data_1NH3
# 
_entry.id   1NH3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1NH3         
NDB   PD0370       
RCSB  RCSB017864   
WWPDB D_1000017864 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1A31 'HUMAN RECONSTITUTED TOPOISOMERASE I IN COVALENT COMPLEX WITH 22 BASE PAIR DNA OLIGONUCLEOTIDE' unspecified 
PDB 1EJ9 'CRYSTAL STRUCTURE OF HUMAN TOPOISOMERASE I DNA COMPLEX' unspecified 
PDB 1LPQ 'HUMAN TOPOISOMERASE I IN NONCOVALENT COMPLEX WITH A 22 BASE PAIR DNA DUPLEX CONTAINING AN 8-OXO-G LESION' unspecified 
PDB 1K4T 
'Human DNA Topoisomerase I (70 Kda) In Complex With The Poison Topotecan and Covalent Complex With A 22 Base Pair DNA Duplex' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1NH3 
_pdbx_database_status.recvd_initial_deposition_date   2002-12-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chrencik, J.E.' 1 
'Burgin, A.B.'   2 
'Pommier, Y.'    3 
'Stewart, L.'    4 
'Redinbo, M.R.'  5 
# 
_citation.id                        primary 
_citation.title                     
'Structural Impact of the Leukemia Drug 1-beta-D-Arabinofuranosylcytosine (Ara-C) on the Covalent Human Topoisomerase I-DNA Complex' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            278 
_citation.page_first                12461 
_citation.page_last                 12466 
_citation.year                      2003 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   12533542 
_citation.pdbx_database_id_DOI      10.1074/jbc.M212930200 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chrencik, J.E.' 1 
primary 'Burgin, A.B.'   2 
primary 'Pommier, Y.'    3 
primary 'Stewart, L.'    4 
primary 'Redinbo, M.R.'  5 
# 
_cell.entry_id           1NH3 
_cell.length_a           72.97 
_cell.length_b           72.97 
_cell.length_c           186.29 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        120 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              3 
# 
_symmetry.entry_id                         1NH3 
_symmetry.space_group_name_H-M             'P 32' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                145 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*AP*AP*AP*AP*AP*GP*AP*CP*UP*(UBB))-3'"                                     3017.004  1  ?        ? ? ? 
2 polymer syn "5'-D(*(GNG)P*GP*AP*AP*AP*AP*AP*UP*UP*UP*UP*T)-3'"                               3564.368  1  ?        ? ? ? 
3 polymer syn "5'-D(*AP*AP*AP*AP*AP*TP*UP*UP*UP*UP*CP*(CAR)P*AP*AP*GP*UP*CP*UP*UP*UP*UP*T)-3'" 6580.128  1  ?        ? ? ? 
4 polymer man 'DNA topoisomerase I'                                                            66733.867 1  5.99.1.2 ? 
'Core Subdomain, C-Terminal Domain' ? 
5 water   nat water                                                                            18.015    33 ?        ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide                             no yes '(DA)(DA)(DA)(DA)(DA)(DG)(DA)(DC)(DU)(UBB)' AAAAAGACUX B ? 
2 polydeoxyribonucleotide                             no yes '(GNG)(DG)(DA)(DA)(DA)(DA)(DA)(DU)(DU)(DU)(DU)(DT)' XGAAAAAUUUUT C ? 
3 'polydeoxyribonucleotide/polyribonucleotide hybrid' no yes 
;(DA)(DA)(DA)(DA)(DA)(DT)(DU)(DU)(DU)(DU)(DC)(CAR)(DA)(DA)(DG)(DU)(DC)(DU)(DU)
(DU)(DU)(DT)
;
AAAAATUUUUCCAAGUCUUUUT D ? 
4 'polypeptide(L)'                                    no yes 
;WKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDW
RKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFR
GRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQ
KYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQE
YVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQL
KELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKK
VVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLN(PTR)LDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDM
ADEDYEF
;
;WKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDW
RKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFR
GRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQ
KYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQE
YVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQL
KELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKK
VVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADED
YEF
;
A ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DA  n 
1 3   DA  n 
1 4   DA  n 
1 5   DA  n 
1 6   DG  n 
1 7   DA  n 
1 8   DC  n 
1 9   DU  n 
1 10  UBB n 
2 1   GNG n 
2 2   DG  n 
2 3   DA  n 
2 4   DA  n 
2 5   DA  n 
2 6   DA  n 
2 7   DA  n 
2 8   DU  n 
2 9   DU  n 
2 10  DU  n 
2 11  DU  n 
2 12  DT  n 
3 1   DA  n 
3 2   DA  n 
3 3   DA  n 
3 4   DA  n 
3 5   DA  n 
3 6   DT  n 
3 7   DU  n 
3 8   DU  n 
3 9   DU  n 
3 10  DU  n 
3 11  DC  n 
3 12  CAR n 
3 13  DA  n 
3 14  DA  n 
3 15  DG  n 
3 16  DU  n 
3 17  DC  n 
3 18  DU  n 
3 19  DU  n 
3 20  DU  n 
3 21  DU  n 
3 22  DT  n 
4 1   TRP n 
4 2   LYS n 
4 3   TRP n 
4 4   TRP n 
4 5   GLU n 
4 6   GLU n 
4 7   GLU n 
4 8   ARG n 
4 9   TYR n 
4 10  PRO n 
4 11  GLU n 
4 12  GLY n 
4 13  ILE n 
4 14  LYS n 
4 15  TRP n 
4 16  LYS n 
4 17  PHE n 
4 18  LEU n 
4 19  GLU n 
4 20  HIS n 
4 21  LYS n 
4 22  GLY n 
4 23  PRO n 
4 24  VAL n 
4 25  PHE n 
4 26  ALA n 
4 27  PRO n 
4 28  PRO n 
4 29  TYR n 
4 30  GLU n 
4 31  PRO n 
4 32  LEU n 
4 33  PRO n 
4 34  GLU n 
4 35  ASN n 
4 36  VAL n 
4 37  LYS n 
4 38  PHE n 
4 39  TYR n 
4 40  TYR n 
4 41  ASP n 
4 42  GLY n 
4 43  LYS n 
4 44  VAL n 
4 45  MET n 
4 46  LYS n 
4 47  LEU n 
4 48  SER n 
4 49  PRO n 
4 50  LYS n 
4 51  ALA n 
4 52  GLU n 
4 53  GLU n 
4 54  VAL n 
4 55  ALA n 
4 56  THR n 
4 57  PHE n 
4 58  PHE n 
4 59  ALA n 
4 60  LYS n 
4 61  MET n 
4 62  LEU n 
4 63  ASP n 
4 64  HIS n 
4 65  GLU n 
4 66  TYR n 
4 67  THR n 
4 68  THR n 
4 69  LYS n 
4 70  GLU n 
4 71  ILE n 
4 72  PHE n 
4 73  ARG n 
4 74  LYS n 
4 75  ASN n 
4 76  PHE n 
4 77  PHE n 
4 78  LYS n 
4 79  ASP n 
4 80  TRP n 
4 81  ARG n 
4 82  LYS n 
4 83  GLU n 
4 84  MET n 
4 85  THR n 
4 86  ASN n 
4 87  GLU n 
4 88  GLU n 
4 89  LYS n 
4 90  ASN n 
4 91  ILE n 
4 92  ILE n 
4 93  THR n 
4 94  ASN n 
4 95  LEU n 
4 96  SER n 
4 97  LYS n 
4 98  CYS n 
4 99  ASP n 
4 100 PHE n 
4 101 THR n 
4 102 GLN n 
4 103 MET n 
4 104 SER n 
4 105 GLN n 
4 106 TYR n 
4 107 PHE n 
4 108 LYS n 
4 109 ALA n 
4 110 GLN n 
4 111 THR n 
4 112 GLU n 
4 113 ALA n 
4 114 ARG n 
4 115 LYS n 
4 116 GLN n 
4 117 MET n 
4 118 SER n 
4 119 LYS n 
4 120 GLU n 
4 121 GLU n 
4 122 LYS n 
4 123 LEU n 
4 124 LYS n 
4 125 ILE n 
4 126 LYS n 
4 127 GLU n 
4 128 GLU n 
4 129 ASN n 
4 130 GLU n 
4 131 LYS n 
4 132 LEU n 
4 133 LEU n 
4 134 LYS n 
4 135 GLU n 
4 136 TYR n 
4 137 GLY n 
4 138 PHE n 
4 139 CYS n 
4 140 ILE n 
4 141 MET n 
4 142 ASP n 
4 143 ASN n 
4 144 HIS n 
4 145 LYS n 
4 146 GLU n 
4 147 ARG n 
4 148 ILE n 
4 149 ALA n 
4 150 ASN n 
4 151 PHE n 
4 152 LYS n 
4 153 ILE n 
4 154 GLU n 
4 155 PRO n 
4 156 PRO n 
4 157 GLY n 
4 158 LEU n 
4 159 PHE n 
4 160 ARG n 
4 161 GLY n 
4 162 ARG n 
4 163 GLY n 
4 164 ASN n 
4 165 HIS n 
4 166 PRO n 
4 167 LYS n 
4 168 MET n 
4 169 GLY n 
4 170 MET n 
4 171 LEU n 
4 172 LYS n 
4 173 ARG n 
4 174 ARG n 
4 175 ILE n 
4 176 MET n 
4 177 PRO n 
4 178 GLU n 
4 179 ASP n 
4 180 ILE n 
4 181 ILE n 
4 182 ILE n 
4 183 ASN n 
4 184 CYS n 
4 185 SER n 
4 186 LYS n 
4 187 ASP n 
4 188 ALA n 
4 189 LYS n 
4 190 VAL n 
4 191 PRO n 
4 192 SER n 
4 193 PRO n 
4 194 PRO n 
4 195 PRO n 
4 196 GLY n 
4 197 HIS n 
4 198 LYS n 
4 199 TRP n 
4 200 LYS n 
4 201 GLU n 
4 202 VAL n 
4 203 ARG n 
4 204 HIS n 
4 205 ASP n 
4 206 ASN n 
4 207 LYS n 
4 208 VAL n 
4 209 THR n 
4 210 TRP n 
4 211 LEU n 
4 212 VAL n 
4 213 SER n 
4 214 TRP n 
4 215 THR n 
4 216 GLU n 
4 217 ASN n 
4 218 ILE n 
4 219 GLN n 
4 220 GLY n 
4 221 SER n 
4 222 ILE n 
4 223 LYS n 
4 224 TYR n 
4 225 ILE n 
4 226 MET n 
4 227 LEU n 
4 228 ASN n 
4 229 PRO n 
4 230 SER n 
4 231 SER n 
4 232 ARG n 
4 233 ILE n 
4 234 LYS n 
4 235 GLY n 
4 236 GLU n 
4 237 LYS n 
4 238 ASP n 
4 239 TRP n 
4 240 GLN n 
4 241 LYS n 
4 242 TYR n 
4 243 GLU n 
4 244 THR n 
4 245 ALA n 
4 246 ARG n 
4 247 ARG n 
4 248 LEU n 
4 249 LYS n 
4 250 LYS n 
4 251 CYS n 
4 252 VAL n 
4 253 ASP n 
4 254 LYS n 
4 255 ILE n 
4 256 ARG n 
4 257 ASN n 
4 258 GLN n 
4 259 TYR n 
4 260 ARG n 
4 261 GLU n 
4 262 ASP n 
4 263 TRP n 
4 264 LYS n 
4 265 SER n 
4 266 LYS n 
4 267 GLU n 
4 268 MET n 
4 269 LYS n 
4 270 VAL n 
4 271 ARG n 
4 272 GLN n 
4 273 ARG n 
4 274 ALA n 
4 275 VAL n 
4 276 ALA n 
4 277 LEU n 
4 278 TYR n 
4 279 PHE n 
4 280 ILE n 
4 281 ASP n 
4 282 LYS n 
4 283 LEU n 
4 284 ALA n 
4 285 LEU n 
4 286 ARG n 
4 287 ALA n 
4 288 GLY n 
4 289 ASN n 
4 290 GLU n 
4 291 LYS n 
4 292 GLU n 
4 293 GLU n 
4 294 GLY n 
4 295 GLU n 
4 296 THR n 
4 297 ALA n 
4 298 ASP n 
4 299 THR n 
4 300 VAL n 
4 301 GLY n 
4 302 CYS n 
4 303 CYS n 
4 304 SER n 
4 305 LEU n 
4 306 ARG n 
4 307 VAL n 
4 308 GLU n 
4 309 HIS n 
4 310 ILE n 
4 311 ASN n 
4 312 LEU n 
4 313 HIS n 
4 314 PRO n 
4 315 GLU n 
4 316 LEU n 
4 317 ASP n 
4 318 GLY n 
4 319 GLN n 
4 320 GLU n 
4 321 TYR n 
4 322 VAL n 
4 323 VAL n 
4 324 GLU n 
4 325 PHE n 
4 326 ASP n 
4 327 PHE n 
4 328 LEU n 
4 329 GLY n 
4 330 LYS n 
4 331 ASP n 
4 332 SER n 
4 333 ILE n 
4 334 ARG n 
4 335 TYR n 
4 336 TYR n 
4 337 ASN n 
4 338 LYS n 
4 339 VAL n 
4 340 PRO n 
4 341 VAL n 
4 342 GLU n 
4 343 LYS n 
4 344 ARG n 
4 345 VAL n 
4 346 PHE n 
4 347 LYS n 
4 348 ASN n 
4 349 LEU n 
4 350 GLN n 
4 351 LEU n 
4 352 PHE n 
4 353 MET n 
4 354 GLU n 
4 355 ASN n 
4 356 LYS n 
4 357 GLN n 
4 358 PRO n 
4 359 GLU n 
4 360 ASP n 
4 361 ASP n 
4 362 LEU n 
4 363 PHE n 
4 364 ASP n 
4 365 ARG n 
4 366 LEU n 
4 367 ASN n 
4 368 THR n 
4 369 GLY n 
4 370 ILE n 
4 371 LEU n 
4 372 ASN n 
4 373 LYS n 
4 374 HIS n 
4 375 LEU n 
4 376 GLN n 
4 377 ASP n 
4 378 LEU n 
4 379 MET n 
4 380 GLU n 
4 381 GLY n 
4 382 LEU n 
4 383 THR n 
4 384 ALA n 
4 385 LYS n 
4 386 VAL n 
4 387 PHE n 
4 388 ARG n 
4 389 THR n 
4 390 TYR n 
4 391 ASN n 
4 392 ALA n 
4 393 SER n 
4 394 ILE n 
4 395 THR n 
4 396 LEU n 
4 397 GLN n 
4 398 GLN n 
4 399 GLN n 
4 400 LEU n 
4 401 LYS n 
4 402 GLU n 
4 403 LEU n 
4 404 THR n 
4 405 ALA n 
4 406 PRO n 
4 407 ASP n 
4 408 GLU n 
4 409 ASN n 
4 410 ILE n 
4 411 PRO n 
4 412 ALA n 
4 413 LYS n 
4 414 ILE n 
4 415 LEU n 
4 416 SER n 
4 417 TYR n 
4 418 ASN n 
4 419 ARG n 
4 420 ALA n 
4 421 ASN n 
4 422 ARG n 
4 423 ALA n 
4 424 VAL n 
4 425 ALA n 
4 426 ILE n 
4 427 LEU n 
4 428 CYS n 
4 429 ASN n 
4 430 HIS n 
4 431 GLN n 
4 432 ARG n 
4 433 ALA n 
4 434 PRO n 
4 435 PRO n 
4 436 LYS n 
4 437 THR n 
4 438 PHE n 
4 439 GLU n 
4 440 LYS n 
4 441 SER n 
4 442 MET n 
4 443 MET n 
4 444 ASN n 
4 445 LEU n 
4 446 GLN n 
4 447 THR n 
4 448 LYS n 
4 449 ILE n 
4 450 ASP n 
4 451 ALA n 
4 452 LYS n 
4 453 LYS n 
4 454 GLU n 
4 455 GLN n 
4 456 LEU n 
4 457 ALA n 
4 458 ASP n 
4 459 ALA n 
4 460 ARG n 
4 461 ARG n 
4 462 ASP n 
4 463 LEU n 
4 464 LYS n 
4 465 SER n 
4 466 ALA n 
4 467 LYS n 
4 468 ALA n 
4 469 ASP n 
4 470 ALA n 
4 471 LYS n 
4 472 VAL n 
4 473 MET n 
4 474 LYS n 
4 475 ASP n 
4 476 ALA n 
4 477 LYS n 
4 478 THR n 
4 479 LYS n 
4 480 LYS n 
4 481 VAL n 
4 482 VAL n 
4 483 GLU n 
4 484 SER n 
4 485 LYS n 
4 486 LYS n 
4 487 LYS n 
4 488 ALA n 
4 489 VAL n 
4 490 GLN n 
4 491 ARG n 
4 492 LEU n 
4 493 GLU n 
4 494 GLU n 
4 495 GLN n 
4 496 LEU n 
4 497 MET n 
4 498 LYS n 
4 499 LEU n 
4 500 GLU n 
4 501 VAL n 
4 502 GLN n 
4 503 ALA n 
4 504 THR n 
4 505 ASP n 
4 506 ARG n 
4 507 GLU n 
4 508 GLU n 
4 509 ASN n 
4 510 LYS n 
4 511 GLN n 
4 512 ILE n 
4 513 ALA n 
4 514 LEU n 
4 515 GLY n 
4 516 THR n 
4 517 SER n 
4 518 LYS n 
4 519 LEU n 
4 520 ASN n 
4 521 PTR n 
4 522 LEU n 
4 523 ASP n 
4 524 PRO n 
4 525 ARG n 
4 526 ILE n 
4 527 THR n 
4 528 VAL n 
4 529 ALA n 
4 530 TRP n 
4 531 CYS n 
4 532 LYS n 
4 533 LYS n 
4 534 TRP n 
4 535 GLY n 
4 536 VAL n 
4 537 PRO n 
4 538 ILE n 
4 539 GLU n 
4 540 LYS n 
4 541 ILE n 
4 542 TYR n 
4 543 ASN n 
4 544 LYS n 
4 545 THR n 
4 546 GLN n 
4 547 ARG n 
4 548 GLU n 
4 549 LYS n 
4 550 PHE n 
4 551 ALA n 
4 552 TRP n 
4 553 ALA n 
4 554 ILE n 
4 555 ASP n 
4 556 MET n 
4 557 ALA n 
4 558 ASP n 
4 559 GLU n 
4 560 ASP n 
4 561 TYR n 
4 562 GLU n 
4 563 PHE n 
# 
_entity_src_gen.entity_id                          4 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 TOP1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'fall armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     Spodoptera 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            SF9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          baculovirus 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP TOP1_HUMAN P11387 4 
;WKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDW
RKEMTNEEKNIITNLSKCDFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGLFR
GRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQ
KYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQE
YVVEFDFLGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQQL
KELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLADARRDLKSAKADAKVMKDAKTKK
VVESKKKAVQRLEEQLKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDY
EF
;
203 ? 
2 PDB 1NH3       1NH3   1 ? ?   ? 
3 PDB 1NH3       1NH3   2 ? ?   ? 
4 PDB 1NH3       1NH3   3 ? ?   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1NH3 A 1 ? 563 ? P11387 203 ? 764 ? 203 765 
2 2 1NH3 B 1 ? 10  ? 1NH3   1   ? 10  ? 1   10  
3 3 1NH3 C 1 ? 12  ? 1NH3   11  ? 22  ? 11  22  
4 4 1NH3 D 1 ? 22  ? 1NH3   101 ? 122 ? 101 122 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1NH3 MET A 497 ? UNP P11387 ?   ?   'INITIATING MET'   699 1 
1 1NH3 PTR A 521 ? UNP P11387 TYR 722 'MODIFIED RESIDUE' 723 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                  ?                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                 ?                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                               ?                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                          ?                 'C4 H7 N O4'      133.103 
CAR 'RNA linking'       n 
;CYTOSINE ARABINOSE-5'-PHOSPHATE
;
?                 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                                 ?                 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"     ?                 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"      ?                 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"     ?                 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"             ?                 'C10 H15 N2 O8 P' 322.208 
DU  'DNA linking'       y "2'-DEOXYURIDINE-5'-MONOPHOSPHATE"       ?                 'C9 H13 N2 O8 P'  308.182 
GLN 'L-peptide linking' y GLUTAMINE                                ?                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                          ?                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                  ?                 'C2 H5 N O2'      75.067  
GNG non-polymer         n "2'-DEOXY-GUANOSINE"                     ?                 'C10 H13 N5 O4'   267.241 
HIS 'L-peptide linking' y HISTIDINE                                ?                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                    ?                 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                               ?                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                  ?                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                   ?                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                               ?                 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                            ?                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                  ?                 'C5 H9 N O2'      115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE                        PHOSPHONOTYROSINE 'C9 H12 N O6 P'   261.168 
SER 'L-peptide linking' y SERINE                                   ?                 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                ?                 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                               ?                 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                 ?                 'C9 H11 N O3'     181.189 
UBB non-polymer         n "2',3'-DIDEOXY-URIDINE-5'-MONOPHOSPHATE" ?                 'C9 H13 N2 O7 P'  292.182 
VAL 'L-peptide linking' y VALINE                                   ?                 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1NH3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.56 
_exptl_crystal.density_percent_sol   65.41 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            276 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.7 
_exptl_crystal_grow.pdbx_details    
'Tris, Magnesium Chloride, PEG 400, DTT, pH 7.7, VAPOR DIFFUSION, SITTING DROP, temperature 276K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2001-02-18 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SAGITALLY FOCUSED Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X12B' 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X12B 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.1 
# 
_reflns.entry_id                     1NH3 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            3.1 
_reflns.d_resolution_low             50 
_reflns.number_all                   13878 
_reflns.number_obs                   13878 
_reflns.percent_possible_obs         69.3 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_k_max                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.1 
_reflns_shell.d_res_low              3.21 
_reflns_shell.percent_possible_all   54.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1NH3 
_refine.ls_d_res_high                            3.10 
_refine.ls_d_res_low                             44.29 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     13878 
_refine.ls_number_reflns_R_free                  1351 
_refine.ls_percent_reflns_obs                    74.6 
_refine.ls_R_factor_all                          0.235 
_refine.ls_R_factor_obs                          0.235 
_refine.ls_R_factor_R_work                       0.235 
_refine.ls_R_factor_R_free                       0.311 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1A31' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            27.26 
_refine.aniso_B[1][2]                            13.437 
_refine.aniso_B[1][3]                            0 
_refine.aniso_B[2][2]                            27.26 
_refine.aniso_B[2][3]                            0 
_refine.aniso_B[3][3]                            -54.52 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1NH3 
_refine_analyze.Luzzati_coordinate_error_obs    0.48 
_refine_analyze.Luzzati_sigma_a_obs             0.71 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3483 
_refine_hist.pdbx_number_atoms_nucleic_acid   878 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             33 
_refine_hist.number_atoms_total               4394 
_refine_hist.d_res_high                       3.10 
_refine_hist.d_res_low                        44.29 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.026 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d          1.6   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.0  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 3.88  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1NH3 
_struct.title                     'Human Topoisomerase I Ara-C Complex' 
_struct.pdbx_descriptor           'DNA topoisomerase I/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1NH3 
_struct_keywords.pdbx_keywords   ISOMERASE/DNA 
_struct_keywords.text            'Ara-C, protein-DNA complex, DNA damage, isomerase, ISOMERASE-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS D 50  ? LYS D 60  ? LYS A 252 LYS A 262 1 ? 11 
HELX_P HELX_P2  2  LYS D 69  ? ASP D 79  ? LYS A 271 ASP A 281 1 ? 11 
HELX_P HELX_P3  3  GLU D 87  ? ILE D 92  ? GLU A 289 ILE A 294 1 ? 6  
HELX_P HELX_P4  4  ASN D 94  ? SER D 96  ? ASN A 296 SER A 298 5 ? 3  
HELX_P HELX_P5  5  PHE D 100 ? ALA D 113 ? PHE A 302 ALA A 315 1 ? 14 
HELX_P HELX_P6  6  GLU D 120 ? ILE D 125 ? GLU A 322 ILE A 327 1 ? 6  
HELX_P HELX_P7  7  GLU D 130 ? TYR D 136 ? GLU A 332 TYR A 338 1 ? 7  
HELX_P HELX_P8  8  SER D 231 ? ARG D 247 ? SER A 433 ARG A 449 1 ? 17 
HELX_P HELX_P9  9  CYS D 251 ? ASP D 262 ? CYS A 453 ASP A 464 1 ? 12 
HELX_P HELX_P10 10 TRP D 263 ? SER D 265 ? TRP A 465 SER A 467 5 ? 3  
HELX_P HELX_P11 11 GLU D 267 ? LEU D 283 ? GLU A 469 LEU A 485 1 ? 17 
HELX_P HELX_P12 12 ARG D 306 ? GLU D 308 ? ARG A 508 GLU A 510 5 ? 3  
HELX_P HELX_P13 13 GLU D 342 ? GLU D 354 ? GLU A 544 GLU A 556 1 ? 13 
HELX_P HELX_P14 14 ASN D 367 ? MET D 379 ? ASN A 569 MET A 581 1 ? 13 
HELX_P HELX_P15 15 LYS D 385 ? LEU D 403 ? LYS A 587 LEU A 605 1 ? 19 
HELX_P HELX_P16 16 LYS D 413 ? ASN D 421 ? LYS A 615 ASN A 623 1 ? 9  
HELX_P HELX_P17 17 ASP D 523 ? TRP D 534 ? ASP A 725 TRP A 736 1 ? 12 
HELX_P HELX_P18 18 PRO D 537 ? ILE D 541 ? PRO A 739 ILE A 743 5 ? 5  
HELX_P HELX_P19 19 THR D 545 ? PHE D 550 ? THR A 747 PHE A 752 1 ? 6  
HELX_P HELX_P20 20 PHE D 550 ? ASP D 555 ? PHE A 752 ASP A 757 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? D PTR 521 O3P   ? ? ? 1_555 A UBB 10  "C3'" ? ? A PTR 723 B UBB 10  1_555 ? ? ? ? ? ? ?            1.650 ? 
covale2  covale ? ? B GNG 1   "O3'" ? ? ? 1_555 B DG  2   P     ? ? C GNG 11  C DG  12  1_555 ? ? ? ? ? ? ?            1.609 ? 
