data_1NB9
# 
_entry.id   1NB9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1NB9         
RCSB  RCSB017737   
WWPDB D_1000017737 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1NB0 . unspecified 
PDB 1nbg . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NB9 
_pdbx_database_status.recvd_initial_deposition_date   2002-12-02 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Karthikeyan, S.' 1 
'Zhou, Q.'        2 
'Mseeh, F.'       3 
'Grishin, N.V.'   4 
'Osterman, A.L.'  5 
'Zhang, H.'       6 
# 
_citation.id                        primary 
_citation.title                     
'Crystal Structure of Human Riboflavin Kinase Reveals a Beta Barrel Fold and a Novel Active Site Arch' 
_citation.journal_abbrev            Structure 
_citation.journal_volume            11 
_citation.page_first                265 
_citation.page_last                 273 
_citation.year                      2003 
_citation.journal_id_ASTM           STRUE6 
_citation.country                   UK 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_id_CSD            2005 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12623014 
_citation.pdbx_database_id_DOI      '10.1016/S0969-2126(03)00024-8' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Karthikeyan, S.' 1 
primary 'Zhou, Q.'        2 
primary 'Mseeh, F.'       3 
primary 'Grishin, N.V.'   4 
primary 'Osterman, A.L.'  5 
primary 'Zhang, H.'       6 
# 
_cell.entry_id           1NB9 
_cell.length_a           56.957 
_cell.length_b           56.957 
_cell.length_c           82.501 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1NB9 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'hypothetical protein FLJ11149' 16772.084 1   2.7.1.26 ? ? ? 
2 non-polymer syn 'MAGNESIUM ION'                 24.305    1   ?        ? ? ? 
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"      427.201   1   ?        ? ? ? 
4 non-polymer syn RIBOFLAVIN                      376.364   1   ?        ? ? ? 
5 water       nat water                           18.015    118 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Riboflavin kinase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;RHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPYYKNTKKSMETH
IMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEYLKIKEDNFFQVSK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;RHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPYYKNTKKSMETH
IMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEYLKIKEDNFFQVSK
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ARG n 
1 2   HIS n 
1 3   LEU n 
1 4   PRO n 
1 5   TYR n 
1 6   PHE n 
1 7   CYS n 
1 8   ARG n 
1 9   GLY n 
1 10  GLN n 
1 11  VAL n 
1 12  VAL n 
1 13  ARG n 
1 14  GLY n 
1 15  PHE n 
1 16  GLY n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  LYS n 
1 21  GLN n 
1 22  LEU n 
1 23  GLY n 
1 24  ILE n 
1 25  PRO n 
1 26  THR n 
1 27  ALA n 
1 28  ASN n 
1 29  PHE n 
1 30  PRO n 
1 31  GLU n 
1 32  GLN n 
1 33  VAL n 
1 34  VAL n 
1 35  ASP n 
1 36  ASN n 
1 37  LEU n 
1 38  PRO n 
1 39  ALA n 
1 40  ASP n 
1 41  ILE n 
1 42  SER n 
1 43  THR n 
1 44  GLY n 
1 45  ILE n 
1 46  TYR n 
1 47  TYR n 
1 48  GLY n 
1 49  TRP n 
1 50  ALA n 
1 51  SER n 
1 52  VAL n 
1 53  GLY n 
1 54  SER n 
1 55  GLY n 
1 56  ASP n 
1 57  VAL n 
1 58  HIS n 
1 59  LYS n 
1 60  MET n 
1 61  VAL n 
1 62  VAL n 
1 63  SER n 
1 64  ILE n 
1 65  GLY n 
1 66  TRP n 
1 67  ASN n 
1 68  PRO n 
1 69  TYR n 
1 70  TYR n 
1 71  LYS n 
1 72  ASN n 
1 73  THR n 
1 74  LYS n 
1 75  LYS n 
1 76  SER n 
1 77  MET n 
1 78  GLU n 
1 79  THR n 
1 80  HIS n 
1 81  ILE n 
1 82  MET n 
1 83  HIS n 
1 84  THR n 
1 85  PHE n 
1 86  LYS n 
1 87  GLU n 
1 88  ASP n 
1 89  PHE n 
1 90  TYR n 
1 91  GLY n 
1 92  GLU n 
1 93  ILE n 
1 94  LEU n 
1 95  ASN n 
1 96  VAL n 
1 97  ALA n 
1 98  ILE n 
1 99  VAL n 
1 100 GLY n 
1 101 TYR n 
1 102 LEU n 
1 103 ARG n 
1 104 PRO n 
1 105 GLU n 
1 106 LYS n 
1 107 ASN n 
1 108 PHE n 
1 109 ASP n 
1 110 SER n 
1 111 LEU n 
1 112 GLU n 
1 113 SER n 
1 114 LEU n 
1 115 ILE n 
1 116 SER n 
1 117 ALA n 
1 118 ILE n 
1 119 GLN n 
1 120 GLY n 
1 121 ASP n 
1 122 ILE n 
1 123 GLU n 
1 124 GLU n 
1 125 ALA n 
1 126 LYS n 
1 127 LYS n 
1 128 ARG n 
1 129 LEU n 
1 130 GLU n 
1 131 LEU n 
1 132 PRO n 
1 133 GLU n 
1 134 TYR n 
1 135 LEU n 
1 136 LYS n 
1 137 ILE n 
1 138 LYS n 
1 139 GLU n 
1 140 ASP n 
1 141 ASN n 
1 142 PHE n 
1 143 PHE n 
1 144 GLN n 
1 145 VAL n 
1 146 SER n 
1 147 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 FLJ11149 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pPROEX-Hta 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RIFK_HUMAN 
_struct_ref.pdbx_db_accession          Q969G6 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RHLPYFCRGQVVRGFGRGSKQLGIPTANFPEQVVDNLPADISTGIYYGWASVGSGDVHKMVVSIGWNPYYKNTKKSMETH
IMHTFKEDFYGEILNVAIVGYLRPEKNFDSLESLISAIQGDIEEAKKRLELPEHLKIKEDNFFQVSK
;
_struct_ref.pdbx_align_begin           9 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1NB9 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 147 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q969G6 
_struct_ref_seq.db_align_beg                  9 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  155 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       9 
_struct_ref_seq.pdbx_auth_seq_align_end       155 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1NB9 
_struct_ref_seq_dif.mon_id                       TYR 
_struct_ref_seq_dif.pdbx_pdb_strand_id           A 
_struct_ref_seq_dif.seq_num                      134 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q969G6 
_struct_ref_seq_dif.db_mon_id                    HIS 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          142 
_struct_ref_seq_dif.details                      CONFLICT 
_struct_ref_seq_dif.pdbx_auth_seq_num            142 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ?                         'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ?                         'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ?                         'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ?                         'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ?                         'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ?                         'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ?                         'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ?                         'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ?                         'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ?                         'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ?                         'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ?                         'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ?                         'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ?                         'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ?                         'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ?                         'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ?                         'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ?                         'C5 H9 N O2'        115.130 
RBF non-polymer         . RIBOFLAVIN                 'RIBOFLAVINE; VITAMIN B2' 'C17 H20 N4 O6'     376.364 
SER 'L-peptide linking' y SERINE                     ?                         'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                  ?                         'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ?                         'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ?                         'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ?                         'C5 H11 N O2'       117.146 
# 
_exptl.entry_id          1NB9 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.01 
_exptl_crystal.density_percent_sol   38.18 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    'Na cadodalyte, Mg acetate, PEG 8000, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'RIGAKU RAXIS IV' 
_diffrn_detector.pdbx_collection_date   2002-09-05 
_diffrn_detector.details                'OSMIC MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    MIRRORS 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
# 
_reflns.entry_id                     1NB9 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   1.0 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            1.7 
_reflns.number_obs                   17163 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.03 
_reflns.pdbx_netI_over_sigmaI        42.2 
_reflns.B_iso_Wilson_estimate        26.838 
_reflns.pdbx_redundancy              7.2 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_all   90.3 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.263 
_reflns_shell.meanI_over_sigI_obs    5.1 
_reflns_shell.pdbx_redundancy        3.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1557 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1NB9 
_refine.ls_number_reflns_obs                     16284 
_refine.ls_number_reflns_all                     17150 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             49.39 
_refine.ls_d_res_high                            1.70 
_refine.ls_percent_reflns_obs                    97.64 
_refine.ls_R_factor_obs                          0.18476 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.18362 
_refine.ls_R_factor_R_free                       0.20573 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  866 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.961 
_refine.correlation_coeff_Fo_to_Fc_free          0.959 
_refine.B_iso_mean                               20.827 
_refine.aniso_B[1][1]                            0.29 
_refine.aniso_B[2][2]                            0.29 
_refine.aniso_B[3][3]                            -0.44 
_refine.aniso_B[1][2]                            0.15 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1NB0' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ISOTROPIC 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R_Free                  0.104 
_refine.overall_SU_B                             2.024 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.114 
_refine.overall_SU_ML                            0.068 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1177 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         55 
_refine_hist.number_atoms_solvent             118 
_refine_hist.number_atoms_total               1350 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        49.39 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.016 0.022 ? 1291 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.725 2.003 ? 1751 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.097 5.000 ? 146  'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.117 0.200 ? 183  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.009 0.020 ? 964  'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.214 0.200 ? 544  'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.153 0.200 ? 113  'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.195 0.200 ? 47   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.168 0.200 ? 12   'X-RAY DIFFRACTION' ? 
r_mcbond_it              1.002 1.500 ? 732  'X-RAY DIFFRACTION' ? 
r_mcangle_it             1.799 2.000 ? 1188 'X-RAY DIFFRACTION' ? 
r_scbond_it              2.536 3.000 ? 559  'X-RAY DIFFRACTION' ? 
r_scangle_it             4.104 4.500 ? 563  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.700 
_refine_ls_shell.d_res_low                        1.744 
_refine_ls_shell.number_reflns_R_work             1067 
_refine_ls_shell.R_factor_R_work                  0.301 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.319 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             59 
_refine_ls_shell.number_reflns_obs                1067 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  1NB9 
_struct.title                     'Crystal Structure of Riboflavin Kinase' 
_struct.pdbx_descriptor           'hypothetical protein FLJ11149 (E.C.2.7.1.26)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NB9 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'TRANSFERASE, BETA BARREL, RIBOFLAVIN, RIBOFLAVIN KINASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 18  ? GLY A 23  ? GLY A 26  GLY A 31  5 ? 6  
HELX_P HELX_P2 2 PRO A 30  ? ASN A 36  ? PRO A 38  ASN A 44  1 ? 7  
HELX_P HELX_P3 3 SER A 110 ? LEU A 129 ? SER A 118 LEU A 137 1 ? 20 
HELX_P HELX_P4 4 LEU A 131 ? LYS A 136 ? LEU A 139 LYS A 144 1 ? 6  
HELX_P HELX_P5 5 ILE A 137 ? GLU A 139 ? ILE A 145 GLU A 147 5 ? 3  
HELX_P HELX_P6 6 ASP A 140 ? VAL A 145 ? ASP A 148 VAL A 153 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? B MG . MG ? ? ? 1_555 A THR 26 O   ? ? A MG 201 A THR 34  1_555 ? ? ? ? ? ? ? 2.160 ? 
metalc2 metalc ? ? B MG . MG ? ? ? 1_555 C ADP .  O1B ? ? A MG 201 A ADP 301 1_555 ? ? ? ? ? ? ? 2.055 ? 
metalc3 metalc ? ? B MG . MG ? ? ? 1_555 E HOH .  O   ? ? A MG 201 A HOH 502 1_555 ? ? ? ? ? ? ? 2.111 ? 
metalc4 metalc ? ? B MG . MG ? ? ? 1_555 C ADP .  O2A ? ? A MG 201 A ADP 301 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc5 metalc ? ? B MG . MG ? ? ? 1_555 A THR 26 OG1 ? ? A MG 201 A THR 34  1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc6 metalc ? ? B MG . MG ? ? ? 1_555 E HOH .  O   ? ? A MG 201 A HOH 568 1_555 ? ? ? ? ? ? ? 2.079 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          LEU 
_struct_mon_prot_cis.label_seq_id           3 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           LEU 
_struct_mon_prot_cis.auth_seq_id            11 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    4 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     12 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.38 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   6 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 5  ? GLN A 10  ? TYR A 13  GLN A 18  
A 2 ILE A 93 ? ARG A 103 ? ILE A 101 ARG A 111 
A 3 GLY A 44 ? VAL A 52  ? GLY A 52  VAL A 60  
A 4 HIS A 58 ? TRP A 66  ? HIS A 66  TRP A 74  
A 5 LYS A 75 ? ILE A 81  ? LYS A 83  ILE A 89  
A 6 ALA A 27 ? ASN A 28  ? ALA A 35  ASN A 36  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N CYS A 7   ? N CYS A 15  O VAL A 96 ? O VAL A 104 
A 2 3 O LEU A 102 ? O LEU A 110 N ILE A 45 ? N ILE A 53  
A 3 4 N GLY A 44  ? N GLY A 52  O ILE A 64 ? O ILE A 72  
A 4 5 N SER A 63  ? N SER A 71  O GLU A 78 ? O GLU A 86  
A 5 6 O THR A 79  ? O THR A 87  N ALA A 27 ? N ALA A 35  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE MG A 201'  
AC2 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE ADP A 301' 
AC3 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE RBF A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  THR A 26  ? THR A 34  . ? 1_555 ? 
2  AC1 4  ADP C .   ? ADP A 301 . ? 1_555 ? 
3  AC1 4  HOH E .   ? HOH A 502 . ? 1_555 ? 
4  AC1 4  HOH E .   ? HOH A 568 . ? 1_555 ? 
5  AC2 24 VAL A 11  ? VAL A 19  . ? 1_555 ? 
6  AC2 24 ARG A 13  ? ARG A 21  . ? 1_555 ? 
7  AC2 24 GLY A 14  ? GLY A 22  . ? 1_555 ? 
8  AC2 24 GLY A 18  ? GLY A 26  . ? 1_555 ? 
9  AC2 24 SER A 19  ? SER A 27  . ? 1_555 ? 
10 AC2 24 LYS A 20  ? LYS A 28  . ? 1_555 ? 
11 AC2 24 PRO A 25  ? PRO A 33  . ? 1_555 ? 
12 AC2 24 THR A 26  ? THR A 34  . ? 1_555 ? 
13 AC2 24 ASN A 28  ? ASN A 36  . ? 1_555 ? 
14 AC2 24 THR A 79  ? THR A 87  . ? 1_555 ? 
15 AC2 24 ILE A 81  ? ILE A 89  . ? 1_555 ? 
16 AC2 24 HIS A 83  ? HIS A 91  . ? 1_555 ? 
17 AC2 24 PHE A 85  ? PHE A 93  . ? 1_555 ? 
18 AC2 24 ASP A 88  ? ASP A 96  . ? 1_555 ? 
19 AC2 24 PHE A 89  ? PHE A 97  . ? 1_555 ? 
20 AC2 24 TYR A 90  ? TYR A 98  . ? 1_555 ? 
21 AC2 24 MG  B .   ? MG  A 201 . ? 1_555 ? 
22 AC2 24 HOH E .   ? HOH A 501 . ? 1_555 ? 
23 AC2 24 HOH E .   ? HOH A 502 . ? 1_555 ? 
24 AC2 24 HOH E .   ? HOH A 508 . ? 1_555 ? 
25 AC2 24 HOH E .   ? HOH A 509 . ? 1_555 ? 
26 AC2 24 HOH E .   ? HOH A 518 . ? 1_555 ? 
27 AC2 24 HOH E .   ? HOH A 523 . ? 3_564 ? 
28 AC2 24 HOH E .   ? HOH A 568 . ? 1_555 ? 
29 AC3 11 THR A 26  ? THR A 34  . ? 1_555 ? 
30 AC3 11 ILE A 45  ? ILE A 53  . ? 1_555 ? 
31 AC3 11 VAL A 61  ? VAL A 69  . ? 1_555 ? 
32 AC3 11 GLU A 78  ? GLU A 86  . ? 1_555 ? 
33 AC3 11 ARG A 103 ? ARG A 111 . ? 1_555 ? 
34 AC3 11 LYS A 106 ? LYS A 114 . ? 1_555 ? 
35 AC3 11 PHE A 108 ? PHE A 116 . ? 1_555 ? 
36 AC3 11 LEU A 114 ? LEU A 122 . ? 1_555 ? 
37 AC3 11 ASP A 121 ? ASP A 129 . ? 1_555 ? 
38 AC3 11 HOH E .   ? HOH A 548 . ? 1_555 ? 
39 AC3 11 HOH E .   ? HOH A 568 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1NB9 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1NB9 
_atom_sites.fract_transf_matrix[1][1]   0.017557 
_atom_sites.fract_transf_matrix[1][2]   0.010137 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.020273 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012121 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1 1   ? -16.890 27.086 46.374 1.00 31.35 ? 9   ARG A N     1 
ATOM   2    C  CA    . ARG A 1 1   ? -18.385 26.959 46.272 1.00 31.24 ? 9   ARG A CA    1 
ATOM   3    C  C     . ARG A 1 1   ? -18.828 25.996 45.169 1.00 30.91 ? 9   ARG A C     1 
ATOM   4    O  O     . ARG A 1 1   ? -19.614 25.066 45.401 1.00 31.68 ? 9   ARG A O     1 
ATOM   5    N  N     . HIS A 1 2   ? -18.349 26.231 43.954 1.00 29.31 ? 10  HIS A N     1 
ATOM   6    C  CA    . HIS A 1 2   ? -18.764 25.396 42.835 1.00 28.29 ? 10  HIS A CA    1 
ATOM   7    C  C     . HIS A 1 2   ? -17.656 24.424 42.439 1.00 26.47 ? 10  HIS A C     1 
ATOM   8    O  O     . HIS A 1 2   ? -17.570 24.051 41.275 1.00 26.91 ? 10  HIS A O     1 
ATOM   9    C  CB    . HIS A 1 2   ? -19.210 26.237 41.617 1.00 28.54 ? 10  HIS A CB    1 
ATOM   10   C  CG    . HIS A 1 2   ? -20.640 26.694 41.684 1.00 30.09 ? 10  HIS A CG    1 
ATOM   11   N  ND1   . HIS A 1 2   ? -21.006 27.916 42.208 1.00 32.18 ? 10  HIS A ND1   1 
ATOM   12   C  CD2   . HIS A 1 2   ? -21.790 26.093 41.291 1.00 30.59 ? 10  HIS A CD2   1 
ATOM   13   C  CE1   . HIS A 1 2   ? -22.319 28.051 42.133 1.00 32.22 ? 10  HIS A CE1   1 
ATOM   14   N  NE2   . HIS A 1 2   ? -22.820 26.956 41.586 1.00 32.96 ? 10  HIS A NE2   1 
ATOM   15   N  N     . LEU A 1 3   ? -16.813 24.025 43.403 1.00 24.89 ? 11  LEU A N     1 
ATOM   16   C  CA    . LEU A 1 3   ? -15.860 22.928 43.161 1.00 22.21 ? 11  LEU A CA    1 
ATOM   17   C  C     . LEU A 1 3   ? -16.337 21.603 43.784 1.00 22.20 ? 11  LEU A C     1 
ATOM   18   O  O     . LEU A 1 3   ? -16.910 21.636 44.888 1.00 22.08 ? 11  LEU A O     1 
ATOM   19   C  CB    . LEU A 1 3   ? -14.465 23.309 43.675 1.00 22.72 ? 11  LEU A CB    1 
ATOM   20   C  CG    . LEU A 1 3   ? -13.866 24.594 43.086 1.00 22.07 ? 11  LEU A CG    1 
ATOM   21   C  CD1   . LEU A 1 3   ? -12.408 24.698 43.532 1.00 24.62 ? 11  LEU A CD1   1 
ATOM   22   C  CD2   . LEU A 1 3   ? -13.959 24.684 41.539 1.00 22.63 ? 11  LEU A CD2   1 
ATOM   23   N  N     . PRO A 1 4   ? -16.119 20.452 43.117 1.00 20.04 ? 12  PRO A N     1 
ATOM   24   C  CA    . PRO A 1 4   ? -15.454 20.356 41.808 1.00 18.26 ? 12  PRO A CA    1 
ATOM   25   C  C     . PRO A 1 4   ? -16.312 20.800 40.646 1.00 17.03 ? 12  PRO A C     1 
ATOM   26   O  O     . PRO A 1 4   ? -17.546 20.563 40.620 1.00 16.39 ? 12  PRO A O     1 
ATOM   27   C  CB    . PRO A 1 4   ? -15.179 18.846 41.662 1.00 19.02 ? 12  PRO A CB    1 
