data_1N9P
# 
_entry.id   1N9P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1N9P         
RCSB  RCSB017693   
WWPDB D_1000017693 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1N9P 
_pdbx_database_status.recvd_initial_deposition_date   2002-11-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Nishida, M.'   1 
'MacKinnon, R.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Structural Basis of Inward Rectification: Cytoplasmic Pore of the G Protein-Gated Inward Rectifier GIRK1 
  at 1.8 A Resolution
;
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            111 
_citation.page_first                957 
_citation.page_last                 965 
_citation.year                      2002 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12507423 
_citation.pdbx_database_id_DOI      '10.1016/S0092-8674(02)01227-8' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nishida, M.'   1 
primary 'MacKinnon, R.' 2 
# 
_cell.entry_id           1N9P 
_cell.length_a           76.02 
_cell.length_b           76.02 
_cell.length_c           86.11 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1N9P 
_symmetry.space_group_name_H-M             'P 4 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                90 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'G protein-activated inward rectifier potassium channel 1' 23949.039 1   ? ? ? ? 
2 water   nat water                                                      18.015    140 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'GIRK1; Potassium channel, inwardly rectifying, subfamily J, member 3; Inward rectifier K+ channel Kir3.1; KGA; KGB1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;GSKKRQRFVDKNGRCNVQHGNLGSERAETL(MSE)FSEHAVIS(MSE)RDGKLTL(MSE)FRVGNLRNSH(MSE)VSAQI
RCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRS(MSE)QTEQFEVVVILEGIVE
TTG(MSE)TCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEE(MSE)LL(MSE)SSPL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSKKRQRFVDKNGRCNVQHGNLGSERAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFL
PLDQLELDVGFSTGADQLFLVSPLTICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTEDEVLWG
HRFFPVISLEEGFFKVDYSQFHATFEVPTPPYSVKEQEEMLLMSSPL
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   LYS n 
1 4   LYS n 
1 5   ARG n 
1 6   GLN n 
1 7   ARG n 
1 8   PHE n 
1 9   VAL n 
1 10  ASP n 
1 11  LYS n 
1 12  ASN n 
1 13  GLY n 
1 14  ARG n 
1 15  CYS n 
1 16  ASN n 
1 17  VAL n 
1 18  GLN n 
1 19  HIS n 
1 20  GLY n 
1 21  ASN n 
1 22  LEU n 
1 23  GLY n 
1 24  SER n 
1 25  GLU n 
1 26  ARG n 
1 27  ALA n 
1 28  GLU n 
1 29  THR n 
1 30  LEU n 
1 31  MSE n 
1 32  PHE n 
1 33  SER n 
1 34  GLU n 
1 35  HIS n 
1 36  ALA n 
1 37  VAL n 
1 38  ILE n 
1 39  SER n 
1 40  MSE n 
1 41  ARG n 
1 42  ASP n 
1 43  GLY n 
1 44  LYS n 
1 45  LEU n 
1 46  THR n 
1 47  LEU n 
1 48  MSE n 
1 49  PHE n 
1 50  ARG n 
1 51  VAL n 
1 52  GLY n 
1 53  ASN n 
1 54  LEU n 
1 55  ARG n 
1 56  ASN n 
1 57  SER n 
1 58  HIS n 
1 59  MSE n 
1 60  VAL n 
1 61  SER n 
1 62  ALA n 
1 63  GLN n 
1 64  ILE n 
1 65  ARG n 
1 66  CYS n 
1 67  LYS n 
1 68  LEU n 
1 69  LEU n 
1 70  LYS n 
1 71  SER n 
1 72  ARG n 
1 73  GLN n 
1 74  THR n 
1 75  PRO n 
1 76  GLU n 
1 77  GLY n 
1 78  GLU n 
1 79  PHE n 
1 80  LEU n 
1 81  PRO n 
1 82  LEU n 
1 83  ASP n 
1 84  GLN n 
1 85  LEU n 
1 86  GLU n 
1 87  LEU n 
1 88  ASP n 
1 89  VAL n 
1 90  GLY n 
1 91  PHE n 
1 92  SER n 
1 93  THR n 
1 94  GLY n 
1 95  ALA n 
1 96  ASP n 
1 97  GLN n 
1 98  LEU n 
1 99  PHE n 
1 100 LEU n 
1 101 VAL n 
1 102 SER n 
1 103 PRO n 
1 104 LEU n 
1 105 THR n 
1 106 ILE n 
1 107 CYS n 
1 108 HIS n 
1 109 VAL n 
1 110 ILE n 
1 111 ASP n 
1 112 ALA n 
1 113 LYS n 
1 114 SER n 
1 115 PRO n 
1 116 PHE n 
1 117 TYR n 
1 118 ASP n 
1 119 LEU n 
1 120 SER n 
1 121 GLN n 
1 122 ARG n 
1 123 SER n 
1 124 MSE n 
1 125 GLN n 
1 126 THR n 
1 127 GLU n 
1 128 GLN n 
1 129 PHE n 
1 130 GLU n 
1 131 VAL n 
1 132 VAL n 
1 133 VAL n 
1 134 ILE n 
1 135 LEU n 
1 136 GLU n 
1 137 GLY n 
1 138 ILE n 
1 139 VAL n 
1 140 GLU n 
1 141 THR n 
1 142 THR n 
1 143 GLY n 
1 144 MSE n 
1 145 THR n 
1 146 CYS n 
1 147 GLN n 
1 148 ALA n 
1 149 ARG n 
1 150 THR n 
1 151 SER n 
1 152 TYR n 
1 153 THR n 
1 154 GLU n 
1 155 ASP n 
1 156 GLU n 
1 157 VAL n 
1 158 LEU n 
1 159 TRP n 
1 160 GLY n 
1 161 HIS n 
1 162 ARG n 
1 163 PHE n 
1 164 PHE n 
1 165 PRO n 
1 166 VAL n 
1 167 ILE n 
1 168 SER n 
1 169 LEU n 
1 170 GLU n 
1 171 GLU n 
1 172 GLY n 
1 173 PHE n 
1 174 PHE n 
1 175 LYS n 
1 176 VAL n 
1 177 ASP n 
1 178 TYR n 
1 179 SER n 
1 180 GLN n 
1 181 PHE n 
1 182 HIS n 
1 183 ALA n 
1 184 THR n 
1 185 PHE n 
1 186 GLU n 
1 187 VAL n 
1 188 PRO n 
1 189 THR n 
1 190 PRO n 
1 191 PRO n 
1 192 TYR n 
1 193 SER n 
1 194 VAL n 
1 195 LYS n 
1 196 GLU n 
1 197 GLN n 
1 198 GLU n 
1 199 GLU n 
1 200 MSE n 
1 201 LEU n 
1 202 LEU n 
1 203 MSE n 
1 204 SER n 
1 205 SER n 
1 206 PRO n 
1 207 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? 3  25  'house mouse' Mus GIRK1 ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? 
? ? ? ? 'B834(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? 'pET28b(+)' ? ? 
1 2 sample ? 26 207 'house mouse' Mus GIRK1 ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 Escherichia ? 
? ? ? ? 'B834(DE3)' ? ? ? ? ? ? ? PLASMID ? ? ? 'pET28b(+)' ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP IRK3_MOUSE P63250 1 KKRQRFVDKNGRCNVQHGNLGSE 41  ? 
2 UNP IRK3_MOUSE P35562 1 
;RAETLMFSEHAVISMRDGKLTLMFRVGNLRNSHMVSAQIRCKLLKSRQTPEGEFLPLDQLELDVGFSTGADQLFLVSPLT
ICHVIDAKSPFYDLSQRSMQTEQFEVVVILEGIVETTGMTCQARTSYTEDEVLWGHRFFPVISLEEGFFKVDYSQFHATF
EVPTPPYSVKEQEEMLLMSSPL
;
190 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1N9P A 3  ? 25  ? P63250 41  ? 63  ? 41  63  
2 2 1N9P A 26 ? 207 ? P35562 190 ? 371 ? 190 371 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1N9P GLY A 1   ? UNP P63250 ?   ?   'CLONING ARTIFACT' 39  1  
1 1N9P SER A 2   ? UNP P63250 ?   ?   'CLONING ARTIFACT' 40  2  
1 1N9P MSE A 31  ? UNP P63250 MET 195 'MODIFIED RESIDUE' 195 3  
1 1N9P MSE A 40  ? UNP P63250 MET 204 'MODIFIED RESIDUE' 204 4  
1 1N9P MSE A 48  ? UNP P63250 MET 212 'MODIFIED RESIDUE' 212 5  
1 1N9P MSE A 59  ? UNP P63250 MET 223 'MODIFIED RESIDUE' 223 6  
1 1N9P MSE A 124 ? UNP P63250 MET 288 'MODIFIED RESIDUE' 288 7  
1 1N9P MSE A 144 ? UNP P63250 MET 308 'MODIFIED RESIDUE' 308 8  
1 1N9P MSE A 200 ? UNP P63250 MET 364 'MODIFIED RESIDUE' 364 9  
1 1N9P MSE A 203 ? UNP P63250 MET 367 'MODIFIED RESIDUE' 367 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE         ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER            ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE       ? 'C5 H11 N O2 S'  149.211 
MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 
PHE 'L-peptide linking' y PHENYLALANINE    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE           ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1N9P 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.57 
_exptl_crystal.density_percent_sol   51.73 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    
'DTT, HEPES, magnesium acetate, PEG 400, sodium chloride, Tris-HCl, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 277K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-08-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    SILICON 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9792 1.0 
2 0.9790 1.0 
3 0.9640 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F2' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.9792, 0.9790, 0.9640' 
# 
_reflns.entry_id                     1N9P 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   -3 
_reflns.d_resolution_high            1.80 
_reflns.d_resolution_low             30.0 
_reflns.number_all                   ? 
_reflns.number_obs                   23971 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.057 
_reflns.pdbx_netI_over_sigmaI        20.2 
_reflns.B_iso_Wilson_estimate        17.0 
_reflns.pdbx_redundancy              19.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.80 
_reflns_shell.d_res_low              1.86 
_reflns_shell.percent_possible_all   96.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.174 
_reflns_shell.meanI_over_sigI_obs    12.9 
_reflns_shell.pdbx_redundancy        13.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      2293 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1N9P 
_refine.ls_d_res_high                            1.80 
_refine.ls_d_res_low                             10.0 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     44247 
_refine.ls_number_reflns_obs                     43936 
_refine.ls_number_reflns_R_free                  2237 
_refine.ls_percent_reflns_obs                    98.8 
_refine.ls_R_factor_all                          0.232 
_refine.ls_R_factor_obs                          0.232 
_refine.ls_R_factor_R_work                       0.231 
_refine.ls_R_factor_R_free                       0.253 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 56.37 
_refine.solvent_model_param_ksol                 0.50 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.B_iso_mean                               21.0 
_refine.aniso_B[1][1]                            0.41 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            0.41 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            -0.82 
_refine.details                                  
;Methionine was replaced by selenomethionine through refinement and anomalous signal of selenium that was based on the experimental value was incorporated. Bijvoet pairs were treated as separate reflections. No test flag was used in the final cycle of refinement.
;
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1585 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             140 
_refine_hist.number_atoms_total               1725 
_refine_hist.d_res_high                       1.80 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.007 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.357 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 26.59 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.15  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.4   1.5 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.4   2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.1   2.0 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.1   2.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   10 
_refine_ls_shell.d_res_high                       1.80 
_refine_ls_shell.d_res_low                        1.86 
_refine_ls_shell.number_reflns_R_work             4054 
_refine_ls_shell.R_factor_R_work                  0.258 
_refine_ls_shell.percent_reflns_obs               95.3 
_refine_ls_shell.R_factor_R_free                  0.319 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            4.8 
_refine_ls_shell.number_reflns_R_free             215 
_refine_ls_shell.number_reflns_obs                5336 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein.param protein.top 'X-RAY DIFFRACTION' 
2 water.param   water.top   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1N9P 
_struct.title                     
'Crystal Structure of the Cytoplasmic Domain of G-protein Activated Inward Rectifier Potassium Channel 1' 
_struct.pdbx_descriptor           'G protein-activated inward rectifier potassium channel 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1N9P 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
_struct_keywords.text            'BETA BARREL, CYTOPLASMIC DOMAIN, G PROTEIN, INWARD RECTIFIER, POTASSIUM CHANNEL, METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The biological assembly is a tetramer generated from the subunit in the asymmetric unit by the operations: x,y,z and -y+1/2,x+1/2,z and -x,-y+1,z and y-1/2,-x+1/2,z.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ARG A 122 ? THR A 126 ? ARG A 286 THR A 290 5 ? 5  
HELX_P HELX_P2 2 TYR A 178 ? PHE A 181 ? TYR A 342 PHE A 345 5 ? 4  
HELX_P HELX_P3 3 SER A 193 ? SER A 205 ? SER A 357 SER A 369 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A LEU 30  C ? ? ? 1_555 A MSE 31  N ? ? A LEU 194 A MSE 195 1_555 ? ? ? ? ? ? ? 1.325 ? 
covale2  covale ? ? A MSE 31  C ? ? ? 1_555 A PHE 32  N ? ? A MSE 195 A PHE 196 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale3  covale ? ? A SER 39  C ? ? ? 1_555 A MSE 40  N ? ? A SER 203 A MSE 204 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale4  covale ? ? A MSE 40  C ? ? ? 1_555 A ARG 41  N ? ? A MSE 204 A ARG 205 1_555 ? ? ? ? ? ? ? 1.327 ? 
covale5  covale ? ? A LEU 47  C ? ? ? 1_555 A MSE 48  N ? ? A LEU 211 A MSE 212 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale6  covale ? ? A MSE 48  C ? ? ? 1_555 A PHE 49  N ? ? A MSE 212 A PHE 213 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale7  covale ? ? A HIS 58  C ? ? ? 1_555 A MSE 59  N ? ? A HIS 222 A MSE 223 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale8  covale ? ? A MSE 59  C ? ? ? 1_555 A VAL 60  N ? ? A MSE 223 A VAL 224 1_555 ? ? ? ? ? ? ? 1.335 ? 
covale9  covale ? ? A SER 123 C ? ? ? 1_555 A MSE 124 N ? ? A SER 287 A MSE 288 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale10 covale ? ? A MSE 124 C ? ? ? 1_555 A GLN 125 N ? ? A MSE 288 A GLN 289 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale11 covale ? ? A GLY 143 C ? ? ? 1_555 A MSE 144 N ? ? A GLY 307 A MSE 308 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale12 covale ? ? A MSE 144 C ? ? ? 1_555 A THR 145 N ? ? A MSE 308 A THR 309 1_555 ? ? ? ? ? ? ? 1.333 ? 
covale13 covale ? ? A GLU 199 C ? ? ? 1_555 A MSE 200 N ? ? A GLU 363 A MSE 364 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale14 covale ? ? A MSE 200 C ? ? ? 1_555 A LEU 201 N ? ? A MSE 364 A LEU 365 1_555 ? ? ? ? ? ? ? 1.332 ? 
covale15 covale ? ? A LEU 202 C ? ? ? 1_555 A MSE 203 N ? ? A LEU 366 A MSE 367 1_555 ? ? ? ? ? ? ? 1.334 ? 
covale16 covale ? ? A MSE 203 C ? ? ? 1_555 A SER 204 N ? ? A MSE 367 A SER 368 1_555 ? ? ? ? ? ? ? 1.332 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 17  ? GLN A 18  ? VAL A 55  GLN A 56  
A 2 PHE A 174 ? VAL A 176 ? PHE A 338 VAL A 340 
A 3 ILE A 167 ? LEU A 169 ? ILE A 331 LEU A 333 
B 1 LEU A 104 ? VAL A 109 ? LEU A 268 VAL A 273 
B 2 LYS A 44  ? VAL A 51  ? LYS A 208 VAL A 215 
B 3 ALA A 36  ? ARG A 41  ? ALA A 200 ARG A 205 
B 4 VAL A 157 ? TRP A 159 ? VAL A 321 TRP A 323 
C 1 ALA A 148 ? THR A 153 ? ALA A 312 THR A 317 
C 2 GLU A 130 ? VAL A 139 ? GLU A 294 VAL A 303 
C 3 MSE A 59  ? GLN A 73  ? MSE A 223 GLN A 237 
C 4 PHE A 79  ? GLU A 86  ? PHE A 243 GLU A 250 
D 1 ALA A 148 ? THR A 153 ? ALA A 312 THR A 317 
D 2 GLU A 130 ? VAL A 139 ? GLU A 294 VAL A 303 
D 3 MSE A 59  ? GLN A 73  ? MSE A 223 GLN A 237 
D 4 GLN A 97  ? PHE A 99  ? GLN A 261 PHE A 263 
E 1 HIS A 161 ? PHE A 163 ? HIS A 325 PHE A 327 
E 2 THR A 184 ? GLU A 186 ? THR A 348 GLU A 350 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLN A 18  ? N GLN A 56  O PHE A 174 ? O PHE A 338 
A 2 3 O LYS A 175 ? O LYS A 339 N SER A 168 ? N SER A 332 
B 1 2 O ILE A 106 ? O ILE A 270 N PHE A 49  ? N PHE A 213 
B 2 3 O THR A 46  ? O THR A 210 N SER A 39  ? N SER A 203 
B 3 4 N ALA A 36  ? N ALA A 200 O LEU A 158 ? O LEU A 322 
C 1 2 O TYR A 152 ? O TYR A 316 N VAL A 131 ? N VAL A 295 
C 2 3 O GLU A 130 ? O GLU A 294 N LEU A 69  ? N LEU A 233 
C 3 4 N ARG A 72  ? N ARG A 236 O LEU A 80  ? O LEU A 244 
D 1 2 O TYR A 152 ? O TYR A 316 N VAL A 131 ? N VAL A 295 
D 2 3 O GLU A 130 ? O GLU A 294 N LEU A 69  ? N LEU A 233 
D 3 4 N ALA A 62  ? N ALA A 226 O LEU A 98  ? O LEU A 262 
E 1 2 N ARG A 162 ? N ARG A 326 O PHE A 185 ? O PHE A 349 
# 
_database_PDB_matrix.entry_id          1N9P 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1N9P 
_atom_sites.fract_transf_matrix[1][1]   0.013154 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013154 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011613 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
SE 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ARG A 1 5   ? -24.864 11.636 73.809 1.00 35.62 ? 43  ARG A N   1 
ATOM   2    C  CA  . ARG A 1 5   ? -23.555 10.919 73.890 1.00 34.54 ? 43  ARG A CA  1 
ATOM   3    C  C   . ARG A 1 5   ? -22.606 11.604 74.872 1.00 33.13 ? 43  ARG A C   1 
ATOM   4    O  O   . ARG A 1 5   ? -22.840 12.742 75.289 1.00 33.54 ? 43  ARG A O   1 
ATOM   5    C  CB  . ARG A 1 5   ? -22.894 10.839 72.502 1.00 34.88 ? 43  ARG A CB  1 
ATOM   6    C  CG  . ARG A 1 5   ? -22.470 12.188 71.917 1.00 34.59 ? 43  ARG A CG  1 
ATOM   7    C  CD  . ARG A 1 5   ? -21.673 12.010 70.638 1.00 33.20 ? 43  ARG A CD  1 
ATOM   8    N  NE  . ARG A 1 5   ? -21.215 13.289 70.096 1.00 33.10 ? 43  ARG A NE  1 
ATOM   9    C  CZ  . ARG A 1 5   ? -20.060 13.876 70.407 1.00 31.00 ? 43  ARG A CZ  1 
ATOM   10   N  NH1 . ARG A 1 5   ? -19.217 13.313 71.265 1.00 30.51 ? 43  ARG A NH1 1 
ATOM   11   N  NH2 . ARG A 1 5   ? -19.738 15.025 69.839 1.00 28.91 ? 43  ARG A NH2 1 
ATOM   12   N  N   . GLN A 1 6   ? -21.540 10.897 75.242 1.00 31.62 ? 44  GLN A N   1 
ATOM   13   C  CA  . GLN A 1 6   ? -20.540 11.431 76.161 1.00 29.61 ? 44  GLN A CA  1 
ATOM   14   C  C   . GLN A 1 6   ? -19.800 12.594 75.510 1.00 26.91 ? 44  GLN A C   1 
ATOM   15   O  O   . GLN A 1 6   ? -19.460 12.543 74.329 1.00 27.37 ? 44  GLN A O   1 
ATOM   16   C  CB  . GLN A 1 6   ? -19.545 10.339 76.568 1.00 32.10 ? 44  GLN A CB  1 
ATOM   17   C  CG  . GLN A 1 6   ? -20.158 9.204  77.382 1.00 35.45 ? 44  GLN A CG  1 
ATOM   18   C  CD  . GLN A 1 6   ? -20.821 9.692  78.666 1.00 37.80 ? 44  GLN A CD  1 
ATOM   19   O  OE1 . GLN A 1 6   ? -20.420 10.712 79.239 1.00 39.10 ? 44  GLN A OE1 1 
ATOM   20   N  NE2 . GLN A 1 6   ? -21.848 8.970  79.116 1.00 37.69 ? 44  GLN A NE2 1 
ATOM   21   N  N   . ARG A 1 7   ? -19.566 13.645 76.286 1.00 23.96 ? 45  ARG A N   1 
ATOM   22   C  CA  . ARG A 1 7   ? -18.871 14.829 75.791 1.00 20.51 ? 45  ARG A CA  1 
ATOM   23   C  C   . ARG A 1 7   ? -17.580 15.042 76.568 1.00 18.26 ? 45  ARG A C   1 
ATOM   24   O  O   . ARG A 1 7   ? -17.471 14.649 77.728 1.00 19.57 ? 45  ARG A O   1 
ATOM   25   C  CB  . ARG A 1 7   ? -19.785 16.057 75.901 1.00 18.18 ? 45  ARG A CB  1 
ATOM   26   C  CG  . ARG A 1 7   ? -20.255 16.384 77.314 1.00 16.02 ? 45  ARG A CG  1 
ATOM   27   C  CD  . ARG A 1 7   ? -21.420 17.370 77.297 1.00 14.84 ? 45  ARG A CD  1 
ATOM   28   N  NE  . ARG A 1 7   ? -21.124 18.578 76.526 1.00 12.51 ? 45  ARG A NE  1 
ATOM   29   C  CZ  . ARG A 1 7   ? -22.035 19.313 75.897 1.00 12.32 ? 45  ARG A CZ  1 
ATOM   30   N  NH1 . ARG A 1 7   ? -23.315 18.976 75.941 1.00 13.52 ? 45  ARG A NH1 1 
ATOM   31   N  NH2 . ARG A 1 7   ? -21.669 20.380 75.206 1.00 11.40 ? 45  ARG A NH2 1 
ATOM   32   N  N   . PHE A 1 8   ? -16.584 15.620 75.913 1.00 18.28 ? 46  PHE A N   1 
ATOM   33   C  CA  . PHE A 1 8   ? -15.305 15.877 76.566 1.00 17.88 ? 46  PHE A CA  1 
ATOM   34   C  C   . PHE A 1 8   ? -15.377 17.020 77.560 1.00 16.39 ? 46  PHE A C   1 
ATOM   35   O  O   . PHE A 1 8   ? -14.706 17.004 78.591 1.00 15.40 ? 46  PHE A O   1 
ATOM   36   C  CB  . PHE A 1 8   ? -14.222 16.175 75.533 1.00 21.31 ? 46  PHE A CB  1 
ATOM   37   C  CG  . PHE A 1 8   ? -13.371 14.991 75.209 1.00 28.05 ? 46  PHE A CG  1 
ATOM   38   C  CD1 . PHE A 1 8   ? -13.716 14.133 74.162 1.00 29.14 ? 46  PHE A CD1 1 
ATOM   39   C  CD2 . PHE A 1 8   ? -12.238 14.706 75.975 1.00 29.22 ? 46  PHE A CD2 1 
ATOM   40   C  CE1 . PHE A 1 8   ? -12.948 13.005 73.882 1.00 31.38 ? 46  PHE A CE1 1 
ATOM   41   C  CE2 . PHE A 1 8   ? -11.460 13.581 75.707 1.00 31.94 ? 46  PHE A CE2 1 
ATOM   42   C  CZ  . PHE A 1 8   ? -11.816 12.725 74.657 1.00 32.95 ? 46  PHE A CZ  1 
ATOM   43   N  N   . VAL A 1 9   ? -16.204 18.009 77.242 1.00 14.73 ? 47  VAL A N   1 
ATOM   44   C  CA  . VAL A 1 9   ? -16.357 19.182 78.084 1.00 12.31 ? 47  VAL A CA  1 
ATOM   45   C  C   . VAL A 1 9   ? -17.839 19.457 78.327 1.00 12.84 ? 47  VAL A C   1 
ATOM   46   O  O   . VAL A 1 9   ? -18.629 19.553 77.388 1.00 10.19 ? 47  VAL A O   1 
ATOM   47   C  CB  . VAL A 1 9   ? -15.695 20.425 77.411 1.00 11.23 ? 47  VAL A CB  1 
ATOM   48   C  CG1 . VAL A 1 9   ? -15.868 21.667 78.274 1.00 8.47  ? 47  VAL A CG1 1 
ATOM   49   C  CG2 . VAL A 1 9   ? -14.215 20.155 77.135 1.00 10.30 ? 47  VAL A CG2 1 
ATOM   50   N  N   . ASP A 1 10  ? -18.211 19.550 79.599 1.00 14.00 ? 48  ASP A N   1 
ATOM   51   C  CA  . ASP A 1 10  ? -19.597 19.831 79.959 1.00 15.87 ? 48  ASP A CA  1 
ATOM   52   C  C   . ASP A 1 10  ? -19.920 21.280 79.612 1.00 16.82 ? 48  ASP A C   1 
ATOM   53   O  O   . ASP A 1 10  ? -19.011 22.082 79.362 1.00 17.54 ? 48  ASP A O   1 
ATOM   54   C  CB  . ASP A 1 10  ? -19.837 19.587 81.454 1.00 15.96 ? 48  ASP A CB  1 
ATOM   55   C  CG  . ASP A 1 10  ? -20.070 18.127 81.783 1.00 17.94 ? 48  ASP A CG  1 
ATOM   56   O  OD1 . ASP A 1 10  ? -20.295 17.314 80.853 1.00 17.12 ? 48  ASP A OD1 1 
ATOM   57   O  OD2 . ASP A 1 10  ? -20.041 17.798 82.987 1.00 18.00 ? 48  ASP A OD2 1 
ATOM   58   N  N   . LYS A 1 11  ? -21.211 21.609 79.610 1.00 16.42 ? 49  LYS A N   1 
ATOM   59   C  CA  . LYS A 1 11  ? -21.658 22.955 79.291 1.00 16.28 ? 49  LYS A CA  1 
ATOM   60   C  C   . LYS A 1 11  ? -21.041 23.988 80.230 1.00 14.05 ? 49  LYS A C   1 
ATOM   61   O  O   . LYS A 1 11  ? -20.777 25.111 79.813 1.00 14.20 ? 49  LYS A O   1 
ATOM   62   C  CB  . LYS A 1 11  ? -23.186 23.042 79.342 1.00 17.79 ? 49  LYS A CB  1 
ATOM   63   C  CG  . LYS A 1 11  ? -23.914 22.089 78.400 1.00 18.29 ? 49  LYS A CG  1 
ATOM   64   C  CD  . LYS A 1 11  ? -23.639 22.408 76.954 1.00 16.95 ? 49  LYS A CD  1 
ATOM   65   C  CE  . LYS A 1 11  ? -24.301 23.702 76.530 1.00 16.74 ? 49  LYS A CE  1 
ATOM   66   N  NZ  . LYS A 1 11  ? -23.939 24.046 75.131 1.00 13.87 ? 49  LYS A NZ  1 
ATOM   67   N  N   . ASN A 1 12  ? -20.791 23.602 81.482 1.00 13.85 ? 50  ASN A N   1 
ATOM   68   C  CA  . ASN A 1 12  ? -20.202 24.522 82.457 1.00 14.23 ? 50  ASN A CA  1 
ATOM   69   C  C   . ASN A 1 12  ? -18.676 24.594 82.418 1.00 14.48 ? 50  ASN A C   1 
ATOM   70   O  O   . ASN A 1 12  ? -18.064 25.284 83.235 1.00 14.90 ? 50  ASN A O   1 
ATOM   71   C  CB  . ASN A 1 12  ? -20.684 24.215 83.878 1.00 15.82 ? 50  ASN A CB  1 
ATOM   72   C  CG  . ASN A 1 12  ? -20.022 22.987 84.479 1.00 17.36 ? 50  ASN A CG  1 
ATOM   73   O  OD1 . ASN A 1 12  ? -19.405 22.184 83.781 1.00 18.41 ? 50  ASN A OD1 1 
ATOM   74   N  ND2 . ASN A 1 12  ? -20.156 22.838 85.790 1.00 18.94 ? 50  ASN A ND2 1 
ATOM   75   N  N   . GLY A 1 13  ? -18.066 23.870 81.483 1.00 15.04 ? 51  GLY A N   1 
ATOM   76   C  CA  . GLY A 1 13  ? -16.619 23.905 81.352 1.00 15.22 ? 51  GLY A CA  1 
