data_1NB0
# 
_entry.id   1NB0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1NB0         
RCSB  RCSB017728   
WWPDB D_1000017728 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1nb9 . unspecified 
PDB 1nbg . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NB0 
_pdbx_database_status.recvd_initial_deposition_date   2002-12-01 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Karthikeyan, S.' 1 
'Zhou, Q.'        2 
'Mseeh, F.'       3 
'Grishin, N.V.'   4 
'Osterman, A.L.'  5 
'Zhang, H.'       6 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure of Human Riboflavin Kinase Reveals a Beta Barrel Fold and a Novel Active Site Arch' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            11 
_citation.page_first                265 
_citation.page_last                 273 
_citation.year                      2003 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12623014 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(03)00024-8' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Karthikeyan, S.' 1 
primary 'Zhou, Q.'        2 
primary 'Mseeh, F.'       3 
primary 'Grishin, N.V.'   4 
primary 'Osterman, A.L.'  5 
primary 'Zhang, H.'       6 
# 
_cell.entry_id           1NB0 
_cell.length_a           57.096 
_cell.length_b           57.096 
_cell.length_c           82.505 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1NB0 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'hypothetical protein FLJ11149' 16772.084 1   2.7.1.26 ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'                 24.305    1   ?        ? ? ? 
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"      427.201   1   ?        ? ? ? 
4 water       nat water                           18.015    130 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Riboflavin kinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPYYKNTKKSMETH
IMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEYLKIKEDNFFQVSK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPYYKNTKKSMETH
IMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEYLKIKEDNFFQVSK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   HIS n 
1 3   LEU n 
1 4   PRO n 
1 5   TYR n 
1 6   PHE n 
1 7   CYS n 
1 8   ARG n 
1 9   GLY n 
1 10  GLN n 
1 11  VAL n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  PHE n 
1 16  GLY n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  LYS n 
1 21  GLN n 
1 22  LEU n 
1 23  GLY n 
1 24  ILE n 
1 25  PRO n 
1 26  THR n 
1 27  ALA n 
1 28  ASN n 
1 29  PHE n 
1 30  PRO n 
1 31  GLU n 
1 32  GLN n 
1 33  VAL n 
1 34  VAL n 
1 35  ASP n 
1 36  ASN n 
1 37  LEU n 
1 38  PRO n 
1 39  ALA n 
1 40  ASP n 
1 41  ILE n 
1 42  SER n 
1 43  THR n 
1 44  GLY n 
1 45  ILE n 
1 46  TYR n 
1 47  TYR n 
1 48  GLY n 
1 49  TRP n 
1 50  ALA n 
1 51  SER n 
1 52  VAL n 
1 53  GLY n 
1 54  SER n 
1 55  GLY n 
1 56  ASP n 
1 57  VAL n 
1 58  HIS n 
1 59  LYS n 
1 60  MET n 
1 61  VAL n 
1 62  VAL n 
1 63  SER n 
1 64  ILE n 
1 65  GLY n 
1 66  TRP n 
1 67  ASN n 
1 68  PRO n 
1 69  TYR n 
1 70  TYR n 
1 71  LYS n 
1 72  ASN n 
1 73  THR n 
1 74  LYS n 
1 75  LYS n 
1 76  SER n 
1 77  MET n 
1 78  GLU n 
1 79  THR n 
1 80  HIS n 
1 81  ILE n 
1 82  MET n 
1 83  HIS n 
1 84  THR n 
1 85  PHE n 
1 86  LYS n 
1 87  GLU n 
1 88  ASP n 
1 89  PHE n 
1 90  TYR n 
1 91  GLY n 
1 92  GLU n 
1 93  ILE n 
1 94  LEU n 
1 95  ASN n 
1 96  VAL n 
1 97  ALA n 
1 98  ILE n 
1 99  VAL n 
1 100 GLY n 
1 101 TYR n 
1 102 LEU n 
1 103 ARG n 
1 104 PRO n 
1 105 GLU n 
1 106 LYS n 
1 107 ASN n 
1 108 PHE n 
1 109 ASP n 
1 110 SER n 
1 111 LEU n 
1 112 GLU n 
1 113 SER n 
1 114 LEU n 
1 115 ILE n 
1 116 SER n 
1 117 ALA n 
1 118 ILE n 
1 119 GLN n 
1 120 GLY n 
1 121 ASP n 
1 122 ILE n 
1 123 GLU n 
1 124 GLU n 
1 125 ALA n 
1 126 LYS n 
1 127 LYS n 
1 128 ARG n 
1 129 LEU n 
1 130 GLU n 
1 131 LEU n 
1 132 PRO n 
1 133 GLU n 
1 134 TYR n 
1 135 LEU n 
1 136 LYS n 
1 137 ILE n 
1 138 LYS n 
1 139 GLU n 
1 140 ASP n 
1 141 ASN n 
1 142 PHE n 
1 143 PHE n 
1 144 GLN n 
1 145 VAL n 
1 146 SER n 
1 147 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 FLJ11149 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                brain 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pPROEX-Hta 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RIFK_HUMAN 
_struct_ref.pdbx_db_accession          Q969G6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPYYKNTKKSMETH
IMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEHLKIKEDNFFQVSK
;
_struct_ref.pdbx_align_begin           9 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1NB0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 147 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q969G6 
_struct_ref_seq.db_align_beg                  9 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  155 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       9 
_struct_ref_seq.pdbx_auth_seq_align_end       155 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1NB0 
_struct_ref_seq_dif.mon_id                       TYR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      134 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q969G6 
_struct_ref_seq_dif.db_mon_id                    HIS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          142 
_struct_ref_seq_dif.details                      CONFLICT 
_struct_ref_seq_dif.pdbx_auth_seq_num            142 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1NB0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.06 
_exptl_crystal.density_percent_sol   39.69 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'NA cadodalyte, Mg acetate, PEG 8000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   CUSTOM-MADE 
_diffrn_detector.pdbx_collection_date   2002-08-25 
_diffrn_detector.details                MIRROR 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'ROSENBAUM-ROCK DOUBLE CRYSTAL MONOCHROMATOR' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0080 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0080 
# 
_reflns.entry_id                     1NB0 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.700 
_reflns.number_obs                   17010 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         95.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.036 
_reflns.pdbx_netI_over_sigmaI        49.2000 
_reflns.B_iso_Wilson_estimate        20.32 
_reflns.pdbx_redundancy              12.470 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   83.2 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.2 
_reflns_shell.meanI_over_sigI_obs    4.300 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1NB0 
_refine.ls_number_reflns_obs                     15843 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.39 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    94.36 
_refine.ls_R_factor_obs                          0.186 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.184 
_refine.ls_R_factor_R_free                       0.221 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  861 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.954 
_refine.correlation_coeff_Fo_to_Fc_free          0.940 
_refine.B_iso_mean                               15.50 
_refine.aniso_B[1][1]                            -0.21 
_refine.aniso_B[2][2]                            -0.21 
_refine.aniso_B[3][3]                            0.32 
_refine.aniso_B[1][2]                            -0.11 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.116 
_refine.pdbx_overall_ESU_R_Free                  0.113 
_refine.overall_SU_ML                            0.075 
_refine.overall_SU_B                             2.264 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1177 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         28 
_refine_hist.number_atoms_solvent             130 
_refine_hist.number_atoms_total               1335 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        49.39 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.015 0.021 ? 1251 'X-RAY DIFFRACTION' ? 
r_bond_other_d           ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.611 1.978 ? 1693 'X-RAY DIFFRACTION' ? 
r_angle_other_deg        ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.017 5.000 ? 146  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.120 0.200 ? 176  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.008 0.020 ? 945  'X-RAY DIFFRACTION' ? 
r_gen_planes_other       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.227 0.200 ? 523  'X-RAY DIFFRACTION' ? 
r_nbd_other              ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other            ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.158 0.200 ? 114  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.180 0.200 ? 42   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other     ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.158 0.200 ? 17   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other   ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.042 1.500 ? 729  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.907 2.000 ? 1178 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.511 3.000 ? 522  'X-RAY DIFFRACTION' ? 
r_scangle_it             3.779 4.500 ? 515  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr       ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free        ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded      ?     ?     ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.698 
_refine_ls_shell.d_res_low                        1.742 
_refine_ls_shell.number_reflns_R_work             895 
_refine_ls_shell.R_factor_R_work                  0.214 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.243 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             74 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1NB0 
_struct.title                     'Crystal Structure of Human Riboflavin Kinase' 
_struct.pdbx_descriptor           'hypothetical protein FLJ11149 (E.C.2.7.1.26)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NB0 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'BETA BARREL, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 18  ? GLY A 23  ? GLY A 26  GLY A 31  5 ? 6  
HELX_P HELX_P2 2 PRO A 30  ? ASN A 36  ? PRO A 38  ASN A 44  1 ? 7  
HELX_P HELX_P3 3 SER A 110 ? LEU A 129 ? SER A 118 LEU A 137 1 ? 20 
HELX_P HELX_P4 4 LEU A 131 ? LYS A 136 ? LEU A 139 LYS A 144 1 ? 6  
HELX_P HELX_P5 5 ILE A 137 ? GLU A 139 ? ILE A 145 GLU A 147 5 ? 3  
HELX_P HELX_P6 6 ASP A 140 ? SER A 146 ? ASP A 148 SER A 154 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 A THR 26 O   ? ? A MG 201 A THR 34  1_555 ? ? ? ? ? ? ? 2.146 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .  O   ? ? A MG 201 A HOH 402 1_555 ? ? ? ? ? ? ? 2.074 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 C ADP .  O1B ? ? A MG 201 A ADP 301 1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 A THR 26 OG1 ? ? A MG 201 A THR 34  1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc5 metalc ? ? B MG . MG ? ? ? 1_555 D HOH .  O   ? ? A MG 201 A HOH 408 1_555 ? ? ? ? ? ? ? 2.140 ? 
metalc6 metalc ? ? B MG . MG ? ? ? 1_555 C ADP .  O2A ? ? A MG 201 A ADP 301 1_555 ? ? ? ? ? ? ? 2.053 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           3 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            11 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    4 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     12 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -2.34 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 5  ? GLN A 10  ? TYR A 13  GLN A 18  
A 2 ILE A 93 ? ARG A 103 ? ILE A 101 ARG A 111 
A 3 GLY A 44 ? VAL A 52  ? GLY A 52  VAL A 60  
A 4 HIS A 58 ? TRP A 66  ? HIS A 66  TRP A 74  
A 5 LYS A 75 ? ILE A 81  ? LYS A 83  ILE A 89  
A 6 ALA A 27 ? ASN A 28  ? ALA A 35  ASN A 36  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLY A 9  ? N GLY A 17  O LEU A 94 ? O LEU A 102 
A 2 3 O ASN A 95 ? O ASN A 103 N SER A 51 ? N SER A 59  
A 3 4 N TYR A 46 ? N TYR A 54  O VAL A 62 ? O VAL A 70  
A 4 5 N VAL A 61 ? N VAL A 69  O HIS A 80 ? O HIS A 88  
A 5 6 O THR A 79 ? O THR A 87  N ALA A 27 ? N ALA A 35  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 201'  
AC2 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE ADP A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  THR A 26 ? THR A 34  . ? 1_555 ? 
2  AC1 4  ADP C .  ? ADP A 301 . ? 1_555 ? 
3  AC1 4  HOH D .  ? HOH A 402 . ? 1_555 ? 
4  AC1 4  HOH D .  ? HOH A 408 . ? 1_555 ? 
5  AC2 23 VAL A 11 ? VAL A 19  . ? 1_555 ? 
6  AC2 23 GLY A 14 ? GLY A 22  . ? 1_555 ? 
7  AC2 23 GLY A 18 ? GLY A 26  . ? 1_555 ? 
8  AC2 23 SER A 19 ? SER A 27  . ? 1_555 ? 
9  AC2 23 LYS A 20 ? LYS A 28  . ? 1_555 ? 
10 AC2 23 PRO A 25 ? PRO A 33  . ? 1_555 ? 
11 AC2 23 THR A 26 ? THR A 34  . ? 1_555 ? 
12 AC2 23 ASN A 28 ? ASN A 36  . ? 1_555 ? 
13 AC2 23 THR A 79 ? THR A 87  . ? 1_555 ? 
14 AC2 23 ILE A 81 ? ILE A 89  . ? 1_555 ? 
15 AC2 23 HIS A 83 ? HIS A 91  . ? 1_555 ? 
16 AC2 23 PHE A 85 ? PHE A 93  . ? 1_555 ? 
17 AC2 23 ASP A 88 ? ASP A 96  . ? 1_555 ? 
18 AC2 23 PHE A 89 ? PHE A 97  . ? 1_555 ? 
19 AC2 23 TYR A 90 ? TYR A 98  . ? 1_555 ? 
20 AC2 23 MG  B .  ? MG  A 201 . ? 1_555 ? 
21 AC2 23 HOH D .  ? HOH A 401 . ? 1_555 ? 
22 AC2 23 HOH D .  ? HOH A 402 . ? 1_555 ? 
23 AC2 23 HOH D .  ? HOH A 406 . ? 1_555 ? 
24 AC2 23 HOH D .  ? HOH A 408 . ? 1_555 ? 
25 AC2 23 HOH D .  ? HOH A 422 . ? 1_555 ? 
26 AC2 23 HOH D .  ? HOH A 426 . ? 1_555 ? 
27 AC2 23 HOH D .  ? HOH A 452 . ? 2_655 ? 
# 
_database_PDB_matrix.entry_id          1NB0 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1NB0 
_atom_sites.fract_transf_matrix[1][1]   0.017514 
_atom_sites.fract_transf_matrix[1][2]   0.010112 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020224 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012120 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 1   ? 31.562 -0.926  -4.999  1.00 27.05 ? 9   ARG A N     1 
ATOM   2    C  CA    . ARG A 1 1   ? 32.360 -2.199  -4.980  1.00 26.61 ? 9   ARG A CA    1 
ATOM   3    C  C     . ARG A 1 1   ? 32.002 -3.129  -3.820  1.00 26.22 ? 9   ARG A C     1 
ATOM   4    O  O     . ARG A 1 1   ? 31.799 -4.342  -4.018  1.00 27.11 ? 9   ARG A O     1 
ATOM   5    N  N     . HIS A 1 2   ? 31.953 -2.585  -2.608  1.00 24.16 ? 10  HIS A N     1 
ATOM   6    C  CA    . HIS A 1 2   ? 31.537 -3.395  -1.474  1.00 22.37 ? 10  HIS A CA    1 
ATOM   7    C  C     . HIS A 1 2   ? 30.130 -3.021  -1.009  1.00 20.29 ? 10  HIS A C     1 
ATOM   8    O  O     . HIS A 1 2   ? 29.797 -3.199  0.156   1.00 18.62 ? 10  HIS A O     1 
ATOM   9    C  CB    . HIS A 1 2   ? 32.550 -3.360  -0.313  1.00 23.44 ? 10  HIS A CB    1 
ATOM   10   C  CG    . HIS A 1 2   ? 33.619 -4.412  -0.420  1.00 25.47 ? 10  HIS A CG    1 
ATOM   11   N  ND1   . HIS A 1 2   ? 34.808 -4.201  -1.087  1.00 27.63 ? 10  HIS A ND1   1 
ATOM   12   C  CD2   . HIS A 1 2   ? 33.664 -5.691  0.031   1.00 27.27 ? 10  HIS A CD2   1 
ATOM   13   C  CE1   . HIS A 1 2   ? 35.545 -5.297  -1.032  1.00 28.66 ? 10  HIS A CE1   1 
ATOM   14   N  NE2   . HIS A 1 2   ? 34.872 -6.218  -0.362  1.00 30.02 ? 10  HIS A NE2   1 
ATOM   15   N  N     . LEU A 1 3   ? 29.312 -2.528  -1.951  1.00 16.75 ? 11  LEU A N     1 
ATOM   16   C  CA    . LEU A 1 3   ? 27.883 -2.330  -1.708  1.00 14.36 ? 11  LEU A CA    1 
ATOM   17   C  C     . LEU A 1 3   ? 27.038 -3.449  -2.331  1.00 13.50 ? 11  LEU A C     1 
ATOM   18   O  O     . LEU A 1 3   ? 27.433 -3.987  -3.393  1.00 13.64 ? 11  LEU A O     1 
ATOM   19   C  CB    . LEU A 1 3   ? 27.448 -0.941  -2.212  1.00 13.37 ? 11  LEU A CB    1 
ATOM   20   C  CG    . LEU A 1 3   ? 28.195 0.288   -1.641  1.00 12.48 ? 11  LEU A CG    1 
ATOM   21   C  CD1   . LEU A 1 3   ? 27.540 1.568   -2.114  1.00 13.84 ? 11  LEU A CD1   1 
ATOM   22   C  CD2   . LEU A 1 3   ? 28.263 0.299   -0.109  1.00 12.23 ? 11  LEU A CD2   1 
ATOM   23   N  N     . PRO A 1 4   ? 25.917 -3.847  -1.704  1.00 11.91 ? 12  PRO A N     1 
ATOM   24   C  CA    . PRO A 1 4   ? 25.445 -3.320  -0.414  1.00 10.35 ? 12  PRO A CA    1 
ATOM   25   C  C     . PRO A 1 4   ? 26.275 -3.803  0.762   1.00 9.41  ? 12  PRO A C     1 
ATOM   26   O  O     . PRO A 1 4   ? 26.764 -4.972  0.776   1.00 9.20  ? 12  PRO A O     1 
ATOM   27   C  CB    . PRO A 1 4   ? 24.018 -3.875  -0.324  1.00 10.82 ? 12  PRO A CB    1 
ATOM   28   C  CG    . PRO A 1 4   ? 24.094 -5.141  -1.072  1.00 11.13 ? 12  PRO A CG    1 
ATOM   29   C  CD    . PRO A 1 4   ? 24.964 -4.827  -2.262  1.00 12.17 ? 12  PRO A CD    1 
ATOM   30   N  N     . TYR A 1 5   ? 26.454 -2.913  1.731   1.00 8.19  ? 13  TYR A N     1 
ATOM   31   C  CA    . TYR A 1 5   ? 27.220 -3.230  2.927   1.00 8.60  ? 13  TYR A CA    1 
ATOM   32   C  C     . TYR A 1 5   ? 26.278 -3.293  4.122   1.00 8.43  ? 13  TYR A C     1 
ATOM   33   O  O     . TYR A 1 5   ? 25.576 -2.338  4.417   1.00 9.31  ? 13  TYR A O     1 
ATOM   34   C  CB    . TYR A 1 5   ? 28.259 -2.138  3.160   1.00 9.82  ? 13  TYR A CB    1 
ATOM   35   C  CG    . TYR A 1 5   ? 29.191 -2.508  4.267   1.00 10.11 ? 13  TYR A CG    1 
ATOM   36   C  CD1   . TYR A 1 5   ? 30.204 -3.403  4.035   1.00 11.56 ? 13  TYR A CD1   1 
ATOM   37   C  CD2   . TYR A 1 5   ? 29.044 -1.967  5.543   1.00 13.19 ? 13  TYR A CD2   1 
ATOM   38   C  CE1   . TYR A 1 5   ? 31.073 -3.791  5.073   1.00 15.01 ? 13  TYR A CE1   1 
ATOM   39   C  CE2   . TYR A 1 5   ? 29.904 -2.336  6.581   1.00 14.45 ? 13  TYR A CE2   1 
ATOM   40   C  CZ    . TYR A 1 5   ? 30.905 -3.246  6.329   1.00 15.22 ? 13  TYR A CZ    1 
ATOM   41   O  OH    . TYR A 1 5   ? 31.786 -3.633  7.324   1.00 18.61 ? 13  TYR A OH    1 
ATOM   42   N  N     . PHE A 1 6   ? 26.324 -4.397  4.847   1.00 8.12  ? 14  PHE A N     1 
ATOM   43   C  CA    . PHE A 1 6   ? 25.417 -4.632  5.949   1.00 8.22  ? 14  PHE A CA    1 
ATOM   44   C  C     . PHE A 1 6   ? 26.182 -4.629  7.241   1.00 8.10  ? 14  PHE A C     1 
ATOM   45   O  O     . PHE A 1 6   ? 27.190 -5.330  7.375   1.00 9.57  ? 14  PHE A O     1 
ATOM   46   C  CB    . PHE A 1 6   ? 24.759 -6.018  5.788   1.00 8.03  ? 14  PHE A CB    1 
ATOM   47   C  CG    . PHE A 1 6   ? 23.860 -6.119  4.605   1.00 7.34  ? 14  PHE A CG    1 
ATOM   48   C  CD1   . PHE A 1 6   ? 22.521 -5.793  4.711   1.00 9.13  ? 14  PHE A CD1   1 
ATOM   49   C  CD2   . PHE A 1 6   ? 24.346 -6.583  3.386   1.00 8.40  ? 14  PHE A CD2   1 
ATOM   50   C  CE1   . PHE A 1 6   ? 21.663 -5.878  3.631   1.00 8.37  ? 14  PHE A CE1   1 
ATOM   51   C  CE2   . PHE A 1 6   ? 23.519 -6.650  2.264   1.00 9.13  ? 14  PHE A CE2   1 
ATOM   52   C  CZ    . PHE A 1 6   ? 22.154 -6.324  2.376   1.00 11.56 ? 14  PHE A CZ    1 
ATOM   53   N  N     . CYS A 1 7   ? 25.714 -3.851  8.198   1.00 7.79  ? 15  CYS A N     1 
ATOM   54   C  CA    . CYS A 1 7   ? 26.351 -3.843  9.526   1.00 7.91  ? 15  CYS A CA    1 
ATOM   55   C  C     . CYS A 1 7   ? 25.399 -3.460  10.637  1.00 7.97  ? 15  CYS A C     1 
ATOM   56   O  O     . CYS A 1 7   ? 24.315 -2.939  10.370  1.00 8.04  ? 15  CYS A O     1 
