data_1NH2
# 
_entry.id   1NH2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1NH2         
NDB   PD0369       
RCSB  RCSB017863   
WWPDB D_1000017863 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NH2 
_pdbx_database_status.recvd_initial_deposition_date   2002-12-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Bleichenbacher, M.' 1 
'Tan, S.'            2 
'Richmond, T.J.'     3 
# 
_citation.id                        primary 
_citation.title                     'Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            332 
_citation.page_first                783 
_citation.page_last                 793 
_citation.year                      2003 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12972251 
_citation.pdbx_database_id_DOI      '10.1016/S0022-2836(03)00887-8' 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bleichenbacher, M.' 1 
primary 'Tan, S.'            2 
primary 'Richmond, T.J.'     3 
# 
_cell.entry_id           1NH2 
_cell.length_a           59.010 
_cell.length_b           92.020 
_cell.length_c           117.017 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1NH2 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*TP*GP*TP*AP*(5IU)P*GP*TP*AP*TP*AP*(5IU)P*AP*AP*AP*AP*C)-3'" 5143.980  1   ? ? ?                         ? 
2 polymer syn "5'-D(*GP*TP*TP*TP*TP*AP*TP*AP*TP*AP*CP*AP*TP*AP*CP*A)-3'"         4871.202  1   ? ? ?                         ? 
3 polymer man 'Transcription initiation factor TFIID'                            20120.754 1   ? ? 'C-TERMINAL 180 RESIDUES' ? 
4 polymer man 'Transcription initiation factor IIA large chain'                  6135.750  1   ? ? 'N-TERMINAL 54 RESIDUES'  ? 
5 polymer man 'Transcription initiation factor IIA large chain'                  8915.654  1   ? ? 'C-TERMINAL 77 RESIDUES'  ? 
6 polymer man 'Transcription initiation factor IIA small chain'                  13341.874 1   ? ? ?                         ? 
7 water   nat water                                                              18.015    477 ? ? ?                         ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
3 'YTBP, TATA-box factor, TATA sequence-binding protein, TBP, Transcription factor D' 
4 'TFIIA 32 kDa subunit'                                                              
5 'TFIIA 32 kDa subunit'                                                              
6 'TFIIA 13.5 kDa subunit'                                                            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes '(DT)(DG)(DT)(DA)(5IU)(DG)(DT)(DA)(DT)(DA)(5IU)(DA)(DA)(DA)(DA)(DC)' TGTAUGTATAUAAAAC E ? 
2 polydeoxyribonucleotide no no  '(DG)(DT)(DT)(DT)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)(DT)(DA)(DC)(DA)' GTTTTATATACATACA F ? 
3 'polypeptide(L)'        no no  
;SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYA
RIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQR
EEIYQAFEAIYPVLSEFRKM
;
;SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYA
RIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQR
EEIYQAFEAIYPVLSEFRKM
;
A ? 
4 'polypeptide(L)'        no no  SNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTF 
SNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTF B ? 
5 'polypeptide(L)'        no no  GSSALLDTDEVGSELDDSDDDYLISEGEEDGPDENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV 
GSSALLDTDEVGSELDDSDDDYLISEGEEDGPDENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV C ? 
6 'polypeptide(L)'        no no  
;AVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVK
NCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNSKKSE
;
;AVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVK
NCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNSKKSE
;
D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DT  n 
1 2   DG  n 
1 3   DT  n 
1 4   DA  n 
1 5   5IU n 
1 6   DG  n 
1 7   DT  n 
1 8   DA  n 
1 9   DT  n 
1 10  DA  n 
1 11  5IU n 
1 12  DA  n 
1 13  DA  n 
1 14  DA  n 
1 15  DA  n 
1 16  DC  n 
2 1   DG  n 
2 2   DT  n 
2 3   DT  n 
2 4   DT  n 
2 5   DT  n 
2 6   DA  n 
2 7   DT  n 
2 8   DA  n 
2 9   DT  n 
2 10  DA  n 
2 11  DC  n 
2 12  DA  n 
2 13  DT  n 
2 14  DA  n 
2 15  DC  n 
2 16  DA  n 
3 1   SER n 
3 2   GLY n 
3 3   ILE n 
3 4   VAL n 
3 5   PRO n 
3 6   THR n 
3 7   LEU n 
3 8   GLN n 
3 9   ASN n 
3 10  ILE n 
3 11  VAL n 
3 12  ALA n 
3 13  THR n 
3 14  VAL n 
3 15  THR n 
3 16  LEU n 
3 17  GLY n 
3 18  CYS n 
3 19  ARG n 
3 20  LEU n 
3 21  ASP n 
3 22  LEU n 
3 23  LYS n 
3 24  THR n 
3 25  VAL n 
3 26  ALA n 
3 27  LEU n 
3 28  HIS n 
3 29  ALA n 
3 30  ARG n 
3 31  ASN n 
3 32  ALA n 
3 33  GLU n 
3 34  TYR n 
3 35  ASN n 
3 36  PRO n 
3 37  LYS n 
3 38  ARG n 
3 39  PHE n 
3 40  ALA n 
3 41  ALA n 
3 42  VAL n 
3 43  ILE n 
3 44  MET n 
3 45  ARG n 
3 46  ILE n 
3 47  ARG n 
3 48  GLU n 
3 49  PRO n 
3 50  LYS n 
3 51  THR n 
3 52  THR n 
3 53  ALA n 
3 54  LEU n 
3 55  ILE n 
3 56  PHE n 
3 57  ALA n 
3 58  SER n 
3 59  GLY n 
3 60  LYS n 
3 61  MET n 
3 62  VAL n 
3 63  VAL n 
3 64  THR n 
3 65  GLY n 
3 66  ALA n 
3 67  LYS n 
3 68  SER n 
3 69  GLU n 
3 70  ASP n 
3 71  ASP n 
3 72  SER n 
3 73  LYS n 
3 74  LEU n 
3 75  ALA n 
3 76  SER n 
3 77  ARG n 
3 78  LYS n 
3 79  TYR n 
3 80  ALA n 
3 81  ARG n 
3 82  ILE n 
3 83  ILE n 
3 84  GLN n 
3 85  LYS n 
3 86  ILE n 
3 87  GLY n 
3 88  PHE n 
3 89  ALA n 
3 90  ALA n 
3 91  LYS n 
3 92  PHE n 
3 93  THR n 
3 94  ASP n 
3 95  PHE n 
3 96  LYS n 
3 97  ILE n 
3 98  GLN n 
3 99  ASN n 
3 100 ILE n 
3 101 VAL n 
3 102 GLY n 
3 103 SER n 
3 104 CYS n 
3 105 ASP n 
3 106 VAL n 
3 107 LYS n 
3 108 PHE n 
3 109 PRO n 
3 110 ILE n 
3 111 ARG n 
3 112 LEU n 
3 113 GLU n 
3 114 GLY n 
3 115 LEU n 
3 116 ALA n 
3 117 PHE n 
3 118 SER n 
3 119 HIS n 
3 120 GLY n 
3 121 THR n 
3 122 PHE n 
3 123 SER n 
3 124 SER n 
3 125 TYR n 
3 126 GLU n 
3 127 PRO n 
3 128 GLU n 
3 129 LEU n 
3 130 PHE n 
3 131 PRO n 
3 132 GLY n 
3 133 LEU n 
3 134 ILE n 
3 135 TYR n 
3 136 ARG n 
3 137 MET n 
3 138 VAL n 
3 139 LYS n 
3 140 PRO n 
3 141 LYS n 
3 142 ILE n 
3 143 VAL n 
3 144 LEU n 
3 145 LEU n 
3 146 ILE n 
3 147 PHE n 
3 148 VAL n 
3 149 SER n 
3 150 GLY n 
3 151 LYS n 
3 152 ILE n 
3 153 VAL n 
3 154 LEU n 
3 155 THR n 
3 156 GLY n 
3 157 ALA n 
3 158 LYS n 
3 159 GLN n 
3 160 ARG n 
3 161 GLU n 
3 162 GLU n 
3 163 ILE n 
3 164 TYR n 
3 165 GLN n 
3 166 ALA n 
3 167 PHE n 
3 168 GLU n 
3 169 ALA n 
3 170 ILE n 
3 171 TYR n 
3 172 PRO n 
3 173 VAL n 
3 174 LEU n 
3 175 SER n 
3 176 GLU n 
3 177 PHE n 
3 178 ARG n 
3 179 LYS n 
3 180 MET n 
4 1   SER n 
4 2   ASN n 
4 3   ALA n 
4 4   GLU n 
4 5   ALA n 
4 6   SER n 
4 7   ARG n 
4 8   VAL n 
4 9   TYR n 
4 10  GLU n 
4 11  ILE n 
4 12  ILE n 
4 13  VAL n 
4 14  GLU n 
4 15  SER n 
4 16  VAL n 
4 17  VAL n 
4 18  ASN n 
4 19  GLU n 
4 20  VAL n 
4 21  ARG n 
4 22  GLU n 
4 23  ASP n 
4 24  PHE n 
4 25  GLU n 
4 26  ASN n 
4 27  ALA n 
4 28  GLY n 
4 29  ILE n 
4 30  ASP n 
4 31  GLU n 
4 32  GLN n 
4 33  THR n 
4 34  LEU n 
4 35  GLN n 
4 36  ASP n 
4 37  LEU n 
4 38  LYS n 
4 39  ASN n 
4 40  ILE n 
4 41  TRP n 
4 42  GLN n 
4 43  LYS n 
4 44  LYS n 
4 45  LEU n 
4 46  THR n 
4 47  GLU n 
4 48  THR n 
4 49  LYS n 
4 50  VAL n 
4 51  THR n 
4 52  THR n 
4 53  PHE n 
5 1   GLY n 
5 2   SER n 
5 3   SER n 
5 4   ALA n 
5 5   LEU n 
5 6   LEU n 
5 7   ASP n 
5 8   THR n 
5 9   ASP n 
5 10  GLU n 
5 11  VAL n 
5 12  GLY n 
5 13  SER n 
5 14  GLU n 
5 15  LEU n 
5 16  ASP n 
5 17  ASP n 
5 18  SER n 
5 19  ASP n 
5 20  ASP n 
5 21  ASP n 
5 22  TYR n 
5 23  LEU n 
5 24  ILE n 
5 25  SER n 
5 26  GLU n 
5 27  GLY n 
5 28  GLU n 
5 29  GLU n 
5 30  ASP n 
5 31  GLY n 
5 32  PRO n 
5 33  ASP n 
5 34  GLU n 
5 35  ASN n 
5 36  LEU n 
5 37  MET n 
5 38  LEU n 
5 39  CYS n 
5 40  LEU n 
5 41  TYR n 
5 42  ASP n 
5 43  LYS n 
5 44  VAL n 
5 45  THR n 
5 46  ARG n 
5 47  THR n 
5 48  LYS n 
5 49  ALA n 
5 50  ARG n 
5 51  TRP n 
5 52  LYS n 
5 53  CYS n 
5 54  SER n 
5 55  LEU n 
5 56  LYS n 
5 57  ASP n 
5 58  GLY n 
5 59  VAL n 
5 60  VAL n 
5 61  THR n 
5 62  ILE n 
5 63  ASN n 
5 64  ARG n 
5 65  ASN n 
5 66  ASP n 
5 67  TYR n 
5 68  THR n 
5 69  PHE n 
5 70  GLN n 
5 71  LYS n 
5 72  ALA n 
5 73  GLN n 
5 74  VAL n 
5 75  GLU n 
5 76  ALA n 
5 77  GLU n 
5 78  TRP n 
5 79  VAL n 
6 1   ALA n 
6 2   VAL n 
6 3   PRO n 
6 4   GLY n 
6 5   TYR n 
6 6   TYR n 
6 7   GLU n 
6 8   LEU n 
6 9   TYR n 
6 10  ARG n 
6 11  ARG n 
6 12  SER n 
6 13  THR n 
6 14  ILE n 
6 15  GLY n 
6 16  ASN n 
6 17  SER n 
6 18  LEU n 
6 19  VAL n 
6 20  ASP n 
6 21  ALA n 
6 22  LEU n 
6 23  ASP n 
6 24  THR n 
6 25  LEU n 
6 26  ILE n 
6 27  SER n 
6 28  ASP n 
6 29  GLY n 
6 30  ARG n 
6 31  ILE n 
6 32  GLU n 
6 33  ALA n 
6 34  SER n 
6 35  LEU n 
6 36  ALA n 
6 37  MET n 
6 38  ARG n 
6 39  VAL n 
6 40  LEU n 
6 41  GLU n 
6 42  THR n 
6 43  PHE n 
6 44  ASP n 
6 45  LYS n 
6 46  VAL n 
6 47  VAL n 
6 48  ALA n 
6 49  GLU n 
6 50  THR n 
6 51  LEU n 
6 52  LYS n 
6 53  ASP n 
6 54  ASN n 
6 55  THR n 
6 56  GLN n 
6 57  SER n 
6 58  LYS n 
6 59  LEU n 
6 60  THR n 
6 61  VAL n 
6 62  LYS n 
6 63  GLY n 
6 64  ASN n 
6 65  LEU n 
6 66  ASP n 
6 67  THR n 
6 68  TYR n 
6 69  GLY n 
6 70  PHE n 
6 71  CYS n 
6 72  ASP n 
6 73  ASP n 
6 74  VAL n 
6 75  TRP n 
6 76  THR n 
6 77  PHE n 
6 78  ILE n 
6 79  VAL n 
6 80  LYS n 
6 81  ASN n 
6 82  CYS n 
6 83  GLN n 
6 84  VAL n 
6 85  THR n 
6 86  VAL n 
6 87  GLU n 
6 88  ASP n 
6 89  SER n 
6 90  HIS n 
6 91  ARG n 
6 92  ASP n 
6 93  ALA n 
6 94  SER n 
6 95  GLN n 
6 96  ASN n 
6 97  GLY n 
6 98  SER n 
6 99  GLY n 
6 100 ASP n 
6 101 SER n 
6 102 GLN n 
6 103 SER n 
6 104 VAL n 
6 105 ILE n 
6 106 SER n 
6 107 VAL n 
6 108 ASP n 
6 109 LYS n 
6 110 LEU n 
6 111 ARG n 
6 112 ILE n 
6 113 VAL n 
6 114 ALA n 
6 115 CYS n 
6 116 ASN n 
6 117 SER n 
6 118 LYS n 
6 119 LYS n 
6 120 SER n 
6 121 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
3 1 sample ? ? ? 
;baker's yeast
;
Saccharomyces 'SPT15 OR BTF1 OR YER148W' ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? 
;baker's yeast
;
Saccharomyces 'TOA1 OR YOR194C'          ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample ? ? ? 
;baker's yeast
;
Saccharomyces 'TOA1 OR YOR194C'          ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample ? ? ? 
;baker's yeast
;
Saccharomyces 'TOA2 OR YKL058W'          ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
Escherichia ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TBP_YEAST  P13393 3 
;SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVVTGAKSEDDSKLASRKYA
RIIQKIGFAAKFTDFKIQNIVGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSGKIVLTGAKQR
EEIYQAFEAIYPVLSEFRKM
;
60  ? 
2 UNP TOA1_YEAST P32773 4 SNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTETKVTTF 2   ? 
3 UNP TOA2_YEAST P32774 5 SALLDTDEVGSELDDSDDDYLISEGEEDGPDENLMLCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV 210 ? 
4 UNP TOA1_YEAST P32773 6 
;AVPGYYELYRRSTIGNSLVDALDTLISDGRIEASLAMRVLETFDKVVAETLKDNTQSKLTVKGNLDTYGFCDDVWTFIVK
NCQVTVEDSHRDASQNGSGDSQSVISVDKLRIVACNSKKSE
;
2   ? 
5 PDB 1NH2       1NH2   1 ? ?   ? 
6 PDB 1NH2       1NH2   2 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1NH2 A 1 ? 180 ? P13393 60  ? 239 ? 61  240 
2 2 1NH2 B 1 ? 53  ? P32773 2   ? 54  ? 2   54  
3 3 1NH2 C 3 ? 79  ? P32774 210 ? 286 ? 210 286 
4 4 1NH2 D 1 ? 121 ? P32773 2   ? 122 ? 2   122 
5 5 1NH2 E 1 ? 16  ? 1NH2   1   ? 16  ? 1   16  
6 6 1NH2 F 1 ? 16  ? 1NH2   1   ? 16  ? 1   16  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3 1NH2 GLY C 1 ? UNP P32774 ? ? 'CLONING ARTIFACTS' 208 1 
3 1NH2 SER C 2 ? UNP P32774 ? ? 'CLONING ARTIFACTS' 209 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
5IU 'DNA linking'       n "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" ? 'C9 H12 I N2 O8 P' 434.078 
ALA 'L-peptide linking' y ALANINE                                   ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                  ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                           ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                  ? 'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"       ? 'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"      ? 'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"              ? 'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                 ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                           ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                   ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                 ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                     ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                   ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                    ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                ? 'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                             ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                   ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                    ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                 ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                  ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                    ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          1NH2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.70 
_exptl_crystal.density_percent_sol   54.44 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1997-03-21 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9076 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X11' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   X11 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9076 
# 
_reflns.entry_id                     1NH2 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             20 
_reflns.d_resolution_high            1.9 
_reflns.number_obs                   217906 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        14.3 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 1NH2 
_refine.ls_number_reflns_obs                     48353 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_d_res_low                             19.93 
_refine.ls_d_res_high                            1.90 
_refine.ls_percent_reflns_obs                    94.9 
_refine.ls_R_factor_obs                          0.201 
_refine.ls_R_factor_all                          0.204 
_refine.ls_R_factor_R_work                       0.201 
_refine.ls_R_factor_R_free                       0.226 
_refine.ls_R_factor_R_free_error                 0.003 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  4843 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               29.7 
_refine.aniso_B[1][1]                            5.74 
_refine.aniso_B[2][2]                            -5.10 
_refine.aniso_B[3][3]                            -0.64 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.460095 
_refine.solvent_model_param_bsol                 76.6007 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'RANDOM, EXPANDED FROM 1YTF' 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1NH2 
_refine_analyze.Luzzati_coordinate_error_obs    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   0.23 
_refine_analyze.Luzzati_sigma_a_free            0.07 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3077 
_refine_hist.pdbx_number_atoms_nucleic_acid   650 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             477 
_refine_hist.number_atoms_total               4204 
_refine_hist.d_res_high                       1.90 
_refine_hist.d_res_low                        19.93 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.4   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      25.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.13  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             1.47  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            2.22  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             2.52  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            3.96  3.00 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        1.99 
_refine_ls_shell.number_reflns_R_work             5580 
_refine_ls_shell.R_factor_R_work                  0.198 
_refine_ls_shell.percent_reflns_obs               98.9 
_refine_ls_shell.R_factor_R_free                  0.231 
_refine_ls_shell.R_factor_R_free_error            0.009 
_refine_ls_shell.percent_reflns_R_free            9.9 
_refine_ls_shell.number_reflns_R_free             613 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PROTEIN_REP.PARAM PROTEIN.TOP 'X-RAY DIFFRACTION' 
2 DNA-RNA_REP.PARAM DNA-RNA.TOP 'X-RAY DIFFRACTION' 
3 WATER_REP.PARAM   WATER.TOP   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1NH2 
_struct.title                     'Crystal structure of a yeast TFIIA/TBP/DNA complex' 
_struct.pdbx_descriptor           
;Transcription initiation factor TFIID, Transcription initiation factor IIA large chain, Transcription initiation factor IIA small chain/DNA Complex
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NH2 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            'TRANSCRIPTION/DNA, TRANSCRIPTION-DNA complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 6 ? 
G N N 7 ? 
H N N 7 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
L N N 7 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP C 21  ? ALA C 29  ? ASP A 81  ALA A 89  1 ? 9  
HELX_P HELX_P2  2  SER C 68  ? GLY C 87  ? SER A 128 GLY A 147 1 ? 20 
HELX_P HELX_P3  3  ARG C 111 ? HIS C 119 ? ARG A 171 HIS A 179 1 ? 9  
HELX_P HELX_P4  4  GLN C 159 ? PHE C 177 ? GLN A 219 PHE A 237 1 ? 19 
HELX_P HELX_P5  5  ASN D 2   ? VAL D 20  ? ASN B 3   VAL B 21  1 ? 19 
HELX_P HELX_P6  6  VAL D 20  ? ALA D 27  ? VAL B 21  ALA B 28  1 ? 8  
HELX_P HELX_P7  7  ASP D 30  ? GLU D 47  ? ASP B 31  GLU B 48  1 ? 18 
HELX_P HELX_P8  8  GLU F 7   ? ARG F 11  ? GLU D 8   ARG D 12  5 ? 5  
HELX_P HELX_P9  9  SER F 12  ? ASP F 28  ? SER D 13  ASP D 29  1 ? 17 
HELX_P HELX_P10 10 GLU F 32  ? ASN F 54  ? GLU D 33  ASN D 55  1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A DA  4  "O3'" ? ? ? 1_555 A 5IU 5  P  ? ? E DA  4  E 5IU 5  1_555 ? ? ? ? ? ? ?            1.614 ? 
covale2  covale ? ? A 5IU 5  "O3'" ? ? ? 1_555 A DG  6  P  ? ? E 5IU 5  E DG  6  1_555 ? ? ? ? ? ? ?            1.612 ? 
covale3  covale ? ? A DA  10 "O3'" ? ? ? 1_555 A 5IU 11 P  ? ? E DA  10 E 5IU 11 1_555 ? ? ? ? ? ? ?            1.607 ? 
covale4  covale ? ? A 5IU 11 "O3'" ? ? ? 1_555 A DA  12 P  ? ? E 5IU 11 E DA  12 1_555 ? ? ? ? ? ? ?            1.597 ? 
hydrog1  hydrog ? ? A DT  1  N3    ? ? ? 1_555 B DA  16 N1 ? ? E DT  1  F DA  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? A DT  1  O4    ? ? ? 1_555 B DA  16 N6 ? ? E DT  1  F DA  16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DG  2  N1    ? ? ? 1_555 B DC  15 N3 ? ? E DG  2  F DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DG  2  N2    ? ? ? 1_555 B DC  15 O2 ? ? E DG  2  F DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DG  2  O6    ? ? ? 1_555 B DC  15 N4 ? ? E DG  2  F DC  15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DT  3  N3    ? ? ? 1_555 B DA  14 N1 ? ? E DT  3  F DA  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DT  3  O4    ? ? ? 1_555 B DA  14 N6 ? ? E DT  3  F DA  14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DA  4  N1    ? ? ? 1_555 B DT  13 N3 ? ? E DA  4  F DT  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DA  4  N6    ? ? ? 1_555 B DT  13 O4 ? ? E DA  4  F DT  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A 5IU 5  N3    ? ? ? 1_555 B DA  12 N1 ? ? E 5IU 5  F DA  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A 5IU 5  O4    ? ? ? 1_555 B DA  12 N6 ? ? E 5IU 5  F DA  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  6  N1    ? ? ? 1_555 B DC  11 N3 ? ? E DG  6  F DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DG  6  N2    ? ? ? 1_555 B DC  11 O2 ? ? E DG  6  F DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DG  6  O6    ? ? ? 1_555 B DC  11 N4 ? ? E DG  6  F DC  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DT  7  N3    ? ? ? 1_555 B DA  10 N1 ? ? E DT  7  F DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DT  7  O4    ? ? ? 1_555 B DA  10 N6 ? ? E DT  7  F DA  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DA  8  N1    ? ? ? 1_555 B DT  9  N3 ? ? E DA  8  F DT  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DA  8  N6    ? ? ? 1_555 B DT  9  O4 ? ? E DA  8  F DT  9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DT  9  N3    ? ? ? 1_555 B DA  8  N1 ? ? E DT  9  F DA  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A DT  9  O4    ? ? ? 1_555 B DA  8  N6 ? ? E DT  9  F DA  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A DA  10 N1    ? ? ? 1_555 B DT  7  N3 ? ? E DA  10 F DT  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? A DA  10 N6    ? ? ? 1_555 B DT  7  O4 ? ? E DA  10 F DT  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? A 5IU 11 N3    ? ? ? 1_555 B DA  6  N1 ? ? E 5IU 11 F DA  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? A 5IU 11 O4    ? ? ? 1_555 B DA  6  N6 ? ? E 5IU 11 F DA  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? A DA  12 N1    ? ? ? 1_555 B DT  5  N3 ? ? E DA  12 F DT  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? A DA  12 N6    ? ? ? 1_555 B DT  5  O4 ? ? E DA  12 F DT  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? A DA  13 N1    ? ? ? 1_555 B DT  4  N3 ? ? E DA  13 F DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? A DA  13 N6    ? ? ? 1_555 B DT  4  O4 ? ? E DA  13 F DT  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? A DA  14 N1    ? ? ? 1_555 B DT  3  N3 ? ? E DA  14 F DT  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? A DA  14 N6    ? ? ? 1_555 B DT  3  O4 ? ? E DA  14 F DT  3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? A DA  15 N1    ? ? ? 1_555 B DT  2  N3 ? ? E DA  15 F DT  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? A DA  15 N6    ? ? ? 1_555 B DT  2  O4 ? ? E DA  15 F DT  2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? A DC  16 N3    ? ? ? 1_555 B DG  1  N1 ? ? E DC  16 F DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? A DC  16 N4    ? ? ? 1_555 B DG  1  O6 ? ? E DC  16 F DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? A DC  16 O2    ? ? ? 1_555 B DG  1  N2 ? ? E DC  16 F DG  1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 48  C . ? GLU 108 A PRO 49  C ? PRO 109 A 1 -0.15 
2 LYS 139 C . ? LYS 199 A PRO 140 C ? PRO 200 A 1 -0.27 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   17 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? anti-parallel 
A 3  4  ? anti-parallel 
A 4  5  ? anti-parallel 
A 5  6  ? anti-parallel 
A 6  7  ? anti-parallel 
A 7  8  ? anti-parallel 
A 8  9  ? anti-parallel 
A 9  10 ? anti-parallel 
A 10 11 ? parallel      
A 11 12 ? anti-parallel 
A 12 13 ? anti-parallel 
A 13 14 ? parallel      
A 14 15 ? anti-parallel 
A 15 16 ? anti-parallel 
A 16 17 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  SER C 123 ? SER C 124 ? SER A 183 SER A 184 
A 2  LEU C 133 ? MET C 137 ? LEU A 193 MET A 197 
A 3  ILE C 142 ? ILE C 146 ? ILE A 202 ILE A 206 
A 4  LYS C 151 ? ALA C 157 ? LYS A 211 ALA A 217 
A 5  THR C 93  ? ASP C 105 ? THR A 153 ASP A 165 
A 6  THR C 6   ? THR C 15  ? THR A 66  THR A 75  
A 7  LYS C 60  ? ALA C 66  ? LYS A 120 ALA A 126 
A 8  THR C 51  ? ILE C 55  ? THR A 111 ILE A 115 
A 9  VAL C 42  ? ILE C 46  ? VAL A 102 ILE A 106 
A 10 ALA C 32  ? TYR C 34  ? ALA A 92  TYR A 94  
A 11 LYS F 58  ? CYS F 71  ? LYS D 59  CYS D 72  
A 12 VAL F 74  ? GLU F 87  ? VAL D 75  GLU D 88  
A 13 SER F 103 ? ASN F 116 ? SER D 104 ASN D 117 
A 14 LEU E 36  ? THR E 47  ? LEU C 243 THR C 254 
A 15 ARG E 50  ? ILE E 62  ? ARG C 257 ILE C 269 
A 16 ASN E 65  ? GLU E 77  ? ASN C 272 GLU C 284 
A 17 LYS F 58  ? CYS F 71  ? LYS D 59  CYS D 72  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O SER C 124 ? O SER A 184 N ILE C 134 ? N ILE A 194 
A 2  3  N MET C 137 ? N MET A 197 O ILE C 142 ? O ILE A 202 
A 3  4  N LEU C 145 ? N LEU A 205 O VAL C 153 ? O VAL A 213 
A 4  5  N ALA C 157 ? N ALA A 217 O ILE C 100 ? O ILE A 160 
A 5  6  O SER C 103 ? O SER A 163 N THR C 6   ? N THR A 66  
A 6  7  O VAL C 14  ? O VAL A 74  N MET C 61  ? N MET A 121 
A 7  8  N THR C 64  ? N THR A 124 O THR C 52  ? O THR A 112 
A 8  9  N ILE C 55  ? N ILE A 115 O VAL C 42  ? O VAL A 102 
A 9  10 O ILE C 43  ? O ILE A 103 N GLU C 33  ? N GLU A 93  
A 10 11 N ALA C 32  ? N ALA A 92  O TYR F 68  ? O TYR D 69  
A 11 12 N CYS F 71  ? N CYS D 72  O VAL F 74  ? O VAL D 75  
A 12 13 N VAL F 86  ? N VAL D 87  O SER F 103 ? O SER D 104 
A 13 14 O ARG F 111 ? O ARG D 112 N MET E 37  ? N MET C 244 
A 14 15 O THR E 47  ? O THR C 254 N ARG E 50  ? N ARG C 257 
A 15 16 N ILE E 62  ? N ILE C 269 O ASN E 65  ? O ASN C 272 
A 16 17 O LYS E 71  ? O LYS C 278 N LEU F 59  ? N LEU D 60  
# 
_database_PDB_matrix.entry_id          1NH2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1NH2 
_atom_sites.fract_transf_matrix[1][1]   0.016946 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010867 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008546 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
I 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DT  A 1 1   ? -1.715  -4.823  34.788  1.00 74.21 ? 1   DT  E "O5'" 1 
ATOM   2    C "C5'" . DT  A 1 1   ? -0.365  -5.095  35.166  1.00 73.22 ? 1   DT  E "C5'" 1 
ATOM   3    C "C4'" . DT  A 1 1   ? 0.600   -4.658  34.090  1.00 72.83 ? 1   DT  E "C4'" 1 
ATOM   4    O "O4'" . DT  A 1 1   ? 0.245   -5.310  32.852  1.00 70.38 ? 1   DT  E "O4'" 1 
ATOM   5    C "C3'" . DT  A 1 1   ? 0.572   -3.159  33.780  1.00 74.45 ? 1   DT  E "C3'" 1 
ATOM   6    O "O3'" . DT  A 1 1   ? 1.855   -2.768  33.296  1.00 78.69 ? 1   DT  E "O3'" 1 
ATOM   7    C "C2'" . DT  A 1 1   ? -0.385  -3.081  32.609  1.00 71.06 ? 1   DT  E "C2'" 1 
ATOM   8    C "C1'" . DT  A 1 1   ? 0.062   -4.315  31.862  1.00 66.98 ? 1   DT  E "C1'" 1 
ATOM   9    N N1    . DT  A 1 1   ? -0.855  -4.838  30.853  1.00 61.09 ? 1   DT  E N1    1 
ATOM   10   C C2    . DT  A 1 1   ? -0.328  -5.715  29.938  1.00 58.05 ? 1   DT  E C2    1 
ATOM   11   O O2    . DT  A 1 1   ? 0.839   -6.077  29.959  1.00 57.91 ? 1   DT  E O2    1 
ATOM   12   N N3    . DT  A 1 1   ? -1.217  -6.155  28.995  1.00 55.67 ? 1   DT  E N3    1 
ATOM   13   C C4    . DT  A 1 1   ? -2.551  -5.813  28.883  1.00 54.92 ? 1   DT  E C4    1 
ATOM   14   O O4    . DT  A 1 1   ? -3.224  -6.286  27.975  1.00 52.77 ? 1   DT  E O4    1 
ATOM   15   C C5    . DT  A 1 1   ? -3.041  -4.892  29.888  1.00 55.24 ? 1   DT  E C5    1 
ATOM   16   C C7    . DT  A 1 1   ? -4.475  -4.464  29.848  1.00 55.05 ? 1   DT  E C7    1 
ATOM   17   C C6    . DT  A 1 1   ? -2.177  -4.459  30.813  1.00 57.90 ? 1   DT  E C6    1 
ATOM   18   P P     . DG  A 1 2   ? 3.086   -2.661  34.305  1.00 81.90 ? 2   DG  E P     1 
ATOM   19   O OP1   . DG  A 1 2   ? 2.764   -3.455  35.516  1.00 83.03 ? 2   DG  E OP1   1 
ATOM   20   O OP2   . DG  A 1 2   ? 3.370   -1.214  34.426  1.00 82.75 ? 2   DG  E OP2   1 
ATOM   21   O "O5'" . DG  A 1 2   ? 4.270   -3.358  33.500  1.00 81.57 ? 2   DG  E "O5'" 1 
ATOM   22   C "C5'" . DG  A 1 2   ? 5.302   -2.566  32.940  1.00 79.50 ? 2   DG  E "C5'" 1 
ATOM   23   C "C4'" . DG  A 1 2   ? 5.504   -2.881  31.475  1.00 77.17 ? 2   DG  E "C4'" 1 
ATOM   24   O "O4'" . DG  A 1 2   ? 4.325   -3.427  30.821  1.00 74.07 ? 2   DG  E "O4'" 1 
ATOM   25   C "C3'" . DG  A 1 2   ? 5.867   -1.615  30.693  1.00 77.34 ? 2   DG  E "C3'" 1 
ATOM   26   O "O3'" . DG  A 1 2   ? 6.779   -1.905  29.634  1.00 79.91 ? 2   DG  E "O3'" 1 
ATOM   27   C "C2'" . DG  A 1 2   ? 4.558   -1.285  30.000  1.00 74.26 ? 2   DG  E "C2'" 1 
ATOM   28   C "C1'" . DG  A 1 2   ? 4.133   -2.687  29.624  1.00 70.40 ? 2   DG  E "C1'" 1 
ATOM   29   N N9    . DG  A 1 2   ? 2.751   -2.832  29.166  1.00 63.80 ? 2   DG  E N9    1 
ATOM   30   C C8    . DG  A 1 2   ? 1.660   -2.160  29.651  1.00 61.95 ? 2   DG  E C8    1 
ATOM   31   N N7    . DG  A 1 2   ? 0.560   -2.425  28.998  1.00 59.58 ? 2   DG  E N7    1 
ATOM   32   C C5    . DG  A 1 2   ? 0.940   -3.347  28.032  1.00 57.17 ? 2   DG  E C5    1 
ATOM   33   C C6    . DG  A 1 2   ? 0.168   -3.994  27.024  1.00 54.82 ? 2   DG  E C6    1 
ATOM   34   O O6    . DG  A 1 2   ? -1.039  -3.876  26.777  1.00 54.20 ? 2   DG  E O6    1 
ATOM   35   N N1    . DG  A 1 2   ? 0.943   -4.851  26.256  1.00 53.25 ? 2   DG  E N1    1 
ATOM   36   C C2    . DG  A 1 2   ? 2.287   -5.068  26.425  1.00 53.46 ? 2   DG  E C2    1 
ATOM   37   N N2    . DG  A 1 2   ? 2.838   -5.948  25.567  1.00 50.91 ? 2   DG  E N2    1 
ATOM   38   N N3    . DG  A 1 2   ? 3.027   -4.471  27.360  1.00 55.98 ? 2   DG  E N3    1 
ATOM   39   C C4    . DG  A 1 2   ? 2.289   -3.626  28.124  1.00 59.08 ? 2   DG  E C4    1 
ATOM   40   P P     . DT  A 1 3   ? 8.073   -2.817  29.895  1.00 81.38 ? 3   DT  E P     1 
ATOM   41   O OP1   . DT  A 1 3   ? 7.691   -4.081  30.567  1.00 82.38 ? 3   DT  E OP1   1 
ATOM   42   O OP2   . DT  A 1 3   ? 9.124   -1.950  30.484  1.00 82.49 ? 3   DT  E OP2   1 
ATOM   43   O "O5'" . DT  A 1 3   ? 8.508   -3.192  28.416  1.00 79.52 ? 3   DT  E "O5'" 1 
ATOM   44   C "C5'" . DT  A 1 3   ? 8.482   -2.195  27.398  1.00 75.36 ? 3   DT  E "C5'" 1 
ATOM   45   C "C4'" . DT  A 1 3   ? 7.985   -2.782  26.100  1.00 71.54 ? 3   DT  E "C4'" 1 
ATOM   46   O "O4'" . DT  A 1 3   ? 6.563   -3.033  26.178  1.00 68.64 ? 3   DT  E "O4'" 1 
ATOM   47   C "C3'" . DT  A 1 3   ? 8.163   -1.816  24.934  1.00 70.25 ? 3   DT  E "C3'" 1 
ATOM   48   O "O3'" . DT  A 1 3   ? 9.335   -2.308  24.264  1.00 70.98 ? 3   DT  E "O3'" 1 
ATOM   49   C "C2'" . DT  A 1 3   ? 6.991   -2.143  24.016  1.00 67.78 ? 3   DT  E "C2'" 1 
ATOM   50   C "C1'" . DT  A 1 3   ? 5.973   -2.842  24.902  1.00 64.73 ? 3   DT  E "C1'" 1 
ATOM   51   N N1    . DT  A 1 3   ? 4.640   -2.242  25.079  1.00 59.62 ? 3   DT  E N1    1 
ATOM   52   C C2    . DT  A 1 3   ? 3.615   -2.736  24.303  1.00 56.42 ? 3   DT  E C2    1 
ATOM   53   O O2    . DT  A 1 3   ? 3.781   -3.564  23.430  1.00 55.57 ? 3   DT  E O2    1 
ATOM   54   N N3    . DT  A 1 3   ? 2.379   -2.227  24.590  1.00 54.57 ? 3   DT  E N3    1 
ATOM   55   C C4    . DT  A 1 3   ? 2.068   -1.281  25.541  1.00 54.09 ? 3   DT  E C4    1 
ATOM   56   O O4    . DT  A 1 3   ? 0.892   -0.939  25.696  1.00 53.62 ? 3   DT  E O4    1 
ATOM   57   C C5    . DT  A 1 3   ? 3.202   -0.767  26.291  1.00 54.71 ? 3   DT  E C5    1 
ATOM   58   C C7    . DT  A 1 3   ? 2.974   0.287   27.328  1.00 53.76 ? 3   DT  E C7    1 
ATOM   59   C C6    . DT  A 1 3   ? 4.416   -1.263  26.018  1.00 56.86 ? 3   DT  E C6    1 
ATOM   60   P P     . DA  A 1 4   ? 9.919   -1.554  22.965  1.00 71.52 ? 4   DA  E P     1 
ATOM   61   O OP1   . DA  A 1 4   ? 11.015  -2.382  22.391  1.00 71.60 ? 4   DA  E OP1   1 
ATOM   62   O OP2   . DA  A 1 4   ? 10.205  -0.146  23.340  1.00 72.55 ? 4   DA  E OP2   1 
ATOM   63   O "O5'" . DA  A 1 4   ? 8.720   -1.624  21.919  1.00 69.30 ? 4   DA  E "O5'" 1 
ATOM   64   C "C5'" . DA  A 1 4   ? 8.451   -2.845  21.245  1.00 65.87 ? 4   DA  E "C5'" 1 
ATOM   65   C "C4'" . DA  A 1 4   ? 7.347   -2.663  20.232  1.00 63.37 ? 4   DA  E "C4'" 1 
ATOM   66   O "O4'" . DA  A 1 4   ? 6.062   -2.544  20.890  1.00 60.57 ? 4   DA  E "O4'" 1 
ATOM   67   C "C3'" . DA  A 1 4   ? 7.509   -1.381  19.416  1.00 63.00 ? 4   DA  E "C3'" 1 
ATOM   68   O "O3'" . DA  A 1 4   ? 8.044   -1.765  18.139  1.00 65.18 ? 4   DA  E "O3'" 1 
ATOM   69   C "C2'" . DA  A 1 4   ? 6.075   -0.973  19.106  1.00 59.65 ? 4   DA  E "C2'" 1 
ATOM   70   C "C1'" . DA  A 1 4   ? 5.221   -1.675  20.147  1.00 56.53 ? 4   DA  E "C1'" 1 
ATOM   71   N N9    . DA  A 1 4   ? 4.416   -0.870  21.070  1.00 50.91 ? 4   DA  E N9    1 
ATOM   72   C C8    . DA  A 1 4   ? 4.782   -0.109  22.154  1.00 48.12 ? 4   DA  E C8    1 
ATOM   73   N N7    . DA  A 1 4   ? 3.767   0.448   22.773  1.00 45.32 ? 4   DA  E N7    1 
ATOM   74   C C5    . DA  A 1 4   ? 2.662   0.029   22.043  1.00 44.13 ? 4   DA  E C5    1 
ATOM   75   C C6    . DA  A 1 4   ? 1.285   0.275   22.181  1.00 41.99 ? 4   DA  E C6    1 
ATOM   76   N N6    . DA  A 1 4   ? 0.756   1.022   23.150  1.00 39.46 ? 4   DA  E N6    1 
ATOM   77   N N1    . DA  A 1 4   ? 0.454   -0.282  21.273  1.00 41.35 ? 4   DA  E N1    1 
ATOM   78   C C2    . DA  A 1 4   ? 0.980   -1.034  20.299  1.00 43.09 ? 4   DA  E C2    1 
ATOM   79   N N3    . DA  A 1 4   ? 2.253   -1.340  20.068  1.00 44.40 ? 4   DA  E N3    1 
ATOM   80   C C4    . DA  A 1 4   ? 3.050   -0.771  20.987  1.00 46.09 ? 4   DA  E C4    1 
HETATM 81   N N1    . 5IU A 1 5   ? 3.100   1.676   18.157  1.00 46.69 ? 5   5IU E N1    1 
HETATM 82   C C2    . 5IU A 1 5   ? 1.829   1.935   18.593  1.00 43.67 ? 5   5IU E C2    1 
HETATM 83   N N3    . 5IU A 1 5   ? 1.735   2.640   19.761  1.00 41.62 ? 5   5IU E N3    1 
HETATM 84   C C4    . 5IU A 1 5   ? 2.769   3.116   20.526  1.00 43.29 ? 5   5IU E C4    1 
HETATM 85   C C5    . 5IU A 1 5   ? 4.088   2.833   20.001  1.00 43.60 ? 5   5IU E C5    1 
HETATM 86   C C6    . 5IU A 1 5   ? 4.202   2.140   18.850  1.00 43.26 ? 5   5IU E C6    1 
HETATM 87   O O2    . 5IU A 1 5   ? 0.852   1.557   17.976  1.00 43.86 ? 5   5IU E O2    1 
HETATM 88   O O4    . 5IU A 1 5   ? 2.502   3.713   21.573  1.00 41.83 ? 5   5IU E O4    1 
HETATM 89   I I5    . 5IU A 1 5   ? 5.410   3.350   20.789  0.55 51.09 ? 5   5IU E I5    1 
HETATM 90   C "C1'" . 5IU A 1 5   ? 3.164   0.851   16.944  1.00 52.47 ? 5   5IU E "C1'" 1 
HETATM 91   C "C2'" . 5IU A 1 5   ? 3.365   1.422   15.553  1.00 56.47 ? 5   5IU E "C2'" 1 
HETATM 92   C "C3'" . 5IU A 1 5   ? 4.492   0.591   14.957  1.00 59.70 ? 5   5IU E "C3'" 1 
HETATM 93   C "C4'" . 5IU A 1 5   ? 4.534   -0.660  15.841  1.00 59.95 ? 5   5IU E "C4'" 1 
HETATM 94   O "O3'" . 5IU A 1 5   ? 3.924   0.163   13.707  1.00 62.13 ? 5   5IU E "O3'" 1 
HETATM 95   O "O4'" . 5IU A 1 5   ? 4.039   -0.236  17.133  1.00 57.00 ? 5   5IU E "O4'" 1 
HETATM 96   C "C5'" . 5IU A 1 5   ? 5.934   -1.210  15.985  1.00 62.41 ? 5   5IU E "C5'" 1 
HETATM 97   O "O5'" . 5IU A 1 5   ? 6.814   -0.234  16.541  1.00 65.03 ? 5   5IU E "O5'" 1 
HETATM 98   P P     . 5IU A 1 5   ? 8.282   -0.661  16.986  1.00 66.80 ? 5   5IU E P     1 
HETATM 99   O OP1   . 5IU A 1 5   ? 8.872   -1.365  15.822  1.00 68.08 ? 5   5IU E OP1   1 
HETATM 100  O OP2   . 5IU A 1 5   ? 8.995   0.499   17.579  1.00 67.70 ? 5   5IU E OP2   1 
ATOM   101  P P     . DG  A 1 6   ? 3.786   1.190   12.472  1.00 61.86 ? 6   DG  E P     1 
ATOM   102  O OP1   . DG  A 1 6   ? 3.485   0.384   11.249  1.00 63.13 ? 6   DG  E OP1   1 
ATOM   103  O OP2   . DG  A 1 6   ? 4.947   2.106   12.474  1.00 63.96 ? 6   DG  E OP2   1 
ATOM   104  O "O5'" . DG  A 1 6   ? 2.473   2.030   12.804  1.00 60.98 ? 6   DG  E "O5'" 1 
ATOM   105  C "C5'" . DG  A 1 6   ? 1.246   1.662   12.192  1.00 57.69 ? 6   DG  E "C5'" 1 
ATOM   106  C "C4'" . DG  A 1 6   ? 0.103   2.552   12.630  1.00 54.70 ? 6   DG  E "C4'" 1 
ATOM   107  O "O4'" . DG  A 1 6   ? 0.001   2.549   14.080  1.00 52.50 ? 6   DG  E "O4'" 1 
ATOM   108  C "C3'" . DG  A 1 6   ? 0.265   4.026   12.253  1.00 53.86 ? 6   DG  E "C3'" 1 
ATOM   109  O "O3'" . DG  A 1 6   ? -0.549  4.325   11.112  1.00 54.86 ? 6   DG  E "O3'" 1 
ATOM   110  C "C2'" . DG  A 1 6   ? -0.495  4.751   13.349  1.00 52.11 ? 6   DG  E "C2'" 1 
ATOM   111  C "C1'" . DG  A 1 6   ? -0.515  3.799   14.525  1.00 50.00 ? 6   DG  E "C1'" 1 
ATOM   112  N N9    . DG  A 1 6   ? 0.211   4.270   15.698  1.00 45.52 ? 6   DG  E N9    1 
ATOM   113  C C8    . DG  A 1 6   ? 1.547   4.159   16.008  1.00 44.02 ? 6   DG  E C8    1 
ATOM   114  N N7    . DG  A 1 6   ? 1.860   4.749   17.131  1.00 41.94 ? 6   DG  E N7    1 
ATOM   115  C C5    . DG  A 1 6   ? 0.655   5.269   17.590  1.00 42.66 ? 6   DG  E C5    1 
ATOM   116  C C6    . DG  A 1 6   ? 0.357   6.020   18.754  1.00 41.47 ? 6   DG  E C6    1 
ATOM   117  O O6    . DG  A 1 6   ? 1.118   6.385   19.654  1.00 41.74 ? 6   DG  E O6    1 
ATOM   118  N N1    . DG  A 1 6   ? -0.992  6.351   18.815  1.00 42.58 ? 6   DG  E N1    1 
ATOM   119  C C2    . DG  A 1 6   ? -1.937  5.998   17.878  1.00 43.45 ? 6   DG  E C2    1 
ATOM   120  N N2    . DG  A 1 6   ? -3.196  6.400   18.095  1.00 44.24 ? 6   DG  E N2    1 
ATOM   121  N N3    . DG  A 1 6   ? -1.669  5.299   16.798  1.00 43.49 ? 6   DG  E N3    1 
ATOM   122  C C4    . DG  A 1 6   ? -0.364  4.971   16.717  1.00 43.57 ? 6   DG  E C4    1 
ATOM   123  P P     . DT  A 1 7   ? -0.570  5.824   10.519  1.00 56.84 ? 7   DT  E P     1 
ATOM   124  O OP1   . DT  A 1 7   ? -1.126  5.810   9.139   1.00 58.24 ? 7   DT  E OP1   1 
ATOM   125  O OP2   . DT  A 1 7   ? 0.781   6.396   10.755  1.00 57.33 ? 7   DT  E OP2   1 
ATOM   126  O "O5'" . DT  A 1 7   ? -1.608  6.592   11.458  1.00 55.74 ? 7   DT  E "O5'" 1 
ATOM   127  C "C5'" . DT  A 1 7   ? -3.001  6.265   11.419  1.00 53.77 ? 7   DT  E "C5'" 1 
ATOM   128  C "C4'" . DT  A 1 7   ? -3.810  7.243   12.243  1.00 53.26 ? 7   DT  E "C4'" 1 
ATOM   129  O "O4'" . DT  A 1 7   ? -3.532  7.038   13.650  1.00 50.76 ? 7   DT  E "O4'" 1 
ATOM   130  C "C3'" . DT  A 1 7   ? -3.478  8.707   11.979  1.00 53.20 ? 7   DT  E "C3'" 1 
ATOM   131  O "O3'" . DT  A 1 7   ? -4.464  9.294   11.130  1.00 56.53 ? 7   DT  E "O3'" 1 
ATOM   132  C "C2'" . DT  A 1 7   ? -3.744  9.369   13.320  1.00 51.20 ? 7   DT  E "C2'" 1 
ATOM   133  C "C1'" . DT  A 1 7   ? -3.562  8.276   14.351  1.00 47.96 ? 7   DT  E "C1'" 1 
ATOM   134  N N1    . DT  A 1 7   ? -2.310  8.417   15.111  1.00 43.22 ? 7   DT  E N1    1 
ATOM   135  C C2    . DT  A 1 7   ? -2.372  9.052   16.333  1.00 41.18 ? 7   DT  E C2    1 
ATOM   136  O O2    . DT  A 1 7   ? -3.410  9.495   16.805  1.00 39.88 ? 7   DT  E O2    1 
ATOM   137  N N3    . DT  A 1 7   ? -1.169  9.156   16.984  1.00 39.11 ? 7   DT  E N3    1 
ATOM   138  C C4    . DT  A 1 7   ? 0.060   8.702   16.548  1.00 37.97 ? 7   DT  E C4    1 
ATOM   139  O O4    . DT  A 1 7   ? 1.056   8.861   17.253  1.00 35.01 ? 7   DT  E O4    1 
ATOM   140  C C5    . DT  A 1 7   ? 0.054   8.055   15.255  1.00 39.26 ? 7   DT  E C5    1 
ATOM   141  C C7    . DT  A 1 7   ? 1.342   7.542   14.695  1.00 40.13 ? 7   DT  E C7    1 
ATOM   142  C C6    . DT  A 1 7   ? -1.115  7.942   14.611  1.00 40.97 ? 7   DT  E C6    1 
ATOM   143  P P     . DA  A 1 8   ? -4.193  10.750  10.518  1.00 58.39 ? 8   DA  E P     1 
ATOM   144  O OP1   . DA  A 1 8   ? -5.213  11.042  9.477   1.00 59.88 ? 8   DA  E OP1   1 
ATOM   145  O OP2   . DA  A 1 8   ? -2.749  10.795  10.164  1.00 60.01 ? 8   DA  E OP2   1 
ATOM   146  O "O5'" . DA  A 1 8   ? -4.414  11.705  11.774  1.00 55.08 ? 8   DA  E "O5'" 1 
ATOM   147  C "C5'" . DA  A 1 8   ? -5.638  11.672  12.505  1.00 48.17 ? 8   DA  E "C5'" 1 
ATOM   148  C "C4'" . DA  A 1 8   ? -5.563  12.591  13.702  1.00 43.51 ? 8   DA  E "C4'" 1 
ATOM   149  O "O4'" . DA  A 1 8   ? -4.756  11.987  14.747  1.00 40.00 ? 8   DA  E "O4'" 1 
ATOM   150  C "C3'" . DA  A 1 8   ? -4.842  13.889  13.370  1.00 41.44 ? 8   DA  E "C3'" 1 
ATOM   151  O "O3'" . DA  A 1 8   ? -5.758  14.932  13.085  1.00 40.62 ? 8   DA  E "O3'" 1 
ATOM   152  C "C2'" . DA  A 1 8   ? -4.219  14.293  14.693  1.00 38.61 ? 8   DA  E "C2'" 1 
ATOM   153  C "C1'" . DA  A 1 8   ? -4.032  12.996  15.448  1.00 36.16 ? 8   DA  E "C1'" 1 
ATOM   154  N N9    . DA  A 1 8   ? -2.622  12.612  15.525  1.00 32.20 ? 8   DA  E N9    1 
ATOM   155  C C8    . DA  A 1 8   ? -1.836  11.949  14.616  1.00 29.45 ? 8   DA  E C8    1 
ATOM   156  N N7    . DA  A 1 8   ? -0.588  11.815  14.998  1.00 30.25 ? 8   DA  E N7    1 
ATOM   157  C C5    . DA  A 1 8   ? -0.556  12.421  16.248  1.00 30.48 ? 8   DA  E C5    1 
ATOM   158  C C6    . DA  A 1 8   ? 0.476   12.614  17.182  1.00 30.35 ? 8   DA  E C6    1 
ATOM   159  N N6    . DA  A 1 8   ? 1.732   12.194  16.998  1.00 29.48 ? 8   DA  E N6    1 
ATOM   160  N N1    . DA  A 1 8   ? 0.171   13.261  18.328  1.00 31.00 ? 8   DA  E N1    1 
ATOM   161  C C2    . DA  A 1 8   ? -1.085  13.682  18.514  1.00 30.06 ? 8   DA  E C2    1 
ATOM   162  N N3    . DA  A 1 8   ? -2.138  13.560  17.713  1.00 31.34 ? 8   DA  E N3    1 
ATOM   163  C C4    . DA  A 1 8   ? -1.801  12.912  16.584  1.00 29.78 ? 8   DA  E C4    1 
ATOM   164  P P     . DT  A 1 9   ? -5.205  16.284  12.426  1.00 39.80 ? 9   DT  E P     1 
ATOM   165  O OP1   . DT  A 1 9   ? -6.361  17.068  11.918  1.00 41.40 ? 9   DT  E OP1   1 
ATOM   166  O OP2   . DT  A 1 9   ? -4.107  15.914  11.494  1.00 38.52 ? 9   DT  E OP2   1 
ATOM   167  O "O5'" . DT  A 1 9   ? -4.537  17.033  13.666  1.00 35.09 ? 9   DT  E "O5'" 1 
ATOM   168  C "C5'" . DT  A 1 9   ? -5.308  17.389  14.815  1.00 31.51 ? 9   DT  E "C5'" 1 
ATOM   169  C "C4'" . DT  A 1 9   ? -4.432  18.065  15.845  1.00 29.10 ? 9   DT  E "C4'" 1 
ATOM   170  O "O4'" . DT  A 1 9   ? -3.551  17.078  16.438  1.00 26.57 ? 9   DT  E "O4'" 1 
ATOM   171  C "C3'" . DT  A 1 9   ? -3.484  19.091  15.235  1.00 29.97 ? 9   DT  E "C3'" 1 
ATOM   172  O "O3'" . DT  A 1 9   ? -4.001  20.408  15.344  1.00 30.43 ? 9   DT  E "O3'" 1 
ATOM   173  C "C2'" . DT  A 1 9   ? -2.287  19.065  16.170  1.00 27.40 ? 9   DT  E "C2'" 1 
ATOM   174  C "C1'" . DT  A 1 9   ? -2.289  17.662  16.751  1.00 25.76 ? 9   DT  E "C1'" 1 
ATOM   175  N N1    . DT  A 1 9   ? -1.221  16.824  16.175  1.00 23.08 ? 9   DT  E N1    1 
ATOM   176  C C2    . DT  A 1 9   ? -0.111  16.591  16.948  1.00 23.79 ? 9   DT  E C2    1 
ATOM   177  O O2    . DT  A 1 9   ? -0.007  17.000  18.091  1.00 26.26 ? 9   DT  E O2    1 
ATOM   178  N N3    . DT  A 1 9   ? 0.881   15.865  16.329  1.00 22.72 ? 9   DT  E N3    1 
ATOM   179  C C4    . DT  A 1 9   ? 0.868   15.363  15.043  1.00 19.15 ? 9   DT  E C4    1 
ATOM   180  O O4    . DT  A 1 9   ? 1.847   14.756  14.619  1.00 19.75 ? 9   DT  E O4    1 
ATOM   181  C C5    . DT  A 1 9   ? -0.346  15.625  14.292  1.00 22.78 ? 9   DT  E C5    1 
ATOM   182  C C7    . DT  A 1 9   ? -0.463  15.114  12.888  1.00 22.81 ? 9   DT  E C7    1 
ATOM   183  C C6    . DT  A 1 9   ? -1.318  16.327  14.892  1.00 22.43 ? 9   DT  E C6    1 
ATOM   184  P P     . DA  A 1 10  ? -3.660  21.463  14.188  1.00 34.79 ? 10  DA  E P     1 
ATOM   185  O OP1   . DA  A 1 10  ? -4.457  22.695  14.417  1.00 37.11 ? 10  DA  E OP1   1 
ATOM   186  O OP2   . DA  A 1 10  ? -3.741  20.761  12.891  1.00 30.26 ? 10  DA  E OP2   1 
ATOM   187  O "O5'" . DA  A 1 10  ? -2.118  21.785  14.413  1.00 29.69 ? 10  DA  E "O5'" 1 
ATOM   188  C "C5'" . DA  A 1 10  ? -1.694  22.620  15.474  1.00 28.52 ? 10  DA  E "C5'" 1 
ATOM   189  C "C4'" . DA  A 1 10  ? -0.252  23.020  15.266  1.00 29.12 ? 10  DA  E "C4'" 1 
ATOM   190  O "O4'" . DA  A 1 10  ? 0.622   21.935  15.671  1.00 27.17 ? 10  DA  E "O4'" 1 
ATOM   191  C "C3'" . DA  A 1 10  ? 0.077   23.254  13.793  1.00 29.30 ? 10  DA  E "C3'" 1 
ATOM   192  O "O3'" . DA  A 1 10  ? 0.090   24.649  13.511  1.00 30.75 ? 10  DA  E "O3'" 1 
ATOM   193  C "C2'" . DA  A 1 10  ? 1.545   22.873  13.691  1.00 27.25 ? 10  DA  E "C2'" 1 
ATOM   194  C "C1'" . DA  A 1 10  ? 1.787   21.918  14.841  1.00 26.39 ? 10  DA  E "C1'" 1 
ATOM   195  N N9    . DA  A 1 10  ? 2.090   20.536  14.467  1.00 25.25 ? 10  DA  E N9    1 
ATOM   196  C C8    . DA  A 1 10  ? 1.238   19.500  14.177  1.00 26.46 ? 10  DA  E C8    1 
ATOM   197  N N7    . DA  A 1 10  ? 1.850   18.364  13.943  1.00 24.74 ? 10  DA  E N7    1 
ATOM   198  C C5    . DA  A 1 10  ? 3.195   18.677  14.076  1.00 21.41 ? 10  DA  E C5    1 
ATOM   199  C C6    . DA  A 1 10  ? 4.363   17.903  13.966  1.00 17.55 ? 10  DA  E C6    1 
ATOM   200  N N6    . DA  A 1 10  ? 4.369   16.592  13.700  1.00 19.34 ? 10  DA  E N6    1 
ATOM   201  N N1    . DA  A 1 10  ? 5.542   18.528  14.148  1.00 16.05 ? 10  DA  E N1    1 
ATOM   202  C C2    . DA  A 1 10  ? 5.544   19.832  14.427  1.00 17.94 ? 10  DA  E C2    1 
ATOM   203  N N3    . DA  A 1 10  ? 4.516   20.663  14.563  1.00 19.43 ? 10  DA  E N3    1 
ATOM   204  C C4    . DA  A 1 10  ? 3.357   20.014  14.376  1.00 20.75 ? 10  DA  E C4    1 
HETATM 205  N N1    . 5IU A 1 11  ? 5.517   22.916  11.197  1.00 19.06 ? 11  5IU E N1    1 
HETATM 206  C C2    . 5IU A 1 11  ? 6.666   22.143  11.205  1.00 15.44 ? 11  5IU E C2    1 
HETATM 207  N N3    . 5IU A 1 11  ? 6.459   20.795  11.043  1.00 15.25 ? 11  5IU E N3    1 
HETATM 208  C C4    . 5IU A 1 11  ? 5.226   20.143  10.855  1.00 15.70 ? 11  5IU E C4    1 
HETATM 209  C C5    . 5IU A 1 11  ? 4.055   21.008  10.811  1.00 18.47 ? 11  5IU E C5    1 
HETATM 210  C C6    . 5IU A 1 11  ? 4.250   22.342  10.971  1.00 15.34 ? 11  5IU E C6    1 
HETATM 211  O O2    . 5IU A 1 11  ? 7.791   22.629  11.341  1.00 16.73 ? 11  5IU E O2    1 
HETATM 212  O O4    . 5IU A 1 11  ? 5.235   18.932  10.759  1.00 16.30 ? 11  5IU E O4    1 
HETATM 213  I I5    . 5IU A 1 11  ? 2.436   20.350  10.585  0.90 29.71 ? 11  5IU E I5    1 
HETATM 214  C "C1'" . 5IU A 1 11  ? 5.706   24.353  11.477  1.00 20.62 ? 11  5IU E "C1'" 1 
HETATM 215  C "C2'" . 5IU A 1 11  ? 5.474   25.339  10.330  1.00 19.88 ? 11  5IU E "C2'" 1 
HETATM 216  C "C3'" . 5IU A 1 11  ? 4.188   26.070  10.706  1.00 20.42 ? 11  5IU E "C3'" 1 
HETATM 217  C "C4'" . 5IU A 1 11  ? 4.134   25.956  12.222  1.00 22.34 ? 11  5IU E "C4'" 1 
HETATM 218  O "O3'" . 5IU A 1 11  ? 4.390   27.443  10.394  1.00 23.67 ? 11  5IU E "O3'" 1 
HETATM 219  O "O4'" . 5IU A 1 11  ? 4.825   24.723  12.537  1.00 21.64 ? 11  5IU E "O4'" 1 
HETATM 220  C "C5'" . 5IU A 1 11  ? 2.712   25.928  12.734  1.00 23.29 ? 11  5IU E "C5'" 1 
HETATM 221  O "O5'" . 5IU A 1 11  ? 1.892   25.172  11.841  1.00 28.76 ? 11  5IU E "O5'" 1 
HETATM 222  P P     . 5IU A 1 11  ? 0.304   25.143  11.997  1.00 33.26 ? 11  5IU E P     1 
HETATM 223  O OP1   . 5IU A 1 11  ? -0.225  26.521  11.877  1.00 31.64 ? 11  5IU E OP1   1 
HETATM 224  O OP2   . 5IU A 1 11  ? -0.201  24.079  11.084  1.00 27.54 ? 11  5IU E OP2   1 
ATOM   225  P P     . DA  A 1 12  ? 3.871   28.011  8.995   1.00 25.46 ? 12  DA  E P     1 
ATOM   226  O OP1   . DA  A 1 12  ? 3.542   29.442  9.154   1.00 28.46 ? 12  DA  E OP1   1 
ATOM   227  O OP2   . DA  A 1 12  ? 2.869   27.080  8.428   1.00 27.38 ? 12  DA  E OP2   1 
ATOM   228  O "O5'" . DA  A 1 12  ? 5.159   27.895  8.082   1.00 24.52 ? 12  DA  E "O5'" 1 
ATOM   229  C "C5'" . DA  A 1 12  ? 6.346   28.597  8.415   1.00 21.78 ? 12  DA  E "C5'" 1 
ATOM   230  C "C4'" . DA  A 1 12  ? 7.445   28.128  7.502   1.00 20.26 ? 12  DA  E "C4'" 1 
ATOM   231  O "O4'" . DA  A 1 12  ? 7.783   26.779  7.873   1.00 18.88 ? 12  DA  E "O4'" 1 
ATOM   232  C "C3'" . DA  A 1 12  ? 6.980   28.047  6.054   1.00 20.53 ? 12  DA  E "C3'" 1 
ATOM   233  O "O3'" . DA  A 1 12  ? 7.432   29.218  5.373   1.00 21.82 ? 12  DA  E "O3'" 1 
ATOM   234  C "C2'" . DA  A 1 12  ? 7.778   26.877  5.500   1.00 18.75 ? 12  DA  E "C2'" 1 
ATOM   235  C "C1'" . DA  A 1 12  ? 8.055   25.995  6.724   1.00 17.47 ? 12  DA  E "C1'" 1 
ATOM   236  N N9    . DA  A 1 12  ? 7.222   24.795  6.828   1.00 17.58 ? 12  DA  E N9    1 
ATOM   237  C C8    . DA  A 1 12  ? 5.874   24.651  6.592   1.00 16.37 ? 12  DA  E C8    1 
ATOM   238  N N7    . DA  A 1 12  ? 5.430   23.431  6.797   1.00 15.09 ? 12  DA  E N7    1 
ATOM   239  C C5    . DA  A 1 12  ? 6.563   22.727  7.192   1.00 17.25 ? 12  DA  E C5    1 
ATOM   240  C C6    . DA  A 1 12  ? 6.769   21.378  7.548   1.00 15.91 ? 12  DA  E C6    1 
ATOM   241  N N6    . DA  A 1 12  ? 5.800   20.453  7.573   1.00 12.98 ? 12  DA  E N6    1 
ATOM   242  N N1    . DA  A 1 12  ? 8.027   21.003  7.884   1.00 16.31 ? 12  DA  E N1    1 
ATOM   243  C C2    . DA  A 1 12  ? 8.999   21.927  7.869   1.00 17.43 ? 12  DA  E C2    1 
ATOM   244  N N3    . DA  A 1 12  ? 8.926   23.222  7.552   1.00 17.56 ? 12  DA  E N3    1 
ATOM   245  C C4    . DA  A 1 12  ? 7.669   23.557  7.216   1.00 16.92 ? 12  DA  E C4    1 
ATOM   246  P P     . DA  A 1 13  ? 6.586   29.781  4.137   1.00 23.44 ? 13  DA  E P     1 
ATOM   247  O OP1   . DA  A 1 13  ? 7.016   31.173  3.866   1.00 26.90 ? 13  DA  E OP1   1 
ATOM   248  O OP2   . DA  A 1 13  ? 5.156   29.477  4.351   1.00 24.95 ? 13  DA  E OP2   1 
ATOM   249  O "O5'" . DA  A 1 13  ? 7.054   28.853  2.937   1.00 21.05 ? 13  DA  E "O5'" 1 
ATOM   250  C "C5'" . DA  A 1 13  ? 8.409   28.869  2.530   1.00 19.74 ? 13  DA  E "C5'" 1 
ATOM   251  C "C4'" . DA  A 1 13  ? 8.674   27.747  1.557   1.00 17.35 ? 13  DA  E "C4'" 1 
ATOM   252  O "O4'" . DA  A 1 13  ? 8.693   26.483  2.270   1.00 15.00 ? 13  DA  E "O4'" 1 
ATOM   253  C "C3'" . DA  A 1 13  ? 7.524   27.594  0.569   1.00 17.65 ? 13  DA  E "C3'" 1 
ATOM   254  O "O3'" . DA  A 1 13  ? 7.795   28.332  -0.615  1.00 20.28 ? 13  DA  E "O3'" 1 
ATOM   255  C "C2'" . DA  A 1 13  ? 7.586   26.119  0.206   1.00 18.38 ? 13  DA  E "C2'" 1 
ATOM   256  C "C1'" . DA  A 1 13  ? 8.197   25.447  1.437   1.00 13.95 ? 13  DA  E "C1'" 1 
ATOM   257  N N9    . DA  A 1 13  ? 7.238   24.636  2.201   1.00 15.69 ? 13  DA  E N9    1 
ATOM   258  C C8    . DA  A 1 13  ? 5.895   24.896  2.428   1.00 16.58 ? 13  DA  E C8    1 
ATOM   259  N N7    . DA  A 1 13  ? 5.273   23.932  3.068   1.00 16.96 ? 13  DA  E N7    1 
ATOM   260  C C5    . DA  A 1 13  ? 6.268   22.988  3.300   1.00 16.08 ? 13  DA  E C5    1 
ATOM   261  C C6    . DA  A 1 13  ? 6.248   21.723  3.924   1.00 16.72 ? 13  DA  E C6    1 
ATOM   262  N N6    . DA  A 1 13  ? 5.137   21.164  4.456   1.00 15.00 ? 13  DA  E N6    1 
ATOM   263  N N1    . DA  A 1 13  ? 7.414   21.036  3.982   1.00 14.04 ? 13  DA  E N1    1 
ATOM   264  C C2    . DA  A 1 13  ? 8.512   21.583  3.442   1.00 16.16 ? 13  DA  E C2    1 
ATOM   265  N N3    . DA  A 1 13  ? 8.656   22.749  2.826   1.00 15.33 ? 13  DA  E N3    1 
ATOM   266  C C4    . DA  A 1 13  ? 7.485   23.416  2.789   1.00 15.15 ? 13  DA  E C4    1 
ATOM   267  P P     . DA  A 1 14  ? 6.584   28.716  -1.608  1.00 21.85 ? 14  DA  E P     1 
ATOM   268  O OP1   . DA  A 1 14  ? 6.909   30.066  -2.153  1.00 25.73 ? 14  DA  E OP1   1 
ATOM   269  O OP2   . DA  A 1 14  ? 5.280   28.474  -0.983  1.00 19.36 ? 14  DA  E OP2   1 
ATOM   270  O "O5'" . DA  A 1 14  ? 6.777   27.669  -2.779  1.00 18.13 ? 14  DA  E "O5'" 1 
ATOM   271  C "C5'" . DA  A 1 14  ? 8.031   27.591  -3.443  1.00 17.73 ? 14  DA  E "C5'" 1 
ATOM   272  C "C4'" . DA  A 1 14  ? 8.152   26.263  -4.141  1.00 16.42 ? 14  DA  E "C4'" 1 
ATOM   273  O "O4'" . DA  A 1 14  ? 8.224   25.231  -3.134  1.00 15.54 ? 14  DA  E "O4'" 1 
ATOM   274  C "C3'" . DA  A 1 14  ? 6.952   25.917  -5.020  1.00 16.97 ? 14  DA  E "C3'" 1 
ATOM   275  O "O3'" . DA  A 1 14  ? 7.292   26.241  -6.373  1.00 18.07 ? 14  DA  E "O3'" 1 
ATOM   276  C "C2'" . DA  A 1 14  ? 6.895   24.397  -4.920  1.00 13.65 ? 14  DA  E "C2'" 1 
ATOM   277  C "C1'" . DA  A 1 14  ? 7.501   24.079  -3.541  1.00 14.50 ? 14  DA  E "C1'" 1 
ATOM   278  N N9    . DA  A 1 14  ? 6.526   23.791  -2.482  1.00 15.64 ? 14  DA  E N9    1 
ATOM   279  C C8    . DA  A 1 14  ? 5.403   24.515  -2.138  1.00 15.24 ? 14  DA  E C8    1 
ATOM   280  N N7    . DA  A 1 14  ? 4.722   23.991  -1.144  1.00 15.43 ? 14  DA  E N7    1 
ATOM   281  C C5    . DA  A 1 14  ? 5.441   22.852  -0.805  1.00 13.73 ? 14  DA  E C5    1 
ATOM   282  C C6    . DA  A 1 14  ? 5.230   21.844  0.169   1.00 15.00 ? 14  DA  E C6    1 
ATOM   283  N N6    . DA  A 1 14  ? 4.174   21.814  1.004   1.00 12.99 ? 14  DA  E N6    1 
ATOM   284  N N1    . DA  A 1 14  ? 6.142   20.848  0.246   1.00 14.24 ? 14  DA  E N1    1 
ATOM   285  C C2    . DA  A 1 14  ? 7.170   20.853  -0.611  1.00 15.52 ? 14  DA  E C2    1 
ATOM   286  N N3    . DA  A 1 14  ? 7.463   21.726  -1.576  1.00 13.69 ? 14  DA  E N3    1 
ATOM   287  C C4    . DA  A 1 14  ? 6.554   22.715  -1.617  1.00 15.19 ? 14  DA  E C4    1 
ATOM   288  P P     . DA  A 1 15  ? 6.133   26.482  -7.471  1.00 21.33 ? 15  DA  E P     1 
ATOM   289  O OP1   . DA  A 1 15  ? 6.803   27.144  -8.619  1.00 21.28 ? 15  DA  E OP1   1 
ATOM   290  O OP2   . DA  A 1 15  ? 4.924   27.077  -6.865  1.00 20.62 ? 15  DA  E OP2   1 
ATOM   291  O "O5'" . DA  A 1 15  ? 5.723   25.018  -7.933  1.00 19.35 ? 15  DA  E "O5'" 1 
ATOM   292  C "C5'" . DA  A 1 15  ? 6.665   24.189  -8.593  1.00 14.73 ? 15  DA  E "C5'" 1 
ATOM   293  C "C4'" . DA  A 1 15  ? 6.170   22.763  -8.616  1.00 15.60 ? 15  DA  E "C4'" 1 
ATOM   294  O "O4'" . DA  A 1 15  ? 6.197   22.225  -7.266  1.00 15.24 ? 15  DA  E "O4'" 1 
ATOM   295  C "C3'" . DA  A 1 15  ? 4.720   22.632  -9.067  1.00 13.27 ? 15  DA  E "C3'" 1 
ATOM   296  O "O3'" . DA  A 1 15  ? 4.660   22.331  -10.457 1.00 15.65 ? 15  DA  E "O3'" 1 
ATOM   297  C "C2'" . DA  A 1 15  ? 4.245   21.386  -8.335  1.00 14.15 ? 15  DA  E "C2'" 1 
ATOM   298  C "C1'" . DA  A 1 15  ? 5.096   21.343  -7.061  1.00 12.87 ? 15  DA  E "C1'" 1 
ATOM   299  N N9    . DA  A 1 15  ? 4.351   21.803  -5.889  1.00 14.47 ? 15  DA  E N9    1 
ATOM   300  C C8    . DA  A 1 15  ? 3.585   22.947  -5.762  1.00 13.79 ? 15  DA  E C8    1 
ATOM   301  N N7    . DA  A 1 15  ? 2.958   23.036  -4.619  1.00 14.93 ? 15  DA  E N7    1 
ATOM   302  C C5    . DA  A 1 15  ? 3.342   21.886  -3.939  1.00 15.42 ? 15  DA  E C5    1 
ATOM   303  C C6    . DA  A 1 15  ? 2.999   21.371  -2.670  1.00 16.54 ? 15  DA  E C6    1 
ATOM   304  N N6    . DA  A 1 15  ? 2.126   21.957  -1.826  1.00 14.78 ? 15  DA  E N6    1 
ATOM   305  N N1    . DA  A 1 15  ? 3.581   20.209  -2.292  1.00 15.88 ? 15  DA  E N1    1 
ATOM   306  C C2    . DA  A 1 15  ? 4.428   19.601  -3.140  1.00 13.37 ? 15  DA  E C2    1 
ATOM   307  N N3    . DA  A 1 15  ? 4.810   19.972  -4.356  1.00 14.25 ? 15  DA  E N3    1 
ATOM   308  C C4    . DA  A 1 15  ? 4.224   21.136  -4.700  1.00 14.31 ? 15  DA  E C4    1 
ATOM   309  P P     . DC  A 1 16  ? 3.395   22.827  -11.328 1.00 18.36 ? 16  DC  E P     1 
ATOM   310  O OP1   . DC  A 1 16  ? 3.765   22.598  -12.743 1.00 17.11 ? 16  DC  E OP1   1 
ATOM   311  O OP2   . DC  A 1 16  ? 2.987   24.186  -10.876 1.00 17.87 ? 16  DC  E OP2   1 
ATOM   312  O "O5'" . DC  A 1 16  ? 2.228   21.828  -10.913 1.00 18.68 ? 16  DC  E "O5'" 1 
ATOM   313  C "C5'" . DC  A 1 16  ? 2.299   20.459  -11.302 1.00 19.45 ? 16  DC  E "C5'" 1 
ATOM   314  C "C4'" . DC  A 1 16  ? 1.172   19.660  -10.686 1.00 18.02 ? 16  DC  E "C4'" 1 
ATOM   315  O "O4'" . DC  A 1 16  ? 1.309   19.653  -9.248  1.00 17.17 ? 16  DC  E "O4'" 1 
ATOM   316  C "C3'" . DC  A 1 16  ? -0.245  20.174  -10.955 1.00 21.50 ? 16  DC  E "C3'" 1 
ATOM   317  O "O3'" . DC  A 1 16  ? -0.910  19.844  -12.166 1.00 22.31 ? 16  DC  E "O3'" 1 
ATOM   318  C "C2'" . DC  A 1 16  ? -1.005  19.917  -9.669  1.00 20.60 ? 16  DC  E "C2'" 1 
ATOM   319  C "C1'" . DC  A 1 16  ? 0.031   19.402  -8.670  1.00 19.20 ? 16  DC  E "C1'" 1 
ATOM   320  N N1    . DC  A 1 16  ? -0.068  20.192  -7.436  1.00 16.61 ? 16  DC  E N1    1 
ATOM   321  C C2    . DC  A 1 16  ? -0.702  19.638  -6.316  1.00 15.56 ? 16  DC  E C2    1 
ATOM   322  O O2    . DC  A 1 16  ? -1.135  18.474  -6.377  1.00 16.21 ? 16  DC  E O2    1 
ATOM   323  N N3    . DC  A 1 16  ? -0.835  20.388  -5.194  1.00 15.92 ? 16  DC  E N3    1 
ATOM   324  C C4    . DC  A 1 16  ? -0.362  21.640  -5.165  1.00 16.58 ? 16  DC  E C4    1 
ATOM   325  N N4    . DC  A 1 16  ? -0.519  22.344  -4.035  1.00 15.61 ? 16  DC  E N4    1 
ATOM   326  C C5    . DC  A 1 16  ? 0.292   22.226  -6.286  1.00 14.74 ? 16  DC  E C5    1 
ATOM   327  C C6    . DC  A 1 16  ? 0.422   21.471  -7.392  1.00 16.48 ? 16  DC  E C6    1 
ATOM   328  O "O5'" . DG  B 2 1   ? -4.121  17.435  4.130   1.00 37.83 ? 1   DG  F "O5'" 1 
ATOM   329  C "C5'" . DG  B 2 1   ? -4.946  16.271  4.070   1.00 31.53 ? 1   DG  F "C5'" 1 
ATOM   330  C "C4'" . DG  B 2 1   ? -4.950  15.646  2.696   1.00 26.19 ? 1   DG  F "C4'" 1 
ATOM   331  O "O4'" . DG  B 2 1   ? -5.538  16.603  1.777   1.00 25.56 ? 1   DG  F "O4'" 1 
ATOM   332  C "C3'" . DG  B 2 1   ? -3.563  15.335  2.135   1.00 26.70 ? 1   DG  F "C3'" 1 
ATOM   333  O "O3'" . DG  B 2 1   ? -3.234  13.956  2.324   1.00 26.58 ? 1   DG  F "O3'" 1 
ATOM   334  C "C2'" . DG  B 2 1   ? -3.771  15.503  0.635   1.00 23.25 ? 1   DG  F "C2'" 1 
ATOM   335  C "C1'" . DG  B 2 1   ? -4.891  16.548  0.515   1.00 21.98 ? 1   DG  F "C1'" 1 
ATOM   336  N N9    . DG  B 2 1   ? -4.303  17.858  0.252   1.00 21.00 ? 1   DG  F N9    1 
ATOM   337  C C8    . DG  B 2 1   ? -4.198  18.934  1.105   1.00 21.43 ? 1   DG  F C8    1 
ATOM   338  N N7    . DG  B 2 1   ? -3.530  19.930  0.586   1.00 18.97 ? 1   DG  F N7    1 
ATOM   339  C C5    . DG  B 2 1   ? -3.191  19.490  -0.685  1.00 19.03 ? 1   DG  F C5    1 
ATOM   340  C C6    . DG  B 2 1   ? -2.446  20.128  -1.714  1.00 18.49 ? 1   DG  F C6    1 
ATOM   341  O O6    . DG  B 2 1   ? -1.932  21.241  -1.705  1.00 20.26 ? 1   DG  F O6    1 