ATOM   77   C  C   . GLY A 1 13  ? -15.836 22.777 82.001 1.00 16.31 ? 51  GLY A C   1 
ATOM   78   O  O   . GLY A 1 13  ? -14.615 22.724 81.863 1.00 15.29 ? 51  GLY A O   1 
ATOM   79   N  N   . ARG A 1 14  ? -16.525 21.896 82.724 1.00 16.43 ? 52  ARG A N   1 
ATOM   80   C  CA  . ARG A 1 14  ? -15.884 20.759 83.380 1.00 17.34 ? 52  ARG A CA  1 
ATOM   81   C  C   . ARG A 1 14  ? -15.440 19.740 82.347 1.00 15.75 ? 52  ARG A C   1 
ATOM   82   O  O   . ARG A 1 14  ? -16.240 19.317 81.519 1.00 15.29 ? 52  ARG A O   1 
ATOM   83   C  CB  . ARG A 1 14  ? -16.865 20.088 84.341 1.00 21.05 ? 52  ARG A CB  1 
ATOM   84   C  CG  . ARG A 1 14  ? -16.733 20.535 85.780 1.00 28.08 ? 52  ARG A CG  1 
ATOM   85   C  CD  . ARG A 1 14  ? -15.398 20.094 86.372 1.00 33.20 ? 52  ARG A CD  1 
ATOM   86   N  NE  . ARG A 1 14  ? -15.355 20.314 87.816 1.00 37.32 ? 52  ARG A NE  1 
ATOM   87   C  CZ  . ARG A 1 14  ? -14.297 20.073 88.582 1.00 39.82 ? 52  ARG A CZ  1 
ATOM   88   N  NH1 . ARG A 1 14  ? -13.177 19.597 88.047 1.00 41.66 ? 52  ARG A NH1 1 
ATOM   89   N  NH2 . ARG A 1 14  ? -14.356 20.324 89.884 1.00 41.41 ? 52  ARG A NH2 1 
ATOM   90   N  N   . CYS A 1 15  ? -14.167 19.349 82.395 1.00 17.05 ? 53  CYS A N   1 
ATOM   91   C  CA  . CYS A 1 15  ? -13.626 18.357 81.459 1.00 18.16 ? 53  CYS A CA  1 
ATOM   92   C  C   . CYS A 1 15  ? -13.898 16.936 81.957 1.00 18.12 ? 53  CYS A C   1 
ATOM   93   O  O   . CYS A 1 15  ? -13.694 16.633 83.134 1.00 20.22 ? 53  CYS A O   1 
ATOM   94   C  CB  . CYS A 1 15  ? -12.125 18.559 81.273 1.00 19.09 ? 53  CYS A CB  1 
ATOM   95   S  SG  . CYS A 1 15  ? -11.661 20.238 80.799 1.00 25.95 ? 53  CYS A SG  1 
ATOM   96   N  N   . ASN A 1 16  ? -14.355 16.072 81.055 1.00 17.36 ? 54  ASN A N   1 
ATOM   97   C  CA  . ASN A 1 16  ? -14.680 14.688 81.390 1.00 17.28 ? 54  ASN A CA  1 
ATOM   98   C  C   . ASN A 1 16  ? -13.595 13.707 80.944 1.00 17.89 ? 54  ASN A C   1 
ATOM   99   O  O   . ASN A 1 16  ? -13.855 12.779 80.179 1.00 19.32 ? 54  ASN A O   1 
ATOM   100  C  CB  . ASN A 1 16  ? -16.019 14.299 80.765 1.00 16.57 ? 54  ASN A CB  1 
ATOM   101  C  CG  . ASN A 1 16  ? -17.131 15.268 81.119 1.00 18.57 ? 54  ASN A CG  1 
ATOM   102  O  OD1 . ASN A 1 16  ? -17.179 15.807 82.236 1.00 18.77 ? 54  ASN A OD1 1 
ATOM   103  N  ND2 . ASN A 1 16  ? -18.019 15.517 80.162 1.00 16.58 ? 54  ASN A ND2 1 
ATOM   104  N  N   . VAL A 1 17  ? -12.376 13.921 81.422 1.00 16.82 ? 55  VAL A N   1 
ATOM   105  C  CA  . VAL A 1 17  ? -11.271 13.050 81.065 1.00 16.95 ? 55  VAL A CA  1 
ATOM   106  C  C   . VAL A 1 17  ? -10.753 12.302 82.295 1.00 16.11 ? 55  VAL A C   1 
ATOM   107  O  O   . VAL A 1 17  ? -10.610 12.876 83.375 1.00 15.73 ? 55  VAL A O   1 
ATOM   108  C  CB  . VAL A 1 17  ? -10.115 13.849 80.376 1.00 18.70 ? 55  VAL A CB  1 
ATOM   109  C  CG1 . VAL A 1 17  ? -9.002  12.910 79.918 1.00 17.64 ? 55  VAL A CG1 1 
ATOM   110  C  CG2 . VAL A 1 17  ? -10.654 14.609 79.169 1.00 18.76 ? 55  VAL A CG2 1 
ATOM   111  N  N   . GLN A 1 18  ? -10.550 10.999 82.121 1.00 15.27 ? 56  GLN A N   1 
ATOM   112  C  CA  . GLN A 1 18  ? -10.023 10.127 83.164 1.00 15.78 ? 56  GLN A CA  1 
ATOM   113  C  C   . GLN A 1 18  ? -8.561  9.852  82.838 1.00 16.64 ? 56  GLN A C   1 
ATOM   114  O  O   . GLN A 1 18  ? -8.262  9.131  81.893 1.00 17.50 ? 56  GLN A O   1 
ATOM   115  C  CB  . GLN A 1 18  ? -10.812 8.819  83.196 1.00 13.75 ? 56  GLN A CB  1 
ATOM   116  C  CG  . GLN A 1 18  ? -12.203 8.957  83.792 1.00 12.53 ? 56  GLN A CG  1 
ATOM   117  C  CD  . GLN A 1 18  ? -12.183 9.224  85.289 1.00 11.38 ? 56  GLN A CD  1 
ATOM   118  O  OE1 . GLN A 1 18  ? -11.356 8.685  86.018 1.00 8.72  ? 56  GLN A OE1 1 
ATOM   119  N  NE2 . GLN A 1 18  ? -13.104 10.054 85.751 1.00 12.37 ? 56  GLN A NE2 1 
ATOM   120  N  N   . HIS A 1 19  ? -7.655  10.432 83.619 1.00 18.42 ? 57  HIS A N   1 
ATOM   121  C  CA  . HIS A 1 19  ? -6.221  10.277 83.389 1.00 19.87 ? 57  HIS A CA  1 
ATOM   122  C  C   . HIS A 1 19  ? -5.634  8.935  83.809 1.00 20.73 ? 57  HIS A C   1 
ATOM   123  O  O   . HIS A 1 19  ? -6.100  8.312  84.755 1.00 20.65 ? 57  HIS A O   1 
ATOM   124  C  CB  . HIS A 1 19  ? -5.463  11.418 84.057 1.00 19.97 ? 57  HIS A CB  1 
ATOM   125  C  CG  . HIS A 1 19  ? -5.874  12.772 83.574 1.00 22.11 ? 57  HIS A CG  1 
ATOM   126  N  ND1 . HIS A 1 19  ? -5.480  13.277 82.354 1.00 22.28 ? 57  HIS A ND1 1 
ATOM   127  C  CD2 . HIS A 1 19  ? -6.649  13.725 84.144 1.00 20.99 ? 57  HIS A CD2 1 
ATOM   128  C  CE1 . HIS A 1 19  ? -5.996  14.484 82.193 1.00 23.41 ? 57  HIS A CE1 1 
ATOM   129  N  NE2 . HIS A 1 19  ? -6.709  14.779 83.265 1.00 23.30 ? 57  HIS A NE2 1 
ATOM   130  N  N   . GLU A 1 25  ? 2.536   8.969  90.810 1.00 35.06 ? 63  GLU A N   1 
ATOM   131  C  CA  . GLU A 1 25  ? 3.824   9.501  91.238 1.00 34.48 ? 63  GLU A CA  1 
ATOM   132  C  C   . GLU A 1 25  ? 3.999   10.993 90.950 1.00 34.28 ? 63  GLU A C   1 
ATOM   133  O  O   . GLU A 1 25  ? 3.273   11.575 90.140 1.00 31.34 ? 63  GLU A O   1 
ATOM   134  C  CB  . GLU A 1 25  ? 4.972   8.700  90.616 1.00 35.72 ? 63  GLU A CB  1 
ATOM   135  C  CG  . GLU A 1 25  ? 4.968   7.219  90.982 1.00 36.91 ? 63  GLU A CG  1 
ATOM   136  C  CD  . GLU A 1 25  ? 4.853   6.972  92.477 1.00 37.83 ? 63  GLU A CD  1 
ATOM   137  O  OE1 . GLU A 1 25  ? 5.348   7.801  93.274 1.00 37.48 ? 63  GLU A OE1 1 
ATOM   138  O  OE2 . GLU A 1 25  ? 4.255   5.943  92.857 1.00 39.39 ? 63  GLU A OE2 1 
ATOM   139  N  N   . ARG A 1 26  ? 4.992   11.593 91.603 1.00 34.65 ? 190 ARG A N   1 
ATOM   140  C  CA  . ARG A 1 26  ? 5.261   13.019 91.466 1.00 35.51 ? 190 ARG A CA  1 
ATOM   141  C  C   . ARG A 1 26  ? 6.329   13.419 90.444 1.00 35.19 ? 190 ARG A C   1 
ATOM   142  O  O   . ARG A 1 26  ? 6.316   14.555 89.948 1.00 35.04 ? 190 ARG A O   1 
ATOM   143  C  CB  . ARG A 1 26  ? 5.594   13.612 92.833 1.00 36.45 ? 190 ARG A CB  1 
ATOM   144  C  CG  . ARG A 1 26  ? 4.477   13.486 93.850 1.00 38.10 ? 190 ARG A CG  1 
ATOM   145  C  CD  . ARG A 1 26  ? 4.794   14.357 95.036 1.00 43.31 ? 190 ARG A CD  1 
ATOM   146  N  NE  . ARG A 1 26  ? 3.825   14.251 96.122 1.00 46.82 ? 190 ARG A NE  1 
ATOM   147  C  CZ  . ARG A 1 26  ? 3.925   14.921 97.269 1.00 49.14 ? 190 ARG A CZ  1 
ATOM   148  N  NH1 . ARG A 1 26  ? 4.953   15.741 97.477 1.00 49.34 ? 190 ARG A NH1 1 
ATOM   149  N  NH2 . ARG A 1 26  ? 2.993   14.785 98.204 1.00 49.96 ? 190 ARG A NH2 1 
ATOM   150  N  N   . ALA A 1 27  ? 7.247   12.501 90.135 1.00 34.04 ? 191 ALA A N   1 
ATOM   151  C  CA  . ALA A 1 27  ? 8.311   12.771 89.164 1.00 33.36 ? 191 ALA A CA  1 
ATOM   152  C  C   . ALA A 1 27  ? 7.704   13.209 87.828 1.00 31.94 ? 191 ALA A C   1 
ATOM   153  O  O   . ALA A 1 27  ? 7.001   12.440 87.176 1.00 31.29 ? 191 ALA A O   1 
ATOM   154  C  CB  . ALA A 1 27  ? 9.175   11.543 88.974 1.00 33.23 ? 191 ALA A CB  1 
ATOM   155  N  N   . GLU A 1 28  ? 7.967   14.457 87.445 1.00 30.17 ? 192 GLU A N   1 
ATOM   156  C  CA  . GLU A 1 28  ? 7.429   15.029 86.212 1.00 27.83 ? 192 GLU A CA  1 
ATOM   157  C  C   . GLU A 1 28  ? 8.014   14.405 84.954 1.00 25.56 ? 192 GLU A C   1 
ATOM   158  O  O   . GLU A 1 28  ? 8.954   14.946 84.359 1.00 27.60 ? 192 GLU A O   1 
ATOM   159  C  CB  . GLU A 1 28  ? 7.653   16.537 86.207 1.00 28.31 ? 192 GLU A CB  1 
ATOM   160  C  CG  . GLU A 1 28  ? 7.061   17.245 87.417 1.00 30.34 ? 192 GLU A CG  1 
ATOM   161  C  CD  . GLU A 1 28  ? 5.539   17.210 87.455 1.00 31.71 ? 192 GLU A CD  1 
ATOM   162  O  OE1 . GLU A 1 28  ? 4.912   16.563 86.579 1.00 30.92 ? 192 GLU A OE1 1 
ATOM   163  O  OE2 . GLU A 1 28  ? 4.966   17.849 88.365 1.00 30.84 ? 192 GLU A OE2 1 
ATOM   164  N  N   . THR A 1 29  ? 7.432   13.282 84.535 1.00 19.94 ? 193 THR A N   1 
ATOM   165  C  CA  . THR A 1 29  ? 7.916   12.572 83.352 1.00 15.86 ? 193 THR A CA  1 
ATOM   166  C  C   . THR A 1 29  ? 6.852   12.318 82.288 1.00 15.21 ? 193 THR A C   1 
ATOM   167  O  O   . THR A 1 29  ? 7.130   11.674 81.279 1.00 14.41 ? 193 THR A O   1 
ATOM   168  C  CB  . THR A 1 29  ? 8.541   11.229 83.746 1.00 14.54 ? 193 THR A CB  1 
ATOM   169  O  OG1 . THR A 1 29  ? 7.529   10.377 84.298 1.00 11.16 ? 193 THR A OG1 1 
ATOM   170  C  CG2 . THR A 1 29  ? 9.638   11.447 84.778 1.00 12.90 ? 193 THR A CG2 1 
ATOM   171  N  N   . LEU A 1 30  ? 5.637   12.803 82.526 1.00 14.09 ? 194 LEU A N   1 
ATOM   172  C  CA  . LEU A 1 30  ? 4.533   12.635 81.582 1.00 13.61 ? 194 LEU A CA  1 
ATOM   173  C  C   . LEU A 1 30  ? 4.108   13.995 81.023 1.00 12.50 ? 194 LEU A C   1 
ATOM   174  O  O   . LEU A 1 30  ? 3.005   14.162 80.506 1.00 14.28 ? 194 LEU A O   1 
ATOM   175  C  CB  . LEU A 1 30  ? 3.368   11.920 82.276 1.00 11.67 ? 194 LEU A CB  1 
ATOM   176  C  CG  . LEU A 1 30  ? 3.710   10.489 82.715 1.00 11.07 ? 194 LEU A CG  1 
ATOM   177  C  CD1 . LEU A 1 30  ? 2.600   9.922  83.573 1.00 13.86 ? 194 LEU A CD1 1 
ATOM   178  C  CD2 . LEU A 1 30  ? 3.951   9.607  81.495 1.00 12.13 ? 194 LEU A CD2 1 
HETATM 179  N  N   . MSE A 1 31  ? 5.034   14.941 81.076 1.00 13.80 ? 195 MSE A N   1 
HETATM 180  C  CA  . MSE A 1 31  ? 4.819   16.309 80.612 1.00 14.89 ? 195 MSE A CA  1 
HETATM 181  C  C   . MSE A 1 31  ? 5.095   16.409 79.105 1.00 12.45 ? 195 MSE A C   1 
HETATM 182  O  O   . MSE A 1 31  ? 4.322   16.996 78.343 1.00 9.32  ? 195 MSE A O   1 
HETATM 183  C  CB  . MSE A 1 31  ? 5.758   17.233 81.406 1.00 19.39 ? 195 MSE A CB  1 
HETATM 184  C  CG  . MSE A 1 31  ? 5.781   18.705 80.997 1.00 26.78 ? 195 MSE A CG  1 
HETATM 185  SE SE  . MSE A 1 31  ? 4.232   19.754 81.491 1.00 33.99 ? 195 MSE A SE  1 
HETATM 186  C  CE  . MSE A 1 31  ? 3.324   19.782 79.777 1.00 32.35 ? 195 MSE A CE  1 
ATOM   187  N  N   . PHE A 1 32  ? 6.225   15.849 78.691 1.00 11.41 ? 196 PHE A N   1 
ATOM   188  C  CA  . PHE A 1 32  ? 6.625   15.851 77.291 1.00 10.59 ? 196 PHE A CA  1 
ATOM   189  C  C   . PHE A 1 32  ? 7.034   14.426 76.920 1.00 10.74 ? 196 PHE A C   1 
ATOM   190  O  O   . PHE A 1 32  ? 7.568   13.686 77.757 1.00 9.55  ? 196 PHE A O   1 
ATOM   191  C  CB  . PHE A 1 32  ? 7.832   16.767 77.084 1.00 10.70 ? 196 PHE A CB  1 
ATOM   192  C  CG  . PHE A 1 32  ? 7.564   18.226 77.355 1.00 9.17  ? 196 PHE A CG  1 
ATOM   193  C  CD1 . PHE A 1 32  ? 8.090   18.841 78.485 1.00 10.11 ? 196 PHE A CD1 1 
ATOM   194  C  CD2 . PHE A 1 32  ? 6.836   18.996 76.454 1.00 9.29  ? 196 PHE A CD2 1 
ATOM   195  C  CE1 . PHE A 1 32  ? 7.901   20.210 78.715 1.00 9.23  ? 196 PHE A CE1 1 
ATOM   196  C  CE2 . PHE A 1 32  ? 6.639   20.370 76.677 1.00 9.44  ? 196 PHE A CE2 1 
ATOM   197  C  CZ  . PHE A 1 32  ? 7.175   20.970 77.807 1.00 8.85  ? 196 PHE A CZ  1 
ATOM   198  N  N   . SER A 1 33  ? 6.775   14.035 75.678 1.00 9.08  ? 197 SER A N   1 
ATOM   199  C  CA  . SER A 1 33  ? 7.162   12.705 75.231 1.00 8.15  ? 197 SER A CA  1 
ATOM   200  C  C   . SER A 1 33  ? 8.690   12.630 75.203 1.00 9.98  ? 197 SER A C   1 
ATOM   201  O  O   . SER A 1 33  ? 9.376   13.645 75.023 1.00 8.95  ? 197 SER A O   1 
ATOM   202  C  CB  . SER A 1 33  ? 6.570   12.381 73.854 1.00 7.40  ? 197 SER A CB  1 
ATOM   203  O  OG  . SER A 1 33  ? 6.960   13.323 72.868 1.00 7.58  ? 197 SER A OG  1 
ATOM   204  N  N   . GLU A 1 34  ? 9.216   11.432 75.427 1.00 11.18 ? 198 GLU A N   1 
ATOM   205  C  CA  . GLU A 1 34  ? 10.657  11.212 75.457 1.00 13.50 ? 198 GLU A CA  1 
ATOM   206  C  C   . GLU A 1 34  ? 11.318  11.526 74.110 1.00 11.76 ? 198 GLU A C   1 
ATOM   207  O  O   . GLU A 1 34  ? 12.436  12.043 74.064 1.00 10.43 ? 198 GLU A O   1 
ATOM   208  C  CB  . GLU A 1 34  ? 10.947  9.764  75.866 1.00 16.76 ? 198 GLU A CB  1 
ATOM   209  C  CG  . GLU A 1 34  ? 12.418  9.451  76.020 1.00 23.79 ? 198 GLU A CG  1 
ATOM   210  C  CD  . GLU A 1 34  ? 12.702  7.962  76.122 1.00 28.42 ? 198 GLU A CD  1 
ATOM   211  O  OE1 . GLU A 1 34  ? 11.747  7.164  76.289 1.00 29.88 ? 198 GLU A OE1 1 
ATOM   212  O  OE2 . GLU A 1 34  ? 13.896  7.594  76.019 1.00 32.12 ? 198 GLU A OE2 1 
ATOM   213  N  N   . HIS A 1 35  ? 10.604  11.235 73.023 1.00 9.76  ? 199 HIS A N   1 
ATOM   214  C  CA  . HIS A 1 35  ? 11.111  11.483 71.683 1.00 11.11 ? 199 HIS A CA  1 
ATOM   215  C  C   . HIS A 1 35  ? 10.169  12.335 70.851 1.00 9.26  ? 199 HIS A C   1 
ATOM   216  O  O   . HIS A 1 35  ? 9.003   12.511 71.188 1.00 10.78 ? 199 HIS A O   1 
ATOM   217  C  CB  . HIS A 1 35  ? 11.287  10.168 70.920 1.00 12.60 ? 199 HIS A CB  1 
ATOM   218  C  CG  . HIS A 1 35  ? 12.162  9.179  71.608 1.00 14.86 ? 199 HIS A CG  1 
ATOM   219  N  ND1 . HIS A 1 35  ? 11.709  7.938  72.000 1.00 15.65 ? 199 HIS A ND1 1 
ATOM   220  C  CD2 . HIS A 1 35  ? 13.465  9.240  71.969 1.00 15.97 ? 199 HIS A CD2 1 
ATOM   221  C  CE1 . HIS A 1 35  ? 12.697  7.277  72.574 1.00 15.77 ? 199 HIS A CE1 1 
ATOM   222  N  NE2 . HIS A 1 35  ? 13.773  8.044  72.567 1.00 16.82 ? 199 HIS A NE2 1 
ATOM   223  N  N   . ALA A 1 36  ? 10.709  12.861 69.759 1.00 7.64  ? 200 ALA A N   1 
ATOM   224  C  CA  . ALA A 1 36  ? 9.939   13.618 68.796 1.00 7.77  ? 200 ALA A CA  1 
ATOM   225  C  C   . ALA A 1 36  ? 10.006  12.702 67.583 1.00 6.99  ? 200 ALA A C   1 
ATOM   226  O  O   . ALA A 1 36  ? 10.829  11.786 67.549 1.00 7.93  ? 200 ALA A O   1 
ATOM   227  C  CB  . ALA A 1 36  ? 10.592  14.971 68.498 1.00 6.68  ? 200 ALA A CB  1 
ATOM   228  N  N   . VAL A 1 37  ? 9.122   12.917 66.613 1.00 8.40  ? 201 VAL A N   1 
ATOM   229  C  CA  . VAL A 1 37  ? 9.087   12.097 65.402 1.00 9.37  ? 201 VAL A CA  1 
ATOM   230  C  C   . VAL A 1 37  ? 8.904   12.971 64.166 1.00 9.21  ? 201 VAL A C   1 
ATOM   231  O  O   . VAL A 1 37  ? 8.475   14.119 64.271 1.00 9.52  ? 201 VAL A O   1 
ATOM   232  C  CB  . VAL A 1 37  ? 7.918   11.059 65.432 1.00 8.16  ? 201 VAL A CB  1 
ATOM   233  C  CG1 . VAL A 1 37  ? 8.003   10.189 66.667 1.00 8.07  ? 201 VAL A CG1 1 
ATOM   234  C  CG2 . VAL A 1 37  ? 6.555   11.763 65.348 1.00 9.25  ? 201 VAL A CG2 1 
ATOM   235  N  N   . ILE A 1 38  ? 9.284   12.442 63.007 1.00 8.28  ? 202 ILE A N   1 
ATOM   236  C  CA  . ILE A 1 38  ? 9.109   13.147 61.742 1.00 9.70  ? 202 ILE A CA  1 
ATOM   237  C  C   . ILE A 1 38  ? 8.470   12.157 60.769 1.00 10.53 ? 202 ILE A C   1 
ATOM   238  O  O   . ILE A 1 38  ? 9.089   11.174 60.373 1.00 10.99 ? 202 ILE A O   1 
ATOM   239  C  CB  . ILE A 1 38  ? 10.434  13.688 61.155 1.00 10.47 ? 202 ILE A CB  1 
ATOM   240  C  CG1 . ILE A 1 38  ? 11.024  14.769 62.068 1.00 10.03 ? 202 ILE A CG1 1 
ATOM   241  C  CG2 . ILE A 1 38  ? 10.187  14.270 59.775 1.00 11.87 ? 202 ILE A CG2 1 
ATOM   242  C  CD1 . ILE A 1 38  ? 12.383  15.252 61.652 1.00 9.19  ? 202 ILE A CD1 1 
ATOM   243  N  N   . SER A 1 39  ? 7.203   12.398 60.449 1.00 11.62 ? 203 SER A N   1 
ATOM   244  C  CA  . SER A 1 39  ? 6.442   11.548 59.535 1.00 13.04 ? 203 SER A CA  1 
ATOM   245  C  C   . SER A 1 39  ? 5.286   12.324 58.909 1.00 13.34 ? 203 SER A C   1 
ATOM   246  O  O   . SER A 1 39  ? 5.069   13.492 59.232 1.00 12.63 ? 203 SER A O   1 
ATOM   247  C  CB  . SER A 1 39  ? 5.940   10.284 60.243 1.00 12.49 ? 203 SER A CB  1 
ATOM   248  O  OG  . SER A 1 39  ? 5.182   10.593 61.397 1.00 13.31 ? 203 SER A OG  1 
HETATM 249  N  N   . MSE A 1 40  ? 4.563   11.670 58.000 1.00 14.36 ? 204 MSE A N   1 
HETATM 250  C  CA  . MSE A 1 40  ? 3.447   12.284 57.277 1.00 15.22 ? 204 MSE A CA  1 
HETATM 251  C  C   . MSE A 1 40  ? 2.127   12.414 58.035 1.00 15.00 ? 204 MSE A C   1 
HETATM 252  O  O   . MSE A 1 40  ? 1.658   11.468 58.669 1.00 14.40 ? 204 MSE A O   1 
HETATM 253  C  CB  . MSE A 1 40  ? 3.179   11.517 55.974 1.00 16.72 ? 204 MSE A CB  1 
HETATM 254  C  CG  . MSE A 1 40  ? 4.394   11.326 55.087 1.00 19.06 ? 204 MSE A CG  1 
HETATM 255  SE SE  . MSE A 1 40  ? 5.106   12.992 54.462 1.00 25.92 ? 204 MSE A SE  1 
HETATM 256  C  CE  . MSE A 1 40  ? 3.720   13.449 53.196 1.00 21.42 ? 204 MSE A CE  1 
ATOM   257  N  N   . ARG A 1 41  ? 1.523   13.592 57.939 1.00 15.43 ? 205 ARG A N   1 
ATOM   258  C  CA  . ARG A 1 41  ? 0.231   13.852 58.561 1.00 16.00 ? 205 ARG A CA  1 
ATOM   259  C  C   . ARG A 1 41  ? -0.481  14.845 57.676 1.00 17.01 ? 205 ARG A C   1 
ATOM   260  O  O   . ARG A 1 41  ? 0.034   15.939 57.420 1.00 18.43 ? 205 ARG A O   1 
ATOM   261  C  CB  . ARG A 1 41  ? 0.353   14.427 59.977 1.00 14.08 ? 205 ARG A CB  1 
ATOM   262  C  CG  . ARG A 1 41  ? -1.023  14.703 60.603 1.00 15.87 ? 205 ARG A CG  1 
ATOM   263  C  CD  . ARG A 1 41  ? -0.958  15.171 62.043 1.00 14.01 ? 205 ARG A CD  1 
ATOM   264  N  NE  . ARG A 1 41  ? -0.654  14.084 62.967 1.00 15.32 ? 205 ARG A NE  1 
ATOM   265  C  CZ  . ARG A 1 41  ? -1.216  13.927 64.163 1.00 15.27 ? 205 ARG A CZ  1 
ATOM   266  N  NH1 . ARG A 1 41  ? -2.127  14.787 64.602 1.00 13.86 ? 205 ARG A NH1 1 
ATOM   267  N  NH2 . ARG A 1 41  ? -0.854  12.910 64.931 1.00 15.93 ? 205 ARG A NH2 1 
ATOM   268  N  N   . ASP A 1 42  ? -1.647  14.446 57.175 1.00 16.49 ? 206 ASP A N   1 
ATOM   269  C  CA  . ASP A 1 42  ? -2.444  15.304 56.306 1.00 16.55 ? 206 ASP A CA  1 
ATOM   270  C  C   . ASP A 1 42  ? -1.660  15.767 55.078 1.00 17.25 ? 206 ASP A C   1 
ATOM   271  O  O   . ASP A 1 42  ? -1.731  16.927 54.679 1.00 19.03 ? 206 ASP A O   1 
ATOM   272  C  CB  . ASP A 1 42  ? -2.989  16.495 57.105 1.00 17.02 ? 206 ASP A CB  1 
ATOM   273  C  CG  . ASP A 1 42  ? -3.934  16.066 58.228 1.00 17.62 ? 206 ASP A CG  1 
ATOM   274  O  OD1 . ASP A 1 42  ? -4.869  15.291 57.943 1.00 15.82 ? 206 ASP A OD1 1 
ATOM   275  O  OD2 . ASP A 1 42  ? -3.739  16.489 59.394 1.00 14.60 ? 206 ASP A OD2 1 
ATOM   276  N  N   . GLY A 1 43  ? -0.892  14.845 54.501 1.00 19.36 ? 207 GLY A N   1 
ATOM   277  C  CA  . GLY A 1 43  ? -0.103  15.138 53.314 1.00 20.50 ? 207 GLY A CA  1 
ATOM   278  C  C   . GLY A 1 43  ? 1.166   15.950 53.507 1.00 21.31 ? 207 GLY A C   1 
ATOM   279  O  O   . GLY A 1 43  ? 1.833   16.290 52.527 1.00 22.23 ? 207 GLY A O   1 
ATOM   280  N  N   . LYS A 1 44  ? 1.532   16.231 54.757 1.00 22.05 ? 208 LYS A N   1 
ATOM   281  C  CA  . LYS A 1 44  ? 2.728   17.024 55.047 1.00 21.05 ? 208 LYS A CA  1 
ATOM   282  C  C   . LYS A 1 44  ? 3.697   16.342 56.015 1.00 18.46 ? 208 LYS A C   1 
ATOM   283  O  O   . LYS A 1 44  ? 3.274   15.746 57.010 1.00 17.60 ? 208 LYS A O   1 
ATOM   284  C  CB  . LYS A 1 44  ? 2.324   18.388 55.634 1.00 24.12 ? 208 LYS A CB  1 
ATOM   285  C  CG  . LYS A 1 44  ? 1.340   19.208 54.788 1.00 28.79 ? 208 LYS A CG  1 
ATOM   286  C  CD  . LYS A 1 44  ? 1.941   19.682 53.457 1.00 33.05 ? 208 LYS A CD  1 
ATOM   287  C  CE  . LYS A 1 44  ? 3.014   20.758 53.656 1.00 36.51 ? 208 LYS A CE  1 
ATOM   288  N  NZ  . LYS A 1 44  ? 3.564   21.287 52.364 1.00 38.41 ? 208 LYS A NZ  1 
ATOM   289  N  N   . LEU A 1 45  ? 4.995   16.428 55.720 1.00 15.83 ? 209 LEU A N   1 
ATOM   290  C  CA  . LEU A 1 45  ? 6.020   15.859 56.598 1.00 13.78 ? 209 LEU A CA  1 
ATOM   291  C  C   . LEU A 1 45  ? 5.992   16.791 57.805 1.00 13.95 ? 209 LEU A C   1 
ATOM   292  O  O   . LEU A 1 45  ? 6.200   18.002 57.682 1.00 12.06 ? 209 LEU A O   1 
ATOM   293  C  CB  . LEU A 1 45  ? 7.401   15.881 55.942 1.00 15.03 ? 209 LEU A CB  1 
ATOM   294  C  CG  . LEU A 1 45  ? 8.465   15.087 56.698 1.00 12.86 ? 209 LEU A CG  1 
ATOM   295  C  CD1 . LEU A 1 45  ? 8.072   13.619 56.748 1.00 14.29 ? 209 LEU A CD1 1 
ATOM   296  C  CD2 . LEU A 1 45  ? 9.816   15.256 56.035 1.00 15.98 ? 209 LEU A CD2 1 
ATOM   297  N  N   . THR A 1 46  ? 5.761   16.211 58.973 1.00 12.61 ? 210 THR A N   1 
ATOM   298  C  CA  . THR A 1 46  ? 5.600   16.993 60.180 1.00 10.67 ? 210 THR A CA  1 
ATOM   299  C  C   . THR A 1 46  ? 6.446   16.518 61.350 1.00 10.11 ? 210 THR A C   1 
ATOM   300  O  O   . THR A 1 46  ? 6.603   15.314 61.571 1.00 9.32  ? 210 THR A O   1 
ATOM   301  C  CB  . THR A 1 46  ? 4.108   16.937 60.585 1.00 10.92 ? 210 THR A CB  1 
ATOM   302  O  OG1 . THR A 1 46  ? 3.300   17.299 59.458 1.00 10.77 ? 210 THR A OG1 1 
ATOM   303  C  CG2 . THR A 1 46  ? 3.804   17.872 61.733 1.00 11.05 ? 210 THR A CG2 1 
ATOM   304  N  N   . LEU A 1 47  ? 7.022   17.483 62.063 1.00 9.20  ? 211 LEU A N   1 
ATOM   305  C  CA  . LEU A 1 47  ? 7.816   17.209 63.252 1.00 8.73  ? 211 LEU A CA  1 
ATOM   306  C  C   . LEU A 1 47  ? 6.773   17.210 64.365 1.00 9.53  ? 211 LEU A C   1 
ATOM   307  O  O   . LEU A 1 47  ? 5.992   18.163 64.491 1.00 10.68 ? 211 LEU A O   1 
ATOM   308  C  CB  . LEU A 1 47  ? 8.838   18.325 63.490 1.00 8.64  ? 211 LEU A CB  1 
ATOM   309  C  CG  . LEU A 1 47  ? 9.526   18.366 64.858 1.00 9.98  ? 211 LEU A CG  1 
ATOM   310  C  CD1 . LEU A 1 47  ? 10.456  17.170 65.027 1.00 10.35 ? 211 LEU A CD1 1 
ATOM   311  C  CD2 . LEU A 1 47  ? 10.302  19.668 65.024 1.00 9.59  ? 211 LEU A CD2 1 
HETATM 312  N  N   . MSE A 1 48  ? 6.758   16.153 65.169 1.00 8.37  ? 212 MSE A N   1 
HETATM 313  C  CA  . MSE A 1 48  ? 5.776   16.049 66.236 1.00 8.58  ? 212 MSE A CA  1 
HETATM 314  C  C   . MSE A 1 48  ? 6.359   15.549 67.543 1.00 9.08  ? 212 MSE A C   1 
HETATM 315  O  O   . MSE A 1 48  ? 7.343   14.813 67.556 1.00 8.06  ? 212 MSE A O   1 
HETATM 316  C  CB  . MSE A 1 48  ? 4.651   15.099 65.809 1.00 9.31  ? 212 MSE A CB  1 
HETATM 317  C  CG  . MSE A 1 48  ? 3.845   15.563 64.602 1.00 10.92 ? 212 MSE A CG  1 
HETATM 318  SE SE  . MSE A 1 48  ? 2.703   14.169 63.864 1.00 15.77 ? 212 MSE A SE  1 
HETATM 319  C  CE  . MSE A 1 48  ? 4.041   13.254 62.785 1.00 8.15  ? 212 MSE A CE  1 
ATOM   320  N  N   . PHE A 1 49  ? 5.756   15.994 68.644 1.00 8.53  ? 213 PHE A N   1 
ATOM   321  C  CA  . PHE A 1 49  ? 6.125   15.559 69.985 1.00 7.95  ? 213 PHE A CA  1 
ATOM   322  C  C   . PHE A 1 49  ? 4.847   15.658 70.796 1.00 7.10  ? 213 PHE A C   1 
ATOM   323  O  O   . PHE A 1 49  ? 3.937   16.408 70.447 1.00 7.23  ? 213 PHE A O   1 
ATOM   324  C  CB  . PHE A 1 49  ? 7.277   16.374 70.607 1.00 9.16  ? 213 PHE A CB  1 
ATOM   325  C  CG  . PHE A 1 49  ? 7.018   17.845 70.703 1.00 10.31 ? 213 PHE A CG  1 
ATOM   326  C  CD1 . PHE A 1 49  ? 6.355   18.379 71.811 1.00 9.21  ? 213 PHE A CD1 1 
ATOM   327  C  CD2 . PHE A 1 49  ? 7.425   18.702 69.683 1.00 9.51  ? 213 PHE A CD2 1 
ATOM   328  C  CE1 . PHE A 1 49  ? 6.096   19.740 71.899 1.00 10.09 ? 213 PHE A CE1 1 
ATOM   329  C  CE2 . PHE A 1 49  ? 7.169   20.074 69.766 1.00 10.63 ? 213 PHE A CE2 1 
ATOM   330  C  CZ  . PHE A 1 49  ? 6.504   20.592 70.873 1.00 8.35  ? 213 PHE A CZ  1 
ATOM   331  N  N   . ARG A 1 50  ? 4.767   14.895 71.868 1.00 7.12  ? 214 ARG A N   1 
ATOM   332  C  CA  . ARG A 1 50  ? 3.561   14.898 72.669 1.00 9.16  ? 214 ARG A CA  1 
ATOM   333  C  C   . ARG A 1 50  ? 3.682   15.661 73.982 1.00 9.02  ? 214 ARG A C   1 
ATOM   334  O  O   . ARG A 1 50  ? 4.740   15.653 74.606 1.00 10.08 ? 214 ARG A O   1 
ATOM   335  C  CB  . ARG A 1 50  ? 3.126   13.442 72.903 1.00 9.48  ? 214 ARG A CB  1 
ATOM   336  C  CG  . ARG A 1 50  ? 2.020   13.261 73.910 1.00 14.52 ? 214 ARG A CG  1 
ATOM   337  C  CD  . ARG A 1 50  ? 0.997   12.248 73.458 1.00 13.67 ? 214 ARG A CD  1 
