . THR A 1 127 ? 11.744  8.512   11.649 1.00 15.85 ? 234 THR A N   1 
ATOM   938  C  CA  . THR A 1 127 ? 11.856  8.151   10.259 1.00 14.98 ? 234 THR A CA  1 
ATOM   939  C  C   . THR A 1 127 ? 13.288  7.729   9.861  1.00 17.07 ? 234 THR A C   1 
ATOM   940  O  O   . THR A 1 127 ? 14.243  7.788   10.670 1.00 17.95 ? 234 THR A O   1 
ATOM   941  C  CB  . THR A 1 127 ? 11.323  9.266   9.384  1.00 14.90 ? 234 THR A CB  1 
ATOM   942  O  OG1 . THR A 1 127 ? 11.944  10.506  9.675  1.00 17.48 ? 234 THR A OG1 1 
ATOM   943  C  CG2 . THR A 1 127 ? 9.900   9.506   9.651  1.00 15.81 ? 234 THR A CG2 1 
ATOM   944  N  N   . GLU A 1 128 ? 13.422  7.264   8.619  1.00 18.02 ? 235 GLU A N   1 
ATOM   945  C  CA  . GLU A 1 128 ? 14.674  6.711   8.122  1.00 20.47 ? 235 GLU A CA  1 
ATOM   946  C  C   . GLU A 1 128 ? 15.279  5.628   9.009  1.00 19.81 ? 235 GLU A C   1 
ATOM   947  O  O   . GLU A 1 128 ? 16.500  5.513   9.194  1.00 26.05 ? 235 GLU A O   1 
ATOM   948  C  CB  . GLU A 1 128 ? 15.699  7.829   7.902  1.00 20.81 ? 235 GLU A CB  1 
ATOM   949  C  CG  . GLU A 1 128 ? 15.381  8.641   6.656  1.00 27.03 ? 235 GLU A CG  1 
ATOM   950  C  CD  . GLU A 1 128 ? 14.088  9.439   6.760  1.00 32.56 ? 235 GLU A CD  1 
ATOM   951  O  OE1 . GLU A 1 128 ? 13.065  9.037   6.147  1.00 36.18 ? 235 GLU A OE1 1 
ATOM   952  O  OE2 . GLU A 1 128 ? 14.092  10.494  7.430  1.00 40.75 ? 235 GLU A OE2 1 
ATOM   953  N  N   . HIS A 1 129 ? 14.399  4.823   9.546  1.00 16.06 ? 236 HIS A N   1 
ATOM   954  C  CA  . HIS A 1 129 ? 14.751  3.654   10.284 1.00 17.88 ? 236 HIS A CA  1 
ATOM   955  C  C   . HIS A 1 129 ? 14.076  2.392   9.779  1.00 17.85 ? 236 HIS A C   1 
ATOM   956  O  O   . HIS A 1 129 ? 12.901  2.420   9.400  1.00 20.42 ? 236 HIS A O   1 
ATOM   957  C  CB  . HIS A 1 129 ? 14.361  3.882   11.739 1.00 19.65 ? 236 HIS A CB  1 
ATOM   958  C  CG  . HIS A 1 129 ? 15.272  4.823   12.456 1.00 22.56 ? 236 HIS A CG  1 
ATOM   959  N  ND1 . HIS A 1 129 ? 15.464  6.130   12.052 1.00 24.70 ? 236 HIS A ND1 1 
ATOM   960  C  CD2 . HIS A 1 129 ? 16.063  4.634   13.540 1.00 25.72 ? 236 HIS A CD2 1 
ATOM   961  C  CE1 . HIS A 1 129 ? 16.354  6.698   12.852 1.00 28.87 ? 236 HIS A CE1 1 
ATOM   962  N  NE2 . HIS A 1 129 ? 16.722  5.815   13.765 1.00 29.44 ? 236 HIS A NE2 1 
ATOM   963  N  N   . ASN A 1 130 ? 14.826  1.282   9.772  1.00 16.72 ? 237 ASN A N   1 
ATOM   964  C  CA  . ASN A 1 130 ? 14.281  0.000   9.378  1.00 18.79 ? 237 ASN A CA  1 
ATOM   965  C  C   . ASN A 1 130 ? 13.527  -0.692  10.482 1.00 17.87 ? 237 ASN A C   1 
ATOM   966  O  O   . ASN A 1 130 ? 13.921  -0.653  11.630 1.00 15.95 ? 237 ASN A O   1 
ATOM   967  C  CB  . ASN A 1 130 ? 15.380  -0.950  8.915  1.00 22.29 ? 237 ASN A CB  1 
ATOM   968  C  CG  . ASN A 1 130 ? 16.014  -0.467  7.661  1.00 24.53 ? 237 ASN A CG  1 
ATOM   969  O  OD1 . ASN A 1 130 ? 15.300  -0.122  6.715  1.00 35.62 ? 237 ASN A OD1 1 
ATOM   970  N  ND2 . ASN A 1 130 ? 17.327  -0.369  7.657  1.00 31.00 ? 237 ASN A ND2 1 
ATOM   971  N  N   . ILE A 1 131 ? 12.395  -1.255  10.100 1.00 17.22 ? 238 ILE A N   1 
ATOM   972  C  CA  . ILE A 1 131 ? 11.621  -2.088  10.966 1.00 20.04 ? 238 ILE A CA  1 
ATOM   973  C  C   . ILE A 1 131 ? 12.268  -3.467  10.950 1.00 21.40 ? 238 ILE A C   1 
ATOM   974  O  O   . ILE A 1 131 ? 12.448  -4.026  9.899  1.00 22.53 ? 238 ILE A O   1 
ATOM   975  C  CB  . ILE A 1 131 ? 10.188  -2.159  10.508 1.00 19.30 ? 238 ILE A CB  1 
ATOM   976  C  CG1 . ILE A 1 131 ? 9.584   -0.761  10.348 1.00 21.34 ? 238 ILE A CG1 1 
ATOM   977  C  CG2 . ILE A 1 131 ? 9.389   -2.945  11.531 1.00 23.77 ? 238 ILE A CG2 1 
ATOM   978  C  CD1 . ILE A 1 131 ? 8.267   -0.715  9.652  1.00 28.31 ? 238 ILE A CD1 1 
ATOM   979  N  N   . CYS A 1 132 ? 12.601  -3.990  12.123 1.00 20.15 ? 239 CYS A N   1 
ATOM   980  C  CA  . CYS A 1 132 ? 13.238  -5.292  12.266 1.00 19.39 ? 239 CYS A CA  1 
ATOM   981  C  C   . CYS A 1 132 ? 12.310  -6.365  12.810 1.00 19.47 ? 239 CYS A C   1 
ATOM   982  O  O   . CYS A 1 132 ? 12.315  -7.482  12.316 1.00 17.44 ? 239 CYS A O   1 
ATOM   983  C  CB  . CYS A 1 132 ? 14.413  -5.191  13.237 1.00 20.05 ? 239 CYS A CB  1 
ATOM   984  S  SG  . CYS A 1 132 ? 15.633  -3.979  12.730 1.00 23.99 ? 239 CYS A SG  1 
ATOM   985  N  N   . GLU A 1 133 ? 11.540  -6.036  13.842 1.00 20.20 ? 240 GLU A N   1 
ATOM   986  C  CA  . GLU A 1 133 ? 10.585  -6.953  14.441 1.00 20.22 ? 240 GLU A CA  1 
ATOM   987  C  C   . GLU A 1 133 ? 9.326   -6.194  14.823 1.00 20.20 ? 240 GLU A C   1 
ATOM   988  O  O   . GLU A 1 133 ? 9.406   -5.046  15.232 1.00 20.60 ? 240 GLU A O   1 
ATOM   989  C  CB  . GLU A 1 133 ? 11.064  -7.553  15.753 1.00 20.45 ? 240 GLU A CB  1 
ATOM   990  C  CG  . GLU A 1 133 ? 12.145  -8.614  15.664 1.00 24.56 ? 240 GLU A CG  1 
ATOM   991  C  CD  . GLU A 1 133 ? 13.517  -8.003  15.653 1.00 24.93 ? 240 GLU A CD  1 
ATOM   992  O  OE1 . GLU A 1 133 ? 13.812  -7.090  16.455 1.00 30.02 ? 240 GLU A OE1 1 
ATOM   993  O  OE2 . GLU A 1 133 ? 14.338  -8.462  14.844 1.00 30.23 ? 240 GLU A OE2 1 
ATOM   994  N  N   . ILE A 1 134 ? 8.193   -6.889  14.757 1.00 16.89 ? 241 ILE A N   1 
ATOM   995  C  CA  . ILE A 1 134 ? 6.949   -6.345  15.237 1.00 19.01 ? 241 ILE A CA  1 
ATOM   996  C  C   . ILE A 1 134 ? 6.340   -7.366  16.166 1.00 19.64 ? 241 ILE A C   1 
ATOM   997  O  O   . ILE A 1 134 ? 6.145   -8.515  15.804 1.00 20.10 ? 241 ILE A O   1 
ATOM   998  C  CB  . ILE A 1 134 ? 5.997   -6.010  14.121 1.00 19.02 ? 241 ILE A CB  1 
ATOM   999  C  CG1 . ILE A 1 134 ? 6.600   -4.993  13.179 1.00 21.27 ? 241 ILE A CG1 1 
ATOM   1000 C  CG2 . ILE A 1 134 ? 4.694   -5.464  14.730 1.00 20.70 ? 241 ILE A CG2 1 
ATOM   1001 C  CD1 . ILE A 1 134 ? 5.719   -4.611  12.016 1.00 26.16 ? 241 ILE A CD1 1 
ATOM   1002 N  N   . ASN A 1 135 ? 6.134   -6.963  17.405 1.00 20.78 ? 242 ASN A N   1 
ATOM   1003 C  CA  . ASN A 1 135 ? 5.633   -7.890  18.398 1.00 22.29 ? 242 ASN A CA  1 
ATOM   1004 C  C   . ASN A 1 135 ? 6.402   -9.212  18.380 1.00 22.82 ? 242 ASN A C   1 
ATOM   1005 O  O   . ASN A 1 135 ? 5.826   -10.297 18.297 1.00 23.45 ? 242 ASN A O   1 
ATOM   1006 C  CB  . ASN A 1 135 ? 4.126   -8.118  18.210 1.00 19.79 ? 242 ASN A CB  1 
ATOM   1007 C  CG  . ASN A 1 135 ? 3.299   -6.867  18.536 1.00 22.80 ? 242 ASN A CG  1 
ATOM   1008 O  OD1 . ASN A 1 135 ? 3.677   -6.057  19.404 1.00 20.60 ? 242 ASN A OD1 1 
ATOM   1009 N  ND2 . ASN A 1 135 ? 2.175   -6.700  17.832 1.00 21.40 ? 242 ASN A ND2 1 
ATOM   1010 N  N   . GLY A 1 136 ? 7.721   -9.122  18.462 1.00 25.64 ? 243 GLY A N   1 
ATOM   1011 C  CA  . GLY A 1 136 ? 8.555   -10.316 18.469 1.00 25.44 ? 243 GLY A CA  1 
ATOM   1012 C  C   . GLY A 1 136 ? 8.698   -11.074 17.153 1.00 25.34 ? 243 GLY A C   1 
ATOM   1013 O  O   . GLY A 1 136 ? 9.488   -11.996 17.064 1.00 27.17 ? 243 GLY A O   1 
ATOM   1014 N  N   . GLN A 1 137 ? 7.940   -10.713 16.131 1.00 24.20 ? 244 GLN A N   1 
ATOM   1015 C  CA  . GLN A 1 137 ? 8.061   -11.327 14.808 1.00 23.85 ? 244 GLN A CA  1 
ATOM   1016 C  C   . GLN A 1 137 ? 9.063   -10.625 13.893 1.00 20.94 ? 244 GLN A C   1 
ATOM   1017 O  O   . GLN A 1 137 ? 8.939   -9.437  13.579 1.00 18.79 ? 244 GLN A O   1 
ATOM   1018 C  CB  . GLN A 1 137 ? 6.689   -11.248 14.152 1.00 24.38 ? 244 GLN A CB  1 
ATOM   1019 C  CG  . GLN A 1 137 ? 6.477   -12.273 13.090 1.00 30.72 ? 244 GLN A CG  1 
ATOM   1020 C  CD  . GLN A 1 137 ? 5.023   -12.380 12.668 1.00 35.50 ? 244 GLN A CD  1 
ATOM   1021 O  OE1 . GLN A 1 137 ? 4.129   -11.783 13.284 1.00 34.03 ? 244 GLN A OE1 1 
ATOM   1022 N  NE2 . GLN A 1 137 ? 4.786   -13.157 11.612 1.00 44.91 ? 244 GLN A NE2 1 
ATOM   1023 N  N   . ASN A 1 138 ? 10.046  -11.372 13.422 1.00 19.75 ? 245 ASN A N   1 
ATOM   1024 C  CA  . ASN A 1 138 ? 10.976  -10.842 12.421 1.00 19.88 ? 245 ASN A CA  1 
ATOM   1025 C  C   . ASN A 1 138 ? 10.284  -10.403 11.139 1.00 19.77 ? 245 ASN A C   1 
ATOM   1026 O  O   . ASN A 1 138 ? 9.549   -11.175 10.543 1.00 18.70 ? 245 ASN A O   1 
ATOM   1027 C  CB  . ASN A 1 138 ? 12.004  -11.920 12.141 1.00 20.88 ? 245 ASN A CB  1 
ATOM   1028 C  CG  . ASN A 1 138 ? 12.912  -11.614 10.979 1.00 19.91 ? 245 ASN A CG  1 
ATOM   1029 O  OD1 . ASN A 1 138 ? 13.140  -10.462 10.611 1.00 19.98 ? 245 ASN A OD1 1 
ATOM   1030 N  ND2 . ASN A 1 138 ? 13.493  -12.668 10.434 1.00 24.45 ? 245 ASN A ND2 1 
ATOM   1031 N  N   . VAL A 1 139 ? 10.510  -9.181  10.686 1.00 18.43 ? 246 VAL A N   1 
ATOM   1032 C  CA  . VAL A 1 139 ? 9.969   -8.739  9.404  1.00 19.57 ? 246 VAL A CA  1 
ATOM   1033 C  C   . VAL A 1 139 ? 10.984  -8.351  8.369  1.00 18.47 ? 246 VAL A C   1 
ATOM   1034 O  O   . VAL A 1 139 ? 10.658  -7.788  7.339  1.00 20.60 ? 246 VAL A O   1 
ATOM   1035 C  CB  . VAL A 1 139 ? 9.001   -7.576  9.547  1.00 20.84 ? 246 VAL A CB  1 
ATOM   1036 C  CG1 . VAL A 1 139 ? 7.844   -8.006  10.466 1.00 22.68 ? 246 VAL A CG1 1 
ATOM   1037 C  CG2 . VAL A 1 139 ? 9.702   -6.325  9.989  1.00 25.11 ? 246 VAL A CG2 1 
ATOM   1038 N  N   . ILE A 1 140 ? 12.243  -8.639  8.650  1.00 19.39 ? 247 ILE A N   1 
ATOM   1039 C  CA  . ILE A 1 140 ? 13.252  -8.448  7.641  1.00 17.59 ? 247 ILE A CA  1 
ATOM   1040 C  C   . ILE A 1 140 ? 12.993  -9.394  6.494  1.00 16.07 ? 247 ILE A C   1 
ATOM   1041 O  O   . ILE A 1 140 ? 12.825  -10.579 6.701  1.00 18.39 ? 247 ILE A O   1 
ATOM   1042 C  CB  . ILE A 1 140 ? 14.650  -8.678  8.246  1.00 17.29 ? 247 ILE A CB  1 
ATOM   1043 C  CG1 . ILE A 1 140 ? 14.919  -7.655  9.353  1.00 17.99 ? 247 ILE A CG1 1 
ATOM   1044 C  CG2 . ILE A 1 140 ? 15.724  -8.558  7.191  1.00 19.63 ? 247 ILE A CG2 1 
ATOM   1045 C  CD1 . ILE A 1 140 ? 14.981  -6.238  8.839  1.00 24.15 ? 247 ILE A CD1 1 
ATOM   1046 N  N   . GLY A 1 141 ? 13.045  -8.873  5.278  1.00 16.76 ? 248 GLY A N   1 
ATOM   1047 C  CA  . GLY A 1 141 ? 12.872  -9.658  4.091  1.00 18.37 ? 248 GLY A CA  1 
ATOM   1048 C  C   . GLY A 1 141 ? 11.406  -9.778  3.690  1.00 19.82 ? 248 GLY A C   1 
ATOM   1049 O  O   . GLY A 1 141 ? 11.162  -10.251 2.596  1.00 21.15 ? 248 GLY A O   1 
ATOM   1050 N  N   . LEU A 1 142 ? 10.462  -9.313  4.509  1.00 19.13 ? 249 LEU A N   1 
ATOM   1051 C  CA  . LEU A 1 142 ? 9.035   -9.353  4.156  1.00 18.74 ? 249 LEU A CA  1 
ATOM   1052 C  C   . LEU A 1 142 ? 8.663   -8.179  3.266  1.00 18.73 ? 249 LEU A C   1 
ATOM   1053 O  O   . LEU A 1 142 ? 9.313   -7.144  3.276  1.00 16.51 ? 249 LEU A O   1 
ATOM   1054 C  CB  . LEU A 1 142 ? 8.140   -9.321  5.397  1.00 16.72 ? 249 LEU A CB  1 
ATOM   1055 C  CG  . LEU A 1 142 ? 8.228   -10.540 6.311  1.00 19.31 ? 249 LEU A CG  1 
ATOM   1056 C  CD1 . LEU A 1 142 ? 7.111   -10.592 7.301  1.00 21.47 ? 249 LEU A CD1 1 
ATOM   1057 C  CD2 . LEU A 1 142 ? 8.247   -11.820 5.498  1.00 24.62 ? 249 LEU A CD2 1 
ATOM   1058 N  N   . LYS A 1 143 ? 7.614   -8.384  2.480  1.00 20.44 ? 250 LYS A N   1 
ATOM   1059 C  CA  . LYS A 1 143 ? 7.036   -7.348  1.620  1.00 20.73 ? 250 LYS A CA  1 
ATOM   1060 C  C   . LYS A 1 143 ? 6.268   -6.327  2.470  1.00 19.15 ? 250 LYS A C   1 
ATOM   1061 O  O   . LYS A 1 143 ? 5.703   -6.683  3.511  1.00 16.22 ? 250 LYS A O   1 
ATOM   1062 C  CB  . LYS A 1 143 ? 6.024   -7.959  0.646  1.00 20.60 ? 250 LYS A CB  1 
ATOM   1063 C  CG  . LYS A 1 143 ? 6.495   -9.104  -0.238 1.00 27.53 ? 250 LYS A CG  1 
ATOM   1064 C  CD  . LYS A 1 143 ? 5.273   -9.953  -0.639 1.00 34.45 ? 250 LYS A CD  1 
ATOM   1065 C  CE  . LYS A 1 143 ? 5.393   -10.674 -1.977 1.00 35.43 ? 250 LYS A CE  1 
ATOM   1066 N  NZ  . LYS A 1 143 ? 4.038   -11.071 -2.514 1.00 38.43 ? 250 LYS A NZ  1 
ATOM   1067 N  N   . ASP A 1 144 ? 6.194   -5.089  1.983  1.00 16.37 ? 251 ASP A N   1 
ATOM   1068 C  CA  . ASP A 1 144 ? 5.451   -4.054  2.683  1.00 18.27 ? 251 ASP A CA  1 
ATOM   1069 C  C   . ASP A 1 144 ? 4.019   -4.524  3.003  1.00 18.49 ? 251 ASP A C   1 
ATOM   1070 O  O   . ASP A 1 144 ? 3.502   -4.254  4.079  1.00 19.88 ? 251 ASP A O   1 
ATOM   1071 C  CB  . ASP A 1 144 ? 5.436   -2.737  1.897  1.00 17.29 ? 251 ASP A CB  1 
ATOM   1072 C  CG  . ASP A 1 144 ? 6.746   -1.994  1.979  1.00 20.26 ? 251 ASP A CG  1 
ATOM   1073 O  OD1 . ASP A 1 144 ? 7.650   -2.417  2.744  1.00 20.43 ? 251 ASP A OD1 1 
ATOM   1074 O  OD2 . ASP A 1 144 ? 7.004   -1.009  1.251  1.00 23.40 ? 251 ASP A OD2 1 
ATOM   1075 N  N   . SER A 1 145 ? 3.389   -5.248  2.088  1.00 19.17 ? 252 SER A N   1 
ATOM   1076 C  CA  . SER A 1 145 ? 2.013   -5.642  2.316  1.00 19.01 ? 252 SER A CA  1 
ATOM   1077 C  C   . SER A 1 145 ? 1.937   -6.653  3.448  1.00 18.87 ? 252 SER A C   1 
ATOM   1078 O  O   . SER A 1 145 ? 0.937   -6.670  4.193  1.00 18.86 ? 252 SER A O   1 
ATOM   1079 C  CB  . SER A 1 145 ? 1.397   -6.196  1.035  1.00 21.20 ? 252 SER A CB  1 
ATOM   1080 O  OG  . SER A 1 145 ? 2.090   -7.348  0.598  1.00 18.65 ? 252 SER A OG  1 
ATOM   1081 N  N   . GLN A 1 146 ? 2.988   -7.456  3.602  1.00 17.49 ? 253 GLN A N   1 
ATOM   1082 C  CA  . GLN A 1 146 ? 3.079   -8.428  4.725  1.00 17.93 ? 253 GLN A CA  1 
ATOM   1083 C  C   . GLN A 1 146 ? 3.285   -7.756  6.091  1.00 18.34 ? 253 GLN A C   1 
ATOM   1084 O  O   . GLN A 1 146 ? 2.642   -8.110  7.112  1.00 15.92 ? 253 GLN A O   1 
ATOM   1085 C  CB  . GLN A 1 146 ? 4.176   -9.465  4.450  1.00 16.72 ? 253 GLN A CB  1 
ATOM   1086 C  CG  . GLN A 1 146 ? 3.848   -10.382 3.292  1.00 19.08 ? 253 GLN A CG  1 
ATOM   1087 C  CD  . GLN A 1 146 ? 4.974   -11.312 2.865  1.00 17.24 ? 253 GLN A CD  1 
ATOM   1088 O  OE1 . GLN A 1 146 ? 6.078   -10.868 2.582  1.00 18.88 ? 253 GLN A OE1 1 
ATOM   1089 N  NE2 . GLN A 1 146 ? 4.684   -12.606 2.795  1.00 25.33 ? 253 GLN A NE2 1 
ATOM   1090 N  N   . ILE A 1 147 ? 4.150   -6.744  6.097  1.00 16.42 ? 254 ILE A N   1 
ATOM   1091 C  CA  . ILE A 1 147 ? 4.307   -5.934  7.284  1.00 18.51 ? 254 ILE A CA  1 
ATOM   1092 C  C   . ILE A 1 147 ? 3.001   -5.247  7.659  1.00 18.63 ? 254 ILE A C   1 
ATOM   1093 O  O   . ILE A 1 147 ? 2.651   -5.257  8.828  1.00 19.95 ? 254 ILE A O   1 
ATOM   1094 C  CB  . ILE A 1 147 ? 5.465   -4.944  7.110  1.00 18.42 ? 254 ILE A CB  1 
ATOM   1095 C  CG1 . ILE A 1 147 ? 6.756   -5.725  6.855  1.00 20.25 ? 254 ILE A CG1 1 
ATOM   1096 C  CG2 . ILE A 1 147 ? 5.632   -4.066  8.317  1.00 22.99 ? 254 ILE A CG2 1 
ATOM   1097 C  CD1 . ILE A 1 147 ? 7.933   -4.856  6.499  1.00 22.84 ? 254 ILE A CD1 1 
ATOM   1098 N  N   . ALA A 1 148 ? 2.322   -4.650  6.684  1.00 17.61 ? 255 ALA A N   1 
ATOM   1099 C  CA  . ALA A 1 148 ? 1.052   -3.970  6.905  1.00 19.83 ? 255 ALA A CA  1 
ATOM   1100 C  C   . ALA A 1 148 ? 0.037   -4.945  7.460  1.00 20.28 ? 255 ALA A C   1 
ATOM   1101 O  O   . ALA A 1 148 ? -0.691  -4.590  8.376  1.00 21.20 ? 255 ALA A O   1 
ATOM   1102 C  CB  . ALA A 1 148 ? 0.524   -3.332  5.616  1.00 20.18 ? 255 ALA A CB  1 
ATOM   1103 N  N   . ASP A 1 149 ? 0.032   -6.176  6.959  1.00 19.52 ? 256 ASP A N   1 
ATOM   1104 C  CA  . ASP A 1 149 ? -0.898  -7.175  7.462  1.00 20.28 ? 256 ASP A CA  1 
ATOM   1105 C  C   . ASP A 1 149 ? -0.593  -7.538  8.915  1.00 18.62 ? 256 ASP A C   1 
ATOM   1106 O  O   . ASP A 1 149 ? -1.497  -7.641  9.721  1.00 17.75 ? 256 ASP A O   1 
ATOM   1107 C  CB  . ASP A 1 149 ? -0.897  -8.468  6.616  1.00 22.30 ? 256 ASP A CB  1 
ATOM   1108 C  CG  . ASP A 1 149 ? -1.487  -8.298  5.207  1.00 23.75 ? 256 ASP A CG  1 
ATOM   1109 O  OD1 . ASP A 1 149 ? -2.111  -7.266  4.875  1.00 30.29 ? 256 ASP A OD1 1 
ATOM   1110 O  OD2 . ASP A 1 149 ? -1.332  -9.172  4.321  1.00 34.05 ? 256 ASP A OD2 1 
ATOM   1111 N  N   . ILE A 1 150 ? 0.669   -7.723  9.281  1.00 20.21 ? 257 ILE A N   1 
ATOM   1112 C  CA  . ILE A 1 150 ? 1.033   -7.946  10.686 1.00 19.31 ? 257 ILE A CA  1 
ATOM   1113 C  C   . ILE A 1 150 ? 0.605   -6.803  11.580 1.00 20.17 ? 257 ILE A C   1 
ATOM   1114 O  O   . ILE A 1 150 ? 0.143   -7.031  12.705 1.00 21.90 ? 257 ILE A O   1 
ATOM   1115 C  CB  . ILE A 1 150 ? 2.559   -8.156  10.831 1.00 19.76 ? 257 ILE A CB  1 
ATOM   1116 C  CG1 . ILE A 1 150 ? 2.942   -9.536  10.315 1.00 17.77 ? 257 ILE A CG1 1 
ATOM   1117 C  CG2 . ILE A 1 150 ? 3.002   -8.069  12.250 1.00 18.38 ? 257 ILE A CG2 1 
ATOM   1118 C  CD1 . ILE A 1 150 ? 4.392   -9.654  10.028 1.00 21.47 ? 257 ILE A CD1 1 
ATOM   1119 N  N   . LEU A 1 151 ? 0.774   -5.577  11.102 1.00 20.03 ? 258 LEU A N   1 
ATOM   1120 C  CA  . LEU A 1 151 ? 0.298   -4.410  11.874 1.00 20.45 ? 258 LEU A CA  1 
ATOM   1121 C  C   . LEU A 1 151 ? -1.234  -4.402  11.986 1.00 21.81 ? 258 LEU A C   1 
ATOM   1122 O  O   . LEU A 1 151 ? -1.776  -4.181  13.081 1.00 22.42 ? 258 LEU A O   1 
ATOM   1123 C  CB  . LEU A 1 151 ? 0.791   -3.127  11.229 1.00 16.64 ? 258 LEU A CB  1 
ATOM   1124 C  CG  . LEU A 1 151 ? 2.251   -2.811  11.421 1.00 18.98 ? 258 LEU A CG  1 
ATOM   1125 C  CD1 . LEU A 1 151 ? 2.718   -1.724  10.470 1.00 25.37 ? 258 LEU A CD1 1 
ATOM   1126 C  CD2 . LEU A 1 151 ? 2.520   -2.436  12.875 1.00 25.27 ? 258 LEU A CD2 1 
ATOM   1127 N  N   . SER A 1 152 ? -1.921  -4.724  10.882 1.00 21.86 ? 259 SER A N   1 
ATOM   1128 C  CA  . SER A 1 152 ? -3.387  -4.690  10.835 1.00 22.51 ? 259 SER A CA  1 
ATOM   1129 C  C   . SER A 1 152 ? -3.929  -5.716  11.766 1.00 20.80 ? 259 SER A C   1 
ATOM   1130 O  O   . SER A 1 152 ? -4.842  -5.443  12.485 1.00 22.41 ? 259 SER A O   1 
ATOM   1131 C  CB  . SER A 1 152 ? -3.974  -5.044  9.469  1.00 24.52 ? 259 SER A CB  1 
ATOM   1132 O  OG  . SER A 1 152 ? -4.000  -3.927  8.620  1.00 33.72 ? 259 SER A OG  1 
ATOM   1133 N  N   . THR A 1 153 ? -3.378  -6.916  11.758 1.00 19.20 ? 260 THR A N   1 
ATOM   1134 C  CA  . THR A 1 153 ? -3.909  -7.936  12.642 1.00 19.66 ? 260 THR A CA  1 
ATOM   1135 C  C   . THR A 1 153 ? -3.508  -7.841  14.099 1.00 16.93 ? 260 THR A C   1 
ATOM   1136 O  O   . THR A 1 153 ? -4.122  -8.462  14.929 1.00 16.86 ? 260 THR A O   1 
ATOM   1137 C  CB  . THR A 1 153 ? -3.650  -9.346  12.089 1.00 17.86 ? 260 THR A CB  1 
ATOM   1138 O  OG1 . THR A 1 153 ? -2.255  -9.515  11.898 1.00 23.82 ? 260 THR A OG1 1 
ATOM   1139 C  CG2 . THR A 1 153 ? -4.231  -9.445  10.679 1.00 24.82 ? 260 THR A CG2 1 
ATOM   1140 N  N   . SER A 1 154 ? -2.478  -7.074  14.412 1.00 18.33 ? 261 SER A N   1 
ATOM   1141 C  CA  . SER A 1 154 ? -2.006  -6.941  15.780 1.00 16.17 ? 261 SER A CA  1 
ATOM   1142 C  C   . SER A 1 154 ? -3.112  -6.468  16.718 1.00 14.64 ? 261 SER A C   1 
ATOM   1143 O  O   . SER A 1 154 ? -3.960  -5.673  16.366 1.00 16.20 ? 261 SER A O   1 
ATOM   1144 C  CB  . SER A 1 154 ? -0.873  -5.925  15.824 1.00 16.07 ? 261 SER A CB  1 
ATOM   1145 O  OG  . SER A 1 154 ? -0.341  -5.863  17.121 1.00 20.19 ? 261 SER A OG  1 
ATOM   1146 N  N   . GLY A 1 155 ? -3.070  -6.957  17.937 1.00 15.55 ? 262 GLY A N   1 
ATOM   1147 C  CA  . GLY A 1 155 ? -3.654  -6.282  19.070 1.00 16.65 ? 262 GLY A CA  1 
ATOM   1148 C  C   . GLY A 1 155 ? -3.253  -4.823  19.184 1.00 14.80 ? 262 GLY A C   1 
ATOM   1149 O  O   . GLY A 1 155 ? -2.432  -4.272  18.456 1.00 14.40 ? 262 GLY A O   1 
ATOM   1150 N  N   . THR A 1 156 ? -3.848  -4.210  20.189 1.00 17.46 ? 263 THR A N   1 
ATOM   1151 C  CA  . THR A 1 156 ? -3.760  -2.775  20.390 1.00 17.06 ? 263 THR A CA  1 
ATOM   1152 C  C   . THR A 1 156 ? -2.299  -2.378  20.589 1.00 14.33 ? 263 THR A C   1 
ATOM   1153 O  O   . THR A 1 156 ? -1.856  -1.347  20.136 1.00 13.12 ? 263 THR A O   1 
ATOM   1154 C  CB  . THR A 1 156 ? -4.566  -2.487  21.639 1.00 14.69 ? 263 THR A CB  1 
ATOM   1155 O  OG1 . THR A 1 156 ? -5.954  -2.764  21.379 1.00 20.33 ? 263 THR A OG1 1 
ATOM   1156 C  CG2 . THR A 1 156 ? -4.513  -1.088  22.032 1.00 18.90 ? 263 THR A CG2 1 
ATOM   1157 N  N   . VAL A 1 157 ? -1.581  -3.184  21.355 1.00 16.48 ? 264 VAL A N   1 
ATOM   1158 C  CA  . VAL A 1 157 ? -0.202  -2.885  21.681 1.00 14.57 ? 264 VAL A CA  1 
ATOM   1159 C  C   . VAL A 1 157 ? 0.676   -3.343  20.539 1.00 16.33 ? 264 VAL A C   1 
ATOM   1160 O  O   . VAL A 1 157 ? 0.606   -4.483  20.111 1.00 15.35 ? 264 VAL A O   1 
ATOM   1161 C  CB  . VAL A 1 157 ? 0.166   -3.633  22.943 1.00 19.19 ? 264 VAL A CB  1 
ATOM   1162 C  CG1 . VAL A 1 157 ? 1.608   -3.371  23.302 1.00 20.29 ? 264 VAL A CG1 1 
ATOM   1163 C  CG2 . VAL A 1 157 ? -0.822  -3.221  24.015 1.00 17.85 ? 264 VAL A CG2 1 
ATOM   1164 N  N   . VAL A 1 158 ? 1.406   -2.399  19.964 1.00 15.38 ? 265 VAL A N   1 
ATOM   1165 C  CA  . VAL A 1 158 ? 2.346   -2.685  18.919 1.00 16.52 ? 265 VAL A CA  1 
ATOM   1166 C  C   . VAL A 1 158 ? 3.757   -2.285  19.378 1.00 15.34 ? 265 VAL A C   1 
ATOM   1167 O  O   . VAL A 1 158 ? 4.069   -1.127  19.609 1.00 18.15 ? 265 VAL A O   1 
ATOM   1168 C  CB  . VAL A 1 158 ? 1.956   -1.969  17.663 1.00 16.17 ? 265 VAL A CB  1 
ATOM   1169 C  CG1 . VAL A 1 158 ? 2.938   -2.284  16.532 1.00 17.13 ? 265 VAL A CG1 1 
ATOM   1170 C  CG2 . VAL A 1 158 ? 0.481   -2.268  17.329 1.00 17.81 ? 265 VAL A CG2 1 
ATOM   1171 N  N   . THR A 1 159 ? 4.603   -3.296  19.506 1.00 16.22 ? 266 THR A N   1 
ATOM   1172 C  CA  . THR A 1 159 ? 5.984   -3.099  19.896 1.00 19.12 ? 266 THR A CA  1 
ATOM   1173 C  C   . THR A 1 159 ? 6.871   -3.308  18.694 1.00 21.89 ? 266 THR A C   1 
ATOM   1174 O  O   . THR A 1 159 ? 6.905   -4.373  18.109 1.00 25.90 ? 266 THR A O   1 
ATOM   1175 C  CB  . THR A 1 159 ? 6.318   -4.104  20.997 1.00 18.89 ? 266 THR A CB  1 
ATOM   1176 O  OG1 . THR A 1 159 ? 5.551   -3.782  22.176 1.00 21.35 ? 266 THR A OG1 1 
ATOM   1177 C  CG2 . THR A 1 159 ? 7.770   -4.083  21.402 1.00 20.32 ? 266 THR A CG2 1 
ATOM   1178 N  N   . ILE A 1 160 ? 7.631   -2.287  18.338 1.00 23.38 ? 267 ILE A N   1 
ATOM   1179 C  CA  . ILE A 1 160 ? 8.463   -2.395  17.156 1.00 20.11 ? 267 ILE A CA  1 
ATOM   1180 C  C   . ILE A 1 160 ? 9.910   -2.149  17.562 1.00 19.43 ? 267 ILE A C   1 
ATOM   1181 O  O   . ILE A 1 160 ? 10.216  -1.271  18.350 1.00 20.26 ? 267 ILE A O   1 
ATOM   1182 C  CB  . ILE A 1 160 ? 7.980   -1.380  16.106 1.00 23.50 ? 267 ILE A CB  1 
ATOM   1183 C  CG1 . ILE A 1 160 ? 6.534   -1.743  15.703 1.00 25.81 ? 267 ILE A CG1 1 
ATOM   1184 C  CG2 . ILE A 1 160 ? 8.803   -1.524  14.875 1.00 27.15 ? 267 ILE A CG2 1 
ATOM   1185 C  CD1 . ILE A 1 160 ? 5.894   -0.770  14.672 1.00 35.31 ? 267 ILE A CD1 1 
ATOM   1186 N  N   . THR A 1 161 ? 10.792  -2.938  16.980 1.00 19.82 ? 268 THR A N   1 
ATOM   1187 C  CA  . THR A 1 161 ? 12.213  -2.707  17.041 1.00 21.49 ? 268 THR A CA  1 
ATOM   1188 C  C   . THR A 1 161 ? 12.734  -2.077  15.759 1.00 19.36 ? 268 THR A C   1 
ATOM   1189 O  O   . THR A 1 161 ? 12.401  -2.544  14.705 1.00 18.52 ? 268 THR A O   1 
ATOM   1190 C  CB  . THR A 1 161 ? 12.835  -4.079  17.325 1.00 20.91 ? 268 THR A CB  1 
ATOM   1191 O  OG1 . THR A 1 161 ? 12.430  -4.443  18.635 1.00 22.99 ? 268 THR A OG1 1 
ATOM   1192 C  CG2 . THR A 1 161 ? 14.304  -3.972  17.494 1.00 28.41 ? 268 THR A CG2 1 
ATOM   1193 N  N   . ILE A 1 162 ? 13.489  -0.984  15.864 1.00 17.52 ? 269 ILE A N   1 
ATOM   1194 C  CA  . ILE A 1 162 ? 13.970  -0.278  14.689 1.00 20.01 ? 269 ILE A CA  1 
ATOM   1195 C  C   . ILE A 1 162 ? 15.487  -0.190  14.787 1.00 18.56 ? 269 ILE A C   1 
ATOM   1196 O  O   . ILE A 1 162 ? 16.100  -0.296  15.856 1.00 18.60 ? 269 ILE A O   1 
ATOM   1197 C  CB  . ILE A 1 162 ? 13.298  1.134   14.547 1.00 20.34 ? 269 ILE A CB  1 