ATOM   342  N N1    . DG  B 2 1   ? -2.328  19.315  -2.844  1.00 19.39 ? 1   DG  F N1    1 
ATOM   343  C C2    . DG  B 2 1   ? -2.857  18.055  -2.966  1.00 17.94 ? 1   DG  F C2    1 
ATOM   344  N N2    . DG  B 2 1   ? -2.640  17.425  -4.132  1.00 20.51 ? 1   DG  F N2    1 
ATOM   345  N N3    . DG  B 2 1   ? -3.552  17.454  -2.017  1.00 22.69 ? 1   DG  F N3    1 
ATOM   346  C C4    . DG  B 2 1   ? -3.675  18.225  -0.913  1.00 17.89 ? 1   DG  F C4    1 
ATOM   347  P P     . DT  B 2 2   ? -1.698  13.529  2.549   1.00 29.51 ? 2   DT  F P     1 
ATOM   348  O OP1   . DT  B 2 2   ? -1.649  12.067  2.820   1.00 29.10 ? 2   DT  F OP1   1 
ATOM   349  O OP2   . DT  B 2 2   ? -1.040  14.461  3.504   1.00 26.56 ? 2   DT  F OP2   1 
ATOM   350  O "O5'" . DT  B 2 2   ? -0.988  13.840  1.148   1.00 24.75 ? 2   DT  F "O5'" 1 
ATOM   351  C "C5'" . DT  B 2 2   ? -1.120  12.983  0.018   1.00 22.02 ? 2   DT  F "C5'" 1 
ATOM   352  C "C4'" . DT  B 2 2   ? 0.182   12.924  -0.752  1.00 22.37 ? 2   DT  F "C4'" 1 
ATOM   353  O "O4'" . DT  B 2 2   ? 0.502   14.222  -1.327  1.00 21.78 ? 2   DT  F "O4'" 1 
ATOM   354  C "C3'" . DT  B 2 2   ? 1.388   12.530  0.108   1.00 19.85 ? 2   DT  F "C3'" 1 
ATOM   355  O "O3'" . DT  B 2 2   ? 2.241   11.628  -0.590  1.00 18.56 ? 2   DT  F "O3'" 1 
ATOM   356  C "C2'" . DT  B 2 2   ? 2.100   13.846  0.368   1.00 20.60 ? 2   DT  F "C2'" 1 
ATOM   357  C "C1'" . DT  B 2 2   ? 1.775   14.685  -0.864  1.00 18.29 ? 2   DT  F "C1'" 1 
ATOM   358  N N1    . DT  B 2 2   ? 1.628   16.121  -0.531  1.00 17.75 ? 2   DT  F N1    1 
ATOM   359  C C2    . DT  B 2 2   ? 2.516   17.042  -1.062  1.00 15.24 ? 2   DT  F C2    1 
ATOM   360  O O2    . DT  B 2 2   ? 3.448   16.739  -1.780  1.00 16.68 ? 2   DT  F O2    1 
ATOM   361  N N3    . DT  B 2 2   ? 2.265   18.349  -0.714  1.00 13.92 ? 2   DT  F N3    1 
ATOM   362  C C4    . DT  B 2 2   ? 1.255   18.817  0.109   1.00 17.30 ? 2   DT  F C4    1 
ATOM   363  O O4    . DT  B 2 2   ? 1.159   20.022  0.337   1.00 15.03 ? 2   DT  F O4    1 
ATOM   364  C C5    . DT  B 2 2   ? 0.377   17.796  0.650   1.00 17.85 ? 2   DT  F C5    1 
ATOM   365  C C7    . DT  B 2 2   ? -0.724  18.205  1.579   1.00 19.21 ? 2   DT  F C7    1 
ATOM   366  C C6    . DT  B 2 2   ? 0.601   16.521  0.300   1.00 18.69 ? 2   DT  F C6    1 
ATOM   367  P P     . DT  B 2 3   ? 3.207   10.637  0.237   1.00 19.82 ? 3   DT  F P     1 
ATOM   368  O OP1   . DT  B 2 3   ? 3.532   9.516   -0.672  1.00 20.23 ? 3   DT  F OP1   1 
ATOM   369  O OP2   . DT  B 2 3   ? 2.640   10.356  1.567   1.00 19.36 ? 3   DT  F OP2   1 
ATOM   370  O "O5'" . DT  B 2 3   ? 4.523   11.507  0.492   1.00 17.73 ? 3   DT  F "O5'" 1 
ATOM   371  C "C5'" . DT  B 2 3   ? 5.425   11.731  -0.577  1.00 15.85 ? 3   DT  F "C5'" 1 
ATOM   372  C "C4'" . DT  B 2 3   ? 6.499   12.728  -0.205  1.00 13.81 ? 3   DT  F "C4'" 1 
ATOM   373  O "O4'" . DT  B 2 3   ? 5.979   14.077  -0.264  1.00 14.69 ? 3   DT  F "O4'" 1 
ATOM   374  C "C3'" . DT  B 2 3   ? 6.970   12.559  1.241   1.00 14.35 ? 3   DT  F "C3'" 1 
ATOM   375  O "O3'" . DT  B 2 3   ? 8.199   11.825  1.177   1.00 12.72 ? 3   DT  F "O3'" 1 
ATOM   376  C "C2'" . DT  B 2 3   ? 7.408   13.965  1.642   1.00 16.46 ? 3   DT  F "C2'" 1 
ATOM   377  C "C1'" . DT  B 2 3   ? 6.719   14.887  0.642   1.00 16.28 ? 3   DT  F "C1'" 1 
ATOM   378  N N1    . DT  B 2 3   ? 5.876   15.995  1.122   1.00 17.84 ? 3   DT  F N1    1 
ATOM   379  C C2    . DT  B 2 3   ? 6.236   17.281  0.736   1.00 15.78 ? 3   DT  F C2    1 
ATOM   380  O O2    . DT  B 2 3   ? 7.215   17.532  0.038   1.00 14.53 ? 3   DT  F O2    1 
ATOM   381  N N3    . DT  B 2 3   ? 5.396   18.274  1.194   1.00 13.93 ? 3   DT  F N3    1 
ATOM   382  C C4    . DT  B 2 3   ? 4.266   18.115  1.973   1.00 15.76 ? 3   DT  F C4    1 
ATOM   383  O O4    . DT  B 2 3   ? 3.602   19.112  2.300   1.00 15.08 ? 3   DT  F O4    1 
ATOM   384  C C5    . DT  B 2 3   ? 3.956   16.741  2.344   1.00 16.01 ? 3   DT  F C5    1 
ATOM   385  C C7    . DT  B 2 3   ? 2.749   16.471  3.194   1.00 16.75 ? 3   DT  F C7    1 
ATOM   386  C C6    . DT  B 2 3   ? 4.767   15.768  1.907   1.00 17.33 ? 3   DT  F C6    1 
ATOM   387  P P     . DT  B 2 4   ? 8.785   11.112  2.486   1.00 13.58 ? 4   DT  F P     1 
ATOM   388  O OP1   . DT  B 2 4   ? 9.678   10.021  2.010   1.00 16.27 ? 4   DT  F OP1   1 
ATOM   389  O OP2   . DT  B 2 4   ? 7.701   10.788  3.457   1.00 14.79 ? 4   DT  F OP2   1 
ATOM   390  O "O5'" . DT  B 2 4   ? 9.663   12.260  3.142   1.00 11.92 ? 4   DT  F "O5'" 1 
ATOM   391  C "C5'" . DT  B 2 4   ? 10.786  12.792  2.450   1.00 13.79 ? 4   DT  F "C5'" 1 
ATOM   392  C "C4'" . DT  B 2 4   ? 11.316  14.008  3.171   1.00 9.52  ? 4   DT  F "C4'" 1 
ATOM   393  O "O4'" . DT  B 2 4   ? 10.335  15.069  3.103   1.00 10.41 ? 4   DT  F "O4'" 1 
ATOM   394  C "C3'" . DT  B 2 4   ? 11.482  13.730  4.663   1.00 11.62 ? 4   DT  F "C3'" 1 
ATOM   395  O "O3'" . DT  B 2 4   ? 12.895  13.458  4.854   1.00 12.26 ? 4   DT  F "O3'" 1 
ATOM   396  C "C2'" . DT  B 2 4   ? 11.224  15.091  5.310   1.00 12.40 ? 4   DT  F "C2'" 1 
ATOM   397  C "C1'" . DT  B 2 4   ? 10.450  15.888  4.250   1.00 12.44 ? 4   DT  F "C1'" 1 
ATOM   398  N N1    . DT  B 2 4   ? 9.128   16.465  4.533   1.00 14.24 ? 4   DT  F N1    1 
ATOM   399  C C2    . DT  B 2 4   ? 8.956   17.824  4.320   1.00 15.36 ? 4   DT  F C2    1 
ATOM   400  O O2    . DT  B 2 4   ? 9.854   18.577  3.944   1.00 13.59 ? 4   DT  F O2    1 
ATOM   401  N N3    . DT  B 2 4   ? 7.676   18.276  4.543   1.00 15.81 ? 4   DT  F N3    1 
ATOM   402  C C4    . DT  B 2 4   ? 6.584   17.532  4.942   1.00 15.07 ? 4   DT  F C4    1 
ATOM   403  O O4    . DT  B 2 4   ? 5.493   18.089  5.090   1.00 13.35 ? 4   DT  F O4    1 
ATOM   404  C C5    . DT  B 2 4   ? 6.846   16.118  5.154   1.00 13.23 ? 4   DT  F C5    1 
ATOM   405  C C7    . DT  B 2 4   ? 5.727   15.219  5.587   1.00 14.46 ? 4   DT  F C7    1 
ATOM   406  C C6    . DT  B 2 4   ? 8.089   15.668  4.952   1.00 12.80 ? 4   DT  F C6    1 
ATOM   407  P P     . DT  B 2 5   ? 13.397  12.568  6.091   1.00 15.59 ? 5   DT  F P     1 
ATOM   408  O OP1   . DT  B 2 5   ? 14.819  12.211  5.809   1.00 14.00 ? 5   DT  F OP1   1 
ATOM   409  O OP2   . DT  B 2 5   ? 12.421  11.497  6.396   1.00 14.61 ? 5   DT  F OP2   1 
ATOM   410  O "O5'" . DT  B 2 5   ? 13.347  13.564  7.327   1.00 14.74 ? 5   DT  F "O5'" 1 
ATOM   411  C "C5'" . DT  B 2 5   ? 14.346  14.542  7.451   1.00 14.28 ? 5   DT  F "C5'" 1 
ATOM   412  C "C4'" . DT  B 2 5   ? 14.006  15.537  8.529   1.00 12.83 ? 5   DT  F "C4'" 1 
ATOM   413  O "O4'" . DT  B 2 5   ? 12.944  16.421  8.078   1.00 10.85 ? 5   DT  F "O4'" 1 
ATOM   414  C "C3'" . DT  B 2 5   ? 13.418  14.846  9.755   1.00 13.86 ? 5   DT  F "C3'" 1 
ATOM   415  O "O3'" . DT  B 2 5   ? 14.500  14.555  10.632  1.00 13.46 ? 5   DT  F "O3'" 1 
ATOM   416  C "C2'" . DT  B 2 5   ? 12.569  15.945  10.384  1.00 12.24 ? 5   DT  F "C2'" 1 
ATOM   417  C "C1'" . DT  B 2 5   ? 12.234  16.891  9.223   1.00 13.81 ? 5   DT  F "C1'" 1 
ATOM   418  N N1    . DT  B 2 5   ? 10.806  17.063  8.873   1.00 13.89 ? 5   DT  F N1    1 
ATOM   419  C C2    . DT  B 2 5   ? 10.348  18.311  8.469   1.00 14.21 ? 5   DT  F C2    1 
ATOM   420  O O2    . DT  B 2 5   ? 11.063  19.296  8.348   1.00 13.57 ? 5   DT  F O2    1 
ATOM   421  N N3    . DT  B 2 5   ? 8.999   18.366  8.203   1.00 13.63 ? 5   DT  F N3    1 
ATOM   422  C C4    . DT  B 2 5   ? 8.085   17.328  8.295   1.00 15.72 ? 5   DT  F C4    1 
ATOM   423  O O4    . DT  B 2 5   ? 6.902   17.538  8.052   1.00 12.92 ? 5   DT  F O4    1 
ATOM   424  C C5    . DT  B 2 5   ? 8.638   16.050  8.696   1.00 14.96 ? 5   DT  F C5    1 
ATOM   425  C C7    . DT  B 2 5   ? 7.728   14.863  8.799   1.00 17.69 ? 5   DT  F C7    1 
ATOM   426  C C6    . DT  B 2 5   ? 9.951   15.984  8.962   1.00 15.11 ? 5   DT  F C6    1 
ATOM   427  P P     . DA  B 2 6   ? 14.291  13.587  11.895  1.00 15.81 ? 6   DA  F P     1 
ATOM   428  O OP1   . DA  B 2 6   ? 15.519  12.762  11.980  1.00 17.29 ? 6   DA  F OP1   1 
ATOM   429  O OP2   . DA  B 2 6   ? 12.958  12.929  11.878  1.00 13.30 ? 6   DA  F OP2   1 
ATOM   430  O "O5'" . DA  B 2 6   ? 14.326  14.593  13.112  1.00 15.55 ? 6   DA  F "O5'" 1 
ATOM   431  C "C5'" . DA  B 2 6   ? 15.498  15.364  13.357  1.00 14.73 ? 6   DA  F "C5'" 1 
ATOM   432  C "C4'" . DA  B 2 6   ? 15.120  16.650  14.042  1.00 15.25 ? 6   DA  F "C4'" 1 
ATOM   433  O "O4'" . DA  B 2 6   ? 14.249  17.392  13.157  1.00 15.75 ? 6   DA  F "O4'" 1 
ATOM   434  C "C3'" . DA  B 2 6   ? 14.312  16.431  15.314  1.00 16.00 ? 6   DA  F "C3'" 1 
ATOM   435  O "O3'" . DA  B 2 6   ? 15.154  16.504  16.455  1.00 20.31 ? 6   DA  F "O3'" 1 
ATOM   436  C "C2'" . DA  B 2 6   ? 13.431  17.664  15.370  1.00 13.56 ? 6   DA  F "C2'" 1 
ATOM   437  C "C1'" . DA  B 2 6   ? 13.232  18.052  13.904  1.00 15.36 ? 6   DA  F "C1'" 1 
ATOM   438  N N9    . DA  B 2 6   ? 11.938  17.580  13.408  1.00 12.99 ? 6   DA  F N9    1 
ATOM   439  C C8    . DA  B 2 6   ? 11.371  16.344  13.618  1.00 16.03 ? 6   DA  F C8    1 
ATOM   440  N N7    . DA  B 2 6   ? 10.159  16.226  13.125  1.00 15.22 ? 6   DA  F N7    1 
ATOM   441  C C5    . DA  B 2 6   ? 9.918   17.462  12.533  1.00 13.72 ? 6   DA  F C5    1 
ATOM   442  C C6    . DA  B 2 6   ? 8.792   17.985  11.852  1.00 14.00 ? 6   DA  F C6    1 
ATOM   443  N N6    . DA  B 2 6   ? 7.656   17.297  11.661  1.00 13.72 ? 6   DA  F N6    1 
ATOM   444  N N1    . DA  B 2 6   ? 8.871   19.252  11.382  1.00 14.20 ? 6   DA  F N1    1 
ATOM   445  C C2    . DA  B 2 6   ? 10.007  19.944  11.595  1.00 13.58 ? 6   DA  F C2    1 
ATOM   446  N N3    . DA  B 2 6   ? 11.129  19.559  12.233  1.00 13.72 ? 6   DA  F N3    1 
ATOM   447  C C4    . DA  B 2 6   ? 11.014  18.297  12.682  1.00 13.76 ? 6   DA  F C4    1 
ATOM   448  P P     . DT  B 2 7   ? 14.797  15.625  17.752  1.00 22.04 ? 7   DT  F P     1 
ATOM   449  O OP1   . DT  B 2 7   ? 15.883  15.896  18.729  1.00 24.64 ? 7   DT  F OP1   1 
ATOM   450  O OP2   . DT  B 2 7   ? 14.494  14.244  17.355  1.00 18.48 ? 7   DT  F OP2   1 
ATOM   451  O "O5'" . DT  B 2 7   ? 13.457  16.295  18.286  1.00 17.91 ? 7   DT  F "O5'" 1 
ATOM   452  C "C5'" . DT  B 2 7   ? 13.504  17.634  18.731  1.00 18.28 ? 7   DT  F "C5'" 1 
ATOM   453  C "C4'" . DT  B 2 7   ? 12.133  18.150  19.085  1.00 21.07 ? 7   DT  F "C4'" 1 
ATOM   454  O "O4'" . DT  B 2 7   ? 11.335  18.321  17.882  1.00 21.42 ? 7   DT  F "O4'" 1 
ATOM   455  C "C3'" . DT  B 2 7   ? 11.350  17.167  19.949  1.00 20.67 ? 7   DT  F "C3'" 1 
ATOM   456  O "O3'" . DT  B 2 7   ? 11.507  17.541  21.328  1.00 21.91 ? 7   DT  F "O3'" 1 
ATOM   457  C "C2'" . DT  B 2 7   ? 9.901   17.477  19.588  1.00 20.47 ? 7   DT  F "C2'" 1 
ATOM   458  C "C1'" . DT  B 2 7   ? 9.962   18.113  18.198  1.00 21.44 ? 7   DT  F "C1'" 1 
ATOM   459  N N1    . DT  B 2 7   ? 9.292   17.372  17.106  1.00 18.21 ? 7   DT  F N1    1 
ATOM   460  C C2    . DT  B 2 7   ? 8.417   18.077  16.302  1.00 19.43 ? 7   DT  F C2    1 
ATOM   461  O O2    . DT  B 2 7   ? 8.248   19.284  16.391  1.00 18.93 ? 7   DT  F O2    1 
ATOM   462  N N3    . DT  B 2 7   ? 7.740   17.313  15.386  1.00 20.40 ? 7   DT  F N3    1 
ATOM   463  C C4    . DT  B 2 7   ? 7.855   15.952  15.188  1.00 19.88 ? 7   DT  F C4    1 
ATOM   464  O O4    . DT  B 2 7   ? 7.159   15.397  14.338  1.00 20.63 ? 7   DT  F O4    1 
ATOM   465  C C5    . DT  B 2 7   ? 8.818   15.285  16.034  1.00 19.60 ? 7   DT  F C5    1 
ATOM   466  C C7    . DT  B 2 7   ? 9.021   13.812  15.875  1.00 20.81 ? 7   DT  F C7    1 
ATOM   467  C C6    . DT  B 2 7   ? 9.488   16.021  16.932  1.00 19.21 ? 7   DT  F C6    1 
ATOM   468  P P     . DA  B 2 8   ? 11.308  16.437  22.488  1.00 20.96 ? 8   DA  F P     1 
ATOM   469  O OP1   . DA  B 2 8   ? 11.960  16.962  23.713  1.00 23.30 ? 8   DA  F OP1   1 
ATOM   470  O OP2   . DA  B 2 8   ? 11.674  15.090  21.990  1.00 21.30 ? 8   DA  F OP2   1 
ATOM   471  O "O5'" . DA  B 2 8   ? 9.735   16.442  22.699  1.00 21.91 ? 8   DA  F "O5'" 1 
ATOM   472  C "C5'" . DA  B 2 8   ? 9.066   17.652  23.038  1.00 22.83 ? 8   DA  F "C5'" 1 
ATOM   473  C "C4'" . DA  B 2 8   ? 7.586   17.392  23.189  1.00 24.82 ? 8   DA  F "C4'" 1 
ATOM   474  O "O4'" . DA  B 2 8   ? 6.957   17.178  21.899  1.00 23.16 ? 8   DA  F "O4'" 1 
ATOM   475  C "C3'" . DA  B 2 8   ? 7.238   16.163  24.030  1.00 25.51 ? 8   DA  F "C3'" 1 
ATOM   476  O "O3'" . DA  B 2 8   ? 6.028   16.453  24.724  1.00 28.27 ? 8   DA  F "O3'" 1 
ATOM   477  C "C2'" . DA  B 2 8   ? 6.915   15.115  22.976  1.00 24.75 ? 8   DA  F "C2'" 1 
ATOM   478  C "C1'" . DA  B 2 8   ? 6.202   15.984  21.955  1.00 22.92 ? 8   DA  F "C1'" 1 
ATOM   479  N N9    . DA  B 2 8   ? 6.092   15.446  20.601  1.00 21.98 ? 8   DA  F N9    1 
ATOM   480  C C8    . DA  B 2 8   ? 6.992   14.722  19.859  1.00 22.90 ? 8   DA  F C8    1 
ATOM   481  N N7    . DA  B 2 8   ? 6.548   14.391  18.669  1.00 24.01 ? 8   DA  F N7    1 
ATOM   482  C C5    . DA  B 2 8   ? 5.273   14.941  18.626  1.00 21.85 ? 8   DA  F C5    1 
ATOM   483  C C6    . DA  B 2 8   ? 4.272   14.952  17.636  1.00 19.81 ? 8   DA  F C6    1 
ATOM   484  N N6    . DA  B 2 8   ? 4.395   14.369  16.441  1.00 19.44 ? 8   DA  F N6    1 
ATOM   485  N N1    . DA  B 2 8   ? 3.115   15.595  17.923  1.00 20.80 ? 8   DA  F N1    1 
ATOM   486  C C2    . DA  B 2 8   ? 2.982   16.182  19.119  1.00 20.93 ? 8   DA  F C2    1 
ATOM   487  N N3    . DA  B 2 8   ? 3.847   16.242  20.124  1.00 21.31 ? 8   DA  F N3    1 
ATOM   488  C C4    . DA  B 2 8   ? 4.984   15.592  19.810  1.00 22.19 ? 8   DA  F C4    1 
ATOM   489  P P     . DT  B 2 9   ? 6.065   16.997  26.234  1.00 31.60 ? 9   DT  F P     1 
ATOM   490  O OP1   . DT  B 2 9   ? 6.397   18.446  26.312  1.00 29.63 ? 9   DT  F OP1   1 
ATOM   491  O OP2   . DT  B 2 9   ? 6.846   16.016  27.023  1.00 31.34 ? 9   DT  F OP2   1 
ATOM   492  O "O5'" . DT  B 2 9   ? 4.544   16.835  26.640  1.00 31.33 ? 9   DT  F "O5'" 1 
ATOM   493  C "C5'" . DT  B 2 9   ? 3.923   15.577  26.471  1.00 28.46 ? 9   DT  F "C5'" 1 
ATOM   494  C "C4'" . DT  B 2 9   ? 2.539   15.749  25.903  1.00 32.12 ? 9   DT  F "C4'" 1 
ATOM   495  O "O4'" . DT  B 2 9   ? 2.610   15.740  24.450  1.00 30.77 ? 9   DT  F "O4'" 1 
ATOM   496  C "C3'" . DT  B 2 9   ? 1.663   14.562  26.290  1.00 34.40 ? 9   DT  F "C3'" 1 
ATOM   497  O "O3'" . DT  B 2 9   ? 0.536   14.950  27.049  1.00 37.47 ? 9   DT  F "O3'" 1 
ATOM   498  C "C2'" . DT  B 2 9   ? 1.240   13.918  24.984  1.00 32.68 ? 9   DT  F "C2'" 1 
ATOM   499  C "C1'" . DT  B 2 9   ? 1.573   14.936  23.908  1.00 31.60 ? 9   DT  F "C1'" 1 
ATOM   500  N N1    . DT  B 2 9   ? 2.089   14.241  22.706  1.00 29.59 ? 9   DT  F N1    1 
ATOM   501  C C2    . DT  B 2 9   ? 1.317   14.220  21.561  1.00 29.82 ? 9   DT  F C2    1 
ATOM   502  O O2    . DT  B 2 9   ? 0.252   14.804  21.461  1.00 30.46 ? 9   DT  F O2    1 
ATOM   503  N N3    . DT  B 2 9   ? 1.842   13.479  20.529  1.00 28.13 ? 9   DT  F N3    1 
ATOM   504  C C4    . DT  B 2 9   ? 3.034   12.781  20.521  1.00 27.55 ? 9   DT  F C4    1 
ATOM   505  O O4    . DT  B 2 9   ? 3.373   12.156  19.515  1.00 26.54 ? 9   DT  F O4    1 
ATOM   506  C C5    . DT  B 2 9   ? 3.800   12.858  21.745  1.00 28.05 ? 9   DT  F C5    1 
ATOM   507  C C7    . DT  B 2 9   ? 5.101   12.120  21.835  1.00 27.92 ? 9   DT  F C7    1 
ATOM   508  C C6    . DT  B 2 9   ? 3.300   13.585  22.758  1.00 29.33 ? 9   DT  F C6    1 
ATOM   509  P P     . DA  B 2 10  ? -0.198  13.845  27.943  1.00 41.56 ? 10  DA  F P     1 
ATOM   510  O OP1   . DA  B 2 10  ? -0.702  14.499  29.183  1.00 43.27 ? 10  DA  F OP1   1 
ATOM   511  O OP2   . DA  B 2 10  ? 0.750   12.713  28.037  1.00 42.57 ? 10  DA  F OP2   1 
ATOM   512  O "O5'" . DA  B 2 10  ? -1.420  13.449  27.017  1.00 38.16 ? 10  DA  F "O5'" 1 
ATOM   513  C "C5'" . DA  B 2 10  ? -2.269  14.475  26.528  1.00 38.99 ? 10  DA  F "C5'" 1 
ATOM   514  C "C4'" . DA  B 2 10  ? -3.323  13.898  25.616  1.00 40.24 ? 10  DA  F "C4'" 1 
ATOM   515  O "O4'" . DA  B 2 10  ? -2.755  13.513  24.340  1.00 38.18 ? 10  DA  F "O4'" 1 
ATOM   516  C "C3'" . DA  B 2 10  ? -4.023  12.655  26.164  1.00 42.30 ? 10  DA  F "C3'" 1 
ATOM   517  O "O3'" . DA  B 2 10  ? -5.428  12.773  25.948  1.00 46.93 ? 10  DA  F "O3'" 1 
ATOM   518  C "C2'" . DA  B 2 10  ? -3.427  11.510  25.356  1.00 39.51 ? 10  DA  F "C2'" 1 
ATOM   519  C "C1'" . DA  B 2 10  ? -3.101  12.171  24.024  1.00 37.95 ? 10  DA  F "C1'" 1 
ATOM   520  N N9    . DA  B 2 10  ? -1.966  11.595  23.300  1.00 35.98 ? 10  DA  F N9    1 
ATOM   521  C C8    . DA  B 2 10  ? -0.711  11.321  23.790  1.00 34.49 ? 10  DA  F C8    1 
ATOM   522  N N7    . DA  B 2 10  ? 0.113   10.839  22.891  1.00 33.94 ? 10  DA  F N7    1 
ATOM   523  C C5    . DA  B 2 10  ? -0.650  10.786  21.732  1.00 35.26 ? 10  DA  F C5    1 
ATOM   524  C C6    . DA  B 2 10  ? -0.355  10.358  20.428  1.00 34.54 ? 10  DA  F C6    1 
ATOM   525  N N6    . DA  B 2 10  ? 0.841   9.901   20.054  1.00 36.26 ? 10  DA  F N6    1 
ATOM   526  N N1    . DA  B 2 10  ? -1.342  10.417  19.507  1.00 34.45 ? 10  DA  F N1    1 
ATOM   527  C C2    . DA  B 2 10  ? -2.538  10.883  19.883  1.00 35.00 ? 10  DA  F C2    1 
ATOM   528  N N3    . DA  B 2 10  ? -2.937  11.319  21.078  1.00 34.59 ? 10  DA  F N3    1 
ATOM   529  C C4    . DA  B 2 10  ? -1.934  11.241  21.970  1.00 35.17 ? 10  DA  F C4    1 
ATOM   530  P P     . DC  B 2 11  ? -6.431  11.685  26.573  1.00 50.30 ? 11  DC  F P     1 
ATOM   531  O OP1   . DC  B 2 11  ? -7.745  12.366  26.726  1.00 50.59 ? 11  DC  F OP1   1 
ATOM   532  O OP2   . DC  B 2 11  ? -5.787  11.059  27.753  1.00 51.00 ? 11  DC  F OP2   1 
ATOM   533  O "O5'" . DC  B 2 11  ? -6.562  10.635  25.386  1.00 49.35 ? 11  DC  F "O5'" 1 
ATOM   534  C "C5'" . DC  B 2 11  ? -7.045  11.087  24.125  1.00 51.58 ? 11  DC  F "C5'" 1 
ATOM   535  C "C4'" . DC  B 2 11  ? -6.943  10.005  23.074  1.00 53.22 ? 11  DC  F "C4'" 1 
ATOM   536  O "O4'" . DC  B 2 11  ? -5.583  9.804   22.606  1.00 51.30 ? 11  DC  F "O4'" 1 
ATOM   537  C "C3'" . DC  B 2 11  ? -7.452  8.628   23.509  1.00 55.72 ? 11  DC  F "C3'" 1 
ATOM   538  O "O3'" . DC  B 2 11  ? -8.290  8.100   22.482  1.00 61.87 ? 11  DC  F "O3'" 1 
ATOM   539  C "C2'" . DC  B 2 11  ? -6.183  7.794   23.597  1.00 52.93 ? 11  DC  F "C2'" 1 
ATOM   540  C "C1'" . DC  B 2 11  ? -5.373  8.410   22.475  1.00 50.14 ? 11  DC  F "C1'" 1 
ATOM   541  N N1    . DC  B 2 11  ? -3.924  8.150   22.473  1.00 47.39 ? 11  DC  F N1    1 
ATOM   542  C C2    . DC  B 2 11  ? -3.327  7.817   21.262  1.00 46.14 ? 11  DC  F C2    1 
ATOM   543  O O2    . DC  B 2 11  ? -4.036  7.771   20.249  1.00 47.38 ? 11  DC  F O2    1 
ATOM   544  N N3    . DC  B 2 11  ? -2.004  7.556   21.220  1.00 45.03 ? 11  DC  F N3    1 
ATOM   545  C C4    . DC  B 2 11  ? -1.277  7.622   22.336  1.00 45.57 ? 11  DC  F C4    1 
ATOM   546  N N4    . DC  B 2 11  ? 0.030   7.356   22.248  1.00 44.39 ? 11  DC  F N4    1 
ATOM   547  C C5    . DC  B 2 11  ? -1.858  7.965   23.594  1.00 45.56 ? 11  DC  F C5    1 
ATOM   548  C C6    . DC  B 2 11  ? -3.175  8.222   23.616  1.00 46.21 ? 11  DC  F C6    1 
ATOM   549  P P     . DA  B 2 12  ? -9.227  6.833   22.778  1.00 67.21 ? 12  DA  F P     1 
ATOM   550  O OP1   . DA  B 2 12  ? -10.628 7.238   22.477  1.00 68.60 ? 12  DA  F OP1   1 
ATOM   551  O OP2   . DA  B 2 12  ? -8.883  6.295   24.112  1.00 67.65 ? 12  DA  F OP2   1 
ATOM   552  O "O5'" . DA  B 2 12  ? -8.769  5.804   21.654  1.00 68.08 ? 12  DA  F "O5'" 1 
ATOM   553  C "C5'" . DA  B 2 12  ? -8.934  6.164   20.282  1.00 68.40 ? 12  DA  F "C5'" 1 
ATOM   554  C "C4'" . DA  B 2 12  ? -8.076  5.320   19.364  1.00 68.04 ? 12  DA  F "C4'" 1 
ATOM   555  O "O4'" . DA  B 2 12  ? -6.665  5.441   19.674  1.00 65.48 ? 12  DA  F "O4'" 1 
ATOM   556  C "C3'" . DA  B 2 12  ? -8.372  3.820   19.317  1.00 69.70 ? 12  DA  F "C3'" 1 
ATOM   557  O "O3'" . DA  B 2 12  ? -8.362  3.411   17.948  1.00 74.57 ? 12  DA  F "O3'" 1 
ATOM   558  C "C2'" . DA  B 2 12  ? -7.188  3.200   20.042  1.00 65.68 ? 12  DA  F "C2'" 1 
ATOM   559  C "C1'" . DA  B 2 12  ? -6.067  4.152   19.655  1.00 61.00 ? 12  DA  F "C1'" 1 
ATOM   560  N N9    . DA  B 2 12  ? -4.911  4.196   20.552  1.00 53.90 ? 12  DA  F N9    1 
ATOM   561  C C8    . DA  B 2 12  ? -4.870  4.727   21.816  1.00 51.32 ? 12  DA  F C8    1 
ATOM   562  N N7    . DA  B 2 12  ? -3.682  4.691   22.366  1.00 48.59 ? 12  DA  F N7    1 
ATOM   563  C C5    . DA  B 2 12  ? -2.886  4.083   21.407  1.00 46.60 ? 12  DA  F C5    1 
ATOM   564  C C6    . DA  B 2 12  ? -1.513  3.756   21.383  1.00 43.88 ? 12  DA  F C6    1 
ATOM   565  N N6    . DA  B 2 12  ? -0.664  4.020   22.382  1.00 42.48 ? 12  DA  F N6    1 
ATOM   566  N N1    . DA  B 2 12  ? -1.032  3.143   20.282  1.00 42.42 ? 12  DA  F N1    1 
ATOM   567  C C2    . DA  B 2 12  ? -1.878  2.885   19.275  1.00 42.81 ? 12  DA  F C2    1 
ATOM   568  N N3    . DA  B 2 12  ? -3.184  3.149   19.175  1.00 45.96 ? 12  DA  F N3    1 
ATOM   569  C C4    . DA  B 2 12  ? -3.633  3.757   20.288  1.00 48.88 ? 12  DA  F C4    1 
ATOM   570  P P     . DT  B 2 13  ? -9.089  2.049   17.518  1.00 78.30 ? 13  DT  F P     1 
ATOM   571  O OP1   . DT  B 2 13  ? -9.407  2.107   16.063  1.00 79.15 ? 13  DT  F OP1   1 
ATOM   572  O OP2   . DT  B 2 13  ? -10.170 1.771   18.490  1.00 79.59 ? 13  DT  F OP2   1 
ATOM   573  O "O5'" . DT  B 2 13  ? -7.948  0.963   17.724  1.00 78.39 ? 13  DT  F "O5'" 1 
ATOM   574  C "C5'" . DT  B 2 13  ? -7.117  0.601   16.629  1.00 77.91 ? 13  DT  F "C5'" 1 
ATOM   575  C "C4'" . DT  B 2 13  ? -6.252  -0.585  16.981  1.00 77.03 ? 13  DT  F "C4'" 1 
ATOM   576  O "O4'" . DT  B 2 13  ? -5.132  -0.206  17.820  1.00 74.57 ? 13  DT  F "O4'" 1 
ATOM   577  C "C3'" . DT  B 2 13  ? -6.977  -1.705  17.731  1.00 77.79 ? 13  DT  F "C3'" 1 
ATOM   578  O "O3'" . DT  B 2 13  ? -6.543  -2.942  17.185  1.00 80.85 ? 13  DT  F "O3'" 1 
ATOM   579  C "C2'" . DT  B 2 13  ? -6.466  -1.566  19.156  1.00 74.74 ? 13  DT  F "C2'" 1 
ATOM   580  C "C1'" . DT  B 2 13  ? -5.042  -1.126  18.896  1.00 70.84 ? 13  DT  F "C1'" 1 
ATOM   581  N N1    . DT  B 2 13  ? -4.339  -0.466  20.004  1.00 64.77 ? 13  DT  F N1    1 
ATOM   582  C C2    . DT  B 2 13  ? -2.968  -0.539  20.001  1.00 61.76 ? 13  DT  F C2    1 
ATOM   583  O O2    . DT  B 2 13  ? -2.334  -1.114  19.132  1.00 61.56 ? 13  DT  F O2    1 
ATOM   584  N N3    . DT  B 2 13  ? -2.359  0.085   21.058  1.00 58.34 ? 13  DT  F N3    1 
ATOM   585  C C4    . DT  B 2 13  ? -2.974  0.757   22.094  1.00 57.05 ? 13  DT  F C4    1 
ATOM   586  O O4    . DT  B 2 13  ? -2.292  1.270   22.976  1.00 55.08 ? 13  DT  F O4    1 
ATOM   587  C C5    . DT  B 2 13  ? -4.420  0.792   22.034  1.00 58.22 ? 13  DT  F C5    1 
ATOM   588  C C7    . DT  B 2 13  ? -5.177  1.488   23.121  1.00 57.55 ? 13  DT  F C7    1 
ATOM   589  C C6    . DT  B 2 13  ? -5.021  0.192   21.001  1.00 61.10 ? 13  DT  F C6    1 
ATOM   590  P P     . DA  B 2 14  ? -7.215  -4.313  17.659  1.00 83.20 ? 14  DA  F P     1 
ATOM   591  O OP1   . DA  B 2 14  ? -8.177  -4.732  16.615  1.00 84.26 ? 14  DA  F OP1   1 
ATOM   592  O OP2   . DA  B 2 14  ? -7.656  -4.166  19.063  1.00 84.06 ? 14  DA  F OP2   1 
ATOM   593  O "O5'" . DA  B 2 14  ? -5.978  -5.304  17.619  1.00 82.89 ? 14  DA  F "O5'" 1 
ATOM   594  C "C5'" . DA  B 2 14  ? -5.123  -5.271  16.491  1.00 82.02 ? 14  DA  F "C5'" 1 
ATOM   595  C "C4'" . DA  B 2 14  ? -3.666  -5.373  16.886  1.00 81.01 ? 14  DA  F "C4'" 1 
ATOM   596  O "O4'" . DA  B 2 14  ? -3.320  -4.384  17.887  1.00 78.65 ? 14  DA  F "O4'" 1 
ATOM   597  C "C3'" . DA  B 2 14  ? -3.296  -6.728  17.491  1.00 81.58 ? 14  DA  F "C3'" 1 
ATOM   598  O "O3'" . DA  B 2 14  ? -2.579  -7.415  16.453  1.00 84.62 ? 14  DA  F "O3'" 1 
ATOM   599  C "C2'" . DA  B 2 14  ? -2.185  -6.396  18.477  1.00 78.83 ? 14  DA  F "C2'" 1 
ATOM   600  C "C1'" . DA  B 2 14  ? -2.303  -4.902  18.726  1.00 75.94 ? 14  DA  F "C1'" 1 
ATOM   601  N N9    . DA  B 2 14  ? -2.436  -4.336  20.070  1.00 71.32 ? 14  DA  F N9    1 
ATOM   602  C C8    . DA  B 2 14  ? -3.567  -3.864  20.684  1.00 69.60 ? 14  DA  F C8    1 
ATOM   603  N N7    . DA  B 2 14  ? -3.339  -3.272  21.830  1.00 67.71 ? 14  DA  F N7    1 
ATOM   604  C C5    . DA  B 2 14  ? -1.968  -3.388  22.001  1.00 66.40 ? 14  DA  F C5    1 
ATOM   605  C C6    . DA  B 2 14  ? -1.104  -2.945  23.019  1.00 64.61 ? 14  DA  F C6    1 
ATOM   606  N N6    . DA  B 2 14  ? -1.505  -2.246  24.084  1.00 62.24 ? 14  DA  F N6    1 
ATOM   607  N N1    . DA  B 2 14  ? 0.208   -3.240  22.902  1.00 64.18 ? 14  DA  F N1    1 
ATOM   608  C C2    . DA  B 2 14  ? 0.614   -3.927  21.825  1.00 65.14 ? 14  DA  F C2    1 
ATOM   609  N N3    . DA  B 2 14  ? -0.101  -4.385  20.794  1.00 66.74 ? 14  DA  F N3    1 
ATOM   610  C C4    . DA  B 2 14  ? -1.402  -4.076  20.944  1.00 68.05 ? 14  DA  F C4    1 
ATOM   611  P P     . DC  B 2 15  ? -2.244  -8.982  16.595  1.00 86.71 ? 15  DC  F P     1 
ATOM   612  O OP1   . DC  B 2 15  ? -1.340  -9.330  15.467  1.00 87.14 ? 15  DC  F OP1   1 
ATOM   613  O OP2   . DC  B 2 15  ? -3.533  -9.715  16.738  1.00 87.65 ? 15  DC  F OP2   1 
ATOM   614  O "O5'" . DC  B 2 15  ? -1.420  -9.084  17.958  1.00 86.51 ? 15  DC  F "O5'" 1 
ATOM   615  C "C5'" . DC  B 2 15  ? -0.019  -9.306  17.927  1.00 85.54 ? 15  DC  F "C5'" 1 
ATOM   616  C "C4'" . DC  B 2 15  ? 0.480   -9.770  19.275  1.00 83.91 ? 15  DC  F "C4'" 1 
ATOM   617  O "O4'" . DC  B 2 15  ? 0.550   -8.653  20.197  1.00 80.91 ? 15  DC  F "O4'" 1 
ATOM   618  C "C3'" . DC  B 2 15  ? -0.500  -10.759 19.905  1.00 84.76 ? 15  DC  F "C3'" 1 
ATOM   619  O "O3'" . DC  B 2 15  ? -0.048  -12.129 19.806  1.00 88.50 ? 15  DC  F "O3'" 1 
ATOM   620  C "C2'" . DC  B 2 15  ? -0.317  -10.509 21.392  1.00 81.38 ? 15  DC  F "C2'" 1 
ATOM   621  C "C1'" . DC  B 2 15  ? 0.295   -9.121  21.507  1.00 77.30 ? 15  DC  F "C1'" 1 
ATOM   622  N N1    . DC  B 2 15  ? -0.478  -8.119  22.251  1.00 71.05 ? 15  DC  F N1    1 
ATOM   623  C C2    . DC  B 2 15  ? 0.183   -7.338  23.219  1.00 67.38 ? 15  DC  F C2    1 
ATOM   624  O O2    . DC  B 2 15  ? 1.412   -7.454  23.357  1.00 66.49 ? 15  DC  F O2    1 
ATOM   625  N N3    . DC  B 2 15  ? -0.533  -6.478  23.976  1.00 64.14 ? 15  DC  F N3    1 
ATOM   626  C C4    . DC  B 2 15  ? -1.850  -6.366  23.789  1.00 62.91 ? 15  DC  F C4    1 
ATOM   627  N N4    . DC  B 2 15  ? -2.517  -5.526  24.578  1.00 59.74 ? 15  DC  F N4    1 
ATOM   628  C C5    . DC  B 2 15  ? -2.541  -7.116  22.788  1.00 64.62 ? 15  DC  F C5    1 
ATOM   629  C C6    . DC  B 2 15  ? -1.820  -7.970  22.044  1.00 68.11 ? 15  DC  F C6    1 
ATOM   630  P P     . DA  B 2 16  ? 1.399   -12.486 19.185  1.00 90.79 ? 16  DA  F P     1 
ATOM   631  O OP1   . DA  B 2 16  ? 1.789   -11.528 18.119  1.00 92.07 ? 16  DA  F OP1   1 
ATOM   632  O OP2   . DA  B 2 16  ? 1.402   -13.935 18.885  1.00 91.95 ? 16  DA  F OP2   1 
ATOM   633  O "O5'" . DA  B 2 16  ? 2.375   -12.300 20.430  1.00 90.63 ? 16  DA  F "O5'" 1 
ATOM   634  C "C5'" . DA  B 2 16  ? 2.404   -13.272 21.474  1.00 88.95 ? 16  DA  F "C5'" 1 
ATOM   635  C "C4'" . DA  B 2 16  ? 3.289   -12.805 22.608  1.00 86.97 ? 16  DA  F "C4'" 1 
ATOM   636  O "O4'" . DA  B 2 16  ? 2.738   -11.614 23.228  1.00 85.24 ? 16  DA  F "O4'" 1 
ATOM   637  C "C3'" . DA  B 2 16  ? 3.441   -13.819 23.741  1.00 86.40 ? 16  DA  F "C3'" 1 
ATOM   638  O "O3'" . DA  B 2 16  ? 4.708   -13.632 24.381  1.00 87.37 ? 16  DA  F "O3'" 1 
ATOM   639  C "C2'" . DA  B 2 16  ? 2.383   -13.379 24.737  1.00 84.58 ? 16  DA  F "C2'" 1 
ATOM   640  C "C1'" . DA  B 2 16  ? 2.420   -11.865 24.596  1.00 82.35 ? 16  DA  F "C1'" 1 
ATOM   641  N N9    . DA  B 2 16  ? 1.141   -11.210 24.885  1.00 78.36 ? 16  DA  F N9    1 
ATOM   642  C C8    . DA  B 2 16  ? -0.079  -11.545 24.357  1.00 77.25 ? 16  DA  F C8    1 
ATOM   643  N N7    . DA  B 2 16  ? -1.063  -10.786 24.769  1.00 75.42 ? 16  DA  F N7    1 
ATOM   644  C C5    . DA  B 2 16  ? -0.453  -9.889  25.632  1.00 74.13 ? 16  DA  F C5    1 
ATOM   645  C C6    . DA  B 2 16  ? -0.961  -8.826  26.394  1.00 72.23 ? 16  DA  F C6    1 
ATOM   646  N N6    . DA  B 2 16  ? -2.249  -8.476  26.402  1.00 70.84 ? 16  DA  F N6    1 
ATOM   647  N N1    . DA  B 2 16  ? -0.093  -8.127  27.156  1.00 71.48 ? 16  DA  F N1    1 
ATOM   648  C C2    . DA  B 2 16  ? 1.199   -8.486  27.143  1.00 72.25 ? 16  DA  F C2    1 
ATOM   649  N N3    . DA  B 2 16  ? 1.798   -9.467  26.466  1.00 73.64 ? 16  DA  F N3    1 
ATOM   650  C C4    . DA  B 2 16  ? 0.906   -10.140 25.720  1.00 75.23 ? 16  DA  F C4    1 
ATOM   651  N N     . SER C 3 1   ? 26.043  32.296  21.699  1.00 50.80 ? 61  SER A N     1 
ATOM   652  C CA    . SER C 3 1   ? 26.179  30.957  22.343  1.00 49.41 ? 61  SER A CA    1 
ATOM   653  C C     . SER C 3 1   ? 27.224  30.090  21.638  1.00 47.80 ? 61  SER A C     1 
ATOM   654  O O     . SER C 3 1   ? 27.806  30.493  20.628  1.00 49.54 ? 61  SER A O     1 
ATOM   655  C CB    . SER C 3 1   ? 24.821  30.245  22.344  1.00 51.14 ? 61  SER A CB    1 
ATOM   656  O OG    . SER C 3 1   ? 24.167  30.398  21.093  1.00 54.09 ? 61  SER A OG    1 
ATOM   657  N N     . GLY C 3 2   ? 27.469  28.909  22.193  1.00 44.34 ? 62  GLY A N     1 
ATOM   658  C CA    . GLY C 3 2   ? 28.423  27.981  21.615  1.00 41.29 ? 62  GLY A CA    1 
ATOM   659  C C     . GLY C 3 2   ? 27.628  26.815  21.061  1.00 38.91 ? 62  GLY A C     1 
ATOM   660  O O     . GLY C 3 2   ? 28.146  25.727  20.824  1.00 40.16 ? 62  GLY A O     1 
ATOM   661  N N     . ILE C 3 3   ? 26.340  27.062  20.870  1.00 34.61 ? 63  ILE A N     1 
ATOM   662  C CA    . ILE C 3 3   ? 25.429  26.064  20.340  1.00 31.44 ? 63  ILE A CA    1 
ATOM   663  C C     . ILE C 3 3   ? 25.088  26.459  18.914  1.00 27.22 ? 63  ILE A C     1 
ATOM   664  O O     . ILE C 3 3   ? 24.720  27.603  18.662  1.00 26.75 ? 63  ILE A O     1 
ATOM   665  C CB    . ILE C 3 3   ? 24.121  26.032  21.144  1.00 32.78 ? 63  ILE A CB    1 
ATOM   666  C CG1   . ILE C 3 3   ? 24.421  25.715  22.612  1.00 34.46 ? 63  ILE A CG1   1 
ATOM   667  C CG2   . ILE C 3 3   ? 23.165  25.015  20.535  1.00 33.96 ? 63  ILE A CG2   1 
ATOM   668  C CD1   . ILE C 3 3   ? 23.216  25.896  23.535  1.00 34.34 ? 63  ILE A CD1   1 
ATOM   669  N N     . VAL C 3 4   ? 25.224  25.521  17.985  1.00 24.25 ? 64  VAL A N     1 
ATOM   670  C CA    . VAL C 3 4   ? 24.895  25.798  16.594  1.00 22.88 ? 64  VAL A CA    1 
ATOM   671  C C     . VAL C 3 4   ? 23.836  24.809  16.106  1.00 18.62 ? 64  VAL A C     1 
ATOM   672  O O     . VAL C 3 4   ? 24.035  23.593  16.165  1.00 18.25 ? 64  VAL A O     1 
ATOM   673  C CB    . VAL C 3 4   ? 26.138  25.678  15.681  1.00 24.54 ? 64  VAL A CB    1 
ATOM   674  C CG1   . VAL C 3 4   ? 25.739  25.957  14.222  1.00 25.59 ? 64  VAL A CG1   1 
ATOM   675  C CG2   . VAL C 3 4   ? 27.228  26.663  16.149  1.00 26.21 ? 64  VAL A CG2   1 
ATOM   676  N N     . PRO C 3 5   ? 22.691  25.320  15.620  1.00 17.59 ? 65  PRO A N     1 
ATOM   677  C CA    . PRO C 3 5   ? 21.638  24.416  15.131  1.00 16.40 ? 65  PRO A CA    1 
ATOM   678  C C     . PRO C 3 5   ? 22.155  23.438  14.082  1.00 15.58 ? 65  PRO A C     1 
ATOM   679  O O     . PRO C 3 5   ? 23.005  23.777  13.268  1.00 16.18 ? 65  PRO A O     1 
ATOM   680  C CB    . PRO C 3 5   ? 20.611  25.368  14.536  1.00 16.72 ? 65  PRO A CB    1 
ATOM   681  C CG    . PRO C 3 5   ? 20.744  26.585  15.411  1.00 16.85 ? 65  PRO A CG    1 
ATOM   682  C CD    . PRO C 3 5   ? 22.252  26.726  15.563  1.00 14.84 ? 65  PRO A CD    1 
ATOM   683  N N     . THR C 3 6   ? 21.621  22.219  14.114  1.00 16.77 ? 66  THR A N     1 
ATOM   684  C CA    . THR C 3 6   ? 21.975  21.163  13.180  1.00 15.02 ? 66  THR A CA    1 
ATOM   685  C C     . THR C 3 6   ? 20.961  21.222  12.038  1.00 14.93 ? 66  THR A C     1 
ATOM   686  O O     . THR C 3 6   ? 19.766  21.262  12.305  1.00 14.03 ? 66  THR A O     1 
ATOM   687  C CB    . THR C 3 6   ? 21.845  19.783  13.861  1.00 18.85 ? 66  THR A CB    1 
ATOM   688  O OG1   . THR C 3 6   ? 22.783  19.694  14.940  1.00 17.95 ? 66  THR A OG1   1 
ATOM   689  C CG2   . THR C 3 6   ? 22.094  18.665  12.865  1.00 18.31 ? 66  THR A CG2   1 
ATOM   690  N N     . LEU C 3 7   ? 21.410  21.236  10.781  1.00 12.76 ? 67  LEU A N     1 
ATOM   691  C CA    . LEU C 3 7   ? 20.449  21.270  9.673   1.00 13.07 ? 67  LEU A CA    1 
ATOM   692  C C     . LEU C 3 7   ? 19.856  19.867  9.521   1.00 13.48 ? 67  LEU A C     1 
ATOM   693  O O     . LEU C 3 7   ? 20.572  18.864  9.530   1.00 12.96 ? 67  LEU A O     1 
ATOM   694  C CB    . LEU C 3 7   ? 21.109  21.737  8.365   1.00 11.79 ? 67  LEU A CB    1 
ATOM   695  C CG    . LEU C 3 7   ? 21.773  23.131  8.401   1.00 11.36 ? 67  LEU A CG    1 
ATOM   696  C CD1   . LEU C 3 7   ? 22.262  23.488  6.996   1.00 16.04 ? 67  LEU A CD1   1 
ATOM   697  C CD2   . LEU C 3 7   ? 20.790  24.192  8.918   1.00 12.96 ? 67  LEU A CD2   1 
ATOM   698  N N     . GLN C 3 8   ? 18.540  19.804  9.351   1.00 12.06 ? 68  GLN A N     1 
ATOM   699  C CA    . GLN C 3 8   ? 17.841  18.526  9.281   1.00 11.37 ? 68  GLN A CA    1 
ATOM   700  C C     . GLN C 3 8   ? 17.097  18.200  7.994   1.00 12.46 ? 68  GLN A C     1 
ATOM   701  O O     . GLN C 3 8   ? 16.890  17.020  7.675   1.00 13.52 ? 68  GLN A O     1 
ATOM   702  C CB    . GLN C 3 8   ? 16.818  18.461  10.423  1.00 12.13 ? 68  GLN A CB    1 
ATOM   703  C CG    . GLN C 3 8   ? 17.381  18.626  11.828  1.00 14.54 ? 68  GLN A CG    1 
ATOM   704  C CD    . GLN C 3 8   ? 18.198  17.435  12.278  1.00 14.91 ? 68  GLN A CD    1 
ATOM   705  O OE1   . GLN C 3 8   ? 18.399  16.493  11.524  1.00 14.37 ? 68  GLN A OE1   1 
ATOM   706  N NE2   . GLN C 3 8   ? 18.685  17.480  13.518  1.00 17.88 ? 68  GLN A NE2   1 
ATOM   707  N N     . ASN C 3 9   ? 16.667  19.230  7.272   1.00 12.16 ? 69  ASN A N     1 
ATOM   708  C CA    . ASN C 3 9   ? 15.881  19.025  6.064   1.00 12.51 ? 69  ASN A CA    1 
ATOM   709  C C     . ASN C 3 9   ? 15.977  20.257  5.176   1.00 13.81 ? 69  ASN A C     1 
ATOM   710  O O     . ASN C 3 9   ? 15.888  21.396  5.654   1.00 14.05 ? 69  ASN A O     1 
ATOM   711  C CB    . ASN C 3 9   ? 14.409  18.770  6.469   1.00 11.29 ? 69  ASN A CB    1 
ATOM   712  C CG    . ASN C 3 9   ? 13.475  18.556  5.275   1.00 15.01 ? 69  ASN A CG    1 
ATOM   713  O OD1   . ASN C 3 9   ? 13.856  17.972  4.267   1.00 12.99 ? 69  ASN A OD1   1 
ATOM   714  N ND2   . ASN C 3 9   ? 12.222  18.998  5.414   1.00 10.56 ? 69  ASN A ND2   1 
ATOM   715  N N     . ILE C 3 10  ? 16.156  20.023  3.885   1.00 12.66 ? 70  ILE A N     1 
ATOM   716  C CA    . ILE C 3 10  ? 16.243  21.098  2.907   1.00 11.73 ? 70  ILE A CA    1 
ATOM   717  C C     . ILE C 3 10  ? 15.369  20.700  1.734   1.00 11.68 ? 70  ILE A C     1 
ATOM   718  O O     . ILE C 3 10  ? 15.444  19.568  1.246   1.00 12.68 ? 70  ILE A O     1 
ATOM   719  C CB    . ILE C 3 10  ? 17.704  21.316  2.426   1.00 13.02 ? 70  ILE A CB    1 
ATOM   720  C CG1   . ILE C 3 10  ? 18.560  21.767  3.619   1.00 14.26 ? 70  ILE A CG1   1 
ATOM   721  C CG2   . ILE C 3 10  ? 17.740  22.350  1.284   1.00 15.25 ? 70  ILE A CG2   1 
ATOM   722  C CD1   . ILE C 3 10  ? 20.020  22.066  3.277   1.00 16.12 ? 70  ILE A CD1   1 
ATOM   723  N N     . VAL C 3 11  ? 14.515  21.627  1.325   1.00 12.81 ? 71  VAL A N     1 
ATOM   724  C CA    . VAL C 3 11  ? 13.588  21.424  0.219   1.00 13.54 ? 71  VAL A CA    1 
ATOM   725  C C     . VAL C 3 11  ? 14.001  22.364  -0.893  1.00 11.62 ? 71  VAL A C     1 
ATOM   726  O O     . VAL C 3 11  ? 14.240  23.548  -0.647  1.00 13.06 ? 71  VAL A O     1 
ATOM   727  C CB    . VAL C 3 11  ? 12.145  21.755  0.653   1.00 14.18 ? 71  VAL A CB    1 
ATOM   728  C CG1   . VAL C 3 11  ? 11.184  21.631  -0.537  1.00 15.54 ? 71  VAL A CG1   1 
ATOM   729  C CG2   . VAL C 3 11  ? 11.725  20.800  1.774   1.00 17.23 ? 71  VAL A CG2   1 
ATOM   730  N N     . ALA C 3 12  ? 14.077  21.831  -2.109  1.00 11.30 ? 72  ALA A N     1 
ATOM   731  C CA    . ALA C 3 12  ? 14.477  22.616  -3.264  1.00 14.73 ? 72  ALA A CA    1 
ATOM   732  C C     . ALA C 3 12  ? 13.574  22.318  -4.455  1.00 14.73 ? 72  ALA A C     1 
ATOM   733  O O     . ALA C 3 12  ? 12.948  21.257  -4.531  1.00 15.34 ? 72  ALA A O     1 
ATOM   734  C CB    . ALA C 3 12  ? 15.940  22.284  -3.635  1.00 12.41 ? 72  ALA A CB    1 
ATOM   735  N N     . THR C 3 13  ? 13.516  23.262  -5.390  1.00 15.83 ? 73  THR A N     1 
ATOM   736  C CA    . THR C 3 13  ? 12.742  23.068  -6.610  1.00 15.40 ? 73  THR A CA    1 
ATOM   737  C C     . THR C 3 13  ? 13.714  23.151  -7.771  1.00 16.51 ? 73  THR A C     1 
ATOM   738  O O     . THR C 3 13  ? 14.766  23.804  -7.681  1.00 15.46 ? 73  THR A O     1 
ATOM   739  C CB    . THR C 3 13  ? 11.669  24.144  -6.817  1.00 19.44 ? 73  THR A CB    1 
ATOM   740  O OG1   . THR C 3 13  ? 12.251  25.437  -6.608  1.00 16.73 ? 73  THR A OG1   1 
ATOM   741  C CG2   . THR C 3 13  ? 10.494  23.907  -5.879  1.00 16.26 ? 73  THR A CG2   1 
ATOM   742  N N     . VAL C 3 14  ? 13.348  22.475  -8.855  1.00 17.08 ? 74  VAL A N     1 
ATOM   743  C CA    . VAL C 3 14  ? 14.147  22.401  -10.075 1.00 19.42 ? 74  VAL A CA    1 
ATOM   744  C C     . VAL C 3 14  ? 13.208  22.377  -11.280 1.00 20.16 ? 74  VAL A C     1 
ATOM   745  O O     . VAL C 3 14  ? 12.139  21.780  -11.215 1.00 18.46 ? 74  VAL A O     1 
ATOM   746  C CB    . VAL C 3 14  ? 14.969  21.071  -10.101 1.00 22.79 ? 74  VAL A CB    1 
ATOM   747  C CG1   . VAL C 3 14  ? 15.557  20.824  -11.485 1.00 25.39 ? 74  VAL A CG1   1 
ATOM   748  C CG2   . VAL C 3 14  ? 16.048  21.113  -9.065  1.00 23.90 ? 74  VAL A CG2   1 
ATOM   749  N N     . THR C 3 15  ? 13.599  23.030  -12.374 1.00 20.34 ? 75  THR A N     1 
ATOM   750  C CA    . THR C 3 15  ? 12.786  23.002  -13.595 1.00 18.69 ? 75  THR A CA    1 
ATOM   751  C C     . THR C 3 15  ? 13.544  22.143  -14.623 1.00 19.67 ? 75  THR A C     1 
ATOM   752  O O     . THR C 3 15  ? 14.676  22.465  -15.009 1.00 23.01 ? 75  THR A O     1 
ATOM   753  C CB    . THR C 3 15  ? 12.557  24.429  -14.176 1.00 19.32 ? 75  THR A CB    1 
ATOM   754  O OG1   . THR C 3 15  ? 11.804  25.221  -13.250 1.00 17.39 ? 75  THR A OG1   1 
ATOM   755  C CG2   . THR C 3 15  ? 11.786  24.350  -15.510 1.00 19.24 ? 75  THR A CG2   1 
ATOM   756  N N     . LEU C 3 16  ? 12.935  21.044  -15.061 1.00 19.45 ? 76  LEU A N     1 
ATOM   757  C CA    . LEU C 3 16  ? 13.587  20.164  -16.027 1.00 19.41 ? 76  LEU A CA    1 
ATOM   758  C C     . LEU C 3 16  ? 13.428  20.670  -17.471 1.00 19.83 ? 76  LEU A C     1 
ATOM   759  O O     . LEU C 3 16  ? 14.195  20.294  -18.349 1.00 18.39 ? 76  LEU A O     1 
ATOM   760  C CB    . LEU C 3 16  ? 13.064  18.729  -15.870 1.00 20.97 ? 76  LEU A CB    1 
ATOM   761  C CG    . LEU C 3 16  ? 13.374  18.131  -14.481 1.00 19.41 ? 76  LEU A CG    1 
ATOM   762  C CD1   . LEU C 3 16  ? 12.790  16.721  -14.351 1.00 21.02 ? 76  LEU A CD1   1 
ATOM   763  C CD2   . LEU C 3 16  ? 14.874  18.105  -14.246 1.00 19.63 ? 76  LEU A CD2   1 
ATOM   764  N N     . GLY C 3 17  ? 12.440  21.527  -17.703 1.00 21.46 ? 77  GLY A N     1 
ATOM   765  C CA    . GLY C 3 17  ? 12.257  22.123  -19.020 1.00 24.69 ? 77  GLY A CA    1 
ATOM   766  C C     . GLY C 3 17  ? 11.575  21.330  -20.122 1.00 28.10 ? 77  GLY A C     1 
ATOM   767  O O     . GLY C 3 17  ? 11.623  21.726  -21.286 1.00 28.72 ? 77  GLY A O     1 
ATOM   768  N N     . CYS C 3 18  ? 10.927  20.225  -19.777 1.00 27.35 ? 78  CYS A N     1 
ATOM   769  C CA    . CYS C 3 18  ? 10.239  19.429  -20.786 1.00 28.16 ? 78  CYS A CA    1 
ATOM   770  C C     . CYS C 3 18  ? 9.070   18.748  -20.104 1.00 27.71 ? 78  CYS A C     1 
ATOM   771  O O     . CYS C 3 18  ? 9.093   18.549  -18.890 1.00 24.50 ? 78  CYS A O     1 
ATOM   772  C CB    . CYS C 3 18  ? 11.191  18.380  -21.385 1.00 29.36 ? 78  CYS A CB    1 
ATOM   773  S SG    . CYS C 3 18  ? 11.749  17.084  -20.244 1.00 29.17 ? 78  CYS A SG    1 
ATOM   774  N N     . ARG C 3 19  ? 8.028   18.415  -20.856 1.00 27.24 ? 79  ARG A N     1 
ATOM   775  C CA    . ARG C 3 19  ? 6.915   17.731  -20.225 1.00 26.55 ? 79  ARG A CA    1 
ATOM   776  C C     . ARG C 3 19  ? 7.319   16.269  -20.087 1.00 23.88 ? 79  ARG A C     1 
ATOM   777  O O     . ARG C 3 19  ? 8.167   15.771  -20.826 1.00 24.21 ? 79  ARG A O     1 
ATOM   778  C CB    . ARG C 3 19  ? 5.614   17.897  -21.026 1.00 31.43 ? 79  ARG A CB    1 
ATOM   779  C CG    . ARG C 3 19  ? 4.914   19.242  -20.747 1.00 35.32 ? 79  ARG A CG    1 
ATOM   780  C CD    . ARG C 3 19  ? 3.407   19.161  -20.934 1.00 37.93 ? 79  ARG A CD    1 
ATOM   781  N NE    . ARG C 3 19  ? 2.680   18.622  -19.778 1.00 39.69 ? 79  ARG A NE    1 
ATOM   782  C CZ    . ARG C 3 19  ? 2.290   19.350  -18.732 1.00 42.04 ? 79  ARG A CZ    1 
ATOM   783  N NH1   . ARG C 3 19  ? 2.563   20.649  -18.683 1.00 43.50 ? 79  ARG A NH1   1 
ATOM   784  N NH2   . ARG C 3 19  ? 1.586   18.795  -17.753 1.00 41.19 ? 79  ARG A NH2   1 
ATOM   785  N N     . LEU C 3 20  ? 6.726   15.590  -19.117 1.00 23.06 ? 80  LEU A N     1 
ATOM   786  C CA    . LEU C 3 20  ? 7.066   14.205  -18.857 1.00 21.88 ? 80  LEU A CA    1 
ATOM   787  C C     . LEU C 3 20  ? 5.829   13.323  -18.860 1.00 21.57 ? 80  LEU A C     1 
ATOM   788  O O     . LEU C 3 20  ? 4.747   13.754  -18.461 1.00 20.86 ? 80  LEU A O     1 
ATOM   789  C CB    . LEU C 3 20  ? 7.745   14.097  -17.480 1.00 20.36 ? 80  LEU A CB    1 
ATOM   790  C CG    . LEU C 3 20  ? 9.044   14.881  -17.244 1.00 20.56 ? 80  LEU A CG    1 
ATOM   791  C CD1   . LEU C 3 20  ? 9.478   14.740  -15.769 1.00 19.97 ? 80  LEU A CD1   1 
ATOM   792  C CD2   . LEU C 3 20  ? 10.130  14.353  -18.171 1.00 22.18 ? 80  LEU A CD2   1 
ATOM   793  N N     . ASP C 3 21  ? 5.992   12.093  -19.328 1.00 21.93 ? 81  ASP A N     1 
ATOM   794  C CA    . ASP C 3 21  ? 4.902   11.122  -19.294 1.00 20.86 ? 81  ASP A CA    1 
ATOM   795  C C     . ASP C 3 21  ? 5.222   10.387  -17.989 1.00 18.23 ? 81  ASP A C     1 
ATOM   796  O O     . ASP C 3 21  ? 6.185   9.638   -17.934 1.00 16.35 ? 81  ASP A O     1 
ATOM   797  C CB    . ASP C 3 21  ? 5.000   10.152  -20.471 1.00 25.32 ? 81  ASP A CB    1 
ATOM   798  C CG    . ASP C 3 21  ? 3.836   9.182   -20.514 1.00 28.60 ? 81  ASP A CG    1 
ATOM   799  O OD1   . ASP C 3 21  ? 3.627   8.448   -19.530 1.00 29.76 ? 81  ASP A OD1   1 
ATOM   800  O OD2   . ASP C 3 21  ? 3.121   9.155   -21.534 1.00 34.89 ? 81  ASP A OD2   1 
ATOM   801  N N     . LEU C 3 22  ? 4.436   10.627  -16.944 1.00 18.59 ? 82  LEU A N     1 
ATOM   802  C CA    . LEU C 3 22  ? 4.690   10.034  -15.630 1.00 18.00 ? 82  LEU A CA    1 
ATOM   803  C C     . LEU C 3 22  ? 4.623   8.516   -15.565 1.00 17.94 ? 82  LEU A C     1 
ATOM   804  O O     . LEU C 3 22  ? 5.357   7.898   -14.792 1.00 17.49 ? 82  LEU A O     1 
ATOM   805  C CB    . LEU C 3 22  ? 3.742   10.641  -14.595 1.00 14.54 ? 82  LEU A CB    1 
ATOM   806  C CG    . LEU C 3 22  ? 3.896   12.157  -14.447 1.00 17.08 ? 82  LEU A CG    1 
ATOM   807  C CD1   . LEU C 3 22  ? 3.014   12.656  -13.303 1.00 13.12 ? 82  LEU A CD1   1 
ATOM   808  C CD2   . LEU C 3 22  ? 5.375   12.501  -14.181 1.00 18.85 ? 82  LEU A CD2   1 
ATOM   809  N N     . LYS C 3 23  ? 3.748   7.910   -16.361 1.00 16.51 ? 83  LYS A N     1 
ATOM   810  C CA    . LYS C 3 23  ? 3.667   6.456   -16.364 1.00 19.97 ? 83  LYS A CA    1 
ATOM   811  C C     . LYS C 3 23  ? 4.969   5.904   -16.938 1.00 17.97 ? 83  LYS A C     1 
ATOM   812  O O     . LYS C 3 23  ? 5.496   4.918   -16.439 1.00 17.43 ? 83  LYS A O     1 
ATOM   813  C CB    . LYS C 3 23  ? 2.472   5.977   -17.202 1.00 21.16 ? 83  LYS A CB    1 
ATOM   814  C CG    . LYS C 3 23  ? 2.411   4.466   -17.360 1.00 24.01 ? 83  LYS A CG    1 
ATOM   815  C CD    . LYS C 3 23  ? 1.117   4.016   -18.034 1.00 24.39 ? 83  LYS A CD    1 
ATOM   816  C CE    . LYS C 3 23  ? 1.209   2.538   -18.418 1.00 31.73 ? 83  LYS A CE    1 
ATOM   817  N NZ    . LYS C 3 23  ? -0.074  1.989   -18.936 1.00 34.13 ? 83  LYS A NZ    1 
ATOM   818  N N     . THR C 3 24  ? 5.494   6.533   -17.988 1.00 18.62 ? 84  THR A N     1 
ATOM   819  C CA    . THR C 3 24  ? 6.751   6.059   -18.574 1.00 20.09 ? 84  THR A CA    1 
ATOM   820  C C     . THR C 3 24  ? 7.893   6.161   -17.554 1.00 18.69 ? 84  THR A C     1 
ATOM   821  O O     . THR C 3 24  ? 8.731   5.250   -17.425 1.00 18.13 ? 84  THR A O     1 
ATOM   822  C CB    . THR C 3 24  ? 7.115   6.865   -19.844 1.00 22.60 ? 84  THR A CB    1 
ATOM   823  O OG1   . THR C 3 24  ? 6.090   6.684   -20.828 1.00 23.36 ? 84  THR A OG1   1 
ATOM   824  C CG2   . THR C 3 24  ? 8.433   6.387   -20.422 1.00 24.36 ? 84  THR A CG2   1 
ATOM   825  N N     . VAL C 3 25  ? 7.924   7.269   -16.817 1.00 16.76 ? 85  VAL A N     1 
ATOM   826  C CA    . VAL C 3 25  ? 8.958   7.460   -15.814 1.00 16.40 ? 85  VAL A CA    1 
ATOM   827  C C     . VAL C 3 25  ? 8.862   6.355   -14.771 1.00 15.22 ? 85  VAL A C     1 
ATOM   828  O O     . VAL C 3 25  ? 9.867   5.740   -14.411 1.00 16.83 ? 85  VAL A O     1 
ATOM   829  C CB    . VAL C 3 25  ? 8.818   8.838   -15.097 1.00 16.35 ? 85  VAL A CB    1 
ATOM   830  C CG1   . VAL C 3 25  ? 9.814   8.937   -13.916 1.00 15.22 ? 85  VAL A CG1   1 
ATOM   831  C CG2   . VAL C 3 25  ? 9.082   9.962   -16.101 1.00 17.18 ? 85  VAL A CG2   1 
ATOM   832  N N     . ALA C 3 26  ? 7.650   6.093   -14.290 1.00 18.14 ? 86  ALA A N     1 
ATOM   833  C CA    . ALA C 3 26  ? 7.469   5.066   -13.250 1.00 18.01 ? 86  ALA A CA    1 
ATOM   834  C C     . ALA C 3 26  ? 7.825   3.664   -13.722 1.00 20.07 ? 86  ALA A C     1 
ATOM   835  O O     . ALA C 3 26  ? 8.304   2.830   -12.942 1.00 17.40 ? 86  ALA A O     1 
ATOM   836  C CB    . ALA C 3 26  ? 6.030   5.071   -12.737 1.00 17.72 ? 86  ALA A CB    1 
ATOM   837  N N     . LEU C 3 27  ? 7.578   3.393   -14.994 1.00 19.86 ? 87  LEU A N     1 
ATOM   838  C CA    . LEU C 3 27  ? 7.871   2.070   -15.525 1.00 20.73 ? 87  LEU A CA    1 
ATOM   839  C C     . LEU C 3 27  ? 9.339   1.843   -15.851 1.00 22.42 ? 87  LEU A C     1 
ATOM   840  O O     . LEU C 3 27  ? 9.749   0.706   -16.094 1.00 24.20 ? 87  LEU A O     1 
ATOM   841  C CB    . LEU C 3 27  ? 7.007   1.814   -16.761 1.00 21.89 ? 87  LEU A CB    1 
ATOM   842  C CG    . LEU C 3 27  ? 5.519   1.662   -16.424 1.00 25.20 ? 87  LEU A CG    1 
ATOM   843  C CD1   . LEU C 3 27  ? 4.724   1.477   -17.703 1.00 26.64 ? 87  LEU A CD1   1 
ATOM   844  C CD2   . LEU C 3 27  ? 5.311   0.485   -15.466 1.00 26.17 ? 87  LEU A CD2   1 
ATOM   845  N N     . HIS C 3 28  ? 10.138  2.907   -15.853 1.00 21.39 ? 88  HIS A N     1 
ATOM   846  C CA    . HIS C 3 28  ? 11.558  2.760   -16.173 1.00 22.35 ? 88  HIS A CA    1 
ATOM   847  C C     . HIS C 3 28  ? 12.538  3.120   -15.065 1.00 22.81 ? 88  HIS A C     1 
ATOM   848  O O     . HIS C 3 28  ? 13.717  2.773   -15.135 1.00 24.93 ? 88  HIS A O     1 
ATOM   849  C CB    . HIS C 3 28  ? 11.897  3.559   -17.435 1.00 24.94 ? 88  HIS A CB    1 
ATOM   850  C CG    . HIS C 3 28  ? 11.240  3.024   -18.666 1.00 27.05 ? 88  HIS A CG    1 
ATOM   851  N ND1   . HIS C 3 28  ? 9.943   3.336   -19.016 1.00 28.67 ? 88  HIS A ND1   1 
ATOM   852  C CD2   . HIS C 3 28  ? 11.679  2.140   -19.594 1.00 30.47 ? 88  HIS A CD2   1 
ATOM   853  C CE1   . HIS C 3 28  ? 9.613   2.666   -20.106 1.00 31.45 ? 88  HIS A CE1   1 
ATOM   854  N NE2   . HIS C 3 28  ? 10.648  1.932   -20.477 1.00 30.57 ? 88  HIS A NE2   1 
ATOM   855  N N     . ALA C 3 29  ? 12.066  3.821   -14.046 1.00 19.93 ? 89  ALA A N     1 
ATOM   856  C CA    . ALA C 3 29  ? 12.947  4.197   -12.947 1.00 19.33 ? 89  ALA A CA    1 
ATOM   857  C C     . ALA C 3 29  ? 12.681  3.289   -11.751 1.00 18.25 ? 89  ALA A C     1 
ATOM   858  O O     . ALA C 3 29  ? 11.531  2.966   -11.466 1.00 17.65 ? 89  ALA A O     1 
ATOM   859  C CB    . ALA C 3 29  ? 12.697  5.646   -12.556 1.00 18.66 ? 89  ALA A CB    1 
ATOM   860  N N     . ARG C 3 30  ? 13.740  2.857   -11.069 1.00 15.97 ? 90  ARG A N     1 
ATOM   861  C CA    . ARG C 3 30  ? 13.575  2.033   -9.879  1.00 14.97 ? 90  ARG A CA    1 
ATOM   862  C C     . ARG C 3 30  ? 13.155  2.953   -8.722  1.00 14.45 ? 90  ARG A C     1 
ATOM   863  O O     . ARG C 3 30  ? 13.380  4.166   -8.774  1.00 13.24 ? 90  ARG A O     1 
ATOM   864  C CB    . ARG C 3 30  ? 14.886  1.335   -9.503  1.00 19.37 ? 90  ARG A CB    1 
ATOM   865  C CG    . ARG C 3 30  ? 15.407  0.344   -10.543 1.00 22.00 ? 90  ARG A CG    1 
ATOM   866  C CD    . ARG C 3 30  ? 16.620  -0.411  -10.007 1.00 30.28 ? 90  ARG A CD    1 
ATOM   867  N NE    . ARG C 3 30  ? 17.383  -1.070  -11.071 1.00 35.99 ? 90  ARG A NE    1 
ATOM   868  C CZ    . ARG C 3 30  ? 16.950  -2.096  -11.801 1.00 38.18 ? 90  ARG A CZ    1 
ATOM   869  N NH1   . ARG C 3 30  ? 15.744  -2.608  -11.598 1.00 40.29 ? 90  ARG A NH1   1 
ATOM   870  N NH2   . ARG C 3 30  ? 17.736  -2.613  -12.741 1.00 39.04 ? 90  ARG A NH2   1 
ATOM   871  N N     . ASN C 3 31  ? 12.541  2.374   -7.692  1.00 12.11 ? 91  ASN A N     1 
ATOM   872  C CA    . ASN C 3 31  ? 12.100  3.120   -6.504  1.00 13.03 ? 91  ASN A CA    1 
ATOM   873  C C     . ASN C 3 31  ? 11.210  4.303   -6.803  1.00 13.57 ? 91  ASN A C     1 
ATOM   874  O O     . ASN C 3 31  ? 11.376  5.395   -6.239  1.00 12.42 ? 91  ASN A O     1 
ATOM   875  C CB    . ASN C 3 31  ? 13.329  3.554   -5.716  1.00 12.10 ? 91  ASN A CB    1 
ATOM   876  C CG    . ASN C 3 31  ? 14.276  2.395   -5.512  1.00 16.29 ? 91  ASN A CG    1 
ATOM   877  O OD1   . ASN C 3 31  ? 13.859  1.348   -5.027  1.00 15.23 ? 91  ASN A OD1   1 
ATOM   878  N ND2   . ASN C 3 31  ? 15.536  2.552   -5.912  1.00 15.75 ? 91  ASN A ND2   1 
ATOM   879  N N     . ALA C 3 32  ? 10.239  4.055   -7.673  1.00 11.92 ? 92  ALA A N     1 
ATOM   880  C CA    . ALA C 3 32  ? 9.313   5.091   -8.088  1.00 12.25 ? 92  ALA A CA    1 
ATOM   881  C C     . ALA C 3 32  ? 7.865   4.679   -7.901  1.00 12.54 ? 92  ALA A C     1 
ATOM   882  O O     . ALA C 3 32  ? 7.483   3.532   -8.166  1.00 13.47 ? 92  ALA A O     1 
ATOM   883  C CB    . ALA C 3 32  ? 9.565   5.437   -9.546  1.00 12.74 ? 92  ALA A CB    1 
ATOM   884  N N     . GLU C 3 33  ? 7.044   5.630   -7.469  1.00 12.69 ? 93  GLU A N     1 
ATOM   885  C CA    . GLU C 3 33  ? 5.628   5.360   -7.286  1.00 12.57 ? 93  GLU A CA    1 
ATOM   886  C C     . GLU C 3 33  ? 4.835   6.335   -8.130  1.00 15.39 ? 93  GLU A C     1 
ATOM   887  O O     . GLU C 3 33  ? 5.125   7.543   -8.131  1.00 14.09 ? 93  GLU A O     1 
ATOM   888  C CB    . GLU C 3 33  ? 5.194   5.606   -5.856  1.00 15.48 ? 93  GLU A CB    1 
ATOM   889  C CG    . GLU C 3 33  ? 5.930   4.844   -4.803  1.00 15.95 ? 93  GLU A CG    1 
ATOM   890  C CD    . GLU C 3 33  ? 5.682   5.420   -3.431  1.00 19.60 ? 93  GLU A CD    1 
ATOM   891  O OE1   . GLU C 3 33  ? 6.636   5.999   -2.870  1.00 20.97 ? 93  GLU A OE1   1 
ATOM   892  O OE2   . GLU C 3 33  ? 4.537   5.300   -2.924  1.00 17.11 ? 93  GLU A OE2   1 
ATOM   893  N N     . TYR C 3 34  ? 3.855   5.816   -8.860  1.00 12.65 ? 94  TYR A N     1 
ATOM   894  C CA    . TYR C 3 34  ? 2.966   6.697   -9.608  1.00 12.18 ? 94  TYR A CA    1 
ATOM   895  C C     . TYR C 3 34  ? 1.541   6.203   -9.363  1.00 13.20 ? 94  TYR A C     1 
ATOM   896  O O     . TYR C 3 34  ? 1.137   5.149   -9.870  1.00 13.26 ? 94  TYR A O     1 
ATOM   897  C CB    . TYR C 3 34  ? 3.268   6.699   -11.107 1.00 13.74 ? 94  TYR A CB    1 
ATOM   898  C CG    . TYR C 3 34  ? 2.311   7.595   -11.882 1.00 13.63 ? 94  TYR A CG    1 
ATOM   899  C CD1   . TYR C 3 34  ? 2.056   8.906   -11.455 1.00 14.33 ? 94  TYR A CD1   1 
ATOM   900  C CD2   . TYR C 3 34  ? 1.643   7.130   -13.019 1.00 16.49 ? 94  TYR A CD2   1 
ATOM   901  C CE1   . TYR C 3 34  ? 1.152   9.731   -12.143 1.00 15.45 ? 94  TYR A CE1   1 
ATOM   902  C CE2   . TYR C 3 34  ? 0.733   7.950   -13.716 1.00 18.87 ? 94  TYR A CE2   1 
ATOM   903  C CZ    . TYR C 3 34  ? 0.500   9.251   -13.267 1.00 16.92 ? 94  TYR A CZ    1 
ATOM   904  O OH    . TYR C 3 34  ? -0.353  10.097  -13.952 1.00 18.76 ? 94  TYR A OH    1 
ATOM   905  N N     . ASN C 3 35  ? 0.799   6.950   -8.547  1.00 11.65 ? 95  ASN A N     1 
ATOM   906  C CA    . ASN C 3 35  ? -0.586  6.624   -8.236  1.00 13.16 ? 95  ASN A CA    1 
ATOM   907  C C     . ASN C 3 35  ? -1.362  7.933   -8.392  1.00 12.72 ? 95  ASN A C     1 
ATOM   908  O O     . ASN C 3 35  ? -1.531  8.684   -7.424  1.00 12.44 ? 95  ASN A O     1 
ATOM   909  C CB    . ASN C 3 35  ? -0.743  6.116   -6.797  1.00 15.29 ? 95  ASN A CB    1 
ATOM   910  C CG    . ASN C 3 35  ? -2.142  5.570   -6.534  1.00 16.99 ? 95  ASN A CG    1 
ATOM   911  O OD1   . ASN C 3 35  ? -3.104  5.969   -7.199  1.00 16.82 ? 95  ASN A OD1   1 
ATOM   912  N ND2   . ASN C 3 35  ? -2.263  4.662   -5.568  1.00 18.12 ? 95  ASN A ND2   1 
ATOM   913  N N     . PRO C 3 36  ? -1.854  8.204   -9.607  1.00 14.16 ? 96  PRO A N     1 
ATOM   914  C CA    . PRO C 3 36  ? -2.604  9.433   -9.899  1.00 15.38 ? 96  PRO A CA    1 
ATOM   915  C C     . PRO C 3 36  ? -3.880  9.666   -9.108  1.00 17.01 ? 96  PRO A C     1 
ATOM   916  O O     . PRO C 3 36  ? -4.383  10.790  -9.052  1.00 16.14 ? 96  PRO A O     1 
ATOM   917  C CB    . PRO C 3 36  ? -2.818  9.369   -11.414 1.00 16.11 ? 96  PRO A CB    1 
ATOM   918  C CG    . PRO C 3 36  ? -2.761  7.885   -11.744 1.00 14.92 ? 96  PRO A CG    1 
ATOM   919  C CD    . PRO C 3 36  ? -1.667  7.380   -10.820 1.00 13.85 ? 96  PRO A CD    1 
ATOM   920  N N     . LYS C 3 37  ? -4.404  8.604   -8.506  1.00 16.93 ? 97  LYS A N     1 
ATOM   921  C CA    . LYS C 3 37  ? -5.594  8.710   -7.673  1.00 17.97 ? 97  LYS A CA    1 
ATOM   922  C C     . LYS C 3 37  ? -5.171  9.353   -6.346  1.00 19.27 ? 97  LYS A C     1 
ATOM   923  O O     . LYS C 3 37  ? -5.984  9.968   -5.648  1.00 20.11 ? 97  LYS A O     1 
ATOM   924  C CB    . LYS C 3 37  ? -6.179  7.313   -7.426  1.00 21.43 ? 97  LYS A CB    1 
ATOM   925  C CG    . LYS C 3 37  ? -7.561  7.289   -6.798  1.00 28.08 ? 97  LYS A CG    1 
ATOM   926  C CD    . LYS C 3 37  ? -8.086  5.853   -6.745  1.00 32.86 ? 97  LYS A CD    1 
ATOM   927  C CE    . LYS C 3 37  ? -9.473  5.779   -6.130  1.00 36.30 ? 97  LYS A CE    1 
ATOM   928  N NZ    . LYS C 3 37  ? -9.922  4.359   -5.984  1.00 40.55 ? 97  LYS A NZ    1 
ATOM   929  N N     . ARG C 3 38  ? -3.889  9.231   -6.010  1.00 16.46 ? 98  ARG A N     1 
ATOM   930  C CA    . ARG C 3 38  ? -3.376  9.796   -4.762  1.00 17.83 ? 98  ARG A CA    1 
ATOM   931  C C     . ARG C 3 38  ? -2.708  11.152  -4.892  1.00 17.30 ? 98  ARG A C     1 
ATOM   932  O O     . ARG C 3 38  ? -2.902  12.033  -4.046  1.00 17.60 ? 98  ARG A O     1 
ATOM   933  C CB    . ARG C 3 38  ? -2.348  8.854   -4.110  1.00 19.88 ? 98  ARG A CB    1 
ATOM   934  C CG    . ARG C 3 38  ? -2.929  7.620   -3.442  1.00 25.11 ? 98  ARG A CG    1 
ATOM   935  C CD    . ARG C 3 38  ? -1.819  6.809   -2.778  1.00 29.61 ? 98  ARG A CD    1 
ATOM   936  N NE    . ARG C 3 38  ? -2.335  5.674   -2.018  1.00 34.65 ? 98  ARG A NE    1 
ATOM   937  C CZ    . ARG C 3 38  ? -1.583  4.905   -1.234  1.00 35.35 ? 98  ARG A CZ    1 
ATOM   938  N NH1   . ARG C 3 38  ? -0.284  5.152   -1.108  1.00 36.64 ? 98  ARG A NH1   1 
ATOM   939  N NH2   . ARG C 3 38  ? -2.133  3.900   -0.572  1.00 35.87 ? 98  ARG A NH2   1 
ATOM   940  N N     . PHE C 3 39  ? -1.906  11.313  -5.936  1.00 15.08 ? 99  PHE A N     1 
ATOM   941  C CA    . PHE C 3 39  ? -1.155  12.548  -6.127  1.00 14.97 ? 99  PHE A CA    1 
ATOM   942  C C     . PHE C 3 39  ? -0.641  12.543  -7.566  1.00 15.94 ? 99  PHE A C     1 
ATOM   943  O O     . PHE C 3 39  ? -0.085  11.537  -8.018  1.00 14.30 ? 99  PHE A O     1 
ATOM   944  C CB    . PHE C 3 39  ? 0.006   12.549  -5.113  1.00 16.10 ? 99  PHE A CB    1 
ATOM   945  C CG    . PHE C 3 39  ? 0.732   13.854  -5.002  1.00 18.10 ? 99  PHE A CG    1 
ATOM   946  C CD1   . PHE C 3 39  ? 0.058   15.014  -4.628  1.00 17.23 ? 99  PHE A CD1   1 
ATOM   947  C CD2   . PHE C 3 39  ? 2.105   13.918  -5.248  1.00 17.83 ? 99  PHE A CD2   1 
ATOM   948  C CE1   . PHE C 3 39  ? 0.745   16.234  -4.498  1.00 17.66 ? 99  PHE A CE1   1 
ATOM   949  C CE2   . PHE C 3 39  ? 2.801   15.123  -5.124  1.00 17.95 ? 99  PHE A CE2   1 
ATOM   950  C CZ    . PHE C 3 39  ? 2.118   16.288  -4.748  1.00 15.29 ? 99  PHE A CZ    1 
ATOM   951  N N     . ALA C 3 40  ? -0.819  13.654  -8.286  1.00 15.21 ? 100 ALA A N     1 
ATOM   952  C CA    . ALA C 3 40  ? -0.388  13.736  -9.688  1.00 15.73 ? 100 ALA A CA    1 
ATOM   953  C C     . ALA C 3 40  ? 1.097   13.968  -9.844  1.00 17.08 ? 100 ALA A C     1 
ATOM   954  O O     . ALA C 3 40  ? 1.533   15.039  -10.263 1.00 17.19 ? 100 ALA A O     1 
ATOM   955  C CB    . ALA C 3 40  ? -1.163  14.834  -10.431 1.00 15.11 ? 100 ALA A CB    1 
ATOM   956  N N     . ALA C 3 41  ? 1.883   12.956  -9.494  1.00 15.49 ? 101 ALA A N     1 
ATOM   957  C CA    . ALA C 3 41  ? 3.318   13.074  -9.621  1.00 14.44 ? 101 ALA A CA    1 
ATOM   958  C C     . ALA C 3 41  ? 3.976   11.725  -9.396  1.00 13.11 ? 101 ALA A C     1 