ATOM   338  N  NE  . ARG A 1 50  ? 1.542   10.917 73.218 1.00 13.03 ? 214 ARG A NE  1 
ATOM   339  C  CZ  . ARG A 1 50  ? 1.008   10.046 72.366 1.00 10.30 ? 214 ARG A CZ  1 
ATOM   340  N  NH1 . ARG A 1 50  ? -0.074  10.371 71.671 1.00 9.28  ? 214 ARG A NH1 1 
ATOM   341  N  NH2 . ARG A 1 50  ? 1.538   8.841  72.226 1.00 13.56 ? 214 ARG A NH2 1 
ATOM   342  N  N   . VAL A 1 51  ? 2.627   16.401 74.341 1.00 10.09 ? 215 VAL A N   1 
ATOM   343  C  CA  . VAL A 1 51  ? 2.588   17.120 75.622 1.00 9.77  ? 215 VAL A CA  1 
ATOM   344  C  C   . VAL A 1 51  ? 1.403   16.595 76.435 1.00 11.77 ? 215 VAL A C   1 
ATOM   345  O  O   . VAL A 1 51  ? 0.340   16.284 75.883 1.00 10.91 ? 215 VAL A O   1 
ATOM   346  C  CB  . VAL A 1 51  ? 2.510   18.671 75.486 1.00 10.24 ? 215 VAL A CB  1 
ATOM   347  C  CG1 . VAL A 1 51  ? 3.704   19.198 74.700 1.00 9.52  ? 215 VAL A CG1 1 
ATOM   348  C  CG2 . VAL A 1 51  ? 1.210   19.104 74.852 1.00 12.34 ? 215 VAL A CG2 1 
ATOM   349  N  N   . GLY A 1 52  ? 1.617   16.433 77.735 1.00 12.90 ? 216 GLY A N   1 
ATOM   350  C  CA  . GLY A 1 52  ? 0.568   15.935 78.601 1.00 15.68 ? 216 GLY A CA  1 
ATOM   351  C  C   . GLY A 1 52  ? 0.261   16.948 79.676 1.00 17.64 ? 216 GLY A C   1 
ATOM   352  O  O   . GLY A 1 52  ? -0.532  17.856 79.464 1.00 21.05 ? 216 GLY A O   1 
ATOM   353  N  N   . ASN A 1 53  ? 0.930   16.832 80.815 1.00 20.12 ? 217 ASN A N   1 
ATOM   354  C  CA  . ASN A 1 53  ? 0.687   17.759 81.918 1.00 21.63 ? 217 ASN A CA  1 
ATOM   355  C  C   . ASN A 1 53  ? 1.672   17.558 83.075 1.00 22.15 ? 217 ASN A C   1 
ATOM   356  O  O   . ASN A 1 53  ? 2.440   16.589 83.096 1.00 21.17 ? 217 ASN A O   1 
ATOM   357  C  CB  . ASN A 1 53  ? -0.761  17.587 82.425 1.00 20.42 ? 217 ASN A CB  1 
ATOM   358  C  CG  . ASN A 1 53  ? -1.449  18.912 82.689 1.00 18.79 ? 217 ASN A CG  1 
ATOM   359  O  OD1 . ASN A 1 53  ? -0.955  19.739 83.452 1.00 18.77 ? 217 ASN A OD1 1 
ATOM   360  N  ND2 . ASN A 1 53  ? -2.588  19.124 82.045 1.00 15.71 ? 217 ASN A ND2 1 
ATOM   361  N  N   . LEU A 1 54  ? 1.665   18.508 84.008 1.00 23.66 ? 218 LEU A N   1 
ATOM   362  C  CA  . LEU A 1 54  ? 2.512   18.444 85.192 1.00 28.13 ? 218 LEU A CA  1 
ATOM   363  C  C   . LEU A 1 54  ? 1.716   17.787 86.325 1.00 29.67 ? 218 LEU A C   1 
ATOM   364  O  O   . LEU A 1 54  ? 0.617   18.226 86.673 1.00 30.63 ? 218 LEU A O   1 
ATOM   365  C  CB  . LEU A 1 54  ? 2.994   19.841 85.605 1.00 28.73 ? 218 LEU A CB  1 
ATOM   366  C  CG  . LEU A 1 54  ? 4.015   20.523 84.686 1.00 29.08 ? 218 LEU A CG  1 
ATOM   367  C  CD1 . LEU A 1 54  ? 4.297   21.932 85.204 1.00 28.79 ? 218 LEU A CD1 1 
ATOM   368  C  CD2 . LEU A 1 54  ? 5.306   19.693 84.591 1.00 27.76 ? 218 LEU A CD2 1 
ATOM   369  N  N   . ARG A 1 55  ? 2.282   16.719 86.876 1.00 31.44 ? 219 ARG A N   1 
ATOM   370  C  CA  . ARG A 1 55  ? 1.663   15.939 87.947 1.00 31.75 ? 219 ARG A CA  1 
ATOM   371  C  C   . ARG A 1 55  ? 1.492   16.704 89.273 1.00 33.69 ? 219 ARG A C   1 
ATOM   372  O  O   . ARG A 1 55  ? 0.517   16.490 90.002 1.00 33.47 ? 219 ARG A O   1 
ATOM   373  C  CB  . ARG A 1 55  ? 2.467   14.639 88.143 1.00 28.85 ? 219 ARG A CB  1 
ATOM   374  C  CG  . ARG A 1 55  ? 2.685   13.870 86.834 1.00 22.83 ? 219 ARG A CG  1 
ATOM   375  C  CD  . ARG A 1 55  ? 3.816   12.855 86.920 1.00 22.79 ? 219 ARG A CD  1 
ATOM   376  N  NE  . ARG A 1 55  ? 3.316   11.494 87.095 1.00 25.37 ? 219 ARG A NE  1 
ATOM   377  C  CZ  . ARG A 1 55  ? 4.075   10.415 87.290 1.00 25.75 ? 219 ARG A CZ  1 
ATOM   378  N  NH1 . ARG A 1 55  ? 5.394   10.512 87.339 1.00 25.50 ? 219 ARG A NH1 1 
ATOM   379  N  NH2 . ARG A 1 55  ? 3.505   9.227  87.453 1.00 24.50 ? 219 ARG A NH2 1 
ATOM   380  N  N   . ASN A 1 56  ? 2.410   17.628 89.551 1.00 34.71 ? 220 ASN A N   1 
ATOM   381  C  CA  . ASN A 1 56  ? 2.366   18.420 90.781 1.00 36.09 ? 220 ASN A CA  1 
ATOM   382  C  C   . ASN A 1 56  ? 1.714   19.795 90.615 1.00 36.06 ? 220 ASN A C   1 
ATOM   383  O  O   . ASN A 1 56  ? 1.508   20.509 91.601 1.00 36.22 ? 220 ASN A O   1 
ATOM   384  C  CB  . ASN A 1 56  ? 3.775   18.580 91.349 1.00 37.62 ? 220 ASN A CB  1 
ATOM   385  C  CG  . ASN A 1 56  ? 4.450   17.246 91.604 1.00 40.47 ? 220 ASN A CG  1 
ATOM   386  O  OD1 . ASN A 1 56  ? 3.988   16.450 92.426 1.00 41.26 ? 220 ASN A OD1 1 
ATOM   387  N  ND2 . ASN A 1 56  ? 5.543   16.988 90.890 1.00 40.12 ? 220 ASN A ND2 1 
ATOM   388  N  N   . SER A 1 57  ? 1.399   20.162 89.374 1.00 34.29 ? 221 SER A N   1 
ATOM   389  C  CA  . SER A 1 57  ? 0.760   21.444 89.074 1.00 33.94 ? 221 SER A CA  1 
ATOM   390  C  C   . SER A 1 57  ? -0.020  21.324 87.765 1.00 32.89 ? 221 SER A C   1 
ATOM   391  O  O   . SER A 1 57  ? 0.443   21.748 86.700 1.00 32.58 ? 221 SER A O   1 
ATOM   392  C  CB  . SER A 1 57  ? 1.803   22.560 88.977 1.00 34.79 ? 221 SER A CB  1 
ATOM   393  O  OG  . SER A 1 57  ? 2.730   22.303 87.936 1.00 37.42 ? 221 SER A OG  1 
ATOM   394  N  N   . HIS A 1 58  ? -1.211  20.742 87.864 1.00 31.97 ? 222 HIS A N   1 
ATOM   395  C  CA  . HIS A 1 58  ? -2.076  20.522 86.714 1.00 30.60 ? 222 HIS A CA  1 
ATOM   396  C  C   . HIS A 1 58  ? -2.547  21.811 86.024 1.00 30.93 ? 222 HIS A C   1 
ATOM   397  O  O   . HIS A 1 58  ? -3.072  22.734 86.662 1.00 28.41 ? 222 HIS A O   1 
ATOM   398  C  CB  . HIS A 1 58  ? -3.274  19.655 87.124 1.00 31.02 ? 222 HIS A CB  1 
ATOM   399  C  CG  . HIS A 1 58  ? -4.021  19.071 85.967 1.00 30.28 ? 222 HIS A CG  1 
ATOM   400  N  ND1 . HIS A 1 58  ? -3.756  17.812 85.474 1.00 30.77 ? 222 HIS A ND1 1 
ATOM   401  C  CD2 . HIS A 1 58  ? -5.016  19.575 85.199 1.00 30.75 ? 222 HIS A CD2 1 
ATOM   402  C  CE1 . HIS A 1 58  ? -4.558  17.565 84.451 1.00 32.64 ? 222 HIS A CE1 1 
ATOM   403  N  NE2 . HIS A 1 58  ? -5.332  18.619 84.263 1.00 31.19 ? 222 HIS A NE2 1 
HETATM 404  N  N   . MSE A 1 59  ? -2.346  21.854 84.710 1.00 30.31 ? 223 MSE A N   1 
HETATM 405  C  CA  . MSE A 1 59  ? -2.734  22.994 83.889 1.00 32.13 ? 223 MSE A CA  1 
HETATM 406  C  C   . MSE A 1 59  ? -3.839  22.599 82.905 1.00 32.42 ? 223 MSE A C   1 
HETATM 407  O  O   . MSE A 1 59  ? -3.977  21.419 82.548 1.00 30.11 ? 223 MSE A O   1 
HETATM 408  C  CB  . MSE A 1 59  ? -1.526  23.508 83.098 1.00 33.35 ? 223 MSE A CB  1 
HETATM 409  C  CG  . MSE A 1 59  ? -0.323  23.864 83.955 1.00 35.39 ? 223 MSE A CG  1 
HETATM 410  SE SE  . MSE A 1 59  ? 1.289   24.074 82.906 1.00 42.67 ? 223 MSE A SE  1 
HETATM 411  C  CE  . MSE A 1 59  ? 1.630   22.202 82.517 1.00 37.30 ? 223 MSE A CE  1 
ATOM   412  N  N   . VAL A 1 60  ? -4.631  23.591 82.491 1.00 32.15 ? 224 VAL A N   1 
ATOM   413  C  CA  . VAL A 1 60  ? -5.711  23.385 81.518 1.00 31.96 ? 224 VAL A CA  1 
ATOM   414  C  C   . VAL A 1 60  ? -5.415  24.247 80.290 1.00 30.04 ? 224 VAL A C   1 
ATOM   415  O  O   . VAL A 1 60  ? -5.655  23.844 79.151 1.00 27.54 ? 224 VAL A O   1 
ATOM   416  C  CB  . VAL A 1 60  ? -7.095  23.787 82.081 1.00 33.32 ? 224 VAL A CB  1 
ATOM   417  C  CG1 . VAL A 1 60  ? -8.184  23.421 81.072 1.00 34.50 ? 224 VAL A CG1 1 
ATOM   418  C  CG2 . VAL A 1 60  ? -7.349  23.104 83.425 1.00 35.24 ? 224 VAL A CG2 1 
ATOM   419  N  N   . SER A 1 61  ? -4.887  25.438 80.546 1.00 28.76 ? 225 SER A N   1 
ATOM   420  C  CA  . SER A 1 61  ? -4.522  26.383 79.502 1.00 29.59 ? 225 SER A CA  1 
ATOM   421  C  C   . SER A 1 61  ? -2.990  26.523 79.482 1.00 28.89 ? 225 SER A C   1 
ATOM   422  O  O   . SER A 1 61  ? -2.333  26.337 80.514 1.00 29.97 ? 225 SER A O   1 
ATOM   423  C  CB  . SER A 1 61  ? -5.176  27.737 79.788 1.00 31.03 ? 225 SER A CB  1 
ATOM   424  O  OG  . SER A 1 61  ? -4.859  28.694 78.790 1.00 31.33 ? 225 SER A OG  1 
ATOM   425  N  N   . ALA A 1 62  ? -2.429  26.848 78.316 1.00 27.00 ? 226 ALA A N   1 
ATOM   426  C  CA  . ALA A 1 62  ? -0.976  27.004 78.169 1.00 24.99 ? 226 ALA A CA  1 
ATOM   427  C  C   . ALA A 1 62  ? -0.544  27.518 76.787 1.00 22.02 ? 226 ALA A C   1 
ATOM   428  O  O   . ALA A 1 62  ? -1.303  27.450 75.823 1.00 22.25 ? 226 ALA A O   1 
ATOM   429  C  CB  . ALA A 1 62  ? -0.280  25.655 78.455 1.00 24.89 ? 226 ALA A CB  1 
ATOM   430  N  N   . GLN A 1 63  ? 0.641   28.115 76.716 1.00 19.05 ? 227 GLN A N   1 
ATOM   431  C  CA  . GLN A 1 63  ? 1.171   28.553 75.431 1.00 18.68 ? 227 GLN A CA  1 
ATOM   432  C  C   . GLN A 1 63  ? 2.454   27.778 75.222 1.00 15.85 ? 227 GLN A C   1 
ATOM   433  O  O   . GLN A 1 63  ? 3.227   27.590 76.157 1.00 15.86 ? 227 GLN A O   1 
ATOM   434  C  CB  . GLN A 1 63  ? 1.476   30.050 75.346 1.00 20.76 ? 227 GLN A CB  1 
ATOM   435  C  CG  . GLN A 1 63  ? 1.919   30.411 73.909 1.00 28.25 ? 227 GLN A CG  1 
ATOM   436  C  CD  . GLN A 1 63  ? 2.432   31.826 73.727 1.00 32.26 ? 227 GLN A CD  1 
ATOM   437  O  OE1 . GLN A 1 63  ? 1.699   32.706 73.268 1.00 33.98 ? 227 GLN A OE1 1 
ATOM   438  N  NE2 . GLN A 1 63  ? 3.712   32.042 74.034 1.00 33.45 ? 227 GLN A NE2 1 
ATOM   439  N  N   . ILE A 1 64  ? 2.677   27.328 73.994 1.00 13.13 ? 228 ILE A N   1 
ATOM   440  C  CA  . ILE A 1 64  ? 3.874   26.565 73.681 1.00 10.93 ? 228 ILE A CA  1 
ATOM   441  C  C   . ILE A 1 64  ? 4.693   27.207 72.561 1.00 9.80  ? 228 ILE A C   1 
ATOM   442  O  O   . ILE A 1 64  ? 4.137   27.834 71.657 1.00 9.39  ? 228 ILE A O   1 
ATOM   443  C  CB  . ILE A 1 64  ? 3.505   25.105 73.317 1.00 9.47  ? 228 ILE A CB  1 
ATOM   444  C  CG1 . ILE A 1 64  ? 4.759   24.236 73.256 1.00 9.74  ? 228 ILE A CG1 1 
ATOM   445  C  CG2 . ILE A 1 64  ? 2.737   25.055 72.002 1.00 9.87  ? 228 ILE A CG2 1 
ATOM   446  C  CD1 . ILE A 1 64  ? 4.462   22.764 73.312 1.00 10.02 ? 228 ILE A CD1 1 
ATOM   447  N  N   . ARG A 1 65  ? 6.016   27.151 72.705 1.00 9.15  ? 229 ARG A N   1 
ATOM   448  C  CA  . ARG A 1 65  ? 6.928   27.665 71.696 1.00 8.80  ? 229 ARG A CA  1 
ATOM   449  C  C   . ARG A 1 65  ? 8.099   26.702 71.548 1.00 9.17  ? 229 ARG A C   1 
ATOM   450  O  O   . ARG A 1 65  ? 8.406   25.929 72.459 1.00 7.50  ? 229 ARG A O   1 
ATOM   451  C  CB  . ARG A 1 65  ? 7.378   29.102 71.987 1.00 11.40 ? 229 ARG A CB  1 
ATOM   452  C  CG  . ARG A 1 65  ? 8.317   29.308 73.140 1.00 14.10 ? 229 ARG A CG  1 
ATOM   453  C  CD  . ARG A 1 65  ? 8.648   30.797 73.231 1.00 19.29 ? 229 ARG A CD  1 
ATOM   454  N  NE  . ARG A 1 65  ? 8.959   31.214 74.595 1.00 23.53 ? 229 ARG A NE  1 
ATOM   455  C  CZ  . ARG A 1 65  ? 8.044   31.424 75.540 1.00 24.23 ? 229 ARG A CZ  1 
ATOM   456  N  NH1 . ARG A 1 65  ? 6.748   31.267 75.280 1.00 26.71 ? 229 ARG A NH1 1 
ATOM   457  N  NH2 . ARG A 1 65  ? 8.427   31.770 76.756 1.00 23.05 ? 229 ARG A NH2 1 
ATOM   458  N  N   . CYS A 1 66  ? 8.751   26.749 70.394 1.00 8.25  ? 230 CYS A N   1 
ATOM   459  C  CA  . CYS A 1 66  ? 9.833   25.826 70.101 1.00 7.93  ? 230 CYS A CA  1 
ATOM   460  C  C   . CYS A 1 66  ? 10.980  26.557 69.433 1.00 8.48  ? 230 CYS A C   1 
ATOM   461  O  O   . CYS A 1 66  ? 10.763  27.363 68.527 1.00 8.08  ? 230 CYS A O   1 
ATOM   462  C  CB  . CYS A 1 66  ? 9.282   24.742 69.163 1.00 8.90  ? 230 CYS A CB  1 
ATOM   463  S  SG  A CYS A 1 66  ? 10.300  23.340 68.820 0.50 6.88  ? 230 CYS A SG  1 
ATOM   464  S  SG  B CYS A 1 66  ? 8.221   23.497 69.937 0.50 12.84 ? 230 CYS A SG  1 
ATOM   465  N  N   . LYS A 1 67  ? 12.195  26.263 69.890 1.00 9.29  ? 231 LYS A N   1 
ATOM   466  C  CA  . LYS A 1 67  ? 13.416  26.869 69.356 1.00 9.51  ? 231 LYS A CA  1 
ATOM   467  C  C   . LYS A 1 67  ? 14.368  25.764 68.885 1.00 10.83 ? 231 LYS A C   1 
ATOM   468  O  O   . LYS A 1 67  ? 14.455  24.704 69.507 1.00 9.65  ? 231 LYS A O   1 
ATOM   469  C  CB  . LYS A 1 67  ? 14.140  27.679 70.445 1.00 8.78  ? 231 LYS A CB  1 
ATOM   470  C  CG  . LYS A 1 67  ? 13.284  28.694 71.212 1.00 8.94  ? 231 LYS A CG  1 
ATOM   471  C  CD  . LYS A 1 67  ? 13.008  29.943 70.392 1.00 12.30 ? 231 LYS A CD  1 
ATOM   472  C  CE  . LYS A 1 67  ? 12.066  30.883 71.133 1.00 10.67 ? 231 LYS A CE  1 
ATOM   473  N  NZ  . LYS A 1 67  ? 11.788  32.132 70.381 1.00 10.42 ? 231 LYS A NZ  1 
ATOM   474  N  N   . LEU A 1 68  ? 15.031  25.993 67.758 1.00 9.99  ? 232 LEU A N   1 
ATOM   475  C  CA  . LEU A 1 68  ? 16.017  25.049 67.256 1.00 11.36 ? 232 LEU A CA  1 
ATOM   476  C  C   . LEU A 1 68  ? 17.381  25.623 67.630 1.00 11.19 ? 232 LEU A C   1 
ATOM   477  O  O   . LEU A 1 68  ? 17.735  26.713 67.191 1.00 12.63 ? 232 LEU A O   1 
ATOM   478  C  CB  . LEU A 1 68  ? 15.943  24.907 65.736 1.00 11.60 ? 232 LEU A CB  1 
ATOM   479  C  CG  . LEU A 1 68  ? 17.010  23.976 65.147 1.00 12.17 ? 232 LEU A CG  1 
ATOM   480  C  CD1 . LEU A 1 68  ? 16.797  22.554 65.654 1.00 12.06 ? 232 LEU A CD1 1 
ATOM   481  C  CD2 . LEU A 1 68  ? 16.948  24.020 63.646 1.00 10.29 ? 232 LEU A CD2 1 
ATOM   482  N  N   . LEU A 1 69  ? 18.121  24.908 68.469 1.00 11.07 ? 233 LEU A N   1 
ATOM   483  C  CA  . LEU A 1 69  ? 19.445  25.347 68.884 1.00 12.37 ? 233 LEU A CA  1 
ATOM   484  C  C   . LEU A 1 69  ? 20.509  24.570 68.132 1.00 13.20 ? 233 LEU A C   1 
ATOM   485  O  O   . LEU A 1 69  ? 20.484  23.344 68.101 1.00 13.56 ? 233 LEU A O   1 
ATOM   486  C  CB  . LEU A 1 69  ? 19.646  25.149 70.389 1.00 11.91 ? 233 LEU A CB  1 
ATOM   487  C  CG  . LEU A 1 69  ? 19.197  26.250 71.350 1.00 12.43 ? 233 LEU A CG  1 
ATOM   488  C  CD1 . LEU A 1 69  ? 17.700  26.470 71.262 1.00 14.13 ? 233 LEU A CD1 1 
ATOM   489  C  CD2 . LEU A 1 69  ? 19.586  25.848 72.758 1.00 10.73 ? 233 LEU A CD2 1 
ATOM   490  N  N   . LYS A 1 70  ? 21.450  25.287 67.532 1.00 14.39 ? 234 LYS A N   1 
ATOM   491  C  CA  . LYS A 1 70  ? 22.517  24.638 66.798 1.00 15.76 ? 234 LYS A CA  1 
ATOM   492  C  C   . LYS A 1 70  ? 23.641  25.614 66.491 1.00 16.82 ? 234 LYS A C   1 
ATOM   493  O  O   . LYS A 1 70  ? 23.468  26.832 66.591 1.00 15.17 ? 234 LYS A O   1 
ATOM   494  C  CB  . LYS A 1 70  ? 21.983  24.067 65.481 1.00 17.28 ? 234 LYS A CB  1 
ATOM   495  C  CG  . LYS A 1 70  ? 21.508  25.138 64.502 1.00 20.73 ? 234 LYS A CG  1 
ATOM   496  C  CD  . LYS A 1 70  ? 21.118  24.546 63.162 1.00 24.15 ? 234 LYS A CD  1 
ATOM   497  C  CE  . LYS A 1 70  ? 22.288  23.820 62.519 1.00 26.07 ? 234 LYS A CE  1 
ATOM   498  N  NZ  . LYS A 1 70  ? 21.939  23.310 61.164 1.00 27.79 ? 234 LYS A NZ  1 
ATOM   499  N  N   . SER A 1 71  ? 24.801  25.052 66.151 1.00 17.66 ? 235 SER A N   1 
ATOM   500  C  CA  . SER A 1 71  ? 25.976  25.821 65.757 1.00 16.98 ? 235 SER A CA  1 
ATOM   501  C  C   . SER A 1 71  ? 25.875  25.910 64.248 1.00 17.77 ? 235 SER A C   1 
ATOM   502  O  O   . SER A 1 71  ? 25.376  24.981 63.599 1.00 17.05 ? 235 SER A O   1 
ATOM   503  C  CB  . SER A 1 71  ? 27.270  25.071 66.082 1.00 16.27 ? 235 SER A CB  1 
ATOM   504  O  OG  . SER A 1 71  ? 27.374  24.782 67.454 1.00 16.69 ? 235 SER A OG  1 
ATOM   505  N  N   . ARG A 1 72  ? 26.332  27.022 63.686 1.00 17.19 ? 236 ARG A N   1 
ATOM   506  C  CA  . ARG A 1 72  ? 26.306  27.183 62.244 1.00 16.84 ? 236 ARG A CA  1 
ATOM   507  C  C   . ARG A 1 72  ? 27.197  28.311 61.773 1.00 17.13 ? 236 ARG A C   1 
ATOM   508  O  O   . ARG A 1 72  ? 27.573  29.196 62.544 1.00 16.08 ? 236 ARG A O   1 
ATOM   509  C  CB  . ARG A 1 72  ? 24.875  27.368 61.714 1.00 16.55 ? 236 ARG A CB  1 
ATOM   510  C  CG  . ARG A 1 72  ? 24.206  28.669 62.071 1.00 15.86 ? 236 ARG A CG  1 
ATOM   511  C  CD  . ARG A 1 72  ? 22.832  28.763 61.422 1.00 15.78 ? 236 ARG A CD  1 
ATOM   512  N  NE  . ARG A 1 72  ? 22.214  30.055 61.694 1.00 17.58 ? 236 ARG A NE  1 
ATOM   513  C  CZ  . ARG A 1 72  ? 22.274  31.102 60.875 1.00 16.47 ? 236 ARG A CZ  1 
ATOM   514  N  NH1 . ARG A 1 72  ? 22.916  31.005 59.721 1.00 15.42 ? 236 ARG A NH1 1 
ATOM   515  N  NH2 . ARG A 1 72  ? 21.732  32.261 61.236 1.00 15.62 ? 236 ARG A NH2 1 
ATOM   516  N  N   . GLN A 1 73  ? 27.574  28.227 60.504 1.00 18.16 ? 237 GLN A N   1 
ATOM   517  C  CA  . GLN A 1 73  ? 28.411  29.228 59.879 1.00 18.78 ? 237 GLN A CA  1 
ATOM   518  C  C   . GLN A 1 73  ? 27.536  29.995 58.894 1.00 19.50 ? 237 GLN A C   1 
ATOM   519  O  O   . GLN A 1 73  ? 26.909  29.407 58.005 1.00 20.78 ? 237 GLN A O   1 
ATOM   520  C  CB  . GLN A 1 73  ? 29.573  28.553 59.154 1.00 20.07 ? 237 GLN A CB  1 
ATOM   521  C  CG  . GLN A 1 73  ? 30.605  29.523 58.620 1.00 25.85 ? 237 GLN A CG  1 
ATOM   522  C  CD  . GLN A 1 73  ? 31.752  28.825 57.908 1.00 27.61 ? 237 GLN A CD  1 
ATOM   523  O  OE1 . GLN A 1 73  ? 31.602  28.369 56.773 1.00 30.91 ? 237 GLN A OE1 1 
ATOM   524  N  NE2 . GLN A 1 73  ? 32.908  28.746 58.568 1.00 28.14 ? 237 GLN A NE2 1 
ATOM   525  N  N   . THR A 1 74  ? 27.439  31.304 59.094 1.00 18.83 ? 238 THR A N   1 
ATOM   526  C  CA  . THR A 1 74  ? 26.643  32.151 58.213 1.00 18.75 ? 238 THR A CA  1 
ATOM   527  C  C   . THR A 1 74  ? 27.336  32.242 56.846 1.00 19.97 ? 238 THR A C   1 
ATOM   528  O  O   . THR A 1 74  ? 28.508  31.872 56.717 1.00 21.65 ? 238 THR A O   1 
ATOM   529  C  CB  . THR A 1 74  ? 26.512  33.580 58.798 1.00 18.53 ? 238 THR A CB  1 
ATOM   530  O  OG1 . THR A 1 74  ? 27.792  34.227 58.778 1.00 17.24 ? 238 THR A OG1 1 
ATOM   531  C  CG2 . THR A 1 74  ? 25.994  33.537 60.230 1.00 15.34 ? 238 THR A CG2 1 
ATOM   532  N  N   . PRO A 1 75  ? 26.614  32.695 55.802 1.00 20.38 ? 239 PRO A N   1 
ATOM   533  C  CA  . PRO A 1 75  ? 27.191  32.830 54.456 1.00 20.45 ? 239 PRO A CA  1 
ATOM   534  C  C   . PRO A 1 75  ? 28.382  33.788 54.474 1.00 20.55 ? 239 PRO A C   1 
ATOM   535  O  O   . PRO A 1 75  ? 29.205  33.779 53.568 1.00 21.41 ? 239 PRO A O   1 
ATOM   536  C  CB  . PRO A 1 75  ? 26.040  33.433 53.660 1.00 20.60 ? 239 PRO A CB  1 
ATOM   537  C  CG  . PRO A 1 75  ? 24.838  32.852 54.321 1.00 21.26 ? 239 PRO A CG  1 
ATOM   538  C  CD  . PRO A 1 75  ? 25.168  32.980 55.777 1.00 19.82 ? 239 PRO A CD  1 
ATOM   539  N  N   . GLU A 1 76  ? 28.462  34.611 55.519 1.00 20.66 ? 240 GLU A N   1 
ATOM   540  C  CA  . GLU A 1 76  ? 29.543  35.586 55.678 1.00 20.34 ? 240 GLU A CA  1 
ATOM   541  C  C   . GLU A 1 76  ? 30.799  34.967 56.278 1.00 20.47 ? 240 GLU A C   1 
ATOM   542  O  O   . GLU A 1 76  ? 31.823  35.636 56.413 1.00 22.22 ? 240 GLU A O   1 
ATOM   543  C  CB  . GLU A 1 76  ? 29.082  36.767 56.545 1.00 19.44 ? 240 GLU A CB  1 
ATOM   544  C  CG  . GLU A 1 76  ? 28.061  37.699 55.880 1.00 19.06 ? 240 GLU A CG  1 
ATOM   545  C  CD  . GLU A 1 76  ? 26.637  37.154 55.867 1.00 19.98 ? 240 GLU A CD  1 
ATOM   546  O  OE1 . GLU A 1 76  ? 26.313  36.263 56.682 1.00 22.16 ? 240 GLU A OE1 1 
ATOM   547  O  OE2 . GLU A 1 76  ? 25.825  37.640 55.056 1.00 19.49 ? 240 GLU A OE2 1 
ATOM   548  N  N   . GLY A 1 77  ? 30.710  33.692 56.646 1.00 20.70 ? 241 GLY A N   1 
ATOM   549  C  CA  . GLY A 1 77  ? 31.844  32.996 57.222 1.00 19.93 ? 241 GLY A CA  1 
ATOM   550  C  C   . GLY A 1 77  ? 31.887  33.037 58.734 1.00 20.48 ? 241 GLY A C   1 
ATOM   551  O  O   . GLY A 1 77  ? 32.812  32.508 59.355 1.00 21.26 ? 241 GLY A O   1 
ATOM   552  N  N   . GLU A 1 78  ? 30.892  33.673 59.337 1.00 19.95 ? 242 GLU A N   1 
ATOM   553  C  CA  . GLU A 1 78  ? 30.849  33.768 60.787 1.00 18.11 ? 242 GLU A CA  1 
ATOM   554  C  C   . GLU A 1 78  ? 30.303  32.496 61.422 1.00 17.82 ? 242 GLU A C   1 
ATOM   555  O  O   . GLU A 1 78  ? 29.274  31.969 60.996 1.00 18.25 ? 242 GLU A O   1 
ATOM   556  C  CB  . GLU A 1 78  ? 29.997  34.955 61.232 1.00 16.96 ? 242 GLU A CB  1 
ATOM   557  C  CG  . GLU A 1 78  ? 29.959  35.115 62.748 1.00 16.70 ? 242 GLU A CG  1 
ATOM   558  C  CD  . GLU A 1 78  ? 28.958  36.159 63.226 1.00 17.04 ? 242 GLU A CD  1 
ATOM   559  O  OE1 . GLU A 1 78  ? 28.997  36.494 64.423 1.00 16.89 ? 242 GLU A OE1 1 
ATOM   560  O  OE2 . GLU A 1 78  ? 28.127  36.634 62.421 1.00 17.79 ? 242 GLU A OE2 1 
ATOM   561  N  N   . PHE A 1 79  ? 31.015  31.995 62.422 1.00 16.18 ? 243 PHE A N   1 
ATOM   562  C  CA  . PHE A 1 79  ? 30.578  30.812 63.137 1.00 16.35 ? 243 PHE A CA  1 
ATOM   563  C  C   . PHE A 1 79  ? 29.754  31.239 64.352 1.00 15.78 ? 243 PHE A C   1 
ATOM   564  O  O   . PHE A 1 79  ? 30.202  32.044 65.184 1.00 13.24 ? 243 PHE A O   1 
ATOM   565  C  CB  . PHE A 1 79  ? 31.769  29.961 63.597 1.00 17.29 ? 243 PHE A CB  1 
ATOM   566  C  CG  . PHE A 1 79  ? 31.366  28.727 64.359 1.00 16.98 ? 243 PHE A CG  1 
ATOM   567  C  CD1 . PHE A 1 79  ? 30.653  27.707 63.731 1.00 18.40 ? 243 PHE A CD1 1 
ATOM   568  C  CD2 . PHE A 1 79  ? 31.686  28.587 65.707 1.00 18.14 ? 243 PHE A CD2 1 
ATOM   569  C  CE1 . PHE A 1 79  ? 30.265  26.565 64.429 1.00 17.65 ? 243 PHE A CE1 1 
ATOM   570  C  CE2 . PHE A 1 79  ? 31.299  27.440 66.419 1.00 18.33 ? 243 PHE A CE2 1 
ATOM   571  C  CZ  . PHE A 1 79  ? 30.588  26.431 65.775 1.00 16.49 ? 243 PHE A CZ  1 
ATOM   572  N  N   . LEU A 1 80  ? 28.527  30.733 64.414 1.00 13.52 ? 244 LEU A N   1 
ATOM   573  C  CA  . LEU A 1 80  ? 27.633  31.022 65.522 1.00 13.43 ? 244 LEU A CA  1 
ATOM   574  C  C   . LEU A 1 80  ? 27.648  29.756 66.383 1.00 14.14 ? 244 LEU A C   1 
ATOM   575  O  O   . LEU A 1 80  ? 27.136  28.711 65.968 1.00 13.26 ? 244 LEU A O   1 
ATOM   576  C  CB  . LEU A 1 80  ? 26.228  31.324 64.987 1.00 12.44 ? 244 LEU A CB  1 
ATOM   577  C  CG  . LEU A 1 80  ? 26.138  32.421 63.914 1.00 11.65 ? 244 LEU A CG  1 
ATOM   578  C  CD1 . LEU A 1 80  ? 24.742  32.489 63.351 1.00 12.12 ? 244 LEU A CD1 1 
ATOM   579  C  CD2 . LEU A 1 80  ? 26.549  33.772 64.478 1.00 10.20 ? 244 LEU A CD2 1 
ATOM   580  N  N   . PRO A 1 81  ? 28.323  29.808 67.551 1.00 14.54 ? 245 PRO A N   1 
ATOM   581  C  CA  . PRO A 1 81  ? 28.426  28.671 68.473 1.00 16.19 ? 245 PRO A CA  1 
ATOM   582  C  C   . PRO A 1 81  ? 27.070  28.073 68.826 1.00 16.80 ? 245 PRO A C   1 
ATOM   583  O  O   . PRO A 1 81  ? 26.899  26.855 68.812 1.00 16.72 ? 245 PRO A O   1 
ATOM   584  C  CB  . PRO A 1 81  ? 29.091  29.293 69.703 1.00 15.52 ? 245 PRO A CB  1 
ATOM   585  C  CG  . PRO A 1 81  ? 29.957  30.328 69.114 1.00 16.77 ? 245 PRO A CG  1 
ATOM   586  C  CD  . PRO A 1 81  ? 29.044  30.969 68.099 1.00 13.99 ? 245 PRO A CD  1 
ATOM   587  N  N   . LEU A 1 82  ? 26.109  28.936 69.136 1.00 16.65 ? 246 LEU A N   1 
ATOM   588  C  CA  . LEU A 1 82  ? 24.774  28.477 69.486 1.00 18.21 ? 246 LEU A CA  1 
ATOM   589  C  C   . LEU A 1 82  ? 23.766  29.483 68.990 1.00 17.92 ? 246 LEU A C   1 
ATOM   590  O  O   . LEU A 1 82  ? 23.609  30.562 69.575 1.00 20.81 ? 246 LEU A O   1 
ATOM   591  C  CB  . LEU A 1 82  ? 24.628  28.318 71.002 1.00 19.15 ? 246 LEU A CB  1 
ATOM   592  C  CG  . LEU A 1 82  ? 23.279  27.735 71.441 1.00 21.70 ? 246 LEU A CG  1 
ATOM   593  C  CD1 . LEU A 1 82  ? 23.295  26.228 71.267 1.00 19.00 ? 246 LEU A CD1 1 
ATOM   594  C  CD2 . LEU A 1 82  ? 22.990  28.116 72.890 1.00 22.22 ? 246 LEU A CD2 1 
ATOM   595  N  N   . ASP A 1 83  ? 23.123  29.150 67.881 1.00 15.10 ? 247 ASP A N   1 
ATOM   596  C  CA  . ASP A 1 83  ? 22.120  30.024 67.302 1.00 14.57 ? 247 ASP A CA  1 
ATOM   597  C  C   . ASP A 1 83  ? 20.735  29.429 67.571 1.00 14.04 ? 247 ASP A C   1 
ATOM   598  O  O   . ASP A 1 83  ? 20.591  28.209 67.685 1.00 15.26 ? 247 ASP A O   1 