ATOM   57   C  CB    . CYS A 1 7   ? 27.613 -2.981  9.550   1.00 9.11  ? 15  CYS A CB    1 
ATOM   58   S  SG    . CYS A 1 7   ? 27.253 -1.271  9.233   1.00 13.42 ? 15  CYS A SG    1 
ATOM   59   N  N     . ARG A 1 8   ? 25.758 -3.775  11.882  1.00 7.32  ? 16  ARG A N     1 
ATOM   60   C  CA    . ARG A 1 8   ? 24.892 -3.501  13.013  1.00 8.37  ? 16  ARG A CA    1 
ATOM   61   C  C     . ARG A 1 8   ? 25.753 -3.043  14.152  1.00 8.95  ? 16  ARG A C     1 
ATOM   62   O  O     . ARG A 1 8   ? 26.890 -3.517  14.314  1.00 11.22 ? 16  ARG A O     1 
ATOM   63   C  CB    . ARG A 1 8   ? 24.169 -4.762  13.507  1.00 7.74  ? 16  ARG A CB    1 
ATOM   64   C  CG    . ARG A 1 8   ? 23.600 -5.695  12.448  1.00 8.25  ? 16  ARG A CG    1 
ATOM   65   C  CD    . ARG A 1 8   ? 22.922 -6.881  13.095  1.00 7.10  ? 16  ARG A CD    1 
ATOM   66   N  NE    . ARG A 1 8   ? 22.574 -7.898  12.129  1.00 6.29  ? 16  ARG A NE    1 
ATOM   67   C  CZ    . ARG A 1 8   ? 21.366 -8.022  11.603  1.00 6.90  ? 16  ARG A CZ    1 
ATOM   68   N  NH1   . ARG A 1 8   ? 20.400 -7.137  11.942  1.00 10.03 ? 16  ARG A NH1   1 
ATOM   69   N  NH2   . ARG A 1 8   ? 21.120 -9.019  10.762  1.00 10.18 ? 16  ARG A NH2   1 
ATOM   70   N  N     . GLY A 1 9   ? 25.202 -2.188  14.995  1.00 8.90  ? 17  GLY A N     1 
ATOM   71   C  CA    . GLY A 1 9   ? 25.988 -1.766  16.151  1.00 9.73  ? 17  GLY A CA    1 
ATOM   72   C  C     . GLY A 1 9   ? 25.140 -1.030  17.160  1.00 9.40  ? 17  GLY A C     1 
ATOM   73   O  O     . GLY A 1 9   ? 24.034 -0.543  16.858  1.00 8.93  ? 17  GLY A O     1 
ATOM   74   N  N     . GLN A 1 10  ? 25.679 -0.935  18.377  1.00 9.79  ? 18  GLN A N     1 
ATOM   75   C  CA    . GLN A 1 10  ? 25.033 -0.179  19.448  1.00 9.72  ? 18  GLN A CA    1 
ATOM   76   C  C     . GLN A 1 10  ? 25.095 1.311   19.087  1.00 9.91  ? 18  GLN A C     1 
ATOM   77   O  O     . GLN A 1 10  ? 26.091 1.794   18.527  1.00 11.07 ? 18  GLN A O     1 
ATOM   78   C  CB    . GLN A 1 10  ? 25.686 -0.533  20.816  1.00 10.98 ? 18  GLN A CB    1 
ATOM   79   C  CG    . GLN A 1 10  ? 25.401 -2.079  21.171  1.00 13.69 ? 18  GLN A CG    1 
ATOM   80   C  CD    . GLN A 1 10  ? 25.629 -2.576  22.646  1.00 23.26 ? 18  GLN A CD    1 
ATOM   81   O  OE1   . GLN A 1 10  ? 26.594 -2.186  23.295  1.00 22.81 ? 18  GLN A OE1   1 
ATOM   82   N  NE2   . GLN A 1 10  ? 24.767 -3.530  23.113  1.00 20.24 ? 18  GLN A NE2   1 
ATOM   83   N  N     . VAL A 1 11  ? 24.023 2.031   19.392  1.00 8.63  ? 19  VAL A N     1 
ATOM   84   C  CA    . VAL A 1 11  ? 23.979 3.469   19.081  1.00 8.18  ? 19  VAL A CA    1 
ATOM   85   C  C     . VAL A 1 11  ? 24.607 4.210   20.256  1.00 7.81  ? 19  VAL A C     1 
ATOM   86   O  O     . VAL A 1 11  ? 24.184 4.039   21.394  1.00 8.36  ? 19  VAL A O     1 
ATOM   87   C  CB    . VAL A 1 11  ? 22.532 3.910   18.817  1.00 8.02  ? 19  VAL A CB    1 
ATOM   88   C  CG1   . VAL A 1 11  ? 22.463 5.452   18.724  1.00 8.15  ? 19  VAL A CG1   1 
ATOM   89   C  CG2   . VAL A 1 11  ? 22.024 3.267   17.535  1.00 8.71  ? 19  VAL A CG2   1 
ATOM   90   N  N     . VAL A 1 12  ? 25.647 4.992   19.966  1.00 7.27  ? 20  VAL A N     1 
ATOM   91   C  CA    . VAL A 1 12  ? 26.472 5.611   21.023  1.00 7.82  ? 20  VAL A CA    1 
ATOM   92   C  C     . VAL A 1 12  ? 26.556 7.118   20.824  1.00 7.68  ? 20  VAL A C     1 
ATOM   93   O  O     . VAL A 1 12  ? 26.333 7.620   19.722  1.00 7.18  ? 20  VAL A O     1 
ATOM   94   C  CB    . VAL A 1 12  ? 27.884 5.004   21.102  1.00 7.33  ? 20  VAL A CB    1 
ATOM   95   C  CG1   . VAL A 1 12  ? 27.780 3.515   21.438  1.00 8.69  ? 20  VAL A CG1   1 
ATOM   96   C  CG2   . VAL A 1 12  ? 28.669 5.241   19.811  1.00 8.23  ? 20  VAL A CG2   1 
ATOM   97   N  N     . ARG A 1 13  ? 26.817 7.830   21.922  1.00 6.81  ? 21  ARG A N     1 
ATOM   98   C  CA    . ARG A 1 13  ? 26.858 9.286   21.852  1.00 8.43  ? 21  ARG A CA    1 
ATOM   99   C  C     . ARG A 1 13  ? 28.117 9.755   21.158  1.00 7.09  ? 21  ARG A C     1 
ATOM   100  O  O     . ARG A 1 13  ? 29.160 9.088   21.225  1.00 8.10  ? 21  ARG A O     1 
ATOM   101  C  CB    . ARG A 1 13  ? 26.817 9.894   23.262  1.00 8.04  ? 21  ARG A CB    1 
ATOM   102  C  CG    . ARG A 1 13  ? 25.410 9.941   23.824  1.00 11.90 ? 21  ARG A CG    1 
ATOM   103  C  CD    . ARG A 1 13  ? 25.173 10.794  25.118  1.00 15.21 ? 21  ARG A CD    1 
ATOM   104  N  NE    A ARG A 1 13  ? 23.751 11.015  25.399  0.50 16.91 ? 21  ARG A NE    1 
ATOM   105  N  NE    B ARG A 1 13  ? 23.764 10.625  25.499  0.50 15.66 ? 21  ARG A NE    1 
ATOM   106  C  CZ    A ARG A 1 13  ? 23.026 12.037  24.962  0.50 16.43 ? 21  ARG A CZ    1 
ATOM   107  C  CZ    B ARG A 1 13  ? 23.265 9.590   26.186  0.50 12.49 ? 21  ARG A CZ    1 
ATOM   108  N  NH1   A ARG A 1 13  ? 23.563 12.989  24.207  0.30 15.22 ? 21  ARG A NH1   1 
ATOM   109  N  NH1   B ARG A 1 13  ? 21.965 9.533   26.420  0.30 10.41 ? 21  ARG A NH1   1 
ATOM   110  N  NH2   A ARG A 1 13  ? 21.744 12.117  25.299  0.50 19.63 ? 21  ARG A NH2   1 
ATOM   111  N  NH2   B ARG A 1 13  ? 24.053 8.615   26.641  0.50 13.50 ? 21  ARG A NH2   1 
ATOM   112  N  N     . GLY A 1 14  ? 28.023 10.938  20.571  1.00 5.90  ? 22  GLY A N     1 
ATOM   113  C  CA    . GLY A 1 14  ? 29.165 11.586  19.952  1.00 6.03  ? 22  GLY A CA    1 
ATOM   114  C  C     . GLY A 1 14  ? 29.631 12.780  20.766  1.00 5.61  ? 22  GLY A C     1 
ATOM   115  O  O     . GLY A 1 14  ? 29.193 13.007  21.898  1.00 5.58  ? 22  GLY A O     1 
ATOM   116  N  N     . PHE A 1 15  ? 30.521 13.555  20.177  1.00 6.05  ? 23  PHE A N     1 
ATOM   117  C  CA    . PHE A 1 15  ? 31.166 14.650  20.888  1.00 7.80  ? 23  PHE A CA    1 
ATOM   118  C  C     . PHE A 1 15  ? 30.868 15.981  20.151  1.00 9.25  ? 23  PHE A C     1 
ATOM   119  O  O     . PHE A 1 15  ? 30.183 16.001  19.107  1.00 12.21 ? 23  PHE A O     1 
ATOM   120  C  CB    . PHE A 1 15  ? 32.644 14.279  21.100  1.00 6.01  ? 23  PHE A CB    1 
ATOM   121  C  CG    . PHE A 1 15  ? 32.777 12.970  21.808  1.00 6.38  ? 23  PHE A CG    1 
ATOM   122  C  CD1   . PHE A 1 15  ? 32.611 12.904  23.200  1.00 9.04  ? 23  PHE A CD1   1 
ATOM   123  C  CD2   . PHE A 1 15  ? 32.921 11.781  21.085  1.00 7.44  ? 23  PHE A CD2   1 
ATOM   124  C  CE1   . PHE A 1 15  ? 32.650 11.690  23.850  1.00 8.02  ? 23  PHE A CE1   1 
ATOM   125  C  CE2   . PHE A 1 15  ? 32.950 10.569  21.734  1.00 8.20  ? 23  PHE A CE2   1 
ATOM   126  C  CZ    . PHE A 1 15  ? 32.829 10.545  23.147  1.00 9.80  ? 23  PHE A CZ    1 
ATOM   127  N  N     . GLY A 1 16  ? 31.286 17.095  20.718  1.00 11.84 ? 24  GLY A N     1 
ATOM   128  C  CA    . GLY A 1 16  ? 30.785 18.380  20.202  1.00 12.69 ? 24  GLY A CA    1 
ATOM   129  C  C     . GLY A 1 16  ? 29.260 18.539  20.343  1.00 13.43 ? 24  GLY A C     1 
ATOM   130  O  O     . GLY A 1 16  ? 28.641 17.902  21.212  1.00 14.27 ? 24  GLY A O     1 
ATOM   131  N  N     . ARG A 1 17  ? 28.643 19.379  19.510  1.00 11.81 ? 25  ARG A N     1 
ATOM   132  C  CA    . ARG A 1 17  ? 27.202 19.584  19.622  1.00 12.02 ? 25  ARG A CA    1 
ATOM   133  C  C     . ARG A 1 17  ? 26.474 18.656  18.658  1.00 11.24 ? 25  ARG A C     1 
ATOM   134  O  O     . ARG A 1 17  ? 26.806 18.586  17.477  1.00 13.99 ? 25  ARG A O     1 
ATOM   135  C  CB    A ARG A 1 17  ? 26.792 21.042  19.386  0.50 11.12 ? 25  ARG A CB    1 
ATOM   136  C  CB    B ARG A 1 17  ? 26.846 21.043  19.305  0.50 11.12 ? 25  ARG A CB    1 
ATOM   137  C  CG    A ARG A 1 17  ? 25.313 21.294  19.712  0.50 11.15 ? 25  ARG A CG    1 
ATOM   138  C  CG    B ARG A 1 17  ? 27.741 22.080  19.974  0.50 10.35 ? 25  ARG A CG    1 
ATOM   139  C  CD    A ARG A 1 17  ? 24.914 22.752  19.890  0.50 9.91  ? 25  ARG A CD    1 
ATOM   140  C  CD    B ARG A 1 17  ? 27.328 23.534  19.710  0.50 11.88 ? 25  ARG A CD    1 
ATOM   141  N  NE    A ARG A 1 17  ? 25.496 23.333  21.100  0.50 10.36 ? 25  ARG A NE    1 
ATOM   142  N  NE    B ARG A 1 17  ? 27.791 24.402  20.787  0.50 11.58 ? 25  ARG A NE    1 
ATOM   143  C  CZ    A ARG A 1 17  ? 25.016 23.181  22.330  0.50 6.62  ? 25  ARG A CZ    1 
ATOM   144  C  CZ    B ARG A 1 17  ? 29.041 24.824  20.916  0.50 12.03 ? 25  ARG A CZ    1 
ATOM   145  N  NH1   A ARG A 1 17  ? 23.911 22.487  22.568  0.50 10.46 ? 25  ARG A NH1   1 
ATOM   146  N  NH1   B ARG A 1 17  ? 29.960 24.492  20.016  0.50 13.36 ? 25  ARG A NH1   1 
ATOM   147  N  NH2   A ARG A 1 17  ? 25.622 23.743  23.327  0.50 7.29  ? 25  ARG A NH2   1 
ATOM   148  N  NH2   B ARG A 1 17  ? 29.370 25.576  21.941  0.50 12.15 ? 25  ARG A NH2   1 
ATOM   149  N  N     . GLY A 1 18  ? 25.485 17.951  19.148  1.00 10.99 ? 26  GLY A N     1 
ATOM   150  C  CA    . GLY A 1 18  ? 24.797 16.985  18.308  1.00 9.22  ? 26  GLY A CA    1 
ATOM   151  C  C     . GLY A 1 18  ? 24.041 17.631  17.167  1.00 9.41  ? 26  GLY A C     1 
ATOM   152  O  O     . GLY A 1 18  ? 23.528 18.736  17.315  1.00 9.80  ? 26  GLY A O     1 
ATOM   153  N  N     . SER A 1 19  ? 23.931 16.935  16.044  1.00 8.38  ? 27  SER A N     1 
ATOM   154  C  CA    . SER A 1 19  ? 23.170 17.468  14.888  1.00 8.21  ? 27  SER A CA    1 
ATOM   155  C  C     . SER A 1 19  ? 21.648 17.481  15.090  1.00 8.18  ? 27  SER A C     1 
ATOM   156  O  O     . SER A 1 19  ? 20.931 17.954  14.206  1.00 9.16  ? 27  SER A O     1 
ATOM   157  C  CB    . SER A 1 19  ? 23.531 16.712  13.600  1.00 7.61  ? 27  SER A CB    1 
ATOM   158  O  OG    . SER A 1 19  ? 23.170 15.341  13.715  1.00 7.95  ? 27  SER A OG    1 
ATOM   159  N  N     . LYS A 1 20  ? 21.161 16.968  16.225  1.00 7.60  ? 28  LYS A N     1 
ATOM   160  C  CA    . LYS A 1 20  ? 19.822 17.331  16.735  1.00 8.30  ? 28  LYS A CA    1 
ATOM   161  C  C     . LYS A 1 20  ? 19.596 18.838  16.712  1.00 7.91  ? 28  LYS A C     1 
ATOM   162  O  O     . LYS A 1 20  ? 18.467 19.296  16.518  1.00 9.41  ? 28  LYS A O     1 
ATOM   163  C  CB    . LYS A 1 20  ? 19.616 16.877  18.189  1.00 8.44  ? 28  LYS A CB    1 
ATOM   164  C  CG    . LYS A 1 20  ? 19.009 15.515  18.318  1.00 11.79 ? 28  LYS A CG    1 
ATOM   165  C  CD    . LYS A 1 20  ? 18.952 15.078  19.768  1.00 11.70 ? 28  LYS A CD    1 
ATOM   166  C  CE    . LYS A 1 20  ? 18.310 13.710  19.930  1.00 14.55 ? 28  LYS A CE    1 
ATOM   167  N  NZ    . LYS A 1 20  ? 18.290 13.382  21.405  1.00 19.79 ? 28  LYS A NZ    1 
ATOM   168  N  N     . GLN A 1 21  ? 20.652 19.618  16.929  1.00 7.47  ? 29  GLN A N     1 
ATOM   169  C  CA    . GLN A 1 21  ? 20.513 21.084  16.914  1.00 8.15  ? 29  GLN A CA    1 
ATOM   170  C  C     . GLN A 1 21  ? 19.980 21.566  15.560  1.00 9.69  ? 29  GLN A C     1 
ATOM   171  O  O     . GLN A 1 21  ? 19.333 22.620  15.507  1.00 10.69 ? 29  GLN A O     1 
ATOM   172  C  CB    . GLN A 1 21  ? 21.823 21.807  17.246  1.00 8.35  ? 29  GLN A CB    1 
ATOM   173  C  CG    . GLN A 1 21  ? 22.914 21.594  16.184  1.00 13.67 ? 29  GLN A CG    1 
ATOM   174  C  CD    . GLN A 1 21  ? 24.185 22.430  16.374  1.00 17.30 ? 29  GLN A CD    1 
ATOM   175  O  OE1   . GLN A 1 21  ? 24.119 23.617  16.621  1.00 17.75 ? 29  GLN A OE1   1 
ATOM   176  N  NE2   . GLN A 1 21  ? 25.343 21.791  16.213  1.00 23.49 ? 29  GLN A NE2   1 
ATOM   177  N  N     . LEU A 1 22  ? 20.289 20.818  14.497  1.00 8.98  ? 30  LEU A N     1 
ATOM   178  C  CA    . LEU A 1 22  ? 19.835 21.138  13.130  1.00 10.89 ? 30  LEU A CA    1 
ATOM   179  C  C     . LEU A 1 22  ? 18.524 20.466  12.747  1.00 10.55 ? 30  LEU A C     1 
ATOM   180  O  O     . LEU A 1 22  ? 18.020 20.700  11.649  1.00 12.04 ? 30  LEU A O     1 
ATOM   181  C  CB    . LEU A 1 22  ? 20.897 20.733  12.092  1.00 10.58 ? 30  LEU A CB    1 
ATOM   182  C  CG    . LEU A 1 22  ? 22.329 21.170  12.366  1.00 13.01 ? 30  LEU A CG    1 
ATOM   183  C  CD1   . LEU A 1 22  ? 23.228 20.643  11.292  1.00 17.40 ? 30  LEU A CD1   1 
ATOM   184  C  CD2   . LEU A 1 22  ? 22.465 22.705  12.503  1.00 14.15 ? 30  LEU A CD2   1 
ATOM   185  N  N     . GLY A 1 23  ? 17.959 19.688  13.657  1.00 11.08 ? 31  GLY A N     1 
ATOM   186  C  CA    . GLY A 1 23  ? 16.741 18.949  13.429  1.00 10.47 ? 31  GLY A CA    1 
ATOM   187  C  C     . GLY A 1 23  ? 17.065 17.710  12.615  1.00 11.14 ? 31  GLY A C     1 
ATOM   188  O  O     . GLY A 1 23  ? 16.134 17.057  12.116  1.00 11.90 ? 31  GLY A O     1 
ATOM   189  N  N     . ILE A 1 24  ? 18.363 17.357  12.511  1.00 10.07 ? 32  ILE A N     1 
ATOM   190  C  CA    . ILE A 1 24  ? 18.768 16.211  11.675  1.00 8.41  ? 32  ILE A CA    1 
ATOM   191  C  C     . ILE A 1 24  ? 19.681 15.265  12.502  1.00 7.53  ? 32  ILE A C     1 
ATOM   192  O  O     . ILE A 1 24  ? 20.903 15.285  12.318  1.00 7.36  ? 32  ILE A O     1 
ATOM   193  C  CB    . ILE A 1 24  ? 19.448 16.651  10.355  1.00 8.33  ? 32  ILE A CB    1 
ATOM   194  C  CG1   . ILE A 1 24  ? 18.557 17.684  9.622   1.00 10.58 ? 32  ILE A CG1   1 
ATOM   195  C  CG2   . ILE A 1 24  ? 19.697 15.388  9.459   1.00 8.97  ? 32  ILE A CG2   1 
ATOM   196  C  CD1   . ILE A 1 24  ? 19.167 18.368  8.413   1.00 15.11 ? 32  ILE A CD1   1 
ATOM   197  N  N     . PRO A 1 25  ? 19.109 14.498  13.435  1.00 7.50  ? 33  PRO A N     1 
ATOM   198  C  CA    . PRO A 1 25  ? 19.949 13.714  14.364  1.00 6.49  ? 33  PRO A CA    1 
ATOM   199  C  C     . PRO A 1 25  ? 20.723 12.656  13.603  1.00 6.62  ? 33  PRO A C     1 
ATOM   200  O  O     . PRO A 1 25  ? 20.221 12.134  12.604  1.00 5.30  ? 33  PRO A O     1 
ATOM   201  C  CB    . PRO A 1 25  ? 18.958 13.007  15.293  1.00 7.41  ? 33  PRO A CB    1 
ATOM   202  C  CG    . PRO A 1 25  ? 17.609 13.147  14.636  1.00 8.49  ? 33  PRO A CG    1 
ATOM   203  C  CD    . PRO A 1 25  ? 17.668 14.338  13.713  1.00 8.00  ? 33  PRO A CD    1 
ATOM   204  N  N     . THR A 1 26  ? 21.943 12.390  14.064  1.00 5.52  ? 34  THR A N     1 
ATOM   205  C  CA    . THR A 1 26  ? 22.854 11.448  13.398  1.00 5.49  ? 34  THR A CA    1 
ATOM   206  C  C     . THR A 1 26  ? 23.365 10.445  14.444  1.00 5.65  ? 34  THR A C     1 
ATOM   207  O  O     . THR A 1 26  ? 24.049 10.812  15.399  1.00 4.72  ? 34  THR A O     1 
ATOM   208  C  CB    . THR A 1 26  ? 24.073 12.165  12.818  1.00 4.71  ? 34  THR A CB    1 
ATOM   209  O  OG1   . THR A 1 26  ? 24.491 13.204  13.730  1.00 5.43  ? 34  THR A OG1   1 
ATOM   210  C  CG2   . THR A 1 26  ? 23.670 12.919  11.567  1.00 7.27  ? 34  THR A CG2   1 
ATOM   211  N  N     . ALA A 1 27  ? 23.035 9.187   14.243  1.00 4.20  ? 35  ALA A N     1 
ATOM   212  C  CA    . ALA A 1 27  ? 23.416 8.135   15.175  1.00 4.47  ? 35  ALA A CA    1 
ATOM   213  C  C     . ALA A 1 27  ? 24.797 7.589   14.837  1.00 5.19  ? 35  ALA A C     1 
ATOM   214  O  O     . ALA A 1 27  ? 25.085 7.284   13.646  1.00 5.97  ? 35  ALA A O     1 
ATOM   215  C  CB    . ALA A 1 27  ? 22.385 7.021   15.091  1.00 4.43  ? 35  ALA A CB    1 
ATOM   216  N  N     . ASN A 1 28  ? 25.599 7.418   15.891  1.00 5.70  ? 36  ASN A N     1 
ATOM   217  C  CA    . ASN A 1 28  ? 26.946 6.805   15.825  1.00 6.92  ? 36  ASN A CA    1 
ATOM   218  C  C     . ASN A 1 28  ? 26.993 5.351   16.261  1.00 7.69  ? 36  ASN A C     1 
ATOM   219  O  O     . ASN A 1 28  ? 26.210 4.898   17.097  1.00 7.17  ? 36  ASN A O     1 
ATOM   220  C  CB    . ASN A 1 28  ? 27.961 7.605   16.674  1.00 5.78  ? 36  ASN A CB    1 
ATOM   221  C  CG    . ASN A 1 28  ? 27.756 9.098   16.542  1.00 6.57  ? 36  ASN A CG    1 
ATOM   222  O  OD1   . ASN A 1 28  ? 28.019 9.681   15.482  1.00 8.44  ? 36  ASN A OD1   1 
ATOM   223  N  ND2   . ASN A 1 28  ? 27.216 9.723   17.581  1.00 5.11  ? 36  ASN A ND2   1 
ATOM   224  N  N     . PHE A 1 29  ? 27.945 4.616   15.676  1.00 11.97 ? 37  PHE A N     1 
ATOM   225  C  CA    . PHE A 1 29  ? 28.280 3.247   16.110  1.00 13.09 ? 37  PHE A CA    1 
ATOM   226  C  C     . PHE A 1 29  ? 29.596 3.243   16.907  1.00 14.37 ? 37  PHE A C     1 
ATOM   227  O  O     . PHE A 1 29  ? 30.363 4.176   16.752  1.00 16.13 ? 37  PHE A O     1 
ATOM   228  C  CB    . PHE A 1 29  ? 28.601 2.428   14.857  1.00 13.88 ? 37  PHE A CB    1 
ATOM   229  C  CG    . PHE A 1 29  ? 27.405 1.966   14.053  1.00 12.91 ? 37  PHE A CG    1 
ATOM   230  C  CD1   . PHE A 1 29  ? 26.294 1.411   14.659  1.00 14.36 ? 37  PHE A CD1   1 
ATOM   231  C  CD2   . PHE A 1 29  ? 27.482 1.983   12.670  1.00 12.89 ? 37  PHE A CD2   1 
ATOM   232  C  CE1   . PHE A 1 29  ? 25.222 0.905   13.845  1.00 13.64 ? 37  PHE A CE1   1 
ATOM   233  C  CE2   . PHE A 1 29  ? 26.448 1.462   11.866  1.00 13.05 ? 37  PHE A CE2   1 
ATOM   234  C  CZ    . PHE A 1 29  ? 25.321 0.958   12.461  1.00 13.78 ? 37  PHE A CZ    1 
ATOM   235  N  N     . PRO A 1 30  ? 29.892 2.206   17.696  1.00 14.71 ? 38  PRO A N     1 
ATOM   236  C  CA    . PRO A 1 30  ? 31.223 2.105   18.329  1.00 14.13 ? 38  PRO A CA    1 
ATOM   237  C  C     . PRO A 1 30  ? 32.340 2.037   17.252  1.00 14.24 ? 38  PRO A C     1 
ATOM   238  O  O     . PRO A 1 30  ? 32.082 1.648   16.125  1.00 12.94 ? 38  PRO A O     1 
ATOM   239  C  CB    . PRO A 1 30  ? 31.135 0.826   19.160  1.00 14.67 ? 38  PRO A CB    1 
ATOM   240  C  CG    . PRO A 1 30  ? 29.701 0.583   19.343  1.00 15.11 ? 38  PRO A CG    1 
ATOM   241  C  CD    . PRO A 1 30  ? 29.016 1.087   18.091  1.00 14.92 ? 38  PRO A CD    1 
ATOM   242  N  N     . GLU A 1 31  ? 33.555 2.466   17.595  1.00 12.82 ? 39  GLU A N     1 
ATOM   243  C  CA    . GLU A 1 31  ? 34.713 2.473   16.686  1.00 14.13 ? 39  GLU A CA    1 
ATOM   244  C  C     . GLU A 1 31  ? 34.902 1.104   15.986  1.00 13.11 ? 39  GLU A C     1 
ATOM   245  O  O     . GLU A 1 31  ? 35.263 1.049   14.787  1.00 13.00 ? 39  GLU A O     1 
ATOM   246  C  CB    . GLU A 1 31  ? 35.971 2.882   17.499  1.00 14.81 ? 39  GLU A CB    1 
ATOM   247  C  CG    . GLU A 1 31  ? 37.330 2.776   16.813  1.00 19.95 ? 39  GLU A CG    1 
ATOM   248  C  CD    . GLU A 1 31  ? 38.498 3.233   17.687  1.00 25.19 ? 39  GLU A CD    1 
ATOM   249  O  OE1   . GLU A 1 31  ? 38.345 3.267   18.943  1.00 27.06 ? 39  GLU A OE1   1 
ATOM   250  O  OE2   . GLU A 1 31  ? 39.588 3.545   17.119  1.00 27.48 ? 39  GLU A OE2   1 
ATOM   251  N  N     . GLN A 1 32  ? 34.632 0.019   16.716  1.00 13.30 ? 40  GLN A N     1 
ATOM   252  C  CA    . GLN A 1 32  ? 34.768 -1.362  16.191  1.00 13.65 ? 40  GLN A CA    1 
ATOM   253  C  C     . GLN A 1 32  ? 34.013 -1.536  14.875  1.00 13.06 ? 40  GLN A C     1 
ATOM   254  O  O     . GLN A 1 32  ? 34.486 -2.231  13.955  1.00 12.51 ? 40  GLN A O     1 
ATOM   255  C  CB    . GLN A 1 32  ? 34.238 -2.403  17.215  1.00 14.83 ? 40  GLN A CB    1 
ATOM   256  C  CG    . GLN A 1 32  ? 32.678 -2.494  17.198  1.00 17.97 ? 40  GLN A CG    1 
ATOM   257  C  CD    . GLN A 1 32  ? 32.012 -3.195  18.405  1.00 23.75 ? 40  GLN A CD    1 
ATOM   258  O  OE1   . GLN A 1 32  ? 30.914 -3.807  18.261  1.00 21.96 ? 40  GLN A OE1   1 
ATOM   259  N  NE2   . GLN A 1 32  ? 32.635 -3.089  19.573  1.00 21.62 ? 40  GLN A NE2   1 
ATOM   260  N  N     . VAL A 1 33  ? 32.820 -0.932  14.767  1.00 12.01 ? 41  VAL A N     1 
ATOM   261  C  CA    . VAL A 1 33  ? 32.023 -1.117  13.575  1.00 12.53 ? 41  VAL A CA    1 
ATOM   262  C  C     . VAL A 1 33  ? 32.702 -0.402  12.418  1.00 12.38 ? 41  VAL A C     1 
ATOM   263  O  O     . VAL A 1 33  ? 32.916 -0.994  11.363  1.00 10.76 ? 41  VAL A O     1 
ATOM   264  C  CB    . VAL A 1 33  ? 30.542 -0.610  13.718  1.00 11.76 ? 41  VAL A CB    1 