covale3  covale ? ? A DU  9   "O3'" ? ? ? 1_555 A UBB 10  P     ? ? B DU  9   B UBB 10  1_555 ? ? ? ? ? ? ?            1.609 ? 
covale4  covale ? ? C DC  11  "O3'" ? ? ? 1_555 C CAR 12  P     ? ? D DC  111 D CAR 112 1_555 ? ? ? ? ? ? ?            1.610 ? 
covale5  covale ? ? C CAR 12  "O3'" ? ? ? 1_555 C DA  13  P     ? ? D CAR 112 D DA  113 1_555 ? ? ? ? ? ? ?            1.663 ? 
covale6  covale ? ? D ASN 520 C     ? ? ? 1_555 D PTR 521 N     ? ? A ASN 722 A PTR 723 1_555 ? ? ? ? ? ? ?            1.337 ? 
covale7  covale ? ? D PTR 521 C     ? ? ? 1_555 D LEU 522 N     ? ? A PTR 723 A LEU 724 1_555 ? ? ? ? ? ? ?            1.332 ? 
hydrog1  hydrog ? ? A DA  1   N1    ? ? ? 1_555 C DT  22  N3    ? ? B DA  1   D DT  122 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog2  hydrog ? ? A DA  2   N1    ? ? ? 1_555 C DU  21  N3    ? ? B DA  2   D DU  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? A DA  2   N6    ? ? ? 1_555 C DU  21  O4    ? ? B DA  2   D DU  121 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? A DA  3   N1    ? ? ? 1_555 C DU  20  N3    ? ? B DA  3   D DU  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? A DA  3   N6    ? ? ? 1_555 C DU  20  O4    ? ? B DA  3   D DU  120 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? A DA  4   N1    ? ? ? 1_555 C DU  19  N3    ? ? B DA  4   D DU  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? A DA  4   N6    ? ? ? 1_555 C DU  19  O4    ? ? B DA  4   D DU  119 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? A DA  5   N1    ? ? ? 1_555 C DU  18  N3    ? ? B DA  5   D DU  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? A DA  5   N6    ? ? ? 1_555 C DU  18  O4    ? ? B DA  5   D DU  118 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? A DG  6   N1    ? ? ? 1_555 C DC  17  N3    ? ? B DG  6   D DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? A DG  6   N2    ? ? ? 1_555 C DC  17  O2    ? ? B DG  6   D DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? A DG  6   O6    ? ? ? 1_555 C DC  17  N4    ? ? B DG  6   D DC  117 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? A DA  7   N1    ? ? ? 1_555 C DU  16  N3    ? ? B DA  7   D DU  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? A DA  7   N6    ? ? ? 1_555 C DU  16  O4    ? ? B DA  7   D DU  116 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? A DC  8   N3    ? ? ? 1_555 C DG  15  N1    ? ? B DC  8   D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? A DC  8   N4    ? ? ? 1_555 C DG  15  O6    ? ? B DC  8   D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? A DC  8   O2    ? ? ? 1_555 C DG  15  N2    ? ? B DC  8   D DG  115 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? A DU  9   N3    ? ? ? 1_555 C DA  14  N1    ? ? B DU  9   D DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? A DU  9   O4    ? ? ? 1_555 C DA  14  N6    ? ? B DU  9   D DA  114 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? A UBB 10  N3    ? ? ? 1_555 C DA  13  N1    ? ? B UBB 10  D DA  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? A UBB 10  O4    ? ? ? 1_555 C DA  13  N6    ? ? B UBB 10  D DA  113 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B GNG 1   N1    ? ? ? 1_555 C CAR 12  N3    ? ? C GNG 11  D CAR 112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B GNG 1   N2    ? ? ? 1_555 C CAR 12  O2    ? ? C GNG 11  D CAR 112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B GNG 1   O6    ? ? ? 1_555 C CAR 12  N4    ? ? C GNG 11  D CAR 112 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DG  2   N1    ? ? ? 1_555 C DC  11  N3    ? ? C DG  12  D DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DG  2   N2    ? ? ? 1_555 C DC  11  O2    ? ? C DG  12  D DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DG  2   O6    ? ? ? 1_555 C DC  11  N4    ? ? C DG  12  D DC  111 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DA  3   N1    ? ? ? 1_555 C DU  10  N3    ? ? C DA  13  D DU  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DA  3   N6    ? ? ? 1_555 C DU  10  O4    ? ? C DA  13  D DU  110 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DA  4   N1    ? ? ? 1_555 C DU  9   N3    ? ? C DA  14  D DU  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DA  4   N6    ? ? ? 1_555 C DU  9   O4    ? ? C DA  14  D DU  109 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DU  8   N3    ? ? C DA  15  D DU  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DU  8   O4    ? ? C DA  15  D DU  108 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DA  6   N1    ? ? ? 1_555 C DU  7   N3    ? ? C DA  16  D DU  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DA  6   N6    ? ? ? 1_555 C DU  7   O4    ? ? C DA  16  D DU  107 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? B DA  7   N1    ? ? ? 1_555 C DT  6   N3    ? ? C DA  17  D DT  106 1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog37 hydrog ? ? B DU  8   N3    ? ? ? 1_555 C DA  5   N1    ? ? C DU  18  D DA  105 1_555 ? ? ? ? ? ? 'DU-DA PAIR' ?     ? 
hydrog38 hydrog ? ? B DU  9   N3    ? ? ? 1_555 C DA  4   N1    ? ? C DU  19  D DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? B DU  9   O4    ? ? ? 1_555 C DA  4   N6    ? ? C DU  19  D DA  104 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? B DU  11  N3    ? ? ? 1_555 C DA  2   N1    ? ? C DU  21  D DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? B DU  11  O4    ? ? ? 1_555 C DA  2   N6    ? ? C DU  21  D DA  102 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
C ? 4 ? 
D ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU D 19  ? HIS D 20  ? GLU A 221 HIS A 222 
A 2 PHE D 138 ? ILE D 140 ? PHE A 340 ILE A 342 
A 3 GLU D 146 ? ARG D 147 ? GLU A 348 ARG A 349 
B 1 LYS D 43  ? VAL D 44  ? LYS A 245 VAL A 246 
B 2 TYR D 39  ? TYR D 40  ? TYR A 241 TYR A 242 
B 3 CYS D 98  ? ASP D 99  ? CYS A 300 ASP A 301 
C 1 GLU D 201 ? ARG D 203 ? GLU A 403 ARG A 405 
C 2 ILE D 181 ? ASN D 183 ? ILE A 383 ASN A 385 
C 3 VAL D 212 ? THR D 215 ? VAL A 414 THR A 417 
C 4 ILE D 222 ? ILE D 225 ? ILE A 424 ILE A 427 
D 1 ILE D 310 ? LEU D 316 ? ILE A 512 LEU A 518 
D 2 GLN D 319 ? LEU D 328 ? GLN A 521 LEU A 530 
D 3 ARG D 334 ? PRO D 340 ? ARG A 536 PRO A 542 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N GLU D 19  ? N GLU A 221 O ILE D 140 ? O ILE A 342 
A 2 3 N CYS D 139 ? N CYS A 341 O GLU D 146 ? O GLU A 348 
B 1 2 O LYS D 43  ? O LYS A 245 N TYR D 40  ? N TYR A 242 
B 2 3 N TYR D 39  ? N TYR A 241 O ASP D 99  ? O ASP A 301 
C 1 2 O ARG D 203 ? O ARG A 405 N ILE D 182 ? N ILE A 384 
C 2 3 N ILE D 181 ? N ILE A 383 O SER D 213 ? O SER A 415 
C 3 4 N TRP D 214 ? N TRP A 416 O LYS D 223 ? O LYS A 425 
D 1 2 N LEU D 316 ? N LEU A 518 O GLN D 319 ? O GLN A 521 
D 2 3 N PHE D 327 ? N PHE A 529 O TYR D 335 ? O TYR A 537 
# 
_database_PDB_matrix.entry_id          1NH3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1NH3 
_atom_sites.fract_transf_matrix[1][1]   0.013704 
_atom_sites.fract_transf_matrix[1][2]   0.007912 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015824 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005368 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? 132.835 -39.302  -2.485  1.00 98.43  ? 1   DA  B "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? 132.684 -38.354  -1.425  1.00 96.50  ? 1   DA  B "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? 131.230 -38.191  -1.049  1.00 95.52  ? 1   DA  B "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? 130.490 -37.790  -2.228  1.00 93.27  ? 1   DA  B "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? 130.565 -39.472  -0.544  1.00 96.43  ? 1   DA  B "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? 129.656 -39.189  0.527   1.00 98.36  ? 1   DA  B "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? 129.836 -40.004  -1.763  1.00 93.84  ? 1   DA  B "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? 129.487 -38.746  -2.545  1.00 89.79  ? 1   DA  B "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? 129.496 -38.933  -3.998  1.00 44.04  ? 1   DA  B N9    1 
ATOM   10   C C8    . DA  A 1 1   ? 130.429 -39.612  -4.747  1.00 42.29  ? 1   DA  B C8    1 
ATOM   11   N N7    . DA  A 1 1   ? 130.185 -39.603  -6.036  1.00 40.19  ? 1   DA  B N7    1 
ATOM   12   C C5    . DA  A 1 1   ? 129.015 -38.866  -6.146  1.00 37.95  ? 1   DA  B C5    1 
ATOM   13   C C6    . DA  A 1 1   ? 128.252 -38.478  -7.255  1.00 35.79  ? 1   DA  B C6    1 
ATOM   14   N N6    . DA  A 1 1   ? 128.570 -38.786  -8.514  1.00 33.93  ? 1   DA  B N6    1 
ATOM   15   N N1    . DA  A 1 1   ? 127.139 -37.749  -7.026  1.00 36.04  ? 1   DA  B N1    1 
ATOM   16   C C2    . DA  A 1 1   ? 126.829 -37.431  -5.761  1.00 38.40  ? 1   DA  B C2    1 
ATOM   17   N N3    . DA  A 1 1   ? 127.472 -37.730  -4.634  1.00 38.14  ? 1   DA  B N3    1 
ATOM   18   C C4    . DA  A 1 1   ? 128.571 -38.454  -4.897  1.00 39.96  ? 1   DA  B C4    1 
ATOM   19   P P     . DA  A 1 2   ? 128.902 -40.398  1.277   1.00 123.22 ? 2   DA  B P     1 
ATOM   20   O OP1   . DA  A 1 2   ? 128.860 -40.069  2.730   1.00 70.99  ? 2   DA  B OP1   1 
ATOM   21   O OP2   . DA  A 1 2   ? 129.459 -41.700  0.827   1.00 70.13  ? 2   DA  B OP2   1 
ATOM   22   O "O5'" . DA  A 1 2   ? 127.422 -40.304  0.714   1.00 120.62 ? 2   DA  B "O5'" 1 
ATOM   23   C "C5'" . DA  A 1 2   ? 126.725 -39.073  0.768   1.00 114.25 ? 2   DA  B "C5'" 1 
ATOM   24   C "C4'" . DA  A 1 2   ? 125.466 -39.141  -0.063  1.00 108.90 ? 2   DA  B "C4'" 1 
ATOM   25   O "O4'" . DA  A 1 2   ? 125.769 -39.102  -1.480  1.00 105.47 ? 2   DA  B "O4'" 1 
ATOM   26   C "C3'" . DA  A 1 2   ? 124.571 -40.364  0.160   1.00 107.23 ? 2   DA  B "C3'" 1 
ATOM   27   O "O3'" . DA  A 1 2   ? 123.225 -39.891  0.345   1.00 109.17 ? 2   DA  B "O3'" 1 
ATOM   28   C "C2'" . DA  A 1 2   ? 124.749 -41.166  -1.123  1.00 104.38 ? 2   DA  B "C2'" 1 
ATOM   29   C "C1'" . DA  A 1 2   ? 124.973 -40.067  -2.143  1.00 100.58 ? 2   DA  B "C1'" 1 
ATOM   30   N N9    . DA  A 1 2   ? 125.648 -40.444  -3.387  1.00 40.99  ? 2   DA  B N9    1 
ATOM   31   C C8    . DA  A 1 2   ? 126.848 -41.091  -3.567  1.00 38.14  ? 2   DA  B C8    1 
ATOM   32   N N7    . DA  A 1 2   ? 127.176 -41.253  -4.828  1.00 34.72  ? 2   DA  B N7    1 
ATOM   33   C C5    . DA  A 1 2   ? 126.117 -40.681  -5.525  1.00 34.85  ? 2   DA  B C5    1 
ATOM   34   C C6    . DA  A 1 2   ? 125.852 -40.526  -6.907  1.00 33.50  ? 2   DA  B C6    1 
ATOM   35   N N6    . DA  A 1 2   ? 126.670 -40.953  -7.870  1.00 33.59  ? 2   DA  B N6    1 
ATOM   36   N N1    . DA  A 1 2   ? 124.705 -39.906  -7.265  1.00 33.68  ? 2   DA  B N1    1 
ATOM   37   C C2    . DA  A 1 2   ? 123.889 -39.471  -6.305  1.00 35.31  ? 2   DA  B C2    1 
ATOM   38   N N3    . DA  A 1 2   ? 124.021 -39.557  -4.981  1.00 37.19  ? 2   DA  B N3    1 
ATOM   39   C C4    . DA  A 1 2   ? 125.169 -40.181  -4.651  1.00 37.19  ? 2   DA  B C4    1 
ATOM   40   P P     . DA  A 1 3   ? 121.984 -40.921  0.391   1.00 92.82  ? 3   DA  B P     1 
ATOM   41   O OP1   . DA  A 1 3   ? 121.036 -40.416  1.431   1.00 76.21  ? 3   DA  B OP1   1 
ATOM   42   O OP2   . DA  A 1 3   ? 122.477 -42.328  0.467   1.00 75.29  ? 3   DA  B OP2   1 
ATOM   43   O "O5'" . DA  A 1 3   ? 121.311 -40.692  -1.035  1.00 89.07  ? 3   DA  B "O5'" 1 
ATOM   44   C "C5'" . DA  A 1 3   ? 120.974 -39.372  -1.475  1.00 83.44  ? 3   DA  B "C5'" 1 
ATOM   45   C "C4'" . DA  A 1 3   ? 120.001 -39.440  -2.626  1.00 79.94  ? 3   DA  B "C4'" 1 
ATOM   46   O "O4'" . DA  A 1 3   ? 120.717 -39.778  -3.838  1.00 75.81  ? 3   DA  B "O4'" 1 
ATOM   47   C "C3'" . DA  A 1 3   ? 118.944 -40.519  -2.423  1.00 80.69  ? 3   DA  B "C3'" 1 
ATOM   48   O "O3'" . DA  A 1 3   ? 117.642 -40.053  -2.783  1.00 82.79  ? 3   DA  B "O3'" 1 
ATOM   49   C "C2'" . DA  A 1 3   ? 119.438 -41.680  -3.271  1.00 76.55  ? 3   DA  B "C2'" 1 
ATOM   50   C "C1'" . DA  A 1 3   ? 120.289 -41.030  -4.356  1.00 71.12  ? 3   DA  B "C1'" 1 
ATOM   51   N N9    . DA  A 1 3   ? 121.489 -41.807  -4.688  1.00 48.38  ? 3   DA  B N9    1 
ATOM   52   C C8    . DA  A 1 3   ? 122.339 -42.421  -3.796  1.00 47.07  ? 3   DA  B C8    1 
ATOM   53   N N7    . DA  A 1 3   ? 123.338 -43.052  -4.364  1.00 43.17  ? 3   DA  B N7    1 
ATOM   54   C C5    . DA  A 1 3   ? 123.137 -42.845  -5.723  1.00 41.48  ? 3   DA  B C5    1 
ATOM   55   C C6    . DA  A 1 3   ? 123.862 -43.255  -6.860  1.00 40.12  ? 3   DA  B C6    1 
ATOM   56   N N6    . DA  A 1 3   ? 124.968 -43.999  -6.804  1.00 40.90  ? 3   DA  B N6    1 
ATOM   57   N N1    . DA  A 1 3   ? 123.407 -42.872  -8.069  1.00 40.85  ? 3   DA  B N1    1 
ATOM   58   C C2    . DA  A 1 3   ? 122.298 -42.136  -8.126  1.00 41.35  ? 3   DA  B C2    1 
ATOM   59   N N3    . DA  A 1 3   ? 121.522 -41.692  -7.133  1.00 42.48  ? 3   DA  B N3    1 
ATOM   60   C C4    . DA  A 1 3   ? 122.002 -42.082  -5.940  1.00 43.91  ? 3   DA  B C4    1 
ATOM   61   P P     . DA  A 1 4   ? 116.401 -41.087  -2.829  1.00 74.38  ? 4   DA  B P     1 
ATOM   62   O OP1   . DA  A 1 4   ? 115.196 -40.356  -2.364  1.00 58.64  ? 4   DA  B OP1   1 
ATOM   63   O OP2   . DA  A 1 4   ? 116.753 -42.395  -2.199  1.00 59.23  ? 4   DA  B OP2   1 
ATOM   64   O "O5'" . DA  A 1 4   ? 116.233 -41.333  -4.389  1.00 70.94  ? 4   DA  B "O5'" 1 
ATOM   65   C "C5'" . DA  A 1 4   ? 116.523 -40.282  -5.306  1.00 66.28  ? 4   DA  B "C5'" 1 
ATOM   66   C "C4'" . DA  A 1 4   ? 116.676 -40.830  -6.702  1.00 60.86  ? 4   DA  B "C4'" 1 
ATOM   67   O "O4'" . DA  A 1 4   ? 117.945 -41.502  -6.883  1.00 57.69  ? 4   DA  B "O4'" 1 
ATOM   68   C "C3'" . DA  A 1 4   ? 115.600 -41.840  -7.081  1.00 58.14  ? 4   DA  B "C3'" 1 
ATOM   69   O "O3'" . DA  A 1 4   ? 115.173 -41.543  -8.394  1.00 55.39  ? 4   DA  B "O3'" 1 
ATOM   70   C "C2'" . DA  A 1 4   ? 116.336 -43.168  -7.044  1.00 57.94  ? 4   DA  B "C2'" 1 
ATOM   71   C "C1'" . DA  A 1 4   ? 117.713 -42.749  -7.504  1.00 55.96  ? 4   DA  B "C1'" 1 
ATOM   72   N N9    . DA  A 1 4   ? 118.814 -43.646  -7.162  1.00 36.82  ? 4   DA  B N9    1 
ATOM   73   C C8    . DA  A 1 4   ? 119.155 -44.184  -5.952  1.00 35.47  ? 4   DA  B C8    1 
ATOM   74   N N7    . DA  A 1 4   ? 120.220 -44.946  -5.996  1.00 29.98  ? 4   DA  B N7    1 
ATOM   75   C C5    . DA  A 1 4   ? 120.601 -44.909  -7.327  1.00 31.83  ? 4   DA  B C5    1 
ATOM   76   C C6    . DA  A 1 4   ? 121.661 -45.517  -8.031  1.00 31.99  ? 4   DA  B C6    1 
ATOM   77   N N6    . DA  A 1 4   ? 122.577 -46.303  -7.464  1.00 33.01  ? 4   DA  B N6    1 
ATOM   78   N N1    . DA  A 1 4   ? 121.751 -45.285  -9.355  1.00 33.70  ? 4   DA  B N1    1 
ATOM   79   C C2    . DA  A 1 4   ? 120.839 -44.491  -9.923  1.00 36.09  ? 4   DA  B C2    1 
ATOM   80   N N3    . DA  A 1 4   ? 119.806 -43.861  -9.371  1.00 35.82  ? 4   DA  B N3    1 
ATOM   81   C C4    . DA  A 1 4   ? 119.743 -44.117  -8.056  1.00 34.40  ? 4   DA  B C4    1 
ATOM   82   P P     . DA  A 1 5   ? 113.778 -42.108  -8.923  1.00 55.86  ? 5   DA  B P     1 
ATOM   83   O OP1   . DA  A 1 5   ? 112.952 -40.923  -9.289  1.00 49.26  ? 5   DA  B OP1   1 
ATOM   84   O OP2   . DA  A 1 5   ? 113.234 -43.141  -8.005  1.00 47.83  ? 5   DA  B OP2   1 
ATOM   85   O "O5'" . DA  A 1 5   ? 114.214 -42.852  -10.248 1.00 53.46  ? 5   DA  B "O5'" 1 
ATOM   86   C "C5'" . DA  A 1 5   ? 115.275 -42.333  -11.036 1.00 49.99  ? 5   DA  B "C5'" 1 
ATOM   87   C "C4'" . DA  A 1 5   ? 115.984 -43.457  -11.749 1.00 48.39  ? 5   DA  B "C4'" 1 
ATOM   88   O "O4'" . DA  A 1 5   ? 116.953 -44.112  -10.896 1.00 46.22  ? 5   DA  B "O4'" 1 
ATOM   89   C "C3'" . DA  A 1 5   ? 115.043 -44.552  -12.246 1.00 47.30  ? 5   DA  B "C3'" 1 
ATOM   90   O "O3'" . DA  A 1 5   ? 115.382 -44.865  -13.591 1.00 49.21  ? 5   DA  B "O3'" 1 
ATOM   91   C "C2'" . DA  A 1 5   ? 115.333 -45.716  -11.313 1.00 45.01  ? 5   DA  B "C2'" 1 
ATOM   92   C "C1'" . DA  A 1 5   ? 116.807 -45.509  -11.062 1.00 43.12  ? 5   DA  B "C1'" 1 
ATOM   93   N N9    . DA  A 1 5   ? 117.382 -46.185  -9.899  1.00 30.87  ? 5   DA  B N9    1 
ATOM   94   C C8    . DA  A 1 5   ? 117.043 -46.078  -8.573  1.00 28.88  ? 5   DA  B C8    1 
ATOM   95   N N7    . DA  A 1 5   ? 117.774 -46.829  -7.783  1.00 25.39  ? 5   DA  B N7    1 
ATOM   96   C C5    . DA  A 1 5   ? 118.644 -47.483  -8.649  1.00 23.15  ? 5   DA  B C5    1 
ATOM   97   C C6    . DA  A 1 5   ? 119.658 -48.434  -8.438  1.00 21.13  ? 5   DA  B C6    1 
ATOM   98   N N6    . DA  A 1 5   ? 119.976 -48.935  -7.245  1.00 22.93  ? 5   DA  B N6    1 
ATOM   99   N N1    . DA  A 1 5   ? 120.338 -48.869  -9.513  1.00 19.19  ? 5   DA  B N1    1 
ATOM   100  C C2    . DA  A 1 5   ? 120.009 -48.391  -10.712 1.00 20.75  ? 5   DA  B C2    1 
ATOM   101  N N3    . DA  A 1 5   ? 119.076 -47.514  -11.040 1.00 24.09  ? 5   DA  B N3    1 