ATOM   1198 C  CG1 . ILE A 1 162 ? 13.688  2.044   15.718 1.00 16.82 ? 269 ILE A CG1 1 
ATOM   1199 C  CG2 . ILE A 1 162 ? 11.811  0.983   14.360 1.00 19.98 ? 269 ILE A CG2 1 
ATOM   1200 C  CD1 . ILE A 1 162 ? 13.060  3.410   15.747 1.00 24.56 ? 269 ILE A CD1 1 
HETATM 1201 N  N   . MSE A 1 163 ? 16.093  0.068   13.652 1.00 19.30 ? 270 MSE A N   1 
HETATM 1202 C  CA  . MSE A 1 163 ? 17.499  0.390   13.558 1.00 20.93 ? 270 MSE A CA  1 
HETATM 1203 C  C   . MSE A 1 163 ? 17.684  1.514   12.543 1.00 20.61 ? 270 MSE A C   1 
HETATM 1204 O  O   . MSE A 1 163 ? 16.972  1.574   11.570 1.00 20.58 ? 270 MSE A O   1 
HETATM 1205 C  CB  . MSE A 1 163 ? 18.261  -0.782  12.924 1.00 21.93 ? 270 MSE A CB  1 
HETATM 1206 C  CG  . MSE A 1 163 ? 18.728  -1.855  13.828 1.00 28.98 ? 270 MSE A CG  1 
HETATM 1207 SE SE  . MSE A 1 163 ? 19.910  -3.017  12.698 1.00 35.52 ? 270 MSE A SE  1 
HETATM 1208 C  CE  . MSE A 1 163 ? 21.254  -1.792  11.936 1.00 41.80 ? 270 MSE A CE  1 
ATOM   1209 N  N   . PRO A 1 164 ? 18.696  2.343   12.717 1.00 26.53 ? 271 PRO A N   1 
ATOM   1210 C  CA  . PRO A 1 164 ? 19.175  3.215   11.643 1.00 30.80 ? 271 PRO A CA  1 
ATOM   1211 C  C   . PRO A 1 164 ? 19.281  2.518   10.315 1.00 32.98 ? 271 PRO A C   1 
ATOM   1212 O  O   . PRO A 1 164 ? 19.645  1.356   10.257 1.00 31.74 ? 271 PRO A O   1 
ATOM   1213 C  CB  . PRO A 1 164 ? 20.576  3.595   12.119 1.00 30.66 ? 271 PRO A CB  1 
ATOM   1214 C  CG  . PRO A 1 164 ? 20.427  3.622   13.616 1.00 31.83 ? 271 PRO A CG  1 
ATOM   1215 C  CD  . PRO A 1 164 ? 19.471  2.516   13.954 1.00 28.91 ? 271 PRO A CD  1 
ATOM   1216 N  N   . ALA A 1 165 ? 18.994  3.234   9.245  1.00 39.11 ? 272 ALA A N   1 
ATOM   1217 C  CA  . ALA A 1 165 ? 18.889  2.607   7.933  1.00 44.29 ? 272 ALA A CA  1 
ATOM   1218 C  C   . ALA A 1 165 ? 20.240  2.429   7.246  1.00 49.06 ? 272 ALA A C   1 
ATOM   1219 O  O   . ALA A 1 165 ? 20.353  1.637   6.305  1.00 53.39 ? 272 ALA A O   1 
ATOM   1220 C  CB  . ALA A 1 165 ? 17.943  3.390   7.052  1.00 46.28 ? 272 ALA A CB  1 
ATOM   1221 N  N   . PHE A 1 166 ? 21.266  3.139   7.711  1.00 53.28 ? 273 PHE A N   1 
ATOM   1222 C  CA  . PHE A 1 166 ? 22.609  3.013   7.135  1.00 56.03 ? 273 PHE A CA  1 
ATOM   1223 C  C   . PHE A 1 166 ? 22.593  2.697   5.625  1.00 57.93 ? 273 PHE A C   1 
ATOM   1224 O  O   . PHE A 1 166 ? 22.334  3.562   4.776  1.00 61.42 ? 273 PHE A O   1 
ATOM   1225 C  CB  . PHE A 1 166 ? 23.334  1.869   7.836  1.00 56.63 ? 273 PHE A CB  1 
ATOM   1226 C  CG  . PHE A 1 166 ? 23.584  2.101   9.304  1.00 60.13 ? 273 PHE A CG  1 
ATOM   1227 C  CD1 . PHE A 1 166 ? 24.113  3.298   9.755  1.00 60.18 ? 273 PHE A CD1 1 
ATOM   1228 C  CD2 . PHE A 1 166 ? 23.326  1.098   10.228 1.00 64.50 ? 273 PHE A CD2 1 
ATOM   1229 C  CE1 . PHE A 1 166 ? 24.355  3.499   11.092 1.00 62.25 ? 273 PHE A CE1 1 
ATOM   1230 C  CE2 . PHE A 1 166 ? 23.582  1.291   11.576 1.00 66.56 ? 273 PHE A CE2 1 
ATOM   1231 C  CZ  . PHE A 1 166 ? 24.100  2.498   12.007 1.00 64.90 ? 273 PHE A CZ  1 
HETATM 1232 N  N   . MSE B 1 3   ? 15.030  2.118   29.532 1.00 45.82 ? 110 MSE B N   1 
HETATM 1233 C  CA  . MSE B 1 3   ? 14.656  2.317   28.110 1.00 49.02 ? 110 MSE B CA  1 
HETATM 1234 C  C   . MSE B 1 3   ? 13.353  3.151   27.980 1.00 43.56 ? 110 MSE B C   1 
HETATM 1235 O  O   . MSE B 1 3   ? 13.104  3.789   26.979 1.00 40.21 ? 110 MSE B O   1 
HETATM 1236 C  CB  . MSE B 1 3   ? 14.579  0.961   27.401 1.00 52.28 ? 110 MSE B CB  1 
HETATM 1237 C  CG  . MSE B 1 3   ? 13.210  0.533   26.847 1.00 64.76 ? 110 MSE B CG  1 
HETATM 1238 SE SE  . MSE B 1 3   ? 13.296  -1.277  26.004 1.00 99.97 ? 110 MSE B SE  1 
HETATM 1239 C  CE  . MSE B 1 3   ? 11.894  -2.262  27.132 1.00 94.08 ? 110 MSE B CE  1 
ATOM   1240 N  N   . ASP B 1 4   ? 12.576  3.222   29.041 1.00 38.81 ? 111 ASP B N   1 
ATOM   1241 C  CA  . ASP B 1 4   ? 11.503  4.187   29.110 1.00 36.69 ? 111 ASP B CA  1 
ATOM   1242 C  C   . ASP B 1 4   ? 11.999  5.624   29.285 1.00 31.86 ? 111 ASP B C   1 
ATOM   1243 O  O   . ASP B 1 4   ? 13.088  5.885   29.814 1.00 31.78 ? 111 ASP B O   1 
ATOM   1244 C  CB  . ASP B 1 4   ? 10.616  3.827   30.290 1.00 37.95 ? 111 ASP B CB  1 
ATOM   1245 C  CG  . ASP B 1 4   ? 9.860   2.521   30.082 1.00 46.57 ? 111 ASP B CG  1 
ATOM   1246 O  OD1 . ASP B 1 4   ? 9.993   1.898   28.996 1.00 53.85 ? 111 ASP B OD1 1 
ATOM   1247 O  OD2 . ASP B 1 4   ? 9.110   2.058   30.969 1.00 50.22 ? 111 ASP B OD2 1 
ATOM   1248 N  N   . PRO B 1 5   ? 11.166  6.560   28.877 1.00 27.06 ? 112 PRO B N   1 
ATOM   1249 C  CA  . PRO B 1 5   ? 11.486  7.975   29.047 1.00 25.65 ? 112 PRO B CA  1 
ATOM   1250 C  C   . PRO B 1 5   ? 11.502  8.410   30.505 1.00 24.77 ? 112 PRO B C   1 
ATOM   1251 O  O   . PRO B 1 5   ? 10.967  7.694   31.339 1.00 19.75 ? 112 PRO B O   1 
ATOM   1252 C  CB  . PRO B 1 5   ? 10.389  8.687   28.264 1.00 26.38 ? 112 PRO B CB  1 
ATOM   1253 C  CG  . PRO B 1 5   ? 9.380   7.725   27.915 1.00 27.50 ? 112 PRO B CG  1 
ATOM   1254 C  CD  . PRO B 1 5   ? 9.892   6.335   28.177 1.00 28.94 ? 112 PRO B CD  1 
ATOM   1255 N  N   . ARG B 1 6   ? 12.182  9.511   30.796 1.00 25.05 ? 113 ARG B N   1 
ATOM   1256 C  CA  . ARG B 1 6   ? 12.213  10.114  32.123 1.00 23.27 ? 113 ARG B CA  1 
ATOM   1257 C  C   . ARG B 1 6   ? 11.697  11.552  32.034 1.00 22.49 ? 113 ARG B C   1 
ATOM   1258 O  O   . ARG B 1 6   ? 11.739  12.158  30.989 1.00 16.77 ? 113 ARG B O   1 
ATOM   1259 C  CB  . ARG B 1 6   ? 13.610  10.020  32.748 1.00 24.71 ? 113 ARG B CB  1 
ATOM   1260 C  CG  . ARG B 1 6   ? 14.797  10.577  31.929 1.00 25.40 ? 113 ARG B CG  1 
ATOM   1261 C  CD  . ARG B 1 6   ? 16.208  10.338  32.537 1.00 25.82 ? 113 ARG B CD  1 
ATOM   1262 N  NE  . ARG B 1 6   ? 17.182  11.329  32.043 1.00 23.17 ? 113 ARG B NE  1 
ATOM   1263 C  CZ  . ARG B 1 6   ? 17.529  12.482  32.647 1.00 22.54 ? 113 ARG B CZ  1 
ATOM   1264 N  NH1 . ARG B 1 6   ? 17.037  12.834  33.816 1.00 21.34 ? 113 ARG B NH1 1 
ATOM   1265 N  NH2 . ARG B 1 6   ? 18.410  13.297  32.063 1.00 24.51 ? 113 ARG B NH2 1 
ATOM   1266 N  N   . GLU B 1 7   ? 11.136  12.052  33.128 1.00 24.42 ? 114 GLU B N   1 
ATOM   1267 C  CA  . GLU B 1 7   ? 10.617  13.414  33.271 1.00 25.70 ? 114 GLU B CA  1 
ATOM   1268 C  C   . GLU B 1 7   ? 11.635  14.300  33.967 1.00 23.75 ? 114 GLU B C   1 
ATOM   1269 O  O   . GLU B 1 7   ? 12.151  13.943  35.018 1.00 21.94 ? 114 GLU B O   1 
ATOM   1270 C  CB  . GLU B 1 7   ? 9.323   13.386  34.084 1.00 26.87 ? 114 GLU B CB  1 
ATOM   1271 C  CG  . GLU B 1 7   ? 8.238   14.290  33.516 1.00 38.33 ? 114 GLU B CG  1 
ATOM   1272 C  CD  . GLU B 1 7   ? 7.090   14.521  34.501 1.00 47.72 ? 114 GLU B CD  1 
ATOM   1273 O  OE1 . GLU B 1 7   ? 7.015   15.633  35.068 1.00 48.36 ? 114 GLU B OE1 1 
ATOM   1274 O  OE2 . GLU B 1 7   ? 6.262   13.597  34.715 1.00 54.87 ? 114 GLU B OE2 1 
ATOM   1275 N  N   . VAL B 1 8   ? 11.913  15.456  33.386 1.00 22.79 ? 115 VAL B N   1 
ATOM   1276 C  CA  . VAL B 1 8   ? 12.728  16.459  34.032 1.00 23.72 ? 115 VAL B CA  1 
ATOM   1277 C  C   . VAL B 1 8   ? 11.875  17.732  34.146 1.00 22.61 ? 115 VAL B C   1 
ATOM   1278 O  O   . VAL B 1 8   ? 10.978  17.947  33.337 1.00 23.21 ? 115 VAL B O   1 
ATOM   1279 C  CB  . VAL B 1 8   ? 14.057  16.726  33.266 1.00 24.00 ? 115 VAL B CB  1 
ATOM   1280 C  CG1 . VAL B 1 8   ? 14.901  15.472  33.216 1.00 29.30 ? 115 VAL B CG1 1 
ATOM   1281 C  CG2 . VAL B 1 8   ? 13.828  17.224  31.872 1.00 25.75 ? 115 VAL B CG2 1 
ATOM   1282 N  N   . ILE B 1 9   ? 12.143  18.527  35.178 1.00 22.36 ? 116 ILE B N   1 
ATOM   1283 C  CA  . ILE B 1 9   ? 11.566  19.859  35.329 1.00 21.22 ? 116 ILE B CA  1 
ATOM   1284 C  C   . ILE B 1 9   ? 12.712  20.823  35.386 1.00 21.10 ? 116 ILE B C   1 
ATOM   1285 O  O   . ILE B 1 9   ? 13.558  20.682  36.237 1.00 22.96 ? 116 ILE B O   1 
ATOM   1286 C  CB  . ILE B 1 9   ? 10.706  20.002  36.576 1.00 21.45 ? 116 ILE B CB  1 
ATOM   1287 C  CG1 . ILE B 1 9   ? 9.623   18.916  36.582 1.00 19.48 ? 116 ILE B CG1 1 
ATOM   1288 C  CG2 . ILE B 1 9   ? 10.127  21.393  36.594 1.00 20.65 ? 116 ILE B CG2 1 
ATOM   1289 C  CD1 . ILE B 1 9   ? 8.726   18.904  37.759 1.00 24.80 ? 116 ILE B CD1 1 
ATOM   1290 N  N   . LEU B 1 10  ? 12.780  21.733  34.426 1.00 21.45 ? 117 LEU B N   1 
ATOM   1291 C  CA  . LEU B 1 10  ? 13.814  22.752  34.444 1.00 25.44 ? 117 LEU B CA  1 
ATOM   1292 C  C   . LEU B 1 10  ? 13.202  24.108  34.789 1.00 24.14 ? 117 LEU B C   1 
ATOM   1293 O  O   . LEU B 1 10  ? 12.000  24.335  34.624 1.00 26.02 ? 117 LEU B O   1 
ATOM   1294 C  CB  . LEU B 1 10  ? 14.490  22.928  33.089 1.00 23.15 ? 117 LEU B CB  1 
ATOM   1295 C  CG  . LEU B 1 10  ? 15.050  21.760  32.303 1.00 30.23 ? 117 LEU B CG  1 
ATOM   1296 C  CD1 . LEU B 1 10  ? 13.921  21.047  31.576 1.00 33.79 ? 117 LEU B CD1 1 
ATOM   1297 C  CD2 . LEU B 1 10  ? 16.061  22.236  31.314 1.00 30.64 ? 117 LEU B CD2 1 
ATOM   1298 N  N   . CYS B 1 11  ? 14.104  25.008  35.141 1.00 21.96 ? 118 CYS B N   1 
ATOM   1299 C  CA  . CYS B 1 11  ? 13.802  26.366  35.528 1.00 24.95 ? 118 CYS B CA  1 
ATOM   1300 C  C   . CYS B 1 11  ? 14.823  27.257  34.839 1.00 23.68 ? 118 CYS B C   1 
ATOM   1301 O  O   . CYS B 1 11  ? 16.031  27.064  35.013 1.00 19.94 ? 118 CYS B O   1 
ATOM   1302 C  CB  . CYS B 1 11  ? 13.928  26.465  37.047 1.00 24.63 ? 118 CYS B CB  1 
ATOM   1303 S  SG  . CYS B 1 11  ? 12.848  25.270  37.874 1.00 38.04 ? 118 CYS B SG  1 
ATOM   1304 N  N   . LYS B 1 12  ? 14.322  28.181  34.022 1.00 22.84 ? 119 LYS B N   1 
ATOM   1305 C  CA  . LYS B 1 12  ? 15.160  29.166  33.354 1.00 24.24 ? 119 LYS B CA  1 
ATOM   1306 C  C   . LYS B 1 12  ? 15.975  29.938  34.385 1.00 24.70 ? 119 LYS B C   1 
ATOM   1307 O  O   . LYS B 1 12  ? 15.516  30.163  35.502 1.00 21.19 ? 119 LYS B O   1 
ATOM   1308 C  CB  . LYS B 1 12  ? 14.307  30.130  32.536 1.00 24.01 ? 119 LYS B CB  1 
ATOM   1309 C  CG  . LYS B 1 12  ? 13.839  29.545  31.213 1.00 24.88 ? 119 LYS B CG  1 
ATOM   1310 C  CD  . LYS B 1 12  ? 13.053  30.520  30.353 1.00 22.65 ? 119 LYS B CD  1 
ATOM   1311 C  CE  . LYS B 1 12  ? 12.510  29.801  29.096 1.00 25.46 ? 119 LYS B CE  1 
ATOM   1312 N  NZ  . LYS B 1 12  ? 11.836  30.670  28.063 1.00 19.86 ? 119 LYS B NZ  1 
ATOM   1313 N  N   . ASP B 1 13  ? 17.208  30.266  34.014 1.00 24.96 ? 120 ASP B N   1 
ATOM   1314 C  CA  . ASP B 1 13  ? 18.087  30.991  34.892 1.00 26.07 ? 120 ASP B CA  1 
ATOM   1315 C  C   . ASP B 1 13  ? 17.839  32.488  34.804 1.00 28.16 ? 120 ASP B C   1 
ATOM   1316 O  O   . ASP B 1 13  ? 16.970  32.936  34.058 1.00 29.37 ? 120 ASP B O   1 
ATOM   1317 C  CB  . ASP B 1 13  ? 19.534  30.616  34.586 1.00 26.51 ? 120 ASP B CB  1 
ATOM   1318 C  CG  . ASP B 1 13  ? 20.067  31.229  33.312 1.00 23.01 ? 120 ASP B CG  1 
ATOM   1319 O  OD1 . ASP B 1 13  ? 19.475  32.170  32.735 1.00 29.82 ? 120 ASP B OD1 1 
ATOM   1320 O  OD2 . ASP B 1 13  ? 21.136  30.805  32.824 1.00 31.34 ? 120 ASP B OD2 1 
ATOM   1321 N  N   . GLN B 1 14  ? 18.613  33.258  35.563 1.00 32.55 ? 121 GLN B N   1 
ATOM   1322 C  CA  . GLN B 1 14  ? 18.413  34.690  35.692 1.00 33.66 ? 121 GLN B CA  1 
ATOM   1323 C  C   . GLN B 1 14  ? 18.365  35.413  34.364 1.00 34.57 ? 121 GLN B C   1 
ATOM   1324 O  O   . GLN B 1 14  ? 17.712  36.454  34.235 1.00 36.37 ? 121 GLN B O   1 
ATOM   1325 N  N   . ASP B 1 15  ? 19.063  34.864  33.375 1.00 34.77 ? 122 ASP B N   1 
ATOM   1326 C  CA  . ASP B 1 15  ? 19.075  35.443  32.031 1.00 34.45 ? 122 ASP B CA  1 
ATOM   1327 C  C   . ASP B 1 15  ? 18.023  34.885  31.104 1.00 31.70 ? 122 ASP B C   1 
ATOM   1328 O  O   . ASP B 1 15  ? 18.128  35.071  29.902 1.00 32.81 ? 122 ASP B O   1 
ATOM   1329 C  CB  . ASP B 1 15  ? 20.454  35.265  31.389 1.00 35.24 ? 122 ASP B CB  1 
ATOM   1330 C  CG  . ASP B 1 15  ? 21.564  35.719  32.308 1.00 39.35 ? 122 ASP B CG  1 
ATOM   1331 O  OD1 . ASP B 1 15  ? 21.518  36.892  32.739 1.00 44.24 ? 122 ASP B OD1 1 
ATOM   1332 O  OD2 . ASP B 1 15  ? 22.487  34.959  32.687 1.00 45.74 ? 122 ASP B OD2 1 
ATOM   1333 N  N   . GLY B 1 16  ? 17.033  34.174  31.639 1.00 29.32 ? 123 GLY B N   1 
ATOM   1334 C  CA  . GLY B 1 16  ? 16.012  33.556  30.810 1.00 26.55 ? 123 GLY B CA  1 
ATOM   1335 C  C   . GLY B 1 16  ? 16.436  32.311  30.037 1.00 25.08 ? 123 GLY B C   1 
ATOM   1336 O  O   . GLY B 1 16  ? 15.811  31.950  29.049 1.00 23.92 ? 123 GLY B O   1 
ATOM   1337 N  N   . LYS B 1 17  ? 17.513  31.645  30.430 1.00 23.94 ? 124 LYS B N   1 
ATOM   1338 C  CA  . LYS B 1 17  ? 18.033  30.573  29.559 1.00 23.08 ? 124 LYS B CA  1 
ATOM   1339 C  C   . LYS B 1 17  ? 18.025  29.229  30.272 1.00 21.26 ? 124 LYS B C   1 
ATOM   1340 O  O   . LYS B 1 17  ? 17.935  29.196  31.486 1.00 18.60 ? 124 LYS B O   1 
ATOM   1341 C  CB  . LYS B 1 17  ? 19.416  30.950  29.051 1.00 25.31 ? 124 LYS B CB  1 
ATOM   1342 N  N   . ILE B 1 18  ? 18.028  28.132  29.527 1.00 20.59 ? 125 ILE B N   1 
ATOM   1343 C  CA  . ILE B 1 18  ? 18.207  26.850  30.133 1.00 21.80 ? 125 ILE B CA  1 
ATOM   1344 C  C   . ILE B 1 18  ? 19.495  26.125  29.716 1.00 20.67 ? 125 ILE B C   1 
ATOM   1345 O  O   . ILE B 1 18  ? 19.800  25.068  30.256 1.00 21.21 ? 125 ILE B O   1 
ATOM   1346 C  CB  . ILE B 1 18  ? 16.990  25.923  29.942 1.00 21.21 ? 125 ILE B CB  1 
ATOM   1347 C  CG1 . ILE B 1 18  ? 16.587  25.775  28.488 1.00 27.47 ? 125 ILE B CG1 1 
ATOM   1348 C  CG2 . ILE B 1 18  ? 15.847  26.371  30.823 1.00 24.58 ? 125 ILE B CG2 1 
ATOM   1349 C  CD1 . ILE B 1 18  ? 15.789  24.487  28.282 1.00 35.20 ? 125 ILE B CD1 1 
ATOM   1350 N  N   . GLY B 1 19  ? 20.199  26.666  28.739 1.00 16.87 ? 126 GLY B N   1 
ATOM   1351 C  CA  . GLY B 1 19  ? 21.448  26.111  28.297 1.00 17.98 ? 126 GLY B CA  1 
ATOM   1352 C  C   . GLY B 1 19  ? 21.291  24.955  27.344 1.00 18.43 ? 126 GLY B C   1 
ATOM   1353 O  O   . GLY B 1 19  ? 22.107  24.079  27.330 1.00 19.21 ? 126 GLY B O   1 
ATOM   1354 N  N   . LEU B 1 20  ? 20.258  24.961  26.522 1.00 18.32 ? 127 LEU B N   1 
ATOM   1355 C  CA  . LEU B 1 20  ? 19.930  23.838  25.685 1.00 18.43 ? 127 LEU B CA  1 
ATOM   1356 C  C   . LEU B 1 20  ? 19.682  24.325  24.270 1.00 20.09 ? 127 LEU B C   1 
ATOM   1357 O  O   . LEU B 1 20  ? 18.964  25.295  24.028 1.00 23.23 ? 127 LEU B O   1 
ATOM   1358 C  CB  . LEU B 1 20  ? 18.646  23.241  26.280 1.00 22.81 ? 127 LEU B CB  1 
ATOM   1359 C  CG  . LEU B 1 20  ? 18.192  21.925  25.754 1.00 20.49 ? 127 LEU B CG  1 
ATOM   1360 C  CD1 . LEU B 1 20  ? 19.236  20.906  26.074 1.00 25.90 ? 127 LEU B CD1 1 
ATOM   1361 C  CD2 . LEU B 1 20  ? 16.825  21.537  26.348 1.00 26.09 ? 127 LEU B CD2 1 
ATOM   1362 N  N   . ARG B 1 21  ? 20.299  23.634  23.330 1.00 18.10 ? 128 ARG B N   1 
ATOM   1363 C  CA  . ARG B 1 21  ? 19.948  23.733  21.957 1.00 19.62 ? 128 ARG B CA  1 
ATOM   1364 C  C   . ARG B 1 21  ? 19.454  22.394  21.415 1.00 17.14 ? 128 ARG B C   1 
ATOM   1365 O  O   . ARG B 1 21  ? 20.017  21.342  21.701 1.00 16.07 ? 128 ARG B O   1 
ATOM   1366 C  CB  . ARG B 1 21  ? 21.184  24.226  21.244 1.00 21.08 ? 128 ARG B CB  1 
ATOM   1367 C  CG  . ARG B 1 21  ? 21.006  24.424  19.795 1.00 26.54 ? 128 ARG B CG  1 
ATOM   1368 C  CD  . ARG B 1 21  ? 22.363  24.552  19.163 1.00 33.78 ? 128 ARG B CD  1 
ATOM   1369 N  NE  . ARG B 1 21  ? 23.119  25.636  19.763 1.00 32.34 ? 128 ARG B NE  1 
ATOM   1370 C  CZ  . ARG B 1 21  ? 24.379  25.877  19.472 1.00 33.47 ? 128 ARG B CZ  1 
ATOM   1371 N  NH1 . ARG B 1 21  ? 25.021  25.075  18.620 1.00 36.39 ? 128 ARG B NH1 1 
ATOM   1372 N  NH2 . ARG B 1 21  ? 24.980  26.905  20.036 1.00 32.79 ? 128 ARG B NH2 1 
ATOM   1373 N  N   . LEU B 1 22  ? 18.334  22.449  20.703 1.00 15.72 ? 129 LEU B N   1 
ATOM   1374 C  CA  . LEU B 1 22  ? 17.663  21.281  20.161 1.00 14.82 ? 129 LEU B CA  1 
ATOM   1375 C  C   . LEU B 1 22  ? 17.730  21.274  18.625 1.00 14.71 ? 129 LEU B C   1 
ATOM   1376 O  O   . LEU B 1 22  ? 17.743  22.316  17.978 1.00 17.66 ? 129 LEU B O   1 
ATOM   1377 C  CB  . LEU B 1 22  ? 16.186  21.284  20.588 1.00 17.16 ? 129 LEU B CB  1 
ATOM   1378 C  CG  . LEU B 1 22  ? 15.948  21.376  22.079 1.00 16.28 ? 129 LEU B CG  1 
ATOM   1379 C  CD1 . LEU B 1 22  ? 14.510  21.486  22.466 1.00 19.72 ? 129 LEU B CD1 1 
ATOM   1380 C  CD2 . LEU B 1 22  ? 16.594  20.182  22.688 1.00 18.67 ? 129 LEU B CD2 1 
ATOM   1381 N  N   . LYS B 1 23  ? 17.735  20.081  18.038 1.00 13.74 ? 130 LYS B N   1 
ATOM   1382 C  CA  . LYS B 1 23  ? 17.759  19.904  16.620 1.00 12.00 ? 130 LYS B CA  1 
ATOM   1383 C  C   . LYS B 1 23  ? 16.797  18.825  16.150 1.00 13.54 ? 130 LYS B C   1 
ATOM   1384 O  O   . LYS B 1 23  ? 16.610  17.803  16.812 1.00 15.39 ? 130 LYS B O   1 
ATOM   1385 C  CB  . LYS B 1 23  ? 19.181  19.601  16.162 1.00 13.07 ? 130 LYS B CB  1 
ATOM   1386 C  CG  . LYS B 1 23  ? 19.322  19.505  14.650 1.00 12.95 ? 130 LYS B CG  1 
ATOM   1387 C  CD  . LYS B 1 23  ? 20.701  19.047  14.257 1.00 19.08 ? 130 LYS B CD  1 
ATOM   1388 C  CE  . LYS B 1 23  ? 20.871  18.957  12.755 1.00 24.97 ? 130 LYS B CE  1 
ATOM   1389 N  NZ  . LYS B 1 23  ? 22.246  18.475  12.403 1.00 26.15 ? 130 LYS B NZ  1 
ATOM   1390 N  N   . SER B 1 24  ? 16.187  19.048  14.999 1.00 12.74 ? 131 SER B N   1 
ATOM   1391 C  CA  . SER B 1 24  ? 15.296  18.089  14.342 1.00 14.84 ? 131 SER B CA  1 
ATOM   1392 C  C   . SER B 1 24  ? 16.082  17.066  13.584 1.00 16.21 ? 131 SER B C   1 
ATOM   1393 O  O   . SER B 1 24  ? 16.838  17.433  12.656 1.00 17.28 ? 131 SER B O   1 
ATOM   1394 C  CB  . SER B 1 24  ? 14.519  18.843  13.262 1.00 16.76 ? 131 SER B CB  1 
ATOM   1395 O  OG  . SER B 1 24  ? 13.384  18.145  12.863 1.00 21.04 ? 131 SER B OG  1 
ATOM   1396 N  N   . ILE B 1 25  ? 15.873  15.803  13.912 1.00 13.84 ? 132 ILE B N   1 
ATOM   1397 C  CA  . ILE B 1 25  ? 16.493  14.719  13.181 1.00 16.67 ? 132 ILE B CA  1 
ATOM   1398 C  C   . ILE B 1 25  ? 15.489  13.579  13.005 1.00 15.29 ? 132 ILE B C   1 
ATOM   1399 O  O   . ILE B 1 25  ? 14.909  13.141  13.982 1.00 16.36 ? 132 ILE B O   1 
ATOM   1400 C  CB  . ILE B 1 25  ? 17.729  14.183  13.902 1.00 16.82 ? 132 ILE B CB  1 
ATOM   1401 C  CG1 . ILE B 1 25  ? 18.699  15.323  14.228 1.00 17.77 ? 132 ILE B CG1 1 
ATOM   1402 C  CG2 . ILE B 1 25  ? 18.406  13.160  12.975 1.00 20.53 ? 132 ILE B CG2 1 
ATOM   1403 C  CD1 . ILE B 1 25  ? 19.858  14.915  15.057 1.00 22.19 ? 132 ILE B CD1 1 
ATOM   1404 N  N   . ASP B 1 26  ? 15.306  13.103  11.779 1.00 16.20 ? 133 ASP B N   1 
ATOM   1405 C  CA  . ASP B 1 26  ? 14.465  11.941  11.484 1.00 13.24 ? 133 ASP B CA  1 
ATOM   1406 C  C   . ASP B 1 26  ? 13.064  12.108  12.094 1.00 11.99 ? 133 ASP B C   1 
ATOM   1407 O  O   . ASP B 1 26  ? 12.467  11.149  12.597 1.00 15.06 ? 133 ASP B O   1 
ATOM   1408 C  CB  . ASP B 1 26  ? 15.117  10.692  12.088 1.00 14.24 ? 133 ASP B CB  1 
ATOM   1409 C  CG  . ASP B 1 26  ? 16.391  10.241  11.357 1.00 22.56 ? 133 ASP B CG  1 
ATOM   1410 O  OD1 . ASP B 1 26  ? 16.696  10.660  10.230 1.00 17.29 ? 133 ASP B OD1 1 
ATOM   1411 O  OD2 . ASP B 1 26  ? 17.135  9.381   11.844 1.00 28.69 ? 133 ASP B OD2 1 
ATOM   1412 N  N   . ASN B 1 27  ? 12.538  13.318  12.113 1.00 11.14 ? 134 ASN B N   1 
ATOM   1413 C  CA  . ASN B 1 27  ? 11.209  13.595  12.655 1.00 13.86 ? 134 ASN B CA  1 
ATOM   1414 C  C   . ASN B 1 27  ? 11.069  13.529  14.158 1.00 11.05 ? 134 ASN B C   1 
ATOM   1415 O  O   . ASN B 1 27  ? 9.980   13.596  14.708 1.00 12.58 ? 134 ASN B O   1 
ATOM   1416 C  CB  . ASN B 1 27  ? 10.170  12.813  11.869 1.00 19.46 ? 134 ASN B CB  1 
ATOM   1417 C  CG  . ASN B 1 27  ? 10.016  13.453  10.479 1.00 28.52 ? 134 ASN B CG  1 
ATOM   1418 O  OD1 . ASN B 1 27  ? 9.428   14.533  10.377 1.00 34.82 ? 134 ASN B OD1 1 
ATOM   1419 N  ND2 . ASN B 1 27  ? 10.654  12.867  9.447  1.00 32.24 ? 134 ASN B ND2 1 
ATOM   1420 N  N   . GLY B 1 28  ? 12.227  13.549  14.803 1.00 10.72 ? 135 GLY B N   1 
ATOM   1421 C  CA  . GLY B 1 28  ? 12.357  13.737  16.236 1.00 13.01 ? 135 GLY B CA  1 
ATOM   1422 C  C   . GLY B 1 28  ? 13.098  15.032  16.539 1.00 13.29 ? 135 GLY B C   1 
ATOM   1423 O  O   . GLY B 1 28  ? 13.478  15.814  15.655 1.00 15.21 ? 135 GLY B O   1 
ATOM   1424 N  N   . ILE B 1 29  ? 13.239  15.257  17.831 1.00 11.84 ? 136 ILE B N   1 
ATOM   1425 C  CA  . ILE B 1 29  ? 13.968  16.349  18.426 1.00 12.67 ? 136 ILE B CA  1 
ATOM   1426 C  C   . ILE B 1 29  ? 15.002  15.750  19.345 1.00 12.23 ? 136 ILE B C   1 
ATOM   1427 O  O   . ILE B 1 29  ? 14.700  14.906  20.196 1.00 14.41 ? 136 ILE B O   1 
ATOM   1428 C  CB  . ILE B 1 29  ? 13.016  17.333  19.110 1.00 11.82 ? 136 ILE B CB  1 
ATOM   1429 C  CG1 . ILE B 1 29  ? 12.198  18.004  18.017 1.00 10.94 ? 136 ILE B CG1 1 
ATOM   1430 C  CG2 . ILE B 1 29  ? 13.794  18.413  19.955 1.00 12.24 ? 136 ILE B CG2 1 
ATOM   1431 C  CD1 . ILE B 1 29  ? 12.937  18.964  17.212 1.00 13.33 ? 136 ILE B CD1 1 
ATOM   1432 N  N   . PHE B 1 30  ? 16.221  16.222  19.155 1.00 13.12 ? 137 PHE B N   1 
ATOM   1433 C  CA  . PHE B 1 30  ? 17.393  15.798  19.886 1.00 15.56 ? 137 PHE B CA  1 
ATOM   1434 C  C   . PHE B 1 30  ? 18.164  16.993  20.472 1.00 15.25 ? 137 PHE B C   1 
ATOM   1435 O  O   . PHE B 1 30  ? 18.192  18.080  19.917 1.00 15.47 ? 137 PHE B O   1 
ATOM   1436 C  CB  . PHE B 1 30  ? 18.302  15.028  18.971 1.00 14.83 ? 137 PHE B CB  1 
ATOM   1437 C  CG  . PHE B 1 30  ? 17.733  13.725  18.575 1.00 14.96 ? 137 PHE B CG  1 
ATOM   1438 C  CD1 . PHE B 1 30  ? 16.830  13.641  17.551 1.00 19.06 ? 137 PHE B CD1 1 
ATOM   1439 C  CD2 . PHE B 1 30  ? 17.999  12.601  19.320 1.00 14.95 ? 137 PHE B CD2 1 
ATOM   1440 C  CE1 . PHE B 1 30  ? 16.229  12.447  17.255 1.00 20.28 ? 137 PHE B CE1 1 
ATOM   1441 C  CE2 . PHE B 1 30  ? 17.402  11.421  19.019 1.00 13.57 ? 137 PHE B CE2 1 
ATOM   1442 C  CZ  . PHE B 1 30  ? 16.541  11.338  17.954 1.00 16.48 ? 137 PHE B CZ  1 
ATOM   1443 N  N   . VAL B 1 31  ? 18.738  16.743  21.632 1.00 13.59 ? 138 VAL B N   1 
ATOM   1444 C  CA  . VAL B 1 31  ? 19.662  17.646  22.265 1.00 14.63 ? 138 VAL B CA  1 
ATOM   1445 C  C   . VAL B 1 31  ? 20.938  17.756  21.443 1.00 15.41 ? 138 VAL B C   1 
ATOM   1446 O  O   . VAL B 1 31  ? 21.625  16.787  21.135 1.00 14.56 ? 138 VAL B O   1 
ATOM   1447 C  CB  . VAL B 1 31  ? 19.952  17.224  23.706 1.00 15.28 ? 138 VAL B CB  1 
ATOM   1448 C  CG1 . VAL B 1 31  ? 21.071  18.095  24.302 1.00 18.44 ? 138 VAL B CG1 1 
ATOM   1449 C  CG2 . VAL B 1 31  ? 18.656  17.311  24.525 1.00 14.78 ? 138 VAL B CG2 1 
ATOM   1450 N  N   . GLN B 1 32  ? 21.253  18.990  21.105 1.00 14.02 ? 139 GLN B N   1 
ATOM   1451 C  CA  . GLN B 1 32  ? 22.377  19.240  20.236 1.00 16.67 ? 139 GLN B CA  1 
ATOM   1452 C  C   . GLN B 1 32  ? 23.511  19.921  20.993 1.00 15.43 ? 139 GLN B C   1 
ATOM   1453 O  O   . GLN B 1 32  ? 24.644  19.750  20.646 1.00 16.23 ? 139 GLN B O   1 
ATOM   1454 C  CB  . GLN B 1 32  ? 21.916  20.074  19.054 1.00 17.88 ? 139 GLN B CB  1 
ATOM   1455 C  CG  . GLN B 1 32  ? 23.047  20.530  18.176 1.00 24.25 ? 139 GLN B CG  1 
ATOM   1456 C  CD  . GLN B 1 32  ? 23.429  19.451  17.201 1.00 29.10 ? 139 GLN B CD  1 
ATOM   1457 O  OE1 . GLN B 1 32  ? 22.909  18.328  17.270 1.00 30.83 ? 139 GLN B OE1 1 