ATOM   265  C  CG1   . VAL A 1 33  ? 29.858 -0.619  12.383  1.00 15.09 ? 41  VAL A CG1   1 
ATOM   266  C  CG2   . VAL A 1 33  ? 29.805 -1.461  14.743  1.00 14.74 ? 41  VAL A CG2   1 
ATOM   267  N  N     . VAL A 1 34  ? 33.050 0.871   12.644  1.00 12.30 ? 42  VAL A N     1 
ATOM   268  C  CA    . VAL A 1 34  ? 33.625 1.699   11.590  1.00 13.97 ? 42  VAL A CA    1 
ATOM   269  C  C     . VAL A 1 34  ? 34.964 1.086   11.134  1.00 14.05 ? 42  VAL A C     1 
ATOM   270  O  O     . VAL A 1 34  ? 35.293 1.102   9.948   1.00 14.17 ? 42  VAL A O     1 
ATOM   271  C  CB    . VAL A 1 34  ? 33.852 3.158   12.077  1.00 14.26 ? 42  VAL A CB    1 
ATOM   272  C  CG1   . VAL A 1 34  ? 34.314 4.027   10.927  1.00 16.60 ? 42  VAL A CG1   1 
ATOM   273  C  CG2   . VAL A 1 34  ? 32.560 3.722   12.695  1.00 17.50 ? 42  VAL A CG2   1 
ATOM   274  N  N     . ASP A 1 35  ? 35.721 0.526   12.077  1.00 14.42 ? 43  ASP A N     1 
ATOM   275  C  CA    . ASP A 1 35  ? 37.017 -0.082  11.731  1.00 15.15 ? 43  ASP A CA    1 
ATOM   276  C  C     . ASP A 1 35  ? 36.936 -1.299  10.827  1.00 15.45 ? 43  ASP A C     1 
ATOM   277  O  O     . ASP A 1 35  ? 37.937 -1.659  10.162  1.00 15.42 ? 43  ASP A O     1 
ATOM   278  C  CB    . ASP A 1 35  ? 37.828 -0.359  12.979  1.00 16.62 ? 43  ASP A CB    1 
ATOM   279  C  CG    . ASP A 1 35  ? 38.291 0.912   13.634  1.00 17.98 ? 43  ASP A CG    1 
ATOM   280  O  OD1   . ASP A 1 35  ? 38.068 2.017   13.054  1.00 21.88 ? 43  ASP A OD1   1 
ATOM   281  O  OD2   . ASP A 1 35  ? 38.854 0.910   14.728  1.00 23.19 ? 43  ASP A OD2   1 
ATOM   282  N  N     . ASN A 1 36  ? 35.763 -1.916  10.757  1.00 14.46 ? 44  ASN A N     1 
ATOM   283  C  CA    . ASN A 1 36  ? 35.625 -3.078  9.899   1.00 15.52 ? 44  ASN A CA    1 
ATOM   284  C  C     . ASN A 1 36  ? 35.112 -2.778  8.524   1.00 15.72 ? 44  ASN A C     1 
ATOM   285  O  O     . ASN A 1 36  ? 34.919 -3.702  7.737   1.00 16.07 ? 44  ASN A O     1 
ATOM   286  C  CB    . ASN A 1 36  ? 34.813 -4.173  10.575  1.00 15.71 ? 44  ASN A CB    1 
ATOM   287  C  CG    . ASN A 1 36  ? 35.670 -5.002  11.481  1.00 16.96 ? 44  ASN A CG    1 
ATOM   288  O  OD1   . ASN A 1 36  ? 36.335 -5.942  11.032  1.00 18.40 ? 44  ASN A OD1   1 
ATOM   289  N  ND2   . ASN A 1 36  ? 35.763 -4.595  12.752  1.00 19.25 ? 44  ASN A ND2   1 
ATOM   290  N  N     . LEU A 1 37  ? 34.874 -1.491  8.227   1.00 15.87 ? 45  LEU A N     1 
ATOM   291  C  CA    . LEU A 1 37  ? 34.545 -1.093  6.859   1.00 17.05 ? 45  LEU A CA    1 
ATOM   292  C  C     . LEU A 1 37  ? 35.719 -1.428  5.937   1.00 17.69 ? 45  LEU A C     1 
ATOM   293  O  O     . LEU A 1 37  ? 36.870 -1.270  6.319   1.00 17.36 ? 45  LEU A O     1 
ATOM   294  C  CB    . LEU A 1 37  ? 34.290 0.415   6.765   1.00 16.96 ? 45  LEU A CB    1 
ATOM   295  C  CG    . LEU A 1 37  ? 33.066 1.049   7.397   1.00 16.97 ? 45  LEU A CG    1 
ATOM   296  C  CD1   . LEU A 1 37  ? 33.280 2.597   7.556   1.00 20.50 ? 45  LEU A CD1   1 
ATOM   297  C  CD2   . LEU A 1 37  ? 31.880 0.743   6.574   1.00 20.17 ? 45  LEU A CD2   1 
ATOM   298  N  N     . PRO A 1 38  ? 35.436 -1.890  4.727   1.00 19.89 ? 46  PRO A N     1 
ATOM   299  C  CA    . PRO A 1 38  ? 36.486 -2.072  3.713   1.00 21.54 ? 46  PRO A CA    1 
ATOM   300  C  C     . PRO A 1 38  ? 37.133 -0.730  3.398   1.00 23.33 ? 46  PRO A C     1 
ATOM   301  O  O     . PRO A 1 38  ? 36.456 0.278   3.595   1.00 23.37 ? 46  PRO A O     1 
ATOM   302  C  CB    . PRO A 1 38  ? 35.697 -2.540  2.482   1.00 21.87 ? 46  PRO A CB    1 
ATOM   303  C  CG    . PRO A 1 38  ? 34.447 -3.094  3.009   1.00 21.42 ? 46  PRO A CG    1 
ATOM   304  C  CD    . PRO A 1 38  ? 34.111 -2.300  4.239   1.00 20.37 ? 46  PRO A CD    1 
ATOM   305  N  N     . ALA A 1 39  ? 38.365 -0.702  2.885   1.00 24.95 ? 47  ALA A N     1 
ATOM   306  C  CA    . ALA A 1 39  ? 38.957 0.566   2.403   1.00 26.10 ? 47  ALA A CA    1 
ATOM   307  C  C     . ALA A 1 39  ? 38.290 1.157   1.137   1.00 27.37 ? 47  ALA A C     1 
ATOM   308  O  O     . ALA A 1 39  ? 38.241 2.381   0.965   1.00 27.00 ? 47  ALA A O     1 
ATOM   309  C  CB    . ALA A 1 39  ? 40.421 0.437   2.222   1.00 26.13 ? 47  ALA A CB    1 
ATOM   310  N  N     . ASP A 1 40  ? 37.760 0.294   0.268   1.00 28.33 ? 48  ASP A N     1 
ATOM   311  C  CA    . ASP A 1 40  ? 37.099 0.747   -0.971  1.00 28.93 ? 48  ASP A CA    1 
ATOM   312  C  C     . ASP A 1 40  ? 35.889 1.585   -0.622  1.00 28.35 ? 48  ASP A C     1 
ATOM   313  O  O     . ASP A 1 40  ? 35.268 2.237   -1.485  1.00 28.86 ? 48  ASP A O     1 
ATOM   314  C  CB    . ASP A 1 40  ? 36.689 -0.436  -1.854  1.00 29.59 ? 48  ASP A CB    1 
ATOM   315  C  CG    . ASP A 1 40  ? 35.991 -1.521  -1.071  1.00 31.11 ? 48  ASP A CG    1 
ATOM   316  O  OD1   . ASP A 1 40  ? 34.761 -1.392  -0.856  1.00 32.43 ? 48  ASP A OD1   1 
ATOM   317  O  OD2   . ASP A 1 40  ? 36.597 -2.527  -0.618  1.00 32.88 ? 48  ASP A OD2   1 
ATOM   318  N  N     . ILE A 1 41  ? 35.548 1.552   0.661   1.00 27.05 ? 49  ILE A N     1 
ATOM   319  C  CA    . ILE A 1 41  ? 34.667 2.517   1.220   1.00 25.95 ? 49  ILE A CA    1 
ATOM   320  C  C     . ILE A 1 41  ? 35.400 3.877   1.210   1.00 24.08 ? 49  ILE A C     1 
ATOM   321  O  O     . ILE A 1 41  ? 36.455 4.111   1.842   1.00 23.57 ? 49  ILE A O     1 
ATOM   322  C  CB    . ILE A 1 41  ? 34.199 2.060   2.592   1.00 26.90 ? 49  ILE A CB    1 
ATOM   323  C  CG1   . ILE A 1 41  ? 32.670 1.998   2.597   1.00 28.61 ? 49  ILE A CG1   1 
ATOM   324  C  CG2   . ILE A 1 41  ? 34.814 2.909   3.705   1.00 27.95 ? 49  ILE A CG2   1 
ATOM   325  C  CD1   . ILE A 1 41  ? 32.111 0.597   2.232   1.00 28.88 ? 49  ILE A CD1   1 
ATOM   326  N  N     . SER A 1 42  ? 34.862 4.731   0.373   1.00 19.59 ? 50  SER A N     1 
ATOM   327  C  CA    . SER A 1 42  ? 35.310 6.088   0.249   1.00 17.14 ? 50  SER A CA    1 
ATOM   328  C  C     . SER A 1 42  ? 34.603 6.888   1.313   1.00 13.68 ? 50  SER A C     1 
ATOM   329  O  O     . SER A 1 42  ? 33.473 6.571   1.703   1.00 12.43 ? 50  SER A O     1 
ATOM   330  C  CB    . SER A 1 42  ? 34.826 6.599   -1.099  1.00 16.45 ? 50  SER A CB    1 
ATOM   331  O  OG    . SER A 1 42  ? 34.993 5.585   -2.071  1.00 21.59 ? 50  SER A OG    1 
ATOM   332  N  N     . THR A 1 43  ? 35.217 7.980   1.735   1.00 10.69 ? 51  THR A N     1 
ATOM   333  C  CA    . THR A 1 43  ? 34.422 8.977   2.436   1.00 8.75  ? 51  THR A CA    1 
ATOM   334  C  C     . THR A 1 43  ? 33.378 9.566   1.504   1.00 8.20  ? 51  THR A C     1 
ATOM   335  O  O     . THR A 1 43  ? 33.524 9.514   0.259   1.00 8.40  ? 51  THR A O     1 
ATOM   336  C  CB    . THR A 1 43  ? 35.302 10.071  3.044   1.00 8.52  ? 51  THR A CB    1 
ATOM   337  O  OG1   . THR A 1 43  ? 36.061 10.710  2.000   1.00 8.87  ? 51  THR A OG1   1 
ATOM   338  C  CG2   . THR A 1 43  ? 36.360 9.446   3.938   1.00 10.15 ? 51  THR A CG2   1 
ATOM   339  N  N     . GLY A 1 44  ? 32.326 10.109  2.089   1.00 6.58  ? 52  GLY A N     1 
ATOM   340  C  CA    . GLY A 1 44  ? 31.250 10.748  1.349   1.00 6.53  ? 52  GLY A CA    1 
ATOM   341  C  C     . GLY A 1 44  ? 29.892 10.379  1.954   1.00 7.50  ? 52  GLY A C     1 
ATOM   342  O  O     . GLY A 1 44  ? 29.787 9.805   3.070   1.00 7.63  ? 52  GLY A O     1 
ATOM   343  N  N     . ILE A 1 45  ? 28.856 10.677  1.190   1.00 6.45  ? 53  ILE A N     1 
ATOM   344  C  CA    . ILE A 1 45  ? 27.488 10.501  1.642   1.00 6.59  ? 53  ILE A CA    1 
ATOM   345  C  C     . ILE A 1 45  ? 26.908 9.310   0.898   1.00 6.20  ? 53  ILE A C     1 
ATOM   346  O  O     . ILE A 1 45  ? 27.005 9.219   -0.319  1.00 7.26  ? 53  ILE A O     1 
ATOM   347  C  CB    . ILE A 1 45  ? 26.623 11.787  1.385   1.00 7.35  ? 53  ILE A CB    1 
ATOM   348  C  CG1   . ILE A 1 45  ? 27.271 13.037  2.007   1.00 9.30  ? 53  ILE A CG1   1 
ATOM   349  C  CG2   . ILE A 1 45  ? 25.244 11.594  1.944   1.00 9.50  ? 53  ILE A CG2   1 
ATOM   350  C  CD1   . ILE A 1 45  ? 27.582 12.937  3.512   1.00 12.76 ? 53  ILE A CD1   1 
ATOM   351  N  N     . TYR A 1 46  ? 26.309 8.392   1.646   1.00 6.42  ? 54  TYR A N     1 
ATOM   352  C  CA    . TYR A 1 46  ? 25.695 7.179   1.065   1.00 6.24  ? 54  TYR A CA    1 
ATOM   353  C  C     . TYR A 1 46  ? 24.231 7.140   1.492   1.00 6.58  ? 54  TYR A C     1 
ATOM   354  O  O     . TYR A 1 46  ? 23.791 7.902   2.394   1.00 7.61  ? 54  TYR A O     1 
ATOM   355  C  CB    . TYR A 1 46  ? 26.393 5.935   1.639   1.00 6.14  ? 54  TYR A CB    1 
ATOM   356  C  CG    . TYR A 1 46  ? 27.827 5.750   1.256   1.00 6.09  ? 54  TYR A CG    1 
ATOM   357  C  CD1   . TYR A 1 46  ? 28.850 6.499   1.867   1.00 7.06  ? 54  TYR A CD1   1 
ATOM   358  C  CD2   . TYR A 1 46  ? 28.189 4.743   0.346   1.00 6.38  ? 54  TYR A CD2   1 
ATOM   359  C  CE1   . TYR A 1 46  ? 30.202 6.290   1.536   1.00 6.61  ? 54  TYR A CE1   1 
ATOM   360  C  CE2   . TYR A 1 46  ? 29.524 4.502   0.048   1.00 8.30  ? 54  TYR A CE2   1 
ATOM   361  C  CZ    . TYR A 1 46  ? 30.523 5.290   0.616   1.00 8.64  ? 54  TYR A CZ    1 
ATOM   362  O  OH    . TYR A 1 46  ? 31.830 5.026   0.244   1.00 12.44 ? 54  TYR A OH    1 
ATOM   363  N  N     . TYR A 1 47  ? 23.465 6.222   0.921   1.00 7.53  ? 55  TYR A N     1 
ATOM   364  C  CA    . TYR A 1 47  ? 22.050 6.073   1.283   1.00 7.63  ? 55  TYR A CA    1 
ATOM   365  C  C     . TYR A 1 47  ? 21.715 4.597   1.379   1.00 7.81  ? 55  TYR A C     1 
ATOM   366  O  O     . TYR A 1 47  ? 22.443 3.737   0.883   1.00 7.54  ? 55  TYR A O     1 
ATOM   367  C  CB    . TYR A 1 47  ? 21.115 6.816   0.316   1.00 8.74  ? 55  TYR A CB    1 
ATOM   368  C  CG    . TYR A 1 47  ? 21.256 6.409   -1.119  1.00 7.50  ? 55  TYR A CG    1 
ATOM   369  C  CD1   . TYR A 1 47  ? 22.223 6.984   -1.936  1.00 10.69 ? 55  TYR A CD1   1 
ATOM   370  C  CD2   . TYR A 1 47  ? 20.467 5.390   -1.664  1.00 9.84  ? 55  TYR A CD2   1 
ATOM   371  C  CE1   . TYR A 1 47  ? 22.367 6.594   -3.260  1.00 9.39  ? 55  TYR A CE1   1 
ATOM   372  C  CE2   . TYR A 1 47  ? 20.606 4.996   -2.968  1.00 11.48 ? 55  TYR A CE2   1 
ATOM   373  C  CZ    . TYR A 1 47  ? 21.556 5.601   -3.767  1.00 10.43 ? 55  TYR A CZ    1 
ATOM   374  O  OH    . TYR A 1 47  ? 21.663 5.192   -5.057  1.00 13.71 ? 55  TYR A OH    1 
ATOM   375  N  N     . GLY A 1 48  ? 20.643 4.289   2.073   1.00 7.14  ? 56  GLY A N     1 
ATOM   376  C  CA    . GLY A 1 48  ? 20.345 2.898   2.311   1.00 7.74  ? 56  GLY A CA    1 
ATOM   377  C  C     . GLY A 1 48  ? 19.128 2.751   3.202   1.00 7.82  ? 56  GLY A C     1 
ATOM   378  O  O     . GLY A 1 48  ? 18.259 3.641   3.248   1.00 6.79  ? 56  GLY A O     1 
ATOM   379  N  N     . TRP A 1 49  ? 19.127 1.652   3.950   1.00 6.88  ? 57  TRP A N     1 
ATOM   380  C  CA    . TRP A 1 49  ? 17.977 1.284   4.789   1.00 6.51  ? 57  TRP A CA    1 
ATOM   381  C  C     . TRP A 1 49  ? 18.469 1.061   6.192   1.00 6.93  ? 57  TRP A C     1 
ATOM   382  O  O     . TRP A 1 49  ? 19.620 0.635   6.412   1.00 6.79  ? 57  TRP A O     1 
ATOM   383  C  CB    . TRP A 1 49  ? 17.313 -0.012  4.281   1.00 5.93  ? 57  TRP A CB    1 
ATOM   384  C  CG    . TRP A 1 49  ? 16.760 0.122   2.885   1.00 6.63  ? 57  TRP A CG    1 
ATOM   385  C  CD1   . TRP A 1 49  ? 17.327 -0.312  1.717   1.00 6.02  ? 57  TRP A CD1   1 
ATOM   386  C  CD2   . TRP A 1 49  ? 15.530 0.745   2.526   1.00 6.26  ? 57  TRP A CD2   1 
ATOM   387  N  NE1   . TRP A 1 49  ? 16.526 0.033   0.652   1.00 5.74  ? 57  TRP A NE1   1 
ATOM   388  C  CE2   . TRP A 1 49  ? 15.401 0.651   1.123   1.00 6.35  ? 57  TRP A CE2   1 
ATOM   389  C  CE3   . TRP A 1 49  ? 14.505 1.363   3.259   1.00 8.32  ? 57  TRP A CE3   1 
ATOM   390  C  CZ2   . TRP A 1 49  ? 14.295 1.180   0.419   1.00 6.42  ? 57  TRP A CZ2   1 
ATOM   391  C  CZ3   . TRP A 1 49  ? 13.412 1.891   2.562   1.00 8.76  ? 57  TRP A CZ3   1 
ATOM   392  C  CH2   . TRP A 1 49  ? 13.304 1.762   1.156   1.00 8.42  ? 57  TRP A CH2   1 
ATOM   393  N  N     . ALA A 1 50  ? 17.610 1.356   7.161   1.00 6.81  ? 58  ALA A N     1 
ATOM   394  C  CA    . ALA A 1 50  ? 17.990 1.166   8.572   1.00 7.84  ? 58  ALA A CA    1 
ATOM   395  C  C     . ALA A 1 50  ? 16.805 0.758   9.396   1.00 7.33  ? 58  ALA A C     1 
ATOM   396  O  O     . ALA A 1 50  ? 15.698 1.217   9.153   1.00 7.88  ? 58  ALA A O     1 
ATOM   397  C  CB    . ALA A 1 50  ? 18.590 2.486   9.162   1.00 7.36  ? 58  ALA A CB    1 
ATOM   398  N  N     . SER A 1 51  ? 17.057 -0.026  10.443  1.00 7.42  ? 59  SER A N     1 
ATOM   399  C  CA    . SER A 1 51  ? 16.034 -0.272  11.446  1.00 6.63  ? 59  SER A CA    1 
ATOM   400  C  C     . SER A 1 51  ? 16.721 -0.195  12.820  1.00 7.77  ? 59  SER A C     1 
ATOM   401  O  O     . SER A 1 51  ? 17.942 -0.407  12.925  1.00 6.68  ? 59  SER A O     1 
ATOM   402  C  CB    . SER A 1 51  ? 15.392 -1.647  11.223  1.00 7.04  ? 59  SER A CB    1 
ATOM   403  O  OG    . SER A 1 51  ? 16.321 -2.711  11.481  1.00 6.37  ? 59  SER A OG    1 
ATOM   404  N  N     . VAL A 1 52  ? 15.924 0.082   13.853  1.00 8.31  ? 60  VAL A N     1 
ATOM   405  C  CA    . VAL A 1 52  ? 16.415 0.124   15.237  1.00 10.50 ? 60  VAL A CA    1 
ATOM   406  C  C     . VAL A 1 52  ? 15.775 -1.006  16.046  1.00 11.50 ? 60  VAL A C     1 
ATOM   407  O  O     . VAL A 1 52  ? 14.520 -1.152  16.086  1.00 10.78 ? 60  VAL A O     1 
ATOM   408  C  CB    . VAL A 1 52  ? 16.095 1.507   15.897  1.00 10.58 ? 60  VAL A CB    1 
ATOM   409  C  CG1   . VAL A 1 52  ? 16.555 1.533   17.386  1.00 12.02 ? 60  VAL A CG1   1 
ATOM   410  C  CG2   . VAL A 1 52  ? 16.791 2.604   15.128  1.00 12.58 ? 60  VAL A CG2   1 
ATOM   411  N  N     . GLY A 1 53  ? 16.634 -1.819  16.668  1.00 12.08 ? 61  GLY A N     1 
ATOM   412  C  CA    . GLY A 1 53  ? 16.187 -3.012  17.400  1.00 13.83 ? 61  GLY A CA    1 
ATOM   413  C  C     . GLY A 1 53  ? 15.256 -3.830  16.515  1.00 14.22 ? 61  GLY A C     1 
ATOM   414  O  O     . GLY A 1 53  ? 15.610 -4.191  15.391  1.00 15.22 ? 61  GLY A O     1 
ATOM   415  N  N     . SER A 1 54  ? 14.040 -4.055  16.984  1.00 15.39 ? 62  SER A N     1 
ATOM   416  C  CA    . SER A 1 54  ? 13.083 -4.900  16.271  1.00 15.62 ? 62  SER A CA    1 
ATOM   417  C  C     . SER A 1 54  ? 12.099 -4.086  15.424  1.00 15.43 ? 62  SER A C     1 
ATOM   418  O  O     . SER A 1 54  ? 11.117 -4.639  14.909  1.00 15.34 ? 62  SER A O     1 
ATOM   419  C  CB    . SER A 1 54  ? 12.330 -5.820  17.260  1.00 16.56 ? 62  SER A CB    1 
ATOM   420  O  OG    . SER A 1 54  ? 11.611 -5.045  18.214  1.00 19.05 ? 62  SER A OG    1 
ATOM   421  N  N     . GLY A 1 55  ? 12.391 -2.790  15.267  1.00 13.78 ? 63  GLY A N     1 
ATOM   422  C  CA    . GLY A 1 55  ? 11.540 -1.844  14.550  1.00 12.10 ? 63  GLY A CA    1 
ATOM   423  C  C     . GLY A 1 55  ? 11.484 -2.032  13.044  1.00 11.58 ? 63  GLY A C     1 
ATOM   424  O  O     . GLY A 1 55  ? 12.163 -2.875  12.470  1.00 11.62 ? 63  GLY A O     1 
ATOM   425  N  N     . ASP A 1 56  ? 10.650 -1.230  12.394  1.00 10.29 ? 64  ASP A N     1 
ATOM   426  C  CA    . ASP A 1 56  ? 10.485 -1.295  10.947  1.00 9.81  ? 64  ASP A CA    1 
ATOM   427  C  C     . ASP A 1 56  ? 11.690 -0.695  10.228  1.00 8.51  ? 64  ASP A C     1 
ATOM   428  O  O     . ASP A 1 56  ? 12.508 0.009   10.858  1.00 9.60  ? 64  ASP A O     1 
ATOM   429  C  CB    . ASP A 1 56  ? 9.214  -0.550  10.554  1.00 10.46 ? 64  ASP A CB    1 
ATOM   430  C  CG    . ASP A 1 56  ? 7.943  -1.308  10.912  1.00 13.95 ? 64  ASP A CG    1 
ATOM   431  O  OD1   . ASP A 1 56  ? 7.976  -2.525  11.201  1.00 16.47 ? 64  ASP A OD1   1 
ATOM   432  O  OD2   . ASP A 1 56  ? 6.838  -0.734  10.911  1.00 19.58 ? 64  ASP A OD2   1 
ATOM   433  N  N     . VAL A 1 57  ? 11.800 -1.022  8.933   1.00 6.92  ? 65  VAL A N     1 
ATOM   434  C  CA    . VAL A 1 57  ? 12.898 -0.578  8.083   1.00 6.67  ? 65  VAL A CA    1 
ATOM   435  C  C     . VAL A 1 57  ? 12.536 0.758   7.433   1.00 6.23  ? 65  VAL A C     1 
ATOM   436  O  O     . VAL A 1 57  ? 11.479 0.895   6.805   1.00 5.83  ? 65  VAL A O     1 
ATOM   437  C  CB    . VAL A 1 57  ? 13.266 -1.635  7.001   1.00 7.07  ? 65  VAL A CB    1 
ATOM   438  C  CG1   . VAL A 1 57  ? 14.493 -1.168  6.202   1.00 8.63  ? 65  VAL A CG1   1 
ATOM   439  C  CG2   . VAL A 1 57  ? 13.543 -3.025  7.692   1.00 7.90  ? 65  VAL A CG2   1 
ATOM   440  N  N     . HIS A 1 58  ? 13.431 1.733   7.586   1.00 6.78  ? 66  HIS A N     1 
ATOM   441  C  CA    . HIS A 1 58  ? 13.218 3.085   7.051   1.00 7.00  ? 66  HIS A CA    1 
ATOM   442  C  C     . HIS A 1 58  ? 14.388 3.507   6.166   1.00 6.39  ? 66  HIS A C     1 
ATOM   443  O  O     . HIS A 1 58  ? 15.492 2.928   6.242   1.00 8.26  ? 66  HIS A O     1 
ATOM   444  C  CB    . HIS A 1 58  ? 13.099 4.089   8.204   1.00 7.92  ? 66  HIS A CB    1 
ATOM   445  C  CG    . HIS A 1 58  ? 12.040 3.730   9.204   1.00 9.98  ? 66  HIS A CG    1 
ATOM   446  N  ND1   . HIS A 1 58  ? 10.698 3.847   8.937   1.00 11.58 ? 66  HIS A ND1   1 
ATOM   447  C  CD2   . HIS A 1 58  ? 12.131 3.267   10.469  1.00 10.35 ? 66  HIS A CD2   1 
ATOM   448  C  CE1   . HIS A 1 58  ? 9.998  3.462   9.991   1.00 10.60 ? 66  HIS A CE1   1 
ATOM   449  N  NE2   . HIS A 1 58  ? 10.843 3.099   10.932  1.00 11.89 ? 66  HIS A NE2   1 
ATOM   450  N  N     . LYS A 1 59  ? 14.163 4.533   5.347   1.00 6.35  ? 67  LYS A N     1 
ATOM   451  C  CA    . LYS A 1 59  ? 15.210 5.091   4.510   1.00 6.30  ? 67  LYS A CA    1 
ATOM   452  C  C     . LYS A 1 59  ? 16.211 5.819   5.396   1.00 5.80  ? 67  LYS A C     1 
ATOM   453  O  O     . LYS A 1 59  ? 15.849 6.276   6.490   1.00 6.66  ? 67  LYS A O     1 
ATOM   454  C  CB    . LYS A 1 59  ? 14.606 6.037   3.464   1.00 5.28  ? 67  LYS A CB    1 
ATOM   455  C  CG    . LYS A 1 59  ? 13.598 5.346   2.557   1.00 5.72  ? 67  LYS A CG    1 
ATOM   456  C  CD    . LYS A 1 59  ? 13.148 6.303   1.429   1.00 5.88  ? 67  LYS A CD    1 
ATOM   457  C  CE    . LYS A 1 59  ? 12.254 5.577   0.407   1.00 5.03  ? 67  LYS A CE    1 
ATOM   458  N  NZ    . LYS A 1 59  ? 11.659 6.545   -0.643  1.00 5.84  ? 67  LYS A NZ    1 
ATOM   459  N  N     . MET A 1 60  ? 17.461 5.921   4.945   1.00 6.41  ? 68  MET A N     1 
ATOM   460  C  CA    . MET A 1 60  ? 18.461 6.608   5.749   1.00 7.13  ? 68  MET A CA    1 
ATOM   461  C  C     . MET A 1 60  ? 19.570 7.129   4.831   1.00 7.70  ? 68  MET A C     1 
ATOM   462  O  O     . MET A 1 60  ? 19.685 6.708   3.653   1.00 7.08  ? 68  MET A O     1 
ATOM   463  C  CB    . MET A 1 60  ? 19.031 5.700   6.845   1.00 6.89  ? 68  MET A CB    1 
ATOM   464  C  CG    . MET A 1 60  ? 19.703 4.409   6.310   1.00 6.66  ? 68  MET A CG    1 
ATOM   465  S  SD    . MET A 1 60  ? 21.289 4.720   5.539   1.00 11.38 ? 68  MET A SD    1 
ATOM   466  C  CE    . MET A 1 60  ? 22.120 3.124   5.822   1.00 9.61  ? 68  MET A CE    1 
ATOM   467  N  N     . VAL A 1 61  ? 20.311 8.101   5.350   1.00 6.69  ? 69  VAL A N     1 
ATOM   468  C  CA    . VAL A 1 61  ? 21.567 8.524   4.730   1.00 7.22  ? 69  VAL A CA    1 
ATOM   469  C  C     . VAL A 1 61  ? 22.693 8.315   5.753   1.00 7.29  ? 69  VAL A C     1 
ATOM   470  O  O     . VAL A 1 61  ? 22.496 8.473   6.976   1.00 7.41  ? 69  VAL A O     1 
ATOM   471  C  CB    . VAL A 1 61  ? 21.571 9.983   4.290   1.00 7.88  ? 69  VAL A CB    1 