ATOM   102  C C4    . DA  A 1 5   ? 118.419 -47.091  -9.950  1.00 25.24  ? 5   DA  B C4    1 
ATOM   103  P P     . DG  A 1 6   ? 114.590 -46.013  -14.364 1.00 50.11  ? 6   DG  B P     1 
ATOM   104  O OP1   . DG  A 1 6   ? 114.285 -45.490  -15.718 1.00 46.43  ? 6   DG  B OP1   1 
ATOM   105  O OP2   . DG  A 1 6   ? 113.490 -46.503  -13.488 1.00 43.32  ? 6   DG  B OP2   1 
ATOM   106  O "O5'" . DG  A 1 6   ? 115.692 -47.143  -14.490 1.00 44.69  ? 6   DG  B "O5'" 1 
ATOM   107  C "C5'" . DG  A 1 6   ? 117.004 -46.794  -14.899 1.00 40.50  ? 6   DG  B "C5'" 1 
ATOM   108  C "C4'" . DG  A 1 6   ? 117.762 -48.028  -15.312 1.00 35.44  ? 6   DG  B "C4'" 1 
ATOM   109  O "O4'" . DG  A 1 6   ? 118.348 -48.691  -14.167 1.00 35.63  ? 6   DG  B "O4'" 1 
ATOM   110  C "C3'" . DG  A 1 6   ? 116.908 -49.067  -16.024 1.00 32.73  ? 6   DG  B "C3'" 1 
ATOM   111  O "O3'" . DG  A 1 6   ? 117.664 -49.556  -17.128 1.00 29.53  ? 6   DG  B "O3'" 1 
ATOM   112  C "C2'" . DG  A 1 6   ? 116.643 -50.102  -14.937 1.00 33.01  ? 6   DG  B "C2'" 1 
ATOM   113  C "C1'" . DG  A 1 6   ? 117.913 -50.036  -14.104 1.00 33.92  ? 6   DG  B "C1'" 1 
ATOM   114  N N9    . DG  A 1 6   ? 117.832 -50.402  -12.687 1.00 28.15  ? 6   DG  B N9    1 
ATOM   115  C C8    . DG  A 1 6   ? 116.852 -50.084  -11.779 1.00 25.68  ? 6   DG  B C8    1 
ATOM   116  N N7    . DG  A 1 6   ? 117.104 -50.536  -10.575 1.00 23.23  ? 6   DG  B N7    1 
ATOM   117  C C5    . DG  A 1 6   ? 118.316 -51.201  -10.703 1.00 22.88  ? 6   DG  B C5    1 
ATOM   118  C C6    . DG  A 1 6   ? 119.111 -51.916  -9.733  1.00 21.91  ? 6   DG  B C6    1 
ATOM   119  O O6    . DG  A 1 6   ? 118.892 -52.099  -8.528  1.00 17.84  ? 6   DG  B O6    1 
ATOM   120  N N1    . DG  A 1 6   ? 120.257 -52.444  -10.306 1.00 22.85  ? 6   DG  B N1    1 
ATOM   121  C C2    . DG  A 1 6   ? 120.610 -52.313  -11.628 1.00 26.36  ? 6   DG  B C2    1 
ATOM   122  N N2    . DG  A 1 6   ? 121.737 -52.922  -12.005 1.00 26.45  ? 6   DG  B N2    1 
ATOM   123  N N3    . DG  A 1 6   ? 119.906 -51.644  -12.524 1.00 27.28  ? 6   DG  B N3    1 
ATOM   124  C C4    . DG  A 1 6   ? 118.779 -51.129  -12.002 1.00 25.55  ? 6   DG  B C4    1 
ATOM   125  P P     . DA  A 1 7   ? 117.126 -50.794  -17.969 1.00 19.71  ? 7   DA  B P     1 
ATOM   126  O OP1   . DA  A 1 7   ? 117.655 -50.692  -19.356 1.00 30.60  ? 7   DA  B OP1   1 
ATOM   127  O OP2   . DA  A 1 7   ? 115.667 -50.864  -17.742 1.00 25.37  ? 7   DA  B OP2   1 
ATOM   128  O "O5'" . DA  A 1 7   ? 117.843 -52.009  -17.252 1.00 18.48  ? 7   DA  B "O5'" 1 
ATOM   129  C "C5'" . DA  A 1 7   ? 119.256 -52.018  -17.122 1.00 16.07  ? 7   DA  B "C5'" 1 
ATOM   130  C "C4'" . DA  A 1 7   ? 119.702 -53.309  -16.484 1.00 14.91  ? 7   DA  B "C4'" 1 
ATOM   131  O "O4'" . DA  A 1 7   ? 119.424 -53.325  -15.071 1.00 14.49  ? 7   DA  B "O4'" 1 
ATOM   132  C "C3'" . DA  A 1 7   ? 119.017 -54.555  -17.027 1.00 12.58  ? 7   DA  B "C3'" 1 
ATOM   133  O "O3'" . DA  A 1 7   ? 119.934 -55.613  -16.854 1.00 15.92  ? 7   DA  B "O3'" 1 
ATOM   134  C "C2'" . DA  A 1 7   ? 117.895 -54.777  -16.034 1.00 13.01  ? 7   DA  B "C2'" 1 
ATOM   135  C "C1'" . DA  A 1 7   ? 118.665 -54.485  -14.778 1.00 11.38  ? 7   DA  B "C1'" 1 
ATOM   136  N N9    . DA  A 1 7   ? 117.897 -54.230  -13.573 1.00 18.83  ? 7   DA  B N9    1 
ATOM   137  C C8    . DA  A 1 7   ? 116.701 -53.589  -13.399 1.00 16.46  ? 7   DA  B C8    1 
ATOM   138  N N7    . DA  A 1 7   ? 116.301 -53.545  -12.149 1.00 15.81  ? 7   DA  B N7    1 
ATOM   139  C C5    . DA  A 1 7   ? 117.307 -54.206  -11.463 1.00 15.84  ? 7   DA  B C5    1 
ATOM   140  C C6    . DA  A 1 7   ? 117.481 -54.502  -10.116 1.00 15.24  ? 7   DA  B C6    1 
ATOM   141  N N6    . DA  A 1 7   ? 116.592 -54.201  -9.176  1.00 17.69  ? 7   DA  B N6    1 
ATOM   142  N N1    . DA  A 1 7   ? 118.609 -55.140  -9.759  1.00 15.48  ? 7   DA  B N1    1 
ATOM   143  C C2    . DA  A 1 7   ? 119.484 -55.480  -10.712 1.00 18.90  ? 7   DA  B C2    1 
ATOM   144  N N3    . DA  A 1 7   ? 119.423 -55.275  -12.016 1.00 18.98  ? 7   DA  B N3    1 
ATOM   145  C C4    . DA  A 1 7   ? 118.298 -54.623  -12.328 1.00 17.26  ? 7   DA  B C4    1 
ATOM   146  P P     . DC  A 1 8   ? 120.173 -56.647  -18.025 1.00 31.04  ? 8   DC  B P     1 
ATOM   147  O OP1   . DC  A 1 8   ? 121.528 -56.322  -18.542 1.00 38.27  ? 8   DC  B OP1   1 
ATOM   148  O OP2   . DC  A 1 8   ? 119.000 -56.611  -18.931 1.00 35.75  ? 8   DC  B OP2   1 
ATOM   149  O "O5'" . DC  A 1 8   ? 120.221 -58.037  -17.256 1.00 28.42  ? 8   DC  B "O5'" 1 
ATOM   150  C "C5'" . DC  A 1 8   ? 121.300 -58.324  -16.369 1.00 29.62  ? 8   DC  B "C5'" 1 
ATOM   151  C "C4'" . DC  A 1 8   ? 120.852 -59.215  -15.229 1.00 29.66  ? 8   DC  B "C4'" 1 
ATOM   152  O "O4'" . DC  A 1 8   ? 120.046 -58.494  -14.260 1.00 27.41  ? 8   DC  B "O4'" 1 
ATOM   153  C "C3'" . DC  A 1 8   ? 120.068 -60.493  -15.564 1.00 29.48  ? 8   DC  B "C3'" 1 
ATOM   154  O "O3'" . DC  A 1 8   ? 120.657 -61.599  -14.873 1.00 34.35  ? 8   DC  B "O3'" 1 
ATOM   155  C "C2'" . DC  A 1 8   ? 118.699 -60.218  -14.963 1.00 29.19  ? 8   DC  B "C2'" 1 
ATOM   156  C "C1'" . DC  A 1 8   ? 119.092 -59.397  -13.768 1.00 25.50  ? 8   DC  B "C1'" 1 
ATOM   157  N N1    . DC  A 1 8   ? 118.045 -58.647  -13.069 1.00 33.07  ? 8   DC  B N1    1 
ATOM   158  C C2    . DC  A 1 8   ? 118.167 -58.486  -11.679 1.00 34.17  ? 8   DC  B C2    1 
ATOM   159  O O2    . DC  A 1 8   ? 119.219 -58.844  -11.120 1.00 37.14  ? 8   DC  B O2    1 
ATOM   160  N N3    . DC  A 1 8   ? 117.143 -57.939  -10.982 1.00 29.69  ? 8   DC  B N3    1 
ATOM   161  C C4    . DC  A 1 8   ? 116.064 -57.498  -11.627 1.00 27.62  ? 8   DC  B C4    1 
ATOM   162  N N4    . DC  A 1 8   ? 115.071 -56.998  -10.898 1.00 28.61  ? 8   DC  B N4    1 
ATOM   163  C C5    . DC  A 1 8   ? 115.960 -57.552  -13.052 1.00 29.09  ? 8   DC  B C5    1 
ATOM   164  C C6    . DC  A 1 8   ? 116.965 -58.133  -13.728 1.00 30.37  ? 8   DC  B C6    1 
ATOM   165  P P     . DU  A 1 9   ? 120.053 -63.082  -15.048 1.00 56.53  ? 9   DU  B P     1 
ATOM   166  O OP1   . DU  A 1 9   ? 120.816 -63.762  -16.126 1.00 37.68  ? 9   DU  B OP1   1 
ATOM   167  O OP2   . DU  A 1 9   ? 118.574 -63.011  -15.141 1.00 36.76  ? 9   DU  B OP2   1 
ATOM   168  O "O5'" . DU  A 1 9   ? 120.404 -63.777  -13.654 1.00 54.60  ? 9   DU  B "O5'" 1 
ATOM   169  C "C5'" . DU  A 1 9   ? 121.480 -63.287  -12.841 1.00 49.45  ? 9   DU  B "C5'" 1 
ATOM   170  C "C4'" . DU  A 1 9   ? 121.163 -63.445  -11.370 1.00 45.84  ? 9   DU  B "C4'" 1 
ATOM   171  O "O4'" . DU  A 1 9   ? 120.086 -62.560  -10.967 1.00 43.92  ? 9   DU  B "O4'" 1 
ATOM   172  C "C3'" . DU  A 1 9   ? 120.755 -64.849  -10.918 1.00 42.15  ? 9   DU  B "C3'" 1 
ATOM   173  O "O3'" . DU  A 1 9   ? 121.405 -65.137  -9.667  1.00 43.13  ? 9   DU  B "O3'" 1 
ATOM   174  C "C2'" . DU  A 1 9   ? 119.246 -64.739  -10.768 1.00 39.78  ? 9   DU  B "C2'" 1 
ATOM   175  C "C1'" . DU  A 1 9   ? 119.067 -63.298  -10.306 1.00 38.94  ? 9   DU  B "C1'" 1 
ATOM   176  N N1    . DU  A 1 9   ? 117.770 -62.688  -10.648 1.00 14.66  ? 9   DU  B N1    1 
ATOM   177  C C2    . DU  A 1 9   ? 116.843 -62.450  -9.622  1.00 12.08  ? 9   DU  B C2    1 
ATOM   178  O O2    . DU  A 1 9   ? 117.035 -62.731  -8.452  1.00 11.21  ? 9   DU  B O2    1 
ATOM   179  N N3    . DU  A 1 9   ? 115.671 -61.870  -10.032 1.00 9.81   ? 9   DU  B N3    1 
ATOM   180  C C4    . DU  A 1 9   ? 115.323 -61.512  -11.325 1.00 10.78  ? 9   DU  B C4    1 
ATOM   181  O O4    . DU  A 1 9   ? 114.222 -61.010  -11.534 1.00 9.39   ? 9   DU  B O4    1 
ATOM   182  C C5    . DU  A 1 9   ? 116.316 -61.791  -12.318 1.00 11.16  ? 9   DU  B C5    1 
ATOM   183  C C6    . DU  A 1 9   ? 117.474 -62.353  -11.955 1.00 12.63  ? 9   DU  B C6    1 
HETATM 184  O O1P   . UBB A 1 10  ? 122.486 -66.842  -8.186  1.00 23.17  ? 10  UBB B O1P   1 
HETATM 185  P P     . UBB A 1 10  ? 121.262 -66.590  -8.991  1.00 34.33  ? 10  UBB B P     1 
HETATM 186  O O2P   . UBB A 1 10  ? 120.863 -67.561  -10.038 1.00 26.47  ? 10  UBB B O2P   1 
HETATM 187  O "O5'" . UBB A 1 10  ? 120.074 -66.390  -7.949  1.00 33.80  ? 10  UBB B "O5'" 1 
HETATM 188  C "C5'" . UBB A 1 10  ? 120.267 -65.569  -6.792  1.00 32.44  ? 10  UBB B "C5'" 1 
HETATM 189  C "C4'" . UBB A 1 10  ? 119.173 -65.814  -5.781  1.00 34.95  ? 10  UBB B "C4'" 1 
HETATM 190  O "O4'" . UBB A 1 10  ? 117.955 -65.156  -6.202  1.00 34.01  ? 10  UBB B "O4'" 1 
HETATM 191  C "C1'" . UBB A 1 10  ? 116.900 -66.099  -6.260  1.00 28.60  ? 10  UBB B "C1'" 1 
HETATM 192  N N1    . UBB A 1 10  ? 115.977 -65.667  -7.322  1.00 19.87  ? 10  UBB B N1    1 
HETATM 193  C C6    . UBB A 1 10  ? 116.231 -65.885  -8.657  1.00 17.25  ? 10  UBB B C6    1 
HETATM 194  C C5    . UBB A 1 10  ? 115.440 -65.422  -9.633  1.00 15.13  ? 10  UBB B C5    1 
HETATM 195  C C4    . UBB A 1 10  ? 114.283 -64.672  -9.302  1.00 17.36  ? 10  UBB B C4    1 
HETATM 196  O O4    . UBB A 1 10  ? 113.596 -64.029  -10.089 1.00 20.60  ? 10  UBB B O4    1 
HETATM 197  N N3    . UBB A 1 10  ? 114.061 -64.533  -7.953  1.00 14.59  ? 10  UBB B N3    1 
HETATM 198  C C2    . UBB A 1 10  ? 114.845 -65.000  -6.928  1.00 17.86  ? 10  UBB B C2    1 
HETATM 199  O O2    . UBB A 1 10  ? 114.550 -64.833  -5.756  1.00 17.36  ? 10  UBB B O2    1 
HETATM 200  C "C2'" . UBB A 1 10  ? 117.566 -67.455  -6.424  1.00 33.30  ? 10  UBB B "C2'" 1 
HETATM 201  C "C3'" . UBB A 1 10  ? 118.818 -67.289  -5.581  1.00 36.50  ? 10  UBB B "C3'" 1 
HETATM 202  O "O5'" . GNG B 2 1   ? 117.235 -70.320  -4.555  1.00 70.50  ? 11  GNG C "O5'" 1 
HETATM 203  C "C5'" . GNG B 2 1   ? 116.006 -70.991  -4.266  1.00 68.57  ? 11  GNG C "C5'" 1 
HETATM 204  C "C4'" . GNG B 2 1   ? 115.102 -70.124  -3.412  1.00 67.66  ? 11  GNG C "C4'" 1 
HETATM 205  O "O4'" . GNG B 2 1   ? 114.778 -68.883  -4.097  1.00 63.74  ? 11  GNG C "O4'" 1 
HETATM 206  C "C1'" . GNG B 2 1   ? 113.377 -68.796  -4.376  1.00 59.60  ? 11  GNG C "C1'" 1 
HETATM 207  N N9    . GNG B 2 1   ? 113.225 -68.433  -5.786  1.00 39.74  ? 11  GNG C N9    1 
HETATM 208  C C8    . GNG B 2 1   ? 114.039 -68.843  -6.815  1.00 39.26  ? 11  GNG C C8    1 
HETATM 209  N N7    . GNG B 2 1   ? 113.634 -68.436  -7.987  1.00 38.08  ? 11  GNG C N7    1 
HETATM 210  C C5    . GNG B 2 1   ? 112.494 -67.700  -7.720  1.00 33.46  ? 11  GNG C C5    1 
HETATM 211  C C4    . GNG B 2 1   ? 112.229 -67.665  -6.360  1.00 32.24  ? 11  GNG C C4    1 
HETATM 212  N N3    . GNG B 2 1   ? 111.217 -67.051  -5.718  1.00 28.39  ? 11  GNG C N3    1 
HETATM 213  C C2    . GNG B 2 1   ? 110.406 -66.418  -6.566  1.00 30.51  ? 11  GNG C C2    1 
HETATM 214  N N1    . GNG B 2 1   ? 110.585 -66.395  -7.931  1.00 31.88  ? 11  GNG C N1    1 
HETATM 215  C C6    . GNG B 2 1   ? 111.618 -67.032  -8.609  1.00 32.36  ? 11  GNG C C6    1 
HETATM 216  O O6    . GNG B 2 1   ? 111.674 -66.982  -9.844  1.00 31.41  ? 11  GNG C O6    1 
HETATM 217  N N2    . GNG B 2 1   ? 109.332 -65.753  -6.108  1.00 26.10  ? 11  GNG C N2    1 
HETATM 218  C "C2'" . GNG B 2 1   ? 112.814 -70.184  -4.125  1.00 65.81  ? 11  GNG C "C2'" 1 
HETATM 219  C "C3'" . GNG B 2 1   ? 113.760 -70.785  -3.105  1.00 69.37  ? 11  GNG C "C3'" 1 
HETATM 220  O "O3'" . GNG B 2 1   ? 113.301 -70.489  -1.785  1.00 74.94  ? 11  GNG C "O3'" 1 
ATOM   221  P P     . DG  B 2 2   ? 111.930 -71.150  -1.264  1.00 62.85  ? 12  DG  C P     1 
ATOM   222  O OP1   . DG  B 2 2   ? 111.992 -71.243  0.222   1.00 56.65  ? 12  DG  C OP1   1 
ATOM   223  O OP2   . DG  B 2 2   ? 111.675 -72.378  -2.068  1.00 55.97  ? 12  DG  C OP2   1 
ATOM   224  O "O5'" . DG  B 2 2   ? 110.818 -70.082  -1.661  1.00 57.82  ? 12  DG  C "O5'" 1 
ATOM   225  C "C5'" . DG  B 2 2   ? 110.599 -68.915  -0.871  1.00 56.46  ? 12  DG  C "C5'" 1 
ATOM   226  C "C4'" . DG  B 2 2   ? 109.142 -68.521  -0.933  1.00 52.97  ? 12  DG  C "C4'" 1 
ATOM   227  O "O4'" . DG  B 2 2   ? 108.813 -68.215  -2.305  1.00 49.90  ? 12  DG  C "O4'" 1 
ATOM   228  C "C3'" . DG  B 2 2   ? 108.186 -69.638  -0.518  1.00 51.19  ? 12  DG  C "C3'" 1 
ATOM   229  O "O3'" . DG  B 2 2   ? 106.998 -69.096  0.069   1.00 55.21  ? 12  DG  C "O3'" 1 
ATOM   230  C "C2'" . DG  B 2 2   ? 107.867 -70.325  -1.830  1.00 46.92  ? 12  DG  C "C2'" 1 
ATOM   231  C "C1'" . DG  B 2 2   ? 107.925 -69.187  -2.833  1.00 39.70  ? 12  DG  C "C1'" 1 
ATOM   232  N N9    . DG  B 2 2   ? 108.445 -69.602  -4.132  1.00 24.80  ? 12  DG  C N9    1 
ATOM   233  C C8    . DG  B 2 2   ? 109.479 -70.474  -4.374  1.00 20.36  ? 12  DG  C C8    1 
ATOM   234  N N7    . DG  B 2 2   ? 109.699 -70.667  -5.646  1.00 18.97  ? 12  DG  C N7    1 
ATOM   235  C C5    . DG  B 2 2   ? 108.751 -69.875  -6.279  1.00 18.30  ? 12  DG  C C5    1 
ATOM   236  C C6    . DG  B 2 2   ? 108.485 -69.684  -7.663  1.00 16.16  ? 12  DG  C C6    1 
ATOM   237  O O6    . DG  B 2 2   ? 109.049 -70.210  -8.638  1.00 14.48  ? 12  DG  C O6    1 
ATOM   238  N N1    . DG  B 2 2   ? 107.438 -68.786  -7.864  1.00 14.48  ? 12  DG  C N1    1 
ATOM   239  C C2    . DG  B 2 2   ? 106.731 -68.159  -6.864  1.00 16.36  ? 12  DG  C C2    1 
ATOM   240  N N2    . DG  B 2 2   ? 105.750 -67.325  -7.255  1.00 14.48  ? 12  DG  C N2    1 
ATOM   241  N N3    . DG  B 2 2   ? 106.964 -68.337  -5.574  1.00 19.83  ? 12  DG  C N3    1 
ATOM   242  C C4    . DG  B 2 2   ? 107.978 -69.201  -5.357  1.00 18.74  ? 12  DG  C C4    1 
ATOM   243  P P     . DA  B 2 3   ? 105.909 -70.082  0.735   1.00 97.35  ? 13  DA  C P     1 
ATOM   244  O OP1   . DA  B 2 3   ? 105.642 -69.551  2.104   1.00 57.70  ? 13  DA  C OP1   1 
ATOM   245  O OP2   . DA  B 2 3   ? 106.345 -71.499  0.557   1.00 58.97  ? 13  DA  C OP2   1 
ATOM   246  O "O5'" . DA  B 2 3   ? 104.604 -69.854  -0.152  1.00 94.72  ? 13  DA  C "O5'" 1 
ATOM   247  C "C5'" . DA  B 2 3   ? 104.133 -68.533  -0.414  1.00 91.48  ? 13  DA  C "C5'" 1 
ATOM   248  C "C4'" . DA  B 2 3   ? 103.177 -68.522  -1.585  1.00 89.21  ? 13  DA  C "C4'" 1 
ATOM   249  O "O4'" . DA  B 2 3   ? 103.872 -68.774  -2.832  1.00 85.52  ? 13  DA  C "O4'" 1 
ATOM   250  C "C3'" . DA  B 2 3   ? 102.015 -69.516  -1.527  1.00 89.47  ? 13  DA  C "C3'" 1 
ATOM   251  O "O3'" . DA  B 2 3   ? 100.826 -68.837  -1.938  1.00 92.68  ? 13  DA  C "O3'" 1 
ATOM   252  C "C2'" . DA  B 2 3   ? 102.408 -70.581  -2.540  1.00 85.75  ? 13  DA  C "C2'" 1 
ATOM   253  C "C1'" . DA  B 2 3   ? 103.198 -69.785  -3.569  1.00 81.04  ? 13  DA  C "C1'" 1 
ATOM   254  N N9    . DA  B 2 3   ? 104.207 -70.540  -4.320  1.00 36.74  ? 13  DA  C N9    1 
ATOM   255  C C8    . DA  B 2 3   ? 105.208 -71.338  -3.824  1.00 34.99  ? 13  DA  C C8    1 
ATOM   256  N N7    . DA  B 2 3   ? 105.978 -71.864  -4.746  1.00 33.22  ? 13  DA  C N7    1 
ATOM   257  C C5    . DA  B 2 3   ? 105.445 -71.388  -5.935  1.00 29.11  ? 13  DA  C C5    1 
ATOM   258  C C6    . DA  B 2 3   ? 105.810 -71.586  -7.282  1.00 25.99  ? 13  DA  C C6    1 
ATOM   259  N N6    . DA  B 2 3   ? 106.847 -72.336  -7.675  1.00 26.43  ? 13  DA  C N6    1 
ATOM   260  N N1    . DA  B 2 3   ? 105.066 -70.978  -8.226  1.00 22.93  ? 13  DA  C N1    1 
ATOM   261  C C2    . DA  B 2 3   ? 104.034 -70.214  -7.836  1.00 25.95  ? 13  DA  C C2    1 
ATOM   262  N N3    . DA  B 2 3   ? 103.596 -69.945  -6.606  1.00 27.51  ? 13  DA  C N3    1 
ATOM   263  C C4    . DA  B 2 3   ? 104.352 -70.575  -5.688  1.00 31.76  ? 13  DA  C C4    1 
ATOM   264  P P     . DA  B 2 4   ? 99.381  -69.336  -1.431  1.00 62.49  ? 14  DA  C P     1 
ATOM   265  O OP1   . DA  B 2 4   ? 98.664  -68.103  -1.005  1.00 58.53  ? 14  DA  C OP1   1 
ATOM   266  O OP2   . DA  B 2 4   ? 99.494  -70.483  -0.487  1.00 58.97  ? 14  DA  C OP2   1 
ATOM   267  O "O5'" . DA  B 2 4   ? 98.723  -69.880  -2.776  1.00 60.53  ? 14  DA  C "O5'" 1 
ATOM   268  C "C5'" . DA  B 2 4   ? 98.764  -69.091  -3.967  1.00 59.29  ? 14  DA  C "C5'" 1 
ATOM   269  C "C4'" . DA  B 2 4   ? 98.700  -69.964  -5.201  1.00 57.03  ? 14  DA  C "C4'" 1 
ATOM   270  O "O4'" . DA  B 2 4   ? 99.977  -70.558  -5.558  1.00 52.81  ? 14  DA  C "O4'" 1 
ATOM   271  C "C3'" . DA  B 2 4   ? 97.695  -71.116  -5.159  1.00 57.97  ? 14  DA  C "C3'" 1 
ATOM   272  O "O3'" . DA  B 2 4   ? 97.021  -71.139  -6.410  1.00 63.81  ? 14  DA  C "O3'" 1 
ATOM   273  C "C2'" . DA  B 2 4   ? 98.590  -72.342  -5.083  1.00 51.46  ? 14  DA  C "C2'" 1 
ATOM   274  C "C1'" . DA  B 2 4   ? 99.707  -71.878  -5.990  1.00 44.02  ? 14  DA  C "C1'" 1 
ATOM   275  N N9    . DA  B 2 4   ? 100.954 -72.647  -6.029  1.00 28.81  ? 14  DA  C N9    1 
ATOM   276  C C8    . DA  B 2 4   ? 101.677 -73.232  -5.013  1.00 25.70  ? 14  DA  C C8    1 
ATOM   277  N N7    . DA  B 2 4   ? 102.764 -73.853  -5.421  1.00 19.00  ? 14  DA  C N7    1 
ATOM   278  C C5    . DA  B 2 4   ? 102.759 -73.669  -6.800  1.00 18.44  ? 14  DA  C C5    1 