ATOM   959  O O     . ALA C 3 41  ? 3.375   10.808  -8.830  1.00 15.01 ? 101 ALA A O     1 
ATOM   960  C CB    . ALA C 3 41  ? 3.848   14.081  -8.592  1.00 13.87 ? 101 ALA A CB    1 
ATOM   961  N N     . VAL C 3 42  ? 5.205   11.602  -9.868  1.00 11.97 ? 102 VAL A N     1 
ATOM   962  C CA    . VAL C 3 42  ? 5.968   10.394  -9.598  1.00 12.16 ? 102 VAL A CA    1 
ATOM   963  C C     . VAL C 3 42  ? 6.748   10.713  -8.315  1.00 13.97 ? 102 VAL A C     1 
ATOM   964  O O     . VAL C 3 42  ? 7.351   11.786  -8.205  1.00 13.66 ? 102 VAL A O     1 
ATOM   965  C CB    . VAL C 3 42  ? 6.986   10.093  -10.707 1.00 15.57 ? 102 VAL A CB    1 
ATOM   966  C CG1   . VAL C 3 42  ? 8.029   9.097   -10.190 1.00 17.99 ? 102 VAL A CG1   1 
ATOM   967  C CG2   . VAL C 3 42  ? 6.279   9.512   -11.923 1.00 13.81 ? 102 VAL A CG2   1 
ATOM   968  N N     . ILE C 3 43  ? 6.718   9.802   -7.343  1.00 11.26 ? 103 ILE A N     1 
ATOM   969  C CA    . ILE C 3 43  ? 7.461   9.978   -6.107  1.00 11.01 ? 103 ILE A CA    1 
ATOM   970  C C     . ILE C 3 43  ? 8.634   9.015   -6.299  1.00 12.17 ? 103 ILE A C     1 
ATOM   971  O O     . ILE C 3 43  ? 8.419   7.827   -6.548  1.00 14.21 ? 103 ILE A O     1 
ATOM   972  C CB    . ILE C 3 43  ? 6.625   9.572   -4.880  1.00 12.23 ? 103 ILE A CB    1 
ATOM   973  C CG1   . ILE C 3 43  ? 5.370   10.456  -4.804  1.00 14.07 ? 103 ILE A CG1   1 
ATOM   974  C CG2   . ILE C 3 43  ? 7.466   9.735   -3.590  1.00 12.61 ? 103 ILE A CG2   1 
ATOM   975  C CD1   . ILE C 3 43  ? 4.294   9.934   -3.844  1.00 17.93 ? 103 ILE A CD1   1 
ATOM   976  N N     . MET C 3 44  ? 9.856   9.533   -6.226  1.00 11.49 ? 104 MET A N     1 
ATOM   977  C CA    . MET C 3 44  ? 11.047  8.709   -6.434  1.00 11.90 ? 104 MET A CA    1 
ATOM   978  C C     . MET C 3 44  ? 12.063  8.923   -5.314  1.00 12.15 ? 104 MET A C     1 
ATOM   979  O O     . MET C 3 44  ? 12.176  10.019  -4.781  1.00 12.00 ? 104 MET A O     1 
ATOM   980  C CB    . MET C 3 44  ? 11.694  9.090   -7.773  1.00 11.86 ? 104 MET A CB    1 
ATOM   981  C CG    . MET C 3 44  ? 12.773  8.110   -8.247  1.00 16.14 ? 104 MET A CG    1 
ATOM   982  S SD    . MET C 3 44  ? 13.544  8.620   -9.806  1.00 16.47 ? 104 MET A SD    1 
ATOM   983  C CE    . MET C 3 44  ? 12.148  8.617   -10.927 1.00 15.74 ? 104 MET A CE    1 
ATOM   984  N N     . ARG C 3 45  ? 12.808  7.882   -4.952  1.00 12.50 ? 105 ARG A N     1 
ATOM   985  C CA    . ARG C 3 45  ? 13.816  8.037   -3.909  1.00 12.31 ? 105 ARG A CA    1 
ATOM   986  C C     . ARG C 3 45  ? 15.157  7.470   -4.335  1.00 12.77 ? 105 ARG A C     1 
ATOM   987  O O     . ARG C 3 45  ? 15.217  6.518   -5.129  1.00 14.62 ? 105 ARG A O     1 
ATOM   988  C CB    . ARG C 3 45  ? 13.394  7.303   -2.625  1.00 11.06 ? 105 ARG A CB    1 
ATOM   989  C CG    . ARG C 3 45  ? 12.055  7.798   -2.046  1.00 11.01 ? 105 ARG A CG    1 
ATOM   990  C CD    . ARG C 3 45  ? 11.741  7.164   -0.684  1.00 10.34 ? 105 ARG A CD    1 
ATOM   991  N NE    . ARG C 3 45  ? 10.571  7.834   -0.122  1.00 11.19 ? 105 ARG A NE    1 
ATOM   992  C CZ    . ARG C 3 45  ? 9.316   7.519   -0.412  1.00 13.68 ? 105 ARG A CZ    1 
ATOM   993  N NH1   . ARG C 3 45  ? 9.069   6.520   -1.237  1.00 13.94 ? 105 ARG A NH1   1 
ATOM   994  N NH2   . ARG C 3 45  ? 8.318   8.254   0.074   1.00 13.84 ? 105 ARG A NH2   1 
ATOM   995  N N     . ILE C 3 46  ? 16.218  8.054   -3.790  1.00 13.51 ? 106 ILE A N     1 
ATOM   996  C CA    . ILE C 3 46  ? 17.573  7.559   -4.020  1.00 14.24 ? 106 ILE A CA    1 
ATOM   997  C C     . ILE C 3 46  ? 18.213  7.447   -2.642  1.00 15.00 ? 106 ILE A C     1 
ATOM   998  O O     . ILE C 3 46  ? 17.833  8.143   -1.690  1.00 11.98 ? 106 ILE A O     1 
ATOM   999  C CB    . ILE C 3 46  ? 18.439  8.484   -4.922  1.00 13.24 ? 106 ILE A CB    1 
ATOM   1000 C CG1   . ILE C 3 46  ? 18.540  9.883   -4.330  1.00 13.86 ? 106 ILE A CG1   1 
ATOM   1001 C CG2   . ILE C 3 46  ? 17.872  8.512   -6.334  1.00 15.70 ? 106 ILE A CG2   1 
ATOM   1002 C CD1   . ILE C 3 46  ? 19.543  10.768  -5.084  1.00 14.10 ? 106 ILE A CD1   1 
ATOM   1003 N N     . ARG C 3 47  ? 19.189  6.558   -2.523  1.00 14.82 ? 107 ARG A N     1 
ATOM   1004 C CA    . ARG C 3 47  ? 19.834  6.344   -1.241  1.00 16.75 ? 107 ARG A CA    1 
ATOM   1005 C C     . ARG C 3 47  ? 20.906  7.353   -0.903  1.00 17.43 ? 107 ARG A C     1 
ATOM   1006 O O     . ARG C 3 47  ? 21.184  7.591   0.274   1.00 19.04 ? 107 ARG A O     1 
ATOM   1007 C CB    . ARG C 3 47  ? 20.481  4.957   -1.205  1.00 19.34 ? 107 ARG A CB    1 
ATOM   1008 C CG    . ARG C 3 47  ? 19.490  3.795   -1.219  1.00 23.75 ? 107 ARG A CG    1 
ATOM   1009 C CD    . ARG C 3 47  ? 20.238  2.468   -1.105  1.00 27.95 ? 107 ARG A CD    1 
ATOM   1010 N NE    . ARG C 3 47  ? 19.354  1.362   -0.745  1.00 32.51 ? 107 ARG A NE    1 
ATOM   1011 C CZ    . ARG C 3 47  ? 18.545  0.734   -1.591  1.00 34.53 ? 107 ARG A CZ    1 
ATOM   1012 N NH1   . ARG C 3 47  ? 18.497  1.092   -2.867  1.00 34.96 ? 107 ARG A NH1   1 
ATOM   1013 N NH2   . ARG C 3 47  ? 17.783  -0.260  -1.156  1.00 32.85 ? 107 ARG A NH2   1 
ATOM   1014 N N     . GLU C 3 48  ? 21.504  7.947   -1.929  1.00 16.34 ? 108 GLU A N     1 
ATOM   1015 C CA    . GLU C 3 48  ? 22.618  8.864   -1.702  1.00 20.35 ? 108 GLU A CA    1 
ATOM   1016 C C     . GLU C 3 48  ? 22.726  10.000  -2.702  1.00 17.74 ? 108 GLU A C     1 
ATOM   1017 O O     . GLU C 3 48  ? 22.983  9.767   -3.879  1.00 19.63 ? 108 GLU A O     1 
ATOM   1018 C CB    . GLU C 3 48  ? 23.927  8.054   -1.737  1.00 22.66 ? 108 GLU A CB    1 
ATOM   1019 C CG    . GLU C 3 48  ? 25.193  8.890   -1.609  1.00 33.30 ? 108 GLU A CG    1 
ATOM   1020 C CD    . GLU C 3 48  ? 25.207  9.744   -0.358  1.00 37.25 ? 108 GLU A CD    1 
ATOM   1021 O OE1   . GLU C 3 48  ? 24.963  9.199   0.741   1.00 41.04 ? 108 GLU A OE1   1 
ATOM   1022 O OE2   . GLU C 3 48  ? 25.466  10.961  -0.472  1.00 38.80 ? 108 GLU A OE2   1 
ATOM   1023 N N     . PRO C 3 49  ? 22.505  11.251  -2.258  1.00 17.46 ? 109 PRO A N     1 
ATOM   1024 C CA    . PRO C 3 49  ? 22.160  11.665  -0.890  1.00 15.97 ? 109 PRO A CA    1 
ATOM   1025 C C     . PRO C 3 49  ? 20.738  11.160  -0.639  1.00 14.95 ? 109 PRO A C     1 
ATOM   1026 O O     . PRO C 3 49  ? 19.910  11.202  -1.555  1.00 15.00 ? 109 PRO A O     1 
ATOM   1027 C CB    . PRO C 3 49  ? 22.203  13.196  -0.955  1.00 15.37 ? 109 PRO A CB    1 
ATOM   1028 C CG    . PRO C 3 49  ? 23.124  13.492  -2.109  1.00 15.69 ? 109 PRO A CG    1 
ATOM   1029 C CD    . PRO C 3 49  ? 22.746  12.421  -3.120  1.00 15.83 ? 109 PRO A CD    1 
ATOM   1030 N N     . LYS C 3 50  ? 20.463  10.703  0.583   1.00 14.20 ? 110 LYS A N     1 
ATOM   1031 C CA    . LYS C 3 50  ? 19.152  10.155  0.946   1.00 14.08 ? 110 LYS A CA    1 
ATOM   1032 C C     . LYS C 3 50  ? 18.076  11.231  0.845   1.00 11.01 ? 110 LYS A C     1 
ATOM   1033 O O     . LYS C 3 50  ? 17.999  12.106  1.697   1.00 11.51 ? 110 LYS A O     1 
ATOM   1034 C CB    . LYS C 3 50  ? 19.198  9.609   2.368   1.00 15.54 ? 110 LYS A CB    1 
ATOM   1035 C CG    . LYS C 3 50  ? 18.013  8.714   2.717   1.00 17.74 ? 110 LYS A CG    1 
ATOM   1036 C CD    . LYS C 3 50  ? 18.020  8.345   4.195   1.00 21.56 ? 110 LYS A CD    1 
ATOM   1037 C CE    . LYS C 3 50  ? 17.593  9.542   5.050   1.00 23.07 ? 110 LYS A CE    1 
ATOM   1038 N NZ    . LYS C 3 50  ? 17.632  9.226   6.497   1.00 31.01 ? 110 LYS A NZ    1 
ATOM   1039 N N     . THR C 3 51  ? 17.239  11.129  -0.179  1.00 12.19 ? 111 THR A N     1 
ATOM   1040 C CA    . THR C 3 51  ? 16.213  12.129  -0.467  1.00 12.17 ? 111 THR A CA    1 
ATOM   1041 C C     . THR C 3 51  ? 14.990  11.519  -1.151  1.00 10.51 ? 111 THR A C     1 
ATOM   1042 O O     . THR C 3 51  ? 14.990  10.355  -1.540  1.00 11.68 ? 111 THR A O     1 
ATOM   1043 C CB    . THR C 3 51  ? 16.774  13.182  -1.454  1.00 11.25 ? 111 THR A CB    1 
ATOM   1044 O OG1   . THR C 3 51  ? 17.377  12.492  -2.552  1.00 11.90 ? 111 THR A OG1   1 
ATOM   1045 C CG2   . THR C 3 51  ? 17.865  14.058  -0.802  1.00 10.98 ? 111 THR A CG2   1 
ATOM   1046 N N     . THR C 3 52  ? 13.952  12.337  -1.306  1.00 11.67 ? 112 THR A N     1 
ATOM   1047 C CA    . THR C 3 52  ? 12.733  11.934  -1.997  1.00 10.75 ? 112 THR A CA    1 
ATOM   1048 C C     . THR C 3 52  ? 12.387  13.066  -2.962  1.00 11.13 ? 112 THR A C     1 
ATOM   1049 O O     . THR C 3 52  ? 12.394  14.242  -2.588  1.00 11.81 ? 112 THR A O     1 
ATOM   1050 C CB    . THR C 3 52  ? 11.537  11.751  -1.026  1.00 11.56 ? 112 THR A CB    1 
ATOM   1051 O OG1   . THR C 3 52  ? 11.832  10.705  -0.095  1.00 10.12 ? 112 THR A OG1   1 
ATOM   1052 C CG2   . THR C 3 52  ? 10.264  11.380  -1.804  1.00 12.77 ? 112 THR A CG2   1 
ATOM   1053 N N     . ALA C 3 53  ? 12.087  12.709  -4.204  1.00 10.72 ? 113 ALA A N     1 
ATOM   1054 C CA    . ALA C 3 53  ? 11.717  13.700  -5.205  1.00 11.15 ? 113 ALA A CA    1 
ATOM   1055 C C     . ALA C 3 53  ? 10.262  13.543  -5.603  1.00 12.22 ? 113 ALA A C     1 
ATOM   1056 O O     . ALA C 3 53  ? 9.745   12.418  -5.634  1.00 11.98 ? 113 ALA A O     1 
ATOM   1057 C CB    . ALA C 3 53  ? 12.584  13.540  -6.459  1.00 12.73 ? 113 ALA A CB    1 
ATOM   1058 N N     . LEU C 3 54  ? 9.617   14.671  -5.909  1.00 12.14 ? 114 LEU A N     1 
ATOM   1059 C CA    . LEU C 3 54  ? 8.242   14.696  -6.423  1.00 11.70 ? 114 LEU A CA    1 
ATOM   1060 C C     . LEU C 3 54  ? 8.459   15.209  -7.858  1.00 12.67 ? 114 LEU A C     1 
ATOM   1061 O O     . LEU C 3 54  ? 8.959   16.318  -8.052  1.00 13.27 ? 114 LEU A O     1 
ATOM   1062 C CB    . LEU C 3 54  ? 7.383   15.681  -5.622  1.00 12.90 ? 114 LEU A CB    1 
ATOM   1063 C CG    . LEU C 3 54  ? 7.350   15.429  -4.106  1.00 13.41 ? 114 LEU A CG    1 
ATOM   1064 C CD1   . LEU C 3 54  ? 6.397   16.420  -3.443  1.00 15.15 ? 114 LEU A CD1   1 
ATOM   1065 C CD2   . LEU C 3 54  ? 6.873   14.011  -3.833  1.00 15.07 ? 114 LEU A CD2   1 
ATOM   1066 N N     . ILE C 3 55  ? 8.097   14.403  -8.854  1.00 12.24 ? 115 ILE A N     1 
ATOM   1067 C CA    . ILE C 3 55  ? 8.328   14.742  -10.262 1.00 14.53 ? 115 ILE A CA    1 
ATOM   1068 C C     . ILE C 3 55  ? 7.003   14.915  -10.990 1.00 12.44 ? 115 ILE A C     1 
ATOM   1069 O O     . ILE C 3 55  ? 6.189   13.998  -11.041 1.00 12.03 ? 115 ILE A O     1 
ATOM   1070 C CB    . ILE C 3 55  ? 9.183   13.640  -10.909 1.00 15.68 ? 115 ILE A CB    1 
ATOM   1071 C CG1   . ILE C 3 55  ? 10.555  13.616  -10.202 1.00 15.51 ? 115 ILE A CG1   1 
ATOM   1072 C CG2   . ILE C 3 55  ? 9.333   13.889  -12.424 1.00 14.48 ? 115 ILE A CG2   1 
ATOM   1073 C CD1   . ILE C 3 55  ? 11.371  12.323  -10.395 1.00 13.96 ? 115 ILE A CD1   1 
ATOM   1074 N N     . PHE C 3 56  ? 6.807   16.092  -11.572 1.00 13.90 ? 116 PHE A N     1 
ATOM   1075 C CA    . PHE C 3 56  ? 5.532   16.406  -12.199 1.00 14.71 ? 116 PHE A CA    1 
ATOM   1076 C C     . PHE C 3 56  ? 5.526   16.365  -13.720 1.00 16.26 ? 116 PHE A C     1 
ATOM   1077 O O     . PHE C 3 56  ? 6.575   16.450  -14.360 1.00 17.50 ? 116 PHE A O     1 
ATOM   1078 C CB    . PHE C 3 56  ? 5.039   17.769  -11.667 1.00 14.60 ? 116 PHE A CB    1 
ATOM   1079 C CG    . PHE C 3 56  ? 4.927   17.825  -10.157 1.00 14.32 ? 116 PHE A CG    1 
ATOM   1080 C CD1   . PHE C 3 56  ? 6.047   18.095  -9.367  1.00 14.61 ? 116 PHE A CD1   1 
ATOM   1081 C CD2   . PHE C 3 56  ? 3.714   17.583  -9.530  1.00 14.63 ? 116 PHE A CD2   1 
ATOM   1082 C CE1   . PHE C 3 56  ? 5.953   18.117  -7.965  1.00 15.11 ? 116 PHE A CE1   1 
ATOM   1083 C CE2   . PHE C 3 56  ? 3.601   17.600  -8.133  1.00 15.61 ? 116 PHE A CE2   1 
ATOM   1084 C CZ    . PHE C 3 56  ? 4.733   17.872  -7.345  1.00 14.70 ? 116 PHE A CZ    1 
ATOM   1085 N N     . ALA C 3 57  ? 4.332   16.208  -14.286 1.00 15.76 ? 117 ALA A N     1 
ATOM   1086 C CA    . ALA C 3 57  ? 4.162   16.111  -15.736 1.00 18.29 ? 117 ALA A CA    1 
ATOM   1087 C C     . ALA C 3 57  ? 4.690   17.337  -16.474 1.00 19.25 ? 117 ALA A C     1 
ATOM   1088 O O     . ALA C 3 57  ? 5.119   17.251  -17.632 1.00 19.33 ? 117 ALA A O     1 
ATOM   1089 C CB    . ALA C 3 57  ? 2.680   15.882  -16.076 1.00 16.18 ? 117 ALA A CB    1 
ATOM   1090 N N     . SER C 3 58  ? 4.668   18.472  -15.786 1.00 19.82 ? 118 SER A N     1 
ATOM   1091 C CA    . SER C 3 58  ? 5.141   19.737  -16.331 1.00 19.10 ? 118 SER A CA    1 
ATOM   1092 C C     . SER C 3 58  ? 6.664   19.804  -16.399 1.00 21.63 ? 118 SER A C     1 
ATOM   1093 O O     . SER C 3 58  ? 7.220   20.730  -16.987 1.00 20.77 ? 118 SER A O     1 
ATOM   1094 C CB    . SER C 3 58  ? 4.636   20.882  -15.456 1.00 20.81 ? 118 SER A CB    1 
ATOM   1095 O OG    . SER C 3 58  ? 5.095   20.722  -14.113 1.00 18.57 ? 118 SER A OG    1 
ATOM   1096 N N     . GLY C 3 59  ? 7.338   18.829  -15.794 1.00 18.51 ? 119 GLY A N     1 
ATOM   1097 C CA    . GLY C 3 59  ? 8.787   18.840  -15.789 1.00 17.54 ? 119 GLY A CA    1 
ATOM   1098 C C     . GLY C 3 59  ? 9.341   19.527  -14.548 1.00 16.83 ? 119 GLY A C     1 
ATOM   1099 O O     . GLY C 3 59  ? 10.550  19.561  -14.351 1.00 19.56 ? 119 GLY A O     1 
ATOM   1100 N N     . LYS C 3 60  ? 8.461   20.086  -13.720 1.00 16.60 ? 120 LYS A N     1 
ATOM   1101 C CA    . LYS C 3 60  ? 8.880   20.733  -12.476 1.00 14.70 ? 120 LYS A CA    1 
ATOM   1102 C C     . LYS C 3 60  ? 9.165   19.614  -11.473 1.00 14.19 ? 120 LYS A C     1 
ATOM   1103 O O     . LYS C 3 60  ? 8.554   18.547  -11.537 1.00 14.74 ? 120 LYS A O     1 
ATOM   1104 C CB    . LYS C 3 60  ? 7.770   21.633  -11.917 1.00 16.10 ? 120 LYS A CB    1 
ATOM   1105 C CG    . LYS C 3 60  ? 7.441   22.874  -12.778 1.00 18.34 ? 120 LYS A CG    1 
ATOM   1106 C CD    . LYS C 3 60  ? 8.706   23.680  -13.084 1.00 17.79 ? 120 LYS A CD    1 
ATOM   1107 C CE    . LYS C 3 60  ? 8.392   24.942  -13.913 1.00 18.28 ? 120 LYS A CE    1 
ATOM   1108 N NZ    . LYS C 3 60  ? 7.472   25.866  -13.200 1.00 17.78 ? 120 LYS A NZ    1 
ATOM   1109 N N     . MET C 3 61  ? 10.095  19.855  -10.561 1.00 14.32 ? 121 MET A N     1 
ATOM   1110 C CA    . MET C 3 61  ? 10.442  18.848  -9.567  1.00 15.73 ? 121 MET A CA    1 
ATOM   1111 C C     . MET C 3 61  ? 10.716  19.479  -8.204  1.00 15.73 ? 121 MET A C     1 
ATOM   1112 O O     . MET C 3 61  ? 11.165  20.626  -8.117  1.00 15.31 ? 121 MET A O     1 
ATOM   1113 C CB    . MET C 3 61  ? 11.676  18.069  -10.050 1.00 15.80 ? 121 MET A CB    1 
ATOM   1114 C CG    . MET C 3 61  ? 12.169  16.958  -9.127  1.00 17.68 ? 121 MET A CG    1 
ATOM   1115 S SD    . MET C 3 61  ? 13.468  15.960  -9.945  1.00 17.32 ? 121 MET A SD    1 
ATOM   1116 C CE    . MET C 3 61  ? 14.827  17.195  -10.067 1.00 16.33 ? 121 MET A CE    1 
ATOM   1117 N N     . VAL C 3 62  ? 10.404  18.732  -7.147  1.00 13.61 ? 122 VAL A N     1 
ATOM   1118 C CA    . VAL C 3 62  ? 10.654  19.159  -5.779  1.00 13.85 ? 122 VAL A CA    1 
ATOM   1119 C C     . VAL C 3 62  ? 11.521  18.039  -5.188  1.00 13.92 ? 122 VAL A C     1 
ATOM   1120 O O     . VAL C 3 62  ? 11.208  16.859  -5.364  1.00 13.54 ? 122 VAL A O     1 
ATOM   1121 C CB    . VAL C 3 62  ? 9.342   19.277  -4.951  1.00 13.54 ? 122 VAL A CB    1 
ATOM   1122 C CG1   . VAL C 3 62  ? 9.683   19.593  -3.488  1.00 13.95 ? 122 VAL A CG1   1 
ATOM   1123 C CG2   . VAL C 3 62  ? 8.443   20.421  -5.514  1.00 12.56 ? 122 VAL A CG2   1 
ATOM   1124 N N     . VAL C 3 63  ? 12.609  18.401  -4.512  1.00 11.19 ? 123 VAL A N     1 
ATOM   1125 C CA    . VAL C 3 63  ? 13.509  17.410  -3.904  1.00 10.35 ? 123 VAL A CA    1 
ATOM   1126 C C     . VAL C 3 63  ? 13.549  17.716  -2.406  1.00 12.67 ? 123 VAL A C     1 
ATOM   1127 O O     . VAL C 3 63  ? 13.810  18.853  -2.001  1.00 13.61 ? 123 VAL A O     1 
ATOM   1128 C CB    . VAL C 3 63  ? 14.929  17.509  -4.536  1.00 12.37 ? 123 VAL A CB    1 
ATOM   1129 C CG1   . VAL C 3 63  ? 15.904  16.555  -3.847  1.00 12.21 ? 123 VAL A CG1   1 
ATOM   1130 C CG2   . VAL C 3 63  ? 14.849  17.172  -6.030  1.00 12.43 ? 123 VAL A CG2   1 
ATOM   1131 N N     . THR C 3 64  ? 13.280  16.704  -1.590  1.00 11.42 ? 124 THR A N     1 
ATOM   1132 C CA    . THR C 3 64  ? 13.217  16.882  -0.143  1.00 11.06 ? 124 THR A CA    1 
ATOM   1133 C C     . THR C 3 64  ? 14.134  15.956  0.648   1.00 10.03 ? 124 THR A C     1 
ATOM   1134 O O     . THR C 3 64  ? 14.634  14.961  0.119   1.00 9.54  ? 124 THR A O     1 
ATOM   1135 C CB    . THR C 3 64  ? 11.786  16.610  0.361   1.00 12.96 ? 124 THR A CB    1 
ATOM   1136 O OG1   . THR C 3 64  ? 11.482  15.223  0.153   1.00 14.51 ? 124 THR A OG1   1 
ATOM   1137 C CG2   . THR C 3 64  ? 10.756  17.448  -0.411  1.00 15.65 ? 124 THR A CG2   1 
ATOM   1138 N N     . GLY C 3 65  ? 14.350  16.301  1.914   1.00 11.04 ? 125 GLY A N     1 
ATOM   1139 C CA    . GLY C 3 65  ? 15.144  15.452  2.788   1.00 13.10 ? 125 GLY A CA    1 
ATOM   1140 C C     . GLY C 3 65  ? 16.649  15.612  2.865   1.00 13.47 ? 125 GLY A C     1 
ATOM   1141 O O     . GLY C 3 65  ? 17.290  14.909  3.656   1.00 13.33 ? 125 GLY A O     1 
ATOM   1142 N N     . ALA C 3 66  ? 17.221  16.517  2.073   1.00 12.56 ? 126 ALA A N     1 
ATOM   1143 C CA    . ALA C 3 66  ? 18.674  16.719  2.093   1.00 14.44 ? 126 ALA A CA    1 
ATOM   1144 C C     . ALA C 3 66  ? 19.064  17.444  3.375   1.00 13.80 ? 126 ALA A C     1 
ATOM   1145 O O     . ALA C 3 66  ? 18.262  18.189  3.928   1.00 13.24 ? 126 ALA A O     1 
ATOM   1146 C CB    . ALA C 3 66  ? 19.116  17.542  0.855   1.00 13.13 ? 126 ALA A CB    1 
ATOM   1147 N N     . LYS C 3 67  ? 20.289  17.237  3.852   1.00 14.08 ? 127 LYS A N     1 
ATOM   1148 C CA    . LYS C 3 67  ? 20.728  17.908  5.079   1.00 14.97 ? 127 LYS A CA    1 
ATOM   1149 C C     . LYS C 3 67  ? 21.761  19.017  4.837   1.00 15.49 ? 127 LYS A C     1 
ATOM   1150 O O     . LYS C 3 67  ? 22.183  19.701  5.774   1.00 15.70 ? 127 LYS A O     1 
ATOM   1151 C CB    . LYS C 3 67  ? 21.256  16.885  6.104   1.00 17.48 ? 127 LYS A CB    1 
ATOM   1152 C CG    . LYS C 3 67  ? 20.139  15.977  6.691   1.00 18.99 ? 127 LYS A CG    1 
ATOM   1153 C CD    . LYS C 3 67  ? 20.597  15.263  7.968   1.00 22.99 ? 127 LYS A CD    1 
ATOM   1154 C CE    . LYS C 3 67  ? 19.548  14.277  8.499   1.00 22.85 ? 127 LYS A CE    1 
ATOM   1155 N NZ    . LYS C 3 67  ? 18.229  14.892  8.866   1.00 21.26 ? 127 LYS A NZ    1 
ATOM   1156 N N     . SER C 3 68  ? 22.177  19.190  3.591   1.00 14.25 ? 128 SER A N     1 
ATOM   1157 C CA    . SER C 3 68  ? 23.115  20.269  3.256   1.00 15.65 ? 128 SER A CA    1 
ATOM   1158 C C     . SER C 3 68  ? 22.774  20.829  1.885   1.00 15.73 ? 128 SER A C     1 
ATOM   1159 O O     . SER C 3 68  ? 22.094  20.161  1.079   1.00 13.56 ? 128 SER A O     1 
ATOM   1160 C CB    . SER C 3 68  ? 24.574  19.789  3.262   1.00 15.51 ? 128 SER A CB    1 
ATOM   1161 O OG    . SER C 3 68  ? 24.854  18.940  2.166   1.00 15.60 ? 128 SER A OG    1 
ATOM   1162 N N     . GLU C 3 69  ? 23.222  22.053  1.609   1.00 13.49 ? 129 GLU A N     1 
ATOM   1163 C CA    . GLU C 3 69  ? 22.937  22.655  0.308   1.00 14.82 ? 129 GLU A CA    1 
ATOM   1164 C C     . GLU C 3 69  ? 23.580  21.827  -0.798  1.00 14.93 ? 129 GLU A C     1 
ATOM   1165 O O     . GLU C 3 69  ? 22.991  21.625  -1.865  1.00 15.81 ? 129 GLU A O     1 
ATOM   1166 C CB    . GLU C 3 69  ? 23.469  24.096  0.221   1.00 12.49 ? 129 GLU A CB    1 
ATOM   1167 C CG    . GLU C 3 69  ? 22.898  25.042  1.265   1.00 13.70 ? 129 GLU A CG    1 
ATOM   1168 C CD    . GLU C 3 69  ? 23.702  25.066  2.554   1.00 15.54 ? 129 GLU A CD    1 
ATOM   1169 O OE1   . GLU C 3 69  ? 24.430  24.085  2.825   1.00 17.80 ? 129 GLU A OE1   1 
ATOM   1170 O OE2   . GLU C 3 69  ? 23.599  26.075  3.298   1.00 16.68 ? 129 GLU A OE2   1 
ATOM   1171 N N     . ASP C 3 70  ? 24.793  21.348  -0.537  1.00 15.20 ? 130 ASP A N     1 
ATOM   1172 C CA    . ASP C 3 70  ? 25.518  20.553  -1.522  1.00 16.68 ? 130 ASP A CA    1 
ATOM   1173 C C     . ASP C 3 70  ? 24.757  19.273  -1.857  1.00 15.70 ? 130 ASP A C     1 
ATOM   1174 O O     . ASP C 3 70  ? 24.603  18.928  -3.027  1.00 15.96 ? 130 ASP A O     1 
ATOM   1175 C CB    . ASP C 3 70  ? 26.917  20.195  -1.002  1.00 20.63 ? 130 ASP A CB    1 
ATOM   1176 C CG    . ASP C 3 70  ? 27.908  21.347  -1.115  1.00 27.99 ? 130 ASP A CG    1 
ATOM   1177 O OD1   . ASP C 3 70  ? 27.533  22.431  -1.611  1.00 30.90 ? 130 ASP A OD1   1 
ATOM   1178 O OD2   . ASP C 3 70  ? 29.073  21.158  -0.697  1.00 34.12 ? 130 ASP A OD2   1 
ATOM   1179 N N     . ASP C 3 71  ? 24.291  18.575  -0.826  1.00 14.75 ? 131 ASP A N     1 
ATOM   1180 C CA    . ASP C 3 71  ? 23.539  17.335  -1.019  1.00 15.41 ? 131 ASP A CA    1 
ATOM   1181 C C     . ASP C 3 71  ? 22.219  17.596  -1.740  1.00 13.50 ? 131 ASP A C     1 
ATOM   1182 O O     . ASP C 3 71  ? 21.794  16.789  -2.558  1.00 14.67 ? 131 ASP A O     1 
ATOM   1183 C CB    . ASP C 3 71  ? 23.267  16.663  0.329   1.00 14.30 ? 131 ASP A CB    1 
ATOM   1184 C CG    . ASP C 3 71  ? 24.425  15.786  0.801   1.00 20.58 ? 131 ASP A CG    1 
ATOM   1185 O OD1   . ASP C 3 71  ? 25.490  15.781  0.142   1.00 20.28 ? 131 ASP A OD1   1 
ATOM   1186 O OD2   . ASP C 3 71  ? 24.257  15.100  1.833   1.00 16.67 ? 131 ASP A OD2   1 
ATOM   1187 N N     . SER C 3 72  ? 21.576  18.721  -1.435  1.00 13.93 ? 132 SER A N     1 
ATOM   1188 C CA    . SER C 3 72  ? 20.316  19.071  -2.083  1.00 14.11 ? 132 SER A CA    1 
ATOM   1189 C C     . SER C 3 72  ? 20.542  19.199  -3.596  1.00 16.32 ? 132 SER A C     1 
ATOM   1190 O O     . SER C 3 72  ? 19.795  18.656  -4.408  1.00 14.05 ? 132 SER A O     1 
ATOM   1191 C CB    . SER C 3 72  ? 19.780  20.399  -1.534  1.00 14.13 ? 132 SER A CB    1 
ATOM   1192 O OG    . SER C 3 72  ? 18.571  20.768  -2.189  1.00 14.16 ? 132 SER A OG    1 
ATOM   1193 N N     . LYS C 3 73  ? 21.593  19.909  -3.977  1.00 16.02 ? 133 LYS A N     1 
ATOM   1194 C CA    . LYS C 3 73  ? 21.849  20.079  -5.397  1.00 15.02 ? 133 LYS A CA    1 
ATOM   1195 C C     . LYS C 3 73  ? 22.327  18.795  -6.069  1.00 14.16 ? 133 LYS A C     1 
ATOM   1196 O O     . LYS C 3 73  ? 21.929  18.501  -7.196  1.00 15.14 ? 133 LYS A O     1 
ATOM   1197 C CB    . LYS C 3 73  ? 22.870  21.196  -5.631  1.00 16.91 ? 133 LYS A CB    1 
ATOM   1198 C CG    . LYS C 3 73  ? 22.954  21.602  -7.100  1.00 22.34 ? 133 LYS A CG    1 
ATOM   1199 C CD    . LYS C 3 73  ? 24.050  22.642  -7.346  1.00 25.99 ? 133 LYS A CD    1 
ATOM   1200 C CE    . LYS C 3 73  ? 23.656  23.997  -6.820  1.00 31.29 ? 133 LYS A CE    1 
ATOM   1201 N NZ    . LYS C 3 73  ? 24.712  25.023  -7.125  1.00 39.15 ? 133 LYS A NZ    1 
ATOM   1202 N N     A LEU C 3 74  ? 23.178  18.038  -5.389  0.50 14.29 ? 134 LEU A N     1 
ATOM   1203 N N     B LEU C 3 74  ? 23.184  18.036  -5.383  0.50 14.82 ? 134 LEU A N     1 
ATOM   1204 C CA    A LEU C 3 74  ? 23.678  16.803  -5.971  0.50 15.48 ? 134 LEU A CA    1 
ATOM   1205 C CA    B LEU C 3 74  ? 23.714  16.779  -5.931  0.50 16.99 ? 134 LEU A CA    1 
ATOM   1206 C C     A LEU C 3 74  ? 22.523  15.839  -6.215  0.50 14.44 ? 134 LEU A C     1 
ATOM   1207 C C     B LEU C 3 74  ? 22.619  15.735  -6.134  0.50 16.95 ? 134 LEU A C     1 
ATOM   1208 O O     A LEU C 3 74  ? 22.406  15.245  -7.293  0.50 9.99  ? 134 LEU A O     1 
ATOM   1209 O O     B LEU C 3 74  ? 22.655  14.961  -7.094  0.50 18.22 ? 134 LEU A O     1 
ATOM   1210 C CB    A LEU C 3 74  ? 24.698  16.153  -5.039  0.50 18.82 ? 134 LEU A CB    1 
ATOM   1211 C CB    B LEU C 3 74  ? 24.804  16.205  -5.021  0.50 19.10 ? 134 LEU A CB    1 
ATOM   1212 C CG    A LEU C 3 74  ? 25.461  14.939  -5.579  0.50 23.98 ? 134 LEU A CG    1 
ATOM   1213 C CG    B LEU C 3 74  ? 26.211  16.817  -5.097  0.50 22.97 ? 134 LEU A CG    1 
ATOM   1214 C CD1   A LEU C 3 74  ? 26.390  15.358  -6.719  0.50 26.54 ? 134 LEU A CD1   1 
ATOM   1215 C CD1   B LEU C 3 74  ? 27.114  16.161  -4.066  0.50 26.75 ? 134 LEU A CD1   1 
ATOM   1216 C CD2   A LEU C 3 74  ? 26.271  14.320  -4.446  0.50 25.47 ? 134 LEU A CD2   1 
ATOM   1217 C CD2   B LEU C 3 74  ? 26.785  16.621  -6.490  0.50 24.71 ? 134 LEU A CD2   1 
ATOM   1218 N N     . ALA C 3 75  ? 21.663  15.693  -5.210  1.00 14.13 ? 135 ALA A N     1 
ATOM   1219 C CA    . ALA C 3 75  ? 20.533  14.772  -5.322  1.00 14.91 ? 135 ALA A CA    1 
ATOM   1220 C C     . ALA C 3 75  ? 19.662  15.207  -6.490  1.00 14.40 ? 135 ALA A C     1 
ATOM   1221 O O     . ALA C 3 75  ? 19.233  14.381  -7.301  1.00 14.26 ? 135 ALA A O     1 
ATOM   1222 C CB    . ALA C 3 75  ? 19.706  14.763  -4.012  1.00 14.40 ? 135 ALA A CB    1 
ATOM   1223 N N     . SER C 3 76  ? 19.382  16.512  -6.565  1.00 13.79 ? 136 SER A N     1 
ATOM   1224 C CA    . SER C 3 76  ? 18.562  17.052  -7.639  1.00 15.37 ? 136 SER A CA    1 
ATOM   1225 C C     . SER C 3 76  ? 19.171  16.744  -9.014  1.00 17.58 ? 136 SER A C     1 
ATOM   1226 O O     . SER C 3 76  ? 18.459  16.373  -9.944  1.00 16.59 ? 136 SER A O     1 
ATOM   1227 C CB    . SER C 3 76  ? 18.376  18.565  -7.453  1.00 14.35 ? 136 SER A CB    1 
ATOM   1228 O OG    . SER C 3 76  ? 17.670  18.847  -6.247  1.00 16.21 ? 136 SER A OG    1 
ATOM   1229 N N     . ARG C 3 77  ? 20.485  16.890  -9.145  1.00 15.83 ? 137 ARG A N     1 
ATOM   1230 C CA    . ARG C 3 77  ? 21.137  16.588  -10.422 1.00 16.99 ? 137 ARG A CA    1 
ATOM   1231 C C     . ARG C 3 77  ? 20.988  15.094  -10.751 1.00 18.22 ? 137 ARG A C     1 
ATOM   1232 O O     . ARG C 3 77  ? 20.795  14.727  -11.913 1.00 17.08 ? 137 ARG A O     1 
ATOM   1233 C CB    . ARG C 3 77  ? 22.638  16.950  -10.369 1.00 17.09 ? 137 ARG A CB    1 
ATOM   1234 C CG    . ARG C 3 77  ? 22.955  18.429  -10.525 1.00 20.19 ? 137 ARG A CG    1 
ATOM   1235 C CD    . ARG C 3 77  ? 24.474  18.661  -10.518 1.00 23.99 ? 137 ARG A CD    1 
ATOM   1236 N NE    . ARG C 3 77  ? 24.833  20.079  -10.574 1.00 25.39 ? 137 ARG A NE    1 
ATOM   1237 C CZ    . ARG C 3 77  ? 24.649  20.866  -11.633 1.00 29.57 ? 137 ARG A CZ    1 
ATOM   1238 N NH1   . ARG C 3 77  ? 24.111  20.389  -12.751 1.00 28.22 ? 137 ARG A NH1   1 
ATOM   1239 N NH2   . ARG C 3 77  ? 24.997  22.143  -11.569 1.00 30.88 ? 137 ARG A NH2   1 
ATOM   1240 N N     A LYS C 3 78  ? 21.059  14.251  -9.722  0.50 17.38 ? 138 LYS A N     1 
ATOM   1241 N N     B LYS C 3 78  ? 21.077  14.231  -9.739  0.50 17.63 ? 138 LYS A N     1 
ATOM   1242 C CA    A LYS C 3 78  ? 20.948  12.807  -9.906  0.50 16.81 ? 138 LYS A CA    1 
ATOM   1243 C CA    B LYS C 3 78  ? 20.945  12.799  -9.994  0.50 17.46 ? 138 LYS A CA    1 
ATOM   1244 C C     A LYS C 3 78  ? 19.567  12.407  -10.431 0.50 15.77 ? 138 LYS A C     1 
ATOM   1245 C C     B LYS C 3 78  ? 19.551  12.470  -10.524 0.50 16.71 ? 138 LYS A C     1 
ATOM   1246 O O     A LYS C 3 78  ? 19.461  11.550  -11.311 0.50 14.12 ? 138 LYS A O     1 
ATOM   1247 O O     B LYS C 3 78  ? 19.414  11.734  -11.505 0.50 17.27 ? 138 LYS A O     1 
ATOM   1248 C CB    A LYS C 3 78  ? 21.263  12.092  -8.590  0.50 19.70 ? 138 LYS A CB    1 
ATOM   1249 C CB    B LYS C 3 78  ? 21.240  11.978  -8.730  0.50 19.86 ? 138 LYS A CB    1 
ATOM   1250 C CG    A LYS C 3 78  ? 21.492  10.601  -8.726  0.50 22.03 ? 138 LYS A CG    1 
ATOM   1251 C CG    B LYS C 3 78  ? 22.688  12.034  -8.267  0.50 22.85 ? 138 LYS A CG    1 
ATOM   1252 C CD    A LYS C 3 78  ? 22.276  10.075  -7.533  0.50 24.64 ? 138 LYS A CD    1 
ATOM   1253 C CD    B LYS C 3 78  ? 22.998  10.957  -7.237  0.50 25.42 ? 138 LYS A CD    1 
ATOM   1254 C CE    A LYS C 3 78  ? 22.407  8.573   -7.584  0.50 26.84 ? 138 LYS A CE    1 
ATOM   1255 C CE    B LYS C 3 78  ? 24.383  11.167  -6.632  0.50 27.01 ? 138 LYS A CE    1 
ATOM   1256 N NZ    A LYS C 3 78  ? 23.200  8.016   -6.443  0.50 24.63 ? 138 LYS A NZ    1 
ATOM   1257 N NZ    B LYS C 3 78  ? 24.764  10.088  -5.684  0.50 27.30 ? 138 LYS A NZ    1 
ATOM   1258 N N     . TYR C 3 79  ? 18.515  13.030  -9.899  1.00 15.29 ? 139 TYR A N     1 
ATOM   1259 C CA    . TYR C 3 79  ? 17.139  12.760  -10.355 1.00 15.69 ? 139 TYR A CA    1 
ATOM   1260 C C     . TYR C 3 79  ? 17.012  13.235  -11.808 1.00 16.03 ? 139 TYR A C     1 
ATOM   1261 O O     . TYR C 3 79  ? 16.400  12.567  -12.648 1.00 15.87 ? 139 TYR A O     1 
ATOM   1262 C CB    . TYR C 3 79  ? 16.100  13.509  -9.500  1.00 13.35 ? 139 TYR A CB    1 
ATOM   1263 C CG    . TYR C 3 79  ? 15.886  12.925  -8.122  1.00 13.56 ? 139 TYR A CG    1 
ATOM   1264 C CD1   . TYR C 3 79  ? 15.258  11.686  -7.958  1.00 13.30 ? 139 TYR A CD1   1 
ATOM   1265 C CD2   . TYR C 3 79  ? 16.335  13.597  -6.978  1.00 13.55 ? 139 TYR A CD2   1 
ATOM   1266 C CE1   . TYR C 3 79  ? 15.085  11.126  -6.702  1.00 13.83 ? 139 TYR A CE1   1 
ATOM   1267 C CE2   . TYR C 3 79  ? 16.172  13.042  -5.712  1.00 10.98 ? 139 TYR A CE2   1 
ATOM   1268 C CZ    . TYR C 3 79  ? 15.549  11.809  -5.577  1.00 14.66 ? 139 TYR A CZ    1 
ATOM   1269 O OH    . TYR C 3 79  ? 15.399  11.257  -4.321  1.00 12.83 ? 139 TYR A OH    1 
ATOM   1270 N N     . ALA C 3 80  ? 17.574  14.404  -12.101 1.00 16.78 ? 140 ALA A N     1 
ATOM   1271 C CA    . ALA C 3 80  ? 17.528  14.926  -13.465 1.00 18.38 ? 140 ALA A CA    1 
ATOM   1272 C C     . ALA C 3 80  ? 18.188  13.941  -14.447 1.00 19.34 ? 140 ALA A C     1 
ATOM   1273 O O     . ALA C 3 80  ? 17.657  13.698  -15.533 1.00 20.57 ? 140 ALA A O     1 
ATOM   1274 C CB    . ALA C 3 80  ? 18.232  16.294  -13.536 1.00 18.14 ? 140 ALA A CB    1 
ATOM   1275 N N     . ARG C 3 81  ? 19.337  13.381  -14.067 1.00 22.14 ? 141 ARG A N     1 
ATOM   1276 C CA    . ARG C 3 81  ? 20.059  12.435  -14.930 1.00 23.18 ? 141 ARG A CA    1 
ATOM   1277 C C     . ARG C 3 81  ? 19.264  11.158  -15.171 1.00 22.74 ? 141 ARG A C     1 
ATOM   1278 O O     . ARG C 3 81  ? 19.283  10.599  -16.270 1.00 19.34 ? 141 ARG A O     1 
ATOM   1279 C CB    . ARG C 3 81  ? 21.418  12.051  -14.334 1.00 25.35 ? 141 ARG A CB    1 
ATOM   1280 C CG    . ARG C 3 81  ? 22.454  13.161  -14.311 1.00 33.51 ? 141 ARG A CG    1 
ATOM   1281 C CD    . ARG C 3 81  ? 23.860  12.570  -14.330 1.00 38.10 ? 141 ARG A CD    1 
ATOM   1282 N NE    . ARG C 3 81  ? 24.099  11.662  -13.210 1.00 42.63 ? 141 ARG A NE    1 
ATOM   1283 C CZ    . ARG C 3 81  ? 24.351  12.059  -11.967 1.00 44.33 ? 141 ARG A CZ    1 
ATOM   1284 N NH1   . ARG C 3 81  ? 24.404  13.355  -11.677 1.00 43.21 ? 141 ARG A NH1   1 
ATOM   1285 N NH2   . ARG C 3 81  ? 24.550  11.159  -11.013 1.00 45.89 ? 141 ARG A NH2   1 
ATOM   1286 N N     . ILE C 3 82  ? 18.583  10.685  -14.133 1.00 21.61 ? 142 ILE A N     1 
ATOM   1287 C CA    . ILE C 3 82  ? 17.757  9.488   -14.245 1.00 21.52 ? 142 ILE A CA    1 
ATOM   1288 C C     . ILE C 3 82  ? 16.657  9.725   -15.280 1.00 21.18 ? 142 ILE A C     1 
ATOM   1289 O O     . ILE C 3 82  ? 16.411  8.878   -16.146 1.00 22.15 ? 142 ILE A O     1 
ATOM   1290 C CB    . ILE C 3 82  ? 17.106  9.129   -12.879 1.00 20.72 ? 142 ILE A CB    1 
ATOM   1291 C CG1   . ILE C 3 82  ? 18.169  8.597   -11.919 1.00 21.05 ? 142 ILE A CG1   1 
ATOM   1292 C CG2   . ILE C 3 82  ? 15.990  8.100   -13.068 1.00 21.63 ? 142 ILE A CG2   1 
ATOM   1293 C CD1   . ILE C 3 82  ? 17.648  8.395   -10.499 1.00 18.80 ? 142 ILE A CD1   1 
ATOM   1294 N N     . ILE C 3 83  ? 16.015  10.887  -15.198 1.00 20.38 ? 143 ILE A N     1 
ATOM   1295 C CA    . ILE C 3 83  ? 14.937  11.239  -16.120 1.00 20.93 ? 143 ILE A CA    1 
ATOM   1296 C C     . ILE C 3 83  ? 15.497  11.374  -17.533 1.00 22.94 ? 143 ILE A C     1 
ATOM   1297 O O     . ILE C 3 83  ? 14.890  10.898  -18.495 1.00 21.19 ? 143 ILE A O     1 
ATOM   1298 C CB    . ILE C 3 83  ? 14.246  12.563  -15.701 1.00 20.15 ? 143 ILE A CB    1 
ATOM   1299 C CG1   . ILE C 3 83  ? 13.566  12.393  -14.337 1.00 22.45 ? 143 ILE A CG1   1 
ATOM   1300 C CG2   . ILE C 3 83  ? 13.230  13.002  -16.762 1.00 20.51 ? 143 ILE A CG2   1 
ATOM   1301 C CD1   . ILE C 3 83  ? 12.522  11.291  -14.285 1.00 22.62 ? 143 ILE A CD1   1 
ATOM   1302 N N     . GLN C 3 84  ? 16.661  12.015  -17.641 1.00 21.75 ? 144 GLN A N     1 
ATOM   1303 C CA    . GLN C 3 84  ? 17.328  12.187  -18.928 1.00 26.05 ? 144 GLN A CA    1 
ATOM   1304 C C     . GLN C 3 84  ? 17.611  10.828  -19.553 1.00 26.87 ? 144 GLN A C     1 
ATOM   1305 O O     . GLN C 3 84  ? 17.340  10.613  -20.733 1.00 27.00 ? 144 GLN A O     1 
ATOM   1306 C CB    . GLN C 3 84  ? 18.654  12.931  -18.748 1.00 28.93 ? 144 GLN A CB    1 
ATOM   1307 C CG    . GLN C 3 84  ? 18.588  14.427  -18.945 1.00 33.27 ? 144 GLN A CG    1 
ATOM   1308 C CD    . GLN C 3 84  ? 19.880  15.116  -18.518 1.00 36.63 ? 144 GLN A CD    1 
ATOM   1309 O OE1   . GLN C 3 84  ? 20.933  14.482  -18.415 1.00 36.03 ? 144 GLN A OE1   1 
ATOM   1310 N NE2   . GLN C 3 84  ? 19.802  16.417  -18.272 1.00 36.85 ? 144 GLN A NE2   1 
ATOM   1311 N N     . LYS C 3 85  ? 18.155  9.914   -18.755 1.00 27.25 ? 145 LYS A N     1 
ATOM   1312 C CA    . LYS C 3 85  ? 18.493  8.582   -19.234 1.00 29.91 ? 145 LYS A CA    1 
ATOM   1313 C C     . LYS C 3 85  ? 17.301  7.760   -19.699 1.00 29.05 ? 145 LYS A C     1 
ATOM   1314 O O     . LYS C 3 85  ? 17.450  6.852   -20.520 1.00 29.13 ? 145 LYS A O     1 
ATOM   1315 C CB    . LYS C 3 85  ? 19.275  7.822   -18.160 1.00 33.27 ? 145 LYS A CB    1 
ATOM   1316 C CG    . LYS C 3 85  ? 20.719  8.274   -18.053 1.00 40.90 ? 145 LYS A CG    1 
ATOM   1317 C CD    . LYS C 3 85  ? 21.456  7.563   -16.934 1.00 46.33 ? 145 LYS A CD    1 
ATOM   1318 C CE    . LYS C 3 85  ? 22.954  7.780   -17.063 1.00 51.10 ? 145 LYS A CE    1 
ATOM   1319 N NZ    . LYS C 3 85  ? 23.458  7.234   -18.362 1.00 54.30 ? 145 LYS A NZ    1 
ATOM   1320 N N     . ILE C 3 86  ? 16.120  8.070   -19.177 1.00 26.22 ? 146 ILE A N     1 
ATOM   1321 C CA    . ILE C 3 86  ? 14.920  7.362   -19.582 1.00 25.51 ? 146 ILE A CA    1 
ATOM   1322 C C     . ILE C 3 86  ? 14.549  7.818   -20.991 1.00 27.03 ? 146 ILE A C     1 
ATOM   1323 O O     . ILE C 3 86  ? 13.805  7.136   -21.697 1.00 26.59 ? 146 ILE A O     1 
ATOM   1324 C CB    . ILE C 3 86  ? 13.759  7.619   -18.586 1.00 23.59 ? 146 ILE A CB    1 
ATOM   1325 C CG1   . ILE C 3 86  ? 14.094  6.929   -17.259 1.00 23.74 ? 146 ILE A CG1   1 
ATOM   1326 C CG2   . ILE C 3 86  ? 12.438  7.064   -19.133 1.00 24.25 ? 146 ILE A CG2   1 
ATOM   1327 C CD1   . ILE C 3 86  ? 13.124  7.210   -16.115 1.00 23.63 ? 146 ILE A CD1   1 
ATOM   1328 N N     . GLY C 3 87  ? 15.080  8.968   -21.404 1.00 26.95 ? 147 GLY A N     1 
ATOM   1329 C CA    . GLY C 3 87  ? 14.808  9.459   -22.747 1.00 26.77 ? 147 GLY A CA    1 
ATOM   1330 C C     . GLY C 3 87  ? 14.176  10.834  -22.883 1.00 27.41 ? 147 GLY A C     1 
ATOM   1331 O O     . GLY C 3 87  ? 13.885  11.278  -23.991 1.00 27.96 ? 147 GLY A O     1 
ATOM   1332 N N     . PHE C 3 88  ? 13.968  11.529  -21.772 1.00 25.66 ? 148 PHE A N     1 
ATOM   1333 C CA    . PHE C 3 88  ? 13.353  12.847  -21.828 1.00 24.60 ? 148 PHE A CA    1 
ATOM   1334 C C     . PHE C 3 88  ? 14.387  13.957  -21.987 1.00 26.00 ? 148 PHE A C     1 
ATOM   1335 O O     . PHE C 3 88  ? 15.514  13.832  -21.524 1.00 26.51 ? 148 PHE A O     1 
ATOM   1336 C CB    . PHE C 3 88  ? 12.506  13.059  -20.568 1.00 22.18 ? 148 PHE A CB    1 
ATOM   1337 C CG    . PHE C 3 88  ? 11.290  12.185  -20.521 1.00 22.96 ? 148 PHE A CG    1 
ATOM   1338 C CD1   . PHE C 3 88  ? 10.165  12.501  -21.273 1.00 21.98 ? 148 PHE A CD1   1 
ATOM   1339 C CD2   . PHE C 3 88  ? 11.279  11.026  -19.750 1.00 23.93 ? 148 PHE A CD2   1 
ATOM   1340 C CE1   . PHE C 3 88  ? 9.036   11.669  -21.262 1.00 24.51 ? 148 PHE A CE1   1 
ATOM   1341 C CE2   . PHE C 3 88  ? 10.160  10.186  -19.729 1.00 24.08 ? 148 PHE A CE2   1 
ATOM   1342 C CZ    . PHE C 3 88  ? 9.035   10.510  -20.488 1.00 25.15 ? 148 PHE A CZ    1 
ATOM   1343 N N     . ALA C 3 89  ? 13.995  15.038  -22.657 1.00 28.54 ? 149 ALA A N     1 
ATOM   1344 C CA    . ALA C 3 89  ? 14.889  16.177  -22.885 1.00 29.96 ? 149 ALA A CA    1 
ATOM   1345 C C     . ALA C 3 89  ? 14.960  17.048  -21.631 1.00 29.93 ? 149 ALA A C     1 
ATOM   1346 O O     . ALA C 3 89  ? 14.688  18.246  -21.673 1.00 29.61 ? 149 ALA A O     1 
ATOM   1347 C CB    . ALA C 3 89  ? 14.389  17.005  -24.076 1.00 29.88 ? 149 ALA A CB    1 
ATOM   1348 N N     . ALA C 3 90  ? 15.338  16.429  -20.519 1.00 30.74 ? 150 ALA A N     1 
ATOM   1349 C CA    . ALA C 3 90  ? 15.425  17.122  -19.243 1.00 29.99 ? 150 ALA A CA    1 
ATOM   1350 C C     . ALA C 3 90  ? 16.726  17.894  -19.071 1.00 30.39 ? 150 ALA A C     1 
ATOM   1351 O O     . ALA C 3 90  ? 17.809  17.405  -19.395 1.00 31.77 ? 150 ALA A O     1 
ATOM   1352 C CB    . ALA C 3 90  ? 15.267  16.121  -18.100 1.00 29.29 ? 150 ALA A CB    1 
ATOM   1353 N N     . LYS C 3 91  ? 16.607  19.112  -18.564 1.00 28.80 ? 151 LYS A N     1 
ATOM   1354 C CA    . LYS C 3 91  ? 17.767  19.960  -18.306 1.00 30.70 ? 151 LYS A CA    1 
ATOM   1355 C C     . LYS C 3 91  ? 17.760  20.261  -16.807 1.00 29.96 ? 151 LYS A C     1 
ATOM   1356 O O     . LYS C 3 91  ? 16.838  19.862  -16.103 1.00 30.80 ? 151 LYS A O     1 
ATOM   1357 C CB    . LYS C 3 91  ? 17.656  21.258  -19.113 1.00 31.79 ? 151 LYS A CB    1 
ATOM   1358 C CG    . LYS C 3 91  ? 17.835  21.073  -20.617 1.00 35.92 ? 151 LYS A CG    1 
ATOM   1359 C CD    . LYS C 3 91  ? 19.256  20.625  -20.937 1.00 41.44 ? 151 LYS A CD    1 
ATOM   1360 C CE    . LYS C 3 91  ? 19.563  20.713  -22.428 1.00 45.30 ? 151 LYS A CE    1 
ATOM   1361 N NZ    . LYS C 3 91  ? 18.720  19.794  -23.243 1.00 48.24 ? 151 LYS A NZ    1 
ATOM   1362 N N     . PHE C 3 92  ? 18.779  20.955  -16.316 1.00 30.36 ? 152 PHE A N     1 
ATOM   1363 C CA    . PHE C 3 92  ? 18.845  21.280  -14.895 1.00 27.42 ? 152 PHE A CA    1 
ATOM   1364 C C     . PHE C 3 92  ? 18.835  22.792  -14.737 1.00 27.13 ? 152 PHE A C     1 
ATOM   1365 O O     . PHE C 3 92  ? 19.890  23.426  -14.648 1.00 27.55 ? 152 PHE A O     1 
ATOM   1366 C CB    . PHE C 3 92  ? 20.120  20.692  -14.292 1.00 25.79 ? 152 PHE A CB    1 
ATOM   1367 C CG    . PHE C 3 92  ? 20.172  20.781  -12.806 1.00 25.43 ? 152 PHE A CG    1 
ATOM   1368 C CD1   . PHE C 3 92  ? 19.405  19.923  -12.019 1.00 21.86 ? 152 PHE A CD1   1 
ATOM   1369 C CD2   . PHE C 3 92  ? 20.975  21.732  -12.183 1.00 23.98 ? 152 PHE A CD2   1 
ATOM   1370 C CE1   . PHE C 3 92  ? 19.441  20.008  -10.643 1.00 19.48 ? 152 PHE A CE1   1 
ATOM   1371 C CE2   . PHE C 3 92  ? 21.016  21.827  -10.799 1.00 23.65 ? 152 PHE A CE2   1 
ATOM   1372 C CZ    . PHE C 3 92  ? 20.246  20.960  -10.026 1.00 21.57 ? 152 PHE A CZ    1 
ATOM   1373 N N     . THR C 3 93  ? 17.647  23.380  -14.680 1.00 25.04 ? 153 THR A N     1 
ATOM   1374 C CA    . THR C 3 93  ? 17.557  24.827  -14.590 1.00 25.32 ? 153 THR A CA    1 
ATOM   1375 C C     . THR C 3 93  ? 16.788  25.377  -13.398 1.00 24.66 ? 153 THR A C     1 
ATOM   1376 O O     . THR C 3 93  ? 15.898  24.727  -12.855 1.00 23.62 ? 153 THR A O     1 
ATOM   1377 C CB    . THR C 3 93  ? 16.930  25.412  -15.878 1.00 28.00 ? 153 THR A CB    1 
ATOM   1378 O OG1   . THR C 3 93  ? 15.510  25.262  -15.830 1.00 29.45 ? 153 THR A OG1   1 
ATOM   1379 C CG2   . THR C 3 93  ? 17.454  24.680  -17.093 1.00 28.41 ? 153 THR A CG2   1 
ATOM   1380 N N     . ASP C 3 94  ? 17.155  26.592  -13.007 1.00 23.15 ? 154 ASP A N     1 
ATOM   1381 C CA    . ASP C 3 94  ? 16.537  27.282  -11.894 1.00 21.86 ? 154 ASP A CA    1 
ATOM   1382 C C     . ASP C 3 94  ? 16.511  26.494  -10.590 1.00 19.68 ? 154 ASP A C     1 
ATOM   1383 O O     . ASP C 3 94  ? 15.502  26.484  -9.901  1.00 20.47 ? 154 ASP A O     1 
ATOM   1384 C CB    . ASP C 3 94  ? 15.109  27.727  -12.259 1.00 23.62 ? 154 ASP A CB    1 
ATOM   1385 C CG    . ASP C 3 94  ? 15.091  28.849  -13.288 1.00 28.77 ? 154 ASP A CG    1 
ATOM   1386 O OD1   . ASP C 3 94  ? 16.070  29.626  -13.343 1.00 30.17 ? 154 ASP A OD1   1 
ATOM   1387 O OD2   . ASP C 3 94  ? 14.089  28.967  -14.024 1.00 32.73 ? 154 ASP A OD2   1 
ATOM   1388 N N     . PHE C 3 95  ? 17.607  25.826  -10.256 1.00 18.39 ? 155 PHE A N     1 
ATOM   1389 C CA    . PHE C 3 95  ? 17.663  25.106  -8.984  1.00 17.84 ? 155 PHE A CA    1 
ATOM   1390 C C     . PHE C 3 95  ? 17.532  26.163  -7.895  1.00 17.92 ? 155 PHE A C     1 
ATOM   1391 O O     . PHE C 3 95  ? 18.243  27.179  -7.916  1.00 15.42 ? 155 PHE A O     1 
ATOM   1392 C CB    . PHE C 3 95  ? 19.007  24.400  -8.795  1.00 17.28 ? 155 PHE A CB    1 
ATOM   1393 C CG    . PHE C 3 95  ? 19.210  23.856  -7.398  1.00 18.23 ? 155 PHE A CG    1 
ATOM   1394 C CD1   . PHE C 3 95  ? 18.605  22.666  -7.002  1.00 16.86 ? 155 PHE A CD1   1 
ATOM   1395 C CD2   . PHE C 3 95  ? 19.981  24.553  -6.473  1.00 17.04 ? 155 PHE A CD2   1 
ATOM   1396 C CE1   . PHE C 3 95  ? 18.765  22.172  -5.709  1.00 15.33 ? 155 PHE A CE1   1 
ATOM   1397 C CE2   . PHE C 3 95  ? 20.152  24.076  -5.172  1.00 18.14 ? 155 PHE A CE2   1 
ATOM   1398 C CZ    . PHE C 3 95  ? 19.539  22.878  -4.785  1.00 18.34 ? 155 PHE A CZ    1 
ATOM   1399 N N     . LYS C 3 96  ? 16.650  25.925  -6.930  1.00 16.45 ? 156 LYS A N     1 
ATOM   1400 C CA    . LYS C 3 96  ? 16.457  26.885  -5.859  1.00 15.56 ? 156 LYS A CA    1 
ATOM   1401 C C     . LYS C 3 96  ? 16.055  26.255  -4.536  1.00 16.93 ? 156 LYS A C     1 
ATOM   1402 O O     . LYS C 3 96  ? 15.069  25.516  -4.460  1.00 13.96 ? 156 LYS A O     1 
ATOM   1403 C CB    . LYS C 3 96  ? 15.380  27.907  -6.237  1.00 19.72 ? 156 LYS A CB    1 
ATOM   1404 C CG    . LYS C 3 96  ? 15.228  29.027  -5.197  1.00 22.56 ? 156 LYS A CG    1 
ATOM   1405 C CD    . LYS C 3 96  ? 14.147  30.024  -5.579  1.00 26.67 ? 156 LYS A CD    1 
ATOM   1406 C CE    . LYS C 3 96  ? 14.038  31.132  -4.533  1.00 32.20 ? 156 LYS A CE    1 
ATOM   1407 N NZ    . LYS C 3 96  ? 12.923  32.078  -4.842  1.00 35.51 ? 156 LYS A NZ    1 
ATOM   1408 N N     . ILE C 3 97  ? 16.808  26.560  -3.488  1.00 15.38 ? 157 ILE A N     1 
ATOM   1409 C CA    . ILE C 3 97  ? 16.451  26.044  -2.171  1.00 15.18 ? 157 ILE A CA    1 
ATOM   1410 C C     . ILE C 3 97  ? 15.282  26.887  -1.672  1.00 16.47 ? 157 ILE A C     1 
ATOM   1411 O O     . ILE C 3 97  ? 15.345  28.118  -1.676  1.00 16.47 ? 157 ILE A O     1 
ATOM   1412 C CB    . ILE C 3 97  ? 17.667  26.095  -1.236  1.00 16.94 ? 157 ILE A CB    1 
ATOM   1413 C CG1   . ILE C 3 97  ? 18.603  24.940  -1.630  1.00 14.90 ? 157 ILE A CG1   1 
ATOM   1414 C CG2   . ILE C 3 97  ? 17.229  26.015  0.245   1.00 13.98 ? 157 ILE A CG2   1 
ATOM   1415 C CD1   . ILE C 3 97  ? 19.972  24.936  -0.950  1.00 19.98 ? 157 ILE A CD1   1 
ATOM   1416 N N     . GLN C 3 98  ? 14.203  26.217  -1.263  1.00 13.36 ? 158 GLN A N     1 
ATOM   1417 C CA    . GLN C 3 98  ? 12.985  26.889  -0.833  1.00 13.17 ? 158 GLN A CA    1 
ATOM   1418 C C     . GLN C 3 98  ? 12.766  26.899  0.671   1.00 14.00 ? 158 GLN A C     1 
ATOM   1419 O O     . GLN C 3 98  ? 12.051  27.761  1.188   1.00 13.46 ? 158 GLN A O     1 
ATOM   1420 C CB    . GLN C 3 98  ? 11.766  26.218  -1.487  1.00 14.08 ? 158 GLN A CB    1 
ATOM   1421 C CG    . GLN C 3 98  ? 11.782  26.223  -3.011  1.00 13.72 ? 158 GLN A CG    1 
ATOM   1422 C CD    . GLN C 3 98  ? 11.534  27.610  -3.607  1.00 16.85 ? 158 GLN A CD    1 
ATOM   1423 O OE1   . GLN C 3 98  ? 11.312  28.583  -2.880  1.00 16.79 ? 158 GLN A OE1   1 
ATOM   1424 N NE2   . GLN C 3 98  ? 11.557  27.698  -4.932  1.00 14.39 ? 158 GLN A NE2   1 
ATOM   1425 N N     . ASN C 3 99  ? 13.348  25.935  1.375   1.00 11.65 ? 159 ASN A N     1 
ATOM   1426 C CA    . ASN C 3 99  ? 13.146  25.870  2.816   1.00 13.07 ? 159 ASN A CA    1 
ATOM   1427 C C     . ASN C 3 99  ? 14.243  25.045  3.479   1.00 13.35 ? 159 ASN A C     1 
ATOM   1428 O O     . ASN C 3 99  ? 14.666  24.022  2.947   1.00 13.04 ? 159 ASN A O     1 
ATOM   1429 C CB    . ASN C 3 99  ? 11.766  25.243  3.111   1.00 14.72 ? 159 ASN A CB    1 
ATOM   1430 C CG    . ASN C 3 99  ? 11.436  25.216  4.590   1.00 17.23 ? 159 ASN A CG    1 
ATOM   1431 O OD1   . ASN C 3 99  ? 11.736  26.153  5.315   1.00 14.85 ? 159 ASN A OD1   1 
ATOM   1432 N ND2   . ASN C 3 99  ? 10.786  24.143  5.040   1.00 17.74 ? 159 ASN A ND2   1 
ATOM   1433 N N     . ILE C 3 100 ? 14.691  25.505  4.639   1.00 11.79 ? 160 ILE A N     1 
ATOM   1434 C CA    . ILE C 3 100 ? 15.717  24.813  5.408   1.00 11.75 ? 160 ILE A CA    1 
ATOM   1435 C C     . ILE C 3 100 ? 15.210  24.712  6.841   1.00 11.87 ? 160 ILE A C     1 
ATOM   1436 O O     . ILE C 3 100 ? 14.737  25.701  7.413   1.00 12.41 ? 160 ILE A O     1 
ATOM   1437 C CB    . ILE C 3 100 ? 17.067  25.591  5.412   1.00 11.46 ? 160 ILE A CB    1 
ATOM   1438 C CG1   . ILE C 3 100 ? 17.627  25.693  3.986   1.00 12.44 ? 160 ILE A CG1   1 
ATOM   1439 C CG2   . ILE C 3 100 ? 18.064  24.890  6.346   1.00 14.52 ? 160 ILE A CG2   1 
ATOM   1440 C CD1   . ILE C 3 100 ? 18.877  26.613  3.862   1.00 13.41 ? 160 ILE A CD1   1 
ATOM   1441 N N     . VAL C 3 101 ? 15.321  23.517  7.411   1.00 12.09 ? 161 VAL A N     1 
ATOM   1442 C CA    . VAL C 3 101 ? 14.888  23.226  8.776   1.00 11.41 ? 161 VAL A CA    1 
ATOM   1443 C C     . VAL C 3 101 ? 16.098  22.862  9.641   1.00 13.19 ? 161 VAL A C     1 
ATOM   1444 O O     . VAL C 3 101 ? 16.965  22.080  9.217   1.00 13.04 ? 161 VAL A O     1 
ATOM   1445 C CB    . VAL C 3 101 ? 13.915  22.012  8.798   1.00 14.47 ? 161 VAL A CB    1 
ATOM   1446 C CG1   . VAL C 3 101 ? 13.403  21.759  10.229  1.00 14.57 ? 161 VAL A CG1   1 
ATOM   1447 C CG2   . VAL C 3 101 ? 12.770  22.252  7.832   1.00 14.52 ? 161 VAL A CG2   1 
ATOM   1448 N N     . GLY C 3 102 ? 16.162  23.436  10.842  1.00 14.70 ? 162 GLY A N     1 
ATOM   1449 C CA    . GLY C 3 102 ? 17.252  23.125  11.750  1.00 14.62 ? 162 GLY A CA    1 
ATOM   1450 C C     . GLY C 3 102 ? 16.707  22.770  13.128  1.00 16.62 ? 162 GLY A C     1 
ATOM   1451 O O     . GLY C 3 102 ? 15.527  22.995  13.407  1.00 16.29 ? 162 GLY A O     1 
ATOM   1452 N N     . SER C 3 103 ? 17.538  22.188  13.981  1.00 15.07 ? 163 SER A N     1 
ATOM   1453 C CA    . SER C 3 103 ? 17.113  21.875  15.341  1.00 17.71 ? 163 SER A CA    1 
ATOM   1454 C C     . SER C 3 103 ? 18.307  21.936  16.277  1.00 17.98 ? 163 SER A C     1 
ATOM   1455 O O     . SER C 3 103 ? 19.460  21.814  15.855  1.00 15.05 ? 163 SER A O     1 
ATOM   1456 C CB    . SER C 3 103 ? 16.476  20.479  15.429  1.00 16.91 ? 163 SER A CB    1 
ATOM   1457 O OG    . SER C 3 103 ? 17.434  19.438  15.244  1.00 16.19 ? 163 SER A OG    1 
ATOM   1458 N N     . CYS C 3 104 ? 18.033  22.154  17.557  1.00 19.26 ? 164 CYS A N     1 
ATOM   1459 C CA    . CYS C 3 104 ? 19.098  22.166  18.537  1.00 21.05 ? 164 CYS A CA    1 
ATOM   1460 C C     . CYS C 3 104 ? 18.538  21.945  19.931  1.00 21.68 ? 164 CYS A C     1 
ATOM   1461 O O     . CYS C 3 104 ? 17.324  21.857  20.124  1.00 19.99 ? 164 CYS A O     1 
ATOM   1462 C CB    . CYS C 3 104 ? 19.923  23.455  18.468  1.00 25.12 ? 164 CYS A CB    1 
ATOM   1463 S SG    . CYS C 3 104 ? 18.996  24.941  18.677  1.00 28.92 ? 164 CYS A SG    1 
ATOM   1464 N N     . ASP C 3 105 ? 19.440  21.853  20.896  1.00 21.89 ? 165 ASP A N     1 
ATOM   1465 C CA    . ASP C 3 105 ? 19.075  21.564  22.278  1.00 24.51 ? 165 ASP A CA    1 
ATOM   1466 C C     . ASP C 3 105 ? 19.858  22.479  23.206  1.00 26.46 ? 165 ASP A C     1 
ATOM   1467 O O     . ASP C 3 105 ? 21.084  22.425  23.219  1.00 27.14 ? 165 ASP A O     1 
ATOM   1468 C CB    . ASP C 3 105 ? 19.434  20.102  22.551  1.00 24.79 ? 165 ASP A CB    1 
ATOM   1469 C CG    . ASP C 3 105 ? 19.006  19.621  23.920  1.00 25.89 ? 165 ASP A CG    1 
ATOM   1470 O OD1   . ASP C 3 105 ? 18.485  20.423  24.720  1.00 26.84 ? 165 ASP A OD1   1 
ATOM   1471 O OD2   . ASP C 3 105 ? 19.194  18.417  24.179  1.00 25.48 ? 165 ASP A OD2   1 
ATOM   1472 N N     . VAL C 3 106 ? 19.163  23.315  23.976  1.00 26.22 ? 166 VAL A N     1 
ATOM   1473 C CA    . VAL C 3 106 ? 19.841  24.222  24.905  1.00 28.93 ? 166 VAL A CA    1 
ATOM   1474 C C     . VAL C 3 106 ? 20.135  23.528  26.240  1.00 30.88 ? 166 VAL A C     1 
ATOM   1475 O O     . VAL C 3 106 ? 20.750  24.106  27.134  1.00 31.88 ? 166 VAL A O     1 
ATOM   1476 C CB    . VAL C 3 106 ? 19.017  25.512  25.155  1.00 27.17 ? 166 VAL A CB    1 
ATOM   1477 C CG1   . VAL C 3 106 ? 18.815  26.256  23.840  1.00 28.21 ? 166 VAL A CG1   1 
ATOM   1478 C CG2   . VAL C 3 106 ? 17.666  25.176  25.791  1.00 27.18 ? 166 VAL A CG2   1 
ATOM   1479 N N     . LYS C 3 107 ? 19.674  22.285  26.349  1.00 32.24 ? 167 LYS A N     1 
ATOM   1480 C CA    . LYS C 3 107 ? 19.882  21.431  27.520  1.00 34.51 ? 167 LYS A CA    1 
ATOM   1481 C C     . LYS C 3 107 ? 19.408  21.896  28.898  1.00 33.93 ? 167 LYS A C     1 
ATOM   1482 O O     . LYS C 3 107 ? 20.028  21.583  29.917  1.00 32.92 ? 167 LYS A O     1 
ATOM   1483 C CB    . LYS C 3 107 ? 21.353  21.027  27.587  1.00 37.64 ? 167 LYS A CB    1 
ATOM   1484 C CG    . LYS C 3 107 ? 21.765  20.163  26.402  1.00 40.85 ? 167 LYS A CG    1 
ATOM   1485 C CD    . LYS C 3 107 ? 23.265  19.981  26.315  1.00 43.78 ? 167 LYS A CD    1 
ATOM   1486 C CE    . LYS C 3 107 ? 23.630  19.262  25.030  1.00 46.77 ? 167 LYS A CE    1 
ATOM   1487 N NZ    . LYS C 3 107 ? 22.935  17.952  24.931  1.00 49.77 ? 167 LYS A NZ    1 
ATOM   1488 N N     . PHE C 3 108 ? 18.321  22.656  28.918  1.00 31.96 ? 168 PHE A N     1 
ATOM   1489 C CA    . PHE C 3 108 ? 17.695  23.094  30.161  1.00 31.25 ? 168 PHE A CA    1 
ATOM   1490 C C     . PHE C 3 108 ? 16.218  23.310  29.853  1.00 31.17 ? 168 PHE A C     1 
ATOM   1491 O O     . PHE C 3 108 ? 15.862  23.739  28.751  1.00 31.10 ? 168 PHE A O     1 
ATOM   1492 C CB    . PHE C 3 108 ? 18.371  24.348  30.775  1.00 31.20 ? 168 PHE A CB    1 
ATOM   1493 C CG    . PHE C 3 108 ? 18.315  25.594  29.925  1.00 30.00 ? 168 PHE A CG    1 
ATOM   1494 C CD1   . PHE C 3 108 ? 17.121  26.280  29.729  1.00 27.13 ? 168 PHE A CD1   1 
ATOM   1495 C CD2   . PHE C 3 108 ? 19.486  26.123  29.384  1.00 31.25 ? 168 PHE A CD2   1 
ATOM   1496 C CE1   . PHE C 3 108 ? 17.099  27.476  29.012  1.00 28.34 ? 168 PHE A CE1   1 
ATOM   1497 C CE2   . PHE C 3 108 ? 19.474  27.321  28.664  1.00 29.49 ? 168 PHE A CE2   1 
ATOM   1498 C CZ    . PHE C 3 108 ? 18.280  27.998  28.478  1.00 29.78 ? 168 PHE A CZ    1 
ATOM   1499 N N     . PRO C 3 109 ? 15.337  22.977  30.811  1.00 30.82 ? 169 PRO A N     1 
ATOM   1500 C CA    . PRO C 3 109 ? 13.892  23.129  30.623  1.00 29.31 ? 169 PRO A CA    1 
ATOM   1501 C C     . PRO C 3 109 ? 13.400  24.563  30.496  1.00 27.78 ? 169 PRO A C     1 
ATOM   1502 O O     . PRO C 3 109 ? 13.993  25.493  31.040  1.00 28.68 ? 169 PRO A O     1 
ATOM   1503 C CB    . PRO C 3 109 ? 13.306  22.372  31.822  1.00 31.89 ? 169 PRO A CB    1 
ATOM   1504 C CG    . PRO C 3 109 ? 14.334  22.590  32.883  1.00 31.15 ? 169 PRO A CG    1 
ATOM   1505 C CD    . PRO C 3 109 ? 15.638  22.406  32.139  1.00 30.01 ? 169 PRO A CD    1 
ATOM   1506 N N     . ILE C 3 110 ? 12.306  24.731  29.758  1.00 27.22 ? 170 ILE A N     1 
ATOM   1507 C CA    . ILE C 3 110 ? 11.749  26.050  29.500  1.00 27.85 ? 170 ILE A CA    1 
ATOM   1508 C C     . ILE C 3 110 ? 10.350  26.298  30.069  1.00 28.69 ? 170 ILE A C     1 
ATOM   1509 O O     . ILE C 3 110 ? 9.465   25.436  29.985  1.00 28.87 ? 170 ILE A O     1 
ATOM   1510 C CB    . ILE C 3 110 ? 11.668  26.323  27.969  1.00 28.86 ? 170 ILE A CB    1 
ATOM   1511 C CG1   . ILE C 3 110 ? 13.015  26.039  27.290  1.00 29.51 ? 170 ILE A CG1   1 
ATOM   1512 C CG2   . ILE C 3 110 ? 11.245  27.756  27.724  1.00 28.74 ? 170 ILE A CG2   1 
ATOM   1513 C CD1   . ILE C 3 110 ? 14.125  26.964  27.708  1.00 33.96 ? 170 ILE A CD1   1 
ATOM   1514 N N     . ARG C 3 111 ? 10.159  27.486  30.640  1.00 29.29 ? 171 ARG A N     1 
ATOM   1515 C CA    . ARG C 3 111 ? 8.863   27.882  31.175  1.00 30.47 ? 171 ARG A CA    1 
ATOM   1516 C C     . ARG C 3 111 ? 8.106   28.481  29.994  1.00 29.53 ? 171 ARG A C     1 
ATOM   1517 O O     . ARG C 3 111 ? 8.092   29.691  29.802  1.00 31.15 ? 171 ARG A O     1 
ATOM   1518 C CB    . ARG C 3 111 ? 9.035   28.914  32.300  1.00 34.05 ? 171 ARG A CB    1 
ATOM   1519 C CG    . ARG C 3 111 ? 9.638   28.324  33.563  1.00 38.32 ? 171 ARG A CG    1 
ATOM   1520 C CD    . ARG C 3 111 ? 9.592   29.292  34.741  1.00 41.16 ? 171 ARG A CD    1 
ATOM   1521 N NE    . ARG C 3 111 ? 10.452  30.459  34.556  1.00 43.88 ? 171 ARG A NE    1 
ATOM   1522 C CZ    . ARG C 3 111 ? 10.012  31.672  34.242  1.00 44.41 ? 171 ARG A CZ    1 
ATOM   1523 N NH1   . ARG C 3 111 ? 8.713   31.888  34.073  1.00 43.82 ? 171 ARG A NH1   1 
ATOM   1524 N NH2   . ARG C 3 111 ? 10.873  32.672  34.105  1.00 44.98 ? 171 ARG A NH2   1 
ATOM   1525 N N     . LEU C 3 112 ? 7.490   27.609  29.198  1.00 29.94 ? 172 LEU A N     1 
ATOM   1526 C CA    . LEU C 3 112 ? 6.766   28.027  28.003  1.00 29.28 ? 172 LEU A CA    1 
ATOM   1527 C C     . LEU C 3 112 ? 5.615   29.001  28.241  1.00 30.44 ? 172 LEU A C     1 
ATOM   1528 O O     . LEU C 3 112 ? 5.425   29.938  27.467  1.00 30.33 ? 172 LEU A O     1 
ATOM   1529 C CB    . LEU C 3 112 ? 6.245   26.800  27.249  1.00 28.80 ? 172 LEU A CB    1 
ATOM   1530 C CG    . LEU C 3 112 ? 7.259   25.753  26.764  1.00 27.79 ? 172 LEU A CG    1 
ATOM   1531 C CD1   . LEU C 3 112 ? 6.537   24.714  25.917  1.00 24.31 ? 172 LEU A CD1   1 
ATOM   1532 C CD2   . LEU C 3 112 ? 8.361   26.417  25.943  1.00 27.21 ? 172 LEU A CD2   1 
ATOM   1533 N N     . GLU C 3 113 ? 4.844   28.793  29.303  1.00 30.32 ? 173 GLU A N     1 
ATOM   1534 C CA    . GLU C 3 113 ? 3.719   29.686  29.570  1.00 32.93 ? 173 GLU A CA    1 
ATOM   1535 C C     . GLU C 3 113 ? 4.176   31.122  29.811  1.00 31.53 ? 173 GLU A C     1 
ATOM   1536 O O     . GLU C 3 113 ? 3.608   32.062  29.263  1.00 31.29 ? 173 GLU A O     1 
ATOM   1537 C CB    . GLU C 3 113 ? 2.907   29.190  30.771  1.00 36.07 ? 173 GLU A CB    1 
ATOM   1538 C CG    . GLU C 3 113 ? 1.741   30.097  31.086  1.00 40.65 ? 173 GLU A CG    1 
ATOM   1539 C CD    . GLU C 3 113 ? 0.698   29.448  31.965  1.00 45.14 ? 173 GLU A CD    1 
ATOM   1540 O OE1   . GLU C 3 113 ? 1.043   28.987  33.074  1.00 47.64 ? 173 GLU A OE1   1 
ATOM   1541 O OE2   . GLU C 3 113 ? -0.475  29.407  31.543  1.00 47.97 ? 173 GLU A OE2   1 
ATOM   1542 N N     . GLY C 3 114 ? 5.206   31.284  30.632  1.00 32.02 ? 174 GLY A N     1 
ATOM   1543 C CA    . GLY C 3 114 ? 5.721   32.611  30.919  1.00 32.27 ? 174 GLY A CA    1 
ATOM   1544 C C     . GLY C 3 114 ? 6.337   33.264  29.695  1.00 32.87 ? 174 GLY A C     1 
ATOM   1545 O O     . GLY C 3 114 ? 6.311   34.491  29.549  1.00 32.06 ? 174 GLY A O     1 
ATOM   1546 N N     . LEU C 3 115 ? 6.900   32.446  28.809  1.00 31.64 ? 175 LEU A N     1 
ATOM   1547 C CA    . LEU C 3 115 ? 7.521   32.964  27.598  1.00 32.04 ? 175 LEU A CA    1 
ATOM   1548 C C     . LEU C 3 115 ? 6.420   33.475  26.663  1.00 32.26 ? 175 LEU A C     1 
ATOM   1549 O O     . LEU C 3 115 ? 6.531   34.563  26.085  1.00 32.79 ? 175 LEU A O     1 
ATOM   1550 C CB    . LEU C 3 115 ? 8.346   31.848  26.930  1.00 32.62 ? 175 LEU A CB    1 
ATOM   1551 C CG    . LEU C 3 115 ? 9.358   32.223  25.840  1.00 33.51 ? 175 LEU A CG    1 
ATOM   1552 C CD1   . LEU C 3 115 ? 10.215  31.008  25.511  1.00 34.68 ? 175 LEU A CD1   1 
ATOM   1553 C CD2   . LEU C 3 115 ? 8.639   32.718  24.606  1.00 33.27 ? 175 LEU A CD2   1 
ATOM   1554 N N     . ALA C 3 116 ? 5.344   32.700  26.545  1.00 33.79 ? 176 ALA A N     1 
ATOM   1555 C CA    . ALA C 3 116 ? 4.222   33.057  25.675  1.00 34.73 ? 176 ALA A CA    1 
ATOM   1556 C C     . ALA C 3 116 ? 3.534   34.350  26.112  1.00 36.91 ? 176 ALA A C     1 
ATOM   1557 O O     . ALA C 3 116 ? 3.164   35.179  25.277  1.00 37.76 ? 176 ALA A O     1 
ATOM   1558 C CB    . ALA C 3 116 ? 3.205   31.920  25.637  1.00 34.15 ? 176 ALA A CB    1 
ATOM   1559 N N     . PHE C 3 117 ? 3.352   34.515  27.417  1.00 38.42 ? 177 PHE A N     1 
ATOM   1560 C CA    . PHE C 3 117 ? 2.713   35.720  27.934  1.00 40.65 ? 177 PHE A CA    1 
ATOM   1561 C C     . PHE C 3 117 ? 3.547   36.966  27.651  1.00 40.49 ? 177 PHE A C     1 
ATOM   1562 O O     . PHE C 3 117 ? 3.011   37.987  27.213  1.00 41.91 ? 177 PHE A O     1 
ATOM   1563 C CB    . PHE C 3 117 ? 2.463   35.583  29.441  1.00 42.38 ? 177 PHE A CB    1 
ATOM   1564 C CG    . PHE C 3 117 ? 1.304   34.687  29.782  1.00 45.29 ? 177 PHE A CG    1 
ATOM   1565 C CD1   . PHE C 3 117 ? 1.405   33.758  30.811  1.00 47.20 ? 177 PHE A CD1   1 
ATOM   1566 C CD2   . PHE C 3 117 ? 0.109   34.778  29.077  1.00 47.03 ? 177 PHE A CD2   1 
ATOM   1567 C CE1   . PHE C 3 117 ? 0.326   32.927  31.134  1.00 49.41 ? 177 PHE A CE1   1 
ATOM   1568 C CE2   . PHE C 3 117 ? -0.975  33.953  29.390  1.00 49.37 ? 177 PHE A CE2   1 
ATOM   1569 C CZ    . PHE C 3 117 ? -0.864  33.026  30.421  1.00 49.33 ? 177 PHE A CZ    1 
ATOM   1570 N N     . SER C 3 118 ? 4.855   36.881  27.887  1.00 39.92 ? 178 SER A N     1 
ATOM   1571 C CA    . SER C 3 118 ? 5.736   38.021  27.665  1.00 40.30 ? 178 SER A CA    1 
ATOM   1572 C C     . SER C 3 118 ? 5.942   38.377  26.194  1.00 39.74 ? 178 SER A C     1 
ATOM   1573 O O     . SER C 3 118 ? 6.185   39.535  25.866  1.00 39.83 ? 178 SER A O     1 
ATOM   1574 C CB    . SER C 3 118 ? 7.094   37.790  28.341  1.00 42.33 ? 178 SER A CB    1 
ATOM   1575 O OG    . SER C 3 118 ? 7.691   36.579  27.918  1.00 47.50 ? 178 SER A OG    1 