ATOM   599  C  CB  . ASP A 1 83  ? 22.362  30.173 65.793 1.00 14.91 ? 247 ASP A CB  1 
ATOM   600  C  CG  . ASP A 1 83  ? 21.496  31.261 65.157 1.00 15.53 ? 247 ASP A CG  1 
ATOM   601  O  OD1 . ASP A 1 83  ? 21.264  32.306 65.800 1.00 15.21 ? 247 ASP A OD1 1 
ATOM   602  O  OD2 . ASP A 1 83  ? 21.046  31.073 64.010 1.00 15.62 ? 247 ASP A OD2 1 
ATOM   603  N  N   . GLN A 1 84  ? 19.738  30.290 67.750 1.00 12.02 ? 248 GLN A N   1 
ATOM   604  C  CA  . GLN A 1 84  ? 18.380  29.820 67.978 1.00 12.03 ? 248 GLN A CA  1 
ATOM   605  C  C   . GLN A 1 84  ? 17.521  30.161 66.769 1.00 13.73 ? 248 GLN A C   1 
ATOM   606  O  O   . GLN A 1 84  ? 17.490  31.308 66.310 1.00 14.47 ? 248 GLN A O   1 
ATOM   607  C  CB  . GLN A 1 84  ? 17.775  30.441 69.231 1.00 12.10 ? 248 GLN A CB  1 
ATOM   608  C  CG  . GLN A 1 84  ? 18.369  29.949 70.527 1.00 11.80 ? 248 GLN A CG  1 
ATOM   609  C  CD  . GLN A 1 84  ? 17.631  30.498 71.735 1.00 13.49 ? 248 GLN A CD  1 
ATOM   610  O  OE1 . GLN A 1 84  ? 16.407  30.640 71.717 1.00 14.52 ? 248 GLN A OE1 1 
ATOM   611  N  NE2 . GLN A 1 84  ? 18.373  30.821 72.784 1.00 15.42 ? 248 GLN A NE2 1 
ATOM   612  N  N   . LEU A 1 85  ? 16.851  29.149 66.237 1.00 13.53 ? 249 LEU A N   1 
ATOM   613  C  CA  . LEU A 1 85  ? 15.989  29.318 65.086 1.00 14.33 ? 249 LEU A CA  1 
ATOM   614  C  C   . LEU A 1 85  ? 14.575  28.980 65.507 1.00 15.00 ? 249 LEU A C   1 
ATOM   615  O  O   . LEU A 1 85  ? 14.339  27.994 66.189 1.00 17.06 ? 249 LEU A O   1 
ATOM   616  C  CB  . LEU A 1 85  ? 16.452  28.413 63.943 1.00 15.69 ? 249 LEU A CB  1 
ATOM   617  C  CG  . LEU A 1 85  ? 17.774  28.856 63.300 1.00 17.50 ? 249 LEU A CG  1 
ATOM   618  C  CD1 . LEU A 1 85  ? 18.516  27.688 62.709 1.00 19.66 ? 249 LEU A CD1 1 
ATOM   619  C  CD2 . LEU A 1 85  ? 17.489  29.907 62.237 1.00 21.64 ? 249 LEU A CD2 1 
ATOM   620  N  N   . GLU A 1 86  ? 13.640  29.822 65.101 1.00 15.10 ? 250 GLU A N   1 
ATOM   621  C  CA  . GLU A 1 86  ? 12.234  29.660 65.432 1.00 15.03 ? 250 GLU A CA  1 
ATOM   622  C  C   . GLU A 1 86  ? 11.575  28.474 64.722 1.00 15.18 ? 250 GLU A C   1 
ATOM   623  O  O   . GLU A 1 86  ? 11.746  28.291 63.511 1.00 14.00 ? 250 GLU A O   1 
ATOM   624  C  CB  . GLU A 1 86  ? 11.512  30.962 65.066 1.00 17.19 ? 250 GLU A CB  1 
ATOM   625  C  CG  . GLU A 1 86  ? 10.173  31.148 65.710 1.00 19.06 ? 250 GLU A CG  1 
ATOM   626  C  CD  . GLU A 1 86  ? 10.249  31.153 67.221 1.00 18.45 ? 250 GLU A CD  1 
ATOM   627  O  OE1 . GLU A 1 86  ? 11.287  31.575 67.782 1.00 18.58 ? 250 GLU A OE1 1 
ATOM   628  O  OE2 . GLU A 1 86  ? 9.252   30.739 67.838 1.00 20.61 ? 250 GLU A OE2 1 
ATOM   629  N  N   . LEU A 1 87  ? 10.858  27.649 65.486 1.00 13.92 ? 251 LEU A N   1 
ATOM   630  C  CA  . LEU A 1 87  ? 10.138  26.500 64.930 1.00 13.23 ? 251 LEU A CA  1 
ATOM   631  C  C   . LEU A 1 87  ? 8.646   26.745 65.156 1.00 12.19 ? 251 LEU A C   1 
ATOM   632  O  O   . LEU A 1 87  ? 8.146   26.616 66.274 1.00 10.45 ? 251 LEU A O   1 
ATOM   633  C  CB  . LEU A 1 87  ? 10.580  25.192 65.596 1.00 15.77 ? 251 LEU A CB  1 
ATOM   634  C  CG  . LEU A 1 87  ? 11.958  24.633 65.216 1.00 17.21 ? 251 LEU A CG  1 
ATOM   635  C  CD1 . LEU A 1 87  ? 12.360  23.521 66.175 1.00 17.61 ? 251 LEU A CD1 1 
ATOM   636  C  CD2 . LEU A 1 87  ? 11.956  24.119 63.785 1.00 17.85 ? 251 LEU A CD2 1 
ATOM   637  N  N   . ASP A 1 88  ? 7.956   27.134 64.088 1.00 10.33 ? 252 ASP A N   1 
ATOM   638  C  CA  . ASP A 1 88  ? 6.531   27.443 64.133 1.00 10.64 ? 252 ASP A CA  1 
ATOM   639  C  C   . ASP A 1 88  ? 5.668   26.292 64.654 1.00 10.77 ? 252 ASP A C   1 
ATOM   640  O  O   . ASP A 1 88  ? 5.571   25.244 64.013 1.00 11.53 ? 252 ASP A O   1 
ATOM   641  C  CB  . ASP A 1 88  ? 6.066   27.874 62.732 1.00 10.62 ? 252 ASP A CB  1 
ATOM   642  C  CG  . ASP A 1 88  ? 4.638   28.413 62.702 1.00 12.30 ? 252 ASP A CG  1 
ATOM   643  O  OD1 . ASP A 1 88  ? 3.907   28.337 63.709 1.00 12.05 ? 252 ASP A OD1 1 
ATOM   644  O  OD2 . ASP A 1 88  ? 4.229   28.909 61.635 1.00 13.57 ? 252 ASP A OD2 1 
ATOM   645  N  N   . VAL A 1 89  ? 5.070   26.481 65.832 1.00 9.66  ? 253 VAL A N   1 
ATOM   646  C  CA  . VAL A 1 89  ? 4.184   25.469 66.401 1.00 10.29 ? 253 VAL A CA  1 
ATOM   647  C  C   . VAL A 1 89  ? 2.774   26.015 66.658 1.00 10.57 ? 253 VAL A C   1 
ATOM   648  O  O   . VAL A 1 89  ? 2.053   25.548 67.541 1.00 11.68 ? 253 VAL A O   1 
ATOM   649  C  CB  . VAL A 1 89  ? 4.773   24.783 67.664 1.00 9.94  ? 253 VAL A CB  1 
ATOM   650  C  CG1 . VAL A 1 89  ? 5.943   23.888 67.272 1.00 7.74  ? 253 VAL A CG1 1 
ATOM   651  C  CG2 . VAL A 1 89  ? 5.200   25.813 68.701 1.00 7.23  ? 253 VAL A CG2 1 
ATOM   652  N  N   . GLY A 1 90  ? 2.386   27.006 65.866 1.00 11.59 ? 254 GLY A N   1 
ATOM   653  C  CA  . GLY A 1 90  ? 1.059   27.567 65.993 1.00 13.99 ? 254 GLY A CA  1 
ATOM   654  C  C   . GLY A 1 90  ? 0.919   29.071 66.103 1.00 16.38 ? 254 GLY A C   1 
ATOM   655  O  O   . GLY A 1 90  ? -0.206  29.556 66.187 1.00 18.20 ? 254 GLY A O   1 
ATOM   656  N  N   . PHE A 1 91  ? 2.013   29.827 66.116 1.00 17.82 ? 255 PHE A N   1 
ATOM   657  C  CA  . PHE A 1 91  ? 1.870   31.274 66.232 1.00 22.74 ? 255 PHE A CA  1 
ATOM   658  C  C   . PHE A 1 91  ? 1.115   31.883 65.047 1.00 24.20 ? 255 PHE A C   1 
ATOM   659  O  O   . PHE A 1 91  ? 0.496   32.932 65.178 1.00 25.81 ? 255 PHE A O   1 
ATOM   660  C  CB  . PHE A 1 91  ? 3.224   31.961 66.465 1.00 24.62 ? 255 PHE A CB  1 
ATOM   661  C  CG  . PHE A 1 91  ? 3.873   32.492 65.219 1.00 29.05 ? 255 PHE A CG  1 
ATOM   662  C  CD1 . PHE A 1 91  ? 3.862   33.858 64.946 1.00 30.48 ? 255 PHE A CD1 1 
ATOM   663  C  CD2 . PHE A 1 91  ? 4.495   31.628 64.313 1.00 30.83 ? 255 PHE A CD2 1 
ATOM   664  C  CE1 . PHE A 1 91  ? 4.460   34.359 63.781 1.00 31.71 ? 255 PHE A CE1 1 
ATOM   665  C  CE2 . PHE A 1 91  ? 5.098   32.115 63.145 1.00 31.29 ? 255 PHE A CE2 1 
ATOM   666  C  CZ  . PHE A 1 91  ? 5.080   33.481 62.879 1.00 32.55 ? 255 PHE A CZ  1 
ATOM   667  N  N   . SER A 1 92  ? 1.102   31.187 63.916 1.00 25.96 ? 256 SER A N   1 
ATOM   668  C  CA  . SER A 1 92  ? 0.412   31.696 62.733 1.00 29.40 ? 256 SER A CA  1 
ATOM   669  C  C   . SER A 1 92  ? -1.032  31.203 62.598 1.00 30.25 ? 256 SER A C   1 
ATOM   670  O  O   . SER A 1 92  ? -1.639  31.313 61.529 1.00 31.15 ? 256 SER A O   1 
ATOM   671  C  CB  . SER A 1 92  ? 1.212   31.382 61.464 1.00 29.37 ? 256 SER A CB  1 
ATOM   672  O  OG  . SER A 1 92  ? 1.423   29.986 61.327 1.00 33.08 ? 256 SER A OG  1 
ATOM   673  N  N   . THR A 1 93  ? -1.565  30.619 63.668 1.00 29.65 ? 257 THR A N   1 
ATOM   674  C  CA  . THR A 1 93  ? -2.950  30.144 63.679 1.00 27.71 ? 257 THR A CA  1 
ATOM   675  C  C   . THR A 1 93  ? -3.562  30.359 65.070 1.00 26.07 ? 257 THR A C   1 
ATOM   676  O  O   . THR A 1 93  ? -4.758  30.622 65.198 1.00 26.82 ? 257 THR A O   1 
ATOM   677  C  CB  . THR A 1 93  ? -3.096  28.638 63.280 1.00 27.66 ? 257 THR A CB  1 
ATOM   678  O  OG1 . THR A 1 93  ? -2.332  27.811 64.161 1.00 27.99 ? 257 THR A OG1 1 
ATOM   679  C  CG2 . THR A 1 93  ? -2.651  28.395 61.849 1.00 29.05 ? 257 THR A CG2 1 
ATOM   680  N  N   . GLY A 1 94  ? -2.708  30.365 66.090 1.00 22.79 ? 258 GLY A N   1 
ATOM   681  C  CA  . GLY A 1 94  ? -3.172  30.510 67.455 1.00 18.17 ? 258 GLY A CA  1 
ATOM   682  C  C   . GLY A 1 94  ? -3.209  29.108 68.036 1.00 17.25 ? 258 GLY A C   1 
ATOM   683  O  O   . GLY A 1 94  ? -3.649  28.897 69.167 1.00 15.64 ? 258 GLY A O   1 
ATOM   684  N  N   . ALA A 1 95  ? -2.762  28.135 67.241 1.00 15.27 ? 259 ALA A N   1 
ATOM   685  C  CA  . ALA A 1 95  ? -2.718  26.739 67.666 1.00 13.84 ? 259 ALA A CA  1 
ATOM   686  C  C   . ALA A 1 95  ? -1.701  26.548 68.797 1.00 11.72 ? 259 ALA A C   1 
ATOM   687  O  O   . ALA A 1 95  ? -1.678  25.500 69.446 1.00 12.75 ? 259 ALA A O   1 
ATOM   688  C  CB  . ALA A 1 95  ? -2.376  25.838 66.493 1.00 14.31 ? 259 ALA A CB  1 
ATOM   689  N  N   . ASP A 1 96  ? -0.844  27.545 69.010 1.00 9.05  ? 260 ASP A N   1 
ATOM   690  C  CA  . ASP A 1 96  ? 0.136   27.469 70.094 1.00 8.22  ? 260 ASP A CA  1 
ATOM   691  C  C   . ASP A 1 96  ? -0.490  27.792 71.456 1.00 6.50  ? 260 ASP A C   1 
ATOM   692  O  O   . ASP A 1 96  ? 0.178   27.690 72.477 1.00 4.15  ? 260 ASP A O   1 
ATOM   693  C  CB  . ASP A 1 96  ? 1.346   28.370 69.826 1.00 8.67  ? 260 ASP A CB  1 
ATOM   694  C  CG  . ASP A 1 96  ? 0.975   29.834 69.675 1.00 9.27  ? 260 ASP A CG  1 
ATOM   695  O  OD1 . ASP A 1 96  ? -0.186  30.140 69.358 1.00 10.76 ? 260 ASP A OD1 1 
ATOM   696  O  OD2 . ASP A 1 96  ? 1.863   30.687 69.859 1.00 11.57 ? 260 ASP A OD2 1 
ATOM   697  N  N   . GLN A 1 97  ? -1.748  28.237 71.454 1.00 7.94  ? 261 GLN A N   1 
ATOM   698  C  CA  . GLN A 1 97  ? -2.484  28.535 72.689 1.00 9.72  ? 261 GLN A CA  1 
ATOM   699  C  C   . GLN A 1 97  ? -3.254  27.244 72.934 1.00 8.39  ? 261 GLN A C   1 
ATOM   700  O  O   . GLN A 1 97  ? -4.316  27.030 72.366 1.00 9.41  ? 261 GLN A O   1 
ATOM   701  C  CB  . GLN A 1 97  ? -3.456  29.708 72.491 1.00 12.26 ? 261 GLN A CB  1 
ATOM   702  C  CG  . GLN A 1 97  ? -2.809  31.033 72.052 1.00 16.84 ? 261 GLN A CG  1 
ATOM   703  C  CD  . GLN A 1 97  ? -1.915  31.666 73.110 1.00 21.46 ? 261 GLN A CD  1 
ATOM   704  O  OE1 . GLN A 1 97  ? -2.239  31.672 74.299 1.00 26.70 ? 261 GLN A OE1 1 
ATOM   705  N  NE2 . GLN A 1 97  ? -0.789  32.222 72.675 1.00 24.53 ? 261 GLN A NE2 1 
ATOM   706  N  N   . LEU A 1 98  ? -2.704  26.394 73.792 1.00 7.94  ? 262 LEU A N   1 
ATOM   707  C  CA  . LEU A 1 98  ? -3.258  25.076 74.080 1.00 8.60  ? 262 LEU A CA  1 
ATOM   708  C  C   . LEU A 1 98  ? -4.400  24.931 75.061 1.00 9.73  ? 262 LEU A C   1 
ATOM   709  O  O   . LEU A 1 98  ? -4.523  25.691 76.018 1.00 11.54 ? 262 LEU A O   1 
ATOM   710  C  CB  . LEU A 1 98  ? -2.140  24.133 74.551 1.00 7.73  ? 262 LEU A CB  1 
ATOM   711  C  CG  . LEU A 1 98  ? -0.800  24.165 73.810 1.00 7.63  ? 262 LEU A CG  1 
ATOM   712  C  CD1 . LEU A 1 98  ? 0.154   23.205 74.484 1.00 5.69  ? 262 LEU A CD1 1 
ATOM   713  C  CD2 . LEU A 1 98  ? -0.983  23.815 72.335 1.00 9.23  ? 262 LEU A CD2 1 
ATOM   714  N  N   . PHE A 1 99  ? -5.204  23.896 74.815 1.00 10.90 ? 263 PHE A N   1 
ATOM   715  C  CA  . PHE A 1 99  ? -6.307  23.498 75.684 1.00 10.34 ? 263 PHE A CA  1 
ATOM   716  C  C   . PHE A 1 99  ? -5.902  22.073 76.081 1.00 11.86 ? 263 PHE A C   1 
ATOM   717  O  O   . PHE A 1 99  ? -6.068  21.138 75.294 1.00 10.22 ? 263 PHE A O   1 
ATOM   718  C  CB  . PHE A 1 99  ? -7.644  23.493 74.930 1.00 10.22 ? 263 PHE A CB  1 
ATOM   719  C  CG  . PHE A 1 99  ? -8.775  22.871 75.703 1.00 9.42  ? 263 PHE A CG  1 
ATOM   720  C  CD1 . PHE A 1 99  ? -8.954  23.157 77.050 1.00 9.54  ? 263 PHE A CD1 1 
ATOM   721  C  CD2 . PHE A 1 99  ? -9.637  21.970 75.090 1.00 11.01 ? 263 PHE A CD2 1 
ATOM   722  C  CE1 . PHE A 1 99  ? -9.963  22.558 77.778 1.00 10.01 ? 263 PHE A CE1 1 
ATOM   723  C  CE2 . PHE A 1 99  ? -10.659 21.359 75.810 1.00 10.35 ? 263 PHE A CE2 1 
ATOM   724  C  CZ  . PHE A 1 99  ? -10.822 21.654 77.158 1.00 10.45 ? 263 PHE A CZ  1 
ATOM   725  N  N   . LEU A 1 100 ? -5.293  21.941 77.260 1.00 13.46 ? 264 LEU A N   1 
ATOM   726  C  CA  . LEU A 1 100 ? -4.809  20.654 77.789 1.00 17.17 ? 264 LEU A CA  1 
ATOM   727  C  C   . LEU A 1 100 ? -5.850  19.754 78.457 1.00 17.66 ? 264 LEU A C   1 
ATOM   728  O  O   . LEU A 1 100 ? -5.734  19.438 79.639 1.00 21.00 ? 264 LEU A O   1 
ATOM   729  C  CB  . LEU A 1 100 ? -3.668  20.901 78.775 1.00 19.71 ? 264 LEU A CB  1 
ATOM   730  C  CG  . LEU A 1 100 ? -2.407  21.567 78.219 1.00 21.38 ? 264 LEU A CG  1 
ATOM   731  C  CD1 . LEU A 1 100 ? -1.419  21.848 79.360 1.00 22.13 ? 264 LEU A CD1 1 
ATOM   732  C  CD2 . LEU A 1 100 ? -1.785  20.677 77.163 1.00 22.09 ? 264 LEU A CD2 1 
ATOM   733  N  N   . VAL A 1 101 ? -6.850  19.320 77.697 1.00 20.35 ? 265 VAL A N   1 
ATOM   734  C  CA  . VAL A 1 101 ? -7.912  18.452 78.222 1.00 20.36 ? 265 VAL A CA  1 
ATOM   735  C  C   . VAL A 1 101 ? -7.400  17.006 78.371 1.00 21.03 ? 265 VAL A C   1 
ATOM   736  O  O   . VAL A 1 101 ? -7.920  16.213 79.161 1.00 22.27 ? 265 VAL A O   1 
ATOM   737  C  CB  . VAL A 1 101 ? -9.167  18.488 77.277 1.00 22.75 ? 265 VAL A CB  1 
ATOM   738  C  CG1 . VAL A 1 101 ? -8.820  17.942 75.874 1.00 20.90 ? 265 VAL A CG1 1 
ATOM   739  C  CG2 . VAL A 1 101 ? -10.350 17.732 77.891 1.00 20.29 ? 265 VAL A CG2 1 
ATOM   740  N  N   . SER A 1 102 ? -6.347  16.702 77.621 1.00 19.09 ? 266 SER A N   1 
ATOM   741  C  CA  . SER A 1 102 ? -5.713  15.391 77.583 1.00 15.19 ? 266 SER A CA  1 
ATOM   742  C  C   . SER A 1 102 ? -4.450  15.600 76.746 1.00 12.34 ? 266 SER A C   1 
ATOM   743  O  O   . SER A 1 102 ? -4.221  16.706 76.243 1.00 9.96  ? 266 SER A O   1 
ATOM   744  C  CB  . SER A 1 102 ? -6.653  14.393 76.902 1.00 16.58 ? 266 SER A CB  1 
ATOM   745  O  OG  . SER A 1 102 ? -7.114  14.902 75.662 1.00 18.73 ? 266 SER A OG  1 
ATOM   746  N  N   . PRO A 1 103 ? -3.607  14.561 76.590 1.00 11.43 ? 267 PRO A N   1 
ATOM   747  C  CA  . PRO A 1 103 ? -2.386  14.743 75.793 1.00 11.24 ? 267 PRO A CA  1 
ATOM   748  C  C   . PRO A 1 103 ? -2.644  15.309 74.398 1.00 11.03 ? 267 PRO A C   1 
ATOM   749  O  O   . PRO A 1 103 ? -3.722  15.113 73.820 1.00 11.30 ? 267 PRO A O   1 
ATOM   750  C  CB  . PRO A 1 103 ? -1.810  13.331 75.732 1.00 10.53 ? 267 PRO A CB  1 
ATOM   751  C  CG  . PRO A 1 103 ? -2.201  12.773 77.073 1.00 10.28 ? 267 PRO A CG  1 
ATOM   752  C  CD  . PRO A 1 103 ? -3.650  13.204 77.161 1.00 11.82 ? 267 PRO A CD  1 
ATOM   753  N  N   . LEU A 1 104 ? -1.668  16.058 73.890 1.00 9.28  ? 268 LEU A N   1 
ATOM   754  C  CA  . LEU A 1 104 ? -1.758  16.669 72.564 1.00 9.27  ? 268 LEU A CA  1 
ATOM   755  C  C   . LEU A 1 104 ? -0.489  16.415 71.771 1.00 6.82  ? 268 LEU A C   1 
ATOM   756  O  O   . LEU A 1 104 ? 0.606   16.504 72.306 1.00 6.67  ? 268 LEU A O   1 
ATOM   757  C  CB  . LEU A 1 104 ? -1.918  18.188 72.676 1.00 11.05 ? 268 LEU A CB  1 
ATOM   758  C  CG  . LEU A 1 104 ? -3.248  18.831 73.047 1.00 15.20 ? 268 LEU A CG  1 
ATOM   759  C  CD1 . LEU A 1 104 ? -3.006  20.311 73.269 1.00 15.71 ? 268 LEU A CD1 1 
ATOM   760  C  CD2 . LEU A 1 104 ? -4.268  18.619 71.931 1.00 17.51 ? 268 LEU A CD2 1 
ATOM   761  N  N   . THR A 1 105 ? -0.646  16.120 70.487 1.00 8.22  ? 269 THR A N   1 
ATOM   762  C  CA  . THR A 1 105 ? 0.495   15.922 69.607 1.00 8.50  ? 269 THR A CA  1 
ATOM   763  C  C   . THR A 1 105 ? 0.751   17.279 68.934 1.00 9.19  ? 269 THR A C   1 
ATOM   764  O  O   . THR A 1 105 ? -0.045  17.744 68.104 1.00 8.37  ? 269 THR A O   1 
ATOM   765  C  CB  . THR A 1 105 ? 0.213   14.840 68.544 1.00 9.05  ? 269 THR A CB  1 
ATOM   766  O  OG1 . THR A 1 105 ? -0.131  13.614 69.198 1.00 9.61  ? 269 THR A OG1 1 
ATOM   767  C  CG2 . THR A 1 105 ? 1.444   14.601 67.690 1.00 9.92  ? 269 THR A CG2 1 
ATOM   768  N  N   . ILE A 1 106 ? 1.811   17.950 69.373 1.00 8.54  ? 270 ILE A N   1 
ATOM   769  C  CA  . ILE A 1 106 ? 2.181   19.254 68.827 1.00 8.44  ? 270 ILE A CA  1 
ATOM   770  C  C   . ILE A 1 106 ? 2.789   19.041 67.447 1.00 8.77  ? 270 ILE A C   1 
ATOM   771  O  O   . ILE A 1 106 ? 3.623   18.160 67.257 1.00 7.86  ? 270 ILE A O   1 
ATOM   772  C  CB  . ILE A 1 106 ? 3.185   19.974 69.748 1.00 8.58  ? 270 ILE A CB  1 
ATOM   773  C  CG1 . ILE A 1 106 ? 2.601   20.093 71.160 1.00 9.28  ? 270 ILE A CG1 1 
ATOM   774  C  CG2 . ILE A 1 106 ? 3.530   21.346 69.196 1.00 9.06  ? 270 ILE A CG2 1 
ATOM   775  C  CD1 . ILE A 1 106 ? 1.337   20.906 71.246 1.00 8.62  ? 270 ILE A CD1 1 
ATOM   776  N  N   . CYS A 1 107 ? 2.348   19.838 66.482 1.00 8.42  ? 271 CYS A N   1 
ATOM   777  C  CA  . CYS A 1 107 ? 2.833   19.695 65.124 1.00 9.53  ? 271 CYS A CA  1 
ATOM   778  C  C   . CYS A 1 107 ? 3.568   20.892 64.553 1.00 10.05 ? 271 CYS A C   1 
ATOM   779  O  O   . CYS A 1 107 ? 3.119   22.038 64.674 1.00 10.81 ? 271 CYS A O   1 
ATOM   780  C  CB  . CYS A 1 107 ? 1.671   19.361 64.183 1.00 8.34  ? 271 CYS A CB  1 
ATOM   781  S  SG  . CYS A 1 107 ? 0.771   17.867 64.576 1.00 10.12 ? 271 CYS A SG  1 
ATOM   782  N  N   . HIS A 1 108 ? 4.707   20.609 63.930 1.00 9.55  ? 272 HIS A N   1 
ATOM   783  C  CA  . HIS A 1 108 ? 5.479   21.631 63.244 1.00 9.69  ? 272 HIS A CA  1 
ATOM   784  C  C   . HIS A 1 108 ? 5.478   21.185 61.785 1.00 10.53 ? 272 HIS A C   1 
ATOM   785  O  O   . HIS A 1 108 ? 6.157   20.223 61.424 1.00 10.75 ? 272 HIS A O   1 
ATOM   786  C  CB  . HIS A 1 108 ? 6.919   21.721 63.746 1.00 8.69  ? 272 HIS A CB  1 
ATOM   787  C  CG  . HIS A 1 108 ? 7.798   22.556 62.864 1.00 11.13 ? 272 HIS A CG  1 
ATOM   788  N  ND1 . HIS A 1 108 ? 7.592   23.906 62.675 1.00 8.62  ? 272 HIS A ND1 1 
ATOM   789  C  CD2 . HIS A 1 108 ? 8.834   22.217 62.057 1.00 10.68 ? 272 HIS A CD2 1 
ATOM   790  C  CE1 . HIS A 1 108 ? 8.459   24.363 61.788 1.00 12.29 ? 272 HIS A CE1 1 
ATOM   791  N  NE2 . HIS A 1 108 ? 9.224   23.358 61.397 1.00 10.76 ? 272 HIS A NE2 1 
ATOM   792  N  N   . VAL A 1 109 ? 4.663   21.830 60.962 1.00 11.59 ? 273 VAL A N   1 
ATOM   793  C  CA  . VAL A 1 109 ? 4.610   21.471 59.550 1.00 13.45 ? 273 VAL A CA  1 
ATOM   794  C  C   . VAL A 1 109 ? 5.842   22.058 58.868 1.00 13.04 ? 273 VAL A C   1 
ATOM   795  O  O   . VAL A 1 109 ? 6.028   23.275 58.832 1.00 12.63 ? 273 VAL A O   1 
ATOM   796  C  CB  . VAL A 1 109 ? 3.315   21.979 58.880 1.00 13.25 ? 273 VAL A CB  1 
ATOM   797  C  CG1 . VAL A 1 109 ? 3.316   21.647 57.398 1.00 14.05 ? 273 VAL A CG1 1 
ATOM   798  C  CG2 . VAL A 1 109 ? 2.114   21.347 59.551 1.00 13.32 ? 273 VAL A CG2 1 
ATOM   799  N  N   . ILE A 1 110 ? 6.707   21.175 58.380 1.00 12.48 ? 274 ILE A N   1 
ATOM   800  C  CA  . ILE A 1 110 ? 7.937   21.590 57.716 1.00 13.42 ? 274 ILE A CA  1 
ATOM   801  C  C   . ILE A 1 110 ? 7.677   22.178 56.321 1.00 14.18 ? 274 ILE A C   1 
ATOM   802  O  O   . ILE A 1 110 ? 7.034   21.557 55.479 1.00 13.92 ? 274 ILE A O   1 
ATOM   803  C  CB  . ILE A 1 110 ? 8.924   20.414 57.610 1.00 11.96 ? 274 ILE A CB  1 
ATOM   804  C  CG1 . ILE A 1 110 ? 9.126   19.772 58.990 1.00 11.84 ? 274 ILE A CG1 1 
ATOM   805  C  CG2 . ILE A 1 110 ? 10.249  20.901 57.064 1.00 14.08 ? 274 ILE A CG2 1 
ATOM   806  C  CD1 . ILE A 1 110 ? 9.929   18.480 58.968 1.00 9.94  ? 274 ILE A CD1 1 
ATOM   807  N  N   . ASP A 1 111 ? 8.135   23.409 56.114 1.00 16.33 ? 275 ASP A N   1 
ATOM   808  C  CA  . ASP A 1 111 ? 7.984   24.095 54.833 1.00 16.93 ? 275 ASP A CA  1 
ATOM   809  C  C   . ASP A 1 111 ? 9.201   24.995 54.590 1.00 16.26 ? 275 ASP A C   1 
ATOM   810  O  O   . ASP A 1 111 ? 10.164  24.955 55.361 1.00 14.53 ? 275 ASP A O   1 
ATOM   811  C  CB  . ASP A 1 111 ? 6.667   24.895 54.776 1.00 18.77 ? 275 ASP A CB  1 
ATOM   812  C  CG  . ASP A 1 111 ? 6.617   26.067 55.775 1.00 21.64 ? 275 ASP A CG  1 
ATOM   813  O  OD1 . ASP A 1 111 ? 7.596   26.310 56.517 1.00 21.21 ? 275 ASP A OD1 1 
ATOM   814  O  OD2 . ASP A 1 111 ? 5.573   26.756 55.817 1.00 23.67 ? 275 ASP A OD2 1 
ATOM   815  N  N   . ALA A 1 112 ? 9.150   25.809 53.538 1.00 16.41 ? 276 ALA A N   1 
ATOM   816  C  CA  . ALA A 1 112 ? 10.260  26.698 53.202 1.00 18.30 ? 276 ALA A CA  1 
ATOM   817  C  C   . ALA A 1 112 ? 10.626  27.705 54.301 1.00 18.78 ? 276 ALA A C   1 
ATOM   818  O  O   . ALA A 1 112 ? 11.745  28.219 54.316 1.00 19.23 ? 276 ALA A O   1 
ATOM   819  C  CB  . ALA A 1 112 ? 9.992   27.414 51.881 1.00 16.92 ? 276 ALA A CB  1 
ATOM   820  N  N   . LYS A 1 113 ? 9.692   27.970 55.219 1.00 18.85 ? 277 LYS A N   1 
ATOM   821  C  CA  . LYS A 1 113 ? 9.922   28.906 56.328 1.00 19.55 ? 277 LYS A CA  1 
ATOM   822  C  C   . LYS A 1 113 ? 10.568  28.231 57.537 1.00 18.66 ? 277 LYS A C   1 
ATOM   823  O  O   . LYS A 1 113 ? 11.046  28.909 58.451 1.00 18.54 ? 277 LYS A O   1 
ATOM   824  C  CB  . LYS A 1 113 ? 8.605   29.539 56.781 1.00 21.88 ? 277 LYS A CB  1 
ATOM   825  C  CG  . LYS A 1 113 ? 8.023   30.561 55.832 1.00 26.29 ? 277 LYS A CG  1 
ATOM   826  C  CD  . LYS A 1 113 ? 8.835   31.841 55.862 1.00 30.42 ? 277 LYS A CD  1 
ATOM   827  C  CE  . LYS A 1 113 ? 8.267   32.874 54.906 1.00 31.94 ? 277 LYS A CE  1 
ATOM   828  N  NZ  . LYS A 1 113 ? 9.073   34.121 54.943 1.00 36.32 ? 277 LYS A NZ  1 
ATOM   829  N  N   . SER A 1 114 ? 10.565  26.899 57.537 1.00 17.13 ? 278 SER A N   1 
ATOM   830  C  CA  . SER A 1 114 ? 11.116  26.104 58.630 1.00 16.83 ? 278 SER A CA  1 
ATOM   831  C  C   . SER A 1 114 ? 12.604  25.834 58.538 1.00 17.82 ? 278 SER A C   1 
ATOM   832  O  O   . SER A 1 114 ? 13.131  25.565 57.458 1.00 18.51 ? 278 SER A O   1 
ATOM   833  C  CB  . SER A 1 114 ? 10.392  24.757 58.719 1.00 16.64 ? 278 SER A CB  1 
ATOM   834  O  OG  . SER A 1 114 ? 11.057  23.875 59.614 1.00 14.93 ? 278 SER A OG  1 
ATOM   835  N  N   . PRO A 1 115 ? 13.297  25.872 59.684 1.00 17.46 ? 279 PRO A N   1 
ATOM   836  C  CA  . PRO A 1 115 ? 14.739  25.616 59.738 1.00 18.76 ? 279 PRO A CA  1 
ATOM   837  C  C   . PRO A 1 115 ? 15.021  24.169 59.304 1.00 18.73 ? 279 PRO A C   1 
ATOM   838  O  O   . PRO A 1 115 ? 16.140  23.833 58.910 1.00 19.70 ? 279 PRO A O   1 
ATOM   839  C  CB  . PRO A 1 115 ? 15.065  25.821 61.219 1.00 19.88 ? 279 PRO A CB  1 
ATOM   840  C  CG  . PRO A 1 115 ? 14.032  26.816 61.669 1.00 19.84 ? 279 PRO A CG  1 
ATOM   841  C  CD  . PRO A 1 115 ? 12.789  26.310 60.997 1.00 18.94 ? 279 PRO A CD  1 
ATOM   842  N  N   . PHE A 1 116 ? 13.993  23.324 59.376 1.00 17.58 ? 280 PHE A N   1 
ATOM   843  C  CA  . PHE A 1 116 ? 14.094  21.911 58.993 1.00 16.54 ? 280 PHE A CA  1 
ATOM   844  C  C   . PHE A 1 116 ? 13.690  21.628 57.540 1.00 15.04 ? 280 PHE A C   1 
ATOM   845  O  O   . PHE A 1 116 ? 13.563  20.473 57.145 1.00 13.25 ? 280 PHE A O   1 
ATOM   846  C  CB  . PHE A 1 116 ? 13.236  21.050 59.924 1.00 16.28 ? 280 PHE A CB  1 
ATOM   847  C  CG  . PHE A 1 116 ? 13.885  20.741 61.237 1.00 17.88 ? 280 PHE A CG  1 
ATOM   848  C  CD1 . PHE A 1 116 ? 15.244  20.947 61.426 1.00 18.18 ? 280 PHE A CD1 1 
ATOM   849  C  CD2 . PHE A 1 116 ? 13.143  20.213 62.282 1.00 19.60 ? 280 PHE A CD2 1 
ATOM   850  C  CE1 . PHE A 1 116 ? 15.849  20.630 62.635 1.00 20.27 ? 280 PHE A CE1 1 
ATOM   851  C  CE2 . PHE A 1 116 ? 13.748  19.893 63.500 1.00 20.25 ? 280 PHE A CE2 1 
ATOM   852  C  CZ  . PHE A 1 116 ? 15.100  20.103 63.672 1.00 17.50 ? 280 PHE A CZ  1 
ATOM   853  N  N   . TYR A 1 117 ? 13.490  22.691 56.763 1.00 15.29 ? 281 TYR A N   1 
ATOM   854  C  CA  . TYR A 1 117 ? 13.089  22.615 55.355 1.00 16.48 ? 281 TYR A CA  1 
ATOM   855  C  C   . TYR A 1 117 ? 13.906  21.598 54.561 1.00 16.53 ? 281 TYR A C   1 
ATOM   856  O  O   . TYR A 1 117 ? 13.349  20.824 53.781 1.00 16.44 ? 281 TYR A O   1 
ATOM   857  C  CB  . TYR A 1 117 ? 13.205  24.012 54.723 1.00 16.72 ? 281 TYR A CB  1 
ATOM   858  C  CG  . TYR A 1 117 ? 12.816  24.137 53.269 1.00 17.39 ? 281 TYR A CG  1 
ATOM   859  C  CD1 . TYR A 1 117 ? 11.644  23.563 52.774 1.00 19.15 ? 281 TYR A CD1 1 