ATOM   1458 N  NE2 . GLN B 1 32  ? 24.347  19.780  16.296 1.00 29.74 ? 139 GLN B NE2 1 
ATOM   1459 N  N   . LEU B 1 33  ? 23.242  20.622  22.074 1.00 17.99 ? 140 LEU B N   1 
ATOM   1460 C  CA  . LEU B 1 33  ? 24.323  21.269  22.838 1.00 18.10 ? 140 LEU B CA  1 
ATOM   1461 C  C   . LEU B 1 33  ? 23.735  21.620  24.192 1.00 16.52 ? 140 LEU B C   1 
ATOM   1462 O  O   . LEU B 1 33  ? 22.628  22.152  24.272 1.00 19.29 ? 140 LEU B O   1 
ATOM   1463 C  CB  . LEU B 1 33  ? 24.805  22.532  22.151 1.00 20.28 ? 140 LEU B CB  1 
ATOM   1464 C  CG  . LEU B 1 33  ? 26.116  23.053  22.717 1.00 23.03 ? 140 LEU B CG  1 
ATOM   1465 C  CD1 . LEU B 1 33  ? 27.294  22.073  22.523 1.00 29.53 ? 140 LEU B CD1 1 
ATOM   1466 C  CD2 . LEU B 1 33  ? 26.410  24.429  22.161 1.00 30.17 ? 140 LEU B CD2 1 
ATOM   1467 N  N   . VAL B 1 34  ? 24.437  21.206  25.242 1.00 15.68 ? 141 VAL B N   1 
ATOM   1468 C  CA  . VAL B 1 34  ? 24.134  21.552  26.604 1.00 14.38 ? 141 VAL B CA  1 
ATOM   1469 C  C   . VAL B 1 34  ? 25.257  22.421  27.124 1.00 17.64 ? 141 VAL B C   1 
ATOM   1470 O  O   . VAL B 1 34  ? 26.417  22.030  27.113 1.00 14.61 ? 141 VAL B O   1 
ATOM   1471 C  CB  . VAL B 1 34  ? 24.023  20.260  27.466 1.00 14.12 ? 141 VAL B CB  1 
ATOM   1472 C  CG1 . VAL B 1 34  ? 23.730  20.620  28.914 1.00 11.82 ? 141 VAL B CG1 1 
ATOM   1473 C  CG2 . VAL B 1 34  ? 22.967  19.375  26.877 1.00 15.51 ? 141 VAL B CG2 1 
ATOM   1474 N  N   . GLN B 1 35  ? 24.901  23.603  27.608 1.00 19.82 ? 142 GLN B N   1 
ATOM   1475 C  CA  . GLN B 1 35  ? 25.899  24.489  28.187 1.00 19.13 ? 142 GLN B CA  1 
ATOM   1476 C  C   . GLN B 1 35  ? 26.275  23.957  29.545 1.00 19.78 ? 142 GLN B C   1 
ATOM   1477 O  O   . GLN B 1 35  ? 25.404  23.568  30.331 1.00 18.66 ? 142 GLN B O   1 
ATOM   1478 C  CB  . GLN B 1 35  ? 25.350  25.885  28.380 1.00 18.65 ? 142 GLN B CB  1 
ATOM   1479 C  CG  . GLN B 1 35  ? 24.916  26.580  27.077 1.00 23.07 ? 142 GLN B CG  1 
ATOM   1480 C  CD  . GLN B 1 35  ? 26.075  26.832  26.136 1.00 32.82 ? 142 GLN B CD  1 
ATOM   1481 O  OE1 . GLN B 1 35  ? 27.049  27.492  26.507 1.00 34.07 ? 142 GLN B OE1 1 
ATOM   1482 N  NE2 . GLN B 1 35  ? 25.980  26.308  24.914 1.00 36.38 ? 142 GLN B NE2 1 
ATOM   1483 N  N   . ALA B 1 36  ? 27.569  24.018  29.838 1.00 19.23 ? 143 ALA B N   1 
ATOM   1484 C  CA  . ALA B 1 36  ? 28.053  23.704  31.164 1.00 19.46 ? 143 ALA B CA  1 
ATOM   1485 C  C   . ALA B 1 36  ? 27.411  24.611  32.222 1.00 18.96 ? 143 ALA B C   1 
ATOM   1486 O  O   . ALA B 1 36  ? 27.123  25.764  31.964 1.00 18.54 ? 143 ALA B O   1 
ATOM   1487 C  CB  . ALA B 1 36  ? 29.572  23.810  31.180 1.00 20.13 ? 143 ALA B CB  1 
ATOM   1488 N  N   . ASN B 1 37  ? 27.206  24.057  33.410 1.00 20.39 ? 144 ASN B N   1 
ATOM   1489 C  CA  . ASN B 1 37  ? 26.617  24.745  34.550 1.00 22.62 ? 144 ASN B CA  1 
ATOM   1490 C  C   . ASN B 1 37  ? 25.325  25.483  34.213 1.00 20.96 ? 144 ASN B C   1 
ATOM   1491 O  O   . ASN B 1 37  ? 25.123  26.607  34.624 1.00 27.55 ? 144 ASN B O   1 
ATOM   1492 C  CB  . ASN B 1 37  ? 27.666  25.651  35.217 1.00 23.42 ? 144 ASN B CB  1 
ATOM   1493 C  CG  . ASN B 1 37  ? 28.927  24.888  35.568 1.00 27.60 ? 144 ASN B CG  1 
ATOM   1494 O  OD1 . ASN B 1 37  ? 28.850  23.796  36.142 1.00 35.55 ? 144 ASN B OD1 1 
ATOM   1495 N  ND2 . ASN B 1 37  ? 30.088  25.424  35.185 1.00 25.80 ? 144 ASN B ND2 1 
ATOM   1496 N  N   . SER B 1 38  ? 24.468  24.835  33.434 1.00 21.15 ? 145 SER B N   1 
ATOM   1497 C  CA  . SER B 1 38  ? 23.185  25.366  33.056 1.00 18.83 ? 145 SER B CA  1 
ATOM   1498 C  C   . SER B 1 38  ? 22.051  24.594  33.703 1.00 18.11 ? 145 SER B C   1 
ATOM   1499 O  O   . SER B 1 38  ? 22.256  23.475  34.162 1.00 18.04 ? 145 SER B O   1 
ATOM   1500 C  CB  . SER B 1 38  ? 23.050  25.284  31.540 1.00 18.94 ? 145 SER B CB  1 
ATOM   1501 O  OG  . SER B 1 38  ? 23.006  23.929  31.106 1.00 18.40 ? 145 SER B OG  1 
ATOM   1502 N  N   . PRO B 1 39  ? 20.827  25.120  33.684 1.00 19.27 ? 146 PRO B N   1 
ATOM   1503 C  CA  . PRO B 1 39  ? 19.685  24.305  34.132 1.00 19.89 ? 146 PRO B CA  1 
ATOM   1504 C  C   . PRO B 1 39  ? 19.586  22.934  33.433 1.00 17.93 ? 146 PRO B C   1 
ATOM   1505 O  O   . PRO B 1 39  ? 19.223  21.927  34.020 1.00 16.49 ? 146 PRO B O   1 
ATOM   1506 C  CB  . PRO B 1 39  ? 18.482  25.212  33.845 1.00 20.66 ? 146 PRO B CB  1 
ATOM   1507 C  CG  . PRO B 1 39  ? 19.012  26.576  33.942 1.00 20.53 ? 146 PRO B CG  1 
ATOM   1508 C  CD  . PRO B 1 39  ? 20.404  26.483  33.332 1.00 19.51 ? 146 PRO B CD  1 
ATOM   1509 N  N   . ALA B 1 40  ? 19.936  22.885  32.162 1.00 18.98 ? 147 ALA B N   1 
ATOM   1510 C  CA  . ALA B 1 40  ? 19.895  21.633  31.411 1.00 16.39 ? 147 ALA B CA  1 
ATOM   1511 C  C   . ALA B 1 40  ? 20.961  20.618  31.828 1.00 16.83 ? 147 ALA B C   1 
ATOM   1512 O  O   . ALA B 1 40  ? 20.646  19.435  32.024 1.00 17.68 ? 147 ALA B O   1 
ATOM   1513 C  CB  . ALA B 1 40  ? 19.987  21.918  29.958 1.00 14.56 ? 147 ALA B CB  1 
ATOM   1514 N  N   . SER B 1 41  ? 22.194  21.061  32.014 1.00 16.86 ? 148 SER B N   1 
ATOM   1515 C  CA  . SER B 1 41  ? 23.217  20.143  32.513 1.00 19.10 ? 148 SER B CA  1 
ATOM   1516 C  C   . SER B 1 41  ? 22.875  19.652  33.885 1.00 20.28 ? 148 SER B C   1 
ATOM   1517 O  O   . SER B 1 41  ? 23.146  18.502  34.202 1.00 21.04 ? 148 SER B O   1 
ATOM   1518 C  CB  . SER B 1 41  ? 24.624  20.728  32.550 1.00 18.46 ? 148 SER B CB  1 
ATOM   1519 O  OG  . SER B 1 41  ? 24.729  21.733  33.524 1.00 25.87 ? 148 SER B OG  1 
ATOM   1520 N  N   . LEU B 1 42  ? 22.276  20.500  34.716 1.00 17.79 ? 149 LEU B N   1 
ATOM   1521 C  CA  . LEU B 1 42  ? 22.010  20.095  36.086 1.00 17.77 ? 149 LEU B CA  1 
ATOM   1522 C  C   . LEU B 1 42  ? 20.831  19.126  36.233 1.00 21.73 ? 149 LEU B C   1 
ATOM   1523 O  O   . LEU B 1 42  ? 20.594  18.600  37.322 1.00 26.23 ? 149 LEU B O   1 
ATOM   1524 C  CB  . LEU B 1 42  ? 21.853  21.312  36.999 1.00 18.50 ? 149 LEU B CB  1 
ATOM   1525 C  CG  . LEU B 1 42  ? 23.043  22.254  37.090 1.00 21.31 ? 149 LEU B CG  1 
ATOM   1526 C  CD1 . LEU B 1 42  ? 22.621  23.622  37.612 1.00 29.14 ? 149 LEU B CD1 1 
ATOM   1527 C  CD2 . LEU B 1 42  ? 24.141  21.698  37.958 1.00 32.15 ? 149 LEU B CD2 1 
ATOM   1528 N  N   . VAL B 1 43  ? 20.121  18.819  35.151 1.00 23.52 ? 150 VAL B N   1 
ATOM   1529 C  CA  . VAL B 1 43  ? 19.149  17.731  35.187 1.00 24.25 ? 150 VAL B CA  1 
ATOM   1530 C  C   . VAL B 1 43  ? 19.650  16.566  34.370 1.00 25.71 ? 150 VAL B C   1 
ATOM   1531 O  O   . VAL B 1 43  ? 18.891  15.677  34.006 1.00 30.61 ? 150 VAL B O   1 
ATOM   1532 C  CB  . VAL B 1 43  ? 17.732  18.165  34.709 1.00 26.16 ? 150 VAL B CB  1 
ATOM   1533 C  CG1 . VAL B 1 43  ? 17.182  19.264  35.594 1.00 21.13 ? 150 VAL B CG1 1 
ATOM   1534 C  CG2 . VAL B 1 43  ? 17.733  18.665  33.282 1.00 25.55 ? 150 VAL B CG2 1 
ATOM   1535 N  N   . GLY B 1 44  ? 20.946  16.548  34.094 1.00 22.78 ? 151 GLY B N   1 
ATOM   1536 C  CA  . GLY B 1 44  ? 21.542  15.461  33.372 1.00 20.50 ? 151 GLY B CA  1 
ATOM   1537 C  C   . GLY B 1 44  ? 21.360  15.355  31.876 1.00 21.08 ? 151 GLY B C   1 
ATOM   1538 O  O   . GLY B 1 44  ? 21.683  14.308  31.338 1.00 21.04 ? 151 GLY B O   1 
ATOM   1539 N  N   . LEU B 1 45  ? 20.960  16.417  31.183 1.00 18.20 ? 152 LEU B N   1 
ATOM   1540 C  CA  . LEU B 1 45  ? 20.775  16.322  29.746 1.00 15.88 ? 152 LEU B CA  1 
ATOM   1541 C  C   . LEU B 1 45  ? 22.110  16.227  29.043 1.00 16.25 ? 152 LEU B C   1 
ATOM   1542 O  O   . LEU B 1 45  ? 23.059  16.871  29.422 1.00 17.76 ? 152 LEU B O   1 
ATOM   1543 C  CB  . LEU B 1 45  ? 19.950  17.515  29.217 1.00 16.22 ? 152 LEU B CB  1 
ATOM   1544 C  CG  . LEU B 1 45  ? 18.484  17.531  29.668 1.00 18.46 ? 152 LEU B CG  1 
ATOM   1545 C  CD1 . LEU B 1 45  ? 17.778  18.765  29.322 1.00 23.84 ? 152 LEU B CD1 1 
ATOM   1546 C  CD2 . LEU B 1 45  ? 17.763  16.362  29.019 1.00 21.12 ? 152 LEU B CD2 1 
ATOM   1547 N  N   . ARG B 1 46  ? 22.166  15.465  27.963 1.00 16.88 ? 153 ARG B N   1 
ATOM   1548 C  CA  . ARG B 1 46  ? 23.392  15.353  27.198 1.00 18.79 ? 153 ARG B CA  1 
ATOM   1549 C  C   . ARG B 1 46  ? 23.094  15.387  25.736 1.00 14.25 ? 153 ARG B C   1 
ATOM   1550 O  O   . ARG B 1 46  ? 22.024  14.985  25.274 1.00 15.84 ? 153 ARG B O   1 
ATOM   1551 C  CB  . ARG B 1 46  ? 24.148  14.047  27.529 1.00 19.74 ? 153 ARG B CB  1 
ATOM   1552 C  CG  . ARG B 1 46  ? 24.126  13.631  28.995 1.00 30.57 ? 153 ARG B CG  1 
ATOM   1553 C  CD  . ARG B 1 46  ? 25.037  12.487  29.300 1.00 33.04 ? 153 ARG B CD  1 
ATOM   1554 N  NE  . ARG B 1 46  ? 24.608  11.277  28.615 1.00 43.32 ? 153 ARG B NE  1 
ATOM   1555 C  CZ  . ARG B 1 46  ? 25.224  10.097  28.728 1.00 49.66 ? 153 ARG B CZ  1 
ATOM   1556 N  NH1 . ARG B 1 46  ? 26.319  9.976   29.475 1.00 50.11 ? 153 ARG B NH1 1 
ATOM   1557 N  NH2 . ARG B 1 46  ? 24.749  9.036   28.086 1.00 48.70 ? 153 ARG B NH2 1 
ATOM   1558 N  N   . PHE B 1 47  ? 24.102  15.738  24.976 1.00 15.37 ? 154 PHE B N   1 
ATOM   1559 C  CA  . PHE B 1 47  ? 24.047  15.565  23.529 1.00 15.25 ? 154 PHE B CA  1 
ATOM   1560 C  C   . PHE B 1 47  ? 23.503  14.209  23.104 1.00 13.73 ? 154 PHE B C   1 
ATOM   1561 O  O   . PHE B 1 47  ? 23.959  13.180  23.572 1.00 14.70 ? 154 PHE B O   1 
ATOM   1562 C  CB  . PHE B 1 47  ? 25.444  15.676  22.941 1.00 13.86 ? 154 PHE B CB  1 
ATOM   1563 C  CG  . PHE B 1 47  ? 25.500  15.366  21.484 1.00 15.97 ? 154 PHE B CG  1 
ATOM   1564 C  CD1 . PHE B 1 47  ? 25.249  16.356  20.564 1.00 22.69 ? 154 PHE B CD1 1 
ATOM   1565 C  CD2 . PHE B 1 47  ? 25.814  14.110  21.035 1.00 16.51 ? 154 PHE B CD2 1 
ATOM   1566 C  CE1 . PHE B 1 47  ? 25.302  16.093  19.236 1.00 15.64 ? 154 PHE B CE1 1 
ATOM   1567 C  CE2 . PHE B 1 47  ? 25.875  13.833  19.669 1.00 22.77 ? 154 PHE B CE2 1 
ATOM   1568 C  CZ  . PHE B 1 47  ? 25.595  14.833  18.782 1.00 21.01 ? 154 PHE B CZ  1 
ATOM   1569 N  N   . GLY B 1 48  ? 22.505  14.221  22.235 1.00 14.03 ? 155 GLY B N   1 
ATOM   1570 C  CA  . GLY B 1 48  ? 21.958  13.020  21.669 1.00 14.98 ? 155 GLY B CA  1 
ATOM   1571 C  C   . GLY B 1 48  ? 20.760  12.446  22.420 1.00 13.42 ? 155 GLY B C   1 
ATOM   1572 O  O   . GLY B 1 48  ? 20.123  11.539  21.933 1.00 13.12 ? 155 GLY B O   1 
ATOM   1573 N  N   . ASP B 1 49  ? 20.428  13.003  23.566 1.00 12.64 ? 156 ASP B N   1 
ATOM   1574 C  CA  . ASP B 1 49  ? 19.210  12.672  24.230 1.00 10.81 ? 156 ASP B CA  1 
ATOM   1575 C  C   . ASP B 1 49  ? 18.048  13.098  23.303 1.00 11.75 ? 156 ASP B C   1 
ATOM   1576 O  O   . ASP B 1 49  ? 18.105  14.106  22.606 1.00 13.27 ? 156 ASP B O   1 
ATOM   1577 C  CB  . ASP B 1 49  ? 19.060  13.407  25.547 1.00 9.82  ? 156 ASP B CB  1 
ATOM   1578 C  CG  . ASP B 1 49  ? 19.912  12.842  26.655 1.00 13.48 ? 156 ASP B CG  1 
ATOM   1579 O  OD1 . ASP B 1 49  ? 20.395  11.706  26.487 1.00 14.82 ? 156 ASP B OD1 1 
ATOM   1580 O  OD2 . ASP B 1 49  ? 20.169  13.516  27.678 1.00 18.79 ? 156 ASP B OD2 1 
ATOM   1581 N  N   . GLN B 1 50  ? 16.986  12.317  23.363 1.00 10.33 ? 157 GLN B N   1 
ATOM   1582 C  CA  . GLN B 1 50  ? 15.802  12.564  22.560 1.00 11.63 ? 157 GLN B CA  1 
ATOM   1583 C  C   . GLN B 1 50  ? 14.714  13.188  23.433 1.00 10.47 ? 157 GLN B C   1 
ATOM   1584 O  O   . GLN B 1 50  ? 14.452  12.749  24.540 1.00 14.10 ? 157 GLN B O   1 
ATOM   1585 C  CB  . GLN B 1 50  ? 15.322  11.344  21.843 1.00 8.72  ? 157 GLN B CB  1 
ATOM   1586 C  CG  . GLN B 1 50  ? 14.156  11.593  20.893 1.00 12.80 ? 157 GLN B CG  1 
ATOM   1587 C  CD  . GLN B 1 50  ? 13.627  10.346  20.247 1.00 19.35 ? 157 GLN B CD  1 
ATOM   1588 O  OE1 . GLN B 1 50  ? 14.149  9.229   20.504 1.00 18.78 ? 157 GLN B OE1 1 
ATOM   1589 N  NE2 . GLN B 1 50  ? 12.565  10.502  19.416 1.00 13.26 ? 157 GLN B NE2 1 
ATOM   1590 N  N   . VAL B 1 51  ? 14.109  14.247  22.929 1.00 12.49 ? 158 VAL B N   1 
ATOM   1591 C  CA  . VAL B 1 51  ? 13.054  14.976  23.644 1.00 11.55 ? 158 VAL B CA  1 
ATOM   1592 C  C   . VAL B 1 51  ? 11.728  14.581  22.991 1.00 14.09 ? 158 VAL B C   1 
ATOM   1593 O  O   . VAL B 1 51  ? 11.489  14.864  21.823 1.00 17.05 ? 158 VAL B O   1 
ATOM   1594 C  CB  . VAL B 1 51  ? 13.198  16.509  23.587 1.00 14.62 ? 158 VAL B CB  1 
ATOM   1595 C  CG1 . VAL B 1 51  ? 12.195  17.142  24.541 1.00 11.35 ? 158 VAL B CG1 1 
ATOM   1596 C  CG2 . VAL B 1 51  ? 14.598  16.926  23.913 1.00 12.96 ? 158 VAL B CG2 1 
ATOM   1597 N  N   . LEU B 1 52  ? 10.902  13.828  23.728 1.00 13.46 ? 159 LEU B N   1 
ATOM   1598 C  CA  . LEU B 1 52  ? 9.637   13.379  23.202 1.00 12.50 ? 159 LEU B CA  1 
ATOM   1599 C  C   . LEU B 1 52  ? 8.496   14.383  23.418 1.00 12.88 ? 159 LEU B C   1 
ATOM   1600 O  O   . LEU B 1 52  ? 7.642   14.556  22.540 1.00 14.51 ? 159 LEU B O   1 
ATOM   1601 C  CB  . LEU B 1 52  ? 9.236   12.062  23.834 1.00 14.83 ? 159 LEU B CB  1 
ATOM   1602 C  CG  . LEU B 1 52  ? 10.222  10.897  23.840 1.00 18.63 ? 159 LEU B CG  1 
ATOM   1603 C  CD1 . LEU B 1 52  ? 9.625   9.578   24.390 1.00 22.53 ? 159 LEU B CD1 1 
ATOM   1604 C  CD2 . LEU B 1 52  ? 10.814  10.695  22.575 1.00 21.03 ? 159 LEU B CD2 1 
ATOM   1605 N  N   . GLN B 1 53  ? 8.506   15.057  24.555 1.00 12.22 ? 160 GLN B N   1 
ATOM   1606 C  CA  . GLN B 1 53  ? 7.501   16.079  24.872 1.00 12.08 ? 160 GLN B CA  1 
ATOM   1607 C  C   . GLN B 1 53  ? 8.123   17.260  25.576 1.00 14.52 ? 160 GLN B C   1 
ATOM   1608 O  O   . GLN B 1 53  ? 9.049   17.073  26.346 1.00 14.88 ? 160 GLN B O   1 
ATOM   1609 C  CB  . GLN B 1 53  ? 6.380   15.515  25.749 1.00 12.71 ? 160 GLN B CB  1 
ATOM   1610 C  CG  . GLN B 1 53  ? 5.344   14.657  25.056 1.00 14.23 ? 160 GLN B CG  1 
ATOM   1611 C  CD  . GLN B 1 53  ? 5.750   13.208  24.923 1.00 15.40 ? 160 GLN B CD  1 
ATOM   1612 O  OE1 . GLN B 1 53  ? 6.457   12.684  25.786 1.00 20.81 ? 160 GLN B OE1 1 
ATOM   1613 N  NE2 . GLN B 1 53  ? 5.282   12.542  23.860 1.00 14.44 ? 160 GLN B NE2 1 
ATOM   1614 N  N   . ILE B 1 54  ? 7.651   18.481  25.264 1.00 13.66 ? 161 ILE B N   1 
ATOM   1615 C  CA  . ILE B 1 54  ? 7.927   19.632  26.097 1.00 13.90 ? 161 ILE B CA  1 
ATOM   1616 C  C   . ILE B 1 54  ? 6.621   20.190  26.623 1.00 13.88 ? 161 ILE B C   1 
ATOM   1617 O  O   . ILE B 1 54  ? 5.703   20.441  25.850 1.00 14.10 ? 161 ILE B O   1 
ATOM   1618 C  CB  . ILE B 1 54  ? 8.696   20.710  25.346 1.00 13.43 ? 161 ILE B CB  1 
ATOM   1619 C  CG1 . ILE B 1 54  ? 10.012  20.144  24.830 1.00 15.68 ? 161 ILE B CG1 1 
ATOM   1620 C  CG2 . ILE B 1 54  ? 8.934   21.899  26.295 1.00 18.05 ? 161 ILE B CG2 1 
ATOM   1621 C  CD1 . ILE B 1 54  ? 10.814  21.117  23.955 1.00 17.98 ? 161 ILE B CD1 1 
ATOM   1622 N  N   . ASN B 1 55  ? 6.517   20.368  27.943 1.00 14.51 ? 162 ASN B N   1 
ATOM   1623 C  CA  . ASN B 1 55  ? 5.271   20.829  28.541 1.00 17.32 ? 162 ASN B CA  1 
ATOM   1624 C  C   . ASN B 1 55  ? 4.073   20.074  28.036 1.00 19.47 ? 162 ASN B C   1 
ATOM   1625 O  O   . ASN B 1 55  ? 3.060   20.658  27.749 1.00 19.48 ? 162 ASN B O   1 
ATOM   1626 C  CB  . ASN B 1 55  ? 5.070   22.319  28.333 1.00 18.09 ? 162 ASN B CB  1 
ATOM   1627 C  CG  . ASN B 1 55  ? 6.067   23.133  29.138 1.00 18.15 ? 162 ASN B CG  1 
ATOM   1628 O  OD1 . ASN B 1 55  ? 6.452   22.727  30.241 1.00 18.24 ? 162 ASN B OD1 1 
ATOM   1629 N  ND2 . ASN B 1 55  ? 6.515   24.221  28.589 1.00 17.99 ? 162 ASN B ND2 1 
ATOM   1630 N  N   . GLY B 1 56  ? 4.245   18.771  27.877 1.00 20.60 ? 163 GLY B N   1 
ATOM   1631 C  CA  . GLY B 1 56  ? 3.142   17.889  27.535 1.00 22.36 ? 163 GLY B CA  1 
ATOM   1632 C  C   . GLY B 1 56  ? 2.761   17.822  26.077 1.00 20.86 ? 163 GLY B C   1 
ATOM   1633 O  O   . GLY B 1 56  ? 1.831   17.085  25.735 1.00 23.18 ? 163 GLY B O   1 
ATOM   1634 N  N   . GLU B 1 57  ? 3.440   18.578  25.223 1.00 18.34 ? 164 GLU B N   1 
ATOM   1635 C  CA  . GLU B 1 57  ? 3.178   18.556  23.784 1.00 14.63 ? 164 GLU B CA  1 
ATOM   1636 C  C   . GLU B 1 57  ? 4.241   17.727  23.051 1.00 12.31 ? 164 GLU B C   1 
ATOM   1637 O  O   . GLU B 1 57  ? 5.405   17.798  23.359 1.00 12.18 ? 164 GLU B O   1 
ATOM   1638 C  CB  . GLU B 1 57  ? 3.188   19.979  23.264 1.00 19.58 ? 164 GLU B CB  1 
ATOM   1639 C  CG  . GLU B 1 57  ? 2.203   20.877  24.019 1.00 27.37 ? 164 GLU B CG  1 
ATOM   1640 C  CD  . GLU B 1 57  ? 0.751   20.621  23.636 1.00 39.28 ? 164 GLU B CD  1 
ATOM   1641 O  OE1 . GLU B 1 57  ? 0.483   20.531  22.419 1.00 45.27 ? 164 GLU B OE1 1 
ATOM   1642 O  OE2 . GLU B 1 57  ? -0.117  20.497  24.537 1.00 43.05 ? 164 GLU B OE2 1 
ATOM   1643 N  N   . ASN B 1 58  ? 3.819   16.901  22.112 1.00 13.11 ? 165 ASN B N   1 
ATOM   1644 C  CA  . ASN B 1 58  ? 4.717   16.120  21.293 1.00 15.52 ? 165 ASN B CA  1 
ATOM   1645 C  C   . ASN B 1 58  ? 5.652   16.942  20.433 1.00 15.07 ? 165 ASN B C   1 
ATOM   1646 O  O   . ASN B 1 58  ? 5.257   17.881  19.751 1.00 16.69 ? 165 ASN B O   1 
ATOM   1647 C  CB  . ASN B 1 58  ? 3.944   15.225  20.344 1.00 15.22 ? 165 ASN B CB  1 
ATOM   1648 C  CG  . ASN B 1 58  ? 3.027   14.237  21.049 1.00 21.63 ? 165 ASN B CG  1 
ATOM   1649 O  OD1 . ASN B 1 58  ? 3.278   13.762  22.157 1.00 15.88 ? 165 ASN B OD1 1 
ATOM   1650 N  ND2 . ASN B 1 58  ? 1.913   13.975  20.411 1.00 19.09 ? 165 ASN B ND2 1 
ATOM   1651 N  N   . CYS B 1 59  ? 6.900   16.513  20.412 1.00 13.34 ? 166 CYS B N   1 
ATOM   1652 C  CA  . CYS B 1 59  ? 7.946   17.169  19.666 1.00 13.54 ? 166 CYS B CA  1 
ATOM   1653 C  C   . CYS B 1 59  ? 7.981   16.597  18.256 1.00 12.15 ? 166 CYS B C   1 
ATOM   1654 O  O   . CYS B 1 59  ? 8.608   17.171  17.376 1.00 17.62 ? 166 CYS B O   1 
ATOM   1655 C  CB  . CYS B 1 59  ? 9.286   16.934  20.375 1.00 16.06 ? 166 CYS B CB  1 
ATOM   1656 S  SG  . CYS B 1 59  ? 9.500   17.859  21.893 1.00 16.71 ? 166 CYS B SG  1 
ATOM   1657 N  N   . ALA B 1 60  ? 7.303   15.479  17.997 1.00 13.05 ? 167 ALA B N   1 
ATOM   1658 C  CA  . ALA B 1 60  ? 7.407   14.820  16.680 1.00 11.27 ? 167 ALA B CA  1 
ATOM   1659 C  C   . ALA B 1 60  ? 7.142   15.774  15.536 1.00 11.42 ? 167 ALA B C   1 
ATOM   1660 O  O   . ALA B 1 60  ? 6.183   16.492  15.590 1.00 12.28 ? 167 ALA B O   1 
ATOM   1661 C  CB  . ALA B 1 60  ? 6.464   13.631  16.551 1.00 12.23 ? 167 ALA B CB  1 
ATOM   1662 N  N   . GLY B 1 61  ? 8.056   15.853  14.577 1.00 11.77 ? 168 GLY B N   1 
ATOM   1663 C  CA  . GLY B 1 61  ? 7.896   16.682  13.409 1.00 11.02 ? 168 GLY B CA  1 
ATOM   1664 C  C   . GLY B 1 61  ? 8.292   18.134  13.522 1.00 11.99 ? 168 GLY B C   1 
ATOM   1665 O  O   . GLY B 1 61  ? 8.204   18.823  12.526 1.00 12.91 ? 168 GLY B O   1 
ATOM   1666 N  N   . TRP B 1 62  ? 8.560   18.630  14.721 1.00 14.30 ? 169 TRP B N   1 
ATOM   1667 C  CA  . TRP B 1 62  ? 8.969   20.014  14.923 1.00 15.56 ? 169 TRP B CA  1 
ATOM   1668 C  C   . TRP B 1 62  ? 10.267  20.250  14.190 1.00 14.02 ? 169 TRP B C   1 
ATOM   1669 O  O   . TRP B 1 62  ? 11.150  19.390  14.144 1.00 14.99 ? 169 TRP B O   1 
ATOM   1670 C  CB  . TRP B 1 62  ? 9.181   20.305  16.407 1.00 14.82 ? 169 TRP B CB  1 
ATOM   1671 C  CG  . TRP B 1 62  ? 7.978   20.413  17.231 1.00 14.77 ? 169 TRP B CG  1 
ATOM   1672 C  CD1 . TRP B 1 62  ? 6.680   20.165  16.868 1.00 17.67 ? 169 TRP B CD1 1 
ATOM   1673 C  CD2 . TRP B 1 62  ? 7.952   20.754  18.599 1.00 14.25 ? 169 TRP B CD2 1 
ATOM   1674 N  NE1 . TRP B 1 62  ? 5.852   20.307  17.957 1.00 17.71 ? 169 TRP B NE1 1 
ATOM   1675 C  CE2 . TRP B 1 62  ? 6.611   20.686  19.029 1.00 16.11 ? 169 TRP B CE2 1 
ATOM   1676 C  CE3 . TRP B 1 62  ? 8.939   21.120  19.519 1.00 19.75 ? 169 TRP B CE3 1 
ATOM   1677 C  CZ2 . TRP B 1 62  ? 6.228   20.970  20.321 1.00 16.92 ? 169 TRP B CZ2 1 
ATOM   1678 C  CZ3 . TRP B 1 62  ? 8.558   21.401  20.807 1.00 17.13 ? 169 TRP B CZ3 1 
ATOM   1679 C  CH2 . TRP B 1 62  ? 7.222   21.311  21.205 1.00 14.81 ? 169 TRP B CH2 1 
ATOM   1680 N  N   . SER B 1 63  ? 10.361  21.385  13.518 1.00 15.11 ? 170 SER B N   1 
ATOM   1681 C  CA  . SER B 1 63  ? 11.616  21.842  12.981 1.00 13.38 ? 170 SER B CA  1 
ATOM   1682 C  C   . SER B 1 63  ? 12.535  22.317  14.100 1.00 12.77 ? 170 SER B C   1 
ATOM   1683 O  O   . SER B 1 63  ? 12.103  22.562  15.202 1.00 15.30 ? 170 SER B O   1 
ATOM   1684 C  CB  . SER B 1 63  ? 11.359  22.966  11.982 1.00 13.40 ? 170 SER B CB  1 
ATOM   1685 O  OG  . SER B 1 63  ? 10.875  24.130  12.620 1.00 14.32 ? 170 SER B OG  1 
ATOM   1686 N  N   . SER B 1 64  ? 13.808  22.541  13.784 1.00 14.50 ? 171 SER B N   1 
ATOM   1687 C  CA  . SER B 1 64  ? 14.748  23.119  14.737 1.00 12.16 ? 171 SER B CA  1 
ATOM   1688 C  C   . SER B 1 64  ? 14.377  24.512  15.212 1.00 10.95 ? 171 SER B C   1 
ATOM   1689 O  O   . SER B 1 64  ? 14.425  24.788  16.420 1.00 15.91 ? 171 SER B O   1 
ATOM   1690 C  CB  . SER B 1 64  ? 16.144  23.106  14.150 1.00 13.15 ? 171 SER B CB  1 
ATOM   1691 O  OG  . SER B 1 64  ? 16.541  21.820  13.728 1.00 13.30 ? 171 SER B OG  1 
ATOM   1692 N  N   . ASP B 1 65  ? 13.909  25.349  14.300 1.00 12.67 ? 172 ASP B N   1 
ATOM   1693 C  CA  . ASP B 1 65  ? 13.498  26.712  14.625 1.00 12.80 ? 172 ASP B CA  1 
ATOM   1694 C  C   . ASP B 1 65  ? 12.246  26.653  15.493 1.00 13.59 ? 172 ASP B C   1 
ATOM   1695 O  O   . ASP B 1 65  ? 12.090  27.435  16.415 1.00 13.58 ? 172 ASP B O   1 
ATOM   1696 C  CB  . ASP B 1 65  ? 13.129  27.509  13.379 1.00 12.85 ? 172 ASP B CB  1 
ATOM   1697 C  CG  . ASP B 1 65  ? 14.339  27.930  12.541 1.00 10.93 ? 172 ASP B CG  1 
ATOM   1698 O  OD1 . ASP B 1 65  ? 15.505  27.598  12.870 1.00 15.17 ? 172 ASP B OD1 1 
ATOM   1699 O  OD2 . ASP B 1 65  ? 14.169  28.515  11.470 1.00 11.32 ? 172 ASP B OD2 1 
ATOM   1700 N  N   . LYS B 1 66  ? 11.302  25.772  15.178 1.00 14.73 ? 173 LYS B N   1 
ATOM   1701 C  CA  . LYS B 1 66  ? 10.111  25.682  16.050 1.00 12.40 ? 173 LYS B CA  1 
ATOM   1702 C  C   . LYS B 1 66  ? 10.523  25.296  17.458 1.00 10.75 ? 173 LYS B C   1 
ATOM   1703 O  O   . LYS B 1 66  ? 10.065  25.838  18.471 1.00 14.89 ? 173 LYS B O   1 
ATOM   1704 C  CB  . LYS B 1 66  ? 9.085   24.719  15.509 1.00 12.43 ? 173 LYS B CB  1 
ATOM   1705 C  CG  . LYS B 1 66  ? 7.899   24.587  16.491 1.00 16.25 ? 173 LYS B CG  1 
ATOM   1706 C  CD  . LYS B 1 66  ? 6.763   23.838  15.878 1.00 16.77 ? 173 LYS B CD  1 
ATOM   1707 C  CE  . LYS B 1 66  ? 5.651   23.559  16.905 1.00 18.17 ? 173 LYS B CE  1 
ATOM   1708 N  NZ  . LYS B 1 66  ? 4.479   22.946  16.240 1.00 20.85 ? 173 LYS B NZ  1 
ATOM   1709 N  N   . ALA B 1 67  ? 11.402  24.318  17.561 1.00 13.92 ? 174 ALA B N   1 
ATOM   1710 C  CA  . ALA B 1 67  ? 11.826  23.895  18.879 1.00 13.57 ? 174 ALA B CA  1 
ATOM   1711 C  C   . ALA B 1 67  ? 12.505  25.024  19.652 1.00 13.41 ? 174 ALA B C   1 
ATOM   1712 O  O   . ALA B 1 67  ? 12.255  25.188  20.834 1.00 15.82 ? 174 ALA B O   1 
ATOM   1713 C  CB  . ALA B 1 67  ? 12.719  22.681  18.803 1.00 12.81 ? 174 ALA B CB  1 
ATOM   1714 N  N   . HIS B 1 68  ? 13.316  25.821  18.968 1.00 16.98 ? 175 HIS B N   1 
ATOM   1715 C  CA  . HIS B 1 68  ? 13.901  27.034  19.530 1.00 17.19 ? 175 HIS B CA  1 
ATOM   1716 C  C   . HIS B 1 68  ? 12.821  28.000  20.051 1.00 17.98 ? 175 HIS B C   1 
ATOM   1717 O  O   . HIS B 1 68  ? 12.875  28.476  21.182 1.00 20.11 ? 175 HIS B O   1 
ATOM   1718 C  CB  . HIS B 1 68  ? 14.781  27.750  18.509 1.00 17.41 ? 175 HIS B CB  1 