ATOM   28   C  CG    . PRO A 1 4   ? -16.224 18.206 42.464 1.00 19.94 ? 12  PRO A CG    1 
ATOM   29   C  CD    . PRO A 1 4   ? -16.462 19.117 43.646 1.00 20.63 ? 12  PRO A CD    1 
ATOM   30   N  N     . TYR A 1 5   ? -15.655 21.416 39.668 1.00 14.80 ? 13  TYR A N     1 
ATOM   31   C  CA    . TYR A 1 5   ? -16.339 21.907 38.494 1.00 15.10 ? 13  TYR A CA    1 
ATOM   32   C  C     . TYR A 1 5   ? -15.921 21.076 37.295 1.00 14.61 ? 13  TYR A C     1 
ATOM   33   O  O     . TYR A 1 5   ? -14.739 20.960 37.013 1.00 14.66 ? 13  TYR A O     1 
ATOM   34   C  CB    . TYR A 1 5   ? -15.929 23.362 38.234 1.00 15.28 ? 13  TYR A CB    1 
ATOM   35   C  CG    . TYR A 1 5   ? -16.723 23.931 37.091 1.00 18.44 ? 13  TYR A CG    1 
ATOM   36   C  CD1   . TYR A 1 5   ? -18.052 24.275 37.281 1.00 20.91 ? 13  TYR A CD1   1 
ATOM   37   C  CD2   . TYR A 1 5   ? -16.154 24.116 35.815 1.00 19.82 ? 13  TYR A CD2   1 
ATOM   38   C  CE1   . TYR A 1 5   ? -18.826 24.780 36.224 1.00 23.73 ? 13  TYR A CE1   1 
ATOM   39   C  CE2   . TYR A 1 5   ? -16.930 24.621 34.750 1.00 21.97 ? 13  TYR A CE2   1 
ATOM   40   C  CZ    . TYR A 1 5   ? -18.255 24.953 34.978 1.00 25.82 ? 13  TYR A CZ    1 
ATOM   41   O  OH    . TYR A 1 5   ? -19.056 25.456 33.981 1.00 25.33 ? 13  TYR A OH    1 
ATOM   42   N  N     . PHE A 1 6   ? -16.892 20.551 36.561 1.00 14.67 ? 14  PHE A N     1 
ATOM   43   C  CA    . PHE A 1 6   ? -16.616 19.658 35.447 1.00 14.55 ? 14  PHE A CA    1 
ATOM   44   C  C     . PHE A 1 6   ? -17.002 20.336 34.138 1.00 14.32 ? 14  PHE A C     1 
ATOM   45   O  O     . PHE A 1 6   ? -18.098 20.907 34.007 1.00 14.68 ? 14  PHE A O     1 
ATOM   46   C  CB    . PHE A 1 6   ? -17.453 18.379 35.587 1.00 14.31 ? 14  PHE A CB    1 
ATOM   47   C  CG    . PHE A 1 6   ? -17.124 17.564 36.798 1.00 13.64 ? 14  PHE A CG    1 
ATOM   48   C  CD1   . PHE A 1 6   ? -16.072 16.638 36.769 1.00 16.14 ? 14  PHE A CD1   1 
ATOM   49   C  CD2   . PHE A 1 6   ? -17.836 17.737 37.980 1.00 15.85 ? 14  PHE A CD2   1 
ATOM   50   C  CE1   . PHE A 1 6   ? -15.734 15.875 37.872 1.00 15.54 ? 14  PHE A CE1   1 
ATOM   51   C  CE2   . PHE A 1 6   ? -17.510 16.988 39.108 1.00 17.49 ? 14  PHE A CE2   1 
ATOM   52   C  CZ    . PHE A 1 6   ? -16.462 16.052 39.077 1.00 17.53 ? 14  PHE A CZ    1 
ATOM   53   N  N     . CYS A 1 7   ? -16.098 20.303 33.189 1.00 14.96 ? 15  CYS A N     1 
ATOM   54   C  CA    . CYS A 1 7   ? -16.382 20.862 31.864 1.00 14.90 ? 15  CYS A CA    1 
ATOM   55   C  C     . CYS A 1 7   ? -15.621 20.172 30.744 1.00 15.31 ? 15  CYS A C     1 
ATOM   56   O  O     . CYS A 1 7   ? -14.640 19.490 30.986 1.00 14.12 ? 15  CYS A O     1 
ATOM   57   C  CB    . CYS A 1 7   ? -16.241 22.381 31.878 1.00 16.34 ? 15  CYS A CB    1 
ATOM   58   S  SG    . CYS A 1 7   ? -14.573 22.919 32.173 1.00 19.33 ? 15  CYS A SG    1 
ATOM   59   N  N     . ARG A 1 8   ? -16.126 20.284 29.512 1.00 14.23 ? 16  ARG A N     1 
ATOM   60   C  CA    . ARG A 1 8   ? -15.463 19.654 28.373 1.00 15.32 ? 16  ARG A CA    1 
ATOM   61   C  C     . ARG A 1 8   ? -15.486 20.598 27.187 1.00 17.05 ? 16  ARG A C     1 
ATOM   62   O  O     . ARG A 1 8   ? -16.455 21.280 26.966 1.00 18.53 ? 16  ARG A O     1 
ATOM   63   C  CB    . ARG A 1 8   ? -16.198 18.381 27.945 1.00 14.94 ? 16  ARG A CB    1 
ATOM   64   C  CG    . ARG A 1 8   ? -16.634 17.420 29.030 1.00 15.67 ? 16  ARG A CG    1 
ATOM   65   C  CD    . ARG A 1 8   ? -17.380 16.278 28.411 1.00 15.12 ? 16  ARG A CD    1 
ATOM   66   N  NE    . ARG A 1 8   ? -18.065 15.451 29.402 1.00 13.14 ? 16  ARG A NE    1 
ATOM   67   C  CZ    . ARG A 1 8   ? -17.570 14.322 29.890 1.00 15.63 ? 16  ARG A CZ    1 
ATOM   68   N  NH1   . ARG A 1 8   ? -16.353 13.912 29.519 1.00 17.19 ? 16  ARG A NH1   1 
ATOM   69   N  NH2   . ARG A 1 8   ? -18.269 13.604 30.767 1.00 17.79 ? 16  ARG A NH2   1 
ATOM   70   N  N     . GLY A 1 9   ? -14.431 20.630 26.398 1.00 17.45 ? 17  GLY A N     1 
ATOM   71   C  CA    . GLY A 1 9   ? -14.457 21.558 25.269 1.00 18.29 ? 17  GLY A CA    1 
ATOM   72   C  C     . GLY A 1 9   ? -13.429 21.166 24.234 1.00 17.98 ? 17  GLY A C     1 
ATOM   73   O  O     . GLY A 1 9   ? -12.449 20.475 24.551 1.00 18.64 ? 17  GLY A O     1 
ATOM   74   N  N     . GLN A 1 10  ? -13.645 21.631 23.002 1.00 16.86 ? 18  GLN A N     1 
ATOM   75   C  CA    . GLN A 1 10  ? -12.694 21.403 21.910 1.00 16.26 ? 18  GLN A CA    1 
ATOM   76   C  C     . GLN A 1 10  ? -11.400 22.183 22.221 1.00 15.42 ? 18  GLN A C     1 
ATOM   77   O  O     . GLN A 1 10  ? -11.471 23.303 22.724 1.00 15.70 ? 18  GLN A O     1 
ATOM   78   C  CB    . GLN A 1 10  ? -13.345 21.797 20.540 1.00 17.51 ? 18  GLN A CB    1 
ATOM   79   C  CG    . GLN A 1 10  ? -14.538 20.756 20.193 1.00 19.57 ? 18  GLN A CG    1 
ATOM   80   C  CD    . GLN A 1 10  ? -15.137 20.663 18.725 1.00 28.94 ? 18  GLN A CD    1 
ATOM   81   O  OE1   . GLN A 1 10  ? -15.337 21.672 18.064 1.00 26.91 ? 18  GLN A OE1   1 
ATOM   82   N  NE2   . GLN A 1 10  ? -15.544 19.417 18.303 1.00 24.92 ? 18  GLN A NE2   1 
ATOM   83   N  N     . VAL A 1 11  ? -10.232 21.570 21.967 1.00 14.31 ? 19  VAL A N     1 
ATOM   84   C  CA    . VAL A 1 11  ? -8.958  22.271 22.208 1.00 14.31 ? 19  VAL A CA    1 
ATOM   85   C  C     . VAL A 1 11  ? -8.646  23.190 21.018 1.00 13.98 ? 19  VAL A C     1 
ATOM   86   O  O     . VAL A 1 11  ? -8.564  22.732 19.867 1.00 14.24 ? 19  VAL A O     1 
ATOM   87   C  CB    . VAL A 1 11  ? -7.836  21.254 22.480 1.00 13.51 ? 19  VAL A CB    1 
ATOM   88   C  CG1   . VAL A 1 11  ? -6.439  21.969 22.557 1.00 14.55 ? 19  VAL A CG1   1 
ATOM   89   C  CG2   . VAL A 1 11  ? -8.170  20.475 23.785 1.00 12.93 ? 19  VAL A CG2   1 
ATOM   90   N  N     . VAL A 1 12  ? -8.496  24.487 21.296 1.00 13.19 ? 20  VAL A N     1 
ATOM   91   C  CA    . VAL A 1 12  ? -8.366  25.481 20.230 1.00 13.31 ? 20  VAL A CA    1 
ATOM   92   C  C     . VAL A 1 12  ? -7.104  26.311 20.430 1.00 12.91 ? 20  VAL A C     1 
ATOM   93   O  O     . VAL A 1 12  ? -6.563  26.400 21.536 1.00 12.43 ? 20  VAL A O     1 
ATOM   94   C  CB    . VAL A 1 12  ? -9.595  26.403 20.145 1.00 12.81 ? 20  VAL A CB    1 
ATOM   95   C  CG1   . VAL A 1 12  ? -10.825 25.578 19.859 1.00 15.60 ? 20  VAL A CG1   1 
ATOM   96   C  CG2   . VAL A 1 12  ? -9.817  27.216 21.413 1.00 14.42 ? 20  VAL A CG2   1 
ATOM   97   N  N     . ARG A 1 13  ? -6.619  26.895 19.332 1.00 12.93 ? 21  ARG A N     1 
ATOM   98   C  CA    . ARG A 1 13  ? -5.381  27.669 19.398 1.00 13.52 ? 21  ARG A CA    1 
ATOM   99   C  C     . ARG A 1 13  ? -5.620  28.994 20.057 1.00 13.45 ? 21  ARG A C     1 
ATOM   100  O  O     . ARG A 1 13  ? -6.741  29.550 19.956 1.00 14.91 ? 21  ARG A O     1 
ATOM   101  C  CB    . ARG A 1 13  ? -4.848  27.906 17.970 1.00 14.62 ? 21  ARG A CB    1 
ATOM   102  C  CG    . ARG A 1 13  ? -3.753  26.929 17.620 1.00 18.14 ? 21  ARG A CG    1 
ATOM   103  C  CD    A ARG A 1 13  ? -3.399  26.884 16.118 0.50 21.25 ? 21  ARG A CD    1 
ATOM   104  C  CD    B ARG A 1 13  ? -3.048  27.150 16.263 0.50 17.80 ? 21  ARG A CD    1 
ATOM   105  N  NE    A ARG A 1 13  ? -4.403  26.073 15.461 0.50 23.42 ? 21  ARG A NE    1 
ATOM   106  N  NE    B ARG A 1 13  ? -2.741  25.847 15.671 0.50 15.71 ? 21  ARG A NE    1 
ATOM   107  C  CZ    A ARG A 1 13  ? -4.230  24.851 14.966 0.50 21.43 ? 21  ARG A CZ    1 
ATOM   108  C  CZ    B ARG A 1 13  ? -1.597  25.205 15.831 0.50 18.53 ? 21  ARG A CZ    1 
ATOM   109  N  NH1   A ARG A 1 13  ? -3.058  24.234 15.000 0.50 18.99 ? 21  ARG A NH1   1 
ATOM   110  N  NH1   B ARG A 1 13  ? -0.593  25.762 16.508 0.50 21.66 ? 21  ARG A NH1   1 
ATOM   111  N  NH2   A ARG A 1 13  ? -5.275  24.240 14.447 0.50 23.07 ? 21  ARG A NH2   1 
ATOM   112  N  NH2   B ARG A 1 13  ? -1.432  24.017 15.255 0.50 22.08 ? 21  ARG A NH2   1 
ATOM   113  N  N     . GLY A 1 14  ? -4.543  29.545 20.619 1.00 12.70 ? 22  GLY A N     1 
ATOM   114  C  CA    . GLY A 1 14  ? -4.579  30.855 21.244 1.00 13.38 ? 22  GLY A CA    1 
ATOM   115  C  C     . GLY A 1 14  ? -3.706  31.858 20.504 1.00 12.30 ? 22  GLY A C     1 
ATOM   116  O  O     . GLY A 1 14  ? -3.248  31.618 19.396 1.00 12.61 ? 22  GLY A O     1 
ATOM   117  N  N     . PHE A 1 15  ? -3.445  32.971 21.160 1.00 12.63 ? 23  PHE A N     1 
ATOM   118  C  CA    . PHE A 1 15  ? -2.796  34.107 20.504 1.00 13.87 ? 23  PHE A CA    1 
ATOM   119  C  C     . PHE A 1 15  ? -1.506  34.472 21.240 1.00 14.86 ? 23  PHE A C     1 
ATOM   120  O  O     . PHE A 1 15  ? -1.110  33.791 22.199 1.00 17.10 ? 23  PHE A O     1 
ATOM   121  C  CB    . PHE A 1 15  ? -3.827  35.240 20.326 1.00 12.67 ? 23  PHE A CB    1 
ATOM   122  C  CG    . PHE A 1 15  ? -5.004  34.766 19.541 1.00 12.26 ? 23  PHE A CG    1 
ATOM   123  C  CD1   . PHE A 1 15  ? -4.938  34.672 18.153 1.00 14.28 ? 23  PHE A CD1   1 
ATOM   124  C  CD2   . PHE A 1 15  ? -6.104  34.234 20.207 1.00 14.54 ? 23  PHE A CD2   1 
ATOM   125  C  CE1   . PHE A 1 15  ? -5.997  34.112 17.438 1.00 13.79 ? 23  PHE A CE1   1 
ATOM   126  C  CE2   . PHE A 1 15  ? -7.167  33.690 19.503 1.00 15.62 ? 23  PHE A CE2   1 
ATOM   127  C  CZ    . PHE A 1 15  ? -7.102  33.638 18.099 1.00 16.28 ? 23  PHE A CZ    1 
ATOM   128  N  N     . GLY A 1 16  ? -0.818  35.499 20.763 1.00 16.13 ? 24  GLY A N     1 
ATOM   129  C  CA    . GLY A 1 16  ? 0.541   35.760 21.250 1.00 16.52 ? 24  GLY A CA    1 
ATOM   130  C  C     . GLY A 1 16  ? 1.441   34.573 20.921 1.00 17.21 ? 24  GLY A C     1 
ATOM   131  O  O     . GLY A 1 16  ? 1.184   33.816 19.971 1.00 17.56 ? 24  GLY A O     1 
ATOM   132  N  N     . ARG A 1 17  ? 2.516   34.399 21.681 1.00 17.64 ? 25  ARG A N     1 
ATOM   133  C  CA    . ARG A 1 17  ? 3.349   33.222 21.474 1.00 18.67 ? 25  ARG A CA    1 
ATOM   134  C  C     . ARG A 1 17  ? 2.901   32.174 22.493 1.00 18.15 ? 25  ARG A C     1 
ATOM   135  O  O     . ARG A 1 17  ? 2.694   32.472 23.682 1.00 21.78 ? 25  ARG A O     1 
ATOM   136  C  CB    A ARG A 1 17  ? 4.839   33.534 21.650 0.50 17.80 ? 25  ARG A CB    1 
ATOM   137  C  CB    B ARG A 1 17  ? 4.835   33.552 21.685 0.50 17.87 ? 25  ARG A CB    1 
ATOM   138  C  CG    A ARG A 1 17  ? 5.739   32.297 21.567 0.50 18.64 ? 25  ARG A CG    1 
ATOM   139  C  CG    B ARG A 1 17  ? 5.310   34.860 21.047 0.50 18.37 ? 25  ARG A CG    1 
ATOM   140  C  CD    A ARG A 1 17  ? 7.205   32.589 21.346 0.50 18.71 ? 25  ARG A CD    1 
ATOM   141  C  CD    B ARG A 1 17  ? 6.816   35.148 21.196 0.50 20.65 ? 25  ARG A CD    1 
ATOM   142  N  NE    A ARG A 1 17  ? 7.421   32.654 19.918 0.50 20.02 ? 25  ARG A NE    1 
ATOM   143  N  NE    B ARG A 1 17  ? 7.229   36.142 20.210 0.50 21.80 ? 25  ARG A NE    1 
ATOM   144  C  CZ    A ARG A 1 17  ? 7.530   33.771 19.248 0.50 18.35 ? 25  ARG A CZ    1 
ATOM   145  C  CZ    B ARG A 1 17  ? 7.134   37.447 20.375 0.50 21.07 ? 25  ARG A CZ    1 
ATOM   146  N  NH1   A ARG A 1 17  ? 7.509   34.929 19.889 0.50 22.88 ? 25  ARG A NH1   1 
ATOM   147  N  NH1   B ARG A 1 17  ? 6.682   37.955 21.513 0.50 22.07 ? 25  ARG A NH1   1 
ATOM   148  N  NH2   A ARG A 1 17  ? 7.700   33.737 17.950 0.50 16.30 ? 25  ARG A NH2   1 
ATOM   149  N  NH2   B ARG A 1 17  ? 7.514   38.246 19.406 0.50 21.95 ? 25  ARG A NH2   1 
ATOM   150  N  N     . GLY A 1 18  ? 2.769   30.956 22.022 1.00 18.19 ? 26  GLY A N     1 
ATOM   151  C  CA    . GLY A 1 18  ? 2.277   29.868 22.818 1.00 16.80 ? 26  GLY A CA    1 
ATOM   152  C  C     . GLY A 1 18  ? 3.258   29.533 23.912 1.00 17.08 ? 26  GLY A C     1 
ATOM   153  O  O     . GLY A 1 18  ? 4.462   29.649 23.703 1.00 17.47 ? 26  GLY A O     1 
ATOM   154  N  N     . SER A 1 19  ? 2.742   29.079 25.047 1.00 15.41 ? 27  SER A N     1 
ATOM   155  C  CA    . SER A 1 19  ? 3.607   28.729 26.181 1.00 14.81 ? 27  SER A CA    1 
ATOM   156  C  C     . SER A 1 19  ? 4.343   27.418 25.983 1.00 15.10 ? 27  SER A C     1 
ATOM   157  O  O     . SER A 1 19  ? 5.155   27.033 26.838 1.00 15.30 ? 27  SER A O     1 
ATOM   158  C  CB    . SER A 1 19  ? 2.815   28.717 27.481 1.00 14.07 ? 27  SER A CB    1 
ATOM   159  O  OG    . SER A 1 19  ? 1.786   27.745 27.410 1.00 14.88 ? 27  SER A OG    1 
ATOM   160  N  N     . LYS A 1 20  ? 4.097   26.728 24.864 1.00 15.32 ? 28  LYS A N     1 
ATOM   161  C  CA    . LYS A 1 20  ? 5.067   25.709 24.425 1.00 16.44 ? 28  LYS A CA    1 
ATOM   162  C  C     . LYS A 1 20  ? 6.498   26.238 24.476 1.00 15.72 ? 28  LYS A C     1 
ATOM   163  O  O     . LYS A 1 20  ? 7.467   25.489 24.722 1.00 17.31 ? 28  LYS A O     1 
ATOM   164  C  CB    . LYS A 1 20  ? 4.783   25.265 22.985 1.00 16.06 ? 28  LYS A CB    1 
ATOM   165  C  CG    . LYS A 1 20  ? 3.817   24.102 22.921 1.00 19.75 ? 28  LYS A CG    1 
ATOM   166  C  CD    . LYS A 1 20  ? 3.402   23.880 21.481 1.00 22.20 ? 28  LYS A CD    1 
ATOM   167  C  CE    . LYS A 1 20  ? 2.761   22.535 21.304 1.00 25.79 ? 28  LYS A CE    1 
ATOM   168  N  NZ    . LYS A 1 20  ? 2.370   22.395 19.863 1.00 29.64 ? 28  LYS A NZ    1 
ATOM   169  N  N     . GLN A 1 21  ? 6.668   27.536 24.250 1.00 16.24 ? 29  GLN A N     1 
ATOM   170  C  CA    . GLN A 1 21  ? 8.032   28.095 24.227 1.00 17.12 ? 29  GLN A CA    1 
ATOM   171  C  C     . GLN A 1 21  ? 8.744   27.880 25.561 1.00 17.38 ? 29  GLN A C     1 
ATOM   172  O  O     . GLN A 1 21  ? 9.971   27.868 25.597 1.00 18.56 ? 29  GLN A O     1 
ATOM   173  C  CB    . GLN A 1 21  ? 8.046   29.576 23.872 1.00 17.47 ? 29  GLN A CB    1 
ATOM   174  C  CG    . GLN A 1 21  ? 7.333   30.447 24.868 1.00 19.48 ? 29  GLN A CG    1 
ATOM   175  C  CD    . GLN A 1 21  ? 7.595   31.923 24.640 1.00 23.77 ? 29  GLN A CD    1 
ATOM   176  O  OE1   . GLN A 1 21  ? 8.658   32.292 24.204 1.00 23.69 ? 29  GLN A OE1   1 
ATOM   177  N  NE2   . GLN A 1 21  ? 6.619   32.756 24.955 1.00 28.38 ? 29  GLN A NE2   1 
ATOM   178  N  N     . LEU A 1 22  ? 7.962   27.727 26.624 1.00 16.71 ? 30  LEU A N     1 
ATOM   179  C  CA    . LEU A 1 22  ? 8.492   27.571 27.980 1.00 16.88 ? 30  LEU A CA    1 
ATOM   180  C  C     . LEU A 1 22  ? 8.548   26.116 28.401 1.00 16.46 ? 30  LEU A C     1 
ATOM   181  O  O     . LEU A 1 22  ? 9.000   25.808 29.523 1.00 17.36 ? 30  LEU A O     1 
ATOM   182  C  CB    . LEU A 1 22  ? 7.622   28.349 28.985 1.00 17.68 ? 30  LEU A CB    1 
ATOM   183  C  CG    . LEU A 1 22  ? 7.224   29.787 28.656 1.00 19.06 ? 30  LEU A CG    1 
ATOM   184  C  CD1   . LEU A 1 22  ? 6.319   30.294 29.735 1.00 20.80 ? 30  LEU A CD1   1 
ATOM   185  C  CD2   . LEU A 1 22  ? 8.436   30.662 28.600 1.00 19.32 ? 30  LEU A CD2   1 
ATOM   186  N  N     . GLY A 1 23  ? 8.113   25.222 27.524 1.00 15.90 ? 31  GLY A N     1 
ATOM   187  C  CA    . GLY A 1 23  ? 8.041   23.820 27.864 1.00 15.75 ? 31  GLY A CA    1 
ATOM   188  C  C     . GLY A 1 23  ? 6.803   23.572 28.682 1.00 15.88 ? 31  GLY A C     1 
ATOM   189  O  O     . GLY A 1 23  ? 6.682   22.498 29.288 1.00 17.74 ? 31  GLY A O     1 
ATOM   190  N  N     . ILE A 1 24  ? 5.869   24.549 28.703 1.00 15.59 ? 32  ILE A N     1 
ATOM   191  C  CA    . ILE A 1 24  ? 4.673   24.401 29.534 1.00 13.72 ? 32  ILE A CA    1 
ATOM   192  C  C     . ILE A 1 24  ? 3.415   24.682 28.679 1.00 13.39 ? 32  ILE A C     1 
ATOM   193  O  O     . ILE A 1 24  ? 2.795   25.718 28.855 1.00 13.48 ? 32  ILE A O     1 
ATOM   194  C  CB    . ILE A 1 24  ? 4.728   25.288 30.809 1.00 14.71 ? 32  ILE A CB    1 
ATOM   195  C  CG1   . ILE A 1 24  ? 6.065   25.077 31.556 1.00 14.99 ? 32  ILE A CG1   1 
ATOM   196  C  CG2   . ILE A 1 24  ? 3.517   24.962 31.737 1.00 15.36 ? 32  ILE A CG2   1 
ATOM   197  C  CD1   . ILE A 1 24  ? 6.262   26.011 32.755 1.00 19.46 ? 32  ILE A CD1   1 
ATOM   198  N  N     . PRO A 1 25  ? 3.062   23.770 27.774 1.00 13.45 ? 33  PRO A N     1 
ATOM   199  C  CA    . PRO A 1 25  ? 1.938   24.015 26.849 1.00 12.82 ? 33  PRO A CA    1 
ATOM   200  C  C     . PRO A 1 25  ? 0.647   24.180 27.648 1.00 12.77 ? 33  PRO A C     1 
ATOM   201  O  O     . PRO A 1 25  ? 0.430   23.511 28.691 1.00 12.88 ? 33  PRO A O     1 
ATOM   202  C  CB    . PRO A 1 25  ? 1.817   22.723 26.033 1.00 14.10 ? 33  PRO A CB    1 
ATOM   203  C  CG    . PRO A 1 25  ? 2.613   21.729 26.760 1.00 14.84 ? 33  PRO A CG    1 
ATOM   204  C  CD    . PRO A 1 25  ? 3.665   22.439 27.562 1.00 14.51 ? 33  PRO A CD    1 
ATOM   205  N  N     . THR A 1 26  ? -0.182  25.096 27.178 1.00 12.60 ? 34  THR A N     1 
ATOM   206  C  CA    . THR A 1 26  ? -1.435  25.428 27.866 1.00 11.86 ? 34  THR A CA    1 
ATOM   207  C  C     . THR A 1 26  ? -2.552  25.338 26.820 1.00 12.08 ? 34  THR A C     1 
ATOM   208  O  O     . THR A 1 26  ? -2.587  26.102 25.859 1.00 11.80 ? 34  THR A O     1 
ATOM   209  C  CB    . THR A 1 26  ? -1.410  26.867 28.398 1.00 11.29 ? 34  THR A CB    1 
ATOM   210  O  OG1   . THR A 1 26  ? -0.749  27.726 27.433 1.00 10.74 ? 34  THR A OG1   1 
ATOM   211  C  CG2   . THR A 1 26  ? -0.546  26.955 29.649 1.00 12.64 ? 34  THR A CG2   1 
ATOM   212  N  N     . ALA A 1 27  ? -3.493  24.431 27.051 1.00 11.16 ? 35  ALA A N     1 
ATOM   213  C  CA    . ALA A 1 27  ? -4.606  24.248 26.131 1.00 11.19 ? 35  ALA A CA    1 
ATOM   214  C  C     . ALA A 1 27  ? -5.786  25.181 26.436 1.00 11.84 ? 35  ALA A C     1 
ATOM   215  O  O     . ALA A 1 27  ? -6.186  25.335 27.604 1.00 12.21 ? 35  ALA A O     1 
ATOM   216  C  CB    . ALA A 1 27  ? -5.067  22.794 26.184 1.00 11.36 ? 35  ALA A CB    1 
ATOM   217  N  N     . ASN A 1 28  ? -6.349  25.731 25.367 1.00 11.10 ? 36  ASN A N     1 
ATOM   218  C  CA    . ASN A 1 28  ? -7.556  26.597 25.427 1.00 12.93 ? 36  ASN A CA    1 
ATOM   219  C  C     . ASN A 1 28  ? -8.820  25.895 25.005 1.00 13.86 ? 36  ASN A C     1 
ATOM   220  O  O     . ASN A 1 28  ? -8.811  24.967 24.199 1.00 14.02 ? 36  ASN A O     1 
ATOM   221  C  CB    . ASN A 1 28  ? -7.371  27.848 24.511 1.00 11.90 ? 36  ASN A CB    1 
ATOM   222  C  CG    . ASN A 1 28  ? -5.979  28.398 24.639 1.00 14.01 ? 36  ASN A CG    1 
ATOM   223  O  OD1   . ASN A 1 28  ? -5.615  28.899 25.730 1.00 16.43 ? 36  ASN A OD1   1 
ATOM   224  N  ND2   . ASN A 1 28  ? -5.150  28.223 23.601 1.00 12.90 ? 36  ASN A ND2   1 
ATOM   225  N  N     . PHE A 1 29  ? -9.930  26.378 25.542 1.00 17.19 ? 37  PHE A N     1 
ATOM   226  C  CA    . PHE A 1 29  ? -11.277 25.930 25.100 1.00 17.40 ? 37  PHE A CA    1 
ATOM   227  C  C     . PHE A 1 29  ? -11.910 27.060 24.308 1.00 18.71 ? 37  PHE A C     1 
ATOM   228  O  O     . PHE A 1 29  ? -11.477 28.201 24.484 1.00 19.53 ? 37  PHE A O     1 
ATOM   229  C  CB    . PHE A 1 29  ? -12.168 25.794 26.334 1.00 17.40 ? 37  PHE A CB    1 
ATOM   230  C  CG    . PHE A 1 29  ? -11.927 24.563 27.204 1.00 15.99 ? 37  PHE A CG    1 
ATOM   231  C  CD1   . PHE A 1 29  ? -11.830 23.319 26.659 1.00 18.81 ? 37  PHE A CD1   1 
ATOM   232  C  CD2   . PHE A 1 29  ? -11.944 24.702 28.586 1.00 17.19 ? 37  PHE A CD2   1 
ATOM   233  C  CE1   . PHE A 1 29  ? -11.699 22.174 27.491 1.00 19.71 ? 37  PHE A CE1   1 
ATOM   234  C  CE2   . PHE A 1 29  ? -11.827 23.576 29.434 1.00 17.74 ? 37  PHE A CE2   1 
ATOM   235  C  CZ    . PHE A 1 29  ? -11.682 22.313 28.859 1.00 18.23 ? 37  PHE A CZ    1 
ATOM   236  N  N     . PRO A 1 30  ? -12.985 26.796 23.545 1.00 19.32 ? 38  PRO A N     1 
ATOM   237  C  CA    . PRO A 1 30  ? -13.771 27.906 22.956 1.00 18.48 ? 38  PRO A CA    1 
ATOM   238  C  C     . PRO A 1 30  ? -14.316 28.821 24.083 1.00 18.92 ? 38  PRO A C     1 
ATOM   239  O  O     . PRO A 1 30  ? -14.522 28.352 25.200 1.00 17.50 ? 38  PRO A O     1 
ATOM   240  C  CB    . PRO A 1 30  ? -14.897 27.189 22.194 1.00 19.14 ? 38  PRO A CB    1 
ATOM   241  C  CG    . PRO A 1 30  ? -14.326 25.795 21.911 1.00 20.66 ? 38  PRO A CG    1 
ATOM   242  C  CD    . PRO A 1 30  ? -13.558 25.474 23.193 1.00 18.86 ? 38  PRO A CD    1 