ATOM   279  C C6    . DA  B 2 4   ? 103.655 -74.086  -7.835  1.00 15.99  ? 14  DA  C C6    1 
ATOM   280  N N6    . DA  B 2 4   ? 104.749 -74.818  -7.629  1.00 14.40  ? 14  DA  C N6    1 
ATOM   281  N N1    . DA  B 2 4   ? 103.367 -73.719  -9.104  1.00 14.40  ? 14  DA  C N1    1 
ATOM   282  C C2    . DA  B 2 4   ? 102.251 -72.997  -9.322  1.00 14.40  ? 14  DA  C C2    1 
ATOM   283  N N3    . DA  B 2 4   ? 101.326 -72.555  -8.443  1.00 15.87  ? 14  DA  C N3    1 
ATOM   284  C C4    . DA  B 2 4   ? 101.649 -72.927  -7.187  1.00 20.60  ? 14  DA  C C4    1 
ATOM   285  P P     . DA  B 2 5   ? 95.458  -71.467  -6.468  1.00 116.62 ? 15  DA  C P     1 
ATOM   286  O OP1   . DA  B 2 5   ? 94.745  -70.205  -6.144  1.00 64.37  ? 15  DA  C OP1   1 
ATOM   287  O OP2   . DA  B 2 5   ? 95.216  -72.683  -5.652  1.00 62.88  ? 15  DA  C OP2   1 
ATOM   288  O "O5'" . DA  B 2 5   ? 95.217  -71.808  -8.007  1.00 115.30 ? 15  DA  C "O5'" 1 
ATOM   289  C "C5'" . DA  B 2 5   ? 95.635  -70.895  -9.023  1.00 112.86 ? 15  DA  C "C5'" 1 
ATOM   290  C "C4'" . DA  B 2 5   ? 96.343  -71.623  -10.145 1.00 110.90 ? 15  DA  C "C4'" 1 
ATOM   291  O "O4'" . DA  B 2 5   ? 97.590  -72.208  -9.682  1.00 107.89 ? 15  DA  C "O4'" 1 
ATOM   292  C "C3'" . DA  B 2 5   ? 95.558  -72.757  -10.809 1.00 113.02 ? 15  DA  C "C3'" 1 
ATOM   293  O "O3'" . DA  B 2 5   ? 95.681  -72.656  -12.234 1.00 115.56 ? 15  DA  C "O3'" 1 
ATOM   294  C "C2'" . DA  B 2 5   ? 96.244  -74.015  -10.296 1.00 109.84 ? 15  DA  C "C2'" 1 
ATOM   295  C "C1'" . DA  B 2 5   ? 97.683  -73.554  -10.133 1.00 102.90 ? 15  DA  C "C1'" 1 
ATOM   296  N N9    . DA  B 2 5   ? 98.488  -74.319  -9.170  1.00 45.76  ? 15  DA  C N9    1 
ATOM   297  C C8    . DA  B 2 5   ? 98.352  -74.352  -7.801  1.00 43.74  ? 15  DA  C C8    1 
ATOM   298  N N7    . DA  B 2 5   ? 99.221  -75.132  -7.196  1.00 41.11  ? 15  DA  C N7    1 
ATOM   299  C C5    . DA  B 2 5   ? 99.981  -75.652  -8.233  1.00 39.05  ? 15  DA  C C5    1 
ATOM   300  C C6    . DA  B 2 5   ? 101.071 -76.543  -8.248  1.00 39.94  ? 15  DA  C C6    1 
ATOM   301  N N6    . DA  B 2 5   ? 101.596 -77.081  -7.147  1.00 35.89  ? 15  DA  C N6    1 
ATOM   302  N N1    . DA  B 2 5   ? 101.610 -76.862  -9.445  1.00 41.22  ? 15  DA  C N1    1 
ATOM   303  C C2    . DA  B 2 5   ? 101.085 -76.312  -10.544 1.00 40.70  ? 15  DA  C C2    1 
ATOM   304  N N3    . DA  B 2 5   ? 100.061 -75.457  -10.660 1.00 37.64  ? 15  DA  C N3    1 
ATOM   305  C C4    . DA  B 2 5   ? 99.545  -75.162  -9.454  1.00 40.56  ? 15  DA  C C4    1 
ATOM   306  P P     . DA  B 2 6   ? 94.667  -73.464  -13.190 1.00 93.81  ? 16  DA  C P     1 
ATOM   307  O OP1   . DA  B 2 6   ? 94.436  -72.598  -14.381 1.00 65.28  ? 16  DA  C OP1   1 
ATOM   308  O OP2   . DA  B 2 6   ? 93.505  -73.941  -12.390 1.00 62.08  ? 16  DA  C OP2   1 
ATOM   309  O "O5'" . DA  B 2 6   ? 95.511  -74.745  -13.632 1.00 94.13  ? 16  DA  C "O5'" 1 
ATOM   310  C "C5'" . DA  B 2 6   ? 96.705  -74.592  -14.403 1.00 92.15  ? 16  DA  C "C5'" 1 
ATOM   311  C "C4'" . DA  B 2 6   ? 97.372  -75.925  -14.677 1.00 89.55  ? 16  DA  C "C4'" 1 
ATOM   312  O "O4'" . DA  B 2 6   ? 98.119  -76.432  -13.545 1.00 85.12  ? 16  DA  C "O4'" 1 
ATOM   313  C "C3'" . DA  B 2 6   ? 96.516  -77.091  -15.173 1.00 90.41  ? 16  DA  C "C3'" 1 
ATOM   314  O "O3'" . DA  B 2 6   ? 97.227  -77.713  -16.246 1.00 94.08  ? 16  DA  C "O3'" 1 
ATOM   315  C "C2'" . DA  B 2 6   ? 96.495  -78.032  -13.979 1.00 86.40  ? 16  DA  C "C2'" 1 
ATOM   316  C "C1'" . DA  B 2 6   ? 97.900  -77.826  -13.453 1.00 81.20  ? 16  DA  C "C1'" 1 
ATOM   317  N N9    . DA  B 2 6   ? 98.190  -78.243  -12.081 1.00 46.38  ? 16  DA  C N9    1 
ATOM   318  C C8    . DA  B 2 6   ? 97.458  -78.072  -10.925 1.00 43.89  ? 16  DA  C C8    1 
ATOM   319  N N7    . DA  B 2 6   ? 98.050  -78.544  -9.851  1.00 41.38  ? 16  DA  C N7    1 
ATOM   320  C C5    . DA  B 2 6   ? 99.245  -79.070  -10.331 1.00 38.51  ? 16  DA  C C5    1 
ATOM   321  C C6    . DA  B 2 6   ? 100.336 -79.711  -9.695  1.00 37.31  ? 16  DA  C C6    1 
ATOM   322  N N6    . DA  B 2 6   ? 100.402 -79.949  -8.383  1.00 31.42  ? 16  DA  C N6    1 
ATOM   323  N N1    . DA  B 2 6   ? 101.372 -80.103  -10.468 1.00 36.86  ? 16  DA  C N1    1 
ATOM   324  C C2    . DA  B 2 6   ? 101.314 -79.871  -11.785 1.00 39.96  ? 16  DA  C C2    1 
ATOM   325  N N3    . DA  B 2 6   ? 100.352 -79.285  -12.498 1.00 38.63  ? 16  DA  C N3    1 
ATOM   326  C C4    . DA  B 2 6   ? 99.338  -78.900  -11.704 1.00 40.27  ? 16  DA  C C4    1 
ATOM   327  P P     . DA  B 2 7   ? 96.510  -78.825  -17.145 1.00 80.02  ? 17  DA  C P     1 
ATOM   328  O OP1   . DA  B 2 7   ? 96.345  -78.234  -18.496 1.00 68.85  ? 17  DA  C OP1   1 
ATOM   329  O OP2   . DA  B 2 7   ? 95.317  -79.316  -16.401 1.00 67.87  ? 17  DA  C OP2   1 
ATOM   330  O "O5'" . DA  B 2 7   ? 97.600  -79.990  -17.224 1.00 76.67  ? 17  DA  C "O5'" 1 
ATOM   331  C "C5'" . DA  B 2 7   ? 98.962  -79.689  -17.549 1.00 72.01  ? 17  DA  C "C5'" 1 
ATOM   332  C "C4'" . DA  B 2 7   ? 99.898  -80.745  -17.002 1.00 67.72  ? 17  DA  C "C4'" 1 
ATOM   333  O "O4'" . DA  B 2 7   ? 99.869  -80.786  -15.553 1.00 62.12  ? 17  DA  C "O4'" 1 
ATOM   334  C "C3'" . DA  B 2 7   ? 99.636  -82.179  -17.460 1.00 67.99  ? 17  DA  C "C3'" 1 
ATOM   335  O "O3'" . DA  B 2 7   ? 100.906 -82.825  -17.602 1.00 74.04  ? 17  DA  C "O3'" 1 
ATOM   336  C "C2'" . DA  B 2 7   ? 98.891  -82.770  -16.278 1.00 61.68  ? 17  DA  C "C2'" 1 
ATOM   337  C "C1'" . DA  B 2 7   ? 99.635  -82.120  -15.127 1.00 52.44  ? 17  DA  C "C1'" 1 
ATOM   338  N N9    . DA  B 2 7   ? 98.930  -82.074  -13.843 1.00 29.01  ? 17  DA  C N9    1 
ATOM   339  C C8    . DA  B 2 7   ? 97.653  -81.618  -13.602 1.00 24.43  ? 17  DA  C C8    1 
ATOM   340  N N7    . DA  B 2 7   ? 97.303  -81.657  -12.332 1.00 19.78  ? 17  DA  C N7    1 
ATOM   341  C C5    . DA  B 2 7   ? 98.422  -82.178  -11.690 1.00 16.93  ? 17  DA  C C5    1 
ATOM   342  C C6    . DA  B 2 7   ? 98.700  -82.445  -10.320 1.00 15.08  ? 17  DA  C C6    1 
ATOM   343  N N6    . DA  B 2 7   ? 97.847  -82.188  -9.323  1.00 15.08  ? 17  DA  C N6    1 
ATOM   344  N N1    . DA  B 2 7   ? 99.905  -82.977  -10.017 1.00 15.08  ? 17  DA  C N1    1 
ATOM   345  C C2    . DA  B 2 7   ? 100.776 -83.206  -11.021 1.00 17.23  ? 17  DA  C C2    1 
ATOM   346  N N3    . DA  B 2 7   ? 100.640 -82.983  -12.339 1.00 18.15  ? 17  DA  C N3    1 
ATOM   347  C C4    . DA  B 2 7   ? 99.427  -82.460  -12.611 1.00 19.32  ? 17  DA  C C4    1 
ATOM   348  P P     . DU  B 2 8   ? 101.173 -83.826  -18.831 1.00 83.89  ? 18  DU  C P     1 
ATOM   349  O OP1   . DU  B 2 8   ? 102.651 -83.997  -18.904 1.00 65.24  ? 18  DU  C OP1   1 
ATOM   350  O OP2   . DU  B 2 8   ? 100.418 -83.356  -20.028 1.00 65.07  ? 18  DU  C OP2   1 
ATOM   351  O "O5'" . DU  B 2 8   ? 100.566 -85.213  -18.344 1.00 82.66  ? 18  DU  C "O5'" 1 
ATOM   352  C "C5'" . DU  B 2 8   ? 100.175 -85.382  -16.991 1.00 80.69  ? 18  DU  C "C5'" 1 
ATOM   353  C "C4'" . DU  B 2 8   ? 101.313 -85.960  -16.187 1.00 79.43  ? 18  DU  C "C4'" 1 
ATOM   354  O "O4'" . DU  B 2 8   ? 101.157 -85.576  -14.804 1.00 74.77  ? 18  DU  C "O4'" 1 
ATOM   355  C "C3'" . DU  B 2 8   ? 101.363 -87.482  -16.202 1.00 79.52  ? 18  DU  C "C3'" 1 
ATOM   356  O "O3'" . DU  B 2 8   ? 102.729 -87.927  -16.175 1.00 84.44  ? 18  DU  C "O3'" 1 
ATOM   357  C "C2'" . DU  B 2 8   ? 100.557 -87.864  -14.966 1.00 76.47  ? 18  DU  C "C2'" 1 
ATOM   358  C "C1'" . DU  B 2 8   ? 100.761 -86.688  -14.007 1.00 71.59  ? 18  DU  C "C1'" 1 
ATOM   359  N N1    . DU  B 2 8   ? 99.583  -86.267  -13.213 1.00 46.56  ? 18  DU  C N1    1 
ATOM   360  C C2    . DU  B 2 8   ? 99.614  -86.446  -11.822 1.00 41.57  ? 18  DU  C C2    1 
ATOM   361  O O2    . DU  B 2 8   ? 100.529 -87.017  -11.239 1.00 36.22  ? 18  DU  C O2    1 
ATOM   362  N N3    . DU  B 2 8   ? 98.525  -85.934  -11.141 1.00 38.70  ? 18  DU  C N3    1 
ATOM   363  C C4    . DU  B 2 8   ? 97.426  -85.295  -11.681 1.00 40.41  ? 18  DU  C C4    1 
ATOM   364  O O4    . DU  B 2 8   ? 96.618  -84.751  -10.931 1.00 38.87  ? 18  DU  C O4    1 
ATOM   365  C C5    . DU  B 2 8   ? 97.434  -85.201  -13.110 1.00 43.59  ? 18  DU  C C5    1 
ATOM   366  C C6    . DU  B 2 8   ? 98.480  -85.675  -13.811 1.00 46.10  ? 18  DU  C C6    1 
ATOM   367  P P     . DU  B 2 9   ? 103.065 -89.503  -16.224 1.00 100.77 ? 19  DU  C P     1 
ATOM   368  O OP1   . DU  B 2 9   ? 104.324 -89.728  -16.990 1.00 72.05  ? 19  DU  C OP1   1 
ATOM   369  O OP2   . DU  B 2 9   ? 101.828 -90.229  -16.622 1.00 72.08  ? 19  DU  C OP2   1 
ATOM   370  O "O5'" . DU  B 2 9   ? 103.388 -89.832  -14.701 1.00 97.49  ? 19  DU  C "O5'" 1 
ATOM   371  C "C5'" . DU  B 2 9   ? 103.220 -91.141  -14.189 1.00 93.68  ? 19  DU  C "C5'" 1 
ATOM   372  C "C4'" . DU  B 2 9   ? 103.431 -91.149  -12.694 1.00 90.10  ? 19  DU  C "C4'" 1 
ATOM   373  O "O4'" . DU  B 2 9   ? 102.521 -90.226  -12.046 1.00 84.20  ? 19  DU  C "O4'" 1 
ATOM   374  C "C3'" . DU  B 2 9   ? 103.158 -92.514  -12.073 1.00 91.40  ? 19  DU  C "C3'" 1 
ATOM   375  O "O3'" . DU  B 2 9   ? 104.117 -92.804  -11.064 1.00 97.83  ? 19  DU  C "O3'" 1 
ATOM   376  C "C2'" . DU  B 2 9   ? 101.763 -92.386  -11.494 1.00 85.15  ? 19  DU  C "C2'" 1 
ATOM   377  C "C1'" . DU  B 2 9   ? 101.681 -90.917  -11.129 1.00 76.88  ? 19  DU  C "C1'" 1 
ATOM   378  N N1    . DU  B 2 9   ? 100.325 -90.356  -11.242 1.00 36.26  ? 19  DU  C N1    1 
ATOM   379  C C2    . DU  B 2 9   ? 99.646  -90.057  -10.059 1.00 30.00  ? 19  DU  C C2    1 
ATOM   380  O O2    . DU  B 2 9   ? 100.120 -90.262  -8.943  1.00 29.60  ? 19  DU  C O2    1 
ATOM   381  N N3    . DU  B 2 9   ? 98.389  -89.514  -10.230 1.00 25.90  ? 19  DU  C N3    1 
ATOM   382  C C4    . DU  B 2 9   ? 97.746  -89.253  -11.433 1.00 26.99  ? 19  DU  C C4    1 
ATOM   383  O O4    . DU  B 2 9   ? 96.596  -88.786  -11.423 1.00 25.51  ? 19  DU  C O4    1 
ATOM   384  C C5    . DU  B 2 9   ? 98.512  -89.601  -12.606 1.00 27.99  ? 19  DU  C C5    1 
ATOM   385  C C6    . DU  B 2 9   ? 99.739  -90.127  -12.473 1.00 31.13  ? 19  DU  C C6    1 
ATOM   386  P P     . DU  B 2 10  ? 104.400 -94.327  -10.675 1.00 99.18  ? 20  DU  C P     1 
ATOM   387  O OP1   . DU  B 2 10  ? 105.846 -94.440  -10.338 1.00 75.72  ? 20  DU  C OP1   1 
ATOM   388  O OP2   . DU  B 2 10  ? 103.829 -95.168  -11.760 1.00 73.84  ? 20  DU  C OP2   1 
ATOM   389  O "O5'" . DU  B 2 10  ? 103.523 -94.532  -9.362  1.00 97.75  ? 20  DU  C "O5'" 1 
ATOM   390  C "C5'" . DU  B 2 10  ? 103.770 -93.746  -8.196  1.00 94.88  ? 20  DU  C "C5'" 1 
ATOM   391  C "C4'" . DU  B 2 10  ? 102.608 -93.836  -7.233  1.00 93.19  ? 20  DU  C "C4'" 1 
ATOM   392  O "O4'" . DU  B 2 10  ? 101.438 -93.169  -7.769  1.00 88.31  ? 20  DU  C "O4'" 1 
ATOM   393  C "C3'" . DU  B 2 10  ? 102.150 -95.254  -6.880  1.00 94.12  ? 20  DU  C "C3'" 1 
ATOM   394  O "O3'" . DU  B 2 10  ? 101.745 -95.275  -5.506  1.00 99.33  ? 20  DU  C "O3'" 1 
ATOM   395  C "C2'" . DU  B 2 10  ? 100.930 -95.436  -7.762  1.00 88.85  ? 20  DU  C "C2'" 1 
ATOM   396  C "C1'" . DU  B 2 10  ? 100.339 -94.051  -7.642  1.00 80.71  ? 20  DU  C "C1'" 1 
ATOM   397  N N1    . DU  B 2 10  ? 99.310  -93.674  -8.618  1.00 45.21  ? 20  DU  C N1    1 
ATOM   398  C C2    . DU  B 2 10  ? 98.172  -93.072  -8.114  1.00 42.02  ? 20  DU  C C2    1 
ATOM   399  O O2    . DU  B 2 10  ? 98.014  -92.852  -6.920  1.00 39.22  ? 20  DU  C O2    1 
ATOM   400  N N3    . DU  B 2 10  ? 97.227  -92.731  -9.053  1.00 41.28  ? 20  DU  C N3    1 
ATOM   401  C C4    . DU  B 2 10  ? 97.304  -92.926  -10.417 1.00 42.68  ? 20  DU  C C4    1 
ATOM   402  O O4    . DU  B 2 10  ? 96.370  -92.552  -11.134 1.00 44.62  ? 20  DU  C O4    1 
ATOM   403  C C5    . DU  B 2 10  ? 98.515  -93.557  -10.863 1.00 38.32  ? 20  DU  C C5    1 
ATOM   404  C C6    . DU  B 2 10  ? 99.453  -93.901  -9.969  1.00 42.21  ? 20  DU  C C6    1 
ATOM   405  P P     . DU  B 2 11  ? 101.206 -96.637  -4.852  1.00 75.52  ? 21  DU  C P     1 
ATOM   406  O OP1   . DU  B 2 11  ? 102.392 -97.495  -4.597  1.00 69.93  ? 21  DU  C OP1   1 
ATOM   407  O OP2   . DU  B 2 11  ? 100.090 -97.160  -5.677  1.00 70.08  ? 21  DU  C OP2   1 
ATOM   408  O "O5'" . DU  B 2 11  ? 100.581 -96.168  -3.465  1.00 78.02  ? 21  DU  C "O5'" 1 
ATOM   409  C "C5'" . DU  B 2 11  ? 99.587  -96.954  -2.809  1.00 80.80  ? 21  DU  C "C5'" 1 
ATOM   410  C "C4'" . DU  B 2 11  ? 98.396  -96.094  -2.460  1.00 83.00  ? 21  DU  C "C4'" 1 
ATOM   411  O "O4'" . DU  B 2 11  ? 97.961  -95.408  -3.664  1.00 80.80  ? 21  DU  C "O4'" 1 
ATOM   412  C "C3'" . DU  B 2 11  ? 97.181  -96.873  -1.945  1.00 85.32  ? 21  DU  C "C3'" 1 
ATOM   413  O "O3'" . DU  B 2 11  ? 96.513  -96.161  -0.885  1.00 89.97  ? 21  DU  C "O3'" 1 
ATOM   414  C "C2'" . DU  B 2 11  ? 96.294  -96.976  -3.169  1.00 82.95  ? 21  DU  C "C2'" 1 
ATOM   415  C "C1'" . DU  B 2 11  ? 96.586  -95.675  -3.896  1.00 78.55  ? 21  DU  C "C1'" 1 
ATOM   416  N N1    . DU  B 2 11  ? 96.358  -95.755  -5.347  1.00 68.30  ? 21  DU  C N1    1 
ATOM   417  C C2    . DU  B 2 11  ? 95.277  -95.056  -5.874  1.00 67.61  ? 21  DU  C C2    1 
ATOM   418  O O2    . DU  B 2 11  ? 94.551  -94.337  -5.202  1.00 68.34  ? 21  DU  C O2    1 
ATOM   419  N N3    . DU  B 2 11  ? 95.084  -95.226  -7.222  1.00 66.03  ? 21  DU  C N3    1 
ATOM   420  C C4    . DU  B 2 11  ? 95.850  -95.989  -8.084  1.00 65.58  ? 21  DU  C C4    1 
ATOM   421  O O4    . DU  B 2 11  ? 95.514  -96.085  -9.266  1.00 64.57  ? 21  DU  C O4    1 
ATOM   422  C C5    . DU  B 2 11  ? 96.965  -96.649  -7.471  1.00 64.85  ? 21  DU  C C5    1 
ATOM   423  C C6    . DU  B 2 11  ? 97.174  -96.514  -6.158  1.00 66.08  ? 21  DU  C C6    1 
ATOM   424  P P     . DT  B 2 12  ? 95.068  -96.657  -0.361  1.00 105.78 ? 22  DT  C P     1 
ATOM   425  O OP1   . DT  B 2 12  ? 94.798  -95.904  0.892   1.00 89.95  ? 22  DT  C OP1   1 
ATOM   426  O OP2   . DT  B 2 12  ? 95.058  -98.144  -0.344  1.00 88.73  ? 22  DT  C OP2   1 
ATOM   427  O "O5'" . DT  B 2 12  ? 94.052  -96.153  -1.488  1.00 105.79 ? 22  DT  C "O5'" 1 
ATOM   428  C "C5'" . DT  B 2 12  ? 92.814  -96.829  -1.747  1.00 105.87 ? 22  DT  C "C5'" 1 
ATOM   429  C "C4'" . DT  B 2 12  ? 92.159  -96.262  -2.990  1.00 105.79 ? 22  DT  C "C4'" 1 
ATOM   430  O "O4'" . DT  B 2 12  ? 93.019  -96.489  -4.132  1.00 104.66 ? 22  DT  C "O4'" 1 
ATOM   431  C "C3'" . DT  B 2 12  ? 90.813  -96.887  -3.370  1.00 106.21 ? 22  DT  C "C3'" 1 
ATOM   432  O "O3'" . DT  B 2 12  ? 90.018  -96.026  -4.209  1.00 106.83 ? 22  DT  C "O3'" 1 
ATOM   433  C "C2'" . DT  B 2 12  ? 91.223  -97.992  -4.319  1.00 105.14 ? 22  DT  C "C2'" 1 
ATOM   434  C "C1'" . DT  B 2 12  ? 92.365  -97.335  -5.068  1.00 100.75 ? 22  DT  C "C1'" 1 
ATOM   435  N N1    . DT  B 2 12  ? 93.353  -98.281  -5.603  1.00 79.83  ? 22  DT  C N1    1 
ATOM   436  C C2    . DT  B 2 12  ? 93.172  -98.722  -6.884  1.00 76.57  ? 22  DT  C C2    1 
ATOM   437  O O2    . DT  B 2 12  ? 92.219  -98.409  -7.553  1.00 72.33  ? 22  DT  C O2    1 
ATOM   438  N N3    . DT  B 2 12  ? 94.143  -99.565  -7.348  1.00 76.26  ? 22  DT  C N3    1 
ATOM   439  C C4    . DT  B 2 12  ? 95.250  -100.021 -6.662  1.00 78.88  ? 22  DT  C C4    1 
ATOM   440  O O4    . DT  B 2 12  ? 96.048  -100.777 -7.223  1.00 81.67  ? 22  DT  C O4    1 
ATOM   441  C C5    . DT  B 2 12  ? 95.364  -99.540  -5.295  1.00 79.78  ? 22  DT  C C5    1 
ATOM   442  C C7    . DT  B 2 12  ? 96.515  -99.994  -4.449  1.00 79.68  ? 22  DT  C C7    1 
ATOM   443  C C6    . DT  B 2 12  ? 94.421  -98.703  -4.847  1.00 79.33  ? 22  DT  C C6    1 
ATOM   444  O "O5'" . DA  C 3 1   ? 87.759  -95.360  -6.373  1.00 199.18 ? 101 DA  D "O5'" 1 
ATOM   445  C "C5'" . DA  C 3 1   ? 86.685  -95.510  -7.316  1.00 199.18 ? 101 DA  D "C5'" 1 
ATOM   446  C "C4'" . DA  C 3 1   ? 86.654  -94.406  -8.350  1.00 199.18 ? 101 DA  D "C4'" 1 
ATOM   447  O "O4'" . DA  C 3 1   ? 87.896  -94.431  -9.095  1.00 199.18 ? 101 DA  D "O4'" 1 
ATOM   448  C "C3'" . DA  C 3 1   ? 85.539  -94.508  -9.399  1.00 199.18 ? 101 DA  D "C3'" 1 
ATOM   449  O "O3'" . DA  C 3 1   ? 84.973  -93.210  -9.680  1.00 199.18 ? 101 DA  D "O3'" 1 
ATOM   450  C "C2'" . DA  C 3 1   ? 86.243  -95.134  -10.588 1.00 199.18 ? 101 DA  D "C2'" 1 
ATOM   451  C "C1'" . DA  C 3 1   ? 87.621  -94.534  -10.487 1.00 196.83 ? 101 DA  D "C1'" 1 
ATOM   452  N N9    . DA  C 3 1   ? 88.641  -95.378  -11.101 1.00 66.64  ? 101 DA  D N9    1 
ATOM   453  C C8    . DA  C 3 1   ? 88.729  -95.717  -12.427 1.00 62.65  ? 101 DA  D C8    1 
ATOM   454  N N7    . DA  C 3 1   ? 89.754  -96.481  -12.710 1.00 58.83  ? 101 DA  D N7    1 
ATOM   455  C C5    . DA  C 3 1   ? 90.380  -96.661  -11.488 1.00 60.41  ? 101 DA  D C5    1 
ATOM   456  C C6    . DA  C 3 1   ? 91.525  -97.379  -11.112 1.00 59.91  ? 101 DA  D C6    1 