ATOM   1576 N N     . HIS C 3 119 ? 5.853   37.391  25.306  1.00 39.16 ? 179 HIS A N     1 
ATOM   1577 C CA    . HIS C 3 119 ? 6.019   37.654  23.878  1.00 37.35 ? 179 HIS A CA    1 
ATOM   1578 C C     . HIS C 3 119 ? 4.751   37.241  23.141  1.00 37.28 ? 179 HIS A C     1 
ATOM   1579 O O     . HIS C 3 119 ? 4.787   36.449  22.198  1.00 37.74 ? 179 HIS A O     1 
ATOM   1580 C CB    . HIS C 3 119 ? 7.229   36.888  23.341  1.00 37.67 ? 179 HIS A CB    1 
ATOM   1581 C CG    . HIS C 3 119 ? 8.495   37.179  24.081  1.00 37.54 ? 179 HIS A CG    1 
ATOM   1582 N ND1   . HIS C 3 119 ? 8.693   36.797  25.390  1.00 37.39 ? 179 HIS A ND1   1 
ATOM   1583 C CD2   . HIS C 3 119 ? 9.611   37.852  23.712  1.00 38.11 ? 179 HIS A CD2   1 
ATOM   1584 C CE1   . HIS C 3 119 ? 9.875   37.224  25.796  1.00 38.16 ? 179 HIS A CE1   1 
ATOM   1585 N NE2   . HIS C 3 119 ? 10.452  37.867  24.798  1.00 37.52 ? 179 HIS A NE2   1 
ATOM   1586 N N     . GLY C 3 120 ? 3.630   37.807  23.582  1.00 36.06 ? 180 GLY A N     1 
ATOM   1587 C CA    . GLY C 3 120 ? 2.327   37.494  23.022  1.00 34.52 ? 180 GLY A CA    1 
ATOM   1588 C C     . GLY C 3 120 ? 2.068   37.685  21.541  1.00 34.02 ? 180 GLY A C     1 
ATOM   1589 O O     . GLY C 3 120 ? 1.321   36.907  20.944  1.00 35.62 ? 180 GLY A O     1 
ATOM   1590 N N     . THR C 3 121 ? 2.659   38.706  20.933  1.00 34.26 ? 181 THR A N     1 
ATOM   1591 C CA    . THR C 3 121 ? 2.424   38.933  19.514  1.00 35.20 ? 181 THR A CA    1 
ATOM   1592 C C     . THR C 3 121 ? 3.192   37.975  18.607  1.00 34.01 ? 181 THR A C     1 
ATOM   1593 O O     . THR C 3 121 ? 2.856   37.841  17.432  1.00 33.25 ? 181 THR A O     1 
ATOM   1594 C CB    . THR C 3 121 ? 2.766   40.373  19.103  1.00 36.46 ? 181 THR A CB    1 
ATOM   1595 O OG1   . THR C 3 121 ? 4.149   40.638  19.370  1.00 39.71 ? 181 THR A OG1   1 
ATOM   1596 C CG2   . THR C 3 121 ? 1.895   41.354  19.874  1.00 38.85 ? 181 THR A CG2   1 
ATOM   1597 N N     . PHE C 3 122 ? 4.204   37.306  19.154  1.00 33.59 ? 182 PHE A N     1 
ATOM   1598 C CA    . PHE C 3 122 ? 5.009   36.364  18.370  1.00 33.20 ? 182 PHE A CA    1 
ATOM   1599 C C     . PHE C 3 122 ? 4.737   34.912  18.752  1.00 32.58 ? 182 PHE A C     1 
ATOM   1600 O O     . PHE C 3 122 ? 5.113   33.988  18.019  1.00 30.41 ? 182 PHE A O     1 
ATOM   1601 C CB    . PHE C 3 122 ? 6.504   36.622  18.588  1.00 34.44 ? 182 PHE A CB    1 
ATOM   1602 C CG    . PHE C 3 122 ? 6.927   38.041  18.341  1.00 37.72 ? 182 PHE A CG    1 
ATOM   1603 C CD1   . PHE C 3 122 ? 7.628   38.746  19.319  1.00 40.19 ? 182 PHE A CD1   1 
ATOM   1604 C CD2   . PHE C 3 122 ? 6.636   38.673  17.137  1.00 39.80 ? 182 PHE A CD2   1 
ATOM   1605 C CE1   . PHE C 3 122 ? 8.035   40.062  19.103  1.00 41.46 ? 182 PHE A CE1   1 
ATOM   1606 C CE2   . PHE C 3 122 ? 7.040   39.993  16.909  1.00 41.70 ? 182 PHE A CE2   1 
ATOM   1607 C CZ    . PHE C 3 122 ? 7.741   40.686  17.897  1.00 41.00 ? 182 PHE A CZ    1 
ATOM   1608 N N     . SER C 3 123 ? 4.081   34.713  19.890  1.00 30.39 ? 183 SER A N     1 
ATOM   1609 C CA    . SER C 3 123 ? 3.837   33.374  20.395  1.00 29.47 ? 183 SER A CA    1 
ATOM   1610 C C     . SER C 3 123 ? 2.437   32.788  20.350  1.00 30.27 ? 183 SER A C     1 
ATOM   1611 O O     . SER C 3 123 ? 1.432   33.488  20.485  1.00 30.93 ? 183 SER A O     1 
ATOM   1612 C CB    . SER C 3 123 ? 4.319   33.284  21.847  1.00 28.08 ? 183 SER A CB    1 
ATOM   1613 O OG    . SER C 3 123 ? 5.635   33.785  21.984  1.00 30.51 ? 183 SER A OG    1 
ATOM   1614 N N     A SER C 3 124 ? 2.377   31.474  20.155  0.50 29.48 ? 184 SER A N     1 
ATOM   1615 N N     B SER C 3 124 ? 2.407   31.477  20.167  0.50 29.46 ? 184 SER A N     1 
ATOM   1616 C CA    A SER C 3 124 ? 1.118   30.731  20.125  0.50 29.69 ? 184 SER A CA    1 
ATOM   1617 C CA    B SER C 3 124 ? 1.178   30.711  20.140  0.50 29.68 ? 184 SER A CA    1 
ATOM   1618 C C     A SER C 3 124 ? 1.360   29.449  20.924  0.50 29.55 ? 184 SER A C     1 
ATOM   1619 C C     B SER C 3 124 ? 1.464   29.491  21.001  0.50 29.54 ? 184 SER A C     1 
ATOM   1620 O O     A SER C 3 124 ? 2.130   28.586  20.501  0.50 27.62 ? 184 SER A O     1 
ATOM   1621 O O     B SER C 3 124 ? 2.387   28.727  20.719  0.50 27.81 ? 184 SER A O     1 
ATOM   1622 C CB    A SER C 3 124 ? 0.723   30.384  18.691  0.50 30.00 ? 184 SER A CB    1 
ATOM   1623 C CB    B SER C 3 124 ? 0.833   30.269  18.714  0.50 29.96 ? 184 SER A CB    1 
ATOM   1624 O OG    A SER C 3 124 ? -0.488  29.652  18.680  0.50 31.33 ? 184 SER A OG    1 
ATOM   1625 O OG    B SER C 3 124 ? 0.377   31.360  17.934  0.50 31.03 ? 184 SER A OG    1 
ATOM   1626 N N     . TYR C 3 125 ? 0.699   29.325  22.071  1.00 28.64 ? 185 TYR A N     1 
ATOM   1627 C CA    . TYR C 3 125 ? 0.887   28.173  22.933  1.00 29.53 ? 185 TYR A CA    1 
ATOM   1628 C C     . TYR C 3 125 ? -0.434  27.637  23.463  1.00 31.70 ? 185 TYR A C     1 
ATOM   1629 O O     . TYR C 3 125 ? -1.078  28.259  24.310  1.00 31.03 ? 185 TYR A O     1 
ATOM   1630 C CB    . TYR C 3 125 ? 1.824   28.546  24.088  1.00 29.50 ? 185 TYR A CB    1 
ATOM   1631 C CG    . TYR C 3 125 ? 2.127   27.421  25.049  1.00 28.39 ? 185 TYR A CG    1 
ATOM   1632 C CD1   . TYR C 3 125 ? 2.599   26.184  24.593  1.00 27.84 ? 185 TYR A CD1   1 
ATOM   1633 C CD2   . TYR C 3 125 ? 1.964   27.599  26.424  1.00 28.31 ? 185 TYR A CD2   1 
ATOM   1634 C CE1   . TYR C 3 125 ? 2.899   25.157  25.483  1.00 26.99 ? 185 TYR A CE1   1 
ATOM   1635 C CE2   . TYR C 3 125 ? 2.262   26.584  27.320  1.00 26.25 ? 185 TYR A CE2   1 
ATOM   1636 C CZ    . TYR C 3 125 ? 2.726   25.369  26.853  1.00 27.95 ? 185 TYR A CZ    1 
ATOM   1637 O OH    . TYR C 3 125 ? 3.009   24.367  27.753  1.00 27.51 ? 185 TYR A OH    1 
ATOM   1638 N N     . GLU C 3 126 ? -0.827  26.483  22.933  1.00 31.41 ? 186 GLU A N     1 
ATOM   1639 C CA    . GLU C 3 126 ? -2.051  25.787  23.313  1.00 33.18 ? 186 GLU A CA    1 
ATOM   1640 C C     . GLU C 3 126 ? -1.603  24.356  23.553  1.00 31.05 ? 186 GLU A C     1 
ATOM   1641 O O     . GLU C 3 126 ? -1.782  23.480  22.704  1.00 29.53 ? 186 GLU A O     1 
ATOM   1642 C CB    . GLU C 3 126 ? -3.072  25.824  22.174  1.00 36.74 ? 186 GLU A CB    1 
ATOM   1643 C CG    . GLU C 3 126 ? -3.849  27.122  22.051  1.00 45.07 ? 186 GLU A CG    1 
ATOM   1644 C CD    . GLU C 3 126 ? -4.718  27.147  20.807  1.00 49.71 ? 186 GLU A CD    1 
ATOM   1645 O OE1   . GLU C 3 126 ? -5.546  26.222  20.641  1.00 50.64 ? 186 GLU A OE1   1 
ATOM   1646 O OE2   . GLU C 3 126 ? -4.566  28.087  19.994  1.00 54.13 ? 186 GLU A OE2   1 
ATOM   1647 N N     . PRO C 3 127 ? -1.015  24.099  24.727  1.00 30.81 ? 187 PRO A N     1 
ATOM   1648 C CA    . PRO C 3 127 ? -0.524  22.766  25.076  1.00 30.01 ? 187 PRO A CA    1 
ATOM   1649 C C     . PRO C 3 127 ? -1.468  21.583  24.884  1.00 29.77 ? 187 PRO A C     1 
ATOM   1650 O O     . PRO C 3 127 ? -1.008  20.466  24.669  1.00 28.55 ? 187 PRO A O     1 
ATOM   1651 C CB    . PRO C 3 127 ? -0.064  22.937  26.528  1.00 30.55 ? 187 PRO A CB    1 
ATOM   1652 C CG    . PRO C 3 127 ? -0.921  24.044  27.036  1.00 32.09 ? 187 PRO A CG    1 
ATOM   1653 C CD    . PRO C 3 127 ? -0.931  25.008  25.883  1.00 31.80 ? 187 PRO A CD    1 
ATOM   1654 N N     . GLU C 3 128 ? -2.776  21.816  24.965  1.00 30.11 ? 188 GLU A N     1 
ATOM   1655 C CA    . GLU C 3 128 ? -3.741  20.732  24.787  1.00 31.85 ? 188 GLU A CA    1 
ATOM   1656 C C     . GLU C 3 128 ? -3.855  20.352  23.313  1.00 29.63 ? 188 GLU A C     1 
ATOM   1657 O O     . GLU C 3 128 ? -4.319  19.269  22.971  1.00 26.50 ? 188 GLU A O     1 
ATOM   1658 C CB    . GLU C 3 128 ? -5.118  21.139  25.330  1.00 36.77 ? 188 GLU A CB    1 
ATOM   1659 C CG    . GLU C 3 128 ? -5.420  20.577  26.719  1.00 46.43 ? 188 GLU A CG    1 
ATOM   1660 C CD    . GLU C 3 128 ? -6.689  21.148  27.334  1.00 52.10 ? 188 GLU A CD    1 
ATOM   1661 O OE1   . GLU C 3 128 ? -7.733  21.196  26.645  1.00 54.78 ? 188 GLU A OE1   1 
ATOM   1662 O OE2   . GLU C 3 128 ? -6.641  21.542  28.518  1.00 55.42 ? 188 GLU A OE2   1 
ATOM   1663 N N     . LEU C 3 129 ? -3.418  21.255  22.445  1.00 27.97 ? 189 LEU A N     1 
ATOM   1664 C CA    . LEU C 3 129 ? -3.469  21.022  21.008  1.00 28.29 ? 189 LEU A CA    1 
ATOM   1665 C C     . LEU C 3 129 ? -2.136  20.457  20.504  1.00 26.73 ? 189 LEU A C     1 
ATOM   1666 O O     . LEU C 3 129 ? -2.102  19.437  19.819  1.00 27.91 ? 189 LEU A O     1 
ATOM   1667 C CB    . LEU C 3 129 ? -3.780  22.334  20.294  1.00 28.95 ? 189 LEU A CB    1 
ATOM   1668 C CG    . LEU C 3 129 ? -3.991  22.287  18.781  1.00 32.02 ? 189 LEU A CG    1 
ATOM   1669 C CD1   . LEU C 3 129 ? -5.148  21.353  18.450  1.00 33.13 ? 189 LEU A CD1   1 
ATOM   1670 C CD2   . LEU C 3 129 ? -4.252  23.696  18.263  1.00 32.50 ? 189 LEU A CD2   1 
ATOM   1671 N N     . PHE C 3 130 ? -1.051  21.143  20.854  1.00 25.38 ? 190 PHE A N     1 
ATOM   1672 C CA    . PHE C 3 130 ? 0.310   20.763  20.473  1.00 24.21 ? 190 PHE A CA    1 
ATOM   1673 C C     . PHE C 3 130 ? 1.201   21.203  21.642  1.00 22.14 ? 190 PHE A C     1 
ATOM   1674 O O     . PHE C 3 130 ? 1.117   22.335  22.096  1.00 23.86 ? 190 PHE A O     1 
ATOM   1675 C CB    . PHE C 3 130 ? 0.707   21.491  19.189  1.00 23.64 ? 190 PHE A CB    1 
ATOM   1676 C CG    . PHE C 3 130 ? 2.061   21.106  18.670  1.00 21.70 ? 190 PHE A CG    1 
ATOM   1677 C CD1   . PHE C 3 130 ? 2.281   19.847  18.126  1.00 20.11 ? 190 PHE A CD1   1 
ATOM   1678 C CD2   . PHE C 3 130 ? 3.119   21.995  18.754  1.00 22.00 ? 190 PHE A CD2   1 
ATOM   1679 C CE1   . PHE C 3 130 ? 3.550   19.475  17.670  1.00 21.79 ? 190 PHE A CE1   1 
ATOM   1680 C CE2   . PHE C 3 130 ? 4.395   21.634  18.303  1.00 21.02 ? 190 PHE A CE2   1 
ATOM   1681 C CZ    . PHE C 3 130 ? 4.609   20.379  17.761  1.00 21.49 ? 190 PHE A CZ    1 
ATOM   1682 N N     . PRO C 3 131 ? 2.094   20.325  22.118  1.00 22.21 ? 191 PRO A N     1 
ATOM   1683 C CA    . PRO C 3 131 ? 2.943   20.708  23.253  1.00 22.38 ? 191 PRO A CA    1 
ATOM   1684 C C     . PRO C 3 131 ? 4.042   21.751  23.069  1.00 21.91 ? 191 PRO A C     1 
ATOM   1685 O O     . PRO C 3 131 ? 4.619   22.226  24.056  1.00 20.45 ? 191 PRO A O     1 
ATOM   1686 C CB    . PRO C 3 131 ? 3.471   19.362  23.751  1.00 24.36 ? 191 PRO A CB    1 
ATOM   1687 C CG    . PRO C 3 131 ? 3.593   18.559  22.470  1.00 24.38 ? 191 PRO A CG    1 
ATOM   1688 C CD    . PRO C 3 131 ? 2.362   18.946  21.669  1.00 19.35 ? 191 PRO A CD    1 
ATOM   1689 N N     . GLY C 3 132 ? 4.330   22.124  21.830  1.00 20.45 ? 192 GLY A N     1 
ATOM   1690 C CA    . GLY C 3 132 ? 5.363   23.116  21.617  1.00 22.09 ? 192 GLY A CA    1 
ATOM   1691 C C     . GLY C 3 132 ? 4.821   24.519  21.424  1.00 21.51 ? 192 GLY A C     1 
ATOM   1692 O O     . GLY C 3 132 ? 3.704   24.706  20.927  1.00 24.56 ? 192 GLY A O     1 
ATOM   1693 N N     . LEU C 3 133 ? 5.614   25.509  21.820  1.00 21.91 ? 193 LEU A N     1 
ATOM   1694 C CA    . LEU C 3 133 ? 5.234   26.904  21.650  1.00 22.49 ? 193 LEU A CA    1 
ATOM   1695 C C     . LEU C 3 133 ? 5.675   27.292  20.234  1.00 23.32 ? 193 LEU A C     1 
ATOM   1696 O O     . LEU C 3 133 ? 6.808   27.035  19.842  1.00 21.73 ? 193 LEU A O     1 
ATOM   1697 C CB    . LEU C 3 133 ? 5.932   27.775  22.706  1.00 21.68 ? 193 LEU A CB    1 
ATOM   1698 C CG    . LEU C 3 133 ? 5.673   29.291  22.727  1.00 23.88 ? 193 LEU A CG    1 
ATOM   1699 C CD1   . LEU C 3 133 ? 6.031   29.840  24.109  1.00 25.12 ? 193 LEU A CD1   1 
ATOM   1700 C CD2   . LEU C 3 133 ? 6.493   29.995  21.646  1.00 22.38 ? 193 LEU A CD2   1 
ATOM   1701 N N     . ILE C 3 134 ? 4.764   27.881  19.465  1.00 20.93 ? 194 ILE A N     1 
ATOM   1702 C CA    . ILE C 3 134 ? 5.054   28.294  18.098  1.00 23.53 ? 194 ILE A CA    1 
ATOM   1703 C C     . ILE C 3 134 ? 5.417   29.774  18.121  1.00 24.71 ? 194 ILE A C     1 
ATOM   1704 O O     . ILE C 3 134 ? 4.571   30.633  18.404  1.00 24.97 ? 194 ILE A O     1 
ATOM   1705 C CB    . ILE C 3 134 ? 3.831   28.042  17.191  1.00 23.22 ? 194 ILE A CB    1 
ATOM   1706 C CG1   . ILE C 3 134 ? 3.479   26.551  17.244  1.00 24.51 ? 194 ILE A CG1   1 
ATOM   1707 C CG2   . ILE C 3 134 ? 4.130   28.480  15.754  1.00 24.56 ? 194 ILE A CG2   1 
ATOM   1708 C CD1   . ILE C 3 134 ? 2.111   26.209  16.667  1.00 30.47 ? 194 ILE A CD1   1 
ATOM   1709 N N     . TYR C 3 135 ? 6.685   30.060  17.836  1.00 22.21 ? 195 TYR A N     1 
ATOM   1710 C CA    . TYR C 3 135 ? 7.199   31.424  17.864  1.00 22.83 ? 195 TYR A CA    1 
ATOM   1711 C C     . TYR C 3 135 ? 7.475   31.937  16.452  1.00 23.86 ? 195 TYR A C     1 
ATOM   1712 O O     . TYR C 3 135 ? 8.312   31.380  15.736  1.00 22.23 ? 195 TYR A O     1 
ATOM   1713 C CB    . TYR C 3 135 ? 8.492   31.457  18.688  1.00 23.79 ? 195 TYR A CB    1 
ATOM   1714 C CG    . TYR C 3 135 ? 8.949   32.837  19.096  1.00 25.98 ? 195 TYR A CG    1 
ATOM   1715 C CD1   . TYR C 3 135 ? 8.633   33.347  20.358  1.00 26.89 ? 195 TYR A CD1   1 
ATOM   1716 C CD2   . TYR C 3 135 ? 9.688   33.638  18.226  1.00 26.73 ? 195 TYR A CD2   1 
ATOM   1717 C CE1   . TYR C 3 135 ? 9.042   34.618  20.748  1.00 29.72 ? 195 TYR A CE1   1 
ATOM   1718 C CE2   . TYR C 3 135 ? 10.104  34.922  18.606  1.00 28.15 ? 195 TYR A CE2   1 
ATOM   1719 C CZ    . TYR C 3 135 ? 9.773   35.399  19.875  1.00 30.27 ? 195 TYR A CZ    1 
ATOM   1720 O OH    . TYR C 3 135 ? 10.177  36.647  20.278  1.00 31.31 ? 195 TYR A OH    1 
ATOM   1721 N N     . ARG C 3 136 ? 6.772   32.988  16.044  1.00 22.09 ? 196 ARG A N     1 
ATOM   1722 C CA    . ARG C 3 136 ? 6.983   33.542  14.711  1.00 23.35 ? 196 ARG A CA    1 
ATOM   1723 C C     . ARG C 3 136 ? 7.879   34.768  14.761  1.00 23.72 ? 196 ARG A C     1 
ATOM   1724 O O     . ARG C 3 136 ? 7.423   35.883  15.009  1.00 26.43 ? 196 ARG A O     1 
ATOM   1725 C CB    . ARG C 3 136 ? 5.649   33.862  14.047  1.00 23.06 ? 196 ARG A CB    1 
ATOM   1726 C CG    . ARG C 3 136 ? 4.865   32.598  13.683  1.00 25.89 ? 196 ARG A CG    1 
ATOM   1727 C CD    . ARG C 3 136 ? 3.464   32.924  13.210  1.00 29.00 ? 196 ARG A CD    1 
ATOM   1728 N NE    . ARG C 3 136 ? 2.662   31.717  13.048  1.00 33.55 ? 196 ARG A NE    1 
ATOM   1729 C CZ    . ARG C 3 136 ? 2.777   30.852  12.047  1.00 36.59 ? 196 ARG A CZ    1 
ATOM   1730 N NH1   . ARG C 3 136 ? 3.670   31.048  11.087  1.00 38.75 ? 196 ARG A NH1   1 
ATOM   1731 N NH2   . ARG C 3 136 ? 1.992   29.783  12.014  1.00 39.67 ? 196 ARG A NH2   1 
ATOM   1732 N N     . MET C 3 137 ? 9.165   34.542  14.516  1.00 23.66 ? 197 MET A N     1 
ATOM   1733 C CA    . MET C 3 137 ? 10.165  35.599  14.550  1.00 24.05 ? 197 MET A CA    1 
ATOM   1734 C C     . MET C 3 137 ? 10.116  36.477  13.309  1.00 24.59 ? 197 MET A C     1 
ATOM   1735 O O     . MET C 3 137 ? 9.927   36.002  12.185  1.00 23.65 ? 197 MET A O     1 
ATOM   1736 C CB    . MET C 3 137 ? 11.566  34.991  14.727  1.00 24.04 ? 197 MET A CB    1 
ATOM   1737 C CG    . MET C 3 137 ? 12.675  36.002  15.033  1.00 21.23 ? 197 MET A CG    1 
ATOM   1738 S SD    . MET C 3 137 ? 14.254  35.197  15.406  1.00 23.27 ? 197 MET A SD    1 
ATOM   1739 C CE    . MET C 3 137 ? 13.915  34.498  17.062  1.00 20.37 ? 197 MET A CE    1 
ATOM   1740 N N     . VAL C 3 138 ? 10.281  37.776  13.534  1.00 26.60 ? 198 VAL A N     1 
ATOM   1741 C CA    . VAL C 3 138 ? 10.241  38.756  12.462  1.00 28.14 ? 198 VAL A CA    1 
ATOM   1742 C C     . VAL C 3 138 ? 11.572  38.904  11.728  1.00 28.14 ? 198 VAL A C     1 
ATOM   1743 O O     . VAL C 3 138 ? 11.614  38.868  10.506  1.00 28.39 ? 198 VAL A O     1 
ATOM   1744 C CB    . VAL C 3 138 ? 9.816   40.144  13.011  1.00 29.92 ? 198 VAL A CB    1 
ATOM   1745 C CG1   . VAL C 3 138 ? 9.960   41.212  11.922  1.00 31.25 ? 198 VAL A CG1   1 
ATOM   1746 C CG2   . VAL C 3 138 ? 8.380   40.078  13.502  1.00 31.74 ? 198 VAL A CG2   1 
ATOM   1747 N N     . LYS C 3 139 ? 12.654  39.063  12.479  1.00 29.29 ? 199 LYS A N     1 
ATOM   1748 C CA    . LYS C 3 139 ? 13.973  39.243  11.879  1.00 29.80 ? 199 LYS A CA    1 
ATOM   1749 C C     . LYS C 3 139 ? 15.020  38.374  12.552  1.00 29.20 ? 199 LYS A C     1 
ATOM   1750 O O     . LYS C 3 139 ? 15.377  38.609  13.705  1.00 29.52 ? 199 LYS A O     1 
ATOM   1751 C CB    . LYS C 3 139 ? 14.399  40.708  11.996  1.00 33.48 ? 199 LYS A CB    1 
ATOM   1752 C CG    . LYS C 3 139 ? 15.774  41.012  11.432  1.00 37.86 ? 199 LYS A CG    1 
ATOM   1753 C CD    . LYS C 3 139 ? 16.264  42.370  11.911  1.00 41.54 ? 199 LYS A CD    1 
ATOM   1754 C CE    . LYS C 3 139 ? 17.488  42.819  11.132  1.00 44.31 ? 199 LYS A CE    1 
ATOM   1755 N NZ    . LYS C 3 139 ? 17.143  42.997  9.693   1.00 47.59 ? 199 LYS A NZ    1 
ATOM   1756 N N     . PRO C 3 140 ? 15.516  37.341  11.850  1.00 28.08 ? 200 PRO A N     1 
ATOM   1757 C CA    . PRO C 3 140 ? 15.141  36.957  10.482  1.00 26.82 ? 200 PRO A CA    1 
ATOM   1758 C C     . PRO C 3 140 ? 13.716  36.394  10.499  1.00 25.57 ? 200 PRO A C     1 
ATOM   1759 O O     . PRO C 3 140 ? 13.178  36.129  11.572  1.00 25.57 ? 200 PRO A O     1 
ATOM   1760 C CB    . PRO C 3 140 ? 16.187  35.900  10.131  1.00 26.95 ? 200 PRO A CB    1 
ATOM   1761 C CG    . PRO C 3 140 ? 16.440  35.242  11.452  1.00 27.33 ? 200 PRO A CG    1 
ATOM   1762 C CD    . PRO C 3 140 ? 16.545  36.431  12.388  1.00 26.68 ? 200 PRO A CD    1 
ATOM   1763 N N     . LYS C 3 141 ? 13.100  36.211  9.334   1.00 24.33 ? 201 LYS A N     1 
ATOM   1764 C CA    . LYS C 3 141 ? 11.740  35.675  9.309   1.00 24.54 ? 201 LYS A CA    1 
ATOM   1765 C C     . LYS C 3 141 ? 11.789  34.153  9.423   1.00 21.97 ? 201 LYS A C     1 
ATOM   1766 O O     . LYS C 3 141 ? 11.877  33.436  8.421   1.00 22.25 ? 201 LYS A O     1 
ATOM   1767 C CB    . LYS C 3 141 ? 11.007  36.082  8.029   1.00 26.48 ? 201 LYS A CB    1 
ATOM   1768 C CG    . LYS C 3 141 ? 9.535   35.714  8.076   1.00 29.45 ? 201 LYS A CG    1 
ATOM   1769 C CD    . LYS C 3 141 ? 8.814   36.088  6.799   1.00 34.74 ? 201 LYS A CD    1 
ATOM   1770 C CE    . LYS C 3 141 ? 7.388   35.547  6.840   1.00 38.00 ? 201 LYS A CE    1 
ATOM   1771 N NZ    . LYS C 3 141 ? 6.697   35.712  5.537   1.00 43.02 ? 201 LYS A NZ    1 
ATOM   1772 N N     . ILE C 3 142 ? 11.717  33.674  10.660  1.00 20.59 ? 202 ILE A N     1 
ATOM   1773 C CA    . ILE C 3 142 ? 11.813  32.254  10.946  1.00 17.98 ? 202 ILE A CA    1 
ATOM   1774 C C     . ILE C 3 142 ? 10.765  31.812  11.965  1.00 18.00 ? 202 ILE A C     1 
ATOM   1775 O O     . ILE C 3 142 ? 10.413  32.568  12.862  1.00 17.91 ? 202 ILE A O     1 
ATOM   1776 C CB    . ILE C 3 142 ? 13.236  31.944  11.510  1.00 18.07 ? 202 ILE A CB    1 
ATOM   1777 C CG1   . ILE C 3 142 ? 14.308  32.173  10.427  1.00 16.98 ? 202 ILE A CG1   1 
ATOM   1778 C CG2   . ILE C 3 142 ? 13.293  30.532  12.080  1.00 17.49 ? 202 ILE A CG2   1 
ATOM   1779 C CD1   . ILE C 3 142 ? 14.230  31.214  9.215   1.00 15.53 ? 202 ILE A CD1   1 
ATOM   1780 N N     . VAL C 3 143 ? 10.249  30.597  11.811  1.00 17.77 ? 203 VAL A N     1 
ATOM   1781 C CA    . VAL C 3 143 ? 9.297   30.083  12.785  1.00 17.48 ? 203 VAL A CA    1 
ATOM   1782 C C     . VAL C 3 143 ? 10.005  29.042  13.650  1.00 17.69 ? 203 VAL A C     1 
ATOM   1783 O O     . VAL C 3 143 ? 10.653  28.118  13.140  1.00 16.54 ? 203 VAL A O     1 
ATOM   1784 C CB    . VAL C 3 143 ? 8.079   29.437  12.118  1.00 19.86 ? 203 VAL A CB    1 
ATOM   1785 C CG1   . VAL C 3 143 ? 7.156   28.865  13.195  1.00 19.17 ? 203 VAL A CG1   1 
ATOM   1786 C CG2   . VAL C 3 143 ? 7.333   30.469  11.282  1.00 22.20 ? 203 VAL A CG2   1 
ATOM   1787 N N     . LEU C 3 144 ? 9.921   29.213  14.964  1.00 16.66 ? 204 LEU A N     1 
ATOM   1788 C CA    . LEU C 3 144 ? 10.543  28.270  15.878  1.00 17.55 ? 204 LEU A CA    1 
ATOM   1789 C C     . LEU C 3 144 ? 9.486   27.519  16.673  1.00 18.27 ? 204 LEU A C     1 
ATOM   1790 O O     . LEU C 3 144 ? 8.430   28.071  16.987  1.00 20.95 ? 204 LEU A O     1 
ATOM   1791 C CB    . LEU C 3 144 ? 11.471  28.988  16.875  1.00 16.98 ? 204 LEU A CB    1 
ATOM   1792 C CG    . LEU C 3 144 ? 12.629  29.845  16.349  1.00 16.18 ? 204 LEU A CG    1 
ATOM   1793 C CD1   . LEU C 3 144 ? 12.129  31.235  15.947  1.00 16.22 ? 204 LEU A CD1   1 
ATOM   1794 C CD2   . LEU C 3 144 ? 13.713  29.942  17.436  1.00 18.11 ? 204 LEU A CD2   1 
ATOM   1795 N N     . LEU C 3 145 ? 9.776   26.256  16.969  1.00 18.49 ? 205 LEU A N     1 
ATOM   1796 C CA    . LEU C 3 145 ? 8.910   25.427  17.803  1.00 17.96 ? 205 LEU A CA    1 
ATOM   1797 C C     . LEU C 3 145 ? 9.767   25.210  19.045  1.00 19.19 ? 205 LEU A C     1 
ATOM   1798 O O     . LEU C 3 145 ? 10.819  24.566  18.983  1.00 18.77 ? 205 LEU A O     1 
ATOM   1799 C CB    . LEU C 3 145 ? 8.591   24.087  17.137  1.00 15.95 ? 205 LEU A CB    1 
ATOM   1800 C CG    . LEU C 3 145 ? 7.955   24.161  15.745  1.00 17.96 ? 205 LEU A CG    1 
ATOM   1801 C CD1   . LEU C 3 145 ? 7.598   22.750  15.292  1.00 17.59 ? 205 LEU A CD1   1 
ATOM   1802 C CD2   . LEU C 3 145 ? 6.699   25.063  15.778  1.00 19.10 ? 205 LEU A CD2   1 
ATOM   1803 N N     . ILE C 3 146 ? 9.325   25.778  20.163  1.00 20.30 ? 206 ILE A N     1 
ATOM   1804 C CA    . ILE C 3 146 ? 10.060  25.688  21.423  1.00 20.17 ? 206 ILE A CA    1 
ATOM   1805 C C     . ILE C 3 146 ? 9.358   24.734  22.385  1.00 20.58 ? 206 ILE A C     1 
ATOM   1806 O O     . ILE C 3 146 ? 8.179   24.893  22.684  1.00 23.37 ? 206 ILE A O     1 
ATOM   1807 C CB    . ILE C 3 146 ? 10.187  27.103  22.058  1.00 21.60 ? 206 ILE A CB    1 
ATOM   1808 C CG1   . ILE C 3 146 ? 10.822  28.050  21.031  1.00 23.61 ? 206 ILE A CG1   1 
ATOM   1809 C CG2   . ILE C 3 146 ? 11.038  27.046  23.336  1.00 21.69 ? 206 ILE A CG2   1 
ATOM   1810 C CD1   . ILE C 3 146 ? 10.831  29.531  21.415  1.00 24.62 ? 206 ILE A CD1   1 
ATOM   1811 N N     . PHE C 3 147 ? 10.092  23.746  22.880  1.00 21.60 ? 207 PHE A N     1 
ATOM   1812 C CA    . PHE C 3 147 ? 9.519   22.754  23.780  1.00 21.28 ? 207 PHE A CA    1 
ATOM   1813 C C     . PHE C 3 147 ? 10.014  22.865  25.216  1.00 22.30 ? 207 PHE A C     1 
ATOM   1814 O O     . PHE C 3 147 ? 11.060  23.449  25.489  1.00 20.13 ? 207 PHE A O     1 
ATOM   1815 C CB    . PHE C 3 147 ? 9.788   21.357  23.206  1.00 18.81 ? 207 PHE A CB    1 
ATOM   1816 C CG    . PHE C 3 147 ? 9.211   21.160  21.825  1.00 20.33 ? 207 PHE A CG    1 
ATOM   1817 C CD1   . PHE C 3 147 ? 7.901   20.719  21.658  1.00 19.89 ? 207 PHE A CD1   1 
ATOM   1818 C CD2   . PHE C 3 147 ? 9.957   21.485  20.691  1.00 19.88 ? 207 PHE A CD2   1 
ATOM   1819 C CE1   . PHE C 3 147 ? 7.337   20.604  20.383  1.00 18.45 ? 207 PHE A CE1   1 
ATOM   1820 C CE2   . PHE C 3 147 ? 9.403   21.375  19.415  1.00 18.94 ? 207 PHE A CE2   1 
ATOM   1821 C CZ    . PHE C 3 147 ? 8.095   20.938  19.259  1.00 18.56 ? 207 PHE A CZ    1 
ATOM   1822 N N     . VAL C 3 148 ? 9.241   22.310  26.142  1.00 23.17 ? 208 VAL A N     1 
ATOM   1823 C CA    . VAL C 3 148 ? 9.593   22.359  27.554  1.00 23.01 ? 208 VAL A CA    1 
ATOM   1824 C C     . VAL C 3 148 ? 10.979  21.782  27.813  1.00 24.19 ? 208 VAL A C     1 
ATOM   1825 O O     . VAL C 3 148 ? 11.731  22.299  28.639  1.00 24.23 ? 208 VAL A O     1 
ATOM   1826 C CB    . VAL C 3 148 ? 8.544   21.587  28.394  1.00 23.37 ? 208 VAL A CB    1 
ATOM   1827 C CG1   . VAL C 3 148 ? 9.005   21.458  29.846  1.00 28.82 ? 208 VAL A CG1   1 
ATOM   1828 C CG2   . VAL C 3 148 ? 7.225   22.324  28.337  1.00 24.35 ? 208 VAL A CG2   1 
ATOM   1829 N N     . SER C 3 149 ? 11.308  20.719  27.085  1.00 24.41 ? 209 SER A N     1 
ATOM   1830 C CA    . SER C 3 149 ? 12.583  20.022  27.204  1.00 24.85 ? 209 SER A CA    1 
ATOM   1831 C C     . SER C 3 149 ? 13.821  20.854  26.878  1.00 24.84 ? 209 SER A C     1 
ATOM   1832 O O     . SER C 3 149 ? 14.937  20.475  27.247  1.00 24.24 ? 209 SER A O     1 
ATOM   1833 C CB    . SER C 3 149 ? 12.576  18.808  26.277  1.00 26.70 ? 209 SER A CB    1 
ATOM   1834 O OG    . SER C 3 149 ? 12.399  19.216  24.919  1.00 26.53 ? 209 SER A OG    1 
ATOM   1835 N N     . GLY C 3 150 ? 13.630  21.969  26.181  1.00 21.91 ? 210 GLY A N     1 
ATOM   1836 C CA    . GLY C 3 150 ? 14.763  22.785  25.783  1.00 22.27 ? 210 GLY A CA    1 
ATOM   1837 C C     . GLY C 3 150 ? 15.159  22.460  24.339  1.00 21.61 ? 210 GLY A C     1 
ATOM   1838 O O     . GLY C 3 150 ? 16.111  23.028  23.809  1.00 20.61 ? 210 GLY A O     1 
ATOM   1839 N N     . LYS C 3 151 ? 14.450  21.524  23.710  1.00 21.84 ? 211 LYS A N     1 
ATOM   1840 C CA    . LYS C 3 151 ? 14.726  21.170  22.309  1.00 22.12 ? 211 LYS A CA    1 
ATOM   1841 C C     . LYS C 3 151 ? 14.049  22.245  21.469  1.00 20.93 ? 211 LYS A C     1 
ATOM   1842 O O     . LYS C 3 151 ? 12.942  22.669  21.792  1.00 19.24 ? 211 LYS A O     1 
ATOM   1843 C CB    . LYS C 3 151 ? 14.133  19.803  21.951  1.00 24.50 ? 211 LYS A CB    1 
ATOM   1844 C CG    . LYS C 3 151 ? 14.793  18.596  22.620  1.00 30.26 ? 211 LYS A CG    1 
ATOM   1845 C CD    . LYS C 3 151 ? 16.212  18.387  22.128  1.00 34.61 ? 211 LYS A CD    1 
ATOM   1846 C CE    . LYS C 3 151 ? 16.687  16.955  22.371  1.00 37.03 ? 211 LYS A CE    1 
ATOM   1847 N NZ    . LYS C 3 151 ? 16.671  16.586  23.812  1.00 37.66 ? 211 LYS A NZ    1 
ATOM   1848 N N     . ILE C 3 152 ? 14.698  22.665  20.385  1.00 18.19 ? 212 ILE A N     1 
ATOM   1849 C CA    . ILE C 3 152 ? 14.164  23.719  19.521  1.00 16.06 ? 212 ILE A CA    1 
ATOM   1850 C C     . ILE C 3 152 ? 14.151  23.308  18.040  1.00 15.97 ? 212 ILE A C     1 
ATOM   1851 O O     . ILE C 3 152 ? 15.081  22.661  17.581  1.00 16.43 ? 212 ILE A O     1 
ATOM   1852 C CB    . ILE C 3 152 ? 15.064  24.998  19.601  1.00 17.18 ? 212 ILE A CB    1 
ATOM   1853 C CG1   . ILE C 3 152 ? 15.391  25.341  21.061  1.00 21.13 ? 212 ILE A CG1   1 
ATOM   1854 C CG2   . ILE C 3 152 ? 14.384  26.165  18.889  1.00 16.19 ? 212 ILE A CG2   1 
ATOM   1855 C CD1   . ILE C 3 152 ? 14.195  25.794  21.883  1.00 22.87 ? 212 ILE A CD1   1 
ATOM   1856 N N     . VAL C 3 153 ? 13.092  23.664  17.315  1.00 15.32 ? 213 VAL A N     1 
ATOM   1857 C CA    . VAL C 3 153 ? 13.017  23.411  15.881  1.00 14.84 ? 213 VAL A CA    1 
ATOM   1858 C C     . VAL C 3 153 ? 12.942  24.790  15.231  1.00 15.28 ? 213 VAL A C     1 
ATOM   1859 O O     . VAL C 3 153 ? 12.217  25.670  15.715  1.00 16.98 ? 213 VAL A O     1 
ATOM   1860 C CB    . VAL C 3 153 ? 11.750  22.581  15.492  1.00 17.07 ? 213 VAL A CB    1 
ATOM   1861 C CG1   . VAL C 3 153 ? 11.532  22.598  13.980  1.00 15.65 ? 213 VAL A CG1   1 
ATOM   1862 C CG2   . VAL C 3 153 ? 11.928  21.142  15.928  1.00 17.32 ? 213 VAL A CG2   1 
ATOM   1863 N N     . LEU C 3 154 ? 13.687  24.990  14.144  1.00 14.47 ? 214 LEU A N     1 
ATOM   1864 C CA    . LEU C 3 154 ? 13.667  26.267  13.439  1.00 14.27 ? 214 LEU A CA    1 
ATOM   1865 C C     . LEU C 3 154 ? 13.387  25.984  11.959  1.00 14.77 ? 214 LEU A C     1 
ATOM   1866 O O     . LEU C 3 154 ? 14.035  25.126  11.359  1.00 14.68 ? 214 LEU A O     1 
ATOM   1867 C CB    . LEU C 3 154 ? 15.018  26.987  13.588  1.00 15.34 ? 214 LEU A CB    1 
ATOM   1868 C CG    . LEU C 3 154 ? 15.478  27.278  15.025  1.00 16.70 ? 214 LEU A CG    1 
ATOM   1869 C CD1   . LEU C 3 154 ? 16.421  26.179  15.516  1.00 16.47 ? 214 LEU A CD1   1 
ATOM   1870 C CD2   . LEU C 3 154 ? 16.174  28.641  15.063  1.00 14.45 ? 214 LEU A CD2   1 
ATOM   1871 N N     . THR C 3 155 ? 12.438  26.703  11.364  1.00 14.12 ? 215 THR A N     1 
ATOM   1872 C CA    . THR C 3 155 ? 12.097  26.458  9.971   1.00 13.84 ? 215 THR A CA    1 
ATOM   1873 C C     . THR C 3 155 ? 11.687  27.719  9.218   1.00 15.03 ? 215 THR A C     1 
ATOM   1874 O O     . THR C 3 155 ? 11.443  28.768  9.828   1.00 15.59 ? 215 THR A O     1 
ATOM   1875 C CB    . THR C 3 155 ? 10.947  25.406  9.867   1.00 14.98 ? 215 THR A CB    1 
ATOM   1876 O OG1   . THR C 3 155 ? 10.782  25.015  8.502   1.00 14.91 ? 215 THR A OG1   1 
ATOM   1877 C CG2   . THR C 3 155 ? 9.616   25.980  10.367  1.00 18.48 ? 215 THR A CG2   1 
ATOM   1878 N N     . GLY C 3 156 ? 11.636  27.600  7.892   1.00 13.87 ? 216 GLY A N     1 
ATOM   1879 C CA    . GLY C 3 156 ? 11.253  28.702  7.031   1.00 14.45 ? 216 GLY A CA    1 
ATOM   1880 C C     . GLY C 3 156 ? 12.409  29.463  6.409   1.00 15.67 ? 216 GLY A C     1 
ATOM   1881 O O     . GLY C 3 156 ? 12.201  30.479  5.754   1.00 16.19 ? 216 GLY A O     1 
ATOM   1882 N N     . ALA C 3 157 ? 13.630  28.975  6.590   1.00 14.20 ? 217 ALA A N     1 
ATOM   1883 C CA    . ALA C 3 157 ? 14.802  29.655  6.045   1.00 15.21 ? 217 ALA A CA    1 
ATOM   1884 C C     . ALA C 3 157 ? 15.069  29.390  4.567   1.00 15.49 ? 217 ALA A C     1 
ATOM   1885 O O     . ALA C 3 157 ? 14.801  28.298  4.066   1.00 15.07 ? 217 ALA A O     1 
ATOM   1886 C CB    . ALA C 3 157 ? 16.037  29.262  6.857   1.00 12.63 ? 217 ALA A CB    1 
ATOM   1887 N N     . LYS C 3 158 ? 15.599  30.408  3.890   1.00 13.41 ? 218 LYS A N     1 
ATOM   1888 C CA    . LYS C 3 158 ? 16.002  30.325  2.487   1.00 15.76 ? 218 LYS A CA    1 
ATOM   1889 C C     . LYS C 3 158 ? 17.521  30.064  2.463   1.00 16.50 ? 218 LYS A C     1 
ATOM   1890 O O     . LYS C 3 158 ? 18.052  29.560  1.482   1.00 15.84 ? 218 LYS A O     1 
ATOM   1891 C CB    . LYS C 3 158 ? 15.678  31.632  1.750   1.00 19.41 ? 218 LYS A CB    1 
ATOM   1892 C CG    . LYS C 3 158 ? 14.218  31.773  1.311   1.00 23.68 ? 218 LYS A CG    1 
ATOM   1893 C CD    . LYS C 3 158 ? 13.960  30.930  0.048   1.00 27.13 ? 218 LYS A CD    1 
ATOM   1894 C CE    . LYS C 3 158 ? 12.608  31.219  -0.588  1.00 29.02 ? 218 LYS A CE    1 
ATOM   1895 N NZ    . LYS C 3 158 ? 11.461  30.770  0.257   1.00 32.57 ? 218 LYS A NZ    1 
ATOM   1896 N N     . GLN C 3 159 ? 18.220  30.436  3.536   1.00 14.91 ? 219 GLN A N     1 
ATOM   1897 C CA    . GLN C 3 159 ? 19.665  30.160  3.632   1.00 15.02 ? 219 GLN A CA    1 
ATOM   1898 C C     . GLN C 3 159 ? 19.989  29.814  5.084   1.00 13.85 ? 219 GLN A C     1 
ATOM   1899 O O     . GLN C 3 159 ? 19.350  30.318  6.012   1.00 12.87 ? 219 GLN A O     1 
ATOM   1900 C CB    . GLN C 3 159 ? 20.514  31.338  3.115   1.00 17.91 ? 219 GLN A CB    1 
ATOM   1901 C CG    . GLN C 3 159 ? 20.567  32.594  3.974   1.00 20.71 ? 219 GLN A CG    1 
ATOM   1902 C CD    . GLN C 3 159 ? 21.251  33.754  3.246   1.00 23.68 ? 219 GLN A CD    1 
ATOM   1903 O OE1   . GLN C 3 159 ? 20.616  34.469  2.462   1.00 23.91 ? 219 GLN A OE1   1 
ATOM   1904 N NE2   . GLN C 3 159 ? 22.550  33.931  3.486   1.00 21.15 ? 219 GLN A NE2   1 
ATOM   1905 N N     . ARG C 3 160 ? 20.982  28.953  5.289   1.00 12.21 ? 220 ARG A N     1 
ATOM   1906 C CA    . ARG C 3 160 ? 21.300  28.498  6.633   1.00 13.46 ? 220 ARG A CA    1 
ATOM   1907 C C     . ARG C 3 160 ? 21.619  29.584  7.660   1.00 13.94 ? 220 ARG A C     1 
ATOM   1908 O O     . ARG C 3 160 ? 21.319  29.427  8.844   1.00 12.57 ? 220 ARG A O     1 
ATOM   1909 C CB    . ARG C 3 160 ? 22.430  27.454  6.593   1.00 12.89 ? 220 ARG A CB    1 
ATOM   1910 C CG    . ARG C 3 160 ? 23.818  27.974  6.280   1.00 12.52 ? 220 ARG A CG    1 
ATOM   1911 C CD    . ARG C 3 160 ? 24.854  26.954  6.770   1.00 11.98 ? 220 ARG A CD    1 
ATOM   1912 N NE    . ARG C 3 160 ? 24.957  25.800  5.883   1.00 13.23 ? 220 ARG A NE    1 
ATOM   1913 C CZ    . ARG C 3 160 ? 25.600  24.681  6.194   1.00 11.73 ? 220 ARG A CZ    1 
ATOM   1914 N NH1   . ARG C 3 160 ? 26.186  24.560  7.381   1.00 14.30 ? 220 ARG A NH1   1 
ATOM   1915 N NH2   . ARG C 3 160 ? 25.702  23.704  5.300   1.00 12.54 ? 220 ARG A NH2   1 
ATOM   1916 N N     . GLU C 3 161 ? 22.213  30.685  7.219   1.00 13.22 ? 221 GLU A N     1 
ATOM   1917 C CA    . GLU C 3 161 ? 22.541  31.757  8.149   1.00 13.88 ? 221 GLU A CA    1 
ATOM   1918 C C     . GLU C 3 161 ? 21.298  32.292  8.870   1.00 14.37 ? 221 GLU A C     1 
ATOM   1919 O O     . GLU C 3 161 ? 21.396  32.811  9.980   1.00 15.93 ? 221 GLU A O     1 
ATOM   1920 C CB    . GLU C 3 161 ? 23.253  32.897  7.410   1.00 12.88 ? 221 GLU A CB    1 
ATOM   1921 C CG    . GLU C 3 161 ? 24.663  32.550  6.913   1.00 14.38 ? 221 GLU A CG    1 
ATOM   1922 C CD    . GLU C 3 161 ? 24.697  31.605  5.707   1.00 16.11 ? 221 GLU A CD    1 
ATOM   1923 O OE1   . GLU C 3 161 ? 23.728  31.577  4.918   1.00 15.61 ? 221 GLU A OE1   1 
ATOM   1924 O OE2   . GLU C 3 161 ? 25.717  30.904  5.535   1.00 17.92 ? 221 GLU A OE2   1 
ATOM   1925 N N     . GLU C 3 162 ? 20.130  32.168  8.243   1.00 14.58 ? 222 GLU A N     1 
ATOM   1926 C CA    . GLU C 3 162 ? 18.897  32.626  8.877   1.00 15.46 ? 222 GLU A CA    1 
ATOM   1927 C C     . GLU C 3 162 ? 18.553  31.731  10.068  1.00 15.01 ? 222 GLU A C     1 
ATOM   1928 O O     . GLU C 3 162 ? 18.051  32.205  11.091  1.00 15.89 ? 222 GLU A O     1 
ATOM   1929 C CB    . GLU C 3 162 ? 17.752  32.654  7.858   1.00 15.25 ? 222 GLU A CB    1 
ATOM   1930 C CG    . GLU C 3 162 ? 18.004  33.664  6.736   1.00 17.21 ? 222 GLU A CG    1 
ATOM   1931 C CD    . GLU C 3 162 ? 17.027  33.535  5.572   1.00 22.46 ? 222 GLU A CD    1 
ATOM   1932 O OE1   . GLU C 3 162 ? 16.292  32.543  5.512   1.00 19.94 ? 222 GLU A OE1   1 
ATOM   1933 O OE2   . GLU C 3 162 ? 17.003  34.429  4.705   1.00 23.96 ? 222 GLU A OE2   1 
ATOM   1934 N N     . ILE C 3 163 ? 18.815  30.436  9.928   1.00 15.55 ? 223 ILE A N     1 
ATOM   1935 C CA    . ILE C 3 163 ? 18.585  29.503  11.027  1.00 14.75 ? 223 ILE A CA    1 
ATOM   1936 C C     . ILE C 3 163 ? 19.525  29.896  12.176  1.00 15.50 ? 223 ILE A C     1 
ATOM   1937 O O     . ILE C 3 163 ? 19.115  29.991  13.332  1.00 14.21 ? 223 ILE A O     1 
ATOM   1938 C CB    . ILE C 3 163 ? 18.919  28.043  10.602  1.00 13.59 ? 223 ILE A CB    1 
ATOM   1939 C CG1   . ILE C 3 163 ? 17.932  27.560  9.530   1.00 14.41 ? 223 ILE A CG1   1 
ATOM   1940 C CG2   . ILE C 3 163 ? 18.924  27.123  11.828  1.00 12.83 ? 223 ILE A CG2   1 
ATOM   1941 C CD1   . ILE C 3 163 ? 16.474  27.582  9.963   1.00 17.16 ? 223 ILE A CD1   1 
ATOM   1942 N N     . TYR C 3 164 ? 20.794  30.135  11.854  1.00 15.60 ? 224 TYR A N     1 
ATOM   1943 C CA    . TYR C 3 164 ? 21.763  30.484  12.894  1.00 16.51 ? 224 TYR A CA    1 
ATOM   1944 C C     . TYR C 3 164 ? 21.429  31.787  13.602  1.00 16.27 ? 224 TYR A C     1 
ATOM   1945 O O     . TYR C 3 164 ? 21.470  31.856  14.832  1.00 17.52 ? 224 TYR A O     1 
ATOM   1946 C CB    . TYR C 3 164 ? 23.179  30.576  12.313  1.00 16.56 ? 224 TYR A CB    1 
ATOM   1947 C CG    . TYR C 3 164 ? 23.668  29.304  11.660  1.00 17.02 ? 224 TYR A CG    1 
ATOM   1948 C CD1   . TYR C 3 164 ? 23.199  28.046  12.071  1.00 15.15 ? 224 TYR A CD1   1 
ATOM   1949 C CD2   . TYR C 3 164 ? 24.637  29.352  10.655  1.00 17.07 ? 224 TYR A CD2   1 
ATOM   1950 C CE1   . TYR C 3 164 ? 23.696  26.867  11.487  1.00 14.74 ? 224 TYR A CE1   1 
ATOM   1951 C CE2   . TYR C 3 164 ? 25.137  28.198  10.081  1.00 16.21 ? 224 TYR A CE2   1 
ATOM   1952 C CZ    . TYR C 3 164 ? 24.670  26.959  10.500  1.00 16.16 ? 224 TYR A CZ    1 
ATOM   1953 O OH    . TYR C 3 164 ? 25.228  25.828  9.963   1.00 14.91 ? 224 TYR A OH    1 
ATOM   1954 N N     . GLN C 3 165 ? 21.099  32.823  12.838  1.00 17.20 ? 225 GLN A N     1 
ATOM   1955 C CA    . GLN C 3 165 ? 20.764  34.105  13.449  1.00 18.65 ? 225 GLN A CA    1 
ATOM   1956 C C     . GLN C 3 165 ? 19.485  34.046  14.289  1.00 18.56 ? 225 GLN A C     1 
ATOM   1957 O O     . GLN C 3 165 ? 19.391  34.703  15.336  1.00 18.11 ? 225 GLN A O     1 
ATOM   1958 C CB    . GLN C 3 165 ? 20.671  35.192  12.374  1.00 19.01 ? 225 GLN A CB    1 
ATOM   1959 C CG    . GLN C 3 165 ? 22.036  35.480  11.728  1.00 19.09 ? 225 GLN A CG    1 
ATOM   1960 C CD    . GLN C 3 165 ? 22.146  36.903  11.202  1.00 21.87 ? 225 GLN A CD    1 
ATOM   1961 O OE1   . GLN C 3 165 ? 21.396  37.311  10.314  1.00 23.83 ? 225 GLN A OE1   1 
ATOM   1962 N NE2   . GLN C 3 165 ? 23.083  37.667  11.758  1.00 20.59 ? 225 GLN A NE2   1 
ATOM   1963 N N     . ALA C 3 166 ? 18.506  33.263  13.845  1.00 17.42 ? 226 ALA A N     1 
ATOM   1964 C CA    . ALA C 3 166 ? 17.261  33.111  14.603  1.00 17.24 ? 226 ALA A CA    1 
ATOM   1965 C C     . ALA C 3 166 ? 17.546  32.467  15.961  1.00 19.90 ? 226 ALA A C     1 
ATOM   1966 O O     . ALA C 3 166 ? 16.982  32.877  16.981  1.00 20.66 ? 226 ALA A O     1 
ATOM   1967 C CB    . ALA C 3 166 ? 16.244  32.252  13.811  1.00 17.72 ? 226 ALA A CB    1 
ATOM   1968 N N     . PHE C 3 167 ? 18.413  31.455  15.992  1.00 18.15 ? 227 PHE A N     1 
ATOM   1969 C CA    . PHE C 3 167 ? 18.726  30.822  17.267  1.00 20.16 ? 227 PHE A CA    1 
ATOM   1970 C C     . PHE C 3 167 ? 19.473  31.793  18.189  1.00 21.04 ? 227 PHE A C     1 
ATOM   1971 O O     . PHE C 3 167 ? 19.224  31.852  19.402  1.00 20.72 ? 227 PHE A O     1 
ATOM   1972 C CB    . PHE C 3 167 ? 19.583  29.571  17.084  1.00 19.39 ? 227 PHE A CB    1 
ATOM   1973 C CG    . PHE C 3 167 ? 19.932  28.912  18.382  1.00 22.94 ? 227 PHE A CG    1 
ATOM   1974 C CD1   . PHE C 3 167 ? 18.942  28.300  19.145  1.00 22.17 ? 227 PHE A CD1   1 
ATOM   1975 C CD2   . PHE C 3 167 ? 21.229  28.961  18.877  1.00 24.00 ? 227 PHE A CD2   1 
ATOM   1976 C CE1   . PHE C 3 167 ? 19.236  27.745  20.390  1.00 24.72 ? 227 PHE A CE1   1 
ATOM   1977 C CE2   . PHE C 3 167 ? 21.537  28.411  20.119  1.00 26.39 ? 227 PHE A CE2   1 
ATOM   1978 C CZ    . PHE C 3 167 ? 20.538  27.802  20.879  1.00 26.90 ? 227 PHE A CZ    1 
ATOM   1979 N N     . GLU C 3 168 ? 20.405  32.543  17.617  1.00 20.67 ? 228 GLU A N     1 
ATOM   1980 C CA    . GLU C 3 168 ? 21.160  33.503  18.409  1.00 22.79 ? 228 GLU A CA    1 
ATOM   1981 C C     . GLU C 3 168 ? 20.222  34.523  19.038  1.00 24.43 ? 228 GLU A C     1 
ATOM   1982 O O     . GLU C 3 168 ? 20.398  34.904  20.199  1.00 24.40 ? 228 GLU A O     1 
ATOM   1983 C CB    . GLU C 3 168 ? 22.193  34.211  17.538  1.00 24.14 ? 228 GLU A CB    1 
ATOM   1984 C CG    . GLU C 3 168 ? 23.351  33.310  17.141  1.00 30.63 ? 228 GLU A CG    1 
ATOM   1985 C CD    . GLU C 3 168 ? 24.046  32.718  18.349  1.00 37.46 ? 228 GLU A CD    1 
ATOM   1986 O OE1   . GLU C 3 168 ? 23.992  31.481  18.527  1.00 40.15 ? 228 GLU A OE1   1 
ATOM   1987 O OE2   . GLU C 3 168 ? 24.638  33.496  19.129  1.00 42.88 ? 228 GLU A OE2   1 
ATOM   1988 N N     . ALA C 3 169 ? 19.229  34.960  18.270  1.00 25.08 ? 229 ALA A N     1 
ATOM   1989 C CA    . ALA C 3 169 ? 18.258  35.934  18.750  1.00 26.00 ? 229 ALA A CA    1 
ATOM   1990 C C     . ALA C 3 169 ? 17.355  35.350  19.836  1.00 26.87 ? 229 ALA A C     1 
ATOM   1991 O O     . ALA C 3 169 ? 16.985  36.052  20.774  1.00 25.96 ? 229 ALA A O     1 
ATOM   1992 C CB    . ALA C 3 169 ? 17.409  36.449  17.589  1.00 27.18 ? 229 ALA A CB    1 
ATOM   1993 N N     . ILE C 3 170 ? 17.004  34.071  19.720  1.00 24.70 ? 230 ILE A N     1 
ATOM   1994 C CA    . ILE C 3 170 ? 16.126  33.451  20.712  1.00 24.43 ? 230 ILE A CA    1 
ATOM   1995 C C     . ILE C 3 170 ? 16.815  32.948  21.982  1.00 24.76 ? 230 ILE A C     1 
ATOM   1996 O O     . ILE C 3 170 ? 16.168  32.818  23.023  1.00 24.03 ? 230 ILE A O     1 
ATOM   1997 C CB    . ILE C 3 170 ? 15.329  32.250  20.097  1.00 23.48 ? 230 ILE A CB    1 
ATOM   1998 C CG1   . ILE C 3 170 ? 14.040  32.014  20.891  1.00 23.45 ? 230 ILE A CG1   1 
ATOM   1999 C CG2   . ILE C 3 170 ? 16.155  30.975  20.146  1.00 21.46 ? 230 ILE A CG2   1 
ATOM   2000 C CD1   . ILE C 3 170 ? 12.990  33.085  20.676  1.00 25.03 ? 230 ILE A CD1   1 
ATOM   2001 N N     . TYR C 3 171 ? 18.116  32.680  21.914  1.00 23.81 ? 231 TYR A N     1 
ATOM   2002 C CA    . TYR C 3 171 ? 18.805  32.125  23.071  1.00 27.98 ? 231 TYR A CA    1 
ATOM   2003 C C     . TYR C 3 171 ? 18.649  32.911  24.378  1.00 29.10 ? 231 TYR A C     1 
ATOM   2004 O O     . TYR C 3 171 ? 18.331  32.330  25.420  1.00 28.50 ? 231 TYR A O     1 
ATOM   2005 C CB    . TYR C 3 171 ? 20.290  31.909  22.777  1.00 28.06 ? 231 TYR A CB    1 
ATOM   2006 C CG    . TYR C 3 171 ? 20.938  31.084  23.857  1.00 33.20 ? 231 TYR A CG    1 
ATOM   2007 C CD1   . TYR C 3 171 ? 20.667  29.718  23.970  1.00 34.28 ? 231 TYR A CD1   1 
ATOM   2008 C CD2   . TYR C 3 171 ? 21.749  31.677  24.824  1.00 35.33 ? 231 TYR A CD2   1 
ATOM   2009 C CE1   . TYR C 3 171 ? 21.180  28.968  25.015  1.00 35.92 ? 231 TYR A CE1   1 
ATOM   2010 C CE2   . TYR C 3 171 ? 22.266  30.930  25.882  1.00 37.41 ? 231 TYR A CE2   1 
ATOM   2011 C CZ    . TYR C 3 171 ? 21.977  29.580  25.969  1.00 37.53 ? 231 TYR A CZ    1 
ATOM   2012 O OH    . TYR C 3 171 ? 22.487  28.837  27.008  1.00 39.09 ? 231 TYR A OH    1 
ATOM   2013 N N     . PRO C 3 172 ? 18.879  34.233  24.344  1.00 29.98 ? 232 PRO A N     1 
ATOM   2014 C CA    . PRO C 3 172 ? 18.737  35.030  25.569  1.00 30.15 ? 232 PRO A CA    1 
ATOM   2015 C C     . PRO C 3 172 ? 17.335  34.891  26.159  1.00 30.95 ? 232 PRO A C     1 
ATOM   2016 O O     . PRO C 3 172 ? 17.167  34.850  27.377  1.00 28.91 ? 232 PRO A O     1 
ATOM   2017 C CB    . PRO C 3 172 ? 19.028  36.449  25.091  1.00 31.33 ? 232 PRO A CB    1 
ATOM   2018 C CG    . PRO C 3 172 ? 20.019  36.227  23.984  1.00 32.97 ? 232 PRO A CG    1 
ATOM   2019 C CD    . PRO C 3 172 ? 19.419  35.052  23.243  1.00 27.97 ? 232 PRO A CD    1 
ATOM   2020 N N     . VAL C 3 173 ? 16.332  34.813  25.288  1.00 30.88 ? 233 VAL A N     1 
ATOM   2021 C CA    . VAL C 3 173 ? 14.948  34.666  25.722  1.00 31.86 ? 233 VAL A CA    1 
ATOM   2022 C C     . VAL C 3 173 ? 14.723  33.315  26.405  1.00 32.50 ? 233 VAL A C     1 
ATOM   2023 O O     . VAL C 3 173 ? 14.027  33.230  27.413  1.00 31.97 ? 233 VAL A O     1 
ATOM   2024 C CB    . VAL C 3 173 ? 13.978  34.791  24.530  1.00 32.89 ? 233 VAL A CB    1 
ATOM   2025 C CG1   . VAL C 3 173 ? 12.540  34.652  25.005  1.00 33.80 ? 233 VAL A CG1   1 
ATOM   2026 C CG2   . VAL C 3 173 ? 14.180  36.124  23.836  1.00 33.46 ? 233 VAL A CG2   1 
ATOM   2027 N N     . LEU C 3 174 ? 15.309  32.258  25.853  1.00 31.78 ? 234 LEU A N     1 
ATOM   2028 C CA    . LEU C 3 174 ? 15.165  30.929  26.437  1.00 32.61 ? 234 LEU A CA    1 
ATOM   2029 C C     . LEU C 3 174 ? 15.775  30.905  27.837  1.00 34.20 ? 234 LEU A C     1 
ATOM   2030 O O     . LEU C 3 174 ? 15.190  30.351  28.772  1.00 32.65 ? 234 LEU A O     1 
ATOM   2031 C CB    . LEU C 3 174 ? 15.857  29.877  25.561  1.00 31.23 ? 234 LEU A CB    1 
ATOM   2032 C CG    . LEU C 3 174 ? 15.293  29.712  24.147  1.00 30.34 ? 234 LEU A CG    1 
ATOM   2033 C CD1   . LEU C 3 174 ? 16.092  28.656  23.385  1.00 28.75 ? 234 LEU A CD1   1 
ATOM   2034 C CD2   . LEU C 3 174 ? 13.830  29.313  24.243  1.00 28.89 ? 234 LEU A CD2   1 
ATOM   2035 N N     . SER C 3 175 ? 16.958  31.499  27.967  1.00 35.45 ? 235 SER A N     1 
ATOM   2036 C CA    . SER C 3 175 ? 17.655  31.557  29.247  1.00 38.30 ? 235 SER A CA    1 
ATOM   2037 C C     . SER C 3 175 ? 16.828  32.359  30.237  1.00 38.17 ? 235 SER A C     1 
ATOM   2038 O O     . SER C 3 175 ? 16.762  32.021  31.415  1.00 39.05 ? 235 SER A O     1 
ATOM   2039 C CB    . SER C 3 175 ? 19.033  32.209  29.082  1.00 40.86 ? 235 SER A CB    1 
ATOM   2040 O OG    . SER C 3 175 ? 20.074  31.257  29.240  1.00 45.64 ? 235 SER A OG    1 
ATOM   2041 N N     . GLU C 3 176 ? 16.198  33.422  29.749  1.00 38.57 ? 236 GLU A N     1 
ATOM   2042 C CA    . GLU C 3 176 ? 15.365  34.276  30.585  1.00 38.83 ? 236 GLU A CA    1 
ATOM   2043 C C     . GLU C 3 176 ? 14.217  33.479  31.195  1.00 38.63 ? 236 GLU A C     1 
ATOM   2044 O O     . GLU C 3 176 ? 13.774  33.758  32.315  1.00 37.56 ? 236 GLU A O     1 
ATOM   2045 C CB    . GLU C 3 176 ? 14.808  35.436  29.755  1.00 41.70 ? 236 GLU A CB    1 
ATOM   2046 C CG    . GLU C 3 176 ? 13.997  36.438  30.561  1.00 47.39 ? 236 GLU A CG    1 
ATOM   2047 C CD    . GLU C 3 176 ? 13.585  37.648  29.748  1.00 51.55 ? 236 GLU A CD    1 
ATOM   2048 O OE1   . GLU C 3 176 ? 14.140  37.845  28.646  1.00 53.17 ? 236 GLU A OE1   1 
ATOM   2049 O OE2   . GLU C 3 176 ? 12.715  38.409  30.219  1.00 54.13 ? 236 GLU A OE2   1 
ATOM   2050 N N     . PHE C 3 177 ? 13.740  32.478  30.464  1.00 36.24 ? 237 PHE A N     1 
ATOM   2051 C CA    . PHE C 3 177 ? 12.638  31.666  30.948  1.00 35.54 ? 237 PHE A CA    1 
ATOM   2052 C C     . PHE C 3 177 ? 13.015  30.232  31.290  1.00 35.04 ? 237 PHE A C     1 
ATOM   2053 O O     . PHE C 3 177 ? 12.210  29.315  31.154  1.00 35.12 ? 237 PHE A O     1 
ATOM   2054 C CB    . PHE C 3 177 ? 11.497  31.718  29.930  1.00 36.14 ? 237 PHE A CB    1 
ATOM   2055 C CG    . PHE C 3 177 ? 10.853  33.072  29.836  1.00 37.20 ? 237 PHE A CG    1 
ATOM   2056 C CD1   . PHE C 3 177 ? 9.880   33.455  30.755  1.00 37.91 ? 237 PHE A CD1   1 
ATOM   2057 C CD2   . PHE C 3 177 ? 11.262  33.989  28.870  1.00 38.09 ? 237 PHE A CD2   1 
ATOM   2058 C CE1   . PHE C 3 177 ? 9.323   34.735  30.716  1.00 39.67 ? 237 PHE A CE1   1 
ATOM   2059 C CE2   . PHE C 3 177 ? 10.714  35.273  28.821  1.00 39.31 ? 237 PHE A CE2   1 
ATOM   2060 C CZ    . PHE C 3 177 ? 9.742   35.646  29.748  1.00 39.49 ? 237 PHE A CZ    1 
ATOM   2061 N N     . ARG C 3 178 ? 14.247  30.045  31.747  1.00 35.60 ? 238 ARG A N     1 
ATOM   2062 C CA    . ARG C 3 178 ? 14.710  28.720  32.137  1.00 37.38 ? 238 ARG A CA    1 
ATOM   2063 C C     . ARG C 3 178 ? 13.880  28.268  33.345  1.00 39.44 ? 238 ARG A C     1 
ATOM   2064 O O     . ARG C 3 178 ? 13.481  29.091  34.172  1.00 38.12 ? 238 ARG A O     1 
ATOM   2065 C CB    . ARG C 3 178 ? 16.196  28.768  32.497  1.00 35.49 ? 238 ARG A CB    1 
ATOM   2066 C CG    . ARG C 3 178 ? 16.768  27.432  32.932  1.00 36.08 ? 238 ARG A CG    1 
ATOM   2067 C CD    . ARG C 3 178 ? 18.272  27.510  33.134  1.00 36.07 ? 238 ARG A CD    1 
ATOM   2068 N NE    . ARG C 3 178 ? 18.830  26.221  33.535  1.00 38.66 ? 238 ARG A NE    1 
ATOM   2069 C CZ    . ARG C 3 178 ? 20.130  25.944  33.561  1.00 40.74 ? 238 ARG A CZ    1 
ATOM   2070 N NH1   . ARG C 3 178 ? 21.014  26.867  33.208  1.00 43.22 ? 238 ARG A NH1   1 
ATOM   2071 N NH2   . ARG C 3 178 ? 20.549  24.740  33.932  1.00 41.34 ? 238 ARG A NH2   1 
ATOM   2072 N N     . LYS C 3 179 ? 13.616  26.968  33.441  1.00 41.83 ? 239 LYS A N     1 
ATOM   2073 C CA    . LYS C 3 179 ? 12.814  26.429  34.540  1.00 46.47 ? 239 LYS A CA    1 
ATOM   2074 C C     . LYS C 3 179 ? 13.610  26.060  35.796  1.00 48.58 ? 239 LYS A C     1 
ATOM   2075 O O     . LYS C 3 179 ? 14.674  25.446  35.711  1.00 49.83 ? 239 LYS A O     1 
ATOM   2076 C CB    . LYS C 3 179 ? 12.038  25.202  34.061  1.00 46.99 ? 239 LYS A CB    1 
ATOM   2077 C CG    . LYS C 3 179 ? 11.279  24.500  35.167  1.00 47.82 ? 239 LYS A CG    1 
ATOM   2078 C CD    . LYS C 3 179 ? 10.608  23.233  34.681  1.00 48.60 ? 239 LYS A CD    1 
ATOM   2079 C CE    . LYS C 3 179 ? 9.414   23.523  33.788  1.00 49.28 ? 239 LYS A CE    1 
ATOM   2080 N NZ    . LYS C 3 179 ? 8.696   22.260  33.436  1.00 51.14 ? 239 LYS A NZ    1 
ATOM   2081 N N     . MET C 3 180 ? 13.062  26.424  36.956  1.00 50.28 ? 240 MET A N     1 
ATOM   2082 C CA    . MET C 3 180 ? 13.674  26.161  38.262  1.00 52.48 ? 240 MET A CA    1 
ATOM   2083 C C     . MET C 3 180 ? 15.149  26.547  38.268  1.00 53.02 ? 240 MET A C     1 
ATOM   2084 O O     . MET C 3 180 ? 15.441  27.713  37.931  1.00 52.23 ? 240 MET A O     1 
ATOM   2085 C CB    . MET C 3 180 ? 13.518  24.682  38.641  1.00 53.76 ? 240 MET A CB    1 
ATOM   2086 C CG    . MET C 3 180 ? 13.875  24.352  40.098  1.00 56.67 ? 240 MET A CG    1 
ATOM   2087 S SD    . MET C 3 180 ? 12.667  24.950  41.322  1.00 61.40 ? 240 MET A SD    1 
ATOM   2088 C CE    . MET C 3 180 ? 13.314  24.230  42.853  1.00 57.42 ? 240 MET A CE    1 
ATOM   2089 O OXT   . MET C 3 180 ? 15.988  25.689  38.618  1.00 61.29 ? 240 MET A OXT   1 
ATOM   2090 N N     . ASN D 4 2   ? 5.511   -29.208 -0.050  1.00 48.49 ? 3   ASN B N     1 
ATOM   2091 C CA    . ASN D 4 2   ? 4.738   -29.473 1.195   1.00 48.74 ? 3   ASN B CA    1 
ATOM   2092 C C     . ASN D 4 2   ? 3.268   -29.776 0.903   1.00 47.75 ? 3   ASN B C     1 
ATOM   2093 O O     . ASN D 4 2   ? 2.725   -29.380 -0.129  1.00 48.18 ? 3   ASN B O     1 
ATOM   2094 C CB    . ASN D 4 2   ? 4.859   -28.279 2.143   1.00 49.32 ? 3   ASN B CB    1 
ATOM   2095 C CG    . ASN D 4 2   ? 4.422   -26.983 1.499   1.00 50.18 ? 3   ASN B CG    1 
ATOM   2096 O OD1   . ASN D 4 2   ? 3.228   -26.725 1.339   1.00 49.24 ? 3   ASN B OD1   1 
ATOM   2097 N ND2   . ASN D 4 2   ? 5.390   -26.162 1.112   1.00 51.00 ? 3   ASN B ND2   1 
ATOM   2098 N N     . ALA D 4 3   ? 2.637   -30.488 1.829   1.00 47.23 ? 4   ALA B N     1 
ATOM   2099 C CA    . ALA D 4 3   ? 1.241   -30.895 1.713   1.00 45.44 ? 4   ALA B CA    1 
ATOM   2100 C C     . ALA D 4 3   ? 0.283   -29.847 1.145   1.00 43.78 ? 4   ALA B C     1 
ATOM   2101 O O     . ALA D 4 3   ? -0.473  -30.136 0.222   1.00 43.75 ? 4   ALA B O     1 
ATOM   2102 C CB    . ALA D 4 3   ? 0.735   -31.372 3.074   1.00 46.30 ? 4   ALA B CB    1 
ATOM   2103 N N     . GLU D 4 4   ? 0.306   -28.636 1.691   1.00 42.01 ? 5   GLU B N     1 
ATOM   2104 C CA    . GLU D 4 4   ? -0.602  -27.599 1.222   1.00 39.80 ? 5   GLU B CA    1 
ATOM   2105 C C     . GLU D 4 4   ? -0.393  -27.229 -0.249  1.00 37.06 ? 5   GLU B C     1 
ATOM   2106 O O     . GLU D 4 4   ? -1.355  -27.174 -1.013  1.00 36.01 ? 5   GLU B O     1 
ATOM   2107 C CB    . GLU D 4 4   ? -0.484  -26.346 2.099   1.00 40.39 ? 5   GLU B CB    1 
ATOM   2108 C CG    . GLU D 4 4   ? -1.520  -25.274 1.773   1.00 43.53 ? 5   GLU B CG    1 
ATOM   2109 C CD    . GLU D 4 4   ? -1.453  -24.070 2.705   1.00 45.78 ? 5   GLU B CD    1 
ATOM   2110 O OE1   . GLU D 4 4   ? -0.387  -23.420 2.763   1.00 47.48 ? 5   GLU B OE1   1 
ATOM   2111 O OE2   . GLU D 4 4   ? -2.466  -23.776 3.379   1.00 45.91 ? 5   GLU B OE2   1 
ATOM   2112 N N     . ALA D 4 5   ? 0.856   -26.989 -0.642  1.00 34.85 ? 6   ALA B N     1 
ATOM   2113 C CA    . ALA D 4 5   ? 1.176   -26.604 -2.017  1.00 33.09 ? 6   ALA B CA    1 
ATOM   2114 C C     . ALA D 4 5   ? 0.880   -27.707 -3.031  1.00 32.79 ? 6   ALA B C     1 
ATOM   2115 O O     . ALA D 4 5   ? 0.296   -27.449 -4.084  1.00 29.28 ? 6   ALA B O     1 
ATOM   2116 C CB    . ALA D 4 5   ? 2.633   -26.188 -2.114  1.00 33.34 ? 6   ALA B CB    1 
ATOM   2117 N N     . SER D 4 6   ? 1.293   -28.934 -2.724  1.00 31.31 ? 7   SER B N     1 
ATOM   2118 C CA    . SER D 4 6   ? 1.035   -30.048 -3.630  1.00 31.36 ? 7   SER B CA    1 
ATOM   2119 C C     . SER D 4 6   ? -0.467  -30.153 -3.798  1.00 28.05 ? 7   SER B C     1 
ATOM   2120 O O     . SER D 4 6   ? -0.978  -30.330 -4.898  1.00 29.27 ? 7   SER B O     1 
ATOM   2121 C CB    . SER D 4 6   ? 1.567   -31.361 -3.044  1.00 33.70 ? 7   SER B CB    1 
ATOM   2122 O OG    . SER D 4 6   ? 2.932   -31.240 -2.704  1.00 37.36 ? 7   SER B OG    1 
ATOM   2123 N N     . ARG D 4 7   ? -1.167  -30.034 -2.681  1.00 28.36 ? 8   ARG B N     1 
ATOM   2124 C CA    . ARG D 4 7   ? -2.618  -30.111 -2.653  1.00 27.76 ? 8   ARG B CA    1 
ATOM   2125 C C     . ARG D 4 7   ? -3.280  -28.996 -3.477  1.00 25.24 ? 8   ARG B C     1 
ATOM   2126 O O     . ARG D 4 7   ? -4.230  -29.239 -4.227  1.00 21.64 ? 8   ARG B O     1 
ATOM   2127 C CB    . ARG D 4 7   ? -3.090  -30.035 -1.202  1.00 30.65 ? 8   ARG B CB    1 
ATOM   2128 C CG    . ARG D 4 7   ? -4.571  -30.096 -1.038  1.00 32.81 ? 8   ARG B CG    1 
ATOM   2129 C CD    . ARG D 4 7   ? -5.080  -31.532 -1.119  1.00 36.56 ? 8   ARG B CD    1 
ATOM   2130 N NE    . ARG D 4 7   ? -6.532  -31.531 -1.211  1.00 35.76 ? 8   ARG B NE    1 
ATOM   2131 C CZ    . ARG D 4 7   ? -7.223  -31.754 -2.322  1.00 35.83 ? 8   ARG B CZ    1 
ATOM   2132 N NH1   . ARG D 4 7   ? -6.604  -32.021 -3.465  1.00 37.23 ? 8   ARG B NH1   1 
ATOM   2133 N NH2   . ARG D 4 7   ? -8.543  -31.662 -2.290  1.00 34.38 ? 8   ARG B NH2   1 
ATOM   2134 N N     . VAL D 4 8   ? -2.788  -27.768 -3.334  1.00 22.31 ? 9   VAL B N     1 
ATOM   2135 C CA    . VAL D 4 8   ? -3.353  -26.652 -4.082  1.00 20.74 ? 9   VAL B CA    1 
ATOM   2136 C C     . VAL D 4 8   ? -3.157  -26.885 -5.584  1.00 19.87 ? 9   VAL B C     1 
ATOM   2137 O O     . VAL D 4 8   ? -4.066  -26.646 -6.371  1.00 18.19 ? 9   VAL B O     1 
ATOM   2138 C CB    . VAL D 4 8   ? -2.703  -25.296 -3.667  1.00 22.30 ? 9   VAL B CB    1 
ATOM   2139 C CG1   . VAL D 4 8   ? -3.003  -24.213 -4.703  1.00 21.19 ? 9   VAL B CG1   1 
ATOM   2140 C CG2   . VAL D 4 8   ? -3.241  -24.864 -2.301  1.00 24.33 ? 9   VAL B CG2   1 
ATOM   2141 N N     . TYR D 4 9   ? -1.976  -27.352 -5.977  1.00 20.03 ? 10  TYR B N     1 
ATOM   2142 C CA    . TYR D 4 9   ? -1.711  -27.602 -7.391  1.00 22.30 ? 10  TYR B CA    1 
ATOM   2143 C C     . TYR D 4 9   ? -2.634  -28.681 -7.950  1.00 23.59 ? 10  TYR B C     1 
ATOM   2144 O O     . TYR D 4 9   ? -3.089  -28.587 -9.085  1.00 22.04 ? 10  TYR B O     1 
ATOM   2145 C CB    . TYR D 4 9   ? -0.261  -28.028 -7.605  1.00 24.00 ? 10  TYR B CB    1 
ATOM   2146 C CG    . TYR D 4 9   ? 0.745   -26.906 -7.503  1.00 25.63 ? 10  TYR B CG    1 
ATOM   2147 C CD1   . TYR D 4 9   ? 2.097   -27.144 -7.743  1.00 28.17 ? 10  TYR B CD1   1 
ATOM   2148 C CD2   . TYR D 4 9   ? 0.349   -25.613 -7.151  1.00 24.84 ? 10  TYR B CD2   1 
ATOM   2149 C CE1   . TYR D 4 9   ? 3.037   -26.126 -7.632  1.00 32.67 ? 10  TYR B CE1   1 
ATOM   2150 C CE2   . TYR D 4 9   ? 1.278   -24.590 -7.036  1.00 28.22 ? 10  TYR B CE2   1 
ATOM   2151 C CZ    . TYR D 4 9   ? 2.620   -24.855 -7.274  1.00 31.09 ? 10  TYR B CZ    1 
ATOM   2152 O OH    . TYR D 4 9   ? 3.547   -23.856 -7.121  1.00 34.71 ? 10  TYR B OH    1 
ATOM   2153 N N     A GLU D 4 10  ? -2.901  -29.713 -7.159  0.50 23.53 ? 11  GLU B N     1 
ATOM   2154 N N     B GLU D 4 10  ? -2.901  -29.705 -7.147  0.50 23.57 ? 11  GLU B N     1 
ATOM   2155 C CA    A GLU D 4 10  ? -3.776  -30.786 -7.617  0.50 24.13 ? 11  GLU B CA    1 
ATOM   2156 C CA    B GLU D 4 10  ? -3.778  -30.787 -7.578  0.50 24.21 ? 11  GLU B CA    1 
ATOM   2157 C C     A GLU D 4 10  ? -5.192  -30.238 -7.788  0.50 22.22 ? 11  GLU B C     1 
ATOM   2158 C C     B GLU D 4 10  ? -5.184  -30.237 -7.782  0.50 22.31 ? 11  GLU B C     1 
ATOM   2159 O O     A GLU D 4 10  ? -5.888  -30.586 -8.740  0.50 21.06 ? 11  GLU B O     1 
ATOM   2160 O O     B GLU D 4 10  ? -5.864  -30.578 -8.748  0.50 21.22 ? 11  GLU B O     1 
ATOM   2161 C CB    A GLU D 4 10  ? -3.753  -31.949 -6.616  0.50 28.73 ? 11  GLU B CB    1 
ATOM   2162 C CB    B GLU D 4 10  ? -3.803  -31.908 -6.530  0.50 28.79 ? 11  GLU B CB    1 
ATOM   2163 C CG    A GLU D 4 10  ? -4.528  -33.190 -7.049  0.50 36.36 ? 11  GLU B CG    1 
ATOM   2164 C CG    B GLU D 4 10  ? -4.732  -33.056 -6.892  0.50 36.07 ? 11  GLU B CG    1 
ATOM   2165 C CD    A GLU D 4 10  ? -4.008  -33.806 -8.341  0.50 40.04 ? 11  GLU B CD    1 
ATOM   2166 C CD    B GLU D 4 10  ? -4.832  -34.113 -5.806  0.50 40.30 ? 11  GLU B CD    1 
ATOM   2167 O OE1   A GLU D 4 10  ? -2.779  -33.991 -8.467  0.50 42.68 ? 11  GLU B OE1   1 
ATOM   2168 O OE1   B GLU D 4 10  ? -4.259  -33.911 -4.713  0.50 42.10 ? 11  GLU B OE1   1 
ATOM   2169 O OE2   A GLU D 4 10  ? -4.834  -34.116 -9.224  0.50 43.10 ? 11  GLU B OE2   1 
ATOM   2170 O OE2   B GLU D 4 10  ? -5.496  -35.144 -6.048  0.50 41.37 ? 11  GLU B OE2   1 
ATOM   2171 N N     . ILE D 4 11  ? -5.618  -29.373 -6.870  1.00 20.21 ? 12  ILE B N     1 
ATOM   2172 C CA    . ILE D 4 11  ? -6.943  -28.774 -6.958  1.00 20.08 ? 12  ILE B CA    1 
ATOM   2173 C C     . ILE D 4 11  ? -7.039  -27.922 -8.230  1.00 19.66 ? 12  ILE B C     1 
ATOM   2174 O O     . ILE D 4 11  ? -8.015  -28.005 -8.983  1.00 18.45 ? 12  ILE B O     1 
ATOM   2175 C CB    . ILE D 4 11  ? -7.234  -27.881 -5.721  1.00 18.06 ? 12  ILE B CB    1 
ATOM   2176 C CG1   . ILE D 4 11  ? -7.518  -28.763 -4.500  1.00 21.49 ? 12  ILE B CG1   1 
ATOM   2177 C CG2   . ILE D 4 11  ? -8.385  -26.943 -6.009  1.00 18.05 ? 12  ILE B CG2   1 
ATOM   2178 C CD1   . ILE D 4 11  ? -7.615  -27.988 -3.204  1.00 21.92 ? 12  ILE B CD1   1 
ATOM   2179 N N     . ILE D 4 12  ? -6.025  -27.095 -8.464  1.00 18.15 ? 13  ILE B N     1 
ATOM   2180 C CA    . ILE D 4 12  ? -6.027  -26.233 -9.646  1.00 17.87 ? 13  ILE B CA    1 
ATOM   2181 C C     . ILE D 4 12  ? -6.117  -27.034 -10.947 1.00 18.83 ? 13  ILE B C     1 
ATOM   2182 O O     . ILE D 4 12  ? -6.940  -26.733 -11.816 1.00 22.39 ? 13  ILE B O     1 
ATOM   2183 C CB    . ILE D 4 12  ? -4.750  -25.347 -9.695  1.00 18.84 ? 13  ILE B CB    1 
ATOM   2184 C CG1   . ILE D 4 12  ? -4.797  -24.306 -8.571  1.00 18.60 ? 13  ILE B CG1   1 
ATOM   2185 C CG2   . ILE D 4 12  ? -4.653  -24.663 -11.062 1.00 17.99 ? 13  ILE B CG2   1 
ATOM   2186 C CD1   . ILE D 4 12  ? -3.425  -23.716 -8.200  1.00 14.93 ? 13  ILE B CD1   1 
ATOM   2187 N N     . VAL D 4 13  ? -5.274  -28.048 -11.080 1.00 20.64 ? 14  VAL B N     1 
ATOM   2188 C CA    . VAL D 4 13  ? -5.274  -28.870 -12.290 1.00 23.34 ? 14  VAL B CA    1 
ATOM   2189 C C     . VAL D 4 13  ? -6.621  -29.572 -12.482 1.00 25.30 ? 14  VAL B C     1 
ATOM   2190 O O     . VAL D 4 13  ? -7.218  -29.490 -13.550 1.00 24.50 ? 14  VAL B O     1 
ATOM   2191 C CB    . VAL D 4 13  ? -4.149  -29.917 -12.252 1.00 22.64 ? 14  VAL B CB    1 
ATOM   2192 C CG1   . VAL D 4 13  ? -4.245  -30.829 -13.473 1.00 24.53 ? 14  VAL B CG1   1 