ATOM   860  C  CD2 . TYR A 1 117 ? 13.601  24.884 52.397 1.00 19.90 ? 281 TYR A CD2 1 
ATOM   861  C  CE1 . TYR A 1 117 ? 11.264  23.738 51.443 1.00 21.09 ? 281 TYR A CE1 1 
ATOM   862  C  CE2 . TYR A 1 117 ? 13.233  25.067 51.070 1.00 21.20 ? 281 TYR A CE2 1 
ATOM   863  C  CZ  . TYR A 1 117 ? 12.069  24.496 50.598 1.00 22.16 ? 281 TYR A CZ  1 
ATOM   864  O  OH  . TYR A 1 117 ? 11.722  24.695 49.280 1.00 24.87 ? 281 TYR A OH  1 
ATOM   865  N  N   . ASP A 1 118 ? 15.214  21.575 54.791 1.00 16.79 ? 282 ASP A N   1 
ATOM   866  C  CA  . ASP A 1 118 ? 16.083  20.641 54.084 1.00 17.72 ? 282 ASP A CA  1 
ATOM   867  C  C   . ASP A 1 118 ? 16.636  19.518 54.973 1.00 17.14 ? 282 ASP A C   1 
ATOM   868  O  O   . ASP A 1 118 ? 17.743  19.025 54.751 1.00 17.99 ? 282 ASP A O   1 
ATOM   869  C  CB  . ASP A 1 118 ? 17.219  21.402 53.388 1.00 19.02 ? 282 ASP A CB  1 
ATOM   870  C  CG  . ASP A 1 118 ? 17.869  20.598 52.275 1.00 20.30 ? 282 ASP A CG  1 
ATOM   871  O  OD1 . ASP A 1 118 ? 17.155  19.849 51.571 1.00 20.08 ? 282 ASP A OD1 1 
ATOM   872  O  OD2 . ASP A 1 118 ? 19.095  20.721 52.102 1.00 22.01 ? 282 ASP A OD2 1 
ATOM   873  N  N   . LEU A 1 119 ? 15.868  19.105 55.978 1.00 16.61 ? 283 LEU A N   1 
ATOM   874  C  CA  . LEU A 1 119 ? 16.318  18.020 56.848 1.00 16.90 ? 283 LEU A CA  1 
ATOM   875  C  C   . LEU A 1 119 ? 15.784  16.707 56.301 1.00 16.37 ? 283 LEU A C   1 
ATOM   876  O  O   . LEU A 1 119 ? 14.579  16.524 56.201 1.00 16.25 ? 283 LEU A O   1 
ATOM   877  C  CB  . LEU A 1 119 ? 15.828  18.198 58.292 1.00 17.07 ? 283 LEU A CB  1 
ATOM   878  C  CG  . LEU A 1 119 ? 16.249  17.079 59.259 1.00 16.73 ? 283 LEU A CG  1 
ATOM   879  C  CD1 . LEU A 1 119 ? 17.729  17.179 59.591 1.00 16.31 ? 283 LEU A CD1 1 
ATOM   880  C  CD2 . LEU A 1 119 ? 15.423  17.145 60.535 1.00 18.97 ? 283 LEU A CD2 1 
ATOM   881  N  N   . SER A 1 120 ? 16.682  15.818 55.893 1.00 17.71 ? 284 SER A N   1 
ATOM   882  C  CA  . SER A 1 120 ? 16.266  14.525 55.369 1.00 17.96 ? 284 SER A CA  1 
ATOM   883  C  C   . SER A 1 120 ? 16.699  13.424 56.339 1.00 18.62 ? 284 SER A C   1 
ATOM   884  O  O   . SER A 1 120 ? 17.453  13.680 57.284 1.00 18.85 ? 284 SER A O   1 
ATOM   885  C  CB  . SER A 1 120 ? 16.868  14.290 53.975 1.00 16.34 ? 284 SER A CB  1 
ATOM   886  O  OG  . SER A 1 120 ? 18.280  14.204 54.027 1.00 15.05 ? 284 SER A OG  1 
ATOM   887  N  N   . GLN A 1 121 ? 16.210  12.206 56.106 1.00 19.96 ? 285 GLN A N   1 
ATOM   888  C  CA  . GLN A 1 121 ? 16.550  11.055 56.941 1.00 19.59 ? 285 GLN A CA  1 
ATOM   889  C  C   . GLN A 1 121 ? 18.060  10.797 56.991 1.00 20.67 ? 285 GLN A C   1 
ATOM   890  O  O   . GLN A 1 121 ? 18.615  10.527 58.060 1.00 19.91 ? 285 GLN A O   1 
ATOM   891  C  CB  . GLN A 1 121 ? 15.823  9.810  56.436 1.00 17.69 ? 285 GLN A CB  1 
ATOM   892  C  CG  . GLN A 1 121 ? 15.964  8.592  57.328 1.00 17.40 ? 285 GLN A CG  1 
ATOM   893  C  CD  . GLN A 1 121 ? 15.005  7.482  56.935 1.00 18.88 ? 285 GLN A CD  1 
ATOM   894  O  OE1 . GLN A 1 121 ? 14.301  7.578  55.934 1.00 19.57 ? 285 GLN A OE1 1 
ATOM   895  N  NE2 . GLN A 1 121 ? 14.972  6.425  57.729 1.00 21.55 ? 285 GLN A NE2 1 
ATOM   896  N  N   . ARG A 1 122 ? 18.720  10.905 55.838 1.00 22.00 ? 286 ARG A N   1 
ATOM   897  C  CA  . ARG A 1 122 ? 20.161  10.684 55.754 1.00 24.38 ? 286 ARG A CA  1 
ATOM   898  C  C   . ARG A 1 122 ? 20.990  11.790 56.406 1.00 24.49 ? 286 ARG A C   1 
ATOM   899  O  O   . ARG A 1 122 ? 21.985  11.501 57.062 1.00 25.69 ? 286 ARG A O   1 
ATOM   900  C  CB  . ARG A 1 122 ? 20.588  10.498 54.298 1.00 27.33 ? 286 ARG A CB  1 
ATOM   901  C  CG  . ARG A 1 122 ? 20.251  11.679 53.419 1.00 31.26 ? 286 ARG A CG  1 
ATOM   902  C  CD  . ARG A 1 122 ? 20.669  11.441 51.995 1.00 36.36 ? 286 ARG A CD  1 
ATOM   903  N  NE  . ARG A 1 122 ? 20.304  12.574 51.156 1.00 39.98 ? 286 ARG A NE  1 
ATOM   904  C  CZ  . ARG A 1 122 ? 21.056  13.047 50.171 1.00 43.36 ? 286 ARG A CZ  1 
ATOM   905  N  NH1 . ARG A 1 122 ? 22.229  12.480 49.897 1.00 45.09 ? 286 ARG A NH1 1 
ATOM   906  N  NH2 . ARG A 1 122 ? 20.631  14.083 49.455 1.00 45.56 ? 286 ARG A NH2 1 
ATOM   907  N  N   . SER A 1 123 ? 20.584  13.048 56.231 1.00 26.40 ? 287 SER A N   1 
ATOM   908  C  CA  . SER A 1 123 ? 21.310  14.179 56.820 1.00 27.56 ? 287 SER A CA  1 
ATOM   909  C  C   . SER A 1 123 ? 21.242  14.134 58.345 1.00 29.36 ? 287 SER A C   1 
ATOM   910  O  O   . SER A 1 123 ? 22.079  14.717 59.026 1.00 27.99 ? 287 SER A O   1 
ATOM   911  C  CB  . SER A 1 123 ? 20.762  15.515 56.306 1.00 28.62 ? 287 SER A CB  1 
ATOM   912  O  OG  . SER A 1 123 ? 19.492  15.816 56.855 1.00 29.31 ? 287 SER A OG  1 
HETATM 913  N  N   . MSE A 1 124 ? 20.237  13.427 58.862 1.00 31.91 ? 288 MSE A N   1 
HETATM 914  C  CA  . MSE A 1 124 ? 20.025  13.247 60.296 1.00 33.52 ? 288 MSE A CA  1 
HETATM 915  C  C   . MSE A 1 124 ? 21.244  12.616 60.950 1.00 33.83 ? 288 MSE A C   1 
HETATM 916  O  O   . MSE A 1 124 ? 21.597  12.965 62.071 1.00 34.49 ? 288 MSE A O   1 
HETATM 917  C  CB  . MSE A 1 124 ? 18.822  12.329 60.537 1.00 36.15 ? 288 MSE A CB  1 
HETATM 918  C  CG  . MSE A 1 124 ? 17.470  12.983 60.376 1.00 38.87 ? 288 MSE A CG  1 
HETATM 919  SE SE  . MSE A 1 124 ? 16.847  13.712 62.045 1.00 44.98 ? 288 MSE A SE  1 
HETATM 920  C  CE  . MSE A 1 124 ? 15.898  12.170 62.677 1.00 42.59 ? 288 MSE A CE  1 
ATOM   921  N  N   . GLN A 1 125 ? 21.869  11.674 60.248 1.00 34.25 ? 289 GLN A N   1 
ATOM   922  C  CA  . GLN A 1 125 ? 23.050  10.969 60.744 1.00 35.98 ? 289 GLN A CA  1 
ATOM   923  C  C   . GLN A 1 125 ? 24.179  11.887 61.205 1.00 35.22 ? 289 GLN A C   1 
ATOM   924  O  O   . GLN A 1 125 ? 24.798  11.645 62.240 1.00 35.41 ? 289 GLN A O   1 
ATOM   925  C  CB  . GLN A 1 125 ? 23.610  10.049 59.664 1.00 37.40 ? 289 GLN A CB  1 
ATOM   926  C  CG  . GLN A 1 125 ? 22.705  8.930  59.221 1.00 40.93 ? 289 GLN A CG  1 
ATOM   927  C  CD  . GLN A 1 125 ? 23.322  8.138  58.082 1.00 43.87 ? 289 GLN A CD  1 
ATOM   928  O  OE1 . GLN A 1 125 ? 24.518  7.822  58.103 1.00 44.73 ? 289 GLN A OE1 1 
ATOM   929  N  NE2 . GLN A 1 125 ? 22.517  7.833  57.069 1.00 46.04 ? 289 GLN A NE2 1 
ATOM   930  N  N   . THR A 1 126 ? 24.451  12.928 60.421 1.00 35.10 ? 290 THR A N   1 
ATOM   931  C  CA  . THR A 1 126 ? 25.530  13.867 60.723 1.00 34.16 ? 290 THR A CA  1 
ATOM   932  C  C   . THR A 1 126 ? 25.106  15.169 61.386 1.00 33.46 ? 290 THR A C   1 
ATOM   933  O  O   . THR A 1 126 ? 25.925  15.842 62.013 1.00 31.84 ? 290 THR A O   1 
ATOM   934  C  CB  . THR A 1 126 ? 26.309  14.226 59.456 1.00 34.12 ? 290 THR A CB  1 
ATOM   935  O  OG1 . THR A 1 126 ? 25.406  14.765 58.480 1.00 33.62 ? 290 THR A OG1 1 
ATOM   936  C  CG2 . THR A 1 126 ? 27.010  12.994 58.900 1.00 34.81 ? 290 THR A CG2 1 
ATOM   937  N  N   . GLU A 1 127 ? 23.837  15.531 61.215 1.00 33.19 ? 291 GLU A N   1 
ATOM   938  C  CA  . GLU A 1 127 ? 23.291  16.761 61.783 1.00 31.63 ? 291 GLU A CA  1 
ATOM   939  C  C   . GLU A 1 127 ? 23.402  16.761 63.308 1.00 28.88 ? 291 GLU A C   1 
ATOM   940  O  O   . GLU A 1 127 ? 23.421  15.710 63.951 1.00 28.72 ? 291 GLU A O   1 
ATOM   941  C  CB  . GLU A 1 127 ? 21.831  16.948 61.337 1.00 33.61 ? 291 GLU A CB  1 
ATOM   942  C  CG  . GLU A 1 127 ? 21.274  18.361 61.509 1.00 38.84 ? 291 GLU A CG  1 
ATOM   943  C  CD  . GLU A 1 127 ? 21.741  19.356 60.444 1.00 41.18 ? 291 GLU A CD  1 
ATOM   944  O  OE1 . GLU A 1 127 ? 21.033  20.369 60.242 1.00 43.12 ? 291 GLU A OE1 1 
ATOM   945  O  OE2 . GLU A 1 127 ? 22.802  19.139 59.814 1.00 43.24 ? 291 GLU A OE2 1 
ATOM   946  N  N   . GLN A 1 128 ? 23.509  17.951 63.875 1.00 26.58 ? 292 GLN A N   1 
ATOM   947  C  CA  . GLN A 1 128 ? 23.644  18.105 65.311 1.00 25.11 ? 292 GLN A CA  1 
ATOM   948  C  C   . GLN A 1 128 ? 22.817  19.319 65.720 1.00 22.58 ? 292 GLN A C   1 
ATOM   949  O  O   . GLN A 1 128 ? 23.083  20.441 65.281 1.00 22.54 ? 292 GLN A O   1 
ATOM   950  C  CB  . GLN A 1 128 ? 25.116  18.308 65.644 1.00 27.75 ? 292 GLN A CB  1 
ATOM   951  C  CG  . GLN A 1 128 ? 25.505  17.956 67.048 1.00 31.96 ? 292 GLN A CG  1 
ATOM   952  C  CD  . GLN A 1 128 ? 26.991  17.720 67.159 1.00 35.62 ? 292 GLN A CD  1 
ATOM   953  O  OE1 . GLN A 1 128 ? 27.765  18.658 67.362 1.00 38.08 ? 292 GLN A OE1 1 
ATOM   954  N  NE2 . GLN A 1 128 ? 27.408  16.466 66.989 1.00 35.94 ? 292 GLN A NE2 1 
ATOM   955  N  N   . PHE A 1 129 ? 21.810  19.090 66.554 1.00 18.89 ? 293 PHE A N   1 
ATOM   956  C  CA  . PHE A 1 129 ? 20.926  20.167 66.980 1.00 16.49 ? 293 PHE A CA  1 
ATOM   957  C  C   . PHE A 1 129 ? 20.172  19.812 68.249 1.00 15.63 ? 293 PHE A C   1 
ATOM   958  O  O   . PHE A 1 129 ? 20.270  18.694 68.761 1.00 15.49 ? 293 PHE A O   1 
ATOM   959  C  CB  . PHE A 1 129 ? 19.917  20.489 65.865 1.00 16.68 ? 293 PHE A CB  1 
ATOM   960  C  CG  . PHE A 1 129 ? 19.030  19.325 65.488 1.00 17.50 ? 293 PHE A CG  1 
ATOM   961  C  CD1 . PHE A 1 129 ? 17.963  18.947 66.296 1.00 17.02 ? 293 PHE A CD1 1 
ATOM   962  C  CD2 . PHE A 1 129 ? 19.280  18.589 64.336 1.00 18.86 ? 293 PHE A CD2 1 
ATOM   963  C  CE1 . PHE A 1 129 ? 17.167  17.857 65.966 1.00 16.98 ? 293 PHE A CE1 1 
ATOM   964  C  CE2 . PHE A 1 129 ? 18.484  17.494 63.999 1.00 18.14 ? 293 PHE A CE2 1 
ATOM   965  C  CZ  . PHE A 1 129 ? 17.429  17.129 64.817 1.00 16.09 ? 293 PHE A CZ  1 
ATOM   966  N  N   . GLU A 1 130 ? 19.373  20.757 68.724 1.00 13.90 ? 294 GLU A N   1 
ATOM   967  C  CA  . GLU A 1 130 ? 18.590  20.536 69.918 1.00 12.69 ? 294 GLU A CA  1 
ATOM   968  C  C   . GLU A 1 130 ? 17.290  21.312 69.805 1.00 11.75 ? 294 GLU A C   1 
ATOM   969  O  O   . GLU A 1 130 ? 17.300  22.530 69.697 1.00 11.87 ? 294 GLU A O   1 
ATOM   970  C  CB  . GLU A 1 130 ? 19.376  21.003 71.128 1.00 16.17 ? 294 GLU A CB  1 
ATOM   971  C  CG  . GLU A 1 130 ? 18.913  20.398 72.438 1.00 17.16 ? 294 GLU A CG  1 
ATOM   972  C  CD  . GLU A 1 130 ? 19.858  20.708 73.586 1.00 19.28 ? 294 GLU A CD  1 
ATOM   973  O  OE1 . GLU A 1 130 ? 21.071  20.913 73.331 1.00 17.72 ? 294 GLU A OE1 1 
ATOM   974  O  OE2 . GLU A 1 130 ? 19.385  20.752 74.742 1.00 18.22 ? 294 GLU A OE2 1 
ATOM   975  N  N   . VAL A 1 131 ? 16.182  20.586 69.733 1.00 11.04 ? 295 VAL A N   1 
ATOM   976  C  CA  . VAL A 1 131 ? 14.862  21.192 69.645 1.00 10.57 ? 295 VAL A CA  1 
ATOM   977  C  C   . VAL A 1 131 ? 14.382  21.426 71.072 1.00 11.05 ? 295 VAL A C   1 
ATOM   978  O  O   . VAL A 1 131 ? 14.085  20.475 71.794 1.00 12.10 ? 295 VAL A O   1 
ATOM   979  C  CB  . VAL A 1 131 ? 13.859  20.251 68.921 1.00 10.70 ? 295 VAL A CB  1 
ATOM   980  C  CG1 . VAL A 1 131 ? 12.477  20.880 68.878 1.00 12.27 ? 295 VAL A CG1 1 
ATOM   981  C  CG2 . VAL A 1 131 ? 14.346  19.935 67.515 1.00 10.67 ? 295 VAL A CG2 1 
ATOM   982  N  N   . VAL A 1 132 ? 14.355  22.686 71.493 1.00 9.96  ? 296 VAL A N   1 
ATOM   983  C  CA  . VAL A 1 132 ? 13.916  23.029 72.839 1.00 8.84  ? 296 VAL A CA  1 
ATOM   984  C  C   . VAL A 1 132 ? 12.445  23.434 72.808 1.00 8.41  ? 296 VAL A C   1 
ATOM   985  O  O   . VAL A 1 132 ? 12.021  24.211 71.961 1.00 7.35  ? 296 VAL A O   1 
ATOM   986  C  CB  . VAL A 1 132 ? 14.775  24.177 73.443 1.00 8.13  ? 296 VAL A CB  1 
ATOM   987  C  CG1 . VAL A 1 132 ? 14.316  24.493 74.859 1.00 9.84  ? 296 VAL A CG1 1 
ATOM   988  C  CG2 . VAL A 1 132 ? 16.239  23.787 73.469 1.00 8.15  ? 296 VAL A CG2 1 
ATOM   989  N  N   . VAL A 1 133 ? 11.668  22.871 73.722 1.00 8.64  ? 297 VAL A N   1 
ATOM   990  C  CA  . VAL A 1 133 ? 10.242  23.149 73.824 1.00 9.30  ? 297 VAL A CA  1 
ATOM   991  C  C   . VAL A 1 133 ? 9.970   23.890 75.133 1.00 9.85  ? 297 VAL A C   1 
ATOM   992  O  O   . VAL A 1 133 ? 10.485  23.526 76.189 1.00 9.29  ? 297 VAL A O   1 
ATOM   993  C  CB  . VAL A 1 133 ? 9.417   21.840 73.778 1.00 10.18 ? 297 VAL A CB  1 
ATOM   994  C  CG1 . VAL A 1 133 ? 7.936   22.143 73.813 1.00 10.07 ? 297 VAL A CG1 1 
ATOM   995  C  CG2 . VAL A 1 133 ? 9.775   21.038 72.534 1.00 10.03 ? 297 VAL A CG2 1 
ATOM   996  N  N   . ILE A 1 134 ? 9.201   24.966 75.043 1.00 9.05  ? 298 ILE A N   1 
ATOM   997  C  CA  . ILE A 1 134 ? 8.865   25.766 76.207 1.00 9.74  ? 298 ILE A CA  1 
ATOM   998  C  C   . ILE A 1 134 ? 7.353   25.906 76.325 1.00 10.30 ? 298 ILE A C   1 
ATOM   999  O  O   . ILE A 1 134 ? 6.694   26.404 75.421 1.00 9.61  ? 298 ILE A O   1 
ATOM   1000 C  CB  . ILE A 1 134 ? 9.518   27.169 76.130 1.00 11.65 ? 298 ILE A CB  1 
ATOM   1001 C  CG1 . ILE A 1 134 ? 11.047  27.039 76.087 1.00 10.56 ? 298 ILE A CG1 1 
ATOM   1002 C  CG2 . ILE A 1 134 ? 9.077   28.015 77.316 1.00 11.29 ? 298 ILE A CG2 1 
ATOM   1003 C  CD1 . ILE A 1 134 ? 11.706  27.753 74.924 1.00 11.36 ? 298 ILE A CD1 1 
ATOM   1004 N  N   . LEU A 1 135 ? 6.808   25.435 77.440 1.00 10.86 ? 299 LEU A N   1 
ATOM   1005 C  CA  . LEU A 1 135 ? 5.377   25.513 77.687 1.00 11.30 ? 299 LEU A CA  1 
ATOM   1006 C  C   . LEU A 1 135 ? 5.146   26.323 78.948 1.00 12.02 ? 299 LEU A C   1 
ATOM   1007 O  O   . LEU A 1 135 ? 5.674   26.001 80.005 1.00 11.76 ? 299 LEU A O   1 
ATOM   1008 C  CB  . LEU A 1 135 ? 4.777   24.104 77.838 1.00 12.63 ? 299 LEU A CB  1 
ATOM   1009 C  CG  . LEU A 1 135 ? 3.265   23.965 78.072 1.00 13.94 ? 299 LEU A CG  1 
ATOM   1010 C  CD1 . LEU A 1 135 ? 2.765   22.633 77.549 1.00 16.79 ? 299 LEU A CD1 1 
ATOM   1011 C  CD2 . LEU A 1 135 ? 2.946   24.104 79.545 1.00 15.59 ? 299 LEU A CD2 1 
ATOM   1012 N  N   . GLU A 1 136 ? 4.391   27.404 78.824 1.00 13.96 ? 300 GLU A N   1 
ATOM   1013 C  CA  . GLU A 1 136 ? 4.070   28.233 79.973 1.00 17.95 ? 300 GLU A CA  1 
ATOM   1014 C  C   . GLU A 1 136 ? 2.578   28.070 80.181 1.00 20.62 ? 300 GLU A C   1 
ATOM   1015 O  O   . GLU A 1 136 ? 1.780   28.554 79.375 1.00 20.65 ? 300 GLU A O   1 
ATOM   1016 C  CB  . GLU A 1 136 ? 4.403   29.679 79.694 1.00 18.67 ? 300 GLU A CB  1 
ATOM   1017 C  CG  . GLU A 1 136 ? 5.824   29.893 79.313 1.00 21.66 ? 300 GLU A CG  1 
ATOM   1018 C  CD  . GLU A 1 136 ? 6.080   31.331 78.977 1.00 23.42 ? 300 GLU A CD  1 
ATOM   1019 O  OE1 . GLU A 1 136 ? 5.347   31.868 78.127 1.00 26.36 ? 300 GLU A OE1 1 
ATOM   1020 O  OE2 . GLU A 1 136 ? 6.983   31.934 79.581 1.00 26.64 ? 300 GLU A OE2 1 
ATOM   1021 N  N   . GLY A 1 137 ? 2.218   27.336 81.232 1.00 22.35 ? 301 GLY A N   1 
ATOM   1022 C  CA  . GLY A 1 137 ? 0.822   27.075 81.515 1.00 24.66 ? 301 GLY A CA  1 
ATOM   1023 C  C   . GLY A 1 137 ? 0.246   27.612 82.806 1.00 27.16 ? 301 GLY A C   1 
ATOM   1024 O  O   . GLY A 1 137 ? 0.965   27.973 83.739 1.00 23.34 ? 301 GLY A O   1 
ATOM   1025 N  N   . ILE A 1 138 ? -1.085  27.604 82.847 1.00 29.52 ? 302 ILE A N   1 
ATOM   1026 C  CA  . ILE A 1 138 ? -1.868  28.075 83.980 1.00 34.02 ? 302 ILE A CA  1 
ATOM   1027 C  C   . ILE A 1 138 ? -2.249  26.918 84.899 1.00 35.50 ? 302 ILE A C   1 
ATOM   1028 O  O   . ILE A 1 138 ? -3.048  26.067 84.514 1.00 36.77 ? 302 ILE A O   1 
ATOM   1029 C  CB  . ILE A 1 138 ? -3.181  28.757 83.498 1.00 33.24 ? 302 ILE A CB  1 
ATOM   1030 C  CG1 . ILE A 1 138 ? -2.863  30.001 82.665 1.00 33.29 ? 302 ILE A CG1 1 
ATOM   1031 C  CG2 . ILE A 1 138 ? -4.048  29.138 84.691 1.00 36.30 ? 302 ILE A CG2 1 
ATOM   1032 C  CD1 . ILE A 1 138 ? -4.088  30.728 82.162 1.00 32.22 ? 302 ILE A CD1 1 
ATOM   1033 N  N   . VAL A 1 139 ? -1.678  26.890 86.104 1.00 38.08 ? 303 VAL A N   1 
ATOM   1034 C  CA  . VAL A 1 139 ? -1.989  25.845 87.084 1.00 39.03 ? 303 VAL A CA  1 
ATOM   1035 C  C   . VAL A 1 139 ? -3.448  26.041 87.509 1.00 41.40 ? 303 VAL A C   1 
ATOM   1036 O  O   . VAL A 1 139 ? -3.819  27.108 88.005 1.00 42.03 ? 303 VAL A O   1 
ATOM   1037 C  CB  . VAL A 1 139 ? -1.062  25.937 88.325 1.00 38.38 ? 303 VAL A CB  1 
ATOM   1038 C  CG1 . VAL A 1 139 ? -1.480  24.923 89.393 1.00 36.69 ? 303 VAL A CG1 1 
ATOM   1039 C  CG2 . VAL A 1 139 ? 0.385   25.709 87.914 1.00 37.06 ? 303 VAL A CG2 1 
ATOM   1040 N  N   . GLU A 1 140 ? -4.273  25.022 87.282 1.00 43.08 ? 304 GLU A N   1 
ATOM   1041 C  CA  . GLU A 1 140 ? -5.696  25.078 87.612 1.00 45.12 ? 304 GLU A CA  1 
ATOM   1042 C  C   . GLU A 1 140 ? -6.021  25.405 89.080 1.00 46.44 ? 304 GLU A C   1 
ATOM   1043 O  O   . GLU A 1 140 ? -6.910  26.218 89.357 1.00 46.74 ? 304 GLU A O   1 
ATOM   1044 C  CB  . GLU A 1 140 ? -6.370  23.759 87.224 1.00 46.20 ? 304 GLU A CB  1 
ATOM   1045 C  CG  . GLU A 1 140 ? -5.796  22.538 87.950 1.00 48.70 ? 304 GLU A CG  1 
ATOM   1046 C  CD  . GLU A 1 140 ? -6.649  21.286 87.807 1.00 48.76 ? 304 GLU A CD  1 
ATOM   1047 O  OE1 . GLU A 1 140 ? -7.345  21.143 86.780 1.00 50.47 ? 304 GLU A OE1 1 
ATOM   1048 O  OE2 . GLU A 1 140 ? -6.618  20.440 88.726 1.00 48.98 ? 304 GLU A OE2 1 
ATOM   1049 N  N   . THR A 1 141 ? -5.281  24.796 90.006 1.00 47.11 ? 305 THR A N   1 
ATOM   1050 C  CA  . THR A 1 141 ? -5.500  24.974 91.445 1.00 47.32 ? 305 THR A CA  1 
ATOM   1051 C  C   . THR A 1 141 ? -5.286  26.367 92.046 1.00 47.89 ? 305 THR A C   1 
ATOM   1052 O  O   . THR A 1 141 ? -6.081  26.804 92.880 1.00 48.40 ? 305 THR A O   1 
ATOM   1053 C  CB  . THR A 1 141 ? -4.690  23.941 92.268 1.00 47.31 ? 305 THR A CB  1 
ATOM   1054 O  OG1 . THR A 1 141 ? -3.313  23.970 91.864 1.00 47.66 ? 305 THR A OG1 1 
ATOM   1055 C  CG2 . THR A 1 141 ? -5.252  22.538 92.071 1.00 45.84 ? 305 THR A CG2 1 
ATOM   1056 N  N   . THR A 1 142 ? -4.215  27.053 91.653 1.00 48.25 ? 306 THR A N   1 
ATOM   1057 C  CA  . THR A 1 142 ? -3.937  28.385 92.192 1.00 48.67 ? 306 THR A CA  1 
ATOM   1058 C  C   . THR A 1 142 ? -4.366  29.506 91.248 1.00 48.68 ? 306 THR A C   1 
ATOM   1059 O  O   . THR A 1 142 ? -4.888  30.535 91.689 1.00 48.87 ? 306 THR A O   1 
ATOM   1060 C  CB  . THR A 1 142 ? -2.434  28.574 92.525 1.00 49.10 ? 306 THR A CB  1 
ATOM   1061 O  OG1 . THR A 1 142 ? -1.673  28.642 91.311 1.00 49.84 ? 306 THR A OG1 1 
ATOM   1062 C  CG2 . THR A 1 142 ? -1.918  27.417 93.376 1.00 49.46 ? 306 THR A CG2 1 
ATOM   1063 N  N   . GLY A 1 143 ? -4.146  29.297 89.952 1.00 48.14 ? 307 GLY A N   1 
ATOM   1064 C  CA  . GLY A 1 143 ? -4.495  30.299 88.956 1.00 47.50 ? 307 GLY A CA  1 
ATOM   1065 C  C   . GLY A 1 143 ? -3.264  31.047 88.472 1.00 46.82 ? 307 GLY A C   1 
ATOM   1066 O  O   . GLY A 1 143 ? -3.338  31.847 87.538 1.00 46.07 ? 307 GLY A O   1 
HETATM 1067 N  N   . MSE A 1 144 ? -2.128  30.769 89.111 1.00 46.17 ? 308 MSE A N   1 
HETATM 1068 C  CA  . MSE A 1 144 ? -0.857  31.402 88.780 1.00 46.06 ? 308 MSE A CA  1 
HETATM 1069 C  C   . MSE A 1 144 ? -0.171  30.689 87.611 1.00 45.09 ? 308 MSE A C   1 
HETATM 1070 O  O   . MSE A 1 144 ? -0.549  29.574 87.244 1.00 44.46 ? 308 MSE A O   1 
HETATM 1071 C  CB  . MSE A 1 144 ? 0.061   31.418 90.010 1.00 48.22 ? 308 MSE A CB  1 
HETATM 1072 C  CG  . MSE A 1 144 ? -0.535  32.081 91.265 1.00 50.74 ? 308 MSE A CG  1 
HETATM 1073 SE SE  . MSE A 1 144 ? -1.064  33.952 91.058 1.00 56.59 ? 308 MSE A SE  1 
HETATM 1074 C  CE  . MSE A 1 144 ? -2.787  33.896 91.948 1.00 53.35 ? 308 MSE A CE  1 
ATOM   1075 N  N   . THR A 1 145 ? 0.847   31.333 87.040 1.00 43.35 ? 309 THR A N   1 
ATOM   1076 C  CA  . THR A 1 145 ? 1.572   30.770 85.902 1.00 40.69 ? 309 THR A CA  1 
ATOM   1077 C  C   . THR A 1 145 ? 2.882   30.047 86.240 1.00 38.60 ? 309 THR A C   1 
ATOM   1078 O  O   . THR A 1 145 ? 3.553   30.356 87.231 1.00 38.88 ? 309 THR A O   1 
ATOM   1079 C  CB  . THR A 1 145 ? 1.877   31.850 84.844 1.00 41.34 ? 309 THR A CB  1 
ATOM   1080 O  OG1 . THR A 1 145 ? 2.163   31.212 83.591 1.00 41.53 ? 309 THR A OG1 1 
ATOM   1081 C  CG2 . THR A 1 145 ? 3.083   32.716 85.277 1.00 39.99 ? 309 THR A CG2 1 
ATOM   1082 N  N   . CYS A 1 146 ? 3.245   29.099 85.382 1.00 34.45 ? 310 CYS A N   1 
ATOM   1083 C  CA  . CYS A 1 146 ? 4.471   28.327 85.543 1.00 30.32 ? 310 CYS A CA  1 
ATOM   1084 C  C   . CYS A 1 146 ? 5.039   28.027 84.158 1.00 25.41 ? 310 CYS A C   1 
ATOM   1085 O  O   . CYS A 1 146 ? 4.498   28.472 83.149 1.00 22.35 ? 310 CYS A O   1 
ATOM   1086 C  CB  . CYS A 1 146 ? 4.191   27.016 86.295 1.00 32.15 ? 310 CYS A CB  1 
ATOM   1087 S  SG  . CYS A 1 146 ? 3.211   25.788 85.376 1.00 38.50 ? 310 CYS A SG  1 
ATOM   1088 N  N   . GLN A 1 147 ? 6.152   27.305 84.121 1.00 21.23 ? 311 GLN A N   1 
ATOM   1089 C  CA  . GLN A 1 147 ? 6.771   26.931 82.861 1.00 17.07 ? 311 GLN A CA  1 
ATOM   1090 C  C   . GLN A 1 147 ? 7.464   25.582 82.954 1.00 16.26 ? 311 GLN A C   1 
ATOM   1091 O  O   . GLN A 1 147 ? 8.023   25.219 83.986 1.00 16.51 ? 311 GLN A O   1 
ATOM   1092 C  CB  . GLN A 1 147 ? 7.769   27.991 82.406 1.00 17.13 ? 311 GLN A CB  1 
ATOM   1093 C  CG  A GLN A 1 147 ? 8.516   27.623 81.134 0.50 15.48 ? 311 GLN A CG  1 
ATOM   1094 C  CG  B GLN A 1 147 ? 8.875   28.263 83.389 0.50 18.13 ? 311 GLN A CG  1 
ATOM   1095 C  CD  A GLN A 1 147 ? 9.541   28.651 80.728 0.50 15.50 ? 311 GLN A CD  1 
ATOM   1096 C  CD  B GLN A 1 147 ? 9.771   29.369 82.918 0.50 18.46 ? 311 GLN A CD  1 
ATOM   1097 O  OE1 A GLN A 1 147 ? 10.719  28.339 80.573 0.50 14.61 ? 311 GLN A OE1 1 
ATOM   1098 O  OE1 B GLN A 1 147 ? 10.136  29.422 81.746 0.50 19.17 ? 311 GLN A OE1 1 
ATOM   1099 N  NE2 A GLN A 1 147 ? 9.096   29.882 80.527 0.50 16.81 ? 311 GLN A NE2 1 
ATOM   1100 N  NE2 B GLN A 1 147 ? 10.122  30.276 83.824 0.50 20.48 ? 311 GLN A NE2 1 
ATOM   1101 N  N   . ALA A 1 148 ? 7.387   24.828 81.869 1.00 14.05 ? 312 ALA A N   1 
ATOM   1102 C  CA  . ALA A 1 148 ? 8.024   23.527 81.786 1.00 13.77 ? 312 ALA A CA  1 
ATOM   1103 C  C   . ALA A 1 148 ? 8.793   23.547 80.468 1.00 12.63 ? 312 ALA A C   1 
ATOM   1104 O  O   . ALA A 1 148 ? 8.376   24.204 79.515 1.00 13.62 ? 312 ALA A O   1 
ATOM   1105 C  CB  . ALA A 1 148 ? 6.974   22.423 81.787 1.00 13.31 ? 312 ALA A CB  1 
ATOM   1106 N  N   . ARG A 1 149 ? 9.957   22.913 80.447 1.00 12.12 ? 313 ARG A N   1 
ATOM   1107 C  CA  . ARG A 1 149 ? 10.763  22.855 79.239 1.00 13.38 ? 313 ARG A CA  1 
ATOM   1108 C  C   . ARG A 1 149 ? 11.274  21.452 79.038 1.00 12.92 ? 313 ARG A C   1 
ATOM   1109 O  O   . ARG A 1 149 ? 11.270  20.629 79.958 1.00 14.81 ? 313 ARG A O   1 
ATOM   1110 C  CB  . ARG A 1 149 ? 11.983  23.780 79.335 1.00 16.20 ? 313 ARG A CB  1 
ATOM   1111 C  CG  . ARG A 1 149 ? 11.692  25.268 79.359 1.00 20.43 ? 313 ARG A CG  1 
ATOM   1112 C  CD  . ARG A 1 149 ? 13.000  26.064 79.354 1.00 22.23 ? 313 ARG A CD  1 
ATOM   1113 N  NE  . ARG A 1 149 ? 13.850  25.735 80.498 1.00 24.68 ? 313 ARG A NE  1 
ATOM   1114 C  CZ  . ARG A 1 149 ? 13.652  26.187 81.733 1.00 26.46 ? 313 ARG A CZ  1 
ATOM   1115 N  NH1 . ARG A 1 149 ? 12.638  26.998 82.001 1.00 26.47 ? 313 ARG A NH1 1 
ATOM   1116 N  NH2 . ARG A 1 149 ? 14.453  25.802 82.715 1.00 29.29 ? 313 ARG A NH2 1 
ATOM   1117 N  N   . THR A 1 150 ? 11.690  21.172 77.816 1.00 11.03 ? 314 THR A N   1 
ATOM   1118 C  CA  . THR A 1 150 ? 12.278  19.891 77.496 1.00 10.58 ? 314 THR A CA  1 
ATOM   1119 C  C   . THR A 1 150 ? 13.141  20.097 76.270 1.00 9.51  ? 314 THR A C   1 