ATOM   472  C  CG1   . VAL A 1 61  ? 20.609 10.179  3.101   1.00 10.05 ? 69  VAL A CG1   1 
ATOM   473  C  CG2   . VAL A 1 61  ? 21.165 10.872  5.405   1.00 10.96 ? 69  VAL A CG2   1 
ATOM   474  N  N     . VAL A 1 62  ? 23.851 7.947   5.256   1.00 6.98  ? 70  VAL A N     1 
ATOM   475  C  CA    . VAL A 1 62  ? 25.010 7.740   6.131   1.00 7.89  ? 70  VAL A CA    1 
ATOM   476  C  C     . VAL A 1 62  ? 26.112 8.592   5.614   1.00 8.01  ? 70  VAL A C     1 
ATOM   477  O  O     . VAL A 1 62  ? 26.371 8.581   4.408   1.00 8.84  ? 70  VAL A O     1 
ATOM   478  C  CB    . VAL A 1 62  ? 25.526 6.270   6.084   1.00 9.28  ? 70  VAL A CB    1 
ATOM   479  C  CG1   . VAL A 1 62  ? 26.850 6.167   6.912   1.00 11.89 ? 70  VAL A CG1   1 
ATOM   480  C  CG2   . VAL A 1 62  ? 24.511 5.315   6.663   1.00 11.59 ? 70  VAL A CG2   1 
ATOM   481  N  N     . SER A 1 63  ? 26.796 9.282   6.522   1.00 7.47  ? 71  SER A N     1 
ATOM   482  C  CA    . SER A 1 63  ? 27.996 10.033  6.192   1.00 8.36  ? 71  SER A CA    1 
ATOM   483  C  C     . SER A 1 63  ? 29.229 9.279   6.681   1.00 8.36  ? 71  SER A C     1 
ATOM   484  O  O     . SER A 1 63  ? 29.335 8.947   7.875   1.00 8.23  ? 71  SER A O     1 
ATOM   485  C  CB    . SER A 1 63  ? 27.916 11.400  6.860   1.00 10.46 ? 71  SER A CB    1 
ATOM   486  O  OG    . SER A 1 63  ? 29.053 12.159  6.521   1.00 17.77 ? 71  SER A OG    1 
ATOM   487  N  N     . ILE A 1 64  ? 30.160 9.001   5.779   1.00 6.82  ? 72  ILE A N     1 
ATOM   488  C  CA    . ILE A 1 64  ? 31.463 8.397   6.175   1.00 8.21  ? 72  ILE A CA    1 
ATOM   489  C  C     . ILE A 1 64  ? 32.519 9.462   6.007   1.00 7.16  ? 72  ILE A C     1 
ATOM   490  O  O     . ILE A 1 64  ? 32.631 10.072  4.928   1.00 7.43  ? 72  ILE A O     1 
ATOM   491  C  CB    . ILE A 1 64  ? 31.788 7.167   5.307   1.00 7.90  ? 72  ILE A CB    1 
ATOM   492  C  CG1   A ILE A 1 64  ? 30.711 6.091   5.569   0.50 8.23  ? 72  ILE A CG1   1 
ATOM   493  C  CG1   B ILE A 1 64  ? 30.623 6.158   5.327   0.50 9.23  ? 72  ILE A CG1   1 
ATOM   494  C  CG2   . ILE A 1 64  ? 33.180 6.618   5.663   1.00 9.23  ? 72  ILE A CG2   1 
ATOM   495  C  CD1   A ILE A 1 64  ? 30.891 4.749   4.822   0.50 6.29  ? 72  ILE A CD1   1 
ATOM   496  C  CD1   B ILE A 1 64  ? 30.519 5.329   6.570   0.50 9.96  ? 72  ILE A CD1   1 
ATOM   497  N  N     . GLY A 1 65  ? 33.261 9.733   7.070   1.00 6.83  ? 73  GLY A N     1 
ATOM   498  C  CA    . GLY A 1 65  ? 34.215 10.814  7.041   1.00 7.22  ? 73  GLY A CA    1 
ATOM   499  C  C     . GLY A 1 65  ? 35.512 10.403  7.676   1.00 6.77  ? 73  GLY A C     1 
ATOM   500  O  O     . GLY A 1 65  ? 35.682 9.236   8.037   1.00 7.18  ? 73  GLY A O     1 
ATOM   501  N  N     . TRP A 1 66  ? 36.453 11.341  7.770   1.00 7.51  ? 74  TRP A N     1 
ATOM   502  C  CA    . TRP A 1 66  ? 37.704 11.084  8.467   1.00 9.14  ? 74  TRP A CA    1 
ATOM   503  C  C     . TRP A 1 66  ? 37.529 11.581  9.897   1.00 12.01 ? 74  TRP A C     1 
ATOM   504  O  O     . TRP A 1 66  ? 36.897 12.618  10.127  1.00 12.64 ? 74  TRP A O     1 
ATOM   505  C  CB    . TRP A 1 66  ? 38.864 11.798  7.808   1.00 9.25  ? 74  TRP A CB    1 
ATOM   506  C  CG    . TRP A 1 66  ? 39.166 11.254  6.453   1.00 8.43  ? 74  TRP A CG    1 
ATOM   507  C  CD1   . TRP A 1 66  ? 38.925 11.867  5.245   1.00 11.10 ? 74  TRP A CD1   1 
ATOM   508  C  CD2   . TRP A 1 66  ? 39.747 9.996   6.158   1.00 9.76  ? 74  TRP A CD2   1 
ATOM   509  N  NE1   . TRP A 1 66  ? 39.333 11.050  4.218   1.00 10.75 ? 74  TRP A NE1   1 
ATOM   510  C  CE2   . TRP A 1 66  ? 39.840 9.894   4.746   1.00 11.92 ? 74  TRP A CE2   1 
ATOM   511  C  CE3   . TRP A 1 66  ? 40.222 8.932   6.942   1.00 10.02 ? 74  TRP A CE3   1 
ATOM   512  C  CZ2   . TRP A 1 66  ? 40.386 8.776   4.110   1.00 13.28 ? 74  TRP A CZ2   1 
ATOM   513  C  CZ3   . TRP A 1 66  ? 40.766 7.815   6.307   1.00 13.66 ? 74  TRP A CZ3   1 
ATOM   514  C  CH2   . TRP A 1 66  ? 40.846 7.750   4.899   1.00 13.53 ? 74  TRP A CH2   1 
ATOM   515  N  N     . ASN A 1 67  ? 38.036 10.796  10.835  1.00 13.71 ? 75  ASN A N     1 
ATOM   516  C  CA    . ASN A 1 67  ? 38.094 11.229  12.230  1.00 16.36 ? 75  ASN A CA    1 
ATOM   517  C  C     . ASN A 1 67  ? 39.396 11.978  12.491  1.00 17.25 ? 75  ASN A C     1 
ATOM   518  O  O     . ASN A 1 67  ? 40.487 11.372  12.440  1.00 18.02 ? 75  ASN A O     1 
ATOM   519  C  CB    . ASN A 1 67  ? 37.989 10.032  13.182  1.00 16.41 ? 75  ASN A CB    1 
ATOM   520  C  CG    . ASN A 1 67  ? 37.750 10.458  14.629  1.00 19.11 ? 75  ASN A CG    1 
ATOM   521  O  OD1   . ASN A 1 67  ? 38.082 11.568  15.023  1.00 21.76 ? 75  ASN A OD1   1 
ATOM   522  N  ND2   . ASN A 1 67  ? 37.155 9.568   15.413  1.00 19.94 ? 75  ASN A ND2   1 
ATOM   523  N  N     . PRO A 1 68  ? 39.285 13.270  12.801  1.00 18.01 ? 76  PRO A N     1 
ATOM   524  C  CA    . PRO A 1 68  ? 40.460 14.070  13.225  1.00 20.07 ? 76  PRO A CA    1 
ATOM   525  C  C     . PRO A 1 68  ? 41.216 13.534  14.486  1.00 21.74 ? 76  PRO A C     1 
ATOM   526  O  O     . PRO A 1 68  ? 42.437 13.680  14.633  1.00 22.98 ? 76  PRO A O     1 
ATOM   527  C  CB    . PRO A 1 68  ? 39.853 15.465  13.496  1.00 19.55 ? 76  PRO A CB    1 
ATOM   528  C  CG    . PRO A 1 68  ? 38.526 15.486  12.694  1.00 19.26 ? 76  PRO A CG    1 
ATOM   529  C  CD    . PRO A 1 68  ? 38.034 14.063  12.766  1.00 17.75 ? 76  PRO A CD    1 
ATOM   530  N  N     . TYR A 1 69  ? 40.493 12.866  15.367  1.00 23.65 ? 77  TYR A N     1 
ATOM   531  C  CA    . TYR A 1 69  ? 40.930 12.703  16.755  1.00 24.62 ? 77  TYR A CA    1 
ATOM   532  C  C     . TYR A 1 69  ? 41.592 11.374  17.157  1.00 25.59 ? 77  TYR A C     1 
ATOM   533  O  O     . TYR A 1 69  ? 42.136 11.287  18.262  1.00 26.04 ? 77  TYR A O     1 
ATOM   534  C  CB    . TYR A 1 69  ? 39.767 12.988  17.719  1.00 24.46 ? 77  TYR A CB    1 
ATOM   535  C  CG    . TYR A 1 69  ? 38.964 14.259  17.489  1.00 23.96 ? 77  TYR A CG    1 
ATOM   536  C  CD1   . TYR A 1 69  ? 39.529 15.523  17.649  1.00 24.60 ? 77  TYR A CD1   1 
ATOM   537  C  CD2   . TYR A 1 69  ? 37.614 14.183  17.162  1.00 25.94 ? 77  TYR A CD2   1 
ATOM   538  C  CE1   . TYR A 1 69  ? 38.765 16.668  17.465  1.00 24.51 ? 77  TYR A CE1   1 
ATOM   539  C  CE2   . TYR A 1 69  ? 36.849 15.311  16.983  1.00 23.87 ? 77  TYR A CE2   1 
ATOM   540  C  CZ    . TYR A 1 69  ? 37.418 16.541  17.134  1.00 24.67 ? 77  TYR A CZ    1 
ATOM   541  O  OH    . TYR A 1 69  ? 36.617 17.643  16.929  1.00 26.50 ? 77  TYR A OH    1 
ATOM   542  N  N     . TYR A 1 70  ? 41.549 10.334  16.326  1.00 25.91 ? 78  TYR A N     1 
ATOM   543  C  CA    . TYR A 1 70  ? 42.247 9.106   16.729  1.00 27.15 ? 78  TYR A CA    1 
ATOM   544  C  C     . TYR A 1 70  ? 43.575 8.963   16.006  1.00 28.00 ? 78  TYR A C     1 
ATOM   545  O  O     . TYR A 1 70  ? 43.717 9.460   14.884  1.00 28.39 ? 78  TYR A O     1 
ATOM   546  C  CB    . TYR A 1 70  ? 41.421 7.849   16.478  1.00 27.49 ? 78  TYR A CB    1 
ATOM   547  C  CG    . TYR A 1 70  ? 40.093 7.776   17.201  1.00 27.85 ? 78  TYR A CG    1 
ATOM   548  C  CD1   . TYR A 1 70  ? 39.872 8.476   18.401  1.00 28.32 ? 78  TYR A CD1   1 
ATOM   549  C  CD2   . TYR A 1 70  ? 39.052 6.989   16.679  1.00 28.36 ? 78  TYR A CD2   1 
ATOM   550  C  CE1   . TYR A 1 70  ? 38.636 8.388   19.054  1.00 28.93 ? 78  TYR A CE1   1 
ATOM   551  C  CE2   . TYR A 1 70  ? 37.824 6.891   17.326  1.00 28.56 ? 78  TYR A CE2   1 
ATOM   552  C  CZ    . TYR A 1 70  ? 37.621 7.593   18.514  1.00 27.33 ? 78  TYR A CZ    1 
ATOM   553  O  OH    . TYR A 1 70  ? 36.401 7.500   19.132  1.00 27.12 ? 78  TYR A OH    1 
ATOM   554  N  N     . LYS A 1 71  ? 44.543 8.284   16.634  1.00 28.68 ? 79  LYS A N     1 
ATOM   555  C  CA    . LYS A 1 71  ? 45.798 7.998   15.938  1.00 29.36 ? 79  LYS A CA    1 
ATOM   556  C  C     . LYS A 1 71  ? 45.536 7.035   14.778  1.00 29.64 ? 79  LYS A C     1 
ATOM   557  O  O     . LYS A 1 71  ? 44.539 6.285   14.775  1.00 29.42 ? 79  LYS A O     1 
ATOM   558  C  CB    . LYS A 1 71  ? 46.954 7.550   16.856  1.00 29.51 ? 79  LYS A CB    1 
ATOM   559  C  CG    . LYS A 1 71  ? 46.615 6.591   17.979  1.00 29.67 ? 79  LYS A CG    1 
ATOM   560  C  CD    . LYS A 1 71  ? 47.881 6.245   18.758  1.00 29.44 ? 79  LYS A CD    1 
ATOM   561  C  CE    . LYS A 1 71  ? 47.802 4.838   19.336  1.00 30.05 ? 79  LYS A CE    1 
ATOM   562  N  NZ    . LYS A 1 71  ? 49.131 4.168   19.360  1.00 29.21 ? 79  LYS A NZ    1 
ATOM   563  N  N     . ASN A 1 72  ? 46.419 7.103   13.781  1.00 30.00 ? 80  ASN A N     1 
ATOM   564  C  CA    . ASN A 1 72  ? 46.200 6.481   12.478  1.00 29.87 ? 80  ASN A CA    1 
ATOM   565  C  C     . ASN A 1 72  ? 45.039 7.178   11.733  1.00 29.25 ? 80  ASN A C     1 
ATOM   566  O  O     . ASN A 1 72  ? 44.409 8.107   12.268  1.00 29.76 ? 80  ASN A O     1 
ATOM   567  C  CB    . ASN A 1 72  ? 46.058 4.951   12.623  1.00 30.23 ? 80  ASN A CB    1 
ATOM   568  C  CG    . ASN A 1 72  ? 47.006 4.374   13.690  1.00 31.39 ? 80  ASN A CG    1 
ATOM   569  O  OD1   . ASN A 1 72  ? 48.206 4.688   13.723  1.00 32.31 ? 80  ASN A OD1   1 
ATOM   570  N  ND2   . ASN A 1 72  ? 46.463 3.544   14.574  1.00 33.51 ? 80  ASN A ND2   1 
ATOM   571  N  N     . THR A 1 73  ? 44.782 6.784   10.491  1.00 28.09 ? 81  THR A N     1 
ATOM   572  C  CA    . THR A 1 73  ? 43.753 7.456   9.695   1.00 26.31 ? 81  THR A CA    1 
ATOM   573  C  C     . THR A 1 73  ? 42.435 6.736   9.919   1.00 24.22 ? 81  THR A C     1 
ATOM   574  O  O     . THR A 1 73  ? 42.079 5.838   9.145   1.00 25.22 ? 81  THR A O     1 
ATOM   575  C  CB    . THR A 1 73  ? 44.094 7.433   8.185   1.00 26.56 ? 81  THR A CB    1 
ATOM   576  O  OG1   . THR A 1 73  ? 44.818 6.235   7.877   1.00 27.82 ? 81  THR A OG1   1 
ATOM   577  C  CG2   . THR A 1 73  ? 45.073 8.548   7.831   1.00 27.94 ? 81  THR A CG2   1 
ATOM   578  N  N     . LYS A 1 74  ? 41.714 7.117   10.970  1.00 20.62 ? 82  LYS A N     1 
ATOM   579  C  CA    . LYS A 1 74  ? 40.454 6.455   11.277  1.00 16.89 ? 82  LYS A CA    1 
ATOM   580  C  C     . LYS A 1 74  ? 39.287 7.212   10.678  1.00 14.17 ? 82  LYS A C     1 
ATOM   581  O  O     . LYS A 1 74  ? 39.307 8.426   10.565  1.00 12.31 ? 82  LYS A O     1 
ATOM   582  C  CB    . LYS A 1 74  ? 40.247 6.284   12.786  1.00 17.72 ? 82  LYS A CB    1 
ATOM   583  C  CG    . LYS A 1 74  ? 41.294 5.383   13.475  1.00 19.06 ? 82  LYS A CG    1 
ATOM   584  C  CD    . LYS A 1 74  ? 41.150 3.918   13.049  1.00 23.48 ? 82  LYS A CD    1 
ATOM   585  C  CE    . LYS A 1 74  ? 42.018 3.007   13.893  1.00 25.41 ? 82  LYS A CE    1 
ATOM   586  N  NZ    . LYS A 1 74  ? 43.383 2.829   13.305  1.00 27.50 ? 82  LYS A NZ    1 
ATOM   587  N  N     . LYS A 1 75  ? 38.248 6.469   10.325  1.00 12.29 ? 83  LYS A N     1 
ATOM   588  C  CA    . LYS A 1 75  ? 37.075 7.077   9.774   1.00 10.00 ? 83  LYS A CA    1 
ATOM   589  C  C     . LYS A 1 75  ? 36.009 7.227   10.830  1.00 9.60  ? 83  LYS A C     1 
ATOM   590  O  O     . LYS A 1 75  ? 36.140 6.729   11.952  1.00 10.00 ? 83  LYS A O     1 
ATOM   591  C  CB    . LYS A 1 75  ? 36.549 6.262   8.607   1.00 10.61 ? 83  LYS A CB    1 
ATOM   592  C  CG    . LYS A 1 75  ? 37.488 6.248   7.387   1.00 10.82 ? 83  LYS A CG    1 
ATOM   593  C  CD    . LYS A 1 75  ? 36.875 5.377   6.303   1.00 12.61 ? 83  LYS A CD    1 
ATOM   594  C  CE    . LYS A 1 75  ? 37.636 5.536   4.996   1.00 14.83 ? 83  LYS A CE    1 
ATOM   595  N  NZ    . LYS A 1 75  ? 38.807 4.612   4.981   1.00 16.74 ? 83  LYS A NZ    1 
ATOM   596  N  N     . SER A 1 76  ? 34.957 7.939   10.458  1.00 8.53  ? 84  SER A N     1 
ATOM   597  C  CA    . SER A 1 76  ? 33.767 8.154   11.278  1.00 7.65  ? 84  SER A CA    1 
ATOM   598  C  C     . SER A 1 76  ? 32.556 7.747   10.461  1.00 7.74  ? 84  SER A C     1 
ATOM   599  O  O     . SER A 1 76  ? 32.596 7.777   9.236   1.00 7.46  ? 84  SER A O     1 
ATOM   600  C  CB    . SER A 1 76  ? 33.682 9.638   11.621  1.00 9.37  ? 84  SER A CB    1 
ATOM   601  O  OG    . SER A 1 76  ? 33.495 10.387  10.420  1.00 14.15 ? 84  SER A OG    1 
ATOM   602  N  N     . MET A 1 77  ? 31.462 7.368   11.109  1.00 5.72  ? 85  MET A N     1 
ATOM   603  C  CA    . MET A 1 77  ? 30.259 6.992   10.380  1.00 5.75  ? 85  MET A CA    1 
ATOM   604  C  C     . MET A 1 77  ? 29.067 7.461   11.225  1.00 7.30  ? 85  MET A C     1 
ATOM   605  O  O     . MET A 1 77  ? 29.035 7.227   12.419  1.00 7.30  ? 85  MET A O     1 
ATOM   606  C  CB    . MET A 1 77  ? 30.189 5.468   10.138  1.00 7.74  ? 85  MET A CB    1 
ATOM   607  C  CG    . MET A 1 77  ? 28.857 4.876   9.742   1.00 12.03 ? 85  MET A CG    1 
ATOM   608  S  SD    A MET A 1 77  ? 28.954 3.181   8.947   0.50 15.42 ? 85  MET A SD    1 
ATOM   609  S  SD    B MET A 1 77  ? 29.083 3.071   9.865   0.50 16.86 ? 85  MET A SD    1 
ATOM   610  C  CE    A MET A 1 77  ? 30.449 2.706   9.672   0.50 2.00  ? 85  MET A CE    1 
ATOM   611  C  CE    B MET A 1 77  ? 27.586 2.635   8.967   0.50 15.97 ? 85  MET A CE    1 
ATOM   612  N  N     . GLU A 1 78  ? 28.089 8.087   10.575  1.00 6.54  ? 86  GLU A N     1 
ATOM   613  C  CA    . GLU A 1 78  ? 26.923 8.582   11.284  1.00 7.69  ? 86  GLU A CA    1 
ATOM   614  C  C     . GLU A 1 78  ? 25.712 8.451   10.361  1.00 7.85  ? 86  GLU A C     1 
ATOM   615  O  O     . GLU A 1 78  ? 25.824 8.664   9.144   1.00 9.55  ? 86  GLU A O     1 
ATOM   616  C  CB    . GLU A 1 78  ? 27.159 9.999   11.784  1.00 9.66  ? 86  GLU A CB    1 
ATOM   617  C  CG    . GLU A 1 78  ? 27.126 11.043  10.712  1.00 11.31 ? 86  GLU A CG    1 
ATOM   618  C  CD    . GLU A 1 78  ? 27.353 12.450  11.269  1.00 18.53 ? 86  GLU A CD    1 
ATOM   619  O  OE1   . GLU A 1 78  ? 27.622 12.614  12.494  1.00 17.40 ? 86  GLU A OE1   1 
ATOM   620  O  OE2   . GLU A 1 78  ? 27.290 13.398  10.450  1.00 22.47 ? 86  GLU A OE2   1 
ATOM   621  N  N     . THR A 1 79  ? 24.592 8.025   10.942  1.00 6.18  ? 87  THR A N     1 
ATOM   622  C  CA    . THR A 1 79  ? 23.408 7.691   10.142  1.00 6.46  ? 87  THR A CA    1 
ATOM   623  C  C     . THR A 1 79  ? 22.242 8.541   10.566  1.00 5.23  ? 87  THR A C     1 
ATOM   624  O  O     . THR A 1 79  ? 21.944 8.602   11.769  1.00 5.63  ? 87  THR A O     1 
ATOM   625  C  CB    . THR A 1 79  ? 23.056 6.204   10.445  1.00 6.26  ? 87  THR A CB    1 
ATOM   626  O  OG1   . THR A 1 79  ? 24.160 5.371   10.002  1.00 7.64  ? 87  THR A OG1   1 
ATOM   627  C  CG2   . THR A 1 79  ? 21.822 5.778   9.620   1.00 8.78  ? 87  THR A CG2   1 
ATOM   628  N  N     . HIS A 1 80  ? 21.589 9.186   9.611   1.00 5.62  ? 88  HIS A N     1 
ATOM   629  C  CA    . HIS A 1 80  ? 20.356 9.889   9.920   1.00 5.27  ? 88  HIS A CA    1 
ATOM   630  C  C     . HIS A 1 80  ? 19.254 9.055   9.288   1.00 6.17  ? 88  HIS A C     1 
ATOM   631  O  O     . HIS A 1 80  ? 19.303 8.787   8.070   1.00 6.44  ? 88  HIS A O     1 
ATOM   632  C  CB    . HIS A 1 80  ? 20.316 11.268  9.242   1.00 5.13  ? 88  HIS A CB    1 
ATOM   633  C  CG    . HIS A 1 80  ? 18.949 11.889  9.291   1.00 6.61  ? 88  HIS A CG    1 
ATOM   634  N  ND1   . HIS A 1 80  ? 18.349 12.260  10.468  1.00 6.06  ? 88  HIS A ND1   1 
ATOM   635  C  CD2   . HIS A 1 80  ? 18.031 12.117  8.310   1.00 7.82  ? 88  HIS A CD2   1 
ATOM   636  C  CE1   . HIS A 1 80  ? 17.132 12.721  10.219  1.00 6.01  ? 88  HIS A CE1   1 
ATOM   637  N  NE2   . HIS A 1 80  ? 16.923 12.663  8.913   1.00 7.45  ? 88  HIS A NE2   1 
ATOM   638  N  N     . ILE A 1 81  ? 18.263 8.662   10.093  1.00 6.50  ? 89  ILE A N     1 
ATOM   639  C  CA    . ILE A 1 81  ? 17.138 7.860   9.597   1.00 6.20  ? 89  ILE A CA    1 
ATOM   640  C  C     . ILE A 1 81  ? 15.975 8.801   9.221   1.00 6.47  ? 89  ILE A C     1 
ATOM   641  O  O     . ILE A 1 81  ? 15.631 9.680   9.998   1.00 6.87  ? 89  ILE A O     1 
ATOM   642  C  CB    . ILE A 1 81  ? 16.704 6.852   10.642  1.00 6.68  ? 89  ILE A CB    1 
ATOM   643  C  CG1   . ILE A 1 81  ? 17.874 5.938   11.034  1.00 6.20  ? 89  ILE A CG1   1 
ATOM   644  C  CG2   . ILE A 1 81  ? 15.568 5.950   10.102  1.00 5.29  ? 89  ILE A CG2   1 
ATOM   645  C  CD1   . ILE A 1 81  ? 17.576 5.054   12.291  1.00 10.27 ? 89  ILE A CD1   1 
ATOM   646  N  N     . MET A 1 82  ? 15.342 8.567   8.067   1.00 6.13  ? 90  MET A N     1 
ATOM   647  C  CA    . MET A 1 82  ? 14.220 9.393   7.630   1.00 7.40  ? 90  MET A CA    1 
ATOM   648  C  C     . MET A 1 82  ? 12.950 8.793   8.223   1.00 7.22  ? 90  MET A C     1 
ATOM   649  O  O     . MET A 1 82  ? 12.130 8.159   7.524   1.00 7.68  ? 90  MET A O     1 
ATOM   650  C  CB    . MET A 1 82  ? 14.143 9.453   6.096   1.00 7.81  ? 90  MET A CB    1 
ATOM   651  C  CG    . MET A 1 82  ? 15.116 10.502  5.515   1.00 9.43  ? 90  MET A CG    1 
ATOM   652  S  SD    . MET A 1 82  ? 16.805 9.826   5.275   1.00 10.50 ? 90  MET A SD    1 
ATOM   653  C  CE    . MET A 1 82  ? 16.605 9.215   3.539   1.00 8.05  ? 90  MET A CE    1 
ATOM   654  N  N     . HIS A 1 83  ? 12.828 9.000   9.528   1.00 6.92  ? 91  HIS A N     1 
ATOM   655  C  CA    . HIS A 1 83  ? 11.687 8.579   10.311  1.00 6.93  ? 91  HIS A CA    1 
ATOM   656  C  C     . HIS A 1 83  ? 11.695 9.423   11.571  1.00 7.54  ? 91  HIS A C     1 
ATOM   657  O  O     . HIS A 1 83  ? 12.748 9.655   12.160  1.00 6.90  ? 91  HIS A O     1 
ATOM   658  C  CB    . HIS A 1 83  ? 11.844 7.113   10.743  1.00 7.27  ? 91  HIS A CB    1 
ATOM   659  C  CG    . HIS A 1 83  ? 10.684 6.624   11.547  1.00 7.82  ? 91  HIS A CG    1 
ATOM   660  N  ND1   . HIS A 1 83  ? 9.405  6.548   11.029  1.00 11.22 ? 91  HIS A ND1   1 
ATOM   661  C  CD2   . HIS A 1 83  ? 10.591 6.263   12.845  1.00 9.23  ? 91  HIS A CD2   1 
ATOM   662  C  CE1   . HIS A 1 83  ? 8.579  6.130   11.971  1.00 10.45 ? 91  HIS A CE1   1 
ATOM   663  N  NE2   . HIS A 1 83  ? 9.277  5.941   13.079  1.00 11.75 ? 91  HIS A NE2   1 
ATOM   664  N  N     . THR A 1 84  ? 10.527 9.859   12.008  1.00 8.61  ? 92  THR A N     1 
ATOM   665  C  CA    . THR A 1 84  ? 10.449 10.592  13.274  1.00 10.39 ? 92  THR A CA    1 
ATOM   666  C  C     . THR A 1 84  ? 10.246 9.633   14.432  1.00 11.21 ? 92  THR A C     1 
ATOM   667  O  O     . THR A 1 84  ? 9.208  8.972   14.527  1.00 12.30 ? 92  THR A O     1 
ATOM   668  C  CB    . THR A 1 84  ? 9.320  11.624  13.227  1.00 10.71 ? 92  THR A CB    1 
ATOM   669  O  OG1   . THR A 1 84  ? 9.548  12.535  12.150  1.00 13.53 ? 92  THR A OG1   1 
ATOM   670  C  CG2   . THR A 1 84  ? 9.358  12.499  14.468  1.00 11.80 ? 92  THR A CG2   1 
ATOM   671  N  N     . PHE A 1 85  ? 11.248 9.557   15.301  1.00 12.50 ? 93  PHE A N     1 
ATOM   672  C  CA    . PHE A 1 85  ? 11.213 8.730   16.491  1.00 13.46 ? 93  PHE A CA    1 
ATOM   673  C  C     . PHE A 1 85  ? 10.674 9.562   17.648  1.00 15.23 ? 93  PHE A C     1 
ATOM   674  O  O     . PHE A 1 85  ? 10.954 10.766  17.743  1.00 16.89 ? 93  PHE A O     1 
ATOM   675  C  CB    . PHE A 1 85  ? 12.616 8.207   16.820  1.00 12.63 ? 93  PHE A CB    1 
ATOM   676  C  CG    . PHE A 1 85  ? 13.112 7.154   15.856  1.00 11.67 ? 93  PHE A CG    1 
ATOM   677  C  CD1   . PHE A 1 85  ? 13.766 7.532   14.692  1.00 11.04 ? 93  PHE A CD1   1 
ATOM   678  C  CD2   . PHE A 1 85  ? 12.906 5.789   16.114  1.00 12.43 ? 93  PHE A CD2   1 
ATOM   679  C  CE1   . PHE A 1 85  ? 14.245 6.580   13.777  1.00 11.16 ? 93  PHE A CE1   1 