ATOM   2193 C CG2   . VAL D 4 13  ? -2.787  -29.223 -12.242 1.00 23.66 ? 14  VAL B CG2   1 
ATOM   2194 N N     . GLU D 4 14  ? -7.112  -30.245 -11.445 1.00 24.57 ? 15  GLU B N     1 
ATOM   2195 C CA    . GLU D 4 14  ? -8.396  -30.926 -11.559 1.00 25.56 ? 15  GLU B CA    1 
ATOM   2196 C C     . GLU D 4 14  ? -9.551  -29.957 -11.853 1.00 25.77 ? 15  GLU B C     1 
ATOM   2197 O O     . GLU D 4 14  ? -10.438 -30.272 -12.651 1.00 25.94 ? 15  GLU B O     1 
ATOM   2198 C CB    . GLU D 4 14  ? -8.691  -31.720 -10.277 1.00 28.06 ? 15  GLU B CB    1 
ATOM   2199 C CG    . GLU D 4 14  ? -7.696  -32.831 -9.982  1.00 32.03 ? 15  GLU B CG    1 
ATOM   2200 C CD    . GLU D 4 14  ? -7.622  -33.856 -11.095 1.00 34.79 ? 15  GLU B CD    1 
ATOM   2201 O OE1   . GLU D 4 14  ? -8.669  -34.116 -11.728 1.00 36.27 ? 15  GLU B OE1   1 
ATOM   2202 O OE2   . GLU D 4 14  ? -6.526  -34.414 -11.324 1.00 35.86 ? 15  GLU B OE2   1 
ATOM   2203 N N     . SER D 4 15  ? -9.552  -28.783 -11.222 1.00 24.22 ? 16  SER B N     1 
ATOM   2204 C CA    . SER D 4 15  ? -10.623 -27.811 -11.450 1.00 23.93 ? 16  SER B CA    1 
ATOM   2205 C C     . SER D 4 15  ? -10.567 -27.178 -12.845 1.00 24.26 ? 16  SER B C     1 
ATOM   2206 O O     . SER D 4 15  ? -11.602 -26.935 -13.465 1.00 23.51 ? 16  SER B O     1 
ATOM   2207 C CB    . SER D 4 15  ? -10.593 -26.692 -10.405 1.00 26.49 ? 16  SER B CB    1 
ATOM   2208 O OG    . SER D 4 15  ? -10.975 -27.164 -9.123  1.00 33.03 ? 16  SER B OG    1 
ATOM   2209 N N     . VAL D 4 16  ? -9.363  -26.892 -13.325 1.00 22.03 ? 17  VAL B N     1 
ATOM   2210 C CA    . VAL D 4 16  ? -9.221  -26.291 -14.648 1.00 21.79 ? 17  VAL B CA    1 
ATOM   2211 C C     . VAL D 4 16  ? -9.697  -27.279 -15.706 1.00 24.02 ? 17  VAL B C     1 
ATOM   2212 O O     . VAL D 4 16  ? -10.523 -26.936 -16.551 1.00 26.50 ? 17  VAL B O     1 
ATOM   2213 C CB    . VAL D 4 16  ? -7.759  -25.896 -14.935 1.00 19.76 ? 17  VAL B CB    1 
ATOM   2214 C CG1   . VAL D 4 16  ? -7.579  -25.588 -16.441 1.00 19.66 ? 17  VAL B CG1   1 
ATOM   2215 C CG2   . VAL D 4 16  ? -7.398  -24.665 -14.100 1.00 18.87 ? 17  VAL B CG2   1 
ATOM   2216 N N     . VAL D 4 17  ? -9.184  -28.503 -15.642 1.00 26.09 ? 18  VAL B N     1 
ATOM   2217 C CA    . VAL D 4 17  ? -9.564  -29.546 -16.589 1.00 30.89 ? 18  VAL B CA    1 
ATOM   2218 C C     . VAL D 4 17  ? -11.079 -29.752 -16.648 1.00 32.89 ? 18  VAL B C     1 
ATOM   2219 O O     . VAL D 4 17  ? -11.660 -29.831 -17.734 1.00 32.33 ? 18  VAL B O     1 
ATOM   2220 C CB    . VAL D 4 17  ? -8.894  -30.891 -16.233 1.00 31.44 ? 18  VAL B CB    1 
ATOM   2221 C CG1   . VAL D 4 17  ? -9.493  -32.024 -17.072 1.00 32.85 ? 18  VAL B CG1   1 
ATOM   2222 C CG2   . VAL D 4 17  ? -7.397  -30.803 -16.472 1.00 32.57 ? 18  VAL B CG2   1 
ATOM   2223 N N     . ASN D 4 18  ? -11.728 -29.830 -15.489 1.00 34.28 ? 19  ASN B N     1 
ATOM   2224 C CA    . ASN D 4 18  ? -13.170 -30.039 -15.475 1.00 36.18 ? 19  ASN B CA    1 
ATOM   2225 C C     . ASN D 4 18  ? -13.964 -28.817 -15.929 1.00 37.38 ? 19  ASN B C     1 
ATOM   2226 O O     . ASN D 4 18  ? -15.037 -28.955 -16.517 1.00 37.95 ? 19  ASN B O     1 
ATOM   2227 C CB    . ASN D 4 18  ? -13.646 -30.474 -14.082 1.00 37.48 ? 19  ASN B CB    1 
ATOM   2228 C CG    . ASN D 4 18  ? -13.204 -31.889 -13.726 1.00 39.88 ? 19  ASN B CG    1 
ATOM   2229 O OD1   . ASN D 4 18  ? -13.187 -32.780 -14.576 1.00 40.36 ? 19  ASN B OD1   1 
ATOM   2230 N ND2   . ASN D 4 18  ? -12.864 -32.104 -12.460 1.00 39.82 ? 19  ASN B ND2   1 
ATOM   2231 N N     . GLU D 4 19  ? -13.447 -27.623 -15.671 1.00 37.00 ? 20  GLU B N     1 
ATOM   2232 C CA    . GLU D 4 19  ? -14.156 -26.413 -16.066 1.00 37.02 ? 20  GLU B CA    1 
ATOM   2233 C C     . GLU D 4 19  ? -14.017 -26.044 -17.541 1.00 36.87 ? 20  GLU B C     1 
ATOM   2234 O O     . GLU D 4 19  ? -14.863 -25.327 -18.075 1.00 38.72 ? 20  GLU B O     1 
ATOM   2235 C CB    . GLU D 4 19  ? -13.721 -25.233 -15.198 1.00 40.43 ? 20  GLU B CB    1 
ATOM   2236 C CG    . GLU D 4 19  ? -14.498 -25.133 -13.890 1.00 45.55 ? 20  GLU B CG    1 
ATOM   2237 C CD    . GLU D 4 19  ? -14.004 -24.024 -12.980 1.00 48.05 ? 20  GLU B CD    1 
ATOM   2238 O OE1   . GLU D 4 19  ? -13.793 -22.896 -13.468 1.00 48.01 ? 20  GLU B OE1   1 
ATOM   2239 O OE2   . GLU D 4 19  ? -13.839 -24.281 -11.768 1.00 50.41 ? 20  GLU B OE2   1 
ATOM   2240 N N     . VAL D 4 20  ? -12.972 -26.526 -18.208 1.00 34.40 ? 21  VAL B N     1 
ATOM   2241 C CA    . VAL D 4 20  ? -12.794 -26.200 -19.623 1.00 33.91 ? 21  VAL B CA    1 
ATOM   2242 C C     . VAL D 4 20  ? -13.308 -27.307 -20.539 1.00 36.16 ? 21  VAL B C     1 
ATOM   2243 O O     . VAL D 4 20  ? -13.060 -27.294 -21.746 1.00 35.54 ? 21  VAL B O     1 
ATOM   2244 C CB    . VAL D 4 20  ? -11.302 -25.902 -19.967 1.00 30.97 ? 21  VAL B CB    1 
ATOM   2245 C CG1   . VAL D 4 20  ? -10.784 -24.785 -19.076 1.00 28.19 ? 21  VAL B CG1   1 
ATOM   2246 C CG2   . VAL D 4 20  ? -10.449 -27.141 -19.795 1.00 25.41 ? 21  VAL B CG2   1 
ATOM   2247 N N     . ARG D 4 21  ? -14.029 -28.272 -19.974 1.00 37.83 ? 22  ARG B N     1 
ATOM   2248 C CA    . ARG D 4 21  ? -14.551 -29.349 -20.803 1.00 39.15 ? 22  ARG B CA    1 
ATOM   2249 C C     . ARG D 4 21  ? -15.676 -28.784 -21.662 1.00 39.55 ? 22  ARG B C     1 
ATOM   2250 O O     . ARG D 4 21  ? -15.858 -29.210 -22.798 1.00 40.58 ? 22  ARG B O     1 
ATOM   2251 C CB    . ARG D 4 21  ? -15.051 -30.521 -19.943 1.00 39.27 ? 22  ARG B CB    1 
ATOM   2252 C CG    . ARG D 4 21  ? -15.261 -31.810 -20.746 1.00 38.55 ? 22  ARG B CG    1 
ATOM   2253 C CD    . ARG D 4 21  ? -15.628 -33.015 -19.872 1.00 37.46 ? 22  ARG B CD    1 
ATOM   2254 N NE    . ARG D 4 21  ? -14.474 -33.849 -19.537 1.00 35.24 ? 22  ARG B NE    1 
ATOM   2255 C CZ    . ARG D 4 21  ? -13.874 -33.857 -18.350 1.00 34.74 ? 22  ARG B CZ    1 
ATOM   2256 N NH1   . ARG D 4 21  ? -14.319 -33.070 -17.378 1.00 34.72 ? 22  ARG B NH1   1 
ATOM   2257 N NH2   . ARG D 4 21  ? -12.833 -34.653 -18.133 1.00 32.40 ? 22  ARG B NH2   1 
ATOM   2258 N N     . GLU D 4 22  ? -16.398 -27.798 -21.128 1.00 41.17 ? 23  GLU B N     1 
ATOM   2259 C CA    . GLU D 4 22  ? -17.505 -27.164 -21.843 1.00 43.00 ? 23  GLU B CA    1 
ATOM   2260 C C     . GLU D 4 22  ? -17.000 -26.295 -22.999 1.00 42.79 ? 23  GLU B C     1 
ATOM   2261 O O     . GLU D 4 22  ? -17.623 -26.242 -24.067 1.00 42.16 ? 23  GLU B O     1 
ATOM   2262 C CB    . GLU D 4 22  ? -18.334 -26.305 -20.886 1.00 45.76 ? 23  GLU B CB    1 
ATOM   2263 C CG    . GLU D 4 22  ? -19.692 -25.910 -21.443 1.00 51.21 ? 23  GLU B CG    1 
ATOM   2264 C CD    . GLU D 4 22  ? -20.549 -25.177 -20.429 1.00 54.05 ? 23  GLU B CD    1 
ATOM   2265 O OE1   . GLU D 4 22  ? -20.415 -23.940 -20.305 1.00 56.12 ? 23  GLU B OE1   1 
ATOM   2266 O OE2   . GLU D 4 22  ? -21.350 -25.847 -19.743 1.00 56.05 ? 23  GLU B OE2   1 
ATOM   2267 N N     . ASP D 4 23  ? -15.885 -25.601 -22.779 1.00 40.80 ? 24  ASP B N     1 
ATOM   2268 C CA    . ASP D 4 23  ? -15.308 -24.764 -23.826 1.00 40.43 ? 24  ASP B CA    1 
ATOM   2269 C C     . ASP D 4 23  ? -14.694 -25.667 -24.894 1.00 38.59 ? 24  ASP B C     1 
ATOM   2270 O O     . ASP D 4 23  ? -14.741 -25.355 -26.086 1.00 38.52 ? 24  ASP B O     1 
ATOM   2271 C CB    . ASP D 4 23  ? -14.239 -23.826 -23.255 1.00 42.02 ? 24  ASP B CB    1 
ATOM   2272 C CG    . ASP D 4 23  ? -14.826 -22.555 -22.668 1.00 46.34 ? 24  ASP B CG    1 
ATOM   2273 O OD1   . ASP D 4 23  ? -16.047 -22.327 -22.817 1.00 48.90 ? 24  ASP B OD1   1 
ATOM   2274 O OD2   . ASP D 4 23  ? -14.060 -21.774 -22.063 1.00 48.27 ? 24  ASP B OD2   1 
ATOM   2275 N N     . PHE D 4 24  ? -14.127 -26.790 -24.454 1.00 36.90 ? 25  PHE B N     1 
ATOM   2276 C CA    . PHE D 4 24  ? -13.510 -27.773 -25.347 1.00 37.58 ? 25  PHE B CA    1 
ATOM   2277 C C     . PHE D 4 24  ? -14.580 -28.380 -26.258 1.00 40.72 ? 25  PHE B C     1 
ATOM   2278 O O     . PHE D 4 24  ? -14.382 -28.535 -27.468 1.00 40.17 ? 25  PHE B O     1 
ATOM   2279 C CB    . PHE D 4 24  ? -12.885 -28.912 -24.533 1.00 36.30 ? 25  PHE B CB    1 
ATOM   2280 C CG    . PHE D 4 24  ? -11.390 -28.822 -24.377 1.00 35.33 ? 25  PHE B CG    1 
ATOM   2281 C CD1   . PHE D 4 24  ? -10.801 -27.764 -23.685 1.00 34.74 ? 25  PHE B CD1   1 
ATOM   2282 C CD2   . PHE D 4 24  ? -10.574 -29.821 -24.899 1.00 33.69 ? 25  PHE B CD2   1 
ATOM   2283 C CE1   . PHE D 4 24  ? -9.410  -27.706 -23.516 1.00 34.20 ? 25  PHE B CE1   1 
ATOM   2284 C CE2   . PHE D 4 24  ? -9.192  -29.778 -24.739 1.00 34.01 ? 25  PHE B CE2   1 
ATOM   2285 C CZ    . PHE D 4 24  ? -8.604  -28.716 -24.044 1.00 34.23 ? 25  PHE B CZ    1 
ATOM   2286 N N     . GLU D 4 25  ? -15.710 -28.750 -25.661 1.00 42.28 ? 26  GLU B N     1 
ATOM   2287 C CA    . GLU D 4 25  ? -16.788 -29.354 -26.424 1.00 44.90 ? 26  GLU B CA    1 
ATOM   2288 C C     . GLU D 4 25  ? -17.418 -28.326 -27.355 1.00 45.86 ? 26  GLU B C     1 
ATOM   2289 O O     . GLU D 4 25  ? -17.806 -28.657 -28.472 1.00 46.10 ? 26  GLU B O     1 
ATOM   2290 C CB    . GLU D 4 25  ? -17.823 -29.974 -25.474 1.00 44.98 ? 26  GLU B CB    1 
ATOM   2291 C CG    . GLU D 4 25  ? -17.201 -31.017 -24.539 1.00 47.18 ? 26  GLU B CG    1 
ATOM   2292 C CD    . GLU D 4 25  ? -18.209 -31.729 -23.644 1.00 48.17 ? 26  GLU B CD    1 
ATOM   2293 O OE1   . GLU D 4 25  ? -19.211 -31.103 -23.242 1.00 47.37 ? 26  GLU B OE1   1 
ATOM   2294 O OE2   . GLU D 4 25  ? -17.981 -32.918 -23.329 1.00 49.68 ? 26  GLU B OE2   1 
ATOM   2295 N N     . ASN D 4 26  ? -17.506 -27.075 -26.910 1.00 46.73 ? 27  ASN B N     1 
ATOM   2296 C CA    . ASN D 4 26  ? -18.074 -26.036 -27.757 1.00 47.55 ? 27  ASN B CA    1 
ATOM   2297 C C     . ASN D 4 26  ? -17.221 -25.866 -29.004 1.00 46.82 ? 27  ASN B C     1 
ATOM   2298 O O     . ASN D 4 26  ? -17.713 -25.421 -30.042 1.00 47.58 ? 27  ASN B O     1 
ATOM   2299 C CB    . ASN D 4 26  ? -18.169 -24.707 -27.009 1.00 49.54 ? 27  ASN B CB    1 
ATOM   2300 C CG    . ASN D 4 26  ? -19.329 -24.672 -26.041 1.00 51.53 ? 27  ASN B CG    1 
ATOM   2301 O OD1   . ASN D 4 26  ? -20.185 -25.557 -26.051 1.00 53.46 ? 27  ASN B OD1   1 
ATOM   2302 N ND2   . ASN D 4 26  ? -19.374 -23.639 -25.206 1.00 52.38 ? 27  ASN B ND2   1 
ATOM   2303 N N     . ALA D 4 27  ? -15.942 -26.219 -28.892 1.00 45.20 ? 28  ALA B N     1 
ATOM   2304 C CA    . ALA D 4 27  ? -15.014 -26.135 -30.017 1.00 44.11 ? 28  ALA B CA    1 
ATOM   2305 C C     . ALA D 4 27  ? -14.853 -27.519 -30.642 1.00 43.67 ? 28  ALA B C     1 
ATOM   2306 O O     . ALA D 4 27  ? -14.055 -27.702 -31.563 1.00 44.00 ? 28  ALA B O     1 
ATOM   2307 C CB    . ALA D 4 27  ? -13.659 -25.609 -29.551 1.00 42.88 ? 28  ALA B CB    1 
ATOM   2308 N N     . GLY D 4 28  ? -15.609 -28.487 -30.122 1.00 42.59 ? 29  GLY B N     1 
ATOM   2309 C CA    . GLY D 4 28  ? -15.577 -29.861 -30.619 1.00 43.22 ? 29  GLY B CA    1 
ATOM   2310 C C     . GLY D 4 28  ? -14.218 -30.542 -30.638 1.00 43.34 ? 29  GLY B C     1 
ATOM   2311 O O     . GLY D 4 28  ? -13.933 -31.363 -31.510 1.00 43.67 ? 29  GLY B O     1 
ATOM   2312 N N     . ILE D 4 29  ? -13.401 -30.248 -29.635 1.00 43.45 ? 30  ILE B N     1 
ATOM   2313 C CA    . ILE D 4 29  ? -12.045 -30.770 -29.557 1.00 43.98 ? 30  ILE B CA    1 
ATOM   2314 C C     . ILE D 4 29  ? -11.708 -32.257 -29.469 1.00 45.20 ? 30  ILE B C     1 
ATOM   2315 O O     . ILE D 4 29  ? -11.078 -32.779 -30.390 1.00 45.81 ? 30  ILE B O     1 
ATOM   2316 C CB    . ILE D 4 29  ? -11.272 -30.039 -28.438 1.00 43.21 ? 30  ILE B CB    1 
ATOM   2317 C CG1   . ILE D 4 29  ? -11.040 -28.591 -28.868 1.00 43.31 ? 30  ILE B CG1   1 
ATOM   2318 C CG2   . ILE D 4 29  ? -9.945  -30.737 -28.157 1.00 40.80 ? 30  ILE B CG2   1 
ATOM   2319 C CD1   . ILE D 4 29  ? -10.282 -28.471 -30.188 1.00 44.88 ? 30  ILE B CD1   1 
ATOM   2320 N N     . ASP D 4 30  ? -12.079 -32.918 -28.369 1.00 45.34 ? 31  ASP B N     1 
ATOM   2321 C CA    . ASP D 4 30  ? -11.770 -34.340 -28.150 1.00 46.68 ? 31  ASP B CA    1 
ATOM   2322 C C     . ASP D 4 30  ? -11.548 -34.550 -26.650 1.00 46.10 ? 31  ASP B C     1 
ATOM   2323 O O     . ASP D 4 30  ? -10.816 -33.784 -26.032 1.00 45.89 ? 31  ASP B O     1 
ATOM   2324 C CB    . ASP D 4 30  ? -10.472 -34.719 -28.880 1.00 48.47 ? 31  ASP B CB    1 
ATOM   2325 C CG    . ASP D 4 30  ? -10.192 -36.212 -28.869 1.00 50.97 ? 31  ASP B CG    1 
ATOM   2326 O OD1   . ASP D 4 30  ? -9.070  -36.604 -28.472 1.00 52.89 ? 31  ASP B OD1   1 
ATOM   2327 O OD2   . ASP D 4 30  ? -11.080 -36.992 -29.268 1.00 52.41 ? 31  ASP B OD2   1 
ATOM   2328 N N     . GLU D 4 31  ? -12.166 -35.572 -26.061 1.00 45.28 ? 32  GLU B N     1 
ATOM   2329 C CA    . GLU D 4 31  ? -11.958 -35.836 -24.635 1.00 43.82 ? 32  GLU B CA    1 
ATOM   2330 C C     . GLU D 4 31  ? -10.525 -36.315 -24.410 1.00 43.34 ? 32  GLU B C     1 
ATOM   2331 O O     . GLU D 4 31  ? -9.903  -35.978 -23.404 1.00 42.18 ? 32  GLU B O     1 
ATOM   2332 C CB    . GLU D 4 31  ? -12.946 -36.890 -24.126 1.00 44.20 ? 32  GLU B CB    1 
ATOM   2333 C CG    . GLU D 4 31  ? -12.654 -37.438 -22.720 1.00 43.62 ? 32  GLU B CG    1 
ATOM   2334 C CD    . GLU D 4 31  ? -12.615 -36.368 -21.639 1.00 42.28 ? 32  GLU B CD    1 
ATOM   2335 O OE1   . GLU D 4 31  ? -13.500 -35.489 -21.631 1.00 42.62 ? 32  GLU B OE1   1 
ATOM   2336 O OE2   . GLU D 4 31  ? -11.704 -36.418 -20.783 1.00 42.15 ? 32  GLU B OE2   1 
ATOM   2337 N N     . GLN D 4 32  ? -9.998  -37.096 -25.349 1.00 41.67 ? 33  GLN B N     1 
ATOM   2338 C CA    . GLN D 4 32  ? -8.633  -37.595 -25.223 1.00 42.37 ? 33  GLN B CA    1 
ATOM   2339 C C     . GLN D 4 32  ? -7.619  -36.456 -25.331 1.00 41.13 ? 33  GLN B C     1 
ATOM   2340 O O     . GLN D 4 32  ? -6.516  -36.552 -24.800 1.00 40.87 ? 33  GLN B O     1 
ATOM   2341 C CB    . GLN D 4 32  ? -8.329  -38.634 -26.304 1.00 45.34 ? 33  GLN B CB    1 
ATOM   2342 C CG    . GLN D 4 32  ? -6.923  -39.212 -26.219 1.00 49.07 ? 33  GLN B CG    1 
ATOM   2343 C CD    . GLN D 4 32  ? -6.656  -39.888 -24.886 1.00 53.03 ? 33  GLN B CD    1 
ATOM   2344 O OE1   . GLN D 4 32  ? -7.422  -40.750 -24.452 1.00 55.42 ? 33  GLN B OE1   1 
ATOM   2345 N NE2   . GLN D 4 32  ? -5.564  -39.504 -24.230 1.00 54.23 ? 33  GLN B NE2   1 
ATOM   2346 N N     . THR D 4 33  ? -7.986  -35.386 -26.029 1.00 38.86 ? 34  THR B N     1 
ATOM   2347 C CA    . THR D 4 33  ? -7.077  -34.254 -26.168 1.00 38.20 ? 34  THR B CA    1 
ATOM   2348 C C     . THR D 4 33  ? -7.025  -33.517 -24.827 1.00 37.90 ? 34  THR B C     1 
ATOM   2349 O O     . THR D 4 33  ? -5.961  -33.066 -24.397 1.00 36.93 ? 34  THR B O     1 
ATOM   2350 C CB    . THR D 4 33  ? -7.541  -33.300 -27.297 1.00 38.28 ? 34  THR B CB    1 
ATOM   2351 O OG1   . THR D 4 33  ? -7.455  -33.983 -28.556 1.00 36.76 ? 34  THR B OG1   1 
ATOM   2352 C CG2   . THR D 4 33  ? -6.658  -32.049 -27.351 1.00 38.75 ? 34  THR B CG2   1 
ATOM   2353 N N     . LEU D 4 34  ? -8.179  -33.416 -24.171 1.00 37.64 ? 35  LEU B N     1 
ATOM   2354 C CA    . LEU D 4 34  ? -8.274  -32.758 -22.874 1.00 37.39 ? 35  LEU B CA    1 
ATOM   2355 C C     . LEU D 4 34  ? -7.451  -33.523 -21.844 1.00 38.14 ? 35  LEU B C     1 
ATOM   2356 O O     . LEU D 4 34  ? -6.799  -32.920 -20.993 1.00 37.53 ? 35  LEU B O     1 
ATOM   2357 C CB    . LEU D 4 34  ? -9.733  -32.669 -22.415 1.00 36.53 ? 35  LEU B CB    1 
ATOM   2358 C CG    . LEU D 4 34  ? -9.945  -32.088 -21.008 1.00 35.48 ? 35  LEU B CG    1 
ATOM   2359 C CD1   . LEU D 4 34  ? -9.242  -30.729 -20.883 1.00 33.03 ? 35  LEU B CD1   1 
ATOM   2360 C CD2   . LEU D 4 34  ? -11.436 -31.946 -20.740 1.00 35.15 ? 35  LEU B CD2   1 
ATOM   2361 N N     . GLN D 4 35  ? -7.477  -34.852 -21.919 1.00 37.16 ? 36  GLN B N     1 
ATOM   2362 C CA    . GLN D 4 35  ? -6.702  -35.668 -20.987 1.00 35.93 ? 36  GLN B CA    1 
ATOM   2363 C C     . GLN D 4 35  ? -5.214  -35.517 -21.254 1.00 35.63 ? 36  GLN B C     1 
ATOM   2364 O O     . GLN D 4 35  ? -4.392  -35.636 -20.339 1.00 36.02 ? 36  GLN B O     1 
ATOM   2365 C CB    . GLN D 4 35  ? -7.096  -37.146 -21.093 1.00 36.42 ? 36  GLN B CB    1 
ATOM   2366 C CG    . GLN D 4 35  ? -8.343  -37.500 -20.311 1.00 35.58 ? 36  GLN B CG    1 
ATOM   2367 C CD    . GLN D 4 35  ? -8.189  -37.196 -18.833 1.00 34.82 ? 36  GLN B CD    1 
ATOM   2368 O OE1   . GLN D 4 35  ? -7.182  -37.545 -18.219 1.00 34.90 ? 36  GLN B OE1   1 
ATOM   2369 N NE2   . GLN D 4 35  ? -9.186  -36.544 -18.259 1.00 37.20 ? 36  GLN B NE2   1 
ATOM   2370 N N     . ASP D 4 36  ? -4.865  -35.267 -22.513 1.00 34.94 ? 37  ASP B N     1 
ATOM   2371 C CA    . ASP D 4 36  ? -3.472  -35.074 -22.894 1.00 34.68 ? 37  ASP B CA    1 
ATOM   2372 C C     . ASP D 4 36  ? -2.967  -33.749 -22.308 1.00 33.06 ? 37  ASP B C     1 
ATOM   2373 O O     . ASP D 4 36  ? -1.837  -33.667 -21.831 1.00 31.20 ? 37  ASP B O     1 
ATOM   2374 C CB    . ASP D 4 36  ? -3.334  -35.070 -24.418 1.00 36.24 ? 37  ASP B CB    1 
ATOM   2375 C CG    . ASP D 4 36  ? -3.668  -36.419 -25.030 1.00 38.28 ? 37  ASP B CG    1 
ATOM   2376 O OD1   . ASP D 4 36  ? -4.281  -37.252 -24.323 1.00 38.46 ? 37  ASP B OD1   1 
ATOM   2377 O OD2   . ASP D 4 36  ? -3.328  -36.643 -26.213 1.00 40.64 ? 37  ASP B OD2   1 
ATOM   2378 N N     . LEU D 4 37  ? -3.803  -32.715 -22.352 1.00 33.50 ? 38  LEU B N     1 
ATOM   2379 C CA    . LEU D 4 37  ? -3.424  -31.420 -21.783 1.00 32.43 ? 38  LEU B CA    1 
ATOM   2380 C C     . LEU D 4 37  ? -3.100  -31.641 -20.307 1.00 32.88 ? 38  LEU B C     1 
ATOM   2381 O O     . LEU D 4 37  ? -2.044  -31.235 -19.814 1.00 33.44 ? 38  LEU B O     1 
ATOM   2382 C CB    . LEU D 4 37  ? -4.578  -30.424 -21.908 1.00 31.91 ? 38  LEU B CB    1 
ATOM   2383 C CG    . LEU D 4 37  ? -4.382  -29.105 -21.158 1.00 30.21 ? 38  LEU B CG    1 
ATOM   2384 C CD1   . LEU D 4 37  ? -3.154  -28.377 -21.696 1.00 30.32 ? 38  LEU B CD1   1 
ATOM   2385 C CD2   . LEU D 4 37  ? -5.626  -28.252 -21.303 1.00 31.19 ? 38  LEU B CD2   1 
ATOM   2386 N N     . LYS D 4 38  ? -4.021  -32.291 -19.606 1.00 33.22 ? 39  LYS B N     1 
ATOM   2387 C CA    . LYS D 4 38  ? -3.834  -32.583 -18.189 1.00 34.49 ? 39  LYS B CA    1 
ATOM   2388 C C     . LYS D 4 38  ? -2.503  -33.283 -17.899 1.00 34.03 ? 39  LYS B C     1 
ATOM   2389 O O     . LYS D 4 38  ? -1.767  -32.888 -17.000 1.00 33.39 ? 39  LYS B O     1 
ATOM   2390 C CB    . LYS D 4 38  ? -4.978  -33.457 -17.668 1.00 36.29 ? 39  LYS B CB    1 
ATOM   2391 C CG    . LYS D 4 38  ? -4.759  -33.913 -16.229 1.00 39.14 ? 39  LYS B CG    1 
ATOM   2392 C CD    . LYS D 4 38  ? -5.835  -34.861 -15.735 1.00 39.92 ? 39  LYS B CD    1 
ATOM   2393 C CE    . LYS D 4 38  ? -5.544  -35.287 -14.298 1.00 42.81 ? 39  LYS B CE    1 
ATOM   2394 N NZ    . LYS D 4 38  ? -6.611  -36.156 -13.722 1.00 43.79 ? 39  LYS B NZ    1 
ATOM   2395 N N     . ASN D 4 39  ? -2.186  -34.319 -18.664 1.00 34.80 ? 40  ASN B N     1 
ATOM   2396 C CA    . ASN D 4 39  ? -0.953  -35.063 -18.441 1.00 34.09 ? 40  ASN B CA    1 
ATOM   2397 C C     . ASN D 4 39  ? 0.347   -34.349 -18.800 1.00 32.85 ? 40  ASN B C     1 
ATOM   2398 O O     . ASN D 4 39  ? 1.357   -34.509 -18.109 1.00 30.63 ? 40  ASN B O     1 
ATOM   2399 C CB    . ASN D 4 39  ? -1.045  -36.410 -19.157 1.00 38.64 ? 40  ASN B CB    1 
ATOM   2400 C CG    . ASN D 4 39  ? -2.082  -37.322 -18.524 1.00 43.44 ? 40  ASN B CG    1 
ATOM   2401 O OD1   . ASN D 4 39  ? -1.952  -37.713 -17.364 1.00 46.58 ? 40  ASN B OD1   1 
ATOM   2402 N ND2   . ASN D 4 39  ? -3.125  -37.650 -19.276 1.00 45.70 ? 40  ASN B ND2   1 
ATOM   2403 N N     . ILE D 4 40  ? 0.337   -33.568 -19.875 1.00 31.30 ? 41  ILE B N     1 
ATOM   2404 C CA    . ILE D 4 40  ? 1.534   -32.838 -20.266 1.00 31.22 ? 41  ILE B CA    1 
ATOM   2405 C C     . ILE D 4 40  ? 1.796   -31.764 -19.201 1.00 30.60 ? 41  ILE B C     1 
ATOM   2406 O O     . ILE D 4 40  ? 2.930   -31.545 -18.782 1.00 30.04 ? 41  ILE B O     1 
ATOM   2407 C CB    . ILE D 4 40  ? 1.350   -32.185 -21.665 1.00 32.24 ? 41  ILE B CB    1 
ATOM   2408 C CG1   . ILE D 4 40  ? 1.235   -33.287 -22.732 1.00 32.85 ? 41  ILE B CG1   1 
ATOM   2409 C CG2   . ILE D 4 40  ? 2.545   -31.297 -21.993 1.00 33.83 ? 41  ILE B CG2   1 
ATOM   2410 C CD1   . ILE D 4 40  ? 0.901   -32.786 -24.132 1.00 34.05 ? 41  ILE B CD1   1 
ATOM   2411 N N     . TRP D 4 41  ? 0.722   -31.116 -18.767 1.00 30.13 ? 42  TRP B N     1 
ATOM   2412 C CA    . TRP D 4 41  ? 0.783   -30.077 -17.738 1.00 30.83 ? 42  TRP B CA    1 
ATOM   2413 C C     . TRP D 4 41  ? 1.394   -30.647 -16.452 1.00 32.21 ? 42  TRP B C     1 
ATOM   2414 O O     . TRP D 4 41  ? 2.373   -30.111 -15.941 1.00 32.36 ? 42  TRP B O     1 
ATOM   2415 C CB    . TRP D 4 41  ? -0.634  -29.551 -17.487 1.00 27.44 ? 42  TRP B CB    1 
ATOM   2416 C CG    . TRP D 4 41  ? -0.781  -28.402 -16.495 1.00 24.18 ? 42  TRP B CG    1 
ATOM   2417 C CD1   . TRP D 4 41  ? 0.218   -27.652 -15.928 1.00 24.57 ? 42  TRP B CD1   1 
ATOM   2418 C CD2   . TRP D 4 41  ? -2.015  -27.860 -16.014 1.00 21.90 ? 42  TRP B CD2   1 
ATOM   2419 N NE1   . TRP D 4 41  ? -0.329  -26.673 -15.123 1.00 22.13 ? 42  TRP B NE1   1 
ATOM   2420 C CE2   . TRP D 4 41  ? -1.696  -26.778 -15.160 1.00 21.36 ? 42  TRP B CE2   1 
ATOM   2421 C CE3   . TRP D 4 41  ? -3.365  -28.184 -16.222 1.00 21.32 ? 42  TRP B CE3   1 
ATOM   2422 C CZ2   . TRP D 4 41  ? -2.678  -26.018 -14.521 1.00 20.02 ? 42  TRP B CZ2   1 
ATOM   2423 C CZ3   . TRP D 4 41  ? -4.339  -27.430 -15.589 1.00 20.61 ? 42  TRP B CZ3   1 
ATOM   2424 C CH2   . TRP D 4 41  ? -3.992  -26.354 -14.746 1.00 20.86 ? 42  TRP B CH2   1 
ATOM   2425 N N     . GLN D 4 42  ? 0.834   -31.740 -15.935 1.00 35.83 ? 43  GLN B N     1 
ATOM   2426 C CA    . GLN D 4 42  ? 1.365   -32.340 -14.708 1.00 38.59 ? 43  GLN B CA    1 
ATOM   2427 C C     . GLN D 4 42  ? 2.815   -32.792 -14.878 1.00 40.54 ? 43  GLN B C     1 
ATOM   2428 O O     . GLN D 4 42  ? 3.614   -32.705 -13.943 1.00 40.16 ? 43  GLN B O     1 
ATOM   2429 C CB    . GLN D 4 42  ? 0.498   -33.525 -14.260 1.00 40.14 ? 43  GLN B CB    1 
ATOM   2430 C CG    . GLN D 4 42  ? -0.906  -33.130 -13.814 1.00 44.60 ? 43  GLN B CG    1 
ATOM   2431 C CD    . GLN D 4 42  ? -1.735  -34.311 -13.336 1.00 47.58 ? 43  GLN B CD    1 
ATOM   2432 O OE1   . GLN D 4 42  ? -1.835  -35.333 -14.018 1.00 49.89 ? 43  GLN B OE1   1 
ATOM   2433 N NE2   . GLN D 4 42  ? -2.345  -34.170 -12.165 1.00 50.00 ? 43  GLN B NE2   1 
ATOM   2434 N N     . LYS D 4 43  ? 3.149   -33.272 -16.072 1.00 42.38 ? 44  LYS B N     1 
ATOM   2435 C CA    . LYS D 4 43  ? 4.504   -33.722 -16.366 1.00 44.33 ? 44  LYS B CA    1 
ATOM   2436 C C     . LYS D 4 43  ? 5.489   -32.558 -16.293 1.00 43.88 ? 44  LYS B C     1 
ATOM   2437 O O     . LYS D 4 43  ? 6.520   -32.646 -15.629 1.00 42.90 ? 44  LYS B O     1 
ATOM   2438 C CB    . LYS D 4 43  ? 4.560   -34.355 -17.762 1.00 47.45 ? 44  LYS B CB    1 
ATOM   2439 C CG    . LYS D 4 43  ? 5.963   -34.461 -18.344 1.00 52.25 ? 44  LYS B CG    1 
ATOM   2440 C CD    . LYS D 4 43  ? 5.940   -35.037 -19.750 1.00 56.96 ? 44  LYS B CD    1 
ATOM   2441 C CE    . LYS D 4 43  ? 7.243   -34.763 -20.487 1.00 60.04 ? 44  LYS B CE    1 
ATOM   2442 N NZ    . LYS D 4 43  ? 7.224   -35.331 -21.864 1.00 63.31 ? 44  LYS B NZ    1 
ATOM   2443 N N     . LYS D 4 44  ? 5.170   -31.470 -16.985 1.00 43.68 ? 45  LYS B N     1 
ATOM   2444 C CA    . LYS D 4 44  ? 6.038   -30.302 -16.984 1.00 43.95 ? 45  LYS B CA    1 
ATOM   2445 C C     . LYS D 4 44  ? 6.116   -29.691 -15.593 1.00 44.39 ? 45  LYS B C     1 
ATOM   2446 O O     . LYS D 4 44  ? 7.110   -29.057 -15.244 1.00 44.21 ? 45  LYS B O     1 
ATOM   2447 C CB    . LYS D 4 44  ? 5.544   -29.279 -18.007 1.00 43.43 ? 45  LYS B CB    1 
ATOM   2448 C CG    . LYS D 4 44  ? 5.859   -29.697 -19.434 1.00 44.23 ? 45  LYS B CG    1 
ATOM   2449 C CD    . LYS D 4 44  ? 5.075   -28.912 -20.466 1.00 45.75 ? 45  LYS B CD    1 
ATOM   2450 C CE    . LYS D 4 44  ? 5.449   -29.366 -21.871 1.00 47.56 ? 45  LYS B CE    1 
ATOM   2451 N NZ    . LYS D 4 44  ? 6.893   -29.127 -22.169 1.00 48.82 ? 45  LYS B NZ    1 
ATOM   2452 N N     . LEU D 4 45  ? 5.072   -29.894 -14.796 1.00 45.63 ? 46  LEU B N     1 
ATOM   2453 C CA    . LEU D 4 45  ? 5.053   -29.377 -13.436 1.00 47.10 ? 46  LEU B CA    1 
ATOM   2454 C C     . LEU D 4 45  ? 6.055   -30.211 -12.646 1.00 48.86 ? 46  LEU B C     1 
ATOM   2455 O O     . LEU D 4 45  ? 6.832   -29.686 -11.851 1.00 49.12 ? 46  LEU B O     1 
ATOM   2456 C CB    . LEU D 4 45  ? 3.650   -29.516 -12.839 1.00 46.54 ? 46  LEU B CB    1 
ATOM   2457 C CG    . LEU D 4 45  ? 3.395   -28.864 -11.477 1.00 47.19 ? 46  LEU B CG    1 
ATOM   2458 C CD1   . LEU D 4 45  ? 3.771   -27.389 -11.528 1.00 45.82 ? 46  LEU B CD1   1 
ATOM   2459 C CD2   . LEU D 4 45  ? 1.927   -29.030 -11.104 1.00 46.44 ? 46  LEU B CD2   1 
ATOM   2460 N N     . THR D 4 46  ? 6.035   -31.516 -12.892 1.00 50.08 ? 47  THR B N     1 
ATOM   2461 C CA    . THR D 4 46  ? 6.939   -32.449 -12.230 1.00 52.10 ? 47  THR B CA    1 
ATOM   2462 C C     . THR D 4 46  ? 8.391   -32.174 -12.605 1.00 52.68 ? 47  THR B C     1 
ATOM   2463 O O     . THR D 4 46  ? 9.284   -32.271 -11.765 1.00 52.99 ? 47  THR B O     1 
ATOM   2464 C CB    . THR D 4 46  ? 6.601   -33.906 -12.603 1.00 52.80 ? 47  THR B CB    1 
ATOM   2465 O OG1   . THR D 4 46  ? 5.382   -34.290 -11.957 1.00 52.54 ? 47  THR B OG1   1 
ATOM   2466 C CG2   . THR D 4 46  ? 7.725   -34.848 -12.186 1.00 53.27 ? 47  THR B CG2   1 
ATOM   2467 N N     . GLU D 4 47  ? 8.625   -31.841 -13.870 1.00 53.11 ? 48  GLU B N     1 
ATOM   2468 C CA    . GLU D 4 47  ? 9.975   -31.542 -14.336 1.00 54.36 ? 48  GLU B CA    1 
ATOM   2469 C C     . GLU D 4 47  ? 10.548  -30.345 -13.585 1.00 54.12 ? 48  GLU B C     1 
ATOM   2470 O O     . GLU D 4 47  ? 9.760   -29.623 -12.936 1.00 52.32 ? 48  GLU B O     1 
ATOM   2471 C CB    . GLU D 4 47  ? 9.960   -31.246 -15.838 1.00 55.80 ? 48  GLU B CB    1 
ATOM   2472 C CG    . GLU D 4 47  ? 10.122  -32.471 -16.719 1.00 59.81 ? 48  GLU B CG    1 
ATOM   2473 C CD    . GLU D 4 47  ? 9.550   -32.270 -18.111 1.00 62.81 ? 48  GLU B CD    1 
ATOM   2474 O OE1   . GLU D 4 47  ? 9.675   -31.155 -18.662 1.00 64.50 ? 48  GLU B OE1   1 
ATOM   2475 O OE2   . GLU D 4 47  ? 8.980   -33.235 -18.657 1.00 64.06 ? 48  GLU B OE2   1 
ATOM   2476 N N     . ASP E 5 21  ? 20.945  -0.628  -9.704  1.00 47.36 ? 228 ASP C N     1 
ATOM   2477 C CA    . ASP E 5 21  ? 21.147  0.743   -10.250 1.00 45.62 ? 228 ASP C CA    1 
ATOM   2478 C C     . ASP E 5 21  ? 19.870  1.573   -10.183 1.00 42.66 ? 228 ASP C C     1 
ATOM   2479 O O     . ASP E 5 21  ? 19.016  1.334   -9.327  1.00 43.96 ? 228 ASP C O     1 
ATOM   2480 C CB    . ASP E 5 21  ? 21.658  0.663   -11.690 1.00 47.40 ? 228 ASP C CB    1 
ATOM   2481 C CG    . ASP E 5 21  ? 20.832  -0.268  -12.552 1.00 50.81 ? 228 ASP C CG    1 
ATOM   2482 O OD1   . ASP E 5 21  ? 19.954  -0.977  -12.009 1.00 52.04 ? 228 ASP C OD1   1 
ATOM   2483 O OD2   . ASP E 5 21  ? 21.071  -0.297  -13.780 1.00 52.70 ? 228 ASP C OD2   1 
ATOM   2484 N N     . TYR E 5 22  ? 19.731  2.537   -11.088 1.00 39.09 ? 229 TYR C N     1 
ATOM   2485 C CA    . TYR E 5 22  ? 18.563  3.415   -11.070 1.00 35.68 ? 229 TYR C CA    1 
ATOM   2486 C C     . TYR E 5 22  ? 17.494  3.165   -12.119 1.00 33.78 ? 229 TYR C C     1 
ATOM   2487 O O     . TYR E 5 22  ? 16.373  3.662   -11.984 1.00 30.19 ? 229 TYR C O     1 
ATOM   2488 C CB    . TYR E 5 22  ? 19.020  4.871   -11.167 1.00 33.17 ? 229 TYR C CB    1 
ATOM   2489 C CG    . TYR E 5 22  ? 20.140  5.168   -10.210 1.00 36.50 ? 229 TYR C CG    1 
ATOM   2490 C CD1   . TYR E 5 22  ? 21.462  4.874   -10.547 1.00 37.34 ? 229 TYR C CD1   1 
ATOM   2491 C CD2   . TYR E 5 22  ? 19.876  5.654   -8.931  1.00 35.04 ? 229 TYR C CD2   1 
ATOM   2492 C CE1   . TYR E 5 22  ? 22.488  5.050   -9.635  1.00 37.69 ? 229 TYR C CE1   1 
ATOM   2493 C CE2   . TYR E 5 22  ? 20.893  5.830   -8.010  1.00 36.42 ? 229 TYR C CE2   1 
ATOM   2494 C CZ    . TYR E 5 22  ? 22.197  5.524   -8.370  1.00 37.56 ? 229 TYR C CZ    1 
ATOM   2495 O OH    . TYR E 5 22  ? 23.211  5.675   -7.458  1.00 41.55 ? 229 TYR C OH    1 
ATOM   2496 N N     . LEU E 5 23  ? 17.834  2.413   -13.160 1.00 32.95 ? 230 LEU C N     1 
ATOM   2497 C CA    . LEU E 5 23  ? 16.876  2.137   -14.221 1.00 34.55 ? 230 LEU C CA    1 
ATOM   2498 C C     . LEU E 5 23  ? 16.519  0.668   -14.339 1.00 36.07 ? 230 LEU C C     1 
ATOM   2499 O O     . LEU E 5 23  ? 17.321  -0.210  -14.034 1.00 35.90 ? 230 LEU C O     1 
ATOM   2500 C CB    . LEU E 5 23  ? 17.416  2.631   -15.563 1.00 35.44 ? 230 LEU C CB    1 
ATOM   2501 C CG    . LEU E 5 23  ? 17.787  4.112   -15.650 1.00 35.80 ? 230 LEU C CG    1 
ATOM   2502 C CD1   . LEU E 5 23  ? 18.424  4.397   -17.003 1.00 39.29 ? 230 LEU C CD1   1 
ATOM   2503 C CD2   . LEU E 5 23  ? 16.550  4.964   -15.442 1.00 36.22 ? 230 LEU C CD2   1 
ATOM   2504 N N     . ILE E 5 24  ? 15.298  0.416   -14.790 1.00 37.02 ? 231 ILE C N     1 
ATOM   2505 C CA    . ILE E 5 24  ? 14.803  -0.939  -14.972 1.00 39.38 ? 231 ILE C CA    1 
ATOM   2506 C C     . ILE E 5 24  ? 15.151  -1.401  -16.384 1.00 40.61 ? 231 ILE C C     1 
ATOM   2507 O O     . ILE E 5 24  ? 15.258  -0.581  -17.296 1.00 42.42 ? 231 ILE C O     1 
ATOM   2508 C CB    . ILE E 5 24  ? 13.279  -0.988  -14.787 1.00 38.60 ? 231 ILE C CB    1 
ATOM   2509 C CG1   . ILE E 5 24  ? 12.923  -0.522  -13.373 1.00 36.67 ? 231 ILE C CG1   1 
ATOM   2510 C CG2   . ILE E 5 24  ? 12.765  -2.398  -15.045 1.00 40.22 ? 231 ILE C CG2   1 
ATOM   2511 C CD1   . ILE E 5 24  ? 11.435  -0.350  -13.141 1.00 33.60 ? 231 ILE C CD1   1 
ATOM   2512 N N     . GLU E 5 34  ? 14.813  -18.038 -10.564 1.00 37.13 ? 241 GLU C N     1 
ATOM   2513 C CA    . GLU E 5 34  ? 14.354  -16.833 -9.881  1.00 33.96 ? 241 GLU C CA    1 
ATOM   2514 C C     . GLU E 5 34  ? 13.374  -17.159 -8.753  1.00 30.37 ? 241 GLU C C     1 
ATOM   2515 O O     . GLU E 5 34  ? 12.509  -18.025 -8.897  1.00 31.23 ? 241 GLU C O     1 
ATOM   2516 C CB    . GLU E 5 34  ? 13.675  -15.886 -10.881 1.00 38.75 ? 241 GLU C CB    1 
ATOM   2517 C CG    . GLU E 5 34  ? 12.979  -14.684 -10.234 1.00 43.25 ? 241 GLU C CG    1 
ATOM   2518 C CD    . GLU E 5 34  ? 12.210  -13.824 -11.233 1.00 46.39 ? 241 GLU C CD    1 
ATOM   2519 O OE1   . GLU E 5 34  ? 11.451  -14.384 -12.050 1.00 47.79 ? 241 GLU C OE1   1 
ATOM   2520 O OE2   . GLU E 5 34  ? 12.355  -12.584 -11.191 1.00 48.73 ? 241 GLU C OE2   1 
ATOM   2521 N N     . ASN E 5 35  ? 13.527  -16.481 -7.620  1.00 25.56 ? 242 ASN C N     1 
ATOM   2522 C CA    . ASN E 5 35  ? 12.611  -16.669 -6.504  1.00 19.19 ? 242 ASN C CA    1 
ATOM   2523 C C     . ASN E 5 35  ? 11.572  -15.585 -6.724  1.00 17.52 ? 242 ASN C C     1 
ATOM   2524 O O     . ASN E 5 35  ? 11.893  -14.395 -6.690  1.00 15.11 ? 242 ASN C O     1 
ATOM   2525 C CB    . ASN E 5 35  ? 13.346  -16.482 -5.189  1.00 18.45 ? 242 ASN C CB    1 
ATOM   2526 C CG    . ASN E 5 35  ? 14.423  -17.522 -5.010  1.00 21.81 ? 242 ASN C CG    1 
ATOM   2527 O OD1   . ASN E 5 35  ? 14.145  -18.712 -5.131  1.00 21.50 ? 242 ASN C OD1   1 
ATOM   2528 N ND2   . ASN E 5 35  ? 15.653  -17.089 -4.745  1.00 20.08 ? 242 ASN C ND2   1 
ATOM   2529 N N     . LEU E 5 36  ? 10.341  -16.011 -6.965  1.00 14.99 ? 243 LEU C N     1 
ATOM   2530 C CA    . LEU E 5 36  ? 9.257   -15.093 -7.277  1.00 15.60 ? 243 LEU C CA    1 
ATOM   2531 C C     . LEU E 5 36  ? 7.972   -15.374 -6.513  1.00 15.86 ? 243 LEU C C     1 
ATOM   2532 O O     . LEU E 5 36  ? 7.469   -16.502 -6.513  1.00 13.78 ? 243 LEU C O     1 
ATOM   2533 C CB    . LEU E 5 36  ? 8.970   -15.180 -8.776  1.00 16.09 ? 243 LEU C CB    1 
ATOM   2534 C CG    . LEU E 5 36  ? 7.772   -14.427 -9.362  1.00 18.01 ? 243 LEU C CG    1 
ATOM   2535 C CD1   . LEU E 5 36  ? 8.006   -12.915 -9.316  1.00 14.63 ? 243 LEU C CD1   1 
ATOM   2536 C CD2   . LEU E 5 36  ? 7.585   -14.887 -10.806 1.00 20.52 ? 243 LEU C CD2   1 
ATOM   2537 N N     . MET E 5 37  ? 7.443   -14.333 -5.881  1.00 14.41 ? 244 MET C N     1 
ATOM   2538 C CA    . MET E 5 37  ? 6.191   -14.412 -5.130  1.00 14.54 ? 244 MET C CA    1 
ATOM   2539 C C     . MET E 5 37  ? 5.143   -13.617 -5.917  1.00 14.79 ? 244 MET C C     1 
ATOM   2540 O O     . MET E 5 37  ? 5.382   -12.469 -6.278  1.00 14.10 ? 244 MET C O     1 
ATOM   2541 C CB    . MET E 5 37  ? 6.376   -13.805 -3.736  1.00 14.37 ? 244 MET C CB    1 
ATOM   2542 C CG    . MET E 5 37  ? 5.061   -13.610 -2.954  1.00 15.10 ? 244 MET C CG    1 
ATOM   2543 S SD    . MET E 5 37  ? 5.317   -12.899 -1.308  1.00 16.31 ? 244 MET C SD    1 
ATOM   2544 C CE    . MET E 5 37  ? 6.078   -14.246 -0.485  1.00 16.17 ? 244 MET C CE    1 
ATOM   2545 N N     . LEU E 5 38  ? 3.994   -14.243 -6.185  1.00 15.09 ? 245 LEU C N     1 
ATOM   2546 C CA    . LEU E 5 38  ? 2.901   -13.629 -6.948  1.00 14.70 ? 245 LEU C CA    1 
ATOM   2547 C C     . LEU E 5 38  ? 1.684   -13.642 -6.025  1.00 14.80 ? 245 LEU C C     1 
ATOM   2548 O O     . LEU E 5 38  ? 1.271   -14.698 -5.567  1.00 13.05 ? 245 LEU C O     1 
ATOM   2549 C CB    . LEU E 5 38  ? 2.639   -14.457 -8.210  1.00 14.93 ? 245 LEU C CB    1 
ATOM   2550 C CG    . LEU E 5 38  ? 3.847   -14.571 -9.156  1.00 16.37 ? 245 LEU C CG    1 
ATOM   2551 C CD1   . LEU E 5 38  ? 3.635   -15.691 -10.177 1.00 15.76 ? 245 LEU C CD1   1 
ATOM   2552 C CD2   . LEU E 5 38  ? 4.058   -13.231 -9.858  1.00 15.75 ? 245 LEU C CD2   1 
ATOM   2553 N N     . CYS E 5 39  ? 1.087   -12.483 -5.768  1.00 12.81 ? 246 CYS C N     1 
ATOM   2554 C CA    . CYS E 5 39  ? -0.016  -12.436 -4.808  1.00 13.34 ? 246 CYS C CA    1 
ATOM   2555 C C     . CYS E 5 39  ? -0.817  -11.149 -4.933  1.00 14.61 ? 246 CYS C C     1 
ATOM   2556 O O     . CYS E 5 39  ? -0.683  -10.425 -5.907  1.00 13.76 ? 246 CYS C O     1 
ATOM   2557 C CB    . CYS E 5 39  ? 0.565   -12.487 -3.394  1.00 13.19 ? 246 CYS C CB    1 
ATOM   2558 S SG    . CYS E 5 39  ? 1.747   -11.102 -3.094  1.00 15.90 ? 246 CYS C SG    1 
ATOM   2559 N N     . LEU E 5 40  ? -1.643  -10.885 -3.925  1.00 14.34 ? 247 LEU C N     1 
ATOM   2560 C CA    . LEU E 5 40  ? -2.449  -9.659  -3.872  1.00 15.45 ? 247 LEU C CA    1 
ATOM   2561 C C     . LEU E 5 40  ? -1.958  -8.871  -2.665  1.00 16.13 ? 247 LEU C C     1 
ATOM   2562 O O     . LEU E 5 40  ? -1.410  -9.461  -1.734  1.00 16.52 ? 247 LEU C O     1 
ATOM   2563 C CB    . LEU E 5 40  ? -3.928  -9.995  -3.636  1.00 16.03 ? 247 LEU C CB    1 
ATOM   2564 C CG    . LEU E 5 40  ? -4.642  -10.912 -4.627  1.00 16.20 ? 247 LEU C CG    1 
ATOM   2565 C CD1   . LEU E 5 40  ? -6.095  -11.154 -4.166  1.00 16.62 ? 247 LEU C CD1   1 
ATOM   2566 C CD2   . LEU E 5 40  ? -4.615  -10.260 -5.999  1.00 16.37 ? 247 LEU C CD2   1 
ATOM   2567 N N     . TYR E 5 41  ? -2.136  -7.548  -2.673  1.00 16.01 ? 248 TYR C N     1 
ATOM   2568 C CA    . TYR E 5 41  ? -1.770  -6.754  -1.506  1.00 14.95 ? 248 TYR C CA    1 
ATOM   2569 C C     . TYR E 5 41  ? -3.041  -6.121  -0.949  1.00 17.54 ? 248 TYR C C     1 
ATOM   2570 O O     . TYR E 5 41  ? -3.926  -5.710  -1.703  1.00 18.11 ? 248 TYR C O     1 
ATOM   2571 C CB    . TYR E 5 41  ? -0.746  -5.646  -1.822  1.00 14.86 ? 248 TYR C CB    1 
ATOM   2572 C CG    . TYR E 5 41  ? -1.235  -4.539  -2.747  1.00 16.38 ? 248 TYR C CG    1 
ATOM   2573 C CD1   . TYR E 5 41  ? -1.988  -3.457  -2.255  1.00 16.55 ? 248 TYR C CD1   1 
ATOM   2574 C CD2   . TYR E 5 41  ? -0.940  -4.570  -4.103  1.00 14.95 ? 248 TYR C CD2   1 
ATOM   2575 C CE1   . TYR E 5 41  ? -2.432  -2.440  -3.109  1.00 16.27 ? 248 TYR C CE1   1 
ATOM   2576 C CE2   . TYR E 5 41  ? -1.375  -3.551  -4.969  1.00 16.31 ? 248 TYR C CE2   1 
ATOM   2577 C CZ    . TYR E 5 41  ? -2.121  -2.496  -4.459  1.00 16.70 ? 248 TYR C CZ    1 
ATOM   2578 O OH    . TYR E 5 41  ? -2.540  -1.494  -5.296  1.00 18.64 ? 248 TYR C OH    1 
ATOM   2579 N N     . ASP E 5 42  ? -3.123  -6.088  0.373   1.00 19.38 ? 249 ASP C N     1 
ATOM   2580 C CA    . ASP E 5 42  ? -4.238  -5.476  1.077   1.00 21.81 ? 249 ASP C CA    1 
ATOM   2581 C C     . ASP E 5 42  ? -3.774  -4.103  1.549   1.00 23.63 ? 249 ASP C C     1 
ATOM   2582 O O     . ASP E 5 42  ? -4.538  -3.130  1.541   1.00 24.94 ? 249 ASP C O     1 
ATOM   2583 C CB    . ASP E 5 42  ? -4.626  -6.294  2.314   1.00 25.79 ? 249 ASP C CB    1 
ATOM   2584 C CG    . ASP E 5 42  ? -5.666  -7.346  2.019   1.00 29.44 ? 249 ASP C CG    1 
ATOM   2585 O OD1   . ASP E 5 42  ? -6.242  -7.327  0.908   1.00 32.38 ? 249 ASP C OD1   1 
ATOM   2586 O OD2   . ASP E 5 42  ? -5.917  -8.192  2.908   1.00 30.15 ? 249 ASP C OD2   1 
ATOM   2587 N N     . LYS E 5 43  ? -2.513  -4.025  1.959   1.00 20.60 ? 250 LYS C N     1 
ATOM   2588 C CA    . LYS E 5 43  ? -1.971  -2.773  2.475   1.00 22.54 ? 250 LYS C CA    1 
ATOM   2589 C C     . LYS E 5 43  ? -0.447  -2.702  2.397   1.00 19.17 ? 250 LYS C C     1 
ATOM   2590 O O     . LYS E 5 43  ? 0.244   -3.698  2.624   1.00 18.42 ? 250 LYS C O     1 
ATOM   2591 C CB    . LYS E 5 43  ? -2.408  -2.614  3.937   1.00 25.24 ? 250 LYS C CB    1 
ATOM   2592 C CG    . LYS E 5 43  ? -1.987  -1.319  4.612   1.00 32.57 ? 250 LYS C CG    1 
ATOM   2593 C CD    . LYS E 5 43  ? -2.678  -1.162  5.967   1.00 38.68 ? 250 LYS C CD    1 
ATOM   2594 C CE    . LYS E 5 43  ? -2.320  -2.291  6.922   1.00 42.53 ? 250 LYS C CE    1 
ATOM   2595 N NZ    . LYS E 5 43  ? -3.206  -2.305  8.127   1.00 47.53 ? 250 LYS C NZ    1 
ATOM   2596 N N     . VAL E 5 44  ? 0.059   -1.517  2.075   1.00 17.06 ? 251 VAL C N     1 
ATOM   2597 C CA    . VAL E 5 44  ? 1.498   -1.263  2.003   1.00 18.28 ? 251 VAL C CA    1 
ATOM   2598 C C     . VAL E 5 44  ? 1.735   0.056   2.747   1.00 18.41 ? 251 VAL C C     1 
ATOM   2599 O O     . VAL E 5 44  ? 1.117   1.073   2.419   1.00 17.96 ? 251 VAL C O     1 
ATOM   2600 C CB    . VAL E 5 44  ? 1.981   -1.112  0.539   1.00 17.98 ? 251 VAL C CB    1 
ATOM   2601 C CG1   . VAL E 5 44  ? 3.458   -0.670  0.511   1.00 18.10 ? 251 VAL C CG1   1 
ATOM   2602 C CG2   . VAL E 5 44  ? 1.818   -2.432  -0.211  1.00 18.12 ? 251 VAL C CG2   1 
ATOM   2603 N N     . THR E 5 45  ? 2.601   0.033   3.752   1.00 17.05 ? 252 THR C N     1 
ATOM   2604 C CA    . THR E 5 45  ? 2.891   1.235   4.533   1.00 18.42 ? 252 THR C CA    1 
ATOM   2605 C C     . THR E 5 45  ? 4.391   1.452   4.650   1.00 18.10 ? 252 THR C C     1 
ATOM   2606 O O     . THR E 5 45  ? 5.180   0.526   4.440   1.00 17.53 ? 252 THR C O     1 
ATOM   2607 C CB    . THR E 5 45  ? 2.314   1.139   5.969   1.00 19.46 ? 252 THR C CB    1 
ATOM   2608 O OG1   . THR E 5 45  ? 2.869   -0.004  6.626   1.00 22.60 ? 252 THR C OG1   1 
ATOM   2609 C CG2   . THR E 5 45  ? 0.795   1.033   5.949   1.00 22.59 ? 252 THR C CG2   1 
ATOM   2610 N N     . ARG E 5 46  ? 4.786   2.673   5.002   1.00 16.59 ? 253 ARG C N     1 
ATOM   2611 C CA    . ARG E 5 46  ? 6.199   3.003   5.138   1.00 16.41 ? 253 ARG C CA    1 
ATOM   2612 C C     . ARG E 5 46  ? 6.389   4.128   6.157   1.00 18.78 ? 253 ARG C C     1 
ATOM   2613 O O     . ARG E 5 46  ? 5.636   5.094   6.150   1.00 18.63 ? 253 ARG C O     1 
ATOM   2614 C CB    . ARG E 5 46  ? 6.777   3.470   3.779   1.00 16.75 ? 253 ARG C CB    1 
ATOM   2615 C CG    . ARG E 5 46  ? 8.251   3.941   3.845   1.00 16.75 ? 253 ARG C CG    1 
ATOM   2616 C CD    . ARG E 5 46  ? 8.660   4.803   2.629   1.00 16.91 ? 253 ARG C CD    1 
ATOM   2617 N NE    . ARG E 5 46  ? 7.801   5.983   2.528   1.00 17.89 ? 253 ARG C NE    1 
ATOM   2618 C CZ    . ARG E 5 46  ? 7.933   7.093   3.255   1.00 17.02 ? 253 ARG C CZ    1 
ATOM   2619 N NH1   . ARG E 5 46  ? 8.915   7.211   4.138   1.00 15.66 ? 253 ARG C NH1   1 
ATOM   2620 N NH2   . ARG E 5 46  ? 7.027   8.064   3.149   1.00 15.33 ? 253 ARG C NH2   1 
ATOM   2621 N N     . THR E 5 47  ? 7.377   3.979   7.035   1.00 18.64 ? 254 THR C N     1 
ATOM   2622 C CA    . THR E 5 47  ? 7.753   5.014   8.006   1.00 20.73 ? 254 THR C CA    1 
ATOM   2623 C C     . THR E 5 47  ? 9.269   5.084   7.870   1.00 20.70 ? 254 THR C C     1 
ATOM   2624 O O     . THR E 5 47  ? 9.966   4.091   8.114   1.00 19.98 ? 254 THR C O     1 
ATOM   2625 C CB    . THR E 5 47  ? 7.384   4.657   9.458   1.00 24.67 ? 254 THR C CB    1 
ATOM   2626 O OG1   . THR E 5 47  ? 5.964   4.531   9.575   1.00 25.86 ? 254 THR C OG1   1 
ATOM   2627 C CG2   . THR E 5 47  ? 7.856   5.766   10.398  1.00 26.92 ? 254 THR C CG2   1 
ATOM   2628 N N     . LYS E 5 48  ? 9.768   6.259   7.483   1.00 19.61 ? 255 LYS C N     1 
ATOM   2629 C CA    . LYS E 5 48  ? 11.189  6.465   7.220   1.00 19.12 ? 255 LYS C CA    1 
ATOM   2630 C C     . LYS E 5 48  ? 11.567  5.432   6.161   1.00 19.17 ? 255 LYS C C     1 
ATOM   2631 O O     . LYS E 5 48  ? 10.972  5.436   5.086   1.00 20.21 ? 255 LYS C O     1 
ATOM   2632 C CB    . LYS E 5 48  ? 12.031  6.328   8.501   1.00 22.28 ? 255 LYS C CB    1 
ATOM   2633 C CG    . LYS E 5 48  ? 11.916  7.563   9.430   1.00 26.32 ? 255 LYS C CG    1 
ATOM   2634 C CD    . LYS E 5 48  ? 12.682  8.758   8.843   1.00 29.58 ? 255 LYS C CD    1 
ATOM   2635 C CE    . LYS E 5 48  ? 12.453  10.071  9.612   1.00 31.58 ? 255 LYS C CE    1 
ATOM   2636 N NZ    . LYS E 5 48  ? 12.912  10.024  11.031  1.00 32.30 ? 255 LYS C NZ    1 
ATOM   2637 N N     . ALA E 5 49  ? 12.528  4.552   6.427   1.00 18.03 ? 256 ALA C N     1 
ATOM   2638 C CA    . ALA E 5 49  ? 12.895  3.558   5.414   1.00 19.63 ? 256 ALA C CA    1 
ATOM   2639 C C     . ALA E 5 49  ? 12.330  2.169   5.718   1.00 19.37 ? 256 ALA C C     1 
ATOM   2640 O O     . ALA E 5 49  ? 12.683  1.186   5.056   1.00 17.19 ? 256 ALA C O     1 
ATOM   2641 C CB    . ALA E 5 49  ? 14.414  3.483   5.279   1.00 19.98 ? 256 ALA C CB    1 
ATOM   2642 N N     . ARG E 5 50  ? 11.432  2.098   6.692   1.00 18.56 ? 257 ARG C N     1 
ATOM   2643 C CA    . ARG E 5 50  ? 10.850  0.823   7.097   1.00 21.54 ? 257 ARG C CA    1 
ATOM   2644 C C     . ARG E 5 50  ? 9.519   0.539   6.406   1.00 17.53 ? 257 ARG C C     1 
ATOM   2645 O O     . ARG E 5 50  ? 8.524   1.213   6.656   1.00 17.78 ? 257 ARG C O     1 
ATOM   2646 C CB    . ARG E 5 50  ? 10.664  0.804   8.620   1.00 25.78 ? 257 ARG C CB    1 
ATOM   2647 C CG    . ARG E 5 50  ? 10.409  -0.586  9.175   1.00 37.47 ? 257 ARG C CG    1 
ATOM   2648 C CD    . ARG E 5 50  ? 10.150  -0.573  10.667  1.00 44.84 ? 257 ARG C CD    1 
ATOM   2649 N NE    . ARG E 5 50  ? 9.960   -1.919  11.199  1.00 52.72 ? 257 ARG C NE    1 
ATOM   2650 C CZ    . ARG E 5 50  ? 9.807   -2.184  12.493  1.00 57.92 ? 257 ARG C CZ    1 
ATOM   2651 N NH1   . ARG E 5 50  ? 9.823   -1.193  13.374  1.00 60.16 ? 257 ARG C NH1   1 
ATOM   2652 N NH2   . ARG E 5 50  ? 9.634   -3.432  12.911  1.00 60.75 ? 257 ARG C NH2   1 
ATOM   2653 N N     . TRP E 5 51  ? 9.507   -0.467  5.536   1.00 16.35 ? 258 TRP C N     1 
ATOM   2654 C CA    . TRP E 5 51  ? 8.295   -0.828  4.797   1.00 16.17 ? 258 TRP C CA    1 
ATOM   2655 C C     . TRP E 5 51  ? 7.596   -2.055  5.392   1.00 17.26 ? 258 TRP C C     1 
ATOM   2656 O O     . TRP E 5 51  ? 8.260   -2.976  5.881   1.00 16.55 ? 258 TRP C O     1 
ATOM   2657 C CB    . TRP E 5 51  ? 8.640   -1.143  3.329   1.00 15.36 ? 258 TRP C CB    1 
ATOM   2658 C CG    . TRP E 5 51  ? 9.077   0.032   2.479   1.00 15.03 ? 258 TRP C CG    1 
ATOM   2659 C CD1   . TRP E 5 51  ? 10.264  0.720   2.554   1.00 15.58 ? 258 TRP C CD1   1 
ATOM   2660 C CD2   . TRP E 5 51  ? 8.334   0.628   1.412   1.00 14.50 ? 258 TRP C CD2   1 
ATOM   2661 N NE1   . TRP E 5 51  ? 10.303  1.705   1.584   1.00 16.50 ? 258 TRP C NE1   1 
ATOM   2662 C CE2   . TRP E 5 51  ? 9.132   1.668   0.872   1.00 14.31 ? 258 TRP C CE2   1 
ATOM   2663 C CE3   . TRP E 5 51  ? 7.070   0.378   0.849   1.00 13.92 ? 258 TRP C CE3   1 
ATOM   2664 C CZ2   . TRP E 5 51  ? 8.701   2.465   -0.195  1.00 14.97 ? 258 TRP C CZ2   1 
ATOM   2665 C CZ3   . TRP E 5 51  ? 6.640   1.176   -0.219  1.00 15.73 ? 258 TRP C CZ3   1 
ATOM   2666 C CH2   . TRP E 5 51  ? 7.457   2.201   -0.729  1.00 14.45 ? 258 TRP C CH2   1 
ATOM   2667 N N     . LYS E 5 52  ? 6.262   -2.057  5.351   1.00 17.88 ? 259 LYS C N     1 
ATOM   2668 C CA    . LYS E 5 52  ? 5.458   -3.188  5.820   1.00 19.15 ? 259 LYS C CA    1 
ATOM   2669 C C     . LYS E 5 52  ? 4.373   -3.447  4.775   1.00 18.35 ? 259 LYS C C     1 
ATOM   2670 O O     . LYS E 5 52  ? 3.699   -2.526  4.321   1.00 19.58 ? 259 LYS C O     1 
ATOM   2671 C CB    . LYS E 5 52  ? 4.816   -2.895  7.185   1.00 20.05 ? 259 LYS C CB    1 
ATOM   2672 C CG    . LYS E 5 52  ? 5.830   -2.701  8.300   1.00 24.88 ? 259 LYS C CG    1 
ATOM   2673 C CD    . LYS E 5 52  ? 5.150   -2.507  9.647   1.00 29.63 ? 259 LYS C CD    1 
ATOM   2674 C CE    . LYS E 5 52  ? 6.177   -2.397  10.754  1.00 33.96 ? 259 LYS C CE    1 
ATOM   2675 N NZ    . LYS E 5 52  ? 5.520   -2.337  12.091  1.00 37.46 ? 259 LYS C NZ    1 
ATOM   2676 N N     . CYS E 5 53  ? 4.214   -4.704  4.380   1.00 17.09 ? 260 CYS C N     1 
ATOM   2677 C CA    . CYS E 5 53  ? 3.217   -5.055  3.387   1.00 18.57 ? 260 CYS C CA    1 
ATOM   2678 C C     . CYS E 5 53  ? 2.387   -6.228  3.891   1.00 20.44 ? 260 CYS C C     1 
ATOM   2679 O O     . CYS E 5 53  ? 2.945   -7.216  4.368   1.00 20.50 ? 260 CYS C O     1 
ATOM   2680 C CB    . CYS E 5 53  ? 3.894   -5.459  2.065   1.00 19.47 ? 260 CYS C CB    1 
ATOM   2681 S SG    . CYS E 5 53  ? 5.293   -4.427  1.577   1.00 24.74 ? 260 CYS C SG    1 
ATOM   2682 N N     . SER E 5 54  ? 1.062   -6.105  3.790   1.00 18.49 ? 261 SER C N     1 
ATOM   2683 C CA    . SER E 5 54  ? 0.133   -7.158  4.182   1.00 19.28 ? 261 SER C CA    1 
ATOM   2684 C C     . SER E 5 54  ? -0.341  -7.742  2.854   1.00 18.85 ? 261 SER C C     1 
ATOM   2685 O O     . SER E 5 54  ? -1.025  -7.073  2.082   1.00 19.81 ? 261 SER C O     1 
ATOM   2686 C CB    . SER E 5 54  ? -1.054  -6.575  4.961   1.00 21.28 ? 261 SER C CB    1 
ATOM   2687 O OG    . SER E 5 54  ? -0.597  -5.994  6.170   1.00 29.30 ? 261 SER C OG    1 
ATOM   2688 N N     . LEU E 5 55  ? 0.034   -8.990  2.596   1.00 18.92 ? 262 LEU C N     1 
ATOM   2689 C CA    . LEU E 5 55  ? -0.295  -9.643  1.337   1.00 16.52 ? 262 LEU C CA    1 
ATOM   2690 C C     . LEU E 5 55  ? -1.205  -10.837 1.580   1.00 16.09 ? 262 LEU C C     1 
ATOM   2691 O O     . LEU E 5 55  ? -1.323  -11.310 2.701   1.00 18.09 ? 262 LEU C O     1 
ATOM   2692 C CB    . LEU E 5 55  ? 1.007   -10.105 0.659   1.00 15.65 ? 262 LEU C CB    1 
ATOM   2693 C CG    . LEU E 5 55  ? 2.150   -9.073  0.599   1.00 15.15 ? 262 LEU C CG    1 
ATOM   2694 C CD1   . LEU E 5 55  ? 3.421   -9.725  0.027   1.00 15.76 ? 262 LEU C CD1   1 
ATOM   2695 C CD2   . LEU E 5 55  ? 1.715   -7.887  -0.283  1.00 18.27 ? 262 LEU C CD2   1 
ATOM   2696 N N     . LYS E 5 56  ? -1.840  -11.323 0.521   1.00 17.12 ? 263 LYS C N     1 
ATOM   2697 C CA    . LYS E 5 56  ? -2.742  -12.468 0.638   1.00 19.12 ? 263 LYS C CA    1 
ATOM   2698 C C     . LYS E 5 56  ? -2.853  -13.249 -0.667  1.00 17.82 ? 263 LYS C C     1 
ATOM   2699 O O     . LYS E 5 56  ? -2.424  -12.779 -1.729  1.00 17.90 ? 263 LYS C O     1 
ATOM   2700 C CB    . LYS E 5 56  ? -4.139  -11.977 1.032   1.00 23.32 ? 263 LYS C CB    1 
ATOM   2701 C CG    . LYS E 5 56  ? -4.747  -11.055 -0.005  1.00 29.81 ? 263 LYS C CG    1 
ATOM   2702 C CD    . LYS E 5 56  ? -5.984  -10.338 0.511   1.00 39.26 ? 263 LYS C CD    1 
ATOM   2703 C CE    . LYS E 5 56  ? -7.224  -11.203 0.401   1.00 43.66 ? 263 LYS C CE    1 
ATOM   2704 N NZ    . LYS E 5 56  ? -8.286  -10.510 -0.384  1.00 47.04 ? 263 LYS C NZ    1 
ATOM   2705 N N     . ASP E 5 57  ? -3.432  -14.446 -0.566  1.00 16.14 ? 264 ASP C N     1 
ATOM   2706 C CA    . ASP E 5 57  ? -3.689  -15.308 -1.718  1.00 16.53 ? 264 ASP C CA    1 
ATOM   2707 C C     . ASP E 5 57  ? -2.520  -15.397 -2.699  1.00 15.65 ? 264 ASP C C     1 
ATOM   2708 O O     . ASP E 5 57  ? -2.635  -14.960 -3.845  1.00 16.61 ? 264 ASP C O     1 
ATOM   2709 C CB    . ASP E 5 57  ? -4.916  -14.784 -2.469  1.00 15.40 ? 264 ASP C CB    1 
ATOM   2710 C CG    . ASP E 5 57  ? -6.151  -14.680 -1.579  1.00 19.68 ? 264 ASP C CG    1 
ATOM   2711 O OD1   . ASP E 5 57  ? -6.052  -14.943 -0.362  1.00 19.57 ? 264 ASP C OD1   1 
ATOM   2712 O OD2   . ASP E 5 57  ? -7.221  -14.324 -2.108  1.00 20.07 ? 264 ASP C OD2   1 
ATOM   2713 N N     . GLY E 5 58  ? -1.416  -15.993 -2.272  1.00 16.63 ? 265 GLY C N     1 
ATOM   2714 C CA    . GLY E 5 58  ? -0.281  -16.056 -3.165  1.00 15.29 ? 265 GLY C CA    1 
ATOM   2715 C C     . GLY E 5 58  ? 0.426   -17.384 -3.284  1.00 16.20 ? 265 GLY C C     1 
ATOM   2716 O O     . GLY E 5 58  ? 0.117   -18.370 -2.598  1.00 16.16 ? 265 GLY C O     1 
ATOM   2717 N N     . VAL E 5 59  ? 1.378   -17.397 -4.206  1.00 14.04 ? 266 VAL C N     1 
ATOM   2718 C CA    . VAL E 5 59  ? 2.203   -18.560 -4.436  1.00 14.54 ? 266 VAL C CA    1 
ATOM   2719 C C     . VAL E 5 59  ? 3.623   -18.036 -4.609  1.00 15.44 ? 266 VAL C C     1 
ATOM   2720 O O     . VAL E 5 59  ? 3.842   -16.965 -5.180  1.00 13.93 ? 266 VAL C O     1 
ATOM   2721 C CB    . VAL E 5 59  ? 1.750   -19.351 -5.696  1.00 16.40 ? 266 VAL C CB    1 
ATOM   2722 C CG1   . VAL E 5 59  ? 1.740   -18.456 -6.917  1.00 16.46 ? 266 VAL C CG1   1 
ATOM   2723 C CG2   . VAL E 5 59  ? 2.676   -20.554 -5.903  1.00 19.18 ? 266 VAL C CG2   1 
ATOM   2724 N N     . VAL E 5 60  ? 4.587   -18.771 -4.075  1.00 16.38 ? 267 VAL C N     1 
ATOM   2725 C CA    . VAL E 5 60  ? 5.963   -18.343 -4.189  1.00 15.31 ? 267 VAL C CA    1 
ATOM   2726 C C     . VAL E 5 60  ? 6.892   -19.535 -4.340  1.00 17.85 ? 267 VAL C C     1 
ATOM   2727 O O     . VAL E 5 60  ? 6.652   -20.602 -3.766  1.00 18.34 ? 267 VAL C O     1 
ATOM   2728 C CB    . VAL E 5 60  ? 6.390   -17.480 -2.948  1.00 15.31 ? 267 VAL C CB    1 
ATOM   2729 C CG1   . VAL E 5 60  ? 6.164   -18.242 -1.651  1.00 16.98 ? 267 VAL C CG1   1 
ATOM   2730 C CG2   . VAL E 5 60  ? 7.845   -17.063 -3.075  1.00 16.42 ? 267 VAL C CG2   1 
ATOM   2731 N N     . THR E 5 61  ? 7.918   -19.347 -5.161  1.00 18.17 ? 268 THR C N     1 
ATOM   2732 C CA    . THR E 5 61  ? 8.941   -20.357 -5.375  1.00 22.19 ? 268 THR C CA    1 
ATOM   2733 C C     . THR E 5 61  ? 10.188  -19.751 -4.746  1.00 23.38 ? 268 THR C C     1 
ATOM   2734 O O     . THR E 5 61  ? 10.585  -18.638 -5.085  1.00 22.94 ? 268 THR C O     1 
ATOM   2735 C CB    . THR E 5 61  ? 9.199   -20.619 -6.886  1.00 21.80 ? 268 THR C CB    1 
ATOM   2736 O OG1   . THR E 5 61  ? 8.007   -21.138 -7.484  1.00 24.42 ? 268 THR C OG1   1 
ATOM   2737 C CG2   . THR E 5 61  ? 10.336  -21.643 -7.077  1.00 23.33 ? 268 THR C CG2   1 
ATOM   2738 N N     . ILE E 5 62  ? 10.770  -20.476 -3.801  1.00 24.49 ? 269 ILE C N     1 
ATOM   2739 C CA    . ILE E 5 62  ? 11.969  -20.044 -3.106  1.00 27.51 ? 269 ILE C CA    1 
ATOM   2740 C C     . ILE E 5 62  ? 12.919  -21.231 -3.020  1.00 28.91 ? 269 ILE C C     1 
ATOM   2741 O O     . ILE E 5 62  ? 12.547  -22.293 -2.512  1.00 27.39 ? 269 ILE C O     1 
ATOM   2742 C CB    . ILE E 5 62  ? 11.658  -19.587 -1.672  1.00 30.36 ? 269 ILE C CB    1 
ATOM   2743 C CG1   . ILE E 5 62  ? 10.893  -18.263 -1.690  1.00 31.70 ? 269 ILE C CG1   1 
ATOM   2744 C CG2   . ILE E 5 62  ? 12.951  -19.439 -0.895  1.00 31.99 ? 269 ILE C CG2   1 
ATOM   2745 C CD1   . ILE E 5 62  ? 10.119  -18.005 -0.417  1.00 36.60 ? 269 ILE C CD1   1 
ATOM   2746 N N     . ASN E 5 63  ? 14.138  -21.039 -3.515  1.00 29.10 ? 270 ASN C N     1 
ATOM   2747 C CA    . ASN E 5 63  ? 15.151  -22.091 -3.495  1.00 30.64 ? 270 ASN C CA    1 
ATOM   2748 C C     . ASN E 5 63  ? 14.614  -23.372 -4.117  1.00 31.86 ? 270 ASN C C     1 
ATOM   2749 O O     . ASN E 5 63  ? 14.810  -24.460 -3.580  1.00 31.19 ? 270 ASN C O     1 
ATOM   2750 C CB    . ASN E 5 63  ? 15.618  -22.378 -2.064  1.00 29.47 ? 270 ASN C CB    1 
ATOM   2751 C CG    . ASN E 5 63  ? 16.271  -21.171 -1.403  1.00 30.55 ? 270 ASN C CG    1 
ATOM   2752 O OD1   . ASN E 5 63  ? 16.841  -20.311 -2.071  1.00 30.50 ? 270 ASN C OD1   1 
ATOM   2753 N ND2   . ASN E 5 63  ? 16.198  -21.115 -0.081  1.00 29.08 ? 270 ASN C ND2   1 
ATOM   2754 N N     . ARG E 5 64  ? 13.907  -23.218 -5.235  1.00 33.05 ? 271 ARG C N     1 
ATOM   2755 C CA    . ARG E 5 64  ? 13.349  -24.340 -5.991  1.00 33.89 ? 271 ARG C CA    1 
ATOM   2756 C C     . ARG E 5 64  ? 12.179  -25.122 -5.378  1.00 32.88 ? 271 ARG C C     1 
ATOM   2757 O O     . ARG E 5 64  ? 11.820  -26.191 -5.881  1.00 33.08 ? 271 ARG C O     1 
ATOM   2758 C CB    . ARG E 5 64  ? 14.488  -25.297 -6.369  1.00 37.24 ? 271 ARG C CB    1 
ATOM   2759 C CG    . ARG E 5 64  ? 15.634  -24.598 -7.109  1.00 41.77 ? 271 ARG C CG    1 
ATOM   2760 C CD    . ARG E 5 64  ? 16.915  -25.422 -7.079  1.00 47.55 ? 271 ARG C CD    1 
ATOM   2761 N NE    . ARG E 5 64  ? 17.379  -25.646 -5.709  1.00 51.96 ? 271 ARG C NE    1 
ATOM   2762 C CZ    . ARG E 5 64  ? 17.866  -24.696 -4.912  1.00 54.63 ? 271 ARG C CZ    1 
ATOM   2763 N NH1   . ARG E 5 64  ? 17.965  -23.443 -5.343  1.00 54.35 ? 271 ARG C NH1   1 
ATOM   2764 N NH2   . ARG E 5 64  ? 18.239  -24.997 -3.674  1.00 55.30 ? 271 ARG C NH2   1 
ATOM   2765 N N     . ASN E 5 65  ? 11.592  -24.602 -4.301  1.00 30.85 ? 272 ASN C N     1 
ATOM   2766 C CA    . ASN E 5 65  ? 10.432  -25.239 -3.663  1.00 30.02 ? 272 ASN C CA    1 
ATOM   2767 C C     . ASN E 5 65  ? 9.270   -24.249 -3.711  1.00 28.06 ? 272 ASN C C     1 
ATOM   2768 O O     . ASN E 5 65  ? 9.498   -23.040 -3.639  1.00 25.13 ? 272 ASN C O     1 
ATOM   2769 C CB    . ASN E 5 65  ? 10.726  -25.597 -2.208  1.00 33.96 ? 272 ASN C CB    1 
ATOM   2770 C CG    . ASN E 5 65  ? 11.643  -26.798 -2.080  1.00 38.28 ? 272 ASN C CG    1 
ATOM   2771 O OD1   . ASN E 5 65  ? 11.327  -27.885 -2.562  1.00 39.33 ? 272 ASN C OD1   1 
ATOM   2772 N ND2   . ASN E 5 65  ? 12.783  -26.607 -1.433  1.00 38.71 ? 272 ASN C ND2   1 
ATOM   2773 N N     . ASP E 5 66  ? 8.040   -24.753 -3.813  1.00 26.82 ? 273 ASP C N     1 
ATOM   2774 C CA    . ASP E 5 66  ? 6.863   -23.882 -3.895  1.00 27.52 ? 273 ASP C CA    1 
ATOM   2775 C C     . ASP E 5 66  ? 6.003   -23.851 -2.640  1.00 26.78 ? 273 ASP C C     1 
ATOM   2776 O O     . ASP E 5 66  ? 5.828   -24.867 -1.957  1.00 27.05 ? 273 ASP C O     1 
ATOM   2777 C CB    . ASP E 5 66  ? 5.965   -24.284 -5.064  1.00 30.64 ? 273 ASP C CB    1 
ATOM   2778 C CG    . ASP E 5 66  ? 6.671   -24.214 -6.398  1.00 33.73 ? 273 ASP C CG    1 
ATOM   2779 O OD1   . ASP E 5 66  ? 7.713   -23.527 -6.504  1.00 36.77 ? 273 ASP C OD1   1 
ATOM   2780 O OD2   . ASP E 5 66  ? 6.172   -24.845 -7.349  1.00 34.55 ? 273 ASP C OD2   1 
ATOM   2781 N N     . TYR E 5 67  ? 5.452   -22.676 -2.353  1.00 22.69 ? 274 TYR C N     1 
ATOM   2782 C CA    . TYR E 5 67  ? 4.598   -22.478 -1.190  1.00 22.88 ? 274 TYR C CA    1 
ATOM   2783 C C     . TYR E 5 67  ? 3.388   -21.664 -1.594  1.00 23.82 ? 274 TYR C C     1 
ATOM   2784 O O     . TYR E 5 67  ? 3.493   -20.738 -2.397  1.00 22.96 ? 274 TYR C O     1 
ATOM   2785 C CB    . TYR E 5 67  ? 5.342   -21.725 -0.079  1.00 23.23 ? 274 TYR C CB    1 
ATOM   2786 C CG    . TYR E 5 67  ? 6.599   -22.420 0.378   1.00 26.11 ? 274 TYR C CG    1 
ATOM   2787 C CD1   . TYR E 5 67  ? 7.769   -22.344 -0.375  1.00 27.93 ? 274 TYR C CD1   1 
ATOM   2788 C CD2   . TYR E 5 67  ? 6.606   -23.198 1.535   1.00 27.02 ? 274 TYR C CD2   1 
ATOM   2789 C CE1   . TYR E 5 67  ? 8.913   -23.029 0.010   1.00 31.33 ? 274 TYR C CE1   1 
ATOM   2790 C CE2   . TYR E 5 67  ? 7.746   -23.888 1.930   1.00 29.57 ? 274 TYR C CE2   1 
ATOM   2791 C CZ    . TYR E 5 67  ? 8.895   -23.798 1.158   1.00 30.19 ? 274 TYR C CZ    1 
ATOM   2792 O OH    . TYR E 5 67  ? 10.036  -24.478 1.520   1.00 33.21 ? 274 TYR C OH    1 
ATOM   2793 N N     . THR E 5 68  ? 2.230   -22.028 -1.068  1.00 21.77 ? 275 THR C N     1 
ATOM   2794 C CA    . THR E 5 68  ? 1.026   -21.271 -1.362  1.00 22.63 ? 275 THR C CA    1 
ATOM   2795 C C     . THR E 5 68  ? 0.682   -20.665 -0.016  1.00 25.95 ? 275 THR C C     1 
ATOM   2796 O O     . THR E 5 68  ? 1.073   -21.214 1.015   1.00 31.32 ? 275 THR C O     1 
ATOM   2797 C CB    . THR E 5 68  ? -0.094  -22.186 -1.907  1.00 25.47 ? 275 THR C CB    1 
ATOM   2798 O OG1   . THR E 5 68  ? -0.212  -23.356 -1.090  1.00 25.31 ? 275 THR C OG1   1 
ATOM   2799 C CG2   . THR E 5 68  ? 0.240   -22.623 -3.331  1.00 21.76 ? 275 THR C CG2   1 
ATOM   2800 N N     . PHE E 5 69  ? 0.011   -19.521 0.009   1.00 21.95 ? 276 PHE C N     1 
ATOM   2801 C CA    . PHE E 5 69  ? -0.307  -18.924 1.294   1.00 20.83 ? 276 PHE C CA    1 
ATOM   2802 C C     . PHE E 5 69  ? -1.553  -18.075 1.301   1.00 19.25 ? 276 PHE C C     1 
ATOM   2803 O O     . PHE E 5 69  ? -1.914  -17.464 0.301   1.00 17.97 ? 276 PHE C O     1 
ATOM   2804 C CB    . PHE E 5 69  ? 0.886   -18.099 1.811   1.00 21.67 ? 276 PHE C CB    1 
ATOM   2805 C CG    . PHE E 5 69  ? 1.253   -16.933 0.927   1.00 21.80 ? 276 PHE C CG    1 
ATOM   2806 C CD1   . PHE E 5 69  ? 0.535   -15.745 0.988   1.00 20.92 ? 276 PHE C CD1   1 
ATOM   2807 C CD2   . PHE E 5 69  ? 2.349   -17.016 0.068   1.00 22.23 ? 276 PHE C CD2   1 
ATOM   2808 C CE1   . PHE E 5 69  ? 0.903   -14.640 0.211   1.00 23.33 ? 276 PHE C CE1   1 
ATOM   2809 C CE2   . PHE E 5 69  ? 2.730   -15.920 -0.718  1.00 23.08 ? 276 PHE C CE2   1 