ATOM   243  N  N     . GLU A 1 31  ? -14.530 30.119 23.809 1.00 19.12 ? 39  GLU A N     1 
ATOM   244  C  CA    . GLU A 1 31  ? -14.975 31.044 24.854 1.00 19.64 ? 39  GLU A CA    1 
ATOM   245  C  C     . GLU A 1 31  ? -16.323 30.607 25.483 1.00 18.60 ? 39  GLU A C     1 
ATOM   246  O  O     . GLU A 1 31  ? -16.595 30.932 26.665 1.00 17.94 ? 39  GLU A O     1 
ATOM   247  C  CB    . GLU A 1 31  ? -15.049 32.490 24.324 1.00 21.72 ? 39  GLU A CB    1 
ATOM   248  C  CG    . GLU A 1 31  ? -16.311 32.853 23.603 1.00 26.02 ? 39  GLU A CG    1 
ATOM   249  C  CD    . GLU A 1 31  ? -16.335 34.303 23.109 1.00 33.44 ? 39  GLU A CD    1 
ATOM   250  O  OE1   . GLU A 1 31  ? -16.559 35.250 23.916 1.00 34.58 ? 39  GLU A OE1   1 
ATOM   251  O  OE2   . GLU A 1 31  ? -16.173 34.483 21.887 1.00 35.10 ? 39  GLU A OE2   1 
ATOM   252  N  N     . GLN A 1 32  ? -17.139 29.876 24.720 1.00 18.20 ? 40  GLN A N     1 
ATOM   253  C  CA    . GLN A 1 32  ? -18.432 29.350 25.229 1.00 18.68 ? 40  GLN A CA    1 
ATOM   254  C  C     . GLN A 1 32  ? -18.216 28.588 26.539 1.00 17.45 ? 40  GLN A C     1 
ATOM   255  O  O     . GLN A 1 32  ? -19.058 28.639 27.451 1.00 18.43 ? 40  GLN A O     1 
ATOM   256  C  CB    . GLN A 1 32  ? -19.108 28.413 24.198 1.00 20.02 ? 40  GLN A CB    1 
ATOM   257  C  CG    . GLN A 1 32  ? -18.491 26.985 24.164 1.00 23.73 ? 40  GLN A CG    1 
ATOM   258  C  CD    . GLN A 1 32  ? -18.778 26.098 22.909 1.00 30.35 ? 40  GLN A CD    1 
ATOM   259  O  OE1   . GLN A 1 32  ? -18.765 24.841 23.007 1.00 33.06 ? 40  GLN A OE1   1 
ATOM   260  N  NE2   . GLN A 1 32  ? -18.981 26.719 21.768 1.00 29.69 ? 40  GLN A NE2   1 
ATOM   261  N  N     . VAL A 1 33  ? -17.117 27.829 26.641 1.00 16.21 ? 41  VAL A N     1 
ATOM   262  C  CA    . VAL A 1 33  ? -16.901 27.031 27.834 1.00 16.47 ? 41  VAL A CA    1 
ATOM   263  C  C     . VAL A 1 33  ? -16.583 27.943 29.004 1.00 17.30 ? 41  VAL A C     1 
ATOM   264  O  O     . VAL A 1 33  ? -17.170 27.817 30.068 1.00 16.93 ? 41  VAL A O     1 
ATOM   265  C  CB    . VAL A 1 33  ? -15.771 25.971 27.672 1.00 15.50 ? 41  VAL A CB    1 
ATOM   266  C  CG1   . VAL A 1 33  ? -15.477 25.283 28.993 1.00 19.08 ? 41  VAL A CG1   1 
ATOM   267  C  CG2   . VAL A 1 33  ? -16.152 24.977 26.575 1.00 18.31 ? 41  VAL A CG2   1 
ATOM   268  N  N     . VAL A 1 34  ? -15.652 28.878 28.783 1.00 17.67 ? 42  VAL A N     1 
ATOM   269  C  CA    . VAL A 1 34  ? -15.254 29.781 29.840 1.00 19.97 ? 42  VAL A CA    1 
ATOM   270  C  C     . VAL A 1 34  ? -16.453 30.612 30.307 1.00 20.71 ? 42  VAL A C     1 
ATOM   271  O  O     . VAL A 1 34  ? -16.669 30.802 31.509 1.00 21.99 ? 42  VAL A O     1 
ATOM   272  C  CB    . VAL A 1 34  ? -14.102 30.695 29.373 1.00 20.48 ? 42  VAL A CB    1 
ATOM   273  C  CG1   . VAL A 1 34  ? -13.512 31.377 30.582 1.00 23.49 ? 42  VAL A CG1   1 
ATOM   274  C  CG2   . VAL A 1 34  ? -13.001 29.820 28.681 1.00 23.61 ? 42  VAL A CG2   1 
ATOM   275  N  N     . ASP A 1 35  ? -17.254 31.065 29.351 1.00 21.91 ? 43  ASP A N     1 
ATOM   276  C  CA    . ASP A 1 35  ? -18.418 31.890 29.698 1.00 22.65 ? 43  ASP A CA    1 
ATOM   277  C  C     . ASP A 1 35  ? -19.454 31.190 30.561 1.00 22.88 ? 43  ASP A C     1 
ATOM   278  O  O     . ASP A 1 35  ? -20.307 31.854 31.195 1.00 23.36 ? 43  ASP A O     1 
ATOM   279  C  CB    . ASP A 1 35  ? -19.072 32.454 28.439 1.00 23.30 ? 43  ASP A CB    1 
ATOM   280  C  CG    . ASP A 1 35  ? -18.238 33.527 27.794 1.00 25.00 ? 43  ASP A CG    1 
ATOM   281  O  OD1   . ASP A 1 35  ? -17.160 33.882 28.331 1.00 28.60 ? 43  ASP A OD1   1 
ATOM   282  O  OD2   . ASP A 1 35  ? -18.566 34.066 26.731 1.00 27.82 ? 43  ASP A OD2   1 
ATOM   283  N  N     . ASN A 1 36  ? -19.396 29.869 30.634 1.00 22.14 ? 44  ASN A N     1 
ATOM   284  C  CA    . ASN A 1 36  ? -20.384 29.171 31.441 1.00 24.14 ? 44  ASN A CA    1 
ATOM   285  C  C     . ASN A 1 36  ? -19.886 28.808 32.819 1.00 24.67 ? 44  ASN A C     1 
ATOM   286  O  O     . ASN A 1 36  ? -20.610 28.196 33.597 1.00 25.03 ? 44  ASN A O     1 
ATOM   287  C  CB    . ASN A 1 36  ? -20.978 27.987 30.675 1.00 23.73 ? 44  ASN A CB    1 
ATOM   288  C  CG    . ASN A 1 36  ? -22.059 28.438 29.728 1.00 24.57 ? 44  ASN A CG    1 
ATOM   289  O  OD1   . ASN A 1 36  ? -23.198 28.577 30.130 1.00 23.98 ? 44  ASN A OD1   1 
ATOM   290  N  ND2   . ASN A 1 36  ? -21.690 28.766 28.488 1.00 22.57 ? 44  ASN A ND2   1 
ATOM   291  N  N     . LEU A 1 37  ? -18.637 29.199 33.117 1.00 25.15 ? 45  LEU A N     1 
ATOM   292  C  CA    . LEU A 1 37  ? -18.120 29.115 34.478 1.00 26.38 ? 45  LEU A CA    1 
ATOM   293  C  C     . LEU A 1 37  ? -19.011 29.917 35.431 1.00 26.66 ? 45  LEU A C     1 
ATOM   294  O  O     . LEU A 1 37  ? -19.400 31.048 35.145 1.00 25.74 ? 45  LEU A O     1 
ATOM   295  C  CB    . LEU A 1 37  ? -16.674 29.639 34.572 1.00 26.45 ? 45  LEU A CB    1 
ATOM   296  C  CG    . LEU A 1 37  ? -15.475 28.910 33.968 1.00 27.95 ? 45  LEU A CG    1 
ATOM   297  C  CD1   . LEU A 1 37  ? -14.223 29.761 34.182 1.00 31.93 ? 45  LEU A CD1   1 
ATOM   298  C  CD2   . LEU A 1 37  ? -15.271 27.552 34.564 1.00 30.87 ? 45  LEU A CD2   1 
ATOM   299  N  N     . PRO A 1 38  ? -19.317 29.332 36.578 1.00 28.11 ? 46  PRO A N     1 
ATOM   300  C  CA    . PRO A 1 38  ? -20.009 30.062 37.647 1.00 28.72 ? 46  PRO A CA    1 
ATOM   301  C  C     . PRO A 1 38  ? -19.212 31.318 38.031 1.00 29.65 ? 46  PRO A C     1 
ATOM   302  O  O     . PRO A 1 38  ? -18.002 31.217 38.056 1.00 29.10 ? 46  PRO A O     1 
ATOM   303  C  CB    . PRO A 1 38  ? -19.988 29.065 38.804 1.00 29.05 ? 46  PRO A CB    1 
ATOM   304  C  CG    . PRO A 1 38  ? -19.857 27.729 38.177 1.00 29.33 ? 46  PRO A CG    1 
ATOM   305  C  CD    . PRO A 1 38  ? -19.048 27.926 36.929 1.00 27.76 ? 46  PRO A CD    1 
ATOM   306  N  N     . ALA A 1 39  ? -19.856 32.452 38.339 1.00 30.89 ? 47  ALA A N     1 
ATOM   307  C  CA    . ALA A 1 39  ? -19.136 33.658 38.815 1.00 31.58 ? 47  ALA A CA    1 
ATOM   308  C  C     . ALA A 1 39  ? -18.169 33.451 40.020 1.00 32.29 ? 47  ALA A C     1 
ATOM   309  O  O     . ALA A 1 39  ? -17.168 34.158 40.160 1.00 32.09 ? 47  ALA A O     1 
ATOM   310  C  CB    . ALA A 1 39  ? -20.111 34.771 39.103 1.00 31.88 ? 47  ALA A CB    1 
ATOM   311  N  N     . ASP A 1 40  ? -18.461 32.472 40.871 1.00 32.66 ? 48  ASP A N     1 
ATOM   312  C  CA    . ASP A 1 40  ? -17.678 32.245 42.089 1.00 33.07 ? 48  ASP A CA    1 
ATOM   313  C  C     . ASP A 1 40  ? -16.334 31.570 41.819 1.00 32.16 ? 48  ASP A C     1 
ATOM   314  O  O     . ASP A 1 40  ? -15.459 31.557 42.694 1.00 32.19 ? 48  ASP A O     1 
ATOM   315  C  CB    . ASP A 1 40  ? -18.494 31.432 43.103 1.00 34.16 ? 48  ASP A CB    1 
ATOM   316  C  CG    . ASP A 1 40  ? -19.303 30.337 42.440 1.00 36.76 ? 48  ASP A CG    1 
ATOM   317  O  OD1   . ASP A 1 40  ? -18.727 29.246 42.242 1.00 38.29 ? 48  ASP A OD1   1 
ATOM   318  O  OD2   . ASP A 1 40  ? -20.500 30.487 42.058 1.00 40.77 ? 48  ASP A OD2   1 
ATOM   319  N  N     . ILE A 1 41  ? -16.166 31.018 40.612 1.00 30.43 ? 49  ILE A N     1 
ATOM   320  C  CA    . ILE A 1 41  ? -14.861 30.549 40.173 1.00 28.79 ? 49  ILE A CA    1 
ATOM   321  C  C     . ILE A 1 41  ? -14.079 31.805 39.765 1.00 28.55 ? 49  ILE A C     1 
ATOM   322  O  O     . ILE A 1 41  ? -14.047 32.221 38.579 1.00 29.00 ? 49  ILE A O     1 
ATOM   323  C  CB    . ILE A 1 41  ? -14.956 29.475 39.080 1.00 29.63 ? 49  ILE A CB    1 
ATOM   324  C  CG1   . ILE A 1 41  ? -15.709 28.258 39.647 1.00 30.33 ? 49  ILE A CG1   1 
ATOM   325  C  CG2   . ILE A 1 41  ? -13.563 29.049 38.615 1.00 27.91 ? 49  ILE A CG2   1 
ATOM   326  C  CD1   . ILE A 1 41  ? -15.888 27.088 38.691 1.00 34.16 ? 49  ILE A CD1   1 
ATOM   327  N  N     . SER A 1 42  ? -13.514 32.432 40.795 1.00 24.83 ? 50  SER A N     1 
ATOM   328  C  CA    . SER A 1 42  ? -12.731 33.655 40.648 1.00 22.81 ? 50  SER A CA    1 
ATOM   329  C  C     . SER A 1 42  ? -11.510 33.407 39.768 1.00 19.95 ? 50  SER A C     1 
ATOM   330  O  O     . SER A 1 42  ? -11.130 32.260 39.502 1.00 17.52 ? 50  SER A O     1 
ATOM   331  C  CB    . SER A 1 42  ? -12.281 34.109 42.019 1.00 24.19 ? 50  SER A CB    1 
ATOM   332  O  OG    . SER A 1 42  ? -11.424 33.114 42.536 1.00 27.57 ? 50  SER A OG    1 
ATOM   333  N  N     . THR A 1 43  ? -10.864 34.484 39.340 1.00 17.96 ? 51  THR A N     1 
ATOM   334  C  CA    . THR A 1 43  ? -9.576  34.294 38.671 1.00 15.99 ? 51  THR A CA    1 
ATOM   335  C  C     . THR A 1 43  ? -8.573  33.729 39.656 1.00 15.15 ? 51  THR A C     1 
ATOM   336  O  O     . THR A 1 43  ? -8.729  33.866 40.884 1.00 15.81 ? 51  THR A O     1 
ATOM   337  C  CB    . THR A 1 43  ? -9.042  35.594 38.106 1.00 15.77 ? 51  THR A CB    1 
ATOM   338  O  OG1   . THR A 1 43  ? -8.962  36.577 39.152 1.00 15.79 ? 51  THR A OG1   1 
ATOM   339  C  CG2   . THR A 1 43  ? -10.054 36.176 37.087 1.00 17.46 ? 51  THR A CG2   1 
ATOM   340  N  N     . GLY A 1 44  ? -7.557  33.097 39.118 1.00 13.70 ? 52  GLY A N     1 
ATOM   341  C  CA    . GLY A 1 44  ? -6.481  32.515 39.906 1.00 13.85 ? 52  GLY A CA    1 
ATOM   342  C  C     . GLY A 1 44  ? -6.073  31.177 39.322 1.00 13.63 ? 52  GLY A C     1 
ATOM   343  O  O     . GLY A 1 44  ? -6.483  30.795 38.180 1.00 12.53 ? 52  GLY A O     1 
ATOM   344  N  N     . ILE A 1 45  ? -5.297  30.452 40.125 1.00 12.41 ? 53  ILE A N     1 
ATOM   345  C  CA    . ILE A 1 45  ? -4.678  29.209 39.679 1.00 12.89 ? 53  ILE A CA    1 
ATOM   346  C  C     . ILE A 1 45  ? -5.326  28.068 40.419 1.00 13.55 ? 53  ILE A C     1 
ATOM   347  O  O     . ILE A 1 45  ? -5.409  28.097 41.640 1.00 13.32 ? 53  ILE A O     1 
ATOM   348  C  CB    . ILE A 1 45  ? -3.156  29.225 39.960 1.00 13.31 ? 53  ILE A CB    1 
ATOM   349  C  CG1   . ILE A 1 45  ? -2.531  30.537 39.426 1.00 15.95 ? 53  ILE A CG1   1 
ATOM   350  C  CG2   . ILE A 1 45  ? -2.481  28.003 39.335 1.00 14.71 ? 53  ILE A CG2   1 
ATOM   351  C  CD1   . ILE A 1 45  ? -2.900  30.855 37.954 1.00 15.53 ? 53  ILE A CD1   1 
ATOM   352  N  N     . TYR A 1 46  ? -5.795  27.090 39.654 1.00 13.47 ? 54  TYR A N     1 
ATOM   353  C  CA    . TYR A 1 46  ? -6.515  25.922 40.186 1.00 12.91 ? 54  TYR A CA    1 
ATOM   354  C  C     . TYR A 1 46  ? -5.800  24.657 39.778 1.00 12.56 ? 54  TYR A C     1 
ATOM   355  O  O     . TYR A 1 46  ? -4.904  24.673 38.913 1.00 13.87 ? 54  TYR A O     1 
ATOM   356  C  CB    . TYR A 1 46  ? -7.934  25.855 39.621 1.00 12.20 ? 54  TYR A CB    1 
ATOM   357  C  CG    . TYR A 1 46  ? -8.833  27.009 40.009 1.00 12.49 ? 54  TYR A CG    1 
ATOM   358  C  CD1   . TYR A 1 46  ? -8.673  28.303 39.428 1.00 13.89 ? 54  TYR A CD1   1 
ATOM   359  C  CD2   . TYR A 1 46  ? -9.863  26.820 40.932 1.00 15.71 ? 54  TYR A CD2   1 
ATOM   360  C  CE1   . TYR A 1 46  ? -9.534  29.349 39.766 1.00 13.62 ? 54  TYR A CE1   1 
ATOM   361  C  CE2   . TYR A 1 46  ? -10.713 27.857 41.260 1.00 14.23 ? 54  TYR A CE2   1 
ATOM   362  C  CZ    . TYR A 1 46  ? -10.539 29.118 40.681 1.00 15.99 ? 54  TYR A CZ    1 
ATOM   363  O  OH    . TYR A 1 46  ? -11.414 30.129 41.047 1.00 17.94 ? 54  TYR A OH    1 
ATOM   364  N  N     . TYR A 1 47  ? -6.210  23.541 40.367 1.00 13.72 ? 55  TYR A N     1 
ATOM   365  C  CA    . TYR A 1 47  ? -5.659  22.228 39.981 1.00 13.59 ? 55  TYR A CA    1 
ATOM   366  C  C     . TYR A 1 47  ? -6.755  21.184 39.929 1.00 13.63 ? 55  TYR A C     1 
ATOM   367  O  O     . TYR A 1 47  ? -7.894  21.402 40.415 1.00 13.66 ? 55  TYR A O     1 
ATOM   368  C  CB    . TYR A 1 47  ? -4.522  21.790 40.929 1.00 14.19 ? 55  TYR A CB    1 
ATOM   369  C  CG    . TYR A 1 47  ? -4.971  21.642 42.362 1.00 12.91 ? 55  TYR A CG    1 
ATOM   370  C  CD1   . TYR A 1 47  ? -5.023  22.747 43.230 1.00 15.87 ? 55  TYR A CD1   1 
ATOM   371  C  CD2   . TYR A 1 47  ? -5.388  20.402 42.848 1.00 16.66 ? 55  TYR A CD2   1 
ATOM   372  C  CE1   . TYR A 1 47  ? -5.450  22.605 44.521 1.00 15.39 ? 55  TYR A CE1   1 
ATOM   373  C  CE2   . TYR A 1 47  ? -5.815  20.258 44.138 1.00 17.84 ? 55  TYR A CE2   1 
ATOM   374  C  CZ    . TYR A 1 47  ? -5.847  21.358 44.976 1.00 17.06 ? 55  TYR A CZ    1 
ATOM   375  O  OH    . TYR A 1 47  ? -6.260  21.195 46.268 1.00 19.90 ? 55  TYR A OH    1 
ATOM   376  N  N     . GLY A 1 48  ? -6.451  20.068 39.290 1.00 13.51 ? 56  GLY A N     1 
ATOM   377  C  CA    . GLY A 1 48  ? -7.478  19.068 39.094 1.00 14.08 ? 56  GLY A CA    1 
ATOM   378  C  C     . GLY A 1 48  ? -6.998  17.958 38.186 1.00 14.26 ? 56  GLY A C     1 
ATOM   379  O  O     . GLY A 1 48  ? -5.811  17.619 38.156 1.00 13.68 ? 56  GLY A O     1 
ATOM   380  N  N     . TRP A 1 49  ? -7.954  17.394 37.455 1.00 12.58 ? 57  TRP A N     1 
ATOM   381  C  CA    . TRP A 1 49  ? -7.716  16.196 36.633 1.00 11.79 ? 57  TRP A CA    1 
ATOM   382  C  C     . TRP A 1 49  ? -8.171  16.489 35.208 1.00 11.54 ? 57  TRP A C     1 
ATOM   383  O  O     . TRP A 1 49  ? -9.146  17.238 35.005 1.00 12.21 ? 57  TRP A O     1 
ATOM   384  C  CB    . TRP A 1 49  ? -8.567  15.061 37.179 1.00 12.89 ? 57  TRP A CB    1 
ATOM   385  C  CG    . TRP A 1 49  ? -8.134  14.610 38.541 1.00 12.27 ? 57  TRP A CG    1 
ATOM   386  C  CD1   . TRP A 1 49  ? -8.778  14.861 39.735 1.00 13.01 ? 57  TRP A CD1   1 
ATOM   387  C  CD2   . TRP A 1 49  ? -6.959  13.871 38.859 1.00 13.84 ? 57  TRP A CD2   1 
ATOM   388  N  NE1   . TRP A 1 49  ? -8.073  14.294 40.765 1.00 10.82 ? 57  TRP A NE1   1 
ATOM   389  C  CE2   . TRP A 1 49  ? -6.965  13.661 40.259 1.00 15.15 ? 57  TRP A CE2   1 
ATOM   390  C  CE3   . TRP A 1 49  ? -5.921  13.304 38.091 1.00 13.79 ? 57  TRP A CE3   1 
ATOM   391  C  CZ2   . TRP A 1 49  ? -5.958  12.949 40.919 1.00 14.16 ? 57  TRP A CZ2   1 
ATOM   392  C  CZ3   . TRP A 1 49  ? -4.917  12.586 38.744 1.00 15.45 ? 57  TRP A CZ3   1 
ATOM   393  C  CH2   . TRP A 1 49  ? -4.953  12.396 40.150 1.00 12.99 ? 57  TRP A CH2   1 
ATOM   394  N  N     . ALA A 1 50  ? -7.482  15.911 34.217 1.00 11.72 ? 58  ALA A N     1 
ATOM   395  C  CA    . ALA A 1 50  ? -7.868  16.105 32.813 1.00 13.60 ? 58  ALA A CA    1 
ATOM   396  C  C     . ALA A 1 50  ? -7.608  14.858 31.992 1.00 12.96 ? 58  ALA A C     1 
ATOM   397  O  O     . ALA A 1 50  ? -6.653  14.126 32.244 1.00 12.77 ? 58  ALA A O     1 
ATOM   398  C  CB    . ALA A 1 50  ? -7.102  17.300 32.203 1.00 14.04 ? 58  ALA A CB    1 
ATOM   399  N  N     . SER A 1 51  ? -8.442  14.648 30.980 1.00 13.21 ? 59  SER A N     1 
ATOM   400  C  CA    . SER A 1 51  ? -8.151  13.649 29.962 1.00 13.50 ? 59  SER A CA    1 
ATOM   401  C  C     . SER A 1 51  ? -8.446  14.246 28.589 1.00 14.60 ? 59  SER A C     1 
ATOM   402  O  O     . SER A 1 51  ? -9.229  15.218 28.486 1.00 13.63 ? 59  SER A O     1 
ATOM   403  C  CB    . SER A 1 51  ? -8.959  12.396 30.186 1.00 12.91 ? 59  SER A CB    1 
ATOM   404  O  OG    . SER A 1 51  ? -10.370 12.634 30.051 1.00 13.61 ? 59  SER A OG    1 
ATOM   405  N  N     . VAL A 1 52  ? -7.844  13.644 27.559 1.00 14.59 ? 60  VAL A N     1 
ATOM   406  C  CA    . VAL A 1 52  ? -8.050  14.113 26.182 1.00 16.38 ? 60  VAL A CA    1 
ATOM   407  C  C     . VAL A 1 52  ? -8.752  12.992 25.426 1.00 17.57 ? 60  VAL A C     1 
ATOM   408  O  O     . VAL A 1 52  ? -8.270  11.853 25.388 1.00 17.33 ? 60  VAL A O     1 
ATOM   409  C  CB    . VAL A 1 52  ? -6.707  14.493 25.508 1.00 16.38 ? 60  VAL A CB    1 
ATOM   410  C  CG1   . VAL A 1 52  ? -6.935  14.790 24.006 1.00 17.63 ? 60  VAL A CG1   1 
ATOM   411  C  CG2   . VAL A 1 52  ? -6.126  15.696 26.208 1.00 17.87 ? 60  VAL A CG2   1 
ATOM   412  N  N     . GLY A 1 53  ? -9.911  13.305 24.846 1.00 18.19 ? 61  GLY A N     1 
ATOM   413  C  CA    . GLY A 1 53  ? -10.716 12.274 24.187 1.00 20.14 ? 61  GLY A CA    1 
ATOM   414  C  C     . GLY A 1 53  ? -10.928 11.085 25.101 1.00 19.91 ? 61  GLY A C     1 
ATOM   415  O  O     . GLY A 1 53  ? -11.344 11.222 26.264 1.00 19.94 ? 61  GLY A O     1 
ATOM   416  N  N     . SER A 1 54  ? -10.591 9.904  24.611 1.00 20.67 ? 62  SER A N     1 
ATOM   417  C  CA    . SER A 1 54  ? -10.839 8.691  25.381 1.00 21.38 ? 62  SER A CA    1 
ATOM   418  C  C     . SER A 1 54  ? -9.588  8.256  26.152 1.00 21.31 ? 62  SER A C     1 
ATOM   419  O  O     . SER A 1 54  ? -9.519  7.120  26.652 1.00 22.52 ? 62  SER A O     1 
ATOM   420  C  CB    . SER A 1 54  ? -11.296 7.552  24.444 1.00 22.22 ? 62  SER A CB    1 
ATOM   421  O  OG    . SER A 1 54  ? -10.308 7.362  23.434 1.00 24.90 ? 62  SER A OG    1 
ATOM   422  N  N     . GLY A 1 55  ? -8.615  9.158  26.245 1.00 19.96 ? 63  GLY A N     1 
ATOM   423  C  CA    . GLY A 1 55  ? -7.355  8.903  26.936 1.00 18.26 ? 63  GLY A CA    1 
ATOM   424  C  C     . GLY A 1 55  ? -7.456  8.783  28.450 1.00 17.39 ? 63  GLY A C     1 
ATOM   425  O  O     . GLY A 1 55  ? -8.510  8.964  29.073 1.00 16.70 ? 63  GLY A O     1 
ATOM   426  N  N     . ASP A 1 56  ? -6.319  8.467  29.055 1.00 16.89 ? 64  ASP A N     1 
ATOM   427  C  CA    . ASP A 1 56  ? -6.241  8.339  30.490 1.00 16.15 ? 64  ASP A CA    1 
ATOM   428  C  C     . ASP A 1 56  ? -6.329  9.709  31.198 1.00 14.70 ? 64  ASP A C     1 
ATOM   429  O  O     . ASP A 1 56  ? -6.109  10.765 30.587 1.00 16.12 ? 64  ASP A O     1 
ATOM   430  C  CB    . ASP A 1 56  ? -4.934  7.652  30.847 1.00 17.09 ? 64  ASP A CB    1 
ATOM   431  C  CG    . ASP A 1 56  ? -4.945  6.140  30.550 1.00 19.94 ? 64  ASP A CG    1 
ATOM   432  O  OD1   . ASP A 1 56  ? -6.016  5.555  30.303 1.00 22.78 ? 64  ASP A OD1   1 
ATOM   433  O  OD2   . ASP A 1 56  ? -3.906  5.455  30.580 1.00 25.36 ? 64  ASP A OD2   1 
ATOM   434  N  N     . VAL A 1 57  ? -6.653  9.649  32.484 1.00 12.69 ? 65  VAL A N     1 
ATOM   435  C  CA    . VAL A 1 57  ? -6.813  10.844 33.308 1.00 13.40 ? 65  VAL A CA    1 
ATOM   436  C  C     . VAL A 1 57  ? -5.475  11.199 33.959 1.00 12.44 ? 65  VAL A C     1 
ATOM   437  O  O     . VAL A 1 57  ? -4.794  10.329 34.552 1.00 14.20 ? 65  VAL A O     1 
ATOM   438  C  CB    . VAL A 1 57  ? -7.892  10.607 34.400 1.00 12.89 ? 65  VAL A CB    1 
ATOM   439  C  CG1   . VAL A 1 57  ? -8.157  11.907 35.170 1.00 13.54 ? 65  VAL A CG1   1 
ATOM   440  C  CG2   . VAL A 1 57  ? -9.199  10.106 33.732 1.00 13.99 ? 65  VAL A CG2   1 
ATOM   441  N  N     . HIS A 1 58  ? -5.097  12.472 33.849 1.00 12.62 ? 66  HIS A N     1 
ATOM   442  C  CA    . HIS A 1 58  ? -3.789  12.955 34.318 1.00 13.14 ? 66  HIS A CA    1 
ATOM   443  C  C     . HIS A 1 58  ? -4.005  14.175 35.202 1.00 12.91 ? 66  HIS A C     1 
ATOM   444  O  O     . HIS A 1 58  ? -5.046  14.845 35.115 1.00 14.44 ? 66  HIS A O     1 
ATOM   445  C  CB    . HIS A 1 58  ? -2.899  13.373 33.136 1.00 14.10 ? 66  HIS A CB    1 
ATOM   446  C  CG    . HIS A 1 58  ? -2.667  12.270 32.143 1.00 16.02 ? 66  HIS A CG    1 
ATOM   447  N  ND1   . HIS A 1 58  ? -1.922  11.154 32.434 1.00 19.61 ? 66  HIS A ND1   1 
ATOM   448  C  CD2   . HIS A 1 58  ? -3.110  12.107 30.871 1.00 16.86 ? 66  HIS A CD2   1 
ATOM   449  C  CE1   . HIS A 1 58  ? -1.920  10.338 31.391 1.00 18.13 ? 66  HIS A CE1   1 
ATOM   450  N  NE2   . HIS A 1 58  ? -2.617  10.902 30.425 1.00 18.12 ? 66  HIS A NE2   1 
ATOM   451  N  N     . LYS A 1 59  ? -3.012  14.468 36.044 1.00 12.35 ? 67  LYS A N     1 
ATOM   452  C  CA    . LYS A 1 59  ? -3.046  15.709 36.840 1.00 13.38 ? 67  LYS A CA    1 
ATOM   453  C  C     . LYS A 1 59  ? -2.913  16.949 35.958 1.00 12.84 ? 67  LYS A C     1 
ATOM   454  O  O     . LYS A 1 59  ? -2.334  16.878 34.877 1.00 15.01 ? 67  LYS A O     1 
ATOM   455  C  CB    . LYS A 1 59  ? -1.941  15.680 37.893 1.00 11.82 ? 67  LYS A CB    1 
ATOM   456  C  CG    . LYS A 1 59  ? -2.129  14.503 38.863 1.00 12.19 ? 67  LYS A CG    1 
ATOM   457  C  CD    . LYS A 1 59  ? -1.003  14.493 39.904 1.00 14.35 ? 67  LYS A CD    1 