ATOM   680  C  CE2   . PHE A 1 85  ? 13.355 4.813   15.203  1.00 12.64 ? 93  PHE A CE2   1 
ATOM   681  C  CZ    . PHE A 1 85  ? 14.031 5.223   14.016  1.00 11.47 ? 93  PHE A CZ    1 
ATOM   682  N  N     . LYS A 1 86  ? 9.924  8.919   18.524  1.00 17.38 ? 94  LYS A N     1 
ATOM   683  C  CA    . LYS A 1 86  ? 9.317  9.610   19.655  1.00 18.96 ? 94  LYS A CA    1 
ATOM   684  C  C     . LYS A 1 86  ? 10.287 9.677   20.834  1.00 19.00 ? 94  LYS A C     1 
ATOM   685  O  O     . LYS A 1 86  ? 10.102 10.463  21.750  1.00 19.21 ? 94  LYS A O     1 
ATOM   686  C  CB    . LYS A 1 86  ? 7.979  8.961   20.053  1.00 19.45 ? 94  LYS A CB    1 
ATOM   687  C  CG    . LYS A 1 86  ? 8.043  7.488   20.494  1.00 22.83 ? 94  LYS A CG    1 
ATOM   688  C  CD    . LYS A 1 86  ? 7.641  7.305   21.966  1.00 29.05 ? 94  LYS A CD    1 
ATOM   689  C  CE    . LYS A 1 86  ? 6.285  6.612   22.124  1.00 30.71 ? 94  LYS A CE    1 
ATOM   690  N  NZ    . LYS A 1 86  ? 5.326  7.008   21.040  1.00 32.98 ? 94  LYS A NZ    1 
ATOM   691  N  N     . GLU A 1 87  ? 11.353 8.882   20.770  1.00 18.57 ? 95  GLU A N     1 
ATOM   692  C  CA    . GLU A 1 87  ? 12.251 8.681   21.893  1.00 18.19 ? 95  GLU A CA    1 
ATOM   693  C  C     . GLU A 1 87  ? 13.645 8.485   21.321  1.00 17.21 ? 95  GLU A C     1 
ATOM   694  O  O     . GLU A 1 87  ? 13.771 7.930   20.235  1.00 16.95 ? 95  GLU A O     1 
ATOM   695  C  CB    . GLU A 1 87  ? 11.812 7.402   22.589  1.00 19.44 ? 95  GLU A CB    1 
ATOM   696  C  CG    . GLU A 1 87  ? 12.542 7.039   23.850  1.00 24.10 ? 95  GLU A CG    1 
ATOM   697  C  CD    . GLU A 1 87  ? 11.607 6.384   24.843  1.00 29.44 ? 95  GLU A CD    1 
ATOM   698  O  OE1   . GLU A 1 87  ? 11.314 5.182   24.669  1.00 31.84 ? 95  GLU A OE1   1 
ATOM   699  O  OE2   . GLU A 1 87  ? 11.149 7.079   25.775  1.00 31.88 ? 95  GLU A OE2   1 
ATOM   700  N  N     . ASP A 1 88  ? 14.681 8.920   22.034  1.00 15.73 ? 96  ASP A N     1 
ATOM   701  C  CA    . ASP A 1 88  ? 16.046 8.536   21.636  1.00 14.15 ? 96  ASP A CA    1 
ATOM   702  C  C     . ASP A 1 88  ? 16.221 7.029   21.745  1.00 12.73 ? 96  ASP A C     1 
ATOM   703  O  O     . ASP A 1 88  ? 15.452 6.348   22.440  1.00 13.54 ? 96  ASP A O     1 
ATOM   704  C  CB    . ASP A 1 88  ? 17.077 9.222   22.511  1.00 14.41 ? 96  ASP A CB    1 
ATOM   705  C  CG    . ASP A 1 88  ? 17.300 10.657  22.128  1.00 17.16 ? 96  ASP A CG    1 
ATOM   706  O  OD1   . ASP A 1 88  ? 16.860 11.103  21.039  1.00 16.03 ? 96  ASP A OD1   1 
ATOM   707  O  OD2   . ASP A 1 88  ? 17.916 11.424  22.890  1.00 21.15 ? 96  ASP A OD2   1 
ATOM   708  N  N     . PHE A 1 89  ? 17.261 6.510   21.099  1.00 10.63 ? 97  PHE A N     1 
ATOM   709  C  CA    . PHE A 1 89  ? 17.519 5.080   21.120  1.00 10.07 ? 97  PHE A CA    1 
ATOM   710  C  C     . PHE A 1 89  ? 18.976 4.723   21.384  1.00 9.27  ? 97  PHE A C     1 
ATOM   711  O  O     . PHE A 1 89  ? 19.542 3.814   20.798  1.00 9.06  ? 97  PHE A O     1 
ATOM   712  C  CB    . PHE A 1 89  ? 16.951 4.381   19.849  1.00 9.91  ? 97  PHE A CB    1 
ATOM   713  C  CG    . PHE A 1 89  ? 17.283 5.062   18.527  1.00 8.93  ? 97  PHE A CG    1 
ATOM   714  C  CD1   . PHE A 1 89  ? 18.483 4.784   17.842  1.00 6.07  ? 97  PHE A CD1   1 
ATOM   715  C  CD2   . PHE A 1 89  ? 16.345 5.911   17.926  1.00 8.27  ? 97  PHE A CD2   1 
ATOM   716  C  CE1   . PHE A 1 89  ? 18.767 5.381   16.593  1.00 8.32  ? 97  PHE A CE1   1 
ATOM   717  C  CE2   . PHE A 1 89  ? 16.627 6.515   16.682  1.00 9.09  ? 97  PHE A CE2   1 
ATOM   718  C  CZ    . PHE A 1 89  ? 17.846 6.236   16.011  1.00 7.42  ? 97  PHE A CZ    1 
ATOM   719  N  N     . TYR A 1 90  ? 19.596 5.446   22.309  1.00 9.43  ? 98  TYR A N     1 
ATOM   720  C  CA    . TYR A 1 90  ? 20.950 5.103   22.721  1.00 9.30  ? 98  TYR A CA    1 
ATOM   721  C  C     . TYR A 1 90  ? 20.983 3.711   23.297  1.00 10.15 ? 98  TYR A C     1 
ATOM   722  O  O     . TYR A 1 90  ? 20.079 3.304   24.052  1.00 9.57  ? 98  TYR A O     1 
ATOM   723  C  CB    . TYR A 1 90  ? 21.496 6.129   23.729  1.00 10.13 ? 98  TYR A CB    1 
ATOM   724  C  CG    . TYR A 1 90  ? 21.803 7.449   23.068  1.00 8.48  ? 98  TYR A CG    1 
ATOM   725  C  CD1   . TYR A 1 90  ? 22.968 7.627   22.291  1.00 8.67  ? 98  TYR A CD1   1 
ATOM   726  C  CD2   . TYR A 1 90  ? 20.914 8.531   23.177  1.00 9.62  ? 98  TYR A CD2   1 
ATOM   727  C  CE1   . TYR A 1 90  ? 23.230 8.854   21.674  1.00 6.81  ? 98  TYR A CE1   1 
ATOM   728  C  CE2   . TYR A 1 90  ? 21.164 9.792   22.528  1.00 7.40  ? 98  TYR A CE2   1 
ATOM   729  C  CZ    . TYR A 1 90  ? 22.344 9.929   21.796  1.00 7.41  ? 98  TYR A CZ    1 
ATOM   730  O  OH    . TYR A 1 90  ? 22.632 11.119  21.169  1.00 7.31  ? 98  TYR A OH    1 
ATOM   731  N  N     . GLY A 1 91  ? 22.016 2.976   22.929  1.00 10.16 ? 99  GLY A N     1 
ATOM   732  C  CA    . GLY A 1 91  ? 22.220 1.654   23.498  1.00 11.28 ? 99  GLY A CA    1 
ATOM   733  C  C     . GLY A 1 91  ? 21.500 0.578   22.694  1.00 11.47 ? 99  GLY A C     1 
ATOM   734  O  O     . GLY A 1 91  ? 21.813 -0.610  22.831  1.00 13.37 ? 99  GLY A O     1 
ATOM   735  N  N     . GLU A 1 92  ? 20.530 0.980   21.863  1.00 11.51 ? 100 GLU A N     1 
ATOM   736  C  CA    . GLU A 1 92  ? 19.780 0.016   21.045  1.00 11.33 ? 100 GLU A CA    1 
ATOM   737  C  C     . GLU A 1 92  ? 20.641 -0.368  19.862  1.00 10.01 ? 100 GLU A C     1 
ATOM   738  O  O     . GLU A 1 92  ? 21.623 0.318   19.540  1.00 10.19 ? 100 GLU A O     1 
ATOM   739  C  CB    . GLU A 1 92  ? 18.467 0.607   20.526  1.00 12.08 ? 100 GLU A CB    1 
ATOM   740  C  CG    . GLU A 1 92  ? 17.447 0.958   21.610  1.00 17.41 ? 100 GLU A CG    1 
ATOM   741  C  CD    . GLU A 1 92  ? 16.944 -0.266  22.312  1.00 26.59 ? 100 GLU A CD    1 
ATOM   742  O  OE1   . GLU A 1 92  ? 16.122 -1.007  21.707  1.00 32.67 ? 100 GLU A OE1   1 
ATOM   743  O  OE2   . GLU A 1 92  ? 17.381 -0.511  23.460  1.00 32.58 ? 100 GLU A OE2   1 
ATOM   744  N  N     . ILE A 1 93  ? 20.292 -1.465  19.207  1.00 8.86  ? 101 ILE A N     1 
ATOM   745  C  CA    . ILE A 1 93  ? 21.068 -1.862  18.021  1.00 7.50  ? 101 ILE A CA    1 
ATOM   746  C  C     . ILE A 1 93  ? 20.543 -1.258  16.721  1.00 8.24  ? 101 ILE A C     1 
ATOM   747  O  O     . ILE A 1 93  ? 19.391 -1.491  16.332  1.00 10.07 ? 101 ILE A O     1 
ATOM   748  C  CB    . ILE A 1 93  ? 21.159 -3.415  17.871  1.00 7.98  ? 101 ILE A CB    1 
ATOM   749  C  CG1   . ILE A 1 93  ? 21.727 -4.069  19.150  1.00 6.65  ? 101 ILE A CG1   1 
ATOM   750  C  CG2   . ILE A 1 93  ? 21.950 -3.780  16.617  1.00 8.71  ? 101 ILE A CG2   1 
ATOM   751  C  CD1   . ILE A 1 93  ? 22.927 -3.353  19.705  1.00 8.60  ? 101 ILE A CD1   1 
ATOM   752  N  N     . LEU A 1 94  ? 21.392 -0.503  16.039  1.00 6.82  ? 102 LEU A N     1 
ATOM   753  C  CA    . LEU A 1 94  ? 21.003 0.031   14.742  1.00 8.05  ? 102 LEU A CA    1 
ATOM   754  C  C     . LEU A 1 94  ? 21.495 -0.941  13.659  1.00 8.35  ? 102 LEU A C     1 
ATOM   755  O  O     . LEU A 1 94  ? 22.684 -1.278  13.594  1.00 8.60  ? 102 LEU A O     1 
ATOM   756  C  CB    . LEU A 1 94  ? 21.592 1.449   14.596  1.00 8.74  ? 102 LEU A CB    1 
ATOM   757  C  CG    . LEU A 1 94  ? 21.672 2.068   13.203  1.00 8.92  ? 102 LEU A CG    1 
ATOM   758  C  CD1   . LEU A 1 94  ? 20.236 2.333   12.772  1.00 7.85  ? 102 LEU A CD1   1 
ATOM   759  C  CD2   . LEU A 1 94  ? 22.486 3.365   13.249  1.00 11.63 ? 102 LEU A CD2   1 
ATOM   760  N  N     . ASN A 1 95  ? 20.572 -1.363  12.799  1.00 7.02  ? 103 ASN A N     1 
ATOM   761  C  CA    . ASN A 1 95  ? 20.869 -2.243  11.687  1.00 6.22  ? 103 ASN A CA    1 
ATOM   762  C  C     . ASN A 1 95  ? 20.879 -1.469  10.385  1.00 7.27  ? 103 ASN A C     1 
ATOM   763  O  O     . ASN A 1 95  ? 19.876 -0.842  10.037  1.00 6.18  ? 103 ASN A O     1 
ATOM   764  C  CB    . ASN A 1 95  ? 19.773 -3.340  11.605  1.00 6.66  ? 103 ASN A CB    1 
ATOM   765  C  CG    . ASN A 1 95  ? 19.484 -3.986  12.950  1.00 8.85  ? 103 ASN A CG    1 
ATOM   766  O  OD1   . ASN A 1 95  ? 20.322 -4.720  13.485  1.00 10.16 ? 103 ASN A OD1   1 
ATOM   767  N  ND2   . ASN A 1 95  ? 18.327 -3.689  13.529  1.00 9.56  ? 103 ASN A ND2   1 
ATOM   768  N  N     . VAL A 1 96  ? 22.000 -1.487  9.677   1.00 6.63  ? 104 VAL A N     1 
ATOM   769  C  CA    . VAL A 1 96  ? 22.058 -0.712  8.427   1.00 7.80  ? 104 VAL A CA    1 
ATOM   770  C  C     . VAL A 1 96  ? 22.440 -1.509  7.195   1.00 7.54  ? 104 VAL A C     1 
ATOM   771  O  O     . VAL A 1 96  ? 23.252 -2.434  7.265   1.00 6.89  ? 104 VAL A O     1 
ATOM   772  C  CB    . VAL A 1 96  ? 22.976 0.563   8.516   1.00 8.92  ? 104 VAL A CB    1 
ATOM   773  C  CG1   . VAL A 1 96  ? 22.588 1.515   9.707   1.00 7.76  ? 104 VAL A CG1   1 
ATOM   774  C  CG2   . VAL A 1 96  ? 24.412 0.213   8.521   1.00 11.47 ? 104 VAL A CG2   1 
ATOM   775  N  N     . ALA A 1 97  ? 21.829 -1.158  6.072   1.00 6.15  ? 105 ALA A N     1 
ATOM   776  C  CA    . ALA A 1 97  ? 22.230 -1.651  4.761   1.00 6.87  ? 105 ALA A CA    1 
ATOM   777  C  C     . ALA A 1 97  ? 22.572 -0.431  3.920   1.00 6.99  ? 105 ALA A C     1 
ATOM   778  O  O     . ALA A 1 97  ? 21.683 0.378   3.617   1.00 6.96  ? 105 ALA A O     1 
ATOM   779  C  CB    . ALA A 1 97  ? 21.084 -2.454  4.106   1.00 7.59  ? 105 ALA A CB    1 
ATOM   780  N  N     . ILE A 1 98  ? 23.852 -0.255  3.614   1.00 6.15  ? 106 ILE A N     1 
ATOM   781  C  CA    . ILE A 1 98  ? 24.313 0.904   2.835   1.00 7.18  ? 106 ILE A CA    1 
ATOM   782  C  C     . ILE A 1 98  ? 24.237 0.447   1.389   1.00 7.55  ? 106 ILE A C     1 
ATOM   783  O  O     . ILE A 1 98  ? 24.901 -0.520  1.005   1.00 7.25  ? 106 ILE A O     1 
ATOM   784  C  CB    . ILE A 1 98  ? 25.767 1.274   3.179   1.00 7.74  ? 106 ILE A CB    1 
ATOM   785  C  CG1   . ILE A 1 98  ? 25.953 1.463   4.705   1.00 8.55  ? 106 ILE A CG1   1 
ATOM   786  C  CG2   . ILE A 1 98  ? 26.220 2.500   2.390   1.00 10.07 ? 106 ILE A CG2   1 
ATOM   787  C  CD1   . ILE A 1 98  ? 27.379 1.811   5.097   1.00 9.83  ? 106 ILE A CD1   1 
ATOM   788  N  N     . VAL A 1 99  ? 23.415 1.123   0.590   1.00 8.37  ? 107 VAL A N     1 
ATOM   789  C  CA    . VAL A 1 99  ? 23.126 0.595   -0.750  1.00 8.41  ? 107 VAL A CA    1 
ATOM   790  C  C     . VAL A 1 99  ? 23.716 1.387   -1.918  1.00 8.66  ? 107 VAL A C     1 
ATOM   791  O  O     . VAL A 1 99  ? 23.963 0.813   -2.972  1.00 9.25  ? 107 VAL A O     1 
ATOM   792  C  CB    . VAL A 1 99  ? 21.596 0.256   -0.988  1.00 9.54  ? 107 VAL A CB    1 
ATOM   793  C  CG1   . VAL A 1 99  ? 20.992 -0.534  0.171   1.00 9.52  ? 107 VAL A CG1   1 
ATOM   794  C  CG2   . VAL A 1 99  ? 20.819 1.520   -1.222  1.00 10.48 ? 107 VAL A CG2   1 
ATOM   795  N  N     . GLY A 1 100 ? 23.964 2.685   -1.738  1.00 7.76  ? 108 GLY A N     1 
ATOM   796  C  CA    . GLY A 1 100 ? 24.360 3.538   -2.841  1.00 9.00  ? 108 GLY A CA    1 
ATOM   797  C  C     . GLY A 1 100 ? 25.183 4.708   -2.369  1.00 9.49  ? 108 GLY A C     1 
ATOM   798  O  O     . GLY A 1 100 ? 25.125 5.082   -1.196  1.00 8.79  ? 108 GLY A O     1 
ATOM   799  N  N     . TYR A 1 101 ? 25.985 5.263   -3.282  1.00 9.33  ? 109 TYR A N     1 
ATOM   800  C  CA    . TYR A 1 101 ? 26.793 6.441   -2.978  1.00 9.78  ? 109 TYR A CA    1 
ATOM   801  C  C     . TYR A 1 101 ? 26.173 7.671   -3.605  1.00 10.33 ? 109 TYR A C     1 
ATOM   802  O  O     . TYR A 1 101 ? 25.871 7.677   -4.795  1.00 10.44 ? 109 TYR A O     1 
ATOM   803  C  CB    . TYR A 1 101 ? 28.136 6.257   -3.632  1.00 10.31 ? 109 TYR A CB    1 
ATOM   804  C  CG    . TYR A 1 101 ? 29.223 7.232   -3.248  1.00 12.33 ? 109 TYR A CG    1 
ATOM   805  C  CD1   . TYR A 1 101 ? 29.728 7.257   -1.956  1.00 11.04 ? 109 TYR A CD1   1 
ATOM   806  C  CD2   . TYR A 1 101 ? 29.787 8.082   -4.201  1.00 14.30 ? 109 TYR A CD2   1 
ATOM   807  C  CE1   . TYR A 1 101 ? 30.776 8.114   -1.608  1.00 12.99 ? 109 TYR A CE1   1 
ATOM   808  C  CE2   . TYR A 1 101 ? 30.834 8.958   -3.864  1.00 14.87 ? 109 TYR A CE2   1 
ATOM   809  C  CZ    . TYR A 1 101 ? 31.323 8.958   -2.576  1.00 12.86 ? 109 TYR A CZ    1 
ATOM   810  O  OH    . TYR A 1 101 ? 32.377 9.780   -2.229  1.00 14.75 ? 109 TYR A OH    1 
ATOM   811  N  N     . LEU A 1 102 ? 26.045 8.732   -2.824  1.00 10.17 ? 110 LEU A N     1 
ATOM   812  C  CA    . LEU A 1 102 ? 25.488 10.000  -3.310  1.00 11.31 ? 110 LEU A CA    1 
ATOM   813  C  C     . LEU A 1 102 ? 26.528 10.961  -3.827  1.00 11.34 ? 110 LEU A C     1 
ATOM   814  O  O     . LEU A 1 102 ? 26.448 11.453  -4.972  1.00 12.19 ? 110 LEU A O     1 
ATOM   815  C  CB    . LEU A 1 102 ? 24.721 10.688  -2.166  1.00 12.45 ? 110 LEU A CB    1 
ATOM   816  C  CG    . LEU A 1 102 ? 23.220 10.608  -2.050  1.00 14.79 ? 110 LEU A CG    1 
ATOM   817  C  CD1   . LEU A 1 102 ? 22.741 11.611  -1.015  1.00 13.71 ? 110 LEU A CD1   1 
ATOM   818  C  CD2   . LEU A 1 102 ? 22.460 10.724  -3.392  1.00 13.00 ? 110 LEU A CD2   1 
ATOM   819  N  N     . ARG A 1 103 ? 27.518 11.252  -2.995  1.00 9.47  ? 111 ARG A N     1 
ATOM   820  C  CA    . ARG A 1 103 ? 28.528 12.230  -3.320  1.00 9.33  ? 111 ARG A CA    1 
ATOM   821  C  C     . ARG A 1 103 ? 29.756 12.171  -2.430  1.00 9.82  ? 111 ARG A C     1 
ATOM   822  O  O     . ARG A 1 103 ? 29.673 11.676  -1.279  1.00 8.38  ? 111 ARG A O     1 
ATOM   823  C  CB    . ARG A 1 103 ? 27.894 13.640  -3.209  1.00 9.54  ? 111 ARG A CB    1 
ATOM   824  C  CG    . ARG A 1 103 ? 27.510 14.053  -1.766  1.00 7.67  ? 111 ARG A CG    1 
ATOM   825  C  CD    . ARG A 1 103 ? 27.077 15.512  -1.727  1.00 7.79  ? 111 ARG A CD    1 
ATOM   826  N  NE    . ARG A 1 103 ? 26.594 15.918  -0.385  1.00 8.87  ? 111 ARG A NE    1 
ATOM   827  C  CZ    . ARG A 1 103 ? 27.369 16.288  0.621   1.00 8.28  ? 111 ARG A CZ    1 
ATOM   828  N  NH1   . ARG A 1 103 ? 28.698 16.293  0.496   1.00 10.91 ? 111 ARG A NH1   1 
ATOM   829  N  NH2   . ARG A 1 103 ? 26.824 16.625  1.787   1.00 8.06  ? 111 ARG A NH2   1 
ATOM   830  N  N     . PRO A 1 104 ? 30.883 12.715  -2.914  1.00 9.38  ? 112 PRO A N     1 
ATOM   831  C  CA    . PRO A 1 104 ? 32.053 12.908  -2.073  1.00 9.87  ? 112 PRO A CA    1 
ATOM   832  C  C     . PRO A 1 104 ? 31.770 13.933  -1.001  1.00 9.86  ? 112 PRO A C     1 
ATOM   833  O  O     . PRO A 1 104 ? 30.791 14.702  -1.096  1.00 9.77  ? 112 PRO A O     1 
ATOM   834  C  CB    . PRO A 1 104 ? 33.097 13.443  -3.061  1.00 10.03 ? 112 PRO A CB    1 
ATOM   835  C  CG    . PRO A 1 104 ? 32.277 14.120  -4.091  1.00 12.12 ? 112 PRO A CG    1 
ATOM   836  C  CD    . PRO A 1 104 ? 31.130 13.194  -4.301  1.00 10.32 ? 112 PRO A CD    1 
ATOM   837  N  N     . GLU A 1 105 ? 32.612 13.955  0.016   1.00 10.29 ? 113 GLU A N     1 
ATOM   838  C  CA    . GLU A 1 105 ? 32.572 15.039  0.978   1.00 11.61 ? 113 GLU A CA    1 
ATOM   839  C  C     . GLU A 1 105 ? 32.851 16.357  0.265   1.00 11.43 ? 113 GLU A C     1 
ATOM   840  O  O     . GLU A 1 105 ? 33.597 16.409  -0.739  1.00 9.68  ? 113 GLU A O     1 
ATOM   841  C  CB    . GLU A 1 105 ? 33.593 14.828  2.084   1.00 12.75 ? 113 GLU A CB    1 
ATOM   842  C  CG    . GLU A 1 105 ? 33.112 13.765  3.047   1.00 17.99 ? 113 GLU A CG    1 
ATOM   843  C  CD    . GLU A 1 105 ? 33.869 13.765  4.341   1.00 21.42 ? 113 GLU A CD    1 
ATOM   844  O  OE1   . GLU A 1 105 ? 35.109 13.772  4.273   1.00 21.97 ? 113 GLU A OE1   1 
ATOM   845  O  OE2   . GLU A 1 105 ? 33.194 13.753  5.402   1.00 24.22 ? 113 GLU A OE2   1 
ATOM   846  N  N     . LYS A 1 106 ? 32.232 17.413  0.779   1.00 12.22 ? 114 LYS A N     1 
ATOM   847  C  CA    . LYS A 1 106 ? 32.398 18.767  0.242   1.00 13.06 ? 114 LYS A CA    1 
ATOM   848  C  C     . LYS A 1 106 ? 32.659 19.753  1.376   1.00 13.14 ? 114 LYS A C     1 
ATOM   849  O  O     . LYS A 1 106 ? 32.272 19.509  2.531   1.00 12.68 ? 114 LYS A O     1 
ATOM   850  C  CB    . LYS A 1 106 ? 31.159 19.200  -0.586  1.00 13.09 ? 114 LYS A CB    1 
ATOM   851  C  CG    . LYS A 1 106 ? 30.750 18.192  -1.684  1.00 15.61 ? 114 LYS A CG    1 
ATOM   852  C  CD    . LYS A 1 106 ? 29.530 18.599  -2.535  1.00 14.55 ? 114 LYS A CD    1 
ATOM   853  C  CE    . LYS A 1 106 ? 29.658 17.942  -3.933  1.00 18.54 ? 114 LYS A CE    1 
ATOM   854  N  NZ    . LYS A 1 106 ? 28.372 17.882  -4.706  1.00 17.15 ? 114 LYS A NZ    1 
ATOM   855  N  N     . ASN A 1 107 ? 33.312 20.864  1.059   1.00 13.30 ? 115 ASN A N     1 
ATOM   856  C  CA    . ASN A 1 107 ? 33.506 21.938  2.029   1.00 15.28 ? 115 ASN A CA    1 
ATOM   857  C  C     . ASN A 1 107 ? 32.383 22.943  1.855   1.00 15.05 ? 115 ASN A C     1 
ATOM   858  O  O     . ASN A 1 107 ? 32.075 23.344  0.737   1.00 15.34 ? 115 ASN A O     1 
ATOM   859  C  CB    . ASN A 1 107 ? 34.861 22.642  1.820   1.00 15.14 ? 115 ASN A CB    1 
ATOM   860  C  CG    . ASN A 1 107 ? 36.028 21.750  2.153   1.00 18.66 ? 115 ASN A CG    1 
ATOM   861  O  OD1   . ASN A 1 107 ? 35.936 20.892  3.046   1.00 23.12 ? 115 ASN A OD1   1 
ATOM   862  N  ND2   . ASN A 1 107 ? 37.138 21.927  1.432   1.00 21.21 ? 115 ASN A ND2   1 
ATOM   863  N  N     . PHE A 1 108 ? 31.772 23.348  2.954   1.00 15.90 ? 116 PHE A N     1 
ATOM   864  C  CA    . PHE A 1 108 ? 30.712 24.340  2.875   1.00 16.11 ? 116 PHE A CA    1 
ATOM   865  C  C     . PHE A 1 108 ? 31.145 25.615  3.596   1.00 17.40 ? 116 PHE A C     1 
ATOM   866  O  O     . PHE A 1 108 ? 31.821 25.561  4.629   1.00 18.64 ? 116 PHE A O     1 
ATOM   867  C  CB    . PHE A 1 108 ? 29.406 23.768  3.438   1.00 15.75 ? 116 PHE A CB    1 
ATOM   868  C  CG    . PHE A 1 108 ? 28.890 22.573  2.668   1.00 12.66 ? 116 PHE A CG    1 
ATOM   869  C  CD1   . PHE A 1 108 ? 28.272 22.736  1.443   1.00 13.07 ? 116 PHE A CD1   1 
ATOM   870  C  CD2   . PHE A 1 108 ? 29.026 21.296  3.164   1.00 13.70 ? 116 PHE A CD2   1 
ATOM   871  C  CE1   . PHE A 1 108 ? 27.827 21.640  0.724   1.00 11.06 ? 116 PHE A CE1   1 
ATOM   872  C  CE2   . PHE A 1 108 ? 28.547 20.200  2.473   1.00 13.74 ? 116 PHE A CE2   1 
ATOM   873  C  CZ    . PHE A 1 108 ? 27.947 20.375  1.223   1.00 12.95 ? 116 PHE A CZ    1 
ATOM   874  N  N     . ASP A 1 109 ? 30.759 26.763  3.068   1.00 17.94 ? 117 ASP A N     1 
ATOM   875  C  CA    . ASP A 1 109 ? 31.243 28.012  3.655   1.00 18.30 ? 117 ASP A CA    1 
ATOM   876  C  C     . ASP A 1 109 ? 30.337 28.659  4.704   1.00 17.27 ? 117 ASP A C     1 
ATOM   877  O  O     . ASP A 1 109 ? 30.639 29.765  5.173   1.00 17.47 ? 117 ASP A O     1 
ATOM   878  C  CB    . ASP A 1 109 ? 31.621 29.030  2.570   1.00 20.07 ? 117 ASP A CB    1 
ATOM   879  C  CG    . ASP A 1 109 ? 30.447 29.436  1.694   1.00 23.31 ? 117 ASP A CG    1 
ATOM   880  O  OD1   . ASP A 1 109 ? 29.271 29.289  2.128   1.00 28.32 ? 117 ASP A OD1   1 
ATOM   881  O  OD2   . ASP A 1 109 ? 30.619 29.916  0.542   1.00 27.63 ? 117 ASP A OD2   1 
ATOM   882  N  N     . SER A 1 110 ? 29.229 27.999  5.051   1.00 14.89 ? 118 SER A N     1 
ATOM   883  C  CA    . SER A 1 110 ? 28.304 28.519  6.051   1.00 12.86 ? 118 SER A CA    1 
ATOM   884  C  C     . SER A 1 110 ? 27.393 27.425  6.527   1.00 12.29 ? 118 SER A C     1 
ATOM   885  O  O     . SER A 1 110 ? 27.236 26.398  5.852   1.00 10.05 ? 118 SER A O     1 
ATOM   886  C  CB    . SER A 1 110 ? 27.437 29.641  5.463   1.00 13.10 ? 118 SER A CB    1 
ATOM   887  O  OG    . SER A 1 110 ? 26.652 29.151  4.387   1.00 11.69 ? 118 SER A OG    1 