ATOM   1120 O  O   . THR A 1 150 ? 13.178  21.183 75.703 1.00 8.26  ? 314 THR A O   1 
ATOM   1121 C  CB  . THR A 1 150 ? 11.243  18.770 77.259 1.00 12.54 ? 314 THR A CB  1 
ATOM   1122 O  OG1 . THR A 1 150 ? 11.917  17.502 77.326 1.00 13.94 ? 314 THR A OG1 1 
ATOM   1123 C  CG2 . THR A 1 150 ? 10.563  18.910 75.884 1.00 9.83  ? 314 THR A CG2 1 
ATOM   1124 N  N   . SER A 1 151 ? 13.851  19.057 75.874 1.00 10.15 ? 315 SER A N   1 
ATOM   1125 C  CA  . SER A 1 151 ? 14.723  19.154 74.733 1.00 10.73 ? 315 SER A CA  1 
ATOM   1126 C  C   . SER A 1 151 ? 14.801  17.830 73.993 1.00 11.12 ? 315 SER A C   1 
ATOM   1127 O  O   . SER A 1 151 ? 14.622  16.761 74.583 1.00 9.90  ? 315 SER A O   1 
ATOM   1128 C  CB  . SER A 1 151 ? 16.109  19.608 75.217 1.00 12.62 ? 315 SER A CB  1 
ATOM   1129 O  OG  . SER A 1 151 ? 17.157  19.052 74.451 1.00 15.04 ? 315 SER A OG  1 
ATOM   1130 N  N   . TYR A 1 152 ? 15.024  17.929 72.686 1.00 11.51 ? 316 TYR A N   1 
ATOM   1131 C  CA  . TYR A 1 152 ? 15.163  16.777 71.808 1.00 11.51 ? 316 TYR A CA  1 
ATOM   1132 C  C   . TYR A 1 152 ? 16.430  16.965 70.983 1.00 11.79 ? 316 TYR A C   1 
ATOM   1133 O  O   . TYR A 1 152 ? 16.470  17.829 70.109 1.00 10.05 ? 316 TYR A O   1 
ATOM   1134 C  CB  . TYR A 1 152 ? 13.969  16.666 70.846 1.00 9.84  ? 316 TYR A CB  1 
ATOM   1135 C  CG  . TYR A 1 152 ? 12.648  16.452 71.523 1.00 8.39  ? 316 TYR A CG  1 
ATOM   1136 C  CD1 . TYR A 1 152 ? 11.720  17.494 71.629 1.00 10.39 ? 316 TYR A CD1 1 
ATOM   1137 C  CD2 . TYR A 1 152 ? 12.337  15.229 72.108 1.00 8.89  ? 316 TYR A CD2 1 
ATOM   1138 C  CE1 . TYR A 1 152 ? 10.515  17.322 72.316 1.00 10.35 ? 316 TYR A CE1 1 
ATOM   1139 C  CE2 . TYR A 1 152 ? 11.136  15.046 72.796 1.00 9.28  ? 316 TYR A CE2 1 
ATOM   1140 C  CZ  . TYR A 1 152 ? 10.231  16.096 72.900 1.00 9.16  ? 316 TYR A CZ  1 
ATOM   1141 O  OH  . TYR A 1 152 ? 9.064   15.929 73.609 1.00 10.29 ? 316 TYR A OH  1 
ATOM   1142 N  N   . THR A 1 153 ? 17.474  16.191 71.279 1.00 13.50 ? 317 THR A N   1 
ATOM   1143 C  CA  . THR A 1 153 ? 18.705  16.277 70.494 1.00 15.33 ? 317 THR A CA  1 
ATOM   1144 C  C   . THR A 1 153 ? 18.456  15.467 69.230 1.00 16.07 ? 317 THR A C   1 
ATOM   1145 O  O   . THR A 1 153 ? 17.431  14.783 69.118 1.00 16.55 ? 317 THR A O   1 
ATOM   1146 C  CB  . THR A 1 153 ? 19.948  15.730 71.240 1.00 14.46 ? 317 THR A CB  1 
ATOM   1147 O  OG1 . THR A 1 153 ? 19.733  14.369 71.614 1.00 18.43 ? 317 THR A OG1 1 
ATOM   1148 C  CG2 . THR A 1 153 ? 20.234  16.549 72.480 1.00 14.12 ? 317 THR A CG2 1 
ATOM   1149 N  N   . GLU A 1 154 ? 19.373  15.550 68.272 1.00 16.22 ? 318 GLU A N   1 
ATOM   1150 C  CA  . GLU A 1 154 ? 19.216  14.830 67.013 1.00 17.81 ? 318 GLU A CA  1 
ATOM   1151 C  C   . GLU A 1 154 ? 18.927  13.339 67.178 1.00 18.27 ? 318 GLU A C   1 
ATOM   1152 O  O   . GLU A 1 154 ? 18.149  12.772 66.405 1.00 20.20 ? 318 GLU A O   1 
ATOM   1153 C  CB  . GLU A 1 154 ? 20.429  15.042 66.090 1.00 19.66 ? 318 GLU A CB  1 
ATOM   1154 C  CG  . GLU A 1 154 ? 21.768  14.477 66.595 1.00 20.06 ? 318 GLU A CG  1 
ATOM   1155 C  CD  . GLU A 1 154 ? 22.446  15.331 67.659 1.00 21.10 ? 318 GLU A CD  1 
ATOM   1156 O  OE1 . GLU A 1 154 ? 23.395  14.828 68.296 1.00 22.83 ? 318 GLU A OE1 1 
ATOM   1157 O  OE2 . GLU A 1 154 ? 22.057  16.501 67.854 1.00 19.46 ? 318 GLU A OE2 1 
ATOM   1158 N  N   . ASP A 1 155 ? 19.513  12.716 68.198 1.00 17.46 ? 319 ASP A N   1 
ATOM   1159 C  CA  . ASP A 1 155 ? 19.299  11.289 68.421 1.00 19.23 ? 319 ASP A CA  1 
ATOM   1160 C  C   . ASP A 1 155 ? 17.951  10.949 69.064 1.00 17.80 ? 319 ASP A C   1 
ATOM   1161 O  O   . ASP A 1 155 ? 17.584  9.786  69.162 1.00 17.38 ? 319 ASP A O   1 
ATOM   1162 C  CB  . ASP A 1 155 ? 20.467  10.660 69.204 1.00 22.57 ? 319 ASP A CB  1 
ATOM   1163 C  CG  . ASP A 1 155 ? 20.825  11.426 70.467 1.00 26.46 ? 319 ASP A CG  1 
ATOM   1164 O  OD1 . ASP A 1 155 ? 20.285  11.100 71.544 1.00 27.08 ? 319 ASP A OD1 1 
ATOM   1165 O  OD2 . ASP A 1 155 ? 21.683  12.333 70.393 1.00 31.36 ? 319 ASP A OD2 1 
ATOM   1166 N  N   . GLU A 1 156 ? 17.200  11.976 69.452 1.00 18.14 ? 320 GLU A N   1 
ATOM   1167 C  CA  . GLU A 1 156 ? 15.889  11.799 70.078 1.00 15.14 ? 320 GLU A CA  1 
ATOM   1168 C  C   . GLU A 1 156 ? 14.745  12.191 69.138 1.00 14.81 ? 320 GLU A C   1 
ATOM   1169 O  O   . GLU A 1 156 ? 13.585  12.270 69.540 1.00 14.41 ? 320 GLU A O   1 
ATOM   1170 C  CB  . GLU A 1 156 ? 15.839  12.577 71.391 1.00 14.28 ? 320 GLU A CB  1 
ATOM   1171 C  CG  . GLU A 1 156 ? 16.869  12.061 72.379 1.00 13.30 ? 320 GLU A CG  1 
ATOM   1172 C  CD  . GLU A 1 156 ? 17.144  12.996 73.536 1.00 14.81 ? 320 GLU A CD  1 
ATOM   1173 O  OE1 . GLU A 1 156 ? 16.633  14.134 73.553 1.00 14.49 ? 320 GLU A OE1 1 
ATOM   1174 O  OE2 . GLU A 1 156 ? 17.896  12.585 74.441 1.00 17.18 ? 320 GLU A OE2 1 
ATOM   1175 N  N   . VAL A 1 157 ? 15.093  12.444 67.881 1.00 14.32 ? 321 VAL A N   1 
ATOM   1176 C  CA  . VAL A 1 157 ? 14.117  12.777 66.848 1.00 14.69 ? 321 VAL A CA  1 
ATOM   1177 C  C   . VAL A 1 157 ? 14.081  11.545 65.950 1.00 16.08 ? 321 VAL A C   1 
ATOM   1178 O  O   . VAL A 1 157 ? 15.084  11.197 65.317 1.00 16.38 ? 321 VAL A O   1 
ATOM   1179 C  CB  . VAL A 1 157 ? 14.535  14.018 66.037 1.00 13.51 ? 321 VAL A CB  1 
ATOM   1180 C  CG1 . VAL A 1 157 ? 13.557  14.250 64.899 1.00 12.67 ? 321 VAL A CG1 1 
ATOM   1181 C  CG2 . VAL A 1 157 ? 14.612  15.239 66.958 1.00 11.85 ? 321 VAL A CG2 1 
ATOM   1182 N  N   . LEU A 1 158 ? 12.928  10.881 65.928 1.00 14.10 ? 322 LEU A N   1 
ATOM   1183 C  CA  . LEU A 1 158 ? 12.754  9.649  65.167 1.00 14.16 ? 322 LEU A CA  1 
ATOM   1184 C  C   . LEU A 1 158 ? 12.083  9.782  63.801 1.00 13.02 ? 322 LEU A C   1 
ATOM   1185 O  O   . LEU A 1 158 ? 10.870  9.954  63.710 1.00 11.54 ? 322 LEU A O   1 
ATOM   1186 C  CB  . LEU A 1 158 ? 11.995  8.627  66.023 1.00 12.34 ? 322 LEU A CB  1 
ATOM   1187 C  CG  . LEU A 1 158 ? 12.500  8.429  67.456 1.00 13.45 ? 322 LEU A CG  1 
ATOM   1188 C  CD1 . LEU A 1 158 ? 11.604  7.461  68.208 1.00 10.67 ? 322 LEU A CD1 1 
ATOM   1189 C  CD2 . LEU A 1 158 ? 13.934  7.944  67.449 1.00 13.49 ? 322 LEU A CD2 1 
ATOM   1190 N  N   . TRP A 1 159 ? 12.884  9.669  62.740 1.00 12.67 ? 323 TRP A N   1 
ATOM   1191 C  CA  . TRP A 1 159 ? 12.375  9.741  61.375 1.00 13.17 ? 323 TRP A CA  1 
ATOM   1192 C  C   . TRP A 1 159 ? 11.532  8.506  61.062 1.00 13.84 ? 323 TRP A C   1 
ATOM   1193 O  O   . TRP A 1 159 ? 11.922  7.381  61.388 1.00 15.57 ? 323 TRP A O   1 
ATOM   1194 C  CB  . TRP A 1 159 ? 13.523  9.824  60.368 1.00 11.41 ? 323 TRP A CB  1 
ATOM   1195 C  CG  . TRP A 1 159 ? 13.057  10.242 59.019 1.00 13.23 ? 323 TRP A CG  1 
ATOM   1196 C  CD1 . TRP A 1 159 ? 12.391  9.475  58.098 1.00 12.04 ? 323 TRP A CD1 1 
ATOM   1197 C  CD2 . TRP A 1 159 ? 13.151  11.557 58.454 1.00 12.48 ? 323 TRP A CD2 1 
ATOM   1198 N  NE1 . TRP A 1 159 ? 12.058  10.238 57.003 1.00 13.72 ? 323 TRP A NE1 1 
ATOM   1199 C  CE2 . TRP A 1 159 ? 12.514  11.518 57.197 1.00 12.34 ? 323 TRP A CE2 1 
ATOM   1200 C  CE3 . TRP A 1 159 ? 13.710  12.766 58.893 1.00 11.60 ? 323 TRP A CE3 1 
ATOM   1201 C  CZ2 . TRP A 1 159 ? 12.420  12.641 56.375 1.00 13.72 ? 323 TRP A CZ2 1 
ATOM   1202 C  CZ3 . TRP A 1 159 ? 13.617  13.878 58.077 1.00 10.49 ? 323 TRP A CZ3 1 
ATOM   1203 C  CH2 . TRP A 1 159 ? 12.977  13.810 56.833 1.00 12.40 ? 323 TRP A CH2 1 
ATOM   1204 N  N   . GLY A 1 160 ? 10.383  8.723  60.431 1.00 12.95 ? 324 GLY A N   1 
ATOM   1205 C  CA  . GLY A 1 160 ? 9.508   7.620  60.071 1.00 13.68 ? 324 GLY A CA  1 
ATOM   1206 C  C   . GLY A 1 160 ? 8.679   7.014  61.191 1.00 14.13 ? 324 GLY A C   1 
ATOM   1207 O  O   . GLY A 1 160 ? 8.086   5.952  61.000 1.00 15.23 ? 324 GLY A O   1 
ATOM   1208 N  N   . HIS A 1 161 ? 8.642   7.666  62.354 1.00 13.28 ? 325 HIS A N   1 
ATOM   1209 C  CA  . HIS A 1 161 ? 7.857   7.172  63.488 1.00 12.26 ? 325 HIS A CA  1 
ATOM   1210 C  C   . HIS A 1 161 ? 6.549   7.924  63.698 1.00 11.55 ? 325 HIS A C   1 
ATOM   1211 O  O   . HIS A 1 161 ? 6.395   9.078  63.284 1.00 12.04 ? 325 HIS A O   1 
ATOM   1212 C  CB  . HIS A 1 161 ? 8.677   7.177  64.776 1.00 12.74 ? 325 HIS A CB  1 
ATOM   1213 C  CG  . HIS A 1 161 ? 9.503   5.945  64.966 1.00 13.95 ? 325 HIS A CG  1 
ATOM   1214 N  ND1 . HIS A 1 161 ? 9.239   5.017  65.950 1.00 15.00 ? 325 HIS A ND1 1 
ATOM   1215 C  CD2 . HIS A 1 161 ? 10.585  5.484  64.293 1.00 14.62 ? 325 HIS A CD2 1 
ATOM   1216 C  CE1 . HIS A 1 161 ? 10.122  4.037  65.877 1.00 16.04 ? 325 HIS A CE1 1 
ATOM   1217 N  NE2 . HIS A 1 161 ? 10.950  4.296  64.879 1.00 17.48 ? 325 HIS A NE2 1 
ATOM   1218 N  N   . ARG A 1 162 ? 5.614   7.262  64.370 1.00 11.24 ? 326 ARG A N   1 
ATOM   1219 C  CA  . ARG A 1 162 ? 4.302   7.832  64.631 1.00 10.38 ? 326 ARG A CA  1 
ATOM   1220 C  C   . ARG A 1 162 ? 3.874   7.529  66.066 1.00 10.04 ? 326 ARG A C   1 
ATOM   1221 O  O   . ARG A 1 162 ? 4.134   6.444  66.592 1.00 9.88  ? 326 ARG A O   1 
ATOM   1222 C  CB  . ARG A 1 162 ? 3.312   7.250  63.618 1.00 10.06 ? 326 ARG A CB  1 
ATOM   1223 C  CG  . ARG A 1 162 ? 1.879   7.726  63.731 1.00 13.30 ? 326 ARG A CG  1 
ATOM   1224 C  CD  . ARG A 1 162 ? 1.043   7.189  62.569 1.00 14.20 ? 326 ARG A CD  1 
ATOM   1225 N  NE  . ARG A 1 162 ? 1.407   7.821  61.302 1.00 17.05 ? 326 ARG A NE  1 
ATOM   1226 C  CZ  . ARG A 1 162 ? 1.000   7.416  60.099 1.00 18.05 ? 326 ARG A CZ  1 
ATOM   1227 N  NH1 . ARG A 1 162 ? 0.208   6.359  59.974 1.00 15.94 ? 326 ARG A NH1 1 
ATOM   1228 N  NH2 . ARG A 1 162 ? 1.366   8.095  59.016 1.00 17.60 ? 326 ARG A NH2 1 
ATOM   1229 N  N   . PHE A 1 163 ? 3.252   8.503  66.721 1.00 9.18  ? 327 PHE A N   1 
ATOM   1230 C  CA  . PHE A 1 163 ? 2.807   8.303  68.094 1.00 9.00  ? 327 PHE A CA  1 
ATOM   1231 C  C   . PHE A 1 163 ? 1.575   7.412  68.177 1.00 10.43 ? 327 PHE A C   1 
ATOM   1232 O  O   . PHE A 1 163 ? 0.684   7.476  67.321 1.00 11.28 ? 327 PHE A O   1 
ATOM   1233 C  CB  . PHE A 1 163 ? 2.486   9.647  68.775 1.00 8.07  ? 327 PHE A CB  1 
ATOM   1234 C  CG  . PHE A 1 163 ? 3.697   10.385 69.290 1.00 7.71  ? 327 PHE A CG  1 
ATOM   1235 C  CD1 . PHE A 1 163 ? 4.246   11.440 68.565 1.00 8.09  ? 327 PHE A CD1 1 
ATOM   1236 C  CD2 . PHE A 1 163 ? 4.294   10.017 70.498 1.00 8.93  ? 327 PHE A CD2 1 
ATOM   1237 C  CE1 . PHE A 1 163 ? 5.377   12.119 69.034 1.00 8.26  ? 327 PHE A CE1 1 
ATOM   1238 C  CE2 . PHE A 1 163 ? 5.426   10.689 70.979 1.00 9.27  ? 327 PHE A CE2 1 
ATOM   1239 C  CZ  . PHE A 1 163 ? 5.969   11.744 70.241 1.00 8.03  ? 327 PHE A CZ  1 
ATOM   1240 N  N   . PHE A 1 164 ? 1.546   6.561  69.199 1.00 11.85 ? 328 PHE A N   1 
ATOM   1241 C  CA  . PHE A 1 164 ? 0.398   5.692  69.450 1.00 13.18 ? 328 PHE A CA  1 
ATOM   1242 C  C   . PHE A 1 164 ? -0.661  6.598  70.041 1.00 12.87 ? 328 PHE A C   1 
ATOM   1243 O  O   . PHE A 1 164 ? -0.334  7.578  70.717 1.00 11.63 ? 328 PHE A O   1 
ATOM   1244 C  CB  . PHE A 1 164 ? 0.725   4.643  70.520 1.00 15.86 ? 328 PHE A CB  1 
ATOM   1245 C  CG  . PHE A 1 164 ? 1.347   3.397  69.981 1.00 20.65 ? 328 PHE A CG  1 
ATOM   1246 C  CD1 . PHE A 1 164 ? 2.730   3.253  69.945 1.00 21.50 ? 328 PHE A CD1 1 
ATOM   1247 C  CD2 . PHE A 1 164 ? 0.548   2.360  69.513 1.00 22.98 ? 328 PHE A CD2 1 
ATOM   1248 C  CE1 . PHE A 1 164 ? 3.315   2.089  69.451 1.00 23.64 ? 328 PHE A CE1 1 
ATOM   1249 C  CE2 . PHE A 1 164 ? 1.122   1.190  69.014 1.00 25.20 ? 328 PHE A CE2 1 
ATOM   1250 C  CZ  . PHE A 1 164 ? 2.511   1.055  68.985 1.00 24.59 ? 328 PHE A CZ  1 
ATOM   1251 N  N   . PRO A 1 165 ? -1.944  6.306  69.777 1.00 14.04 ? 329 PRO A N   1 
ATOM   1252 C  CA  . PRO A 1 165 ? -3.012  7.138  70.338 1.00 12.23 ? 329 PRO A CA  1 
ATOM   1253 C  C   . PRO A 1 165 ? -3.128  6.815  71.826 1.00 10.52 ? 329 PRO A C   1 
ATOM   1254 O  O   . PRO A 1 165 ? -2.858  5.691  72.239 1.00 10.35 ? 329 PRO A O   1 
ATOM   1255 C  CB  . PRO A 1 165 ? -4.240  6.669  69.569 1.00 13.07 ? 329 PRO A CB  1 
ATOM   1256 C  CG  . PRO A 1 165 ? -3.950  5.222  69.317 1.00 13.85 ? 329 PRO A CG  1 
ATOM   1257 C  CD  . PRO A 1 165 ? -2.495  5.262  68.892 1.00 14.39 ? 329 PRO A CD  1 
ATOM   1258 N  N   . VAL A 1 166 ? -3.493  7.809  72.627 1.00 10.34 ? 330 VAL A N   1 
ATOM   1259 C  CA  . VAL A 1 166 ? -3.639  7.623  74.072 1.00 11.71 ? 330 VAL A CA  1 
ATOM   1260 C  C   . VAL A 1 166 ? -5.068  7.811  74.599 1.00 12.78 ? 330 VAL A C   1 
ATOM   1261 O  O   . VAL A 1 166 ? -5.329  7.518  75.763 1.00 12.15 ? 330 VAL A O   1 
ATOM   1262 C  CB  . VAL A 1 166 ? -2.686  8.563  74.884 1.00 10.91 ? 330 VAL A CB  1 
ATOM   1263 C  CG1 . VAL A 1 166 ? -1.234  8.210  74.614 1.00 10.56 ? 330 VAL A CG1 1 
ATOM   1264 C  CG2 . VAL A 1 166 ? -2.945  10.029 74.550 1.00 9.88  ? 330 VAL A CG2 1 
ATOM   1265 N  N   . ILE A 1 167 ? -5.982  8.274  73.744 1.00 14.05 ? 331 ILE A N   1 
ATOM   1266 C  CA  . ILE A 1 167 ? -7.375  8.512  74.140 1.00 16.70 ? 331 ILE A CA  1 
ATOM   1267 C  C   . ILE A 1 167 ? -8.350  7.444  73.643 1.00 19.11 ? 331 ILE A C   1 
ATOM   1268 O  O   . ILE A 1 167 ? -8.253  6.983  72.504 1.00 17.61 ? 331 ILE A O   1 
ATOM   1269 C  CB  . ILE A 1 167 ? -7.863  9.911  73.665 1.00 18.83 ? 331 ILE A CB  1 
ATOM   1270 C  CG1 . ILE A 1 167 ? -7.010  11.012 74.307 1.00 18.85 ? 331 ILE A CG1 1 
ATOM   1271 C  CG2 . ILE A 1 167 ? -9.339  10.127 74.041 1.00 20.05 ? 331 ILE A CG2 1 
ATOM   1272 C  CD1 . ILE A 1 167 ? -7.052  12.332 73.579 1.00 19.19 ? 331 ILE A CD1 1 
ATOM   1273 N  N   . SER A 1 168 ? -9.290  7.065  74.509 1.00 21.68 ? 332 SER A N   1 
ATOM   1274 C  CA  . SER A 1 168 ? -10.315 6.062  74.195 1.00 24.97 ? 332 SER A CA  1 
ATOM   1275 C  C   . SER A 1 168 ? -11.565 6.272  75.051 1.00 27.29 ? 332 SER A C   1 
ATOM   1276 O  O   . SER A 1 168 ? -11.571 7.111  75.951 1.00 26.26 ? 332 SER A O   1 
ATOM   1277 C  CB  . SER A 1 168 ? -9.778  4.651  74.441 1.00 24.99 ? 332 SER A CB  1 
ATOM   1278 O  OG  . SER A 1 168 ? -9.535  4.420  75.821 1.00 24.93 ? 332 SER A OG  1 
ATOM   1279 N  N   . LEU A 1 169 ? -12.616 5.508  74.762 1.00 30.60 ? 333 LEU A N   1 
ATOM   1280 C  CA  . LEU A 1 169 ? -13.871 5.583  75.513 1.00 33.51 ? 333 LEU A CA  1 
ATOM   1281 C  C   . LEU A 1 169 ? -14.282 4.191  76.005 1.00 35.86 ? 333 LEU A C   1 
ATOM   1282 O  O   . LEU A 1 169 ? -14.710 3.347  75.215 1.00 37.16 ? 333 LEU A O   1 
ATOM   1283 C  CB  . LEU A 1 169 ? -14.986 6.168  74.643 1.00 32.32 ? 333 LEU A CB  1 
ATOM   1284 C  CG  . LEU A 1 169 ? -16.363 6.304  75.311 1.00 33.61 ? 333 LEU A CG  1 
ATOM   1285 C  CD1 . LEU A 1 169 ? -16.351 7.413  76.342 1.00 32.49 ? 333 LEU A CD1 1 
ATOM   1286 C  CD2 . LEU A 1 169 ? -17.411 6.597  74.264 1.00 32.65 ? 333 LEU A CD2 1 
ATOM   1287 N  N   . GLU A 1 170 ? -14.104 3.937  77.298 1.00 37.74 ? 334 GLU A N   1 
ATOM   1288 C  CA  . GLU A 1 170 ? -14.470 2.649  77.888 1.00 40.78 ? 334 GLU A CA  1 
ATOM   1289 C  C   . GLU A 1 170 ? -15.486 2.836  79.016 1.00 42.21 ? 334 GLU A C   1 
ATOM   1290 O  O   . GLU A 1 170 ? -15.111 3.024  80.180 1.00 43.12 ? 334 GLU A O   1 
ATOM   1291 C  CB  . GLU A 1 170 ? -13.235 1.898  78.419 1.00 41.66 ? 334 GLU A CB  1 
ATOM   1292 C  CG  . GLU A 1 170 ? -12.497 1.019  77.401 1.00 44.63 ? 334 GLU A CG  1 
ATOM   1293 C  CD  . GLU A 1 170 ? -11.511 1.788  76.528 1.00 46.25 ? 334 GLU A CD  1 
ATOM   1294 O  OE1 . GLU A 1 170 ? -11.851 2.100  75.366 1.00 45.90 ? 334 GLU A OE1 1 
ATOM   1295 O  OE2 . GLU A 1 170 ? -10.385 2.060  77.001 1.00 47.63 ? 334 GLU A OE2 1 
ATOM   1296 N  N   . GLU A 1 171 ? -16.768 2.788  78.653 1.00 42.43 ? 335 GLU A N   1 
ATOM   1297 C  CA  . GLU A 1 171 ? -17.886 2.945  79.586 1.00 41.70 ? 335 GLU A CA  1 
ATOM   1298 C  C   . GLU A 1 171 ? -18.154 4.389  80.016 1.00 39.80 ? 335 GLU A C   1 
ATOM   1299 O  O   . GLU A 1 171 ? -18.064 4.733  81.202 1.00 41.21 ? 335 GLU A O   1 
ATOM   1300 C  CB  . GLU A 1 171 ? -17.736 2.013  80.805 1.00 43.58 ? 335 GLU A CB  1 
ATOM   1301 C  CG  . GLU A 1 171 ? -18.922 2.012  81.790 1.00 45.62 ? 335 GLU A CG  1 
ATOM   1302 C  CD  . GLU A 1 171 ? -20.290 1.894  81.114 1.00 47.50 ? 335 GLU A CD  1 
ATOM   1303 O  OE1 . GLU A 1 171 ? -20.412 1.186  80.089 1.00 49.27 ? 335 GLU A OE1 1 
ATOM   1304 O  OE2 . GLU A 1 171 ? -21.254 2.513  81.617 1.00 48.94 ? 335 GLU A OE2 1 
ATOM   1305 N  N   . GLY A 1 172 ? -18.490 5.225  79.036 1.00 37.21 ? 336 GLY A N   1 
ATOM   1306 C  CA  . GLY A 1 172 ? -18.803 6.621  79.301 1.00 34.06 ? 336 GLY A CA  1 
ATOM   1307 C  C   . GLY A 1 172 ? -17.655 7.477  79.791 1.00 32.11 ? 336 GLY A C   1 
ATOM   1308 O  O   . GLY A 1 172 ? -17.838 8.659  80.091 1.00 32.48 ? 336 GLY A O   1 
ATOM   1309 N  N   . PHE A 1 173 ? -16.473 6.878  79.872 1.00 30.04 ? 337 PHE A N   1 
ATOM   1310 C  CA  . PHE A 1 173 ? -15.274 7.575  80.322 1.00 27.16 ? 337 PHE A CA  1 
ATOM   1311 C  C   . PHE A 1 173 ? -14.258 7.765  79.197 1.00 25.85 ? 337 PHE A C   1 
ATOM   1312 O  O   . PHE A 1 173 ? -13.830 6.788  78.578 1.00 25.22 ? 337 PHE A O   1 
ATOM   1313 C  CB  . PHE A 1 173 ? -14.591 6.783  81.438 1.00 27.16 ? 337 PHE A CB  1 
ATOM   1314 C  CG  . PHE A 1 173 ? -15.264 6.893  82.774 1.00 28.34 ? 337 PHE A CG  1 
ATOM   1315 C  CD1 . PHE A 1 173 ? -15.725 5.753  83.428 1.00 27.83 ? 337 PHE A CD1 1 
ATOM   1316 C  CD2 . PHE A 1 173 ? -15.393 8.130  83.406 1.00 26.65 ? 337 PHE A CD2 1 
ATOM   1317 C  CE1 . PHE A 1 173 ? -16.300 5.845  84.692 1.00 28.97 ? 337 PHE A CE1 1 
ATOM   1318 C  CE2 . PHE A 1 173 ? -15.967 8.233  84.673 1.00 26.03 ? 337 PHE A CE2 1 
ATOM   1319 C  CZ  . PHE A 1 173 ? -16.421 7.091  85.318 1.00 27.09 ? 337 PHE A CZ  1 
ATOM   1320 N  N   . PHE A 1 174 ? -13.921 9.018  78.900 1.00 23.96 ? 338 PHE A N   1 
ATOM   1321 C  CA  . PHE A 1 174 ? -12.894 9.320  77.906 1.00 22.94 ? 338 PHE A CA  1 
ATOM   1322 C  C   . PHE A 1 174 ? -11.597 9.139  78.686 1.00 22.08 ? 338 PHE A C   1 
ATOM   1323 O  O   . PHE A 1 174 ? -11.247 9.969  79.533 1.00 23.79 ? 338 PHE A O   1 
ATOM   1324 C  CB  . PHE A 1 174 ? -13.017 10.755 77.412 1.00 23.23 ? 338 PHE A CB  1 
ATOM   1325 C  CG  . PHE A 1 174 ? -14.149 10.968 76.448 1.00 24.44 ? 338 PHE A CG  1 
ATOM   1326 C  CD1 . PHE A 1 174 ? -15.159 11.878 76.729 1.00 23.50 ? 338 PHE A CD1 1 
ATOM   1327 C  CD2 . PHE A 1 174 ? -14.184 10.287 75.238 1.00 25.84 ? 338 PHE A CD2 1 
ATOM   1328 C  CE1 . PHE A 1 174 ? -16.181 12.111 75.820 1.00 22.38 ? 338 PHE A CE1 1 
ATOM   1329 C  CE2 . PHE A 1 174 ? -15.207 10.516 74.319 1.00 25.07 ? 338 PHE A CE2 1 
ATOM   1330 C  CZ  . PHE A 1 174 ? -16.205 11.433 74.616 1.00 23.58 ? 338 PHE A CZ  1 
ATOM   1331 N  N   . LYS A 1 175 ? -10.928 8.018  78.428 1.00 19.90 ? 339 LYS A N   1 
ATOM   1332 C  CA  . LYS A 1 175 ? -9.707  7.630  79.117 1.00 17.34 ? 339 LYS A CA  1 
ATOM   1333 C  C   . LYS A 1 175 ? -8.401  7.962  78.416 1.00 15.45 ? 339 LYS A C   1 
ATOM   1334 O  O   . LYS A 1 175 ? -8.314  7.924  77.193 1.00 15.53 ? 339 LYS A O   1 
ATOM   1335 C  CB  . LYS A 1 175 ? -9.739  6.121  79.368 1.00 19.57 ? 339 LYS A CB  1 
ATOM   1336 C  CG  . LYS A 1 175 ? -10.878 5.651  80.261 1.00 22.94 ? 339 LYS A CG  1 
ATOM   1337 C  CD  . LYS A 1 175 ? -11.251 4.190  79.985 1.00 25.51 ? 339 LYS A CD  1 
ATOM   1338 C  CE  . LYS A 1 175 ? -10.089 3.215  80.224 1.00 28.95 ? 339 LYS A CE  1 
ATOM   1339 N  NZ  . LYS A 1 175 ? -9.645  3.132  81.653 1.00 30.37 ? 339 LYS A NZ  1 
ATOM   1340 N  N   . VAL A 1 176 ? -7.389  8.277  79.220 1.00 13.83 ? 340 VAL A N   1 
ATOM   1341 C  CA  . VAL A 1 176 ? -6.048  8.567  78.726 1.00 12.64 ? 340 VAL A CA  1 
ATOM   1342 C  C   . VAL A 1 176 ? -5.127  7.460  79.260 1.00 12.80 ? 340 VAL A C   1 
ATOM   1343 O  O   . VAL A 1 176 ? -5.003  7.262  80.473 1.00 11.20 ? 340 VAL A O   1 
ATOM   1344 C  CB  . VAL A 1 176 ? -5.511  9.942  79.215 1.00 12.40 ? 340 VAL A CB  1 
ATOM   1345 C  CG1 . VAL A 1 176 ? -4.125  10.184 78.646 1.00 9.89  ? 340 VAL A CG1 1 
ATOM   1346 C  CG2 . VAL A 1 176 ? -6.447  11.063 78.801 1.00 11.83 ? 340 VAL A CG2 1 
ATOM   1347 N  N   . ASP A 1 177 ? -4.503  6.729  78.346 1.00 11.79 ? 341 ASP A N   1 
ATOM   1348 C  CA  . ASP A 1 177 ? -3.601  5.650  78.709 1.00 11.42 ? 341 ASP A CA  1 
ATOM   1349 C  C   . ASP A 1 177 ? -2.177  6.183  78.656 1.00 12.11 ? 341 ASP A C   1 
ATOM   1350 O  O   . ASP A 1 177 ? -1.547  6.175  77.599 1.00 11.40 ? 341 ASP A O   1 
ATOM   1351 C  CB  . ASP A 1 177 ? -3.772  4.493  77.718 1.00 13.11 ? 341 ASP A CB  1 
ATOM   1352 C  CG  . ASP A 1 177 ? -2.871  3.306  78.026 1.00 12.76 ? 341 ASP A CG  1 
ATOM   1353 O  OD1 . ASP A 1 177 ? -2.124  3.341  79.018 1.00 10.89 ? 341 ASP A OD1 1 
ATOM   1354 O  OD2 . ASP A 1 177 ? -2.918  2.327  77.258 1.00 16.64 ? 341 ASP A OD2 1 
ATOM   1355 N  N   . TYR A 1 178 ? -1.644  6.595  79.799 1.00 12.52 ? 342 TYR A N   1 
ATOM   1356 C  CA  . TYR A 1 178 ? -0.291  7.134  79.824 1.00 14.38 ? 342 TYR A CA  1 
ATOM   1357 C  C   . TYR A 1 178 ? 0.819   6.119  79.615 1.00 14.30 ? 342 TYR A C   1 
ATOM   1358 O  O   . TYR A 1 178 ? 1.975   6.496  79.442 1.00 15.04 ? 342 TYR A O   1 
ATOM   1359 C  CB  . TYR A 1 178 ? -0.050  7.931  81.097 1.00 16.08 ? 342 TYR A CB  1 
ATOM   1360 C  CG  . TYR A 1 178 ? -0.743  9.271  81.084 1.00 20.86 ? 342 TYR A CG  1 
ATOM   1361 C  CD1 . TYR A 1 178 ? -2.023  9.413  81.614 1.00 20.47 ? 342 TYR A CD1 1 
ATOM   1362 C  CD2 . TYR A 1 178 ? -0.125  10.398 80.525 1.00 21.34 ? 342 TYR A CD2 1 
ATOM   1363 C  CE1 . TYR A 1 178 ? -2.678  10.636 81.593 1.00 22.96 ? 342 TYR A CE1 1 
ATOM   1364 C  CE2 . TYR A 1 178 ? -0.775  11.631 80.499 1.00 23.74 ? 342 TYR A CE2 1 
ATOM   1365 C  CZ  . TYR A 1 178 ? -2.054  11.737 81.037 1.00 23.72 ? 342 TYR A CZ  1 
ATOM   1366 O  OH  . TYR A 1 178 ? -2.725  12.936 81.029 1.00 28.45 ? 342 TYR A OH  1 
ATOM   1367 N  N   . SER A 1 179 ? 0.469   4.837  79.629 1.00 15.07 ? 343 SER A N   1 
ATOM   1368 C  CA  . SER A 1 179 ? 1.452   3.782  79.420 1.00 15.22 ? 343 SER A CA  1 
ATOM   1369 C  C   . SER A 1 179 ? 1.873   3.816  77.957 1.00 16.59 ? 343 SER A C   1 
ATOM   1370 O  O   . SER A 1 179 ? 2.862   3.184  77.575 1.00 18.74 ? 343 SER A O   1 
ATOM   1371 C  CB  . SER A 1 179 ? 0.875   2.400  79.767 1.00 13.49 ? 343 SER A CB  1 
ATOM   1372 O  OG  . SER A 1 179 ? 0.056   1.888  78.724 1.00 16.06 ? 343 SER A OG  1 
ATOM   1373 N  N   . GLN A 1 180 ? 1.097   4.530  77.141 1.00 15.71 ? 344 GLN A N   1 
ATOM   1374 C  CA  . GLN A 1 180 ? 1.389   4.677  75.719 1.00 14.75 ? 344 GLN A CA  1 
ATOM   1375 C  C   . GLN A 1 180 ? 1.775   6.122  75.392 1.00 13.76 ? 344 GLN A C   1 
ATOM   1376 O  O   . GLN A 1 180 ? 1.934   6.481  74.218 1.00 12.48 ? 344 GLN A O   1 
ATOM   1377 C  CB  . GLN A 1 180 ? 0.181   4.257  74.869 1.00 18.28 ? 344 GLN A CB  1 
ATOM   1378 C  CG  . GLN A 1 180 ? -0.275  2.806  75.079 1.00 24.59 ? 344 GLN A CG  1 
ATOM   1379 C  CD  . GLN A 1 180 ? 0.881   1.811  75.088 1.00 27.19 ? 344 GLN A CD  1 
ATOM   1380 O  OE1 . GLN A 1 180 ? 1.657   1.732  74.136 1.00 29.65 ? 344 GLN A OE1 1 