ATOM   458  C  CE    . LYS A 1 59  ? -1.195  13.364 40.930 1.00 13.77 ? 67  LYS A CE    1 
ATOM   459  N  NZ    . LYS A 1 59  ? -0.040  13.308 41.970 1.00 14.71 ? 67  LYS A NZ    1 
ATOM   460  N  N     . MET A 1 60  ? -3.456  18.068 36.416 1.00 12.61 ? 68  MET A N     1 
ATOM   461  C  CA    . MET A 1 60  ? -3.377  19.297 35.644 1.00 13.43 ? 68  MET A CA    1 
ATOM   462  C  C     . MET A 1 60  ? -3.482  20.513 36.554 1.00 13.79 ? 68  MET A C     1 
ATOM   463  O  O     . MET A 1 60  ? -3.874  20.413 37.737 1.00 12.88 ? 68  MET A O     1 
ATOM   464  C  CB    . MET A 1 60  ? -4.450  19.376 34.538 1.00 12.58 ? 68  MET A CB    1 
ATOM   465  C  CG    . MET A 1 60  ? -5.904  19.238 35.057 1.00 12.46 ? 68  MET A CG    1 
ATOM   466  S  SD    . MET A 1 60  ? -6.419  20.759 35.834 1.00 17.44 ? 68  MET A SD    1 
ATOM   467  C  CE    . MET A 1 60  ? -8.227  20.673 35.408 1.00 16.16 ? 68  MET A CE    1 
ATOM   468  N  N     . VAL A 1 61  ? -3.040  21.632 35.979 1.00 13.14 ? 69  VAL A N     1 
ATOM   469  C  CA    . VAL A 1 61  ? -3.280  22.952 36.575 1.00 12.61 ? 69  VAL A CA    1 
ATOM   470  C  C     . VAL A 1 61  ? -4.024  23.799 35.553 1.00 13.35 ? 69  VAL A C     1 
ATOM   471  O  O     . VAL A 1 61  ? -3.841  23.607 34.347 1.00 13.81 ? 69  VAL A O     1 
ATOM   472  C  CB    . VAL A 1 61  ? -2.003  23.676 37.009 1.00 12.88 ? 69  VAL A CB    1 
ATOM   473  C  CG1   . VAL A 1 61  ? -1.343  22.999 38.256 1.00 13.99 ? 69  VAL A CG1   1 
ATOM   474  C  CG2   . VAL A 1 61  ? -0.973  23.735 35.874 1.00 11.75 ? 69  VAL A CG2   1 
ATOM   475  N  N     . VAL A 1 62  ? -4.855  24.698 36.050 1.00 13.20 ? 70  VAL A N     1 
ATOM   476  C  CA    . VAL A 1 62  ? -5.608  25.621 35.190 1.00 13.34 ? 70  VAL A CA    1 
ATOM   477  C  C     . VAL A 1 62  ? -5.359  27.031 35.673 1.00 14.06 ? 70  VAL A C     1 
ATOM   478  O  O     . VAL A 1 62  ? -5.420  27.288 36.896 1.00 14.81 ? 70  VAL A O     1 
ATOM   479  C  CB    . VAL A 1 62  ? -7.156  25.337 35.330 1.00 14.77 ? 70  VAL A CB    1 
ATOM   480  C  CG1   . VAL A 1 62  ? -7.975  26.466 34.646 1.00 18.21 ? 70  VAL A CG1   1 
ATOM   481  C  CG2   . VAL A 1 62  ? -7.521  24.014 34.644 1.00 18.04 ? 70  VAL A CG2   1 
ATOM   482  N  N     . SER A 1 63  ? -5.083  27.951 34.738 1.00 12.90 ? 71  SER A N     1 
ATOM   483  C  CA    . SER A 1 63  ? -5.041  29.371 35.050 1.00 13.53 ? 71  SER A CA    1 
ATOM   484  C  C     . SER A 1 63  ? -6.297  30.055 34.525 1.00 14.43 ? 71  SER A C     1 
ATOM   485  O  O     . SER A 1 63  ? -6.566  29.996 33.329 1.00 14.50 ? 71  SER A O     1 
ATOM   486  C  CB    . SER A 1 63  ? -3.805  30.000 34.421 1.00 14.78 ? 71  SER A CB    1 
ATOM   487  O  OG    . SER A 1 63  ? -3.757  31.396 34.640 1.00 18.20 ? 71  SER A OG    1 
ATOM   488  N  N     . ILE A 1 64  ? -7.042  30.691 35.420 1.00 13.81 ? 72  ILE A N     1 
ATOM   489  C  CA    . ILE A 1 64  ? -8.216  31.488 35.023 1.00 15.08 ? 72  ILE A CA    1 
ATOM   490  C  C     . ILE A 1 64  ? -7.867  32.953 35.206 1.00 15.03 ? 72  ILE A C     1 
ATOM   491  O  O     . ILE A 1 64  ? -7.496  33.362 36.304 1.00 14.56 ? 72  ILE A O     1 
ATOM   492  C  CB    . ILE A 1 64  ? -9.434  31.086 35.868 1.00 14.24 ? 72  ILE A CB    1 
ATOM   493  C  CG1   . ILE A 1 64  ? -9.714  29.580 35.626 1.00 17.14 ? 72  ILE A CG1   1 
ATOM   494  C  CG2   . ILE A 1 64  ? -10.646 31.990 35.506 1.00 15.37 ? 72  ILE A CG2   1 
ATOM   495  C  CD1   . ILE A 1 64  ? -10.946 28.998 36.240 1.00 22.68 ? 72  ILE A CD1   1 
ATOM   496  N  N     . GLY A 1 65  ? -7.977  33.748 34.144 1.00 14.58 ? 73  GLY A N     1 
ATOM   497  C  CA    . GLY A 1 65  ? -7.592  35.138 34.210 1.00 13.93 ? 73  GLY A CA    1 
ATOM   498  C  C     . GLY A 1 65  ? -8.632  36.024 33.577 1.00 14.18 ? 73  GLY A C     1 
ATOM   499  O  O     . GLY A 1 65  ? -9.693  35.537 33.187 1.00 13.77 ? 73  GLY A O     1 
ATOM   500  N  N     . TRP A 1 66  ? -8.358  37.320 33.528 1.00 14.18 ? 74  TRP A N     1 
ATOM   501  C  CA    . TRP A 1 66  ? -9.239  38.236 32.817 1.00 16.30 ? 74  TRP A CA    1 
ATOM   502  C  C     . TRP A 1 66  ? -8.715  38.377 31.386 1.00 18.85 ? 74  TRP A C     1 
ATOM   503  O  O     . TRP A 1 66  ? -7.503  38.486 31.167 1.00 20.72 ? 74  TRP A O     1 
ATOM   504  C  CB    . TRP A 1 66  ? -9.250  39.589 33.512 1.00 15.78 ? 74  TRP A CB    1 
ATOM   505  C  CG    . TRP A 1 66  ? -9.890  39.550 34.862 1.00 15.46 ? 74  TRP A CG    1 
ATOM   506  C  CD1   . TRP A 1 66  ? -9.250  39.675 36.095 1.00 16.77 ? 74  TRP A CD1   1 
ATOM   507  C  CD2   . TRP A 1 66  ? -11.276 39.390 35.144 1.00 13.69 ? 74  TRP A CD2   1 
ATOM   508  N  NE1   . TRP A 1 66  ? -10.182 39.607 37.105 1.00 15.62 ? 74  TRP A NE1   1 
ATOM   509  C  CE2   . TRP A 1 66  ? -11.427 39.423 36.558 1.00 16.49 ? 74  TRP A CE2   1 
ATOM   510  C  CE3   . TRP A 1 66  ? -12.422 39.216 34.352 1.00 14.49 ? 74  TRP A CE3   1 
ATOM   511  C  CZ2   . TRP A 1 66  ? -12.667 39.292 37.181 1.00 17.17 ? 74  TRP A CZ2   1 
ATOM   512  C  CZ3   . TRP A 1 66  ? -13.655 39.095 34.962 1.00 18.37 ? 74  TRP A CZ3   1 
ATOM   513  C  CH2   . TRP A 1 66  ? -13.770 39.135 36.386 1.00 18.45 ? 74  TRP A CH2   1 
ATOM   514  N  N     . ASN A 1 67  ? -9.639  38.302 30.438 1.00 20.50 ? 75  ASN A N     1 
ATOM   515  C  CA    . ASN A 1 67  ? -9.355  38.560 29.032 1.00 22.04 ? 75  ASN A CA    1 
ATOM   516  C  C     . ASN A 1 67  ? -9.415  40.063 28.745 1.00 22.48 ? 75  ASN A C     1 
ATOM   517  O  O     . ASN A 1 67  ? -10.515 40.685 28.792 1.00 22.72 ? 75  ASN A O     1 
ATOM   518  C  CB    . ASN A 1 67  ? -10.341 37.803 28.142 1.00 22.58 ? 75  ASN A CB    1 
ATOM   519  C  CG    . ASN A 1 67  ? -9.941  37.812 26.669 1.00 25.84 ? 75  ASN A CG    1 
ATOM   520  O  OD1   . ASN A 1 67  ? -9.109  38.613 26.224 1.00 28.69 ? 75  ASN A OD1   1 
ATOM   521  N  ND2   . ASN A 1 67  ? -10.557 36.919 25.904 1.00 27.33 ? 75  ASN A ND2   1 
ATOM   522  N  N     . PRO A 1 68  ? -8.234  40.616 28.432 1.00 22.56 ? 76  PRO A N     1 
ATOM   523  C  CA    . PRO A 1 68  ? -8.074  42.015 27.971 1.00 24.89 ? 76  PRO A CA    1 
ATOM   524  C  C     . PRO A 1 68  ? -8.865  42.389 26.681 1.00 25.23 ? 76  PRO A C     1 
ATOM   525  O  O     . PRO A 1 68  ? -9.254  43.547 26.457 1.00 26.90 ? 76  PRO A O     1 
ATOM   526  C  CB    . PRO A 1 68  ? -6.543  42.117 27.706 1.00 24.10 ? 76  PRO A CB    1 
ATOM   527  C  CG    . PRO A 1 68  ? -5.899  40.994 28.471 1.00 24.60 ? 76  PRO A CG    1 
ATOM   528  C  CD    . PRO A 1 68  ? -6.945  39.895 28.487 1.00 22.84 ? 76  PRO A CD    1 
ATOM   529  N  N     . TYR A 1 69  ? -9.149  41.396 25.859 1.00 26.23 ? 77  TYR A N     1 
ATOM   530  C  CA    . TYR A 1 69  ? -9.480  41.623 24.448 1.00 26.77 ? 77  TYR A CA    1 
ATOM   531  C  C     . TYR A 1 69  ? -10.955 41.584 24.052 1.00 27.15 ? 77  TYR A C     1 
ATOM   532  O  O     . TYR A 1 69  ? -11.305 42.000 22.932 1.00 27.55 ? 77  TYR A O     1 
ATOM   533  C  CB    . TYR A 1 69  ? -8.672  40.673 23.561 1.00 26.18 ? 77  TYR A CB    1 
ATOM   534  C  CG    . TYR A 1 69  ? -7.182  40.718 23.815 1.00 26.30 ? 77  TYR A CG    1 
ATOM   535  C  CD1   . TYR A 1 69  ? -6.459  41.887 23.632 1.00 27.30 ? 77  TYR A CD1   1 
ATOM   536  C  CD2   . TYR A 1 69  ? -6.496  39.572 24.247 1.00 29.39 ? 77  TYR A CD2   1 
ATOM   537  C  CE1   . TYR A 1 69  ? -5.096  41.921 23.861 1.00 27.98 ? 77  TYR A CE1   1 
ATOM   538  C  CE2   . TYR A 1 69  ? -5.134  39.594 24.464 1.00 28.16 ? 77  TYR A CE2   1 
ATOM   539  C  CZ    . TYR A 1 69  ? -4.445  40.769 24.268 1.00 29.33 ? 77  TYR A CZ    1 
ATOM   540  O  OH    . TYR A 1 69  ? -3.094  40.787 24.513 1.00 31.10 ? 77  TYR A OH    1 
ATOM   541  N  N     . TYR A 1 70  ? -11.823 41.073 24.918 1.00 26.79 ? 78  TYR A N     1 
ATOM   542  C  CA    . TYR A 1 70  ? -13.241 41.044 24.560 1.00 27.46 ? 78  TYR A CA    1 
ATOM   543  C  C     . TYR A 1 70  ? -14.048 42.087 25.305 1.00 28.59 ? 78  TYR A C     1 
ATOM   544  O  O     . TYR A 1 70  ? -13.740 42.410 26.453 1.00 28.72 ? 78  TYR A O     1 
ATOM   545  C  CB    . TYR A 1 70  ? -13.861 39.686 24.847 1.00 28.11 ? 78  TYR A CB    1 
ATOM   546  C  CG    . TYR A 1 70  ? -13.252 38.531 24.095 1.00 27.36 ? 78  TYR A CG    1 
ATOM   547  C  CD1   . TYR A 1 70  ? -12.467 38.734 22.938 1.00 26.32 ? 78  TYR A CD1   1 
ATOM   548  C  CD2   . TYR A 1 70  ? -13.474 37.220 24.542 1.00 28.65 ? 78  TYR A CD2   1 
ATOM   549  C  CE1   . TYR A 1 70  ? -11.916 37.643 22.250 1.00 25.95 ? 78  TYR A CE1   1 
ATOM   550  C  CE2   . TYR A 1 70  ? -12.944 36.132 23.865 1.00 29.31 ? 78  TYR A CE2   1 
ATOM   551  C  CZ    . TYR A 1 70  ? -12.170 36.345 22.723 1.00 26.59 ? 78  TYR A CZ    1 
ATOM   552  O  OH    . TYR A 1 70  ? -11.664 35.231 22.111 1.00 25.46 ? 78  TYR A OH    1 
ATOM   553  N  N     . LYS A 1 71  ? -15.099 42.586 24.661 1.00 29.39 ? 79  LYS A N     1 
ATOM   554  C  CA    . LYS A 1 71  ? -15.997 43.529 25.324 1.00 31.02 ? 79  LYS A CA    1 
ATOM   555  C  C     . LYS A 1 71  ? -16.792 42.816 26.419 1.00 31.61 ? 79  LYS A C     1 
ATOM   556  O  O     . LYS A 1 71  ? -16.780 41.570 26.523 1.00 31.10 ? 79  LYS A O     1 
ATOM   557  C  CB    . LYS A 1 71  ? -16.902 44.280 24.335 1.00 31.25 ? 79  LYS A CB    1 
ATOM   558  C  CG    . LYS A 1 71  ? -17.772 43.391 23.496 1.00 32.45 ? 79  LYS A CG    1 
ATOM   559  C  CD    . LYS A 1 71  ? -18.715 44.243 22.669 1.00 34.12 ? 79  LYS A CD    1 
ATOM   560  C  CE    . LYS A 1 71  ? -19.596 43.365 21.812 1.00 35.93 ? 79  LYS A CE    1 
ATOM   561  N  NZ    . LYS A 1 71  ? -20.830 44.096 21.419 1.00 34.67 ? 79  LYS A NZ    1 
ATOM   562  N  N     . ASN A 1 72  ? -17.490 43.623 27.217 1.00 32.66 ? 80  ASN A N     1 
ATOM   563  C  CA    . ASN A 1 72  ? -17.923 43.223 28.547 1.00 33.18 ? 80  ASN A CA    1 
ATOM   564  C  C     . ASN A 1 72  ? -16.672 42.941 29.386 1.00 32.83 ? 80  ASN A C     1 
ATOM   565  O  O     . ASN A 1 72  ? -15.667 43.690 29.317 1.00 34.07 ? 80  ASN A O     1 
ATOM   566  C  CB    . ASN A 1 72  ? -18.911 42.036 28.517 1.00 33.71 ? 80  ASN A CB    1 
ATOM   567  C  CG    . ASN A 1 72  ? -19.989 42.181 27.445 1.00 35.58 ? 80  ASN A CG    1 
ATOM   568  O  OD1   . ASN A 1 72  ? -20.437 43.296 27.118 1.00 35.54 ? 80  ASN A OD1   1 
ATOM   569  N  ND2   . ASN A 1 72  ? -20.413 41.042 26.887 1.00 38.81 ? 80  ASN A ND2   1 
ATOM   570  N  N     . THR A 1 73  ? -16.708 41.866 30.156 1.00 31.00 ? 81  THR A N     1 
ATOM   571  C  CA    . THR A 1 73  ? -15.659 41.620 31.131 1.00 29.69 ? 81  THR A CA    1 
ATOM   572  C  C     . THR A 1 73  ? -15.437 40.119 31.236 1.00 27.41 ? 81  THR A C     1 
ATOM   573  O  O     . THR A 1 73  ? -15.857 39.479 32.202 1.00 28.68 ? 81  THR A O     1 
ATOM   574  C  CB    . THR A 1 73  ? -16.077 42.248 32.481 1.00 29.93 ? 81  THR A CB    1 
ATOM   575  O  OG1   . THR A 1 73  ? -16.069 43.679 32.335 1.00 31.71 ? 81  THR A OG1   1 
ATOM   576  C  CG2   . THR A 1 73  ? -15.033 42.004 33.539 1.00 30.89 ? 81  THR A CG2   1 
ATOM   577  N  N     . LYS A 1 74  ? -14.751 39.567 30.240 1.00 24.12 ? 82  LYS A N     1 
ATOM   578  C  CA    . LYS A 1 74  ? -14.700 38.126 30.072 1.00 20.72 ? 82  LYS A CA    1 
ATOM   579  C  C     . LYS A 1 74  ? -13.430 37.518 30.672 1.00 18.64 ? 82  LYS A C     1 
ATOM   580  O  O     . LYS A 1 74  ? -12.405 38.169 30.799 1.00 18.28 ? 82  LYS A O     1 
ATOM   581  C  CB    . LYS A 1 74  ? -14.864 37.722 28.600 1.00 21.29 ? 82  LYS A CB    1 
ATOM   582  C  CG    . LYS A 1 74  ? -16.130 38.310 27.873 1.00 23.11 ? 82  LYS A CG    1 
ATOM   583  C  CD    . LYS A 1 74  ? -17.455 37.749 28.464 1.00 27.23 ? 82  LYS A CD    1 
ATOM   584  C  CE    . LYS A 1 74  ? -18.659 37.979 27.536 1.00 30.59 ? 82  LYS A CE    1 
ATOM   585  N  NZ    . LYS A 1 74  ? -18.713 36.937 26.462 1.00 33.96 ? 82  LYS A NZ    1 
ATOM   586  N  N     . LYS A 1 75  ? -13.536 36.256 31.050 1.00 17.14 ? 83  LYS A N     1 
ATOM   587  C  CA    . LYS A 1 75  ? -12.419 35.548 31.592 1.00 15.51 ? 83  LYS A CA    1 
ATOM   588  C  C     . LYS A 1 75  ? -11.736 34.716 30.527 1.00 15.91 ? 83  LYS A C     1 
ATOM   589  O  O     . LYS A 1 75  ? -12.252 34.545 29.435 1.00 15.90 ? 83  LYS A O     1 
ATOM   590  C  CB    . LYS A 1 75  ? -12.853 34.652 32.734 1.00 15.13 ? 83  LYS A CB    1 
ATOM   591  C  CG    . LYS A 1 75  ? -13.286 35.445 33.949 1.00 18.32 ? 83  LYS A CG    1 
ATOM   592  C  CD    . LYS A 1 75  ? -13.724 34.523 35.052 1.00 18.23 ? 83  LYS A CD    1 
ATOM   593  C  CE    . LYS A 1 75  ? -13.994 35.319 36.341 1.00 22.01 ? 83  LYS A CE    1 
ATOM   594  N  NZ    . LYS A 1 75  ? -15.435 35.623 36.434 1.00 23.68 ? 83  LYS A NZ    1 
ATOM   595  N  N     . SER A 1 76  ? -10.553 34.234 30.862 1.00 14.12 ? 84  SER A N     1 
ATOM   596  C  CA    . SER A 1 76  ? -9.811  33.293 30.016 1.00 14.62 ? 84  SER A CA    1 
ATOM   597  C  C     . SER A 1 76  ? -9.463  32.064 30.839 1.00 14.80 ? 84  SER A C     1 
ATOM   598  O  O     . SER A 1 76  ? -9.452  32.139 32.072 1.00 15.55 ? 84  SER A O     1 
ATOM   599  C  CB    A SER A 1 76  ? -8.516  33.950 29.548 0.50 14.94 ? 84  SER A CB    1 
ATOM   600  C  CB    B SER A 1 76  ? -8.574  33.949 29.427 0.50 15.35 ? 84  SER A CB    1 
ATOM   601  O  OG    A SER A 1 76  ? -7.695  34.318 30.655 0.50 15.27 ? 84  SER A OG    1 
ATOM   602  O  OG    B SER A 1 76  ? -8.928  34.712 28.285 0.50 19.27 ? 84  SER A OG    1 
ATOM   603  N  N     . MET A 1 77  ? -9.240  30.925 30.187 1.00 11.71 ? 85  MET A N     1 
ATOM   604  C  CA    . MET A 1 77  ? -8.907  29.709 30.916 1.00 13.04 ? 85  MET A CA    1 
ATOM   605  C  C     . MET A 1 77  ? -7.928  28.933 30.063 1.00 13.51 ? 85  MET A C     1 
ATOM   606  O  O     . MET A 1 77  ? -8.159  28.789 28.852 1.00 13.69 ? 85  MET A O     1 
ATOM   607  C  CB    . MET A 1 77  ? -10.180 28.881 31.156 1.00 14.49 ? 85  MET A CB    1 
ATOM   608  C  CG    . MET A 1 77  ? -10.018 27.478 31.618 1.00 17.55 ? 85  MET A CG    1 
ATOM   609  S  SD    A MET A 1 77  ? -11.719 26.723 31.539 0.50 19.73 ? 85  MET A SD    1 
ATOM   610  S  SD    B MET A 1 77  ? -11.478 26.706 32.409 0.50 22.00 ? 85  MET A SD    1 
ATOM   611  C  CE    A MET A 1 77  ? -11.193 25.164 32.336 0.50 17.51 ? 85  MET A CE    1 
ATOM   612  C  CE    B MET A 1 77  ? -12.653 27.615 31.595 0.50 14.29 ? 85  MET A CE    1 
ATOM   613  N  N     . GLU A 1 78  ? -6.876  28.430 30.701 1.00 12.78 ? 86  GLU A N     1 
ATOM   614  C  CA    . GLU A 1 78  ? -5.932  27.566 30.002 1.00 12.76 ? 86  GLU A CA    1 
ATOM   615  C  C     . GLU A 1 78  ? -5.437  26.483 30.946 1.00 13.37 ? 86  GLU A C     1 
ATOM   616  O  O     . GLU A 1 78  ? -5.285  26.707 32.162 1.00 14.85 ? 86  GLU A O     1 
ATOM   617  C  CB    . GLU A 1 78  ? -4.788  28.397 29.424 1.00 13.88 ? 86  GLU A CB    1 
ATOM   618  C  CG    . GLU A 1 78  ? -3.926  29.022 30.499 1.00 16.30 ? 86  GLU A CG    1 
ATOM   619  C  CD    . GLU A 1 78  ? -2.780  29.834 29.947 1.00 20.53 ? 86  GLU A CD    1 
ATOM   620  O  OE1   . GLU A 1 78  ? -2.634  30.001 28.704 1.00 20.51 ? 86  GLU A OE1   1 
ATOM   621  O  OE2   . GLU A 1 78  ? -2.002  30.329 30.801 1.00 21.90 ? 86  GLU A OE2   1 
ATOM   622  N  N     . THR A 1 79  ? -5.238  25.307 30.381 1.00 12.03 ? 87  THR A N     1 
ATOM   623  C  CA    . THR A 1 79  ? -4.932  24.122 31.174 1.00 12.29 ? 87  THR A CA    1 
ATOM   624  C  C     . THR A 1 79  ? -3.616  23.532 30.743 1.00 12.23 ? 87  THR A C     1 
ATOM   625  O  O     . THR A 1 79  ? -3.432  23.251 29.552 1.00 12.82 ? 87  THR A O     1 
ATOM   626  C  CB    . THR A 1 79  ? -6.083  23.085 30.904 1.00 12.55 ? 87  THR A CB    1 
ATOM   627  O  OG1   . THR A 1 79  ? -7.349  23.657 31.359 1.00 13.55 ? 87  THR A OG1   1 
ATOM   628  C  CG2   . THR A 1 79  ? -5.856  21.835 31.726 1.00 14.84 ? 87  THR A CG2   1 
ATOM   629  N  N     . HIS A 1 80  ? -2.724  23.305 31.716 1.00 11.65 ? 88  HIS A N     1 
ATOM   630  C  CA    . HIS A 1 80  ? -1.500  22.574 31.439 1.00 11.47 ? 88  HIS A CA    1 
ATOM   631  C  C     . HIS A 1 80  ? -1.650  21.200 32.075 1.00 12.43 ? 88  HIS A C     1 
ATOM   632  O  O     . HIS A 1 80  ? -1.909  21.102 33.286 1.00 12.43 ? 88  HIS A O     1 
ATOM   633  C  CB    . HIS A 1 80  ? -0.309  23.232 32.094 1.00 11.02 ? 88  HIS A CB    1 
ATOM   634  C  CG    . HIS A 1 80  ? 0.922   22.382 32.005 1.00 12.56 ? 88  HIS A CG    1 
ATOM   635  N  ND1   . HIS A 1 80  ? 1.525   22.065 30.813 1.00 13.54 ? 88  HIS A ND1   1 
ATOM   636  C  CD2   . HIS A 1 80  ? 1.585   21.697 32.960 1.00 14.68 ? 88  HIS A CD2   1 
ATOM   637  C  CE1   . HIS A 1 80  ? 2.551   21.257 31.040 1.00 14.82 ? 88  HIS A CE1   1 
ATOM   638  N  NE2   . HIS A 1 80  ? 2.618   21.028 32.341 1.00 13.48 ? 88  HIS A NE2   1 
ATOM   639  N  N     . ILE A 1 81  ? -1.526  20.153 31.271 1.00 12.31 ? 89  ILE A N     1 
ATOM   640  C  CA    . ILE A 1 81  ? -1.630  18.789 31.774 1.00 12.76 ? 89  ILE A CA    1 
ATOM   641  C  C     . ILE A 1 81  ? -0.227  18.260 32.125 1.00 12.66 ? 89  ILE A C     1 
ATOM   642  O  O     . ILE A 1 81  ? 0.708   18.376 31.323 1.00 13.04 ? 89  ILE A O     1 
ATOM   643  C  CB    . ILE A 1 81  ? -2.295  17.888 30.736 1.00 13.04 ? 89  ILE A CB    1 
ATOM   644  C  CG1   . ILE A 1 81  ? -3.690  18.439 30.345 1.00 13.15 ? 89  ILE A CG1   1 
ATOM   645  C  CG2   . ILE A 1 81  ? -2.457  16.423 31.298 1.00 13.45 ? 89  ILE A CG2   1 
ATOM   646  C  CD1   . ILE A 1 81  ? -4.316  17.666 29.158 1.00 17.47 ? 89  ILE A CD1   1 
ATOM   647  N  N     . MET A 1 82  ? -0.111  17.638 33.297 1.00 12.68 ? 90  MET A N     1 
ATOM   648  C  CA    . MET A 1 82  ? 1.146   17.010 33.731 1.00 13.71 ? 90  MET A CA    1 
ATOM   649  C  C     . MET A 1 82  ? 1.284   15.626 33.094 1.00 14.31 ? 90  MET A C     1 
ATOM   650  O  O     . MET A 1 82  ? 1.170   14.569 33.747 1.00 14.87 ? 90  MET A O     1 
ATOM   651  C  CB    . MET A 1 82  ? 1.224   17.010 35.273 1.00 13.97 ? 90  MET A CB    1 
ATOM   652  C  CG    . MET A 1 82  ? 1.668   18.334 35.806 1.00 16.74 ? 90  MET A CG    1 
ATOM   653  S  SD    . MET A 1 82  ? 0.270   19.496 36.084 1.00 16.12 ? 90  MET A SD    1 
ATOM   654  C  CE    . MET A 1 82  ? -0.137  19.057 37.796 1.00 15.65 ? 90  MET A CE    1 
ATOM   655  N  N     . HIS A 1 83  ? 1.507   15.649 31.787 1.00 13.98 ? 91  HIS A N     1 
ATOM   656  C  CA    . HIS A 1 83  ? 1.714   14.420 31.023 1.00 14.27 ? 91  HIS A CA    1 
ATOM   657  C  C     . HIS A 1 83  ? 2.406   14.805 29.734 1.00 15.51 ? 91  HIS A C     1 
ATOM   658  O  O     . HIS A 1 83  ? 2.079   15.821 29.127 1.00 14.48 ? 91  HIS A O     1 
ATOM   659  C  CB    . HIS A 1 83  ? 0.380   13.710 30.734 1.00 14.85 ? 91  HIS A CB    1 
ATOM   660  C  CG    . HIS A 1 83  ? 0.521   12.487 29.871 1.00 16.59 ? 91  HIS A CG    1 
ATOM   661  N  ND1   . HIS A 1 83  ? 1.074   11.306 30.330 1.00 18.49 ? 91  HIS A ND1   1 
ATOM   662  C  CD2   . HIS A 1 83  ? 0.169   12.264 28.581 1.00 17.11 ? 91  HIS A CD2   1 
ATOM   663  C  CE1   . HIS A 1 83  ? 1.057   10.409 29.357 1.00 15.48 ? 91  HIS A CE1   1 
ATOM   664  N  NE2   . HIS A 1 83  ? 0.524   10.970 28.282 1.00 16.95 ? 91  HIS A NE2   1 
ATOM   665  N  N     . THR A 1 84  ? 3.394   14.010 29.331 1.00 15.52 ? 92  THR A N     1 
ATOM   666  C  CA    . THR A 1 84  ? 4.055   14.244 28.038 1.00 17.32 ? 92  THR A CA    1 
ATOM   667  C  C     . THR A 1 84  ? 3.282   13.592 26.909 1.00 18.18 ? 92  THR A C     1 
ATOM   668  O  O     . THR A 1 84  ? 3.194   12.361 26.856 1.00 18.05 ? 92  THR A O     1 
ATOM   669  C  CB    . THR A 1 84  ? 5.498   13.716 28.066 1.00 18.53 ? 92  THR A CB    1 
ATOM   670  O  OG1   . THR A 1 84  ? 6.178   14.354 29.138 1.00 18.56 ? 92  THR A OG1   1 
ATOM   671  C  CG2   . THR A 1 84  ? 6.243   14.185 26.816 1.00 19.29 ? 92  THR A CG2   1 
ATOM   672  N  N     . PHE A 1 85  ? 2.742   14.413 26.012 1.00 18.67 ? 93  PHE A N     1 