ATOM   888  N  N     . LEU A 1 111 ? 26.741 27.658  7.666   1.00 11.87 ? 119 LEU A N     1 
ATOM   889  C  CA    . LEU A 1 111 ? 25.735 26.714  8.114   1.00 10.88 ? 119 LEU A CA    1 
ATOM   890  C  C     . LEU A 1 111 ? 24.567 26.683  7.135   1.00 9.16  ? 119 LEU A C     1 
ATOM   891  O  O     . LEU A 1 111 ? 23.973 25.646  6.967   1.00 8.27  ? 119 LEU A O     1 
ATOM   892  C  CB    . LEU A 1 111 ? 25.202 27.062  9.510   1.00 12.13 ? 119 LEU A CB    1 
ATOM   893  C  CG    . LEU A 1 111 ? 26.191 26.701  10.624  1.00 15.57 ? 119 LEU A CG    1 
ATOM   894  C  CD1   . LEU A 1 111 ? 25.807 27.454  11.893  1.00 19.93 ? 119 LEU A CD1   1 
ATOM   895  C  CD2   . LEU A 1 111 ? 26.222 25.204  10.849  1.00 16.71 ? 119 LEU A CD2   1 
ATOM   896  N  N     . GLU A 1 112 ? 24.250 27.818  6.523   1.00 7.99  ? 120 GLU A N     1 
ATOM   897  C  CA    . GLU A 1 112 ? 23.159 27.888  5.553   1.00 8.04  ? 120 GLU A CA    1 
ATOM   898  C  C     . GLU A 1 112 ? 23.433 26.926  4.392   1.00 6.75  ? 120 GLU A C     1 
ATOM   899  O  O     . GLU A 1 112 ? 22.563 26.148  4.012   1.00 6.11  ? 120 GLU A O     1 
ATOM   900  C  CB    . GLU A 1 112 ? 23.004 29.300  5.040   1.00 8.78  ? 120 GLU A CB    1 
ATOM   901  C  CG    . GLU A 1 112 ? 21.684 29.536  4.349   1.00 12.71 ? 120 GLU A CG    1 
ATOM   902  C  CD    . GLU A 1 112 ? 21.583 30.933  3.817   1.00 12.06 ? 120 GLU A CD    1 
ATOM   903  O  OE1   . GLU A 1 112 ? 21.944 31.870  4.548   1.00 13.41 ? 120 GLU A OE1   1 
ATOM   904  O  OE2   . GLU A 1 112 ? 21.147 31.099  2.645   1.00 16.32 ? 120 GLU A OE2   1 
ATOM   905  N  N     . SER A 1 113 ? 24.652 26.961  3.855   1.00 6.05  ? 121 SER A N     1 
ATOM   906  C  CA    . SER A 1 113 ? 24.950 26.028  2.754   1.00 6.72  ? 121 SER A CA    1 
ATOM   907  C  C     . SER A 1 113 ? 25.035 24.587  3.209   1.00 6.37  ? 121 SER A C     1 
ATOM   908  O  O     . SER A 1 113 ? 24.577 23.669  2.494   1.00 4.74  ? 121 SER A O     1 
ATOM   909  C  CB    . SER A 1 113 ? 26.201 26.475  1.958   1.00 8.37  ? 121 SER A CB    1 
ATOM   910  O  OG    . SER A 1 113 ? 27.317 26.638  2.794   1.00 16.47 ? 121 SER A OG    1 
ATOM   911  N  N     . LEU A 1 114 ? 25.600 24.354  4.400   1.00 4.57  ? 122 LEU A N     1 
ATOM   912  C  CA    . LEU A 1 114 ? 25.617 23.024  4.984   1.00 6.40  ? 122 LEU A CA    1 
ATOM   913  C  C     . LEU A 1 114 ? 24.228 22.423  5.187   1.00 6.03  ? 122 LEU A C     1 
ATOM   914  O  O     . LEU A 1 114 ? 23.950 21.295  4.775   1.00 5.76  ? 122 LEU A O     1 
ATOM   915  C  CB    . LEU A 1 114 ? 26.390 23.048  6.314   1.00 6.63  ? 122 LEU A CB    1 
ATOM   916  C  CG    . LEU A 1 114 ? 26.358 21.739  7.139   1.00 8.73  ? 122 LEU A CG    1 
ATOM   917  C  CD1   . LEU A 1 114 ? 27.051 20.591  6.385   1.00 13.71 ? 122 LEU A CD1   1 
ATOM   918  C  CD2   . LEU A 1 114 ? 27.002 21.929  8.505   1.00 15.56 ? 122 LEU A CD2   1 
ATOM   919  N  N     . ILE A 1 115 ? 23.342 23.191  5.814   1.00 6.36  ? 123 ILE A N     1 
ATOM   920  C  CA    . ILE A 1 115 ? 22.032 22.662  6.140   1.00 6.36  ? 123 ILE A CA    1 
ATOM   921  C  C     . ILE A 1 115 ? 21.253 22.414  4.847   1.00 5.50  ? 123 ILE A C     1 
ATOM   922  O  O     . ILE A 1 115 ? 20.595 21.370  4.699   1.00 7.27  ? 123 ILE A O     1 
ATOM   923  C  CB    . ILE A 1 115 ? 21.297 23.632  7.067   1.00 6.94  ? 123 ILE A CB    1 
ATOM   924  C  CG1   . ILE A 1 115 ? 21.915 23.583  8.483   1.00 6.23  ? 123 ILE A CG1   1 
ATOM   925  C  CG2   . ILE A 1 115 ? 19.795 23.297  7.123   1.00 8.52  ? 123 ILE A CG2   1 
ATOM   926  C  CD1   . ILE A 1 115 ? 21.436 24.769  9.382   1.00 7.21  ? 123 ILE A CD1   1 
ATOM   927  N  N     . SER A 1 116 ? 21.371 23.330  3.885   1.00 6.56  ? 124 SER A N     1 
ATOM   928  C  CA    . SER A 1 116 ? 20.690 23.121  2.603   1.00 5.46  ? 124 SER A CA    1 
ATOM   929  C  C     . SER A 1 116 ? 21.199 21.859  1.905   1.00 6.50  ? 124 SER A C     1 
ATOM   930  O  O     . SER A 1 116 ? 20.425 21.077  1.331   1.00 5.52  ? 124 SER A O     1 
ATOM   931  C  CB    . SER A 1 116 ? 20.890 24.339  1.704   1.00 7.58  ? 124 SER A CB    1 
ATOM   932  O  OG    . SER A 1 116 ? 20.351 24.042  0.433   1.00 9.84  ? 124 SER A OG    1 
ATOM   933  N  N     . ALA A 1 117 ? 22.512 21.655  1.977   1.00 6.02  ? 125 ALA A N     1 
ATOM   934  C  CA    . ALA A 1 117 ? 23.118 20.474  1.388   1.00 6.60  ? 125 ALA A CA    1 
ATOM   935  C  C     . ALA A 1 117 ? 22.619 19.185  2.010   1.00 8.25  ? 125 ALA A C     1 
ATOM   936  O  O     . ALA A 1 117 ? 22.301 18.228  1.273   1.00 9.58  ? 125 ALA A O     1 
ATOM   937  C  CB    . ALA A 1 117 ? 24.632 20.539  1.453   1.00 6.19  ? 125 ALA A CB    1 
ATOM   938  N  N     . ILE A 1 118 ? 22.567 19.153  3.337   1.00 8.32  ? 126 ILE A N     1 
ATOM   939  C  CA    . ILE A 1 118 ? 22.112 17.971  4.062   1.00 9.39  ? 126 ILE A CA    1 
ATOM   940  C  C     . ILE A 1 118 ? 20.670 17.677  3.672   1.00 9.26  ? 126 ILE A C     1 
ATOM   941  O  O     . ILE A 1 118 ? 20.324 16.523  3.342   1.00 9.17  ? 126 ILE A O     1 
ATOM   942  C  CB    . ILE A 1 118 ? 22.247 18.140  5.588   1.00 10.53 ? 126 ILE A CB    1 
ATOM   943  C  CG1   . ILE A 1 118 ? 23.719 18.205  6.032   1.00 11.32 ? 126 ILE A CG1   1 
ATOM   944  C  CG2   . ILE A 1 118 ? 21.504 16.989  6.318   1.00 14.01 ? 126 ILE A CG2   1 
ATOM   945  C  CD1   . ILE A 1 118 ? 23.820 18.936  7.468   1.00 12.99 ? 126 ILE A CD1   1 
ATOM   946  N  N     . GLN A 1 119 ? 19.822 18.702  3.707   1.00 9.01  ? 127 GLN A N     1 
ATOM   947  C  CA    . GLN A 1 119 ? 18.423 18.514  3.313   1.00 10.25 ? 127 GLN A CA    1 
ATOM   948  C  C     . GLN A 1 119 ? 18.296 17.982  1.889   1.00 9.48  ? 127 GLN A C     1 
ATOM   949  O  O     . GLN A 1 119 ? 17.477 17.101  1.628   1.00 10.07 ? 127 GLN A O     1 
ATOM   950  C  CB    . GLN A 1 119 ? 17.647 19.817  3.485   1.00 11.03 ? 127 GLN A CB    1 
ATOM   951  C  CG    . GLN A 1 119 ? 17.565 20.238  4.981   1.00 15.70 ? 127 GLN A CG    1 
ATOM   952  C  CD    . GLN A 1 119 ? 16.914 21.578  5.146   1.00 20.28 ? 127 GLN A CD    1 
ATOM   953  O  OE1   . GLN A 1 119 ? 16.610 22.243  4.146   1.00 22.72 ? 127 GLN A OE1   1 
ATOM   954  N  NE2   . GLN A 1 119 ? 16.728 22.015  6.396   1.00 19.99 ? 127 GLN A NE2   1 
ATOM   955  N  N     . GLY A 1 120 ? 19.111 18.491  0.962   1.00 8.75  ? 128 GLY A N     1 
ATOM   956  C  CA    . GLY A 1 120 ? 19.077 18.037  -0.418  1.00 7.82  ? 128 GLY A CA    1 
ATOM   957  C  C     . GLY A 1 120 ? 19.566 16.590  -0.569  1.00 7.70  ? 128 GLY A C     1 
ATOM   958  O  O     . GLY A 1 120 ? 19.028 15.859  -1.420  1.00 7.26  ? 128 GLY A O     1 
ATOM   959  N  N     . ASP A 1 121 ? 20.566 16.185  0.234   1.00 7.85  ? 129 ASP A N     1 
ATOM   960  C  CA    . ASP A 1 121 ? 21.047 14.800  0.250   1.00 7.21  ? 129 ASP A CA    1 
ATOM   961  C  C     . ASP A 1 121 ? 19.891 13.897  0.680   1.00 8.25  ? 129 ASP A C     1 
ATOM   962  O  O     . ASP A 1 121 ? 19.638 12.866  0.056   1.00 8.46  ? 129 ASP A O     1 
ATOM   963  C  CB    . ASP A 1 121 ? 22.161 14.574  1.267   1.00 8.19  ? 129 ASP A CB    1 
ATOM   964  C  CG    . ASP A 1 121 ? 23.489 15.254  0.901   1.00 8.36  ? 129 ASP A CG    1 
ATOM   965  O  OD1   . ASP A 1 121 ? 23.742 15.540  -0.289  1.00 10.23 ? 129 ASP A OD1   1 
ATOM   966  O  OD2   . ASP A 1 121 ? 24.345 15.485  1.811   1.00 10.46 ? 129 ASP A OD2   1 
ATOM   967  N  N     . ILE A 1 122 ? 19.187 14.295  1.739   1.00 7.36  ? 130 ILE A N     1 
ATOM   968  C  CA    . ILE A 1 122 ? 18.074 13.490  2.218   1.00 7.38  ? 130 ILE A CA    1 
ATOM   969  C  C     . ILE A 1 122 ? 16.973 13.358  1.122   1.00 7.10  ? 130 ILE A C     1 
ATOM   970  O  O     . ILE A 1 122 ? 16.484 12.249  0.867   1.00 7.51  ? 130 ILE A O     1 
ATOM   971  C  CB    . ILE A 1 122 ? 17.519 14.095  3.521   1.00 8.38  ? 130 ILE A CB    1 
ATOM   972  C  CG1   . ILE A 1 122 ? 18.508 13.858  4.673   1.00 8.21  ? 130 ILE A CG1   1 
ATOM   973  C  CG2   . ILE A 1 122 ? 16.060 13.570  3.806   1.00 8.49  ? 130 ILE A CG2   1 
ATOM   974  C  CD1   . ILE A 1 122 ? 18.246 14.750  5.917   1.00 8.70  ? 130 ILE A CD1   1 
ATOM   975  N  N     . GLU A 1 123 ? 16.629 14.447  0.434   1.00 6.46  ? 131 GLU A N     1 
ATOM   976  C  CA    . GLU A 1 123 ? 15.576 14.370  -0.568  1.00 7.46  ? 131 GLU A CA    1 
ATOM   977  C  C     . GLU A 1 123 ? 16.014 13.495  -1.752  1.00 7.38  ? 131 GLU A C     1 
ATOM   978  O  O     . GLU A 1 123 ? 15.238 12.710  -2.269  1.00 7.04  ? 131 GLU A O     1 
ATOM   979  C  CB    . GLU A 1 123 ? 15.144 15.786  -0.978  1.00 8.29  ? 131 GLU A CB    1 
ATOM   980  C  CG    . GLU A 1 123 ? 14.512 16.546  0.198   1.00 11.86 ? 131 GLU A CG    1 
ATOM   981  C  CD    . GLU A 1 123 ? 13.297 15.819  0.800   1.00 17.12 ? 131 GLU A CD    1 
ATOM   982  O  OE1   . GLU A 1 123 ? 12.404 15.419  0.029   1.00 18.06 ? 131 GLU A OE1   1 
ATOM   983  O  OE2   . GLU A 1 123 ? 13.256 15.607  2.038   1.00 15.13 ? 131 GLU A OE2   1 
ATOM   984  N  N     . GLU A 1 124 ? 17.283 13.601  -2.141  1.00 7.31  ? 132 GLU A N     1 
ATOM   985  C  CA    . GLU A 1 124 ? 17.800 12.796  -3.241  1.00 7.11  ? 132 GLU A CA    1 
ATOM   986  C  C     . GLU A 1 124 ? 17.809 11.310  -2.866  1.00 7.03  ? 132 GLU A C     1 
ATOM   987  O  O     . GLU A 1 124 ? 17.452 10.459  -3.675  1.00 6.95  ? 132 GLU A O     1 
ATOM   988  C  CB    . GLU A 1 124 ? 19.196 13.276  -3.652  1.00 7.09  ? 132 GLU A CB    1 
ATOM   989  C  CG    . GLU A 1 124 ? 19.809 12.540  -4.863  1.00 8.88  ? 132 GLU A CG    1 
ATOM   990  C  CD    . GLU A 1 124 ? 19.054 12.719  -6.183  1.00 12.95 ? 132 GLU A CD    1 
ATOM   991  O  OE1   . GLU A 1 124 ? 18.150 13.580  -6.330  1.00 12.30 ? 132 GLU A OE1   1 
ATOM   992  O  OE2   . GLU A 1 124 ? 19.368 11.942  -7.113  1.00 14.64 ? 132 GLU A OE2   1 
ATOM   993  N  N     . ALA A 1 125 ? 18.254 11.010  -1.654  1.00 5.90  ? 133 ALA A N     1 
ATOM   994  C  CA    . ALA A 1 125 ? 18.294 9.634   -1.132  1.00 5.99  ? 133 ALA A CA    1 
ATOM   995  C  C     . ALA A 1 125 ? 16.888 9.028   -1.159  1.00 5.65  ? 133 ALA A C     1 
ATOM   996  O  O     . ALA A 1 125 ? 16.708 7.907   -1.628  1.00 6.41  ? 133 ALA A O     1 
ATOM   997  C  CB    . ALA A 1 125 ? 18.843 9.631   0.291   1.00 6.57  ? 133 ALA A CB    1 
ATOM   998  N  N     . LYS A 1 126 ? 15.891 9.792   -0.720  1.00 5.44  ? 134 LYS A N     1 
ATOM   999  C  CA    . LYS A 1 126 ? 14.500 9.304   -0.761  1.00 6.69  ? 134 LYS A CA    1 
ATOM   1000 C  C     . LYS A 1 126 ? 14.071 8.886   -2.148  1.00 6.84  ? 134 LYS A C     1 
ATOM   1001 O  O     . LYS A 1 126 ? 13.400 7.856   -2.323  1.00 7.35  ? 134 LYS A O     1 
ATOM   1002 C  CB    . LYS A 1 126 ? 13.536 10.356  -0.215  1.00 7.23  ? 134 LYS A CB    1 
ATOM   1003 C  CG    . LYS A 1 126 ? 13.641 10.535  1.266   1.00 7.88  ? 134 LYS A CG    1 
ATOM   1004 C  CD    . LYS A 1 126 ? 12.675 11.680  1.601   1.00 14.00 ? 134 LYS A CD    1 
ATOM   1005 C  CE    . LYS A 1 126 ? 12.579 11.922  3.078   1.00 16.66 ? 134 LYS A CE    1 
ATOM   1006 N  NZ    . LYS A 1 126 ? 11.736 13.172  3.286   1.00 19.02 ? 134 LYS A NZ    1 
ATOM   1007 N  N     . LYS A 1 127 ? 14.467 9.662   -3.159  1.00 6.46  ? 135 LYS A N     1 
ATOM   1008 C  CA    . LYS A 1 127 ? 14.091 9.346   -4.536  1.00 7.34  ? 135 LYS A CA    1 
ATOM   1009 C  C     . LYS A 1 127 ? 14.789 8.096   -5.057  1.00 7.52  ? 135 LYS A C     1 
ATOM   1010 O  O     . LYS A 1 127 ? 14.147 7.266   -5.747  1.00 7.25  ? 135 LYS A O     1 
ATOM   1011 C  CB    . LYS A 1 127 ? 14.349 10.549  -5.466  1.00 7.83  ? 135 LYS A CB    1 
ATOM   1012 C  CG    . LYS A 1 127 ? 13.510 11.750  -5.113  1.00 10.83 ? 135 LYS A CG    1 
ATOM   1013 C  CD    . LYS A 1 127 ? 14.047 13.019  -5.810  1.00 15.32 ? 135 LYS A CD    1 
ATOM   1014 C  CE    . LYS A 1 127 ? 13.560 14.295  -5.112  1.00 20.06 ? 135 LYS A CE    1 
ATOM   1015 N  NZ    . LYS A 1 127 ? 13.908 15.477  -5.945  1.00 22.76 ? 135 LYS A NZ    1 
ATOM   1016 N  N     . ARG A 1 128 ? 16.086 7.970   -4.763  1.00 6.39  ? 136 ARG A N     1 
ATOM   1017 C  CA    . ARG A 1 128 ? 16.896 6.897   -5.340  1.00 6.90  ? 136 ARG A CA    1 
ATOM   1018 C  C     . ARG A 1 128 ? 16.505 5.553   -4.751  1.00 7.18  ? 136 ARG A C     1 
ATOM   1019 O  O     . ARG A 1 128 ? 16.633 4.489   -5.398  1.00 8.62  ? 136 ARG A O     1 
ATOM   1020 C  CB    . ARG A 1 128 ? 18.391 7.172   -5.097  1.00 7.87  ? 136 ARG A CB    1 
ATOM   1021 C  CG    . ARG A 1 128 ? 18.914 8.379   -5.926  1.00 9.12  ? 136 ARG A CG    1 
ATOM   1022 C  CD    . ARG A 1 128 ? 20.405 8.338   -6.187  1.00 12.64 ? 136 ARG A CD    1 
ATOM   1023 N  NE    . ARG A 1 128 ? 20.880 9.621   -6.693  1.00 13.20 ? 136 ARG A NE    1 
ATOM   1024 C  CZ    . ARG A 1 128 ? 22.160 9.923   -6.883  1.00 13.51 ? 136 ARG A CZ    1 
ATOM   1025 N  NH1   . ARG A 1 128 ? 23.110 9.019   -6.655  1.00 13.61 ? 136 ARG A NH1   1 
ATOM   1026 N  NH2   . ARG A 1 128 ? 22.484 11.132  -7.329  1.00 15.63 ? 136 ARG A NH2   1 
ATOM   1027 N  N     . LEU A 1 129 ? 16.029 5.590   -3.511  1.00 6.70  ? 137 LEU A N     1 
ATOM   1028 C  CA    . LEU A 1 129 ? 15.685 4.354   -2.817  1.00 7.10  ? 137 LEU A CA    1 
ATOM   1029 C  C     . LEU A 1 129 ? 14.370 3.749   -3.325  1.00 7.43  ? 137 LEU A C     1 
ATOM   1030 O  O     . LEU A 1 129 ? 14.003 2.633   -2.914  1.00 8.55  ? 137 LEU A O     1 
ATOM   1031 C  CB    . LEU A 1 129 ? 15.613 4.609   -1.313  1.00 6.74  ? 137 LEU A CB    1 
ATOM   1032 C  CG    . LEU A 1 129 ? 16.995 4.768   -0.653  1.00 4.48  ? 137 LEU A CG    1 
ATOM   1033 C  CD1   . LEU A 1 129 ? 16.889 5.435   0.702   1.00 5.50  ? 137 LEU A CD1   1 
ATOM   1034 C  CD2   . LEU A 1 129 ? 17.647 3.406   -0.485  1.00 6.49  ? 137 LEU A CD2   1 
ATOM   1035 N  N     . GLU A 1 130 ? 13.675 4.489   -4.178  1.00 8.67  ? 138 GLU A N     1 
ATOM   1036 C  CA    . GLU A 1 130 ? 12.467 3.982   -4.834  1.00 8.51  ? 138 GLU A CA    1 
ATOM   1037 C  C     . GLU A 1 130 ? 12.771 3.134   -6.045  1.00 8.86  ? 138 GLU A C     1 
ATOM   1038 O  O     . GLU A 1 130 ? 11.888 2.444   -6.562  1.00 8.71  ? 138 GLU A O     1 
ATOM   1039 C  CB    . GLU A 1 130 ? 11.558 5.152   -5.238  1.00 9.82  ? 138 GLU A CB    1 
ATOM   1040 C  CG    . GLU A 1 130 ? 10.793 5.796   -4.094  1.00 11.51 ? 138 GLU A CG    1 
ATOM   1041 C  CD    . GLU A 1 130 ? 10.018 4.788   -3.262  1.00 14.32 ? 138 GLU A CD    1 
ATOM   1042 O  OE1   . GLU A 1 130 ? 9.239  3.956   -3.805  1.00 16.20 ? 138 GLU A OE1   1 
ATOM   1043 O  OE2   . GLU A 1 130 ? 10.169 4.820   -2.044  1.00 12.85 ? 138 GLU A OE2   1 
ATOM   1044 N  N     . LEU A 1 131 ? 14.002 3.190   -6.527  1.00 9.10  ? 139 LEU A N     1 
ATOM   1045 C  CA    . LEU A 1 131 ? 14.388 2.390   -7.676  1.00 9.88  ? 139 LEU A CA    1 
ATOM   1046 C  C     . LEU A 1 131 ? 14.254 0.932   -7.267  1.00 9.72  ? 139 LEU A C     1 
ATOM   1047 O  O     . LEU A 1 131 ? 14.690 0.561   -6.187  1.00 7.86  ? 139 LEU A O     1 
ATOM   1048 C  CB    . LEU A 1 131 ? 15.825 2.707   -8.075  1.00 11.12 ? 139 LEU A CB    1 
ATOM   1049 C  CG    . LEU A 1 131 ? 16.124 4.035   -8.780  1.00 13.11 ? 139 LEU A CG    1 
ATOM   1050 C  CD1   . LEU A 1 131 ? 17.663 4.243   -8.807  1.00 16.31 ? 139 LEU A CD1   1 
ATOM   1051 C  CD2   . LEU A 1 131 ? 15.536 4.035   -10.193 1.00 15.59 ? 139 LEU A CD2   1 
ATOM   1052 N  N     . PRO A 1 132 ? 13.619 0.111   -8.099  1.00 10.37 ? 140 PRO A N     1 
ATOM   1053 C  CA    . PRO A 1 132 ? 13.329 -1.286  -7.724  1.00 10.63 ? 140 PRO A CA    1 
ATOM   1054 C  C     . PRO A 1 132 ? 14.534 -2.054  -7.167  1.00 10.93 ? 140 PRO A C     1 
ATOM   1055 O  O     . PRO A 1 132 ? 14.388 -2.822  -6.219  1.00 10.56 ? 140 PRO A O     1 
ATOM   1056 C  CB    . PRO A 1 132 ? 12.884 -1.912  -9.059  1.00 10.51 ? 140 PRO A CB    1 
ATOM   1057 C  CG    . PRO A 1 132 ? 12.337 -0.776  -9.806  1.00 11.89 ? 140 PRO A CG    1 
ATOM   1058 C  CD    . PRO A 1 132 ? 13.111 0.449   -9.440  1.00 10.85 ? 140 PRO A CD    1 
ATOM   1059 N  N     . GLU A 1 133 ? 15.705 -1.818  -7.745  1.00 11.70 ? 141 GLU A N     1 
ATOM   1060 C  CA    . GLU A 1 133 ? 16.946 -2.475  -7.350  1.00 13.06 ? 141 GLU A CA    1 
ATOM   1061 C  C     . GLU A 1 133 ? 17.379 -2.171  -5.896  1.00 11.81 ? 141 GLU A C     1 
ATOM   1062 O  O     . GLU A 1 133 ? 18.064 -2.969  -5.243  1.00 11.81 ? 141 GLU A O     1 
ATOM   1063 C  CB    . GLU A 1 133 ? 18.007 -2.088  -8.366  1.00 13.88 ? 141 GLU A CB    1 
ATOM   1064 C  CG    . GLU A 1 133 ? 19.382 -1.708  -7.880  1.00 19.80 ? 141 GLU A CG    1 
ATOM   1065 C  CD    . GLU A 1 133 ? 20.235 -1.158  -9.022  1.00 27.47 ? 141 GLU A CD    1 
ATOM   1066 O  OE1   . GLU A 1 133 ? 19.672 -0.479  -9.946  1.00 29.67 ? 141 GLU A OE1   1 
ATOM   1067 O  OE2   . GLU A 1 133 ? 21.467 -1.418  -9.002  1.00 30.70 ? 141 GLU A OE2   1 
ATOM   1068 N  N     . TYR A 1 134 ? 16.966 -1.017  -5.394  1.00 10.90 ? 142 TYR A N     1 
ATOM   1069 C  CA    . TYR A 1 134 ? 17.292 -0.614  -4.028  1.00 9.83  ? 142 TYR A CA    1 
ATOM   1070 C  C     . TYR A 1 134 ? 16.098 -0.839  -3.139  1.00 10.08 ? 142 TYR A C     1 
ATOM   1071 O  O     . TYR A 1 134 ? 16.228 -1.243  -1.980  1.00 9.47  ? 142 TYR A O     1 
ATOM   1072 C  CB    . TYR A 1 134 ? 17.685 0.858   -3.977  1.00 9.06  ? 142 TYR A CB    1 
ATOM   1073 C  CG    . TYR A 1 134 ? 18.917 1.167   -4.778  1.00 10.39 ? 142 TYR A CG    1 
ATOM   1074 C  CD1   . TYR A 1 134 ? 20.051 0.358   -4.686  1.00 11.90 ? 142 TYR A CD1   1 
ATOM   1075 C  CD2   . TYR A 1 134 ? 18.942 2.273   -5.645  1.00 13.14 ? 142 TYR A CD2   1 
ATOM   1076 C  CE1   . TYR A 1 134 ? 21.188 0.639   -5.436  1.00 16.42 ? 142 TYR A CE1   1 
ATOM   1077 C  CE2   . TYR A 1 134 ? 20.063 2.570   -6.392  1.00 16.70 ? 142 TYR A CE2   1 
ATOM   1078 C  CZ    . TYR A 1 134 ? 21.177 1.755   -6.300  1.00 17.00 ? 142 TYR A CZ    1 
ATOM   1079 O  OH    . TYR A 1 134 ? 22.275 2.060   -7.068  1.00 19.39 ? 142 TYR A OH    1 
ATOM   1080 N  N     . LEU A 1 135 ? 14.915 -0.578  -3.687  1.00 9.50  ? 143 LEU A N     1 
ATOM   1081 C  CA    . LEU A 1 135 ? 13.694 -0.832  -2.930  1.00 10.30 ? 143 LEU A CA    1 
ATOM   1082 C  C     . LEU A 1 135 ? 13.595 -2.250  -2.353  1.00 10.07 ? 143 LEU A C     1 
ATOM   1083 O  O     . LEU A 1 135 ? 13.141 -2.440  -1.234  1.00 11.07 ? 143 LEU A O     1 
ATOM   1084 C  CB    . LEU A 1 135 ? 12.458 -0.494  -3.785  1.00 10.10 ? 143 LEU A CB    1 
ATOM   1085 C  CG    . LEU A 1 135 ? 11.137 -0.291  -3.037  1.00 11.65 ? 143 LEU A CG    1 
ATOM   1086 C  CD1   . LEU A 1 135 ? 11.243 0.665   -1.841  1.00 11.23 ? 143 LEU A CD1   1 
ATOM   1087 C  CD2   . LEU A 1 135 ? 10.050 0.182   -3.989  1.00 10.79 ? 143 LEU A CD2   1 
ATOM   1088 N  N     . LYS A 1 136 ? 14.050 -3.243  -3.104  1.00 9.29  ? 144 LYS A N     1 
ATOM   1089 C  CA    . LYS A 1 136 ? 14.007 -4.635  -2.653  1.00 10.09 ? 144 LYS A CA    1 
ATOM   1090 C  C     . LYS A 1 136 ? 14.859 -4.926  -1.419  1.00 9.60  ? 144 LYS A C     1 
ATOM   1091 O  O     . LYS A 1 136 ? 14.585 -5.873  -0.677  1.00 9.77  ? 144 LYS A O     1 
ATOM   1092 C  CB    . LYS A 1 136 ? 14.449 -5.555  -3.785  1.00 10.29 ? 144 LYS A CB    1 
ATOM   1093 C  CG    . LYS A 1 136 ? 15.924 -5.381  -4.123  1.00 13.43 ? 144 LYS A CG    1 
ATOM   1094 C  CD    . LYS A 1 136 ? 16.522 -6.607  -4.765  1.00 17.19 ? 144 LYS A CD    1 