ATOM   457  N N6    . DA  C 3 1   ? 92.269  -98.088  -11.965 1.00 63.02  ? 101 DA  D N6    1 
ATOM   458  N N1    . DA  C 3 1   ? 91.880  -97.350  -9.811  1.00 58.44  ? 101 DA  D N1    1 
ATOM   459  C C2    . DA  C 3 1   ? 91.121  -96.651  -8.955  1.00 58.31  ? 101 DA  D C2    1 
ATOM   460  N N3    . DA  C 3 1   ? 90.023  -95.945  -9.186  1.00 60.71  ? 101 DA  D N3    1 
ATOM   461  C C4    . DA  C 3 1   ? 89.703  -95.988  -10.487 1.00 62.07  ? 101 DA  D C4    1 
ATOM   462  P P     . DA  C 3 2   ? 84.409  -92.840  -11.156 1.00 133.71 ? 102 DA  D P     1 
ATOM   463  O OP1   . DA  C 3 2   ? 83.055  -92.254  -10.984 1.00 74.56  ? 102 DA  D OP1   1 
ATOM   464  O OP2   . DA  C 3 2   ? 84.588  -93.971  -12.111 1.00 73.99  ? 102 DA  D OP2   1 
ATOM   465  O "O5'" . DA  C 3 2   ? 85.384  -91.654  -11.601 1.00 131.16 ? 102 DA  D "O5'" 1 
ATOM   466  C "C5'" . DA  C 3 2   ? 85.475  -90.425  -10.850 1.00 129.80 ? 102 DA  D "C5'" 1 
ATOM   467  C "C4'" . DA  C 3 2   ? 85.945  -90.688  -9.434  1.00 129.13 ? 102 DA  D "C4'" 1 
ATOM   468  O "O4'" . DA  C 3 2   ? 86.995  -91.682  -9.415  1.00 126.33 ? 102 DA  D "O4'" 1 
ATOM   469  C "C3'" . DA  C 3 2   ? 86.498  -89.487  -8.667  1.00 129.70 ? 102 DA  D "C3'" 1 
ATOM   470  O "O3'" . DA  C 3 2   ? 86.109  -89.575  -7.290  1.00 132.73 ? 102 DA  D "O3'" 1 
ATOM   471  C "C2'" . DA  C 3 2   ? 88.000  -89.685  -8.769  1.00 127.11 ? 102 DA  D "C2'" 1 
ATOM   472  C "C1'" . DA  C 3 2   ? 88.099  -91.196  -8.671  1.00 123.54 ? 102 DA  D "C1'" 1 
ATOM   473  N N9    . DA  C 3 2   ? 89.313  -91.816  -9.211  1.00 60.48  ? 102 DA  D N9    1 
ATOM   474  C C8    . DA  C 3 2   ? 89.765  -91.797  -10.507 1.00 58.99  ? 102 DA  D C8    1 
ATOM   475  N N7    . DA  C 3 2   ? 90.871  -92.477  -10.691 1.00 55.31  ? 102 DA  D N7    1 
ATOM   476  C C5    . DA  C 3 2   ? 91.173  -92.972  -9.433  1.00 53.27  ? 102 DA  D C5    1 
ATOM   477  C C6    . DA  C 3 2   ? 92.218  -93.773  -8.968  1.00 51.79  ? 102 DA  D C6    1 
ATOM   478  N N6    . DA  C 3 2   ? 93.179  -94.255  -9.753  1.00 50.91  ? 102 DA  D N6    1 
ATOM   479  N N1    . DA  C 3 2   ? 92.243  -94.079  -7.655  1.00 50.37  ? 102 DA  D N1    1 
ATOM   480  C C2    . DA  C 3 2   ? 91.265  -93.619  -6.876  1.00 51.78  ? 102 DA  D C2    1 
ATOM   481  N N3    . DA  C 3 2   ? 90.218  -92.866  -7.197  1.00 54.04  ? 102 DA  D N3    1 
ATOM   482  C C4    . DA  C 3 2   ? 90.230  -92.570  -8.508  1.00 55.73  ? 102 DA  D C4    1 
ATOM   483  P P     . DA  C 3 3   ? 85.987  -88.238  -6.406  1.00 99.57  ? 103 DA  D P     1 
ATOM   484  O OP1   . DA  C 3 3   ? 84.643  -88.251  -5.770  1.00 81.12  ? 103 DA  D OP1   1 
ATOM   485  O OP2   . DA  C 3 3   ? 86.406  -87.064  -7.218  1.00 79.87  ? 103 DA  D OP2   1 
ATOM   486  O "O5'" . DA  C 3 3   ? 87.081  -88.420  -5.270  1.00 98.18  ? 103 DA  D "O5'" 1 
ATOM   487  C "C5'" . DA  C 3 3   ? 86.929  -89.402  -4.260  1.00 95.14  ? 103 DA  D "C5'" 1 
ATOM   488  C "C4'" . DA  C 3 3   ? 88.271  -89.686  -3.635  1.00 93.34  ? 103 DA  D "C4'" 1 
ATOM   489  O "O4'" . DA  C 3 3   ? 89.137  -90.240  -4.657  1.00 91.05  ? 103 DA  D "O4'" 1 
ATOM   490  C "C3'" . DA  C 3 3   ? 88.992  -88.440  -3.107  1.00 92.11  ? 103 DA  D "C3'" 1 
ATOM   491  O "O3'" . DA  C 3 3   ? 89.739  -88.766  -1.925  1.00 92.20  ? 103 DA  D "O3'" 1 
ATOM   492  C "C2'" . DA  C 3 3   ? 89.946  -88.093  -4.235  1.00 89.24  ? 103 DA  D "C2'" 1 
ATOM   493  C "C1'" . DA  C 3 3   ? 90.333  -89.482  -4.689  1.00 86.24  ? 103 DA  D "C1'" 1 
ATOM   494  N N9    . DA  C 3 3   ? 90.913  -89.584  -6.023  1.00 58.69  ? 103 DA  D N9    1 
ATOM   495  C C8    . DA  C 3 3   ? 90.488  -89.036  -7.206  1.00 55.74  ? 103 DA  D C8    1 
ATOM   496  N N7    . DA  C 3 3   ? 91.260  -89.325  -8.227  1.00 53.68  ? 103 DA  D N7    1 
ATOM   497  C C5    . DA  C 3 3   ? 92.259  -90.115  -7.676  1.00 52.56  ? 103 DA  D C5    1 
ATOM   498  C C6    . DA  C 3 3   ? 93.383  -90.740  -8.231  1.00 52.86  ? 103 DA  D C6    1 
ATOM   499  N N6    . DA  C 3 3   ? 93.704  -90.668  -9.526  1.00 52.86  ? 103 DA  D N6    1 
ATOM   500  N N1    . DA  C 3 3   ? 94.180  -91.455  -7.403  1.00 53.00  ? 103 DA  D N1    1 
ATOM   501  C C2    . DA  C 3 3   ? 93.854  -91.529  -6.106  1.00 54.71  ? 103 DA  D C2    1 
ATOM   502  N N3    . DA  C 3 3   ? 92.825  -90.987  -5.468  1.00 53.44  ? 103 DA  D N3    1 
ATOM   503  C C4    . DA  C 3 3   ? 92.057  -90.285  -6.320  1.00 54.47  ? 103 DA  D C4    1 
ATOM   504  P P     . DA  C 3 4   ? 90.470  -87.601  -1.092  1.00 127.92 ? 104 DA  D P     1 
ATOM   505  O OP1   . DA  C 3 4   ? 89.896  -87.638  0.278   1.00 71.68  ? 104 DA  D OP1   1 
ATOM   506  O OP2   . DA  C 3 4   ? 90.394  -86.343  -1.885  1.00 71.18  ? 104 DA  D OP2   1 
ATOM   507  O "O5'" . DA  C 3 4   ? 91.996  -88.074  -1.016  1.00 127.47 ? 104 DA  D "O5'" 1 
ATOM   508  C "C5'" . DA  C 3 4   ? 92.357  -89.294  -0.358  1.00 122.48 ? 104 DA  D "C5'" 1 
ATOM   509  C "C4'" . DA  C 3 4   ? 93.787  -89.684  -0.672  1.00 119.17 ? 104 DA  D "C4'" 1 
ATOM   510  O "O4'" . DA  C 3 4   ? 93.963  -89.793  -2.105  1.00 116.83 ? 104 DA  D "O4'" 1 
ATOM   511  C "C3'" . DA  C 3 4   ? 94.907  -88.754  -0.185  1.00 117.91 ? 104 DA  D "C3'" 1 
ATOM   512  O "O3'" . DA  C 3 4   ? 96.036  -89.549  0.235   1.00 118.02 ? 104 DA  D "O3'" 1 
ATOM   513  C "C2'" . DA  C 3 4   ? 95.268  -87.974  -1.435  1.00 115.17 ? 104 DA  D "C2'" 1 
ATOM   514  C "C1'" . DA  C 3 4   ? 95.109  -89.049  -2.489  1.00 112.37 ? 104 DA  D "C1'" 1 
ATOM   515  N N9    . DA  C 3 4   ? 94.914  -88.583  -3.860  1.00 48.51  ? 104 DA  D N9    1 
ATOM   516  C C8    . DA  C 3 4   ? 93.955  -87.740  -4.362  1.00 46.32  ? 104 DA  D C8    1 
ATOM   517  N N7    . DA  C 3 4   ? 94.044  -87.557  -5.658  1.00 42.74  ? 104 DA  D N7    1 
ATOM   518  C C5    . DA  C 3 4   ? 95.137  -88.327  -6.030  1.00 40.26  ? 104 DA  D C5    1 
ATOM   519  C C6    . DA  C 3 4   ? 95.742  -88.572  -7.271  1.00 37.94  ? 104 DA  D C6    1 
ATOM   520  N N6    . DA  C 3 4   ? 95.296  -88.072  -8.420  1.00 35.15  ? 104 DA  D N6    1 
ATOM   521  N N1    . DA  C 3 4   ? 96.827  -89.370  -7.295  1.00 36.84  ? 104 DA  D N1    1 
ATOM   522  C C2    . DA  C 3 4   ? 97.255  -89.899  -6.146  1.00 41.73  ? 104 DA  D C2    1 
ATOM   523  N N3    . DA  C 3 4   ? 96.762  -89.760  -4.920  1.00 43.15  ? 104 DA  D N3    1 
ATOM   524  C C4    . DA  C 3 4   ? 95.692  -88.950  -4.932  1.00 43.31  ? 104 DA  D C4    1 
ATOM   525  P P     . DA  C 3 5   ? 97.300  -88.855  0.963   1.00 87.86  ? 105 DA  D P     1 
ATOM   526  O OP1   . DA  C 3 5   ? 97.776  -89.785  2.023   1.00 70.99  ? 105 DA  D OP1   1 
ATOM   527  O OP2   . DA  C 3 5   ? 96.971  -87.450  1.316   1.00 72.12  ? 105 DA  D OP2   1 
ATOM   528  O "O5'" . DA  C 3 5   ? 98.428  -88.819  -0.159  1.00 86.08  ? 105 DA  D "O5'" 1 
ATOM   529  C "C5'" . DA  C 3 5   ? 99.062  -90.020  -0.579  1.00 82.07  ? 105 DA  D "C5'" 1 
ATOM   530  C "C4'" . DA  C 3 5   ? 100.199 -89.714  -1.526  1.00 79.53  ? 105 DA  D "C4'" 1 
ATOM   531  O "O4'" . DA  C 3 5   ? 99.706  -89.204  -2.783  1.00 76.48  ? 105 DA  D "O4'" 1 
ATOM   532  C "C3'" . DA  C 3 5   ? 101.225 -88.693  -1.048  1.00 77.92  ? 105 DA  D "C3'" 1 
ATOM   533  O "O3'" . DA  C 3 5   ? 102.476 -89.100  -1.598  1.00 79.89  ? 105 DA  D "O3'" 1 
ATOM   534  C "C2'" . DA  C 3 5   ? 100.762 -87.414  -1.720  1.00 73.98  ? 105 DA  D "C2'" 1 
ATOM   535  C "C1'" . DA  C 3 5   ? 100.319 -87.959  -3.062  1.00 69.38  ? 105 DA  D "C1'" 1 
ATOM   536  N N9    . DA  C 3 5   ? 99.350  -87.169  -3.806  1.00 45.08  ? 105 DA  D N9    1 
ATOM   537  C C8    . DA  C 3 5   ? 98.288  -86.429  -3.342  1.00 42.94  ? 105 DA  D C8    1 
ATOM   538  N N7    . DA  C 3 5   ? 97.557  -85.900  -4.297  1.00 39.08  ? 105 DA  D N7    1 
ATOM   539  C C5    . DA  C 3 5   ? 98.192  -86.305  -5.464  1.00 35.22  ? 105 DA  D C5    1 
ATOM   540  C C6    . DA  C 3 5   ? 97.905  -86.083  -6.825  1.00 32.23  ? 105 DA  D C6    1 
ATOM   541  N N6    . DA  C 3 5   ? 96.866  -85.365  -7.252  1.00 27.89  ? 105 DA  D N6    1 
ATOM   542  N N1    . DA  C 3 5   ? 98.735  -86.632  -7.741  1.00 31.73  ? 105 DA  D N1    1 
ATOM   543  C C2    . DA  C 3 5   ? 99.784  -87.352  -7.305  1.00 34.14  ? 105 DA  D C2    1 
ATOM   544  N N3    . DA  C 3 5   ? 100.159 -87.628  -6.054  1.00 35.18  ? 105 DA  D N3    1 
ATOM   545  C C4    . DA  C 3 5   ? 99.309  -87.073  -5.174  1.00 37.92  ? 105 DA  D C4    1 
ATOM   546  P P     . DT  C 3 6   ? 103.846 -88.664  -0.894  1.00 90.99  ? 106 DT  D P     1 
ATOM   547  O OP1   . DT  C 3 6   ? 104.622 -89.924  -0.715  1.00 64.87  ? 106 DT  D OP1   1 
ATOM   548  O OP2   . DT  C 3 6   ? 103.556 -87.786  0.281   1.00 65.95  ? 106 DT  D OP2   1 
ATOM   549  O "O5'" . DT  C 3 6   ? 104.570 -87.799  -2.015  1.00 90.28  ? 106 DT  D "O5'" 1 
ATOM   550  C "C5'" . DT  C 3 6   ? 103.817 -87.260  -3.090  1.00 86.71  ? 106 DT  D "C5'" 1 
ATOM   551  C "C4'" . DT  C 3 6   ? 104.470 -87.593  -4.409  1.00 82.51  ? 106 DT  D "C4'" 1 
ATOM   552  O "O4'" . DT  C 3 6   ? 103.487 -87.372  -5.438  1.00 78.16  ? 106 DT  D "O4'" 1 
ATOM   553  C "C3'" . DT  C 3 6   ? 105.658 -86.700  -4.756  1.00 80.65  ? 106 DT  D "C3'" 1 
ATOM   554  O "O3'" . DT  C 3 6   ? 106.636 -87.393  -5.546  1.00 81.88  ? 106 DT  D "O3'" 1 
ATOM   555  C "C2'" . DT  C 3 6   ? 105.020 -85.569  -5.536  1.00 77.81  ? 106 DT  D "C2'" 1 
ATOM   556  C "C1'" . DT  C 3 6   ? 103.807 -86.216  -6.189  1.00 70.37  ? 106 DT  D "C1'" 1 
ATOM   557  N N1    . DT  C 3 6   ? 102.622 -85.348  -6.178  1.00 33.51  ? 106 DT  D N1    1 
ATOM   558  C C2    . DT  C 3 6   ? 102.127 -84.919  -7.392  1.00 28.08  ? 106 DT  D C2    1 
ATOM   559  O O2    . DT  C 3 6   ? 102.629 -85.234  -8.464  1.00 29.64  ? 106 DT  D O2    1 
ATOM   560  N N3    . DT  C 3 6   ? 101.020 -84.106  -7.313  1.00 20.96  ? 106 DT  D N3    1 
ATOM   561  C C4    . DT  C 3 6   ? 100.374 -83.691  -6.169  1.00 20.30  ? 106 DT  D C4    1 
ATOM   562  O O4    . DT  C 3 6   ? 99.374  -82.972  -6.268  1.00 7.94   ? 106 DT  D O4    1 
ATOM   563  C C5    . DT  C 3 6   ? 100.963 -84.176  -4.915  1.00 21.16  ? 106 DT  D C5    1 
ATOM   564  C C7    . DT  C 3 6   ? 100.359 -83.764  -3.609  1.00 24.38  ? 106 DT  D C7    1 
ATOM   565  C C6    . DT  C 3 6   ? 102.034 -84.972  -4.990  1.00 25.45  ? 106 DT  D C6    1 
ATOM   566  P P     . DU  C 3 7   ? 108.039 -86.675  -5.893  1.00 68.25  ? 107 DU  D P     1 
ATOM   567  O OP1   . DU  C 3 7   ? 109.050 -87.734  -6.152  1.00 67.86  ? 107 DU  D OP1   1 
ATOM   568  O OP2   . DU  C 3 7   ? 108.310 -85.637  -4.870  1.00 69.16  ? 107 DU  D OP2   1 
ATOM   569  O "O5'" . DU  C 3 7   ? 107.754 -85.910  -7.257  1.00 66.46  ? 107 DU  D "O5'" 1 
ATOM   570  C "C5'" . DU  C 3 7   ? 107.460 -86.640  -8.439  1.00 60.18  ? 107 DU  D "C5'" 1 
ATOM   571  C "C4'" . DU  C 3 7   ? 107.246 -85.707  -9.608  1.00 55.13  ? 107 DU  D "C4'" 1 
ATOM   572  O "O4'" . DU  C 3 7   ? 106.001 -84.984  -9.460  1.00 49.37  ? 107 DU  D "O4'" 1 
ATOM   573  C "C3'" . DU  C 3 7   ? 108.331 -84.659  -9.861  1.00 53.17  ? 107 DU  D "C3'" 1 
ATOM   574  O "O3'" . DU  C 3 7   ? 108.611 -84.634  -11.261 1.00 57.55  ? 107 DU  D "O3'" 1 
ATOM   575  C "C2'" . DU  C 3 7   ? 107.684 -83.358  -9.414  1.00 48.16  ? 107 DU  D "C2'" 1 
ATOM   576  C "C1'" . DU  C 3 7   ? 106.212 -83.605  -9.714  1.00 40.45  ? 107 DU  D "C1'" 1 
ATOM   577  N N1    . DU  C 3 7   ? 105.243 -82.852  -8.899  1.00 27.94  ? 107 DU  D N1    1 
ATOM   578  C C2    . DU  C 3 7   ? 104.206 -82.174  -9.557  1.00 26.75  ? 107 DU  D C2    1 
ATOM   579  O O2    . DU  C 3 7   ? 104.087 -82.132  -10.786 1.00 25.98  ? 107 DU  D O2    1 
ATOM   580  N N3    . DU  C 3 7   ? 103.309 -81.543  -8.722  1.00 25.24  ? 107 DU  D N3    1 
ATOM   581  C C4    . DU  C 3 7   ? 103.335 -81.506  -7.329  1.00 24.67  ? 107 DU  D C4    1 
ATOM   582  O O4    . DU  C 3 7   ? 102.420 -80.930  -6.711  1.00 19.59  ? 107 DU  D O4    1 
ATOM   583  C C5    . DU  C 3 7   ? 104.446 -82.201  -6.738  1.00 18.57  ? 107 DU  D C5    1 
ATOM   584  C C6    . DU  C 3 7   ? 105.336 -82.830  -7.520  1.00 21.43  ? 107 DU  D C6    1 
ATOM   585  P P     . DU  C 3 8   ? 109.877 -83.816  -11.819 1.00 66.76  ? 108 DU  D P     1 
ATOM   586  O OP1   . DU  C 3 8   ? 110.637 -84.769  -12.678 1.00 54.94  ? 108 DU  D OP1   1 
ATOM   587  O OP2   . DU  C 3 8   ? 110.582 -83.104  -10.711 1.00 55.14  ? 108 DU  D OP2   1 
ATOM   588  O "O5'" . DU  C 3 8   ? 109.173 -82.733  -12.751 1.00 65.83  ? 108 DU  D "O5'" 1 
ATOM   589  C "C5'" . DU  C 3 8   ? 108.093 -83.120  -13.597 1.00 63.22  ? 108 DU  D "C5'" 1 
ATOM   590  C "C4'" . DU  C 3 8   ? 107.316 -81.914  -14.073 1.00 61.17  ? 108 DU  D "C4'" 1 
ATOM   591  O "O4'" . DU  C 3 8   ? 106.404 -81.404  -13.069 1.00 58.45  ? 108 DU  D "O4'" 1 
ATOM   592  C "C3'" . DU  C 3 8   ? 108.129 -80.711  -14.563 1.00 59.99  ? 108 DU  D "C3'" 1 
ATOM   593  O "O3'" . DU  C 3 8   ? 107.545 -80.258  -15.791 1.00 62.88  ? 108 DU  D "O3'" 1 
ATOM   594  C "C2'" . DU  C 3 8   ? 107.910 -79.681  -13.466 1.00 57.90  ? 108 DU  D "C2'" 1 
ATOM   595  C "C1'" . DU  C 3 8   ? 106.476 -79.988  -13.105 1.00 51.84  ? 108 DU  D "C1'" 1 
ATOM   596  N N1    . DU  C 3 8   ? 105.950 -79.452  -11.840 1.00 33.25  ? 108 DU  D N1    1 
ATOM   597  C C2    . DU  C 3 8   ? 104.804 -78.655  -11.916 1.00 31.34  ? 108 DU  D C2    1 
ATOM   598  O O2    . DU  C 3 8   ? 104.263 -78.355  -12.973 1.00 31.12  ? 108 DU  D O2    1 
ATOM   599  N N3    . DU  C 3 8   ? 104.311 -78.220  -10.710 1.00 28.21  ? 108 DU  D N3    1 
ATOM   600  C C4    . DU  C 3 8   ? 104.828 -78.481  -9.463  1.00 29.36  ? 108 DU  D C4    1 
ATOM   601  O O4    . DU  C 3 8   ? 104.228 -78.068  -8.471  1.00 27.14  ? 108 DU  D O4    1 
ATOM   602  C C5    . DU  C 3 8   ? 106.025 -79.284  -9.461  1.00 25.27  ? 108 DU  D C5    1 
ATOM   603  C C6    . DU  C 3 8   ? 106.533 -79.730  -10.624 1.00 29.89  ? 108 DU  D C6    1 
ATOM   604  P P     . DU  C 3 9   ? 108.087 -78.925  -16.500 1.00 80.31  ? 109 DU  D P     1 
ATOM   605  O OP1   . DU  C 3 9   ? 107.985 -79.139  -17.966 1.00 61.70  ? 109 DU  D OP1   1 
ATOM   606  O OP2   . DU  C 3 9   ? 109.399 -78.564  -15.898 1.00 59.73  ? 109 DU  D OP2   1 
ATOM   607  O "O5'" . DU  C 3 9   ? 107.001 -77.827  -16.101 1.00 79.28  ? 109 DU  D "O5'" 1 
ATOM   608  C "C5'" . DU  C 3 9   ? 105.655 -77.932  -16.574 1.00 76.69  ? 109 DU  D "C5'" 1 
ATOM   609  C "C4'" . DU  C 3 9   ? 104.869 -76.678  -16.255 1.00 73.63  ? 109 DU  D "C4'" 1 
ATOM   610  O "O4'" . DU  C 3 9   ? 104.641 -76.592  -14.827 1.00 70.01  ? 109 DU  D "O4'" 1 
ATOM   611  C "C3'" . DU  C 3 9   ? 105.516 -75.355  -16.679 1.00 72.76  ? 109 DU  D "C3'" 1 
ATOM   612  O "O3'" . DU  C 3 9   ? 104.547 -74.477  -17.283 1.00 78.95  ? 109 DU  D "O3'" 1 
ATOM   613  C "C2'" . DU  C 3 9   ? 106.042 -74.779  -15.371 1.00 68.11  ? 109 DU  D "C2'" 1 
ATOM   614  C "C1'" . DU  C 3 9   ? 105.086 -75.342  -14.319 1.00 62.57  ? 109 DU  D "C1'" 1 
ATOM   615  N N1    . DU  C 3 9   ? 105.671 -75.573  -12.981 1.00 33.50  ? 109 DU  D N1    1 
ATOM   616  C C2    . DU  C 3 9   ? 104.986 -75.088  -11.858 1.00 29.58  ? 109 DU  D C2    1 
ATOM   617  O O2    . DU  C 3 9   ? 103.920 -74.519  -11.915 1.00 28.72  ? 109 DU  D O2    1 
ATOM   618  N N3    . DU  C 3 9   ? 105.607 -75.300  -10.657 1.00 24.44  ? 109 DU  D N3    1 
ATOM   619  C C4    . DU  C 3 9   ? 106.815 -75.934  -10.444 1.00 25.73  ? 109 DU  D C4    1 
ATOM   620  O O4    . DU  C 3 9   ? 107.306 -75.927  -9.307  1.00 25.17  ? 109 DU  D O4    1 
ATOM   621  C C5    . DU  C 3 9   ? 107.449 -76.434  -11.636 1.00 24.95  ? 109 DU  D C5    1 
ATOM   622  C C6    . DU  C 3 9   ? 106.872 -76.241  -12.830 1.00 29.35  ? 109 DU  D C6    1 
ATOM   623  P P     . DU  C 3 10  ? 104.688 -74.062  -18.844 1.00 76.67  ? 110 DU  D P     1 
ATOM   624  O OP1   . DU  C 3 10  ? 103.513 -74.649  -19.549 1.00 48.90  ? 110 DU  D OP1   1 
ATOM   625  O OP2   . DU  C 3 10  ? 106.066 -74.330  -19.352 1.00 49.63  ? 110 DU  D OP2   1 
ATOM   626  O "O5'" . DU  C 3 10  ? 104.505 -72.483  -18.835 1.00 75.96  ? 110 DU  D "O5'" 1 
ATOM   627  C "C5'" . DU  C 3 10  ? 104.794 -71.740  -17.662 1.00 75.79  ? 110 DU  D "C5'" 1 
ATOM   628  C "C4'" . DU  C 3 10  ? 103.511 -71.417  -16.936 1.00 75.05  ? 110 DU  D "C4'" 1 
ATOM   629  O "O4'" . DU  C 3 10  ? 103.567 -71.945  -15.592 1.00 71.74  ? 110 DU  D "O4'" 1 
ATOM   630  C "C3'" . DU  C 3 10  ? 103.261 -69.921  -16.785 1.00 75.39  ? 110 DU  D "C3'" 1 
ATOM   631  O "O3'" . DU  C 3 10  ? 101.849 -69.654  -16.797 1.00 77.73  ? 110 DU  D "O3'" 1 
ATOM   632  C "C2'" . DU  C 3 10  ? 103.873 -69.625  -15.431 1.00 70.42  ? 110 DU  D "C2'" 1 
ATOM   633  C "C1'" . DU  C 3 10  ? 103.529 -70.878  -14.659 1.00 66.67  ? 110 DU  D "C1'" 1 