ATOM   673  C  CA    . PHE A 1 85  ? 2.022   13.924 24.838 1.00 20.45 ? 93  PHE A CA    1 
ATOM   674  C  C     . PHE A 1 85  ? 2.971   13.893 23.653 1.00 22.25 ? 93  PHE A C     1 
ATOM   675  O  O     . PHE A 1 85  ? 3.828   14.775 23.522 1.00 24.04 ? 93  PHE A O     1 
ATOM   676  C  CB    . PHE A 1 85  ? 0.841   14.850 24.499 1.00 18.87 ? 93  PHE A CB    1 
ATOM   677  C  CG    . PHE A 1 85  ? -0.284  14.808 25.515 1.00 17.55 ? 93  PHE A CG    1 
ATOM   678  C  CD1   . PHE A 1 85  ? -0.226  15.592 26.661 1.00 18.00 ? 93  PHE A CD1   1 
ATOM   679  C  CD2   . PHE A 1 85  ? -1.403  13.980 25.306 1.00 18.07 ? 93  PHE A CD2   1 
ATOM   680  C  CE1   . PHE A 1 85  ? -1.287  15.577 27.604 1.00 17.38 ? 93  PHE A CE1   1 
ATOM   681  C  CE2   . PHE A 1 85  ? -2.446  13.935 26.234 1.00 19.70 ? 93  PHE A CE2   1 
ATOM   682  C  CZ    . PHE A 1 85  ? -2.384  14.732 27.390 1.00 18.36 ? 93  PHE A CZ    1 
ATOM   683  N  N     . LYS A 1 86  ? 2.756   12.927 22.769 1.00 25.07 ? 94  LYS A N     1 
ATOM   684  C  CA    . LYS A 1 86  ? 3.634   12.685 21.612 1.00 26.55 ? 94  LYS A CA    1 
ATOM   685  C  C     . LYS A 1 86  ? 3.211   13.533 20.429 1.00 26.46 ? 94  LYS A C     1 
ATOM   686  O  O     . LYS A 1 86  ? 3.979   13.734 19.495 1.00 26.38 ? 94  LYS A O     1 
ATOM   687  C  CB    . LYS A 1 86  ? 3.594   11.209 21.195 1.00 27.29 ? 94  LYS A CB    1 
ATOM   688  C  CG    . LYS A 1 86  ? 3.849   10.215 22.331 1.00 31.12 ? 94  LYS A CG    1 
ATOM   689  C  CD    . LYS A 1 86  ? 5.287   9.653  22.306 1.00 34.31 ? 94  LYS A CD    1 
ATOM   690  C  CE    . LYS A 1 86  ? 5.364   8.304  21.564 1.00 37.22 ? 94  LYS A CE    1 
ATOM   691  N  NZ    . LYS A 1 86  ? 4.267   7.381  21.977 1.00 38.04 ? 94  LYS A NZ    1 
ATOM   692  N  N     . GLU A 1 87  ? 1.969   14.009 20.454 1.00 25.46 ? 95  GLU A N     1 
ATOM   693  C  CA    . GLU A 1 87  ? 1.526   14.965 19.446 1.00 25.20 ? 95  GLU A CA    1 
ATOM   694  C  C     . GLU A 1 87  ? 0.569   15.938 20.050 1.00 23.60 ? 95  GLU A C     1 
ATOM   695  O  O     . GLU A 1 87  ? 0.048   15.692 21.136 1.00 23.00 ? 95  GLU A O     1 
ATOM   696  C  CB    . GLU A 1 87  ? 0.847   14.308 18.245 1.00 25.69 ? 95  GLU A CB    1 
ATOM   697  C  CG    . GLU A 1 87  ? -0.219  13.272 18.514 1.00 29.47 ? 95  GLU A CG    1 
ATOM   698  C  CD    . GLU A 1 87  ? -0.261  12.255 17.387 1.00 35.06 ? 95  GLU A CD    1 
ATOM   699  O  OE1   . GLU A 1 87  ? 0.819   11.942 16.824 1.00 38.04 ? 95  GLU A OE1   1 
ATOM   700  O  OE2   . GLU A 1 87  ? -1.359  11.776 17.041 1.00 37.29 ? 95  GLU A OE2   1 
ATOM   701  N  N     . ASP A 1 88  ? 0.331   17.021 19.323 1.00 22.15 ? 96  ASP A N     1 
ATOM   702  C  CA    . ASP A 1 88  ? -0.696  17.971 19.711 1.00 20.97 ? 96  ASP A CA    1 
ATOM   703  C  C     . ASP A 1 88  ? -2.063  17.330 19.625 1.00 19.78 ? 96  ASP A C     1 
ATOM   704  O  O     . ASP A 1 88  ? -2.248  16.275 18.996 1.00 19.86 ? 96  ASP A O     1 
ATOM   705  C  CB    . ASP A 1 88  ? -0.649  19.187 18.804 1.00 21.90 ? 96  ASP A CB    1 
ATOM   706  C  CG    . ASP A 1 88  ? 0.564   20.070 19.070 1.00 24.67 ? 96  ASP A CG    1 
ATOM   707  O  OD1   . ASP A 1 88  ? 1.188   20.000 20.165 1.00 23.02 ? 96  ASP A OD1   1 
ATOM   708  O  OD2   . ASP A 1 88  ? 0.961   20.877 18.209 1.00 28.42 ? 96  ASP A OD2   1 
ATOM   709  N  N     . PHE A 1 89  ? -3.036  17.976 20.265 1.00 17.57 ? 97  PHE A N     1 
ATOM   710  C  CA    . PHE A 1 89  ? -4.392  17.467 20.237 1.00 17.03 ? 97  PHE A CA    1 
ATOM   711  C  C     . PHE A 1 89  ? -5.427  18.527 19.953 1.00 16.18 ? 97  PHE A C     1 
ATOM   712  O  O     . PHE A 1 89  ? -6.515  18.531 20.544 1.00 15.59 ? 97  PHE A O     1 
ATOM   713  C  CB    . PHE A 1 89  ? -4.714  16.676 21.530 1.00 16.22 ? 97  PHE A CB    1 
ATOM   714  C  CG    . PHE A 1 89  ? -4.274  17.335 22.823 1.00 14.68 ? 97  PHE A CG    1 
ATOM   715  C  CD1   . PHE A 1 89  ? -5.121  18.243 23.496 1.00 13.93 ? 97  PHE A CD1   1 
ATOM   716  C  CD2   . PHE A 1 89  ? -3.069  16.960 23.432 1.00 15.01 ? 97  PHE A CD2   1 
ATOM   717  C  CE1   . PHE A 1 89  ? -4.718  18.810 24.731 1.00 14.02 ? 97  PHE A CE1   1 
ATOM   718  C  CE2   . PHE A 1 89  ? -2.678  17.512 24.671 1.00 12.97 ? 97  PHE A CE2   1 
ATOM   719  C  CZ    . PHE A 1 89  ? -3.526  18.430 25.322 1.00 13.75 ? 97  PHE A CZ    1 
ATOM   720  N  N     . TYR A 1 90  ? -5.102  19.429 19.024 1.00 16.27 ? 98  TYR A N     1 
ATOM   721  C  CA    . TYR A 1 90  ? -6.051  20.459 18.624 1.00 16.17 ? 98  TYR A CA    1 
ATOM   722  C  C     . TYR A 1 90  ? -7.278  19.798 18.045 1.00 16.10 ? 98  TYR A C     1 
ATOM   723  O  O     . TYR A 1 90  ? -7.150  18.837 17.247 1.00 16.93 ? 98  TYR A O     1 
ATOM   724  C  CB    . TYR A 1 90  ? -5.408  21.368 17.587 1.00 16.25 ? 98  TYR A CB    1 
ATOM   725  C  CG    . TYR A 1 90  ? -4.445  22.328 18.219 1.00 14.44 ? 98  TYR A CG    1 
ATOM   726  C  CD1   . TYR A 1 90  ? -4.906  23.403 18.987 1.00 13.84 ? 98  TYR A CD1   1 
ATOM   727  C  CD2   . TYR A 1 90  ? -3.085  22.148 18.100 1.00 16.02 ? 98  TYR A CD2   1 
ATOM   728  C  CE1   . TYR A 1 90  ? -3.993  24.283 19.606 1.00 11.84 ? 98  TYR A CE1   1 
ATOM   729  C  CE2   . TYR A 1 90  ? -2.146  23.030 18.715 1.00 15.15 ? 98  TYR A CE2   1 
ATOM   730  C  CZ    . TYR A 1 90  ? -2.615  24.089 19.462 1.00 12.83 ? 98  TYR A CZ    1 
ATOM   731  O  OH    . TYR A 1 90  ? -1.695  24.957 20.023 1.00 13.45 ? 98  TYR A OH    1 
ATOM   732  N  N     . GLY A 1 91  ? -8.443  20.318 18.425 1.00 15.69 ? 99  GLY A N     1 
ATOM   733  C  CA    . GLY A 1 91  ? -9.736  19.813 17.950 1.00 16.61 ? 99  GLY A CA    1 
ATOM   734  C  C     . GLY A 1 91  ? -10.285 18.626 18.740 1.00 16.87 ? 99  GLY A C     1 
ATOM   735  O  O     . GLY A 1 91  ? -11.458 18.292 18.594 1.00 17.63 ? 99  GLY A O     1 
ATOM   736  N  N     . GLU A 1 92  ? -9.451  17.971 19.552 1.00 16.94 ? 100 GLU A N     1 
ATOM   737  C  CA    . GLU A 1 92  ? -9.926  16.870 20.411 1.00 16.47 ? 100 GLU A CA    1 
ATOM   738  C  C     . GLU A 1 92  ? -10.687 17.463 21.580 1.00 15.43 ? 100 GLU A C     1 
ATOM   739  O  O     . GLU A 1 92  ? -10.548 18.651 21.877 1.00 16.06 ? 100 GLU A O     1 
ATOM   740  C  CB    . GLU A 1 92  ? -8.775  16.022 20.933 1.00 16.42 ? 100 GLU A CB    1 
ATOM   741  C  CG    . GLU A 1 92  ? -7.951  15.331 19.833 1.00 21.71 ? 100 GLU A CG    1 
ATOM   742  C  CD    . GLU A 1 92  ? -8.757  14.288 19.112 1.00 31.50 ? 100 GLU A CD    1 
ATOM   743  O  OE1   . GLU A 1 92  ? -8.876  13.157 19.646 1.00 37.31 ? 100 GLU A OE1   1 
ATOM   744  O  OE2   . GLU A 1 92  ? -9.305  14.596 18.023 1.00 38.59 ? 100 GLU A OE2   1 
ATOM   745  N  N     . ILE A 1 93  ? -11.476 16.647 22.266 1.00 14.49 ? 101 ILE A N     1 
ATOM   746  C  CA    . ILE A 1 93  ? -12.175 17.157 23.446 1.00 13.96 ? 101 ILE A CA    1 
ATOM   747  C  C     . ILE A 1 93  ? -11.328 16.980 24.703 1.00 14.24 ? 101 ILE A C     1 
ATOM   748  O  O     . ILE A 1 93  ? -10.920 15.864 25.032 1.00 15.92 ? 101 ILE A O     1 
ATOM   749  C  CB    . ILE A 1 93  ? -13.530 16.448 23.627 1.00 14.38 ? 101 ILE A CB    1 
ATOM   750  C  CG1   . ILE A 1 93  ? -14.404 16.625 22.386 1.00 13.36 ? 101 ILE A CG1   1 
ATOM   751  C  CG2   . ILE A 1 93  ? -14.245 16.994 24.861 1.00 16.44 ? 101 ILE A CG2   1 
ATOM   752  C  CD1   . ILE A 1 93  ? -14.528 18.058 21.917 1.00 15.76 ? 101 ILE A CD1   1 
ATOM   753  N  N     . LEU A 1 94  ? -11.104 18.077 25.408 1.00 13.78 ? 102 LEU A N     1 
ATOM   754  C  CA    . LEU A 1 94  ? -10.416 18.017 26.685 1.00 13.92 ? 102 LEU A CA    1 
ATOM   755  C  C     . LEU A 1 94  ? -11.494 17.992 27.789 1.00 14.61 ? 102 LEU A C     1 
ATOM   756  O  O     . LEU A 1 94  ? -12.392 18.857 27.836 1.00 14.99 ? 102 LEU A O     1 
ATOM   757  C  CB    . LEU A 1 94  ? -9.506  19.247 26.784 1.00 13.99 ? 102 LEU A CB    1 
ATOM   758  C  CG    . LEU A 1 94  ? -8.963  19.653 28.156 1.00 15.11 ? 102 LEU A CG    1 
ATOM   759  C  CD1   . LEU A 1 94  ? -8.028  18.566 28.579 1.00 15.54 ? 102 LEU A CD1   1 
ATOM   760  C  CD2   . LEU A 1 94  ? -8.237  20.980 28.106 1.00 19.02 ? 102 LEU A CD2   1 
ATOM   761  N  N     . ASN A 1 95  ? -11.393 16.988 28.643 1.00 12.82 ? 103 ASN A N     1 
ATOM   762  C  CA    . ASN A 1 95  ? -12.307 16.800 29.766 1.00 13.21 ? 103 ASN A CA    1 
ATOM   763  C  C     . ASN A 1 95  ? -11.611 17.219 31.053 1.00 12.61 ? 103 ASN A C     1 
ATOM   764  O  O     . ASN A 1 95  ? -10.544 16.682 31.364 1.00 12.85 ? 103 ASN A O     1 
ATOM   765  C  CB    . ASN A 1 95  ? -12.691 15.298 29.869 1.00 13.65 ? 103 ASN A CB    1 
ATOM   766  C  CG    . ASN A 1 95  ? -13.090 14.690 28.519 1.00 16.03 ? 103 ASN A CG    1 
ATOM   767  O  OD1   . ASN A 1 95  ? -14.114 15.059 27.935 1.00 16.92 ? 103 ASN A OD1   1 
ATOM   768  N  ND2   . ASN A 1 95  ? -12.248 13.782 27.983 1.00 14.46 ? 103 ASN A ND2   1 
ATOM   769  N  N     . VAL A 1 96  ? -12.195 18.173 31.782 1.00 11.91 ? 104 VAL A N     1 
ATOM   770  C  CA    . VAL A 1 96  ? -11.532 18.676 32.994 1.00 11.63 ? 104 VAL A CA    1 
ATOM   771  C  C     . VAL A 1 96  ? -12.415 18.627 34.205 1.00 11.97 ? 104 VAL A C     1 
ATOM   772  O  O     . VAL A 1 96  ? -13.628 18.868 34.120 1.00 11.12 ? 104 VAL A O     1 
ATOM   773  C  CB    A VAL A 1 96  ? -10.966 20.103 32.784 0.50 12.71 ? 104 VAL A CB    1 
ATOM   774  C  CB    B VAL A 1 96  ? -10.851 20.140 32.901 0.50 13.21 ? 104 VAL A CB    1 
ATOM   775  C  CG1   A VAL A 1 96  ? -9.754  20.068 31.787 0.50 10.30 ? 104 VAL A CG1   1 
ATOM   776  C  CG1   B VAL A 1 96  ? -10.312 20.511 31.496 0.50 11.11 ? 104 VAL A CG1   1 
ATOM   777  C  CG2   A VAL A 1 96  ? -11.971 20.969 32.265 0.50 10.57 ? 104 VAL A CG2   1 
ATOM   778  C  CG2   B VAL A 1 96  ? -11.666 21.241 33.528 0.50 11.46 ? 104 VAL A CG2   1 
ATOM   779  N  N     . ALA A 1 97  ? -11.782 18.277 35.323 1.00 11.75 ? 105 ALA A N     1 
ATOM   780  C  CA    . ALA A 1 97  ? -12.385 18.413 36.648 1.00 12.34 ? 105 ALA A CA    1 
ATOM   781  C  C     . ALA A 1 97  ? -11.498 19.357 37.449 1.00 13.52 ? 105 ALA A C     1 
ATOM   782  O  O     . ALA A 1 97  ? -10.346 19.011 37.769 1.00 13.96 ? 105 ALA A O     1 
ATOM   783  C  CB    . ALA A 1 97  ? -12.446 17.072 37.320 1.00 12.95 ? 105 ALA A CB    1 
ATOM   784  N  N     . ILE A 1 98  ? -12.024 20.533 37.757 1.00 12.57 ? 106 ILE A N     1 
ATOM   785  C  CA    . ILE A 1 98  ? -11.265 21.523 38.533 1.00 13.97 ? 106 ILE A CA    1 
ATOM   786  C  C     . ILE A 1 98  ? -11.604 21.238 39.989 1.00 14.02 ? 106 ILE A C     1 
ATOM   787  O  O     . ILE A 1 98  ? -12.773 21.338 40.378 1.00 13.90 ? 106 ILE A O     1 
ATOM   788  C  CB    . ILE A 1 98  ? -11.702 22.947 38.181 1.00 14.44 ? 106 ILE A CB    1 
ATOM   789  C  CG1   . ILE A 1 98  ? -11.579 23.227 36.659 1.00 16.27 ? 106 ILE A CG1   1 
ATOM   790  C  CG2   . ILE A 1 98  ? -10.899 24.002 39.054 1.00 16.49 ? 106 ILE A CG2   1 
ATOM   791  C  CD1   . ILE A 1 98  ? -11.891 24.659 36.306 1.00 17.61 ? 106 ILE A CD1   1 
ATOM   792  N  N     . VAL A 1 99  ? -10.616 20.853 40.800 1.00 13.71 ? 107 VAL A N     1 
ATOM   793  C  CA    . VAL A 1 99  ? -10.929 20.377 42.146 1.00 14.72 ? 107 VAL A CA    1 
ATOM   794  C  C     . VAL A 1 99  ? -10.505 21.261 43.316 1.00 14.88 ? 107 VAL A C     1 
ATOM   795  O  O     . VAL A 1 99  ? -11.102 21.159 44.391 1.00 15.40 ? 107 VAL A O     1 
ATOM   796  C  CB    . VAL A 1 99  ? -10.415 18.924 42.436 1.00 17.65 ? 107 VAL A CB    1 
ATOM   797  C  CG1   . VAL A 1 99  ? -10.812 17.950 41.312 1.00 17.55 ? 107 VAL A CG1   1 
ATOM   798  C  CG2   . VAL A 1 99  ? -8.952  18.952 42.645 1.00 18.36 ? 107 VAL A CG2   1 
ATOM   799  N  N     . GLY A 1 100 ? -9.495  22.120 43.126 1.00 13.59 ? 108 GLY A N     1 
ATOM   800  C  CA    . GLY A 1 100 ? -9.007  22.949 44.218 1.00 14.31 ? 108 GLY A CA    1 
ATOM   801  C  C     . GLY A 1 100 ? -8.375  24.230 43.703 1.00 14.07 ? 108 GLY A C     1 
ATOM   802  O  O     . GLY A 1 100 ? -8.029  24.352 42.513 1.00 14.53 ? 108 GLY A O     1 
ATOM   803  N  N     . TYR A 1 101 ? -8.197  25.183 44.613 1.00 15.21 ? 109 TYR A N     1 
ATOM   804  C  CA    . TYR A 1 101 ? -7.611  26.496 44.276 1.00 14.86 ? 109 TYR A CA    1 
ATOM   805  C  C     . TYR A 1 101 ? -6.255  26.585 44.932 1.00 15.21 ? 109 TYR A C     1 
ATOM   806  O  O     . TYR A 1 101 ? -6.097  26.192 46.127 1.00 15.16 ? 109 TYR A O     1 
ATOM   807  C  CB    . TYR A 1 101 ? -8.462  27.576 44.903 1.00 14.95 ? 109 TYR A CB    1 
ATOM   808  C  CG    . TYR A 1 101 ? -8.138  29.015 44.562 1.00 18.37 ? 109 TYR A CG    1 
ATOM   809  C  CD1   . TYR A 1 101 ? -8.503  29.516 43.331 1.00 20.26 ? 109 TYR A CD1   1 
ATOM   810  C  CD2   . TYR A 1 101 ? -7.555  29.886 45.496 1.00 21.21 ? 109 TYR A CD2   1 
ATOM   811  C  CE1   . TYR A 1 101 ? -8.298  30.836 43.002 1.00 24.18 ? 109 TYR A CE1   1 
ATOM   812  C  CE2   . TYR A 1 101 ? -7.328  31.247 45.164 1.00 21.58 ? 109 TYR A CE2   1 
ATOM   813  C  CZ    . TYR A 1 101 ? -7.718  31.686 43.902 1.00 22.22 ? 109 TYR A CZ    1 
ATOM   814  O  OH    . TYR A 1 101 ? -7.567  32.997 43.500 1.00 27.92 ? 109 TYR A OH    1 
ATOM   815  N  N     . LEU A 1 102 ? -5.283  27.097 44.188 1.00 14.56 ? 110 LEU A N     1 
ATOM   816  C  CA    . LEU A 1 102 ? -3.922  27.324 44.730 1.00 14.24 ? 110 LEU A CA    1 
ATOM   817  C  C     . LEU A 1 102 ? -3.672  28.724 45.243 1.00 14.84 ? 110 LEU A C     1 
ATOM   818  O  O     . LEU A 1 102 ? -3.221  28.920 46.365 1.00 15.22 ? 110 LEU A O     1 
ATOM   819  C  CB    . LEU A 1 102 ? -2.849  26.998 43.670 1.00 16.45 ? 110 LEU A CB    1 
ATOM   820  C  CG    . LEU A 1 102 ? -2.587  25.544 43.330 1.00 15.60 ? 110 LEU A CG    1 
ATOM   821  C  CD1   . LEU A 1 102 ? -1.473  25.391 42.284 1.00 17.75 ? 110 LEU A CD1   1 
ATOM   822  C  CD2   . LEU A 1 102 ? -2.232  24.768 44.633 1.00 18.57 ? 110 LEU A CD2   1 
ATOM   823  N  N     . ARG A 1 103 ? -3.925  29.704 44.402 1.00 13.05 ? 111 ARG A N     1 
ATOM   824  C  CA    . ARG A 1 103 ? -3.585  31.085 44.675 1.00 13.28 ? 111 ARG A CA    1 
ATOM   825  C  C     . ARG A 1 103 ? -4.200  32.015 43.663 1.00 13.44 ? 111 ARG A C     1 
ATOM   826  O  O     . ARG A 1 103 ? -4.535  31.590 42.525 1.00 13.23 ? 111 ARG A O     1 
ATOM   827  C  CB    . ARG A 1 103 ? -2.047  31.254 44.588 1.00 12.64 ? 111 ARG A CB    1 
ATOM   828  C  CG    . ARG A 1 103 ? -1.460  30.884 43.193 1.00 12.65 ? 111 ARG A CG    1 
ATOM   829  C  CD    . ARG A 1 103 ? 0.048   31.161 43.138 1.00 12.81 ? 111 ARG A CD    1 
ATOM   830  N  NE    . ARG A 1 103 ? 0.661   30.899 41.818 1.00 11.86 ? 111 ARG A NE    1 
ATOM   831  C  CZ    . ARG A 1 103 ? 0.650   31.757 40.805 1.00 12.68 ? 111 ARG A CZ    1 
ATOM   832  N  NH1   . ARG A 1 103 ? 0.030   32.928 40.898 1.00 14.61 ? 111 ARG A NH1   1 
ATOM   833  N  NH2   . ARG A 1 103 ? 1.277   31.439 39.675 1.00 12.75 ? 111 ARG A NH2   1 
ATOM   834  N  N     . PRO A 1 104 ? -4.271  33.302 44.025 1.00 14.16 ? 112 PRO A N     1 
ATOM   835  C  CA    . PRO A 1 104 ? -4.644  34.326 43.056 1.00 14.20 ? 112 PRO A CA    1 
ATOM   836  C  C     . PRO A 1 104 ? -3.575  34.476 41.995 1.00 14.84 ? 112 PRO A C     1 
ATOM   837  O  O     . PRO A 1 104 ? -2.414  34.062 42.167 1.00 14.32 ? 112 PRO A O     1 
ATOM   838  C  CB    . PRO A 1 104 ? -4.742  35.613 43.898 1.00 15.67 ? 112 PRO A CB    1 
ATOM   839  C  CG    . PRO A 1 104 ? -3.945  35.382 45.093 1.00 16.56 ? 112 PRO A CG    1 
ATOM   840  C  CD    . PRO A 1 104 ? -3.987  33.880 45.365 1.00 14.72 ? 112 PRO A CD    1 
ATOM   841  N  N     . GLU A 1 105 ? -3.967  35.105 40.893 1.00 15.50 ? 113 GLU A N     1 
ATOM   842  C  CA    . GLU A 1 105 ? -2.983  35.568 39.935 1.00 16.85 ? 113 GLU A CA    1 
ATOM   843  C  C     . GLU A 1 105 ? -2.069  36.581 40.603 1.00 17.06 ? 113 GLU A C     1 
ATOM   844  O  O     . GLU A 1 105 ? -2.472  37.265 41.558 1.00 16.20 ? 113 GLU A O     1 
ATOM   845  C  CB    . GLU A 1 105 ? -3.687  36.304 38.809 1.00 18.01 ? 113 GLU A CB    1 
ATOM   846  C  CG    . GLU A 1 105 ? -4.577  35.403 37.983 1.00 22.28 ? 113 GLU A CG    1 
ATOM   847  C  CD    . GLU A 1 105 ? -4.911  36.083 36.675 1.00 27.99 ? 113 GLU A CD    1 
ATOM   848  O  OE1   . GLU A 1 105 ? -5.782  37.000 36.704 1.00 30.92 ? 113 GLU A OE1   1 
ATOM   849  O  OE2   . GLU A 1 105 ? -4.265  35.729 35.652 1.00 29.43 ? 113 GLU A OE2   1 
ATOM   850  N  N     . LYS A 1 106 ? -0.838  36.663 40.102 1.00 17.58 ? 114 LYS A N     1 
ATOM   851  C  CA    . LYS A 1 106 ? 0.185   37.555 40.671 1.00 18.01 ? 114 LYS A CA    1 
ATOM   852  C  C     . LYS A 1 106 ? 0.914   38.270 39.559 1.00 18.68 ? 114 LYS A C     1 
ATOM   853  O  O     . LYS A 1 106 ? 0.960   37.790 38.416 1.00 17.33 ? 114 LYS A O     1 
ATOM   854  C  CB    . LYS A 1 106 ? 1.185   36.763 41.569 1.00 18.21 ? 114 LYS A CB    1 
ATOM   855  C  CG    . LYS A 1 106 ? 0.496   36.110 42.803 1.00 20.85 ? 114 LYS A CG    1 
ATOM   856  C  CD    A LYS A 1 106 ? 1.425   35.351 43.800 0.50 21.33 ? 114 LYS A CD    1 
ATOM   857  C  CD    B LYS A 1 106 ? 1.274   34.881 43.325 0.50 21.29 ? 114 LYS A CD    1 
ATOM   858  C  CE    A LYS A 1 106 ? 0.576   34.737 44.946 0.50 20.58 ? 114 LYS A CE    1 
ATOM   859  C  CE    B LYS A 1 106 ? 2.456   35.302 44.175 0.50 21.03 ? 114 LYS A CE    1 
ATOM   860  N  NZ    A LYS A 1 106 ? 1.265   33.693 45.780 0.50 19.55 ? 114 LYS A NZ    1 
ATOM   861  N  NZ    B LYS A 1 106 ? 3.528   34.240 44.298 0.50 19.09 ? 114 LYS A NZ    1 
ATOM   862  N  N     . ASN A 1 107 ? 1.475   39.431 39.884 1.00 18.94 ? 115 ASN A N     1 
ATOM   863  C  CA    . ASN A 1 107 ? 2.278   40.178 38.925 1.00 21.16 ? 115 ASN A CA    1 
ATOM   864  C  C     . ASN A 1 107 ? 3.715   39.762 39.120 1.00 21.18 ? 115 ASN A C     1 
ATOM   865  O  O     . ASN A 1 107 ? 4.218   39.759 40.255 1.00 22.15 ? 115 ASN A O     1 
ATOM   866  C  CB    . ASN A 1 107 ? 2.171   41.699 39.171 1.00 21.44 ? 115 ASN A CB    1 
ATOM   867  C  CG    . ASN A 1 107 ? 0.795   42.228 38.885 1.00 26.21 ? 115 ASN A CG    1 
ATOM   868  O  OD1   . ASN A 1 107 ? 0.140   41.801 37.931 1.00 31.48 ? 115 ASN A OD1   1 
ATOM   869  N  ND2   . ASN A 1 107 ? 0.319   43.134 39.739 1.00 28.23 ? 115 ASN A ND2   1 
ATOM   870  N  N     . PHE A 1 108 ? 4.397   39.416 38.037 1.00 21.09 ? 116 PHE A N     1 
ATOM   871  C  CA    . PHE A 1 108 ? 5.797   39.043 38.175 1.00 21.76 ? 116 PHE A CA    1 
ATOM   872  C  C     . PHE A 1 108 ? 6.674   40.060 37.451 1.00 23.31 ? 116 PHE A C     1 
ATOM   873  O  O     . PHE A 1 108 ? 6.270   40.600 36.424 1.00 24.15 ? 116 PHE A O     1 
ATOM   874  C  CB    . PHE A 1 108 ? 6.005   37.604 37.658 1.00 21.11 ? 116 PHE A CB    1 
ATOM   875  C  CG    . PHE A 1 108 ? 5.304   36.557 38.491 1.00 18.79 ? 116 PHE A CG    1 
ATOM   876  C  CD1   . PHE A 1 108 ? 5.871   36.092 39.661 1.00 18.30 ? 116 PHE A CD1   1 
ATOM   877  C  CD2   . PHE A 1 108 ? 4.094   36.020 38.080 1.00 17.49 ? 116 PHE A CD2   1 
ATOM   878  C  CE1   . PHE A 1 108 ? 5.210   35.119 40.430 1.00 17.97 ? 116 PHE A CE1   1 
ATOM   879  C  CE2   . PHE A 1 108 ? 3.453   35.046 38.815 1.00 17.95 ? 116 PHE A CE2   1 
ATOM   880  C  CZ    . PHE A 1 108 ? 4.022   34.593 40.013 1.00 18.35 ? 116 PHE A CZ    1 
ATOM   881  N  N     . ASP A 1 109 ? 7.858   40.328 37.986 1.00 25.11 ? 117 ASP A N     1 
ATOM   882  C  CA    . ASP A 1 109 ? 8.762   41.315 37.357 1.00 26.25 ? 117 ASP A CA    1 
ATOM   883  C  C     . ASP A 1 109 ? 9.650   40.756 36.242 1.00 25.09 ? 117 ASP A C     1 
ATOM   884  O  O     . ASP A 1 109 ? 10.343  41.522 35.546 1.00 25.09 ? 117 ASP A O     1 
ATOM   885  C  CB    . ASP A 1 109 ? 9.652   42.015 38.385 1.00 27.64 ? 117 ASP A CB    1 
ATOM   886  C  CG    . ASP A 1 109 ? 10.187  41.065 39.445 1.00 31.85 ? 117 ASP A CG    1 