ATOM   1719 C  CG  . HIS B 1 68  ? 15.349  29.035  19.019 1.00 22.51 ? 175 HIS B CG  1 
ATOM   1720 N  ND1 . HIS B 1 68  ? 14.817  30.270  18.713 1.00 36.22 ? 175 HIS B ND1 1 
ATOM   1721 C  CD2 . HIS B 1 68  ? 16.385  29.271  19.859 1.00 35.09 ? 175 HIS B CD2 1 
ATOM   1722 C  CE1 . HIS B 1 68  ? 15.526  31.211  19.312 1.00 35.68 ? 175 HIS B CE1 1 
ATOM   1723 N  NE2 . HIS B 1 68  ? 16.483  30.631  20.014 1.00 34.24 ? 175 HIS B NE2 1 
ATOM   1724 N  N   . LYS B 1 69  ? 11.818  28.249  19.226 1.00 19.63 ? 176 LYS B N   1 
ATOM   1725 C  CA  . LYS B 1 69  ? 10.719  29.140  19.564 1.00 20.17 ? 176 LYS B CA  1 
ATOM   1726 C  C   . LYS B 1 69  ? 9.931   28.651  20.773 1.00 19.26 ? 176 LYS B C   1 
ATOM   1727 O  O   . LYS B 1 69  ? 9.564   29.446  21.631 1.00 16.65 ? 176 LYS B O   1 
ATOM   1728 C  CB  . LYS B 1 69  ? 9.809   29.302  18.357 1.00 21.85 ? 176 LYS B CB  1 
ATOM   1729 C  CG  . LYS B 1 69  ? 8.578   30.196  18.595 1.00 31.33 ? 176 LYS B CG  1 
ATOM   1730 C  CD  . LYS B 1 69  ? 8.240   31.145  17.426 1.00 39.05 ? 176 LYS B CD  1 
ATOM   1731 C  CE  . LYS B 1 69  ? 7.771   30.384  16.180 1.00 46.29 ? 176 LYS B CE  1 
ATOM   1732 N  NZ  . LYS B 1 69  ? 6.332   30.622  15.783 1.00 49.97 ? 176 LYS B NZ  1 
ATOM   1733 N  N   . VAL B 1 70  ? 9.671   27.344  20.847 1.00 19.41 ? 177 VAL B N   1 
ATOM   1734 C  CA  . VAL B 1 70  ? 8.877   26.793  21.932 1.00 18.51 ? 177 VAL B CA  1 
ATOM   1735 C  C   . VAL B 1 70  ? 9.552   27.051  23.266 1.00 21.30 ? 177 VAL B C   1 
ATOM   1736 O  O   . VAL B 1 70  ? 8.898   27.526  24.174 1.00 22.28 ? 177 VAL B O   1 
ATOM   1737 C  CB  . VAL B 1 70  ? 8.554   25.309  21.733 1.00 19.93 ? 177 VAL B CB  1 
ATOM   1738 C  CG1 . VAL B 1 70  ? 7.978   24.696  22.983 1.00 21.92 ? 177 VAL B CG1 1 
ATOM   1739 C  CG2 . VAL B 1 70  ? 7.611   25.144  20.586 1.00 16.95 ? 177 VAL B CG2 1 
ATOM   1740 N  N   . LEU B 1 71  ? 10.861  26.804  23.322 1.00 22.07 ? 178 LEU B N   1 
ATOM   1741 C  CA  . LEU B 1 71  ? 11.686  27.045  24.488 1.00 24.35 ? 178 LEU B CA  1 
ATOM   1742 C  C   . LEU B 1 71  ? 11.769  28.537  24.827 1.00 23.98 ? 178 LEU B C   1 
ATOM   1743 O  O   . LEU B 1 71  ? 11.576  28.931  25.956 1.00 27.09 ? 178 LEU B O   1 
ATOM   1744 C  CB  . LEU B 1 71  ? 13.100  26.529  24.230 1.00 24.20 ? 178 LEU B CB  1 
ATOM   1745 C  CG  . LEU B 1 71  ? 13.334  25.031  24.097 1.00 24.03 ? 178 LEU B CG  1 
ATOM   1746 C  CD1 . LEU B 1 71  ? 14.841  24.791  24.040 1.00 25.94 ? 178 LEU B CD1 1 
ATOM   1747 C  CD2 . LEU B 1 71  ? 12.676  24.273  25.182 1.00 21.72 ? 178 LEU B CD2 1 
ATOM   1748 N  N   . LYS B 1 72  ? 11.983  29.376  23.830 1.00 25.41 ? 179 LYS B N   1 
ATOM   1749 C  CA  . LYS B 1 72  ? 11.968  30.818  24.035 1.00 26.38 ? 179 LYS B CA  1 
ATOM   1750 C  C   . LYS B 1 72  ? 10.679  31.301  24.684 1.00 25.48 ? 179 LYS B C   1 
ATOM   1751 O  O   . LYS B 1 72  ? 10.737  32.014  25.679 1.00 26.75 ? 179 LYS B O   1 
ATOM   1752 C  CB  . LYS B 1 72  ? 12.247  31.566  22.726 1.00 27.79 ? 179 LYS B CB  1 
ATOM   1753 C  CG  . LYS B 1 72  ? 12.348  33.064  22.901 1.00 30.22 ? 179 LYS B CG  1 
ATOM   1754 C  CD  . LYS B 1 72  ? 12.982  33.727  21.684 1.00 39.52 ? 179 LYS B CD  1 
ATOM   1755 C  CE  . LYS B 1 72  ? 13.098  35.239  21.864 1.00 39.74 ? 179 LYS B CE  1 
ATOM   1756 N  NZ  . LYS B 1 72  ? 13.193  35.947  20.553 1.00 46.23 ? 179 LYS B NZ  1 
ATOM   1757 N  N   . GLN B 1 73  ? 9.531   30.888  24.152 1.00 26.03 ? 180 GLN B N   1 
ATOM   1758 C  CA  . GLN B 1 73  ? 8.232   31.286  24.668 1.00 26.87 ? 180 GLN B CA  1 
ATOM   1759 C  C   . GLN B 1 73  ? 7.782   30.657  25.989 1.00 26.72 ? 180 GLN B C   1 
ATOM   1760 O  O   . GLN B 1 73  ? 6.839   31.135  26.598 1.00 28.49 ? 180 GLN B O   1 
ATOM   1761 C  CB  . GLN B 1 73  ? 7.150   31.001  23.639 1.00 27.87 ? 180 GLN B CB  1 
ATOM   1762 C  CG  . GLN B 1 73  ? 7.205   31.863  22.376 1.00 30.49 ? 180 GLN B CG  1 
ATOM   1763 C  CD  . GLN B 1 73  ? 6.026   31.580  21.489 1.00 32.60 ? 180 GLN B CD  1 
ATOM   1764 O  OE1 . GLN B 1 73  ? 5.055   30.961  21.936 1.00 41.19 ? 180 GLN B OE1 1 
ATOM   1765 N  NE2 . GLN B 1 73  ? 6.089   32.033  20.236 1.00 38.28 ? 180 GLN B NE2 1 
ATOM   1766 N  N   . ALA B 1 74  ? 8.401   29.569  26.409 1.00 24.44 ? 181 ALA B N   1 
ATOM   1767 C  CA  . ALA B 1 74  ? 7.916   28.826  27.580 1.00 23.31 ? 181 ALA B CA  1 
ATOM   1768 C  C   . ALA B 1 74  ? 8.076   29.605  28.880 1.00 23.26 ? 181 ALA B C   1 
ATOM   1769 O  O   . ALA B 1 74  ? 9.136   30.150  29.171 1.00 20.74 ? 181 ALA B O   1 
ATOM   1770 C  CB  . ALA B 1 74  ? 8.667   27.561  27.725 1.00 20.98 ? 181 ALA B CB  1 
ATOM   1771 N  N   . PHE B 1 75  ? 7.012   29.582  29.671 1.00 24.59 ? 182 PHE B N   1 
ATOM   1772 C  CA  . PHE B 1 75  ? 7.029   30.024  31.065 1.00 23.71 ? 182 PHE B CA  1 
ATOM   1773 C  C   . PHE B 1 75  ? 8.222   29.470  31.833 1.00 23.22 ? 182 PHE B C   1 
ATOM   1774 O  O   . PHE B 1 75  ? 8.382   28.247  31.931 1.00 27.11 ? 182 PHE B O   1 
ATOM   1775 C  CB  . PHE B 1 75  ? 5.725   29.563  31.709 1.00 21.82 ? 182 PHE B CB  1 
ATOM   1776 C  CG  . PHE B 1 75  ? 5.673   29.800  33.194 1.00 27.27 ? 182 PHE B CG  1 
ATOM   1777 C  CD1 . PHE B 1 75  ? 5.821   31.077  33.704 1.00 27.71 ? 182 PHE B CD1 1 
ATOM   1778 C  CD2 . PHE B 1 75  ? 5.496   28.738  34.075 1.00 30.01 ? 182 PHE B CD2 1 
ATOM   1779 C  CE1 . PHE B 1 75  ? 5.784   31.298  35.073 1.00 26.67 ? 182 PHE B CE1 1 
ATOM   1780 C  CE2 . PHE B 1 75  ? 5.460   28.956  35.438 1.00 25.30 ? 182 PHE B CE2 1 
ATOM   1781 C  CZ  . PHE B 1 75  ? 5.596   30.250  35.929 1.00 21.44 ? 182 PHE B CZ  1 
ATOM   1782 N  N   . GLY B 1 76  ? 9.055   30.339  32.403 1.00 22.56 ? 183 GLY B N   1 
ATOM   1783 C  CA  . GLY B 1 76  ? 10.366  29.927  32.871 1.00 21.89 ? 183 GLY B CA  1 
ATOM   1784 C  C   . GLY B 1 76  ? 10.442  29.165  34.196 1.00 21.21 ? 183 GLY B C   1 
ATOM   1785 O  O   . GLY B 1 76  ? 11.375  28.426  34.472 1.00 19.26 ? 183 GLY B O   1 
ATOM   1786 N  N   . GLU B 1 77  ? 9.476   29.349  35.077 1.00 20.95 ? 184 GLU B N   1 
ATOM   1787 C  CA  . GLU B 1 77  ? 9.598   28.711  36.382 1.00 20.08 ? 184 GLU B CA  1 
ATOM   1788 C  C   . GLU B 1 77  ? 9.409   27.196  36.367 1.00 18.93 ? 184 GLU B C   1 
ATOM   1789 O  O   . GLU B 1 77  ? 9.747   26.504  37.329 1.00 21.52 ? 184 GLU B O   1 
ATOM   1790 C  CB  . GLU B 1 77  ? 8.623   29.347  37.385 1.00 19.68 ? 184 GLU B CB  1 
ATOM   1791 C  CG  . GLU B 1 77  ? 8.967   30.782  37.718 1.00 22.44 ? 184 GLU B CG  1 
ATOM   1792 C  CD  . GLU B 1 77  ? 10.258  30.902  38.493 1.00 21.67 ? 184 GLU B CD  1 
ATOM   1793 O  OE1 . GLU B 1 77  ? 10.546  30.034  39.345 1.00 15.82 ? 184 GLU B OE1 1 
ATOM   1794 O  OE2 . GLU B 1 77  ? 10.955  31.911  38.282 1.00 33.21 ? 184 GLU B OE2 1 
ATOM   1795 N  N   . LYS B 1 78  ? 8.824   26.650  35.315 1.00 18.28 ? 185 LYS B N   1 
ATOM   1796 C  CA  . LYS B 1 78  ? 8.565   25.204  35.295 1.00 18.87 ? 185 LYS B CA  1 
ATOM   1797 C  C   . LYS B 1 78  ? 8.376   24.773  33.859 1.00 18.68 ? 185 LYS B C   1 
ATOM   1798 O  O   . LYS B 1 78  ? 7.360   25.099  33.262 1.00 18.56 ? 185 LYS B O   1 
ATOM   1799 C  CB  . LYS B 1 78  ? 7.304   24.860  36.094 1.00 21.54 ? 185 LYS B CB  1 
ATOM   1800 C  CG  . LYS B 1 78  ? 6.889   23.399  36.085 1.00 21.09 ? 185 LYS B CG  1 
ATOM   1801 C  CD  . LYS B 1 78  ? 5.436   23.236  36.444 1.00 24.66 ? 185 LYS B CD  1 
ATOM   1802 C  CE  . LYS B 1 78  ? 4.970   21.791  36.317 1.00 34.86 ? 185 LYS B CE  1 
ATOM   1803 N  NZ  . LYS B 1 78  ? 3.474   21.696  36.467 1.00 38.68 ? 185 LYS B NZ  1 
ATOM   1804 N  N   . ILE B 1 79  ? 9.394   24.107  33.316 1.00 17.69 ? 186 ILE B N   1 
ATOM   1805 C  CA  . ILE B 1 79  ? 9.379   23.543  31.967 1.00 19.03 ? 186 ILE B CA  1 
ATOM   1806 C  C   . ILE B 1 79  ? 9.583   22.058  32.140 1.00 20.68 ? 186 ILE B C   1 
ATOM   1807 O  O   . ILE B 1 79  ? 10.644  21.604  32.573 1.00 23.04 ? 186 ILE B O   1 
ATOM   1808 C  CB  . ILE B 1 79  ? 10.557  24.042  31.142 1.00 19.01 ? 186 ILE B CB  1 
ATOM   1809 C  CG1 . ILE B 1 79  ? 10.633  25.552  31.152 1.00 21.45 ? 186 ILE B CG1 1 
ATOM   1810 C  CG2 . ILE B 1 79  ? 10.507  23.494  29.730 1.00 20.59 ? 186 ILE B CG2 1 
ATOM   1811 C  CD1 . ILE B 1 79  ? 11.852  26.090  30.423 1.00 27.59 ? 186 ILE B CD1 1 
ATOM   1812 N  N   . THR B 1 80  ? 8.545   21.326  31.819 1.00 17.11 ? 187 THR B N   1 
ATOM   1813 C  CA  . THR B 1 80  ? 8.581   19.893  31.793 1.00 19.82 ? 187 THR B CA  1 
ATOM   1814 C  C   . THR B 1 80  ? 9.049   19.330  30.451 1.00 18.44 ? 187 THR B C   1 
ATOM   1815 O  O   . THR B 1 80  ? 8.729   19.860  29.404 1.00 19.57 ? 187 THR B O   1 
ATOM   1816 C  CB  . THR B 1 80  ? 7.200   19.405  32.149 1.00 18.59 ? 187 THR B CB  1 
ATOM   1817 O  OG1 . THR B 1 80  ? 6.878   19.964  33.441 1.00 24.39 ? 187 THR B OG1 1 
ATOM   1818 C  CG2 . THR B 1 80  ? 7.225   17.916  32.421 1.00 26.49 ? 187 THR B CG2 1 
HETATM 1819 N  N   . MSE B 1 81  ? 9.901   18.315  30.507 1.00 19.45 ? 188 MSE B N   1 
HETATM 1820 C  CA  . MSE B 1 81  ? 10.351  17.619  29.308 1.00 18.83 ? 188 MSE B CA  1 
HETATM 1821 C  C   . MSE B 1 81  ? 10.314  16.148  29.606 1.00 17.38 ? 188 MSE B C   1 
HETATM 1822 O  O   . MSE B 1 81  ? 10.603  15.702  30.716 1.00 19.19 ? 188 MSE B O   1 
HETATM 1823 C  CB  . MSE B 1 81  ? 11.741  18.040  28.867 1.00 17.91 ? 188 MSE B CB  1 
HETATM 1824 C  CG  . MSE B 1 81  ? 11.858  19.475  28.585 1.00 25.61 ? 188 MSE B CG  1 
HETATM 1825 SE SE  . MSE B 1 81  ? 13.655  19.754  27.880 1.00 29.58 ? 188 MSE B SE  1 
HETATM 1826 C  CE  . MSE B 1 81  ? 13.607  21.573  28.165 1.00 32.52 ? 188 MSE B CE  1 
ATOM   1827 N  N   . THR B 1 82  ? 9.829   15.395  28.629 1.00 17.31 ? 189 THR B N   1 
ATOM   1828 C  CA  . THR B 1 82  ? 9.979   13.959  28.607 1.00 15.55 ? 189 THR B CA  1 
ATOM   1829 C  C   . THR B 1 82  ? 11.130  13.554  27.683 1.00 11.81 ? 189 THR B C   1 
ATOM   1830 O  O   . THR B 1 82  ? 11.186  13.938  26.513 1.00 15.41 ? 189 THR B O   1 
ATOM   1831 C  CB  . THR B 1 82  ? 8.665   13.356  28.116 1.00 17.63 ? 189 THR B CB  1 
ATOM   1832 O  OG1 . THR B 1 82  ? 7.600   13.792  28.969 1.00 21.25 ? 189 THR B OG1 1 
ATOM   1833 C  CG2 . THR B 1 82  ? 8.704   11.869  28.166 1.00 13.97 ? 189 THR B CG2 1 
ATOM   1834 N  N   . ILE B 1 83  ? 12.063  12.774  28.221 1.00 14.52 ? 190 ILE B N   1 
ATOM   1835 C  CA  . ILE B 1 83  ? 13.394  12.541  27.639 1.00 15.32 ? 190 ILE B CA  1 
ATOM   1836 C  C   . ILE B 1 83  ? 13.632  11.051  27.530 1.00 15.54 ? 190 ILE B C   1 
ATOM   1837 O  O   . ILE B 1 83  ? 13.511  10.352  28.504 1.00 16.39 ? 190 ILE B O   1 
ATOM   1838 C  CB  . ILE B 1 83  ? 14.452  13.076  28.614 1.00 14.96 ? 190 ILE B CB  1 
ATOM   1839 C  CG1 . ILE B 1 83  ? 14.266  14.580  28.761 1.00 17.36 ? 190 ILE B CG1 1 
ATOM   1840 C  CG2 . ILE B 1 83  ? 15.822  12.711  28.167 1.00 21.47 ? 190 ILE B CG2 1 
ATOM   1841 C  CD1 . ILE B 1 83  ? 14.428  15.313  27.518 1.00 20.81 ? 190 ILE B CD1 1 
ATOM   1842 N  N   . ARG B 1 84  ? 14.045  10.582  26.359 1.00 14.16 ? 191 ARG B N   1 
ATOM   1843 C  CA  . ARG B 1 84  ? 14.713  9.312   26.205 1.00 13.90 ? 191 ARG B CA  1 
ATOM   1844 C  C   . ARG B 1 84  ? 16.221  9.520   26.107 1.00 15.02 ? 191 ARG B C   1 
ATOM   1845 O  O   . ARG B 1 84  ? 16.736  10.311  25.319 1.00 14.78 ? 191 ARG B O   1 
ATOM   1846 C  CB  . ARG B 1 84  ? 14.099  8.633   25.009 1.00 14.48 ? 191 ARG B CB  1 
ATOM   1847 C  CG  . ARG B 1 84  ? 14.787  7.462   24.446 1.00 21.95 ? 191 ARG B CG  1 
ATOM   1848 C  CD  . ARG B 1 84  ? 14.087  6.975   23.186 1.00 20.41 ? 191 ARG B CD  1 
ATOM   1849 N  NE  . ARG B 1 84  ? 12.690  6.581   23.405 1.00 20.30 ? 191 ARG B NE  1 
ATOM   1850 C  CZ  . ARG B 1 84  ? 11.743  6.607   22.452 1.00 19.35 ? 191 ARG B CZ  1 
ATOM   1851 N  NH1 . ARG B 1 84  ? 12.043  7.022   21.226 1.00 19.72 ? 191 ARG B NH1 1 
ATOM   1852 N  NH2 . ARG B 1 84  ? 10.519  6.135   22.701 1.00 24.68 ? 191 ARG B NH2 1 
ATOM   1853 N  N   . ASP B 1 85  ? 16.902  8.859   27.030 1.00 14.72 ? 192 ASP B N   1 
ATOM   1854 C  CA  . ASP B 1 85  ? 18.345  8.906   27.190 1.00 19.91 ? 192 ASP B CA  1 
ATOM   1855 C  C   . ASP B 1 85  ? 19.005  8.409   25.916 1.00 20.97 ? 192 ASP B C   1 
ATOM   1856 O  O   . ASP B 1 85  ? 18.580  7.411   25.381 1.00 20.37 ? 192 ASP B O   1 
ATOM   1857 C  CB  . ASP B 1 85  ? 18.759  8.058   28.402 1.00 17.40 ? 192 ASP B CB  1 
ATOM   1858 C  CG  . ASP B 1 85  ? 18.328  8.699   29.681 1.00 22.37 ? 192 ASP B CG  1 
ATOM   1859 O  OD1 . ASP B 1 85  ? 18.280  9.952   29.715 1.00 21.38 ? 192 ASP B OD1 1 
ATOM   1860 O  OD2 . ASP B 1 85  ? 18.001  8.043   30.701 1.00 34.76 ? 192 ASP B OD2 1 
ATOM   1861 N  N   . ARG B 1 86  ? 19.950  9.196   25.413 1.00 21.95 ? 193 ARG B N   1 
ATOM   1862 C  CA  . ARG B 1 86  ? 20.662  8.935   24.186 1.00 24.46 ? 193 ARG B CA  1 
ATOM   1863 C  C   . ARG B 1 86  ? 20.421  7.577   23.556 1.00 25.52 ? 193 ARG B C   1 
ATOM   1864 O  O   . ARG B 1 86  ? 21.056  6.600   23.919 1.00 23.76 ? 193 ARG B O   1 
ATOM   1865 C  CB  . ARG B 1 86  ? 22.162  9.087   24.425 1.00 22.90 ? 193 ARG B CB  1 
ATOM   1866 C  CG  . ARG B 1 86  ? 22.883  9.108   23.117 1.00 28.42 ? 193 ARG B CG  1 
ATOM   1867 C  CD  . ARG B 1 86  ? 24.413  9.166   23.241 1.00 31.80 ? 193 ARG B CD  1 
ATOM   1868 N  NE  . ARG B 1 86  ? 24.858  10.478  23.696 1.00 30.28 ? 193 ARG B NE  1 
ATOM   1869 C  CZ  . ARG B 1 86  ? 25.883  10.695  24.503 1.00 28.64 ? 193 ARG B CZ  1 
ATOM   1870 N  NH1 . ARG B 1 86  ? 26.558  9.657   24.971 1.00 25.46 ? 193 ARG B NH1 1 
ATOM   1871 N  NH2 . ARG B 1 86  ? 26.226  11.953  24.839 1.00 17.71 ? 193 ARG B NH2 1 
ATOM   1872 N  N   . PRO B 1 87  ? 19.438  7.503   22.679 1.00 28.90 ? 194 PRO B N   1 
ATOM   1873 C  CA  . PRO B 1 87  ? 19.029  6.204   22.150 1.00 31.63 ? 194 PRO B CA  1 
ATOM   1874 C  C   . PRO B 1 87  ? 20.018  5.474   21.275 1.00 34.65 ? 194 PRO B C   1 
ATOM   1875 O  O   . PRO B 1 87  ? 20.046  4.256   21.359 1.00 31.86 ? 194 PRO B O   1 
ATOM   1876 C  CB  . PRO B 1 87  ? 17.722  6.494   21.409 1.00 32.75 ? 194 PRO B CB  1 
ATOM   1877 C  CG  . PRO B 1 87  ? 17.712  8.022   21.182 1.00 29.43 ? 194 PRO B CG  1 
ATOM   1878 C  CD  . PRO B 1 87  ? 18.499  8.577   22.326 1.00 28.53 ? 194 PRO B CD  1 
ATOM   1879 N  N   . PHE B 1 88  ? 20.783  6.139   20.429 1.00 39.91 ? 195 PHE B N   1 
ATOM   1880 C  CA  . PHE B 1 88  ? 21.794  5.351   19.750 1.00 45.50 ? 195 PHE B CA  1 
ATOM   1881 C  C   . PHE B 1 88  ? 23.144  5.682   20.376 1.00 45.82 ? 195 PHE B C   1 
ATOM   1882 O  O   . PHE B 1 88  ? 23.535  6.847   20.470 1.00 48.86 ? 195 PHE B O   1 
ATOM   1883 C  CB  . PHE B 1 88  ? 21.651  5.432   18.228 1.00 48.35 ? 195 PHE B CB  1 
ATOM   1884 C  CG  . PHE B 1 88  ? 20.329  4.873   17.743 1.00 52.37 ? 195 PHE B CG  1 
ATOM   1885 C  CD1 . PHE B 1 88  ? 20.136  3.500   17.627 1.00 55.19 ? 195 PHE B CD1 1 
ATOM   1886 C  CD2 . PHE B 1 88  ? 19.253  5.714   17.486 1.00 58.07 ? 195 PHE B CD2 1 
ATOM   1887 C  CE1 . PHE B 1 88  ? 18.918  2.982   17.232 1.00 55.48 ? 195 PHE B CE1 1 
ATOM   1888 C  CE2 . PHE B 1 88  ? 18.026  5.191   17.083 1.00 58.40 ? 195 PHE B CE2 1 
ATOM   1889 C  CZ  . PHE B 1 88  ? 17.863  3.829   16.950 1.00 56.52 ? 195 PHE B CZ  1 
ATOM   1890 N  N   . GLU B 1 89  ? 23.751  4.673   20.988 1.00 44.32 ? 196 GLU B N   1 
ATOM   1891 C  CA  . GLU B 1 89  ? 24.943  4.899   21.813 1.00 43.63 ? 196 GLU B CA  1 
ATOM   1892 C  C   . GLU B 1 89  ? 25.656  3.579   21.931 1.00 41.37 ? 196 GLU B C   1 
ATOM   1893 O  O   . GLU B 1 89  ? 25.039  2.516   22.046 1.00 43.65 ? 196 GLU B O   1 
ATOM   1894 C  CB  . GLU B 1 89  ? 24.609  5.404   23.215 1.00 45.21 ? 196 GLU B CB  1 
ATOM   1895 C  CG  . GLU B 1 89  ? 25.844  5.925   23.944 1.00 48.39 ? 196 GLU B CG  1 
ATOM   1896 C  CD  . GLU B 1 89  ? 25.683  6.040   25.455 1.00 48.74 ? 196 GLU B CD  1 
ATOM   1897 O  OE1 . GLU B 1 89  ? 25.777  7.166   25.972 1.00 46.49 ? 196 GLU B OE1 1 
ATOM   1898 O  OE2 . GLU B 1 89  ? 25.527  5.011   26.135 1.00 54.17 ? 196 GLU B OE2 1 
ATOM   1899 N  N   . ARG B 1 90  ? 26.966  3.618   21.822 1.00 34.30 ? 197 ARG B N   1 
ATOM   1900 C  CA  . ARG B 1 90  ? 27.714  2.389   21.942 1.00 33.04 ? 197 ARG B CA  1 
ATOM   1901 C  C   . ARG B 1 90  ? 28.989  2.915   22.573 1.00 30.91 ? 197 ARG B C   1 
ATOM   1902 O  O   . ARG B 1 90  ? 29.537  3.906   22.123 1.00 28.26 ? 197 ARG B O   1 
ATOM   1903 C  CB  . ARG B 1 90  ? 27.979  1.748   20.573 1.00 34.83 ? 197 ARG B CB  1 
ATOM   1904 C  CG  . ARG B 1 90  ? 28.722  0.396   20.551 1.00 39.30 ? 197 ARG B CG  1 
ATOM   1905 C  CD  . ARG B 1 90  ? 27.835  -0.829  20.853 1.00 39.35 ? 197 ARG B CD  1 
ATOM   1906 N  NE  . ARG B 1 90  ? 28.517  -1.747  21.749 1.00 38.11 ? 197 ARG B NE  1 
ATOM   1907 C  CZ  . ARG B 1 90  ? 27.956  -2.771  22.379 1.00 40.92 ? 197 ARG B CZ  1 
ATOM   1908 N  NH1 . ARG B 1 90  ? 26.658  -3.053  22.253 1.00 38.46 ? 197 ARG B NH1 1 
ATOM   1909 N  NH2 . ARG B 1 90  ? 28.725  -3.539  23.151 1.00 43.26 ? 197 ARG B NH2 1 
ATOM   1910 N  N   . THR B 1 91  ? 29.412  2.242   23.635 1.00 26.20 ? 198 THR B N   1 
ATOM   1911 C  CA  . THR B 1 91  ? 30.638  2.544   24.309 1.00 25.92 ? 198 THR B CA  1 
ATOM   1912 C  C   . THR B 1 91  ? 31.586  1.415   23.990 1.00 24.70 ? 198 THR B C   1 
ATOM   1913 O  O   . THR B 1 91  ? 31.199  0.260   23.996 1.00 23.02 ? 198 THR B O   1 
ATOM   1914 C  CB  . THR B 1 91  ? 30.342  2.617   25.802 1.00 25.07 ? 198 THR B CB  1 
ATOM   1915 O  OG1 . THR B 1 91  ? 29.565  3.794   26.031 1.00 24.00 ? 198 THR B OG1 1 
ATOM   1916 C  CG2 . THR B 1 91  ? 31.598  2.795   26.567 1.00 26.80 ? 198 THR B CG2 1 
ATOM   1917 N  N   . ILE B 1 92  ? 32.799  1.790   23.605 1.00 22.22 ? 199 ILE B N   1 
ATOM   1918 C  CA  . ILE B 1 92  ? 33.809  0.857   23.168 1.00 24.14 ? 199 ILE B CA  1 
ATOM   1919 C  C   . ILE B 1 92  ? 35.082  1.224   23.879 1.00 23.32 ? 199 ILE B C   1 
ATOM   1920 O  O   . ILE B 1 92  ? 35.503  2.389   23.879 1.00 21.82 ? 199 ILE B O   1 
ATOM   1921 C  CB  . ILE B 1 92  ? 34.043  0.927   21.672 1.00 24.77 ? 199 ILE B CB  1 
ATOM   1922 C  CG1 . ILE B 1 92  ? 32.833  0.400   20.915 1.00 30.84 ? 199 ILE B CG1 1 
ATOM   1923 C  CG2 . ILE B 1 92  ? 35.216  0.011   21.308 1.00 27.06 ? 199 ILE B CG2 1 
ATOM   1924 C  CD1 . ILE B 1 92  ? 32.874  0.692   19.443 1.00 24.85 ? 199 ILE B CD1 1 
ATOM   1925 N  N   . THR B 1 93  ? 35.685  0.190   24.449 1.00 23.09 ? 200 THR B N   1 
ATOM   1926 C  CA  . THR B 1 93  ? 36.954  0.236   25.120 1.00 23.32 ? 200 THR B CA  1 
ATOM   1927 C  C   . THR B 1 93  ? 38.130  -0.288  24.304 1.00 23.45 ? 200 THR B C   1 
ATOM   1928 O  O   . THR B 1 93  ? 38.101  -1.353  23.716 1.00 21.68 ? 200 THR B O   1 
ATOM   1929 C  CB  . THR B 1 93  ? 36.828  -0.529  26.416 1.00 26.03 ? 200 THR B CB  1 
ATOM   1930 O  OG1 . THR B 1 93  ? 35.818  0.102   27.201 1.00 28.49 ? 200 THR B OG1 1 
ATOM   1931 C  CG2 . THR B 1 93  ? 38.089  -0.394  27.256 1.00 28.84 ? 200 THR B CG2 1 
HETATM 1932 N  N   . MSE B 1 94  ? 39.171  0.523   24.245 1.00 20.56 ? 201 MSE B N   1 
HETATM 1933 C  CA  . MSE B 1 94  ? 40.314  0.266   23.405 1.00 20.68 ? 201 MSE B CA  1 
HETATM 1934 C  C   . MSE B 1 94  ? 41.580  0.420   24.242 1.00 17.80 ? 201 MSE B C   1 
HETATM 1935 O  O   . MSE B 1 94  ? 41.559  0.957   25.360 1.00 19.07 ? 201 MSE B O   1 
HETATM 1936 C  CB  . MSE B 1 94  ? 40.310  1.217   22.219 1.00 20.97 ? 201 MSE B CB  1 
HETATM 1937 C  CG  . MSE B 1 94  ? 39.456  0.714   21.076 1.00 25.67 ? 201 MSE B CG  1 
HETATM 1938 SE SE  . MSE B 1 94  ? 38.930  2.191   19.942 1.00 29.87 ? 201 MSE B SE  1 
HETATM 1939 C  CE  . MSE B 1 94  ? 37.902  3.274   21.261 1.00 29.80 ? 201 MSE B CE  1 
ATOM   1940 N  N   . HIS B 1 95  ? 42.691  -0.025  23.679 1.00 20.75 ? 202 HIS B N   1 
ATOM   1941 C  CA  . HIS B 1 95  ? 43.993  0.082   24.318 1.00 19.94 ? 202 HIS B CA  1 
ATOM   1942 C  C   . HIS B 1 95  ? 45.015  0.634   23.341 1.00 21.13 ? 202 HIS B C   1 
ATOM   1943 O  O   . HIS B 1 95  ? 45.109  0.190   22.175 1.00 19.93 ? 202 HIS B O   1 
ATOM   1944 C  CB  . HIS B 1 95  ? 44.411  -1.288  24.860 1.00 24.63 ? 202 HIS B CB  1 
ATOM   1945 C  CG  . HIS B 1 95  ? 43.475  -1.820  25.906 1.00 30.38 ? 202 HIS B CG  1 
ATOM   1946 N  ND1 . HIS B 1 95  ? 42.343  -2.542  25.598 1.00 39.61 ? 202 HIS B ND1 1 
ATOM   1947 C  CD2 . HIS B 1 95  ? 43.490  -1.713  27.258 1.00 39.19 ? 202 HIS B CD2 1 
ATOM   1948 C  CE1 . HIS B 1 95  ? 41.709  -2.873  26.712 1.00 38.84 ? 202 HIS B CE1 1 
ATOM   1949 N  NE2 . HIS B 1 95  ? 42.387  -2.386  27.734 1.00 40.10 ? 202 HIS B NE2 1 
ATOM   1950 N  N   . LYS B 1 96  ? 45.763  1.647   23.784 1.00 20.41 ? 203 LYS B N   1 
ATOM   1951 C  CA  . LYS B 1 96  ? 46.857  2.179   22.974 1.00 18.77 ? 203 LYS B CA  1 
ATOM   1952 C  C   . LYS B 1 96  ? 47.958  1.137   22.713 1.00 19.41 ? 203 LYS B C   1 
ATOM   1953 O  O   . LYS B 1 96  ? 48.291  0.292   23.541 1.00 21.18 ? 203 LYS B O   1 
ATOM   1954 C  CB  . LYS B 1 96  ? 47.469  3.407   23.649 1.00 21.46 ? 203 LYS B CB  1 
ATOM   1955 C  CG  . LYS B 1 96  ? 46.577  4.644   23.729 1.00 19.09 ? 203 LYS B CG  1 
ATOM   1956 C  CD  . LYS B 1 96  ? 47.338  5.839   24.243 1.00 24.10 ? 203 LYS B CD  1 
ATOM   1957 C  CE  . LYS B 1 96  ? 46.622  7.166   23.913 1.00 22.96 ? 203 LYS B CE  1 
ATOM   1958 N  NZ  . LYS B 1 96  ? 47.245  8.306   24.658 1.00 19.16 ? 203 LYS B NZ  1 
ATOM   1959 N  N   . ASP B 1 97  ? 48.486  1.154   21.501 1.00 19.53 ? 204 ASP B N   1 
ATOM   1960 C  CA  . ASP B 1 97  ? 49.650  0.351   21.198 1.00 21.38 ? 204 ASP B CA  1 
ATOM   1961 C  C   . ASP B 1 97  ? 50.966  0.957   21.738 1.00 21.25 ? 204 ASP B C   1 
ATOM   1962 O  O   . ASP B 1 97  ? 50.940  1.974   22.427 1.00 18.19 ? 204 ASP B O   1 
ATOM   1963 C  CB  . ASP B 1 97  ? 49.678  0.080   19.697 1.00 21.74 ? 204 ASP B CB  1 
ATOM   1964 C  CG  . ASP B 1 97  ? 50.045  1.283   18.892 1.00 21.10 ? 204 ASP B CG  1 
ATOM   1965 O  OD1 . ASP B 1 97  ? 50.454  2.331   19.437 1.00 27.77 ? 204 ASP B OD1 1 
ATOM   1966 O  OD2 . ASP B 1 97  ? 49.973  1.255   17.654 1.00 26.27 ? 204 ASP B OD2 1 
ATOM   1967 N  N   . SER B 1 98  ? 52.092  0.287   21.459 1.00 20.04 ? 205 SER B N   1 
ATOM   1968 C  CA  . SER B 1 98  ? 53.394  0.645   22.003 1.00 21.50 ? 205 SER B CA  1 
ATOM   1969 C  C   . SER B 1 98  ? 53.880  2.021   21.562 1.00 22.83 ? 205 SER B C   1 
ATOM   1970 O  O   . SER B 1 98  ? 54.841  2.512   22.125 1.00 24.15 ? 205 SER B O   1 
ATOM   1971 C  CB  . SER B 1 98  ? 54.446  -0.422  21.655 1.00 21.13 ? 205 SER B CB  1 
ATOM   1972 O  OG  . SER B 1 98  ? 54.428  -0.755  20.267 1.00 24.93 ? 205 SER B OG  1 
ATOM   1973 N  N   . THR B 1 99  ? 53.229  2.655   20.589 1.00 22.50 ? 206 THR B N   1 
ATOM   1974 C  CA  . THR B 1 99  ? 53.598  4.017   20.253 1.00 24.75 ? 206 THR B CA  1 
ATOM   1975 C  C   . THR B 1 99  ? 52.447  4.999   20.414 1.00 24.43 ? 206 THR B C   1 
ATOM   1976 O  O   . THR B 1 99  ? 52.485  6.092   19.878 1.00 24.70 ? 206 THR B O   1 
ATOM   1977 C  CB  . THR B 1 99  ? 54.227  4.103   18.852 1.00 24.47 ? 206 THR B CB  1 
ATOM   1978 O  OG1 . THR B 1 99  ? 53.367  3.485   17.891 1.00 28.19 ? 206 THR B OG1 1 