ATOM   2810 C CZ    . PHE E 5 69  ? 2.006   -14.727 -0.644  1.00 21.03 ? 276 PHE C CZ    1 
ATOM   2811 N N     . GLN E 5 70  ? -2.211  -18.054 2.454   1.00 18.67 ? 277 GLN C N     1 
ATOM   2812 C CA    . GLN E 5 70  ? -3.426  -17.282 2.651   1.00 18.86 ? 277 GLN C CA    1 
ATOM   2813 C C     . GLN E 5 70  ? -3.009  -15.844 2.963   1.00 19.87 ? 277 GLN C C     1 
ATOM   2814 O O     . GLN E 5 70  ? -3.585  -14.895 2.439   1.00 19.92 ? 277 GLN C O     1 
ATOM   2815 C CB    . GLN E 5 70  ? -4.221  -17.869 3.828   1.00 20.82 ? 277 GLN C CB    1 
ATOM   2816 C CG    . GLN E 5 70  ? -5.382  -17.007 4.323   1.00 24.47 ? 277 GLN C CG    1 
ATOM   2817 C CD    . GLN E 5 70  ? -6.552  -16.951 3.356   1.00 27.67 ? 277 GLN C CD    1 
ATOM   2818 O OE1   . GLN E 5 70  ? -7.473  -16.152 3.533   1.00 29.12 ? 277 GLN C OE1   1 
ATOM   2819 N NE2   . GLN E 5 70  ? -6.527  -17.800 2.330   1.00 27.98 ? 277 GLN C NE2   1 
ATOM   2820 N N     . LYS E 5 71  ? -2.000  -15.697 3.818   1.00 20.44 ? 278 LYS C N     1 
ATOM   2821 C CA    . LYS E 5 71  ? -1.507  -14.372 4.206   1.00 22.37 ? 278 LYS C CA    1 
ATOM   2822 C C     . LYS E 5 71  ? -0.001  -14.332 4.267   1.00 21.16 ? 278 LYS C C     1 
ATOM   2823 O O     . LYS E 5 71  ? 0.653   -15.342 4.517   1.00 20.40 ? 278 LYS C O     1 
ATOM   2824 C CB    . LYS E 5 71  ? -1.969  -13.986 5.611   1.00 26.08 ? 278 LYS C CB    1 
ATOM   2825 C CG    . LYS E 5 71  ? -3.436  -13.787 5.853   1.00 33.39 ? 278 LYS C CG    1 
ATOM   2826 C CD    . LYS E 5 71  ? -3.676  -13.900 7.361   1.00 39.32 ? 278 LYS C CD    1 
ATOM   2827 C CE    . LYS E 5 71  ? -4.610  -12.823 7.873   1.00 44.05 ? 278 LYS C CE    1 
ATOM   2828 N NZ    . LYS E 5 71  ? -5.863  -12.800 7.080   1.00 46.49 ? 278 LYS C NZ    1 
ATOM   2829 N N     . ALA E 5 72  ? 0.548   -13.137 4.078   1.00 20.56 ? 279 ALA C N     1 
ATOM   2830 C CA    . ALA E 5 72  ? 1.984   -12.951 4.194   1.00 20.85 ? 279 ALA C CA    1 
ATOM   2831 C C     . ALA E 5 72  ? 2.232   -11.530 4.681   1.00 20.40 ? 279 ALA C C     1 
ATOM   2832 O O     . ALA E 5 72  ? 1.562   -10.598 4.252   1.00 20.98 ? 279 ALA C O     1 
ATOM   2833 C CB    . ALA E 5 72  ? 2.678   -13.178 2.850   1.00 20.50 ? 279 ALA C CB    1 
ATOM   2834 N N     A GLN E 5 73  ? 3.181   -11.380 5.600   0.50 19.51 ? 280 GLN C N     1 
ATOM   2835 N N     B GLN E 5 73  ? 3.174   -11.371 5.604   0.50 19.48 ? 280 GLN C N     1 
ATOM   2836 C CA    A GLN E 5 73  ? 3.533   -10.068 6.123   0.50 20.16 ? 280 GLN C CA    1 
ATOM   2837 C CA    B GLN E 5 73  ? 3.518   -10.046 6.102   0.50 20.03 ? 280 GLN C CA    1 
ATOM   2838 C C     A GLN E 5 73  ? 4.995   -9.795  5.781   0.50 18.99 ? 280 GLN C C     1 
ATOM   2839 C C     B GLN E 5 73  ? 4.983   -9.793  5.776   0.50 18.96 ? 280 GLN C C     1 
ATOM   2840 O O     A GLN E 5 73  ? 5.872   -10.600 6.089   0.50 19.50 ? 280 GLN C O     1 
ATOM   2841 O O     B GLN E 5 73  ? 5.849   -10.610 6.085   0.50 19.48 ? 280 GLN C O     1 
ATOM   2842 C CB    A GLN E 5 73  ? 3.348   -10.018 7.645   0.50 22.19 ? 280 GLN C CB    1 
ATOM   2843 C CB    B GLN E 5 73  ? 3.294   -9.946  7.617   0.50 22.14 ? 280 GLN C CB    1 
ATOM   2844 C CG    A GLN E 5 73  ? 1.947   -10.361 8.138   0.50 25.10 ? 280 GLN C CG    1 
ATOM   2845 C CG    B GLN E 5 73  ? 3.891   -8.692  8.287   0.50 24.02 ? 280 GLN C CG    1 
ATOM   2846 C CD    A GLN E 5 73  ? 0.862   -9.492  7.529   0.50 27.43 ? 280 GLN C CD    1 
ATOM   2847 C CD    B GLN E 5 73  ? 3.204   -7.382  7.909   0.50 27.42 ? 280 GLN C CD    1 
ATOM   2848 O OE1   A GLN E 5 73  ? 0.997   -8.271  7.453   0.50 29.47 ? 280 GLN C OE1   1 
ATOM   2849 O OE1   B GLN E 5 73  ? 1.981   -7.316  7.781   0.50 24.62 ? 280 GLN C OE1   1 
ATOM   2850 N NE2   A GLN E 5 73  ? -0.229  -10.118 7.106   0.50 27.20 ? 280 GLN C NE2   1 
ATOM   2851 N NE2   B GLN E 5 73  ? 3.998   -6.323  7.756   0.50 25.61 ? 280 GLN C NE2   1 
ATOM   2852 N N     . VAL E 5 74  ? 5.256   -8.667  5.133   1.00 17.04 ? 281 VAL C N     1 
ATOM   2853 C CA    . VAL E 5 74  ? 6.621   -8.320  4.779   1.00 17.11 ? 281 VAL C CA    1 
ATOM   2854 C C     . VAL E 5 74  ? 7.087   -7.139  5.623   1.00 18.46 ? 281 VAL C C     1 
ATOM   2855 O O     . VAL E 5 74  ? 6.345   -6.175  5.802   1.00 17.31 ? 281 VAL C O     1 
ATOM   2856 C CB    . VAL E 5 74  ? 6.737   -7.899  3.284   1.00 18.04 ? 281 VAL C CB    1 
ATOM   2857 C CG1   . VAL E 5 74  ? 8.199   -7.537  2.943   1.00 17.63 ? 281 VAL C CG1   1 
ATOM   2858 C CG2   . VAL E 5 74  ? 6.245   -9.018  2.382   1.00 19.76 ? 281 VAL C CG2   1 
ATOM   2859 N N     A GLU E 5 75  ? 8.296   -7.242  6.167   0.60 16.72 ? 282 GLU C N     1 
ATOM   2860 N N     B GLU E 5 75  ? 8.301   -7.236  6.157   0.40 17.65 ? 282 GLU C N     1 
ATOM   2861 C CA    A GLU E 5 75  ? 8.912   -6.163  6.943   0.60 18.26 ? 282 GLU C CA    1 
ATOM   2862 C CA    B GLU E 5 75  ? 8.897   -6.146  6.925   0.40 19.05 ? 282 GLU C CA    1 
ATOM   2863 C C     A GLU E 5 75  ? 10.319  -6.002  6.363   0.60 17.74 ? 282 GLU C C     1 
ATOM   2864 C C     B GLU E 5 75  ? 10.305  -6.004  6.352   0.40 18.27 ? 282 GLU C C     1 
ATOM   2865 O O     A GLU E 5 75  ? 11.182  -6.854  6.561   0.60 17.54 ? 282 GLU C O     1 
ATOM   2866 O O     B GLU E 5 75  ? 11.155  -6.871  6.544   0.40 18.05 ? 282 GLU C O     1 
ATOM   2867 C CB    A GLU E 5 75  ? 8.970   -6.521  8.438   0.60 20.37 ? 282 GLU C CB    1 
ATOM   2868 C CB    B GLU E 5 75  ? 8.968   -6.473  8.423   0.40 21.46 ? 282 GLU C CB    1 
ATOM   2869 C CG    A GLU E 5 75  ? 7.606   -6.467  9.125   0.60 24.20 ? 282 GLU C CG    1 
ATOM   2870 C CG    B GLU E 5 75  ? 9.289   -5.250  9.274   0.40 27.04 ? 282 GLU C CG    1 
ATOM   2871 C CD    A GLU E 5 75  ? 7.684   -6.698  10.621  0.60 30.05 ? 282 GLU C CD    1 
ATOM   2872 C CD    B GLU E 5 75  ? 9.360   -5.548  10.756  0.40 30.40 ? 282 GLU C CD    1 
ATOM   2873 O OE1   A GLU E 5 75  ? 8.516   -6.045  11.284  0.60 34.47 ? 282 GLU C OE1   1 
ATOM   2874 O OE1   B GLU E 5 75  ? 8.356   -6.038  11.320  0.40 33.65 ? 282 GLU C OE1   1 
ATOM   2875 O OE2   A GLU E 5 75  ? 6.906   -7.522  11.136  0.60 33.26 ? 282 GLU C OE2   1 
ATOM   2876 O OE2   B GLU E 5 75  ? 10.422  -5.286  11.357  0.40 31.65 ? 282 GLU C OE2   1 
ATOM   2877 N N     . ALA E 5 76  ? 10.544  -4.920  5.623   1.00 19.19 ? 283 ALA C N     1 
ATOM   2878 C CA    . ALA E 5 76  ? 11.848  -4.697  5.002   1.00 18.11 ? 283 ALA C CA    1 
ATOM   2879 C C     . ALA E 5 76  ? 12.346  -3.267  5.101   1.00 19.60 ? 283 ALA C C     1 
ATOM   2880 O O     . ALA E 5 76  ? 11.575  -2.321  4.978   1.00 17.76 ? 283 ALA C O     1 
ATOM   2881 C CB    . ALA E 5 76  ? 11.796  -5.112  3.538   1.00 18.59 ? 283 ALA C CB    1 
ATOM   2882 N N     . GLU E 5 77  ? 13.647  -3.132  5.312   1.00 20.37 ? 284 GLU C N     1 
ATOM   2883 C CA    . GLU E 5 77  ? 14.305  -1.830  5.423   1.00 22.00 ? 284 GLU C CA    1 
ATOM   2884 C C     . GLU E 5 77  ? 14.987  -1.455  4.099   1.00 19.36 ? 284 GLU C C     1 
ATOM   2885 O O     . GLU E 5 77  ? 15.789  -2.224  3.562   1.00 18.20 ? 284 GLU C O     1 
ATOM   2886 C CB    . GLU E 5 77  ? 15.350  -1.880  6.540   1.00 26.05 ? 284 GLU C CB    1 
ATOM   2887 C CG    . GLU E 5 77  ? 14.781  -1.942  7.954   1.00 36.91 ? 284 GLU C CG    1 
ATOM   2888 C CD    . GLU E 5 77  ? 14.338  -0.584  8.469   1.00 43.02 ? 284 GLU C CD    1 
ATOM   2889 O OE1   . GLU E 5 77  ? 14.752  0.441   7.884   1.00 47.42 ? 284 GLU C OE1   1 
ATOM   2890 O OE2   . GLU E 5 77  ? 13.591  -0.540  9.471   1.00 48.03 ? 284 GLU C OE2   1 
ATOM   2891 N N     . TRP E 5 78  ? 14.668  -0.272  3.582   1.00 19.60 ? 285 TRP C N     1 
ATOM   2892 C CA    . TRP E 5 78  ? 15.235  0.222   2.325   1.00 21.17 ? 285 TRP C CA    1 
ATOM   2893 C C     . TRP E 5 78  ? 16.483  1.053   2.685   1.00 25.98 ? 285 TRP C C     1 
ATOM   2894 O O     . TRP E 5 78  ? 16.417  2.277   2.822   1.00 27.89 ? 285 TRP C O     1 
ATOM   2895 C CB    . TRP E 5 78  ? 14.178  1.083   1.600   1.00 17.33 ? 285 TRP C CB    1 
ATOM   2896 C CG    . TRP E 5 78  ? 14.507  1.482   0.172   1.00 18.31 ? 285 TRP C CG    1 
ATOM   2897 C CD1   . TRP E 5 78  ? 14.343  0.728   -0.959  1.00 17.02 ? 285 TRP C CD1   1 
ATOM   2898 C CD2   . TRP E 5 78  ? 15.000  2.752   -0.259  1.00 15.89 ? 285 TRP C CD2   1 
ATOM   2899 N NE1   . TRP E 5 78  ? 14.699  1.461   -2.077  1.00 16.79 ? 285 TRP C NE1   1 
ATOM   2900 C CE2   . TRP E 5 78  ? 15.108  2.706   -1.671  1.00 17.64 ? 285 TRP C CE2   1 
ATOM   2901 C CE3   . TRP E 5 78  ? 15.360  3.932   0.412   1.00 18.59 ? 285 TRP C CE3   1 
ATOM   2902 C CZ2   . TRP E 5 78  ? 15.561  3.795   -2.421  1.00 17.75 ? 285 TRP C CZ2   1 
ATOM   2903 C CZ3   . TRP E 5 78  ? 15.807  5.013   -0.332  1.00 15.34 ? 285 TRP C CZ3   1 
ATOM   2904 C CH2   . TRP E 5 78  ? 15.906  4.938   -1.738  1.00 16.48 ? 285 TRP C CH2   1 
ATOM   2905 N N     . VAL E 5 79  ? 17.615  0.385   2.864   1.00 31.64 ? 286 VAL C N     1 
ATOM   2906 C CA    . VAL E 5 79  ? 18.841  1.088   3.235   1.00 35.56 ? 286 VAL C CA    1 
ATOM   2907 C C     . VAL E 5 79  ? 20.061  0.499   2.524   1.00 38.55 ? 286 VAL C C     1 
ATOM   2908 O O     . VAL E 5 79  ? 19.871  -0.333  1.608   1.00 38.35 ? 286 VAL C O     1 
ATOM   2909 C CB    . VAL E 5 79  ? 19.082  1.036   4.777   1.00 37.38 ? 286 VAL C CB    1 
ATOM   2910 C CG1   . VAL E 5 79  ? 20.049  2.133   5.188   1.00 39.66 ? 286 VAL C CG1   1 
ATOM   2911 C CG2   . VAL E 5 79  ? 17.767  1.180   5.540   1.00 38.48 ? 286 VAL C CG2   1 
ATOM   2912 O OXT   . VAL E 5 79  ? 21.196  0.887   2.890   1.00 45.28 ? 286 VAL C OXT   1 
ATOM   2913 N N     . GLY F 6 4   ? -12.609 -10.640 -15.433 1.00 40.53 ? 5   GLY D N     1 
ATOM   2914 C CA    . GLY F 6 4   ? -12.118 -9.699  -14.385 1.00 37.67 ? 5   GLY D CA    1 
ATOM   2915 C C     . GLY F 6 4   ? -11.143 -10.332 -13.406 1.00 36.46 ? 5   GLY D C     1 
ATOM   2916 O O     . GLY F 6 4   ? -11.217 -10.077 -12.202 1.00 37.77 ? 5   GLY D O     1 
ATOM   2917 N N     . TYR F 6 5   ? -10.233 -11.164 -13.906 1.00 34.50 ? 6   TYR D N     1 
ATOM   2918 C CA    . TYR F 6 5   ? -9.238  -11.797 -13.037 1.00 32.89 ? 6   TYR D CA    1 
ATOM   2919 C C     . TYR F 6 5   ? -7.824  -11.470 -13.507 1.00 29.25 ? 6   TYR D C     1 
ATOM   2920 O O     . TYR F 6 5   ? -7.558  -11.440 -14.698 1.00 31.06 ? 6   TYR D O     1 
ATOM   2921 C CB    . TYR F 6 5   ? -9.420  -13.319 -13.011 1.00 34.90 ? 6   TYR D CB    1 
ATOM   2922 C CG    . TYR F 6 5   ? -10.739 -13.764 -12.422 1.00 36.48 ? 6   TYR D CG    1 
ATOM   2923 C CD1   . TYR F 6 5   ? -11.859 -13.962 -13.233 1.00 39.13 ? 6   TYR D CD1   1 
ATOM   2924 C CD2   . TYR F 6 5   ? -10.876 -13.961 -11.051 1.00 37.61 ? 6   TYR D CD2   1 
ATOM   2925 C CE1   . TYR F 6 5   ? -13.081 -14.345 -12.688 1.00 40.85 ? 6   TYR D CE1   1 
ATOM   2926 C CE2   . TYR F 6 5   ? -12.093 -14.341 -10.498 1.00 40.84 ? 6   TYR D CE2   1 
ATOM   2927 C CZ    . TYR F 6 5   ? -13.190 -14.531 -11.323 1.00 41.92 ? 6   TYR D CZ    1 
ATOM   2928 O OH    . TYR F 6 5   ? -14.395 -14.909 -10.775 1.00 45.85 ? 6   TYR D OH    1 
ATOM   2929 N N     . TYR F 6 6   ? -6.923  -11.221 -12.563 1.00 28.01 ? 7   TYR D N     1 
ATOM   2930 C CA    . TYR F 6 6   ? -5.534  -10.908 -12.892 1.00 25.85 ? 7   TYR D CA    1 
ATOM   2931 C C     . TYR F 6 6   ? -4.856  -12.081 -13.573 1.00 25.23 ? 7   TYR D C     1 
ATOM   2932 O O     . TYR F 6 6   ? -5.129  -13.236 -13.246 1.00 24.30 ? 7   TYR D O     1 
ATOM   2933 C CB    . TYR F 6 6   ? -4.754  -10.577 -11.626 1.00 23.95 ? 7   TYR D CB    1 
ATOM   2934 C CG    . TYR F 6 6   ? -5.238  -9.349  -10.917 1.00 23.72 ? 7   TYR D CG    1 
ATOM   2935 C CD1   . TYR F 6 6   ? -5.220  -8.106  -11.548 1.00 25.56 ? 7   TYR D CD1   1 
ATOM   2936 C CD2   . TYR F 6 6   ? -5.693  -9.415  -9.602  1.00 23.28 ? 7   TYR D CD2   1 
ATOM   2937 C CE1   . TYR F 6 6   ? -5.633  -6.962  -10.889 1.00 24.51 ? 7   TYR D CE1   1 
ATOM   2938 C CE2   . TYR F 6 6   ? -6.113  -8.267  -8.934  1.00 22.75 ? 7   TYR D CE2   1 
ATOM   2939 C CZ    . TYR F 6 6   ? -6.074  -7.047  -9.584  1.00 25.61 ? 7   TYR D CZ    1 
ATOM   2940 O OH    . TYR F 6 6   ? -6.445  -5.896  -8.921  1.00 25.77 ? 7   TYR D OH    1 
ATOM   2941 N N     . GLU F 6 7   ? -3.953  -11.782 -14.503 1.00 22.74 ? 8   GLU D N     1 
ATOM   2942 C CA    . GLU F 6 7   ? -3.220  -12.818 -15.223 1.00 22.42 ? 8   GLU D CA    1 
ATOM   2943 C C     . GLU F 6 7   ? -1.850  -13.099 -14.598 1.00 20.03 ? 8   GLU D C     1 
ATOM   2944 O O     . GLU F 6 7   ? -1.109  -13.939 -15.101 1.00 18.84 ? 8   GLU D O     1 
ATOM   2945 C CB    . GLU F 6 7   ? -3.015  -12.399 -16.685 1.00 25.32 ? 8   GLU D CB    1 
ATOM   2946 C CG    . GLU F 6 7   ? -4.306  -12.274 -17.492 1.00 27.99 ? 8   GLU D CG    1 
ATOM   2947 C CD    . GLU F 6 7   ? -4.073  -11.819 -18.931 1.00 31.06 ? 8   GLU D CD    1 
ATOM   2948 O OE1   . GLU F 6 7   ? -2.909  -11.819 -19.399 1.00 32.41 ? 8   GLU D OE1   1 
ATOM   2949 O OE2   . GLU F 6 7   ? -5.067  -11.475 -19.598 1.00 31.19 ? 8   GLU D OE2   1 
ATOM   2950 N N     . LEU F 6 8   ? -1.521  -12.422 -13.498 1.00 19.12 ? 9   LEU D N     1 
ATOM   2951 C CA    . LEU F 6 8   ? -0.199  -12.582 -12.889 1.00 19.53 ? 9   LEU D CA    1 
ATOM   2952 C C     . LEU F 6 8   ? 0.233   -13.989 -12.501 1.00 19.54 ? 9   LEU D C     1 
ATOM   2953 O O     . LEU F 6 8   ? 1.423   -14.295 -12.545 1.00 17.35 ? 9   LEU D O     1 
ATOM   2954 C CB    . LEU F 6 8   ? -0.030  -11.653 -11.667 1.00 23.29 ? 9   LEU D CB    1 
ATOM   2955 C CG    . LEU F 6 8   ? -0.390  -12.147 -10.267 1.00 24.01 ? 9   LEU D CG    1 
ATOM   2956 C CD1   . LEU F 6 8   ? 0.358   -11.320 -9.214  1.00 21.32 ? 9   LEU D CD1   1 
ATOM   2957 C CD2   . LEU F 6 8   ? -1.901  -12.063 -10.071 1.00 24.67 ? 9   LEU D CD2   1 
ATOM   2958 N N     . TYR F 6 9   ? -0.711  -14.848 -12.118 1.00 16.85 ? 10  TYR D N     1 
ATOM   2959 C CA    . TYR F 6 9   ? -0.349  -16.202 -11.726 1.00 16.51 ? 10  TYR D CA    1 
ATOM   2960 C C     . TYR F 6 9   ? 0.156   -17.075 -12.870 1.00 15.99 ? 10  TYR D C     1 
ATOM   2961 O O     . TYR F 6 9   ? 0.692   -18.153 -12.626 1.00 17.13 ? 10  TYR D O     1 
ATOM   2962 C CB    . TYR F 6 9   ? -1.531  -16.892 -11.022 1.00 16.38 ? 10  TYR D CB    1 
ATOM   2963 C CG    . TYR F 6 9   ? -1.982  -16.165 -9.771  1.00 14.78 ? 10  TYR D CG    1 
ATOM   2964 C CD1   . TYR F 6 9   ? -1.148  -16.058 -8.657  1.00 14.34 ? 10  TYR D CD1   1 
ATOM   2965 C CD2   . TYR F 6 9   ? -3.245  -15.567 -9.711  1.00 16.09 ? 10  TYR D CD2   1 
ATOM   2966 C CE1   . TYR F 6 9   ? -1.568  -15.368 -7.505  1.00 15.51 ? 10  TYR D CE1   1 
ATOM   2967 C CE2   . TYR F 6 9   ? -3.670  -14.886 -8.576  1.00 17.10 ? 10  TYR D CE2   1 
ATOM   2968 C CZ    . TYR F 6 9   ? -2.835  -14.791 -7.478  1.00 17.80 ? 10  TYR D CZ    1 
ATOM   2969 O OH    . TYR F 6 9   ? -3.299  -14.157 -6.349  1.00 18.51 ? 10  TYR D OH    1 
ATOM   2970 N N     . ARG F 6 10  ? -0.015  -16.625 -14.110 1.00 17.44 ? 11  ARG D N     1 
ATOM   2971 C CA    . ARG F 6 10  ? 0.482   -17.381 -15.254 1.00 17.79 ? 11  ARG D CA    1 
ATOM   2972 C C     . ARG F 6 10  ? 2.006   -17.472 -15.191 1.00 19.10 ? 11  ARG D C     1 
ATOM   2973 O O     . ARG F 6 10  ? 2.611   -18.339 -15.831 1.00 18.63 ? 11  ARG D O     1 
ATOM   2974 C CB    . ARG F 6 10  ? 0.042   -16.723 -16.569 1.00 19.46 ? 11  ARG D CB    1 
ATOM   2975 C CG    . ARG F 6 10  ? -1.470  -16.715 -16.767 1.00 19.08 ? 11  ARG D CG    1 
ATOM   2976 C CD    . ARG F 6 10  ? -1.831  -16.209 -18.162 1.00 22.99 ? 11  ARG D CD    1 
ATOM   2977 N NE    . ARG F 6 10  ? -3.256  -15.912 -18.260 1.00 22.68 ? 11  ARG D NE    1 
ATOM   2978 C CZ    . ARG F 6 10  ? -3.874  -15.557 -19.380 1.00 25.66 ? 11  ARG D CZ    1 
ATOM   2979 N NH1   . ARG F 6 10  ? -3.187  -15.459 -20.507 1.00 23.44 ? 11  ARG D NH1   1 
ATOM   2980 N NH2   . ARG F 6 10  ? -5.176  -15.287 -19.364 1.00 24.58 ? 11  ARG D NH2   1 
ATOM   2981 N N     . ARG F 6 11  ? 2.617   -16.600 -14.387 1.00 19.25 ? 12  ARG D N     1 
ATOM   2982 C CA    . ARG F 6 11  ? 4.072   -16.575 -14.220 1.00 18.08 ? 12  ARG D CA    1 
ATOM   2983 C C     . ARG F 6 11  ? 4.577   -17.520 -13.132 1.00 19.33 ? 12  ARG D C     1 
ATOM   2984 O O     . ARG F 6 11  ? 5.789   -17.648 -12.942 1.00 19.27 ? 12  ARG D O     1 
ATOM   2985 C CB    . ARG F 6 11  ? 4.543   -15.152 -13.894 1.00 22.94 ? 12  ARG D CB    1 
ATOM   2986 C CG    . ARG F 6 11  ? 4.367   -14.164 -15.037 1.00 23.93 ? 12  ARG D CG    1 
ATOM   2987 C CD    . ARG F 6 11  ? 4.487   -12.726 -14.537 1.00 27.75 ? 12  ARG D CD    1 
ATOM   2988 N NE    . ARG F 6 11  ? 5.808   -12.424 -13.997 1.00 26.13 ? 12  ARG D NE    1 
ATOM   2989 C CZ    . ARG F 6 11  ? 6.124   -11.259 -13.435 1.00 28.22 ? 12  ARG D CZ    1 
ATOM   2990 N NH1   . ARG F 6 11  ? 5.214   -10.296 -13.340 1.00 27.17 ? 12  ARG D NH1   1 
ATOM   2991 N NH2   . ARG F 6 11  ? 7.348   -11.050 -12.981 1.00 27.72 ? 12  ARG D NH2   1 
ATOM   2992 N N     . SER F 6 12  ? 3.661   -18.159 -12.405 1.00 17.66 ? 13  SER D N     1 
ATOM   2993 C CA    . SER F 6 12  ? 4.048   -19.104 -11.358 1.00 18.35 ? 13  SER D CA    1 
ATOM   2994 C C     . SER F 6 12  ? 4.497   -20.391 -12.032 1.00 20.33 ? 13  SER D C     1 
ATOM   2995 O O     . SER F 6 12  ? 4.344   -20.553 -13.242 1.00 20.21 ? 13  SER D O     1 
ATOM   2996 C CB    . SER F 6 12  ? 2.861   -19.438 -10.452 1.00 16.21 ? 13  SER D CB    1 
ATOM   2997 O OG    . SER F 6 12  ? 1.823   -20.067 -11.199 1.00 16.68 ? 13  SER D OG    1 
ATOM   2998 N N     . THR F 6 13  ? 5.038   -21.310 -11.243 1.00 19.54 ? 14  THR D N     1 
ATOM   2999 C CA    . THR F 6 13  ? 5.477   -22.587 -11.783 1.00 22.49 ? 14  THR D CA    1 
ATOM   3000 C C     . THR F 6 13  ? 4.297   -23.333 -12.411 1.00 21.94 ? 14  THR D C     1 
ATOM   3001 O O     . THR F 6 13  ? 4.421   -23.885 -13.501 1.00 22.76 ? 14  THR D O     1 
ATOM   3002 C CB    . THR F 6 13  ? 6.101   -23.477 -10.683 1.00 24.56 ? 14  THR D CB    1 
ATOM   3003 O OG1   . THR F 6 13  ? 7.209   -22.794 -10.081 1.00 26.71 ? 14  THR D OG1   1 
ATOM   3004 C CG2   . THR F 6 13  ? 6.592   -24.792 -11.275 1.00 28.11 ? 14  THR D CG2   1 
ATOM   3005 N N     . ILE F 6 14  ? 3.147   -23.342 -11.742 1.00 20.03 ? 15  ILE D N     1 
ATOM   3006 C CA    . ILE F 6 14  ? 2.012   -24.065 -12.303 1.00 20.39 ? 15  ILE D CA    1 
ATOM   3007 C C     . ILE F 6 14  ? 1.463   -23.368 -13.537 1.00 21.66 ? 15  ILE D C     1 
ATOM   3008 O O     . ILE F 6 14  ? 1.032   -24.024 -14.492 1.00 20.00 ? 15  ILE D O     1 
ATOM   3009 C CB    . ILE F 6 14  ? 0.893   -24.316 -11.233 1.00 20.36 ? 15  ILE D CB    1 
ATOM   3010 C CG1   . ILE F 6 14  ? -0.253  -25.110 -11.867 1.00 22.02 ? 15  ILE D CG1   1 
ATOM   3011 C CG2   . ILE F 6 14  ? 0.371   -22.999 -10.646 1.00 18.78 ? 15  ILE D CG2   1 
ATOM   3012 C CD1   . ILE F 6 14  ? -1.167  -25.741 -10.831 1.00 25.01 ? 15  ILE D CD1   1 
ATOM   3013 N N     . GLY F 6 15  ? 1.509   -22.039 -13.529 1.00 20.17 ? 16  GLY D N     1 
ATOM   3014 C CA    . GLY F 6 15  ? 1.038   -21.281 -14.671 1.00 20.55 ? 16  GLY D CA    1 
ATOM   3015 C C     . GLY F 6 15  ? 1.946   -21.476 -15.878 1.00 21.71 ? 16  GLY D C     1 
ATOM   3016 O O     . GLY F 6 15  ? 1.458   -21.690 -16.995 1.00 19.45 ? 16  GLY D O     1 
ATOM   3017 N N     . ASN F 6 16  ? 3.261   -21.406 -15.663 1.00 20.67 ? 17  ASN D N     1 
ATOM   3018 C CA    . ASN F 6 16  ? 4.220   -21.575 -16.760 1.00 24.80 ? 17  ASN D CA    1 
ATOM   3019 C C     . ASN F 6 16  ? 4.081   -22.949 -17.407 1.00 24.29 ? 17  ASN D C     1 
ATOM   3020 O O     . ASN F 6 16  ? 4.194   -23.090 -18.630 1.00 23.04 ? 17  ASN D O     1 
ATOM   3021 C CB    . ASN F 6 16  ? 5.663   -21.400 -16.264 1.00 27.68 ? 17  ASN D CB    1 
ATOM   3022 C CG    . ASN F 6 16  ? 6.043   -19.943 -16.053 1.00 34.37 ? 17  ASN D CG    1 
ATOM   3023 O OD1   . ASN F 6 16  ? 5.681   -19.074 -16.847 1.00 37.56 ? 17  ASN D OD1   1 
ATOM   3024 N ND2   . ASN F 6 16  ? 6.797   -19.673 -14.991 1.00 38.42 ? 17  ASN D ND2   1 
ATOM   3025 N N     . SER F 6 17  ? 3.854   -23.958 -16.573 1.00 24.21 ? 18  SER D N     1 
ATOM   3026 C CA    . SER F 6 17  ? 3.692   -25.333 -17.042 1.00 24.71 ? 18  SER D CA    1 
ATOM   3027 C C     . SER F 6 17  ? 2.452   -25.486 -17.918 1.00 24.47 ? 18  SER D C     1 
ATOM   3028 O O     . SER F 6 17  ? 2.472   -26.217 -18.914 1.00 25.72 ? 18  SER D O     1 
ATOM   3029 C CB    . SER F 6 17  ? 3.611   -26.278 -15.843 1.00 25.94 ? 18  SER D CB    1 
ATOM   3030 O OG    . SER F 6 17  ? 4.840   -26.277 -15.141 1.00 28.98 ? 18  SER D OG    1 
ATOM   3031 N N     . LEU F 6 18  ? 1.375   -24.804 -17.547 1.00 22.94 ? 19  LEU D N     1 
ATOM   3032 C CA    . LEU F 6 18  ? 0.142   -24.849 -18.320 1.00 22.86 ? 19  LEU D CA    1 
ATOM   3033 C C     . LEU F 6 18  ? 0.355   -24.157 -19.674 1.00 24.01 ? 19  LEU D C     1 
ATOM   3034 O O     . LEU F 6 18  ? -0.034  -24.685 -20.715 1.00 23.32 ? 19  LEU D O     1 
ATOM   3035 C CB    . LEU F 6 18  ? -1.005  -24.179 -17.555 1.00 21.94 ? 19  LEU D CB    1 
ATOM   3036 C CG    . LEU F 6 18  ? -2.292  -23.949 -18.363 1.00 22.42 ? 19  LEU D CG    1 
ATOM   3037 C CD1   . LEU F 6 18  ? -2.777  -25.267 -18.960 1.00 24.11 ? 19  LEU D CD1   1 
ATOM   3038 C CD2   . LEU F 6 18  ? -3.363  -23.337 -17.483 1.00 19.21 ? 19  LEU D CD2   1 
ATOM   3039 N N     . VAL F 6 19  ? 0.984   -22.987 -19.661 1.00 22.12 ? 20  VAL D N     1 
ATOM   3040 C CA    . VAL F 6 19  ? 1.255   -22.266 -20.906 1.00 23.64 ? 20  VAL D CA    1 
ATOM   3041 C C     . VAL F 6 19  ? 2.055   -23.145 -21.867 1.00 25.90 ? 20  VAL D C     1 
ATOM   3042 O O     . VAL F 6 19  ? 1.721   -23.274 -23.057 1.00 26.89 ? 20  VAL D O     1 
ATOM   3043 C CB    . VAL F 6 19  ? 2.061   -20.970 -20.636 1.00 24.06 ? 20  VAL D CB    1 
ATOM   3044 C CG1   . VAL F 6 19  ? 2.584   -20.384 -21.957 1.00 24.92 ? 20  VAL D CG1   1 
ATOM   3045 C CG2   . VAL F 6 19  ? 1.181   -19.964 -19.941 1.00 21.19 ? 20  VAL D CG2   1 
ATOM   3046 N N     . ASP F 6 20  ? 3.119   -23.747 -21.353 1.00 26.78 ? 21  ASP D N     1 
ATOM   3047 C CA    . ASP F 6 20  ? 3.961   -24.599 -22.175 1.00 29.19 ? 21  ASP D CA    1 
ATOM   3048 C C     . ASP F 6 20  ? 3.190   -25.803 -22.718 1.00 29.40 ? 21  ASP D C     1 
ATOM   3049 O O     . ASP F 6 20  ? 3.373   -26.198 -23.874 1.00 28.82 ? 21  ASP D O     1 
ATOM   3050 C CB    . ASP F 6 20  ? 5.184   -25.056 -21.379 1.00 30.74 ? 21  ASP D CB    1 
ATOM   3051 C CG    . ASP F 6 20  ? 6.187   -23.936 -21.155 1.00 34.67 ? 21  ASP D CG    1 
ATOM   3052 O OD1   . ASP F 6 20  ? 6.010   -22.841 -21.729 1.00 37.00 ? 21  ASP D OD1   1 
ATOM   3053 O OD2   . ASP F 6 20  ? 7.162   -24.156 -20.409 1.00 38.15 ? 21  ASP D OD2   1 
ATOM   3054 N N     . ALA F 6 21  ? 2.320   -26.377 -21.894 1.00 28.07 ? 22  ALA D N     1 
ATOM   3055 C CA    . ALA F 6 21  ? 1.517   -27.515 -22.321 1.00 28.54 ? 22  ALA D CA    1 
ATOM   3056 C C     . ALA F 6 21  ? 0.576   -27.102 -23.450 1.00 28.15 ? 22  ALA D C     1 
ATOM   3057 O O     . ALA F 6 21  ? 0.450   -27.809 -24.452 1.00 29.56 ? 22  ALA D O     1 
ATOM   3058 C CB    . ALA F 6 21  ? 0.713   -28.069 -21.141 1.00 28.44 ? 22  ALA D CB    1 
ATOM   3059 N N     . LEU F 6 22  ? -0.088  -25.963 -23.287 1.00 27.53 ? 23  LEU D N     1 
ATOM   3060 C CA    . LEU F 6 22  ? -1.013  -25.479 -24.304 1.00 28.44 ? 23  LEU D CA    1 
ATOM   3061 C C     . LEU F 6 22  ? -0.262  -25.202 -25.605 1.00 30.18 ? 23  LEU D C     1 
ATOM   3062 O O     . LEU F 6 22  ? -0.729  -25.564 -26.690 1.00 29.32 ? 23  LEU D O     1 
ATOM   3063 C CB    . LEU F 6 22  ? -1.732  -24.214 -23.820 1.00 27.18 ? 23  LEU D CB    1 
ATOM   3064 C CG    . LEU F 6 22  ? -2.841  -24.388 -22.761 1.00 26.32 ? 23  LEU D CG    1 
ATOM   3065 C CD1   . LEU F 6 22  ? -3.207  -23.038 -22.167 1.00 24.42 ? 23  LEU D CD1   1 
ATOM   3066 C CD2   . LEU F 6 22  ? -4.088  -25.026 -23.388 1.00 26.10 ? 23  LEU D CD2   1 
ATOM   3067 N N     . ASP F 6 23  ? 0.901   -24.566 -25.496 1.00 30.49 ? 24  ASP D N     1 
ATOM   3068 C CA    . ASP F 6 23  ? 1.715   -24.264 -26.673 1.00 33.09 ? 24  ASP D CA    1 
ATOM   3069 C C     . ASP F 6 23  ? 2.096   -25.530 -27.439 1.00 34.94 ? 24  ASP D C     1 
ATOM   3070 O O     . ASP F 6 23  ? 2.171   -25.526 -28.670 1.00 34.10 ? 24  ASP D O     1 
ATOM   3071 C CB    . ASP F 6 23  ? 3.001   -23.532 -26.273 1.00 31.93 ? 24  ASP D CB    1 
ATOM   3072 C CG    . ASP F 6 23  ? 2.758   -22.093 -25.867 1.00 31.30 ? 24  ASP D CG    1 
ATOM   3073 O OD1   . ASP F 6 23  ? 1.745   -21.503 -26.305 1.00 31.46 ? 24  ASP D OD1   1 
ATOM   3074 O OD2   . ASP F 6 23  ? 3.597   -21.547 -25.121 1.00 33.34 ? 24  ASP D OD2   1 
ATOM   3075 N N     . THR F 6 24  ? 2.356   -26.608 -26.704 1.00 37.06 ? 25  THR D N     1 
ATOM   3076 C CA    . THR F 6 24  ? 2.731   -27.875 -27.319 1.00 38.10 ? 25  THR D CA    1 
ATOM   3077 C C     . THR F 6 24  ? 1.581   -28.445 -28.149 1.00 38.61 ? 25  THR D C     1 
ATOM   3078 O O     . THR F 6 24  ? 1.794   -28.932 -29.263 1.00 39.28 ? 25  THR D O     1 
ATOM   3079 C CB    . THR F 6 24  ? 3.150   -28.907 -26.254 1.00 39.61 ? 25  THR D CB    1 
ATOM   3080 O OG1   . THR F 6 24  ? 4.324   -28.440 -25.574 1.00 38.00 ? 25  THR D OG1   1 
ATOM   3081 C CG2   . THR F 6 24  ? 3.448   -30.251 -26.902 1.00 40.69 ? 25  THR D CG2   1 
ATOM   3082 N N     . LEU F 6 25  ? 0.365   -28.384 -27.612 1.00 37.47 ? 26  LEU D N     1 
ATOM   3083 C CA    . LEU F 6 25  ? -0.795  -28.889 -28.334 1.00 37.21 ? 26  LEU D CA    1 
ATOM   3084 C C     . LEU F 6 25  ? -1.069  -28.032 -29.565 1.00 36.40 ? 26  LEU D C     1 
ATOM   3085 O O     . LEU F 6 25  ? -1.474  -28.545 -30.610 1.00 34.87 ? 26  LEU D O     1 
ATOM   3086 C CB    . LEU F 6 25  ? -2.025  -28.918 -27.426 1.00 36.90 ? 26  LEU D CB    1 
ATOM   3087 C CG    . LEU F 6 25  ? -2.008  -30.019 -26.360 1.00 37.93 ? 26  LEU D CG    1 
ATOM   3088 C CD1   . LEU F 6 25  ? -3.181  -29.830 -25.415 1.00 37.34 ? 26  LEU D CD1   1 
ATOM   3089 C CD2   . LEU F 6 25  ? -2.068  -31.391 -27.027 1.00 36.93 ? 26  LEU D CD2   1 
ATOM   3090 N N     . ILE F 6 26  ? -0.858  -26.725 -29.441 1.00 35.52 ? 27  ILE D N     1 
ATOM   3091 C CA    . ILE F 6 26  ? -1.064  -25.835 -30.574 1.00 36.53 ? 27  ILE D CA    1 
ATOM   3092 C C     . ILE F 6 26  ? -0.057  -26.227 -31.658 1.00 36.87 ? 27  ILE D C     1 
ATOM   3093 O O     . ILE F 6 26  ? -0.413  -26.392 -32.825 1.00 36.56 ? 27  ILE D O     1 
ATOM   3094 C CB    . ILE F 6 26  ? -0.849  -24.357 -30.172 1.00 35.78 ? 27  ILE D CB    1 
ATOM   3095 C CG1   . ILE F 6 26  ? -1.971  -23.893 -29.237 1.00 33.75 ? 27  ILE D CG1   1 
ATOM   3096 C CG2   . ILE F 6 26  ? -0.813  -23.476 -31.420 1.00 36.74 ? 27  ILE D CG2   1 
ATOM   3097 C CD1   . ILE F 6 26  ? -1.753  -22.502 -28.680 1.00 32.68 ? 27  ILE D CD1   1 
ATOM   3098 N N     . SER F 6 27  ? 1.197   -26.402 -31.258 1.00 37.38 ? 28  SER D N     1 
ATOM   3099 C CA    . SER F 6 27  ? 2.252   -26.774 -32.192 1.00 38.20 ? 28  SER D CA    1 
ATOM   3100 C C     . SER F 6 27  ? 2.000   -28.104 -32.886 1.00 38.92 ? 28  SER D C     1 
ATOM   3101 O O     . SER F 6 27  ? 2.414   -28.298 -34.029 1.00 38.09 ? 28  SER D O     1 
ATOM   3102 C CB    . SER F 6 27  ? 3.602   -26.820 -31.478 1.00 39.46 ? 28  SER D CB    1 
ATOM   3103 O OG    . SER F 6 27  ? 4.011   -25.512 -31.123 1.00 40.69 ? 28  SER D OG    1 
ATOM   3104 N N     . ASP F 6 28  ? 1.334   -29.026 -32.201 1.00 38.97 ? 29  ASP D N     1 
ATOM   3105 C CA    . ASP F 6 28  ? 1.040   -30.318 -32.809 1.00 40.06 ? 29  ASP D CA    1 
ATOM   3106 C C     . ASP F 6 28  ? -0.263  -30.228 -33.596 1.00 39.85 ? 29  ASP D C     1 
ATOM   3107 O O     . ASP F 6 28  ? -0.749  -31.229 -34.119 1.00 40.47 ? 29  ASP D O     1 
ATOM   3108 C CB    . ASP F 6 28  ? 0.924   -31.416 -31.745 1.00 41.65 ? 29  ASP D CB    1 
ATOM   3109 C CG    . ASP F 6 28  ? 2.209   -31.610 -30.958 1.00 42.80 ? 29  ASP D CG    1 
ATOM   3110 O OD1   . ASP F 6 28  ? 3.295   -31.291 -31.487 1.00 42.80 ? 29  ASP D OD1   1 
ATOM   3111 O OD2   . ASP F 6 28  ? 2.133   -32.094 -29.811 1.00 44.98 ? 29  ASP D OD2   1 
ATOM   3112 N N     . GLY F 6 29  ? -0.821  -29.021 -33.670 1.00 39.40 ? 30  GLY D N     1 
ATOM   3113 C CA    . GLY F 6 29  ? -2.062  -28.795 -34.395 1.00 39.97 ? 30  GLY D CA    1 
ATOM   3114 C C     . GLY F 6 29  ? -3.283  -29.477 -33.798 1.00 40.22 ? 30  GLY D C     1 
ATOM   3115 O O     . GLY F 6 29  ? -4.217  -29.832 -34.522 1.00 40.63 ? 30  GLY D O     1 
ATOM   3116 N N     . ARG F 6 30  ? -3.299  -29.643 -32.478 1.00 39.98 ? 31  ARG D N     1 
ATOM   3117 C CA    . ARG F 6 30  ? -4.418  -30.317 -31.816 1.00 39.49 ? 31  ARG D CA    1 
ATOM   3118 C C     . ARG F 6 30  ? -5.496  -29.396 -31.247 1.00 38.69 ? 31  ARG D C     1 
ATOM   3119 O O     . ARG F 6 30  ? -6.644  -29.808 -31.077 1.00 39.10 ? 31  ARG D O     1 
ATOM   3120 C CB    . ARG F 6 30  ? -3.876  -31.253 -30.739 1.00 41.20 ? 31  ARG D CB    1 
ATOM   3121 C CG    . ARG F 6 30  ? -2.860  -32.237 -31.304 1.00 42.28 ? 31  ARG D CG    1 
ATOM   3122 C CD    . ARG F 6 30  ? -2.439  -33.268 -30.282 1.00 44.52 ? 31  ARG D CD    1 
ATOM   3123 N NE    . ARG F 6 30  ? -3.579  -34.031 -29.780 1.00 43.62 ? 31  ARG D NE    1 
ATOM   3124 C CZ    . ARG F 6 30  ? -3.503  -34.911 -28.788 1.00 42.75 ? 31  ARG D CZ    1 
ATOM   3125 N NH1   . ARG F 6 30  ? -2.336  -35.137 -28.198 1.00 41.68 ? 31  ARG D NH1   1 
ATOM   3126 N NH2   . ARG F 6 30  ? -4.593  -35.555 -28.383 1.00 41.83 ? 31  ARG D NH2   1 
ATOM   3127 N N     . ILE F 6 31  ? -5.127  -28.162 -30.924 1.00 36.19 ? 32  ILE D N     1 
ATOM   3128 C CA    . ILE F 6 31  ? -6.102  -27.186 -30.445 1.00 34.51 ? 32  ILE D CA    1 
ATOM   3129 C C     . ILE F 6 31  ? -5.665  -25.859 -31.034 1.00 33.80 ? 32  ILE D C     1 
ATOM   3130 O O     . ILE F 6 31  ? -4.533  -25.731 -31.485 1.00 32.33 ? 32  ILE D O     1 
ATOM   3131 C CB    . ILE F 6 31  ? -6.155  -27.050 -28.887 1.00 33.73 ? 32  ILE D CB    1 
ATOM   3132 C CG1   . ILE F 6 31  ? -4.830  -26.509 -28.348 1.00 32.77 ? 32  ILE D CG1   1 
ATOM   3133 C CG2   . ILE F 6 31  ? -6.511  -28.375 -28.254 1.00 30.86 ? 32  ILE D CG2   1 
ATOM   3134 C CD1   . ILE F 6 31  ? -4.912  -26.087 -26.884 1.00 30.67 ? 32  ILE D CD1   1 
ATOM   3135 N N     . GLU F 6 32  ? -6.560  -24.880 -31.037 1.00 35.45 ? 33  GLU D N     1 
ATOM   3136 C CA    . GLU F 6 32  ? -6.243  -23.567 -31.579 1.00 36.71 ? 33  GLU D CA    1 
ATOM   3137 C C     . GLU F 6 32  ? -5.944  -22.605 -30.439 1.00 37.66 ? 33  GLU D C     1 
ATOM   3138 O O     . GLU F 6 32  ? -6.334  -22.842 -29.292 1.00 36.99 ? 33  GLU D O     1 
ATOM   3139 C CB    . GLU F 6 32  ? -7.416  -23.041 -32.412 1.00 39.29 ? 33  GLU D CB    1 
ATOM   3140 C CG    . GLU F 6 32  ? -7.820  -23.959 -33.561 1.00 40.48 ? 33  GLU D CG    1 
ATOM   3141 C CD    . GLU F 6 32  ? -6.723  -24.111 -34.609 1.00 44.44 ? 33  GLU D CD    1 
ATOM   3142 O OE1   . GLU F 6 32  ? -6.362  -23.100 -35.244 1.00 45.85 ? 33  GLU D OE1   1 
ATOM   3143 O OE2   . GLU F 6 32  ? -6.221  -25.240 -34.798 1.00 45.71 ? 33  GLU D OE2   1 
ATOM   3144 N N     . ALA F 6 33  ? -5.259  -21.514 -30.764 1.00 36.56 ? 34  ALA D N     1 
ATOM   3145 C CA    . ALA F 6 33  ? -4.892  -20.514 -29.777 1.00 36.41 ? 34  ALA D CA    1 
ATOM   3146 C C     . ALA F 6 33  ? -6.111  -19.914 -29.105 1.00 36.45 ? 34  ALA D C     1 
ATOM   3147 O O     . ALA F 6 33  ? -6.026  -19.427 -27.973 1.00 35.80 ? 34  ALA D O     1 
ATOM   3148 C CB    . ALA F 6 33  ? -4.081  -19.403 -30.435 1.00 37.42 ? 34  ALA D CB    1 
ATOM   3149 N N     . SER F 6 34  ? -7.242  -19.921 -29.804 1.00 34.65 ? 35  SER D N     1 
ATOM   3150 C CA    . SER F 6 34  ? -8.449  -19.343 -29.231 1.00 35.15 ? 35  SER D CA    1 
ATOM   3151 C C     . SER F 6 34  ? -8.907  -20.143 -28.017 1.00 34.74 ? 35  SER D C     1 
ATOM   3152 O O     . SER F 6 34  ? -9.362  -19.564 -27.031 1.00 34.93 ? 35  SER D O     1 
ATOM   3153 C CB    . SER F 6 34  ? -9.573  -19.263 -30.276 1.00 34.01 ? 35  SER D CB    1 
ATOM   3154 O OG    . SER F 6 34  ? -9.812  -20.515 -30.884 1.00 33.91 ? 35  SER D OG    1 
ATOM   3155 N N     . LEU F 6 35  ? -8.778  -21.466 -28.090 1.00 33.36 ? 36  LEU D N     1 
ATOM   3156 C CA    . LEU F 6 35  ? -9.184  -22.330 -26.983 1.00 34.06 ? 36  LEU D CA    1 
ATOM   3157 C C     . LEU F 6 35  ? -8.178  -22.210 -25.848 1.00 34.21 ? 36  LEU D C     1 
ATOM   3158 O O     . LEU F 6 35  ? -8.560  -22.195 -24.678 1.00 33.66 ? 36  LEU D O     1 
ATOM   3159 C CB    . LEU F 6 35  ? -9.279  -23.795 -27.421 1.00 33.50 ? 36  LEU D CB    1 
ATOM   3160 C CG    . LEU F 6 35  ? -9.657  -24.768 -26.287 1.00 34.07 ? 36  LEU D CG    1 
ATOM   3161 C CD1   . LEU F 6 35  ? -11.037 -24.424 -25.731 1.00 33.05 ? 36  LEU D CD1   1 
ATOM   3162 C CD2   . LEU F 6 35  ? -9.633  -26.202 -26.794 1.00 33.65 ? 36  LEU D CD2   1 
ATOM   3163 N N     . ALA F 6 36  ? -6.896  -22.128 -26.197 1.00 34.24 ? 37  ALA D N     1 
ATOM   3164 C CA    . ALA F 6 36  ? -5.845  -21.984 -25.193 1.00 33.80 ? 37  ALA D CA    1 
ATOM   3165 C C     . ALA F 6 36  ? -6.090  -20.711 -24.388 1.00 33.56 ? 37  ALA D C     1 
ATOM   3166 O O     . ALA F 6 36  ? -5.875  -20.688 -23.175 1.00 32.76 ? 37  ALA D O     1 
ATOM   3167 C CB    . ALA F 6 36  ? -4.477  -21.930 -25.861 1.00 34.57 ? 37  ALA D CB    1 
ATOM   3168 N N     . MET F 6 37  ? -6.545  -19.653 -25.060 1.00 32.58 ? 38  MET D N     1 
ATOM   3169 C CA    . MET F 6 37  ? -6.822  -18.399 -24.368 1.00 33.63 ? 38  MET D CA    1 
ATOM   3170 C C     . MET F 6 37  ? -7.962  -18.584 -23.366 1.00 31.85 ? 38  MET D C     1 
ATOM   3171 O O     . MET F 6 37  ? -7.916  -18.049 -22.261 1.00 30.44 ? 38  MET D O     1 
ATOM   3172 C CB    . MET F 6 37  ? -7.185  -17.283 -25.357 1.00 35.55 ? 38  MET D CB    1 
ATOM   3173 C CG    . MET F 6 37  ? -7.573  -15.973 -24.664 1.00 42.73 ? 38  MET D CG    1 
ATOM   3174 S SD    . MET F 6 37  ? -7.765  -14.560 -25.781 1.00 52.67 ? 38  MET D SD    1 
ATOM   3175 C CE    . MET F 6 37  ? -8.972  -13.557 -24.902 1.00 51.57 ? 38  MET D CE    1 
ATOM   3176 N N     . ARG F 6 38  ? -8.989  -19.332 -23.756 1.00 32.38 ? 39  ARG D N     1 
ATOM   3177 C CA    . ARG F 6 38  ? -10.109 -19.577 -22.852 1.00 31.76 ? 39  ARG D CA    1 
ATOM   3178 C C     . ARG F 6 38  ? -9.644  -20.445 -21.679 1.00 28.76 ? 39  ARG D C     1 
ATOM   3179 O O     . ARG F 6 38  ? -10.082 -20.257 -20.546 1.00 28.38 ? 39  ARG D O     1 
ATOM   3180 C CB    . ARG F 6 38  ? -11.270 -20.254 -23.595 1.00 37.40 ? 39  ARG D CB    1 
ATOM   3181 C CG    . ARG F 6 38  ? -12.052 -19.316 -24.519 1.00 43.48 ? 39  ARG D CG    1 
ATOM   3182 C CD    . ARG F 6 38  ? -13.333 -19.981 -25.016 1.00 49.04 ? 39  ARG D CD    1 
ATOM   3183 N NE    . ARG F 6 38  ? -14.202 -19.054 -25.742 1.00 53.31 ? 39  ARG D NE    1 
ATOM   3184 C CZ    . ARG F 6 38  ? -14.065 -18.721 -27.024 1.00 56.30 ? 39  ARG D CZ    1 
ATOM   3185 N NH1   . ARG F 6 38  ? -13.085 -19.236 -27.758 1.00 56.44 ? 39  ARG D NH1   1 
ATOM   3186 N NH2   . ARG F 6 38  ? -14.921 -17.868 -27.574 1.00 58.03 ? 39  ARG D NH2   1 
ATOM   3187 N N     . VAL F 6 39  ? -8.749  -21.384 -21.950 1.00 24.84 ? 40  VAL D N     1 
ATOM   3188 C CA    . VAL F 6 39  ? -8.223  -22.241 -20.898 1.00 25.34 ? 40  VAL D CA    1 
ATOM   3189 C C     . VAL F 6 39  ? -7.419  -21.393 -19.901 1.00 25.07 ? 40  VAL D C     1 
ATOM   3190 O O     . VAL F 6 39  ? -7.526  -21.577 -18.695 1.00 24.88 ? 40  VAL D O     1 
ATOM   3191 C CB    . VAL F 6 39  ? -7.313  -23.345 -21.485 1.00 23.44 ? 40  VAL D CB    1 
ATOM   3192 C CG1   . VAL F 6 39  ? -6.608  -24.104 -20.372 1.00 25.05 ? 40  VAL D CG1   1 
ATOM   3193 C CG2   . VAL F 6 39  ? -8.148  -24.317 -22.321 1.00 26.88 ? 40  VAL D CG2   1 
ATOM   3194 N N     . LEU F 6 40  ? -6.628  -20.451 -20.410 1.00 23.58 ? 41  LEU D N     1 
ATOM   3195 C CA    . LEU F 6 40  ? -5.815  -19.606 -19.545 1.00 23.66 ? 41  LEU D CA    1 
ATOM   3196 C C     . LEU F 6 40  ? -6.685  -18.665 -18.727 1.00 24.45 ? 41  LEU D C     1 
ATOM   3197 O O     . LEU F 6 40  ? -6.386  -18.384 -17.567 1.00 23.24 ? 41  LEU D O     1 
ATOM   3198 C CB    . LEU F 6 40  ? -4.762  -18.848 -20.380 1.00 24.03 ? 41  LEU D CB    1 
ATOM   3199 C CG    . LEU F 6 40  ? -3.614  -19.758 -20.864 1.00 25.19 ? 41  LEU D CG    1 
ATOM   3200 C CD1   . LEU F 6 40  ? -2.800  -19.076 -21.967 1.00 27.75 ? 41  LEU D CD1   1 
ATOM   3201 C CD2   . LEU F 6 40  ? -2.706  -20.111 -19.690 1.00 23.58 ? 41  LEU D CD2   1 
ATOM   3202 N N     . GLU F 6 41  ? -7.776  -18.191 -19.323 1.00 24.86 ? 42  GLU D N     1 
ATOM   3203 C CA    . GLU F 6 41  ? -8.703  -17.320 -18.614 1.00 27.48 ? 42  GLU D CA    1 
ATOM   3204 C C     . GLU F 6 41  ? -9.357  -18.092 -17.455 1.00 24.74 ? 42  GLU D C     1 
ATOM   3205 O O     . GLU F 6 41  ? -9.609  -17.534 -16.390 1.00 25.28 ? 42  GLU D O     1 
ATOM   3206 C CB    . GLU F 6 41  ? -9.779  -16.807 -19.578 1.00 29.85 ? 42  GLU D CB    1 
ATOM   3207 C CG    . GLU F 6 41  ? -9.270  -15.760 -20.560 1.00 37.83 ? 42  GLU D CG    1 
ATOM   3208 C CD    . GLU F 6 41  ? -10.283 -15.433 -21.648 1.00 43.44 ? 42  GLU D CD    1 
ATOM   3209 O OE1   . GLU F 6 41  ? -10.185 -14.334 -22.235 1.00 47.27 ? 42  GLU D OE1   1 
ATOM   3210 O OE2   . GLU F 6 41  ? -11.166 -16.278 -21.922 1.00 44.04 ? 42  GLU D OE2   1 
ATOM   3211 N N     . THR F 6 42  ? -9.634  -19.373 -17.671 1.00 25.63 ? 43  THR D N     1 
ATOM   3212 C CA    . THR F 6 42  ? -10.232 -20.209 -16.635 1.00 23.54 ? 43  THR D CA    1 
ATOM   3213 C C     . THR F 6 42  ? -9.187  -20.461 -15.539 1.00 22.08 ? 43  THR D C     1 
ATOM   3214 O O     . THR F 6 42  ? -9.502  -20.449 -14.351 1.00 21.51 ? 43  THR D O     1 
ATOM   3215 C CB    . THR F 6 42  ? -10.722 -21.542 -17.233 1.00 27.05 ? 43  THR D CB    1 
ATOM   3216 O OG1   . THR F 6 42  ? -11.750 -21.264 -18.190 1.00 28.89 ? 43  THR D OG1   1 
ATOM   3217 C CG2   . THR F 6 42  ? -11.292 -22.460 -16.140 1.00 28.64 ? 43  THR D CG2   1 
ATOM   3218 N N     . PHE F 6 43  ? -7.942  -20.687 -15.948 1.00 21.66 ? 44  PHE D N     1 
ATOM   3219 C CA    . PHE F 6 43  ? -6.847  -20.887 -15.001 1.00 20.97 ? 44  PHE D CA    1 
ATOM   3220 C C     . PHE F 6 43  ? -6.760  -19.652 -14.099 1.00 19.49 ? 44  PHE D C     1 
ATOM   3221 O O     . PHE F 6 43  ? -6.675  -19.776 -12.876 1.00 18.71 ? 44  PHE D O     1 
ATOM   3222 C CB    . PHE F 6 43  ? -5.518  -21.076 -15.750 1.00 20.00 ? 44  PHE D CB    1 
ATOM   3223 C CG    . PHE F 6 43  ? -4.287  -20.922 -14.883 1.00 19.13 ? 44  PHE D CG    1 
ATOM   3224 C CD1   . PHE F 6 43  ? -3.778  -21.998 -14.166 1.00 18.46 ? 44  PHE D CD1   1 
ATOM   3225 C CD2   . PHE F 6 43  ? -3.649  -19.688 -14.775 1.00 20.40 ? 44  PHE D CD2   1 
ATOM   3226 C CE1   . PHE F 6 43  ? -2.647  -21.857 -13.351 1.00 22.27 ? 44  PHE D CE1   1 
ATOM   3227 C CE2   . PHE F 6 43  ? -2.518  -19.529 -13.963 1.00 19.71 ? 44  PHE D CE2   1 
ATOM   3228 C CZ    . PHE F 6 43  ? -2.015  -20.620 -13.247 1.00 19.42 ? 44  PHE D CZ    1 
ATOM   3229 N N     . ASP F 6 44  ? -6.797  -18.460 -14.696 1.00 20.77 ? 45  ASP D N     1 
ATOM   3230 C CA    . ASP F 6 44  ? -6.707  -17.224 -13.911 1.00 20.41 ? 45  ASP D CA    1 
ATOM   3231 C C     . ASP F 6 44  ? -7.743  -17.203 -12.793 1.00 21.13 ? 45  ASP D C     1 
ATOM   3232 O O     . ASP F 6 44  ? -7.445  -16.826 -11.666 1.00 19.57 ? 45  ASP D O     1 
ATOM   3233 C CB    . ASP F 6 44  ? -6.915  -15.985 -14.789 1.00 23.04 ? 45  ASP D CB    1 
ATOM   3234 C CG    . ASP F 6 44  ? -5.832  -15.817 -15.846 1.00 24.33 ? 45  ASP D CG    1 
ATOM   3235 O OD1   . ASP F 6 44  ? -4.681  -16.269 -15.637 1.00 21.87 ? 45  ASP D OD1   1 
ATOM   3236 O OD2   . ASP F 6 44  ? -6.137  -15.211 -16.891 1.00 27.66 ? 45  ASP D OD2   1 
ATOM   3237 N N     . LYS F 6 45  ? -8.969  -17.599 -13.123 1.00 21.59 ? 46  LYS D N     1 
ATOM   3238 C CA    . LYS F 6 45  ? -10.058 -17.641 -12.156 1.00 21.71 ? 46  LYS D CA    1 
ATOM   3239 C C     . LYS F 6 45  ? -9.879  -18.745 -11.111 1.00 21.03 ? 46  LYS D C     1 
ATOM   3240 O O     . LYS F 6 45  ? -10.054 -18.505 -9.919  1.00 22.34 ? 46  LYS D O     1 
ATOM   3241 C CB    . LYS F 6 45  ? -11.383 -17.844 -12.898 1.00 25.37 ? 46  LYS D CB    1 
ATOM   3242 C CG    . LYS F 6 45  ? -12.600 -18.035 -12.003 1.00 26.77 ? 46  LYS D CG    1 
ATOM   3243 C CD    . LYS F 6 45  ? -13.823 -18.302 -12.877 1.00 31.31 ? 46  LYS D CD    1 
ATOM   3244 C CE    . LYS F 6 45  ? -15.076 -18.568 -12.061 1.00 36.97 ? 46  LYS D CE    1 
ATOM   3245 N NZ    . LYS F 6 45  ? -16.182 -19.042 -12.949 1.00 43.11 ? 46  LYS D NZ    1 
ATOM   3246 N N     . VAL F 6 46  ? -9.546  -19.953 -11.563 1.00 20.97 ? 47  VAL D N     1 
ATOM   3247 C CA    . VAL F 6 46  ? -9.353  -21.094 -10.664 1.00 21.24 ? 47  VAL D CA    1 
ATOM   3248 C C     . VAL F 6 46  ? -8.208  -20.855 -9.666  1.00 19.28 ? 47  VAL D C     1 
ATOM   3249 O O     . VAL F 6 46  ? -8.330  -21.164 -8.480  1.00 19.74 ? 47  VAL D O     1 
ATOM   3250 C CB    . VAL F 6 46  ? -9.078  -22.395 -11.463 1.00 21.24 ? 47  VAL D CB    1 
ATOM   3251 C CG1   . VAL F 6 46  ? -8.690  -23.530 -10.516 1.00 20.39 ? 47  VAL D CG1   1 
ATOM   3252 C CG2   . VAL F 6 46  ? -10.327 -22.789 -12.257 1.00 23.07 ? 47  VAL D CG2   1 
ATOM   3253 N N     . VAL F 6 47  ? -7.095  -20.297 -10.132 1.00 18.59 ? 48  VAL D N     1 
ATOM   3254 C CA    . VAL F 6 47  ? -5.999  -20.036 -9.209  1.00 17.90 ? 48  VAL D CA    1 
ATOM   3255 C C     . VAL F 6 47  ? -6.443  -19.009 -8.172  1.00 18.25 ? 48  VAL D C     1 
ATOM   3256 O O     . VAL F 6 47  ? -6.205  -19.189 -6.981  1.00 18.80 ? 48  VAL D O     1 
ATOM   3257 C CB    . VAL F 6 47  ? -4.723  -19.531 -9.938  1.00 18.70 ? 48  VAL D CB    1 
ATOM   3258 C CG1   . VAL F 6 47  ? -3.688  -19.070 -8.906  1.00 17.15 ? 48  VAL D CG1   1 
ATOM   3259 C CG2   . VAL F 6 47  ? -4.120  -20.648 -10.735 1.00 18.65 ? 48  VAL D CG2   1 
ATOM   3260 N N     . ALA F 6 48  ? -7.101  -17.939 -8.616  1.00 18.13 ? 49  ALA D N     1 
ATOM   3261 C CA    . ALA F 6 48  ? -7.577  -16.916 -7.685  1.00 18.90 ? 49  ALA D CA    1 
ATOM   3262 C C     . ALA F 6 48  ? -8.500  -17.508 -6.614  1.00 20.61 ? 49  ALA D C     1 
ATOM   3263 O O     . ALA F 6 48  ? -8.345  -17.221 -5.424  1.00 20.88 ? 49  ALA D O     1 
ATOM   3264 C CB    . ALA F 6 48  ? -8.312  -15.810 -8.439  1.00 19.49 ? 49  ALA D CB    1 
ATOM   3265 N N     . GLU F 6 49  ? -9.456  -18.336 -7.034  1.00 20.22 ? 50  GLU D N     1 
ATOM   3266 C CA    . GLU F 6 49  ? -10.395 -18.935 -6.088  1.00 21.34 ? 50  GLU D CA    1 
ATOM   3267 C C     . GLU F 6 49  ? -9.734  -19.974 -5.186  1.00 20.05 ? 50  GLU D C     1 
ATOM   3268 O O     . GLU F 6 49  ? -10.091 -20.100 -4.016  1.00 21.49 ? 50  GLU D O     1 
ATOM   3269 C CB    . GLU F 6 49  ? -11.583 -19.571 -6.836  1.00 24.05 ? 50  GLU D CB    1 
ATOM   3270 C CG    . GLU F 6 49  ? -12.343 -18.600 -7.752  1.00 29.43 ? 50  GLU D CG    1 
ATOM   3271 C CD    . GLU F 6 49  ? -13.612 -19.206 -8.364  1.00 34.00 ? 50  GLU D CD    1 
ATOM   3272 O OE1   . GLU F 6 49  ? -13.654 -20.433 -8.577  1.00 33.88 ? 50  GLU D OE1   1 
ATOM   3273 O OE2   . GLU F 6 49  ? -14.563 -18.448 -8.650  1.00 34.87 ? 50  GLU D OE2   1 
ATOM   3274 N N     . THR F 6 50  ? -8.770  -20.721 -5.717  1.00 18.35 ? 51  THR D N     1 
ATOM   3275 C CA    . THR F 6 50  ? -8.088  -21.741 -4.919  1.00 18.47 ? 51  THR D CA    1 
ATOM   3276 C C     . THR F 6 50  ? -7.148  -21.130 -3.875  1.00 18.79 ? 51  THR D C     1 
ATOM   3277 O O     . THR F 6 50  ? -7.068  -21.609 -2.739  1.00 18.67 ? 51  THR D O     1 
ATOM   3278 C CB    . THR F 6 50  ? -7.299  -22.707 -5.829  1.00 17.51 ? 51  THR D CB    1 
ATOM   3279 O OG1   . THR F 6 50  ? -8.208  -23.301 -6.762  1.00 19.68 ? 51  THR D OG1   1 
ATOM   3280 C CG2   . THR F 6 50  ? -6.624  -23.824 -5.010  1.00 17.77 ? 51  THR D CG2   1 
ATOM   3281 N N     . LEU F 6 51  ? -6.436  -20.073 -4.253  1.00 17.09 ? 52  LEU D N     1 
ATOM   3282 C CA    . LEU F 6 51  ? -5.529  -19.437 -3.305  1.00 18.82 ? 52  LEU D CA    1 
ATOM   3283 C C     . LEU F 6 51  ? -6.309  -18.728 -2.192  1.00 18.81 ? 52  LEU D C     1 
ATOM   3284 O O     . LEU F 6 51  ? -5.819  -18.587 -1.071  1.00 20.08 ? 52  LEU D O     1 
ATOM   3285 C CB    . LEU F 6 51  ? -4.594  -18.463 -4.035  1.00 18.38 ? 52  LEU D CB    1 
ATOM   3286 C CG    . LEU F 6 51  ? -3.572  -19.153 -4.949  1.00 17.45 ? 52  LEU D CG    1 
ATOM   3287 C CD1   . LEU F 6 51  ? -2.635  -18.100 -5.576  1.00 19.81 ? 52  LEU D CD1   1 
ATOM   3288 C CD2   . LEU F 6 51  ? -2.766  -20.176 -4.152  1.00 17.33 ? 52  LEU D CD2   1 
ATOM   3289 N N     . LYS F 6 52  ? -7.530  -18.306 -2.497  1.00 18.62 ? 53  LYS D N     1 
ATOM   3290 C CA    . LYS F 6 52  ? -8.366  -17.650 -1.504  1.00 22.40 ? 53  LYS D CA    1 
ATOM   3291 C C     . LYS F 6 52  ? -9.021  -18.649 -0.553  1.00 23.15 ? 53  LYS D C     1 
ATOM   3292 O O     . LYS F 6 52  ? -8.991  -18.464 0.657   1.00 23.81 ? 53  LYS D O     1 
ATOM   3293 C CB    . LYS F 6 52  ? -9.470  -16.835 -2.181  1.00 24.58 ? 53  LYS D CB    1 
ATOM   3294 C CG    . LYS F 6 52  ? -10.399 -16.118 -1.197  1.00 31.38 ? 53  LYS D CG    1 
ATOM   3295 C CD    . LYS F 6 52  ? -11.449 -15.257 -1.910  1.00 36.69 ? 53  LYS D CD    1 
ATOM   3296 C CE    . LYS F 6 52  ? -12.609 -16.085 -2.451  1.00 41.56 ? 53  LYS D CE    1 
ATOM   3297 N NZ    . LYS F 6 52  ? -12.209 -17.051 -3.514  1.00 46.13 ? 53  LYS D NZ    1 
ATOM   3298 N N     . ASP F 6 53  ? -9.591  -19.719 -1.105  1.00 24.46 ? 54  ASP D N     1 
ATOM   3299 C CA    . ASP F 6 53  ? -10.322 -20.702 -0.296  1.00 26.23 ? 54  ASP D CA    1 
ATOM   3300 C C     . ASP F 6 53  ? -9.594  -21.954 0.181   1.00 24.87 ? 54  ASP D C     1 
ATOM   3301 O O     . ASP F 6 53  ? -10.031 -22.586 1.146   1.00 24.93 ? 54  ASP D O     1 
ATOM   3302 C CB    . ASP F 6 53  ? -11.583 -21.156 -1.048  1.00 29.31 ? 54  ASP D CB    1 
ATOM   3303 C CG    . ASP F 6 53  ? -12.455 -19.998 -1.489  1.00 33.17 ? 54  ASP D CG    1 
ATOM   3304 O OD1   . ASP F 6 53  ? -12.582 -19.018 -0.725  1.00 36.89 ? 54  ASP D OD1   1 
ATOM   3305 O OD2   . ASP F 6 53  ? -13.023 -20.070 -2.601  1.00 36.34 ? 54  ASP D OD2   1 
ATOM   3306 N N     . ASN F 6 54  ? -8.490  -22.313 -0.467  1.00 21.38 ? 55  ASN D N     1 
ATOM   3307 C CA    . ASN F 6 54  ? -7.783  -23.525 -0.096  1.00 20.45 ? 55  ASN D CA    1 
ATOM   3308 C C     . ASN F 6 54  ? -6.385  -23.377 0.509   1.00 21.15 ? 55  ASN D C     1 
ATOM   3309 O O     . ASN F 6 54  ? -5.584  -24.311 0.478   1.00 20.87 ? 55  ASN D O     1 
ATOM   3310 C CB    . ASN F 6 54  ? -7.748  -24.473 -1.307  1.00 19.92 ? 55  ASN D CB    1 
ATOM   3311 C CG    . ASN F 6 54  ? -9.140  -24.879 -1.756  1.00 22.15 ? 55  ASN D CG    1 
ATOM   3312 O OD1   . ASN F 6 54  ? -9.711  -24.282 -2.661  1.00 22.67 ? 55  ASN D OD1   1 
ATOM   3313 N ND2   . ASN F 6 54  ? -9.706  -25.889 -1.092  1.00 22.35 ? 55  ASN D ND2   1 
ATOM   3314 N N     . THR F 6 55  ? -6.081  -22.212 1.068   1.00 21.99 ? 56  THR D N     1 
ATOM   3315 C CA    . THR F 6 55  ? -4.784  -22.028 1.705   1.00 22.98 ? 56  THR D CA    1 
ATOM   3316 C C     . THR F 6 55  ? -5.039  -21.586 3.133   1.00 24.46 ? 56  THR D C     1 
ATOM   3317 O O     . THR F 6 55  ? -6.061  -20.983 3.420   1.00 23.71 ? 56  THR D O     1 
ATOM   3318 C CB    . THR F 6 55  ? -3.944  -20.937 1.008   1.00 21.72 ? 56  THR D CB    1 
ATOM   3319 O OG1   . THR F 6 55  ? -4.698  -19.724 0.969   1.00 21.28 ? 56  THR D OG1   1 
ATOM   3320 C CG2   . THR F 6 55  ? -3.574  -21.356 -0.415  1.00 21.87 ? 56  THR D CG2   1 
ATOM   3321 N N     . GLN F 6 56  ? -4.110  -21.881 4.029   1.00 25.83 ? 57  GLN D N     1 
ATOM   3322 C CA    . GLN F 6 56  ? -4.275  -21.468 5.409   1.00 29.13 ? 57  GLN D CA    1 
ATOM   3323 C C     . GLN F 6 56  ? -2.966  -20.937 5.977   1.00 27.80 ? 57  GLN D C     1 
ATOM   3324 O O     . GLN F 6 56  ? -2.977  -20.159 6.922   1.00 28.61 ? 57  GLN D O     1 
ATOM   3325 C CB    . GLN F 6 56  ? -4.793  -22.635 6.257   1.00 32.78 ? 57  GLN D CB    1 
ATOM   3326 C CG    . GLN F 6 56  ? -3.894  -23.852 6.226   1.00 39.53 ? 57  GLN D CG    1 
ATOM   3327 C CD    . GLN F 6 56  ? -2.688  -23.720 7.135   1.00 44.73 ? 57  GLN D CD    1 
ATOM   3328 O OE1   . GLN F 6 56  ? -1.609  -24.230 6.830   1.00 48.04 ? 57  GLN D OE1   1 
ATOM   3329 N NE2   . GLN F 6 56  ? -2.869  -23.050 8.267   1.00 47.19 ? 57  GLN D NE2   1 
ATOM   3330 N N     . SER F 6 57  ? -1.845  -21.332 5.383   1.00 27.65 ? 58  SER D N     1 
ATOM   3331 C CA    . SER F 6 57  ? -0.541  -20.893 5.873   1.00 27.46 ? 58  SER D CA    1 
ATOM   3332 C C     . SER F 6 57  ? -0.321  -19.388 5.836   1.00 27.41 ? 58  SER D C     1 
ATOM   3333 O O     . SER F 6 57  ? -0.899  -18.664 5.013   1.00 25.68 ? 58  SER D O     1 
ATOM   3334 C CB    . SER F 6 57  ? 0.593   -21.582 5.105   1.00 29.31 ? 58  SER D CB    1 
ATOM   3335 O OG    . SER F 6 57  ? 0.651   -21.145 3.766   1.00 33.31 ? 58  SER D OG    1 
ATOM   3336 N N     . LYS F 6 58  ? 0.530   -18.931 6.745   1.00 25.90 ? 59  LYS D N     1 
ATOM   3337 C CA    . LYS F 6 58  ? 0.869   -17.520 6.860   1.00 27.01 ? 59  LYS D CA    1 
ATOM   3338 C C     . LYS F 6 58  ? 2.378   -17.433 6.766   1.00 25.61 ? 59  LYS D C     1 
ATOM   3339 O O     . LYS F 6 58  ? 3.089   -18.212 7.412   1.00 24.53 ? 59  LYS D O     1 
ATOM   3340 C CB    . LYS F 6 58  ? 0.396   -16.982 8.213   1.00 31.64 ? 59  LYS D CB    1 
ATOM   3341 C CG    . LYS F 6 58  ? -1.055  -17.313 8.490   1.00 38.89 ? 59  LYS D CG    1 
ATOM   3342 C CD    . LYS F 6 58  ? -1.412  -17.201 9.961   1.00 45.35 ? 59  LYS D CD    1 
ATOM   3343 C CE    . LYS F 6 58  ? -2.534  -18.175 10.299  1.00 48.71 ? 59  LYS D CE    1 
ATOM   3344 N NZ    . LYS F 6 58  ? -3.641  -18.111 9.300   1.00 52.40 ? 59  LYS D NZ    1 
ATOM   3345 N N     . LEU F 6 59  ? 2.870   -16.516 5.940   1.00 22.80 ? 60  LEU D N     1 
ATOM   3346 C CA    . LEU F 6 59  ? 4.306   -16.348 5.789   1.00 23.29 ? 60  LEU D CA    1 
ATOM   3347 C C     . LEU F 6 59  ? 4.723   -14.992 6.329   1.00 23.42 ? 60  LEU D C     1 
ATOM   3348 O O     . LEU F 6 59  ? 3.938   -14.044 6.336   1.00 21.71 ? 60  LEU D O     1 
ATOM   3349 C CB    . LEU F 6 59  ? 4.735   -16.393 4.313   1.00 26.00 ? 60  LEU D CB    1 
ATOM   3350 C CG    . LEU F 6 59  ? 4.614   -17.631 3.435   1.00 28.51 ? 60  LEU D CG    1 
ATOM   3351 C CD1   . LEU F 6 59  ? 5.541   -17.448 2.230   1.00 26.47 ? 60  LEU D CD1   1 
ATOM   3352 C CD2   . LEU F 6 59  ? 4.982   -18.879 4.210   1.00 31.67 ? 60  LEU D CD2   1 
ATOM   3353 N N     . THR F 6 60  ? 5.961   -14.915 6.798   1.00 22.28 ? 61  THR D N     1 
ATOM   3354 C CA    . THR F 6 60  ? 6.512   -13.657 7.264   1.00 21.81 ? 61  THR D CA    1 
ATOM   3355 C C     . THR F 6 60  ? 7.798   -13.503 6.468   1.00 21.64 ? 61  THR D C     1 
ATOM   3356 O O     . THR F 6 60  ? 8.580   -14.443 6.355   1.00 21.22 ? 61  THR D O     1 
ATOM   3357 C CB    . THR F 6 60  ? 6.806   -13.668 8.769   1.00 25.49 ? 61  THR D CB    1 
ATOM   3358 O OG1   . THR F 6 60  ? 5.575   -13.831 9.489   1.00 26.59 ? 61  THR D OG1   1 
ATOM   3359 C CG2   . THR F 6 60  ? 7.428   -12.342 9.183   1.00 27.80 ? 61  THR D CG2   1 
ATOM   3360 N N     . VAL F 6 61  ? 7.999   -12.333 5.884   1.00 19.03 ? 62  VAL D N     1 
ATOM   3361 C CA    . VAL F 6 61  ? 9.188   -12.104 5.086   1.00 18.84 ? 62  VAL D CA    1 
ATOM   3362 C C     . VAL F 6 61  ? 9.936   -10.933 5.691   1.00 19.21 ? 62  VAL D C     1 
ATOM   3363 O O     . VAL F 6 61  ? 9.368   -9.853  5.848   1.00 20.06 ? 62  VAL D O     1 
ATOM   3364 C CB    . VAL F 6 61  ? 8.807   -11.771 3.619   1.00 19.76 ? 62  VAL D CB    1 
ATOM   3365 C CG1   . VAL F 6 61  ? 10.056  -11.491 2.804   1.00 21.51 ? 62  VAL D CG1   1 
ATOM   3366 C CG2   . VAL F 6 61  ? 8.012   -12.921 3.011   1.00 17.91 ? 62  VAL D CG2   1 
ATOM   3367 N N     . LYS F 6 62  ? 11.200  -11.150 6.039   1.00 18.25 ? 63  LYS D N     1 
ATOM   3368 C CA    . LYS F 6 62  ? 12.010  -10.083 6.630   1.00 20.85 ? 63  LYS D CA    1 
ATOM   3369 C C     . LYS F 6 62  ? 13.361  -9.984  5.950   1.00 21.22 ? 63  LYS D C     1 
ATOM   3370 O O     . LYS F 6 62  ? 14.035  -10.991 5.753   1.00 23.74 ? 63  LYS D O     1 
ATOM   3371 C CB    . LYS F 6 62  ? 12.220  -10.327 8.129   1.00 22.74 ? 63  LYS D CB    1 
ATOM   3372 C CG    . LYS F 6 62  ? 10.943  -10.283 8.943   1.00 28.16 ? 63  LYS D CG    1 
ATOM   3373 C CD    . LYS F 6 62  ? 11.207  -10.454 10.432  1.00 33.18 ? 63  LYS D CD    1 
ATOM   3374 C CE    . LYS F 6 62  ? 9.908   -10.352 11.214  1.00 36.85 ? 63  LYS D CE    1 
ATOM   3375 N NZ    . LYS F 6 62  ? 9.964   -11.162 12.464  1.00 39.39 ? 63  LYS D NZ    1 
ATOM   3376 N N     . GLY F 6 63  ? 13.764  -8.767  5.593   1.00 20.13 ? 64  GLY D N     1 
ATOM   3377 C CA    . GLY F 6 63  ? 15.046  -8.599  4.935   1.00 19.39 ? 64  GLY D CA    1 
ATOM   3378 C C     . GLY F 6 63  ? 15.278  -7.159  4.526   1.00 18.50 ? 64  GLY D C     1 
ATOM   3379 O O     . GLY F 6 63  ? 14.587  -6.253  4.994   1.00 19.47 ? 64  GLY D O     1 
ATOM   3380 N N     . ASN F 6 64  ? 16.247  -6.955  3.645   1.00 17.52 ? 65  ASN D N     1 
ATOM   3381 C CA    . ASN F 6 64  ? 16.577  -5.626  3.144   1.00 20.24 ? 65  ASN D CA    1 
ATOM   3382 C C     . ASN F 6 64  ? 15.742  -5.333  1.900   1.00 19.02 ? 65  ASN D C     1 
ATOM   3383 O O     . ASN F 6 64  ? 15.645  -6.178  1.012   1.00 19.23 ? 65  ASN D O     1 
ATOM   3384 C CB    . ASN F 6 64  ? 18.054  -5.563  2.751   1.00 23.06 ? 65  ASN D CB    1 
ATOM   3385 C CG    . ASN F 6 64  ? 18.983  -5.856  3.909   1.00 31.78 ? 65  ASN D CG    1 
ATOM   3386 O OD1   . ASN F 6 64  ? 19.982  -6.572  3.752   1.00 37.24 ? 65  ASN D OD1   1 
ATOM   3387 N ND2   . ASN F 6 64  ? 18.679  -5.290  5.075   1.00 32.75 ? 65  ASN D ND2   1 
ATOM   3388 N N     . LEU F 6 65  ? 15.144  -4.146  1.813   1.00 16.47 ? 66  LEU D N     1 
ATOM   3389 C CA    . LEU F 6 65  ? 14.380  -3.828  0.604   1.00 16.61 ? 66  LEU D CA    1 
ATOM   3390 C C     . LEU F 6 65  ? 15.351  -3.196  -0.385  1.00 16.89 ? 66  LEU D C     1 
ATOM   3391 O O     . LEU F 6 65  ? 15.834  -2.074  -0.181  1.00 17.20 ? 66  LEU D O     1 
ATOM   3392 C CB    . LEU F 6 65  ? 13.221  -2.857  0.891   1.00 15.33 ? 66  LEU D CB    1 
ATOM   3393 C CG    . LEU F 6 65  ? 12.305  -2.611  -0.325  1.00 13.58 ? 66  LEU D CG    1 
ATOM   3394 C CD1   . LEU F 6 65  ? 11.610  -3.914  -0.738  1.00 15.11 ? 66  LEU D CD1   1 
ATOM   3395 C CD2   . LEU F 6 65  ? 11.236  -1.566  0.046   1.00 15.94 ? 66  LEU D CD2   1 
ATOM   3396 N N     . ASP F 6 66  ? 15.651  -3.939  -1.445  1.00 14.90 ? 67  ASP D N     1 
ATOM   3397 C CA    . ASP F 6 66  ? 16.573  -3.476  -2.460  1.00 17.00 ? 67  ASP D CA    1 
ATOM   3398 C C     . ASP F 6 66  ? 15.887  -2.458  -3.363  1.00 15.94 ? 67  ASP D C     1 
ATOM   3399 O O     . ASP F 6 66  ? 16.410  -1.379  -3.598  1.00 15.51 ? 67  ASP D O     1 
ATOM   3400 C CB    . ASP F 6 66  ? 17.061  -4.643  -3.304  1.00 18.68 ? 67  ASP D CB    1 
ATOM   3401 C CG    . ASP F 6 66  ? 18.246  -4.276  -4.144  1.00 24.55 ? 67  ASP D CG    1 
ATOM   3402 O OD1   . ASP F 6 66  ? 19.240  -3.798  -3.564  1.00 27.54 ? 67  ASP D OD1   1 
ATOM   3403 O OD2   . ASP F 6 66  ? 18.190  -4.460  -5.370  1.00 26.94 ? 67  ASP D OD2   1 
ATOM   3404 N N     . THR F 6 67  ? 14.716  -2.813  -3.879  1.00 16.09 ? 68  THR D N     1 
ATOM   3405 C CA    . THR F 6 67  ? 13.985  -1.892  -4.747  1.00 15.74 ? 68  THR D CA    1 
ATOM   3406 C C     . THR F 6 67  ? 12.492  -2.070  -4.543  1.00 15.68 ? 68  THR D C     1 
ATOM   3407 O O     . THR F 6 67  ? 12.031  -3.112  -4.056  1.00 14.64 ? 68  THR D O     1 
ATOM   3408 C CB    . THR F 6 67  ? 14.274  -2.133  -6.263  1.00 20.79 ? 68  THR D CB    1 
ATOM   3409 O OG1   . THR F 6 67  ? 13.695  -3.379  -6.664  1.00 25.48 ? 68  THR D OG1   1 
ATOM   3410 C CG2   . THR F 6 67  ? 15.767  -2.160  -6.562  1.00 22.83 ? 68  THR D CG2   1 
ATOM   3411 N N     . TYR F 6 68  ? 11.736  -1.037  -4.898  1.00 15.11 ? 69  TYR D N     1 
ATOM   3412 C CA    . TYR F 6 68  ? 10.283  -1.104  -4.812  1.00 14.67 ? 69  TYR D CA    1 
ATOM   3413 C C     . TYR F 6 68  ? 9.742   -0.271  -5.956  1.00 14.41 ? 69  TYR D C     1 
ATOM   3414 O O     . TYR F 6 68  ? 10.462  0.538   -6.533  1.00 13.78 ? 69  TYR D O     1 
ATOM   3415 C CB    . TYR F 6 68  ? 9.774   -0.527  -3.491  1.00 15.66 ? 69  TYR D CB    1 
ATOM   3416 C CG    . TYR F 6 68  ? 10.040  0.950   -3.346  1.00 14.01 ? 69  TYR D CG    1 
ATOM   3417 C CD1   . TYR F 6 68  ? 9.199   1.898   -3.947  1.00 12.79 ? 69  TYR D CD1   1 
ATOM   3418 C CD2   . TYR F 6 68  ? 11.160  1.403   -2.657  1.00 12.99 ? 69  TYR D CD2   1 
ATOM   3419 C CE1   . TYR F 6 68  ? 9.472   3.260   -3.867  1.00 12.42 ? 69  TYR D CE1   1 
ATOM   3420 C CE2   . TYR F 6 68  ? 11.444  2.770   -2.568  1.00 16.03 ? 69  TYR D CE2   1 
ATOM   3421 C CZ    . TYR F 6 68  ? 10.597  3.688   -3.176  1.00 13.49 ? 69  TYR D CZ    1 
ATOM   3422 O OH    . TYR F 6 68  ? 10.887  5.033   -3.106  1.00 13.53 ? 69  TYR D OH    1 
ATOM   3423 N N     . GLY F 6 69  ? 8.477   -0.482  -6.289  1.00 13.47 ? 70  GLY D N     1 
ATOM   3424 C CA    . GLY F 6 69  ? 7.882   0.311   -7.337  1.00 13.68 ? 70  GLY D CA    1 
ATOM   3425 C C     . GLY F 6 69  ? 6.386   0.109   -7.342  1.00 12.93 ? 70  GLY D C     1 
ATOM   3426 O O     . GLY F 6 69  ? 5.895   -0.956  -6.975  1.00 13.63 ? 70  GLY D O     1 