ATOM   634  N N1    . DU  C 3 10  ? 104.475 -71.186  -13.582 1.00 35.17  ? 110 DU  D N1    1 
ATOM   635  C C2    . DU  C 3 10  ? 104.129 -70.802  -12.308 1.00 33.00  ? 110 DU  D C2    1 
ATOM   636  O O2    . DU  C 3 10  ? 103.110 -70.180  -12.059 1.00 33.91  ? 110 DU  D O2    1 
ATOM   637  N N3    . DU  C 3 10  ? 105.018 -71.165  -11.331 1.00 29.19  ? 110 DU  D N3    1 
ATOM   638  C C4    . DU  C 3 10  ? 106.198 -71.848  -11.497 1.00 29.62  ? 110 DU  D C4    1 
ATOM   639  O O4    . DU  C 3 10  ? 106.836 -72.200  -10.502 1.00 26.69  ? 110 DU  D O4    1 
ATOM   640  C C5    . DU  C 3 10  ? 106.507 -72.180  -12.854 1.00 29.30  ? 110 DU  D C5    1 
ATOM   641  C C6    . DU  C 3 10  ? 105.653 -71.846  -13.826 1.00 31.17  ? 110 DU  D C6    1 
ATOM   642  P P     . DC  C 3 11  ? 101.295 -68.259  -17.392 1.00 81.86  ? 111 DC  D P     1 
ATOM   643  O OP1   . DC  C 3 11  ? 99.901  -68.541  -17.851 1.00 60.06  ? 111 DC  D OP1   1 
ATOM   644  O OP2   . DC  C 3 11  ? 102.298 -67.724  -18.360 1.00 58.12  ? 111 DC  D OP2   1 
ATOM   645  O "O5'" . DC  C 3 11  ? 101.243 -67.275  -16.130 1.00 77.15  ? 111 DC  D "O5'" 1 
ATOM   646  C "C5'" . DC  C 3 11  ? 102.219 -67.383  -15.094 1.00 74.29  ? 111 DC  D "C5'" 1 
ATOM   647  C "C4'" . DC  C 3 11  ? 101.769 -66.695  -13.826 1.00 71.99  ? 111 DC  D "C4'" 1 
ATOM   648  O "O4'" . DC  C 3 11  ? 102.462 -67.324  -12.719 1.00 68.77  ? 111 DC  D "O4'" 1 
ATOM   649  C "C3'" . DC  C 3 11  ? 102.130 -65.210  -13.747 1.00 72.11  ? 111 DC  D "C3'" 1 
ATOM   650  O "O3'" . DC  C 3 11  ? 101.211 -64.493  -12.908 1.00 75.60  ? 111 DC  D "O3'" 1 
ATOM   651  C "C2'" . DC  C 3 11  ? 103.492 -65.238  -13.082 1.00 68.26  ? 111 DC  D "C2'" 1 
ATOM   652  C "C1'" . DC  C 3 11  ? 103.341 -66.390  -12.104 1.00 63.47  ? 111 DC  D "C1'" 1 
ATOM   653  N N1    . DC  C 3 11  ? 104.607 -67.080  -11.802 1.00 36.62  ? 111 DC  D N1    1 
ATOM   654  C C2    . DC  C 3 11  ? 104.900 -67.414  -10.465 1.00 33.35  ? 111 DC  D C2    1 
ATOM   655  O O2    . DC  C 3 11  ? 104.032 -67.223  -9.583  1.00 36.42  ? 111 DC  D O2    1 
ATOM   656  N N3    . DC  C 3 11  ? 106.118 -67.940  -10.171 1.00 28.94  ? 111 DC  D N3    1 
ATOM   657  C C4    . DC  C 3 11  ? 107.003 -68.163  -11.149 1.00 31.80  ? 111 DC  D C4    1 
ATOM   658  N N4    . DC  C 3 11  ? 108.210 -68.626  -10.814 1.00 32.63  ? 111 DC  D N4    1 
ATOM   659  C C5    . DC  C 3 11  ? 106.693 -67.916  -12.519 1.00 32.41  ? 111 DC  D C5    1 
ATOM   660  C C6    . DC  C 3 11  ? 105.499 -67.378  -12.799 1.00 31.86  ? 111 DC  D C6    1 
HETATM 661  P P     . CAR C 3 12  ? 101.426 -62.917  -12.659 1.00 55.94  ? 112 CAR D P     1 
HETATM 662  O OP1   . CAR C 3 12  ? 100.502 -62.451  -11.584 1.00 54.60  ? 112 CAR D OP1   1 
HETATM 663  O OP2   . CAR C 3 12  ? 101.366 -62.291  -13.999 1.00 55.17  ? 112 CAR D OP2   1 
HETATM 664  O "O5'" . CAR C 3 12  ? 102.940 -62.805  -12.163 1.00 54.29  ? 112 CAR D "O5'" 1 
HETATM 665  C "C5'" . CAR C 3 12  ? 103.325 -61.895  -11.134 1.00 51.25  ? 112 CAR D "C5'" 1 
HETATM 666  C "C4'" . CAR C 3 12  ? 103.257 -62.580  -9.789  1.00 49.52  ? 112 CAR D "C4'" 1 
HETATM 667  O "O4'" . CAR C 3 12  ? 103.768 -63.931  -9.916  1.00 47.86  ? 112 CAR D "O4'" 1 
HETATM 668  C "C3'" . CAR C 3 12  ? 104.007 -61.895  -8.652  1.00 48.62  ? 112 CAR D "C3'" 1 
HETATM 669  O "O3'" . CAR C 3 12  ? 103.056 -61.295  -7.771  1.00 48.01  ? 112 CAR D "O3'" 1 
HETATM 670  C "C2'" . CAR C 3 12  ? 104.766 -63.019  -7.939  1.00 46.73  ? 112 CAR D "C2'" 1 
HETATM 671  O "O2'" . CAR C 3 12  ? 106.051 -62.694  -7.463  1.00 49.44  ? 112 CAR D "O2'" 1 
HETATM 672  C "C1'" . CAR C 3 12  ? 104.798 -64.149  -8.972  1.00 42.29  ? 112 CAR D "C1'" 1 
HETATM 673  N N1    . CAR C 3 12  ? 106.063 -64.457  -9.694  1.00 35.07  ? 112 CAR D N1    1 
HETATM 674  C C2    . CAR C 3 12  ? 107.167 -65.027  -8.970  1.00 32.18  ? 112 CAR D C2    1 
HETATM 675  O O2    . CAR C 3 12  ? 107.062 -65.224  -7.740  1.00 30.63  ? 112 CAR D O2    1 
HETATM 676  N N3    . CAR C 3 12  ? 108.321 -65.300  -9.646  1.00 29.16  ? 112 CAR D N3    1 
HETATM 677  C C4    . CAR C 3 12  ? 108.411 -65.042  -10.962 1.00 29.38  ? 112 CAR D C4    1 
HETATM 678  N N4    . CAR C 3 12  ? 109.532 -65.392  -11.585 1.00 25.40  ? 112 CAR D N4    1 
HETATM 679  C C5    . CAR C 3 12  ? 107.318 -64.487  -11.712 1.00 29.62  ? 112 CAR D C5    1 
HETATM 680  C C6    . CAR C 3 12  ? 106.183 -64.199  -11.042 1.00 31.80  ? 112 CAR D C6    1 
ATOM   681  P P     . DA  C 3 13  ? 103.445 -59.756  -8.266  1.00 49.48  ? 113 DA  D P     1 
ATOM   682  O OP1   . DA  C 3 13  ? 102.417 -58.716  -8.037  1.00 57.70  ? 113 DA  D OP1   1 
ATOM   683  O OP2   . DA  C 3 13  ? 104.269 -59.706  -9.502  1.00 58.45  ? 113 DA  D OP2   1 
ATOM   684  O "O5'" . DA  C 3 13  ? 104.449 -59.728  -7.029  1.00 43.20  ? 113 DA  D "O5'" 1 
ATOM   685  C "C5'" . DA  C 3 13  ? 103.967 -59.755  -5.681  1.00 32.43  ? 113 DA  D "C5'" 1 
ATOM   686  C "C4'" . DA  C 3 13  ? 105.059 -60.196  -4.725  1.00 25.67  ? 113 DA  D "C4'" 1 
ATOM   687  O "O4'" . DA  C 3 13  ? 105.976 -61.121  -5.367  1.00 23.61  ? 113 DA  D "O4'" 1 
ATOM   688  C "C3'" . DA  C 3 13  ? 105.932 -59.100  -4.116  1.00 21.11  ? 113 DA  D "C3'" 1 
ATOM   689  O "O3'" . DA  C 3 13  ? 106.097 -59.363  -2.716  1.00 21.18  ? 113 DA  D "O3'" 1 
ATOM   690  C "C2'" . DA  C 3 13  ? 107.237 -59.227  -4.880  1.00 18.97  ? 113 DA  D "C2'" 1 
ATOM   691  C "C1'" . DA  C 3 13  ? 107.312 -60.714  -5.156  1.00 18.10  ? 113 DA  D "C1'" 1 
ATOM   692  N N9    . DA  C 3 13  ? 108.088 -61.068  -6.351  1.00 20.67  ? 113 DA  D N9    1 
ATOM   693  C C8    . DA  C 3 13  ? 107.844 -60.709  -7.656  1.00 17.69  ? 113 DA  D C8    1 
ATOM   694  N N7    . DA  C 3 13  ? 108.737 -61.167  -8.506  1.00 16.63  ? 113 DA  D N7    1 
ATOM   695  C C5    . DA  C 3 13  ? 109.625 -61.876  -7.711  1.00 14.82  ? 113 DA  D C5    1 
ATOM   696  C C6    . DA  C 3 13  ? 110.805 -62.595  -8.008  1.00 15.68  ? 113 DA  D C6    1 
ATOM   697  N N6    . DA  C 3 13  ? 111.274 -62.778  -9.239  1.00 13.68  ? 113 DA  D N6    1 
ATOM   698  N N1    . DA  C 3 13  ? 111.485 -63.141  -6.983  1.00 15.35  ? 113 DA  D N1    1 
ATOM   699  C C2    . DA  C 3 13  ? 110.994 -63.007  -5.751  1.00 15.90  ? 113 DA  D C2    1 
ATOM   700  N N3    . DA  C 3 13  ? 109.882 -62.385  -5.344  1.00 13.68  ? 113 DA  D N3    1 
ATOM   701  C C4    . DA  C 3 13  ? 109.240 -61.827  -6.382  1.00 16.13  ? 113 DA  D C4    1 
ATOM   702  P P     . DA  C 3 14  ? 107.238 -58.596  -1.873  1.00 34.60  ? 114 DA  D P     1 
ATOM   703  O OP1   . DA  C 3 14  ? 107.012 -58.901  -0.428  1.00 31.56  ? 114 DA  D OP1   1 
ATOM   704  O OP2   . DA  C 3 14  ? 107.336 -57.173  -2.307  1.00 34.23  ? 114 DA  D OP2   1 
ATOM   705  O "O5'" . DA  C 3 14  ? 108.577 -59.321  -2.341  1.00 36.89  ? 114 DA  D "O5'" 1 
ATOM   706  C "C5'" . DA  C 3 14  ? 109.003 -60.523  -1.718  1.00 33.04  ? 114 DA  D "C5'" 1 
ATOM   707  C "C4'" . DA  C 3 14  ? 110.511 -60.568  -1.649  1.00 31.51  ? 114 DA  D "C4'" 1 
ATOM   708  O "O4'" . DA  C 3 14  ? 111.048 -60.833  -2.962  1.00 29.88  ? 114 DA  D "O4'" 1 
ATOM   709  C "C3'" . DA  C 3 14  ? 111.195 -59.286  -1.171  1.00 28.81  ? 114 DA  D "C3'" 1 
ATOM   710  O "O3'" . DA  C 3 14  ? 112.370 -59.646  -0.425  1.00 33.79  ? 114 DA  D "O3'" 1 
ATOM   711  C "C2'" . DA  C 3 14  ? 111.582 -58.621  -2.478  1.00 27.06  ? 114 DA  D "C2'" 1 
ATOM   712  C "C1'" . DA  C 3 14  ? 111.992 -59.837  -3.281  1.00 23.82  ? 114 DA  D "C1'" 1 
ATOM   713  N N9    . DA  C 3 14  ? 112.044 -59.719  -4.735  1.00 18.88  ? 114 DA  D N9    1 
ATOM   714  C C8    . DA  C 3 14  ? 111.192 -59.085  -5.596  1.00 17.54  ? 114 DA  D C8    1 
ATOM   715  N N7    . DA  C 3 14  ? 111.534 -59.201  -6.855  1.00 15.70  ? 114 DA  D N7    1 
ATOM   716  C C5    . DA  C 3 14  ? 112.697 -59.958  -6.820  1.00 13.09  ? 114 DA  D C5    1 
ATOM   717  C C6    . DA  C 3 14  ? 113.572 -60.425  -7.838  1.00 13.22  ? 114 DA  D C6    1 
ATOM   718  N N6    . DA  C 3 14  ? 113.389 -60.192  -9.139  1.00 13.09  ? 114 DA  D N6    1 
ATOM   719  N N1    . DA  C 3 14  ? 114.656 -61.147  -7.460  1.00 15.16  ? 114 DA  D N1    1 
ATOM   720  C C2    . DA  C 3 14  ? 114.840 -61.379  -6.152  1.00 13.09  ? 114 DA  D C2    1 
ATOM   721  N N3    . DA  C 3 14  ? 114.091 -60.996  -5.109  1.00 13.09  ? 114 DA  D N3    1 
ATOM   722  C C4    . DA  C 3 14  ? 113.024 -60.280  -5.520  1.00 16.32  ? 114 DA  D C4    1 
ATOM   723  P P     . DG  C 3 15  ? 113.016 -58.607  0.629   1.00 47.74  ? 115 DG  D P     1 
ATOM   724  O OP1   . DG  C 3 15  ? 112.799 -59.156  1.985   1.00 31.53  ? 115 DG  D OP1   1 
ATOM   725  O OP2   . DG  C 3 15  ? 112.558 -57.228  0.310   1.00 35.27  ? 115 DG  D OP2   1 
ATOM   726  O "O5'" . DG  C 3 15  ? 114.578 -58.690  0.335   1.00 42.91  ? 115 DG  D "O5'" 1 
ATOM   727  C "C5'" . DG  C 3 15  ? 115.043 -58.704  -1.004  1.00 38.24  ? 115 DG  D "C5'" 1 
ATOM   728  C "C4'" . DG  C 3 15  ? 116.271 -59.571  -1.135  1.00 35.94  ? 115 DG  D "C4'" 1 
ATOM   729  O "O4'" . DG  C 3 15  ? 116.203 -60.222  -2.422  1.00 34.14  ? 115 DG  D "O4'" 1 
ATOM   730  C "C3'" . DG  C 3 15  ? 117.570 -58.782  -1.128  1.00 37.66  ? 115 DG  D "C3'" 1 
ATOM   731  O "O3'" . DG  C 3 15  ? 118.624 -59.430  -0.429  1.00 39.04  ? 115 DG  D "O3'" 1 
ATOM   732  C "C2'" . DG  C 3 15  ? 117.923 -58.612  -2.593  1.00 35.01  ? 115 DG  D "C2'" 1 
ATOM   733  C "C1'" . DG  C 3 15  ? 117.058 -59.601  -3.366  1.00 30.69  ? 115 DG  D "C1'" 1 
ATOM   734  N N9    . DG  C 3 15  ? 116.206 -58.856  -4.292  1.00 11.91  ? 115 DG  D N9    1 
ATOM   735  C C8    . DG  C 3 15  ? 115.157 -58.057  -3.927  1.00 10.45  ? 115 DG  D C8    1 
ATOM   736  N N7    . DG  C 3 15  ? 114.637 -57.409  -4.925  1.00 12.71  ? 115 DG  D N7    1 
ATOM   737  C C5    . DG  C 3 15  ? 115.374 -57.817  -6.018  1.00 7.85   ? 115 DG  D C5    1 
ATOM   738  C C6    . DG  C 3 15  ? 115.276 -57.422  -7.349  1.00 12.92  ? 115 DG  D C6    1 
ATOM   739  O O6    . DG  C 3 15  ? 114.514 -56.575  -7.839  1.00 12.12  ? 115 DG  D O6    1 
ATOM   740  N N1    . DG  C 3 15  ? 116.184 -58.105  -8.155  1.00 12.67  ? 115 DG  D N1    1 
ATOM   741  C C2    . DG  C 3 15  ? 117.068 -59.048  -7.714  1.00 10.30  ? 115 DG  D C2    1 
ATOM   742  N N2    . DG  C 3 15  ? 117.797 -59.643  -8.666  1.00 13.38  ? 115 DG  D N2    1 
ATOM   743  N N3    . DG  C 3 15  ? 117.202 -59.393  -6.444  1.00 8.47   ? 115 DG  D N3    1 
ATOM   744  C C4    . DG  C 3 15  ? 116.324 -58.743  -5.656  1.00 7.85   ? 115 DG  D C4    1 
ATOM   745  P P     . DU  C 3 16  ? 119.967 -58.602  -0.107  1.00 32.44  ? 116 DU  D P     1 
ATOM   746  O OP1   . DU  C 3 16  ? 120.679 -59.362  0.954   1.00 33.94  ? 116 DU  D OP1   1 
ATOM   747  O OP2   . DU  C 3 16  ? 119.581 -57.180  0.143   1.00 31.11  ? 116 DU  D OP2   1 
ATOM   748  O "O5'" . DU  C 3 16  ? 120.792 -58.682  -1.476  1.00 27.33  ? 116 DU  D "O5'" 1 
ATOM   749  C "C5'" . DU  C 3 16  ? 120.980 -59.946  -2.145  1.00 29.51  ? 116 DU  D "C5'" 1 
ATOM   750  C "C4'" . DU  C 3 16  ? 121.879 -59.807  -3.359  1.00 27.88  ? 116 DU  D "C4'" 1 
ATOM   751  O "O4'" . DU  C 3 16  ? 121.167 -59.301  -4.514  1.00 29.18  ? 116 DU  D "O4'" 1 
ATOM   752  C "C3'" . DU  C 3 16  ? 123.104 -58.914  -3.189  1.00 30.25  ? 116 DU  D "C3'" 1 
ATOM   753  O "O3'" . DU  C 3 16  ? 124.247 -59.504  -3.826  1.00 30.49  ? 116 DU  D "O3'" 1 
ATOM   754  C "C2'" . DU  C 3 16  ? 122.684 -57.615  -3.848  1.00 32.24  ? 116 DU  D "C2'" 1 
ATOM   755  C "C1'" . DU  C 3 16  ? 121.724 -58.068  -4.941  1.00 29.52  ? 116 DU  D "C1'" 1 
ATOM   756  N N1    . DU  C 3 16  ? 120.606 -57.141  -5.182  1.00 29.04  ? 116 DU  D N1    1 
ATOM   757  C C2    . DU  C 3 16  ? 120.275 -56.853  -6.492  1.00 30.00  ? 116 DU  D C2    1 
ATOM   758  O O2    . DU  C 3 16  ? 120.888 -57.305  -7.452  1.00 31.41  ? 116 DU  D O2    1 
ATOM   759  N N3    . DU  C 3 16  ? 119.202 -56.010  -6.643  1.00 29.95  ? 116 DU  D N3    1 
ATOM   760  C C4    . DU  C 3 16  ? 118.450 -55.428  -5.644  1.00 32.25  ? 116 DU  D C4    1 
ATOM   761  O O4    . DU  C 3 16  ? 117.515 -54.691  -5.946  1.00 34.00  ? 116 DU  D O4    1 
ATOM   762  C C5    . DU  C 3 16  ? 118.861 -55.755  -4.322  1.00 30.95  ? 116 DU  D C5    1 
ATOM   763  C C6    . DU  C 3 16  ? 119.898 -56.578  -4.138  1.00 29.86  ? 116 DU  D C6    1 
ATOM   764  P P     . DC  C 3 17  ? 125.662 -58.728  -3.818  1.00 37.48  ? 117 DC  D P     1 
ATOM   765  O OP1   . DC  C 3 17  ? 126.764 -59.722  -3.894  1.00 15.87  ? 117 DC  D OP1   1 
ATOM   766  O OP2   . DC  C 3 17  ? 125.652 -57.721  -2.711  1.00 15.99  ? 117 DC  D OP2   1 
ATOM   767  O "O5'" . DC  C 3 17  ? 125.623 -57.948  -5.203  1.00 34.27  ? 117 DC  D "O5'" 1 
ATOM   768  C "C5'" . DC  C 3 17  ? 125.259 -58.622  -6.409  1.00 38.41  ? 117 DC  D "C5'" 1 
ATOM   769  C "C4'" . DC  C 3 17  ? 125.440 -57.694  -7.585  1.00 38.96  ? 117 DC  D "C4'" 1 
ATOM   770  O "O4'" . DC  C 3 17  ? 124.260 -56.901  -7.853  1.00 40.84  ? 117 DC  D "O4'" 1 
ATOM   771  C "C3'" . DC  C 3 17  ? 126.572 -56.703  -7.368  1.00 40.48  ? 117 DC  D "C3'" 1 
ATOM   772  O "O3'" . DC  C 3 17  ? 127.331 -56.616  -8.560  1.00 41.34  ? 117 DC  D "O3'" 1 
ATOM   773  C "C2'" . DC  C 3 17  ? 125.857 -55.408  -7.015  1.00 37.43  ? 117 DC  D "C2'" 1 
ATOM   774  C "C1'" . DC  C 3 17  ? 124.593 -55.523  -7.837  1.00 36.42  ? 117 DC  D "C1'" 1 
ATOM   775  N N1    . DC  C 3 17  ? 123.420 -54.782  -7.339  1.00 18.11  ? 117 DC  D N1    1 
ATOM   776  C C2    . DC  C 3 17  ? 122.555 -54.216  -8.274  1.00 16.16  ? 117 DC  D C2    1 
ATOM   777  O O2    . DC  C 3 17  ? 122.760 -54.434  -9.474  1.00 17.94  ? 117 DC  D O2    1 
ATOM   778  N N3    . DC  C 3 17  ? 121.514 -53.460  -7.854  1.00 14.70  ? 117 DC  D N3    1 
ATOM   779  C C4    . DC  C 3 17  ? 121.282 -53.326  -6.548  1.00 16.02  ? 117 DC  D C4    1 
ATOM   780  N N4    . DC  C 3 17  ? 120.241 -52.575  -6.169  1.00 18.70  ? 117 DC  D N4    1 
ATOM   781  C C5    . DC  C 3 17  ? 122.111 -53.955  -5.566  1.00 16.80  ? 117 DC  D C5    1 
ATOM   782  C C6    . DC  C 3 17  ? 123.171 -54.646  -6.001  1.00 18.06  ? 117 DC  D C6    1 
ATOM   783  P P     . DU  C 3 18  ? 128.236 -55.330  -8.822  1.00 28.68  ? 118 DU  D P     1 
ATOM   784  O OP1   . DU  C 3 18  ? 129.368 -55.772  -9.696  1.00 21.16  ? 118 DU  D OP1   1 
ATOM   785  O OP2   . DU  C 3 18  ? 128.522 -54.627  -7.544  1.00 14.43  ? 118 DU  D OP2   1 
ATOM   786  O "O5'" . DU  C 3 18  ? 127.222 -54.403  -9.615  1.00 26.47  ? 118 DU  D "O5'" 1 
ATOM   787  C "C5'" . DU  C 3 18  ? 127.687 -53.345  -10.416 1.00 27.73  ? 118 DU  D "C5'" 1 
ATOM   788  C "C4'" . DU  C 3 18  ? 126.846 -53.248  -11.661 1.00 27.41  ? 118 DU  D "C4'" 1 
ATOM   789  O "O4'" . DU  C 3 18  ? 125.455 -53.192  -11.303 1.00 26.39  ? 118 DU  D "O4'" 1 
ATOM   790  C "C3'" . DU  C 3 18  ? 127.124 -51.964  -12.407 1.00 31.37  ? 118 DU  D "C3'" 1 
ATOM   791  O "O3'" . DU  C 3 18  ? 126.958 -52.149  -13.794 1.00 37.82  ? 118 DU  D "O3'" 1 
ATOM   792  C "C2'" . DU  C 3 18  ? 126.118 -50.995  -11.839 1.00 30.09  ? 118 DU  D "C2'" 1 
ATOM   793  C "C1'" . DU  C 3 18  ? 124.966 -51.869  -11.422 1.00 26.64  ? 118 DU  D "C1'" 1 
ATOM   794  N N1    . DU  C 3 18  ? 124.429 -51.471  -10.116 1.00 18.55  ? 118 DU  D N1    1 
ATOM   795  C C2    . DU  C 3 18  ? 123.378 -50.581  -10.118 1.00 19.88  ? 118 DU  D C2    1 
ATOM   796  O O2    . DU  C 3 18  ? 122.933 -50.086  -11.145 1.00 21.71  ? 118 DU  D O2    1 
ATOM   797  N N3    . DU  C 3 18  ? 122.875 -50.280  -8.876  1.00 21.96  ? 118 DU  D N3    1 
ATOM   798  C C4    . DU  C 3 18  ? 123.328 -50.755  -7.659  1.00 22.79  ? 118 DU  D C4    1 
ATOM   799  O O4    . DU  C 3 18  ? 122.777 -50.375  -6.625  1.00 27.43  ? 118 DU  D O4    1 
ATOM   800  C C5    . DU  C 3 18  ? 124.440 -51.654  -7.738  1.00 18.14  ? 118 DU  D C5    1 
ATOM   801  C C6    . DU  C 3 18  ? 124.941 -51.972  -8.932  1.00 17.35  ? 118 DU  D C6    1 
ATOM   802  P P     . DU  C 3 19  ? 128.168 -51.787  -14.764 1.00 60.54  ? 119 DU  D P     1 
ATOM   803  O OP1   . DU  C 3 19  ? 128.573 -53.071  -15.401 1.00 35.48  ? 119 DU  D OP1   1 
ATOM   804  O OP2   . DU  C 3 19  ? 129.176 -50.969  -14.013 1.00 33.44  ? 119 DU  D OP2   1 
ATOM   805  O "O5'" . DU  C 3 19  ? 127.492 -50.839  -15.840 1.00 61.68  ? 119 DU  D "O5'" 1 
ATOM   806  C "C5'" . DU  C 3 19  ? 127.477 -49.432  -15.652 1.00 63.74  ? 119 DU  D "C5'" 1 
ATOM   807  C "C4'" . DU  C 3 19  ? 126.066 -48.917  -15.781 1.00 63.95  ? 119 DU  D "C4'" 1 
ATOM   808  O "O4'" . DU  C 3 19  ? 125.360 -49.013  -14.520 1.00 61.72  ? 119 DU  D "O4'" 1 
ATOM   809  C "C3'" . DU  C 3 19  ? 125.992 -47.453  -16.187 1.00 65.30  ? 119 DU  D "C3'" 1 
ATOM   810  O "O3'" . DU  C 3 19  ? 124.887 -47.312  -17.071 1.00 69.40  ? 119 DU  D "O3'" 1 
ATOM   811  C "C2'" . DU  C 3 19  ? 125.735 -46.738  -14.877 1.00 62.44  ? 119 DU  D "C2'" 1 