ATOM   1095 C  CE    . LYS A 1 136 ? 17.194 -6.244  -6.056  1.00 18.67 ? 144 LYS A CE    1 
ATOM   1096 N  NZ    . LYS A 1 136 ? 18.589 -5.756  -5.840  1.00 17.51 ? 144 LYS A NZ    1 
ATOM   1097 N  N     . ILE A 1 137 ? 15.892 -4.115  -1.186  1.00 9.20  ? 145 ILE A N     1 
ATOM   1098 C  CA    . ILE A 1 137 ? 16.827 -4.372  -0.088  1.00 9.44  ? 145 ILE A CA    1 
ATOM   1099 C  C     . ILE A 1 137 ? 16.154 -4.179  1.270   1.00 9.84  ? 145 ILE A C     1 
ATOM   1100 O  O     . ILE A 1 137 ? 16.538 -4.789  2.272   1.00 9.14  ? 145 ILE A O     1 
ATOM   1101 C  CB    . ILE A 1 137 ? 18.116 -3.531  -0.230  1.00 8.91  ? 145 ILE A CB    1 
ATOM   1102 C  CG1   . ILE A 1 137 ? 18.772 -3.907  -1.574  1.00 11.94 ? 145 ILE A CG1   1 
ATOM   1103 C  CG2   . ILE A 1 137 ? 19.079 -3.807  0.991   1.00 9.29  ? 145 ILE A CG2   1 
ATOM   1104 C  CD1   . ILE A 1 137 ? 19.894 -3.031  -2.061  1.00 13.21 ? 145 ILE A CD1   1 
ATOM   1105 N  N     . LYS A 1 138 ? 15.092 -3.394  1.257   1.00 9.80  ? 146 LYS A N     1 
ATOM   1106 C  CA    . LYS A 1 138 ? 14.262 -3.184  2.424   1.00 11.46 ? 146 LYS A CA    1 
ATOM   1107 C  C     . LYS A 1 138 ? 13.773 -4.529  2.991   1.00 11.78 ? 146 LYS A C     1 
ATOM   1108 O  O     . LYS A 1 138 ? 13.561 -4.672  4.217   1.00 11.06 ? 146 LYS A O     1 
ATOM   1109 C  CB    . LYS A 1 138 ? 13.074 -2.324  1.999   1.00 11.46 ? 146 LYS A CB    1 
ATOM   1110 C  CG    . LYS A 1 138 ? 12.348 -1.734  3.159   1.00 15.03 ? 146 LYS A CG    1 
ATOM   1111 C  CD    . LYS A 1 138 ? 11.065 -1.060  2.709   1.00 14.67 ? 146 LYS A CD    1 
ATOM   1112 C  CE    . LYS A 1 138 ? 10.383 -0.511  3.952   1.00 17.85 ? 146 LYS A CE    1 
ATOM   1113 N  NZ    . LYS A 1 138 ? 8.997  -0.037  3.708   1.00 19.42 ? 146 LYS A NZ    1 
ATOM   1114 N  N     . GLU A 1 139 ? 13.603 -5.516  2.099   1.00 10.61 ? 147 GLU A N     1 
ATOM   1115 C  CA    . GLU A 1 139 ? 13.016 -6.797  2.461   1.00 11.14 ? 147 GLU A CA    1 
ATOM   1116 C  C     . GLU A 1 139 ? 14.051 -7.884  2.711   1.00 10.63 ? 147 GLU A C     1 
ATOM   1117 O  O     . GLU A 1 139 ? 13.697 -9.058  2.890   1.00 9.17  ? 147 GLU A O     1 
ATOM   1118 C  CB    . GLU A 1 139 ? 12.034 -7.269  1.365   1.00 11.62 ? 147 GLU A CB    1 
ATOM   1119 C  CG    . GLU A 1 139 ? 10.984 -6.240  0.953   1.00 16.46 ? 147 GLU A CG    1 
ATOM   1120 C  CD    . GLU A 1 139 ? 9.842  -6.126  1.945   1.00 21.93 ? 147 GLU A CD    1 
ATOM   1121 O  OE1   . GLU A 1 139 ? 10.107 -5.950  3.163   1.00 26.71 ? 147 GLU A OE1   1 
ATOM   1122 O  OE2   . GLU A 1 139 ? 8.666  -6.217  1.506   1.00 27.05 ? 147 GLU A OE2   1 
ATOM   1123 N  N     . ASP A 1 140 ? 15.327 -7.489  2.761   1.00 9.57  ? 148 ASP A N     1 
ATOM   1124 C  CA    . ASP A 1 140 ? 16.405 -8.461  2.917   1.00 9.92  ? 148 ASP A CA    1 
ATOM   1125 C  C     . ASP A 1 140 ? 16.256 -9.183  4.264   1.00 9.43  ? 148 ASP A C     1 
ATOM   1126 O  O     . ASP A 1 140 ? 15.835 -8.568  5.250   1.00 10.28 ? 148 ASP A O     1 
ATOM   1127 C  CB    . ASP A 1 140 ? 17.778 -7.750  2.872   1.00 9.65  ? 148 ASP A CB    1 
ATOM   1128 C  CG    . ASP A 1 140 ? 18.930 -8.741  2.666   1.00 11.44 ? 148 ASP A CG    1 
ATOM   1129 O  OD1   . ASP A 1 140 ? 19.381 -9.318  3.662   1.00 10.97 ? 148 ASP A OD1   1 
ATOM   1130 O  OD2   . ASP A 1 140 ? 19.378 -9.068  1.547   1.00 12.72 ? 148 ASP A OD2   1 
ATOM   1131 N  N     . ASN A 1 141 ? 16.618 -10.468 4.300   1.00 9.62  ? 149 ASN A N     1 
ATOM   1132 C  CA    . ASN A 1 141 ? 16.565 -11.237 5.558   1.00 9.75  ? 149 ASN A CA    1 
ATOM   1133 C  C     . ASN A 1 141 ? 17.406 -10.619 6.658   1.00 8.86  ? 149 ASN A C     1 
ATOM   1134 O  O     . ASN A 1 141 ? 17.164 -10.857 7.847   1.00 8.76  ? 149 ASN A O     1 
ATOM   1135 C  CB    . ASN A 1 141 ? 16.964 -12.691 5.337   1.00 10.57 ? 149 ASN A CB    1 
ATOM   1136 C  CG    . ASN A 1 141 ? 15.859 -13.497 4.720   1.00 14.78 ? 149 ASN A CG    1 
ATOM   1137 O  OD1   . ASN A 1 141 ? 14.685 -13.079 4.718   1.00 17.45 ? 149 ASN A OD1   1 
ATOM   1138 N  ND2   . ASN A 1 141 ? 16.215 -14.649 4.167   1.00 15.20 ? 149 ASN A ND2   1 
ATOM   1139 N  N     . PHE A 1 142 ? 18.404 -9.826  6.271   1.00 8.51  ? 150 PHE A N     1 
ATOM   1140 C  CA    . PHE A 1 142 ? 19.212 -9.069  7.248   1.00 8.12  ? 150 PHE A CA    1 
ATOM   1141 C  C     . PHE A 1 142 ? 18.295 -8.366  8.253   1.00 9.03  ? 150 PHE A C     1 
ATOM   1142 O  O     . PHE A 1 142 ? 18.573 -8.341  9.458   1.00 8.82  ? 150 PHE A O     1 
ATOM   1143 C  CB    . PHE A 1 142 ? 20.082 -8.011  6.500   1.00 7.58  ? 150 PHE A CB    1 
ATOM   1144 C  CG    . PHE A 1 142 ? 20.863 -7.093  7.404   1.00 8.47  ? 150 PHE A CG    1 
ATOM   1145 C  CD1   . PHE A 1 142 ? 22.031 -7.511  8.017   1.00 6.86  ? 150 PHE A CD1   1 
ATOM   1146 C  CD2   . PHE A 1 142 ? 20.428 -5.770  7.613   1.00 7.73  ? 150 PHE A CD2   1 
ATOM   1147 C  CE1   . PHE A 1 142 ? 22.762 -6.626  8.849   1.00 7.57  ? 150 PHE A CE1   1 
ATOM   1148 C  CE2   . PHE A 1 142 ? 21.144 -4.885  8.427   1.00 8.92  ? 150 PHE A CE2   1 
ATOM   1149 C  CZ    . PHE A 1 142 ? 22.294 -5.309  9.053   1.00 9.23  ? 150 PHE A CZ    1 
ATOM   1150 N  N     . PHE A 1 143 ? 17.223 -7.747  7.741   1.00 10.29 ? 151 PHE A N     1 
ATOM   1151 C  CA    . PHE A 1 143 ? 16.348 -6.991  8.606   1.00 12.92 ? 151 PHE A CA    1 
ATOM   1152 C  C     . PHE A 1 143 ? 15.320 -7.853  9.308   1.00 16.53 ? 151 PHE A C     1 
ATOM   1153 O  O     . PHE A 1 143 ? 14.794 -7.453  10.344  1.00 16.80 ? 151 PHE A O     1 
ATOM   1154 C  CB    . PHE A 1 143 ? 15.640 -5.912  7.802   1.00 12.43 ? 151 PHE A CB    1 
ATOM   1155 C  CG    . PHE A 1 143 ? 16.543 -4.836  7.350   1.00 8.14  ? 151 PHE A CG    1 
ATOM   1156 C  CD1   . PHE A 1 143 ? 17.116 -3.961  8.266   1.00 7.71  ? 151 PHE A CD1   1 
ATOM   1157 C  CD2   . PHE A 1 143 ? 16.823 -4.678  5.984   1.00 8.89  ? 151 PHE A CD2   1 
ATOM   1158 C  CE1   . PHE A 1 143 ? 17.973 -2.951  7.833   1.00 7.79  ? 151 PHE A CE1   1 
ATOM   1159 C  CE2   . PHE A 1 143 ? 17.686 -3.661  5.532   1.00 7.50  ? 151 PHE A CE2   1 
ATOM   1160 C  CZ    . PHE A 1 143 ? 18.261 -2.797  6.450   1.00 7.68  ? 151 PHE A CZ    1 
ATOM   1161 N  N     . GLN A 1 144 ? 15.028 -9.008  8.732   1.00 20.00 ? 152 GLN A N     1 
ATOM   1162 C  CA    . GLN A 1 144 ? 14.085 -9.950  9.332   1.00 24.32 ? 152 GLN A CA    1 
ATOM   1163 C  C     . GLN A 1 144 ? 14.654 -10.665 10.569  1.00 26.10 ? 152 GLN A C     1 
ATOM   1164 O  O     . GLN A 1 144 ? 13.908 -10.964 11.496  1.00 26.43 ? 152 GLN A O     1 
ATOM   1165 C  CB    . GLN A 1 144 ? 13.551 -10.917 8.273   1.00 24.98 ? 152 GLN A CB    1 
ATOM   1166 C  CG    . GLN A 1 144 ? 12.222 -10.438 7.633   1.00 28.45 ? 152 GLN A CG    1 
ATOM   1167 C  CD    . GLN A 1 144 ? 12.224 -10.466 6.102   1.00 33.83 ? 152 GLN A CD    1 
ATOM   1168 O  OE1   . GLN A 1 144 ? 11.554 -9.647  5.452   1.00 36.39 ? 152 GLN A OE1   1 
ATOM   1169 N  NE2   . GLN A 1 144 ? 12.959 -11.413 5.523   1.00 35.70 ? 152 GLN A NE2   1 
ATOM   1170 N  N     . VAL A 1 145 ? 15.968 -10.895 10.618  1.00 28.08 ? 153 VAL A N     1 
ATOM   1171 C  CA    . VAL A 1 145 ? 16.558 -11.506 11.814  1.00 29.92 ? 153 VAL A CA    1 
ATOM   1172 C  C     . VAL A 1 145 ? 16.297 -10.657 13.051  1.00 31.30 ? 153 VAL A C     1 
ATOM   1173 O  O     . VAL A 1 145 ? 15.956 -11.186 14.112  1.00 31.27 ? 153 VAL A O     1 
ATOM   1174 C  CB    . VAL A 1 145 ? 18.084 -11.900 11.699  1.00 30.15 ? 153 VAL A CB    1 
ATOM   1175 C  CG1   . VAL A 1 145 ? 18.668 -11.591 10.354  1.00 30.15 ? 153 VAL A CG1   1 
ATOM   1176 C  CG2   . VAL A 1 145 ? 18.937 -11.279 12.830  1.00 30.12 ? 153 VAL A CG2   1 
ATOM   1177 N  N     . SER A 1 146 ? 16.408 -9.339  12.895  1.00 32.86 ? 154 SER A N     1 
ATOM   1178 C  CA    . SER A 1 146 ? 16.256 -8.420  14.019  1.00 34.24 ? 154 SER A CA    1 
ATOM   1179 C  C     . SER A 1 146 ? 14.799 -8.232  14.483  1.00 35.23 ? 154 SER A C     1 
ATOM   1180 O  O     . SER A 1 146 ? 14.569 -7.624  15.536  1.00 35.53 ? 154 SER A O     1 
ATOM   1181 C  CB    . SER A 1 146 ? 16.925 -7.071  13.716  1.00 34.13 ? 154 SER A CB    1 
ATOM   1182 O  OG    . SER A 1 146 ? 17.420 -7.029  12.386  1.00 34.36 ? 154 SER A OG    1 
ATOM   1183 N  N     . LYS A 1 147 ? 13.830 -8.741  13.708  1.00 36.35 ? 155 LYS A N     1 
ATOM   1184 C  CA    . LYS A 1 147 ? 12.442 -8.912  14.202  1.00 37.08 ? 155 LYS A CA    1 
ATOM   1185 C  C     . LYS A 1 147 ? 12.066 -10.380 14.512  1.00 37.50 ? 155 LYS A C     1 
ATOM   1186 O  O     . LYS A 1 147 ? 11.807 -10.815 15.644  1.00 37.71 ? 155 LYS A O     1 
ATOM   1187 C  CB    . LYS A 1 147 ? 11.391 -8.263  13.278  1.00 37.27 ? 155 LYS A CB    1 
ATOM   1188 C  CG    . LYS A 1 147 ? 11.878 -7.778  11.911  1.00 37.28 ? 155 LYS A CG    1 
ATOM   1189 C  CD    . LYS A 1 147 ? 11.757 -6.266  11.784  1.00 37.26 ? 155 LYS A CD    1 
ATOM   1190 C  CE    . LYS A 1 147 ? 10.558 -5.847  10.943  1.00 36.81 ? 155 LYS A CE    1 
ATOM   1191 N  NZ    . LYS A 1 147 ? 10.922 -5.586  9.521   1.00 35.44 ? 155 LYS A NZ    1 
ATOM   1192 O  OXT   . LYS A 1 147 ? 11.986 -11.292 13.685  1.00 37.78 ? 155 LYS A OXT   1 
HETATM 1193 MG MG    . MG  B 2 .   ? 25.099 12.657  15.712  1.00 18.88 ? 201 MG  A MG    1 
HETATM 1194 P  PB    . ADP C 3 .   ? 25.080 12.260  18.932  1.00 19.24 ? 301 ADP A PB    1 
HETATM 1195 O  O1B   . ADP C 3 .   ? 25.722 12.236  17.603  1.00 19.90 ? 301 ADP A O1B   1 
HETATM 1196 O  O2B   . ADP C 3 .   ? 24.539 10.932  19.427  1.00 21.39 ? 301 ADP A O2B   1 
HETATM 1197 O  O3B   . ADP C 3 .   ? 26.106 12.831  19.890  1.00 18.86 ? 301 ADP A O3B   1 
HETATM 1198 P  PA    . ADP C 3 .   ? 22.792 13.701  17.804  1.00 18.60 ? 301 ADP A PA    1 
HETATM 1199 O  O1A   . ADP C 3 .   ? 22.345 15.118  18.143  1.00 19.48 ? 301 ADP A O1A   1 
HETATM 1200 O  O2A   . ADP C 3 .   ? 23.367 13.525  16.391  1.00 18.31 ? 301 ADP A O2A   1 
HETATM 1201 O  O3A   . ADP C 3 .   ? 23.850 13.290  18.907  1.00 17.71 ? 301 ADP A O3A   1 
HETATM 1202 O  "O5'" . ADP C 3 .   ? 21.559 12.777  18.013  1.00 17.27 ? 301 ADP A "O5'" 1 
HETATM 1203 C  "C5'" . ADP C 3 .   ? 21.634 11.386  17.674  1.00 17.43 ? 301 ADP A "C5'" 1 
HETATM 1204 C  "C4'" . ADP C 3 .   ? 20.602 10.598  18.446  1.00 19.27 ? 301 ADP A "C4'" 1 
HETATM 1205 O  "O4'" . ADP C 3 .   ? 19.309 10.937  18.025  1.00 19.03 ? 301 ADP A "O4'" 1 
HETATM 1206 C  "C3'" . ADP C 3 .   ? 20.680 9.083   18.137  1.00 19.35 ? 301 ADP A "C3'" 1 
HETATM 1207 O  "O3'" . ADP C 3 .   ? 21.592 8.378   18.969  1.00 19.52 ? 301 ADP A "O3'" 1 
HETATM 1208 C  "C2'" . ADP C 3 .   ? 19.260 8.628   18.447  1.00 19.54 ? 301 ADP A "C2'" 1 
HETATM 1209 O  "O2'" . ADP C 3 .   ? 19.126 8.298   19.827  1.00 21.97 ? 301 ADP A "O2'" 1 
HETATM 1210 C  "C1'" . ADP C 3 .   ? 18.399 9.859   18.217  1.00 19.07 ? 301 ADP A "C1'" 1 
HETATM 1211 N  N9    . ADP C 3 .   ? 17.532 9.876   17.029  1.00 20.07 ? 301 ADP A N9    1 
HETATM 1212 C  C8    . ADP C 3 .   ? 16.188 10.183  17.056  1.00 21.95 ? 301 ADP A C8    1 
HETATM 1213 N  N7    . ADP C 3 .   ? 15.710 10.179  15.809  1.00 19.80 ? 301 ADP A N7    1 
HETATM 1214 C  C5    . ADP C 3 .   ? 16.742 9.867   14.956  1.00 18.11 ? 301 ADP A C5    1 
HETATM 1215 C  C6    . ADP C 3 .   ? 16.794 9.713   13.572  1.00 19.96 ? 301 ADP A C6    1 
HETATM 1216 N  N6    . ADP C 3 .   ? 15.783 10.032  12.776  1.00 18.29 ? 301 ADP A N6    1 
HETATM 1217 N  N1    . ADP C 3 .   ? 18.031 9.377   13.006  1.00 17.35 ? 301 ADP A N1    1 
HETATM 1218 C  C2    . ADP C 3 .   ? 19.140 9.231   13.806  1.00 17.78 ? 301 ADP A C2    1 
HETATM 1219 N  N3    . ADP C 3 .   ? 19.086 9.350   15.170  1.00 16.90 ? 301 ADP A N3    1 
HETATM 1220 C  C4    . ADP C 3 .   ? 17.884 9.681   15.723  1.00 19.33 ? 301 ADP A C4    1 
HETATM 1221 O  O     . HOH D 4 .   ? 24.222 8.602   18.298  1.00 18.15 ? 401 HOH A O     1 
HETATM 1222 O  O     . HOH D 4 .   ? 26.822 11.860  14.876  1.00 16.59 ? 402 HOH A O     1 
HETATM 1223 O  O     . HOH D 4 .   ? 26.036 5.173   12.104  1.00 19.11 ? 403 HOH A O     1 
HETATM 1224 O  O     . HOH D 4 .   ? 28.077 -2.412  18.838  1.00 23.78 ? 404 HOH A O     1 
HETATM 1225 O  O     . HOH D 4 .   ? 13.268 1.113   13.143  1.00 22.30 ? 405 HOH A O     1 
HETATM 1226 O  O     . HOH D 4 .   ? 13.471 11.623  14.926  1.00 24.71 ? 406 HOH A O     1 
HETATM 1227 O  O     . HOH D 4 .   ? 22.116 32.098  7.286   1.00 25.95 ? 407 HOH A O     1 
HETATM 1228 O  O     . HOH D 4 .   ? 26.014 14.591  15.766  1.00 19.96 ? 408 HOH A O     1 
HETATM 1229 O  O     . HOH D 4 .   ? 10.278 8.229   1.126   1.00 31.17 ? 409 HOH A O     1 
HETATM 1230 O  O     . HOH D 4 .   ? 31.993 7.088   13.987  1.00 26.90 ? 410 HOH A O     1 
HETATM 1231 O  O     . HOH D 4 .   ? 11.891 6.360   5.469   1.00 27.71 ? 411 HOH A O     1 
HETATM 1232 O  O     . HOH D 4 .   ? 28.259 -6.562  4.050   1.00 26.82 ? 412 HOH A O     1 
HETATM 1233 O  O     . HOH D 4 .   ? 12.489 13.296  -1.954  1.00 29.08 ? 413 HOH A O     1 
HETATM 1234 O  O     . HOH D 4 .   ? 23.432 17.956  -1.371  1.00 27.23 ? 414 HOH A O     1 
HETATM 1235 O  O     . HOH D 4 .   ? 24.223 14.790  4.482   1.00 32.22 ? 415 HOH A O     1 
HETATM 1236 O  O     . HOH D 4 .   ? 21.389 13.345  21.987  1.00 34.02 ? 416 HOH A O     1 
HETATM 1237 O  O     . HOH D 4 .   ? 18.348 23.164  10.613  1.00 31.79 ? 417 HOH A O     1 
HETATM 1238 O  O     . HOH D 4 .   ? 24.412 30.673  8.197   1.00 32.82 ? 418 HOH A O     1 
HETATM 1239 O  O     . HOH D 4 .   ? 34.929 12.263  -0.290  1.00 29.18 ? 419 HOH A O     1 
HETATM 1240 O  O     . HOH D 4 .   ? 18.096 21.715  -0.058  1.00 32.46 ? 420 HOH A O     1 
HETATM 1241 O  O     . HOH D 4 .   ? 25.205 4.068   24.127  1.00 32.15 ? 421 HOH A O     1 
HETATM 1242 O  O     . HOH D 4 .   ? 27.600 14.558  18.519  1.00 28.10 ? 422 HOH A O     1 
HETATM 1243 O  O     . HOH D 4 .   ? 30.231 16.834  2.832   1.00 28.99 ? 423 HOH A O     1 
HETATM 1244 O  O     . HOH D 4 .   ? 30.920 10.771  9.512   1.00 28.40 ? 424 HOH A O     1 
HETATM 1245 O  O     . HOH D 4 .   ? 27.097 15.282  13.462  1.00 31.55 ? 425 HOH A O     1 
HETATM 1246 O  O     . HOH D 4 .   ? 22.485 15.697  20.801  1.00 29.43 ? 426 HOH A O     1 
HETATM 1247 O  O     . HOH D 4 .   ? 38.491 3.531   10.574  1.00 31.96 ? 427 HOH A O     1 
HETATM 1248 O  O     . HOH D 4 .   ? 30.584 9.461   14.599  1.00 25.61 ? 428 HOH A O     1 
HETATM 1249 O  O     . HOH D 4 .   ? 30.679 8.489   18.856  1.00 31.77 ? 429 HOH A O     1 
HETATM 1250 O  O     . HOH D 4 .   ? 16.715 15.449  -5.371  1.00 32.00 ? 430 HOH A O     1 
HETATM 1251 O  O     . HOH D 4 .   ? 15.018 17.107  3.467   1.00 39.66 ? 431 HOH A O     1 
HETATM 1252 O  O     . HOH D 4 .   ? 18.137 6.639   24.681  1.00 33.54 ? 432 HOH A O     1 
HETATM 1253 O  O     . HOH D 4 .   ? 11.438 8.549   3.895   1.00 33.73 ? 433 HOH A O     1 
HETATM 1254 O  O     . HOH D 4 .   ? 25.540 10.639  -7.200  1.00 29.74 ? 434 HOH A O     1 
HETATM 1255 O  O     . HOH D 4 .   ? 23.893 -1.876  -3.606  1.00 31.30 ? 435 HOH A O     1 
HETATM 1256 O  O     . HOH D 4 .   ? 23.466 6.090   -6.511  1.00 34.83 ? 436 HOH A O     1 
HETATM 1257 O  O     . HOH D 4 .   ? 30.066 7.680   23.394  1.00 30.79 ? 437 HOH A O     1 
HETATM 1258 O  O     . HOH D 4 .   ? 14.649 13.459  7.737   1.00 33.07 ? 438 HOH A O     1 
HETATM 1259 O  O     . HOH D 4 .   ? 27.163 25.373  23.286  1.00 31.93 ? 439 HOH A O     1 
HETATM 1260 O  O     . HOH D 4 .   ? 24.802 18.674  22.371  1.00 38.73 ? 440 HOH A O     1 
HETATM 1261 O  O     . HOH D 4 .   ? 16.279 -0.310  -10.217 1.00 41.59 ? 441 HOH A O     1 
HETATM 1262 O  O     . HOH D 4 .   ? 17.745 -6.326  -8.619  1.00 48.18 ? 442 HOH A O     1 
HETATM 1263 O  O     . HOH D 4 .   ? 15.481 -8.504  -0.520  1.00 38.82 ? 443 HOH A O     1 
HETATM 1264 O  O     . HOH D 4 .   ? 21.707 19.364  -2.098  1.00 36.09 ? 444 HOH A O     1 
HETATM 1265 O  O     . HOH D 4 .   ? 24.178 11.232  8.126   1.00 31.82 ? 445 HOH A O     1 
HETATM 1266 O  O     . HOH D 4 .   ? 18.457 -7.992  -0.736  1.00 36.04 ? 446 HOH A O     1 
HETATM 1267 O  O     . HOH D 4 .   ? 31.544 12.788  17.677  1.00 31.58 ? 447 HOH A O     1 
HETATM 1268 O  O     . HOH D 4 .   ? 14.356 -4.574  12.809  1.00 36.24 ? 448 HOH A O     1 
HETATM 1269 O  O     . HOH D 4 .   ? 37.212 23.098  -1.240  1.00 39.73 ? 449 HOH A O     1 
HETATM 1270 O  O     . HOH D 4 .   ? 9.819  -2.901  7.765   1.00 26.85 ? 450 HOH A O     1 
HETATM 1271 O  O     . HOH D 4 .   ? 17.397 -4.485  -10.979 1.00 45.94 ? 451 HOH A O     1 
HETATM 1272 O  O     . HOH D 4 .   ? 28.417 20.530  -5.527  1.00 29.76 ? 452 HOH A O     1 
HETATM 1273 O  O     . HOH D 4 .   ? 14.272 10.056  24.590  1.00 38.99 ? 453 HOH A O     1 
HETATM 1274 O  O     . HOH D 4 .   ? 9.360  5.969   17.877  1.00 50.20 ? 454 HOH A O     1 
HETATM 1275 O  O     . HOH D 4 .   ? 34.239 -0.526  19.463  1.00 32.16 ? 455 HOH A O     1 
HETATM 1276 O  O     . HOH D 4 .   ? 8.644  5.190   15.723  1.00 43.91 ? 456 HOH A O     1 
HETATM 1277 O  O     . HOH D 4 .   ? 17.872 17.163  -3.473  1.00 34.17 ? 457 HOH A O     1 
HETATM 1278 O  O     . HOH D 4 .   ? 8.071  9.670   10.556  1.00 31.85 ? 458 HOH A O     1 
HETATM 1279 O  O     . HOH D 4 .   ? 11.058 -4.638  5.708   1.00 39.09 ? 459 HOH A O     1 
HETATM 1280 O  O     . HOH D 4 .   ? 37.391 2.122   8.498   1.00 43.45 ? 460 HOH A O     1 
HETATM 1281 O  O     . HOH D 4 .   ? 30.965 12.639  4.655   1.00 43.01 ? 461 HOH A O     1 
HETATM 1282 O  O     . HOH D 4 .   ? 11.572 1.848   15.066  1.00 40.94 ? 462 HOH A O     1 
HETATM 1283 O  O     . HOH D 4 .   ? 8.698  6.841   8.317   1.00 40.63 ? 463 HOH A O     1 
HETATM 1284 O  O     . HOH D 4 .   ? 19.972 13.049  -9.433  1.00 38.01 ? 464 HOH A O     1 
HETATM 1285 O  O     . HOH D 4 .   ? 12.774 7.901   -7.875  1.00 43.77 ? 465 HOH A O     1 
HETATM 1286 O  O     . HOH D 4 .   ? 28.457 13.037  24.535  1.00 29.61 ? 466 HOH A O     1 
HETATM 1287 O  O     . HOH D 4 .   ? 31.870 4.459   -3.685  1.00 45.77 ? 467 HOH A O     1 
HETATM 1288 O  O     . HOH D 4 .   ? 12.870 5.230   19.975  1.00 49.60 ? 468 HOH A O     1 
HETATM 1289 O  O     . HOH D 4 .   ? 26.822 6.162   24.323  1.00 32.98 ? 469 HOH A O     1 
HETATM 1290 O  O     . HOH D 4 .   ? 22.884 13.644  7.771   1.00 44.46 ? 470 HOH A O     1 
HETATM 1291 O  O     . HOH D 4 .   ? 38.006 8.459   0.685   1.00 46.96 ? 471 HOH A O     1 
HETATM 1292 O  O     . HOH D 4 .   ? 36.698 5.273   13.965  1.00 36.03 ? 472 HOH A O     1 
HETATM 1293 O  O     . HOH D 4 .   ? 22.820 15.942  10.230  1.00 33.64 ? 473 HOH A O     1 
HETATM 1294 O  O     . HOH D 4 .   ? 10.269 11.711  -1.979  1.00 43.72 ? 474 HOH A O     1 
HETATM 1295 O  O     . HOH D 4 .   ? 21.991 22.358  -1.185  1.00 38.81 ? 475 HOH A O     1 
HETATM 1296 O  O     . HOH D 4 .   ? 22.941 -1.985  24.664  1.00 38.06 ? 476 HOH A O     1 
HETATM 1297 O  O     . HOH D 4 .   ? 25.403 16.372  10.743  1.00 36.41 ? 477 HOH A O     1 
HETATM 1298 O  O     . HOH D 4 .   ? 17.410 3.713   24.470  1.00 42.63 ? 478 HOH A O     1 
HETATM 1299 O  O     . HOH D 4 .   ? 25.959 3.980   -5.910  1.00 33.76 ? 479 HOH A O     1 
HETATM 1300 O  O     . HOH D 4 .   ? 25.945 19.416  14.797  1.00 38.18 ? 480 HOH A O     1 
HETATM 1301 O  O     . HOH D 4 .   ? 31.667 6.030   18.441  1.00 39.74 ? 481 HOH A O     1 
HETATM 1302 O  O     . HOH D 4 .   ? 29.450 13.253  16.170  1.00 46.42 ? 482 HOH A O     1 