ATOM   3427 N N     . PHE F 6 70  ? 5.657   1.145   -7.734  1.00 13.55 ? 71  PHE D N     1 
ATOM   3428 C CA    . PHE F 6 70  ? 4.213   1.045   -7.827  1.00 12.08 ? 71  PHE D CA    1 
ATOM   3429 C C     . PHE F 6 70  ? 3.776   1.747   -9.095  1.00 14.14 ? 71  PHE D C     1 
ATOM   3430 O O     . PHE F 6 70  ? 4.199   2.875   -9.368  1.00 12.47 ? 71  PHE D O     1 
ATOM   3431 C CB    . PHE F 6 70  ? 3.492   1.741   -6.667  1.00 11.67 ? 71  PHE D CB    1 
ATOM   3432 C CG    . PHE F 6 70  ? 1.992   1.716   -6.815  1.00 13.81 ? 71  PHE D CG    1 
ATOM   3433 C CD1   . PHE F 6 70  ? 1.260   0.634   -6.345  1.00 13.82 ? 71  PHE D CD1   1 
ATOM   3434 C CD2   . PHE F 6 70  ? 1.325   2.738   -7.516  1.00 14.25 ? 71  PHE D CD2   1 
ATOM   3435 C CE1   . PHE F 6 70  ? -0.125  0.547   -6.563  1.00 15.41 ? 71  PHE D CE1   1 
ATOM   3436 C CE2   . PHE F 6 70  ? -0.058  2.668   -7.743  1.00 14.87 ? 71  PHE D CE2   1 
ATOM   3437 C CZ    . PHE F 6 70  ? -0.786  1.569   -7.264  1.00 15.88 ? 71  PHE D CZ    1 
ATOM   3438 N N     . CYS F 6 71  ? 2.934   1.072   -9.869  1.00 13.54 ? 72  CYS D N     1 
ATOM   3439 C CA    . CYS F 6 71  ? 2.361   1.659   -11.071 1.00 16.78 ? 72  CYS D CA    1 
ATOM   3440 C C     . CYS F 6 71  ? 1.202   0.772   -11.512 1.00 17.15 ? 72  CYS D C     1 
ATOM   3441 O O     . CYS F 6 71  ? 1.284   -0.451  -11.419 1.00 15.48 ? 72  CYS D O     1 
ATOM   3442 C CB    . CYS F 6 71  ? 3.394   1.784   -12.199 1.00 16.40 ? 72  CYS D CB    1 
ATOM   3443 S SG    . CYS F 6 71  ? 2.849   2.908   -13.532 1.00 19.87 ? 72  CYS D SG    1 
ATOM   3444 N N     . ASP F 6 72  ? 0.112   1.394   -11.951 1.00 16.02 ? 73  ASP D N     1 
ATOM   3445 C CA    . ASP F 6 72  ? -1.058  0.656   -12.422 1.00 17.11 ? 73  ASP D CA    1 
ATOM   3446 C C     . ASP F 6 72  ? -1.579  -0.426  -11.480 1.00 16.57 ? 73  ASP D C     1 
ATOM   3447 O O     . ASP F 6 72  ? -1.765  -1.568  -11.899 1.00 16.83 ? 73  ASP D O     1 
ATOM   3448 C CB    . ASP F 6 72  ? -0.756  0.023   -13.790 1.00 19.45 ? 73  ASP D CB    1 
ATOM   3449 C CG    . ASP F 6 72  ? -0.391  1.055   -14.834 1.00 22.31 ? 73  ASP D CG    1 
ATOM   3450 O OD1   . ASP F 6 72  ? -1.172  2.003   -15.012 1.00 22.60 ? 73  ASP D OD1   1 
ATOM   3451 O OD2   . ASP F 6 72  ? 0.673   0.924   -15.472 1.00 25.04 ? 73  ASP D OD2   1 
ATOM   3452 N N     . ASP F 6 73  ? -1.820  -0.063  -10.220 1.00 16.91 ? 74  ASP D N     1 
ATOM   3453 C CA    . ASP F 6 73  ? -2.338  -0.988  -9.213  1.00 17.43 ? 74  ASP D CA    1 
ATOM   3454 C C     . ASP F 6 73  ? -1.469  -2.201  -8.908  1.00 17.86 ? 74  ASP D C     1 
ATOM   3455 O O     . ASP F 6 73  ? -1.977  -3.205  -8.426  1.00 16.51 ? 74  ASP D O     1 
ATOM   3456 C CB    . ASP F 6 73  ? -3.730  -1.490  -9.610  1.00 20.28 ? 74  ASP D CB    1 
ATOM   3457 C CG    . ASP F 6 73  ? -4.837  -0.816  -8.835  1.00 25.84 ? 74  ASP D CG    1 
ATOM   3458 O OD1   . ASP F 6 73  ? -6.020  -1.088  -9.148  1.00 30.59 ? 74  ASP D OD1   1 
ATOM   3459 O OD2   . ASP F 6 73  ? -4.535  -0.029  -7.914  1.00 23.63 ? 74  ASP D OD2   1 
ATOM   3460 N N     . VAL F 6 74  ? -0.177  -2.122  -9.209  1.00 13.96 ? 75  VAL D N     1 
ATOM   3461 C CA    . VAL F 6 74  ? 0.721   -3.235  -8.919  1.00 12.38 ? 75  VAL D CA    1 
ATOM   3462 C C     . VAL F 6 74  ? 1.947   -2.778  -8.126  1.00 13.64 ? 75  VAL D C     1 
ATOM   3463 O O     . VAL F 6 74  ? 2.618   -1.811  -8.508  1.00 13.13 ? 75  VAL D O     1 
ATOM   3464 C CB    . VAL F 6 74  ? 1.234   -3.927  -10.219 1.00 13.46 ? 75  VAL D CB    1 
ATOM   3465 C CG1   . VAL F 6 74  ? 2.191   -5.088  -9.849  1.00 12.97 ? 75  VAL D CG1   1 
ATOM   3466 C CG2   . VAL F 6 74  ? 0.052   -4.453  -11.047 1.00 16.03 ? 75  VAL D CG2   1 
ATOM   3467 N N     . TRP F 6 75  ? 2.225   -3.467  -7.022  1.00 11.95 ? 76  TRP D N     1 
ATOM   3468 C CA    . TRP F 6 75  ? 3.404   -3.172  -6.221  1.00 12.30 ? 76  TRP D CA    1 
ATOM   3469 C C     . TRP F 6 75  ? 4.432   -4.245  -6.573  1.00 12.21 ? 76  TRP D C     1 
ATOM   3470 O O     . TRP F 6 75  ? 4.095   -5.429  -6.657  1.00 13.24 ? 76  TRP D O     1 
ATOM   3471 C CB    . TRP F 6 75  ? 3.102   -3.258  -4.716  1.00 12.49 ? 76  TRP D CB    1 
ATOM   3472 C CG    . TRP F 6 75  ? 2.602   -1.976  -4.107  1.00 14.19 ? 76  TRP D CG    1 
ATOM   3473 C CD1   . TRP F 6 75  ? 1.316   -1.667  -3.758  1.00 16.20 ? 76  TRP D CD1   1 
ATOM   3474 C CD2   . TRP F 6 75  ? 3.396   -0.829  -3.771  1.00 14.34 ? 76  TRP D CD2   1 
ATOM   3475 N NE1   . TRP F 6 75  ? 1.260   -0.398  -3.220  1.00 13.68 ? 76  TRP D NE1   1 
ATOM   3476 C CE2   . TRP F 6 75  ? 2.525   0.137   -3.215  1.00 13.83 ? 76  TRP D CE2   1 
ATOM   3477 C CE3   . TRP F 6 75  ? 4.764   -0.525  -3.885  1.00 16.04 ? 76  TRP D CE3   1 
ATOM   3478 C CZ2   . TRP F 6 75  ? 2.974   1.393   -2.774  1.00 16.24 ? 76  TRP D CZ2   1 
ATOM   3479 C CZ3   . TRP F 6 75  ? 5.214   0.735   -3.443  1.00 15.75 ? 76  TRP D CZ3   1 
ATOM   3480 C CH2   . TRP F 6 75  ? 4.317   1.671   -2.893  1.00 15.59 ? 76  TRP D CH2   1 
ATOM   3481 N N     . THR F 6 76  ? 5.669   -3.829  -6.799  1.00 12.97 ? 77  THR D N     1 
ATOM   3482 C CA    . THR F 6 76  ? 6.744   -4.778  -7.095  1.00 13.96 ? 77  THR D CA    1 
ATOM   3483 C C     . THR F 6 76  ? 7.858   -4.534  -6.093  1.00 14.41 ? 77  THR D C     1 
ATOM   3484 O O     . THR F 6 76  ? 8.276   -3.404  -5.908  1.00 14.10 ? 77  THR D O     1 
ATOM   3485 C CB    . THR F 6 76  ? 7.310   -4.591  -8.520  1.00 16.85 ? 77  THR D CB    1 
ATOM   3486 O OG1   . THR F 6 76  ? 6.293   -4.893  -9.487  1.00 17.82 ? 77  THR D OG1   1 
ATOM   3487 C CG2   . THR F 6 76  ? 8.504   -5.543  -8.741  1.00 18.27 ? 77  THR D CG2   1 
ATOM   3488 N N     . PHE F 6 77  ? 8.347   -5.577  -5.433  1.00 14.44 ? 78  PHE D N     1 
ATOM   3489 C CA    . PHE F 6 77  ? 9.431   -5.372  -4.468  1.00 13.62 ? 78  PHE D CA    1 
ATOM   3490 C C     . PHE F 6 77  ? 10.538  -6.394  -4.691  1.00 15.93 ? 78  PHE D C     1 
ATOM   3491 O O     . PHE F 6 77  ? 10.263  -7.522  -5.083  1.00 15.36 ? 78  PHE D O     1 
ATOM   3492 C CB    . PHE F 6 77  ? 8.967   -5.602  -3.023  1.00 13.05 ? 78  PHE D CB    1 
ATOM   3493 C CG    . PHE F 6 77  ? 7.760   -4.806  -2.608  1.00 14.57 ? 78  PHE D CG    1 
ATOM   3494 C CD1   . PHE F 6 77  ? 7.877   -3.471  -2.241  1.00 13.96 ? 78  PHE D CD1   1 
ATOM   3495 C CD2   . PHE F 6 77  ? 6.503   -5.416  -2.559  1.00 17.14 ? 78  PHE D CD2   1 
ATOM   3496 C CE1   . PHE F 6 77  ? 6.758   -2.745  -1.825  1.00 15.07 ? 78  PHE D CE1   1 
ATOM   3497 C CE2   . PHE F 6 77  ? 5.369   -4.703  -2.146  1.00 18.21 ? 78  PHE D CE2   1 
ATOM   3498 C CZ    . PHE F 6 77  ? 5.498   -3.361  -1.777  1.00 16.14 ? 78  PHE D CZ    1 
ATOM   3499 N N     A ILE F 6 78  ? 11.780  -5.980  -4.453  0.50 14.75 ? 79  ILE D N     1 
ATOM   3500 N N     B ILE F 6 78  ? 11.785  -5.990  -4.464  0.50 14.83 ? 79  ILE D N     1 
ATOM   3501 C CA    A ILE F 6 78  ? 12.917  -6.889  -4.542  0.50 15.35 ? 79  ILE D CA    1 
ATOM   3502 C CA    B ILE F 6 78  ? 12.909  -6.921  -4.563  0.50 15.45 ? 79  ILE D CA    1 
ATOM   3503 C C     A ILE F 6 78  ? 13.505  -6.856  -3.142  0.50 14.81 ? 79  ILE D C     1 
ATOM   3504 C C     B ILE F 6 78  ? 13.532  -6.875  -3.174  0.50 14.94 ? 79  ILE D C     1 
ATOM   3505 O O     A ILE F 6 78  ? 13.984  -5.816  -2.686  0.50 16.09 ? 79  ILE D O     1 
ATOM   3506 O O     B ILE F 6 78  ? 14.062  -5.844  -2.760  0.50 16.34 ? 79  ILE D O     1 
ATOM   3507 C CB    A ILE F 6 78  ? 13.995  -6.423  -5.544  0.50 15.70 ? 79  ILE D CB    1 
ATOM   3508 C CB    B ILE F 6 78  ? 13.960  -6.495  -5.613  0.50 15.88 ? 79  ILE D CB    1 
ATOM   3509 C CG1   A ILE F 6 78  ? 13.416  -6.393  -6.962  0.50 18.02 ? 79  ILE D CG1   1 
ATOM   3510 C CG1   B ILE F 6 78  ? 13.315  -6.407  -7.003  0.50 18.01 ? 79  ILE D CG1   1 
ATOM   3511 C CG2   A ILE F 6 78  ? 15.199  -7.377  -5.483  0.50 16.88 ? 79  ILE D CG2   1 
ATOM   3512 C CG2   B ILE F 6 78  ? 15.101  -7.524  -5.641  0.50 17.38 ? 79  ILE D CG2   1 
ATOM   3513 C CD1   A ILE F 6 78  ? 12.878  -7.725  -7.431  0.50 17.82 ? 79  ILE D CD1   1 
ATOM   3514 C CD1   B ILE F 6 78  ? 14.289  -6.041  -8.107  0.50 18.72 ? 79  ILE D CD1   1 
ATOM   3515 N N     . VAL F 6 79  ? 13.443  -7.985  -2.449  1.00 14.26 ? 80  VAL D N     1 
ATOM   3516 C CA    . VAL F 6 79  ? 13.965  -8.067  -1.097  1.00 16.16 ? 80  VAL D CA    1 
ATOM   3517 C C     . VAL F 6 79  ? 15.204  -8.951  -1.129  1.00 16.97 ? 80  VAL D C     1 
ATOM   3518 O O     . VAL F 6 79  ? 15.187  -10.030 -1.728  1.00 15.52 ? 80  VAL D O     1 
ATOM   3519 C CB    . VAL F 6 79  ? 12.903  -8.676  -0.152  1.00 17.94 ? 80  VAL D CB    1 
ATOM   3520 C CG1   . VAL F 6 79  ? 13.394  -8.673  1.297   1.00 19.27 ? 80  VAL D CG1   1 
ATOM   3521 C CG2   . VAL F 6 79  ? 11.603  -7.868  -0.271  1.00 18.49 ? 80  VAL D CG2   1 
ATOM   3522 N N     . LYS F 6 80  ? 16.274  -8.484  -0.500  1.00 17.59 ? 81  LYS D N     1 
ATOM   3523 C CA    . LYS F 6 80  ? 17.524  -9.246  -0.486  1.00 17.46 ? 81  LYS D CA    1 
ATOM   3524 C C     . LYS F 6 80  ? 17.883  -9.758  0.904   1.00 18.37 ? 81  LYS D C     1 
ATOM   3525 O O     . LYS F 6 80  ? 17.422  -9.220  1.914   1.00 15.92 ? 81  LYS D O     1 
ATOM   3526 C CB    . LYS F 6 80  ? 18.658  -8.390  -1.070  1.00 19.99 ? 81  LYS D CB    1 
ATOM   3527 C CG    . LYS F 6 80  ? 18.588  -8.302  -2.591  1.00 23.37 ? 81  LYS D CG    1 
ATOM   3528 C CD    . LYS F 6 80  ? 19.771  -7.552  -3.165  1.00 27.35 ? 81  LYS D CD    1 
ATOM   3529 C CE    . LYS F 6 80  ? 19.756  -7.595  -4.687  1.00 28.99 ? 81  LYS D CE    1 
ATOM   3530 N NZ    . LYS F 6 80  ? 20.880  -6.786  -5.263  1.00 32.08 ? 81  LYS D NZ    1 
ATOM   3531 N N     . ASN F 6 81  ? 18.692  -10.819 0.946   1.00 18.67 ? 82  ASN D N     1 
ATOM   3532 C CA    . ASN F 6 81  ? 19.094  -11.435 2.208   1.00 20.92 ? 82  ASN D CA    1 
ATOM   3533 C C     . ASN F 6 81  ? 17.924  -11.544 3.173   1.00 21.66 ? 82  ASN D C     1 
ATOM   3534 O O     . ASN F 6 81  ? 17.959  -11.029 4.287   1.00 21.01 ? 82  ASN D O     1 
ATOM   3535 C CB    . ASN F 6 81  ? 20.236  -10.633 2.832   1.00 23.49 ? 82  ASN D CB    1 
ATOM   3536 C CG    . ASN F 6 81  ? 21.439  -10.559 1.914   1.00 29.71 ? 82  ASN D CG    1 
ATOM   3537 O OD1   . ASN F 6 81  ? 21.634  -11.440 1.077   1.00 30.81 ? 82  ASN D OD1   1 
ATOM   3538 N ND2   . ASN F 6 81  ? 22.250  -9.516  2.060   1.00 35.57 ? 82  ASN D ND2   1 
ATOM   3539 N N     . CYS F 6 82  ? 16.868  -12.227 2.767   1.00 22.54 ? 83  CYS D N     1 
ATOM   3540 C CA    . CYS F 6 82  ? 15.752  -12.298 3.681   1.00 24.21 ? 83  CYS D CA    1 
ATOM   3541 C C     . CYS F 6 82  ? 15.516  -13.667 4.272   1.00 24.31 ? 83  CYS D C     1 
ATOM   3542 O O     . CYS F 6 82  ? 16.100  -14.665 3.831   1.00 22.53 ? 83  CYS D O     1 
ATOM   3543 C CB    . CYS F 6 82  ? 14.474  -11.789 3.009   1.00 30.65 ? 83  CYS D CB    1 
ATOM   3544 S SG    . CYS F 6 82  ? 13.927  -12.759 1.609   1.00 37.24 ? 83  CYS D SG    1 
ATOM   3545 N N     . GLN F 6 83  ? 14.704  -13.682 5.322   1.00 23.37 ? 84  GLN D N     1 
ATOM   3546 C CA    . GLN F 6 83  ? 14.312  -14.916 5.992   1.00 24.07 ? 84  GLN D CA    1 
ATOM   3547 C C     . GLN F 6 83  ? 12.805  -15.009 5.820   1.00 24.04 ? 84  GLN D C     1 
ATOM   3548 O O     . GLN F 6 83  ? 12.081  -14.044 6.066   1.00 23.91 ? 84  GLN D O     1 
ATOM   3549 C CB    . GLN F 6 83  ? 14.618  -14.884 7.491   1.00 24.68 ? 84  GLN D CB    1 
ATOM   3550 C CG    . GLN F 6 83  ? 16.088  -14.803 7.866   1.00 30.61 ? 84  GLN D CG    1 
ATOM   3551 C CD    . GLN F 6 83  ? 16.305  -15.004 9.357   1.00 33.40 ? 84  GLN D CD    1 
ATOM   3552 O OE1   . GLN F 6 83  ? 15.406  -14.764 10.165  1.00 37.24 ? 84  GLN D OE1   1 
ATOM   3553 N NE2   . GLN F 6 83  ? 17.504  -15.437 9.731   1.00 35.63 ? 84  GLN D NE2   1 
ATOM   3554 N N     . VAL F 6 84  ? 12.343  -16.171 5.390   1.00 22.63 ? 85  VAL D N     1 
ATOM   3555 C CA    . VAL F 6 84  ? 10.929  -16.397 5.202   1.00 23.52 ? 85  VAL D CA    1 
ATOM   3556 C C     . VAL F 6 84  ? 10.494  -17.431 6.231   1.00 24.65 ? 85  VAL D C     1 
ATOM   3557 O O     . VAL F 6 84  ? 11.042  -18.537 6.288   1.00 23.39 ? 85  VAL D O     1 
ATOM   3558 C CB    . VAL F 6 84  ? 10.643  -16.930 3.791   1.00 24.48 ? 85  VAL D CB    1 
ATOM   3559 C CG1   . VAL F 6 84  ? 9.158   -17.223 3.639   1.00 24.61 ? 85  VAL D CG1   1 
ATOM   3560 C CG2   . VAL F 6 84  ? 11.107  -15.907 2.753   1.00 25.65 ? 85  VAL D CG2   1 
ATOM   3561 N N     . THR F 6 85  ? 9.533   -17.058 7.061   1.00 23.46 ? 86  THR D N     1 
ATOM   3562 C CA    . THR F 6 85  ? 9.028   -17.974 8.064   1.00 26.29 ? 86  THR D CA    1 
ATOM   3563 C C     . THR F 6 85  ? 7.695   -18.522 7.587   1.00 27.52 ? 86  THR D C     1 
ATOM   3564 O O     . THR F 6 85  ? 6.789   -17.769 7.216   1.00 25.25 ? 86  THR D O     1 
ATOM   3565 C CB    . THR F 6 85  ? 8.841   -17.276 9.410   1.00 26.61 ? 86  THR D CB    1 
ATOM   3566 O OG1   . THR F 6 85  ? 10.078  -16.656 9.788   1.00 29.96 ? 86  THR D OG1   1 
ATOM   3567 C CG2   . THR F 6 85  ? 8.449   -18.286 10.474  1.00 28.25 ? 86  THR D CG2   1 
ATOM   3568 N N     . VAL F 6 86  ? 7.589   -19.843 7.577   1.00 28.51 ? 87  VAL D N     1 
ATOM   3569 C CA    . VAL F 6 86  ? 6.370   -20.492 7.138   1.00 31.26 ? 87  VAL D CA    1 
ATOM   3570 C C     . VAL F 6 86  ? 5.672   -21.129 8.326   1.00 34.96 ? 87  VAL D C     1 
ATOM   3571 O O     . VAL F 6 86  ? 6.268   -21.934 9.041   1.00 33.54 ? 87  VAL D O     1 
ATOM   3572 C CB    . VAL F 6 86  ? 6.673   -21.602 6.115   1.00 31.98 ? 87  VAL D CB    1 
ATOM   3573 C CG1   . VAL F 6 86  ? 5.383   -22.230 5.626   1.00 31.56 ? 87  VAL D CG1   1 
ATOM   3574 C CG2   . VAL F 6 86  ? 7.468   -21.040 4.953   1.00 31.86 ? 87  VAL D CG2   1 
ATOM   3575 N N     . GLU F 6 87  ? 4.422   -20.749 8.561   1.00 37.84 ? 88  GLU D N     1 
ATOM   3576 C CA    . GLU F 6 87  ? 3.671   -21.363 9.643   1.00 42.17 ? 88  GLU D CA    1 
ATOM   3577 C C     . GLU F 6 87  ? 2.273   -21.752 9.187   1.00 42.64 ? 88  GLU D C     1 
ATOM   3578 O O     . GLU F 6 87  ? 1.645   -21.064 8.384   1.00 40.98 ? 88  GLU D O     1 
ATOM   3579 C CB    . GLU F 6 87  ? 3.630   -20.465 10.892  1.00 45.07 ? 88  GLU D CB    1 
ATOM   3580 C CG    . GLU F 6 87  ? 2.959   -19.117 10.765  1.00 50.56 ? 88  GLU D CG    1 
ATOM   3581 C CD    . GLU F 6 87  ? 3.228   -18.238 11.986  1.00 54.53 ? 88  GLU D CD    1 
ATOM   3582 O OE1   . GLU F 6 87  ? 2.921   -18.672 13.120  1.00 56.85 ? 88  GLU D OE1   1 
ATOM   3583 O OE2   . GLU F 6 87  ? 3.749   -17.117 11.814  1.00 55.68 ? 88  GLU D OE2   1 
ATOM   3584 N N     . ASP F 6 88  ? 1.811   -22.893 9.685   1.00 44.66 ? 89  ASP D N     1 
ATOM   3585 C CA    . ASP F 6 88  ? 0.500   -23.421 9.341   1.00 46.58 ? 89  ASP D CA    1 
ATOM   3586 C C     . ASP F 6 88  ? -0.399  -23.443 10.565  1.00 48.48 ? 89  ASP D C     1 
ATOM   3587 O O     . ASP F 6 88  ? -0.275  -24.410 11.349  1.00 48.15 ? 89  ASP D O     1 
ATOM   3588 C CB    . ASP F 6 88  ? 0.642   -24.828 8.769   1.00 47.16 ? 89  ASP D CB    1 
ATOM   3589 N N     . GLN F 6 102 ? 7.338   -23.471 12.064  1.00 59.54 ? 103 GLN D N     1 
ATOM   3590 C CA    . GLN F 6 102 ? 8.632   -24.015 12.576  1.00 59.33 ? 103 GLN D CA    1 
ATOM   3591 C C     . GLN F 6 102 ? 9.692   -24.048 11.477  1.00 56.63 ? 103 GLN D C     1 
ATOM   3592 O O     . GLN F 6 102 ? 10.823  -24.489 11.700  1.00 57.60 ? 103 GLN D O     1 
ATOM   3593 C CB    . GLN F 6 102 ? 8.419   -25.429 13.129  1.00 61.65 ? 103 GLN D CB    1 
ATOM   3594 C CG    . GLN F 6 102 ? 9.635   -26.037 13.819  1.00 65.68 ? 103 GLN D CG    1 
ATOM   3595 C CD    . GLN F 6 102 ? 10.145  -25.180 14.959  1.00 68.34 ? 103 GLN D CD    1 
ATOM   3596 O OE1   . GLN F 6 102 ? 9.457   -24.271 15.424  1.00 69.83 ? 103 GLN D OE1   1 
ATOM   3597 N NE2   . GLN F 6 102 ? 11.355  -25.472 15.424  1.00 69.70 ? 103 GLN D NE2   1 
ATOM   3598 N N     . SER F 6 103 ? 9.330   -23.561 10.294  1.00 53.86 ? 104 SER D N     1 
ATOM   3599 C CA    . SER F 6 103 ? 10.257  -23.569 9.171   1.00 49.95 ? 104 SER D CA    1 
ATOM   3600 C C     . SER F 6 103 ? 10.743  -22.179 8.773   1.00 46.75 ? 104 SER D C     1 
ATOM   3601 O O     . SER F 6 103 ? 9.945   -21.312 8.414   1.00 45.56 ? 104 SER D O     1 
ATOM   3602 C CB    . SER F 6 103 ? 9.598   -24.248 7.971   1.00 51.18 ? 104 SER D CB    1 
ATOM   3603 O OG    . SER F 6 103 ? 10.565  -24.612 7.008   1.00 53.22 ? 104 SER D OG    1 
ATOM   3604 N N     . VAL F 6 104 ? 12.059  -21.981 8.836   1.00 42.59 ? 105 VAL D N     1 
ATOM   3605 C CA    . VAL F 6 104 ? 12.681  -20.710 8.479   1.00 39.67 ? 105 VAL D CA    1 
ATOM   3606 C C     . VAL F 6 104 ? 13.594  -20.900 7.270   1.00 37.45 ? 105 VAL D C     1 
ATOM   3607 O O     . VAL F 6 104 ? 14.599  -21.604 7.343   1.00 37.30 ? 105 VAL D O     1 
ATOM   3608 C CB    . VAL F 6 104 ? 13.514  -20.152 9.641   1.00 39.62 ? 105 VAL D CB    1 
ATOM   3609 C CG1   . VAL F 6 104 ? 14.078  -18.793 9.258   1.00 40.89 ? 105 VAL D CG1   1 
ATOM   3610 C CG2   . VAL F 6 104 ? 12.655  -20.041 10.891  1.00 40.76 ? 105 VAL D CG2   1 
ATOM   3611 N N     . ILE F 6 105 ? 13.236  -20.250 6.169   1.00 33.34 ? 106 ILE D N     1 
ATOM   3612 C CA    . ILE F 6 105 ? 13.968  -20.344 4.918   1.00 30.51 ? 106 ILE D CA    1 
ATOM   3613 C C     . ILE F 6 105 ? 14.677  -19.030 4.582   1.00 28.46 ? 106 ILE D C     1 
ATOM   3614 O O     . ILE F 6 105 ? 14.102  -17.959 4.740   1.00 25.87 ? 106 ILE D O     1 
ATOM   3615 C CB    . ILE F 6 105 ? 13.001  -20.679 3.765   1.00 32.58 ? 106 ILE D CB    1 
ATOM   3616 C CG1   . ILE F 6 105 ? 12.223  -21.959 4.092   1.00 35.12 ? 106 ILE D CG1   1 
ATOM   3617 C CG2   . ILE F 6 105 ? 13.767  -20.833 2.464   1.00 33.58 ? 106 ILE D CG2   1 
ATOM   3618 C CD1   . ILE F 6 105 ? 13.097  -23.192 4.232   1.00 35.65 ? 106 ILE D CD1   1 
ATOM   3619 N N     . SER F 6 106 ? 15.919  -19.123 4.113   1.00 25.68 ? 107 SER D N     1 
ATOM   3620 C CA    . SER F 6 106 ? 16.695  -17.937 3.744   1.00 24.62 ? 107 SER D CA    1 
ATOM   3621 C C     . SER F 6 106 ? 16.834  -17.828 2.236   1.00 24.54 ? 107 SER D C     1 
ATOM   3622 O O     . SER F 6 106 ? 17.083  -18.821 1.537   1.00 23.16 ? 107 SER D O     1 
ATOM   3623 C CB    . SER F 6 106 ? 18.072  -17.980 4.396   1.00 24.53 ? 107 SER D CB    1 
ATOM   3624 O OG    . SER F 6 106 ? 17.931  -18.039 5.802   1.00 27.34 ? 107 SER D OG    1 
ATOM   3625 N N     . VAL F 6 107 ? 16.690  -16.606 1.738   1.00 22.10 ? 108 VAL D N     1 
ATOM   3626 C CA    . VAL F 6 107 ? 16.743  -16.355 0.306   1.00 21.48 ? 108 VAL D CA    1 
ATOM   3627 C C     . VAL F 6 107 ? 17.641  -15.158 0.009   1.00 20.71 ? 108 VAL D C     1 
ATOM   3628 O O     . VAL F 6 107 ? 17.504  -14.119 0.647   1.00 21.07 ? 108 VAL D O     1 
ATOM   3629 C CB    . VAL F 6 107 ? 15.319  -16.010 -0.224  1.00 26.19 ? 108 VAL D CB    1 
ATOM   3630 C CG1   . VAL F 6 107 ? 15.288  -16.103 -1.722  1.00 22.25 ? 108 VAL D CG1   1 
ATOM   3631 C CG2   . VAL F 6 107 ? 14.276  -16.912 0.431   1.00 28.43 ? 108 VAL D CG2   1 
ATOM   3632 N N     . ASP F 6 108 ? 18.542  -15.301 -0.959  1.00 19.85 ? 109 ASP D N     1 
ATOM   3633 C CA    . ASP F 6 108 ? 19.434  -14.203 -1.351  1.00 19.98 ? 109 ASP D CA    1 
ATOM   3634 C C     . ASP F 6 108 ? 18.651  -13.052 -2.002  1.00 18.54 ? 109 ASP D C     1 
ATOM   3635 O O     . ASP F 6 108 ? 18.892  -11.881 -1.709  1.00 17.59 ? 109 ASP D O     1 
ATOM   3636 C CB    . ASP F 6 108 ? 20.465  -14.675 -2.375  1.00 24.11 ? 109 ASP D CB    1 
ATOM   3637 C CG    . ASP F 6 108 ? 21.557  -15.545 -1.765  1.00 28.70 ? 109 ASP D CG    1 
ATOM   3638 O OD1   . ASP F 6 108 ? 21.556  -15.749 -0.533  1.00 30.51 ? 109 ASP D OD1   1 
ATOM   3639 O OD2   . ASP F 6 108 ? 22.416  -16.020 -2.542  1.00 30.13 ? 109 ASP D OD2   1 
ATOM   3640 N N     . LYS F 6 109 ? 17.740  -13.395 -2.908  1.00 16.00 ? 110 LYS D N     1 
ATOM   3641 C CA    . LYS F 6 109 ? 16.955  -12.372 -3.617  1.00 15.68 ? 110 LYS D CA    1 
ATOM   3642 C C     . LYS F 6 109 ? 15.553  -12.887 -3.924  1.00 15.56 ? 110 LYS D C     1 
ATOM   3643 O O     . LYS F 6 109 ? 15.396  -13.959 -4.504  1.00 15.42 ? 110 LYS D O     1 
ATOM   3644 C CB    . LYS F 6 109 ? 17.663  -12.012 -4.922  1.00 17.31 ? 110 LYS D CB    1 
ATOM   3645 C CG    . LYS F 6 109 ? 16.974  -10.966 -5.790  1.00 21.75 ? 110 LYS D CG    1 
ATOM   3646 C CD    . LYS F 6 109 ? 17.847  -10.682 -7.010  1.00 27.55 ? 110 LYS D CD    1 
ATOM   3647 C CE    . LYS F 6 109 ? 17.177  -9.756  -8.005  1.00 34.45 ? 110 LYS D CE    1 
ATOM   3648 N NZ    . LYS F 6 109 ? 18.095  -9.466  -9.149  1.00 37.69 ? 110 LYS D NZ    1 
ATOM   3649 N N     . LEU F 6 110 ? 14.537  -12.122 -3.527  1.00 14.87 ? 111 LEU D N     1 
ATOM   3650 C CA    . LEU F 6 110 ? 13.149  -12.507 -3.754  1.00 14.48 ? 111 LEU D CA    1 
ATOM   3651 C C     . LEU F 6 110 ? 12.420  -11.357 -4.430  1.00 14.30 ? 111 LEU D C     1 
ATOM   3652 O O     . LEU F 6 110 ? 12.487  -10.234 -3.956  1.00 14.43 ? 111 LEU D O     1 
ATOM   3653 C CB    . LEU F 6 110 ? 12.452  -12.826 -2.423  1.00 13.97 ? 111 LEU D CB    1 
ATOM   3654 C CG    . LEU F 6 110 ? 10.920  -12.952 -2.443  1.00 15.15 ? 111 LEU D CG    1 
ATOM   3655 C CD1   . LEU F 6 110 ? 10.495  -14.163 -3.262  1.00 15.17 ? 111 LEU D CD1   1 
ATOM   3656 C CD2   . LEU F 6 110 ? 10.400  -13.078 -1.009  1.00 15.72 ? 111 LEU D CD2   1 
ATOM   3657 N N     . ARG F 6 111 ? 11.756  -11.645 -5.544  1.00 12.44 ? 112 ARG D N     1 
ATOM   3658 C CA    . ARG F 6 111 ? 10.973  -10.637 -6.247  1.00 13.16 ? 112 ARG D CA    1 
ATOM   3659 C C     . ARG F 6 111 ? 9.522   -10.863 -5.850  1.00 13.31 ? 112 ARG D C     1 
ATOM   3660 O O     . ARG F 6 111 ? 9.036   -11.998 -5.868  1.00 13.31 ? 112 ARG D O     1 
ATOM   3661 C CB    . ARG F 6 111 ? 11.121  -10.796 -7.765  1.00 15.77 ? 112 ARG D CB    1 
ATOM   3662 C CG    . ARG F 6 111 ? 10.155  -9.941  -8.587  1.00 18.04 ? 112 ARG D CG    1 
ATOM   3663 C CD    . ARG F 6 111 ? 10.368  -10.155 -10.092 1.00 23.98 ? 112 ARG D CD    1 
ATOM   3664 N NE    . ARG F 6 111 ? 11.670  -9.656  -10.528 1.00 26.32 ? 112 ARG D NE    1 
ATOM   3665 C CZ    . ARG F 6 111 ? 11.903  -8.414  -10.945 1.00 30.50 ? 112 ARG D CZ    1 
ATOM   3666 N NH1   . ARG F 6 111 ? 10.915  -7.529  -10.996 1.00 31.07 ? 112 ARG D NH1   1 
ATOM   3667 N NH2   . ARG F 6 111 ? 13.133  -8.052  -11.302 1.00 30.68 ? 112 ARG D NH2   1 
ATOM   3668 N N     . ILE F 6 112 ? 8.832   -9.792  -5.475  1.00 12.19 ? 113 ILE D N     1 
ATOM   3669 C CA    . ILE F 6 112 ? 7.429   -9.901  -5.096  1.00 12.14 ? 113 ILE D CA    1 
ATOM   3670 C C     . ILE F 6 112 ? 6.616   -9.018  -6.043  1.00 13.45 ? 113 ILE D C     1 
ATOM   3671 O O     . ILE F 6 112 ? 6.933   -7.836  -6.221  1.00 14.66 ? 113 ILE D O     1 
ATOM   3672 C CB    . ILE F 6 112 ? 7.181   -9.391  -3.646  1.00 12.29 ? 113 ILE D CB    1 
ATOM   3673 C CG1   . ILE F 6 112 ? 8.018   -10.199 -2.657  1.00 14.19 ? 113 ILE D CG1   1 
ATOM   3674 C CG2   . ILE F 6 112 ? 5.683   -9.539  -3.280  1.00 10.71 ? 113 ILE D CG2   1 
ATOM   3675 C CD1   . ILE F 6 112 ? 7.856   -9.761  -1.204  1.00 17.54 ? 113 ILE D CD1   1 
ATOM   3676 N N     . VAL F 6 113 ? 5.597   -9.598  -6.669  1.00 11.57 ? 114 VAL D N     1 
ATOM   3677 C CA    . VAL F 6 113 ? 4.711   -8.841  -7.553  1.00 13.64 ? 114 VAL D CA    1 
ATOM   3678 C C     . VAL F 6 113 ? 3.328   -8.990  -6.942  1.00 15.11 ? 114 VAL D C     1 
ATOM   3679 O O     . VAL F 6 113 ? 2.827   -10.114 -6.805  1.00 15.02 ? 114 VAL D O     1 
ATOM   3680 C CB    . VAL F 6 113 ? 4.708   -9.413  -8.988  1.00 12.97 ? 114 VAL D CB    1 
ATOM   3681 C CG1   . VAL F 6 113 ? 3.746   -8.599  -9.880  1.00 16.45 ? 114 VAL D CG1   1 
ATOM   3682 C CG2   . VAL F 6 113 ? 6.125   -9.372  -9.565  1.00 16.23 ? 114 VAL D CG2   1 
ATOM   3683 N N     . ALA F 6 114 ? 2.714   -7.871  -6.562  1.00 14.00 ? 115 ALA D N     1 
ATOM   3684 C CA    . ALA F 6 114 ? 1.403   -7.925  -5.931  1.00 14.13 ? 115 ALA D CA    1 
ATOM   3685 C C     . ALA F 6 114 ? 0.370   -7.016  -6.581  1.00 15.97 ? 115 ALA D C     1 
ATOM   3686 O O     . ALA F 6 114 ? 0.620   -5.827  -6.795  1.00 14.66 ? 115 ALA D O     1 
ATOM   3687 C CB    . ALA F 6 114 ? 1.525   -7.589  -4.452  1.00 13.74 ? 115 ALA D CB    1 
ATOM   3688 N N     . CYS F 6 115 ? -0.786  -7.593  -6.904  1.00 15.32 ? 116 CYS D N     1 
ATOM   3689 C CA    . CYS F 6 115 ? -1.881  -6.839  -7.515  1.00 17.00 ? 116 CYS D CA    1 
ATOM   3690 C C     . CYS F 6 115 ? -2.868  -6.418  -6.418  1.00 16.97 ? 116 CYS D C     1 
ATOM   3691 O O     . CYS F 6 115 ? -3.002  -7.090  -5.398  1.00 16.93 ? 116 CYS D O     1 
ATOM   3692 C CB    . CYS F 6 115 ? -2.584  -7.702  -8.581  1.00 18.17 ? 116 CYS D CB    1 
ATOM   3693 S SG    . CYS F 6 115 ? -1.584  -8.048  -10.059 1.00 19.49 ? 116 CYS D SG    1 
ATOM   3694 N N     . ASN F 6 116 ? -3.545  -5.288  -6.617  1.00 19.48 ? 117 ASN D N     1 
ATOM   3695 C CA    . ASN F 6 116 ? -4.498  -4.767  -5.634  1.00 19.86 ? 117 ASN D CA    1 
ATOM   3696 C C     . ASN F 6 116 ? -5.596  -5.787  -5.333  1.00 20.62 ? 117 ASN D C     1 
ATOM   3697 O O     . ASN F 6 116 ? -6.267  -6.256  -6.248  1.00 23.19 ? 117 ASN D O     1 
ATOM   3698 C CB    . ASN F 6 116 ? -5.144  -3.486  -6.175  1.00 21.85 ? 117 ASN D CB    1 
ATOM   3699 C CG    . ASN F 6 116 ? -5.792  -2.655  -5.086  1.00 21.69 ? 117 ASN D CG    1 
ATOM   3700 O OD1   . ASN F 6 116 ? -6.253  -3.187  -4.072  1.00 22.02 ? 117 ASN D OD1   1 
ATOM   3701 N ND2   . ASN F 6 116 ? -5.842  -1.343  -5.296  1.00 23.10 ? 117 ASN D ND2   1 
ATOM   3702 N N     . SER F 6 117 ? -5.795  -6.125  -4.064  1.00 21.78 ? 118 SER D N     1 
ATOM   3703 C CA    . SER F 6 117 ? -6.837  -7.094  -3.724  1.00 25.09 ? 118 SER D CA    1 
ATOM   3704 C C     . SER F 6 117 ? -8.208  -6.533  -4.123  1.00 28.83 ? 118 SER D C     1 
ATOM   3705 O O     . SER F 6 117 ? -9.160  -7.284  -4.355  1.00 28.08 ? 118 SER D O     1 
ATOM   3706 C CB    . SER F 6 117 ? -6.790  -7.438  -2.236  1.00 22.48 ? 118 SER D CB    1 
ATOM   3707 O OG    . SER F 6 117 ? -6.957  -6.290  -1.419  1.00 25.51 ? 118 SER D OG    1 
ATOM   3708 N N     . LYS F 6 118 ? -8.286  -5.209  -4.213  1.00 30.53 ? 119 LYS D N     1 
ATOM   3709 C CA    . LYS F 6 118 ? -9.500  -4.518  -4.634  1.00 37.28 ? 119 LYS D CA    1 
ATOM   3710 C C     . LYS F 6 118 ? -9.302  -4.255  -6.132  1.00 38.77 ? 119 LYS D C     1 
ATOM   3711 O O     . LYS F 6 118 ? -8.568  -3.347  -6.527  1.00 39.09 ? 119 LYS D O     1 
ATOM   3712 C CB    . LYS F 6 118 ? -9.646  -3.206  -3.854  1.00 39.94 ? 119 LYS D CB    1 
ATOM   3713 C CG    . LYS F 6 118 ? -9.750  -3.418  -2.342  1.00 44.98 ? 119 LYS D CG    1 
ATOM   3714 C CD    . LYS F 6 118 ? -9.928  -2.108  -1.585  1.00 49.59 ? 119 LYS D CD    1 
ATOM   3715 C CE    . LYS F 6 118 ? -8.653  -1.280  -1.585  1.00 52.55 ? 119 LYS D CE    1 
ATOM   3716 N NZ    . LYS F 6 118 ? -8.902  0.135   -1.186  1.00 53.90 ? 119 LYS D NZ    1 
ATOM   3717 N N     . LYS F 6 119 ? -9.951  -5.068  -6.960  1.00 40.81 ? 120 LYS D N     1 
ATOM   3718 C CA    . LYS F 6 119 ? -9.814  -4.969  -8.411  1.00 42.45 ? 120 LYS D CA    1 
ATOM   3719 C C     . LYS F 6 119 ? -10.667 -3.900  -9.087  1.00 43.93 ? 120 LYS D C     1 
ATOM   3720 O O     . LYS F 6 119 ? -11.762 -3.580  -8.630  1.00 44.47 ? 120 LYS D O     1 
ATOM   3721 C CB    . LYS F 6 119 ? -10.101 -6.333  -9.045  1.00 42.98 ? 120 LYS D CB    1 
ATOM   3722 N N     . SER F 6 120 ? -10.147 -3.362  -10.189 1.00 45.28 ? 121 SER D N     1 
ATOM   3723 C CA    . SER F 6 120 ? -10.837 -2.339  -10.972 1.00 46.88 ? 121 SER D CA    1 
ATOM   3724 C C     . SER F 6 120 ? -10.994 -2.791  -12.424 1.00 47.76 ? 121 SER D C     1 
ATOM   3725 O O     . SER F 6 120 ? -11.349 -1.947  -13.277 1.00 48.96 ? 121 SER D O     1 
ATOM   3726 C CB    . SER F 6 120 ? -10.057 -1.019  -10.930 1.00 47.31 ? 121 SER D CB    1 
ATOM   3727 O OG    . SER F 6 120 ? -10.167 -0.398  -9.659  1.00 47.60 ? 121 SER D OG    1 
HETATM 3728 O O     . HOH G 7 .   ? 1.524   24.383  -8.484  1.00 19.88 ? 33  HOH E O     1 
HETATM 3729 O O     . HOH G 7 .   ? 8.753   26.504  -10.568 1.00 23.36 ? 46  HOH E O     1 
HETATM 3730 O O     . HOH G 7 .   ? 4.159   16.874  9.749   1.00 26.56 ? 55  HOH E O     1 
HETATM 3731 O O     . HOH G 7 .   ? -0.313  17.661  -13.404 1.00 28.01 ? 66  HOH E O     1 
HETATM 3732 O O     . HOH G 7 .   ? 4.802   24.742  -14.127 1.00 21.93 ? 67  HOH E O     1 
HETATM 3733 O O     . HOH G 7 .   ? 2.771   20.300  6.719   1.00 31.30 ? 77  HOH E O     1 
HETATM 3734 O O     . HOH G 7 .   ? 2.345   26.272  -6.781  1.00 28.67 ? 89  HOH E O     1 
HETATM 3735 O O     . HOH G 7 .   ? 2.600   22.928  3.918   1.00 26.51 ? 104 HOH E O     1 
HETATM 3736 O O     . HOH G 7 .   ? 5.087   26.143  -11.198 1.00 33.22 ? 116 HOH E O     1 
HETATM 3737 O O     . HOH G 7 .   ? 2.400   13.576  12.335  1.00 37.33 ? 152 HOH E O     1 
HETATM 3738 O O     . HOH G 7 .   ? -4.249  14.821  18.998  1.00 40.01 ? 155 HOH E O     1 
HETATM 3739 O O     . HOH G 7 .   ? 1.461   25.203  -4.089  1.00 37.16 ? 161 HOH E O     1 
HETATM 3740 O O     . HOH G 7 .   ? 6.275   30.853  -4.742  1.00 40.72 ? 164 HOH E O     1 
HETATM 3741 O O     . HOH G 7 .   ? 8.545   29.313  -8.088  1.00 49.26 ? 165 HOH E O     1 
HETATM 3742 O O     . HOH G 7 .   ? 3.097   27.337  -2.451  1.00 43.19 ? 168 HOH E O     1 
HETATM 3743 O O     . HOH G 7 .   ? -5.738  24.601  15.648  1.00 46.21 ? 175 HOH E O     1 
HETATM 3744 O O     . HOH G 7 .   ? 0.823   27.641  14.154  1.00 50.24 ? 186 HOH E O     1 
HETATM 3745 O O     . HOH G 7 .   ? 2.880   22.878  6.749   1.00 30.05 ? 218 HOH E O     1 
HETATM 3746 O O     . HOH G 7 .   ? 3.847   27.250  0.951   1.00 34.52 ? 245 HOH E O     1 
HETATM 3747 O O     . HOH G 7 .   ? 3.006   26.245  5.679   1.00 41.55 ? 246 HOH E O     1 
HETATM 3748 O O     . HOH G 7 .   ? 0.798   27.792  9.941   1.00 36.97 ? 260 HOH E O     1 
HETATM 3749 O O     . HOH G 7 .   ? 1.470   22.315  -14.457 1.00 42.47 ? 277 HOH E O     1 
HETATM 3750 O O     . HOH G 7 .   ? 1.774   16.769  11.063  1.00 46.97 ? 289 HOH E O     1 
HETATM 3751 O O     . HOH G 7 .   ? 8.902   31.293  -0.861  1.00 46.24 ? 294 HOH E O     1 
HETATM 3752 O O     . HOH G 7 .   ? -7.053  21.961  15.451  1.00 37.10 ? 296 HOH E O     1 
HETATM 3753 O O     . HOH G 7 .   ? 3.251   10.941  14.833  1.00 50.46 ? 300 HOH E O     1 
HETATM 3754 O O     . HOH G 7 .   ? 4.413   29.488  -5.959  1.00 41.40 ? 304 HOH E O     1 
HETATM 3755 O O     . HOH G 7 .   ? 8.486   32.973  1.100   1.00 56.29 ? 308 HOH E O     1 
HETATM 3756 O O     . HOH G 7 .   ? 3.304   5.721   23.475  1.00 54.67 ? 310 HOH E O     1 
HETATM 3757 O O     . HOH G 7 .   ? 1.008   24.253  5.550   1.00 34.62 ? 321 HOH E O     1 
HETATM 3758 O O     . HOH G 7 .   ? -2.288  27.087  13.319  1.00 48.12 ? 332 HOH E O     1 
HETATM 3759 O O     . HOH G 7 .   ? 1.101   11.071  13.160  1.00 47.98 ? 334 HOH E O     1 
HETATM 3760 O O     . HOH G 7 .   ? -2.146  22.345  -12.284 1.00 42.14 ? 338 HOH E O     1 
HETATM 3761 O O     . HOH G 7 .   ? -5.840  20.109  11.465  1.00 47.70 ? 339 HOH E O     1 
HETATM 3762 O O     . HOH G 7 .   ? 7.493   1.024   11.488  1.00 45.94 ? 360 HOH E O     1 
HETATM 3763 O O     . HOH G 7 .   ? -1.650  27.760  9.126   1.00 56.17 ? 361 HOH E O     1 
HETATM 3764 O O     . HOH G 7 .   ? 0.553   9.304   10.783  1.00 48.45 ? 414 HOH E O     1 
HETATM 3765 O O     . HOH G 7 .   ? -6.227  20.141  8.990   1.00 64.48 ? 423 HOH E O     1 
HETATM 3766 O O     . HOH G 7 .   ? -0.829  21.400  10.590  1.00 49.44 ? 425 HOH E O     1 
HETATM 3767 O O     . HOH G 7 .   ? -0.550  19.688  7.885   1.00 44.21 ? 426 HOH E O     1 
HETATM 3768 O O     . HOH G 7 .   ? -1.774  18.977  11.865  1.00 55.20 ? 429 HOH E O     1 
HETATM 3769 O O     . HOH G 7 .   ? 1.622   24.165  9.121   1.00 49.61 ? 440 HOH E O     1 
HETATM 3770 O O     . HOH G 7 .   ? 0.989   25.740  -12.047 1.00 44.89 ? 465 HOH E O     1 
HETATM 3771 O O     . HOH G 7 .   ? 2.865   26.785  -14.267 1.00 51.83 ? 466 HOH E O     1 
HETATM 3772 O O     . HOH G 7 .   ? 3.951   1.450   8.790   1.00 49.96 ? 475 HOH E O     1 
HETATM 3773 O O     . HOH G 7 .   ? 7.042   3.987   14.120  1.00 48.27 ? 476 HOH E O     1 
HETATM 3774 O O     . HOH G 7 .   ? 3.132   5.567   10.736  1.00 53.83 ? 477 HOH E O     1 
HETATM 3775 O O     . HOH H 7 .   ? 11.873  8.880   2.852   1.00 12.32 ? 17  HOH F O     1 
HETATM 3776 O O     . HOH H 7 .   ? 12.432  8.928   5.461   1.00 17.87 ? 18  HOH F O     1 
HETATM 3777 O O     . HOH H 7 .   ? 5.558   7.688   -0.753  1.00 21.27 ? 19  HOH F O     1 
HETATM 3778 O O     . HOH H 7 .   ? 8.062   12.400  5.970   1.00 20.60 ? 20  HOH F O     1 
HETATM 3779 O O     . HOH H 7 .   ? 3.552   12.784  3.484   1.00 23.82 ? 21  HOH F O     1 
HETATM 3780 O O     . HOH H 7 .   ? -8.294  17.614  2.094   1.00 22.57 ? 22  HOH F O     1 
HETATM 3781 O O     . HOH H 7 .   ? 9.197   18.651  26.373  1.00 27.42 ? 23  HOH F O     1 
HETATM 3782 O O     . HOH H 7 .   ? 17.091  12.574  9.782   1.00 18.88 ? 24  HOH F O     1 
HETATM 3783 O O     . HOH H 7 .   ? 10.178  11.589  7.533   1.00 28.20 ? 25  HOH F O     1 
HETATM 3784 O O     . HOH H 7 .   ? 1.804   19.700  4.231   1.00 25.33 ? 26  HOH F O     1 
HETATM 3785 O O     . HOH H 7 .   ? 3.541   17.558  7.026   1.00 19.86 ? 27  HOH F O     1 
HETATM 3786 O O     . HOH H 7 .   ? 12.197  13.835  16.621  1.00 34.48 ? 28  HOH F O     1 
HETATM 3787 O O     . HOH H 7 .   ? 10.573  13.078  10.635  1.00 23.20 ? 29  HOH F O     1 
HETATM 3788 O O     . HOH H 7 .   ? -0.703  16.981  20.679  1.00 32.85 ? 30  HOH F O     1 
HETATM 3789 O O     . HOH H 7 .   ? -6.689  19.431  3.784   1.00 26.97 ? 31  HOH F O     1 
HETATM 3790 O O     . HOH H 7 .   ? 5.231   11.126  4.561   1.00 29.77 ? 32  HOH F O     1 
HETATM 3791 O O     . HOH H 7 .   ? 6.984   11.680  17.769  1.00 37.35 ? 33  HOH F O     1 
HETATM 3792 O O     . HOH H 7 .   ? 8.819   13.804  12.159  1.00 31.40 ? 34  HOH F O     1 
HETATM 3793 O O     . HOH H 7 .   ? 13.915  15.773  25.092  1.00 39.14 ? 35  HOH F O     1 
HETATM 3794 O O     . HOH H 7 .   ? 6.873   13.642  26.425  1.00 41.37 ? 36  HOH F O     1 
HETATM 3795 O O     . HOH H 7 .   ? 10.062  13.702  20.453  1.00 38.74 ? 37  HOH F O     1 
HETATM 3796 O O     . HOH H 7 .   ? 16.480  11.546  14.061  1.00 39.27 ? 38  HOH F O     1 
HETATM 3797 O O     . HOH H 7 .   ? 1.246   13.407  4.787   1.00 33.50 ? 39  HOH F O     1 
HETATM 3798 O O     . HOH H 7 .   ? 14.848  13.078  24.584  1.00 63.83 ? 40  HOH F O     1 
HETATM 3799 O O     . HOH H 7 .   ? -1.442  20.902  4.203   1.00 45.13 ? 41  HOH F O     1 
HETATM 3800 O O     . HOH H 7 .   ? 3.090   8.912   21.687  1.00 55.70 ? 42  HOH F O     1 
HETATM 3801 O O     . HOH H 7 .   ? 5.118   10.104  18.640  1.00 43.45 ? 43  HOH F O     1 
HETATM 3802 O O     . HOH H 7 .   ? 16.557  12.715  16.367  1.00 42.27 ? 44  HOH F O     1 
HETATM 3803 O O     . HOH H 7 .   ? 5.814   11.898  7.383   1.00 25.57 ? 45  HOH F O     1 
HETATM 3804 O O     . HOH H 7 .   ? 1.895   15.460  6.722   1.00 35.26 ? 46  HOH F O     1 
HETATM 3805 O O     . HOH H 7 .   ? 12.018  12.195  14.193  1.00 31.11 ? 47  HOH F O     1 
HETATM 3806 O O     . HOH H 7 .   ? 9.308   10.968  9.763   1.00 39.19 ? 48  HOH F O     1 
HETATM 3807 O O     . HOH H 7 .   ? -6.280  18.913  6.153   1.00 36.39 ? 49  HOH F O     1 
HETATM 3808 O O     . HOH H 7 .   ? 9.389   11.241  13.758  1.00 31.89 ? 50  HOH F O     1 
HETATM 3809 O O     . HOH H 7 .   ? 4.552   19.759  28.075  1.00 35.78 ? 51  HOH F O     1 
HETATM 3810 O O     . HOH H 7 .   ? -1.324  16.526  5.136   1.00 50.73 ? 52  HOH F O     1 
HETATM 3811 O O     . HOH H 7 .   ? 11.677  12.505  18.763  1.00 38.26 ? 53  HOH F O     1 
HETATM 3812 O O     . HOH H 7 .   ? 4.055   8.014   2.335   1.00 36.68 ? 54  HOH F O     1 
HETATM 3813 O O     . HOH H 7 .   ? 14.195  14.236  21.518  1.00 50.24 ? 55  HOH F O     1 
HETATM 3814 O O     . HOH H 7 .   ? 9.985   17.935  29.109  1.00 45.56 ? 56  HOH F O     1 
HETATM 3815 O O     . HOH H 7 .   ? 6.174   13.277  12.229  1.00 44.04 ? 57  HOH F O     1 
HETATM 3816 O O     . HOH H 7 .   ? 4.597   14.301  10.669  1.00 34.58 ? 58  HOH F O     1 
HETATM 3817 O O     . HOH H 7 .   ? 8.846   11.516  21.728  1.00 49.57 ? 59  HOH F O     1 
HETATM 3818 O O     . HOH H 7 .   ? 10.696  15.667  25.869  1.00 41.50 ? 60  HOH F O     1 
HETATM 3819 O O     . HOH H 7 .   ? 5.410   12.337  14.487  1.00 41.25 ? 61  HOH F O     1 
HETATM 3820 O O     . HOH H 7 .   ? -2.720  1.797   25.517  1.00 47.70 ? 62  HOH F O     1 
HETATM 3821 O O     . HOH H 7 .   ? -0.207  9.656   2.319   1.00 50.00 ? 63  HOH F O     1 
HETATM 3822 O O     . HOH H 7 .   ? 4.390   12.898  29.050  1.00 68.06 ? 64  HOH F O     1 
HETATM 3823 O O     . HOH H 7 .   ? 7.510   16.956  29.675  1.00 59.60 ? 65  HOH F O     1 
HETATM 3824 O O     . HOH H 7 .   ? 1.163   9.108   -2.072  1.00 31.35 ? 66  HOH F O     1 
HETATM 3825 O O     . HOH H 7 .   ? -0.793  9.084   -0.603  1.00 35.61 ? 67  HOH F O     1 
HETATM 3826 O O     . HOH H 7 .   ? 4.053   13.366  8.361   1.00 34.98 ? 68  HOH F O     1 
HETATM 3827 O O     . HOH H 7 .   ? 0.472   21.871  2.298   1.00 52.28 ? 69  HOH F O     1 
HETATM 3828 O O     . HOH H 7 .   ? -3.318  5.006   25.080  1.00 49.32 ? 70  HOH F O     1 
HETATM 3829 O O     . HOH H 7 .   ? 2.021   18.606  28.391  1.00 57.50 ? 71  HOH F O     1 
HETATM 3830 O O     . HOH H 7 .   ? 1.470   7.397   24.720  1.00 53.42 ? 72  HOH F O     1 
HETATM 3831 O O     . HOH H 7 .   ? 9.051   8.947   11.749  1.00 45.22 ? 73  HOH F O     1 
HETATM 3832 O O     . HOH H 7 .   ? 1.230   10.989  6.193   1.00 49.21 ? 74  HOH F O     1 
HETATM 3833 O O     . HOH H 7 .   ? 6.470   10.903  10.125  1.00 57.13 ? 75  HOH F O     1 
HETATM 3834 O O     . HOH H 7 .   ? 8.154   10.298  15.903  1.00 47.20 ? 76  HOH F O     1 
HETATM 3835 O O     . HOH I 7 .   ? 24.618  23.533  11.070  1.00 14.45 ? 241 HOH A O     1 
HETATM 3836 O O     . HOH I 7 .   ? 13.860  10.292  1.597   1.00 14.07 ? 242 HOH A O     1 
HETATM 3837 O O     . HOH I 7 .   ? 1.602   9.420   -7.233  1.00 11.34 ? 243 HOH A O     1 
HETATM 3838 O O     . HOH I 7 .   ? 15.367  8.251   0.469   1.00 14.95 ? 244 HOH A O     1 
HETATM 3839 O O     . HOH I 7 .   ? 22.213  28.279  2.782   1.00 16.72 ? 245 HOH A O     1 
HETATM 3840 O O     . HOH I 7 .   ? 26.558  22.162  1.565   1.00 18.31 ? 246 HOH A O     1 
HETATM 3841 O O     . HOH I 7 .   ? 12.965  26.472  -8.992  1.00 16.65 ? 247 HOH A O     1 
HETATM 3842 O O     . HOH I 7 .   ? 15.540  11.968  3.083   1.00 15.24 ? 248 HOH A O     1 
HETATM 3843 O O     . HOH I 7 .   ? 16.699  4.978   -6.785  1.00 15.47 ? 249 HOH A O     1 
HETATM 3844 O O     . HOH I 7 .   ? 10.057  1.602   -9.729  1.00 16.39 ? 250 HOH A O     1 
HETATM 3845 O O     . HOH I 7 .   ? -0.476  4.166   -11.761 1.00 15.62 ? 251 HOH A O     1 
HETATM 3846 O O     . HOH I 7 .   ? 24.262  20.896  10.112  1.00 16.53 ? 252 HOH A O     1 
HETATM 3847 O O     . HOH I 7 .   ? 16.538  19.067  -1.196  1.00 14.54 ? 253 HOH A O     1 
HETATM 3848 O O     . HOH I 7 .   ? 27.384  29.916  7.508   1.00 15.54 ? 254 HOH A O     1 
HETATM 3849 O O     . HOH I 7 .   ? 22.581  10.906  2.594   1.00 16.91 ? 255 HOH A O     1 
HETATM 3850 O O     . HOH I 7 .   ? -0.975  12.429  -12.935 1.00 19.49 ? 256 HOH A O     1 
HETATM 3851 O O     . HOH I 7 .   ? 1.763   16.186  -12.675 1.00 19.76 ? 257 HOH A O     1 
HETATM 3852 O O     . HOH I 7 .   ? 9.601   22.874  -9.266  1.00 15.87 ? 258 HOH A O     1 
HETATM 3853 O O     . HOH I 7 .   ? 9.538   22.149  -16.665 1.00 18.95 ? 259 HOH A O     1 
HETATM 3854 O O     . HOH I 7 .   ? 20.424  28.216  0.543   1.00 18.19 ? 260 HOH A O     1 
HETATM 3855 O O     . HOH I 7 .   ? 21.755  15.003  2.827   1.00 18.71 ? 261 HOH A O     1 
HETATM 3856 O O     . HOH I 7 .   ? 26.799  21.259  6.437   1.00 17.72 ? 262 HOH A O     1 
HETATM 3857 O O     . HOH I 7 .   ? 15.719  5.351   -9.543  1.00 20.35 ? 263 HOH A O     1 
HETATM 3858 O O     . HOH I 7 .   ? 1.960   5.370   -4.195  1.00 21.06 ? 264 HOH A O     1 
HETATM 3859 O O     . HOH I 7 .   ? 17.285  13.521  5.975   1.00 19.22 ? 265 HOH A O     1 
HETATM 3860 O O     . HOH I 7 .   ? 0.080   3.470   -4.348  1.00 21.44 ? 266 HOH A O     1 
HETATM 3861 O O     . HOH I 7 .   ? 7.412   1.896   -10.562 1.00 18.65 ? 267 HOH A O     1 
HETATM 3862 O O     . HOH I 7 .   ? 11.060  25.005  -10.507 1.00 16.58 ? 268 HOH A O     1 
HETATM 3863 O O     . HOH I 7 .   ? -8.665  10.671  -6.257  1.00 17.64 ? 269 HOH A O     1 
HETATM 3864 O O     . HOH I 7 .   ? 19.955  13.050  3.265   1.00 22.93 ? 270 HOH A O     1 
HETATM 3865 O O     . HOH I 7 .   ? -4.683  12.911  -10.624 1.00 21.34 ? 271 HOH A O     1 
HETATM 3866 O O     . HOH I 7 .   ? 19.353  4.833   -4.914  1.00 21.19 ? 272 HOH A O     1 
HETATM 3867 O O     . HOH I 7 .   ? 19.003  28.413  -3.699  1.00 22.81 ? 273 HOH A O     1 
HETATM 3868 O O     . HOH I 7 .   ? 19.709  35.949  8.619   1.00 22.08 ? 274 HOH A O     1 
HETATM 3869 O O     . HOH I 7 .   ? 6.781   20.911  25.027  1.00 23.34 ? 275 HOH A O     1 
HETATM 3870 O O     . HOH I 7 .   ? 10.814  29.782  -6.811  1.00 28.05 ? 276 HOH A O     1 
HETATM 3871 O O     . HOH I 7 .   ? -4.372  4.222   -8.935  1.00 22.74 ? 277 HOH A O     1 
HETATM 3872 O O     . HOH I 7 .   ? 24.513  19.946  7.222   1.00 21.51 ? 278 HOH A O     1 
HETATM 3873 O O     . HOH I 7 .   ? 23.612  24.020  -3.507  1.00 25.70 ? 279 HOH A O     1 
HETATM 3874 O O     . HOH I 7 .   ? 23.854  40.589  10.930  1.00 25.54 ? 280 HOH A O     1 
HETATM 3875 O O     . HOH I 7 .   ? -4.715  3.053   -5.056  1.00 28.86 ? 281 HOH A O     1 
HETATM 3876 O O     . HOH I 7 .   ? 24.680  12.364  1.858   1.00 28.03 ? 282 HOH A O     1 
HETATM 3877 O O     . HOH I 7 .   ? 7.955   34.479  11.428  1.00 28.39 ? 283 HOH A O     1 
HETATM 3878 O O     . HOH I 7 .   ? 23.995  30.510  2.539   1.00 23.59 ? 284 HOH A O     1 
HETATM 3879 O O     . HOH I 7 .   ? 21.759  6.569   -4.652  1.00 24.36 ? 285 HOH A O     1 
HETATM 3880 O O     . HOH I 7 .   ? 0.770   24.879  21.127  1.00 22.17 ? 286 HOH A O     1 
HETATM 3881 O O     . HOH I 7 .   ? 18.796  36.452  4.911   1.00 32.13 ? 287 HOH A O     1 
HETATM 3882 O O     . HOH I 7 .   ? 22.003  20.796  19.781  1.00 28.21 ? 288 HOH A O     1 
HETATM 3883 O O     . HOH I 7 .   ? 7.541   28.130  -14.688 1.00 37.20 ? 289 HOH A O     1 
HETATM 3884 O O     . HOH I 7 .   ? 1.800   11.964  -17.437 1.00 24.43 ? 290 HOH A O     1 
HETATM 3885 O O     . HOH I 7 .   ? 22.995  21.418  17.274  1.00 26.64 ? 291 HOH A O     1 
HETATM 3886 O O     . HOH I 7 .   ? 25.447  20.153  14.346  1.00 28.78 ? 292 HOH A O     1 
HETATM 3887 O O     . HOH I 7 .   ? -2.390  9.059   -15.568 1.00 32.07 ? 293 HOH A O     1 
HETATM 3888 O O     . HOH I 7 .   ? 1.374   9.198   -17.701 1.00 29.52 ? 294 HOH A O     1 
HETATM 3889 O O     . HOH I 7 .   ? 3.695   22.003  26.688  1.00 29.43 ? 295 HOH A O     1 
HETATM 3890 O O     . HOH I 7 .   ? 26.207  22.504  14.865  1.00 35.95 ? 296 HOH A O     1 
HETATM 3891 O O     . HOH I 7 .   ? 10.512  30.959  -3.691  1.00 29.67 ? 297 HOH A O     1 
HETATM 3892 O O     . HOH I 7 .   ? 31.642  21.837  -1.176  1.00 34.21 ? 298 HOH A O     1 
HETATM 3893 O O     . HOH I 7 .   ? 17.018  18.970  26.304  1.00 30.06 ? 299 HOH A O     1 
HETATM 3894 O O     . HOH I 7 .   ? 23.415  29.985  16.027  1.00 26.46 ? 300 HOH A O     1 
HETATM 3895 O O     . HOH I 7 .   ? 24.554  36.594  14.177  1.00 31.85 ? 301 HOH A O     1 
HETATM 3896 O O     . HOH I 7 .   ? 20.103  25.743  -11.896 1.00 29.61 ? 302 HOH A O     1 
HETATM 3897 O O     . HOH I 7 .   ? 27.271  17.963  2.567   1.00 31.47 ? 303 HOH A O     1 
HETATM 3898 O O     . HOH I 7 .   ? 17.928  18.400  17.822  1.00 34.48 ? 304 HOH A O     1 
HETATM 3899 O O     . HOH I 7 .   ? 1.416   30.997  15.079  1.00 46.96 ? 305 HOH A O     1 
HETATM 3900 O O     . HOH I 7 .   ? 17.777  0.460   -5.724  1.00 27.53 ? 306 HOH A O     1 
HETATM 3901 O O     . HOH I 7 .   ? 1.714   18.841  -14.442 1.00 30.60 ? 307 HOH A O     1 
HETATM 3902 O O     . HOH I 7 .   ? 22.847  25.760  27.321  1.00 43.50 ? 308 HOH A O     1 
HETATM 3903 O O     . HOH I 7 .   ? 23.434  18.060  -13.730 1.00 49.08 ? 309 HOH A O     1 
HETATM 3904 O O     . HOH I 7 .   ? 11.739  27.809  -13.726 1.00 30.30 ? 310 HOH A O     1 
HETATM 3905 O O     . HOH I 7 .   ? 24.771  15.679  -13.512 1.00 43.70 ? 311 HOH A O     1 
HETATM 3906 O O     . HOH I 7 .   ? 10.065  38.837  16.385  1.00 42.61 ? 312 HOH A O     1 
HETATM 3907 O O     . HOH I 7 .   ? 27.720  22.374  8.776   1.00 31.24 ? 313 HOH A O     1 
HETATM 3908 O O     . HOH I 7 .   ? 14.822  36.511  6.941   1.00 32.61 ? 314 HOH A O     1 
HETATM 3909 O O     . HOH I 7 .   ? -0.371  16.274  -17.912 1.00 44.28 ? 315 HOH A O     1 
HETATM 3910 O O     . HOH I 7 .   ? 29.580  18.229  0.642   1.00 36.33 ? 316 HOH A O     1 
HETATM 3911 O O     . HOH I 7 .   ? 20.212  28.612  -6.348  1.00 50.25 ? 317 HOH A O     1 
HETATM 3912 O O     . HOH I 7 .   ? 18.635  16.887  -22.079 1.00 41.03 ? 318 HOH A O     1 
HETATM 3913 O O     . HOH I 7 .   ? -3.953  17.186  20.189  1.00 34.47 ? 319 HOH A O     1 
HETATM 3914 O O     . HOH I 7 .   ? 13.576  -2.217  -9.801  1.00 45.91 ? 320 HOH A O     1 
HETATM 3915 O O     . HOH I 7 .   ? 21.111  22.252  -17.698 1.00 36.50 ? 321 HOH A O     1 
HETATM 3916 O O     . HOH I 7 .   ? 11.579  37.986  18.659  1.00 39.03 ? 322 HOH A O     1 
HETATM 3917 O O     . HOH I 7 .   ? 1.228   8.036   -4.756  1.00 19.25 ? 323 HOH A O     1 
HETATM 3918 O O     . HOH I 7 .   ? 14.787  7.511   5.375   1.00 19.86 ? 324 HOH A O     1 
HETATM 3919 O O     . HOH I 7 .   ? 26.433  24.194  -2.388  1.00 30.52 ? 325 HOH A O     1 
HETATM 3920 O O     . HOH I 7 .   ? 17.157  30.008  -1.412  1.00 24.01 ? 326 HOH A O     1 
HETATM 3921 O O     . HOH I 7 .   ? 22.892  17.574  9.441   1.00 30.68 ? 327 HOH A O     1 
HETATM 3922 O O     . HOH I 7 .   ? 12.394  29.031  -9.170  1.00 22.87 ? 328 HOH A O     1 
HETATM 3923 O O     . HOH I 7 .   ? 2.987   32.221  16.903  1.00 37.66 ? 329 HOH A O     1 
HETATM 3924 O O     . HOH I 7 .   ? 9.052   15.875  -23.311 1.00 28.53 ? 330 HOH A O     1 
HETATM 3925 O O     . HOH I 7 .   ? 6.418   36.726  10.994  1.00 35.62 ? 331 HOH A O     1 
HETATM 3926 O O     . HOH I 7 .   ? 10.408  28.894  -11.363 1.00 37.14 ? 332 HOH A O     1 
HETATM 3927 O O     . HOH I 7 .   ? 25.814  19.314  11.400  1.00 33.15 ? 333 HOH A O     1 
HETATM 3928 O O     . HOH I 7 .   ? 6.324   22.747  -18.489 1.00 33.84 ? 334 HOH A O     1 
HETATM 3929 O O     . HOH I 7 .   ? 20.212  37.183  15.479  1.00 29.94 ? 335 HOH A O     1 
HETATM 3930 O O     . HOH I 7 .   ? 8.962   24.695  -17.757 1.00 34.43 ? 336 HOH A O     1 
HETATM 3931 O O     . HOH I 7 .   ? 0.182   14.453  -14.242 1.00 31.94 ? 337 HOH A O     1 
HETATM 3932 O O     . HOH I 7 .   ? 19.351  12.104  5.545   1.00 35.44 ? 338 HOH A O     1 
HETATM 3933 O O     . HOH I 7 .   ? 29.714  21.711  1.767   1.00 41.74 ? 339 HOH A O     1 
HETATM 3934 O O     . HOH I 7 .   ? 20.053  5.642   2.469   1.00 31.60 ? 340 HOH A O     1 
HETATM 3935 O O     . HOH I 7 .   ? 22.752  34.666  21.551  1.00 34.25 ? 341 HOH A O     1 
HETATM 3936 O O     . HOH I 7 .   ? 11.381  29.499  3.137   1.00 39.56 ? 342 HOH A O     1 
HETATM 3937 O O     . HOH I 7 .   ? 26.203  19.617  -7.690  1.00 40.90 ? 343 HOH A O     1 
HETATM 3938 O O     . HOH I 7 .   ? -3.844  12.831  -13.097 1.00 30.16 ? 344 HOH A O     1 
HETATM 3939 O O     . HOH I 7 .   ? 11.478  14.970  -23.890 1.00 39.10 ? 345 HOH A O     1 
HETATM 3940 O O     . HOH I 7 .   ? 17.711  37.459  7.576   1.00 31.27 ? 346 HOH A O     1 
HETATM 3941 O O     . HOH I 7 .   ? -1.975  2.864   -17.390 1.00 36.16 ? 347 HOH A O     1 
HETATM 3942 O O     . HOH I 7 .   ? 17.088  38.594  21.314  1.00 41.73 ? 348 HOH A O     1 
HETATM 3943 O O     . HOH I 7 .   ? 28.252  19.908  4.674   1.00 44.20 ? 349 HOH A O     1 
HETATM 3944 O O     . HOH I 7 .   ? 21.565  16.530  -14.198 1.00 39.63 ? 350 HOH A O     1 
HETATM 3945 O O     . HOH I 7 .   ? 6.799   24.779  31.019  1.00 43.97 ? 351 HOH A O     1 
HETATM 3946 O O     . HOH I 7 .   ? 16.160  10.721  8.069   1.00 37.65 ? 352 HOH A O     1 
HETATM 3947 O O     . HOH I 7 .   ? 18.569  32.194  -0.628  1.00 47.70 ? 353 HOH A O     1 
HETATM 3948 O O     . HOH I 7 .   ? 19.196  27.894  -14.485 1.00 40.79 ? 354 HOH A O     1 
HETATM 3949 O O     . HOH I 7 .   ? -0.002  13.436  -16.540 1.00 38.55 ? 355 HOH A O     1 
HETATM 3950 O O     . HOH I 7 .   ? 18.848  37.275  28.123  1.00 93.44 ? 356 HOH A O     1 
HETATM 3951 O O     . HOH I 7 .   ? -4.074  16.853  22.907  1.00 41.59 ? 357 HOH A O     1 
HETATM 3952 O O     . HOH I 7 .   ? 5.404   37.371  13.967  1.00 42.03 ? 358 HOH A O     1 
HETATM 3953 O O     . HOH I 7 .   ? 19.522  17.007  26.247  1.00 37.96 ? 359 HOH A O     1 
HETATM 3954 O O     . HOH I 7 .   ? 26.482  19.872  -4.882  1.00 29.86 ? 360 HOH A O     1 
HETATM 3955 O O     . HOH I 7 .   ? 9.628   31.756  7.632   1.00 33.21 ? 361 HOH A O     1 
HETATM 3956 O O     . HOH I 7 .   ? 17.118  29.681  -9.056  1.00 35.83 ? 362 HOH A O     1 
HETATM 3957 O O     . HOH I 7 .   ? 12.741  39.627  15.149  1.00 42.05 ? 363 HOH A O     1 
HETATM 3958 O O     . HOH I 7 .   ? 26.924  33.380  17.361  1.00 46.59 ? 364 HOH A O     1 
HETATM 3959 O O     . HOH I 7 .   ? 28.548  18.271  9.373   1.00 63.08 ? 365 HOH A O     1 
HETATM 3960 O O     . HOH I 7 .   ? 3.890   4.463   -20.605 1.00 53.88 ? 366 HOH A O     1 
HETATM 3961 O O     . HOH I 7 .   ? 16.111  -4.492  -14.003 1.00 55.84 ? 367 HOH A O     1 
HETATM 3962 O O     . HOH I 7 .   ? 19.659  39.139  11.125  1.00 36.15 ? 368 HOH A O     1 
HETATM 3963 O O     . HOH I 7 .   ? -5.385  5.005   -3.295  1.00 43.59 ? 369 HOH A O     1 
HETATM 3964 O O     . HOH I 7 .   ? 25.038  17.291  7.873   1.00 41.70 ? 370 HOH A O     1 
HETATM 3965 O O     . HOH I 7 .   ? 21.032  37.740  20.596  1.00 54.15 ? 371 HOH A O     1 
HETATM 3966 O O     . HOH I 7 .   ? -4.147  24.240  25.404  1.00 41.58 ? 372 HOH A O     1 
HETATM 3967 O O     . HOH I 7 .   ? -1.397  31.273  22.663  1.00 36.53 ? 373 HOH A O     1 
HETATM 3968 O O     . HOH I 7 .   ? 16.959  19.922  -25.363 1.00 40.60 ? 374 HOH A O     1 
HETATM 3969 O O     . HOH I 7 .   ? 1.962   6.384   -20.949 1.00 46.28 ? 375 HOH A O     1 
HETATM 3970 O O     . HOH I 7 .   ? 10.427  21.779  -23.551 1.00 43.90 ? 376 HOH A O     1 
HETATM 3971 O O     . HOH I 7 .   ? 16.208  19.969  29.654  1.00 50.22 ? 377 HOH A O     1 
HETATM 3972 O O     . HOH I 7 .   ? 24.570  14.337  -8.765  1.00 33.85 ? 378 HOH A O     1 
HETATM 3973 O O     . HOH I 7 .   ? 26.610  23.151  18.610  1.00 40.72 ? 379 HOH A O     1 
HETATM 3974 O O     . HOH I 7 .   ? 25.979  15.860  3.977   1.00 59.85 ? 380 HOH A O     1 
HETATM 3975 O O     . HOH I 7 .   ? 23.514  21.551  22.766  1.00 53.89 ? 381 HOH A O     1 
HETATM 3976 O O     . HOH I 7 .   ? 24.222  24.915  29.705  1.00 73.55 ? 382 HOH A O     1 
HETATM 3977 O O     . HOH I 7 .   ? 14.772  20.447  -23.301 1.00 41.58 ? 383 HOH A O     1 
HETATM 3978 O O     . HOH I 7 .   ? 27.060  16.101  -12.579 1.00 48.69 ? 384 HOH A O     1 
HETATM 3979 O O     . HOH I 7 .   ? 7.291   32.978  8.941   1.00 43.82 ? 385 HOH A O     1 
HETATM 3980 O O     . HOH I 7 .   ? 12.623  38.552  26.562  1.00 60.04 ? 386 HOH A O     1 
HETATM 3981 O O     . HOH I 7 .   ? -4.353  12.510  -1.848  1.00 34.05 ? 387 HOH A O     1 
HETATM 3982 O O     . HOH I 7 .   ? 5.654   36.385  31.446  1.00 46.39 ? 388 HOH A O     1 
HETATM 3983 O O     . HOH I 7 .   ? 19.776  21.355  32.537  1.00 48.78 ? 389 HOH A O     1 
HETATM 3984 O O     . HOH I 7 .   ? 24.895  41.196  13.319  1.00 43.68 ? 390 HOH A O     1 
HETATM 3985 O O     . HOH I 7 .   ? 25.290  8.175   -8.452  1.00 49.22 ? 391 HOH A O     1 
HETATM 3986 O O     . HOH I 7 .   ? 17.413  12.424  -23.014 1.00 42.92 ? 392 HOH A O     1 
HETATM 3987 O O     . HOH I 7 .   ? 2.266   34.941  16.451  1.00 40.84 ? 393 HOH A O     1 
HETATM 3988 O O     . HOH I 7 .   ? 20.478  18.791  18.632  1.00 63.31 ? 394 HOH A O     1 
HETATM 3989 O O     . HOH I 7 .   ? 21.812  17.772  16.624  1.00 40.74 ? 395 HOH A O     1 
HETATM 3990 O O     . HOH I 7 .   ? 20.283  15.867  15.179  1.00 41.84 ? 396 HOH A O     1 
HETATM 3991 O O     . HOH I 7 .   ? 20.573  27.893  -8.852  1.00 39.98 ? 397 HOH A O     1 
HETATM 3992 O O     . HOH I 7 .   ? 11.462  -4.026  -10.385 1.00 50.84 ? 398 HOH A O     1 
HETATM 3993 O O     . HOH I 7 .   ? -1.111  3.691   -21.126 1.00 50.73 ? 399 HOH A O     1 
HETATM 3994 O O     . HOH I 7 .   ? 2.850   36.473  14.622  1.00 44.46 ? 400 HOH A O     1 
HETATM 3995 O O     . HOH I 7 .   ? 23.603  25.857  33.519  1.00 60.06 ? 401 HOH A O     1 
HETATM 3996 O O     . HOH I 7 .   ? 16.808  32.569  34.283  1.00 59.53 ? 402 HOH A O     1 
HETATM 3997 O O     . HOH I 7 .   ? 29.140  23.989  19.126  1.00 51.20 ? 403 HOH A O     1 
HETATM 3998 O O     . HOH I 7 .   ? 16.195  6.416   7.214   1.00 26.32 ? 404 HOH A O     1 
HETATM 3999 O O     . HOH I 7 .   ? 14.504  30.561  -9.422  1.00 37.74 ? 405 HOH A O     1 
HETATM 4000 O O     . HOH I 7 .   ? 17.982  4.925   5.932   1.00 30.75 ? 406 HOH A O     1 
HETATM 4001 O O     . HOH I 7 .   ? 23.468  4.619   -4.026  1.00 34.00 ? 407 HOH A O     1 
HETATM 4002 O O     . HOH I 7 .   ? -3.002  15.743  -14.113 1.00 42.84 ? 408 HOH A O     1 
HETATM 4003 O O     . HOH I 7 .   ? 14.015  33.997  6.674   1.00 41.57 ? 409 HOH A O     1 
HETATM 4004 O O     . HOH I 7 .   ? 17.907  34.435  0.571   1.00 74.99 ? 410 HOH A O     1 
HETATM 4005 O O     . HOH I 7 .   ? -1.306  17.919  23.149  1.00 38.02 ? 411 HOH A O     1 
HETATM 4006 O O     . HOH I 7 .   ? 8.404   -1.521  -15.740 1.00 41.96 ? 412 HOH A O     1 
HETATM 4007 O O     . HOH I 7 .   ? 22.140  15.174  11.077  1.00 55.65 ? 413 HOH A O     1 
HETATM 4008 O O     . HOH I 7 .   ? 19.808  2.329   -4.882  1.00 41.19 ? 414 HOH A O     1 
HETATM 4009 O O     . HOH I 7 .   ? 13.280  4.493   -21.869 1.00 44.35 ? 415 HOH A O     1 
HETATM 4010 O O     . HOH I 7 .   ? 21.130  16.890  22.978  1.00 48.26 ? 416 HOH A O     1 
HETATM 4011 O O     . HOH I 7 .   ? 22.468  22.911  30.378  1.00 47.93 ? 417 HOH A O     1 
HETATM 4012 O O     . HOH I 7 .   ? -6.211  13.556  -0.501  1.00 39.45 ? 418 HOH A O     1 
HETATM 4013 O O     . HOH I 7 .   ? -0.557  26.712  19.185  1.00 41.58 ? 419 HOH A O     1 
HETATM 4014 O O     . HOH I 7 .   ? 26.892  15.923  -9.951  1.00 39.82 ? 420 HOH A O     1 
HETATM 4015 O O     . HOH I 7 .   ? 18.285  18.244  28.758  1.00 54.34 ? 421 HOH A O     1 
HETATM 4016 O O     . HOH I 7 .   ? 20.455  29.844  31.894  1.00 73.52 ? 422 HOH A O     1 
HETATM 4017 O O     . HOH I 7 .   ? 15.624  19.866  18.753  1.00 50.04 ? 423 HOH A O     1 
HETATM 4018 O O     . HOH I 7 .   ? 26.960  13.648  -1.264  1.00 72.76 ? 424 HOH A O     1 
HETATM 4019 O O     . HOH I 7 .   ? 27.476  16.742  -1.190  1.00 40.52 ? 425 HOH A O     1 
HETATM 4020 O O     . HOH I 7 .   ? 12.344  39.545  23.952  1.00 61.29 ? 426 HOH A O     1 
HETATM 4021 O O     . HOH I 7 .   ? 5.171   26.743  31.244  1.00 51.33 ? 427 HOH A O     1 
HETATM 4022 O O     . HOH I 7 .   ? 14.911  23.479  -17.681 1.00 47.50 ? 428 HOH A O     1 
HETATM 4023 O O     . HOH I 7 .   ? 20.163  24.425  -19.914 1.00 37.92 ? 429 HOH A O     1 
HETATM 4024 O O     . HOH I 7 .   ? 14.638  10.412  -26.370 1.00 48.63 ? 430 HOH A O     1 
HETATM 4025 O O     . HOH I 7 .   ? 0.358   35.344  18.710  1.00 49.49 ? 431 HOH A O     1 
HETATM 4026 O O     . HOH I 7 .   ? 21.248  41.686  10.959  1.00 60.03 ? 432 HOH A O     1 
HETATM 4027 O O     . HOH I 7 .   ? 22.100  40.929  14.489  1.00 60.42 ? 433 HOH A O     1 
HETATM 4028 O O     . HOH I 7 .   ? 14.700  34.843  3.446   1.00 42.81 ? 434 HOH A O     1 
HETATM 4029 O O     . HOH I 7 .   ? 15.331  35.227  34.235  1.00 67.51 ? 435 HOH A O     1 
HETATM 4030 O O     . HOH I 7 .   ? 12.017  29.046  37.342  1.00 58.69 ? 436 HOH A O     1 
HETATM 4031 O O     . HOH I 7 .   ? 10.336  35.346  33.738  1.00 59.68 ? 437 HOH A O     1 
HETATM 4032 O O     . HOH I 7 .   ? 26.816  21.729  -9.063  1.00 51.88 ? 438 HOH A O     1 
HETATM 4033 O O     . HOH I 7 .   ? 0.399   37.925  26.059  1.00 54.41 ? 439 HOH A O     1 
HETATM 4034 O O     . HOH I 7 .   ? 3.577   23.374  -18.187 1.00 49.70 ? 440 HOH A O     1 
HETATM 4035 O O     . HOH I 7 .   ? 26.566  29.827  18.245  1.00 49.83 ? 441 HOH A O     1 
HETATM 4036 O O     . HOH I 7 .   ? 5.635   24.849  -16.796 1.00 42.70 ? 442 HOH A O     1 
HETATM 4037 O O     . HOH I 7 .   ? 23.753  8.859   -13.594 1.00 62.40 ? 443 HOH A O     1 
HETATM 4038 O O     . HOH I 7 .   ? 14.721  31.517  -14.890 1.00 64.92 ? 444 HOH A O     1 
HETATM 4039 O O     . HOH I 7 .   ? 8.283   38.164  31.859  1.00 51.08 ? 445 HOH A O     1 
HETATM 4040 O O     . HOH I 7 .   ? 7.156   34.427  34.132  1.00 68.61 ? 446 HOH A O     1 
HETATM 4041 O O     . HOH I 7 .   ? 17.293  24.405  35.278  1.00 49.58 ? 447 HOH A O     1 
HETATM 4042 O O     . HOH I 7 .   ? 24.554  21.340  29.889  1.00 42.69 ? 448 HOH A O     1 
HETATM 4043 O O     . HOH I 7 .   ? -8.545  14.141  1.930   1.00 73.25 ? 449 HOH A O     1 