ATOM   812  C "C1'" . DU  C 3 19  ? 124.858 -47.736  -14.163 1.00 58.98  ? 119 DU  D "C1'" 1 
ATOM   813  N N1    . DU  C 3 19  ? 124.887 -47.625  -12.702 1.00 28.17  ? 119 DU  D N1    1 
ATOM   814  C C2    . DU  C 3 19  ? 123.798 -47.066  -12.080 1.00 26.05  ? 119 DU  D C2    1 
ATOM   815  O O2    . DU  C 3 19  ? 122.847 -46.615  -12.689 1.00 27.60  ? 119 DU  D O2    1 
ATOM   816  N N3    . DU  C 3 19  ? 123.859 -47.043  -10.713 1.00 24.33  ? 119 DU  D N3    1 
ATOM   817  C C4    . DU  C 3 19  ? 124.884 -47.512  -9.926  1.00 25.81  ? 119 DU  D C4    1 
ATOM   818  O O4    . DU  C 3 19  ? 124.744 -47.544  -8.708  1.00 29.91  ? 119 DU  D O4    1 
ATOM   819  C C5    . DU  C 3 19  ? 125.990 -48.040  -10.647 1.00 25.51  ? 119 DU  D C5    1 
ATOM   820  C C6    . DU  C 3 19  ? 125.954 -48.075  -11.978 1.00 28.04  ? 119 DU  D C6    1 
ATOM   821  P P     . DU  C 3 20  ? 124.994 -46.320  -18.322 1.00 61.23  ? 120 DU  D P     1 
ATOM   822  O OP1   . DU  C 3 20  ? 124.360 -47.030  -19.465 1.00 60.26  ? 120 DU  D OP1   1 
ATOM   823  O OP2   . DU  C 3 20  ? 126.413 -45.863  -18.424 1.00 61.07  ? 120 DU  D OP2   1 
ATOM   824  O "O5'" . DU  C 3 20  ? 124.068 -45.102  -17.879 1.00 59.10  ? 120 DU  D "O5'" 1 
ATOM   825  C "C5'" . DU  C 3 20  ? 123.872 -44.849  -16.501 1.00 55.74  ? 120 DU  D "C5'" 1 
ATOM   826  C "C4'" . DU  C 3 20  ? 122.661 -43.984  -16.270 1.00 52.43  ? 120 DU  D "C4'" 1 
ATOM   827  O "O4'" . DU  C 3 20  ? 122.428 -44.006  -14.850 1.00 42.84  ? 120 DU  D "O4'" 1 
ATOM   828  C "C3'" . DU  C 3 20  ? 122.847 -42.513  -16.624 1.00 53.44  ? 120 DU  D "C3'" 1 
ATOM   829  O "O3'" . DU  C 3 20  ? 121.565 -41.918  -16.907 1.00 59.40  ? 120 DU  D "O3'" 1 
ATOM   830  C "C2'" . DU  C 3 20  ? 123.479 -41.952  -15.363 1.00 48.16  ? 120 DU  D "C2'" 1 
ATOM   831  C "C1'" . DU  C 3 20  ? 122.827 -42.777  -14.262 1.00 39.34  ? 120 DU  D "C1'" 1 
ATOM   832  N N1    . DU  C 3 20  ? 123.693 -43.100  -13.119 1.00 31.92  ? 120 DU  D N1    1 
ATOM   833  C C2    . DU  C 3 20  ? 123.285 -42.682  -11.856 1.00 29.75  ? 120 DU  D C2    1 
ATOM   834  O O2    . DU  C 3 20  ? 122.271 -42.033  -11.659 1.00 29.81  ? 120 DU  D O2    1 
ATOM   835  N N3    . DU  C 3 20  ? 124.111 -43.050  -10.828 1.00 23.76  ? 120 DU  D N3    1 
ATOM   836  C C4    . DU  C 3 20  ? 125.280 -43.768  -10.922 1.00 23.48  ? 120 DU  D C4    1 
ATOM   837  O O4    . DU  C 3 20  ? 125.923 -43.997  -9.896  1.00 21.36  ? 120 DU  D O4    1 
ATOM   838  C C5    . DU  C 3 20  ? 125.649 -44.154  -12.258 1.00 23.39  ? 120 DU  D C5    1 
ATOM   839  C C6    . DU  C 3 20  ? 124.865 -43.813  -13.284 1.00 28.70  ? 120 DU  D C6    1 
ATOM   840  P P     . DU  C 3 21  ? 121.453 -40.340  -17.223 1.00 75.06  ? 121 DU  D P     1 
ATOM   841  O OP1   . DU  C 3 21  ? 120.273 -40.157  -18.100 1.00 59.53  ? 121 DU  D OP1   1 
ATOM   842  O OP2   . DU  C 3 21  ? 122.775 -39.823  -17.653 1.00 58.17  ? 121 DU  D OP2   1 
ATOM   843  O "O5'" . DU  C 3 21  ? 121.090 -39.676  -15.823 1.00 74.02  ? 121 DU  D "O5'" 1 
ATOM   844  C "C5'" . DU  C 3 21  ? 119.830 -39.928  -15.207 1.00 74.84  ? 121 DU  D "C5'" 1 
ATOM   845  C "C4'" . DU  C 3 21  ? 119.701 -39.156  -13.912 1.00 74.36  ? 121 DU  D "C4'" 1 
ATOM   846  O "O4'" . DU  C 3 21  ? 120.637 -39.642  -12.919 1.00 71.94  ? 121 DU  D "O4'" 1 
ATOM   847  C "C3'" . DU  C 3 21  ? 119.925 -37.645  -13.997 1.00 75.64  ? 121 DU  D "C3'" 1 
ATOM   848  O "O3'" . DU  C 3 21  ? 118.998 -37.006  -13.113 1.00 78.78  ? 121 DU  D "O3'" 1 
ATOM   849  C "C2'" . DU  C 3 21  ? 121.342 -37.480  -13.481 1.00 73.00  ? 121 DU  D "C2'" 1 
ATOM   850  C "C1'" . DU  C 3 21  ? 121.402 -38.555  -12.412 1.00 68.70  ? 121 DU  D "C1'" 1 
ATOM   851  N N1    . DU  C 3 21  ? 122.750 -39.052  -12.079 1.00 46.93  ? 121 DU  D N1    1 
ATOM   852  C C2    . DU  C 3 21  ? 123.077 -39.168  -10.733 1.00 43.34  ? 121 DU  D C2    1 
ATOM   853  O O2    . DU  C 3 21  ? 122.308 -38.859  -9.827  1.00 40.54  ? 121 DU  D O2    1 
ATOM   854  N N3    . DU  C 3 21  ? 124.335 -39.662  -10.486 1.00 40.28  ? 121 DU  D N3    1 
ATOM   855  C C4    . DU  C 3 21  ? 125.274 -40.043  -11.415 1.00 41.39  ? 121 DU  D C4    1 
ATOM   856  O O4    . DU  C 3 21  ? 126.327 -40.544  -11.034 1.00 41.78  ? 121 DU  D O4    1 
ATOM   857  C C5    . DU  C 3 21  ? 124.872 -39.878  -12.775 1.00 41.85  ? 121 DU  D C5    1 
ATOM   858  C C6    . DU  C 3 21  ? 123.658 -39.401  -13.056 1.00 45.25  ? 121 DU  D C6    1 
ATOM   859  P P     . DT  C 3 22  ? 119.049 -35.414  -12.891 1.00 69.52  ? 122 DT  D P     1 
ATOM   860  O OP1   . DT  C 3 22  ? 117.648 -34.935  -13.035 1.00 47.85  ? 122 DT  D OP1   1 
ATOM   861  O OP2   . DT  C 3 22  ? 120.127 -34.801  -13.718 1.00 46.28  ? 122 DT  D OP2   1 
ATOM   862  O "O5'" . DT  C 3 22  ? 119.442 -35.278  -11.353 1.00 67.52  ? 122 DT  D "O5'" 1 
ATOM   863  C "C5'" . DT  C 3 22  ? 118.595 -35.824  -10.342 1.00 67.23  ? 122 DT  D "C5'" 1 
ATOM   864  C "C4'" . DT  C 3 22  ? 119.108 -35.456  -8.970  1.00 67.16  ? 122 DT  D "C4'" 1 
ATOM   865  O "O4'" . DT  C 3 22  ? 120.409 -36.063  -8.769  1.00 65.13  ? 122 DT  D "O4'" 1 
ATOM   866  C "C3'" . DT  C 3 22  ? 119.320 -33.960  -8.766  1.00 68.11  ? 122 DT  D "C3'" 1 
ATOM   867  O "O3'" . DT  C 3 22  ? 119.244 -33.632  -7.377  1.00 70.12  ? 122 DT  D "O3'" 1 
ATOM   868  C "C2'" . DT  C 3 22  ? 120.777 -33.796  -9.135  1.00 65.06  ? 122 DT  D "C2'" 1 
ATOM   869  C "C1'" . DT  C 3 22  ? 121.379 -35.054  -8.553  1.00 60.50  ? 122 DT  D "C1'" 1 
ATOM   870  N N1    . DT  C 3 22  ? 122.662 -35.509  -9.141  1.00 31.58  ? 122 DT  D N1    1 
ATOM   871  C C2    . DT  C 3 22  ? 123.661 -35.946  -8.275  1.00 28.25  ? 122 DT  D C2    1 
ATOM   872  O O2    . DT  C 3 22  ? 123.569 -35.913  -7.053  1.00 26.75  ? 122 DT  D O2    1 
ATOM   873  N N3    . DT  C 3 22  ? 124.786 -36.418  -8.893  1.00 25.70  ? 122 DT  D N3    1 
ATOM   874  C C4    . DT  C 3 22  ? 125.031 -36.477  -10.244 1.00 24.66  ? 122 DT  D C4    1 
ATOM   875  O O4    . DT  C 3 22  ? 126.088 -36.963  -10.644 1.00 20.76  ? 122 DT  D O4    1 
ATOM   876  C C5    . DT  C 3 22  ? 123.975 -35.951  -11.088 1.00 25.89  ? 122 DT  D C5    1 
ATOM   877  C C7    . DT  C 3 22  ? 124.182 -35.909  -12.566 1.00 27.40  ? 122 DT  D C7    1 
ATOM   878  C C6    . DT  C 3 22  ? 122.856 -35.513  -10.504 1.00 28.59  ? 122 DT  D C6    1 
ATOM   879  N N     . TRP D 4 1   ? 121.926 -77.711  -30.867 1.00 94.60  ? 203 TRP A N     1 
ATOM   880  C CA    . TRP D 4 1   ? 122.846 -76.553  -31.084 1.00 94.71  ? 203 TRP A CA    1 
ATOM   881  C C     . TRP D 4 1   ? 123.695 -76.245  -29.840 1.00 93.54  ? 203 TRP A C     1 
ATOM   882  O O     . TRP D 4 1   ? 123.195 -76.278  -28.714 1.00 93.33  ? 203 TRP A O     1 
ATOM   883  C CB    . TRP D 4 1   ? 122.041 -75.315  -31.508 1.00 148.47 ? 203 TRP A CB    1 
ATOM   884  C CG    . TRP D 4 1   ? 122.890 -74.143  -31.954 1.00 150.70 ? 203 TRP A CG    1 
ATOM   885  C CD1   . TRP D 4 1   ? 123.745 -74.107  -33.025 1.00 151.36 ? 203 TRP A CD1   1 
ATOM   886  C CD2   . TRP D 4 1   ? 122.987 -72.858  -31.323 1.00 151.93 ? 203 TRP A CD2   1 
ATOM   887  N NE1   . TRP D 4 1   ? 124.370 -72.884  -33.098 1.00 152.36 ? 203 TRP A NE1   1 
ATOM   888  C CE2   . TRP D 4 1   ? 123.928 -72.094  -32.070 1.00 152.56 ? 203 TRP A CE2   1 
ATOM   889  C CE3   . TRP D 4 1   ? 122.372 -72.271  -30.196 1.00 152.57 ? 203 TRP A CE3   1 
ATOM   890  C CZ2   . TRP D 4 1   ? 124.274 -70.764  -31.728 1.00 153.43 ? 203 TRP A CZ2   1 
ATOM   891  C CZ3   . TRP D 4 1   ? 122.715 -70.938  -29.851 1.00 153.54 ? 203 TRP A CZ3   1 
ATOM   892  C CH2   . TRP D 4 1   ? 123.661 -70.205  -30.622 1.00 153.77 ? 203 TRP A CH2   1 
ATOM   893  N N     . LYS D 4 2   ? 124.976 -75.934  -30.066 1.00 100.21 ? 204 LYS A N     1 
ATOM   894  C CA    . LYS D 4 2   ? 125.943 -75.623  -29.000 1.00 98.79  ? 204 LYS A CA    1 
ATOM   895  C C     . LYS D 4 2   ? 126.557 -74.217  -29.114 1.00 97.04  ? 204 LYS A C     1 
ATOM   896  O O     . LYS D 4 2   ? 127.195 -73.876  -30.123 1.00 96.50  ? 204 LYS A O     1 
ATOM   897  C CB    . LYS D 4 2   ? 127.070 -76.671  -28.963 1.00 198.72 ? 204 LYS A CB    1 
ATOM   898  C CG    . LYS D 4 2   ? 126.608 -78.115  -28.747 1.00 198.72 ? 204 LYS A CG    1 
ATOM   899  C CD    . LYS D 4 2   ? 127.772 -79.074  -28.550 1.00 198.72 ? 204 LYS A CD    1 
ATOM   900  C CE    . LYS D 4 2   ? 127.270 -80.498  -28.353 1.00 198.72 ? 204 LYS A CE    1 
ATOM   901  N NZ    . LYS D 4 2   ? 128.376 -81.474  -28.139 1.00 198.72 ? 204 LYS A NZ    1 
ATOM   902  N N     . TRP D 4 3   ? 126.392 -73.430  -28.051 1.00 76.98  ? 205 TRP A N     1 
ATOM   903  C CA    . TRP D 4 3   ? 126.903 -72.060  -27.988 1.00 75.42  ? 205 TRP A CA    1 
ATOM   904  C C     . TRP D 4 3   ? 128.196 -71.878  -27.209 1.00 74.92  ? 205 TRP A C     1 
ATOM   905  O O     . TRP D 4 3   ? 128.871 -70.852  -27.340 1.00 74.83  ? 205 TRP A O     1 
ATOM   906  C CB    . TRP D 4 3   ? 125.837 -71.097  -27.438 1.00 76.58  ? 205 TRP A CB    1 
ATOM   907  C CG    . TRP D 4 3   ? 125.101 -71.523  -26.174 1.00 74.76  ? 205 TRP A CG    1 
ATOM   908  C CD1   . TRP D 4 3   ? 123.880 -72.137  -26.112 1.00 73.88  ? 205 TRP A CD1   1 
ATOM   909  C CD2   . TRP D 4 3   ? 125.505 -71.302  -24.814 1.00 73.91  ? 205 TRP A CD2   1 
ATOM   910  N NE1   . TRP D 4 3   ? 123.492 -72.308  -24.804 1.00 73.29  ? 205 TRP A NE1   1 
ATOM   911  C CE2   . TRP D 4 3   ? 124.468 -71.807  -23.982 1.00 73.51  ? 205 TRP A CE2   1 
ATOM   912  C CE3   . TRP D 4 3   ? 126.643 -70.727  -24.209 1.00 73.86  ? 205 TRP A CE3   1 
ATOM   913  C CZ2   . TRP D 4 3   ? 124.531 -71.756  -22.569 1.00 73.17  ? 205 TRP A CZ2   1 
ATOM   914  C CZ3   . TRP D 4 3   ? 126.711 -70.676  -22.796 1.00 73.42  ? 205 TRP A CZ3   1 
ATOM   915  C CH2   . TRP D 4 3   ? 125.655 -71.190  -21.997 1.00 73.13  ? 205 TRP A CH2   1 
ATOM   916  N N     . TRP D 4 4   ? 128.508 -72.851  -26.361 1.00 73.47  ? 206 TRP A N     1 
ATOM   917  C CA    . TRP D 4 4   ? 129.705 -72.810  -25.533 1.00 73.59  ? 206 TRP A CA    1 
ATOM   918  C C     . TRP D 4 4   ? 130.986 -73.095  -26.309 1.00 74.13  ? 206 TRP A C     1 
ATOM   919  O O     . TRP D 4 4   ? 132.075 -72.681  -25.897 1.00 73.59  ? 206 TRP A O     1 
ATOM   920  C CB    . TRP D 4 4   ? 129.537 -73.726  -24.315 1.00 66.44  ? 206 TRP A CB    1 
ATOM   921  C CG    . TRP D 4 4   ? 129.001 -75.109  -24.595 1.00 66.19  ? 206 TRP A CG    1 
ATOM   922  C CD1   . TRP D 4 4   ? 129.727 -76.254  -24.672 1.00 66.45  ? 206 TRP A CD1   1 
ATOM   923  C CD2   . TRP D 4 4   ? 127.628 -75.496  -24.766 1.00 66.43  ? 206 TRP A CD2   1 
ATOM   924  N NE1   . TRP D 4 4   ? 128.904 -77.336  -24.869 1.00 65.89  ? 206 TRP A NE1   1 
ATOM   925  C CE2   . TRP D 4 4   ? 127.608 -76.906  -24.932 1.00 65.97  ? 206 TRP A CE2   1 
ATOM   926  C CE3   . TRP D 4 4   ? 126.408 -74.793  -24.796 1.00 67.01  ? 206 TRP A CE3   1 
ATOM   927  C CZ2   . TRP D 4 4   ? 126.409 -77.639  -25.123 1.00 65.83  ? 206 TRP A CZ2   1 
ATOM   928  C CZ3   . TRP D 4 4   ? 125.198 -75.522  -24.990 1.00 67.34  ? 206 TRP A CZ3   1 
ATOM   929  C CH2   . TRP D 4 4   ? 125.219 -76.935  -25.151 1.00 66.40  ? 206 TRP A CH2   1 
ATOM   930  N N     . GLU D 4 5   ? 130.829 -73.742  -27.464 1.00 67.73  ? 207 GLU A N     1 
ATOM   931  C CA    . GLU D 4 5   ? 131.953 -74.064  -28.339 1.00 70.15  ? 207 GLU A CA    1 
ATOM   932  C C     . GLU D 4 5   ? 132.268 -72.946  -29.335 1.00 71.79  ? 207 GLU A C     1 
ATOM   933  O O     . GLU D 4 5   ? 133.381 -72.878  -29.884 1.00 71.65  ? 207 GLU A O     1 
ATOM   934  C CB    . GLU D 4 5   ? 131.709 -75.385  -29.072 1.00 194.44 ? 207 GLU A CB    1 
ATOM   935  C CG    . GLU D 4 5   ? 132.110 -76.622  -28.273 1.00 196.71 ? 207 GLU A CG    1 
ATOM   936  C CD    . GLU D 4 5   ? 133.596 -76.958  -28.383 1.00 198.10 ? 207 GLU A CD    1 
ATOM   937  O OE1   . GLU D 4 5   ? 134.439 -76.213  -27.833 1.00 198.72 ? 207 GLU A OE1   1 
ATOM   938  O OE2   . GLU D 4 5   ? 133.918 -77.983  -29.017 1.00 198.33 ? 207 GLU A OE2   1 
ATOM   939  N N     . GLU D 4 6   ? 131.288 -72.061  -29.534 1.00 73.06  ? 208 GLU A N     1 
ATOM   940  C CA    . GLU D 4 6   ? 131.428 -70.922  -30.436 1.00 74.89  ? 208 GLU A CA    1 
ATOM   941  C C     . GLU D 4 6   ? 132.184 -69.784  -29.732 1.00 76.11  ? 208 GLU A C     1 
ATOM   942  O O     . GLU D 4 6   ? 132.423 -69.837  -28.518 1.00 76.31  ? 208 GLU A O     1 
ATOM   943  C CB    . GLU D 4 6   ? 130.048 -70.441  -30.929 1.00 108.18 ? 208 GLU A CB    1 
ATOM   944  C CG    . GLU D 4 6   ? 130.097 -69.664  -32.266 1.00 109.31 ? 208 GLU A CG    1 
ATOM   945  C CD    . GLU D 4 6   ? 128.753 -69.113  -32.724 1.00 109.95 ? 208 GLU A CD    1 
ATOM   946  O OE1   . GLU D 4 6   ? 127.785 -69.897  -32.810 1.00 110.59 ? 208 GLU A OE1   1 
ATOM   947  O OE2   . GLU D 4 6   ? 128.679 -67.898  -33.027 1.00 109.85 ? 208 GLU A OE2   1 
ATOM   948  N N     . GLU D 4 7   ? 132.581 -68.785  -30.522 1.00 150.07 ? 209 GLU A N     1 
ATOM   949  C CA    . GLU D 4 7   ? 133.315 -67.601  -30.069 1.00 151.75 ? 209 GLU A CA    1 
ATOM   950  C C     . GLU D 4 7   ? 132.442 -66.712  -29.162 1.00 152.34 ? 209 GLU A C     1 
ATOM   951  O O     . GLU D 4 7   ? 131.281 -66.435  -29.482 1.00 152.79 ? 209 GLU A O     1 
ATOM   952  C CB    . GLU D 4 7   ? 133.819 -66.822  -31.297 1.00 116.57 ? 209 GLU A CB    1 
ATOM   953  C CG    . GLU D 4 7   ? 134.638 -67.670  -32.302 1.00 117.36 ? 209 GLU A CG    1 
ATOM   954  C CD    . GLU D 4 7   ? 134.032 -67.710  -33.709 1.00 118.26 ? 209 GLU A CD    1 
ATOM   955  O OE1   . GLU D 4 7   ? 132.916 -68.250  -33.877 1.00 118.43 ? 209 GLU A OE1   1 
ATOM   956  O OE2   . GLU D 4 7   ? 134.686 -67.219  -34.655 1.00 118.89 ? 209 GLU A OE2   1 
ATOM   957  N N     . ARG D 4 8   ? 133.003 -66.311  -28.020 1.00 98.75  ? 210 ARG A N     1 
ATOM   958  C CA    . ARG D 4 8   ? 132.302 -65.488  -27.027 1.00 99.16  ? 210 ARG A CA    1 
ATOM   959  C C     . ARG D 4 8   ? 132.412 -63.974  -27.216 1.00 99.02  ? 210 ARG A C     1 
ATOM   960  O O     . ARG D 4 8   ? 133.518 -63.424  -27.261 1.00 98.35  ? 210 ARG A O     1 
ATOM   961  N N     . TYR D 4 9   ? 131.248 -63.319  -27.277 1.00 61.92  ? 211 TYR A N     1 
ATOM   962  C CA    . TYR D 4 9   ? 131.130 -61.872  -27.448 1.00 62.75  ? 211 TYR A CA    1 
ATOM   963  C C     . TYR D 4 9   ? 131.606 -61.150  -26.188 1.00 61.84  ? 211 TYR A C     1 
ATOM   964  O O     . TYR D 4 9   ? 131.031 -61.340  -25.117 1.00 61.33  ? 211 TYR A O     1 
ATOM   965  N N     . PRO D 4 10  ? 132.664 -60.317  -26.299 1.00 110.94 ? 212 PRO A N     1 
ATOM   966  C CA    . PRO D 4 10  ? 133.237 -59.559  -25.176 1.00 110.58 ? 212 PRO A CA    1 
ATOM   967  C C     . PRO D 4 10  ? 132.283 -58.594  -24.451 1.00 109.82 ? 212 PRO A C     1 
ATOM   968  O O     . PRO D 4 10  ? 131.132 -58.414  -24.865 1.00 110.52 ? 212 PRO A O     1 
ATOM   969  C CB    . PRO D 4 10  ? 134.388 -58.806  -25.839 1.00 130.32 ? 212 PRO A CB    1 
ATOM   970  C CG    . PRO D 4 10  ? 134.783 -59.695  -26.949 1.00 130.46 ? 212 PRO A CG    1 
ATOM   971  C CD    . PRO D 4 10  ? 133.451 -60.065  -27.520 1.00 130.43 ? 212 PRO A CD    1 
ATOM   972  N N     . GLU D 4 11  ? 132.790 -57.986  -23.373 1.00 80.23  ? 213 GLU A N     1 
ATOM   973  C CA    . GLU D 4 11  ? 132.056 -57.042  -22.526 1.00 78.44  ? 213 GLU A CA    1 
ATOM   974  C C     . GLU D 4 11  ? 131.576 -55.749  -23.195 1.00 75.71  ? 213 GLU A C     1 
ATOM   975  O O     . GLU D 4 11  ? 132.368 -54.972  -23.735 1.00 75.69  ? 213 GLU A O     1 
ATOM   976  N N     . GLY D 4 12  ? 130.262 -55.544  -23.131 1.00 111.54 ? 214 GLY A N     1 
ATOM   977  C CA    . GLY D 4 12  ? 129.612 -54.377  -23.711 1.00 107.38 ? 214 GLY A CA    1 
ATOM   978  C C     . GLY D 4 12  ? 128.267 -54.754  -24.314 1.00 103.30 ? 214 GLY A C     1 
ATOM   979  O O     . GLY D 4 12  ? 127.238 -54.743  -23.623 1.00 103.50 ? 214 GLY A O     1 
ATOM   980  N N     . ILE D 4 13  ? 128.304 -55.139  -25.594 1.00 66.12  ? 215 ILE A N     1 
ATOM   981  C CA    . ILE D 4 13  ? 127.129 -55.550  -26.369 1.00 61.45  ? 215 ILE A CA    1 
ATOM   982  C C     . ILE D 4 13  ? 126.689 -56.956  -25.969 1.00 58.02  ? 215 ILE A C     1 
ATOM   983  O O     . ILE D 4 13  ? 127.514 -57.873  -25.912 1.00 57.62  ? 215 ILE A O     1 
ATOM   984  N N     . LYS D 4 14  ? 125.397 -57.108  -25.672 1.00 34.14  ? 216 LYS A N     1 
ATOM   985  C CA    . LYS D 4 14  ? 124.840 -58.390  -25.239 1.00 30.35  ? 216 LYS A CA    1 
ATOM   986  C C     . LYS D 4 14  ? 124.150 -59.245  -26.313 1.00 28.12  ? 216 LYS A C     1 
ATOM   987  O O     . LYS D 4 14  ? 123.869 -60.426  -26.084 1.00 27.70  ? 216 LYS A O     1 
ATOM   988  C CB    . LYS D 4 14  ? 123.982 -58.204  -23.975 1.00 94.62  ? 216 LYS A CB    1 
ATOM   989  C CG    . LYS D 4 14  ? 124.821 -57.829  -22.739 1.00 93.56  ? 216 LYS A CG    1 