HETATM 1303 O  O     . HOH D 4 .   ? 29.863 5.625   14.033  1.00 34.53 ? 483 HOH A O     1 
HETATM 1304 O  O     . HOH D 4 .   ? 25.025 1.404   -5.642  1.00 45.71 ? 484 HOH A O     1 
HETATM 1305 O  O     . HOH D 4 .   ? 12.558 0.879   17.395  1.00 54.87 ? 485 HOH A O     1 
HETATM 1306 O  O     . HOH D 4 .   ? 14.250 13.309  12.601  1.00 39.01 ? 486 HOH A O     1 
HETATM 1307 O  O     . HOH D 4 .   ? 16.715 23.264  1.741   1.00 44.84 ? 487 HOH A O     1 
HETATM 1308 O  O     . HOH D 4 .   ? 37.926 1.929   6.084   1.00 40.68 ? 488 HOH A O     1 
HETATM 1309 O  O     . HOH D 4 .   ? 20.454 -6.624  -9.578  1.00 50.00 ? 489 HOH A O     1 
HETATM 1310 O  O     . HOH D 4 .   ? 9.998  3.025   4.982   1.00 51.26 ? 490 HOH A O     1 
HETATM 1311 O  O     . HOH D 4 .   ? 36.571 18.311  2.294   1.00 50.77 ? 491 HOH A O     1 
HETATM 1312 O  O     . HOH D 4 .   ? 13.926 12.423  18.300  1.00 45.58 ? 492 HOH A O     1 
HETATM 1313 O  O     . HOH D 4 .   ? 7.412  2.393   -2.804  1.00 50.88 ? 493 HOH A O     1 
HETATM 1314 O  O     . HOH D 4 .   ? 36.118 13.850  6.774   1.00 37.13 ? 494 HOH A O     1 
HETATM 1315 O  O     . HOH D 4 .   ? 8.793  2.590   -6.024  1.00 46.36 ? 495 HOH A O     1 
HETATM 1316 O  O     . HOH D 4 .   ? 8.748  -4.389  13.219  1.00 48.70 ? 496 HOH A O     1 
HETATM 1317 O  O     . HOH D 4 .   ? 8.794  0.225   6.798   1.00 41.18 ? 497 HOH A O     1 
HETATM 1318 O  O     . HOH D 4 .   ? 14.765 14.950  10.672  1.00 39.16 ? 498 HOH A O     1 
HETATM 1319 O  O     . HOH D 4 .   ? 6.915  2.274   10.115  1.00 42.79 ? 499 HOH A O     1 
HETATM 1320 O  O     . HOH D 4 .   ? 39.843 5.119   2.436   1.00 42.59 ? 500 HOH A O     1 
HETATM 1321 O  O     . HOH D 4 .   ? 14.015 15.830  6.324   1.00 45.93 ? 501 HOH A O     1 
HETATM 1322 O  O     . HOH D 4 .   ? 21.806 -10.184 0.998   1.00 37.44 ? 502 HOH A O     1 
HETATM 1323 O  O     . HOH D 4 .   ? 14.616 2.937   11.571  1.00 47.24 ? 503 HOH A O     1 
HETATM 1324 O  O     . HOH D 4 .   ? 42.714 6.323   1.773   1.00 55.52 ? 504 HOH A O     1 
HETATM 1325 O  O     . HOH D 4 .   ? 15.387 18.887  -2.563  1.00 38.71 ? 505 HOH A O     1 
HETATM 1326 O  O     . HOH D 4 .   ? 34.317 12.979  10.722  1.00 43.90 ? 506 HOH A O     1 
HETATM 1327 O  O     . HOH D 4 .   ? 12.835 12.858  10.520  1.00 56.03 ? 507 HOH A O     1 
HETATM 1328 O  O     . HOH D 4 .   ? 34.249 6.454   15.264  1.00 46.25 ? 508 HOH A O     1 
HETATM 1329 O  O     . HOH D 4 .   ? 27.641 29.912  9.159   1.00 45.02 ? 509 HOH A O     1 
HETATM 1330 O  O     . HOH D 4 .   ? 32.115 10.293  17.595  1.00 47.80 ? 510 HOH A O     1 
HETATM 1331 O  O     . HOH D 4 .   ? 37.045 13.090  2.441   1.00 46.64 ? 511 HOH A O     1 
HETATM 1332 O  O     . HOH D 4 .   ? 21.811 15.125  25.775  1.00 50.20 ? 512 HOH A O     1 
HETATM 1333 O  O     . HOH D 4 .   ? 10.130 1.953   13.399  1.00 41.33 ? 513 HOH A O     1 
HETATM 1334 O  O     . HOH D 4 .   ? 41.575 9.983   9.962   1.00 50.52 ? 514 HOH A O     1 
HETATM 1335 O  O     . HOH D 4 .   ? 21.954 6.145   27.417  1.00 41.50 ? 515 HOH A O     1 
HETATM 1336 O  O     . HOH D 4 .   ? 41.430 0.728   15.222  1.00 48.03 ? 516 HOH A O     1 
HETATM 1337 O  O     . HOH D 4 .   ? 10.663 -3.436  -0.882  1.00 44.32 ? 517 HOH A O     1 
HETATM 1338 O  O     . HOH D 4 .   ? 30.083 20.689  17.560  1.00 42.94 ? 518 HOH A O     1 
HETATM 1339 O  O     . HOH D 4 .   ? 8.901  0.155   13.895  1.00 41.70 ? 519 HOH A O     1 
HETATM 1340 O  O     . HOH D 4 .   ? 29.761 12.588  11.191  1.00 54.16 ? 520 HOH A O     1 
HETATM 1341 O  O     . HOH D 4 .   ? 26.970 8.285   -7.211  1.00 46.12 ? 521 HOH A O     1 
HETATM 1342 O  O     . HOH D 4 .   ? 34.104 21.385  -1.706  1.00 45.80 ? 522 HOH A O     1 
HETATM 1343 O  O     . HOH D 4 .   ? 20.307 33.245  1.755   1.00 47.94 ? 523 HOH A O     1 
HETATM 1344 O  O     . HOH D 4 .   ? 15.888 19.919  -0.167  1.00 39.95 ? 524 HOH A O     1 
HETATM 1345 O  O     . HOH D 4 .   ? 29.161 0.821   23.764  1.00 58.74 ? 525 HOH A O     1 
HETATM 1346 O  O     . HOH D 4 .   ? 28.489 -1.348  21.680  1.00 50.03 ? 526 HOH A O     1 
HETATM 1347 O  O     . HOH D 4 .   ? 28.228 16.818  4.247   1.00 43.57 ? 527 HOH A O     1 
HETATM 1348 O  O     . HOH D 4 .   ? 9.718  4.780   6.541   1.00 42.73 ? 528 HOH A O     1 
HETATM 1349 O  O     . HOH D 4 .   ? 30.997 -7.913  6.393   1.00 42.15 ? 529 HOH A O     1 
HETATM 1350 O  O     . HOH D 4 .   ? 22.642 -11.484 11.180  1.00 40.69 ? 530 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   9   9   ARG ARG A . n 
A 1 2   HIS 2   10  10  HIS HIS A . n 
A 1 3   LEU 3   11  11  LEU LEU A . n 
A 1 4   PRO 4   12  12  PRO PRO A . n 
A 1 5   TYR 5   13  13  TYR TYR A . n 
A 1 6   PHE 6   14  14  PHE PHE A . n 
A 1 7   CYS 7   15  15  CYS CYS A . n 
A 1 8   ARG 8   16  16  ARG ARG A . n 
A 1 9   GLY 9   17  17  GLY GLY A . n 
A 1 10  GLN 10  18  18  GLN GLN A . n 
A 1 11  VAL 11  19  19  VAL VAL A . n 
A 1 12  VAL 12  20  20  VAL VAL A . n 
A 1 13  ARG 13  21  21  ARG ARG A . n 
A 1 14  GLY 14  22  22  GLY GLY A . n 
A 1 15  PHE 15  23  23  PHE PHE A . n 
A 1 16  GLY 16  24  24  GLY GLY A . n 
A 1 17  ARG 17  25  25  ARG ARG A . n 
A 1 18  GLY 18  26  26  GLY GLY A . n 
A 1 19  SER 19  27  27  SER SER A . n 
A 1 20  LYS 20  28  28  LYS LYS A . n 
A 1 21  GLN 21  29  29  GLN GLN A . n 
A 1 22  LEU 22  30  30  LEU LEU A . n 
A 1 23  GLY 23  31  31  GLY GLY A . n 
A 1 24  ILE 24  32  32  ILE ILE A . n 
A 1 25  PRO 25  33  33  PRO PRO A . n 
A 1 26  THR 26  34  34  THR THR A . n 
A 1 27  ALA 27  35  35  ALA ALA A . n 
A 1 28  ASN 28  36  36  ASN ASN A . n 
A 1 29  PHE 29  37  37  PHE PHE A . n 
A 1 30  PRO 30  38  38  PRO PRO A . n 
A 1 31  GLU 31  39  39  GLU GLU A . n 
A 1 32  GLN 32  40  40  GLN GLN A . n 
A 1 33  VAL 33  41  41  VAL VAL A . n 
A 1 34  VAL 34  42  42  VAL VAL A . n 
A 1 35  ASP 35  43  43  ASP ASP A . n 
A 1 36  ASN 36  44  44  ASN ASN A . n 
A 1 37  LEU 37  45  45  LEU LEU A . n 
A 1 38  PRO 38  46  46  PRO PRO A . n 
A 1 39  ALA 39  47  47  ALA ALA A . n 
A 1 40  ASP 40  48  48  ASP ASP A . n 
A 1 41  ILE 41  49  49  ILE ILE A . n 
A 1 42  SER 42  50  50  SER SER A . n 
A 1 43  THR 43  51  51  THR THR A . n 
A 1 44  GLY 44  52  52  GLY GLY A . n 
A 1 45  ILE 45  53  53  ILE ILE A . n 
A 1 46  TYR 46  54  54  TYR TYR A . n 
A 1 47  TYR 47  55  55  TYR TYR A . n 
A 1 48  GLY 48  56  56  GLY GLY A . n 
A 1 49  TRP 49  57  57  TRP TRP A . n 
A 1 50  ALA 50  58  58  ALA ALA A . n 
A 1 51  SER 51  59  59  SER SER A . n 
A 1 52  VAL 52  60  60  VAL VAL A . n 
A 1 53  GLY 53  61  61  GLY GLY A . n 
A 1 54  SER 54  62  62  SER SER A . n 
A 1 55  GLY 55  63  63  GLY GLY A . n 
A 1 56  ASP 56  64  64  ASP ASP A . n 
A 1 57  VAL 57  65  65  VAL VAL A . n 
A 1 58  HIS 58  66  66  HIS HIS A . n 
A 1 59  LYS 59  67  67  LYS LYS A . n 
A 1 60  MET 60  68  68  MET MET A . n 
A 1 61  VAL 61  69  69  VAL VAL A . n 
A 1 62  VAL 62  70  70  VAL VAL A . n 
A 1 63  SER 63  71  71  SER SER A . n 
A 1 64  ILE 64  72  72  ILE ILE A . n 
A 1 65  GLY 65  73  73  GLY GLY A . n 
A 1 66  TRP 66  74  74  TRP TRP A . n 
A 1 67  ASN 67  75  75  ASN ASN A . n 
A 1 68  PRO 68  76  76  PRO PRO A . n 
A 1 69  TYR 69  77  77  TYR TYR A . n 
A 1 70  TYR 70  78  78  TYR TYR A . n 
A 1 71  LYS 71  79  79  LYS LYS A . n 
A 1 72  ASN 72  80  80  ASN ASN A . n 
A 1 73  THR 73  81  81  THR THR A . n 
A 1 74  LYS 74  82  82  LYS LYS A . n 
A 1 75  LYS 75  83  83  LYS LYS A . n 
A 1 76  SER 76  84  84  SER SER A . n 
A 1 77  MET 77  85  85  MET MET A . n 
A 1 78  GLU 78  86  86  GLU GLU A . n 
A 1 79  THR 79  87  87  THR THR A . n 
A 1 80  HIS 80  88  88  HIS HIS A . n 
A 1 81  ILE 81  89  89  ILE ILE A . n 
A 1 82  MET 82  90  90  MET MET A . n 
A 1 83  HIS 83  91  91  HIS HIS A . n 
A 1 84  THR 84  92  92  THR THR A . n 
A 1 85  PHE 85  93  93  PHE PHE A . n 
A 1 86  LYS 86  94  94  LYS LYS A . n 
A 1 87  GLU 87  95  95  GLU GLU A . n 
A 1 88  ASP 88  96  96  ASP ASP A . n 
A 1 89  PHE 89  97  97  PHE PHE A . n 
A 1 90  TYR 90  98  98  TYR TYR A . n 
A 1 91  GLY 91  99  99  GLY GLY A . n 
A 1 92  GLU 92  100 100 GLU GLU A . n 
A 1 93  ILE 93  101 101 ILE ILE A . n 
A 1 94  LEU 94  102 102 LEU LEU A . n 
A 1 95  ASN 95  103 103 ASN ASN A . n 
A 1 96  VAL 96  104 104 VAL VAL A . n 
A 1 97  ALA 97  105 105 ALA ALA A . n 
A 1 98  ILE 98  106 106 ILE ILE A . n 
A 1 99  VAL 99  107 107 VAL VAL A . n 
A 1 100 GLY 100 108 108 GLY GLY A . n 
A 1 101 TYR 101 109 109 TYR TYR A . n 
A 1 102 LEU 102 110 110 LEU LEU A . n 
A 1 103 ARG 103 111 111 ARG ARG A . n 
A 1 104 PRO 104 112 112 PRO PRO A . n 
A 1 105 GLU 105 113 113 GLU GLU A . n 
A 1 106 LYS 106 114 114 LYS LYS A . n 
A 1 107 ASN 107 115 115 ASN ASN A . n 
A 1 108 PHE 108 116 116 PHE PHE A . n 
A 1 109 ASP 109 117 117 ASP ASP A . n 
A 1 110 SER 110 118 118 SER SER A . n 
A 1 111 LEU 111 119 119 LEU LEU A . n 
A 1 112 GLU 112 120 120 GLU GLU A . n 
A 1 113 SER 113 121 121 SER SER A . n 
A 1 114 LEU 114 122 122 LEU LEU A . n 
A 1 115 ILE 115 123 123 ILE ILE A . n 
A 1 116 SER 116 124 124 SER SER A . n 
A 1 117 ALA 117 125 125 ALA ALA A . n 
A 1 118 ILE 118 126 126 ILE ILE A . n 
A 1 119 GLN 119 127 127 GLN GLN A . n 
A 1 120 GLY 120 128 128 GLY GLY A . n 
A 1 121 ASP 121 129 129 ASP ASP A . n 
A 1 122 ILE 122 130 130 ILE ILE A . n 
A 1 123 GLU 123 131 131 GLU GLU A . n 
A 1 124 GLU 124 132 132 GLU GLU A . n 
A 1 125 ALA 125 133 133 ALA ALA A . n 
A 1 126 LYS 126 134 134 LYS LYS A . n 
A 1 127 LYS 127 135 135 LYS LYS A . n 
A 1 128 ARG 128 136 136 ARG ARG A . n 
A 1 129 LEU 129 137 137 LEU LEU A . n 
A 1 130 GLU 130 138 138 GLU GLU A . n 
A 1 131 LEU 131 139 139 LEU LEU A . n 
A 1 132 PRO 132 140 140 PRO PRO A . n 
A 1 133 GLU 133 141 141 GLU GLU A . n 
A 1 134 TYR 134 142 142 TYR TYR A . n 
A 1 135 LEU 135 143 143 LEU LEU A . n 
A 1 136 LYS 136 144 144 LYS LYS A . n 
A 1 137 ILE 137 145 145 ILE ILE A . n 
A 1 138 LYS 138 146 146 LYS LYS A . n 
A 1 139 GLU 139 147 147 GLU GLU A . n 
A 1 140 ASP 140 148 148 ASP ASP A . n 
A 1 141 ASN 141 149 149 ASN ASN A . n 
A 1 142 PHE 142 150 150 PHE PHE A . n 
A 1 143 PHE 143 151 151 PHE PHE A . n 
A 1 144 GLN 144 152 152 GLN GLN A . n 
A 1 145 VAL 145 153 153 VAL VAL A . n 
A 1 146 SER 146 154 154 SER SER A . n 
A 1 147 LYS 147 155 155 LYS LYS A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A THR 26 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 402 ? 1_555 91.0  ? 
2  O   ? A THR 26 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O1B ? C ADP .  ? A ADP 301 ? 1_555 96.2  ? 
3  O   ? D HOH .  ? A HOH 402 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O1B ? C ADP .  ? A ADP 301 ? 1_555 92.3  ? 
4  O   ? A THR 26 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OG1 ? A THR 26 ? A THR 34  ? 1_555 86.9  ? 
5  O   ? D HOH .  ? A HOH 402 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OG1 ? A THR 26 ? A THR 34  ? 1_555 87.8  ? 
6  O1B ? C ADP .  ? A ADP 301 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OG1 ? A THR 26 ? A THR 34  ? 1_555 176.9 ? 
7  O   ? A THR 26 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 408 ? 1_555 171.8 ? 
8  O   ? D HOH .  ? A HOH 402 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 408 ? 1_555 90.1  ? 
9  O1B ? C ADP .  ? A ADP 301 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 408 ? 1_555 91.9  ? 
10 OG1 ? A THR 26 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? D HOH .  ? A HOH 408 ? 1_555 85.1  ? 
11 O   ? A THR 26 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C ADP .  ? A ADP 301 ? 1_555 89.9  ? 
12 O   ? D HOH .  ? A HOH 402 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C ADP .  ? A ADP 301 ? 1_555 175.2 ? 
13 O1B ? C ADP .  ? A ADP 301 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C ADP .  ? A ADP 301 ? 1_555 92.2  ? 
14 OG1 ? A THR 26 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C ADP .  ? A ADP 301 ? 1_555 87.6  ? 
15 O   ? D HOH .  ? A HOH 408 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C ADP .  ? A ADP 301 ? 1_555 88.3  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-03-11 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         23.9860 
_pdbx_refine_tls.origin_y         6.4160 
_pdbx_refine_tls.origin_z         7.8820 
_pdbx_refine_tls.T[1][1]          0.1375 
_pdbx_refine_tls.T[2][2]          0.1355 
_pdbx_refine_tls.T[3][3]          0.0809 
_pdbx_refine_tls.T[1][2]          0.0356 
_pdbx_refine_tls.T[1][3]          -0.0212 
_pdbx_refine_tls.T[2][3]          -0.0139 
_pdbx_refine_tls.L[1][1]          0.7481 
_pdbx_refine_tls.L[2][2]          2.3148 
_pdbx_refine_tls.L[3][3]          1.7423 
_pdbx_refine_tls.L[1][2]          -0.3628 
_pdbx_refine_tls.L[1][3]          0.1217 
_pdbx_refine_tls.L[2][3]          -0.6373 
_pdbx_refine_tls.S[1][1]          0.0557 
_pdbx_refine_tls.S[1][2]          0.0404 
_pdbx_refine_tls.S[1][3]          0.0264 
_pdbx_refine_tls.S[2][1]          -0.0512 
_pdbx_refine_tls.S[2][2]          -0.0192 
_pdbx_refine_tls.S[2][3]          0.0046 
_pdbx_refine_tls.S[3][1]          0.0593 
_pdbx_refine_tls.S[3][2]          0.0646 
_pdbx_refine_tls.S[3][3]          -0.0365 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_label_asym_id   A 
_pdbx_refine_tls_group.beg_label_seq_id    1 
_pdbx_refine_tls_group.beg_auth_seq_id     9 
_pdbx_refine_tls_group.end_label_asym_id   A 
_pdbx_refine_tls_group.end_label_seq_id    147 
_pdbx_refine_tls_group.end_auth_seq_id     155 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .      ? 1 
SCALEPACK 'data scaling'    .      ? 2 
SOLVE     phasing           .      ? 3 
REFMAC    refinement        5.1.27 ? 4 
HKL-2000  'data reduction'  .      ? 5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              148 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              148 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             OD2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              148 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.99 
_pdbx_validate_rmsd_angle.angle_target_value         118.30 
_pdbx_validate_rmsd_angle.angle_deviation            5.69 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.90 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASN 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     80 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             67.08 
_pdbx_validate_torsion.psi             175.34 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 9 ? CB  ? A ARG 1 CB  
2 1 Y 1 A ARG 9 ? CG  ? A ARG 1 CG  
3 1 Y 1 A ARG 9 ? CD  ? A ARG 1 CD  
4 1 Y 1 A ARG 9 ? NE  ? A ARG 1 NE  
5 1 Y 1 A ARG 9 ? CZ  ? A ARG 1 CZ  
6 1 Y 1 A ARG 9 ? NH1 ? A ARG 1 NH1 
7 1 Y 1 A ARG 9 ? NH2 ? A ARG 1 NH2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'            MG  
3 "ADENOSINE-5'-DIPHOSPHATE" ADP 
4 water                      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   201 301 MG  MG  A . 
C 3 ADP 1   301 201 ADP ADP A . 
D 4 HOH 1   401 401 HOH HOH A . 
D 4 HOH 2   402 402 HOH HOH A . 
D 4 HOH 3   403 403 HOH HOH A . 
D 4 HOH 4   404 404 HOH HOH A . 
D 4 HOH 5   405 405 HOH HOH A . 
D 4 HOH 6   406 406 HOH HOH A . 
D 4 HOH 7   407 407 HOH HOH A . 
D 4 HOH 8   408 408 HOH HOH A . 
D 4 HOH 9   409 409 HOH HOH A . 
D 4 HOH 10  410 410 HOH HOH A . 
D 4 HOH 11  411 411 HOH HOH A . 
D 4 HOH 12  412 412 HOH HOH A . 
D 4 HOH 13  413 413 HOH HOH A . 
D 4 HOH 14  414 414 HOH HOH A . 
D 4 HOH 15  415 415 HOH HOH A . 
D 4 HOH 16  416 416 HOH HOH A . 
D 4 HOH 17  417 417 HOH HOH A . 
D 4 HOH 18  418 418 HOH HOH A . 
D 4 HOH 19  419 419 HOH HOH A . 
D 4 HOH 20  420 420 HOH HOH A . 
D 4 HOH 21  421 421 HOH HOH A . 
D 4 HOH 22  422 422 HOH HOH A . 
D 4 HOH 23  423 423 HOH HOH A . 
D 4 HOH 24  424 424 HOH HOH A . 
D 4 HOH 25  425 425 HOH HOH A . 
D 4 HOH 26  426 426 HOH HOH A . 
D 4 HOH 27  427 427 HOH HOH A . 
D 4 HOH 28  428 428 HOH HOH A . 
D 4 HOH 29  429 429 HOH HOH A . 
D 4 HOH 30  430 430 HOH HOH A . 
D 4 HOH 31  431 431 HOH HOH A . 
D 4 HOH 32  432 432 HOH HOH A . 
D 4 HOH 33  433 433 HOH HOH A . 
D 4 HOH 34  434 434 HOH HOH A . 
D 4 HOH 35  435 435 HOH HOH A . 
D 4 HOH 36  436 436 HOH HOH A . 
D 4 HOH 37  437 437 HOH HOH A . 
D 4 HOH 38  438 438 HOH HOH A . 
D 4 HOH 39  439 439 HOH HOH A . 
D 4 HOH 40  440 440 HOH HOH A . 
D 4 HOH 41  441 441 HOH HOH A . 
D 4 HOH 42  442 442 HOH HOH A . 
D 4 HOH 43  443 443 HOH HOH A . 
D 4 HOH 44  444 444 HOH HOH A . 
D 4 HOH 45  445 445 HOH HOH A . 
D 4 HOH 46  446 446 HOH HOH A . 
D 4 HOH 47  447 447 HOH HOH A . 
D 4 HOH 48  448 448 HOH HOH A . 
D 4 HOH 49  449 449 HOH HOH A . 
D 4 HOH 50  450 450 HOH HOH A . 
D 4 HOH 51  451 451 HOH HOH A . 
D 4 HOH 52  452 452 HOH HOH A . 
D 4 HOH 53  453 453 HOH HOH A . 
D 4 HOH 54  454 454 HOH HOH A . 
D 4 HOH 55  455 455 HOH HOH A . 
D 4 HOH 56  456 456 HOH HOH A . 
D 4 HOH 57  457 457 HOH HOH A . 
D 4 HOH 58  458 458 HOH HOH A . 
D 4 HOH 59  459 459 HOH HOH A . 
D 4 HOH 60  460 460 HOH HOH A . 
D 4 HOH 61  461 461 HOH HOH A . 
D 4 HOH 62  462 462 HOH HOH A . 
D 4 HOH 63  463 463 HOH HOH A . 
D 4 HOH 64  464 464 HOH HOH A . 
D 4 HOH 65  465 465 HOH HOH A . 
D 4 HOH 66  466 466 HOH HOH A . 
D 4 HOH 67  467 467 HOH HOH A . 
D 4 HOH 68  468 468 HOH HOH A . 
D 4 HOH 69  469 469 HOH HOH A . 
D 4 HOH 70  470 470 HOH HOH A . 
D 4 HOH 71  471 471 HOH HOH A . 
D 4 HOH 72  472 472 HOH HOH A . 
D 4 HOH 73  473 473 HOH HOH A . 
D 4 HOH 74  474 474 HOH HOH A . 
D 4 HOH 75  475 475 HOH HOH A . 
D 4 HOH 76  476 476 HOH HOH A . 
D 4 HOH 77  477 477 HOH HOH A . 
D 4 HOH 78  478 478 HOH HOH A . 
D 4 HOH 79  479 479 HOH HOH A . 
D 4 HOH 80  480 480 HOH HOH A . 
D 4 HOH 81  481 481 HOH HOH A . 
D 4 HOH 82  482 482 HOH HOH A . 
D 4 HOH 83  483 483 HOH HOH A . 
D 4 HOH 84  484 484 HOH HOH A . 
D 4 HOH 85  485 485 HOH HOH A . 
D 4 HOH 86  486 486 HOH HOH A . 
D 4 HOH 87  487 487 HOH HOH A . 
D 4 HOH 88  488 488 HOH HOH A . 
D 4 HOH 89  489 489 HOH HOH A . 
D 4 HOH 90  490 490 HOH HOH A . 
D 4 HOH 91  491 491 HOH HOH A . 
D 4 HOH 92  492 492 HOH HOH A . 
D 4 HOH 93  493 493 HOH HOH A . 
D 4 HOH 94  494 494 HOH HOH A . 
D 4 HOH 95  495 495 HOH HOH A . 
D 4 HOH 96  496 496 HOH HOH A . 
D 4 HOH 97  497 497 HOH HOH A . 
D 4 HOH 98  498 498 HOH HOH A . 
D 4 HOH 99  499 499 HOH HOH A . 
D 4 HOH 100 500 500 HOH HOH A . 
D 4 HOH 101 501 501 HOH HOH A . 
D 4 HOH 102 502 502 HOH HOH A . 
D 4 HOH 103 503 503 HOH HOH A . 
D 4 HOH 104 504 504 HOH HOH A . 
D 4 HOH 105 505 505 HOH HOH A . 
D 4 HOH 106 506 506 HOH HOH A . 
D 4 HOH 107 507 507 HOH HOH A . 
D 4 HOH 108 508 508 HOH HOH A . 
D 4 HOH 109 509 509 HOH HOH A . 
D 4 HOH 110 510 510 HOH HOH A . 
D 4 HOH 111 511 511 HOH HOH A . 
D 4 HOH 112 512 512 HOH HOH A . 
D 4 HOH 113 513 513 HOH HOH A . 
D 4 HOH 114 514 514 HOH HOH A . 
D 4 HOH 115 515 515 HOH HOH A . 
D 4 HOH 116 516 516 HOH HOH A . 
D 4 HOH 117 517 517 HOH HOH A . 
D 4 HOH 118 518 518 HOH HOH A . 
D 4 HOH 119 519 519 HOH HOH A . 
D 4 HOH 120 520 520 HOH HOH A . 
D 4 HOH 121 521 521 HOH HOH A . 
D 4 HOH 122 522 522 HOH HOH A . 
D 4 HOH 123 523 523 HOH HOH A . 
D 4 HOH 124 524 524 HOH HOH A . 
D 4 HOH 125 525 525 HOH HOH A . 
D 4 HOH 126 526 526 HOH HOH A . 
D 4 HOH 127 527 527 HOH HOH A . 
D 4 HOH 128 528 528 HOH HOH A . 
D 4 HOH 129 529 529 HOH HOH A . 
D 4 HOH 130 530 530 HOH HOH A . 
#