ATOM   1979 C  CG2 . THR B 1 99  ? 55.542  3.331   18.766 1.00 26.36 ? 206 THR B CG2 1 
ATOM   1980 N  N   . GLY B 1 100 ? 51.446  4.630   21.199 1.00 24.36 ? 207 GLY B N   1 
ATOM   1981 C  CA  . GLY B 1 100 ? 50.428  5.561   21.642 1.00 25.96 ? 207 GLY B CA  1 
ATOM   1982 C  C   . GLY B 1 100 ? 49.140  5.647   20.844 1.00 27.19 ? 207 GLY B C   1 
ATOM   1983 O  O   . GLY B 1 100 ? 48.337  6.520   21.118 1.00 27.01 ? 207 GLY B O   1 
ATOM   1984 N  N   . HIS B 1 101 ? 48.921  4.738   19.893 1.00 26.11 ? 208 HIS B N   1 
ATOM   1985 C  CA  . HIS B 1 101 ? 47.795  4.816   18.956 1.00 25.12 ? 208 HIS B CA  1 
ATOM   1986 C  C   . HIS B 1 101 ? 46.746  3.762   19.318 1.00 23.66 ? 208 HIS B C   1 
ATOM   1987 O  O   . HIS B 1 101 ? 47.072  2.641   19.673 1.00 22.65 ? 208 HIS B O   1 
ATOM   1988 C  CB  . HIS B 1 101 ? 48.270  4.493   17.526 1.00 28.06 ? 208 HIS B CB  1 
ATOM   1989 C  CG  . HIS B 1 101 ? 49.507  5.227   17.099 1.00 32.31 ? 208 HIS B CG  1 
ATOM   1990 N  ND1 . HIS B 1 101 ? 49.512  6.577   16.820 1.00 41.79 ? 208 HIS B ND1 1 
ATOM   1991 C  CD2 . HIS B 1 101 ? 50.768  4.791   16.866 1.00 36.12 ? 208 HIS B CD2 1 
ATOM   1992 C  CE1 . HIS B 1 101 ? 50.725  6.943   16.446 1.00 42.87 ? 208 HIS B CE1 1 
ATOM   1993 N  NE2 . HIS B 1 101 ? 51.503  5.875   16.453 1.00 41.43 ? 208 HIS B NE2 1 
ATOM   1994 N  N   . VAL B 1 102 ? 45.471  4.112   19.197 1.00 23.44 ? 209 VAL B N   1 
ATOM   1995 C  CA  . VAL B 1 102 ? 44.357  3.203   19.425 1.00 25.97 ? 209 VAL B CA  1 
ATOM   1996 C  C   . VAL B 1 102 ? 43.854  2.662   18.096 1.00 25.46 ? 209 VAL B C   1 
ATOM   1997 O  O   . VAL B 1 102 ? 43.438  1.477   17.980 1.00 24.54 ? 209 VAL B O   1 
ATOM   1998 C  CB  . VAL B 1 102 ? 43.321  3.916   20.318 1.00 29.75 ? 209 VAL B CB  1 
ATOM   1999 C  CG1 . VAL B 1 102 ? 41.934  3.899   19.790 1.00 31.78 ? 209 VAL B CG1 1 
ATOM   2000 C  CG2 . VAL B 1 102 ? 43.369  3.266   21.703 1.00 32.27 ? 209 VAL B CG2 1 
ATOM   2001 N  N   . GLY B 1 103 ? 44.036  3.491   17.073 1.00 24.00 ? 210 GLY B N   1 
ATOM   2002 C  CA  . GLY B 1 103 ? 43.954  3.046   15.688 1.00 22.95 ? 210 GLY B CA  1 
ATOM   2003 C  C   . GLY B 1 103 ? 42.792  3.601   14.885 1.00 22.27 ? 210 GLY B C   1 
ATOM   2004 O  O   . GLY B 1 103 ? 42.162  2.866   14.135 1.00 20.95 ? 210 GLY B O   1 
ATOM   2005 N  N   . PHE B 1 104 ? 42.450  4.873   15.058 1.00 21.76 ? 211 PHE B N   1 
ATOM   2006 C  CA  . PHE B 1 104 ? 41.498  5.487   14.143 1.00 22.83 ? 211 PHE B CA  1 
ATOM   2007 C  C   . PHE B 1 104 ? 41.834  6.936   13.774 1.00 24.06 ? 211 PHE B C   1 
ATOM   2008 O  O   . PHE B 1 104 ? 42.551  7.609   14.515 1.00 23.14 ? 211 PHE B O   1 
ATOM   2009 C  CB  . PHE B 1 104 ? 40.089  5.428   14.711 1.00 19.89 ? 211 PHE B CB  1 
ATOM   2010 C  CG  . PHE B 1 104 ? 39.889  6.254   15.926 1.00 22.09 ? 211 PHE B CG  1 
ATOM   2011 C  CD1 . PHE B 1 104 ? 39.368  7.541   15.839 1.00 20.21 ? 211 PHE B CD1 1 
ATOM   2012 C  CD2 . PHE B 1 104 ? 40.189  5.748   17.169 1.00 20.22 ? 211 PHE B CD2 1 
ATOM   2013 C  CE1 . PHE B 1 104 ? 39.145  8.267   16.973 1.00 21.93 ? 211 PHE B CE1 1 
ATOM   2014 C  CE2 . PHE B 1 104 ? 39.985  6.503   18.282 1.00 20.46 ? 211 PHE B CE2 1 
ATOM   2015 C  CZ  . PHE B 1 104 ? 39.451  7.751   18.184 1.00 22.30 ? 211 PHE B CZ  1 
ATOM   2016 N  N   . ILE B 1 105 ? 41.287  7.389   12.641 1.00 24.76 ? 212 ILE B N   1 
ATOM   2017 C  CA  . ILE B 1 105 ? 41.424  8.773   12.191 1.00 21.17 ? 212 ILE B CA  1 
ATOM   2018 C  C   . ILE B 1 105 ? 40.054  9.393   12.398 1.00 21.69 ? 212 ILE B C   1 
ATOM   2019 O  O   . ILE B 1 105 ? 39.049  8.738   12.195 1.00 21.09 ? 212 ILE B O   1 
ATOM   2020 C  CB  . ILE B 1 105 ? 41.814  8.832   10.681 1.00 22.33 ? 212 ILE B CB  1 
ATOM   2021 C  CG1 . ILE B 1 105 ? 43.188  8.184   10.415 1.00 29.60 ? 212 ILE B CG1 1 
ATOM   2022 C  CG2 . ILE B 1 105 ? 41.830  10.262  10.159 1.00 19.89 ? 212 ILE B CG2 1 
ATOM   2023 C  CD1 . ILE B 1 105 ? 44.201  8.379   11.498 1.00 34.45 ? 212 ILE B CD1 1 
ATOM   2024 N  N   . PHE B 1 106 ? 39.975  10.643  12.835 1.00 21.20 ? 213 PHE B N   1 
ATOM   2025 C  CA  . PHE B 1 106 ? 38.675  11.303  12.841 1.00 23.22 ? 213 PHE B CA  1 
ATOM   2026 C  C   . PHE B 1 106 ? 38.814  12.705  12.255 1.00 23.55 ? 213 PHE B C   1 
ATOM   2027 O  O   . PHE B 1 106 ? 39.904  13.238  12.145 1.00 21.27 ? 213 PHE B O   1 
ATOM   2028 C  CB  . PHE B 1 106 ? 38.105  11.372  14.248 1.00 21.70 ? 213 PHE B CB  1 
ATOM   2029 C  CG  . PHE B 1 106 ? 38.915  12.197  15.139 1.00 23.59 ? 213 PHE B CG  1 
ATOM   2030 C  CD1 . PHE B 1 106 ? 38.548  13.506  15.425 1.00 27.16 ? 213 PHE B CD1 1 
ATOM   2031 C  CD2 . PHE B 1 106 ? 40.076  11.687  15.668 1.00 26.52 ? 213 PHE B CD2 1 
ATOM   2032 C  CE1 . PHE B 1 106 ? 39.351  14.294  16.201 1.00 25.37 ? 213 PHE B CE1 1 
ATOM   2033 C  CE2 . PHE B 1 106 ? 40.883  12.489  16.465 1.00 30.30 ? 213 PHE B CE2 1 
ATOM   2034 C  CZ  . PHE B 1 106 ? 40.508  13.785  16.742 1.00 28.88 ? 213 PHE B CZ  1 
ATOM   2035 N  N   . LYS B 1 107 ? 37.712  13.265  11.798 1.00 25.01 ? 214 LYS B N   1 
ATOM   2036 C  CA  . LYS B 1 107 ? 37.750  14.603  11.226 1.00 25.66 ? 214 LYS B CA  1 
ATOM   2037 C  C   . LYS B 1 107 ? 36.374  15.164  11.473 1.00 26.32 ? 214 LYS B C   1 
ATOM   2038 O  O   . LYS B 1 107 ? 35.387  14.463  11.403 1.00 23.60 ? 214 LYS B O   1 
ATOM   2039 C  CB  . LYS B 1 107 ? 38.081  14.582  9.757  1.00 27.43 ? 214 LYS B CB  1 
ATOM   2040 N  N   . ASN B 1 108 ? 36.353  16.432  11.845 1.00 27.16 ? 215 ASN B N   1 
ATOM   2041 C  CA  . ASN B 1 108 ? 35.195  17.075  12.426 1.00 28.83 ? 215 ASN B CA  1 
ATOM   2042 C  C   . ASN B 1 108 ? 34.406  16.238  13.426 1.00 26.29 ? 215 ASN B C   1 
ATOM   2043 O  O   . ASN B 1 108 ? 33.191  16.141  13.381 1.00 26.52 ? 215 ASN B O   1 
ATOM   2044 C  CB  . ASN B 1 108 ? 34.362  17.645  11.296 1.00 32.70 ? 215 ASN B CB  1 
ATOM   2045 C  CG  . ASN B 1 108 ? 35.150  18.661  10.475 1.00 37.51 ? 215 ASN B CG  1 
ATOM   2046 O  OD1 . ASN B 1 108 ? 35.603  19.710  10.987 1.00 45.32 ? 215 ASN B OD1 1 
ATOM   2047 N  ND2 . ASN B 1 108 ? 35.358  18.334  9.203  1.00 44.19 ? 215 ASN B ND2 1 
ATOM   2048 N  N   . GLY B 1 109 ? 35.125  15.566  14.316 1.00 24.63 ? 216 GLY B N   1 
ATOM   2049 C  CA  . GLY B 1 109 ? 34.487  14.936  15.447 1.00 23.46 ? 216 GLY B CA  1 
ATOM   2050 C  C   . GLY B 1 109 ? 33.826  13.642  15.052 1.00 23.84 ? 216 GLY B C   1 
ATOM   2051 O  O   . GLY B 1 109 ? 33.221  12.996  15.895 1.00 25.29 ? 216 GLY B O   1 
ATOM   2052 N  N   . LYS B 1 110 ? 34.050  13.223  13.812 1.00 19.85 ? 217 LYS B N   1 
ATOM   2053 C  CA  . LYS B 1 110 ? 33.531  11.978  13.260 1.00 23.23 ? 217 LYS B CA  1 
ATOM   2054 C  C   . LYS B 1 110 ? 34.722  11.097  12.914 1.00 19.92 ? 217 LYS B C   1 
ATOM   2055 O  O   . LYS B 1 110 ? 35.680  11.548  12.314 1.00 23.03 ? 217 LYS B O   1 
ATOM   2056 C  CB  . LYS B 1 110 ? 32.833  12.313  11.943 1.00 24.89 ? 217 LYS B CB  1 
ATOM   2057 C  CG  . LYS B 1 110 ? 31.622  11.522  11.582 1.00 35.83 ? 217 LYS B CG  1 
ATOM   2058 C  CD  . LYS B 1 110 ? 30.726  12.333  10.605 1.00 44.01 ? 217 LYS B CD  1 
ATOM   2059 C  CE  . LYS B 1 110 ? 30.909  11.890  9.142  1.00 47.77 ? 217 LYS B CE  1 
ATOM   2060 N  NZ  . LYS B 1 110 ? 32.340  11.687  8.737  1.00 49.79 ? 217 LYS B NZ  1 
ATOM   2061 N  N   . ILE B 1 111 ? 34.643  9.848   13.302 1.00 20.48 ? 218 ILE B N   1 
ATOM   2062 C  CA  . ILE B 1 111 ? 35.636  8.830   12.986 1.00 19.37 ? 218 ILE B CA  1 
ATOM   2063 C  C   . ILE B 1 111 ? 35.484  8.538   11.500 1.00 20.02 ? 218 ILE B C   1 
ATOM   2064 O  O   . ILE B 1 111 ? 34.374  8.245   11.031 1.00 20.76 ? 218 ILE B O   1 
ATOM   2065 C  CB  . ILE B 1 111 ? 35.314  7.561   13.749 1.00 20.02 ? 218 ILE B CB  1 
ATOM   2066 C  CG1 . ILE B 1 111 ? 35.381  7.851   15.250 1.00 22.94 ? 218 ILE B CG1 1 
ATOM   2067 C  CG2 . ILE B 1 111 ? 36.293  6.409   13.288 1.00 19.13 ? 218 ILE B CG2 1 
ATOM   2068 C  CD1 . ILE B 1 111 ? 34.664  6.871   16.112 1.00 25.12 ? 218 ILE B CD1 1 
ATOM   2069 N  N   . THR B 1 112 ? 36.608  8.562   10.790 1.00 19.13 ? 219 THR B N   1 
ATOM   2070 C  CA  . THR B 1 112 ? 36.626  8.404   9.332  1.00 20.64 ? 219 THR B CA  1 
ATOM   2071 C  C   . THR B 1 112 ? 37.422  7.216   8.808  1.00 20.07 ? 219 THR B C   1 
ATOM   2072 O  O   . THR B 1 112 ? 37.217  6.797   7.681  1.00 20.62 ? 219 THR B O   1 
ATOM   2073 C  CB  . THR B 1 112 ? 37.205  9.655   8.641  1.00 20.02 ? 219 THR B CB  1 
ATOM   2074 O  OG1 . THR B 1 112 ? 38.433  10.036  9.273  1.00 24.12 ? 219 THR B OG1 1 
ATOM   2075 C  CG2 . THR B 1 112 ? 36.311  10.816  8.850  1.00 20.72 ? 219 THR B CG2 1 
ATOM   2076 N  N   . SER B 1 113 ? 38.355  6.710   9.591  1.00 18.21 ? 220 SER B N   1 
ATOM   2077 C  CA  . SER B 1 113 ? 39.115  5.566   9.163  1.00 19.73 ? 220 SER B CA  1 
ATOM   2078 C  C   . SER B 1 113 ? 39.495  4.738   10.365 1.00 18.65 ? 220 SER B C   1 
ATOM   2079 O  O   . SER B 1 113 ? 39.769  5.277   11.429 1.00 18.84 ? 220 SER B O   1 
ATOM   2080 C  CB  . SER B 1 113 ? 40.418  6.048   8.531  1.00 20.46 ? 220 SER B CB  1 
ATOM   2081 O  OG  . SER B 1 113 ? 40.612  5.267   7.402  1.00 28.50 ? 220 SER B OG  1 
ATOM   2082 N  N   . ILE B 1 114 ? 39.497  3.428   10.182 1.00 19.43 ? 221 ILE B N   1 
ATOM   2083 C  CA  . ILE B 1 114 ? 39.955  2.489   11.179 1.00 18.93 ? 221 ILE B CA  1 
ATOM   2084 C  C   . ILE B 1 114 ? 41.281  1.865   10.696 1.00 20.07 ? 221 ILE B C   1 
ATOM   2085 O  O   . ILE B 1 114 ? 41.379  1.378   9.579  1.00 19.02 ? 221 ILE B O   1 
ATOM   2086 C  CB  . ILE B 1 114 ? 38.914  1.383   11.407 1.00 20.45 ? 221 ILE B CB  1 
ATOM   2087 C  CG1 . ILE B 1 114 ? 37.554  1.955   11.768 1.00 19.72 ? 221 ILE B CG1 1 
ATOM   2088 C  CG2 . ILE B 1 114 ? 39.370  0.475   12.480 1.00 17.34 ? 221 ILE B CG2 1 
ATOM   2089 C  CD1 . ILE B 1 114 ? 37.579  2.858   12.939 1.00 25.78 ? 221 ILE B CD1 1 
ATOM   2090 N  N   . VAL B 1 115 ? 42.310  1.878   11.534 1.00 19.43 ? 222 VAL B N   1 
ATOM   2091 C  CA  . VAL B 1 115 ? 43.584  1.302   11.161 1.00 19.43 ? 222 VAL B CA  1 
ATOM   2092 C  C   . VAL B 1 115 ? 43.621  -0.215  11.281 1.00 21.68 ? 222 VAL B C   1 
ATOM   2093 O  O   . VAL B 1 115 ? 43.241  -0.782  12.300 1.00 17.25 ? 222 VAL B O   1 
ATOM   2094 C  CB  . VAL B 1 115 ? 44.715  1.909   11.974 1.00 22.62 ? 222 VAL B CB  1 
ATOM   2095 C  CG1 . VAL B 1 115 ? 46.062  1.245   11.651 1.00 24.94 ? 222 VAL B CG1 1 
ATOM   2096 C  CG2 . VAL B 1 115 ? 44.776  3.372   11.681 1.00 23.56 ? 222 VAL B CG2 1 
ATOM   2097 N  N   . LYS B 1 116 ? 44.119  -0.861  10.226 1.00 21.42 ? 223 LYS B N   1 
ATOM   2098 C  CA  . LYS B 1 116 ? 44.158  -2.313  10.151 1.00 22.52 ? 223 LYS B CA  1 
ATOM   2099 C  C   . LYS B 1 116 ? 44.968  -2.846  11.316 1.00 23.68 ? 223 LYS B C   1 
ATOM   2100 O  O   . LYS B 1 116 ? 46.000  -2.269  11.689 1.00 22.54 ? 223 LYS B O   1 
ATOM   2101 C  CB  . LYS B 1 116 ? 44.724  -2.779  8.795  1.00 24.78 ? 223 LYS B CB  1 
ATOM   2102 C  CG  . LYS B 1 116 ? 43.973  -2.465  7.633  0.00 30.02 ? 223 LYS B CG  1 
ATOM   2103 C  CD  . LYS B 1 116 ? 44.643  -2.963  6.364  0.00 31.29 ? 223 LYS B CD  1 
ATOM   2104 C  CE  . LYS B 1 116 ? 43.782  -2.688  5.142  0.00 31.74 ? 223 LYS B CE  1 
ATOM   2105 N  NZ  . LYS B 1 116 ? 44.426  -3.170  3.890  0.00 33.17 ? 223 LYS B NZ  1 
ATOM   2106 N  N   . ASP B 1 117 ? 44.468  -3.933  11.896 1.00 23.86 ? 224 ASP B N   1 
ATOM   2107 C  CA  . ASP B 1 117 ? 45.142  -4.666  12.961 1.00 25.18 ? 224 ASP B CA  1 
ATOM   2108 C  C   . ASP B 1 117 ? 45.362  -3.863  14.238 1.00 23.01 ? 224 ASP B C   1 
ATOM   2109 O  O   . ASP B 1 117 ? 46.220  -4.220  15.045 1.00 26.09 ? 224 ASP B O   1 
ATOM   2110 C  CB  . ASP B 1 117 ? 46.498  -5.210  12.520 1.00 28.74 ? 224 ASP B CB  1 
ATOM   2111 C  CG  . ASP B 1 117 ? 46.406  -6.314  11.482 1.00 36.32 ? 224 ASP B CG  1 
ATOM   2112 O  OD1 . ASP B 1 117 ? 45.303  -6.844  11.179 1.00 46.34 ? 224 ASP B OD1 1 
ATOM   2113 O  OD2 . ASP B 1 117 ? 47.450  -6.686  10.901 1.00 48.27 ? 224 ASP B OD2 1 
ATOM   2114 N  N   . SER B 1 118 ? 44.621  -2.777  14.432 1.00 21.37 ? 225 SER B N   1 
ATOM   2115 C  CA  . SER B 1 118 ? 44.685  -1.990  15.667 1.00 18.49 ? 225 SER B CA  1 
ATOM   2116 C  C   . SER B 1 118 ? 43.644  -2.409  16.698 1.00 19.54 ? 225 SER B C   1 
ATOM   2117 O  O   . SER B 1 118 ? 42.783  -3.244  16.471 1.00 18.15 ? 225 SER B O   1 
ATOM   2118 C  CB  . SER B 1 118 ? 44.399  -0.546  15.325 1.00 17.51 ? 225 SER B CB  1 
ATOM   2119 O  OG  . SER B 1 118 ? 43.030  -0.392  14.968 1.00 19.24 ? 225 SER B OG  1 
ATOM   2120 N  N   . SER B 1 119 ? 43.746  -1.840  17.873 1.00 18.45 ? 226 SER B N   1 
ATOM   2121 C  CA  . SER B 1 119 ? 42.733  -2.040  18.885 1.00 19.61 ? 226 SER B CA  1 
ATOM   2122 C  C   . SER B 1 119 ? 41.341  -1.577  18.452 1.00 17.13 ? 226 SER B C   1 
ATOM   2123 O  O   . SER B 1 119 ? 40.331  -2.242  18.749 1.00 20.30 ? 226 SER B O   1 
ATOM   2124 C  CB  . SER B 1 119 ? 43.180  -1.337  20.157 1.00 17.41 ? 226 SER B CB  1 
ATOM   2125 O  OG  . SER B 1 119 ? 42.280  -1.591  21.179 1.00 21.00 ? 226 SER B OG  1 
ATOM   2126 N  N   . ALA B 1 120 ? 41.270  -0.506  17.693 1.00 18.07 ? 227 ALA B N   1 
ATOM   2127 C  CA  . ALA B 1 120 ? 39.987  -0.005  17.233 1.00 19.34 ? 227 ALA B CA  1 
ATOM   2128 C  C   . ALA B 1 120 ? 39.429  -1.042  16.238 1.00 18.02 ? 227 ALA B C   1 
ATOM   2129 O  O   . ALA B 1 120 ? 38.234  -1.296  16.225 1.00 18.88 ? 227 ALA B O   1 
ATOM   2130 C  CB  . ALA B 1 120 ? 40.159  1.319   16.542 1.00 21.63 ? 227 ALA B CB  1 
ATOM   2131 N  N   . ALA B 1 121 ? 40.281  -1.659  15.421 1.00 18.91 ? 228 ALA B N   1 
ATOM   2132 C  CA  . ALA B 1 121 ? 39.838  -2.745  14.562 1.00 16.91 ? 228 ALA B CA  1 
ATOM   2133 C  C   . ALA B 1 121 ? 39.347  -3.906  15.383 1.00 19.87 ? 228 ALA B C   1 
ATOM   2134 O  O   . ALA B 1 121 ? 38.278  -4.433  15.107 1.00 19.82 ? 228 ALA B O   1 
ATOM   2135 C  CB  . ALA B 1 121 ? 40.930  -3.237  13.585 1.00 21.14 ? 228 ALA B CB  1 
ATOM   2136 N  N   . ARG B 1 122 ? 40.145  -4.350  16.349 1.00 19.41 ? 229 ARG B N   1 
ATOM   2137 C  CA  . ARG B 1 122 ? 39.773  -5.560  17.058 1.00 18.77 ? 229 ARG B CA  1 
ATOM   2138 C  C   . ARG B 1 122 ? 38.436  -5.346  17.748 1.00 15.77 ? 229 ARG B C   1 
ATOM   2139 O  O   . ARG B 1 122 ? 37.679  -6.307  17.882 1.00 18.26 ? 229 ARG B O   1 
ATOM   2140 C  CB  . ARG B 1 122 ? 40.809  -5.940  18.109 1.00 19.33 ? 229 ARG B CB  1 
ATOM   2141 C  CG  . ARG B 1 122 ? 42.093  -6.458  17.502 1.00 26.97 ? 229 ARG B CG  1 
ATOM   2142 C  CD  . ARG B 1 122 ? 43.070  -7.004  18.507 1.00 28.75 ? 229 ARG B CD  1 
ATOM   2143 N  NE  . ARG B 1 122 ? 43.624  -5.924  19.288 1.00 33.20 ? 229 ARG B NE  1 
ATOM   2144 C  CZ  . ARG B 1 122 ? 44.645  -5.147  18.944 1.00 28.45 ? 229 ARG B CZ  1 
ATOM   2145 N  NH1 . ARG B 1 122 ? 45.290  -5.282  17.804 1.00 30.11 ? 229 ARG B NH1 1 
ATOM   2146 N  NH2 . ARG B 1 122 ? 45.043  -4.227  19.788 1.00 30.32 ? 229 ARG B NH2 1 
ATOM   2147 N  N   . ASN B 1 123 ? 38.123  -4.111  18.144 1.00 15.26 ? 230 ASN B N   1 
ATOM   2148 C  CA  . ASN B 1 123 ? 36.944  -3.865  18.970 1.00 16.76 ? 230 ASN B CA  1 
ATOM   2149 C  C   . ASN B 1 123 ? 35.759  -3.330  18.160 1.00 18.65 ? 230 ASN B C   1 
ATOM   2150 O  O   . ASN B 1 123 ? 34.776  -2.825  18.701 1.00 20.77 ? 230 ASN B O   1 
ATOM   2151 C  CB  . ASN B 1 123 ? 37.291  -2.917  20.097 1.00 17.09 ? 230 ASN B CB  1 
ATOM   2152 C  CG  . ASN B 1 123 ? 38.082  -3.572  21.191 1.00 23.75 ? 230 ASN B CG  1 
ATOM   2153 O  OD1 . ASN B 1 123 ? 37.493  -4.242  22.016 1.00 31.39 ? 230 ASN B OD1 1 
ATOM   2154 N  ND2 . ASN B 1 123 ? 39.406  -3.397  21.211 1.00 24.81 ? 230 ASN B ND2 1 
ATOM   2155 N  N   . GLY B 1 124 ? 35.885  -3.411  16.850 1.00 17.88 ? 231 GLY B N   1 
ATOM   2156 C  CA  . GLY B 1 124 ? 34.821  -2.999  15.964 1.00 19.67 ? 231 GLY B CA  1 
ATOM   2157 C  C   . GLY B 1 124 ? 34.355  -1.562  15.982 1.00 14.99 ? 231 GLY B C   1 
ATOM   2158 O  O   . GLY B 1 124 ? 33.183  -1.332  15.776 1.00 15.76 ? 231 GLY B O   1 
ATOM   2159 N  N   . LEU B 1 125 ? 35.274  -0.613  16.067 1.00 18.41 ? 232 LEU B N   1 
ATOM   2160 C  CA  . LEU B 1 125 ? 34.945  0.785   16.069 1.00 17.05 ? 232 LEU B CA  1 
ATOM   2161 C  C   . LEU B 1 125 ? 34.440  1.081   14.681 1.00 17.07 ? 232 LEU B C   1 
ATOM   2162 O  O   . LEU B 1 125 ? 34.881  0.457   13.749 1.00 17.62 ? 232 LEU B O   1 
ATOM   2163 C  CB  . LEU B 1 125 ? 36.146  1.648   16.439 1.00 20.99 ? 232 LEU B CB  1 
ATOM   2164 C  CG  . LEU B 1 125 ? 35.955  3.151   16.564 1.00 22.60 ? 232 LEU B CG  1 
ATOM   2165 C  CD1 . LEU B 1 125 ? 35.074  3.513   17.708 1.00 26.23 ? 232 LEU B CD1 1 
ATOM   2166 C  CD2 . LEU B 1 125 ? 37.265  3.870   16.638 1.00 25.63 ? 232 LEU B CD2 1 
ATOM   2167 N  N   . LEU B 1 126 ? 33.501  2.021   14.551 1.00 19.97 ? 233 LEU B N   1 
ATOM   2168 C  CA  . LEU B 1 126 ? 32.854  2.319   13.276 1.00 17.13 ? 233 LEU B CA  1 
ATOM   2169 C  C   . LEU B 1 126 ? 33.077  3.713   12.794 1.00 17.85 ? 233 LEU B C   1 
ATOM   2170 O  O   . LEU B 1 126 ? 33.179  4.645   13.595 1.00 21.74 ? 233 LEU B O   1 
ATOM   2171 C  CB  . LEU B 1 126 ? 31.331  2.078   13.413 1.00 16.15 ? 233 LEU B CB  1 
ATOM   2172 C  CG  . LEU B 1 126 ? 31.010  0.647   13.832 1.00 18.02 ? 233 LEU B CG  1 
ATOM   2173 C  CD1 . LEU B 1 126 ? 29.547  0.541   14.256 1.00 24.13 ? 233 LEU B CD1 1 
ATOM   2174 C  CD2 . LEU B 1 126 ? 31.152  -0.372  12.704 1.00 14.36 ? 233 LEU B CD2 1 
ATOM   2175 N  N   . THR B 1 127 ? 33.168  3.877   11.482 1.00 17.05 ? 234 THR B N   1 
ATOM   2176 C  CA  . THR B 1 127 ? 33.225  5.222   10.911 1.00 18.14 ? 234 THR B CA  1 
ATOM   2177 C  C   . THR B 1 127 ? 31.808  5.820   10.771 1.00 17.75 ? 234 THR B C   1 
ATOM   2178 O  O   . THR B 1 127 ? 30.811  5.170   11.096 1.00 19.35 ? 234 THR B O   1 
ATOM   2179 C  CB  . THR B 1 127 ? 33.914  5.248   9.553  1.00 16.33 ? 234 THR B CB  1 
ATOM   2180 O  OG1 . THR B 1 127 ? 33.284  4.329   8.661  1.00 17.55 ? 234 THR B OG1 1 
ATOM   2181 C  CG2 . THR B 1 127 ? 35.402  4.871   9.593  1.00 17.80 ? 234 THR B CG2 1 
ATOM   2182 N  N   . GLU B 1 128 ? 31.750  7.079   10.357 1.00 17.63 ? 235 GLU B N   1 
ATOM   2183 C  CA  . GLU B 1 128 ? 30.534  7.849   10.232 1.00 20.72 ? 235 GLU B CA  1 
ATOM   2184 C  C   . GLU B 1 128 ? 29.755  7.863   11.550 1.00 21.75 ? 235 GLU B C   1 
ATOM   2185 O  O   . GLU B 1 128 ? 28.527  7.859   11.587 1.00 19.69 ? 235 GLU B O   1 
ATOM   2186 C  CB  . GLU B 1 128 ? 29.732  7.333   9.044  1.00 22.20 ? 235 GLU B CB  1 
ATOM   2187 C  CG  . GLU B 1 128 ? 30.321  7.652   7.675  1.00 28.74 ? 235 GLU B CG  1 
ATOM   2188 C  CD  . GLU B 1 128 ? 31.720  7.080   7.434  1.00 43.66 ? 235 GLU B CD  1 
ATOM   2189 O  OE1 . GLU B 1 128 ? 31.820  5.838   7.263  1.00 48.42 ? 235 GLU B OE1 1 
ATOM   2190 O  OE2 . GLU B 1 128 ? 32.725  7.859   7.408  1.00 45.76 ? 235 GLU B OE2 1 
ATOM   2191 N  N   . HIS B 1 129 ? 30.526  7.896   12.632 1.00 22.36 ? 236 HIS B N   1 
ATOM   2192 C  CA  . HIS B 1 129 ? 30.057  7.993   14.001 1.00 20.71 ? 236 HIS B CA  1 
ATOM   2193 C  C   . HIS B 1 129 ? 30.685  9.180   14.714 1.00 18.58 ? 236 HIS B C   1 
ATOM   2194 O  O   . HIS B 1 129 ? 31.874  9.429   14.567 1.00 21.51 ? 236 HIS B O   1 
ATOM   2195 C  CB  . HIS B 1 129 ? 30.406  6.687   14.717 1.00 21.65 ? 236 HIS B CB  1 
ATOM   2196 C  CG  . HIS B 1 129 ? 29.410  5.598   14.479 1.00 26.04 ? 236 HIS B CG  1 
ATOM   2197 N  ND1 . HIS B 1 129 ? 29.149  5.087   13.226 1.00 19.59 ? 236 HIS B ND1 1 
ATOM   2198 C  CD2 . HIS B 1 129 ? 28.551  4.983   15.327 1.00 27.62 ? 236 HIS B CD2 1 
ATOM   2199 C  CE1 . HIS B 1 129 ? 28.185  4.193   13.321 1.00 23.18 ? 236 HIS B CE1 1 
ATOM   2200 N  NE2 . HIS B 1 129 ? 27.815  4.098   14.587 1.00 23.33 ? 236 HIS B NE2 1 
ATOM   2201 N  N   . ASN B 1 130 ? 29.894  9.920   15.491 1.00 18.91 ? 237 ASN B N   1 
ATOM   2202 C  CA  . ASN B 1 130 ? 30.381  11.076  16.204 1.00 20.12 ? 237 ASN B CA  1 
ATOM   2203 C  C   . ASN B 1 130 ? 30.891  10.560  17.519 1.00 22.69 ? 237 ASN B C   1 
ATOM   2204 O  O   . ASN B 1 130 ? 30.313  9.671   18.130 1.00 22.22 ? 237 ASN B O   1 
ATOM   2205 C  CB  . ASN B 1 130 ? 29.263  12.083  16.490 1.00 25.27 ? 237 ASN B CB  1 
ATOM   2206 C  CG  . ASN B 1 130 ? 28.949  12.952  15.296 1.00 21.50 ? 237 ASN B CG  1 
ATOM   2207 O  OD1 . ASN B 1 130 ? 29.846  13.362  14.564 1.00 35.89 ? 237 ASN B OD1 1 
ATOM   2208 N  ND2 . ASN B 1 130 ? 27.677  13.165  15.055 1.00 32.83 ? 237 ASN B ND2 1 
ATOM   2209 N  N   . ILE B 1 131 ? 31.978  11.151  17.952 1.00 20.03 ? 238 ILE B N   1 
ATOM   2210 C  CA  . ILE B 1 131 ? 32.535  10.856  19.251 1.00 23.02 ? 238 ILE B CA  1 
ATOM   2211 C  C   . ILE B 1 131 ? 31.842  11.739  20.297 1.00 22.40 ? 238 ILE B C   1 
ATOM   2212 O  O   . ILE B 1 131 ? 31.897  12.967  20.259 1.00 22.02 ? 238 ILE B O   1 
ATOM   2213 C  CB  . ILE B 1 131 ? 34.054  11.140  19.224 1.00 20.98 ? 238 ILE B CB  1 
ATOM   2214 C  CG1 . ILE B 1 131 ? 34.709  10.294  18.137 1.00 26.98 ? 238 ILE B CG1 1 
ATOM   2215 C  CG2 . ILE B 1 131 ? 34.624  10.842  20.584 1.00 23.23 ? 238 ILE B CG2 1 
ATOM   2216 C  CD1 . ILE B 1 131 ? 36.023  10.832  17.567 1.00 30.92 ? 238 ILE B CD1 1 
ATOM   2217 N  N   . CYS B 1 132 ? 31.217  11.101  21.274 1.00 20.75 ? 239 CYS B N   1 
ATOM   2218 C  CA  . CYS B 1 132 ? 30.490  11.854  22.246 1.00 19.42 ? 239 CYS B CA  1 
ATOM   2219 C  C   . CYS B 1 132 ? 31.280  12.123  23.524 1.00 18.80 ? 239 CYS B C   1 
ATOM   2220 O  O   . CYS B 1 132 ? 31.277  13.241  23.994 1.00 19.00 ? 239 CYS B O   1 
ATOM   2221 C  CB  . CYS B 1 132 ? 29.146  11.169  22.529 1.00 22.79 ? 239 CYS B CB  1 
ATOM   2222 S  SG  . CYS B 1 132 ? 28.142  10.898  21.051 1.00 24.09 ? 239 CYS B SG  1 
ATOM   2223 N  N   . GLU B 1 133 ? 31.900  11.090  24.084 1.00 19.13 ? 240 GLU B N   1 
ATOM   2224 C  CA  . GLU B 1 133 ? 32.706  11.158  25.297 1.00 20.06 ? 240 GLU B CA  1 
ATOM   2225 C  C   . GLU B 1 133 ? 33.965  10.328  25.065 1.00 19.89 ? 240 GLU B C   1 
ATOM   2226 O  O   . GLU B 1 133 ? 33.925  9.354   24.327 1.00 21.94 ? 240 GLU B O   1 
ATOM   2227 C  CB  . GLU B 1 133 ? 32.008  10.570  26.520 1.00 18.82 ? 240 GLU B CB  1 
ATOM   2228 C  CG  . GLU B 1 133 ? 30.912  11.425  27.094 1.00 23.55 ? 240 GLU B CG  1 
ATOM   2229 C  CD  . GLU B 1 133 ? 29.553  11.091  26.546 1.00 21.70 ? 240 GLU B CD  1 
ATOM   2230 O  OE1 . GLU B 1 133 ? 29.335  9.889   26.288 1.00 34.23 ? 240 GLU B OE1 1 
ATOM   2231 O  OE2 . GLU B 1 133 ? 28.714  12.019  26.400 1.00 30.86 ? 240 GLU B OE2 1 
ATOM   2232 N  N   . ILE B 1 134 ? 35.049  10.744  25.701 1.00 19.64 ? 241 ILE B N   1 
ATOM   2233 C  CA  . ILE B 1 134 ? 36.283  9.979   25.820 1.00 19.46 ? 241 ILE B CA  1 
ATOM   2234 C  C   . ILE B 1 134 ? 36.557  9.898   27.301 1.00 20.74 ? 241 ILE B C   1 
ATOM   2235 O  O   . ILE B 1 134 ? 36.637  10.921  27.990 1.00 20.07 ? 241 ILE B O   1 
ATOM   2236 C  CB  . ILE B 1 134 ? 37.431  10.656  25.045 1.00 20.33 ? 241 ILE B CB  1 
ATOM   2237 C  CG1 . ILE B 1 134 ? 37.055  10.771  23.578 1.00 19.93 ? 241 ILE B CG1 1 
ATOM   2238 C  CG2 . ILE B 1 134 ? 38.710  9.880   25.228 1.00 21.60 ? 241 ILE B CG2 1 
ATOM   2239 C  CD1 . ILE B 1 134 ? 38.073  11.441  22.747 1.00 25.59 ? 241 ILE B CD1 1 