ATOM   1381 N  NE2 . GLN A 1 180 ? 1.002   1.051  76.176 1.00 31.34 ? 344 GLN A NE2 1 
ATOM   1382 N  N   . PHE A 1 181 ? 1.938   6.942  76.430 1.00 12.41 ? 345 PHE A N   1 
ATOM   1383 C  CA  . PHE A 1 181 ? 2.286   8.354  76.263 1.00 10.31 ? 345 PHE A CA  1 
ATOM   1384 C  C   . PHE A 1 181 ? 3.567   8.558  75.457 1.00 9.71  ? 345 PHE A C   1 
ATOM   1385 O  O   . PHE A 1 181 ? 3.601   9.372  74.540 1.00 11.22 ? 345 PHE A O   1 
ATOM   1386 C  CB  . PHE A 1 181 ? 2.415   9.029  77.632 1.00 10.09 ? 345 PHE A CB  1 
ATOM   1387 C  CG  . PHE A 1 181 ? 2.720   10.503 77.562 1.00 11.71 ? 345 PHE A CG  1 
ATOM   1388 C  CD1 . PHE A 1 181 ? 1.694   11.433 77.409 1.00 11.46 ? 345 PHE A CD1 1 
ATOM   1389 C  CD2 . PHE A 1 181 ? 4.030   10.960 77.648 1.00 10.21 ? 345 PHE A CD2 1 
ATOM   1390 C  CE1 . PHE A 1 181 ? 1.967   12.793 77.343 1.00 9.95  ? 345 PHE A CE1 1 
ATOM   1391 C  CE2 . PHE A 1 181 ? 4.315   12.329 77.583 1.00 11.35 ? 345 PHE A CE2 1 
ATOM   1392 C  CZ  . PHE A 1 181 ? 3.276   13.245 77.429 1.00 10.25 ? 345 PHE A CZ  1 
ATOM   1393 N  N   . HIS A 1 182 ? 4.597   7.783  75.780 1.00 9.73  ? 346 HIS A N   1 
ATOM   1394 C  CA  . HIS A 1 182 ? 5.899   7.873  75.126 1.00 9.55  ? 346 HIS A CA  1 
ATOM   1395 C  C   . HIS A 1 182 ? 6.077   6.930  73.958 1.00 10.64 ? 346 HIS A C   1 
ATOM   1396 O  O   . HIS A 1 182 ? 7.097   6.993  73.271 1.00 12.79 ? 346 HIS A O   1 
ATOM   1397 C  CB  . HIS A 1 182 ? 7.007   7.555  76.126 1.00 9.61  ? 346 HIS A CB  1 
ATOM   1398 C  CG  . HIS A 1 182 ? 7.077   8.503  77.276 1.00 10.30 ? 346 HIS A CG  1 
ATOM   1399 N  ND1 . HIS A 1 182 ? 7.494   9.807  77.136 1.00 9.19  ? 346 HIS A ND1 1 
ATOM   1400 C  CD2 . HIS A 1 182 ? 6.803   8.333  78.590 1.00 9.18  ? 346 HIS A CD2 1 
ATOM   1401 C  CE1 . HIS A 1 182 ? 7.474   10.402 78.315 1.00 10.02 ? 346 HIS A CE1 1 
ATOM   1402 N  NE2 . HIS A 1 182 ? 7.058   9.528  79.215 1.00 10.36 ? 346 HIS A NE2 1 
ATOM   1403 N  N   . ALA A 1 183 ? 5.102   6.055  73.741 1.00 10.71 ? 347 ALA A N   1 
ATOM   1404 C  CA  . ALA A 1 183 ? 5.163   5.059  72.673 1.00 10.74 ? 347 ALA A CA  1 
ATOM   1405 C  C   . ALA A 1 183 ? 4.977   5.559  71.247 1.00 11.48 ? 347 ALA A C   1 
ATOM   1406 O  O   . ALA A 1 183 ? 4.051   6.323  70.946 1.00 11.35 ? 347 ALA A O   1 
ATOM   1407 C  CB  . ALA A 1 183 ? 4.170   3.929  72.953 1.00 10.96 ? 347 ALA A CB  1 
ATOM   1408 N  N   . THR A 1 184 ? 5.860   5.079  70.370 1.00 11.99 ? 348 THR A N   1 
ATOM   1409 C  CA  . THR A 1 184 ? 5.835   5.402  68.945 1.00 12.82 ? 348 THR A CA  1 
ATOM   1410 C  C   . THR A 1 184 ? 6.052   4.112  68.159 1.00 12.31 ? 348 THR A C   1 
ATOM   1411 O  O   . THR A 1 184 ? 6.557   3.124  68.692 1.00 11.05 ? 348 THR A O   1 
ATOM   1412 C  CB  . THR A 1 184 ? 6.960   6.406  68.531 1.00 13.77 ? 348 THR A CB  1 
ATOM   1413 O  OG1 . THR A 1 184 ? 8.246   5.781  68.669 1.00 14.51 ? 348 THR A OG1 1 
ATOM   1414 C  CG2 . THR A 1 184 ? 6.911   7.662  69.380 1.00 12.40 ? 348 THR A CG2 1 
ATOM   1415 N  N   . PHE A 1 185 ? 5.648   4.120  66.897 1.00 13.73 ? 349 PHE A N   1 
ATOM   1416 C  CA  . PHE A 1 185 ? 5.830   2.963  66.033 1.00 14.43 ? 349 PHE A CA  1 
ATOM   1417 C  C   . PHE A 1 185 ? 6.258   3.436  64.649 1.00 15.67 ? 349 PHE A C   1 
ATOM   1418 O  O   . PHE A 1 185 ? 5.906   4.532  64.220 1.00 12.88 ? 349 PHE A O   1 
ATOM   1419 C  CB  . PHE A 1 185 ? 4.562   2.090  65.972 1.00 13.99 ? 349 PHE A CB  1 
ATOM   1420 C  CG  . PHE A 1 185 ? 3.372   2.754  65.323 1.00 15.58 ? 349 PHE A CG  1 
ATOM   1421 C  CD1 . PHE A 1 185 ? 3.073   2.521  63.982 1.00 14.85 ? 349 PHE A CD1 1 
ATOM   1422 C  CD2 . PHE A 1 185 ? 2.522   3.570  66.059 1.00 15.67 ? 349 PHE A CD2 1 
ATOM   1423 C  CE1 . PHE A 1 185 ? 1.953   3.085  63.390 1.00 11.39 ? 349 PHE A CE1 1 
ATOM   1424 C  CE2 . PHE A 1 185 ? 1.392   4.141  65.467 1.00 15.20 ? 349 PHE A CE2 1 
ATOM   1425 C  CZ  . PHE A 1 185 ? 1.111   3.897  64.134 1.00 13.43 ? 349 PHE A CZ  1 
ATOM   1426 N  N   . GLU A 1 186 ? 7.049   2.610  63.973 1.00 17.48 ? 350 GLU A N   1 
ATOM   1427 C  CA  . GLU A 1 186 ? 7.559   2.930  62.649 1.00 19.41 ? 350 GLU A CA  1 
ATOM   1428 C  C   . GLU A 1 186 ? 6.514   2.758  61.551 1.00 19.48 ? 350 GLU A C   1 
ATOM   1429 O  O   . GLU A 1 186 ? 5.719   1.816  61.572 1.00 19.08 ? 350 GLU A O   1 
ATOM   1430 C  CB  . GLU A 1 186 ? 8.778   2.059  62.352 1.00 22.72 ? 350 GLU A CB  1 
ATOM   1431 C  CG  . GLU A 1 186 ? 9.681   2.603  61.265 1.00 30.20 ? 350 GLU A CG  1 
ATOM   1432 C  CD  . GLU A 1 186 ? 10.813  1.649  60.899 1.00 34.13 ? 350 GLU A CD  1 
ATOM   1433 O  OE1 . GLU A 1 186 ? 11.138  0.740  61.704 1.00 36.48 ? 350 GLU A OE1 1 
ATOM   1434 O  OE2 . GLU A 1 186 ? 11.375  1.812  59.794 1.00 37.57 ? 350 GLU A OE2 1 
ATOM   1435 N  N   . VAL A 1 187 ? 6.515   3.693  60.603 1.00 19.95 ? 351 VAL A N   1 
ATOM   1436 C  CA  . VAL A 1 187 ? 5.599   3.673  59.460 1.00 20.78 ? 351 VAL A CA  1 
ATOM   1437 C  C   . VAL A 1 187 ? 6.377   4.061  58.205 1.00 20.75 ? 351 VAL A C   1 
ATOM   1438 O  O   . VAL A 1 187 ? 7.366   4.797  58.286 1.00 20.01 ? 351 VAL A O   1 
ATOM   1439 C  CB  . VAL A 1 187 ? 4.417   4.676  59.619 1.00 20.64 ? 351 VAL A CB  1 
ATOM   1440 C  CG1 . VAL A 1 187 ? 3.440   4.191  60.687 1.00 19.90 ? 351 VAL A CG1 1 
ATOM   1441 C  CG2 . VAL A 1 187 ? 4.945   6.074  59.951 1.00 21.11 ? 351 VAL A CG2 1 
ATOM   1442 N  N   . PRO A 1 188 ? 5.983   3.513  57.039 1.00 20.85 ? 352 PRO A N   1 
ATOM   1443 C  CA  . PRO A 1 188 ? 6.660   3.827  55.774 1.00 20.47 ? 352 PRO A CA  1 
ATOM   1444 C  C   . PRO A 1 188 ? 6.599   5.337  55.547 1.00 18.77 ? 352 PRO A C   1 
ATOM   1445 O  O   . PRO A 1 188 ? 5.519   5.910  55.386 1.00 19.48 ? 352 PRO A O   1 
ATOM   1446 C  CB  . PRO A 1 188 ? 5.828   3.059  54.745 1.00 20.94 ? 352 PRO A CB  1 
ATOM   1447 C  CG  . PRO A 1 188 ? 5.395   1.834  55.531 1.00 22.06 ? 352 PRO A CG  1 
ATOM   1448 C  CD  . PRO A 1 188 ? 4.965   2.459  56.843 1.00 21.56 ? 352 PRO A CD  1 
ATOM   1449 N  N   . THR A 1 189 ? 7.763   5.972  55.567 1.00 17.58 ? 353 THR A N   1 
ATOM   1450 C  CA  . THR A 1 189 ? 7.860   7.419  55.410 1.00 16.33 ? 353 THR A CA  1 
ATOM   1451 C  C   . THR A 1 189 ? 8.922   7.789  54.385 1.00 16.27 ? 353 THR A C   1 
ATOM   1452 O  O   . THR A 1 189 ? 9.983   7.166  54.333 1.00 17.49 ? 353 THR A O   1 
ATOM   1453 C  CB  . THR A 1 189 ? 8.240   8.071  56.776 1.00 14.45 ? 353 THR A CB  1 
ATOM   1454 O  OG1 . THR A 1 189 ? 7.217   7.787  57.735 1.00 13.95 ? 353 THR A OG1 1 
ATOM   1455 C  CG2 . THR A 1 189 ? 8.406   9.577  56.662 1.00 13.35 ? 353 THR A CG2 1 
ATOM   1456 N  N   . PRO A 1 190 ? 8.620   8.762  53.509 1.00 16.73 ? 354 PRO A N   1 
ATOM   1457 C  CA  . PRO A 1 190 ? 9.579   9.207  52.490 1.00 16.79 ? 354 PRO A CA  1 
ATOM   1458 C  C   . PRO A 1 190 ? 10.834  9.734  53.199 1.00 17.88 ? 354 PRO A C   1 
ATOM   1459 O  O   . PRO A 1 190 ? 10.726  10.493 54.165 1.00 18.52 ? 354 PRO A O   1 
ATOM   1460 C  CB  . PRO A 1 190 ? 8.820   10.331 51.791 1.00 16.15 ? 354 PRO A CB  1 
ATOM   1461 C  CG  . PRO A 1 190 ? 7.394   9.864  51.869 1.00 16.88 ? 354 PRO A CG  1 
ATOM   1462 C  CD  . PRO A 1 190 ? 7.294   9.370  53.289 1.00 15.33 ? 354 PRO A CD  1 
ATOM   1463 N  N   . PRO A 1 191 ? 12.038  9.302  52.760 1.00 19.24 ? 355 PRO A N   1 
ATOM   1464 C  CA  . PRO A 1 191 ? 13.327  9.717  53.348 1.00 18.87 ? 355 PRO A CA  1 
ATOM   1465 C  C   . PRO A 1 191 ? 13.775  11.144 52.992 1.00 20.14 ? 355 PRO A C   1 
ATOM   1466 O  O   . PRO A 1 191 ? 14.696  11.696 53.601 1.00 19.81 ? 355 PRO A O   1 
ATOM   1467 C  CB  . PRO A 1 191 ? 14.300  8.695  52.760 1.00 18.72 ? 355 PRO A CB  1 
ATOM   1468 C  CG  . PRO A 1 191 ? 13.737  8.480  51.380 1.00 17.19 ? 355 PRO A CG  1 
ATOM   1469 C  CD  . PRO A 1 191 ? 12.252  8.341  51.657 1.00 17.67 ? 355 PRO A CD  1 
ATOM   1470 N  N   . TYR A 1 192 ? 13.091  11.735 52.022 1.00 20.13 ? 356 TYR A N   1 
ATOM   1471 C  CA  . TYR A 1 192 ? 13.411  13.059 51.520 1.00 21.41 ? 356 TYR A CA  1 
ATOM   1472 C  C   . TYR A 1 192 ? 13.050  14.225 52.418 1.00 20.40 ? 356 TYR A C   1 
ATOM   1473 O  O   . TYR A 1 192 ? 12.087  14.171 53.182 1.00 20.55 ? 356 TYR A O   1 
ATOM   1474 C  CB  . TYR A 1 192 ? 12.710  13.258 50.186 1.00 24.99 ? 356 TYR A CB  1 
ATOM   1475 C  CG  . TYR A 1 192 ? 12.805  12.063 49.275 1.00 28.22 ? 356 TYR A CG  1 
ATOM   1476 C  CD1 . TYR A 1 192 ? 11.691  11.263 49.029 1.00 29.15 ? 356 TYR A CD1 1 
ATOM   1477 C  CD2 . TYR A 1 192 ? 14.009  11.737 48.649 1.00 29.78 ? 356 TYR A CD2 1 
ATOM   1478 C  CE1 . TYR A 1 192 ? 11.775  10.164 48.179 1.00 32.57 ? 356 TYR A CE1 1 
ATOM   1479 C  CE2 . TYR A 1 192 ? 14.103  10.647 47.799 1.00 31.66 ? 356 TYR A CE2 1 
ATOM   1480 C  CZ  . TYR A 1 192 ? 12.988  9.864  47.566 1.00 32.52 ? 356 TYR A CZ  1 
ATOM   1481 O  OH  . TYR A 1 192 ? 13.088  8.793  46.709 1.00 35.19 ? 356 TYR A OH  1 
ATOM   1482 N  N   . SER A 1 193 ? 13.812  15.300 52.281 1.00 18.61 ? 357 SER A N   1 
ATOM   1483 C  CA  . SER A 1 193 ? 13.548  16.514 53.031 1.00 17.89 ? 357 SER A CA  1 
ATOM   1484 C  C   . SER A 1 193 ? 12.422  17.215 52.275 1.00 18.15 ? 357 SER A C   1 
ATOM   1485 O  O   . SER A 1 193 ? 12.181  16.908 51.103 1.00 18.18 ? 357 SER A O   1 
ATOM   1486 C  CB  . SER A 1 193 ? 14.787  17.405 53.023 1.00 19.71 ? 357 SER A CB  1 
ATOM   1487 O  OG  . SER A 1 193 ? 15.033  17.908 51.722 1.00 17.67 ? 357 SER A OG  1 
ATOM   1488 N  N   . VAL A 1 194 ? 11.745  18.163 52.918 1.00 16.46 ? 358 VAL A N   1 
ATOM   1489 C  CA  . VAL A 1 194 ? 10.664  18.875 52.249 1.00 16.44 ? 358 VAL A CA  1 
ATOM   1490 C  C   . VAL A 1 194 ? 11.173  19.645 51.036 1.00 16.82 ? 358 VAL A C   1 
ATOM   1491 O  O   . VAL A 1 194 ? 10.500  19.700 50.009 1.00 17.06 ? 358 VAL A O   1 
ATOM   1492 C  CB  . VAL A 1 194 ? 9.917   19.824 53.207 1.00 16.24 ? 358 VAL A CB  1 
ATOM   1493 C  CG1 . VAL A 1 194 ? 8.845   20.615 52.446 1.00 14.20 ? 358 VAL A CG1 1 
ATOM   1494 C  CG2 . VAL A 1 194 ? 9.264   19.011 54.320 1.00 14.81 ? 358 VAL A CG2 1 
ATOM   1495 N  N   . LYS A 1 195 ? 12.367  20.220 51.152 1.00 18.49 ? 359 LYS A N   1 
ATOM   1496 C  CA  . LYS A 1 195 ? 12.966  20.965 50.049 1.00 19.83 ? 359 LYS A CA  1 
ATOM   1497 C  C   . LYS A 1 195 ? 13.153  20.009 48.866 1.00 21.38 ? 359 LYS A C   1 
ATOM   1498 O  O   . LYS A 1 195 ? 12.800  20.334 47.729 1.00 22.07 ? 359 LYS A O   1 
ATOM   1499 C  CB  . LYS A 1 195 ? 14.315  21.557 50.462 1.00 19.23 ? 359 LYS A CB  1 
ATOM   1500 C  CG  . LYS A 1 195 ? 14.920  22.460 49.400 1.00 21.89 ? 359 LYS A CG  1 
ATOM   1501 C  CD  . LYS A 1 195 ? 16.250  23.043 49.829 1.00 22.45 ? 359 LYS A CD  1 
ATOM   1502 C  CE  . LYS A 1 195 ? 16.734  24.085 48.823 1.00 23.95 ? 359 LYS A CE  1 
ATOM   1503 N  NZ  . LYS A 1 195 ? 18.106  24.585 49.152 1.00 24.86 ? 359 LYS A NZ  1 
ATOM   1504 N  N   . GLU A 1 196 ? 13.662  18.814 49.155 1.00 21.52 ? 360 GLU A N   1 
ATOM   1505 C  CA  . GLU A 1 196 ? 13.876  17.804 48.130 1.00 22.61 ? 360 GLU A CA  1 
ATOM   1506 C  C   . GLU A 1 196 ? 12.559  17.389 47.482 1.00 24.13 ? 360 GLU A C   1 
ATOM   1507 O  O   . GLU A 1 196 ? 12.505  17.221 46.267 1.00 24.25 ? 360 GLU A O   1 
ATOM   1508 C  CB  . GLU A 1 196 ? 14.593  16.589 48.712 1.00 21.85 ? 360 GLU A CB  1 
ATOM   1509 C  CG  . GLU A 1 196 ? 16.015  16.881 49.156 1.00 22.81 ? 360 GLU A CG  1 
ATOM   1510 C  CD  . GLU A 1 196 ? 16.673  15.715 49.866 1.00 25.59 ? 360 GLU A CD  1 
ATOM   1511 O  OE1 . GLU A 1 196 ? 15.973  14.741 50.221 1.00 27.01 ? 360 GLU A OE1 1 
ATOM   1512 O  OE2 . GLU A 1 196 ? 17.901  15.772 50.079 1.00 28.75 ? 360 GLU A OE2 1 
ATOM   1513 N  N   . GLN A 1 197 ? 11.506  17.241 48.291 1.00 24.85 ? 361 GLN A N   1 
ATOM   1514 C  CA  . GLN A 1 197 ? 10.178  16.862 47.799 1.00 25.76 ? 361 GLN A CA  1 
ATOM   1515 C  C   . GLN A 1 197 ? 9.697   17.910 46.801 1.00 25.93 ? 361 GLN A C   1 
ATOM   1516 O  O   . GLN A 1 197 ? 9.161   17.578 45.744 1.00 26.23 ? 361 GLN A O   1 
ATOM   1517 C  CB  . GLN A 1 197 ? 9.163   16.758 48.956 1.00 28.10 ? 361 GLN A CB  1 
ATOM   1518 C  CG  . GLN A 1 197 ? 9.374   15.580 49.937 1.00 30.73 ? 361 GLN A CG  1 
ATOM   1519 C  CD  . GLN A 1 197 ? 8.307   15.514 51.049 1.00 32.11 ? 361 GLN A CD  1 
ATOM   1520 O  OE1 . GLN A 1 197 ? 7.687   16.524 51.398 1.00 32.78 ? 361 GLN A OE1 1 
ATOM   1521 N  NE2 . GLN A 1 197 ? 8.098   14.322 51.602 1.00 29.79 ? 361 GLN A NE2 1 
ATOM   1522 N  N   . GLU A 1 198 ? 9.898   19.179 47.147 1.00 26.44 ? 362 GLU A N   1 
ATOM   1523 C  CA  . GLU A 1 198 ? 9.497   20.286 46.286 1.00 26.61 ? 362 GLU A CA  1 
ATOM   1524 C  C   . GLU A 1 198 ? 10.411  20.376 45.066 1.00 26.90 ? 362 GLU A C   1 
ATOM   1525 O  O   . GLU A 1 198 ? 9.975   20.797 43.988 1.00 26.05 ? 362 GLU A O   1 
ATOM   1526 C  CB  . GLU A 1 198 ? 9.494   21.600 47.068 1.00 26.63 ? 362 GLU A CB  1 
ATOM   1527 C  CG  . GLU A 1 198 ? 8.356   21.701 48.077 1.00 26.81 ? 362 GLU A CG  1 
ATOM   1528 C  CD  . GLU A 1 198 ? 8.439   22.941 48.946 1.00 28.37 ? 362 GLU A CD  1 
ATOM   1529 O  OE1 . GLU A 1 198 ? 9.297   23.806 48.688 1.00 30.07 ? 362 GLU A OE1 1 
ATOM   1530 O  OE2 . GLU A 1 198 ? 7.643   23.056 49.900 1.00 30.79 ? 362 GLU A OE2 1 
ATOM   1531 N  N   . GLU A 1 199 ? 11.677  19.988 45.244 1.00 26.64 ? 363 GLU A N   1 
ATOM   1532 C  CA  . GLU A 1 199 ? 12.643  19.982 44.145 1.00 27.69 ? 363 GLU A CA  1 
ATOM   1533 C  C   . GLU A 1 199 ? 12.214  18.906 43.147 1.00 28.22 ? 363 GLU A C   1 
ATOM   1534 O  O   . GLU A 1 199 ? 12.287  19.108 41.933 1.00 28.77 ? 363 GLU A O   1 
ATOM   1535 C  CB  . GLU A 1 199 ? 14.063  19.705 44.655 1.00 26.46 ? 363 GLU A CB  1 
ATOM   1536 C  CG  . GLU A 1 199 ? 14.725  20.918 45.300 1.00 28.34 ? 363 GLU A CG  1 
ATOM   1537 C  CD  . GLU A 1 199 ? 16.092  20.626 45.909 1.00 29.86 ? 363 GLU A CD  1 
ATOM   1538 O  OE1 . GLU A 1 199 ? 16.345  19.478 46.329 1.00 31.54 ? 363 GLU A OE1 1 
ATOM   1539 O  OE2 . GLU A 1 199 ? 16.917  21.561 45.991 1.00 31.92 ? 363 GLU A OE2 1 
HETATM 1540 N  N   . MSE A 1 200 ? 11.724  17.785 43.672 1.00 29.03 ? 364 MSE A N   1 
HETATM 1541 C  CA  . MSE A 1 200 ? 11.262  16.678 42.845 1.00 30.94 ? 364 MSE A CA  1 
HETATM 1542 C  C   . MSE A 1 200 ? 9.937   17.000 42.186 1.00 32.64 ? 364 MSE A C   1 
HETATM 1543 O  O   . MSE A 1 200 ? 9.628   16.469 41.117 1.00 32.26 ? 364 MSE A O   1 
HETATM 1544 C  CB  . MSE A 1 200 ? 11.162  15.400 43.660 1.00 31.24 ? 364 MSE A CB  1 
HETATM 1545 C  CG  . MSE A 1 200 ? 12.521  14.885 44.058 1.00 34.83 ? 364 MSE A CG  1 
HETATM 1546 SE SE  . MSE A 1 200 ? 12.455  13.262 45.047 1.00 41.92 ? 364 MSE A SE  1 
HETATM 1547 C  CE  . MSE A 1 200 ? 12.081  14.003 46.770 1.00 38.44 ? 364 MSE A CE  1 
ATOM   1548 N  N   . LEU A 1 201 ? 9.153   17.862 42.831 1.00 33.69 ? 365 LEU A N   1 
ATOM   1549 C  CA  . LEU A 1 201 ? 7.872   18.280 42.279 1.00 35.15 ? 365 LEU A CA  1 
ATOM   1550 C  C   . LEU A 1 201 ? 8.149   19.190 41.087 1.00 35.42 ? 365 LEU A C   1 
ATOM   1551 O  O   . LEU A 1 201 ? 7.501   19.074 40.048 1.00 34.97 ? 365 LEU A O   1 
ATOM   1552 C  CB  . LEU A 1 201 ? 7.026   19.009 43.328 1.00 36.80 ? 365 LEU A CB  1 
ATOM   1553 C  CG  . LEU A 1 201 ? 6.191   18.136 44.272 1.00 38.61 ? 365 LEU A CG  1 
ATOM   1554 C  CD1 . LEU A 1 201 ? 5.536   19.007 45.336 1.00 39.00 ? 365 LEU A CD1 1 
ATOM   1555 C  CD2 . LEU A 1 201 ? 5.129   17.370 43.490 1.00 38.33 ? 365 LEU A CD2 1 
ATOM   1556 N  N   . LEU A 1 202 ? 9.135   20.073 41.235 1.00 35.90 ? 366 LEU A N   1 
ATOM   1557 C  CA  . LEU A 1 202 ? 9.517   20.985 40.162 1.00 37.43 ? 366 LEU A CA  1 
ATOM   1558 C  C   . LEU A 1 202 ? 10.016  20.223 38.932 1.00 37.99 ? 366 LEU A C   1 
ATOM   1559 O  O   . LEU A 1 202 ? 9.634   20.544 37.807 1.00 38.12 ? 366 LEU A O   1 
ATOM   1560 C  CB  . LEU A 1 202 ? 10.605  21.954 40.632 1.00 38.48 ? 366 LEU A CB  1 
ATOM   1561 C  CG  . LEU A 1 202 ? 10.199  23.168 41.474 1.00 40.04 ? 366 LEU A CG  1 
ATOM   1562 C  CD1 . LEU A 1 202 ? 11.449  23.947 41.865 1.00 39.81 ? 366 LEU A CD1 1 
ATOM   1563 C  CD2 . LEU A 1 202 ? 9.233   24.060 40.695 1.00 39.33 ? 366 LEU A CD2 1 
HETATM 1564 N  N   . MSE A 1 203 ? 10.867  19.219 39.149 1.00 38.30 ? 367 MSE A N   1 
HETATM 1565 C  CA  . MSE A 1 203 ? 11.402  18.430 38.046 1.00 38.98 ? 367 MSE A CA  1 
HETATM 1566 C  C   . MSE A 1 203 ? 10.405  17.430 37.453 1.00 39.81 ? 367 MSE A C   1 
HETATM 1567 O  O   . MSE A 1 203 ? 10.642  16.870 36.381 1.00 39.98 ? 367 MSE A O   1 
HETATM 1568 C  CB  . MSE A 1 203 ? 12.737  17.753 38.430 1.00 38.99 ? 367 MSE A CB  1 
HETATM 1569 C  CG  . MSE A 1 203 ? 12.754  16.929 39.715 1.00 38.91 ? 367 MSE A CG  1 
HETATM 1570 SE SE  . MSE A 1 203 ? 14.537  16.285 40.250 1.00 38.14 ? 367 MSE A SE  1 
HETATM 1571 C  CE  . MSE A 1 203 ? 15.297  17.930 40.901 1.00 40.71 ? 367 MSE A CE  1 
ATOM   1572 N  N   . SER A 1 204 ? 9.264   17.258 38.118 1.00 41.10 ? 368 SER A N   1 
ATOM   1573 C  CA  . SER A 1 204 ? 8.231   16.336 37.649 1.00 42.50 ? 368 SER A CA  1 
ATOM   1574 C  C   . SER A 1 204 ? 7.343   16.975 36.591 1.00 43.82 ? 368 SER A C   1 
ATOM   1575 O  O   . SER A 1 204 ? 6.610   16.278 35.885 1.00 45.03 ? 368 SER A O   1 
ATOM   1576 C  CB  . SER A 1 204 ? 7.361   15.859 38.809 1.00 42.67 ? 368 SER A CB  1 
ATOM   1577 O  OG  . SER A 1 204 ? 6.485   16.887 39.236 1.00 43.70 ? 368 SER A OG  1 
ATOM   1578 N  N   . SER A 1 205 ? 7.387   18.302 36.501 1.00 45.14 ? 369 SER A N   1 
ATOM   1579 C  CA  . SER A 1 205 ? 6.579   19.019 35.523 1.00 46.46 ? 369 SER A CA  1 
ATOM   1580 C  C   . SER A 1 205 ? 7.114   18.792 34.111 1.00 47.35 ? 369 SER A C   1 
ATOM   1581 O  O   . SER A 1 205 ? 8.287   19.058 33.833 1.00 47.80 ? 369 SER A O   1 
ATOM   1582 C  CB  . SER A 1 205 ? 6.550   20.522 35.828 1.00 46.33 ? 369 SER A CB  1 
ATOM   1583 O  OG  . SER A 1 205 ? 7.775   21.150 35.486 1.00 47.07 ? 369 SER A OG  1 
ATOM   1584 N  N   . PRO A 1 206 ? 6.277   18.226 33.221 1.00 47.70 ? 370 PRO A N   1 
ATOM   1585 C  CA  . PRO A 1 206 ? 6.670   17.965 31.832 1.00 47.41 ? 370 PRO A CA  1 
ATOM   1586 C  C   . PRO A 1 206 ? 6.751   19.235 30.962 1.00 47.59 ? 370 PRO A C   1 
ATOM   1587 O  O   . PRO A 1 206 ? 7.078   19.105 29.763 1.00 48.30 ? 370 PRO A O   1 
ATOM   1588 C  CB  . PRO A 1 206 ? 5.581   17.000 31.352 1.00 47.54 ? 370 PRO A CB  1 
ATOM   1589 C  CG  . PRO A 1 206 ? 4.390   17.399 32.154 1.00 47.37 ? 370 PRO A CG  1 
ATOM   1590 C  CD  . PRO A 1 206 ? 4.981   17.590 33.525 1.00 47.17 ? 370 PRO A CD  1 
HETATM 1591 O  O   . HOH B 2 .   ? 5.071   29.093 67.066 1.00 10.44 ? 401 HOH A O   1 
HETATM 1592 O  O   . HOH B 2 .   ? 12.274  18.347 55.610 1.00 15.97 ? 402 HOH A O   1 
HETATM 1593 O  O   . HOH B 2 .   ? 5.667   32.199 70.277 1.00 19.27 ? 403 HOH A O   1 
HETATM 1594 O  O   . HOH B 2 .   ? 4.728   8.638  57.300 1.00 15.09 ? 404 HOH A O   1 
HETATM 1595 O  O   . HOH B 2 .   ? 3.203   24.507 62.037 1.00 18.14 ? 405 HOH A O   1 
HETATM 1596 O  O   . HOH B 2 .   ? 8.423   9.260  72.781 1.00 14.70 ? 406 HOH A O   1 
HETATM 1597 O  O   . HOH B 2 .   ? 8.327   15.014 80.834 1.00 19.48 ? 407 HOH A O   1 
HETATM 1598 O  O   . HOH B 2 .   ? -1.581  12.960 71.443 1.00 10.40 ? 408 HOH A O   1 
HETATM 1599 O  O   . HOH B 2 .   ? 7.767   28.312 68.386 1.00 10.46 ? 409 HOH A O   1 
HETATM 1600 O  O   . HOH B 2 .   ? -3.641  16.130 69.445 1.00 19.39 ? 410 HOH A O   1 
HETATM 1601 O  O   . HOH B 2 .   ? 27.901  38.204 65.970 1.00 18.13 ? 411 HOH A O   1 
HETATM 1602 O  O   . HOH B 2 .   ? 2.652   11.106 65.201 1.00 13.09 ? 412 HOH A O   1 
HETATM 1603 O  O   . HOH B 2 .   ? 14.838  32.840 71.959 1.00 10.29 ? 413 HOH A O   1 
HETATM 1604 O  O   . HOH B 2 .   ? -23.212 19.475 80.028 1.00 17.04 ? 414 HOH A O   1 
HETATM 1605 O  O   . HOH B 2 .   ? 29.630  34.233 66.630 1.00 14.00 ? 415 HOH A O   1 
HETATM 1606 O  O   . HOH B 2 .   ? 0.506   17.959 59.182 1.00 13.78 ? 416 HOH A O   1 
HETATM 1607 O  O   . HOH B 2 .   ? 8.503   31.769 70.079 1.00 19.53 ? 417 HOH A O   1 
HETATM 1608 O  O   . HOH B 2 .   ? 9.079   27.713 61.399 1.00 20.05 ? 418 HOH A O   1 
HETATM 1609 O  O   . HOH B 2 .   ? -1.377  4.578  61.899 1.00 31.03 ? 419 HOH A O   1 
HETATM 1610 O  O   . HOH B 2 .   ? 27.552  36.741 59.634 1.00 17.65 ? 420 HOH A O   1 
HETATM 1611 O  O   . HOH B 2 .   ? 0.503   23.794 69.001 1.00 18.90 ? 421 HOH A O   1 
HETATM 1612 O  O   . HOH B 2 .   ? 23.056  34.016 67.042 1.00 13.86 ? 422 HOH A O   1 
HETATM 1613 O  O   . HOH B 2 .   ? -12.196 20.134 84.268 1.00 20.48 ? 423 HOH A O   1 
HETATM 1614 O  O   . HOH B 2 .   ? 2.557   10.402 61.038 1.00 12.17 ? 424 HOH A O   1 
HETATM 1615 O  O   . HOH B 2 .   ? 5.680   29.469 59.235 1.00 23.88 ? 425 HOH A O   1 
HETATM 1616 O  O   . HOH B 2 .   ? 11.418  14.885 76.330 1.00 14.64 ? 426 HOH A O   1 
HETATM 1617 O  O   . HOH B 2 .   ? -1.079  11.826 67.693 1.00 15.39 ? 427 HOH A O   1 
HETATM 1618 O  O   . HOH B 2 .   ? -7.216  4.942  76.603 1.00 19.01 ? 428 HOH A O   1 
HETATM 1619 O  O   . HOH B 2 .   ? 7.219   26.881 59.262 1.00 20.52 ? 429 HOH A O   1 
HETATM 1620 O  O   . HOH B 2 .   ? -3.670  23.671 69.604 1.00 17.60 ? 430 HOH A O   1 
HETATM 1621 O  O   . HOH B 2 .   ? -6.545  16.819 73.713 1.00 32.11 ? 431 HOH A O   1 
HETATM 1622 O  O   . HOH B 2 .   ? -8.823  17.664 81.003 1.00 30.00 ? 432 HOH A O   1 
HETATM 1623 O  O   . HOH B 2 .   ? 23.885  29.072 57.972 1.00 21.95 ? 433 HOH A O   1 
HETATM 1624 O  O   . HOH B 2 .   ? 15.691  9.253  63.239 1.00 21.49 ? 434 HOH A O   1 
HETATM 1625 O  O   . HOH B 2 .   ? 18.915  33.736 66.082 1.00 19.54 ? 435 HOH A O   1 
HETATM 1626 O  O   . HOH B 2 .   ? 25.714  32.016 68.370 1.00 18.33 ? 436 HOH A O   1 
HETATM 1627 O  O   . HOH B 2 .   ? 22.962  20.957 71.317 1.00 18.52 ? 437 HOH A O   1 
HETATM 1628 O  O   . HOH B 2 .   ? 26.580  38.612 62.711 1.00 14.58 ? 438 HOH A O   1 
HETATM 1629 O  O   . HOH B 2 .   ? -20.698 19.747 84.707 1.00 23.08 ? 439 HOH A O   1 
HETATM 1630 O  O   . HOH B 2 .   ? -16.321 27.250 82.850 1.00 20.83 ? 440 HOH A O   1 
HETATM 1631 O  O   . HOH B 2 .   ? 14.053  32.654 67.377 1.00 26.95 ? 441 HOH A O   1 
HETATM 1632 O  O   . HOH B 2 .   ? -4.742  10.270 71.078 1.00 5.43  ? 442 HOH A O   1 
HETATM 1633 O  O   . HOH B 2 .   ? 4.349   29.668 69.761 1.00 7.87  ? 443 HOH A O   1 
HETATM 1634 O  O   . HOH B 2 .   ? -15.301 10.706 80.670 1.00 25.73 ? 444 HOH A O   1 
HETATM 1635 O  O   . HOH B 2 .   ? 27.464  34.425 68.326 1.00 12.48 ? 445 HOH A O   1 
HETATM 1636 O  O   . HOH B 2 .   ? 24.881  22.306 66.733 1.00 18.73 ? 446 HOH A O   1 
HETATM 1637 O  O   . HOH B 2 .   ? 0.100   21.801 67.162 1.00 16.21 ? 447 HOH A O   1 
HETATM 1638 O  O   . HOH B 2 .   ? -7.307  30.989 66.115 1.00 20.09 ? 448 HOH A O   1 
HETATM 1639 O  O   . HOH B 2 .   ? -16.168 13.137 69.660 1.00 28.15 ? 449 HOH A O   1 
HETATM 1640 O  O   . HOH B 2 .   ? -1.283  6.434  65.861 1.00 15.08 ? 450 HOH A O   1 
HETATM 1641 O  O   . HOH B 2 .   ? 10.021  18.021 81.327 1.00 30.72 ? 451 HOH A O   1 