ATOM   887  O  OD1   . ASP A 1 109 ? 10.878  40.069 39.083 1.00 36.39 ? 117 ASP A OD1   1 
ATOM   888  O  OD2   . ASP A 1 109 ? 9.956   41.231 40.674 1.00 36.71 ? 117 ASP A OD2   1 
ATOM   889  N  N     . SER A 1 110 ? 9.657   39.437 36.077 1.00 22.29 ? 118 SER A N     1 
ATOM   890  C  CA    . SER A 1 110 ? 10.504  38.815 35.077 1.00 20.25 ? 118 SER A CA    1 
ATOM   891  C  C     . SER A 1 110 ? 9.945   37.491 34.649 1.00 19.29 ? 118 SER A C     1 
ATOM   892  O  O     . SER A 1 110 ? 9.180   36.853 35.379 1.00 18.16 ? 118 SER A O     1 
ATOM   893  C  CB    . SER A 1 110 ? 11.923  38.583 35.621 1.00 20.41 ? 118 SER A CB    1 
ATOM   894  O  OG    . SER A 1 110 ? 11.923  37.648 36.698 1.00 17.62 ? 118 SER A OG    1 
ATOM   895  N  N     . LEU A 1 111 ? 10.377  37.052 33.476 1.00 18.11 ? 119 LEU A N     1 
ATOM   896  C  CA    . LEU A 1 111 ? 10.047  35.715 33.048 1.00 17.34 ? 119 LEU A CA    1 
ATOM   897  C  C     . LEU A 1 111 ? 10.625  34.652 34.005 1.00 15.30 ? 119 LEU A C     1 
ATOM   898  O  O     . LEU A 1 111 ? 10.001  33.613 34.240 1.00 14.43 ? 119 LEU A O     1 
ATOM   899  C  CB    . LEU A 1 111 ? 10.576  35.491 31.642 1.00 19.05 ? 119 LEU A CB    1 
ATOM   900  C  CG    . LEU A 1 111 ? 9.457   35.554 30.593 1.00 23.78 ? 119 LEU A CG    1 
ATOM   901  C  CD1   . LEU A 1 111 ? 10.068  35.385 29.189 1.00 28.21 ? 119 LEU A CD1   1 
ATOM   902  C  CD2   . LEU A 1 111 ? 8.359   34.537 30.832 1.00 25.46 ? 119 LEU A CD2   1 
ATOM   903  N  N     . GLU A 1 112 ? 11.796  34.922 34.551 1.00 13.88 ? 120 GLU A N     1 
ATOM   904  C  CA    . GLU A 1 112 ? 12.422  33.988 35.489 1.00 13.62 ? 120 GLU A CA    1 
ATOM   905  C  C     . GLU A 1 112 ? 11.496  33.724 36.698 1.00 13.78 ? 120 GLU A C     1 
ATOM   906  O  O     . GLU A 1 112 ? 11.261  32.568 37.086 1.00 13.70 ? 120 GLU A O     1 
ATOM   907  C  CB    . GLU A 1 112 ? 13.782  34.529 35.902 1.00 14.97 ? 120 GLU A CB    1 
ATOM   908  C  CG    . GLU A 1 112 ? 14.503  33.631 36.880 1.00 18.14 ? 120 GLU A CG    1 
ATOM   909  C  CD    . GLU A 1 112 ? 15.833  34.179 37.313 1.00 19.74 ? 120 GLU A CD    1 
ATOM   910  O  OE1   . GLU A 1 112 ? 16.467  34.935 36.551 1.00 20.88 ? 120 GLU A OE1   1 
ATOM   911  O  OE2   . GLU A 1 112 ? 16.254  33.856 38.454 1.00 23.93 ? 120 GLU A OE2   1 
ATOM   912  N  N     . SER A 1 113 ? 10.942  34.792 37.271 1.00 12.94 ? 121 SER A N     1 
ATOM   913  C  CA    . SER A 1 113 ? 10.026  34.600 38.410 1.00 12.57 ? 121 SER A CA    1 
ATOM   914  C  C     . SER A 1 113 ? 8.733   33.958 38.003 1.00 12.47 ? 121 SER A C     1 
ATOM   915  O  O     . SER A 1 113 ? 8.198   33.098 38.735 1.00 11.99 ? 121 SER A O     1 
ATOM   916  C  CB    A SER A 1 113 ? 9.780   35.923 39.162 0.50 12.97 ? 121 SER A CB    1 
ATOM   917  C  CB    B SER A 1 113 ? 9.735   35.954 39.093 0.50 12.54 ? 121 SER A CB    1 
ATOM   918  O  OG    A SER A 1 113 ? 9.357   36.928 38.273 0.50 15.63 ? 121 SER A OG    1 
ATOM   919  O  OG    B SER A 1 113 ? 10.916  36.529 39.615 0.50 11.87 ? 121 SER A OG    1 
ATOM   920  N  N     . LEU A 1 114 ? 8.211   34.323 36.827 1.00 11.63 ? 122 LEU A N     1 
ATOM   921  C  CA    . LEU A 1 114 ? 6.963   33.722 36.358 1.00 12.61 ? 122 LEU A CA    1 
ATOM   922  C  C     . LEU A 1 114 ? 7.134   32.213 36.129 1.00 12.79 ? 122 LEU A C     1 
ATOM   923  O  O     . LEU A 1 114 ? 6.327   31.409 36.574 1.00 12.53 ? 122 LEU A O     1 
ATOM   924  C  CB    . LEU A 1 114 ? 6.494   34.403 35.060 1.00 12.90 ? 122 LEU A CB    1 
ATOM   925  C  CG    . LEU A 1 114 ? 5.324   33.700 34.340 1.00 14.85 ? 122 LEU A CG    1 
ATOM   926  C  CD1   . LEU A 1 114 ? 4.022   33.695 35.190 1.00 17.43 ? 122 LEU A CD1   1 
ATOM   927  C  CD2   . LEU A 1 114 ? 5.082   34.424 33.034 1.00 18.71 ? 122 LEU A CD2   1 
ATOM   928  N  N     . ILE A 1 115 ? 8.216   31.835 35.455 1.00 12.48 ? 123 ILE A N     1 
ATOM   929  C  CA    . ILE A 1 115 ? 8.395   30.425 35.129 1.00 12.65 ? 123 ILE A CA    1 
ATOM   930  C  C     . ILE A 1 115 ? 8.599   29.633 36.419 1.00 11.84 ? 123 ILE A C     1 
ATOM   931  O  O     . ILE A 1 115 ? 8.020   28.532 36.598 1.00 13.55 ? 123 ILE A O     1 
ATOM   932  C  CB    . ILE A 1 115 ? 9.597   30.244 34.142 1.00 13.75 ? 123 ILE A CB    1 
ATOM   933  C  CG1   . ILE A 1 115 ? 9.228   30.797 32.758 1.00 14.64 ? 123 ILE A CG1   1 
ATOM   934  C  CG2   . ILE A 1 115 ? 9.941   28.741 34.014 1.00 14.91 ? 123 ILE A CG2   1 
ATOM   935  C  CD1   . ILE A 1 115 ? 10.452  30.944 31.838 1.00 15.20 ? 123 ILE A CD1   1 
ATOM   936  N  N     . SER A 1 116 ? 9.379   30.179 37.357 1.00 12.58 ? 124 SER A N     1 
ATOM   937  C  CA    . SER A 1 116 ? 9.608   29.481 38.620 1.00 11.69 ? 124 SER A CA    1 
ATOM   938  C  C     . SER A 1 116 ? 8.266   29.302 39.368 1.00 12.78 ? 124 SER A C     1 
ATOM   939  O  O     . SER A 1 116 ? 7.994   28.256 39.965 1.00 12.74 ? 124 SER A O     1 
ATOM   940  C  CB    . SER A 1 116 ? 10.591  30.272 39.477 1.00 13.83 ? 124 SER A CB    1 
ATOM   941  O  OG    . SER A 1 116 ? 10.662  29.666 40.745 1.00 15.12 ? 124 SER A OG    1 
ATOM   942  N  N     . ALA A 1 117 ? 7.438   30.328 39.305 1.00 12.19 ? 125 ALA A N     1 
ATOM   943  C  CA    . ALA A 1 117 ? 6.127   30.256 39.949 1.00 13.07 ? 125 ALA A CA    1 
ATOM   944  C  C     . ALA A 1 117 ? 5.237   29.203 39.350 1.00 14.10 ? 125 ALA A C     1 
ATOM   945  O  O     . ALA A 1 117 ? 4.616   28.422 40.088 1.00 15.29 ? 125 ALA A O     1 
ATOM   946  C  CB    . ALA A 1 117 ? 5.443   31.614 39.992 1.00 12.19 ? 125 ALA A CB    1 
ATOM   947  N  N     . ILE A 1 118 ? 5.205   29.131 38.018 1.00 13.27 ? 126 ILE A N     1 
ATOM   948  C  CA    . ILE A 1 118 ? 4.375   28.153 37.345 1.00 14.17 ? 126 ILE A CA    1 
ATOM   949  C  C     . ILE A 1 118 ? 4.866   26.746 37.689 1.00 13.98 ? 126 ILE A C     1 
ATOM   950  O  O     . ILE A 1 118 ? 4.044   25.864 38.005 1.00 14.09 ? 126 ILE A O     1 
ATOM   951  C  CB    . ILE A 1 118 ? 4.363   28.387 35.824 1.00 13.47 ? 126 ILE A CB    1 
ATOM   952  C  CG1   . ILE A 1 118 ? 3.676   29.705 35.487 1.00 13.82 ? 126 ILE A CG1   1 
ATOM   953  C  CG2   . ILE A 1 118 ? 3.590   27.176 35.119 1.00 15.95 ? 126 ILE A CG2   1 
ATOM   954  C  CD1   . ILE A 1 118 ? 3.839   30.109 34.004 1.00 15.52 ? 126 ILE A CD1   1 
ATOM   955  N  N     . GLN A 1 119 ? 6.184   26.547 37.673 1.00 15.53 ? 127 GLN A N     1 
ATOM   956  C  CA    . GLN A 1 119 ? 6.743   25.222 38.007 1.00 16.09 ? 127 GLN A CA    1 
ATOM   957  C  C     . GLN A 1 119 ? 6.389   24.864 39.450 1.00 15.45 ? 127 GLN A C     1 
ATOM   958  O  O     . GLN A 1 119 ? 6.057   23.715 39.769 1.00 14.65 ? 127 GLN A O     1 
ATOM   959  C  CB    . GLN A 1 119 ? 8.260   25.223 37.798 1.00 16.11 ? 127 GLN A CB    1 
ATOM   960  C  CG    . GLN A 1 119 ? 8.643   25.256 36.304 1.00 21.63 ? 127 GLN A CG    1 
ATOM   961  C  CD    . GLN A 1 119 ? 10.128  25.441 36.101 1.00 29.41 ? 127 GLN A CD    1 
ATOM   962  O  OE1   . GLN A 1 119 ? 10.855  25.707 37.066 1.00 33.88 ? 127 GLN A OE1   1 
ATOM   963  N  NE2   . GLN A 1 119 ? 10.591  25.336 34.848 1.00 32.89 ? 127 GLN A NE2   1 
ATOM   964  N  N     . GLY A 1 120 ? 6.438   25.853 40.341 1.00 15.10 ? 128 GLY A N     1 
ATOM   965  C  CA    . GLY A 1 120 ? 6.038   25.615 41.720 1.00 14.23 ? 128 GLY A CA    1 
ATOM   966  C  C     . GLY A 1 120 ? 4.556   25.227 41.911 1.00 14.09 ? 128 GLY A C     1 
ATOM   967  O  O     . GLY A 1 120 ? 4.210   24.389 42.778 1.00 13.84 ? 128 GLY A O     1 
ATOM   968  N  N     . ASP A 1 121 ? 3.689   25.876 41.134 1.00 14.14 ? 129 ASP A N     1 
ATOM   969  C  CA    . ASP A 1 121 ? 2.253   25.552 41.104 1.00 13.40 ? 129 ASP A CA    1 
ATOM   970  C  C     . ASP A 1 121 ? 2.094   24.097 40.678 1.00 13.77 ? 129 ASP A C     1 
ATOM   971  O  O     . ASP A 1 121 ? 1.309   23.362 41.254 1.00 15.13 ? 129 ASP A O     1 
ATOM   972  C  CB    . ASP A 1 121 ? 1.549   26.394 40.052 1.00 12.99 ? 129 ASP A CB    1 
ATOM   973  C  CG    . ASP A 1 121 ? 1.423   27.869 40.433 1.00 14.79 ? 129 ASP A CG    1 
ATOM   974  O  OD1   . ASP A 1 121 ? 1.475   28.214 41.628 1.00 15.01 ? 129 ASP A OD1   1 
ATOM   975  O  OD2   . ASP A 1 121 ? 1.233   28.733 39.531 1.00 15.96 ? 129 ASP A OD2   1 
ATOM   976  N  N     . ILE A 1 122 ? 2.802   23.716 39.613 1.00 14.06 ? 130 ILE A N     1 
ATOM   977  C  CA    . ILE A 1 122 ? 2.704   22.338 39.104 1.00 13.30 ? 130 ILE A CA    1 
ATOM   978  C  C     . ILE A 1 122 ? 3.137   21.317 40.188 1.00 13.60 ? 130 ILE A C     1 
ATOM   979  O  O     . ILE A 1 122 ? 2.432   20.321 40.455 1.00 13.82 ? 130 ILE A O     1 
ATOM   980  C  CB    . ILE A 1 122 ? 3.536   22.196 37.837 1.00 13.82 ? 130 ILE A CB    1 
ATOM   981  C  CG1   . ILE A 1 122 ? 2.834   22.872 36.666 1.00 14.06 ? 130 ILE A CG1   1 
ATOM   982  C  CG2   . ILE A 1 122 ? 3.816   20.660 37.526 1.00 13.92 ? 130 ILE A CG2   1 
ATOM   983  C  CD1   . ILE A 1 122 ? 3.769   23.196 35.436 1.00 16.35 ? 130 ILE A CD1   1 
ATOM   984  N  N     . GLU A 1 123 ? 4.258   21.583 40.856 1.00 12.94 ? 131 GLU A N     1 
ATOM   985  C  CA    . GLU A 1 123 ? 4.712   20.687 41.919 1.00 13.43 ? 131 GLU A CA    1 
ATOM   986  C  C     . GLU A 1 123 ? 3.723   20.600 43.088 1.00 13.26 ? 131 GLU A C     1 
ATOM   987  O  O     . GLU A 1 123 ? 3.473   19.529 43.584 1.00 14.35 ? 131 GLU A O     1 
ATOM   988  C  CB    . GLU A 1 123 ? 6.117   21.078 42.379 1.00 15.13 ? 131 GLU A CB    1 
ATOM   989  C  CG    . GLU A 1 123 ? 7.174   20.798 41.286 1.00 19.31 ? 131 GLU A CG    1 
ATOM   990  C  CD    . GLU A 1 123 ? 7.080   19.368 40.677 1.00 23.98 ? 131 GLU A CD    1 
ATOM   991  O  OE1   . GLU A 1 123 ? 7.085   18.381 41.434 1.00 26.44 ? 131 GLU A OE1   1 
ATOM   992  O  OE2   . GLU A 1 123 ? 6.940   19.215 39.438 1.00 23.65 ? 131 GLU A OE2   1 
ATOM   993  N  N     . GLU A 1 124 ? 3.159   21.724 43.500 1.00 12.60 ? 132 GLU A N     1 
ATOM   994  C  CA    . GLU A 1 124 ? 2.208   21.776 44.619 1.00 12.73 ? 132 GLU A CA    1 
ATOM   995  C  C     . GLU A 1 124 ? 0.913   21.050 44.208 1.00 13.16 ? 132 GLU A C     1 
ATOM   996  O  O     . GLU A 1 124 ? 0.361   20.287 44.990 1.00 12.92 ? 132 GLU A O     1 
ATOM   997  C  CB    . GLU A 1 124 ? 1.914   23.254 44.982 1.00 12.90 ? 132 GLU A CB    1 
ATOM   998  C  CG    . GLU A 1 124 ? 0.942   23.448 46.144 1.00 13.83 ? 132 GLU A CG    1 
ATOM   999  C  CD    . GLU A 1 124 ? 1.482   22.959 47.495 1.00 17.40 ? 132 GLU A CD    1 
ATOM   1000 O  OE1   . GLU A 1 124 ? 2.647   22.518 47.615 1.00 17.19 ? 132 GLU A OE1   1 
ATOM   1001 O  OE2   . GLU A 1 124 ? 0.683   22.964 48.446 1.00 18.82 ? 132 GLU A OE2   1 
ATOM   1002 N  N     . ALA A 1 125 ? 0.455   21.268 42.981 1.00 12.73 ? 133 ALA A N     1 
ATOM   1003 C  CA    . ALA A 1 125 ? -0.727  20.551 42.475 1.00 12.36 ? 133 ALA A CA    1 
ATOM   1004 C  C     . ALA A 1 125 ? -0.512  19.031 42.545 1.00 12.08 ? 133 ALA A C     1 
ATOM   1005 O  O     . ALA A 1 125 ? -1.401  18.291 42.999 1.00 12.26 ? 133 ALA A O     1 
ATOM   1006 C  CB    . ALA A 1 125 ? -1.030  20.969 41.057 1.00 13.64 ? 133 ALA A CB    1 
ATOM   1007 N  N     . LYS A 1 126 ? 0.659   18.561 42.124 1.00 12.30 ? 134 LYS A N     1 
ATOM   1008 C  CA    . LYS A 1 126 ? 0.904   17.126 42.129 1.00 12.86 ? 134 LYS A CA    1 
ATOM   1009 C  C     . LYS A 1 126 ? 0.760   16.577 43.536 1.00 12.60 ? 134 LYS A C     1 
ATOM   1010 O  O     . LYS A 1 126 ? 0.227   15.473 43.731 1.00 13.22 ? 134 LYS A O     1 
ATOM   1011 C  CB    . LYS A 1 126 ? 2.297   16.810 41.582 1.00 13.24 ? 134 LYS A CB    1 
ATOM   1012 C  CG    . LYS A 1 126 ? 2.456   17.035 40.088 1.00 13.98 ? 134 LYS A CG    1 
ATOM   1013 C  CD    . LYS A 1 126 ? 3.957   16.789 39.769 1.00 20.61 ? 134 LYS A CD    1 
ATOM   1014 C  CE    . LYS A 1 126 ? 4.279   16.948 38.325 1.00 26.60 ? 134 LYS A CE    1 
ATOM   1015 N  NZ    . LYS A 1 126 ? 5.778   16.863 38.115 1.00 27.10 ? 134 LYS A NZ    1 
ATOM   1016 N  N     . LYS A 1 127 ? 1.238   17.334 44.528 1.00 12.92 ? 135 LYS A N     1 
ATOM   1017 C  CA    . LYS A 1 127 ? 1.168   16.860 45.921 1.00 13.16 ? 135 LYS A CA    1 
ATOM   1018 C  C     . LYS A 1 127 ? -0.284  16.870 46.438 1.00 13.28 ? 135 LYS A C     1 
ATOM   1019 O  O     . LYS A 1 127 ? -0.706  15.941 47.138 1.00 12.68 ? 135 LYS A O     1 
ATOM   1020 C  CB    . LYS A 1 127 ? 2.045   17.741 46.824 1.00 13.78 ? 135 LYS A CB    1 
ATOM   1021 C  CG    . LYS A 1 127 ? 3.525   17.643 46.473 1.00 18.63 ? 135 LYS A CG    1 
ATOM   1022 C  CD    . LYS A 1 127 ? 4.315   18.673 47.298 1.00 22.87 ? 135 LYS A CD    1 
ATOM   1023 C  CE    . LYS A 1 127 ? 5.644   19.004 46.625 1.00 27.93 ? 135 LYS A CE    1 
ATOM   1024 N  NZ    . LYS A 1 127 ? 6.394   19.987 47.473 1.00 31.60 ? 135 LYS A NZ    1 
ATOM   1025 N  N     . ARG A 1 128 ? -1.021  17.946 46.142 1.00 12.12 ? 136 ARG A N     1 
ATOM   1026 C  CA    . ARG A 1 128 ? -2.365  18.087 46.694 1.00 13.49 ? 136 ARG A CA    1 
ATOM   1027 C  C     . ARG A 1 128 ? -3.293  17.036 46.106 1.00 12.98 ? 136 ARG A C     1 
ATOM   1028 O  O     . ARG A 1 128 ? -4.211  16.576 46.790 1.00 13.39 ? 136 ARG A O     1 
ATOM   1029 C  CB    . ARG A 1 128 ? -2.934  19.481 46.470 1.00 13.84 ? 136 ARG A CB    1 
ATOM   1030 C  CG    . ARG A 1 128 ? -2.185  20.567 47.264 1.00 14.55 ? 136 ARG A CG    1 
ATOM   1031 C  CD    . ARG A 1 128 ? -2.970  21.866 47.390 1.00 14.85 ? 136 ARG A CD    1 
ATOM   1032 N  NE    . ARG A 1 128 ? -2.127  22.889 47.966 1.00 15.59 ? 136 ARG A NE    1 
ATOM   1033 C  CZ    . ARG A 1 128 ? -2.517  24.142 48.183 1.00 17.17 ? 136 ARG A CZ    1 
ATOM   1034 N  NH1   . ARG A 1 128 ? -3.775  24.495 47.952 1.00 17.87 ? 136 ARG A NH1   1 
ATOM   1035 N  NH2   . ARG A 1 128 ? -1.636  25.018 48.669 1.00 18.64 ? 136 ARG A NH2   1 
ATOM   1036 N  N     . LEU A 1 129 ? -3.044  16.645 44.856 1.00 12.43 ? 137 LEU A N     1 
ATOM   1037 C  CA    . LEU A 1 129 ? -3.973  15.718 44.169 1.00 12.70 ? 137 LEU A CA    1 
ATOM   1038 C  C     . LEU A 1 129 ? -3.827  14.293 44.696 1.00 14.24 ? 137 LEU A C     1 
ATOM   1039 O  O     . LEU A 1 129 ? -4.586  13.408 44.282 1.00 15.24 ? 137 LEU A O     1 
ATOM   1040 C  CB    . LEU A 1 129 ? -3.712  15.771 42.658 1.00 13.16 ? 137 LEU A CB    1 
ATOM   1041 C  CG    . LEU A 1 129 ? -4.284  17.064 42.037 1.00 11.35 ? 137 LEU A CG    1 
ATOM   1042 C  CD1   . LEU A 1 129 ? -3.666  17.330 40.686 1.00 11.60 ? 137 LEU A CD1   1 
ATOM   1043 C  CD2   . LEU A 1 129 ? -5.792  16.927 41.893 1.00 12.72 ? 137 LEU A CD2   1 
ATOM   1044 N  N     . GLU A 1 130 ? -2.840  14.073 45.574 1.00 14.86 ? 138 GLU A N     1 
ATOM   1045 C  CA    . GLU A 1 130 ? -2.670  12.762 46.209 1.00 16.18 ? 138 GLU A CA    1 
ATOM   1046 C  C     . GLU A 1 130 ? -3.564  12.565 47.431 1.00 16.35 ? 138 GLU A C     1 
ATOM   1047 O  O     . GLU A 1 130 ? -3.681  11.448 47.957 1.00 16.58 ? 138 GLU A O     1 
ATOM   1048 C  CB    . GLU A 1 130 ? -1.196  12.530 46.564 1.00 16.57 ? 138 GLU A CB    1 
ATOM   1049 C  CG    . GLU A 1 130 ? -0.300  12.282 45.353 1.00 17.88 ? 138 GLU A CG    1 
ATOM   1050 C  CD    . GLU A 1 130 ? -0.698  11.066 44.537 1.00 21.77 ? 138 GLU A CD    1 
ATOM   1051 O  OE1   . GLU A 1 130 ? -0.990  9.972  45.124 1.00 24.21 ? 138 GLU A OE1   1 
ATOM   1052 O  OE2   . GLU A 1 130 ? -0.714  11.169 43.295 1.00 21.61 ? 138 GLU A OE2   1 
ATOM   1053 N  N     . LEU A 1 131 ? -4.162  13.648 47.913 1.00 17.00 ? 139 LEU A N     1 
ATOM   1054 C  CA    . LEU A 1 131 ? -5.053  13.583 49.062 1.00 17.64 ? 139 LEU A CA    1 
ATOM   1055 C  C     . LEU A 1 131 ? -6.236  12.723 48.671 1.00 17.11 ? 139 LEU A C     1 
ATOM   1056 O  O     . LEU A 1 131 ? -6.776  12.864 47.580 1.00 16.47 ? 139 LEU A O     1 
ATOM   1057 C  CB    . LEU A 1 131 ? -5.489  14.990 49.455 1.00 18.41 ? 139 LEU A CB    1 
ATOM   1058 C  CG    . LEU A 1 131 ? -4.472  15.861 50.184 1.00 20.43 ? 139 LEU A CG    1 
ATOM   1059 C  CD1   . LEU A 1 131 ? -5.059  17.273 50.372 1.00 23.70 ? 139 LEU A CD1   1 
ATOM   1060 C  CD2   . LEU A 1 131 ? -4.146  15.259 51.541 1.00 20.61 ? 139 LEU A CD2   1 
ATOM   1061 N  N     . PRO A 1 132 ? -6.617  11.772 49.517 1.00 17.17 ? 140 PRO A N     1 
ATOM   1062 C  CA    . PRO A 1 132 ? -7.648  10.807 49.114 1.00 17.21 ? 140 PRO A CA    1 
ATOM   1063 C  C     . PRO A 1 132 ? -8.914  11.489 48.583 1.00 17.19 ? 140 PRO A C     1 
ATOM   1064 O  O     . PRO A 1 132 ? -9.512  10.948 47.669 1.00 16.89 ? 140 PRO A O     1 
ATOM   1065 C  CB    . PRO A 1 132 ? -7.943  10.032 50.416 1.00 17.45 ? 140 PRO A CB    1 
ATOM   1066 C  CG    . PRO A 1 132 ? -6.780  10.279 51.268 1.00 18.85 ? 140 PRO A CG    1 
ATOM   1067 C  CD    . PRO A 1 132 ? -6.084  11.508 50.865 1.00 17.11 ? 140 PRO A CD    1 
ATOM   1068 N  N     . GLU A 1 133 ? -9.277  12.649 49.133 1.00 18.53 ? 141 GLU A N     1 
ATOM   1069 C  CA    . GLU A 1 133 ? -10.480 13.397 48.743 1.00 19.12 ? 141 GLU A CA    1 
ATOM   1070 C  C     . GLU A 1 133 ? -10.427 13.876 47.276 1.00 18.39 ? 141 GLU A C     1 
ATOM   1071 O  O     . GLU A 1 133 ? -11.460 13.983 46.582 1.00 17.56 ? 141 GLU A O     1 
ATOM   1072 C  CB    . GLU A 1 133 ? -10.668 14.597 49.671 1.00 20.89 ? 141 GLU A CB    1 
ATOM   1073 C  CG    . GLU A 1 133 ? -11.344 15.801 49.007 1.00 26.26 ? 141 GLU A CG    1 
ATOM   1074 C  CD    . GLU A 1 133 ? -11.822 16.881 49.975 1.00 34.27 ? 141 GLU A CD    1 
ATOM   1075 O  OE1   . GLU A 1 133 ? -11.148 17.145 51.004 1.00 37.44 ? 141 GLU A OE1   1 
ATOM   1076 O  OE2   . GLU A 1 133 ? -12.878 17.494 49.665 1.00 38.28 ? 141 GLU A OE2   1 
ATOM   1077 N  N     . TYR A 1 134 ? -9.220  14.138 46.796 1.00 17.84 ? 142 TYR A N     1 
ATOM   1078 C  CA    . TYR A 1 134 ? -9.042  14.591 45.419 1.00 17.50 ? 142 TYR A CA    1 
ATOM   1079 C  C     . TYR A 1 134 ? -8.640  13.451 44.513 1.00 18.01 ? 142 TYR A C     1 
ATOM   1080 O  O     . TYR A 1 134 ? -9.053  13.371 43.352 1.00 17.51 ? 142 TYR A O     1 
ATOM   1081 C  CB    . TYR A 1 134 ? -7.987  15.690 45.373 1.00 17.12 ? 142 TYR A CB    1 
ATOM   1082 C  CG    . TYR A 1 134 ? -8.358  16.900 46.169 1.00 17.84 ? 142 TYR A CG    1 
ATOM   1083 C  CD1   . TYR A 1 134 ? -9.638  17.444 46.102 1.00 18.64 ? 142 TYR A CD1   1 
ATOM   1084 C  CD2   . TYR A 1 134 ? -7.418  17.517 46.995 1.00 17.40 ? 142 TYR A CD2   1 
ATOM   1085 C  CE1   . TYR A 1 134 ? -9.979  18.570 46.848 1.00 22.19 ? 142 TYR A CE1   1 
ATOM   1086 C  CE2   . TYR A 1 134 ? -7.734  18.634 47.728 1.00 22.50 ? 142 TYR A CE2   1 
ATOM   1087 C  CZ    . TYR A 1 134 ? -9.009  19.165 47.661 1.00 23.11 ? 142 TYR A CZ    1 
ATOM   1088 O  OH    . TYR A 1 134 ? -9.304  20.274 48.423 1.00 24.56 ? 142 TYR A OH    1 
ATOM   1089 N  N     . LEU A 1 135 ? -7.843  12.533 45.053 1.00 18.13 ? 143 LEU A N     1 
ATOM   1090 C  CA    . LEU A 1 135 ? -7.439  11.360 44.292 1.00 18.62 ? 143 LEU A CA    1 
ATOM   1091 C  C     . LEU A 1 135 ? -8.622  10.593 43.708 1.00 18.33 ? 143 LEU A C     1 
ATOM   1092 O  O     . LEU A 1 135 ? -8.560  10.116 42.566 1.00 19.83 ? 143 LEU A O     1 
ATOM   1093 C  CB    . LEU A 1 135 ? -6.539  10.436 45.159 1.00 18.44 ? 143 LEU A CB    1 
ATOM   1094 C  CG    . LEU A 1 135 ? -5.684  9.422  44.406 1.00 19.36 ? 143 LEU A CG    1 
ATOM   1095 C  CD1   . LEU A 1 135 ? -4.941  10.003 43.218 1.00 19.70 ? 143 LEU A CD1   1 
ATOM   1096 C  CD2   . LEU A 1 135 ? -4.698  8.692  45.334 1.00 17.70 ? 143 LEU A CD2   1 
ATOM   1097 N  N     . LYS A 1 136 ? -9.716  10.470 44.462 1.00 17.13 ? 144 LYS A N     1 
ATOM   1098 C  CA    . LYS A 1 136 ? -10.882 9.741  43.974 1.00 17.49 ? 144 LYS A CA    1 
ATOM   1099 C  C     . LYS A 1 136 ? -11.564 10.342 42.742 1.00 16.73 ? 144 LYS A C     1 
ATOM   1100 O  O     . LYS A 1 136 ? -12.235 9.633  42.008 1.00 16.63 ? 144 LYS A O     1 
ATOM   1101 C  CB    . LYS A 1 136 ? -11.923 9.601  45.076 1.00 17.19 ? 144 LYS A CB    1 