ATOM   2240 N  N   . ASN B 1 135 ? 36.663  8.681   27.805 1.00 20.68 ? 242 ASN B N   1 
ATOM   2241 C  CA  . ASN B 1 135 ? 36.950  8.427   29.215 1.00 24.51 ? 242 ASN B CA  1 
ATOM   2242 C  C   . ASN B 1 135 ? 36.032  9.234   30.123 1.00 26.04 ? 242 ASN B C   1 
ATOM   2243 O  O   . ASN B 1 135 ? 36.491  9.922   31.034 1.00 27.90 ? 242 ASN B O   1 
ATOM   2244 C  CB  . ASN B 1 135 ? 38.413  8.733   29.553 1.00 22.39 ? 242 ASN B CB  1 
ATOM   2245 C  CG  . ASN B 1 135 ? 39.359  7.835   28.802 1.00 26.48 ? 242 ASN B CG  1 
ATOM   2246 O  OD1 . ASN B 1 135 ? 38.965  6.726   28.428 1.00 23.12 ? 242 ASN B OD1 1 
ATOM   2247 N  ND2 . ASN B 1 135 ? 40.577  8.311   28.524 1.00 27.06 ? 242 ASN B ND2 1 
ATOM   2248 N  N   . GLY B 1 136 ? 34.754  9.164   29.804 1.00 27.49 ? 243 GLY B N   1 
ATOM   2249 C  CA  . GLY B 1 136 ? 33.709  9.872   30.515 1.00 28.10 ? 243 GLY B CA  1 
ATOM   2250 C  C   . GLY B 1 136 ? 33.599  11.356  30.256 1.00 30.24 ? 243 GLY B C   1 
ATOM   2251 O  O   . GLY B 1 136 ? 32.792  12.023  30.889 1.00 32.69 ? 243 GLY B O   1 
ATOM   2252 N  N   . GLN B 1 137 ? 34.430  11.919  29.391 1.00 30.19 ? 244 GLN B N   1 
ATOM   2253 C  CA  . GLN B 1 137 ? 34.437  13.368  29.272 1.00 29.60 ? 244 GLN B CA  1 
ATOM   2254 C  C   . GLN B 1 137 ? 33.740  13.736  27.972 1.00 27.21 ? 244 GLN B C   1 
ATOM   2255 O  O   . GLN B 1 137 ? 34.086  13.245  26.917 1.00 25.92 ? 244 GLN B O   1 
ATOM   2256 C  CB  . GLN B 1 137 ? 35.866  13.915  29.276 1.00 29.52 ? 244 GLN B CB  1 
ATOM   2257 C  CG  . GLN B 1 137 ? 35.930  15.431  29.281 1.00 32.93 ? 244 GLN B CG  1 
ATOM   2258 C  CD  . GLN B 1 137 ? 37.282  16.014  28.891 1.00 35.45 ? 244 GLN B CD  1 
ATOM   2259 O  OE1 . GLN B 1 137 ? 38.278  15.298  28.680 1.00 30.71 ? 244 GLN B OE1 1 
ATOM   2260 N  NE2 . GLN B 1 137 ? 37.313  17.337  28.789 1.00 34.46 ? 244 GLN B NE2 1 
ATOM   2261 N  N   . ASN B 1 138 ? 32.780  14.631  28.052 1.00 26.33 ? 245 ASN B N   1 
ATOM   2262 C  CA  . ASN B 1 138 ? 32.068  15.107  26.880 1.00 26.88 ? 245 ASN B CA  1 
ATOM   2263 C  C   . ASN B 1 138 ? 33.018  15.872  26.004 1.00 24.90 ? 245 ASN B C   1 
ATOM   2264 O  O   . ASN B 1 138 ? 33.678  16.784  26.476 1.00 24.63 ? 245 ASN B O   1 
ATOM   2265 C  CB  . ASN B 1 138 ? 30.946  16.044  27.343 1.00 27.25 ? 245 ASN B CB  1 
ATOM   2266 C  CG  . ASN B 1 138 ? 30.400  16.934  26.236 1.00 31.29 ? 245 ASN B CG  1 
ATOM   2267 O  OD1 . ASN B 1 138 ? 30.069  16.467  25.144 1.00 22.79 ? 245 ASN B OD1 1 
ATOM   2268 N  ND2 . ASN B 1 138 ? 30.222  18.225  26.556 1.00 35.16 ? 245 ASN B ND2 1 
ATOM   2269 N  N   . VAL B 1 139 ? 33.014  15.571  24.720 1.00 23.25 ? 246 VAL B N   1 
ATOM   2270 C  CA  . VAL B 1 139 ? 33.903  16.254  23.786 1.00 23.67 ? 246 VAL B CA  1 
ATOM   2271 C  C   . VAL B 1 139 ? 33.122  16.808  22.635 1.00 21.95 ? 246 VAL B C   1 
ATOM   2272 O  O   . VAL B 1 139 ? 33.687  17.239  21.650 1.00 21.56 ? 246 VAL B O   1 
ATOM   2273 C  CB  . VAL B 1 139 ? 35.001  15.334  23.210 1.00 21.89 ? 246 VAL B CB  1 
ATOM   2274 C  CG1 . VAL B 1 139 ? 35.880  14.846  24.295 1.00 26.50 ? 246 VAL B CG1 1 
ATOM   2275 C  CG2 . VAL B 1 139 ? 34.410  14.170  22.435 1.00 24.01 ? 246 VAL B CG2 1 
ATOM   2276 N  N   . ILE B 1 140 ? 31.801  16.785  22.734 1.00 23.09 ? 247 ILE B N   1 
ATOM   2277 C  CA  . ILE B 1 140 ? 30.989  17.449  21.725 1.00 22.33 ? 247 ILE B CA  1 
ATOM   2278 C  C   . ILE B 1 140 ? 31.230  18.939  21.723 1.00 22.92 ? 247 ILE B C   1 
ATOM   2279 O  O   . ILE B 1 140 ? 31.355  19.529  22.800 1.00 26.09 ? 247 ILE B O   1 
ATOM   2280 C  CB  . ILE B 1 140 ? 29.480  17.132  21.965 1.00 22.83 ? 247 ILE B CB  1 
ATOM   2281 C  CG1 . ILE B 1 140 ? 29.218  15.668  21.620 1.00 24.23 ? 247 ILE B CG1 1 
ATOM   2282 C  CG2 . ILE B 1 140 ? 28.621  18.012  21.111 1.00 22.31 ? 247 ILE B CG2 1 
ATOM   2283 C  CD1 . ILE B 1 140 ? 29.066  15.401  20.153 1.00 23.36 ? 247 ILE B CD1 1 
ATOM   2284 N  N   . GLY B 1 141 ? 31.331  19.552  20.540 1.00 20.81 ? 248 GLY B N   1 
ATOM   2285 C  CA  . GLY B 1 141 ? 31.706  20.952  20.445 1.00 21.59 ? 248 GLY B CA  1 
ATOM   2286 C  C   . GLY B 1 141 ? 33.188  21.291  20.592 1.00 20.50 ? 248 GLY B C   1 
ATOM   2287 O  O   . GLY B 1 141 ? 33.575  22.449  20.478 1.00 22.95 ? 248 GLY B O   1 
ATOM   2288 N  N   . LEU B 1 142 ? 34.023  20.311  20.893 1.00 20.22 ? 249 LEU B N   1 
ATOM   2289 C  CA  . LEU B 1 142 ? 35.455  20.571  20.928 1.00 20.36 ? 249 LEU B CA  1 
ATOM   2290 C  C   . LEU B 1 142 ? 36.026  20.440  19.522 1.00 19.04 ? 249 LEU B C   1 
ATOM   2291 O  O   . LEU B 1 142 ? 35.537  19.640  18.744 1.00 17.96 ? 249 LEU B O   1 
ATOM   2292 C  CB  . LEU B 1 142 ? 36.154  19.570  21.840 1.00 20.53 ? 249 LEU B CB  1 
ATOM   2293 C  CG  . LEU B 1 142 ? 35.824  19.617  23.325 1.00 19.03 ? 249 LEU B CG  1 
ATOM   2294 C  CD1 . LEU B 1 142 ? 36.899  18.824  24.071 1.00 19.51 ? 249 LEU B CD1 1 
ATOM   2295 C  CD2 . LEU B 1 142 ? 35.726  21.040  23.781 1.00 23.52 ? 249 LEU B CD2 1 
ATOM   2296 N  N   . LYS B 1 143 ? 37.074  21.198  19.212 1.00 21.71 ? 250 LYS B N   1 
ATOM   2297 C  CA  . LYS B 1 143 ? 37.765  21.118  17.918 1.00 22.21 ? 250 LYS B CA  1 
ATOM   2298 C  C   . LYS B 1 143 ? 38.549  19.813  17.743 1.00 21.24 ? 250 LYS B C   1 
ATOM   2299 O  O   . LYS B 1 143 ? 38.911  19.167  18.725 1.00 19.18 ? 250 LYS B O   1 
ATOM   2300 C  CB  . LYS B 1 143 ? 38.696  22.339  17.756 1.00 24.87 ? 250 LYS B CB  1 
ATOM   2301 N  N   . ASP B 1 144 ? 38.749  19.382  16.490 1.00 20.12 ? 251 ASP B N   1 
ATOM   2302 C  CA  . ASP B 1 144 ? 39.462  18.147  16.218 1.00 20.94 ? 251 ASP B CA  1 
ATOM   2303 C  C   . ASP B 1 144 ? 40.768  18.154  16.978 1.00 19.11 ? 251 ASP B C   1 
ATOM   2304 O  O   . ASP B 1 144 ? 41.140  17.156  17.572 1.00 23.65 ? 251 ASP B O   1 
ATOM   2305 C  CB  . ASP B 1 144 ? 39.729  17.921  14.724 1.00 20.57 ? 251 ASP B CB  1 
ATOM   2306 C  CG  . ASP B 1 144 ? 38.515  17.457  13.947 1.00 21.79 ? 251 ASP B CG  1 
ATOM   2307 O  OD1 . ASP B 1 144 ? 37.459  17.021  14.479 1.00 25.72 ? 251 ASP B OD1 1 
ATOM   2308 O  OD2 . ASP B 1 144 ? 38.508  17.521  12.710 1.00 20.65 ? 251 ASP B OD2 1 
ATOM   2309 N  N   . SER B 1 145 ? 41.483  19.276  16.997 1.00 19.78 ? 252 SER B N   1 
ATOM   2310 C  CA  . SER B 1 145 ? 42.764  19.298  17.654 1.00 19.15 ? 252 SER B CA  1 
ATOM   2311 C  C   . SER B 1 145 ? 42.614  19.149  19.175 1.00 18.52 ? 252 SER B C   1 
ATOM   2312 O  O   . SER B 1 145 ? 43.499  18.614  19.845 1.00 16.99 ? 252 SER B O   1 
ATOM   2313 C  CB  . SER B 1 145 ? 43.540  20.553  17.233 1.00 19.14 ? 252 SER B CB  1 
ATOM   2314 O  OG  . SER B 1 145 ? 42.615  21.626  17.156 1.00 28.18 ? 252 SER B OG  1 
ATOM   2315 N  N   . GLN B 1 146 ? 41.490  19.570  19.737 1.00 17.63 ? 253 GLN B N   1 
ATOM   2316 C  CA  . GLN B 1 146 ? 41.269  19.385  21.172 1.00 18.15 ? 253 GLN B CA  1 
ATOM   2317 C  C   . GLN B 1 146 ? 40.923  17.927  21.510 1.00 20.54 ? 253 GLN B C   1 
ATOM   2318 O  O   . GLN B 1 146 ? 41.363  17.329  22.511 1.00 19.84 ? 253 GLN B O   1 
ATOM   2319 C  CB  . GLN B 1 146 ? 40.143  20.317  21.593 1.00 21.02 ? 253 GLN B CB  1 
ATOM   2320 C  CG  . GLN B 1 146 ? 40.496  21.829  21.490 1.00 16.00 ? 253 GLN B CG  1 
ATOM   2321 C  CD  . GLN B 1 146 ? 39.350  22.735  21.890 1.00 17.60 ? 253 GLN B CD  1 
ATOM   2322 O  OE1 . GLN B 1 146 ? 38.252  22.572  21.394 1.00 21.65 ? 253 GLN B OE1 1 
ATOM   2323 N  NE2 . GLN B 1 146 ? 39.621  23.737  22.717 1.00 25.21 ? 253 GLN B NE2 1 
ATOM   2324 N  N   . ILE B 1 147 ? 40.152  17.311  20.631 1.00 19.91 ? 254 ILE B N   1 
ATOM   2325 C  CA  . ILE B 1 147 ? 39.885  15.894  20.768 1.00 19.17 ? 254 ILE B CA  1 
ATOM   2326 C  C   . ILE B 1 147 ? 41.154  15.087  20.679 1.00 19.31 ? 254 ILE B C   1 
ATOM   2327 O  O   . ILE B 1 147 ? 41.340  14.179  21.479 1.00 20.01 ? 254 ILE B O   1 
ATOM   2328 C  CB  . ILE B 1 147 ? 38.865  15.469  19.749 1.00 19.33 ? 254 ILE B CB  1 
ATOM   2329 C  CG1 . ILE B 1 147 ? 37.511  16.087  20.123 1.00 20.77 ? 254 ILE B CG1 1 
ATOM   2330 C  CG2 . ILE B 1 147 ? 38.687  13.961  19.774 1.00 19.05 ? 254 ILE B CG2 1 
ATOM   2331 C  CD1 . ILE B 1 147 ? 36.484  16.073  18.993 1.00 27.21 ? 254 ILE B CD1 1 
ATOM   2332 N  N   . ALA B 1 148 ? 42.031  15.458  19.749 1.00 18.99 ? 255 ALA B N   1 
ATOM   2333 C  CA  . ALA B 1 148 ? 43.276  14.731  19.518 1.00 21.40 ? 255 ALA B CA  1 
ATOM   2334 C  C   . ALA B 1 148 ? 44.146  14.826  20.727 1.00 22.20 ? 255 ALA B C   1 
ATOM   2335 O  O   . ALA B 1 148 ? 44.859  13.896  21.081 1.00 24.16 ? 255 ALA B O   1 
ATOM   2336 C  CB  . ALA B 1 148 ? 44.017  15.297  18.312 1.00 20.88 ? 255 ALA B CB  1 
ATOM   2337 N  N   . ASP B 1 149 ? 44.067  15.982  21.364 1.00 24.13 ? 256 ASP B N   1 
ATOM   2338 C  CA  . ASP B 1 149 ? 44.764  16.216  22.603 1.00 25.50 ? 256 ASP B CA  1 
ATOM   2339 C  C   . ASP B 1 149 ? 44.267  15.335  23.723 1.00 24.21 ? 256 ASP B C   1 
ATOM   2340 O  O   . ASP B 1 149 ? 45.054  14.828  24.517 1.00 26.69 ? 256 ASP B O   1 
ATOM   2341 C  CB  . ASP B 1 149 ? 44.589  17.673  23.001 1.00 27.80 ? 256 ASP B CB  1 
ATOM   2342 C  CG  . ASP B 1 149 ? 45.845  18.259  23.478 1.00 27.07 ? 256 ASP B CG  1 
ATOM   2343 O  OD1 . ASP B 1 149 ? 46.845  18.081  22.747 1.00 37.59 ? 256 ASP B OD1 1 
ATOM   2344 O  OD2 . ASP B 1 149 ? 45.897  18.921  24.536 1.00 35.27 ? 256 ASP B OD2 1 
ATOM   2345 N  N   . ILE B 1 150 ? 42.962  15.152  23.814 1.00 23.49 ? 257 ILE B N   1 
ATOM   2346 C  CA  . ILE B 1 150 ? 42.439  14.325  24.880 1.00 21.40 ? 257 ILE B CA  1 
ATOM   2347 C  C   . ILE B 1 150 ? 42.864  12.863  24.604 1.00 21.62 ? 257 ILE B C   1 
ATOM   2348 O  O   . ILE B 1 150 ? 43.211  12.145  25.518 1.00 20.59 ? 257 ILE B O   1 
ATOM   2349 C  CB  . ILE B 1 150 ? 40.932  14.483  24.980 1.00 24.19 ? 257 ILE B CB  1 
ATOM   2350 C  CG1 . ILE B 1 150 ? 40.578  15.897  25.415 1.00 23.31 ? 257 ILE B CG1 1 
ATOM   2351 C  CG2 . ILE B 1 150 ? 40.329  13.456  25.924 1.00 27.30 ? 257 ILE B CG2 1 
ATOM   2352 C  CD1 . ILE B 1 150 ? 39.132  16.231  25.312 1.00 25.33 ? 257 ILE B CD1 1 
ATOM   2353 N  N   . LEU B 1 151 ? 42.892  12.442  23.348 1.00 19.00 ? 258 LEU B N   1 
ATOM   2354 C  CA  . LEU B 1 151 ? 43.324  11.090  23.004 1.00 22.33 ? 258 LEU B CA  1 
ATOM   2355 C  C   . LEU B 1 151 ? 44.843  10.901  23.143 1.00 22.75 ? 258 LEU B C   1 
ATOM   2356 O  O   . LEU B 1 151 ? 45.303  9.868   23.607 1.00 24.13 ? 258 LEU B O   1 
ATOM   2357 C  CB  . LEU B 1 151 ? 42.938  10.757  21.580 1.00 19.57 ? 258 LEU B CB  1 
ATOM   2358 C  CG  . LEU B 1 151 ? 41.473  10.544  21.261 1.00 21.86 ? 258 LEU B CG  1 
ATOM   2359 C  CD1 . LEU B 1 151 ? 41.281  10.578  19.748 1.00 28.55 ? 258 LEU B CD1 1 
ATOM   2360 C  CD2 . LEU B 1 151 ? 41.019  9.185   21.820 1.00 25.74 ? 258 LEU B CD2 1 
ATOM   2361 N  N   . SER B 1 152 ? 45.623  11.882  22.720 1.00 24.40 ? 259 SER B N   1 
ATOM   2362 C  CA  . SER B 1 152 ? 47.063  11.837  22.934 1.00 25.80 ? 259 SER B CA  1 
ATOM   2363 C  C   . SER B 1 152 ? 47.439  11.781  24.406 1.00 24.66 ? 259 SER B C   1 
ATOM   2364 O  O   . SER B 1 152 ? 48.394  11.117  24.747 1.00 21.64 ? 259 SER B O   1 
ATOM   2365 C  CB  . SER B 1 152 ? 47.774  13.087  22.407 1.00 26.50 ? 259 SER B CB  1 
ATOM   2366 O  OG  . SER B 1 152 ? 47.633  13.242  21.015 1.00 39.07 ? 259 SER B OG  1 
ATOM   2367 N  N   . THR B 1 153 ? 46.771  12.553  25.259 1.00 24.47 ? 260 THR B N   1 
ATOM   2368 C  CA  . THR B 1 153 ? 47.197  12.642  26.652 1.00 22.71 ? 260 THR B CA  1 
ATOM   2369 C  C   . THR B 1 153 ? 46.577  11.532  27.481 1.00 21.28 ? 260 THR B C   1 
ATOM   2370 O  O   . THR B 1 153 ? 46.910  11.326  28.643 1.00 20.45 ? 260 THR B O   1 
ATOM   2371 C  CB  . THR B 1 153 ? 46.859  13.979  27.319 1.00 22.69 ? 260 THR B CB  1 
ATOM   2372 O  OG1 . THR B 1 153 ? 45.444  14.253  27.309 1.00 19.49 ? 260 THR B OG1 1 
ATOM   2373 C  CG2 . THR B 1 153 ? 47.552  15.121  26.587 1.00 25.23 ? 260 THR B CG2 1 
ATOM   2374 N  N   . SER B 1 154 ? 45.646  10.829  26.889 1.00 21.35 ? 261 SER B N   1 
ATOM   2375 C  CA  . SER B 1 154 ? 44.967  9.764   27.599 1.00 20.15 ? 261 SER B CA  1 
ATOM   2376 C  C   . SER B 1 154 ? 45.937  8.685   28.083 1.00 19.87 ? 261 SER B C   1 
ATOM   2377 O  O   . SER B 1 154 ? 46.906  8.360   27.401 1.00 19.40 ? 261 SER B O   1 
ATOM   2378 C  CB  . SER B 1 154 ? 43.978  9.107   26.678 1.00 22.36 ? 261 SER B CB  1 
ATOM   2379 O  OG  . SER B 1 154 ? 43.413  7.991   27.347 1.00 16.99 ? 261 SER B OG  1 
ATOM   2380 N  N   . GLY B 1 155 ? 45.628  8.077   29.218 1.00 20.02 ? 262 GLY B N   1 
ATOM   2381 C  CA  . GLY B 1 155 ? 46.206  6.796   29.561 1.00 21.36 ? 262 GLY B CA  1 
ATOM   2382 C  C   . GLY B 1 155 ? 45.927  5.718   28.525 1.00 24.15 ? 262 GLY B C   1 
ATOM   2383 O  O   . GLY B 1 155 ? 45.270  5.940   27.500 1.00 24.25 ? 262 GLY B O   1 
ATOM   2384 N  N   . THR B 1 156 ? 46.386  4.515   28.845 1.00 25.75 ? 263 THR B N   1 
ATOM   2385 C  CA  . THR B 1 156 ? 46.458  3.395   27.908 1.00 25.03 ? 263 THR B CA  1 
ATOM   2386 C  C   . THR B 1 156 ? 45.079  2.897   27.504 1.00 26.06 ? 263 THR B C   1 
ATOM   2387 O  O   . THR B 1 156 ? 44.828  2.539   26.347 1.00 23.05 ? 263 THR B O   1 
ATOM   2388 C  CB  . THR B 1 156 ? 47.332  2.280   28.541 1.00 24.97 ? 263 THR B CB  1 
ATOM   2389 O  OG1 . THR B 1 156 ? 48.711  2.612   28.306 1.00 28.34 ? 263 THR B OG1 1 
ATOM   2390 C  CG2 . THR B 1 156 ? 47.162  0.964   27.821 1.00 28.75 ? 263 THR B CG2 1 
ATOM   2391 N  N   . VAL B 1 157 ? 44.162  2.933   28.458 1.00 25.65 ? 264 VAL B N   1 
ATOM   2392 C  CA  . VAL B 1 157 ? 42.777  2.559   28.210 1.00 26.39 ? 264 VAL B CA  1 
ATOM   2393 C  C   . VAL B 1 157 ? 42.012  3.759   27.679 1.00 26.48 ? 264 VAL B C   1 
ATOM   2394 O  O   . VAL B 1 157 ? 41.987  4.834   28.282 1.00 28.54 ? 264 VAL B O   1 
ATOM   2395 C  CB  . VAL B 1 157 ? 42.117  2.123   29.503 1.00 26.54 ? 264 VAL B CB  1 
ATOM   2396 C  CG1 . VAL B 1 157 ? 40.675  1.763   29.260 1.00 31.71 ? 264 VAL B CG1 1 
ATOM   2397 C  CG2 . VAL B 1 157 ? 42.910  0.980   30.148 1.00 29.37 ? 264 VAL B CG2 1 
ATOM   2398 N  N   . VAL B 1 158 ? 41.397  3.591   26.518 1.00 25.80 ? 265 VAL B N   1 
ATOM   2399 C  CA  . VAL B 1 158 ? 40.656  4.673   25.887 1.00 22.63 ? 265 VAL B CA  1 
ATOM   2400 C  C   . VAL B 1 158 ? 39.261  4.113   25.668 1.00 22.16 ? 265 VAL B C   1 
ATOM   2401 O  O   . VAL B 1 158 ? 39.075  3.141   24.951 1.00 24.27 ? 265 VAL B O   1 
ATOM   2402 C  CB  . VAL B 1 158 ? 41.305  5.121   24.584 1.00 22.48 ? 265 VAL B CB  1 
ATOM   2403 C  CG1 . VAL B 1 158 ? 40.491  6.211   23.866 1.00 26.15 ? 265 VAL B CG1 1 
ATOM   2404 C  CG2 . VAL B 1 158 ? 42.710  5.602   24.851 1.00 24.19 ? 265 VAL B CG2 1 
ATOM   2405 N  N   . THR B 1 159 ? 38.322  4.692   26.386 1.00 21.39 ? 266 THR B N   1 
ATOM   2406 C  CA  . THR B 1 159 ? 36.917  4.410   26.308 1.00 23.29 ? 266 THR B CA  1 
ATOM   2407 C  C   . THR B 1 159 ? 36.224  5.540   25.600 1.00 22.22 ? 266 THR B C   1 
ATOM   2408 O  O   . THR B 1 159 ? 36.347  6.700   25.998 1.00 24.93 ? 266 THR B O   1 
ATOM   2409 C  CB  . THR B 1 159 ? 36.423  4.296   27.740 1.00 22.45 ? 266 THR B CB  1 
ATOM   2410 O  OG1 . THR B 1 159 ? 37.061  3.167   28.331 1.00 28.16 ? 266 THR B OG1 1 
ATOM   2411 C  CG2 . THR B 1 159 ? 34.962  3.956   27.787 1.00 28.52 ? 266 THR B CG2 1 
ATOM   2412 N  N   . ILE B 1 160 ? 35.521  5.200   24.525 1.00 19.86 ? 267 ILE B N   1 
ATOM   2413 C  CA  . ILE B 1 160 ? 34.887  6.168   23.652 1.00 20.47 ? 267 ILE B CA  1 
ATOM   2414 C  C   . ILE B 1 160 ? 33.408  5.779   23.577 1.00 22.39 ? 267 ILE B C   1 
ATOM   2415 O  O   . ILE B 1 160 ? 33.062  4.601   23.468 1.00 21.84 ? 267 ILE B O   1 
ATOM   2416 C  CB  . ILE B 1 160 ? 35.566  6.128   22.272 1.00 20.36 ? 267 ILE B CB  1 
ATOM   2417 C  CG1 . ILE B 1 160 ? 37.066  6.404   22.458 1.00 27.66 ? 267 ILE B CG1 1 
ATOM   2418 C  CG2 . ILE B 1 160 ? 35.059  7.209   21.379 1.00 26.01 ? 267 ILE B CG2 1 
ATOM   2419 C  CD1 . ILE B 1 160 ? 37.807  6.690   21.166 1.00 36.12 ? 267 ILE B CD1 1 
ATOM   2420 N  N   . THR B 1 161 ? 32.550  6.777   23.662 1.00 20.86 ? 268 THR B N   1 
ATOM   2421 C  CA  . THR B 1 161 ? 31.140  6.622   23.420 1.00 22.54 ? 268 THR B CA  1 
ATOM   2422 C  C   . THR B 1 161 ? 30.872  7.313   22.086 1.00 22.64 ? 268 THR B C   1 
ATOM   2423 O  O   . THR B 1 161 ? 31.348  8.417   21.871 1.00 20.87 ? 268 THR B O   1 
ATOM   2424 C  CB  . THR B 1 161 ? 30.413  7.330   24.513 1.00 23.15 ? 268 THR B CB  1 
ATOM   2425 O  OG1 . THR B 1 161 ? 30.751  6.684   25.743 1.00 26.76 ? 268 THR B OG1 1 
ATOM   2426 C  CG2 . THR B 1 161 ? 28.925  7.178   24.382 1.00 28.26 ? 268 THR B CG2 1 
ATOM   2427 N  N   . ILE B 1 162 ? 30.227  6.578   21.183 1.00 21.82 ? 269 ILE B N   1 
ATOM   2428 C  CA  . ILE B 1 162 ? 29.959  6.989   19.811 1.00 20.52 ? 269 ILE B CA  1 
ATOM   2429 C  C   . ILE B 1 162 ? 28.486  6.936   19.527 1.00 21.56 ? 269 ILE B C   1 
ATOM   2430 O  O   . ILE B 1 162 ? 27.709  6.245   20.182 1.00 20.06 ? 269 ILE B O   1 
ATOM   2431 C  CB  . ILE B 1 162 ? 30.712  6.118   18.764 1.00 21.77 ? 269 ILE B CB  1 
ATOM   2432 C  CG1 . ILE B 1 162 ? 30.345  4.622   18.847 1.00 25.64 ? 269 ILE B CG1 1 
ATOM   2433 C  CG2 . ILE B 1 162 ? 32.177  6.297   18.909 1.00 26.24 ? 269 ILE B CG2 1 
ATOM   2434 C  CD1 . ILE B 1 162 ? 31.025  3.771   17.791 1.00 27.59 ? 269 ILE B CD1 1 
HETATM 2435 N  N   . MSE B 1 163 ? 28.103  7.684   18.521 1.00 21.54 ? 270 MSE B N   1 
HETATM 2436 C  CA  . MSE B 1 163 ? 26.744  7.635   18.055 1.00 25.05 ? 270 MSE B CA  1 
HETATM 2437 C  C   . MSE B 1 163 ? 26.779  7.796   16.557 1.00 24.20 ? 270 MSE B C   1 
HETATM 2438 O  O   . MSE B 1 163 ? 27.529  8.607   16.039 1.00 21.24 ? 270 MSE B O   1 
HETATM 2439 C  CB  . MSE B 1 163 ? 26.032  8.830   18.683 1.00 22.89 ? 270 MSE B CB  1 
HETATM 2440 C  CG  . MSE B 1 163 ? 24.570  8.792   18.627 1.00 34.15 ? 270 MSE B CG  1 
HETATM 2441 SE SE  . MSE B 1 163 ? 24.033  10.503  19.420 1.00 35.78 ? 270 MSE B SE  1 
HETATM 2442 C  CE  . MSE B 1 163 ? 22.271  10.566  18.497 1.00 43.01 ? 270 MSE B CE  1 
ATOM   2443 N  N   . PRO B 1 164 ? 25.885  7.096   15.877 1.00 32.53 ? 271 PRO B N   1 
ATOM   2444 C  CA  . PRO B 1 164 ? 25.653  7.300   14.448 1.00 33.42 ? 271 PRO B CA  1 
ATOM   2445 C  C   . PRO B 1 164 ? 25.484  8.762   14.123 1.00 40.06 ? 271 PRO B C   1 
ATOM   2446 O  O   . PRO B 1 164 ? 24.920  9.551   14.908 1.00 40.37 ? 271 PRO B O   1 
ATOM   2447 C  CB  . PRO B 1 164 ? 24.392  6.482   14.183 1.00 38.02 ? 271 PRO B CB  1 
ATOM   2448 C  CG  . PRO B 1 164 ? 24.471  5.353   15.233 1.00 33.22 ? 271 PRO B CG  1 
ATOM   2449 C  CD  . PRO B 1 164 ? 25.007  6.054   16.431 1.00 31.19 ? 271 PRO B CD  1 
ATOM   2450 N  N   . ALA B 1 165 ? 26.036  9.173   12.990 1.00 41.29 ? 272 ALA B N   1 
ATOM   2451 C  CA  . ALA B 1 165 ? 25.925  10.587  12.631 1.00 47.20 ? 272 ALA B CA  1 
ATOM   2452 C  C   . ALA B 1 165 ? 24.726  10.826  11.717 1.00 48.80 ? 272 ALA B C   1 
ATOM   2453 O  O   . ALA B 1 165 ? 23.816  9.985   11.647 1.00 53.86 ? 272 ALA B O   1 
ATOM   2454 C  CB  . ALA B 1 165 ? 27.213  11.090  11.974 1.00 48.05 ? 272 ALA B CB  1 
HETATM 2455 O  O   . HOH C 2 .   ? 7.011   13.358  20.148 1.00 21.24 ? 274 HOH A O   1 
HETATM 2456 O  O   . HOH C 2 .   ? 8.833   11.538  16.339 1.00 28.86 ? 275 HOH A O   1 
HETATM 2457 O  O   . HOH C 2 .   ? 36.946  -6.105  13.277 1.00 26.75 ? 276 HOH A O   1 
HETATM 2458 O  O   . HOH C 2 .   ? 32.472  -5.315  12.293 1.00 19.94 ? 277 HOH A O   1 
HETATM 2459 O  O   . HOH C 2 .   ? 34.799  -4.334  12.734 1.00 25.25 ? 278 HOH A O   1 
HETATM 2460 O  O   . HOH C 2 .   ? 20.769  -10.610 17.990 1.00 33.08 ? 279 HOH A O   1 
HETATM 2461 O  O   . HOH C 2 .   ? -5.978  -2.405  13.506 1.00 50.49 ? 280 HOH A O   1 
HETATM 2462 O  O   . HOH C 2 .   ? 35.458  -1.818  12.139 1.00 24.11 ? 281 HOH A O   1 
HETATM 2463 O  O   . HOH C 2 .   ? 23.380  -12.693 17.949 1.00 35.19 ? 282 HOH A O   1 
HETATM 2464 O  O   . HOH C 2 .   ? 18.373  -23.543 12.493 1.00 26.38 ? 283 HOH A O   1 
HETATM 2465 O  O   . HOH C 2 .   ? 12.488  -3.639  7.596  1.00 38.56 ? 284 HOH A O   1 
HETATM 2466 O  O   . HOH C 2 .   ? 28.069  -12.534 2.928  1.00 33.73 ? 285 HOH A O   1 
HETATM 2467 O  O   . HOH C 2 .   ? 9.328   12.609  18.725 1.00 21.74 ? 286 HOH A O   1 
HETATM 2468 O  O   . HOH C 2 .   ? 15.211  -9.856  12.628 1.00 29.29 ? 287 HOH A O   1 
HETATM 2469 O  O   . HOH C 2 .   ? 33.516  -2.839  6.547  1.00 29.25 ? 288 HOH A O   1 
HETATM 2470 O  O   . HOH C 2 .   ? 0.043   -9.308  14.159 1.00 32.99 ? 289 HOH A O   1 
HETATM 2471 O  O   . HOH C 2 .   ? 1.115   -9.017  16.379 1.00 39.90 ? 290 HOH A O   1 
HETATM 2472 O  O   . HOH C 2 .   ? 17.141  -11.518 11.498 1.00 23.78 ? 291 HOH A O   1 
HETATM 2473 O  O   . HOH C 2 .   ? -2.233  6.357   17.220 1.00 33.22 ? 292 HOH A O   1 
HETATM 2474 O  O   . HOH C 2 .   ? 1.636   15.185  17.783 1.00 37.22 ? 293 HOH A O   1 
HETATM 2475 O  O   . HOH C 2 .   ? 17.414  -11.735 8.780  1.00 26.80 ? 294 HOH A O   1 
HETATM 2476 O  O   . HOH C 2 .   ? 42.976  -9.904  11.834 1.00 38.63 ? 295 HOH A O   1 
HETATM 2477 O  O   . HOH C 2 .   ? 21.105  0.367   20.546 1.00 48.63 ? 296 HOH A O   1 
HETATM 2478 O  O   . HOH C 2 .   ? 2.566   2.687   5.225  1.00 45.57 ? 297 HOH A O   1 
HETATM 2479 O  O   . HOH C 2 .   ? 14.762  -18.344 4.720  1.00 40.97 ? 298 HOH A O   1 
HETATM 2480 O  O   . HOH C 2 .   ? 28.149  -21.437 18.911 1.00 38.23 ? 299 HOH A O   1 
HETATM 2481 O  O   . HOH C 2 .   ? 25.206  -23.824 13.124 1.00 30.13 ? 300 HOH A O   1 
HETATM 2482 O  O   . HOH C 2 .   ? 19.635  -27.968 -0.352 1.00 46.41 ? 301 HOH A O   1 
HETATM 2483 O  O   . HOH C 2 .   ? 37.688  -5.204  1.528  1.00 39.91 ? 302 HOH A O   1 
HETATM 2484 O  O   . HOH C 2 .   ? -0.504  1.165   12.216 1.00 45.12 ? 303 HOH A O   1 
HETATM 2485 O  O   . HOH C 2 .   ? 15.401  -0.496  23.209 1.00 43.42 ? 304 HOH A O   1 
HETATM 2486 O  O   . HOH C 2 .   ? 32.024  -20.868 21.438 1.00 53.22 ? 305 HOH A O   1 
HETATM 2487 O  O   . HOH C 2 .   ? 0.288   14.018  10.320 1.00 41.89 ? 306 HOH A O   1 
HETATM 2488 O  O   . HOH C 2 .   ? 20.649  -26.137 8.829  1.00 49.34 ? 307 HOH A O   1 
HETATM 2489 O  O   . HOH C 2 .   ? 0.844   -9.499  1.391  1.00 41.98 ? 308 HOH A O   1 
HETATM 2490 O  O   . HOH C 2 .   ? 9.937   -14.100 13.815 1.00 50.00 ? 309 HOH A O   1 
HETATM 2491 O  O   . HOH C 2 .   ? 14.861  -14.763 6.516  1.00 47.06 ? 310 HOH A O   1 
HETATM 2492 O  O   . HOH C 2 .   ? 27.171  -8.771  22.149 1.00 47.63 ? 311 HOH A O   1 
HETATM 2493 O  O   . HOH C 2 .   ? 22.717  -3.132  14.981 1.00 33.60 ? 312 HOH A O   1 
HETATM 2494 O  O   . HOH C 2 .   ? 24.031  -26.109 11.947 1.00 30.30 ? 313 HOH A O   1 
HETATM 2495 O  O   . HOH C 2 .   ? -2.565  -0.965  11.772 1.00 48.08 ? 314 HOH A O   1 
HETATM 2496 O  O   . HOH C 2 .   ? 32.011  0.343   5.205  1.00 41.52 ? 315 HOH A O   1 
HETATM 2497 O  O   . HOH C 2 .   ? 19.068  -1.188  9.417  1.00 42.54 ? 316 HOH A O   1 
HETATM 2498 O  O   . HOH C 2 .   ? 36.499  -15.679 15.226 1.00 33.19 ? 317 HOH A O   1 
HETATM 2499 O  O   . HOH C 2 .   ? 7.779   -12.246 1.486  1.00 50.93 ? 318 HOH A O   1 
HETATM 2500 O  O   . HOH C 2 .   ? -6.415  -6.593  15.174 1.00 43.48 ? 319 HOH A O   1 