HETATM 4044 O O     . HOH J 7 .   ? -10.532 -31.365 -3.805  1.00 22.98 ? 55  HOH B O     1 
HETATM 4045 O O     . HOH J 7 .   ? 8.532   -26.836 -21.939 1.00 55.87 ? 56  HOH B O     1 
HETATM 4046 O O     . HOH J 7 .   ? -4.393  -25.739 3.619   1.00 53.52 ? 57  HOH B O     1 
HETATM 4047 O O     . HOH J 7 .   ? 2.491   -24.875 4.821   1.00 43.60 ? 58  HOH B O     1 
HETATM 4048 O O     . HOH J 7 .   ? -8.614  -27.973 -34.134 1.00 39.73 ? 59  HOH B O     1 
HETATM 4049 O O     . HOH J 7 .   ? -10.190 -35.458 -15.680 1.00 41.55 ? 60  HOH B O     1 
HETATM 4050 O O     . HOH J 7 .   ? 3.323   -22.306 -8.779  1.00 32.26 ? 61  HOH B O     1 
HETATM 4051 O O     . HOH J 7 .   ? -15.458 -32.282 -33.562 1.00 42.41 ? 62  HOH B O     1 
HETATM 4052 O O     . HOH J 7 .   ? 8.456   -27.543 -11.632 1.00 49.57 ? 63  HOH B O     1 
HETATM 4053 O O     . HOH J 7 .   ? -16.773 -28.285 -18.541 1.00 48.17 ? 64  HOH B O     1 
HETATM 4054 O O     . HOH J 7 .   ? -14.898 -23.065 -27.109 1.00 40.57 ? 65  HOH B O     1 
HETATM 4055 O O     . HOH J 7 .   ? -11.615 -38.918 -27.026 1.00 43.52 ? 66  HOH B O     1 
HETATM 4056 O O     . HOH J 7 .   ? 0.391   -31.653 -6.906  1.00 46.88 ? 67  HOH B O     1 
HETATM 4057 O O     . HOH J 7 .   ? -12.993 -25.593 -32.922 1.00 47.39 ? 68  HOH B O     1 
HETATM 4058 O O     . HOH J 7 .   ? -9.605  -33.367 -13.988 1.00 41.99 ? 69  HOH B O     1 
HETATM 4059 O O     . HOH J 7 .   ? -10.447 -26.254 -33.144 1.00 36.57 ? 70  HOH B O     1 
HETATM 4060 O O     . HOH J 7 .   ? -0.808  -31.660 -9.829  1.00 60.21 ? 71  HOH B O     1 
HETATM 4061 O O     . HOH J 7 .   ? -19.379 -27.833 -31.743 1.00 96.51 ? 72  HOH B O     1 
HETATM 4062 O O     . HOH J 7 .   ? -16.760 -21.813 -25.299 1.00 59.08 ? 73  HOH B O     1 
HETATM 4063 O O     . HOH J 7 .   ? -14.379 -19.241 -21.455 1.00 66.14 ? 74  HOH B O     1 
HETATM 4064 O O     . HOH J 7 .   ? -17.099 -21.955 -30.156 1.00 94.39 ? 75  HOH B O     1 
HETATM 4065 O O     . HOH J 7 .   ? -13.353 -23.132 -31.976 1.00 43.99 ? 76  HOH B O     1 
HETATM 4066 O O     . HOH J 7 .   ? 1.903   -32.956 -11.157 1.00 78.90 ? 77  HOH B O     1 
HETATM 4067 O O     . HOH J 7 .   ? -15.192 -21.052 -14.652 1.00 56.53 ? 78  HOH B O     1 
HETATM 4068 O O     . HOH J 7 .   ? -15.800 -34.376 -23.235 1.00 56.03 ? 79  HOH B O     1 
HETATM 4069 O O     . HOH K 7 .   ? 5.529   -20.471 -8.377  1.00 20.56 ? 287 HOH C O     1 
HETATM 4070 O O     . HOH K 7 .   ? 12.385  6.128   2.701   1.00 17.91 ? 288 HOH C O     1 
HETATM 4071 O O     . HOH K 7 .   ? 12.064  3.936   0.930   1.00 16.46 ? 289 HOH C O     1 
HETATM 4072 O O     . HOH K 7 .   ? 2.514   4.572   4.827   1.00 21.96 ? 290 HOH C O     1 
HETATM 4073 O O     . HOH K 7 .   ? -3.317  0.869   -4.015  1.00 21.95 ? 291 HOH C O     1 
HETATM 4074 O O     . HOH K 7 .   ? 8.567   8.705   6.718   1.00 24.90 ? 292 HOH C O     1 
HETATM 4075 O O     . HOH K 7 .   ? 5.734   5.386   0.733   1.00 29.74 ? 293 HOH C O     1 
HETATM 4076 O O     . HOH K 7 .   ? 13.037  -6.411  8.370   1.00 44.60 ? 294 HOH C O     1 
HETATM 4077 O O     . HOH K 7 .   ? 5.667   -17.841 -8.092  1.00 29.17 ? 295 HOH C O     1 
HETATM 4078 O O     . HOH K 7 .   ? 14.168  -11.427 -9.847  1.00 49.68 ? 296 HOH C O     1 
HETATM 4079 O O     . HOH K 7 .   ? 9.548   -2.829  8.135   1.00 36.28 ? 297 HOH C O     1 
HETATM 4080 O O     . HOH K 7 .   ? 15.178  6.547   2.847   1.00 15.58 ? 298 HOH C O     1 
HETATM 4081 O O     . HOH K 7 .   ? 17.477  4.757   3.261   1.00 21.31 ? 299 HOH C O     1 
HETATM 4082 O O     . HOH K 7 .   ? 3.292   4.498   0.274   1.00 55.02 ? 300 HOH C O     1 
HETATM 4083 O O     . HOH K 7 .   ? 15.898  -14.637 -7.500  1.00 30.52 ? 301 HOH C O     1 
HETATM 4084 O O     . HOH K 7 .   ? -2.043  -10.166 4.997   1.00 25.26 ? 302 HOH C O     1 
HETATM 4085 O O     . HOH K 7 .   ? 14.162  3.549   8.643   1.00 32.80 ? 303 HOH C O     1 
HETATM 4086 O O     . HOH K 7 .   ? 14.077  -20.854 -7.022  1.00 28.06 ? 304 HOH C O     1 
HETATM 4087 O O     . HOH K 7 .   ? 15.108  -25.490 -0.924  1.00 60.31 ? 305 HOH C O     1 
HETATM 4088 O O     . HOH K 7 .   ? 2.383   -23.747 1.209   1.00 34.96 ? 306 HOH C O     1 
HETATM 4089 O O     . HOH K 7 .   ? 17.714  -19.118 -4.582  1.00 30.79 ? 307 HOH C O     1 
HETATM 4090 O O     . HOH K 7 .   ? -8.154  -14.668 1.268   1.00 28.21 ? 308 HOH C O     1 
HETATM 4091 O O     . HOH K 7 .   ? 6.259   0.673   8.143   1.00 38.39 ? 309 HOH C O     1 
HETATM 4092 O O     . HOH K 7 .   ? 14.216  -12.869 -7.499  1.00 36.76 ? 310 HOH C O     1 
HETATM 4093 O O     . HOH K 7 .   ? -1.831  0.383   -0.029  1.00 51.18 ? 311 HOH C O     1 
HETATM 4094 O O     . HOH K 7 .   ? 5.775   8.168   6.896   1.00 43.87 ? 312 HOH C O     1 
HETATM 4095 O O     . HOH K 7 .   ? 1.650   -4.645  7.081   1.00 45.32 ? 313 HOH C O     1 
HETATM 4096 O O     . HOH K 7 .   ? 21.713  3.434   2.115   1.00 46.44 ? 314 HOH C O     1 
HETATM 4097 O O     . HOH K 7 .   ? 3.404   6.881   4.418   1.00 46.36 ? 315 HOH C O     1 
HETATM 4098 O O     . HOH K 7 .   ? 1.898   4.617   7.758   1.00 54.84 ? 316 HOH C O     1 
HETATM 4099 O O     . HOH K 7 .   ? 7.818   -27.428 -4.711  1.00 41.61 ? 317 HOH C O     1 
HETATM 4100 O O     . HOH K 7 .   ? 14.768  -23.662 1.283   1.00 46.23 ? 318 HOH C O     1 
HETATM 4101 O O     . HOH K 7 .   ? -5.164  0.492   -1.955  1.00 39.82 ? 319 HOH C O     1 
HETATM 4102 O O     . HOH K 7 .   ? 10.449  -19.081 -10.276 1.00 48.42 ? 320 HOH C O     1 
HETATM 4103 O O     . HOH K 7 .   ? 8.053   -26.546 -8.318  1.00 66.54 ? 321 HOH C O     1 
HETATM 4104 O O     . HOH K 7 .   ? 20.474  2.305   -14.014 1.00 59.79 ? 322 HOH C O     1 
HETATM 4105 O O     . HOH K 7 .   ? 12.038  -23.895 0.044   1.00 46.45 ? 323 HOH C O     1 
HETATM 4106 O O     . HOH K 7 .   ? 11.697  8.535   12.957  1.00 53.82 ? 324 HOH C O     1 
HETATM 4107 O O     . HOH K 7 .   ? -9.256  -12.784 -1.558  1.00 50.72 ? 325 HOH C O     1 
HETATM 4108 O O     . HOH K 7 .   ? 18.311  -2.488  1.160   1.00 59.61 ? 326 HOH C O     1 
HETATM 4109 O O     . HOH K 7 .   ? 1.121   -2.458  5.606   1.00 39.70 ? 327 HOH C O     1 
HETATM 4110 O O     . HOH L 7 .   ? 4.934   -2.408  -9.987  1.00 14.51 ? 123 HOH D O     1 
HETATM 4111 O O     . HOH L 7 .   ? -3.501  -15.540 -13.297 1.00 17.93 ? 124 HOH D O     1 
HETATM 4112 O O     . HOH L 7 .   ? 8.992   6.520   -4.212  1.00 17.74 ? 125 HOH D O     1 
HETATM 4113 O O     . HOH L 7 .   ? -6.118  -13.729 -6.530  1.00 19.52 ? 126 HOH D O     1 
HETATM 4114 O O     . HOH L 7 .   ? -7.707  -14.792 -4.722  1.00 22.17 ? 127 HOH D O     1 
HETATM 4115 O O     . HOH L 7 .   ? -2.649  2.768   -10.372 1.00 21.69 ? 128 HOH D O     1 
HETATM 4116 O O     . HOH L 7 .   ? 10.897  -2.967  -7.473  1.00 22.51 ? 129 HOH D O     1 
HETATM 4117 O O     . HOH L 7 .   ? -6.313  -14.479 -10.968 1.00 23.39 ? 130 HOH D O     1 
HETATM 4118 O O     . HOH L 7 .   ? 6.583   -6.033  -11.776 1.00 27.78 ? 131 HOH D O     1 
HETATM 4119 O O     . HOH L 7 .   ? -10.911 -23.826 -6.436  1.00 30.53 ? 132 HOH D O     1 
HETATM 4120 O O     . HOH L 7 .   ? -5.774  2.302   -7.414  1.00 33.11 ? 133 HOH D O     1 
HETATM 4121 O O     . HOH L 7 .   ? -0.990  1.278   -2.783  1.00 23.57 ? 134 HOH D O     1 
HETATM 4122 O O     . HOH L 7 .   ? 8.107   -8.068  -12.237 1.00 28.78 ? 135 HOH D O     1 
HETATM 4123 O O     . HOH L 7 .   ? 19.275  -16.314 7.713   1.00 32.60 ? 136 HOH D O     1 
HETATM 4124 O O     . HOH L 7 .   ? 10.862  -14.173 8.677   1.00 28.25 ? 137 HOH D O     1 
HETATM 4125 O O     . HOH L 7 .   ? -8.106  -13.402 -16.832 1.00 29.04 ? 138 HOH D O     1 
HETATM 4126 O O     . HOH L 7 .   ? -1.816  -9.577  -13.855 1.00 34.86 ? 139 HOH D O     1 
HETATM 4127 O O     . HOH L 7 .   ? 18.727  -17.921 -2.092  1.00 28.56 ? 140 HOH D O     1 
HETATM 4128 O O     . HOH L 7 .   ? -6.616  -3.445  -10.298 1.00 27.47 ? 141 HOH D O     1 
HETATM 4129 O O     . HOH L 7 .   ? -1.990  -3.395  -14.004 1.00 32.82 ? 142 HOH D O     1 
HETATM 4130 O O     . HOH L 7 .   ? -12.139 -24.309 -3.867  1.00 25.67 ? 143 HOH D O     1 
HETATM 4131 O O     . HOH L 7 .   ? 0.014   -16.168 -21.229 1.00 37.22 ? 144 HOH D O     1 
HETATM 4132 O O     . HOH L 7 .   ? 18.226  -15.846 -4.175  1.00 30.94 ? 145 HOH D O     1 
HETATM 4133 O O     . HOH L 7 .   ? -4.415  -26.869 0.081   1.00 47.00 ? 146 HOH D O     1 
HETATM 4134 O O     . HOH L 7 .   ? 1.044   -13.002 -16.400 1.00 32.47 ? 147 HOH D O     1 
HETATM 4135 O O     . HOH L 7 .   ? 7.726   -18.683 -10.395 1.00 36.53 ? 148 HOH D O     1 
HETATM 4136 O O     . HOH L 7 .   ? 3.762   -17.854 -18.359 1.00 35.71 ? 149 HOH D O     1 
HETATM 4137 O O     . HOH L 7 .   ? -0.497  4.675   -14.643 1.00 29.24 ? 150 HOH D O     1 
HETATM 4138 O O     . HOH L 7 .   ? 17.143  -20.114 7.080   1.00 31.66 ? 151 HOH D O     1 
HETATM 4139 O O     . HOH L 7 .   ? -0.206  -12.481 -18.916 1.00 40.87 ? 152 HOH D O     1 
HETATM 4140 O O     . HOH L 7 .   ? 2.447   -9.994  -14.329 1.00 44.03 ? 153 HOH D O     1 
HETATM 4141 O O     . HOH L 7 .   ? -4.082  -9.047  -15.285 1.00 36.13 ? 154 HOH D O     1 
HETATM 4142 O O     . HOH L 7 .   ? -7.501  -12.241 -19.350 1.00 40.86 ? 155 HOH D O     1 
HETATM 4143 O O     . HOH L 7 .   ? 12.787  -13.716 10.333  1.00 35.03 ? 156 HOH D O     1 
HETATM 4144 O O     . HOH L 7 .   ? -12.441 -22.789 -8.851  1.00 42.29 ? 157 HOH D O     1 
HETATM 4145 O O     . HOH L 7 .   ? 21.341  -19.027 -1.049  1.00 42.34 ? 158 HOH D O     1 
HETATM 4146 O O     . HOH L 7 .   ? 4.912   -16.779 9.299   1.00 34.43 ? 159 HOH D O     1 
HETATM 4147 O O     . HOH L 7 .   ? 6.773   -0.676  -10.794 1.00 25.83 ? 160 HOH D O     1 
HETATM 4148 O O     . HOH L 7 .   ? -9.359  -25.339 -30.735 1.00 40.04 ? 161 HOH D O     1 
HETATM 4149 O O     . HOH L 7 .   ? -4.473  1.955   -12.226 1.00 35.14 ? 162 HOH D O     1 
HETATM 4150 O O     . HOH L 7 .   ? -2.237  6.342   -15.661 1.00 31.81 ? 163 HOH D O     1 
HETATM 4151 O O     . HOH L 7 .   ? 7.850   -13.974 -14.563 1.00 31.35 ? 164 HOH D O     1 
HETATM 4152 O O     . HOH L 7 .   ? 11.388  -0.760  -9.188  1.00 30.24 ? 165 HOH D O     1 
HETATM 4153 O O     . HOH L 7 .   ? 0.292   -33.787 -29.041 1.00 39.80 ? 166 HOH D O     1 
HETATM 4154 O O     . HOH L 7 .   ? -10.881 -22.984 -30.301 1.00 47.14 ? 167 HOH D O     1 
HETATM 4155 O O     . HOH L 7 .   ? -13.545 -22.216 -3.807  1.00 38.27 ? 168 HOH D O     1 
HETATM 4156 O O     . HOH L 7 .   ? -15.199 -21.499 -6.654  1.00 34.97 ? 169 HOH D O     1 
HETATM 4157 O O     . HOH L 7 .   ? 20.170  -14.040 6.609   1.00 37.50 ? 170 HOH D O     1 
HETATM 4158 O O     . HOH L 7 .   ? -9.179  -23.756 3.716   1.00 53.75 ? 171 HOH D O     1 
HETATM 4159 O O     . HOH L 7 .   ? -3.674  -4.692  -9.570  1.00 41.91 ? 172 HOH D O     1 
HETATM 4160 O O     . HOH L 7 .   ? 17.709  -6.912  6.860   1.00 46.11 ? 173 HOH D O     1 
HETATM 4161 O O     . HOH L 7 .   ? -5.979  -34.199 -31.376 1.00 50.76 ? 174 HOH D O     1 
HETATM 4162 O O     . HOH L 7 .   ? -7.816  -11.777 -7.499  1.00 41.33 ? 175 HOH D O     1 
HETATM 4163 O O     . HOH L 7 .   ? -8.258  -1.006  -7.780  1.00 40.68 ? 176 HOH D O     1 
HETATM 4164 O O     . HOH L 7 .   ? 1.895   -1.290  -15.906 1.00 37.00 ? 177 HOH D O     1 
HETATM 4165 O O     . HOH L 7 .   ? -7.748  0.306   -3.845  1.00 40.70 ? 178 HOH D O     1 
HETATM 4166 O O     . HOH L 7 .   ? 3.850   -1.966  -12.400 1.00 43.55 ? 179 HOH D O     1 
HETATM 4167 O O     . HOH L 7 .   ? -0.039  -21.186 -24.377 1.00 44.18 ? 180 HOH D O     1 
HETATM 4168 O O     . HOH L 7 .   ? 9.612   -12.356 -13.184 1.00 47.30 ? 181 HOH D O     1 
HETATM 4169 O O     . HOH L 7 .   ? 21.147  -10.817 -2.830  1.00 36.91 ? 182 HOH D O     1 
HETATM 4170 O O     . HOH L 7 .   ? -6.914  -19.700 -32.966 1.00 52.56 ? 183 HOH D O     1 
HETATM 4171 O O     . HOH L 7 .   ? -3.349  -1.980  -16.478 1.00 61.39 ? 184 HOH D O     1 
HETATM 4172 O O     . HOH L 7 .   ? 1.879   -13.717 8.375   1.00 53.48 ? 185 HOH D O     1 
HETATM 4173 O O     . HOH L 7 .   ? -5.796  -3.116  -1.323  1.00 41.86 ? 186 HOH D O     1 
HETATM 4174 O O     . HOH L 7 .   ? 1.221   -7.782  -12.605 1.00 55.94 ? 187 HOH D O     1 
HETATM 4175 O O     . HOH L 7 .   ? 19.057  -8.726  5.779   1.00 40.77 ? 188 HOH D O     1 
HETATM 4176 O O     . HOH L 7 .   ? -8.894  -9.671  -5.799  1.00 42.51 ? 189 HOH D O     1 
HETATM 4177 O O     . HOH L 7 .   ? -15.946 -21.648 -9.899  1.00 43.53 ? 190 HOH D O     1 
HETATM 4178 O O     . HOH L 7 .   ? 23.511  -11.981 -0.791  1.00 56.47 ? 191 HOH D O     1 
HETATM 4179 O O     . HOH L 7 .   ? -8.075  -12.092 -9.924  1.00 37.21 ? 192 HOH D O     1 
HETATM 4180 O O     . HOH L 7 .   ? 8.898   -2.411  -11.135 1.00 42.55 ? 193 HOH D O     1 
HETATM 4181 O O     . HOH L 7 .   ? 5.912   -22.459 -24.313 1.00 54.66 ? 194 HOH D O     1 
HETATM 4182 O O     . HOH L 7 .   ? -12.375 -21.842 -28.260 1.00 45.63 ? 195 HOH D O     1 
HETATM 4183 O O     . HOH L 7 .   ? -9.920  -20.349 -33.638 1.00 43.27 ? 196 HOH D O     1 
HETATM 4184 O O     . HOH L 7 .   ? -10.193 -14.957 -16.236 1.00 51.12 ? 197 HOH D O     1 
HETATM 4185 O O     . HOH L 7 .   ? -3.196  -25.178 -34.547 1.00 68.11 ? 198 HOH D O     1 
HETATM 4186 O O     . HOH L 7 .   ? 2.817   -23.156 -30.133 1.00 47.23 ? 199 HOH D O     1 
HETATM 4187 O O     . HOH L 7 .   ? -10.579 -17.033 -26.911 1.00 40.82 ? 200 HOH D O     1 
HETATM 4188 O O     . HOH L 7 .   ? -13.253 -17.461 1.390   1.00 76.44 ? 201 HOH D O     1 
HETATM 4189 O O     . HOH L 7 .   ? -3.738  -21.754 -33.422 1.00 50.30 ? 202 HOH D O     1 
HETATM 4190 O O     . HOH L 7 .   ? 2.591   -1.608  -18.388 1.00 61.18 ? 203 HOH D O     1 
HETATM 4191 O O     . HOH L 7 .   ? 3.467   -6.522  -13.731 1.00 63.96 ? 204 HOH D O     1 
HETATM 4192 O O     . HOH L 7 .   ? 2.395   -16.253 -19.928 1.00 50.40 ? 205 HOH D O     1 
HETATM 4193 O O     . HOH L 7 .   ? -4.981  -32.210 -35.722 1.00 45.41 ? 206 HOH D O     1 
HETATM 4194 O O     . HOH L 7 .   ? -6.380  -15.670 -21.929 1.00 50.74 ? 207 HOH D O     1 
HETATM 4195 O O     . HOH L 7 .   ? -13.060 -18.195 -30.396 1.00 79.21 ? 208 HOH D O     1 
HETATM 4196 O O     . HOH L 7 .   ? 0.894   -3.878  -15.044 1.00 54.94 ? 209 HOH D O     1 
HETATM 4197 O O     . HOH L 7 .   ? 3.032   -18.826 -24.987 1.00 57.80 ? 210 HOH D O     1 
HETATM 4198 O O     . HOH L 7 .   ? 20.916  -6.251  0.985   1.00 55.12 ? 211 HOH D O     1 
HETATM 4199 O O     . HOH L 7 .   ? 25.395  -9.258  0.850   1.00 71.50 ? 212 HOH D O     1 
HETATM 4200 O O     . HOH L 7 .   ? 22.630  -8.290  -0.801  1.00 55.61 ? 213 HOH D O     1 
HETATM 4201 O O     . HOH L 7 .   ? 19.604  -4.076  -0.620  1.00 55.78 ? 214 HOH D O     1 
HETATM 4202 O O     . HOH L 7 .   ? -6.359  -3.499  -12.864 1.00 49.46 ? 215 HOH D O     1 
HETATM 4203 O O     . HOH L 7 .   ? -13.949 -19.094 -16.862 1.00 57.09 ? 216 HOH D O     1 
HETATM 4204 O O     . HOH L 7 .   ? 6.323   -30.068 -24.741 1.00 52.19 ? 217 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DT  1   1   1   DT  T   E . n 
A 1 2   DG  2   2   2   DG  G   E . n 
A 1 3   DT  3   3   3   DT  T   E . n 
A 1 4   DA  4   4   4   DA  A   E . n 
A 1 5   5IU 5   5   5   5IU +U  E . n 
A 1 6   DG  6   6   6   DG  G   E . n 
A 1 7   DT  7   7   7   DT  T   E . n 
A 1 8   DA  8   8   8   DA  A   E . n 
A 1 9   DT  9   9   9   DT  T   E . n 
A 1 10  DA  10  10  10  DA  A   E . n 
A 1 11  5IU 11  11  11  5IU +U  E . n 
A 1 12  DA  12  12  12  DA  A   E . n 
A 1 13  DA  13  13  13  DA  A   E . n 
A 1 14  DA  14  14  14  DA  A   E . n 
A 1 15  DA  15  15  15  DA  A   E . n 
A 1 16  DC  16  16  16  DC  C   E . n 
B 2 1   DG  1   1   1   DG  G   F . n 
B 2 2   DT  2   2   2   DT  T   F . n 
B 2 3   DT  3   3   3   DT  T   F . n 
B 2 4   DT  4   4   4   DT  T   F . n 
B 2 5   DT  5   5   5   DT  T   F . n 
B 2 6   DA  6   6   6   DA  A   F . n 
B 2 7   DT  7   7   7   DT  T   F . n 
B 2 8   DA  8   8   8   DA  A   F . n 
B 2 9   DT  9   9   9   DT  T   F . n 
B 2 10  DA  10  10  10  DA  A   F . n 
B 2 11  DC  11  11  11  DC  C   F . n 
B 2 12  DA  12  12  12  DA  A   F . n 
B 2 13  DT  13  13  13  DT  T   F . n 
B 2 14  DA  14  14  14  DA  A   F . n 
B 2 15  DC  15  15  15  DC  C   F . n 
B 2 16  DA  16  16  16  DA  A   F . n 
C 3 1   SER 1   61  61  SER SER A . n 
C 3 2   GLY 2   62  62  GLY GLY A . n 
C 3 3   ILE 3   63  63  ILE ILE A . n 
C 3 4   VAL 4   64  64  VAL VAL A . n 
C 3 5   PRO 5   65  65  PRO PRO A . n 
C 3 6   THR 6   66  66  THR THR A . n 
C 3 7   LEU 7   67  67  LEU LEU A . n 
C 3 8   GLN 8   68  68  GLN GLN A . n 
C 3 9   ASN 9   69  69  ASN ASN A . n 
C 3 10  ILE 10  70  70  ILE ILE A . n 
C 3 11  VAL 11  71  71  VAL VAL A . n 
C 3 12  ALA 12  72  72  ALA ALA A . n 
C 3 13  THR 13  73  73  THR THR A . n 
C 3 14  VAL 14  74  74  VAL VAL A . n 
C 3 15  THR 15  75  75  THR THR A . n 
C 3 16  LEU 16  76  76  LEU LEU A . n 
C 3 17  GLY 17  77  77  GLY GLY A . n 
C 3 18  CYS 18  78  78  CYS CYS A . n 
C 3 19  ARG 19  79  79  ARG ARG A . n 
C 3 20  LEU 20  80  80  LEU LEU A . n 
C 3 21  ASP 21  81  81  ASP ASP A . n 
C 3 22  LEU 22  82  82  LEU LEU A . n 
C 3 23  LYS 23  83  83  LYS LYS A . n 
C 3 24  THR 24  84  84  THR THR A . n 
C 3 25  VAL 25  85  85  VAL VAL A . n 
C 3 26  ALA 26  86  86  ALA ALA A . n 
C 3 27  LEU 27  87  87  LEU LEU A . n 
C 3 28  HIS 28  88  88  HIS HIS A . n 
C 3 29  ALA 29  89  89  ALA ALA A . n 
C 3 30  ARG 30  90  90  ARG ARG A . n 
C 3 31  ASN 31  91  91  ASN ASN A . n 
C 3 32  ALA 32  92  92  ALA ALA A . n 
C 3 33  GLU 33  93  93  GLU GLU A . n 
C 3 34  TYR 34  94  94  TYR TYR A . n 
C 3 35  ASN 35  95  95  ASN ASN A . n 
C 3 36  PRO 36  96  96  PRO PRO A . n 
C 3 37  LYS 37  97  97  LYS LYS A . n 
C 3 38  ARG 38  98  98  ARG ARG A . n 
C 3 39  PHE 39  99  99  PHE PHE A . n 
C 3 40  ALA 40  100 100 ALA ALA A . n 
C 3 41  ALA 41  101 101 ALA ALA A . n 
C 3 42  VAL 42  102 102 VAL VAL A . n 
C 3 43  ILE 43  103 103 ILE ILE A . n 
C 3 44  MET 44  104 104 MET MET A . n 
C 3 45  ARG 45  105 105 ARG ARG A . n 
C 3 46  ILE 46  106 106 ILE ILE A . n 
C 3 47  ARG 47  107 107 ARG ARG A . n 
C 3 48  GLU 48  108 108 GLU GLU A . n 
C 3 49  PRO 49  109 109 PRO PRO A . n 
C 3 50  LYS 50  110 110 LYS LYS A . n 
C 3 51  THR 51  111 111 THR THR A . n 
C 3 52  THR 52  112 112 THR THR A . n 
C 3 53  ALA 53  113 113 ALA ALA A . n 
C 3 54  LEU 54  114 114 LEU LEU A . n 
C 3 55  ILE 55  115 115 ILE ILE A . n 
C 3 56  PHE 56  116 116 PHE PHE A . n 
C 3 57  ALA 57  117 117 ALA ALA A . n 
C 3 58  SER 58  118 118 SER SER A . n 
C 3 59  GLY 59  119 119 GLY GLY A . n 
C 3 60  LYS 60  120 120 LYS LYS A . n 
C 3 61  MET 61  121 121 MET MET A . n 
C 3 62  VAL 62  122 122 VAL VAL A . n 
C 3 63  VAL 63  123 123 VAL VAL A . n 
C 3 64  THR 64  124 124 THR THR A . n 
C 3 65  GLY 65  125 125 GLY GLY A . n 
C 3 66  ALA 66  126 126 ALA ALA A . n 
C 3 67  LYS 67  127 127 LYS LYS A . n 
C 3 68  SER 68  128 128 SER SER A . n 
C 3 69  GLU 69  129 129 GLU GLU A . n 
C 3 70  ASP 70  130 130 ASP ASP A . n 
C 3 71  ASP 71  131 131 ASP ASP A . n 
C 3 72  SER 72  132 132 SER SER A . n 
C 3 73  LYS 73  133 133 LYS LYS A . n 
C 3 74  LEU 74  134 134 LEU LEU A . n 
C 3 75  ALA 75  135 135 ALA ALA A . n 
C 3 76  SER 76  136 136 SER SER A . n 
C 3 77  ARG 77  137 137 ARG ARG A . n 
C 3 78  LYS 78  138 138 LYS LYS A . n 
C 3 79  TYR 79  139 139 TYR TYR A . n 
C 3 80  ALA 80  140 140 ALA ALA A . n 
C 3 81  ARG 81  141 141 ARG ARG A . n 
C 3 82  ILE 82  142 142 ILE ILE A . n 
C 3 83  ILE 83  143 143 ILE ILE A . n 
C 3 84  GLN 84  144 144 GLN GLN A . n 
C 3 85  LYS 85  145 145 LYS LYS A . n 
C 3 86  ILE 86  146 146 ILE ILE A . n 
C 3 87  GLY 87  147 147 GLY GLY A . n 
C 3 88  PHE 88  148 148 PHE PHE A . n 
C 3 89  ALA 89  149 149 ALA ALA A . n 
C 3 90  ALA 90  150 150 ALA ALA A . n 
C 3 91  LYS 91  151 151 LYS LYS A . n 
C 3 92  PHE 92  152 152 PHE PHE A . n 
C 3 93  THR 93  153 153 THR THR A . n 
C 3 94  ASP 94  154 154 ASP ASP A . n 
C 3 95  PHE 95  155 155 PHE PHE A . n 
C 3 96  LYS 96  156 156 LYS LYS A . n 
C 3 97  ILE 97  157 157 ILE ILE A . n 
C 3 98  GLN 98  158 158 GLN GLN A . n 
C 3 99  ASN 99  159 159 ASN ASN A . n 
C 3 100 ILE 100 160 160 ILE ILE A . n 
C 3 101 VAL 101 161 161 VAL VAL A . n 
C 3 102 GLY 102 162 162 GLY GLY A . n 
C 3 103 SER 103 163 163 SER SER A . n 
C 3 104 CYS 104 164 164 CYS CYS A . n 
C 3 105 ASP 105 165 165 ASP ASP A . n 
C 3 106 VAL 106 166 166 VAL VAL A . n 
C 3 107 LYS 107 167 167 LYS LYS A . n 
C 3 108 PHE 108 168 168 PHE PHE A . n 
C 3 109 PRO 109 169 169 PRO PRO A . n 
C 3 110 ILE 110 170 170 ILE ILE A . n 
C 3 111 ARG 111 171 171 ARG ARG A . n 
C 3 112 LEU 112 172 172 LEU LEU A . n 
C 3 113 GLU 113 173 173 GLU GLU A . n 
C 3 114 GLY 114 174 174 GLY GLY A . n 
C 3 115 LEU 115 175 175 LEU LEU A . n 
C 3 116 ALA 116 176 176 ALA ALA A . n 
C 3 117 PHE 117 177 177 PHE PHE A . n 
C 3 118 SER 118 178 178 SER SER A . n 
C 3 119 HIS 119 179 179 HIS HIS A . n 
C 3 120 GLY 120 180 180 GLY GLY A . n 
C 3 121 THR 121 181 181 THR THR A . n 
C 3 122 PHE 122 182 182 PHE PHE A . n 
C 3 123 SER 123 183 183 SER SER A . n 
C 3 124 SER 124 184 184 SER SER A . n 
C 3 125 TYR 125 185 185 TYR TYR A . n 
C 3 126 GLU 126 186 186 GLU GLU A . n 
C 3 127 PRO 127 187 187 PRO PRO A . n 
C 3 128 GLU 128 188 188 GLU GLU A . n 
C 3 129 LEU 129 189 189 LEU LEU A . n 
C 3 130 PHE 130 190 190 PHE PHE A . n 
C 3 131 PRO 131 191 191 PRO PRO A . n 
C 3 132 GLY 132 192 192 GLY GLY A . n 
C 3 133 LEU 133 193 193 LEU LEU A . n 
C 3 134 ILE 134 194 194 ILE ILE A . n 
C 3 135 TYR 135 195 195 TYR TYR A . n 
C 3 136 ARG 136 196 196 ARG ARG A . n 
C 3 137 MET 137 197 197 MET MET A . n 
C 3 138 VAL 138 198 198 VAL VAL A . n 
C 3 139 LYS 139 199 199 LYS LYS A . n 
C 3 140 PRO 140 200 200 PRO PRO A . n 
C 3 141 LYS 141 201 201 LYS LYS A . n 
C 3 142 ILE 142 202 202 ILE ILE A . n 
C 3 143 VAL 143 203 203 VAL VAL A . n 
C 3 144 LEU 144 204 204 LEU LEU A . n 
C 3 145 LEU 145 205 205 LEU LEU A . n 
C 3 146 ILE 146 206 206 ILE ILE A . n 
C 3 147 PHE 147 207 207 PHE PHE A . n 
C 3 148 VAL 148 208 208 VAL VAL A . n 
C 3 149 SER 149 209 209 SER SER A . n 
C 3 150 GLY 150 210 210 GLY GLY A . n 
C 3 151 LYS 151 211 211 LYS LYS A . n 
C 3 152 ILE 152 212 212 ILE ILE A . n 
C 3 153 VAL 153 213 213 VAL VAL A . n 
C 3 154 LEU 154 214 214 LEU LEU A . n 
C 3 155 THR 155 215 215 THR THR A . n 
C 3 156 GLY 156 216 216 GLY GLY A . n 
C 3 157 ALA 157 217 217 ALA ALA A . n 
C 3 158 LYS 158 218 218 LYS LYS A . n 
C 3 159 GLN 159 219 219 GLN GLN A . n 
C 3 160 ARG 160 220 220 ARG ARG A . n 
C 3 161 GLU 161 221 221 GLU GLU A . n 
C 3 162 GLU 162 222 222 GLU GLU A . n 
C 3 163 ILE 163 223 223 ILE ILE A . n 
C 3 164 TYR 164 224 224 TYR TYR A . n 
C 3 165 GLN 165 225 225 GLN GLN A . n 
C 3 166 ALA 166 226 226 ALA ALA A . n 
C 3 167 PHE 167 227 227 PHE PHE A . n 
C 3 168 GLU 168 228 228 GLU GLU A . n 
C 3 169 ALA 169 229 229 ALA ALA A . n 
C 3 170 ILE 170 230 230 ILE ILE A . n 
C 3 171 TYR 171 231 231 TYR TYR A . n 
C 3 172 PRO 172 232 232 PRO PRO A . n 
C 3 173 VAL 173 233 233 VAL VAL A . n 
C 3 174 LEU 174 234 234 LEU LEU A . n 
C 3 175 SER 175 235 235 SER SER A . n 
C 3 176 GLU 176 236 236 GLU GLU A . n 
C 3 177 PHE 177 237 237 PHE PHE A . n 
C 3 178 ARG 178 238 238 ARG ARG A . n 
C 3 179 LYS 179 239 239 LYS LYS A . n 
C 3 180 MET 180 240 240 MET MET A . n 
D 4 1   SER 1   2   ?   ?   ?   B . n 
D 4 2   ASN 2   3   3   ASN ASN B . n 
D 4 3   ALA 3   4   4   ALA ALA B . n 
D 4 4   GLU 4   5   5   GLU GLU B . n 
D 4 5   ALA 5   6   6   ALA ALA B . n 
D 4 6   SER 6   7   7   SER SER B . n 
D 4 7   ARG 7   8   8   ARG ARG B . n 
D 4 8   VAL 8   9   9   VAL VAL B . n 
D 4 9   TYR 9   10  10  TYR TYR B . n 
D 4 10  GLU 10  11  11  GLU GLU B . n 
D 4 11  ILE 11  12  12  ILE ILE B . n 
D 4 12  ILE 12  13  13  ILE ILE B . n 
D 4 13  VAL 13  14  14  VAL VAL B . n 
D 4 14  GLU 14  15  15  GLU GLU B . n 
D 4 15  SER 15  16  16  SER SER B . n 
D 4 16  VAL 16  17  17  VAL VAL B . n 
D 4 17  VAL 17  18  18  VAL VAL B . n 
D 4 18  ASN 18  19  19  ASN ASN B . n 
D 4 19  GLU 19  20  20  GLU GLU B . n 
D 4 20  VAL 20  21  21  VAL VAL B . n 
D 4 21  ARG 21  22  22  ARG ARG B . n 
D 4 22  GLU 22  23  23  GLU GLU B . n 
D 4 23  ASP 23  24  24  ASP ASP B . n 
D 4 24  PHE 24  25  25  PHE PHE B . n 
D 4 25  GLU 25  26  26  GLU GLU B . n 
D 4 26  ASN 26  27  27  ASN ASN B . n 
D 4 27  ALA 27  28  28  ALA ALA B . n 
D 4 28  GLY 28  29  29  GLY GLY B . n 
D 4 29  ILE 29  30  30  ILE ILE B . n 
D 4 30  ASP 30  31  31  ASP ASP B . n 
D 4 31  GLU 31  32  32  GLU GLU B . n 
D 4 32  GLN 32  33  33  GLN GLN B . n 
D 4 33  THR 33  34  34  THR THR B . n 
D 4 34  LEU 34  35  35  LEU LEU B . n 
D 4 35  GLN 35  36  36  GLN GLN B . n 
D 4 36  ASP 36  37  37  ASP ASP B . n 
D 4 37  LEU 37  38  38  LEU LEU B . n 
D 4 38  LYS 38  39  39  LYS LYS B . n 
D 4 39  ASN 39  40  40  ASN ASN B . n 
D 4 40  ILE 40  41  41  ILE ILE B . n 
D 4 41  TRP 41  42  42  TRP TRP B . n 
D 4 42  GLN 42  43  43  GLN GLN B . n 
D 4 43  LYS 43  44  44  LYS LYS B . n 
D 4 44  LYS 44  45  45  LYS LYS B . n 
D 4 45  LEU 45  46  46  LEU LEU B . n 
D 4 46  THR 46  47  47  THR THR B . n 
D 4 47  GLU 47  48  48  GLU GLU B . n 
D 4 48  THR 48  49  ?   ?   ?   B . n 
D 4 49  LYS 49  50  ?   ?   ?   B . n 
D 4 50  VAL 50  51  ?   ?   ?   B . n 
D 4 51  THR 51  52  ?   ?   ?   B . n 
D 4 52  THR 52  53  ?   ?   ?   B . n 
D 4 53  PHE 53  54  ?   ?   ?   B . n 
E 5 1   GLY 1   208 ?   ?   ?   C . n 
E 5 2   SER 2   209 ?   ?   ?   C . n 
E 5 3   SER 3   210 ?   ?   ?   C . n 
E 5 4   ALA 4   211 ?   ?   ?   C . n 
E 5 5   LEU 5   212 ?   ?   ?   C . n 
E 5 6   LEU 6   213 ?   ?   ?   C . n 
E 5 7   ASP 7   214 ?   ?   ?   C . n 
E 5 8   THR 8   215 ?   ?   ?   C . n 
E 5 9   ASP 9   216 ?   ?   ?   C . n 
E 5 10  GLU 10  217 ?   ?   ?   C . n 
E 5 11  VAL 11  218 ?   ?   ?   C . n 
E 5 12  GLY 12  219 ?   ?   ?   C . n 
E 5 13  SER 13  220 ?   ?   ?   C . n 
E 5 14  GLU 14  221 ?   ?   ?   C . n 
E 5 15  LEU 15  222 ?   ?   ?   C . n 
E 5 16  ASP 16  223 ?   ?   ?   C . n 
E 5 17  ASP 17  224 ?   ?   ?   C . n 
E 5 18  SER 18  225 ?   ?   ?   C . n 
E 5 19  ASP 19  226 ?   ?   ?   C . n 
E 5 20  ASP 20  227 ?   ?   ?   C . n 
E 5 21  ASP 21  228 228 ASP ASP C . n 
E 5 22  TYR 22  229 229 TYR TYR C . n 
E 5 23  LEU 23  230 230 LEU LEU C . n 
E 5 24  ILE 24  231 231 ILE ILE C . n 
E 5 25  SER 25  232 ?   ?   ?   C . n 
E 5 26  GLU 26  233 ?   ?   ?   C . n 
E 5 27  GLY 27  234 ?   ?   ?   C . n 
E 5 28  GLU 28  235 ?   ?   ?   C . n 
E 5 29  GLU 29  236 ?   ?   ?   C . n 
E 5 30  ASP 30  237 ?   ?   ?   C . n 
E 5 31  GLY 31  238 ?   ?   ?   C . n 
E 5 32  PRO 32  239 ?   ?   ?   C . n 
E 5 33  ASP 33  240 ?   ?   ?   C . n 
E 5 34  GLU 34  241 241 GLU GLU C . n 
E 5 35  ASN 35  242 242 ASN ASN C . n 
E 5 36  LEU 36  243 243 LEU LEU C . n 
E 5 37  MET 37  244 244 MET MET C . n 
E 5 38  LEU 38  245 245 LEU LEU C . n 
E 5 39  CYS 39  246 246 CYS CYS C . n 
E 5 40  LEU 40  247 247 LEU LEU C . n 
E 5 41  TYR 41  248 248 TYR TYR C . n 
E 5 42  ASP 42  249 249 ASP ASP C . n 
E 5 43  LYS 43  250 250 LYS LYS C . n 
E 5 44  VAL 44  251 251 VAL VAL C . n 
E 5 45  THR 45  252 252 THR THR C . n 
E 5 46  ARG 46  253 253 ARG ARG C . n 
E 5 47  THR 47  254 254 THR THR C . n 
E 5 48  LYS 48  255 255 LYS LYS C . n 
E 5 49  ALA 49  256 256 ALA ALA C . n 
E 5 50  ARG 50  257 257 ARG ARG C . n 
E 5 51  TRP 51  258 258 TRP TRP C . n 
E 5 52  LYS 52  259 259 LYS LYS C . n 
E 5 53  CYS 53  260 260 CYS CYS C . n 
E 5 54  SER 54  261 261 SER SER C . n 
E 5 55  LEU 55  262 262 LEU LEU C . n 
E 5 56  LYS 56  263 263 LYS LYS C . n 
E 5 57  ASP 57  264 264 ASP ASP C . n 
E 5 58  GLY 58  265 265 GLY GLY C . n 
E 5 59  VAL 59  266 266 VAL VAL C . n 
E 5 60  VAL 60  267 267 VAL VAL C . n 
E 5 61  THR 61  268 268 THR THR C . n 
E 5 62  ILE 62  269 269 ILE ILE C . n 
E 5 63  ASN 63  270 270 ASN ASN C . n 
E 5 64  ARG 64  271 271 ARG ARG C . n 
E 5 65  ASN 65  272 272 ASN ASN C . n 
E 5 66  ASP 66  273 273 ASP ASP C . n 
E 5 67  TYR 67  274 274 TYR TYR C . n 
E 5 68  THR 68  275 275 THR THR C . n 
E 5 69  PHE 69  276 276 PHE PHE C . n 
E 5 70  GLN 70  277 277 GLN GLN C . n 
E 5 71  LYS 71  278 278 LYS LYS C . n 
E 5 72  ALA 72  279 279 ALA ALA C . n 
E 5 73  GLN 73  280 280 GLN GLN C . n 
E 5 74  VAL 74  281 281 VAL VAL C . n 
E 5 75  GLU 75  282 282 GLU GLU C . n 
E 5 76  ALA 76  283 283 ALA ALA C . n 
E 5 77  GLU 77  284 284 GLU GLU C . n 
E 5 78  TRP 78  285 285 TRP TRP C . n 
E 5 79  VAL 79  286 286 VAL VAL C . n 
F 6 1   ALA 1   2   ?   ?   ?   D . n 
F 6 2   VAL 2   3   ?   ?   ?   D . n 
F 6 3   PRO 3   4   ?   ?   ?   D . n 
F 6 4   GLY 4   5   5   GLY GLY D . n 
F 6 5   TYR 5   6   6   TYR TYR D . n 
F 6 6   TYR 6   7   7   TYR TYR D . n 
F 6 7   GLU 7   8   8   GLU GLU D . n 
F 6 8   LEU 8   9   9   LEU LEU D . n 
F 6 9   TYR 9   10  10  TYR TYR D . n 
F 6 10  ARG 10  11  11  ARG ARG D . n 
F 6 11  ARG 11  12  12  ARG ARG D . n 
F 6 12  SER 12  13  13  SER SER D . n 
F 6 13  THR 13  14  14  THR THR D . n 
F 6 14  ILE 14  15  15  ILE ILE D . n 
F 6 15  GLY 15  16  16  GLY GLY D . n 
F 6 16  ASN 16  17  17  ASN ASN D . n 
F 6 17  SER 17  18  18  SER SER D . n 
F 6 18  LEU 18  19  19  LEU LEU D . n 
F 6 19  VAL 19  20  20  VAL VAL D . n 
F 6 20  ASP 20  21  21  ASP ASP D . n 
F 6 21  ALA 21  22  22  ALA ALA D . n 
F 6 22  LEU 22  23  23  LEU LEU D . n 
F 6 23  ASP 23  24  24  ASP ASP D . n 
F 6 24  THR 24  25  25  THR THR D . n 
F 6 25  LEU 25  26  26  LEU LEU D . n 
F 6 26  ILE 26  27  27  ILE ILE D . n 
F 6 27  SER 27  28  28  SER SER D . n 
F 6 28  ASP 28  29  29  ASP ASP D . n 
F 6 29  GLY 29  30  30  GLY GLY D . n 
F 6 30  ARG 30  31  31  ARG ARG D . n 
F 6 31  ILE 31  32  32  ILE ILE D . n 
F 6 32  GLU 32  33  33  GLU GLU D . n 
F 6 33  ALA 33  34  34  ALA ALA D . n 
F 6 34  SER 34  35  35  SER SER D . n 
F 6 35  LEU 35  36  36  LEU LEU D . n 
F 6 36  ALA 36  37  37  ALA ALA D . n 
F 6 37  MET 37  38  38  MET MET D . n 
F 6 38  ARG 38  39  39  ARG ARG D . n 
F 6 39  VAL 39  40  40  VAL VAL D . n 
F 6 40  LEU 40  41  41  LEU LEU D . n 
F 6 41  GLU 41  42  42  GLU GLU D . n 
F 6 42  THR 42  43  43  THR THR D . n 
F 6 43  PHE 43  44  44  PHE PHE D . n 
F 6 44  ASP 44  45  45  ASP ASP D . n 
F 6 45  LYS 45  46  46  LYS LYS D . n 
F 6 46  VAL 46  47  47  VAL VAL D . n 
F 6 47  VAL 47  48  48  VAL VAL D . n 
F 6 48  ALA 48  49  49  ALA ALA D . n 
F 6 49  GLU 49  50  50  GLU GLU D . n 
F 6 50  THR 50  51  51  THR THR D . n 
F 6 51  LEU 51  52  52  LEU LEU D . n 
F 6 52  LYS 52  53  53  LYS LYS D . n 
F 6 53  ASP 53  54  54  ASP ASP D . n 
F 6 54  ASN 54  55  55  ASN ASN D . n 
F 6 55  THR 55  56  56  THR THR D . n 
F 6 56  GLN 56  57  57  GLN GLN D . n 
F 6 57  SER 57  58  58  SER SER D . n 
F 6 58  LYS 58  59  59  LYS LYS D . n 
F 6 59  LEU 59  60  60  LEU LEU D . n 
F 6 60  THR 60  61  61  THR THR D . n 
F 6 61  VAL 61  62  62  VAL VAL D . n 
F 6 62  LYS 62  63  63  LYS LYS D . n 
F 6 63  GLY 63  64  64  GLY GLY D . n 
F 6 64  ASN 64  65  65  ASN ASN D . n 
F 6 65  LEU 65  66  66  LEU LEU D . n 
F 6 66  ASP 66  67  67  ASP ASP D . n 
F 6 67  THR 67  68  68  THR THR D . n 
F 6 68  TYR 68  69  69  TYR TYR D . n 
F 6 69  GLY 69  70  70  GLY GLY D . n 
F 6 70  PHE 70  71  71  PHE PHE D . n 
F 6 71  CYS 71  72  72  CYS CYS D . n 
F 6 72  ASP 72  73  73  ASP ASP D . n 
F 6 73  ASP 73  74  74  ASP ASP D . n 
F 6 74  VAL 74  75  75  VAL VAL D . n 
F 6 75  TRP 75  76  76  TRP TRP D . n 
F 6 76  THR 76  77  77  THR THR D . n 
F 6 77  PHE 77  78  78  PHE PHE D . n 
F 6 78  ILE 78  79  79  ILE ILE D . n 
F 6 79  VAL 79  80  80  VAL VAL D . n 
F 6 80  LYS 80  81  81  LYS LYS D . n 
F 6 81  ASN 81  82  82  ASN ASN D . n 
F 6 82  CYS 82  83  83  CYS CYS D . n 
F 6 83  GLN 83  84  84  GLN GLN D . n 
F 6 84  VAL 84  85  85  VAL VAL D . n 
F 6 85  THR 85  86  86  THR THR D . n 
F 6 86  VAL 86  87  87  VAL VAL D . n 
F 6 87  GLU 87  88  88  GLU GLU D . n 
F 6 88  ASP 88  89  89  ASP ALA D . n 
F 6 89  SER 89  90  ?   ?   ?   D . n 
F 6 90  HIS 90  91  ?   ?   ?   D . n 
F 6 91  ARG 91  92  ?   ?   ?   D . n 
F 6 92  ASP 92  93  ?   ?   ?   D . n 
F 6 93  ALA 93  94  ?   ?   ?   D . n 
F 6 94  SER 94  95  ?   ?   ?   D . n 
F 6 95  GLN 95  96  ?   ?   ?   D . n 
F 6 96  ASN 96  97  ?   ?   ?   D . n 
F 6 97  GLY 97  98  ?   ?   ?   D . n 
F 6 98  SER 98  99  ?   ?   ?   D . n 
F 6 99  GLY 99  100 ?   ?   ?   D . n 
F 6 100 ASP 100 101 ?   ?   ?   D . n 
F 6 101 SER 101 102 ?   ?   ?   D . n 
F 6 102 GLN 102 103 103 GLN GLN D . n 
F 6 103 SER 103 104 104 SER SER D . n 
F 6 104 VAL 104 105 105 VAL VAL D . n 
F 6 105 ILE 105 106 106 ILE ILE D . n 
F 6 106 SER 106 107 107 SER SER D . n 
F 6 107 VAL 107 108 108 VAL VAL D . n 
F 6 108 ASP 108 109 109 ASP ASP D . n 
F 6 109 LYS 109 110 110 LYS LYS D . n 
F 6 110 LEU 110 111 111 LEU LEU D . n 
F 6 111 ARG 111 112 112 ARG ARG D . n 
F 6 112 ILE 112 113 113 ILE ILE D . n 
F 6 113 VAL 113 114 114 VAL VAL D . n 
F 6 114 ALA 114 115 115 ALA ALA D . n 
F 6 115 CYS 115 116 116 CYS CYS D . n 
F 6 116 ASN 116 117 117 ASN ASN D . n 
F 6 117 SER 117 118 118 SER SER D . n 
F 6 118 LYS 118 119 119 LYS LYS D . n 
F 6 119 LYS 119 120 120 LYS ALA D . n 
F 6 120 SER 120 121 121 SER SER D . n 
F 6 121 GLU 121 122 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 7 HOH 1   33  33  HOH HOH E . 
G 7 HOH 2   46  46  HOH HOH E . 
G 7 HOH 3   55  55  HOH HOH E . 
G 7 HOH 4   66  66  HOH HOH E . 
G 7 HOH 5   67  67  HOH HOH E . 
G 7 HOH 6   77  77  HOH HOH E . 
G 7 HOH 7   89  89  HOH HOH E . 
G 7 HOH 8   104 104 HOH HOH E . 
G 7 HOH 9   116 116 HOH HOH E . 
G 7 HOH 10  152 152 HOH HOH E . 
G 7 HOH 11  155 155 HOH HOH E . 
G 7 HOH 12  161 161 HOH HOH E . 
G 7 HOH 13  164 164 HOH HOH E . 
G 7 HOH 14  165 165 HOH HOH E . 
G 7 HOH 15  168 168 HOH HOH E . 
G 7 HOH 16  175 175 HOH HOH E . 
G 7 HOH 17  186 186 HOH HOH E . 
G 7 HOH 18  218 218 HOH HOH E . 
G 7 HOH 19  245 245 HOH HOH E . 
G 7 HOH 20  246 246 HOH HOH E . 
G 7 HOH 21  260 260 HOH HOH E . 
G 7 HOH 22  277 277 HOH HOH E . 
G 7 HOH 23  289 289 HOH HOH E . 
G 7 HOH 24  294 294 HOH HOH E . 
G 7 HOH 25  296 296 HOH HOH E . 
G 7 HOH 26  300 300 HOH HOH E . 
G 7 HOH 27  304 304 HOH HOH E . 
G 7 HOH 28  308 308 HOH HOH E . 
G 7 HOH 29  310 310 HOH HOH E . 
G 7 HOH 30  321 321 HOH HOH E . 
G 7 HOH 31  332 332 HOH HOH E . 
G 7 HOH 32  334 334 HOH HOH E . 
G 7 HOH 33  338 338 HOH HOH E . 
G 7 HOH 34  339 339 HOH HOH E . 
G 7 HOH 35  360 360 HOH HOH E . 
G 7 HOH 36  361 361 HOH HOH E . 
G 7 HOH 37  414 414 HOH HOH E . 
G 7 HOH 38  423 423 HOH HOH E . 
G 7 HOH 39  425 425 HOH HOH E . 
G 7 HOH 40  426 426 HOH HOH E . 
G 7 HOH 41  429 429 HOH HOH E . 
G 7 HOH 42  440 440 HOH HOH E . 
G 7 HOH 43  465 465 HOH HOH E . 
G 7 HOH 44  466 466 HOH HOH E . 
G 7 HOH 45  475 475 HOH HOH E . 
G 7 HOH 46  476 476 HOH HOH E . 
G 7 HOH 47  477 477 HOH HOH E . 
H 7 HOH 1   17  4   HOH HOH F . 
H 7 HOH 2   18  36  HOH HOH F . 
H 7 HOH 3   19  39  HOH HOH F . 
H 7 HOH 4   20  50  HOH HOH F . 
H 7 HOH 5   21  51  HOH HOH F . 
H 7 HOH 6   22  52  HOH HOH F . 
H 7 HOH 7   23  62  HOH HOH F . 
H 7 HOH 8   24  73  HOH HOH F . 
H 7 HOH 9   25  80  HOH HOH F . 
H 7 HOH 10  26  82  HOH HOH F . 
H 7 HOH 11  27  86  HOH HOH F . 
H 7 HOH 12  28  88  HOH HOH F . 
H 7 HOH 13  29  94  HOH HOH F . 
H 7 HOH 14  30  99  HOH HOH F . 
H 7 HOH 15  31  109 HOH HOH F . 
H 7 HOH 16  32  114 HOH HOH F . 
H 7 HOH 17  33  124 HOH HOH F . 
H 7 HOH 18  34  125 HOH HOH F . 
H 7 HOH 19  35  132 HOH HOH F . 
H 7 HOH 20  36  135 HOH HOH F . 
H 7 HOH 21  37  145 HOH HOH F . 
H 7 HOH 22  38  149 HOH HOH F . 
H 7 HOH 23  39  150 HOH HOH F . 
H 7 HOH 24  40  162 HOH HOH F . 
H 7 HOH 25  41  166 HOH HOH F . 
H 7 HOH 26  42  170 HOH HOH F . 
H 7 HOH 27  43  171 HOH HOH F . 
H 7 HOH 28  44  174 HOH HOH F . 
H 7 HOH 29  45  182 HOH HOH F . 
H 7 HOH 30  46  194 HOH HOH F . 
H 7 HOH 31  47  198 HOH HOH F . 
H 7 HOH 32  48  207 HOH HOH F . 
H 7 HOH 33  49  221 HOH HOH F . 
H 7 HOH 34  50  223 HOH HOH F . 
H 7 HOH 35  51  230 HOH HOH F . 
H 7 HOH 36  52  231 HOH HOH F . 
H 7 HOH 37  53  239 HOH HOH F . 
H 7 HOH 38  54  244 HOH HOH F . 
H 7 HOH 39  55  261 HOH HOH F . 
H 7 HOH 40  56  272 HOH HOH F . 
H 7 HOH 41  57  279 HOH HOH F . 
H 7 HOH 42  58  283 HOH HOH F . 
H 7 HOH 43  59  299 HOH HOH F . 
H 7 HOH 44  60  302 HOH HOH F . 
H 7 HOH 45  61  343 HOH HOH F . 
H 7 HOH 46  62  350 HOH HOH F . 
H 7 HOH 47  63  355 HOH HOH F . 
H 7 HOH 48  64  359 HOH HOH F . 
H 7 HOH 49  65  363 HOH HOH F . 
H 7 HOH 50  66  364 HOH HOH F . 
H 7 HOH 51  67  367 HOH HOH F . 
H 7 HOH 52  68  370 HOH HOH F . 
H 7 HOH 53  69  384 HOH HOH F . 
H 7 HOH 54  70  398 HOH HOH F . 
H 7 HOH 55  71  409 HOH HOH F . 
H 7 HOH 56  72  430 HOH HOH F . 
H 7 HOH 57  73  438 HOH HOH F . 
H 7 HOH 58  74  443 HOH HOH F . 
H 7 HOH 59  75  456 HOH HOH F . 
H 7 HOH 60  76  463 HOH HOH F . 
I 7 HOH 1   241 2   HOH HOH A . 
I 7 HOH 2   242 3   HOH HOH A . 
I 7 HOH 3   243 5   HOH HOH A . 
I 7 HOH 4   244 6   HOH HOH A . 
I 7 HOH 5   245 7   HOH HOH A . 
I 7 HOH 6   246 9   HOH HOH A . 
I 7 HOH 7   247 10  HOH HOH A . 
I 7 HOH 8   248 11  HOH HOH A . 
I 7 HOH 9   249 12  HOH HOH A . 
I 7 HOH 10  250 13  HOH HOH A . 
I 7 HOH 11  251 14  HOH HOH A . 
I 7 HOH 12  252 15  HOH HOH A . 
I 7 HOH 13  253 17  HOH HOH A . 
I 7 HOH 14  254 18  HOH HOH A . 
I 7 HOH 15  255 19  HOH HOH A . 
I 7 HOH 16  256 20  HOH HOH A . 
I 7 HOH 17  257 21  HOH HOH A . 
I 7 HOH 18  258 23  HOH HOH A . 
I 7 HOH 19  259 26  HOH HOH A . 
I 7 HOH 20  260 27  HOH HOH A . 
I 7 HOH 21  261 28  HOH HOH A . 
I 7 HOH 22  262 30  HOH HOH A . 
I 7 HOH 23  263 31  HOH HOH A . 
I 7 HOH 24  264 32  HOH HOH A . 
I 7 HOH 25  265 34  HOH HOH A . 
I 7 HOH 26  266 35  HOH HOH A . 
I 7 HOH 27  267 37  HOH HOH A . 
I 7 HOH 28  268 38  HOH HOH A . 
I 7 HOH 29  269 40  HOH HOH A . 
I 7 HOH 30  270 42  HOH HOH A . 
I 7 HOH 31  271 43  HOH HOH A . 
I 7 HOH 32  272 44  HOH HOH A . 
I 7 HOH 33  273 45  HOH HOH A . 
I 7 HOH 34  274 49  HOH HOH A . 
I 7 HOH 35  275 53  HOH HOH A . 
I 7 HOH 36  276 57  HOH HOH A . 
I 7 HOH 37  277 59  HOH HOH A . 
I 7 HOH 38  278 60  HOH HOH A . 
I 7 HOH 39  279 64  HOH HOH A . 
I 7 HOH 40  280 68  HOH HOH A . 
I 7 HOH 41  281 71  HOH HOH A . 
I 7 HOH 42  282 72  HOH HOH A . 
I 7 HOH 43  283 74  HOH HOH A . 
I 7 HOH 44  284 75  HOH HOH A . 
I 7 HOH 45  285 76  HOH HOH A . 
I 7 HOH 46  286 78  HOH HOH A . 
I 7 HOH 47  287 83  HOH HOH A . 
I 7 HOH 48  288 87  HOH HOH A . 
I 7 HOH 49  289 90  HOH HOH A . 
I 7 HOH 50  290 92  HOH HOH A . 
I 7 HOH 51  291 95  HOH HOH A . 
I 7 HOH 52  292 96  HOH HOH A . 
I 7 HOH 53  293 97  HOH HOH A . 
I 7 HOH 54  294 102 HOH HOH A . 
I 7 HOH 55  295 103 HOH HOH A . 
I 7 HOH 56  296 105 HOH HOH A . 
I 7 HOH 57  297 108 HOH HOH A . 
I 7 HOH 58  298 110 HOH HOH A . 
I 7 HOH 59  299 112 HOH HOH A . 
I 7 HOH 60  300 115 HOH HOH A . 
I 7 HOH 61  301 119 HOH HOH A . 
I 7 HOH 62  302 121 HOH HOH A . 
I 7 HOH 63  303 122 HOH HOH A . 
I 7 HOH 64  304 123 HOH HOH A . 
I 7 HOH 65  305 126 HOH HOH A . 
I 7 HOH 66  306 129 HOH HOH A . 
I 7 HOH 67  307 131 HOH HOH A . 
I 7 HOH 68  308 133 HOH HOH A . 
I 7 HOH 69  309 134 HOH HOH A . 
I 7 HOH 70  310 136 HOH HOH A . 
I 7 HOH 71  311 140 HOH HOH A . 
I 7 HOH 72  312 142 HOH HOH A . 
I 7 HOH 73  313 143 HOH HOH A . 
I 7 HOH 74  314 148 HOH HOH A . 
I 7 HOH 75  315 156 HOH HOH A . 
I 7 HOH 76  316 157 HOH HOH A . 
I 7 HOH 77  317 158 HOH HOH A . 
I 7 HOH 78  318 159 HOH HOH A . 
I 7 HOH 79  319 160 HOH HOH A . 
I 7 HOH 80  320 167 HOH HOH A . 
I 7 HOH 81  321 172 HOH HOH A . 
I 7 HOH 82  322 173 HOH HOH A . 
I 7 HOH 83  323 179 HOH HOH A . 
I 7 HOH 84  324 180 HOH HOH A . 
I 7 HOH 85  325 185 HOH HOH A . 
I 7 HOH 86  326 189 HOH HOH A . 
I 7 HOH 87  327 192 HOH HOH A . 
I 7 HOH 88  328 193 HOH HOH A . 
I 7 HOH 89  329 196 HOH HOH A . 
I 7 HOH 90  330 200 HOH HOH A . 
I 7 HOH 91  331 202 HOH HOH A . 
I 7 HOH 92  332 203 HOH HOH A . 
I 7 HOH 93  333 204 HOH HOH A . 
I 7 HOH 94  334 210 HOH HOH A . 
I 7 HOH 95  335 211 HOH HOH A . 
I 7 HOH 96  336 212 HOH HOH A . 
I 7 HOH 97  337 214 HOH HOH A . 
I 7 HOH 98  338 215 HOH HOH A . 
I 7 HOH 99  339 219 HOH HOH A . 
I 7 HOH 100 340 220 HOH HOH A . 
I 7 HOH 101 341 222 HOH HOH A . 
I 7 HOH 102 342 224 HOH HOH A . 
I 7 HOH 103 343 225 HOH HOH A . 
I 7 HOH 104 344 226 HOH HOH A . 
I 7 HOH 105 345 227 HOH HOH A . 
I 7 HOH 106 346 228 HOH HOH A . 
I 7 HOH 107 347 229 HOH HOH A . 
I 7 HOH 108 348 234 HOH HOH A . 
I 7 HOH 109 349 236 HOH HOH A . 
I 7 HOH 110 350 237 HOH HOH A . 
I 7 HOH 111 351 238 HOH HOH A . 
I 7 HOH 112 352 241 HOH HOH A . 
I 7 HOH 113 353 247 HOH HOH A . 
I 7 HOH 114 354 248 HOH HOH A . 
I 7 HOH 115 355 249 HOH HOH A . 
I 7 HOH 116 356 254 HOH HOH A . 
I 7 HOH 117 357 257 HOH HOH A . 
I 7 HOH 118 358 259 HOH HOH A . 
I 7 HOH 119 359 263 HOH HOH A . 
I 7 HOH 120 360 264 HOH HOH A . 
I 7 HOH 121 361 266 HOH HOH A . 
I 7 HOH 122 362 267 HOH HOH A . 
I 7 HOH 123 363 269 HOH HOH A . 
I 7 HOH 124 364 274 HOH HOH A . 
I 7 HOH 125 365 275 HOH HOH A . 
I 7 HOH 126 366 276 HOH HOH A . 
I 7 HOH 127 367 278 HOH HOH A . 
I 7 HOH 128 368 280 HOH HOH A . 
I 7 HOH 129 369 281 HOH HOH A . 
I 7 HOH 130 370 282 HOH HOH A . 
I 7 HOH 131 371 288 HOH HOH A . 
I 7 HOH 132 372 292 HOH HOH A . 
I 7 HOH 133 373 293 HOH HOH A . 
I 7 HOH 134 374 298 HOH HOH A . 
I 7 HOH 135 375 301 HOH HOH A . 
I 7 HOH 136 376 303 HOH HOH A . 
I 7 HOH 137 377 305 HOH HOH A . 
I 7 HOH 138 378 307 HOH HOH A . 
I 7 HOH 139 379 311 HOH HOH A . 
I 7 HOH 140 380 314 HOH HOH A . 
I 7 HOH 141 381 315 HOH HOH A . 
I 7 HOH 142 382 317 HOH HOH A . 
I 7 HOH 143 383 318 HOH HOH A . 
I 7 HOH 144 384 319 HOH HOH A . 
I 7 HOH 145 385 322 HOH HOH A . 
I 7 HOH 146 386 325 HOH HOH A . 
I 7 HOH 147 387 329 HOH HOH A . 
I 7 HOH 148 388 330 HOH HOH A . 
I 7 HOH 149 389 331 HOH HOH A . 
I 7 HOH 150 390 335 HOH HOH A . 
I 7 HOH 151 391 341 HOH HOH A . 
I 7 HOH 152 392 342 HOH HOH A . 
I 7 HOH 153 393 344 HOH HOH A . 
I 7 HOH 154 394 346 HOH HOH A . 
I 7 HOH 155 395 348 HOH HOH A . 
I 7 HOH 156 396 351 HOH HOH A . 
I 7 HOH 157 397 352 HOH HOH A . 
I 7 HOH 158 398 353 HOH HOH A . 
I 7 HOH 159 399 354 HOH HOH A . 
I 7 HOH 160 400 356 HOH HOH A . 
I 7 HOH 161 401 357 HOH HOH A . 
I 7 HOH 162 402 358 HOH HOH A . 
I 7 HOH 163 403 362 HOH HOH A . 
I 7 HOH 164 404 365 HOH HOH A . 
I 7 HOH 165 405 366 HOH HOH A . 
I 7 HOH 166 406 368 HOH HOH A . 
I 7 HOH 167 407 373 HOH HOH A . 
I 7 HOH 168 408 374 HOH HOH A . 
I 7 HOH 169 409 375 HOH HOH A . 
I 7 HOH 170 410 377 HOH HOH A . 
I 7 HOH 171 411 378 HOH HOH A . 
I 7 HOH 172 412 379 HOH HOH A . 
I 7 HOH 173 413 387 HOH HOH A . 
I 7 HOH 174 414 388 HOH HOH A . 
I 7 HOH 175 415 389 HOH HOH A . 
I 7 HOH 176 416 391 HOH HOH A . 
I 7 HOH 177 417 393 HOH HOH A . 
I 7 HOH 178 418 394 HOH HOH A . 
I 7 HOH 179 419 396 HOH HOH A . 
I 7 HOH 180 420 401 HOH HOH A . 
I 7 HOH 181 421 402 HOH HOH A . 
I 7 HOH 182 422 404 HOH HOH A . 
I 7 HOH 183 423 406 HOH HOH A . 
I 7 HOH 184 424 410 HOH HOH A . 
I 7 HOH 185 425 411 HOH HOH A . 
I 7 HOH 186 426 413 HOH HOH A . 
I 7 HOH 187 427 416 HOH HOH A . 
I 7 HOH 188 428 419 HOH HOH A . 
I 7 HOH 189 429 424 HOH HOH A . 
I 7 HOH 190 430 427 HOH HOH A . 
I 7 HOH 191 431 428 HOH HOH A . 
I 7 HOH 192 432 431 HOH HOH A . 
I 7 HOH 193 433 432 HOH HOH A . 
I 7 HOH 194 434 435 HOH HOH A . 
I 7 HOH 195 435 436 HOH HOH A . 
I 7 HOH 196 436 442 HOH HOH A . 
I 7 HOH 197 437 451 HOH HOH A . 
I 7 HOH 198 438 454 HOH HOH A . 
I 7 HOH 199 439 455 HOH HOH A . 
I 7 HOH 200 440 459 HOH HOH A . 
I 7 HOH 201 441 460 HOH HOH A . 
I 7 HOH 202 442 461 HOH HOH A . 
I 7 HOH 203 443 462 HOH HOH A . 
I 7 HOH 204 444 464 HOH HOH A . 
I 7 HOH 205 445 467 HOH HOH A . 
I 7 HOH 206 446 468 HOH HOH A . 
I 7 HOH 207 447 469 HOH HOH A . 
I 7 HOH 208 448 471 HOH HOH A . 
I 7 HOH 209 449 472 HOH HOH A . 
J 7 HOH 1   55  54  HOH HOH B . 
J 7 HOH 2   56  139 HOH HOH B . 
J 7 HOH 3   57  169 HOH HOH B . 
J 7 HOH 4   58  201 HOH HOH B . 
J 7 HOH 5   59  240 HOH HOH B . 
J 7 HOH 6   60  243 HOH HOH B . 
J 7 HOH 7   61  251 HOH HOH B . 
J 7 HOH 8   62  252 HOH HOH B . 
J 7 HOH 9   63  284 HOH HOH B . 
J 7 HOH 10  64  286 HOH HOH B . 
J 7 HOH 11  65  290 HOH HOH B . 
J 7 HOH 12  66  316 HOH HOH B . 
J 7 HOH 13  67  324 HOH HOH B . 
J 7 HOH 14  68  337 HOH HOH B . 
J 7 HOH 15  69  340 HOH HOH B . 
J 7 HOH 16  70  372 HOH HOH B . 
J 7 HOH 17  71  403 HOH HOH B . 
J 7 HOH 18  72  407 HOH HOH B . 
J 7 HOH 19  73  415 HOH HOH B . 
J 7 HOH 20  74  420 HOH HOH B . 
J 7 HOH 21  75  434 HOH HOH B . 
J 7 HOH 22  76  444 HOH HOH B . 
J 7 HOH 23  77  446 HOH HOH B . 
J 7 HOH 24  78  457 HOH HOH B . 
J 7 HOH 25  79  470 HOH HOH B . 
K 7 HOH 1   287 16  HOH HOH C . 
K 7 HOH 2   288 24  HOH HOH C . 
K 7 HOH 3   289 25  HOH HOH C . 
K 7 HOH 4   290 41  HOH HOH C . 
K 7 HOH 5   291 47  HOH HOH C . 
K 7 HOH 6   292 79  HOH HOH C . 
K 7 HOH 7   293 84  HOH HOH C . 
K 7 HOH 8   294 138 HOH HOH C . 
K 7 HOH 9   295 144 HOH HOH C . 
K 7 HOH 10  296 176 HOH HOH C . 
K 7 HOH 11  297 177 HOH HOH C . 
K 7 HOH 12  298 178 HOH HOH C . 
K 7 HOH 13  299 181 HOH HOH C . 
K 7 HOH 14  300 187 HOH HOH C . 
K 7 HOH 15  301 190 HOH HOH C . 
K 7 HOH 16  302 197 HOH HOH C . 
K 7 HOH 17  303 199 HOH HOH C . 
K 7 HOH 18  304 205 HOH HOH C . 
K 7 HOH 19  305 206 HOH HOH C . 
K 7 HOH 20  306 208 HOH HOH C . 
K 7 HOH 21  307 213 HOH HOH C . 
K 7 HOH 22  308 216 HOH HOH C . 
K 7 HOH 23  309 217 HOH HOH C . 
K 7 HOH 24  310 233 HOH HOH C . 
K 7 HOH 25  311 242 HOH HOH C . 
K 7 HOH 26  312 287 HOH HOH C . 
K 7 HOH 27  313 291 HOH HOH C . 
K 7 HOH 28  314 306 HOH HOH C . 
K 7 HOH 29  315 313 HOH HOH C . 
K 7 HOH 30  316 333 HOH HOH C . 
K 7 HOH 31  317 347 HOH HOH C . 
K 7 HOH 32  318 371 HOH HOH C . 
K 7 HOH 33  319 385 HOH HOH C . 
K 7 HOH 34  320 390 HOH HOH C . 
K 7 HOH 35  321 405 HOH HOH C . 
K 7 HOH 36  322 412 HOH HOH C . 
K 7 HOH 37  323 417 HOH HOH C . 
K 7 HOH 38  324 437 HOH HOH C . 
K 7 HOH 39  325 441 HOH HOH C . 
K 7 HOH 40  326 448 HOH HOH C . 
K 7 HOH 41  327 474 HOH HOH C . 
L 7 HOH 1   123 1   HOH HOH D . 
L 7 HOH 2   124 8   HOH HOH D . 
L 7 HOH 3   125 22  HOH HOH D . 
L 7 HOH 4   126 29  HOH HOH D . 
L 7 HOH 5   127 48  HOH HOH D . 
L 7 HOH 6   128 56  HOH HOH D . 
L 7 HOH 7   129 58  HOH HOH D . 
L 7 HOH 8   130 61  HOH HOH D . 
L 7 HOH 9   131 63  HOH HOH D . 
L 7 HOH 10  132 65  HOH HOH D . 
L 7 HOH 11  133 69  HOH HOH D . 
L 7 HOH 12  134 70  HOH HOH D . 
L 7 HOH 13  135 81  HOH HOH D . 
L 7 HOH 14  136 85  HOH HOH D . 
L 7 HOH 15  137 91  HOH HOH D . 
L 7 HOH 16  138 93  HOH HOH D . 
L 7 HOH 17  139 98  HOH HOH D . 
L 7 HOH 18  140 100 HOH HOH D . 
L 7 HOH 19  141 101 HOH HOH D . 
L 7 HOH 20  142 106 HOH HOH D . 
L 7 HOH 21  143 107 HOH HOH D . 
L 7 HOH 22  144 111 HOH HOH D . 
L 7 HOH 23  145 113 HOH HOH D . 
L 7 HOH 24  146 117 HOH HOH D . 
L 7 HOH 25  147 118 HOH HOH D . 
L 7 HOH 26  148 120 HOH HOH D . 
L 7 HOH 27  149 127 HOH HOH D . 
L 7 HOH 28  150 128 HOH HOH D . 
L 7 HOH 29  151 130 HOH HOH D . 
L 7 HOH 30  152 137 HOH HOH D . 
L 7 HOH 31  153 141 HOH HOH D . 
L 7 HOH 32  154 146 HOH HOH D . 
L 7 HOH 33  155 147 HOH HOH D . 
L 7 HOH 34  156 151 HOH HOH D . 
L 7 HOH 35  157 153 HOH HOH D . 
L 7 HOH 36  158 154 HOH HOH D . 
L 7 HOH 37  159 163 HOH HOH D . 
L 7 HOH 38  160 183 HOH HOH D . 
L 7 HOH 39  161 184 HOH HOH D . 
L 7 HOH 40  162 188 HOH HOH D . 
L 7 HOH 41  163 191 HOH HOH D . 
L 7 HOH 42  164 195 HOH HOH D . 
L 7 HOH 43  165 209 HOH HOH D . 
L 7 HOH 44  166 232 HOH HOH D . 
L 7 HOH 45  167 235 HOH HOH D . 
L 7 HOH 46  168 250 HOH HOH D . 
L 7 HOH 47  169 253 HOH HOH D . 
L 7 HOH 48  170 255 HOH HOH D . 
L 7 HOH 49  171 256 HOH HOH D . 
L 7 HOH 50  172 258 HOH HOH D . 
L 7 HOH 51  173 262 HOH HOH D . 
L 7 HOH 52  174 265 HOH HOH D . 
L 7 HOH 53  175 268 HOH HOH D . 
L 7 HOH 54  176 270 HOH HOH D . 
L 7 HOH 55  177 271 HOH HOH D . 
L 7 HOH 56  178 273 HOH HOH D . 
L 7 HOH 57  179 285 HOH HOH D . 
L 7 HOH 58  180 295 HOH HOH D . 
L 7 HOH 59  181 297 HOH HOH D . 
L 7 HOH 60  182 309 HOH HOH D . 
L 7 HOH 61  183 312 HOH HOH D . 
L 7 HOH 62  184 320 HOH HOH D . 
L 7 HOH 63  185 323 HOH HOH D . 
L 7 HOH 64  186 326 HOH HOH D . 
L 7 HOH 65  187 327 HOH HOH D . 
L 7 HOH 66  188 328 HOH HOH D . 
L 7 HOH 67  189 336 HOH HOH D . 
L 7 HOH 68  190 345 HOH HOH D . 
L 7 HOH 69  191 349 HOH HOH D . 
L 7 HOH 70  192 369 HOH HOH D . 
L 7 HOH 71  193 376 HOH HOH D . 
L 7 HOH 72  194 380 HOH HOH D . 
L 7 HOH 73  195 381 HOH HOH D . 
L 7 HOH 74  196 382 HOH HOH D . 
L 7 HOH 75  197 383 HOH HOH D . 
L 7 HOH 76  198 386 HOH HOH D . 
L 7 HOH 77  199 392 HOH HOH D . 
L 7 HOH 78  200 395 HOH HOH D . 
L 7 HOH 79  201 397 HOH HOH D . 
L 7 HOH 80  202 399 HOH HOH D . 
L 7 HOH 81  203 400 HOH HOH D . 
L 7 HOH 82  204 408 HOH HOH D . 
L 7 HOH 83  205 418 HOH HOH D . 
L 7 HOH 84  206 421 HOH HOH D . 
L 7 HOH 85  207 422 HOH HOH D . 
L 7 HOH 86  208 433 HOH HOH D . 
L 7 HOH 87  209 439 HOH HOH D . 
L 7 HOH 88  210 445 HOH HOH D . 
L 7 HOH 89  211 447 HOH HOH D . 
L 7 HOH 90  212 449 HOH HOH D . 
L 7 HOH 91  213 450 HOH HOH D . 
L 7 HOH 92  214 452 HOH HOH D . 
L 7 HOH 93  215 453 HOH HOH D . 
L 7 HOH 94  216 458 HOH HOH D . 
L 7 HOH 95  217 473 HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A 5IU 5  E 5IU 5  ? DU "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
2 A 5IU 11 E 5IU 11 ? DU "5-IODO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-10-21 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS       refinement       0.9 ? 1 
DENZO     'data reduction' .   ? 2 
SCALEPACK 'data scaling'   .   ? 3 
AMoRE     phasing          .   ? 4 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" E DG 6 ? ? "C1'" E DG 6 ? ? N9 E DG 6 ? ? 110.78 108.30 2.48 0.30 N 
2 1 "O4'" F DT 7 ? ? "C1'" F DT 7 ? ? N1 F DT 7 ? ? 110.23 108.30 1.93 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP B 31  ? ? 146.58  132.29  
2 1 CYS C 246 ? ? -163.84 -165.82 
3 1 LYS C 255 ? ? 56.38   -121.74 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DA 
_pdbx_validate_planes.auth_asym_id    F 
_pdbx_validate_planes.auth_seq_id     14 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.057 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 D ASP 89  ? CG  ? F ASP 88  CG  
2 1 Y 1 D ASP 89  ? OD1 ? F ASP 88  OD1 
3 1 Y 1 D ASP 89  ? OD2 ? F ASP 88  OD2 
4 1 Y 1 D LYS 120 ? CG  ? F LYS 119 CG  
5 1 Y 1 D LYS 120 ? CD  ? F LYS 119 CD  
6 1 Y 1 D LYS 120 ? CE  ? F LYS 119 CE  
7 1 Y 1 D LYS 120 ? NZ  ? F LYS 119 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B SER 2   ? D SER 1   
2  1 Y 1 B THR 49  ? D THR 48  
3  1 Y 1 B LYS 50  ? D LYS 49  
4  1 Y 1 B VAL 51  ? D VAL 50  
5  1 Y 1 B THR 52  ? D THR 51  
6  1 Y 1 B THR 53  ? D THR 52  
7  1 Y 1 B PHE 54  ? D PHE 53  
8  1 Y 1 C GLY 208 ? E GLY 1   
9  1 Y 1 C SER 209 ? E SER 2   
10 1 Y 1 C SER 210 ? E SER 3   
11 1 Y 1 C ALA 211 ? E ALA 4   
12 1 Y 1 C LEU 212 ? E LEU 5   
13 1 Y 1 C LEU 213 ? E LEU 6   
14 1 Y 1 C ASP 214 ? E ASP 7   
15 1 Y 1 C THR 215 ? E THR 8   
16 1 Y 1 C ASP 216 ? E ASP 9   
17 1 Y 1 C GLU 217 ? E GLU 10  
18 1 Y 1 C VAL 218 ? E VAL 11  
19 1 Y 1 C GLY 219 ? E GLY 12  
20 1 Y 1 C SER 220 ? E SER 13  
21 1 Y 1 C GLU 221 ? E GLU 14  
22 1 Y 1 C LEU 222 ? E LEU 15  
23 1 Y 1 C ASP 223 ? E ASP 16  
24 1 Y 1 C ASP 224 ? E ASP 17  
25 1 Y 1 C SER 225 ? E SER 18  
26 1 Y 1 C ASP 226 ? E ASP 19  
27 1 Y 1 C ASP 227 ? E ASP 20  
28 1 Y 1 C SER 232 ? E SER 25  
29 1 Y 1 C GLU 233 ? E GLU 26  
30 1 Y 1 C GLY 234 ? E GLY 27  
31 1 Y 1 C GLU 235 ? E GLU 28  
32 1 Y 1 C GLU 236 ? E GLU 29  
33 1 Y 1 C ASP 237 ? E ASP 30  
34 1 Y 1 C GLY 238 ? E GLY 31  
35 1 Y 1 C PRO 239 ? E PRO 32  
36 1 Y 1 C ASP 240 ? E ASP 33  
37 1 Y 1 D ALA 2   ? F ALA 1   
38 1 Y 1 D VAL 3   ? F VAL 2   
39 1 Y 1 D PRO 4   ? F PRO 3   
40 1 Y 1 D SER 90  ? F SER 89  
41 1 Y 1 D HIS 91  ? F HIS 90  
42 1 Y 1 D ARG 92  ? F ARG 91  
43 1 Y 1 D ASP 93  ? F ASP 92  
44 1 Y 1 D ALA 94  ? F ALA 93  
45 1 Y 1 D SER 95  ? F SER 94  
46 1 Y 1 D GLN 96  ? F GLN 95  
47 1 Y 1 D ASN 97  ? F ASN 96  
48 1 Y 1 D GLY 98  ? F GLY 97  
49 1 Y 1 D SER 99  ? F SER 98  
50 1 Y 1 D GLY 100 ? F GLY 99  
51 1 Y 1 D ASP 101 ? F ASP 100 
52 1 Y 1 D SER 102 ? F SER 101 
53 1 Y 1 D GLU 122 ? F GLU 121 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1NH2 'double helix'        
1NH2 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DT  1  1_555 B DA 16 1_555 0.091  -0.083 0.147  -11.554 -7.328  -3.969 1  E_DT1:DA16_F  E 1  ? F 16 ? 20 1 
1 A DG  2  1_555 B DC 15 1_555 -0.151 0.146  -0.065 -2.869  -0.766  -1.027 2  E_DG2:DC15_F  E 2  ? F 15 ? 19 1 
1 A DT  3  1_555 B DA 14 1_555 -0.013 0.022  0.099  8.696   -11.531 3.620  3  E_DT3:DA14_F  E 3  ? F 14 ? 20 1 
1 A DA  4  1_555 B DT 13 1_555 0.098  -0.077 -0.233 -2.205  -4.179  3.827  4  E_DA4:DT13_F  E 4  ? F 13 ? 20 1 
1 A 5IU 5  1_555 B DA 12 1_555 0.292  -0.007 0.042  9.156   -11.889 9.405  5  E_5IU5:DA12_F E 5  ? F 12 ? 20 1 
1 A DG  6  1_555 B DC 11 1_555 -0.185 -0.089 -0.252 -16.872 -10.014 2.988  6  E_DG6:DC11_F  E 6  ? F 11 ? 19 1 
1 A DT  7  1_555 B DA 10 1_555 0.009  -0.106 0.020  -12.383 -6.738  2.344  7  E_DT7:DA10_F  E 7  ? F 10 ? 20 1 
1 A DA  8  1_555 B DT 9  1_555 0.004  -0.143 0.001  -11.027 -10.333 3.224  8  E_DA8:DT9_F   E 8  ? F 9  ? 20 1 
1 A DT  9  1_555 B DA 8  1_555 0.044  -0.115 -0.095 2.118   -0.752  8.519  9  E_DT9:DA8_F   E 9  ? F 8  ? 20 1 
1 A DA  10 1_555 B DT 7  1_555 0.244  0.070  -0.353 -41.440 14.677  7.516  10 E_DA10:DT7_F  E 10 ? F 7  ? 20 1 
1 A 5IU 11 1_555 B DA 6  1_555 0.080  0.051  0.097  -29.950 -9.301  4.338  11 E_5IU11:DA6_F E 11 ? F 6  ? 20 1 
1 A DA  12 1_555 B DT 5  1_555 0.017  -0.092 -0.476 -0.053  -0.804  6.484  12 E_DA12:DT5_F  E 12 ? F 5  ? 20 1 
1 A DA  13 1_555 B DT 4  1_555 -0.060 -0.046 -0.080 15.105  2.744   7.004  13 E_DA13:DT4_F  E 13 ? F 4  ? 20 1 
1 A DA  14 1_555 B DT 3  1_555 -0.054 -0.026 -0.057 27.033  -3.204  5.334  14 E_DA14:DT3_F  E 14 ? F 3  ? 20 1 
1 A DA  15 1_555 B DT 2  1_555 0.125  0.072  0.415  43.029  -8.448  7.011  15 E_DA15:DT2_F  E 15 ? F 2  ? 20 1 
1 A DC  16 1_555 B DG 1  1_555 0.049  -0.034 -0.113 2.892   -2.014  -1.212 16 E_DC16:DG1_F  E 16 ? F 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT  1  1_555 B DA 16 1_555 A DG  2  1_555 B DC 15 1_555 -0.198 0.831  3.098 -2.286 1.547  32.667 1.218  -0.025 3.139 2.745  
4.055  32.780 1  EE_DT1DG2:DC15DA16_FF  E 1  ? F 16 ? E 2  ? F 15 ? 
1 A DG  2  1_555 B DC 15 1_555 A DT  3  1_555 B DA 14 1_555 0.037  -0.442 3.047 -2.953 4.859  34.465 -1.414 -0.473 2.946 8.132  
4.942  34.917 2  EE_DG2DT3:DA14DC15_FF  E 2  ? F 15 ? E 3  ? F 14 ? 
1 A DT  3  1_555 B DA 14 1_555 A DA  4  1_555 B DT 13 1_555 0.341  -0.551 3.529 3.361  3.971  33.113 -1.657 0.002  3.459 6.913  
-5.851 33.508 3  EE_DT3DA4:DT13DA14_FF  E 3  ? F 14 ? E 4  ? F 13 ? 
1 A DA  4  1_555 B DT 13 1_555 A 5IU 5  1_555 B DA 12 1_555 0.783  -0.630 3.008 -0.738 6.206  28.057 -2.520 -1.726 2.786 12.603 
1.500  28.731 4  EE_DA45IU5:DA12DT13_FF E 4  ? F 13 ? E 5  ? F 12 ? 
1 A 5IU 5  1_555 B DA 12 1_555 A DG  6  1_555 B DC 11 1_555 -0.318 -0.779 3.716 1.093  8.770  37.152 -2.421 0.640  3.441 13.530 
-1.686 38.153 5  EE_5IU5DG6:DC11DA12_FF E 5  ? F 12 ? E 6  ? F 11 ? 
1 A DG  6  1_555 B DC 11 1_555 A DT  7  1_555 B DA 10 1_555 -0.630 -0.864 3.148 -0.901 2.322  32.333 -1.938 0.976  3.096 4.162  
1.614  32.426 6  EE_DG6DT7:DA10DC11_FF  E 6  ? F 11 ? E 7  ? F 10 ? 
1 A DT  7  1_555 B DA 10 1_555 A DA  8  1_555 B DT 9  1_555 0.521  -0.682 3.353 -1.183 8.296  31.209 -2.693 -1.147 3.054 15.081 
2.151  32.287 7  EE_DT7DA8:DT9DA10_FF   E 7  ? F 10 ? E 8  ? F 9  ? 
1 A DA  8  1_555 B DT 9  1_555 A DT  9  1_555 B DA 8  1_555 0.810  -0.597 3.055 2.853  0.332  32.129 -1.130 -0.979 3.107 0.599  
-5.142 32.254 8  EE_DA8DT9:DA8DT9_FF    E 8  ? F 9  ? E 9  ? F 8  ? 
1 A DT  9  1_555 B DA 8  1_555 A DA  10 1_555 B DT 7  1_555 0.174  -0.769 5.056 -1.515 48.964 18.354 -5.674 -0.346 1.114 70.673 
2.186  52.113 9  EE_DT9DA10:DT7DA8_FF   E 9  ? F 8  ? E 10 ? F 7  ? 
1 A DA  10 1_555 B DT 7  1_555 A 5IU 11 1_555 B DA 6  1_555 -1.398 -0.410 3.404 1.048  21.473 16.836 -6.141 3.225  1.741 52.300 
-2.553 27.245 10 EE_DA105IU11:DA6DT7_FF E 10 ? F 7  ? E 11 ? F 6  ? 
1 A 5IU 11 1_555 B DA 6  1_555 A DA  12 1_555 B DT 5  1_555 -0.201 2.137  2.884 2.732  6.693  23.432 3.025  1.293  3.313 16.000 
-6.530 24.507 11 EE_5IU11DA12:DT5DA6_FF E 11 ? F 6  ? E 12 ? F 5  ? 
1 A DA  12 1_555 B DT 5  1_555 A DA  13 1_555 B DT 4  1_555 0.322  1.350  3.195 -2.454 24.212 10.750 -5.059 -1.510 2.500 66.179 
6.707  26.572 12 EE_DA12DA13:DT4DT5_FF  E 12 ? F 5  ? E 13 ? F 4  ? 
1 A DA  13 1_555 B DT 4  1_555 A DA  14 1_555 B DT 3  1_555 -0.234 1.353  3.469 2.070  21.654 18.949 -3.378 1.055  3.290 49.189 
-4.702 28.773 13 EE_DA13DA14:DT3DT4_FF  E 13 ? F 4  ? E 14 ? F 3  ? 
1 A DA  14 1_555 B DT 3  1_555 A DA  15 1_555 B DT 2  1_555 0.385  0.485  3.202 0.681  13.531 24.021 -2.373 -0.638 3.045 29.682 
-1.493 27.529 14 EE_DA14DA15:DT2DT3_FF  E 14 ? F 3  ? E 15 ? F 2  ? 
1 A DA  15 1_555 B DT 2  1_555 A DC  16 1_555 B DG 1  1_555 0.037  -1.491 5.144 -0.466 38.545 30.706 -5.927 -0.094 2.143 52.865 
0.639  48.916 15 EE_DA15DC16:DG1DT2_FF  E 15 ? F 2  ? E 16 ? F 1  ? 
# 
_pdbx_entity_nonpoly.entity_id   7 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#