ATOM   1102 C  CG    . LYS A 1 136 ? -12.523 10.948 45.454 1.00 19.86 ? 144 LYS A CG    1 
ATOM   1103 C  CD    . LYS A 1 136 ? -13.611 10.849 46.495 1.00 23.98 ? 144 LYS A CD    1 
ATOM   1104 C  CE    . LYS A 1 136 ? -14.462 12.120 46.435 1.00 25.08 ? 144 LYS A CE    1 
ATOM   1105 N  NZ    . LYS A 1 136 ? -13.924 13.229 47.273 1.00 24.12 ? 144 LYS A NZ    1 
ATOM   1106 N  N     . ILE A 1 137 ? -11.431 11.649 42.548 1.00 17.08 ? 145 ILE A N     1 
ATOM   1107 C  CA    . ILE A 1 137 ? -12.173 12.337 41.486 1.00 17.56 ? 145 ILE A CA    1 
ATOM   1108 C  C     . ILE A 1 137 ? -11.672 11.860 40.124 1.00 18.53 ? 145 ILE A C     1 
ATOM   1109 O  O     . ILE A 1 137 ? -12.383 11.939 39.117 1.00 18.66 ? 145 ILE A O     1 
ATOM   1110 C  CB    . ILE A 1 137 ? -12.017 13.883 41.629 1.00 17.22 ? 145 ILE A CB    1 
ATOM   1111 C  CG1   A ILE A 1 137 ? -12.604 14.293 42.989 0.50 16.82 ? 145 ILE A CG1   1 
ATOM   1112 C  CG1   B ILE A 1 137 ? -12.487 14.347 43.011 0.50 18.10 ? 145 ILE A CG1   1 
ATOM   1113 C  CG2   . ILE A 1 137 ? -12.764 14.600 40.487 1.00 18.74 ? 145 ILE A CG2   1 
ATOM   1114 C  CD1   A ILE A 1 137 ? -12.427 15.746 43.398 0.50 13.95 ? 145 ILE A CD1   1 
ATOM   1115 C  CD1   B ILE A 1 137 ? -13.935 14.067 43.292 0.50 20.25 ? 145 ILE A CD1   1 
ATOM   1116 N  N     . LYS A 1 138 ? -10.446 11.358 40.121 1.00 18.70 ? 146 LYS A N     1 
ATOM   1117 C  CA    . LYS A 1 138 ? -9.843  10.727 38.951 1.00 20.98 ? 146 LYS A CA    1 
ATOM   1118 C  C     . LYS A 1 138 ? -10.723 9.611  38.396 1.00 21.27 ? 146 LYS A C     1 
ATOM   1119 O  O     . LYS A 1 138 ? -10.699 9.318  37.180 1.00 21.42 ? 146 LYS A O     1 
ATOM   1120 C  CB    . LYS A 1 138 ? -8.504  10.133 39.366 1.00 21.47 ? 146 LYS A CB    1 
ATOM   1121 C  CG    . LYS A 1 138 ? -7.582  9.839  38.224 1.00 25.18 ? 146 LYS A CG    1 
ATOM   1122 C  CD    . LYS A 1 138 ? -6.330  9.134  38.716 1.00 26.73 ? 146 LYS A CD    1 
ATOM   1123 C  CE    . LYS A 1 138 ? -5.560  8.589  37.512 1.00 30.82 ? 146 LYS A CE    1 
ATOM   1124 N  NZ    . LYS A 1 138 ? -4.202  8.026  37.826 1.00 33.87 ? 146 LYS A NZ    1 
ATOM   1125 N  N     . GLU A 1 139 ? -11.478 8.974  39.301 1.00 21.17 ? 147 GLU A N     1 
ATOM   1126 C  CA    . GLU A 1 139 ? -12.330 7.845  38.952 1.00 21.44 ? 147 GLU A CA    1 
ATOM   1127 C  C     . GLU A 1 139 ? -13.796 8.219  38.763 1.00 20.78 ? 147 GLU A C     1 
ATOM   1128 O  O     . GLU A 1 139 ? -14.630 7.329  38.608 1.00 20.22 ? 147 GLU A O     1 
ATOM   1129 C  CB    . GLU A 1 139 ? -12.251 6.726  40.013 1.00 22.24 ? 147 GLU A CB    1 
ATOM   1130 C  CG    . GLU A 1 139 ? -10.883 6.443  40.620 1.00 27.62 ? 147 GLU A CG    1 
ATOM   1131 C  CD    . GLU A 1 139 ? -9.875  5.890  39.618 1.00 34.82 ? 147 GLU A CD    1 
ATOM   1132 O  OE1   . GLU A 1 139 ? -10.271 5.514  38.489 1.00 38.67 ? 147 GLU A OE1   1 
ATOM   1133 O  OE2   . GLU A 1 139 ? -8.662  5.848  39.952 1.00 37.70 ? 147 GLU A OE2   1 
ATOM   1134 N  N     . ASP A 1 140 ? -14.117 9.516  38.762 1.00 19.14 ? 148 ASP A N     1 
ATOM   1135 C  CA    . ASP A 1 140 ? -15.499 9.945  38.592 1.00 18.74 ? 148 ASP A CA    1 
ATOM   1136 C  C     . ASP A 1 140 ? -16.053 9.438  37.264 1.00 18.33 ? 148 ASP A C     1 
ATOM   1137 O  O     . ASP A 1 140 ? -15.310 9.320  36.288 1.00 18.32 ? 148 ASP A O     1 
ATOM   1138 C  CB    . ASP A 1 140 ? -15.590 11.473 38.595 1.00 18.79 ? 148 ASP A CB    1 
ATOM   1139 C  CG    . ASP A 1 140 ? -17.002 11.961 38.792 1.00 19.68 ? 148 ASP A CG    1 
ATOM   1140 O  OD1   . ASP A 1 140 ? -17.729 12.058 37.790 1.00 19.76 ? 148 ASP A OD1   1 
ATOM   1141 O  OD2   . ASP A 1 140 ? -17.489 12.220 39.911 1.00 24.08 ? 148 ASP A OD2   1 
ATOM   1142 N  N     . ASN A 1 141 ? -17.356 9.155  37.240 1.00 19.20 ? 149 ASN A N     1 
ATOM   1143 C  CA    . ASN A 1 141 ? -18.020 8.690  36.022 1.00 19.36 ? 149 ASN A CA    1 
ATOM   1144 C  C     . ASN A 1 141 ? -17.886 9.691  34.881 1.00 17.85 ? 149 ASN A C     1 
ATOM   1145 O  O     . ASN A 1 141 ? -17.929 9.330  33.692 1.00 17.07 ? 149 ASN A O     1 
ATOM   1146 C  CB    . ASN A 1 141 ? -19.481 8.395  36.301 1.00 20.40 ? 149 ASN A CB    1 
ATOM   1147 C  CG    . ASN A 1 141 ? -19.691 6.994  36.822 1.00 25.15 ? 149 ASN A CG    1 
ATOM   1148 O  OD1   . ASN A 1 141 ? -18.766 6.162  36.826 1.00 28.20 ? 149 ASN A OD1   1 
ATOM   1149 N  ND2   . ASN A 1 141 ? -20.904 6.719  37.272 1.00 28.88 ? 149 ASN A ND2   1 
ATOM   1150 N  N     . PHE A 1 142 ? -17.657 10.947 35.254 1.00 17.01 ? 150 PHE A N     1 
ATOM   1151 C  CA    . PHE A 1 142 ? -17.380 11.994 34.281 1.00 15.92 ? 150 PHE A CA    1 
ATOM   1152 C  C     . PHE A 1 142 ? -16.296 11.555 33.315 1.00 16.52 ? 150 PHE A C     1 
ATOM   1153 O  O     . PHE A 1 142 ? -16.386 11.791 32.099 1.00 15.57 ? 150 PHE A O     1 
ATOM   1154 C  CB    . PHE A 1 142 ? -16.917 13.265 35.033 1.00 15.08 ? 150 PHE A CB    1 
ATOM   1155 C  CG    . PHE A 1 142 ? -16.491 14.382 34.136 1.00 13.74 ? 150 PHE A CG    1 
ATOM   1156 C  CD1   . PHE A 1 142 ? -17.426 15.161 33.480 1.00 12.45 ? 150 PHE A CD1   1 
ATOM   1157 C  CD2   . PHE A 1 142 ? -15.130 14.664 33.961 1.00 13.31 ? 150 PHE A CD2   1 
ATOM   1158 C  CE1   . PHE A 1 142 ? -17.007 16.225 32.626 1.00 13.43 ? 150 PHE A CE1   1 
ATOM   1159 C  CE2   . PHE A 1 142 ? -14.699 15.687 33.144 1.00 13.81 ? 150 PHE A CE2   1 
ATOM   1160 C  CZ    . PHE A 1 142 ? -15.629 16.476 32.453 1.00 14.02 ? 150 PHE A CZ    1 
ATOM   1161 N  N     . PHE A 1 143 ? -15.226 10.976 33.870 1.00 16.89 ? 151 PHE A N     1 
ATOM   1162 C  CA    . PHE A 1 143 ? -14.132 10.516 33.052 1.00 19.75 ? 151 PHE A CA    1 
ATOM   1163 C  C     . PHE A 1 143 ? -14.343 9.137  32.442 1.00 22.64 ? 151 PHE A C     1 
ATOM   1164 O  O     . PHE A 1 143 ? -13.851 8.874  31.344 1.00 23.07 ? 151 PHE A O     1 
ATOM   1165 C  CB    . PHE A 1 143 ? -12.871 10.482 33.888 1.00 19.86 ? 151 PHE A CB    1 
ATOM   1166 C  CG    . PHE A 1 143 ? -12.367 11.830 34.231 1.00 15.55 ? 151 PHE A CG    1 
ATOM   1167 C  CD1   . PHE A 1 143 ? -11.917 12.700 33.231 1.00 14.85 ? 151 PHE A CD1   1 
ATOM   1168 C  CD2   . PHE A 1 143 ? -12.336 12.246 35.568 1.00 15.89 ? 151 PHE A CD2   1 
ATOM   1169 C  CE1   . PHE A 1 143 ? -11.445 13.972 33.564 1.00 14.55 ? 151 PHE A CE1   1 
ATOM   1170 C  CE2   . PHE A 1 143 ? -11.885 13.526 35.918 1.00 14.35 ? 151 PHE A CE2   1 
ATOM   1171 C  CZ    . PHE A 1 143 ? -11.415 14.387 34.933 1.00 13.85 ? 151 PHE A CZ    1 
ATOM   1172 N  N     . GLN A 1 144 ? -15.020 8.276  33.187 1.00 26.11 ? 152 GLN A N     1 
ATOM   1173 C  CA    . GLN A 1 144 ? -15.272 6.899  32.759 1.00 30.28 ? 152 GLN A CA    1 
ATOM   1174 C  C     . GLN A 1 144 ? -16.206 6.815  31.563 1.00 31.77 ? 152 GLN A C     1 
ATOM   1175 O  O     . GLN A 1 144 ? -16.088 5.887  30.772 1.00 32.59 ? 152 GLN A O     1 
ATOM   1176 C  CB    . GLN A 1 144 ? -15.760 6.036  33.922 1.00 30.03 ? 152 GLN A CB    1 
ATOM   1177 C  CG    . GLN A 1 144 ? -14.637 5.205  34.556 1.00 33.91 ? 152 GLN A CG    1 
ATOM   1178 C  CD    . GLN A 1 144 ? -14.733 5.121  36.079 1.00 39.40 ? 152 GLN A CD    1 
ATOM   1179 O  OE1   . GLN A 1 144 ? -13.718 4.926  36.769 1.00 42.18 ? 152 GLN A OE1   1 
ATOM   1180 N  NE2   . GLN A 1 144 ? -15.952 5.253  36.607 1.00 42.32 ? 152 GLN A NE2   1 
ATOM   1181 N  N     . VAL A 1 145 ? -17.110 7.785  31.406 1.00 34.10 ? 153 VAL A N     1 
ATOM   1182 C  CA    . VAL A 1 145 ? -17.931 7.850  30.191 1.00 35.99 ? 153 VAL A CA    1 
ATOM   1183 C  C     . VAL A 1 145 ? -17.128 8.269  28.952 1.00 37.54 ? 153 VAL A C     1 
ATOM   1184 O  O     . VAL A 1 145 ? -17.445 7.869  27.819 1.00 37.67 ? 153 VAL A O     1 
ATOM   1185 C  CB    . VAL A 1 145 ? -19.238 8.707  30.365 1.00 35.92 ? 153 VAL A CB    1 
ATOM   1186 C  CG1   . VAL A 1 145 ? -18.945 10.197 30.467 1.00 34.54 ? 153 VAL A CG1   1 
ATOM   1187 C  CG2   . VAL A 1 145 ? -20.244 8.418  29.229 1.00 36.58 ? 153 VAL A CG2   1 
ATOM   1188 N  N     . SER A 1 146 ? -16.080 9.058  29.171 1.00 39.09 ? 154 SER A N     1 
ATOM   1189 C  CA    . SER A 1 146 ? -15.287 9.577  28.059 1.00 40.71 ? 154 SER A CA    1 
ATOM   1190 C  C     . SER A 1 146 ? -14.391 8.506  27.409 1.00 41.64 ? 154 SER A C     1 
ATOM   1191 O  O     . SER A 1 146 ? -13.991 8.664  26.249 1.00 42.24 ? 154 SER A O     1 
ATOM   1192 C  CB    . SER A 1 146 ? -14.467 10.806 28.477 1.00 40.70 ? 154 SER A CB    1 
ATOM   1193 O  OG    . SER A 1 146 ? -14.861 11.295 29.750 1.00 40.94 ? 154 SER A OG    1 
ATOM   1194 N  N     . LYS A 1 147 ? -14.070 7.435  28.144 1.00 42.82 ? 155 LYS A N     1 
ATOM   1195 C  CA    . LYS A 1 147 ? -13.502 6.215  27.522 1.00 43.60 ? 155 LYS A CA    1 
ATOM   1196 C  C     . LYS A 1 147 ? -14.610 5.232  27.092 1.00 44.09 ? 155 LYS A C     1 
ATOM   1197 O  O     . LYS A 1 147 ? -14.703 4.727  25.963 1.00 44.44 ? 155 LYS A O     1 
ATOM   1198 C  CB    . LYS A 1 147 ? -12.467 5.508  28.418 1.00 43.69 ? 155 LYS A CB    1 
ATOM   1199 C  CG    . LYS A 1 147 ? -12.331 6.038  29.848 1.00 43.06 ? 155 LYS A CG    1 
ATOM   1200 C  CD    . LYS A 1 147 ? -11.016 6.785  30.047 1.00 42.81 ? 155 LYS A CD    1 
ATOM   1201 C  CE    . LYS A 1 147 ? -10.239 6.271  31.258 1.00 42.86 ? 155 LYS A CE    1 
ATOM   1202 N  NZ    . LYS A 1 147 ? -10.884 6.696  32.525 1.00 41.90 ? 155 LYS A NZ    1 
ATOM   1203 O  OXT   . LYS A 1 147 ? -15.529 4.860  27.826 1.00 44.39 ? 155 LYS A OXT   1 
HETATM 1204 MG MG    . MG  B 2 .   ? -1.542  27.946 25.441 1.00 18.99 ? 201 MG  A MG    1 
HETATM 1205 P  PB    . ADP C 3 .   ? -1.941  27.686 22.233 1.00 20.28 ? 301 ADP A PB    1 
HETATM 1206 O  O1B   . ADP C 3 .   ? -2.326  28.218 23.561 1.00 19.51 ? 301 ADP A O1B   1 
HETATM 1207 O  O2B   . ADP C 3 .   ? -2.800  26.525 21.734 1.00 20.22 ? 301 ADP A O2B   1 
HETATM 1208 O  O3B   . ADP C 3 .   ? -1.930  28.822 21.269 1.00 21.75 ? 301 ADP A O3B   1 
HETATM 1209 P  PA    . ADP C 3 .   ? 0.469   26.463 23.374 1.00 19.34 ? 301 ADP A PA    1 
HETATM 1210 O  O1A   . ADP C 3 .   ? 1.924   26.804 23.009 1.00 19.76 ? 301 ADP A O1A   1 
HETATM 1211 O  O2A   . ADP C 3 .   ? 0.026   26.891 24.778 1.00 19.05 ? 301 ADP A O2A   1 
HETATM 1212 O  O3A   . ADP C 3 .   ? -0.405  27.183 22.282 1.00 19.22 ? 301 ADP A O3A   1 
HETATM 1213 O  "O5'" . ADP C 3 .   ? 0.322   24.930 23.219 1.00 18.20 ? 301 ADP A "O5'" 1 
HETATM 1214 C  "C5'" . ADP C 3 .   ? -0.950  24.313 23.542 1.00 19.69 ? 301 ADP A "C5'" 1 
HETATM 1215 C  "C4'" . ADP C 3 .   ? -1.153  22.983 22.819 1.00 20.46 ? 301 ADP A "C4'" 1 
HETATM 1216 O  "O4'" . ADP C 3 .   ? -0.198  22.025 23.212 1.00 20.39 ? 301 ADP A "O4'" 1 
HETATM 1217 C  "C3'" . ADP C 3 .   ? -2.464  22.249 23.136 1.00 20.04 ? 301 ADP A "C3'" 1 
HETATM 1218 O  "O3'" . ADP C 3 .   ? -3.569  22.664 22.324 1.00 20.50 ? 301 ADP A "O3'" 1 
HETATM 1219 C  "C2'" . ADP C 3 .   ? -2.136  20.805 22.845 1.00 22.97 ? 301 ADP A "C2'" 1 
HETATM 1220 O  "O2'" . ADP C 3 .   ? -2.348  20.525 21.473 1.00 22.44 ? 301 ADP A "O2'" 1 
HETATM 1221 C  "C1'" . ADP C 3 .   ? -0.628  20.698 23.032 1.00 21.28 ? 301 ADP A "C1'" 1 
HETATM 1222 N  N9    . ADP C 3 .   ? -0.180  20.007 24.261 1.00 19.74 ? 301 ADP A N9    1 
HETATM 1223 C  C8    . ADP C 3 .   ? 0.757   18.974 24.290 1.00 20.06 ? 301 ADP A C8    1 
HETATM 1224 N  N7    . ADP C 3 .   ? 0.981   18.568 25.541 1.00 20.46 ? 301 ADP A N7    1 
HETATM 1225 C  C5    . ADP C 3 .   ? 0.185   19.320 26.362 1.00 18.99 ? 301 ADP A C5    1 
HETATM 1226 C  C6    . ADP C 3 .   ? 0.035   19.318 27.763 1.00 20.68 ? 301 ADP A C6    1 
HETATM 1227 N  N6    . ADP C 3 .   ? 0.800   18.611 28.590 1.00 18.50 ? 301 ADP A N6    1 
HETATM 1228 N  N1    . ADP C 3 .   ? -0.862  20.214 28.304 1.00 17.87 ? 301 ADP A N1    1 
HETATM 1229 C  C2    . ADP C 3 .   ? -1.551  21.079 27.479 1.00 17.42 ? 301 ADP A C2    1 
HETATM 1230 N  N3    . ADP C 3 .   ? -1.443  21.071 26.105 1.00 19.45 ? 301 ADP A N3    1 
HETATM 1231 C  C4    . ADP C 3 .   ? -0.559  20.188 25.564 1.00 19.98 ? 301 ADP A C4    1 
HETATM 1232 N  N1    . RBF D 4 .   ? 0.414   34.782 34.454 1.00 25.93 ? 401 RBF A N1    1 
HETATM 1233 C  C2    . RBF D 4 .   ? 0.490   35.826 35.328 1.00 29.05 ? 401 RBF A C2    1 
HETATM 1234 O  O2    . RBF D 4 .   ? 0.609   36.993 34.866 1.00 31.18 ? 401 RBF A O2    1 
HETATM 1235 N  N3    . RBF D 4 .   ? 0.464   35.665 36.668 1.00 25.31 ? 401 RBF A N3    1 
HETATM 1236 C  C4    . RBF D 4 .   ? 0.327   34.457 37.255 1.00 21.16 ? 401 RBF A C4    1 
HETATM 1237 O  O4    . RBF D 4 .   ? 0.226   34.327 38.500 1.00 21.35 ? 401 RBF A O4    1 
HETATM 1238 C  C4A   . RBF D 4 .   ? 0.233   33.277 36.385 1.00 19.07 ? 401 RBF A C4A   1 
HETATM 1239 N  N5    . RBF D 4 .   ? 0.139   32.046 36.917 1.00 19.90 ? 401 RBF A N5    1 
HETATM 1240 C  C5A   . RBF D 4 .   ? 0.073   30.969 36.094 1.00 18.50 ? 401 RBF A C5A   1 
HETATM 1241 C  C6    . RBF D 4 .   ? -0.014  29.693 36.660 1.00 19.21 ? 401 RBF A C6    1 
HETATM 1242 C  C7    . RBF D 4 .   ? -0.110  28.571 35.812 1.00 17.84 ? 401 RBF A C7    1 
HETATM 1243 C  C7M   . RBF D 4 .   ? -0.239  27.187 36.371 1.00 20.48 ? 401 RBF A C7M   1 
HETATM 1244 C  C8    . RBF D 4 .   ? -0.087  28.755 34.346 1.00 21.63 ? 401 RBF A C8    1 
HETATM 1245 C  C8M   . RBF D 4 .   ? -0.189  27.553 33.435 1.00 21.06 ? 401 RBF A C8M   1 
HETATM 1246 C  C9    . RBF D 4 .   ? 0.001   30.025 33.789 1.00 19.87 ? 401 RBF A C9    1 
HETATM 1247 C  C9A   . RBF D 4 .   ? 0.096   31.150 34.611 1.00 19.17 ? 401 RBF A C9A   1 
HETATM 1248 N  N10   . RBF D 4 .   ? 0.217   32.436 34.056 1.00 20.72 ? 401 RBF A N10   1 
HETATM 1249 C  C10   . RBF D 4 .   ? 0.301   33.507 34.928 1.00 21.30 ? 401 RBF A C10   1 
HETATM 1250 C  "C1'" . RBF D 4 .   ? 0.187   32.751 32.603 1.00 22.26 ? 401 RBF A "C1'" 1 
HETATM 1251 C  "C2'" . RBF D 4 .   ? 1.316   32.274 31.761 0.50 25.48 ? 401 RBF A "C2'" 1 
HETATM 1252 O  "O2'" . RBF D 4 .   ? 2.151   33.396 31.932 0.50 29.37 ? 401 RBF A "O2'" 1 
HETATM 1253 C  "C3'" . RBF D 4 .   ? 0.674   31.957 30.386 0.50 29.68 ? 401 RBF A "C3'" 1 
HETATM 1254 O  "O3'" . RBF D 4 .   ? 0.543   30.552 30.307 0.50 28.35 ? 401 RBF A "O3'" 1 
HETATM 1255 C  "C4'" . RBF D 4 .   ? 1.358   32.331 29.078 0.30 32.55 ? 401 RBF A "C4'" 1 
HETATM 1256 O  "O4'" . RBF D 4 .   ? 2.043   33.541 29.328 1.00 41.54 ? 401 RBF A "O4'" 1 
HETATM 1257 C  "C5'" . RBF D 4 .   ? 0.355   32.476 27.907 0.10 31.89 ? 401 RBF A "C5'" 1 
HETATM 1258 O  "O5'" . RBF D 4 .   ? -0.409  31.303 27.536 1.00 28.56 ? 401 RBF A "O5'" 1 
HETATM 1259 O  O     . HOH E 5 .   ? -4.663  25.141 22.965 1.00 19.92 ? 501 HOH A O     1 
HETATM 1260 O  O     . HOH E 5 .   ? -3.115  29.076 26.280 1.00 17.68 ? 502 HOH A O     1 
HETATM 1261 O  O     . HOH E 5 .   ? -8.465  25.040 29.198 1.00 17.84 ? 503 HOH A O     1 
HETATM 1262 O  O     . HOH E 5 .   ? -9.716  31.237 27.323 1.00 26.54 ? 504 HOH A O     1 
HETATM 1263 O  O     . HOH E 5 .   ? 3.869   29.078 42.690 1.00 24.26 ? 505 HOH A O     1 
HETATM 1264 O  O     . HOH E 5 .   ? 16.585  35.312 33.775 1.00 25.12 ? 506 HOH A O     1 
HETATM 1265 O  O     . HOH E 5 .   ? -16.122 22.938 22.494 1.00 24.32 ? 507 HOH A O     1 
HETATM 1266 O  O     . HOH E 5 .   ? -1.190  30.958 22.828 1.00 21.96 ? 508 HOH A O     1 
HETATM 1267 O  O     . HOH E 5 .   ? 3.322   17.358 26.231 1.00 25.57 ? 509 HOH A O     1 
HETATM 1268 O  O     . HOH E 5 .   ? -5.550  11.960 28.288 1.00 22.82 ? 510 HOH A O     1 
HETATM 1269 O  O     . HOH E 5 .   ? -0.300  13.421 35.894 1.00 24.72 ? 511 HOH A O     1 
HETATM 1270 O  O     . HOH E 5 .   ? -19.647 21.048 37.261 1.00 31.57 ? 512 HOH A O     1 
HETATM 1271 O  O     . HOH E 5 .   ? 2.171   13.019 40.131 1.00 31.26 ? 513 HOH A O     1 
HETATM 1272 O  O     . HOH E 5 .   ? -6.468  36.484 41.109 1.00 28.44 ? 514 HOH A O     1 
HETATM 1273 O  O     . HOH E 5 .   ? -3.561  27.410 48.505 1.00 26.25 ? 515 HOH A O     1 
HETATM 1274 O  O     . HOH E 5 .   ? -7.009  31.082 26.679 1.00 24.39 ? 516 HOH A O     1 
HETATM 1275 O  O     . HOH E 5 .   ? -8.888  23.463 17.101 1.00 36.58 ? 517 HOH A O     1 
HETATM 1276 O  O     . HOH E 5 .   ? 2.214   27.304 20.316 1.00 26.09 ? 518 HOH A O     1 
HETATM 1277 O  O     . HOH E 5 .   ? -19.893 22.786 39.966 1.00 34.63 ? 519 HOH A O     1 
HETATM 1278 O  O     . HOH E 5 .   ? -3.323  18.677 16.750 1.00 34.05 ? 520 HOH A O     1 
HETATM 1279 O  O     . HOH E 5 .   ? -15.743 15.251 45.845 1.00 44.89 ? 521 HOH A O     1 
HETATM 1280 O  O     . HOH E 5 .   ? 3.818   30.833 18.908 1.00 42.29 ? 522 HOH A O     1 
HETATM 1281 O  O     . HOH E 5 .   ? 3.169   34.737 46.975 1.00 33.48 ? 523 HOH A O     1 
HETATM 1282 O  O     . HOH E 5 .   ? 4.385   11.706 30.827 1.00 32.03 ? 524 HOH A O     1 
HETATM 1283 O  O     . HOH E 5 .   ? -17.450 29.417 21.996 1.00 32.34 ? 525 HOH A O     1 
HETATM 1284 O  O     . HOH E 5 .   ? 5.129   22.334 46.656 1.00 28.77 ? 526 HOH A O     1 
HETATM 1285 O  O     . HOH E 5 .   ? -6.392  23.200 47.776 1.00 32.39 ? 527 HOH A O     1 
HETATM 1286 O  O     . HOH E 5 .   ? 10.851  27.530 30.505 1.00 27.06 ? 528 HOH A O     1 
HETATM 1287 O  O     . HOH E 5 .   ? -2.876  30.845 16.732 1.00 24.54 ? 529 HOH A O     1 
HETATM 1288 O  O     . HOH E 5 .   ? -7.252  7.034  33.635 1.00 31.69 ? 530 HOH A O     1 
HETATM 1289 O  O     . HOH E 5 .   ? -18.215 25.483 31.504 1.00 36.91 ? 531 HOH A O     1 
HETATM 1290 O  O     . HOH E 5 .   ? -7.881  30.754 22.413 1.00 31.19 ? 532 HOH A O     1 
HETATM 1291 O  O     . HOH E 5 .   ? -5.993  38.454 34.495 1.00 33.21 ? 533 HOH A O     1 
HETATM 1292 O  O     . HOH E 5 .   ? -4.593  33.441 23.628 1.00 31.10 ? 534 HOH A O     1 
HETATM 1293 O  O     . HOH E 5 .   ? -10.069 28.484 27.276 1.00 28.92 ? 535 HOH A O     1 
HETATM 1294 O  O     . HOH E 5 .   ? 1.281   23.884 50.792 1.00 36.26 ? 536 HOH A O     1 
HETATM 1295 O  O     . HOH E 5 .   ? 9.668   26.437 41.243 1.00 33.15 ? 537 HOH A O     1 
HETATM 1296 O  O     . HOH E 5 .   ? -10.983 9.956  28.810 1.00 35.53 ? 538 HOH A O     1 
HETATM 1297 O  O     . HOH E 5 .   ? 5.417   17.498 43.386 1.00 34.59 ? 539 HOH A O     1 
HETATM 1298 O  O     . HOH E 5 .   ? -3.638  32.304 32.196 1.00 36.89 ? 540 HOH A O     1 
HETATM 1299 O  O     . HOH E 5 .   ? -9.162  24.479 47.261 1.00 32.92 ? 541 HOH A O     1 
HETATM 1300 O  O     . HOH E 5 .   ? -13.397 19.730 45.030 1.00 33.52 ? 542 HOH A O     1 
HETATM 1301 O  O     . HOH E 5 .   ? -7.004  38.182 38.571 1.00 35.43 ? 543 HOH A O     1 
HETATM 1302 O  O     . HOH E 5 .   ? 1.721   11.130 33.078 1.00 37.32 ? 544 HOH A O     1 
HETATM 1303 O  O     . HOH E 5 .   ? -16.186 34.890 30.951 1.00 33.57 ? 545 HOH A O     1 
HETATM 1304 O  O     . HOH E 5 .   ? 4.071   31.975 26.273 1.00 40.66 ? 546 HOH A O     1 
HETATM 1305 O  O     . HOH E 5 .   ? -8.438  29.891 17.956 1.00 40.68 ? 547 HOH A O     1 
HETATM 1306 O  O     . HOH E 5 .   ? 3.083   38.461 35.614 1.00 42.07 ? 548 HOH A O     1 
HETATM 1307 O  O     . HOH E 5 .   ? -1.914  13.651 21.518 1.00 47.37 ? 549 HOH A O     1 
HETATM 1308 O  O     . HOH E 5 .   ? 0.807   25.155 19.081 1.00 32.20 ? 550 HOH A O     1 
HETATM 1309 O  O     . HOH E 5 .   ? 5.928   24.054 44.842 1.00 32.52 ? 551 HOH A O     1 
HETATM 1310 O  O     . HOH E 5 .   ? -1.290  7.355  44.024 1.00 43.50 ? 552 HOH A O     1 
HETATM 1311 O  O     . HOH E 5 .   ? -13.236 19.021 16.854 1.00 39.71 ? 553 HOH A O     1 
HETATM 1312 O  O     . HOH E 5 .   ? 5.501   20.104 30.577 1.00 38.69 ? 554 HOH A O     1 
HETATM 1313 O  O     . HOH E 5 .   ? -17.480 33.656 35.217 1.00 41.93 ? 555 HOH A O     1 
HETATM 1314 O  O     . HOH E 5 .   ? -16.433 33.273 32.867 1.00 37.37 ? 556 HOH A O     1 
HETATM 1315 O  O     . HOH E 5 .   ? 1.058   40.448 42.587 1.00 34.96 ? 557 HOH A O     1 
HETATM 1316 O  O     . HOH E 5 .   ? -9.482  7.130  35.504 1.00 42.02 ? 558 HOH A O     1 