HETATM 1642 O  O   . HOH B 2 .   ? 4.717   25.572 59.515 1.00 20.31 ? 452 HOH A O   1 
HETATM 1643 O  O   . HOH B 2 .   ? 18.364  33.541 63.223 1.00 29.94 ? 453 HOH A O   1 
HETATM 1644 O  O   . HOH B 2 .   ? -14.590 11.869 84.125 1.00 28.72 ? 454 HOH A O   1 
HETATM 1645 O  O   . HOH B 2 .   ? 17.624  9.130  65.323 1.00 23.00 ? 455 HOH A O   1 
HETATM 1646 O  O   . HOH B 2 .   ? -2.548  17.744 78.023 1.00 22.99 ? 456 HOH A O   1 
HETATM 1647 O  O   . HOH B 2 .   ? -2.272  18.184 60.964 1.00 27.61 ? 457 HOH A O   1 
HETATM 1648 O  O   . HOH B 2 .   ? -4.252  17.179 80.445 1.00 25.26 ? 458 HOH A O   1 
HETATM 1649 O  O   . HOH B 2 .   ? 25.260  23.530 60.898 1.00 34.73 ? 459 HOH A O   1 
HETATM 1650 O  O   . HOH B 2 .   ? 7.103   25.393 51.389 1.00 32.75 ? 460 HOH A O   1 
HETATM 1651 O  O   . HOH B 2 .   ? 5.630   17.447 52.997 1.00 22.87 ? 461 HOH A O   1 
HETATM 1652 O  O   . HOH B 2 .   ? -3.040  6.233  82.594 1.00 10.49 ? 462 HOH A O   1 
HETATM 1653 O  O   . HOH B 2 .   ? 8.351   8.351  86.105 0.50 9.89  ? 463 HOH A O   1 
HETATM 1654 O  O   . HOH B 2 .   ? 4.763   7.043  87.100 1.00 19.28 ? 464 HOH A O   1 
HETATM 1655 O  O   . HOH B 2 .   ? 7.415   36.525 78.373 1.00 26.59 ? 465 HOH A O   1 
HETATM 1656 O  O   . HOH B 2 .   ? -3.712  1.243  83.310 1.00 24.79 ? 466 HOH A O   1 
HETATM 1657 O  O   . HOH B 2 .   ? 6.048   5.241  88.402 1.00 22.60 ? 467 HOH A O   1 
HETATM 1658 O  O   . HOH B 2 .   ? -10.548 5.113  83.745 1.00 21.98 ? 468 HOH A O   1 
HETATM 1659 O  O   . HOH B 2 .   ? 17.079  10.686 52.938 1.00 17.55 ? 469 HOH A O   1 
HETATM 1660 O  O   . HOH B 2 .   ? -6.614  3.654  80.428 1.00 28.97 ? 470 HOH A O   1 
HETATM 1661 O  O   . HOH B 2 .   ? -1.835  16.487 86.596 1.00 24.14 ? 471 HOH A O   1 
HETATM 1662 O  O   . HOH B 2 .   ? -1.168  11.239 84.971 1.00 28.77 ? 472 HOH A O   1 
HETATM 1663 O  O   . HOH B 2 .   ? 4.570   14.698 84.388 1.00 24.61 ? 473 HOH A O   1 
HETATM 1664 O  O   . HOH B 2 .   ? 7.431   8.383  82.432 1.00 15.51 ? 474 HOH A O   1 
HETATM 1665 O  O   . HOH B 2 .   ? -0.545  14.034 84.705 1.00 20.65 ? 475 HOH A O   1 
HETATM 1666 O  O   . HOH B 2 .   ? 5.893   34.551 79.403 1.00 31.48 ? 476 HOH A O   1 
HETATM 1667 O  O   . HOH B 2 .   ? -8.121  5.068  82.439 1.00 27.47 ? 477 HOH A O   1 
HETATM 1668 O  O   . HOH B 2 .   ? -12.872 3.538  83.457 1.00 27.41 ? 478 HOH A O   1 
HETATM 1669 O  O   . HOH B 2 .   ? 8.274   9.880  91.283 1.00 23.41 ? 479 HOH A O   1 
HETATM 1670 O  O   . HOH B 2 .   ? 2.137   5.542  82.753 1.00 25.71 ? 480 HOH A O   1 
HETATM 1671 O  O   . HOH B 2 .   ? -0.322  3.962  83.510 1.00 20.46 ? 481 HOH A O   1 
HETATM 1672 O  O   . HOH B 2 .   ? -9.377  0.365  81.939 1.00 25.94 ? 482 HOH A O   1 
HETATM 1673 O  O   . HOH B 2 .   ? -0.444  8.704  86.380 1.00 27.35 ? 483 HOH A O   1 
HETATM 1674 O  O   . HOH B 2 .   ? 5.494   4.556  94.743 1.00 29.32 ? 484 HOH A O   1 
HETATM 1675 O  O   . HOH B 2 .   ? -21.020 13.609 79.071 1.00 34.43 ? 485 HOH A O   1 
HETATM 1676 O  O   . HOH B 2 .   ? 8.182   30.534 62.111 1.00 26.53 ? 486 HOH A O   1 
HETATM 1677 O  O   . HOH B 2 .   ? -0.428  32.983 69.095 1.00 27.34 ? 487 HOH A O   1 
HETATM 1678 O  O   . HOH B 2 .   ? -2.442  3.416  81.795 1.00 29.54 ? 488 HOH A O   1 
HETATM 1679 O  O   . HOH B 2 .   ? 16.894  22.965 56.245 1.00 23.28 ? 489 HOH A O   1 
HETATM 1680 O  O   . HOH B 2 .   ? -0.566  6.107  85.390 1.00 24.05 ? 490 HOH A O   1 
HETATM 1681 O  O   . HOH B 2 .   ? 32.754  32.165 66.452 1.00 31.41 ? 491 HOH A O   1 
HETATM 1682 O  O   . HOH B 2 .   ? -21.092 8.085  74.018 1.00 31.95 ? 492 HOH A O   1 
HETATM 1683 O  O   . HOH B 2 .   ? 6.482   10.134 93.745 1.00 24.00 ? 493 HOH A O   1 
HETATM 1684 O  O   . HOH B 2 .   ? 19.816  24.287 51.379 1.00 31.60 ? 494 HOH A O   1 
HETATM 1685 O  O   . HOH B 2 .   ? 7.686   22.817 32.656 1.00 31.04 ? 495 HOH A O   1 
HETATM 1686 O  O   . HOH B 2 .   ? -3.319  7.941  85.714 1.00 36.72 ? 496 HOH A O   1 
HETATM 1687 O  O   . HOH B 2 .   ? 17.778  13.046 51.128 1.00 35.15 ? 497 HOH A O   1 
HETATM 1688 O  O   . HOH B 2 .   ? 19.703  23.601 55.618 1.00 24.23 ? 498 HOH A O   1 
HETATM 1689 O  O   . HOH B 2 .   ? 1.847   4.934  86.054 1.00 24.38 ? 499 HOH A O   1 
HETATM 1690 O  O   . HOH B 2 .   ? -8.407  8.407  86.105 0.50 16.42 ? 500 HOH A O   1 
HETATM 1691 O  O   . HOH B 2 .   ? 22.686  14.737 47.199 1.00 33.71 ? 501 HOH A O   1 
HETATM 1692 O  O   . HOH B 2 .   ? -18.668 3.804  76.741 1.00 31.93 ? 502 HOH A O   1 
HETATM 1693 O  O   . HOH B 2 .   ? -24.458 10.268 78.768 1.00 32.97 ? 503 HOH A O   1 
HETATM 1694 O  O   . HOH B 2 .   ? -6.119  16.128 55.692 1.00 23.13 ? 504 HOH A O   1 
HETATM 1695 O  O   . HOH B 2 .   ? 26.648  38.588 52.736 1.00 38.00 ? 505 HOH A O   1 
HETATM 1696 O  O   . HOH B 2 .   ? 10.146  15.798 89.134 1.00 22.33 ? 506 HOH A O   1 
HETATM 1697 O  O   . HOH B 2 .   ? 5.899   19.312 54.933 1.00 27.81 ? 507 HOH A O   1 
HETATM 1698 O  O   . HOH B 2 .   ? 12.112  29.968 79.025 1.00 38.65 ? 508 HOH A O   1 
HETATM 1699 O  O   . HOH B 2 .   ? 21.900  32.092 71.070 1.00 36.41 ? 509 HOH A O   1 
HETATM 1700 O  O   . HOH B 2 .   ? -5.261  26.205 83.352 1.00 18.41 ? 510 HOH A O   1 
HETATM 1701 O  O   . HOH B 2 .   ? -9.982  -0.675 78.377 1.00 27.78 ? 511 HOH A O   1 
HETATM 1702 O  O   . HOH B 2 .   ? 11.714  25.382 84.195 1.00 34.38 ? 512 HOH A O   1 
HETATM 1703 O  O   . HOH B 2 .   ? -8.975  19.112 88.029 1.00 25.19 ? 513 HOH A O   1 
HETATM 1704 O  O   . HOH B 2 .   ? 13.248  30.152 61.457 1.00 35.88 ? 514 HOH A O   1 
HETATM 1705 O  O   . HOH B 2 .   ? -6.730  26.947 76.582 1.00 44.06 ? 515 HOH A O   1 
HETATM 1706 O  O   . HOH B 2 .   ? 8.454   1.105  68.021 1.00 36.84 ? 516 HOH A O   1 
HETATM 1707 O  O   . HOH B 2 .   ? 2.347   7.180  56.412 1.00 33.52 ? 517 HOH A O   1 
HETATM 1708 O  O   . HOH B 2 .   ? -17.643 11.865 79.283 1.00 31.52 ? 518 HOH A O   1 
HETATM 1709 O  O   . HOH B 2 .   ? 29.258  40.014 53.815 1.00 29.05 ? 519 HOH A O   1 
HETATM 1710 O  O   . HOH B 2 .   ? -4.380  13.271 72.059 1.00 46.09 ? 520 HOH A O   1 
HETATM 1711 O  O   . HOH B 2 .   ? 13.805  30.236 58.532 1.00 43.16 ? 521 HOH A O   1 
HETATM 1712 O  O   . HOH B 2 .   ? 14.689  28.573 56.329 1.00 26.90 ? 522 HOH A O   1 
HETATM 1713 O  O   . HOH B 2 .   ? 10.129  4.624  57.782 1.00 33.98 ? 523 HOH A O   1 
HETATM 1714 O  O   . HOH B 2 .   ? 33.439  33.395 63.152 1.00 20.99 ? 524 HOH A O   1 
HETATM 1715 O  O   . HOH B 2 .   ? -10.266 15.725 82.921 1.00 30.84 ? 525 HOH A O   1 
HETATM 1716 O  O   . HOH B 2 .   ? 9.649   12.773 53.610 1.00 42.72 ? 526 HOH A O   1 
HETATM 1717 O  O   . HOH B 2 .   ? 8.827   0.643  65.228 1.00 30.41 ? 527 HOH A O   1 
HETATM 1718 O  O   . HOH B 2 .   ? 19.366  16.222 52.485 1.00 39.01 ? 528 HOH A O   1 
HETATM 1719 O  O   . HOH B 2 .   ? -2.888  14.907 79.457 1.00 26.52 ? 529 HOH A O   1 
HETATM 1720 O  O   . HOH B 2 .   ? 5.294   -0.760 62.918 1.00 29.11 ? 530 HOH A O   1 
HETATM 1721 O  O   . HOH B 2 .   ? -2.847  0.792  80.663 1.00 37.61 ? 531 HOH A O   1 
HETATM 1722 O  O   . HOH B 2 .   ? -3.075  17.349 63.631 1.00 38.04 ? 532 HOH A O   1 
HETATM 1723 O  O   . HOH B 2 .   ? 25.780  19.711 62.693 1.00 33.12 ? 533 HOH A O   1 
HETATM 1724 O  O   . HOH B 2 .   ? -12.909 14.426 85.104 1.00 30.33 ? 534 HOH A O   1 
HETATM 1725 O  O   . HOH B 2 .   ? 12.422  4.780  60.217 1.00 39.24 ? 535 HOH A O   1 
HETATM 1726 O  O   . HOH B 2 .   ? -2.764  20.445 68.288 1.00 29.03 ? 536 HOH A O   1 
HETATM 1727 O  O   . HOH B 2 .   ? 21.090  12.788 73.673 1.00 42.32 ? 537 HOH A O   1 
HETATM 1728 O  O   . HOH B 2 .   ? -12.195 17.362 87.131 1.00 34.83 ? 538 HOH A O   1 
HETATM 1729 O  O   . HOH B 2 .   ? 3.245   3.584  88.540 1.00 29.11 ? 539 HOH A O   1 
HETATM 1730 O  O   . HOH B 2 .   ? -0.171  23.390 64.514 1.00 34.84 ? 540 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   39  ?   ?   ?   A . n 
A 1 2   SER 2   40  ?   ?   ?   A . n 
A 1 3   LYS 3   41  ?   ?   ?   A . n 
A 1 4   LYS 4   42  ?   ?   ?   A . n 
A 1 5   ARG 5   43  43  ARG ARG A . n 
A 1 6   GLN 6   44  44  GLN GLN A . n 
A 1 7   ARG 7   45  45  ARG ARG A . n 
A 1 8   PHE 8   46  46  PHE PHE A . n 
A 1 9   VAL 9   47  47  VAL VAL A . n 
A 1 10  ASP 10  48  48  ASP ASP A . n 
A 1 11  LYS 11  49  49  LYS LYS A . n 
A 1 12  ASN 12  50  50  ASN ASN A . n 
A 1 13  GLY 13  51  51  GLY GLY A . n 
A 1 14  ARG 14  52  52  ARG ARG A . n 
A 1 15  CYS 15  53  53  CYS CYS A . n 
A 1 16  ASN 16  54  54  ASN ASN A . n 
A 1 17  VAL 17  55  55  VAL VAL A . n 
A 1 18  GLN 18  56  56  GLN GLN A . n 
A 1 19  HIS 19  57  57  HIS HIS A . n 
A 1 20  GLY 20  58  ?   ?   ?   A . n 
A 1 21  ASN 21  59  ?   ?   ?   A . n 
A 1 22  LEU 22  60  ?   ?   ?   A . n 
A 1 23  GLY 23  61  ?   ?   ?   A . n 
A 1 24  SER 24  62  ?   ?   ?   A . n 
A 1 25  GLU 25  63  63  GLU GLU A . n 
A 1 26  ARG 26  190 190 ARG ARG A . n 
A 1 27  ALA 27  191 191 ALA ALA A . n 
A 1 28  GLU 28  192 192 GLU GLU A . n 
A 1 29  THR 29  193 193 THR THR A . n 
A 1 30  LEU 30  194 194 LEU LEU A . n 
A 1 31  MSE 31  195 195 MSE MET A . n 
A 1 32  PHE 32  196 196 PHE PHE A . n 
A 1 33  SER 33  197 197 SER SER A . n 
A 1 34  GLU 34  198 198 GLU GLU A . n 
A 1 35  HIS 35  199 199 HIS HIS A . n 
A 1 36  ALA 36  200 200 ALA ALA A . n 
A 1 37  VAL 37  201 201 VAL VAL A . n 
A 1 38  ILE 38  202 202 ILE ILE A . n 
A 1 39  SER 39  203 203 SER SER A . n 
A 1 40  MSE 40  204 204 MSE MET A . n 
A 1 41  ARG 41  205 205 ARG ARG A . n 
A 1 42  ASP 42  206 206 ASP ASP A . n 
A 1 43  GLY 43  207 207 GLY GLY A . n 
A 1 44  LYS 44  208 208 LYS LYS A . n 
A 1 45  LEU 45  209 209 LEU LEU A . n 
A 1 46  THR 46  210 210 THR THR A . n 
A 1 47  LEU 47  211 211 LEU LEU A . n 
A 1 48  MSE 48  212 212 MSE MET A . n 
A 1 49  PHE 49  213 213 PHE PHE A . n 
A 1 50  ARG 50  214 214 ARG ARG A . n 
A 1 51  VAL 51  215 215 VAL VAL A . n 
A 1 52  GLY 52  216 216 GLY GLY A . n 
A 1 53  ASN 53  217 217 ASN ASN A . n 
A 1 54  LEU 54  218 218 LEU LEU A . n 
A 1 55  ARG 55  219 219 ARG ARG A . n 
A 1 56  ASN 56  220 220 ASN ASN A . n 
A 1 57  SER 57  221 221 SER SER A . n 
A 1 58  HIS 58  222 222 HIS HIS A . n 
A 1 59  MSE 59  223 223 MSE MET A . n 
A 1 60  VAL 60  224 224 VAL VAL A . n 
A 1 61  SER 61  225 225 SER SER A . n 
A 1 62  ALA 62  226 226 ALA ALA A . n 
A 1 63  GLN 63  227 227 GLN GLN A . n 
A 1 64  ILE 64  228 228 ILE ILE A . n 
A 1 65  ARG 65  229 229 ARG ARG A . n 
A 1 66  CYS 66  230 230 CYS CYS A . n 
A 1 67  LYS 67  231 231 LYS LYS A . n 
A 1 68  LEU 68  232 232 LEU LEU A . n 
A 1 69  LEU 69  233 233 LEU LEU A . n 
A 1 70  LYS 70  234 234 LYS LYS A . n 
A 1 71  SER 71  235 235 SER SER A . n 
A 1 72  ARG 72  236 236 ARG ARG A . n 
A 1 73  GLN 73  237 237 GLN GLN A . n 
A 1 74  THR 74  238 238 THR THR A . n 
A 1 75  PRO 75  239 239 PRO PRO A . n 
A 1 76  GLU 76  240 240 GLU GLU A . n 
A 1 77  GLY 77  241 241 GLY GLY A . n 
A 1 78  GLU 78  242 242 GLU GLU A . n 
A 1 79  PHE 79  243 243 PHE PHE A . n 
A 1 80  LEU 80  244 244 LEU LEU A . n 
A 1 81  PRO 81  245 245 PRO PRO A . n 
A 1 82  LEU 82  246 246 LEU LEU A . n 
A 1 83  ASP 83  247 247 ASP ASP A . n 
A 1 84  GLN 84  248 248 GLN GLN A . n 
A 1 85  LEU 85  249 249 LEU LEU A . n 
A 1 86  GLU 86  250 250 GLU GLU A . n 
A 1 87  LEU 87  251 251 LEU LEU A . n 
A 1 88  ASP 88  252 252 ASP ASP A . n 
A 1 89  VAL 89  253 253 VAL VAL A . n 
A 1 90  GLY 90  254 254 GLY GLY A . n 
A 1 91  PHE 91  255 255 PHE PHE A . n 
A 1 92  SER 92  256 256 SER SER A . n 
A 1 93  THR 93  257 257 THR THR A . n 
A 1 94  GLY 94  258 258 GLY GLY A . n 
A 1 95  ALA 95  259 259 ALA ALA A . n 
A 1 96  ASP 96  260 260 ASP ASP A . n 
A 1 97  GLN 97  261 261 GLN GLN A . n 
A 1 98  LEU 98  262 262 LEU LEU A . n 
A 1 99  PHE 99  263 263 PHE PHE A . n 
A 1 100 LEU 100 264 264 LEU LEU A . n 
A 1 101 VAL 101 265 265 VAL VAL A . n 
A 1 102 SER 102 266 266 SER SER A . n 
A 1 103 PRO 103 267 267 PRO PRO A . n 
A 1 104 LEU 104 268 268 LEU LEU A . n 
A 1 105 THR 105 269 269 THR THR A . n 
A 1 106 ILE 106 270 270 ILE ILE A . n 
A 1 107 CYS 107 271 271 CYS CYS A . n 
A 1 108 HIS 108 272 272 HIS HIS A . n 
A 1 109 VAL 109 273 273 VAL VAL A . n 
A 1 110 ILE 110 274 274 ILE ILE A . n 
A 1 111 ASP 111 275 275 ASP ASP A . n 
A 1 112 ALA 112 276 276 ALA ALA A . n 
A 1 113 LYS 113 277 277 LYS LYS A . n 
A 1 114 SER 114 278 278 SER SER A . n 
A 1 115 PRO 115 279 279 PRO PRO A . n 
A 1 116 PHE 116 280 280 PHE PHE A . n 
A 1 117 TYR 117 281 281 TYR TYR A . n 
A 1 118 ASP 118 282 282 ASP ASP A . n 
A 1 119 LEU 119 283 283 LEU LEU A . n 
A 1 120 SER 120 284 284 SER SER A . n 
A 1 121 GLN 121 285 285 GLN GLN A . n 
A 1 122 ARG 122 286 286 ARG ARG A . n 
A 1 123 SER 123 287 287 SER SER A . n 
A 1 124 MSE 124 288 288 MSE MET A . n 
A 1 125 GLN 125 289 289 GLN GLN A . n 
A 1 126 THR 126 290 290 THR THR A . n 
A 1 127 GLU 127 291 291 GLU GLU A . n 
A 1 128 GLN 128 292 292 GLN GLN A . n 
A 1 129 PHE 129 293 293 PHE PHE A . n 
A 1 130 GLU 130 294 294 GLU GLU A . n 
A 1 131 VAL 131 295 295 VAL VAL A . n 
A 1 132 VAL 132 296 296 VAL VAL A . n 
A 1 133 VAL 133 297 297 VAL VAL A . n 
A 1 134 ILE 134 298 298 ILE ILE A . n 
A 1 135 LEU 135 299 299 LEU LEU A . n 
A 1 136 GLU 136 300 300 GLU GLU A . n 
A 1 137 GLY 137 301 301 GLY GLY A . n 
A 1 138 ILE 138 302 302 ILE ILE A . n 
A 1 139 VAL 139 303 303 VAL VAL A . n 
A 1 140 GLU 140 304 304 GLU GLU A . n 
A 1 141 THR 141 305 305 THR THR A . n 
A 1 142 THR 142 306 306 THR THR A . n 
A 1 143 GLY 143 307 307 GLY GLY A . n 
A 1 144 MSE 144 308 308 MSE MET A . n 
A 1 145 THR 145 309 309 THR THR A . n 
A 1 146 CYS 146 310 310 CYS CYS A . n 
A 1 147 GLN 147 311 311 GLN GLN A . n 
A 1 148 ALA 148 312 312 ALA ALA A . n 
A 1 149 ARG 149 313 313 ARG ARG A . n 
A 1 150 THR 150 314 314 THR THR A . n 
A 1 151 SER 151 315 315 SER SER A . n 
A 1 152 TYR 152 316 316 TYR TYR A . n 
A 1 153 THR 153 317 317 THR THR A . n 
A 1 154 GLU 154 318 318 GLU GLU A . n 
A 1 155 ASP 155 319 319 ASP ASP A . n 
A 1 156 GLU 156 320 320 GLU GLU A . n 
A 1 157 VAL 157 321 321 VAL VAL A . n 
A 1 158 LEU 158 322 322 LEU LEU A . n 
A 1 159 TRP 159 323 323 TRP TRP A . n 
A 1 160 GLY 160 324 324 GLY GLY A . n 
A 1 161 HIS 161 325 325 HIS HIS A . n 
A 1 162 ARG 162 326 326 ARG ARG A . n 
A 1 163 PHE 163 327 327 PHE PHE A . n 
A 1 164 PHE 164 328 328 PHE PHE A . n 
A 1 165 PRO 165 329 329 PRO PRO A . n 
A 1 166 VAL 166 330 330 VAL VAL A . n 
A 1 167 ILE 167 331 331 ILE ILE A . n 
A 1 168 SER 168 332 332 SER SER A . n 
A 1 169 LEU 169 333 333 LEU LEU A . n 
A 1 170 GLU 170 334 334 GLU GLU A . n 
A 1 171 GLU 171 335 335 GLU GLU A . n 
A 1 172 GLY 172 336 336 GLY GLY A . n 
A 1 173 PHE 173 337 337 PHE PHE A . n 
A 1 174 PHE 174 338 338 PHE PHE A . n 
A 1 175 LYS 175 339 339 LYS LYS A . n 
A 1 176 VAL 176 340 340 VAL VAL A . n 
A 1 177 ASP 177 341 341 ASP ASP A . n 
A 1 178 TYR 178 342 342 TYR TYR A . n 
A 1 179 SER 179 343 343 SER SER A . n 
A 1 180 GLN 180 344 344 GLN GLN A . n 
A 1 181 PHE 181 345 345 PHE PHE A . n 
A 1 182 HIS 182 346 346 HIS HIS A . n 
A 1 183 ALA 183 347 347 ALA ALA A . n 
A 1 184 THR 184 348 348 THR THR A . n 
A 1 185 PHE 185 349 349 PHE PHE A . n 
A 1 186 GLU 186 350 350 GLU GLU A . n 
A 1 187 VAL 187 351 351 VAL VAL A . n 
A 1 188 PRO 188 352 352 PRO PRO A . n 
A 1 189 THR 189 353 353 THR THR A . n 
A 1 190 PRO 190 354 354 PRO PRO A . n 
A 1 191 PRO 191 355 355 PRO PRO A . n 
A 1 192 TYR 192 356 356 TYR TYR A . n 
A 1 193 SER 193 357 357 SER SER A . n 
A 1 194 VAL 194 358 358 VAL VAL A . n 
A 1 195 LYS 195 359 359 LYS LYS A . n 
A 1 196 GLU 196 360 360 GLU GLU A . n 
A 1 197 GLN 197 361 361 GLN GLN A . n 
A 1 198 GLU 198 362 362 GLU GLU A . n 
A 1 199 GLU 199 363 363 GLU GLU A . n 
A 1 200 MSE 200 364 364 MSE MET A . n 
A 1 201 LEU 201 365 365 LEU LEU A . n 
A 1 202 LEU 202 366 366 LEU LEU A . n 
A 1 203 MSE 203 367 367 MSE MET A . n 
A 1 204 SER 204 368 368 SER SER A . n 
A 1 205 SER 205 369 369 SER SER A . n 
A 1 206 PRO 206 370 370 PRO PRO A . n 
A 1 207 LEU 207 371 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   401 401 HOH HOH A . 
B 2 HOH 2   402 402 HOH HOH A . 
B 2 HOH 3   403 403 HOH HOH A . 
B 2 HOH 4   404 404 HOH HOH A . 
B 2 HOH 5   405 405 HOH HOH A . 
B 2 HOH 6   406 406 HOH HOH A . 
B 2 HOH 7   407 407 HOH HOH A . 
B 2 HOH 8   408 408 HOH HOH A . 
B 2 HOH 9   409 409 HOH HOH A . 
B 2 HOH 10  410 410 HOH HOH A . 
B 2 HOH 11  411 411 HOH HOH A . 
B 2 HOH 12  412 412 HOH HOH A . 
B 2 HOH 13  413 413 HOH HOH A . 
B 2 HOH 14  414 414 HOH HOH A . 
B 2 HOH 15  415 415 HOH HOH A . 
B 2 HOH 16  416 416 HOH HOH A . 
B 2 HOH 17  417 417 HOH HOH A . 
B 2 HOH 18  418 418 HOH HOH A . 
B 2 HOH 19  419 419 HOH HOH A . 
B 2 HOH 20  420 420 HOH HOH A . 
B 2 HOH 21  421 421 HOH HOH A . 
B 2 HOH 22  422 422 HOH HOH A . 
B 2 HOH 23  423 423 HOH HOH A . 
B 2 HOH 24  424 424 HOH HOH A . 
B 2 HOH 25  425 425 HOH HOH A . 
B 2 HOH 26  426 426 HOH HOH A . 
B 2 HOH 27  427 427 HOH HOH A . 
B 2 HOH 28  428 428 HOH HOH A . 
B 2 HOH 29  429 429 HOH HOH A . 
B 2 HOH 30  430 430 HOH HOH A . 
B 2 HOH 31  431 431 HOH HOH A . 
B 2 HOH 32  432 432 HOH HOH A . 
B 2 HOH 33  433 433 HOH HOH A . 
B 2 HOH 34  434 434 HOH HOH A . 
B 2 HOH 35  435 435 HOH HOH A . 
B 2 HOH 36  436 436 HOH HOH A . 
B 2 HOH 37  437 437 HOH HOH A . 
B 2 HOH 38  438 438 HOH HOH A . 
B 2 HOH 39  439 439 HOH HOH A . 
B 2 HOH 40  440 440 HOH HOH A . 
B 2 HOH 41  441 441 HOH HOH A . 
B 2 HOH 42  442 442 HOH HOH A . 
B 2 HOH 43  443 443 HOH HOH A . 
B 2 HOH 44  444 444 HOH HOH A . 
B 2 HOH 45  445 445 HOH HOH A . 
B 2 HOH 46  446 446 HOH HOH A . 
B 2 HOH 47  447 447 HOH HOH A . 
B 2 HOH 48  448 448 HOH HOH A . 
B 2 HOH 49  449 449 HOH HOH A . 
B 2 HOH 50  450 450 HOH HOH A . 
B 2 HOH 51  451 451 HOH HOH A . 
B 2 HOH 52  452 452 HOH HOH A . 
B 2 HOH 53  453 453 HOH HOH A . 
B 2 HOH 54  454 454 HOH HOH A . 
B 2 HOH 55  455 455 HOH HOH A . 
B 2 HOH 56  456 456 HOH HOH A . 
B 2 HOH 57  457 457 HOH HOH A . 
B 2 HOH 58  458 458 HOH HOH A . 
B 2 HOH 59  459 459 HOH HOH A . 
B 2 HOH 60  460 460 HOH HOH A . 
B 2 HOH 61  461 461 HOH HOH A . 
B 2 HOH 62  462 462 HOH HOH A . 
B 2 HOH 63  463 463 HOH HOH A . 
B 2 HOH 64  464 464 HOH HOH A . 
B 2 HOH 65  465 465 HOH HOH A . 
B 2 HOH 66  466 466 HOH HOH A . 
B 2 HOH 67  467 467 HOH HOH A . 
B 2 HOH 68  468 468 HOH HOH A . 
B 2 HOH 69  469 469 HOH HOH A . 
B 2 HOH 70  470 470 HOH HOH A . 
B 2 HOH 71  471 471 HOH HOH A . 
B 2 HOH 72  472 472 HOH HOH A . 
B 2 HOH 73  473 473 HOH HOH A . 
B 2 HOH 74  474 474 HOH HOH A . 
B 2 HOH 75  475 475 HOH HOH A . 
B 2 HOH 76  476 476 HOH HOH A . 
B 2 HOH 77  477 477 HOH HOH A . 
B 2 HOH 78  478 478 HOH HOH A . 
B 2 HOH 79  479 479 HOH HOH A . 
B 2 HOH 80  480 480 HOH HOH A . 
B 2 HOH 81  481 481 HOH HOH A . 
B 2 HOH 82  482 482 HOH HOH A . 
B 2 HOH 83  483 483 HOH HOH A . 
B 2 HOH 84  484 484 HOH HOH A . 
B 2 HOH 85  485 485 HOH HOH A . 
B 2 HOH 86  486 486 HOH HOH A . 
B 2 HOH 87  487 487 HOH HOH A . 
B 2 HOH 88  488 488 HOH HOH A . 
B 2 HOH 89  489 489 HOH HOH A . 
B 2 HOH 90  490 490 HOH HOH A . 
B 2 HOH 91  491 491 HOH HOH A . 
B 2 HOH 92  492 492 HOH HOH A . 
B 2 HOH 93  493 493 HOH HOH A . 
B 2 HOH 94  494 494 HOH HOH A . 
B 2 HOH 95  495 495 HOH HOH A . 
B 2 HOH 96  496 496 HOH HOH A . 
B 2 HOH 97  497 497 HOH HOH A . 
B 2 HOH 98  498 498 HOH HOH A . 
B 2 HOH 99  499 499 HOH HOH A . 
B 2 HOH 100 500 500 HOH HOH A . 
B 2 HOH 101 501 501 HOH HOH A . 
B 2 HOH 102 502 502 HOH HOH A . 
B 2 HOH 103 503 503 HOH HOH A . 
B 2 HOH 104 504 504 HOH HOH A . 
B 2 HOH 105 505 505 HOH HOH A . 
B 2 HOH 106 506 506 HOH HOH A . 
B 2 HOH 107 507 507 HOH HOH A . 
B 2 HOH 108 508 508 HOH HOH A . 
B 2 HOH 109 509 509 HOH HOH A . 
B 2 HOH 110 510 510 HOH HOH A . 
B 2 HOH 111 511 511 HOH HOH A . 
B 2 HOH 112 512 512 HOH HOH A . 
B 2 HOH 113 513 513 HOH HOH A . 
B 2 HOH 114 514 514 HOH HOH A . 
B 2 HOH 115 515 515 HOH HOH A . 
B 2 HOH 116 516 516 HOH HOH A . 
B 2 HOH 117 517 517 HOH HOH A . 
B 2 HOH 118 518 518 HOH HOH A . 
B 2 HOH 119 519 519 HOH HOH A . 
B 2 HOH 120 520 520 HOH HOH A . 
B 2 HOH 121 521 521 HOH HOH A . 
B 2 HOH 122 522 522 HOH HOH A . 
B 2 HOH 123 523 523 HOH HOH A . 
B 2 HOH 124 524 524 HOH HOH A . 
B 2 HOH 125 525 525 HOH HOH A . 
B 2 HOH 126 526 526 HOH HOH A . 
B 2 HOH 127 527 527 HOH HOH A . 
B 2 HOH 128 528 528 HOH HOH A . 
B 2 HOH 129 529 529 HOH HOH A . 
B 2 HOH 130 530 530 HOH HOH A . 
B 2 HOH 131 531 531 HOH HOH A . 
B 2 HOH 132 532 532 HOH HOH A . 
B 2 HOH 133 533 533 HOH HOH A . 
B 2 HOH 134 534 534 HOH HOH A . 
B 2 HOH 135 535 535 HOH HOH A . 
B 2 HOH 136 536 536 HOH HOH A . 
B 2 HOH 137 537 537 HOH HOH A . 
B 2 HOH 138 538 538 HOH HOH A . 
B 2 HOH 139 539 539 HOH HOH A . 
B 2 HOH 140 540 540 HOH HOH A . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A MSE 31  A MSE 195 ? MET SELENOMETHIONINE 
2 A MSE 40  A MSE 204 ? MET SELENOMETHIONINE 
3 A MSE 48  A MSE 212 ? MET SELENOMETHIONINE 
4 A MSE 59  A MSE 223 ? MET SELENOMETHIONINE 
5 A MSE 124 A MSE 288 ? MET SELENOMETHIONINE 
6 A MSE 144 A MSE 308 ? MET SELENOMETHIONINE 
7 A MSE 200 A MSE 364 ? MET SELENOMETHIONINE 
8 A MSE 203 A MSE 367 ? MET SELENOMETHIONINE 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 10360 ? 
1 MORE         -9    ? 
1 'SSA (A^2)'  36540 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_565 -x,-y+1,z      -1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
-1.0000000000 0.0000000000 76.0200000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_555 -y+1/2,x+1/2,z 0.0000000000  -1.0000000000 0.0000000000 38.0100000000  1.0000000000  
0.0000000000  0.0000000000 38.0100000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_455 y-1/2,-x+1/2,z 0.0000000000  1.0000000000  0.0000000000 -38.0100000000 -1.0000000000 
0.0000000000  0.0000000000 38.0100000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 463 ? B HOH . 
2 1 A HOH 500 ? B HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-01-07 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-08-02 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
5 4 'Structure model' 'Source and taxonomy'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen 
2 4 'Structure model' software       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
MLPHARE   phasing          . ? 3 
CNS       refinement       . ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 54  ? ? -102.24 57.53  
2 1 GLU A 192 ? ? -68.60  84.65  
3 1 SER A 221 ? ? -154.64 79.97  
4 1 THR A 257 ? ? -144.22 -27.20 
5 1 GLU A 335 ? ? 76.82   61.92  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 39  ? A GLY 1   
2  1 Y 1 A SER 40  ? A SER 2   
3  1 Y 1 A LYS 41  ? A LYS 3   
4  1 Y 1 A LYS 42  ? A LYS 4   
5  1 Y 1 A GLY 58  ? A GLY 20  
6  1 Y 1 A ASN 59  ? A ASN 21  
7  1 Y 1 A LEU 60  ? A LEU 22  
8  1 Y 1 A GLY 61  ? A GLY 23  
9  1 Y 1 A SER 62  ? A SER 24  
10 1 Y 1 A LEU 371 ? A LEU 207 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#