HETATM 2501 O  O   . HOH C 2 .   ? 14.855  -12.355 7.944  1.00 37.34 ? 320 HOH A O   1 
HETATM 2502 O  O   . HOH C 2 .   ? 3.011   0.827   3.707  1.00 77.03 ? 321 HOH A O   1 
HETATM 2503 O  O   . HOH C 2 .   ? 17.825  -7.209  4.581  1.00 59.06 ? 322 HOH A O   1 
HETATM 2504 O  O   . HOH C 2 .   ? -7.558  0.807   11.081 1.00 72.64 ? 323 HOH A O   1 
HETATM 2505 O  O   . HOH C 2 .   ? 38.686  -15.306 8.259  1.00 52.64 ? 324 HOH A O   1 
HETATM 2506 O  O   . HOH C 2 .   ? 14.470  -11.755 14.224 1.00 55.69 ? 325 HOH A O   1 
HETATM 2507 O  O   . HOH C 2 .   ? 9.461   -4.315  2.772  1.00 49.38 ? 326 HOH A O   1 
HETATM 2508 O  O   . HOH C 2 .   ? 15.785  -15.519 10.228 1.00 44.48 ? 327 HOH A O   1 
HETATM 2509 O  O   . HOH C 2 .   ? 30.506  -26.834 17.181 1.00 52.34 ? 328 HOH A O   1 
HETATM 2510 O  O   . HOH C 2 .   ? 31.731  -5.255  -1.793 1.00 48.00 ? 329 HOH A O   1 
HETATM 2511 O  O   . HOH C 2 .   ? 9.413   -6.078  18.810 1.00 41.27 ? 330 HOH A O   1 
HETATM 2512 O  O   . HOH C 2 .   ? 38.564  -17.976 7.171  1.00 47.73 ? 331 HOH A O   1 
HETATM 2513 O  O   . HOH C 2 .   ? 8.475   1.634   24.629 1.00 47.41 ? 332 HOH A O   1 
HETATM 2514 O  O   . HOH C 2 .   ? 6.975   7.391   25.361 1.00 34.92 ? 333 HOH A O   1 
HETATM 2515 O  O   . HOH C 2 .   ? 0.536   -11.278 4.953  1.00 49.79 ? 334 HOH A O   1 
HETATM 2516 O  O   . HOH C 2 .   ? -7.181  -3.155  23.832 1.00 40.11 ? 335 HOH A O   1 
HETATM 2517 O  O   . HOH C 2 .   ? -0.350  -6.929  20.779 1.00 39.21 ? 336 HOH A O   1 
HETATM 2518 O  O   . HOH C 2 .   ? 3.810   -5.869  22.451 1.00 55.72 ? 337 HOH A O   1 
HETATM 2519 O  O   . HOH C 2 .   ? 41.370  -10.088 16.682 1.00 50.40 ? 338 HOH A O   1 
HETATM 2520 O  O   . HOH C 2 .   ? 24.982  -27.737 9.442  1.00 56.82 ? 339 HOH A O   1 
HETATM 2521 O  O   . HOH C 2 .   ? 20.838  -14.848 3.736  1.00 48.51 ? 340 HOH A O   1 
HETATM 2522 O  O   . HOH C 2 .   ? 18.298  -16.134 15.017 1.00 48.41 ? 341 HOH A O   1 
HETATM 2523 O  O   . HOH C 2 .   ? 7.459   -4.384  -0.480 1.00 43.17 ? 342 HOH A O   1 
HETATM 2524 O  O   . HOH C 2 .   ? -1.565  -1.889  8.702  1.00 41.17 ? 343 HOH A O   1 
HETATM 2525 O  O   . HOH C 2 .   ? 6.851   12.491  9.459  1.00 45.08 ? 344 HOH A O   1 
HETATM 2526 O  O   . HOH C 2 .   ? 22.614  -30.272 2.613  1.00 62.32 ? 345 HOH A O   1 
HETATM 2527 O  O   . HOH C 2 .   ? 28.617  -10.365 1.868  1.00 41.92 ? 346 HOH A O   1 
HETATM 2528 O  O   . HOH C 2 .   ? 40.044  -14.166 -3.036 1.00 64.97 ? 347 HOH A O   1 
HETATM 2529 O  O   . HOH C 2 .   ? -7.557  1.187   20.859 1.00 51.86 ? 348 HOH A O   1 
HETATM 2530 O  O   . HOH C 2 .   ? 5.422   -7.672  -3.254 1.00 71.52 ? 349 HOH A O   1 
HETATM 2531 O  O   . HOH C 2 .   ? 26.158  -24.684 15.347 1.00 41.97 ? 350 HOH A O   1 
HETATM 2532 O  O   . HOH C 2 .   ? 10.017  -0.036  25.374 1.00 56.91 ? 351 HOH A O   1 
HETATM 2533 O  O   . HOH C 2 .   ? 44.248  -7.301  15.710 1.00 59.28 ? 352 HOH A O   1 
HETATM 2534 O  O   . HOH C 2 .   ? 42.029  -8.358  0.958  1.00 62.20 ? 353 HOH A O   1 
HETATM 2535 O  O   . HOH C 2 .   ? 16.940  -14.151 12.533 1.00 42.06 ? 354 HOH A O   1 
HETATM 2536 O  O   . HOH C 2 .   ? 40.483  -5.847  9.166  1.00 49.64 ? 355 HOH A O   1 
HETATM 2537 O  O   . HOH C 2 .   ? -7.492  9.607   16.786 1.00 53.45 ? 356 HOH A O   1 
HETATM 2538 O  O   . HOH C 2 .   ? 2.024   -10.863 7.030  1.00 48.51 ? 357 HOH A O   1 
HETATM 2539 O  O   . HOH C 2 .   ? -0.001  3.099   11.306 1.00 54.09 ? 358 HOH A O   1 
HETATM 2540 O  O   . HOH C 2 .   ? -1.466  5.353   10.067 1.00 50.66 ? 359 HOH A O   1 
HETATM 2541 O  O   . HOH C 2 .   ? 25.427  -19.309 2.956  1.00 38.06 ? 360 HOH A O   1 
HETATM 2542 O  O   . HOH C 2 .   ? 43.675  -15.924 8.353  1.00 73.13 ? 361 HOH A O   1 
HETATM 2543 O  O   . HOH C 2 .   ? 11.098  10.533  5.649  1.00 51.64 ? 362 HOH A O   1 
HETATM 2544 O  O   . HOH C 2 .   ? 19.210  -2.949  5.216  1.00 57.28 ? 363 HOH A O   1 
HETATM 2545 O  O   . HOH C 2 .   ? 4.113   -4.907  -0.846 1.00 45.69 ? 364 HOH A O   1 
HETATM 2546 O  O   . HOH C 2 .   ? 28.762  2.484   5.088  1.00 39.80 ? 365 HOH A O   1 
HETATM 2547 O  O   . HOH C 2 .   ? 0.337   0.173   7.840  1.00 48.84 ? 366 HOH A O   1 
HETATM 2548 O  O   . HOH C 2 .   ? 11.573  -5.688  5.587  1.00 51.92 ? 367 HOH A O   1 
HETATM 2549 O  O   . HOH C 2 .   ? 26.660  5.754   10.622 1.00 45.70 ? 368 HOH A O   1 
HETATM 2550 O  O   . HOH C 2 .   ? 22.147  -16.548 2.134  1.00 61.38 ? 369 HOH A O   1 
HETATM 2551 O  O   . HOH C 2 .   ? 27.668  -17.381 21.839 1.00 43.46 ? 370 HOH A O   1 
HETATM 2552 O  O   . HOH C 2 .   ? 18.237  -21.856 17.470 1.00 33.48 ? 371 HOH A O   1 
HETATM 2553 O  O   . HOH C 2 .   ? 8.883   -2.229  24.692 1.00 51.82 ? 372 HOH A O   1 
HETATM 2554 O  O   . HOH C 2 .   ? 32.739  -1.264  1.591  1.00 54.53 ? 373 HOH A O   1 
HETATM 2555 O  O   . HOH C 2 .   ? 3.159   -2.386  -0.618 1.00 57.29 ? 374 HOH A O   1 
HETATM 2556 O  O   . HOH C 2 .   ? 27.255  -17.072 24.301 1.00 60.73 ? 375 HOH A O   1 
HETATM 2557 O  O   . HOH C 2 .   ? 31.272  -16.552 24.159 1.00 51.51 ? 376 HOH A O   1 
HETATM 2558 O  O   . HOH C 2 .   ? 10.391  -14.101 7.433  1.00 62.10 ? 377 HOH A O   1 
HETATM 2559 O  O   . HOH C 2 .   ? -2.916  7.029   11.452 1.00 53.93 ? 378 HOH A O   1 
HETATM 2560 O  O   . HOH C 2 .   ? 5.131   14.192  12.502 1.00 51.00 ? 379 HOH A O   1 
HETATM 2561 O  O   . HOH C 2 .   ? 18.667  6.519   10.008 1.00 53.80 ? 380 HOH A O   1 
HETATM 2562 O  O   . HOH C 2 .   ? 36.062  -22.251 8.946  1.00 40.44 ? 381 HOH A O   1 
HETATM 2563 O  O   . HOH C 2 .   ? 4.116   -15.856 14.013 1.00 68.59 ? 382 HOH A O   1 
HETATM 2564 O  O   . HOH C 2 .   ? 40.287  -4.338  5.827  1.00 51.77 ? 383 HOH A O   1 
HETATM 2565 O  O   . HOH C 2 .   ? 30.714  -23.422 1.034  1.00 65.61 ? 384 HOH A O   1 
HETATM 2566 O  O   . HOH C 2 .   ? -3.406  10.592  15.090 1.00 37.15 ? 385 HOH A O   1 
HETATM 2567 O  O   . HOH C 2 .   ? 36.484  -6.367  -2.718 1.00 69.15 ? 386 HOH A O   1 
HETATM 2568 O  O   . HOH C 2 .   ? 25.204  -8.388  24.805 1.00 57.57 ? 387 HOH A O   1 
HETATM 2569 O  O   . HOH C 2 .   ? 44.917  -13.615 6.676  1.00 51.83 ? 388 HOH A O   1 
HETATM 2570 O  O   . HOH C 2 .   ? 12.887  -23.610 6.501  1.00 47.43 ? 389 HOH A O   1 
HETATM 2571 O  O   . HOH C 2 .   ? 39.252  -21.470 11.549 1.00 72.28 ? 390 HOH A O   1 
HETATM 2572 O  O   . HOH C 2 .   ? 43.109  -13.075 -3.355 1.00 64.43 ? 391 HOH A O   1 
HETATM 2573 O  O   . HOH C 2 .   ? 39.810  -4.981  3.349  1.00 54.10 ? 392 HOH A O   1 
HETATM 2574 O  O   . HOH C 2 .   ? 28.848  -27.786 -1.561 1.00 65.35 ? 393 HOH A O   1 
HETATM 2575 O  O   . HOH C 2 .   ? 3.136   -7.269  -1.678 1.00 67.42 ? 394 HOH A O   1 
HETATM 2576 O  O   . HOH C 2 .   ? 37.094  -17.037 18.410 1.00 45.06 ? 395 HOH A O   1 
HETATM 2577 O  O   . HOH C 2 .   ? 22.316  -4.563  9.099  1.00 41.07 ? 396 HOH A O   1 
HETATM 2578 O  O   . HOH C 2 .   ? 30.346  -7.772  25.416 1.00 55.08 ? 397 HOH A O   1 
HETATM 2579 O  O   . HOH D 2 .   ? 11.729  13.465  19.494 1.00 18.41 ? 274 HOH B O   1 
HETATM 2580 O  O   . HOH D 2 .   ? 7.021   26.230  30.822 1.00 25.88 ? 275 HOH B O   1 
HETATM 2581 O  O   . HOH D 2 .   ? 11.359  16.831  14.140 1.00 22.54 ? 276 HOH B O   1 
HETATM 2582 O  O   . HOH D 2 .   ? 15.409  6.528   28.193 1.00 30.45 ? 277 HOH B O   1 
HETATM 2583 O  O   . HOH D 2 .   ? 14.842  31.257  11.685 1.00 33.36 ? 278 HOH B O   1 
HETATM 2584 O  O   . HOH D 2 .   ? 18.821  22.456  12.188 1.00 27.37 ? 279 HOH B O   1 
HETATM 2585 O  O   . HOH D 2 .   ? 6.463   27.215  24.637 1.00 39.26 ? 280 HOH B O   1 
HETATM 2586 O  O   . HOH D 2 .   ? 11.635  28.821  10.723 1.00 41.97 ? 281 HOH B O   1 
HETATM 2587 O  O   . HOH D 2 .   ? 5.492   21.214  13.774 1.00 34.98 ? 282 HOH B O   1 
HETATM 2588 O  O   . HOH D 2 .   ? 17.150  26.329  14.719 1.00 28.48 ? 283 HOH B O   1 
HETATM 2589 O  O   . HOH D 2 .   ? 7.723   22.560  12.615 1.00 24.56 ? 284 HOH B O   1 
HETATM 2590 O  O   . HOH D 2 .   ? 14.494  21.638  11.068 1.00 28.19 ? 285 HOH B O   1 
HETATM 2591 O  O   . HOH D 2 .   ? 29.492  -6.090  24.417 1.00 39.55 ? 286 HOH B O   1 
HETATM 2592 O  O   . HOH D 2 .   ? 19.997  12.126  29.900 1.00 31.32 ? 287 HOH B O   1 
HETATM 2593 O  O   . HOH D 2 .   ? 32.314  14.520  17.920 1.00 48.14 ? 288 HOH B O   1 
HETATM 2594 O  O   . HOH D 2 .   ? 18.891  8.490   33.317 1.00 31.89 ? 289 HOH B O   1 
HETATM 2595 O  O   . HOH D 2 .   ? 17.728  28.233  26.652 1.00 48.75 ? 290 HOH B O   1 
HETATM 2596 O  O   . HOH D 2 .   ? 42.344  -4.086  22.522 1.00 37.30 ? 291 HOH B O   1 
HETATM 2597 O  O   . HOH D 2 .   ? 11.863  30.608  41.488 1.00 33.62 ? 292 HOH B O   1 
HETATM 2598 O  O   . HOH D 2 .   ? 46.139  -0.197  18.783 1.00 37.28 ? 293 HOH B O   1 
HETATM 2599 O  O   . HOH D 2 .   ? 45.063  6.422   16.657 1.00 45.47 ? 294 HOH B O   1 
HETATM 2600 O  O   . HOH D 2 .   ? -0.515  12.662  21.341 1.00 42.88 ? 295 HOH B O   1 
HETATM 2601 O  O   . HOH D 2 .   ? 42.643  11.951  13.264 1.00 42.07 ? 296 HOH B O   1 
HETATM 2602 O  O   . HOH D 2 .   ? 26.515  16.665  25.921 1.00 32.52 ? 297 HOH B O   1 
HETATM 2603 O  O   . HOH D 2 .   ? 16.697  24.728  17.700 1.00 26.96 ? 298 HOH B O   1 
HETATM 2604 O  O   . HOH D 2 .   ? 1.086   17.095  21.612 1.00 35.93 ? 299 HOH B O   1 
HETATM 2605 O  O   . HOH D 2 .   ? 13.908  18.286  37.739 1.00 32.95 ? 300 HOH B O   1 
HETATM 2606 O  O   . HOH D 2 .   ? 53.026  0.582   17.862 1.00 49.37 ? 301 HOH B O   1 
HETATM 2607 O  O   . HOH D 2 .   ? 33.576  7.520   27.584 1.00 38.93 ? 302 HOH B O   1 
HETATM 2608 O  O   . HOH D 2 .   ? 18.176  22.356  36.406 1.00 40.21 ? 303 HOH B O   1 
HETATM 2609 O  O   . HOH D 2 .   ? 21.287  22.338  11.118 1.00 30.22 ? 304 HOH B O   1 
HETATM 2610 O  O   . HOH D 2 .   ? 16.628  24.711  20.523 1.00 34.17 ? 305 HOH B O   1 
HETATM 2611 O  O   . HOH D 2 .   ? 6.199   10.010  26.051 1.00 33.48 ? 306 HOH B O   1 
HETATM 2612 O  O   . HOH D 2 .   ? 28.287  14.619  25.365 1.00 35.46 ? 307 HOH B O   1 
HETATM 2613 O  O   . HOH D 2 .   ? 5.333   22.729  24.523 1.00 41.02 ? 308 HOH B O   1 
HETATM 2614 O  O   . HOH D 2 .   ? 5.139   12.979  28.452 1.00 40.52 ? 309 HOH B O   1 
HETATM 2615 O  O   . HOH D 2 .   ? 47.900  -1.857  25.581 1.00 59.49 ? 310 HOH B O   1 
HETATM 2616 O  O   . HOH D 2 .   ? 26.462  19.146  24.472 1.00 33.72 ? 311 HOH B O   1 
HETATM 2617 O  O   . HOH D 2 .   ? 46.763  1.493   32.667 1.00 45.69 ? 312 HOH B O   1 
HETATM 2618 O  O   . HOH D 2 .   ? 17.136  21.236  10.752 1.00 55.50 ? 313 HOH B O   1 
HETATM 2619 O  O   . HOH D 2 .   ? 15.256  28.836  22.826 1.00 45.72 ? 314 HOH B O   1 
HETATM 2620 O  O   . HOH D 2 .   ? 25.891  17.307  28.581 1.00 52.81 ? 315 HOH B O   1 
HETATM 2621 O  O   . HOH D 2 .   ? 5.585   24.888  25.907 1.00 32.92 ? 316 HOH B O   1 
HETATM 2622 O  O   . HOH D 2 .   ? 4.933   22.051  32.396 1.00 52.25 ? 317 HOH B O   1 
HETATM 2623 O  O   . HOH D 2 .   ? 1.866   21.814  20.331 1.00 46.37 ? 318 HOH B O   1 
HETATM 2624 O  O   . HOH D 2 .   ? 38.687  2.669   7.492  1.00 50.66 ? 319 HOH B O   1 
HETATM 2625 O  O   . HOH D 2 .   ? 12.638  30.195  15.878 1.00 44.01 ? 320 HOH B O   1 
HETATM 2626 O  O   . HOH D 2 .   ? 45.062  0.647   7.741  1.00 39.69 ? 321 HOH B O   1 
HETATM 2627 O  O   . HOH D 2 .   ? 8.186   21.602  10.148 1.00 38.42 ? 322 HOH B O   1 
HETATM 2628 O  O   . HOH D 2 .   ? 10.405  25.909  10.895 1.00 38.56 ? 323 HOH B O   1 
HETATM 2629 O  O   . HOH D 2 .   ? 42.665  -5.615  11.287 1.00 46.36 ? 324 HOH B O   1 
HETATM 2630 O  O   . HOH D 2 .   ? 25.182  22.123  17.300 1.00 61.59 ? 325 HOH B O   1 
HETATM 2631 O  O   . HOH D 2 .   ? 4.161   17.026  17.143 1.00 46.46 ? 326 HOH B O   1 
HETATM 2632 O  O   . HOH D 2 .   ? 27.579  0.098   24.508 1.00 42.99 ? 327 HOH B O   1 
HETATM 2633 O  O   . HOH D 2 .   ? 3.419   24.601  13.965 1.00 52.08 ? 328 HOH B O   1 
HETATM 2634 O  O   . HOH D 2 .   ? 13.505  29.030  37.208 1.00 56.45 ? 329 HOH B O   1 
HETATM 2635 O  O   . HOH D 2 .   ? 22.524  32.285  31.854 1.00 59.06 ? 330 HOH B O   1 
HETATM 2636 O  O   . HOH D 2 .   ? 6.490   17.168  29.019 1.00 37.26 ? 331 HOH B O   1 
HETATM 2637 O  O   . HOH D 2 .   ? 13.470  15.767  10.941 1.00 41.78 ? 332 HOH B O   1 
HETATM 2638 O  O   . HOH D 2 .   ? 47.518  1.259   16.492 1.00 52.02 ? 333 HOH B O   1 
HETATM 2639 O  O   . HOH D 2 .   ? 38.134  20.944  14.150 1.00 49.10 ? 334 HOH B O   1 
HETATM 2640 O  O   . HOH D 2 .   ? 24.198  20.320  13.477 1.00 44.84 ? 335 HOH B O   1 
HETATM 2641 O  O   . HOH D 2 .   ? 46.714  -1.792  20.922 1.00 44.48 ? 336 HOH B O   1 
HETATM 2642 O  O   . HOH D 2 .   ? 42.832  12.722  27.727 1.00 36.30 ? 337 HOH B O   1 
HETATM 2643 O  O   . HOH D 2 .   ? 41.132  11.452  29.384 1.00 51.37 ? 338 HOH B O   1 
HETATM 2644 O  O   . HOH D 2 .   ? 35.595  18.540  16.046 1.00 41.73 ? 339 HOH B O   1 
HETATM 2645 O  O   . HOH D 2 .   ? 26.629  2.735   25.833 1.00 69.20 ? 340 HOH B O   1 
HETATM 2646 O  O   . HOH D 2 .   ? 34.673  -2.501  24.337 1.00 46.18 ? 341 HOH B O   1 
HETATM 2647 O  O   . HOH D 2 .   ? 23.602  25.085  24.570 1.00 51.66 ? 342 HOH B O   1 
HETATM 2648 O  O   . HOH D 2 .   ? 32.552  21.810  24.121 1.00 67.80 ? 343 HOH B O   1 
HETATM 2649 O  O   . HOH D 2 .   ? 39.859  -0.461  8.275  1.00 48.79 ? 344 HOH B O   1 
HETATM 2650 O  O   . HOH D 2 .   ? 49.422  15.519  18.669 1.00 45.75 ? 345 HOH B O   1 
HETATM 2651 O  O   . HOH D 2 .   ? 5.036   18.568  13.936 1.00 42.54 ? 346 HOH B O   1 
HETATM 2652 O  O   . HOH D 2 .   ? 35.046  7.635   6.377  1.00 52.62 ? 347 HOH B O   1 
HETATM 2653 O  O   . HOH D 2 .   ? 1.521   14.028  24.247 1.00 38.12 ? 348 HOH B O   1 
HETATM 2654 O  O   . HOH D 2 .   ? 17.395  26.997  22.245 1.00 49.47 ? 349 HOH B O   1 
HETATM 2655 O  O   . HOH D 2 .   ? 38.538  12.558  29.188 1.00 42.88 ? 350 HOH B O   1 
HETATM 2656 O  O   . HOH D 2 .   ? 12.120  6.074   26.083 1.00 50.34 ? 351 HOH B O   1 
HETATM 2657 O  O   . HOH D 2 .   ? 29.690  -3.819  26.547 1.00 53.95 ? 352 HOH B O   1 
HETATM 2658 O  O   . HOH D 2 .   ? 2.924   18.735  18.523 1.00 56.48 ? 353 HOH B O   1 
HETATM 2659 O  O   . HOH D 2 .   ? 34.747  -4.842  22.346 1.00 67.35 ? 354 HOH B O   1 
HETATM 2660 O  O   . HOH D 2 .   ? 48.161  4.654   31.375 1.00 50.27 ? 355 HOH B O   1 
HETATM 2661 O  O   . HOH D 2 .   ? 6.045   17.739  36.301 1.00 58.54 ? 356 HOH B O   1 
HETATM 2662 O  O   . HOH D 2 .   ? 49.735  14.334  23.961 1.00 61.53 ? 357 HOH B O   1 
HETATM 2663 O  O   . HOH D 2 .   ? 16.859  13.933  9.621  1.00 48.46 ? 358 HOH B O   1 
HETATM 2664 O  O   . HOH D 2 .   ? 29.603  24.900  27.897 1.00 48.88 ? 359 HOH B O   1 
HETATM 2665 O  O   . HOH D 2 .   ? 25.864  -1.602  24.995 1.00 59.45 ? 360 HOH B O   1 
HETATM 2666 O  O   . HOH D 2 .   ? 27.338  20.088  29.272 1.00 46.91 ? 361 HOH B O   1 
HETATM 2667 O  O   . HOH D 2 .   ? 7.097   25.200  12.503 1.00 56.58 ? 362 HOH B O   1 
HETATM 2668 O  O   . HOH D 2 .   ? 39.620  12.125  7.729  1.00 69.67 ? 363 HOH B O   1 
HETATM 2669 O  O   . HOH D 2 .   ? 32.953  -1.652  26.072 1.00 63.07 ? 364 HOH B O   1 
HETATM 2670 O  O   . HOH D 2 .   ? 50.109  17.128  25.263 1.00 43.16 ? 365 HOH B O   1 
HETATM 2671 O  O   . HOH D 2 .   ? 10.686  10.110  35.385 1.00 57.10 ? 366 HOH B O   1 
HETATM 2672 O  O   . HOH D 2 .   ? 23.053  29.542  34.363 1.00 57.12 ? 367 HOH B O   1 
HETATM 2673 O  O   . HOH D 2 .   ? 15.208  30.122  26.168 1.00 61.07 ? 368 HOH B O   1 
HETATM 2674 O  O   . HOH D 2 .   ? 22.813  31.489  36.338 1.00 64.68 ? 369 HOH B O   1 
HETATM 2675 O  O   . HOH D 2 .   ? 18.297  2.494   21.068 1.00 58.01 ? 370 HOH B O   1 
HETATM 2676 O  O   . HOH D 2 .   ? 28.129  21.362  33.447 1.00 54.30 ? 371 HOH B O   1 
HETATM 2677 O  O   . HOH D 2 .   ? 28.767  22.529  26.262 1.00 41.10 ? 372 HOH B O   1 
HETATM 2678 O  O   . HOH D 2 .   ? 29.365  24.544  24.338 1.00 65.61 ? 373 HOH B O   1 
HETATM 2679 O  O   . HOH D 2 .   ? 8.990   33.599  31.886 1.00 53.53 ? 374 HOH B O   1 
HETATM 2680 O  O   . HOH D 2 .   ? 22.132  11.816  11.769 1.00 56.44 ? 375 HOH B O   1 
HETATM 2681 O  O   . HOH D 2 .   ? 20.991  9.490   12.394 1.00 66.18 ? 376 HOH B O   1 
HETATM 2682 O  O   . HOH D 2 .   ? 3.845   22.322  11.292 1.00 66.86 ? 377 HOH B O   1 
HETATM 2683 O  O   . HOH D 2 .   ? 28.378  -1.021  26.228 1.00 63.17 ? 378 HOH B O   1 
HETATM 2684 O  O   . HOH D 2 .   ? 21.370  3.711   24.018 1.00 55.03 ? 379 HOH B O   1 
HETATM 2685 O  O   . HOH D 2 .   ? 43.415  22.690  19.698 1.00 44.95 ? 380 HOH B O   1 
HETATM 2686 O  O   . HOH D 2 .   ? 36.347  -7.043  20.714 1.00 60.62 ? 381 HOH B O   1 
HETATM 2687 O  O   . HOH D 2 .   ? 21.065  19.305  39.920 1.00 50.60 ? 382 HOH B O   1 
HETATM 2688 O  O   . HOH D 2 .   ? 9.832   32.803  29.601 1.00 59.77 ? 383 HOH B O   1 
HETATM 2689 O  O   . HOH D 2 .   ? 3.873   30.125  15.929 1.00 80.15 ? 384 HOH B O   1 
HETATM 2690 O  O   . HOH D 2 .   ? 43.584  10.155  15.059 1.00 58.58 ? 385 HOH B O   1 
HETATM 2691 O  O   . HOH D 2 .   ? 44.202  11.974  17.139 1.00 54.39 ? 386 HOH B O   1 
HETATM 2692 O  O   . HOH D 2 .   ? 48.958  1.761   32.159 1.00 48.74 ? 387 HOH B O   1 
HETATM 2693 O  O   . HOH D 2 .   ? 22.087  14.719  18.499 1.00 35.71 ? 388 HOH B O   1 
HETATM 2694 O  O   . HOH D 2 .   ? 30.007  6.148   4.846  1.00 81.98 ? 389 HOH B O   1 
HETATM 2695 O  O   . HOH D 2 .   ? 23.275  14.154  15.651 1.00 54.60 ? 390 HOH B O   1 
HETATM 2696 O  O   . HOH D 2 .   ? 42.679  5.908   30.619 1.00 53.05 ? 391 HOH B O   1 
HETATM 2697 O  O   . HOH D 2 .   ? 46.356  5.527   14.661 1.00 49.18 ? 392 HOH B O   1 
HETATM 2698 O  O   . HOH D 2 .   ? 48.088  13.170  17.827 1.00 56.95 ? 393 HOH B O   1 
HETATM 2699 O  O   . HOH D 2 .   ? 20.156  7.306   14.314 1.00 65.41 ? 394 HOH B O   1 
HETATM 2700 O  O   . HOH D 2 .   ? 18.340  32.832  20.367 1.00 61.48 ? 395 HOH B O   1 
HETATM 2701 O  O   . HOH D 2 .   ? 42.328  24.429  23.289 1.00 52.35 ? 396 HOH B O   1 
HETATM 2702 O  O   . HOH D 2 .   ? 41.394  10.705  31.784 1.00 48.93 ? 397 HOH B O   1 
HETATM 2703 O  O   . HOH D 2 .   ? 22.681  32.924  28.878 1.00 68.39 ? 398 HOH B O   1 
HETATM 2704 O  O   . HOH D 2 .   ? 30.502  27.292  33.849 1.00 62.17 ? 399 HOH B O   1 
HETATM 2705 O  O   . HOH D 2 .   ? 21.439  16.612  18.309 1.00 43.40 ? 400 HOH B O   1 
HETATM 2706 O  O   . HOH D 2 .   ? 21.189  9.383   20.853 1.00 49.98 ? 401 HOH B O   1 
HETATM 2707 O  O   . HOH D 2 .   ? 8.099   13.289  11.747 1.00 43.19 ? 402 HOH B O   1 
HETATM 2708 O  O   . HOH D 2 .   ? 44.929  6.811   18.626 1.00 33.58 ? 403 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   108 ?   ?   ?   A . n 
A 1 2   ALA 2   109 ?   ?   ?   A . n 
A 1 3   MSE 3   110 ?   ?   ?   A . n 
A 1 4   ASP 4   111 ?   ?   ?   A . n 
A 1 5   PRO 5   112 112 PRO PRO A . n 
A 1 6   ARG 6   113 113 ARG ARG A . n 
A 1 7   GLU 7   114 114 GLU GLU A . n 
A 1 8   VAL 8   115 115 VAL VAL A . n 
A 1 9   ILE 9   116 116 ILE ILE A . n 
A 1 10  LEU 10  117 117 LEU LEU A . n 
A 1 11  CYS 11  118 118 CYS CYS A . n 
A 1 12  LYS 12  119 119 LYS LYS A . n 
A 1 13  ASP 13  120 120 ASP ASP A . n 
A 1 14  GLN 14  121 121 GLN GLN A . n 
A 1 15  ASP 15  122 122 ASP ASP A . n 
A 1 16  GLY 16  123 123 GLY GLY A . n 
A 1 17  LYS 17  124 124 LYS LYS A . n 
A 1 18  ILE 18  125 125 ILE ILE A . n 
A 1 19  GLY 19  126 126 GLY GLY A . n 
A 1 20  LEU 20  127 127 LEU LEU A . n 
A 1 21  ARG 21  128 128 ARG ARG A . n 
A 1 22  LEU 22  129 129 LEU LEU A . n 
A 1 23  LYS 23  130 130 LYS LYS A . n 
A 1 24  SER 24  131 131 SER SER A . n 
A 1 25  ILE 25  132 132 ILE ILE A . n 
A 1 26  ASP 26  133 133 ASP ASP A . n 
A 1 27  ASN 27  134 134 ASN ASN A . n 
A 1 28  GLY 28  135 135 GLY GLY A . n 
A 1 29  ILE 29  136 136 ILE ILE A . n 
A 1 30  PHE 30  137 137 PHE PHE A . n 
A 1 31  VAL 31  138 138 VAL VAL A . n 
A 1 32  GLN 32  139 139 GLN GLN A . n 
A 1 33  LEU 33  140 140 LEU LEU A . n 
A 1 34  VAL 34  141 141 VAL VAL A . n 
A 1 35  GLN 35  142 142 GLN GLN A . n 
A 1 36  ALA 36  143 143 ALA ALA A . n 
A 1 37  ASN 37  144 144 ASN ASN A . n 
A 1 38  SER 38  145 145 SER SER A . n 
A 1 39  PRO 39  146 146 PRO PRO A . n 
A 1 40  ALA 40  147 147 ALA ALA A . n 
A 1 41  SER 41  148 148 SER SER A . n 
A 1 42  LEU 42  149 149 LEU LEU A . n 
A 1 43  VAL 43  150 150 VAL VAL A . n 
A 1 44  GLY 44  151 151 GLY GLY A . n 
A 1 45  LEU 45  152 152 LEU LEU A . n 
A 1 46  ARG 46  153 153 ARG ARG A . n 
A 1 47  PHE 47  154 154 PHE PHE A . n 
A 1 48  GLY 48  155 155 GLY GLY A . n 
A 1 49  ASP 49  156 156 ASP ASP A . n 
A 1 50  GLN 50  157 157 GLN GLN A . n 
A 1 51  VAL 51  158 158 VAL VAL A . n 
A 1 52  LEU 52  159 159 LEU LEU A . n 
A 1 53  GLN 53  160 160 GLN GLN A . n 
A 1 54  ILE 54  161 161 ILE ILE A . n 
A 1 55  ASN 55  162 162 ASN ASN A . n 
A 1 56  GLY 56  163 163 GLY GLY A . n 
A 1 57  GLU 57  164 164 GLU GLU A . n 
A 1 58  ASN 58  165 165 ASN ASN A . n 
A 1 59  CYS 59  166 166 CYS CYS A . n 
A 1 60  ALA 60  167 167 ALA ALA A . n 
A 1 61  GLY 61  168 168 GLY GLY A . n 
A 1 62  TRP 62  169 169 TRP TRP A . n 
A 1 63  SER 63  170 170 SER SER A . n 
A 1 64  SER 64  171 171 SER SER A . n 
A 1 65  ASP 65  172 172 ASP ASP A . n 
A 1 66  LYS 66  173 173 LYS LYS A . n 
A 1 67  ALA 67  174 174 ALA ALA A . n 
A 1 68  HIS 68  175 175 HIS HIS A . n 
A 1 69  LYS 69  176 176 LYS LYS A . n 
A 1 70  VAL 70  177 177 VAL VAL A . n 
A 1 71  LEU 71  178 178 LEU LEU A . n 
A 1 72  LYS 72  179 179 LYS LYS A . n 
A 1 73  GLN 73  180 180 GLN GLN A . n 
A 1 74  ALA 74  181 181 ALA ALA A . n 
A 1 75  PHE 75  182 182 PHE PHE A . n 
A 1 76  GLY 76  183 183 GLY GLY A . n 
A 1 77  GLU 77  184 184 GLU GLU A . n 
A 1 78  LYS 78  185 185 LYS LYS A . n 
A 1 79  ILE 79  186 186 ILE ILE A . n 
A 1 80  THR 80  187 187 THR THR A . n 
A 1 81  MSE 81  188 188 MSE MSE A . n 
A 1 82  THR 82  189 189 THR THR A . n 
A 1 83  ILE 83  190 190 ILE ILE A . n 
A 1 84  ARG 84  191 191 ARG ARG A . n 
A 1 85  ASP 85  192 192 ASP ASP A . n 
A 1 86  ARG 86  193 193 ARG ARG A . n 
A 1 87  PRO 87  194 194 PRO PRO A . n 
A 1 88  PHE 88  195 195 PHE PHE A . n 
A 1 89  GLU 89  196 196 GLU GLU A . n 
A 1 90  ARG 90  197 197 ARG ARG A . n 
A 1 91  THR 91  198 198 THR THR A . n 
A 1 92  ILE 92  199 199 ILE ILE A . n 
A 1 93  THR 93  200 200 THR THR A . n 
A 1 94  MSE 94  201 201 MSE MSE A . n 
A 1 95  HIS 95  202 202 HIS HIS A . n 
A 1 96  LYS 96  203 203 LYS LYS A . n 
A 1 97  ASP 97  204 204 ASP ASP A . n 
A 1 98  SER 98  205 205 SER SER A . n 
A 1 99  THR 99  206 206 THR THR A . n 
A 1 100 GLY 100 207 207 GLY GLY A . n 
A 1 101 HIS 101 208 208 HIS HIS A . n 
A 1 102 VAL 102 209 209 VAL VAL A . n 
A 1 103 GLY 103 210 210 GLY GLY A . n 
A 1 104 PHE 104 211 211 PHE PHE A . n 
A 1 105 ILE 105 212 212 ILE ILE A . n 
A 1 106 PHE 106 213 213 PHE PHE A . n 
A 1 107 LYS 107 214 214 LYS LYS A . n 
A 1 108 ASN 108 215 215 ASN ASN A . n 
A 1 109 GLY 109 216 216 GLY GLY A . n 
A 1 110 LYS 110 217 217 LYS LYS A . n 
A 1 111 ILE 111 218 218 ILE ILE A . n 
A 1 112 THR 112 219 219 THR THR A . n 
A 1 113 SER 113 220 220 SER SER A . n 
A 1 114 ILE 114 221 221 ILE ILE A . n 
A 1 115 VAL 115 222 222 VAL VAL A . n 
A 1 116 LYS 116 223 223 LYS LYS A . n 
A 1 117 ASP 117 224 224 ASP ASP A . n 