HETATM 1317 O  O     . HOH E 5 .   ? -10.983 22.160 46.987 1.00 39.55 ? 559 HOH A O     1 
HETATM 1318 O  O     . HOH E 5 .   ? -20.040 32.683 25.230 1.00 42.47 ? 560 HOH A O     1 
HETATM 1319 O  O     . HOH E 5 .   ? -2.213  9.521  40.497 1.00 56.47 ? 561 HOH A O     1 
HETATM 1320 O  O     . HOH E 5 .   ? 0.533   14.931 49.230 1.00 37.12 ? 562 HOH A O     1 
HETATM 1321 O  O     . HOH E 5 .   ? 1.688   17.212 16.733 1.00 39.13 ? 563 HOH A O     1 
HETATM 1322 O  O     . HOH E 5 .   ? -4.216  7.750  27.389 1.00 44.06 ? 564 HOH A O     1 
HETATM 1323 O  O     . HOH E 5 .   ? -16.203 12.121 42.113 1.00 39.31 ? 565 HOH A O     1 
HETATM 1324 O  O     . HOH E 5 .   ? -3.137  9.542  28.136 1.00 48.16 ? 566 HOH A O     1 
HETATM 1325 O  O     . HOH E 5 .   ? 8.414   38.949 40.699 1.00 43.00 ? 567 HOH A O     1 
HETATM 1326 O  O     . HOH E 5 .   ? -0.339  29.633 25.268 1.00 18.13 ? 568 HOH A O     1 
HETATM 1327 O  O     . HOH E 5 .   ? -6.122  32.201 31.447 1.00 25.98 ? 569 HOH A O     1 
HETATM 1328 O  O     . HOH E 5 .   ? 4.608   19.599 33.364 1.00 31.02 ? 570 HOH A O     1 
HETATM 1329 O  O     . HOH E 5 .   ? 4.027   14.205 36.186 1.00 41.34 ? 571 HOH A O     1 
HETATM 1330 O  O     . HOH E 5 .   ? 14.200  36.441 32.834 1.00 36.79 ? 572 HOH A O     1 
HETATM 1331 O  O     . HOH E 5 .   ? 1.837   14.130 37.646 1.00 35.23 ? 573 HOH A O     1 
HETATM 1332 O  O     . HOH E 5 .   ? 4.502   18.786 28.578 1.00 37.58 ? 574 HOH A O     1 
HETATM 1333 O  O     . HOH E 5 .   ? -4.174  10.746 26.325 1.00 40.59 ? 575 HOH A O     1 
HETATM 1334 O  O     . HOH E 5 .   ? 9.255   23.553 41.503 1.00 37.52 ? 576 HOH A O     1 
HETATM 1335 O  O     . HOH E 5 .   ? -7.039  29.626 15.851 1.00 36.28 ? 577 HOH A O     1 
HETATM 1336 O  O     . HOH E 5 .   ? -0.637  10.734 34.777 1.00 37.29 ? 578 HOH A O     1 
HETATM 1337 O  O     . HOH E 5 .   ? 7.426   21.505 37.870 1.00 41.29 ? 579 HOH A O     1 
HETATM 1338 O  O     . HOH E 5 .   ? 8.489   22.856 43.921 1.00 39.81 ? 580 HOH A O     1 
HETATM 1339 O  O     . HOH E 5 .   ? -11.562 32.917 26.140 1.00 43.83 ? 581 HOH A O     1 
HETATM 1340 O  O     . HOH E 5 .   ? -7.022  32.572 23.654 1.00 45.39 ? 582 HOH A O     1 
HETATM 1341 O  O     . HOH E 5 .   ? -13.689 17.335 46.022 1.00 49.37 ? 583 HOH A O     1 
HETATM 1342 O  O     . HOH E 5 .   ? -12.245 37.016 40.018 1.00 44.62 ? 584 HOH A O     1 
HETATM 1343 O  O     . HOH E 5 .   ? -20.686 19.620 34.703 1.00 40.63 ? 585 HOH A O     1 
HETATM 1344 O  O     . HOH E 5 .   ? 2.730   18.196 21.576 1.00 45.41 ? 586 HOH A O     1 
HETATM 1345 O  O     . HOH E 5 .   ? -13.682 34.463 27.233 1.00 35.93 ? 587 HOH A O     1 
HETATM 1346 O  O     . HOH E 5 .   ? -10.646 12.386 17.582 1.00 46.04 ? 588 HOH A O     1 
HETATM 1347 O  O     . HOH E 5 .   ? -21.869 31.787 26.181 1.00 50.50 ? 589 HOH A O     1 
HETATM 1348 O  O     . HOH E 5 .   ? -1.346  41.019 42.839 1.00 48.19 ? 590 HOH A O     1 
HETATM 1349 O  O     . HOH E 5 .   ? 0.244   9.847  25.788 1.00 42.90 ? 591 HOH A O     1 
HETATM 1350 O  O     . HOH E 5 .   ? 11.824  26.128 39.377 1.00 41.90 ? 592 HOH A O     1 
HETATM 1351 O  O     . HOH E 5 .   ? -10.570 30.446 22.927 1.00 37.76 ? 593 HOH A O     1 
HETATM 1352 O  O     . HOH E 5 .   ? -4.070  7.775  34.664 1.00 44.64 ? 594 HOH A O     1 
HETATM 1353 O  O     . HOH E 5 .   ? -8.006  26.028 16.924 1.00 33.47 ? 595 HOH A O     1 
HETATM 1354 O  O     . HOH E 5 .   ? -14.753 9.006  42.104 1.00 44.36 ? 596 HOH A O     1 
HETATM 1355 O  O     . HOH E 5 .   ? -16.542 37.685 33.860 1.00 41.14 ? 597 HOH A O     1 
HETATM 1356 O  O     . HOH E 5 .   ? 11.876  38.996 31.922 1.00 42.95 ? 598 HOH A O     1 
HETATM 1357 O  O     . HOH E 5 .   ? 10.124  26.745 43.960 1.00 39.71 ? 599 HOH A O     1 
HETATM 1358 O  O     . HOH E 5 .   ? -5.577  16.903 16.817 1.00 42.83 ? 600 HOH A O     1 
HETATM 1359 O  O     . HOH E 5 .   ? -6.285  27.315 48.495 1.00 47.22 ? 601 HOH A O     1 
HETATM 1360 O  O     . HOH E 5 .   ? -19.535 36.023 30.743 1.00 53.75 ? 602 HOH A O     1 
HETATM 1361 O  O     . HOH E 5 .   ? -11.869 32.835 23.498 1.00 49.38 ? 603 HOH A O     1 
HETATM 1362 O  O     . HOH E 5 .   ? -3.101  31.899 24.711 1.00 45.62 ? 604 HOH A O     1 
HETATM 1363 O  O     . HOH E 5 .   ? -5.448  32.027 28.826 1.00 38.17 ? 605 HOH A O     1 
HETATM 1364 O  O     . HOH E 5 .   ? -5.892  41.138 34.342 1.00 54.29 ? 606 HOH A O     1 
HETATM 1365 O  O     . HOH E 5 .   ? -16.018 33.050 36.951 1.00 49.81 ? 607 HOH A O     1 
HETATM 1366 O  O     . HOH E 5 .   ? 4.568   38.105 42.903 1.00 44.58 ? 608 HOH A O     1 
HETATM 1367 O  O     . HOH E 5 .   ? 5.056   14.825 43.486 1.00 44.46 ? 609 HOH A O     1 
HETATM 1368 O  O     . HOH E 5 .   ? -2.890  40.866 38.670 1.00 60.54 ? 610 HOH A O     1 
HETATM 1369 O  O     . HOH E 5 .   ? -14.080 31.177 21.048 1.00 39.70 ? 611 HOH A O     1 
HETATM 1370 O  O     . HOH E 5 .   ? 8.400   29.957 42.508 1.00 44.72 ? 612 HOH A O     1 
HETATM 1371 O  O     . HOH E 5 .   ? -2.169  8.905  47.493 1.00 47.75 ? 613 HOH A O     1 
HETATM 1372 O  O     . HOH E 5 .   ? -14.109 13.361 25.398 1.00 40.98 ? 614 HOH A O     1 
HETATM 1373 O  O     . HOH E 5 .   ? -4.557  33.233 36.637 1.00 34.64 ? 615 HOH A O     1 
HETATM 1374 O  O     . HOH E 5 .   ? 0.550   10.929 23.546 1.00 50.80 ? 616 HOH A O     1 
HETATM 1375 O  O     . HOH E 5 .   ? -0.157  21.348 15.981 1.00 49.87 ? 617 HOH A O     1 
HETATM 1376 O  O     . HOH E 5 .   ? -8.705  8.275  47.231 1.00 45.76 ? 618 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ARG 1   9   9   ARG ARG A . n 
A 1 2   HIS 2   10  10  HIS HIS A . n 
A 1 3   LEU 3   11  11  LEU LEU A . n 
A 1 4   PRO 4   12  12  PRO PRO A . n 
A 1 5   TYR 5   13  13  TYR TYR A . n 
A 1 6   PHE 6   14  14  PHE PHE A . n 
A 1 7   CYS 7   15  15  CYS CYS A . n 
A 1 8   ARG 8   16  16  ARG ARG A . n 
A 1 9   GLY 9   17  17  GLY GLY A . n 
A 1 10  GLN 10  18  18  GLN GLN A . n 
A 1 11  VAL 11  19  19  VAL VAL A . n 
A 1 12  VAL 12  20  20  VAL VAL A . n 
A 1 13  ARG 13  21  21  ARG ARG A . n 
A 1 14  GLY 14  22  22  GLY GLY A . n 
A 1 15  PHE 15  23  23  PHE PHE A . n 
A 1 16  GLY 16  24  24  GLY GLY A . n 
A 1 17  ARG 17  25  25  ARG ARG A . n 
A 1 18  GLY 18  26  26  GLY GLY A . n 
A 1 19  SER 19  27  27  SER SER A . n 
A 1 20  LYS 20  28  28  LYS LYS A . n 
A 1 21  GLN 21  29  29  GLN GLN A . n 
A 1 22  LEU 22  30  30  LEU LEU A . n 
A 1 23  GLY 23  31  31  GLY GLY A . n 
A 1 24  ILE 24  32  32  ILE ILE A . n 
A 1 25  PRO 25  33  33  PRO PRO A . n 
A 1 26  THR 26  34  34  THR THR A . n 
A 1 27  ALA 27  35  35  ALA ALA A . n 
A 1 28  ASN 28  36  36  ASN ASN A . n 
A 1 29  PHE 29  37  37  PHE PHE A . n 
A 1 30  PRO 30  38  38  PRO PRO A . n 
A 1 31  GLU 31  39  39  GLU GLU A . n 
A 1 32  GLN 32  40  40  GLN GLN A . n 
A 1 33  VAL 33  41  41  VAL VAL A . n 
A 1 34  VAL 34  42  42  VAL VAL A . n 
A 1 35  ASP 35  43  43  ASP ASP A . n 
A 1 36  ASN 36  44  44  ASN ASN A . n 
A 1 37  LEU 37  45  45  LEU LEU A . n 
A 1 38  PRO 38  46  46  PRO PRO A . n 
A 1 39  ALA 39  47  47  ALA ALA A . n 
A 1 40  ASP 40  48  48  ASP ASP A . n 
A 1 41  ILE 41  49  49  ILE ILE A . n 
A 1 42  SER 42  50  50  SER SER A . n 
A 1 43  THR 43  51  51  THR THR A . n 
A 1 44  GLY 44  52  52  GLY GLY A . n 
A 1 45  ILE 45  53  53  ILE ILE A . n 
A 1 46  TYR 46  54  54  TYR TYR A . n 
A 1 47  TYR 47  55  55  TYR TYR A . n 
A 1 48  GLY 48  56  56  GLY GLY A . n 
A 1 49  TRP 49  57  57  TRP TRP A . n 
A 1 50  ALA 50  58  58  ALA ALA A . n 
A 1 51  SER 51  59  59  SER SER A . n 
A 1 52  VAL 52  60  60  VAL VAL A . n 
A 1 53  GLY 53  61  61  GLY GLY A . n 
A 1 54  SER 54  62  62  SER SER A . n 
A 1 55  GLY 55  63  63  GLY GLY A . n 
A 1 56  ASP 56  64  64  ASP ASP A . n 
A 1 57  VAL 57  65  65  VAL VAL A . n 
A 1 58  HIS 58  66  66  HIS HIS A . n 
A 1 59  LYS 59  67  67  LYS LYS A . n 
A 1 60  MET 60  68  68  MET MET A . n 
A 1 61  VAL 61  69  69  VAL VAL A . n 
A 1 62  VAL 62  70  70  VAL VAL A . n 
A 1 63  SER 63  71  71  SER SER A . n 
A 1 64  ILE 64  72  72  ILE ILE A . n 
A 1 65  GLY 65  73  73  GLY GLY A . n 
A 1 66  TRP 66  74  74  TRP TRP A . n 
A 1 67  ASN 67  75  75  ASN ASN A . n 
A 1 68  PRO 68  76  76  PRO PRO A . n 
A 1 69  TYR 69  77  77  TYR TYR A . n 
A 1 70  TYR 70  78  78  TYR TYR A . n 
A 1 71  LYS 71  79  79  LYS LYS A . n 
A 1 72  ASN 72  80  80  ASN ASN A . n 
A 1 73  THR 73  81  81  THR THR A . n 
A 1 74  LYS 74  82  82  LYS LYS A . n 
A 1 75  LYS 75  83  83  LYS LYS A . n 
A 1 76  SER 76  84  84  SER SER A . n 
A 1 77  MET 77  85  85  MET MET A . n 
A 1 78  GLU 78  86  86  GLU GLU A . n 
A 1 79  THR 79  87  87  THR THR A . n 
A 1 80  HIS 80  88  88  HIS HIS A . n 
A 1 81  ILE 81  89  89  ILE ILE A . n 
A 1 82  MET 82  90  90  MET MET A . n 
A 1 83  HIS 83  91  91  HIS HIS A . n 
A 1 84  THR 84  92  92  THR THR A . n 
A 1 85  PHE 85  93  93  PHE PHE A . n 
A 1 86  LYS 86  94  94  LYS LYS A . n 
A 1 87  GLU 87  95  95  GLU GLU A . n 
A 1 88  ASP 88  96  96  ASP ASP A . n 
A 1 89  PHE 89  97  97  PHE PHE A . n 
A 1 90  TYR 90  98  98  TYR TYR A . n 
A 1 91  GLY 91  99  99  GLY GLY A . n 
A 1 92  GLU 92  100 100 GLU GLU A . n 
A 1 93  ILE 93  101 101 ILE ILE A . n 
A 1 94  LEU 94  102 102 LEU LEU A . n 
A 1 95  ASN 95  103 103 ASN ASN A . n 
A 1 96  VAL 96  104 104 VAL VAL A . n 
A 1 97  ALA 97  105 105 ALA ALA A . n 
A 1 98  ILE 98  106 106 ILE ILE A . n 
A 1 99  VAL 99  107 107 VAL VAL A . n 
A 1 100 GLY 100 108 108 GLY GLY A . n 
A 1 101 TYR 101 109 109 TYR TYR A . n 
A 1 102 LEU 102 110 110 LEU LEU A . n 
A 1 103 ARG 103 111 111 ARG ARG A . n 
A 1 104 PRO 104 112 112 PRO PRO A . n 
A 1 105 GLU 105 113 113 GLU GLU A . n 
A 1 106 LYS 106 114 114 LYS LYS A . n 
A 1 107 ASN 107 115 115 ASN ASN A . n 
A 1 108 PHE 108 116 116 PHE PHE A . n 
A 1 109 ASP 109 117 117 ASP ASP A . n 
A 1 110 SER 110 118 118 SER SER A . n 
A 1 111 LEU 111 119 119 LEU LEU A . n 
A 1 112 GLU 112 120 120 GLU GLU A . n 
A 1 113 SER 113 121 121 SER SER A . n 
A 1 114 LEU 114 122 122 LEU LEU A . n 
A 1 115 ILE 115 123 123 ILE ILE A . n 
A 1 116 SER 116 124 124 SER SER A . n 
A 1 117 ALA 117 125 125 ALA ALA A . n 
A 1 118 ILE 118 126 126 ILE ILE A . n 
A 1 119 GLN 119 127 127 GLN GLN A . n 
A 1 120 GLY 120 128 128 GLY GLY A . n 
A 1 121 ASP 121 129 129 ASP ASP A . n 
A 1 122 ILE 122 130 130 ILE ILE A . n 
A 1 123 GLU 123 131 131 GLU GLU A . n 
A 1 124 GLU 124 132 132 GLU GLU A . n 
A 1 125 ALA 125 133 133 ALA ALA A . n 
A 1 126 LYS 126 134 134 LYS LYS A . n 
A 1 127 LYS 127 135 135 LYS LYS A . n 
A 1 128 ARG 128 136 136 ARG ARG A . n 
A 1 129 LEU 129 137 137 LEU LEU A . n 
A 1 130 GLU 130 138 138 GLU GLU A . n 
A 1 131 LEU 131 139 139 LEU LEU A . n 
A 1 132 PRO 132 140 140 PRO PRO A . n 
A 1 133 GLU 133 141 141 GLU GLU A . n 
A 1 134 TYR 134 142 142 TYR TYR A . n 
A 1 135 LEU 135 143 143 LEU LEU A . n 
A 1 136 LYS 136 144 144 LYS LYS A . n 
A 1 137 ILE 137 145 145 ILE ILE A . n 
A 1 138 LYS 138 146 146 LYS LYS A . n 
A 1 139 GLU 139 147 147 GLU GLU A . n 
A 1 140 ASP 140 148 148 ASP ASP A . n 
A 1 141 ASN 141 149 149 ASN ASN A . n 
A 1 142 PHE 142 150 150 PHE PHE A . n 
A 1 143 PHE 143 151 151 PHE PHE A . n 
A 1 144 GLN 144 152 152 GLN GLN A . n 
A 1 145 VAL 145 153 153 VAL VAL A . n 
A 1 146 SER 146 154 154 SER SER A . n 
A 1 147 LYS 147 155 155 LYS LYS A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A THR 26 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O1B ? C ADP .  ? A ADP 301 ? 1_555 96.1  ? 
2  O   ? A THR 26 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? E HOH .  ? A HOH 502 ? 1_555 91.1  ? 
3  O1B ? C ADP .  ? A ADP 301 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? E HOH .  ? A HOH 502 ? 1_555 90.5  ? 
4  O   ? A THR 26 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C ADP .  ? A ADP 301 ? 1_555 89.6  ? 
5  O1B ? C ADP .  ? A ADP 301 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C ADP .  ? A ADP 301 ? 1_555 93.8  ? 
6  O   ? E HOH .  ? A HOH 502 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O2A ? C ADP .  ? A ADP 301 ? 1_555 175.6 ? 
7  O   ? A THR 26 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OG1 ? A THR 26 ? A THR 34  ? 1_555 85.0  ? 
8  O1B ? C ADP .  ? A ADP 301 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OG1 ? A THR 26 ? A THR 34  ? 1_555 178.0 ? 
9  O   ? E HOH .  ? A HOH 502 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OG1 ? A THR 26 ? A THR 34  ? 1_555 87.8  ? 
10 O2A ? C ADP .  ? A ADP 301 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 OG1 ? A THR 26 ? A THR 34  ? 1_555 87.9  ? 
11 O   ? A THR 26 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? E HOH .  ? A HOH 568 ? 1_555 171.3 ? 
12 O1B ? C ADP .  ? A ADP 301 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? E HOH .  ? A HOH 568 ? 1_555 92.1  ? 
13 O   ? E HOH .  ? A HOH 502 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? E HOH .  ? A HOH 568 ? 1_555 91.7  ? 
14 O2A ? C ADP .  ? A ADP 301 ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? E HOH .  ? A HOH 568 ? 1_555 87.0  ? 
15 OG1 ? A THR 26 ? A THR 34  ? 1_555 MG ? B MG . ? A MG 201 ? 1_555 O   ? E HOH .  ? A HOH 568 ? 1_555 87.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-03-11 
2 'Structure model' 1 1 2008-04-28 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         -6.3140 
_pdbx_refine_tls.origin_y         23.8390 
_pdbx_refine_tls.origin_z         33.4110 
_pdbx_refine_tls.T[1][1]          0.0129 
_pdbx_refine_tls.T[2][2]          0.0680 
_pdbx_refine_tls.T[3][3]          0.0408 
_pdbx_refine_tls.T[1][2]          0.0165 
_pdbx_refine_tls.T[1][3]          0.0002 
_pdbx_refine_tls.T[2][3]          0.0088 
_pdbx_refine_tls.L[1][1]          1.9446 
_pdbx_refine_tls.L[2][2]          0.7347 
_pdbx_refine_tls.L[3][3]          1.5882 
_pdbx_refine_tls.L[1][2]          0.5016 
_pdbx_refine_tls.L[1][3]          0.6070 
_pdbx_refine_tls.L[2][3]          0.1609 
_pdbx_refine_tls.S[1][1]          0.0070 
_pdbx_refine_tls.S[1][2]          0.0133 
_pdbx_refine_tls.S[1][3]          -0.0097 
_pdbx_refine_tls.S[2][1]          0.0281 
_pdbx_refine_tls.S[2][2]          0.0289 
_pdbx_refine_tls.S[2][3]          0.0125 
_pdbx_refine_tls.S[3][1]          -0.0074 
_pdbx_refine_tls.S[3][2]          -0.0652 
_pdbx_refine_tls.S[3][3]          -0.0359 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_label_asym_id   A 
_pdbx_refine_tls_group.beg_label_seq_id    1 
_pdbx_refine_tls_group.beg_auth_seq_id     9 
_pdbx_refine_tls_group.end_label_asym_id   A 
_pdbx_refine_tls_group.end_label_seq_id    147 
_pdbx_refine_tls_group.end_auth_seq_id     155 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' .      ? 1 
SCALEPACK 'data scaling'    .      ? 2 
SOLVE     phasing           .      ? 3 
REFMAC    refinement        5.1.27 ? 4 
HKL-2000  'data reduction'  .      ? 5 
MOLREP    phasing           .      ? 6 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ASN 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     80 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             62.01 
_pdbx_validate_torsion.psi             -137.35 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 9 ? CB  ? A ARG 1 CB  
2 1 Y 1 A ARG 9 ? CG  ? A ARG 1 CG  
3 1 Y 1 A ARG 9 ? CD  ? A ARG 1 CD  
4 1 Y 1 A ARG 9 ? NE  ? A ARG 1 NE  
5 1 Y 1 A ARG 9 ? CZ  ? A ARG 1 CZ  
6 1 Y 1 A ARG 9 ? NH1 ? A ARG 1 NH1 
7 1 Y 1 A ARG 9 ? NH2 ? A ARG 1 NH2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'            MG  
3 "ADENOSINE-5'-DIPHOSPHATE" ADP 
4 RIBOFLAVIN                 RBF 
5 water                      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1   201 301 MG  MG  A . 
C 3 ADP 1   301 201 ADP ADP A . 
D 4 RBF 1   401 401 RBF RBF A . 
E 5 HOH 1   501 501 HOH HOH A . 
E 5 HOH 2   502 502 HOH HOH A . 
E 5 HOH 3   503 503 HOH HOH A . 
E 5 HOH 4   504 504 HOH HOH A . 
E 5 HOH 5   505 505 HOH HOH A . 
E 5 HOH 6   506 506 HOH HOH A . 
E 5 HOH 7   507 507 HOH HOH A . 
E 5 HOH 8   508 508 HOH HOH A . 
E 5 HOH 9   509 509 HOH HOH A . 
E 5 HOH 10  510 510 HOH HOH A . 
E 5 HOH 11  511 511 HOH HOH A . 
E 5 HOH 12  512 512 HOH HOH A . 
E 5 HOH 13  513 513 HOH HOH A . 
E 5 HOH 14  514 514 HOH HOH A . 
E 5 HOH 15  515 515 HOH HOH A . 
E 5 HOH 16  516 516 HOH HOH A . 
E 5 HOH 17  517 517 HOH HOH A . 
E 5 HOH 18  518 518 HOH HOH A . 
E 5 HOH 19  519 519 HOH HOH A . 
E 5 HOH 20  520 520 HOH HOH A . 
E 5 HOH 21  521 521 HOH HOH A . 
E 5 HOH 22  522 522 HOH HOH A . 
E 5 HOH 23  523 523 HOH HOH A . 
E 5 HOH 24  524 524 HOH HOH A . 
E 5 HOH 25  525 525 HOH HOH A . 
E 5 HOH 26  526 526 HOH HOH A . 
E 5 HOH 27  527 527 HOH HOH A . 
E 5 HOH 28  528 528 HOH HOH A . 
E 5 HOH 29  529 529 HOH HOH A . 
E 5 HOH 30  530 530 HOH HOH A . 
E 5 HOH 31  531 531 HOH HOH A . 
E 5 HOH 32  532 532 HOH HOH A . 
E 5 HOH 33  533 533 HOH HOH A . 
E 5 HOH 34  534 534 HOH HOH A . 
E 5 HOH 35  535 535 HOH HOH A . 
E 5 HOH 36  536 536 HOH HOH A . 
E 5 HOH 37  537 537 HOH HOH A . 
E 5 HOH 38  538 538 HOH HOH A . 
E 5 HOH 39  539 539 HOH HOH A . 
E 5 HOH 40  540 540 HOH HOH A . 
E 5 HOH 41  541 541 HOH HOH A . 
E 5 HOH 42  542 542 HOH HOH A . 
E 5 HOH 43  543 543 HOH HOH A . 
E 5 HOH 44  544 544 HOH HOH A . 
E 5 HOH 45  545 545 HOH HOH A . 
E 5 HOH 46  546 546 HOH HOH A . 
E 5 HOH 47  547 547 HOH HOH A . 
E 5 HOH 48  548 548 HOH HOH A . 
E 5 HOH 49  549 549 HOH HOH A . 
E 5 HOH 50  550 550 HOH HOH A . 
E 5 HOH 51  551 551 HOH HOH A . 
E 5 HOH 52  552 552 HOH HOH A . 
E 5 HOH 53  553 553 HOH HOH A . 
E 5 HOH 54  554 554 HOH HOH A . 
E 5 HOH 55  555 555 HOH HOH A . 
E 5 HOH 56  556 556 HOH HOH A . 
E 5 HOH 57  557 557 HOH HOH A . 
E 5 HOH 58  558 558 HOH HOH A . 
E 5 HOH 59  559 559 HOH HOH A . 
E 5 HOH 60  560 560 HOH HOH A . 
E 5 HOH 61  561 561 HOH HOH A . 
E 5 HOH 62  562 562 HOH HOH A . 
E 5 HOH 63  563 563 HOH HOH A . 
E 5 HOH 64  564 564 HOH HOH A . 
E 5 HOH 65  565 565 HOH HOH A . 
E 5 HOH 66  566 566 HOH HOH A . 
E 5 HOH 67  567 567 HOH HOH A . 
E 5 HOH 68  568 568 HOH HOH A . 
E 5 HOH 69  569 569 HOH HOH A . 
E 5 HOH 70  570 570 HOH HOH A . 
E 5 HOH 71  571 571 HOH HOH A . 
E 5 HOH 72  572 572 HOH HOH A . 
E 5 HOH 73  573 573 HOH HOH A . 
E 5 HOH 74  574 574 HOH HOH A . 
E 5 HOH 75  575 575 HOH HOH A . 
E 5 HOH 76  576 576 HOH HOH A . 
E 5 HOH 77  577 577 HOH HOH A . 
E 5 HOH 78  578 578 HOH HOH A . 
E 5 HOH 79  579 579 HOH HOH A . 
E 5 HOH 80  580 580 HOH HOH A . 
E 5 HOH 81  581 581 HOH HOH A . 
E 5 HOH 82  582 582 HOH HOH A . 
E 5 HOH 83  583 583 HOH HOH A . 
E 5 HOH 84  584 584 HOH HOH A . 
E 5 HOH 85  585 585 HOH HOH A . 
E 5 HOH 86  586 586 HOH HOH A . 
E 5 HOH 87  587 587 HOH HOH A . 
E 5 HOH 88  588 588 HOH HOH A . 
E 5 HOH 89  589 589 HOH HOH A . 
E 5 HOH 90  590 590 HOH HOH A . 
E 5 HOH 91  591 591 HOH HOH A . 
E 5 HOH 92  592 592 HOH HOH A . 
E 5 HOH 93  593 593 HOH HOH A . 
E 5 HOH 94  594 594 HOH HOH A . 
E 5 HOH 95  595 595 HOH HOH A . 
E 5 HOH 96  596 596 HOH HOH A . 
E 5 HOH 97  597 597 HOH HOH A . 
E 5 HOH 98  598 598 HOH HOH A . 
E 5 HOH 99  599 599 HOH HOH A . 
E 5 HOH 100 600 600 HOH HOH A . 
E 5 HOH 101 601 601 HOH HOH A . 
E 5 HOH 102 602 602 HOH HOH A . 
E 5 HOH 103 603 603 HOH HOH A . 
E 5 HOH 104 604 604 HOH HOH A . 
E 5 HOH 105 605 605 HOH HOH A . 
E 5 HOH 106 606 606 HOH HOH A . 
E 5 HOH 107 607 607 HOH HOH A . 
E 5 HOH 108 608 608 HOH HOH A . 
E 5 HOH 109 609 609 HOH HOH A . 
E 5 HOH 110 610 610 HOH HOH A . 
E 5 HOH 111 611 611 HOH HOH A . 
E 5 HOH 112 612 612 HOH HOH A . 
E 5 HOH 113 613 613 HOH HOH A . 
E 5 HOH 114 614 614 HOH HOH A . 
E 5 HOH 115 615 615 HOH HOH A . 
E 5 HOH 116 616 616 HOH HOH A . 
E 5 HOH 117 617 617 HOH HOH A . 
E 5 HOH 118 618 618 HOH HOH A . 
#