A 1 118 SER 118 225 225 SER SER A . n 
A 1 119 SER 119 226 226 SER SER A . n 
A 1 120 ALA 120 227 227 ALA ALA A . n 
A 1 121 ALA 121 228 228 ALA ALA A . n 
A 1 122 ARG 122 229 229 ARG ARG A . n 
A 1 123 ASN 123 230 230 ASN ASN A . n 
A 1 124 GLY 124 231 231 GLY GLY A . n 
A 1 125 LEU 125 232 232 LEU LEU A . n 
A 1 126 LEU 126 233 233 LEU LEU A . n 
A 1 127 THR 127 234 234 THR THR A . n 
A 1 128 GLU 128 235 235 GLU GLU A . n 
A 1 129 HIS 129 236 236 HIS HIS A . n 
A 1 130 ASN 130 237 237 ASN ASN A . n 
A 1 131 ILE 131 238 238 ILE ILE A . n 
A 1 132 CYS 132 239 239 CYS CYS A . n 
A 1 133 GLU 133 240 240 GLU GLU A . n 
A 1 134 ILE 134 241 241 ILE ILE A . n 
A 1 135 ASN 135 242 242 ASN ASN A . n 
A 1 136 GLY 136 243 243 GLY GLY A . n 
A 1 137 GLN 137 244 244 GLN GLN A . n 
A 1 138 ASN 138 245 245 ASN ASN A . n 
A 1 139 VAL 139 246 246 VAL VAL A . n 
A 1 140 ILE 140 247 247 ILE ILE A . n 
A 1 141 GLY 141 248 248 GLY GLY A . n 
A 1 142 LEU 142 249 249 LEU LEU A . n 
A 1 143 LYS 143 250 250 LYS LYS A . n 
A 1 144 ASP 144 251 251 ASP ASP A . n 
A 1 145 SER 145 252 252 SER SER A . n 
A 1 146 GLN 146 253 253 GLN GLN A . n 
A 1 147 ILE 147 254 254 ILE ILE A . n 
A 1 148 ALA 148 255 255 ALA ALA A . n 
A 1 149 ASP 149 256 256 ASP ASP A . n 
A 1 150 ILE 150 257 257 ILE ILE A . n 
A 1 151 LEU 151 258 258 LEU LEU A . n 
A 1 152 SER 152 259 259 SER SER A . n 
A 1 153 THR 153 260 260 THR THR A . n 
A 1 154 SER 154 261 261 SER SER A . n 
A 1 155 GLY 155 262 262 GLY GLY A . n 
A 1 156 THR 156 263 263 THR THR A . n 
A 1 157 VAL 157 264 264 VAL VAL A . n 
A 1 158 VAL 158 265 265 VAL VAL A . n 
A 1 159 THR 159 266 266 THR THR A . n 
A 1 160 ILE 160 267 267 ILE ILE A . n 
A 1 161 THR 161 268 268 THR THR A . n 
A 1 162 ILE 162 269 269 ILE ILE A . n 
A 1 163 MSE 163 270 270 MSE MSE A . n 
A 1 164 PRO 164 271 271 PRO PRO A . n 
A 1 165 ALA 165 272 272 ALA ALA A . n 
A 1 166 PHE 166 273 273 PHE PHE A . n 
B 1 1   GLY 1   108 ?   ?   ?   B . n 
B 1 2   ALA 2   109 ?   ?   ?   B . n 
B 1 3   MSE 3   110 110 MSE MSE B . n 
B 1 4   ASP 4   111 111 ASP ASP B . n 
B 1 5   PRO 5   112 112 PRO PRO B . n 
B 1 6   ARG 6   113 113 ARG ARG B . n 
B 1 7   GLU 7   114 114 GLU GLU B . n 
B 1 8   VAL 8   115 115 VAL VAL B . n 
B 1 9   ILE 9   116 116 ILE ILE B . n 
B 1 10  LEU 10  117 117 LEU LEU B . n 
B 1 11  CYS 11  118 118 CYS CYS B . n 
B 1 12  LYS 12  119 119 LYS LYS B . n 
B 1 13  ASP 13  120 120 ASP ASP B . n 
B 1 14  GLN 14  121 121 GLN GLN B . n 
B 1 15  ASP 15  122 122 ASP ASP B . n 
B 1 16  GLY 16  123 123 GLY GLY B . n 
B 1 17  LYS 17  124 124 LYS LYS B . n 
B 1 18  ILE 18  125 125 ILE ILE B . n 
B 1 19  GLY 19  126 126 GLY GLY B . n 
B 1 20  LEU 20  127 127 LEU LEU B . n 
B 1 21  ARG 21  128 128 ARG ARG B . n 
B 1 22  LEU 22  129 129 LEU LEU B . n 
B 1 23  LYS 23  130 130 LYS LYS B . n 
B 1 24  SER 24  131 131 SER SER B . n 
B 1 25  ILE 25  132 132 ILE ILE B . n 
B 1 26  ASP 26  133 133 ASP ASP B . n 
B 1 27  ASN 27  134 134 ASN ASN B . n 
B 1 28  GLY 28  135 135 GLY GLY B . n 
B 1 29  ILE 29  136 136 ILE ILE B . n 
B 1 30  PHE 30  137 137 PHE PHE B . n 
B 1 31  VAL 31  138 138 VAL VAL B . n 
B 1 32  GLN 32  139 139 GLN GLN B . n 
B 1 33  LEU 33  140 140 LEU LEU B . n 
B 1 34  VAL 34  141 141 VAL VAL B . n 
B 1 35  GLN 35  142 142 GLN GLN B . n 
B 1 36  ALA 36  143 143 ALA ALA B . n 
B 1 37  ASN 37  144 144 ASN ASN B . n 
B 1 38  SER 38  145 145 SER SER B . n 
B 1 39  PRO 39  146 146 PRO PRO B . n 
B 1 40  ALA 40  147 147 ALA ALA B . n 
B 1 41  SER 41  148 148 SER SER B . n 
B 1 42  LEU 42  149 149 LEU LEU B . n 
B 1 43  VAL 43  150 150 VAL VAL B . n 
B 1 44  GLY 44  151 151 GLY GLY B . n 
B 1 45  LEU 45  152 152 LEU LEU B . n 
B 1 46  ARG 46  153 153 ARG ARG B . n 
B 1 47  PHE 47  154 154 PHE PHE B . n 
B 1 48  GLY 48  155 155 GLY GLY B . n 
B 1 49  ASP 49  156 156 ASP ASP B . n 
B 1 50  GLN 50  157 157 GLN GLN B . n 
B 1 51  VAL 51  158 158 VAL VAL B . n 
B 1 52  LEU 52  159 159 LEU LEU B . n 
B 1 53  GLN 53  160 160 GLN GLN B . n 
B 1 54  ILE 54  161 161 ILE ILE B . n 
B 1 55  ASN 55  162 162 ASN ASN B . n 
B 1 56  GLY 56  163 163 GLY GLY B . n 
B 1 57  GLU 57  164 164 GLU GLU B . n 
B 1 58  ASN 58  165 165 ASN ASN B . n 
B 1 59  CYS 59  166 166 CYS CYS B . n 
B 1 60  ALA 60  167 167 ALA ALA B . n 
B 1 61  GLY 61  168 168 GLY GLY B . n 
B 1 62  TRP 62  169 169 TRP TRP B . n 
B 1 63  SER 63  170 170 SER SER B . n 
B 1 64  SER 64  171 171 SER SER B . n 
B 1 65  ASP 65  172 172 ASP ASP B . n 
B 1 66  LYS 66  173 173 LYS LYS B . n 
B 1 67  ALA 67  174 174 ALA ALA B . n 
B 1 68  HIS 68  175 175 HIS HIS B . n 
B 1 69  LYS 69  176 176 LYS LYS B . n 
B 1 70  VAL 70  177 177 VAL VAL B . n 
B 1 71  LEU 71  178 178 LEU LEU B . n 
B 1 72  LYS 72  179 179 LYS LYS B . n 
B 1 73  GLN 73  180 180 GLN GLN B . n 
B 1 74  ALA 74  181 181 ALA ALA B . n 
B 1 75  PHE 75  182 182 PHE PHE B . n 
B 1 76  GLY 76  183 183 GLY GLY B . n 
B 1 77  GLU 77  184 184 GLU GLU B . n 
B 1 78  LYS 78  185 185 LYS LYS B . n 
B 1 79  ILE 79  186 186 ILE ILE B . n 
B 1 80  THR 80  187 187 THR THR B . n 
B 1 81  MSE 81  188 188 MSE MSE B . n 
B 1 82  THR 82  189 189 THR THR B . n 
B 1 83  ILE 83  190 190 ILE ILE B . n 
B 1 84  ARG 84  191 191 ARG ARG B . n 
B 1 85  ASP 85  192 192 ASP ASP B . n 
B 1 86  ARG 86  193 193 ARG ARG B . n 
B 1 87  PRO 87  194 194 PRO PRO B . n 
B 1 88  PHE 88  195 195 PHE PHE B . n 
B 1 89  GLU 89  196 196 GLU GLU B . n 
B 1 90  ARG 90  197 197 ARG ARG B . n 
B 1 91  THR 91  198 198 THR THR B . n 
B 1 92  ILE 92  199 199 ILE ILE B . n 
B 1 93  THR 93  200 200 THR THR B . n 
B 1 94  MSE 94  201 201 MSE MSE B . n 
B 1 95  HIS 95  202 202 HIS HIS B . n 
B 1 96  LYS 96  203 203 LYS LYS B . n 
B 1 97  ASP 97  204 204 ASP ASP B . n 
B 1 98  SER 98  205 205 SER SER B . n 
B 1 99  THR 99  206 206 THR THR B . n 
B 1 100 GLY 100 207 207 GLY GLY B . n 
B 1 101 HIS 101 208 208 HIS HIS B . n 
B 1 102 VAL 102 209 209 VAL VAL B . n 
B 1 103 GLY 103 210 210 GLY GLY B . n 
B 1 104 PHE 104 211 211 PHE PHE B . n 
B 1 105 ILE 105 212 212 ILE ILE B . n 
B 1 106 PHE 106 213 213 PHE PHE B . n 
B 1 107 LYS 107 214 214 LYS LYS B . n 
B 1 108 ASN 108 215 215 ASN ASN B . n 
B 1 109 GLY 109 216 216 GLY GLY B . n 
B 1 110 LYS 110 217 217 LYS LYS B . n 
B 1 111 ILE 111 218 218 ILE ILE B . n 
B 1 112 THR 112 219 219 THR THR B . n 
B 1 113 SER 113 220 220 SER SER B . n 
B 1 114 ILE 114 221 221 ILE ILE B . n 
B 1 115 VAL 115 222 222 VAL VAL B . n 
B 1 116 LYS 116 223 223 LYS LYS B . n 
B 1 117 ASP 117 224 224 ASP ASP B . n 
B 1 118 SER 118 225 225 SER SER B . n 
B 1 119 SER 119 226 226 SER SER B . n 
B 1 120 ALA 120 227 227 ALA ALA B . n 
B 1 121 ALA 121 228 228 ALA ALA B . n 
B 1 122 ARG 122 229 229 ARG ARG B . n 
B 1 123 ASN 123 230 230 ASN ASN B . n 
B 1 124 GLY 124 231 231 GLY GLY B . n 
B 1 125 LEU 125 232 232 LEU LEU B . n 
B 1 126 LEU 126 233 233 LEU LEU B . n 
B 1 127 THR 127 234 234 THR THR B . n 
B 1 128 GLU 128 235 235 GLU GLU B . n 
B 1 129 HIS 129 236 236 HIS HIS B . n 
B 1 130 ASN 130 237 237 ASN ASN B . n 
B 1 131 ILE 131 238 238 ILE ILE B . n 
B 1 132 CYS 132 239 239 CYS CYS B . n 
B 1 133 GLU 133 240 240 GLU GLU B . n 
B 1 134 ILE 134 241 241 ILE ILE B . n 
B 1 135 ASN 135 242 242 ASN ASN B . n 
B 1 136 GLY 136 243 243 GLY GLY B . n 
B 1 137 GLN 137 244 244 GLN GLN B . n 
B 1 138 ASN 138 245 245 ASN ASN B . n 
B 1 139 VAL 139 246 246 VAL VAL B . n 
B 1 140 ILE 140 247 247 ILE ILE B . n 
B 1 141 GLY 141 248 248 GLY GLY B . n 
B 1 142 LEU 142 249 249 LEU LEU B . n 
B 1 143 LYS 143 250 250 LYS LYS B . n 
B 1 144 ASP 144 251 251 ASP ASP B . n 
B 1 145 SER 145 252 252 SER SER B . n 
B 1 146 GLN 146 253 253 GLN GLN B . n 
B 1 147 ILE 147 254 254 ILE ILE B . n 
B 1 148 ALA 148 255 255 ALA ALA B . n 
B 1 149 ASP 149 256 256 ASP ASP B . n 
B 1 150 ILE 150 257 257 ILE ILE B . n 
B 1 151 LEU 151 258 258 LEU LEU B . n 
B 1 152 SER 152 259 259 SER SER B . n 
B 1 153 THR 153 260 260 THR THR B . n 
B 1 154 SER 154 261 261 SER SER B . n 
B 1 155 GLY 155 262 262 GLY GLY B . n 
B 1 156 THR 156 263 263 THR THR B . n 
B 1 157 VAL 157 264 264 VAL VAL B . n 
B 1 158 VAL 158 265 265 VAL VAL B . n 
B 1 159 THR 159 266 266 THR THR B . n 
B 1 160 ILE 160 267 267 ILE ILE B . n 
B 1 161 THR 161 268 268 THR THR B . n 
B 1 162 ILE 162 269 269 ILE ILE B . n 
B 1 163 MSE 163 270 270 MSE MSE B . n 
B 1 164 PRO 164 271 271 PRO PRO B . n 
B 1 165 ALA 165 272 272 ALA ALA B . n 
B 1 166 PHE 166 273 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 81  A MSE 188 ? MET SELENOMETHIONINE 
2 A MSE 94  A MSE 201 ? MET SELENOMETHIONINE 
3 A MSE 163 A MSE 270 ? MET SELENOMETHIONINE 
4 B MSE 3   B MSE 110 ? MET SELENOMETHIONINE 
5 B MSE 81  B MSE 188 ? MET SELENOMETHIONINE 
6 B MSE 94  B MSE 201 ? MET SELENOMETHIONINE 
7 B MSE 163 B MSE 270 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2450  ? 
1 MORE         -9    ? 
1 'SSA (A^2)'  15990 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-04-15 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.pdbx_refine_id 
1 ? refined 28.9410 -13.6970 9.7270  0.1062 0.1189 0.0259 -0.0302 0.0481  0.0075  2.4901 4.7488 1.4838 1.6665  0.5331  0.2066 
-0.1519 0.2056  -0.1612 -0.2671 0.2494  -0.2525 0.1707  -0.0105 -0.0974 'X-RAY DIFFRACTION' 
2 ? refined 5.7740  0.3000   12.9720 0.0389 0.0859 0.0613 -0.0169 -0.0015 0.0204  3.6759 3.8885 2.1664 -0.7084 -0.6635 1.5039 
-0.0284 0.2724  -0.0987 -0.1093 0.1331  0.2292  -0.0011 0.0513  -0.1047 'X-RAY DIFFRACTION' 
3 ? refined 14.8380 20.3460  25.4140 0.0837 0.0845 0.0861 -0.0097 0.0148  0.0391  2.1459 2.0718 2.1608 0.3090  0.0446  0.9157 
-0.1679 -0.0405 0.0489  0.0659  0.1251  -0.1026 -0.1562 0.0591  0.0429  'X-RAY DIFFRACTION' 
4 ? refined 38.6120 7.4570   19.5710 0.0346 0.0374 0.1476 -0.0162 0.0343  -0.0186 2.7931 2.7338 1.3753 0.6351  0.0926  0.2181 
0.0748  -0.0263 0.3832  0.1843  -0.0488 -0.1048 0.1073  0.0388  -0.0261 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.selection_details 
1 1 A 5  112 A 87  194 ? A A 'X-RAY DIFFRACTION' ? 
2 2 A 90 197 A 164 271 ? A A 'X-RAY DIFFRACTION' ? 
3 3 B 5  112 B 87  194 ? B B 'X-RAY DIFFRACTION' ? 
4 4 B 90 197 B 163 270 ? B B 'X-RAY DIFFRACTION' ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .            ? 1 
TRUNCATE 'data reduction'  .            ? 2 
SHARP    phasing           .            ? 3 
REFMAC   refinement        5.1.24       ? 4 
HKL-2000 'data reduction'  .            ? 5 
CCP4     'data scaling'    '(TRUNCATE)' ? 6 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O  B HOH 388 ? ? O B HOH 400 ? ? 2.01 
2 1 O  B HOH 294 ? ? O B HOH 403 ? ? 2.01 
3 1 CB B ASN 134 ? ? O B HOH 402 ? ? 2.13 
4 1 O  A HOH 397 ? ? O B HOH 286 ? ? 2.13 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    N 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    MSE 
_pdbx_validate_symm_contact.auth_seq_id_1     110 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     312 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_656 
_pdbx_validate_symm_contact.dist              2.15 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CB 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            PHE 
_pdbx_validate_rmsd_bond.auth_seq_id_1             182 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            CG 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            PHE 
_pdbx_validate_rmsd_bond.auth_seq_id_2             182 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.317 
_pdbx_validate_rmsd_bond.bond_target_value         1.509 
_pdbx_validate_rmsd_bond.bond_deviation            -0.192 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.017 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB A ASP 192 ? ? CG A ASP 192 ? ? OD1 A ASP 192 ? ? 124.15 118.30 5.85 0.90 N 
2 1 CB B ASP 251 ? ? CG B ASP 251 ? ? OD1 B ASP 251 ? ? 124.14 118.30 5.84 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 193 ? ? -15.62 90.47   
2 1 ASP A 204 ? ? -95.79 -148.34 
3 1 THR A 206 ? ? -61.67 3.77    
4 1 ARG B 193 ? ? -8.42  90.95   
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 SER A 205 ? ? THR A 206 ? ? 147.65  
2 1 THR A 206 ? ? GLY A 207 ? ? -142.49 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 0 A GLN 121 ? CG  ? A GLN 14  CG  
2  1 Y 0 A GLN 121 ? CD  ? A GLN 14  CD  
3  1 Y 0 A GLN 121 ? OE1 ? A GLN 14  OE1 
4  1 Y 0 A GLN 121 ? NE2 ? A GLN 14  NE2 
5  1 Y 0 A LYS 124 ? CD  ? A LYS 17  CD  
6  1 Y 0 A LYS 124 ? CE  ? A LYS 17  CE  
7  1 Y 0 A LYS 124 ? NZ  ? A LYS 17  NZ  
8  1 Y 0 A ARG 128 ? CG  ? A ARG 21  CG  
9  1 Y 0 A ARG 128 ? CD  ? A ARG 21  CD  
10 1 Y 0 A ARG 128 ? NE  ? A ARG 21  NE  
11 1 Y 0 A ARG 128 ? CZ  ? A ARG 21  CZ  
12 1 Y 0 A ARG 128 ? NH1 ? A ARG 21  NH1 
13 1 Y 0 A ARG 128 ? NH2 ? A ARG 21  NH2 
14 1 Y 0 A LYS 176 ? CB  ? A LYS 69  CB  
15 1 Y 0 A LYS 176 ? CG  ? A LYS 69  CG  
16 1 Y 0 A LYS 176 ? CD  ? A LYS 69  CD  
17 1 Y 0 A LYS 176 ? CE  ? A LYS 69  CE  
18 1 Y 0 A LYS 176 ? NZ  ? A LYS 69  NZ  
19 1 Y 0 A PHE 182 ? CG  ? A PHE 75  CG  
20 1 Y 0 A PHE 182 ? CD1 ? A PHE 75  CD1 
21 1 Y 0 A PHE 182 ? CD2 ? A PHE 75  CD2 
22 1 Y 0 A PHE 182 ? CE1 ? A PHE 75  CE1 
23 1 Y 0 A PHE 182 ? CE2 ? A PHE 75  CE2 
24 1 Y 0 A PHE 182 ? CZ  ? A PHE 75  CZ  
25 1 Y 1 A LYS 214 ? CG  ? A LYS 107 CG  
26 1 Y 1 A LYS 214 ? CD  ? A LYS 107 CD  
27 1 Y 1 A LYS 214 ? CE  ? A LYS 107 CE  
28 1 Y 1 A LYS 214 ? NZ  ? A LYS 107 NZ  
29 1 Y 0 A LYS 217 ? CE  ? A LYS 110 CE  
30 1 Y 0 A LYS 217 ? NZ  ? A LYS 110 NZ  
31 1 Y 1 B GLN 121 ? CB  ? B GLN 14  CB  
32 1 Y 1 B GLN 121 ? CG  ? B GLN 14  CG  
33 1 Y 1 B GLN 121 ? CD  ? B GLN 14  CD  
34 1 Y 1 B GLN 121 ? OE1 ? B GLN 14  OE1 
35 1 Y 1 B GLN 121 ? NE2 ? B GLN 14  NE2 
36 1 Y 1 B LYS 124 ? CG  ? B LYS 17  CG  
37 1 Y 1 B LYS 124 ? CD  ? B LYS 17  CD  
38 1 Y 1 B LYS 124 ? CE  ? B LYS 17  CE  
39 1 Y 1 B LYS 124 ? NZ  ? B LYS 17  NZ  
40 1 Y 1 B LYS 214 ? CG  ? B LYS 107 CG  
41 1 Y 1 B LYS 214 ? CD  ? B LYS 107 CD  
42 1 Y 1 B LYS 214 ? CE  ? B LYS 107 CE  
43 1 Y 1 B LYS 214 ? NZ  ? B LYS 107 NZ  
44 1 Y 0 B LYS 223 ? CG  ? B LYS 116 CG  
45 1 Y 0 B LYS 223 ? CD  ? B LYS 116 CD  
46 1 Y 0 B LYS 223 ? CE  ? B LYS 116 CE  
47 1 Y 0 B LYS 223 ? NZ  ? B LYS 116 NZ  
48 1 Y 1 B LYS 250 ? CG  ? B LYS 143 CG  
49 1 Y 1 B LYS 250 ? CD  ? B LYS 143 CD  
50 1 Y 1 B LYS 250 ? CE  ? B LYS 143 CE  
51 1 Y 1 B LYS 250 ? NZ  ? B LYS 143 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 108 ? A GLY 1   
2 1 Y 1 A ALA 109 ? A ALA 2   
3 1 Y 1 A MSE 110 ? A MSE 3   
4 1 Y 1 A ASP 111 ? A ASP 4   
5 1 Y 1 B GLY 108 ? B GLY 1   
6 1 Y 1 B ALA 109 ? B ALA 2   
7 1 Y 1 B PHE 273 ? B PHE 166 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1   274 4   HOH HOH A . 
C 2 HOH 2   275 5   HOH HOH A . 
C 2 HOH 3   276 6   HOH HOH A . 
C 2 HOH 4   277 8   HOH HOH A . 
C 2 HOH 5   278 12  HOH HOH A . 
C 2 HOH 6   279 13  HOH HOH A . 
C 2 HOH 7   280 17  HOH HOH A . 
C 2 HOH 8   281 19  HOH HOH A . 
C 2 HOH 9   282 20  HOH HOH A . 
C 2 HOH 10  283 22  HOH HOH A . 
C 2 HOH 11  284 25  HOH HOH A . 
C 2 HOH 12  285 28  HOH HOH A . 
C 2 HOH 13  286 29  HOH HOH A . 
C 2 HOH 14  287 30  HOH HOH A . 
C 2 HOH 15  288 31  HOH HOH A . 
C 2 HOH 16  289 33  HOH HOH A . 
C 2 HOH 17  290 38  HOH HOH A . 
C 2 HOH 18  291 39  HOH HOH A . 
C 2 HOH 19  292 40  HOH HOH A . 
C 2 HOH 20  293 44  HOH HOH A . 
C 2 HOH 21  294 45  HOH HOH A . 
C 2 HOH 22  295 46  HOH HOH A . 
C 2 HOH 23  296 51  HOH HOH A . 
C 2 HOH 24  297 52  HOH HOH A . 
C 2 HOH 25  298 53  HOH HOH A . 
C 2 HOH 26  299 54  HOH HOH A . 
C 2 HOH 27  300 55  HOH HOH A . 
C 2 HOH 28  301 60  HOH HOH A . 
C 2 HOH 29  302 63  HOH HOH A . 
C 2 HOH 30  303 65  HOH HOH A . 
C 2 HOH 31  304 66  HOH HOH A . 
C 2 HOH 32  305 69  HOH HOH A . 
C 2 HOH 33  306 70  HOH HOH A . 
C 2 HOH 34  307 72  HOH HOH A . 
C 2 HOH 35  308 73  HOH HOH A . 
C 2 HOH 36  309 74  HOH HOH A . 
C 2 HOH 37  310 78  HOH HOH A . 
C 2 HOH 38  311 79  HOH HOH A . 
C 2 HOH 39  312 82  HOH HOH A . 
C 2 HOH 40  313 86  HOH HOH A . 
C 2 HOH 41  314 87  HOH HOH A . 
C 2 HOH 42  315 92  HOH HOH A . 
C 2 HOH 43  316 94  HOH HOH A . 
C 2 HOH 44  317 96  HOH HOH A . 
C 2 HOH 45  318 97  HOH HOH A . 
C 2 HOH 46  319 98  HOH HOH A . 
C 2 HOH 47  320 99  HOH HOH A . 
C 2 HOH 48  321 103 HOH HOH A . 
C 2 HOH 49  322 104 HOH HOH A . 
C 2 HOH 50  323 105 HOH HOH A . 
C 2 HOH 51  324 106 HOH HOH A . 
C 2 HOH 52  325 109 HOH HOH A . 
C 2 HOH 53  326 111 HOH HOH A . 
C 2 HOH 54  327 112 HOH HOH A . 
C 2 HOH 55  328 114 HOH HOH A . 
C 2 HOH 56  329 116 HOH HOH A . 
C 2 HOH 57  330 117 HOH HOH A . 
C 2 HOH 58  331 118 HOH HOH A . 
C 2 HOH 59  332 123 HOH HOH A . 
C 2 HOH 60  333 127 HOH HOH A . 
C 2 HOH 61  334 132 HOH HOH A . 
C 2 HOH 62  335 135 HOH HOH A . 
C 2 HOH 63  336 137 HOH HOH A . 
C 2 HOH 64  337 141 HOH HOH A . 
C 2 HOH 65  338 143 HOH HOH A . 
C 2 HOH 66  339 144 HOH HOH A . 
C 2 HOH 67  340 145 HOH HOH A . 
C 2 HOH 68  341 146 HOH HOH A . 
C 2 HOH 69  342 147 HOH HOH A . 
C 2 HOH 70  343 148 HOH HOH A . 
C 2 HOH 71  344 149 HOH HOH A . 
C 2 HOH 72  345 152 HOH HOH A . 
C 2 HOH 73  346 155 HOH HOH A . 
C 2 HOH 74  347 157 HOH HOH A . 
C 2 HOH 75  348 160 HOH HOH A . 
C 2 HOH 76  349 163 HOH HOH A . 
C 2 HOH 77  350 164 HOH HOH A . 
C 2 HOH 78  351 167 HOH HOH A . 
C 2 HOH 79  352 170 HOH HOH A . 
C 2 HOH 80  353 173 HOH HOH A . 
C 2 HOH 81  354 174 HOH HOH A . 
C 2 HOH 82  355 175 HOH HOH A . 
C 2 HOH 83  356 176 HOH HOH A . 
C 2 HOH 84  357 177 HOH HOH A . 
C 2 HOH 85  358 178 HOH HOH A . 
C 2 HOH 86  359 179 HOH HOH A . 
C 2 HOH 87  360 180 HOH HOH A . 
C 2 HOH 88  361 181 HOH HOH A . 
C 2 HOH 89  362 182 HOH HOH A . 
C 2 HOH 90  363 185 HOH HOH A . 
C 2 HOH 91  364 188 HOH HOH A . 
C 2 HOH 92  365 190 HOH HOH A . 
C 2 HOH 93  366 191 HOH HOH A . 
C 2 HOH 94  367 192 HOH HOH A . 
C 2 HOH 95  368 193 HOH HOH A . 
C 2 HOH 96  369 194 HOH HOH A . 
C 2 HOH 97  370 196 HOH HOH A . 
C 2 HOH 98  371 197 HOH HOH A . 
C 2 HOH 99  372 198 HOH HOH A . 
C 2 HOH 100 373 199 HOH HOH A . 
C 2 HOH 101 374 201 HOH HOH A . 
C 2 HOH 102 375 202 HOH HOH A . 
C 2 HOH 103 376 203 HOH HOH A . 
C 2 HOH 104 377 204 HOH HOH A . 
C 2 HOH 105 378 205 HOH HOH A . 
C 2 HOH 106 379 210 HOH HOH A . 
C 2 HOH 107 380 211 HOH HOH A . 
C 2 HOH 108 381 214 HOH HOH A . 
C 2 HOH 109 382 216 HOH HOH A . 
C 2 HOH 110 383 221 HOH HOH A . 
C 2 HOH 111 384 222 HOH HOH A . 
C 2 HOH 112 385 223 HOH HOH A . 
C 2 HOH 113 386 225 HOH HOH A . 
C 2 HOH 114 387 226 HOH HOH A . 
C 2 HOH 115 388 228 HOH HOH A . 
C 2 HOH 116 389 230 HOH HOH A . 
C 2 HOH 117 390 231 HOH HOH A . 
C 2 HOH 118 391 232 HOH HOH A . 
C 2 HOH 119 392 238 HOH HOH A . 
C 2 HOH 120 393 239 HOH HOH A . 
C 2 HOH 121 394 240 HOH HOH A . 
C 2 HOH 122 395 244 HOH HOH A . 
C 2 HOH 123 396 248 HOH HOH A . 
C 2 HOH 124 397 254 HOH HOH A . 
D 2 HOH 1   274 1   HOH HOH B . 
D 2 HOH 2   275 2   HOH HOH B . 
D 2 HOH 3   276 3   HOH HOH B . 
D 2 HOH 4   277 7   HOH HOH B . 
D 2 HOH 5   278 9   HOH HOH B . 
D 2 HOH 6   279 10  HOH HOH B . 
D 2 HOH 7   280 11  HOH HOH B . 
D 2 HOH 8   281 14  HOH HOH B . 
D 2 HOH 9   282 15  HOH HOH B . 
D 2 HOH 10  283 16  HOH HOH B . 
D 2 HOH 11  284 18  HOH HOH B . 
D 2 HOH 12  285 21  HOH HOH B . 
D 2 HOH 13  286 23  HOH HOH B . 
D 2 HOH 14  287 24  HOH HOH B . 
D 2 HOH 15  288 26  HOH HOH B . 
D 2 HOH 16  289 27  HOH HOH B . 
D 2 HOH 17  290 32  HOH HOH B . 
D 2 HOH 18  291 34  HOH HOH B . 
D 2 HOH 19  292 35  HOH HOH B . 
D 2 HOH 20  293 36  HOH HOH B . 
D 2 HOH 21  294 37  HOH HOH B . 
D 2 HOH 22  295 41  HOH HOH B . 
D 2 HOH 23  296 42  HOH HOH B . 
D 2 HOH 24  297 43  HOH HOH B . 
D 2 HOH 25  298 47  HOH HOH B . 
D 2 HOH 26  299 48  HOH HOH B . 
D 2 HOH 27  300 49  HOH HOH B . 
D 2 HOH 28  301 50  HOH HOH B . 
D 2 HOH 29  302 56  HOH HOH B . 
D 2 HOH 30  303 57  HOH HOH B . 
D 2 HOH 31  304 58  HOH HOH B . 
D 2 HOH 32  305 59  HOH HOH B . 
D 2 HOH 33  306 61  HOH HOH B . 
D 2 HOH 34  307 62  HOH HOH B . 
D 2 HOH 35  308 64  HOH HOH B . 
D 2 HOH 36  309 67  HOH HOH B . 
D 2 HOH 37  310 68  HOH HOH B . 
D 2 HOH 38  311 71  HOH HOH B . 
D 2 HOH 39  312 75  HOH HOH B . 
D 2 HOH 40  313 76  HOH HOH B . 
D 2 HOH 41  314 77  HOH HOH B . 
D 2 HOH 42  315 80  HOH HOH B . 
D 2 HOH 43  316 81  HOH HOH B . 
D 2 HOH 44  317 83  HOH HOH B . 
D 2 HOH 45  318 84  HOH HOH B . 
D 2 HOH 46  319 85  HOH HOH B . 
D 2 HOH 47  320 88  HOH HOH B . 
D 2 HOH 48  321 89  HOH HOH B . 
D 2 HOH 49  322 90  HOH HOH B . 
D 2 HOH 50  323 91  HOH HOH B . 
D 2 HOH 51  324 93  HOH HOH B . 
D 2 HOH 52  325 95  HOH HOH B . 
D 2 HOH 53  326 100 HOH HOH B . 
D 2 HOH 54  327 101 HOH HOH B . 
D 2 HOH 55  328 102 HOH HOH B . 
D 2 HOH 56  329 107 HOH HOH B . 
D 2 HOH 57  330 108 HOH HOH B . 
D 2 HOH 58  331 110 HOH HOH B . 
D 2 HOH 59  332 113 HOH HOH B . 
D 2 HOH 60  333 115 HOH HOH B . 
D 2 HOH 61  334 119 HOH HOH B . 
D 2 HOH 62  335 120 HOH HOH B . 
D 2 HOH 63  336 121 HOH HOH B . 
D 2 HOH 64  337 122 HOH HOH B . 
D 2 HOH 65  338 124 HOH HOH B . 
D 2 HOH 66  339 125 HOH HOH B . 
D 2 HOH 67  340 126 HOH HOH B . 
D 2 HOH 68  341 128 HOH HOH B . 
D 2 HOH 69  342 129 HOH HOH B . 
D 2 HOH 70  343 130 HOH HOH B . 
D 2 HOH 71  344 131 HOH HOH B . 
D 2 HOH 72  345 133 HOH HOH B . 
D 2 HOH 73  346 134 HOH HOH B . 
D 2 HOH 74  347 136 HOH HOH B . 
D 2 HOH 75  348 138 HOH HOH B . 
D 2 HOH 76  349 139 HOH HOH B . 
D 2 HOH 77  350 140 HOH HOH B . 
D 2 HOH 78  351 142 HOH HOH B . 
D 2 HOH 79  352 150 HOH HOH B . 
D 2 HOH 80  353 151 HOH HOH B . 
D 2 HOH 81  354 153 HOH HOH B . 
D 2 HOH 82  355 154 HOH HOH B . 
D 2 HOH 83  356 156 HOH HOH B . 
D 2 HOH 84  357 158 HOH HOH B . 
D 2 HOH 85  358 159 HOH HOH B . 
D 2 HOH 86  359 161 HOH HOH B . 
D 2 HOH 87  360 162 HOH HOH B . 
D 2 HOH 88  361 165 HOH HOH B . 
D 2 HOH 89  362 166 HOH HOH B . 
D 2 HOH 90  363 168 HOH HOH B . 
D 2 HOH 91  364 169 HOH HOH B . 
D 2 HOH 92  365 171 HOH HOH B . 
D 2 HOH 93  366 172 HOH HOH B . 
D 2 HOH 94  367 183 HOH HOH B . 
D 2 HOH 95  368 184 HOH HOH B . 
D 2 HOH 96  369 186 HOH HOH B . 
D 2 HOH 97  370 187 HOH HOH B . 
D 2 HOH 98  371 189 HOH HOH B . 
D 2 HOH 99  372 195 HOH HOH B . 
D 2 HOH 100 373 200 HOH HOH B . 
D 2 HOH 101 374 206 HOH HOH B . 
D 2 HOH 102 375 207 HOH HOH B . 
D 2 HOH 103 376 208 HOH HOH B . 
D 2 HOH 104 377 209 HOH HOH B . 
D 2 HOH 105 378 212 HOH HOH B . 
D 2 HOH 106 379 213 HOH HOH B . 
D 2 HOH 107 380 215 HOH HOH B . 
D 2 HOH 108 381 217 HOH HOH B . 
D 2 HOH 109 382 218 HOH HOH B . 
D 2 HOH 110 383 219 HOH HOH B . 
D 2 HOH 111 384 220 HOH HOH B . 
D 2 HOH 112 385 224 HOH HOH B . 
D 2 HOH 113 386 227 HOH HOH B . 
D 2 HOH 114 387 229 HOH HOH B . 
D 2 HOH 115 388 233 HOH HOH B . 
D 2 HOH 116 389 234 HOH HOH B . 
D 2 HOH 117 390 235 HOH HOH B . 
D 2 HOH 118 391 236 HOH HOH B . 
D 2 HOH 119 392 237 HOH HOH B . 
D 2 HOH 120 393 241 HOH HOH B . 
D 2 HOH 121 394 242 HOH HOH B . 
D 2 HOH 122 395 243 HOH HOH B . 
D 2 HOH 123 396 245 HOH HOH B . 
D 2 HOH 124 397 246 HOH HOH B . 
D 2 HOH 125 398 247 HOH HOH B . 
D 2 HOH 126 399 249 HOH HOH B . 
D 2 HOH 127 400 250 HOH HOH B . 
D 2 HOH 128 401 251 HOH HOH B . 
D 2 HOH 129 402 252 HOH HOH B . 
D 2 HOH 130 403 253 HOH HOH B . 
#