ATOM   990  C CD    . LYS D 4 14  ? 124.026 -57.776  -21.441 1.00 93.26  ? 216 LYS A CD    1 
ATOM   991  C CE    . LYS D 4 14  ? 124.914 -57.392  -20.250 1.00 93.01  ? 216 LYS A CE    1 
ATOM   992  N NZ    . LYS D 4 14  ? 124.190 -57.387  -18.933 1.00 93.46  ? 216 LYS A NZ    1 
ATOM   993  N N     . TRP D 4 15  ? 123.903 -58.649  -27.484 1.00 60.19  ? 217 TRP A N     1 
ATOM   994  C CA    . TRP D 4 15  ? 123.311 -59.329  -28.654 1.00 57.75  ? 217 TRP A CA    1 
ATOM   995  C C     . TRP D 4 15  ? 123.614 -58.566  -29.940 1.00 57.40  ? 217 TRP A C     1 
ATOM   996  O O     . TRP D 4 15  ? 123.635 -57.326  -29.945 1.00 57.50  ? 217 TRP A O     1 
ATOM   997  C CB    . TRP D 4 15  ? 121.793 -59.569  -28.526 1.00 68.29  ? 217 TRP A CB    1 
ATOM   998  C CG    . TRP D 4 15  ? 120.945 -58.404  -28.063 1.00 65.65  ? 217 TRP A CG    1 
ATOM   999  C CD1   . TRP D 4 15  ? 120.507 -58.177  -26.794 1.00 65.54  ? 217 TRP A CD1   1 
ATOM   1000 C CD2   . TRP D 4 15  ? 120.364 -57.374  -28.875 1.00 64.61  ? 217 TRP A CD2   1 
ATOM   1001 N NE1   . TRP D 4 15  ? 119.679 -57.083  -26.758 1.00 63.95  ? 217 TRP A NE1   1 
ATOM   1002 C CE2   . TRP D 4 15  ? 119.570 -56.569  -28.018 1.00 63.75  ? 217 TRP A CE2   1 
ATOM   1003 C CE3   . TRP D 4 15  ? 120.432 -57.050  -30.244 1.00 65.27  ? 217 TRP A CE3   1 
ATOM   1004 C CZ2   . TRP D 4 15  ? 118.842 -55.453  -28.488 1.00 63.99  ? 217 TRP A CZ2   1 
ATOM   1005 C CZ3   . TRP D 4 15  ? 119.706 -55.930  -30.721 1.00 64.33  ? 217 TRP A CZ3   1 
ATOM   1006 C CH2   . TRP D 4 15  ? 118.921 -55.149  -29.835 1.00 64.06  ? 217 TRP A CH2   1 
ATOM   1007 N N     . LYS D 4 16  ? 123.840 -59.303  -31.026 1.00 61.40  ? 218 LYS A N     1 
ATOM   1008 C CA    . LYS D 4 16  ? 124.138 -58.688  -32.318 1.00 60.86  ? 218 LYS A CA    1 
ATOM   1009 C C     . LYS D 4 16  ? 122.845 -58.289  -33.030 1.00 58.31  ? 218 LYS A C     1 
ATOM   1010 O O     . LYS D 4 16  ? 122.734 -57.179  -33.562 1.00 57.87  ? 218 LYS A O     1 
ATOM   1011 N N     . PHE D 4 17  ? 121.860 -59.185  -32.987 1.00 52.66  ? 219 PHE A N     1 
ATOM   1012 C CA    . PHE D 4 17  ? 120.573 -58.963  -33.635 1.00 50.57  ? 219 PHE A CA    1 
ATOM   1013 C C     . PHE D 4 17  ? 119.432 -59.550  -32.803 1.00 48.05  ? 219 PHE A C     1 
ATOM   1014 O O     . PHE D 4 17  ? 119.601 -60.580  -32.145 1.00 48.65  ? 219 PHE A O     1 
ATOM   1015 C CB    . PHE D 4 17  ? 120.587 -59.586  -35.043 1.00 129.46 ? 219 PHE A CB    1 
ATOM   1016 C CG    . PHE D 4 17  ? 119.420 -59.183  -35.915 1.00 131.49 ? 219 PHE A CG    1 
ATOM   1017 C CD1   . PHE D 4 17  ? 119.214 -57.833  -36.269 1.00 132.26 ? 219 PHE A CD1   1 
ATOM   1018 C CD2   . PHE D 4 17  ? 118.522 -60.157  -36.393 1.00 132.32 ? 219 PHE A CD2   1 
ATOM   1019 C CE1   . PHE D 4 17  ? 118.121 -57.452  -37.094 1.00 132.78 ? 219 PHE A CE1   1 
ATOM   1020 C CE2   . PHE D 4 17  ? 117.424 -59.798  -37.219 1.00 132.78 ? 219 PHE A CE2   1 
ATOM   1021 C CZ    . PHE D 4 17  ? 117.223 -58.440  -37.570 1.00 132.71 ? 219 PHE A CZ    1 
ATOM   1022 N N     . LEU D 4 18  ? 118.273 -58.882  -32.860 1.00 47.39  ? 220 LEU A N     1 
ATOM   1023 C CA    . LEU D 4 18  ? 117.063 -59.291  -32.145 1.00 43.71  ? 220 LEU A CA    1 
ATOM   1024 C C     . LEU D 4 18  ? 115.787 -58.806  -32.846 1.00 42.62  ? 220 LEU A C     1 
ATOM   1025 O O     . LEU D 4 18  ? 115.694 -57.637  -33.238 1.00 41.67  ? 220 LEU A O     1 
ATOM   1026 C CB    . LEU D 4 18  ? 117.098 -58.762  -30.707 1.00 31.08  ? 220 LEU A CB    1 
ATOM   1027 C CG    . LEU D 4 18  ? 115.955 -59.045  -29.726 1.00 29.70  ? 220 LEU A CG    1 
ATOM   1028 C CD1   . LEU D 4 18  ? 115.848 -60.534  -29.451 1.00 29.09  ? 220 LEU A CD1   1 
ATOM   1029 C CD2   . LEU D 4 18  ? 116.173 -58.262  -28.446 1.00 28.97  ? 220 LEU A CD2   1 
ATOM   1030 N N     . GLU D 4 19  ? 114.821 -59.724  -32.979 1.00 23.23  ? 221 GLU A N     1 
ATOM   1031 C CA    . GLU D 4 19  ? 113.510 -59.482  -33.596 1.00 22.32  ? 221 GLU A CA    1 
ATOM   1032 C C     . GLU D 4 19  ? 112.456 -60.351  -32.886 1.00 21.23  ? 221 GLU A C     1 
ATOM   1033 O O     . GLU D 4 19  ? 112.358 -61.563  -33.135 1.00 20.15  ? 221 GLU A O     1 
ATOM   1034 C CB    . GLU D 4 19  ? 113.540 -59.814  -35.101 1.00 92.03  ? 221 GLU A CB    1 
ATOM   1035 C CG    . GLU D 4 19  ? 112.280 -59.410  -35.885 1.00 94.79  ? 221 GLU A CG    1 
ATOM   1036 C CD    . GLU D 4 19  ? 111.569 -60.591  -36.537 1.00 96.77  ? 221 GLU A CD    1 
ATOM   1037 O OE1   . GLU D 4 19  ? 112.073 -61.104  -37.561 1.00 98.41  ? 221 GLU A OE1   1 
ATOM   1038 O OE2   . GLU D 4 19  ? 110.497 -60.995  -36.030 1.00 97.55  ? 221 GLU A OE2   1 
ATOM   1039 N N     . HIS D 4 20  ? 111.680 -59.735  -31.997 1.00 23.18  ? 222 HIS A N     1 
ATOM   1040 C CA    . HIS D 4 20  ? 110.647 -60.462  -31.273 1.00 23.70  ? 222 HIS A CA    1 
ATOM   1041 C C     . HIS D 4 20  ? 109.266 -60.138  -31.784 1.00 24.82  ? 222 HIS A C     1 
ATOM   1042 O O     . HIS D 4 20  ? 109.049 -59.059  -32.320 1.00 25.05  ? 222 HIS A O     1 
ATOM   1043 C CB    . HIS D 4 20  ? 110.750 -60.237  -29.766 1.00 40.44  ? 222 HIS A CB    1 
ATOM   1044 C CG    . HIS D 4 20  ? 110.755 -58.802  -29.351 1.00 40.36  ? 222 HIS A CG    1 
ATOM   1045 N ND1   . HIS D 4 20  ? 109.780 -58.267  -28.539 1.00 41.03  ? 222 HIS A ND1   1 
ATOM   1046 C CD2   . HIS D 4 20  ? 111.641 -57.806  -29.584 1.00 39.57  ? 222 HIS A CD2   1 
ATOM   1047 C CE1   . HIS D 4 20  ? 110.070 -57.004  -28.286 1.00 40.00  ? 222 HIS A CE1   1 
ATOM   1048 N NE2   . HIS D 4 20  ? 111.194 -56.699  -28.908 1.00 39.00  ? 222 HIS A NE2   1 
ATOM   1049 N N     . LYS D 4 21  ? 108.344 -61.082  -31.610 1.00 70.73  ? 223 LYS A N     1 
ATOM   1050 C CA    . LYS D 4 21  ? 106.967 -60.944  -32.072 1.00 72.45  ? 223 LYS A CA    1 
ATOM   1051 C C     . LYS D 4 21  ? 106.112 -59.945  -31.258 1.00 72.35  ? 223 LYS A C     1 
ATOM   1052 O O     . LYS D 4 21  ? 105.156 -59.367  -31.788 1.00 72.50  ? 223 LYS A O     1 
ATOM   1053 C CB    . LYS D 4 21  ? 106.318 -62.335  -32.114 1.00 100.23 ? 223 LYS A CB    1 
ATOM   1054 C CG    . LYS D 4 21  ? 105.076 -62.480  -33.006 1.00 102.11 ? 223 LYS A CG    1 
ATOM   1055 C CD    . LYS D 4 21  ? 105.378 -62.482  -34.506 1.00 103.14 ? 223 LYS A CD    1 
ATOM   1056 C CE    . LYS D 4 21  ? 104.089 -62.664  -35.318 1.00 103.35 ? 223 LYS A CE    1 
ATOM   1057 N NZ    . LYS D 4 21  ? 104.318 -62.708  -36.791 1.00 103.63 ? 223 LYS A NZ    1 
ATOM   1058 N N     . GLY D 4 22  ? 106.498 -59.701  -30.004 1.00 58.96  ? 224 GLY A N     1 
ATOM   1059 C CA    . GLY D 4 22  ? 105.761 -58.784  -29.144 1.00 59.19  ? 224 GLY A CA    1 
ATOM   1060 C C     . GLY D 4 22  ? 105.064 -59.480  -27.980 1.00 59.40  ? 224 GLY A C     1 
ATOM   1061 O O     . GLY D 4 22  ? 105.041 -60.714  -27.940 1.00 60.41  ? 224 GLY A O     1 
ATOM   1062 N N     . PRO D 4 23  ? 104.509 -58.732  -26.999 1.00 52.37  ? 225 PRO A N     1 
ATOM   1063 C CA    . PRO D 4 23  ? 103.813 -59.304  -25.831 1.00 51.28  ? 225 PRO A CA    1 
ATOM   1064 C C     . PRO D 4 23  ? 102.374 -59.770  -26.058 1.00 51.12  ? 225 PRO A C     1 
ATOM   1065 O O     . PRO D 4 23  ? 101.915 -59.842  -27.195 1.00 51.27  ? 225 PRO A O     1 
ATOM   1066 C CB    . PRO D 4 23  ? 103.861 -58.160  -24.824 1.00 29.88  ? 225 PRO A CB    1 
ATOM   1067 C CG    . PRO D 4 23  ? 103.794 -56.949  -25.677 1.00 29.85  ? 225 PRO A CG    1 
ATOM   1068 C CD    . PRO D 4 23  ? 104.751 -57.289  -26.792 1.00 30.69  ? 225 PRO A CD    1 
ATOM   1069 N N     . VAL D 4 24  ? 101.706 -60.146  -24.964 1.00 19.67  ? 226 VAL A N     1 
ATOM   1070 C CA    . VAL D 4 24  ? 100.303 -60.601  -24.943 1.00 19.10  ? 226 VAL A CA    1 
ATOM   1071 C C     . VAL D 4 24  ? 99.703  -60.101  -23.630 1.00 19.18  ? 226 VAL A C     1 
ATOM   1072 O O     . VAL D 4 24  ? 100.202 -60.412  -22.555 1.00 17.85  ? 226 VAL A O     1 
ATOM   1073 C CB    . VAL D 4 24  ? 100.160 -62.177  -24.993 1.00 30.59  ? 226 VAL A CB    1 
ATOM   1074 C CG1   . VAL D 4 24  ? 98.701  -62.626  -24.726 1.00 29.35  ? 226 VAL A CG1   1 
ATOM   1075 C CG2   . VAL D 4 24  ? 100.587 -62.719  -26.351 1.00 30.89  ? 226 VAL A CG2   1 
ATOM   1076 N N     . PHE D 4 25  ? 98.585  -59.395  -23.720 1.00 43.85  ? 227 PHE A N     1 
ATOM   1077 C CA    . PHE D 4 25  ? 97.907  -58.856  -22.542 1.00 46.74  ? 227 PHE A CA    1 
ATOM   1078 C C     . PHE D 4 25  ? 96.861  -59.841  -22.039 1.00 49.72  ? 227 PHE A C     1 
ATOM   1079 O O     . PHE D 4 25  ? 96.821  -60.999  -22.470 1.00 50.33  ? 227 PHE A O     1 
ATOM   1080 C CB    . PHE D 4 25  ? 97.255  -57.518  -22.899 1.00 38.19  ? 227 PHE A CB    1 
ATOM   1081 C CG    . PHE D 4 25  ? 98.207  -56.539  -23.522 1.00 38.56  ? 227 PHE A CG    1 
ATOM   1082 C CD1   . PHE D 4 25  ? 98.702  -55.457  -22.773 1.00 38.55  ? 227 PHE A CD1   1 
ATOM   1083 C CD2   . PHE D 4 25  ? 98.682  -56.731  -24.845 1.00 38.31  ? 227 PHE A CD2   1 
ATOM   1084 C CE1   . PHE D 4 25  ? 99.680  -54.570  -23.329 1.00 38.11  ? 227 PHE A CE1   1 
ATOM   1085 C CE2   . PHE D 4 25  ? 99.654  -55.865  -25.415 1.00 37.66  ? 227 PHE A CE2   1 
ATOM   1086 C CZ    . PHE D 4 25  ? 100.156 -54.782  -24.656 1.00 37.69  ? 227 PHE A CZ    1 
ATOM   1087 N N     . ALA D 4 26  ? 96.063  -59.406  -21.071 1.00 83.18  ? 228 ALA A N     1 
ATOM   1088 C CA    . ALA D 4 26  ? 94.993  -60.241  -20.546 1.00 87.06  ? 228 ALA A CA    1 
ATOM   1089 C C     . ALA D 4 26  ? 93.810  -59.910  -21.443 1.00 89.66  ? 228 ALA A C     1 
ATOM   1090 O O     . ALA D 4 26  ? 93.556  -58.723  -21.675 1.00 90.55  ? 228 ALA A O     1 
ATOM   1091 C CB    . ALA D 4 26  ? 94.680  -59.861  -19.109 1.00 130.54 ? 228 ALA A CB    1 
ATOM   1092 N N     . PRO D 4 27  ? 93.136  -60.933  -22.043 1.00 57.47  ? 229 PRO A N     1 
ATOM   1093 C CA    . PRO D 4 27  ? 91.977  -60.687  -22.920 1.00 58.72  ? 229 PRO A CA    1 
ATOM   1094 C C     . PRO D 4 27  ? 91.014  -59.734  -22.200 1.00 59.63  ? 229 PRO A C     1 
ATOM   1095 O O     . PRO D 4 27  ? 90.626  -60.012  -21.060 1.00 59.12  ? 229 PRO A O     1 
ATOM   1096 C CB    . PRO D 4 27  ? 91.388  -62.086  -23.096 1.00 132.12 ? 229 PRO A CB    1 
ATOM   1097 C CG    . PRO D 4 27  ? 92.613  -62.933  -23.141 1.00 131.88 ? 229 PRO A CG    1 
ATOM   1098 C CD    . PRO D 4 27  ? 93.431  -62.381  -21.985 1.00 130.95 ? 229 PRO A CD    1 
ATOM   1099 N N     . PRO D 4 28  ? 90.739  -58.541  -22.799 1.00 91.39  ? 230 PRO A N     1 
ATOM   1100 C CA    . PRO D 4 28  ? 89.859  -57.489  -22.265 1.00 93.00  ? 230 PRO A CA    1 
ATOM   1101 C C     . PRO D 4 28  ? 88.762  -57.990  -21.345 1.00 94.63  ? 230 PRO A C     1 
ATOM   1102 O O     . PRO D 4 28  ? 87.970  -58.849  -21.740 1.00 95.25  ? 230 PRO A O     1 
ATOM   1103 C CB    . PRO D 4 28  ? 89.311  -56.844  -23.531 1.00 114.81 ? 230 PRO A CB    1 
ATOM   1104 C CG    . PRO D 4 28  ? 90.504  -56.830  -24.395 1.00 113.97 ? 230 PRO A CG    1 
ATOM   1105 C CD    . PRO D 4 28  ? 91.076  -58.228  -24.206 1.00 113.67 ? 230 PRO A CD    1 
ATOM   1106 N N     . TYR D 4 29  ? 88.838  -57.549  -20.085 1.00 70.02  ? 231 TYR A N     1 
ATOM   1107 C CA    . TYR D 4 29  ? 87.915  -57.906  -19.000 1.00 72.12  ? 231 TYR A CA    1 
ATOM   1108 C C     . TYR D 4 29  ? 86.482  -58.283  -19.404 1.00 73.95  ? 231 TYR A C     1 
ATOM   1109 O O     . TYR D 4 29  ? 85.736  -57.454  -19.942 1.00 74.33  ? 231 TYR A O     1 
ATOM   1110 C CB    . TYR D 4 29  ? 87.900  -56.786  -17.943 1.00 74.76  ? 231 TYR A CB    1 
ATOM   1111 C CG    . TYR D 4 29  ? 86.881  -56.972  -16.838 1.00 75.71  ? 231 TYR A CG    1 
ATOM   1112 C CD1   . TYR D 4 29  ? 87.014  -58.011  -15.897 1.00 76.62  ? 231 TYR A CD1   1 
ATOM   1113 C CD2   . TYR D 4 29  ? 85.729  -56.157  -16.779 1.00 76.24  ? 231 TYR A CD2   1 
ATOM   1114 C CE1   . TYR D 4 29  ? 86.014  -58.246  -14.926 1.00 77.06  ? 231 TYR A CE1   1 
ATOM   1115 C CE2   . TYR D 4 29  ? 84.723  -56.381  -15.814 1.00 76.81  ? 231 TYR A CE2   1 
ATOM   1116 C CZ    . TYR D 4 29  ? 84.872  -57.428  -14.893 1.00 76.92  ? 231 TYR A CZ    1 
ATOM   1117 O OH    . TYR D 4 29  ? 83.894  -57.655  -13.949 1.00 76.97  ? 231 TYR A OH    1 
ATOM   1118 N N     . GLU D 4 30  ? 86.115  -59.522  -19.070 1.00 103.98 ? 232 GLU A N     1 
ATOM   1119 C CA    . GLU D 4 30  ? 84.795  -60.088  -19.363 1.00 105.49 ? 232 GLU A CA    1 
ATOM   1120 C C     . GLU D 4 30  ? 83.822  -59.704  -18.234 1.00 105.66 ? 232 GLU A C     1 
ATOM   1121 O O     . GLU D 4 30  ? 84.052  -60.066  -17.079 1.00 105.77 ? 232 GLU A O     1 
ATOM   1122 C CB    . GLU D 4 30  ? 84.889  -61.620  -19.496 1.00 108.48 ? 232 GLU A CB    1 
ATOM   1123 C CG    . GLU D 4 30  ? 86.175  -62.176  -20.178 1.00 111.53 ? 232 GLU A CG    1 
ATOM   1124 C CD    . GLU D 4 30  ? 86.350  -61.793  -21.659 1.00 113.98 ? 232 GLU A CD    1 
ATOM   1125 O OE1   . GLU D 4 30  ? 87.515  -61.695  -22.111 1.00 116.05 ? 232 GLU A OE1   1 
ATOM   1126 O OE2   . GLU D 4 30  ? 85.341  -61.610  -22.377 1.00 114.69 ? 232 GLU A OE2   1 
ATOM   1127 N N     . PRO D 4 31  ? 82.740  -58.948  -18.549 1.00 87.67  ? 233 PRO A N     1 
ATOM   1128 C CA    . PRO D 4 31  ? 81.742  -58.508  -17.558 1.00 87.39  ? 233 PRO A CA    1 
ATOM   1129 C C     . PRO D 4 31  ? 80.905  -59.575  -16.836 1.00 86.90  ? 233 PRO A C     1 
ATOM   1130 O O     . PRO D 4 31  ? 80.800  -60.724  -17.285 1.00 86.75  ? 233 PRO A O     1 
ATOM   1131 C CB    . PRO D 4 31  ? 80.851  -57.561  -18.369 1.00 87.35  ? 233 PRO A CB    1 
ATOM   1132 C CG    . PRO D 4 31  ? 81.768  -57.044  -19.428 1.00 87.87  ? 233 PRO A CG    1 
ATOM   1133 C CD    . PRO D 4 31  ? 82.458  -58.308  -19.849 1.00 87.51  ? 233 PRO A CD    1 
ATOM   1134 N N     . LEU D 4 32  ? 80.324  -59.162  -15.707 1.00 84.16  ? 234 LEU A N     1 
ATOM   1135 C CA    . LEU D 4 32  ? 79.479  -60.016  -14.874 1.00 83.98  ? 234 LEU A CA    1 
ATOM   1136 C C     . LEU D 4 32  ? 78.077  -60.179  -15.438 1.00 84.03  ? 234 LEU A C     1 
ATOM   1137 O O     . LEU D 4 32  ? 77.444  -59.191  -15.816 1.00 84.11  ? 234 LEU A O     1 
ATOM   1138 C CB    . LEU D 4 32  ? 79.284  -59.432  -13.464 1.00 51.06  ? 234 LEU A CB    1 
ATOM   1139 C CG    . LEU D 4 32  ? 80.223  -59.521  -12.261 1.00 50.35  ? 234 LEU A CG    1 
ATOM   1140 C CD1   . LEU D 4 32  ? 79.485  -58.913  -11.075 1.00 49.61  ? 234 LEU A CD1   1 
ATOM   1141 C CD2   . LEU D 4 32  ? 80.624  -60.943  -11.947 1.00 50.06  ? 234 LEU A CD2   1 
ATOM   1142 N N     . PRO D 4 33  ? 77.581  -61.428  -15.530 1.00 90.72  ? 235 PRO A N     1 
ATOM   1143 C CA    . PRO D 4 33  ? 76.230  -61.699  -16.035 1.00 90.72  ? 235 PRO A CA    1 
ATOM   1144 C C     . PRO D 4 33  ? 75.179  -61.166  -15.041 1.00 90.45  ? 235 PRO A C     1 
ATOM   1145 O O     . PRO D 4 33  ? 75.510  -60.854  -13.889 1.00 89.42  ? 235 PRO A O     1 
ATOM   1146 C CB    . PRO D 4 33  ? 76.218  -63.222  -16.143 1.00 52.01  ? 235 PRO A CB    1 
ATOM   1147 C CG    . PRO D 4 33  ? 77.620  -63.497  -16.577 1.00 51.54  ? 235 PRO A CG    1 
ATOM   1148 C CD    . PRO D 4 33  ? 78.397  -62.652  -15.610 1.00 51.23  ? 235 PRO A CD    1 
ATOM   1149 N N     . GLU D 4 34  ? 73.934  -61.048  -15.504 1.00 90.97  ? 236 GLU A N     1 
ATOM   1150 C CA    . GLU D 4 34  ? 72.813  -60.516  -14.716 1.00 91.74  ? 236 GLU A CA    1 
ATOM   1151 C C     . GLU D 4 34  ? 72.550  -61.115  -13.333 1.00 90.66  ? 236 GLU A C     1 
ATOM   1152 O O     . GLU D 4 34  ? 72.294  -60.376  -12.376 1.00 89.87  ? 236 GLU A O     1 
ATOM   1153 N N     . ASN D 4 35  ? 72.682  -62.439  -13.236 1.00 118.36 ? 237 ASN A N     1 
ATOM   1154 C CA    . ASN D 4 35  ? 72.440  -63.201  -12.003 1.00 118.19 ? 237 ASN A CA    1 
ATOM   1155 C C     . ASN D 4 35  ? 73.363  -63.000  -10.785 1.00 117.90 ? 237 ASN A C     1 
ATOM   1156 O O     . ASN D 4 35  ? 72.989  -63.364  -9.664  1.00 117.08 ? 237 ASN A O     1 
ATOM   1157 C CB    . ASN D 4 35  ? 72.303  -64.705  -12.322 1.00 107.37 ? 237 ASN A CB    1 
ATOM   1158 C CG    . ASN D 4 35  ? 73.481  -65.262  -13.112 1.00 107.92 ? 237 ASN A CG    1 
ATOM   1159 O OD1   . ASN D 4 35  ? 73.595  -65.046  -14.318 1.00 107.65 ? 237 ASN A OD1   1 
ATOM   1160 N ND2   . ASN D 4 35  ? 74.346  -66.006  -12.433 1.00 108.94 ? 237 ASN A ND2   1 
ATOM   1161 N N     . VAL D 4 36  ? 74.538  -62.398  -10.993 1.00 119.75 ? 238 VAL A N     1 
ATOM   1162 C CA    . VAL D 4 36  ? 75.507  -62.153  -9.906  1.00 118.80 ? 238 VAL A CA    1 
ATOM   1163 C C     . VAL D 4 36  ? 75.067  -60.934  -9.074  1.00 117.50 ? 238 VAL A C     1 
ATOM   1164 O O     . VAL D 4 36  ? 74.317  -60.087  -9.568  1.00 118.47 ? 238 VAL A O     1 
ATOM   1165 C CB    . VAL D 4 36  ? 76.956  -61.934  -10.445 1.00 75.32  ? 238 VAL A CB    1 
ATOM   1166 C CG1   . VAL D 4 36  ? 77.964  -62.400  -9.418  1.00 76.11  ? 238 VAL A CG1   1 
ATOM   1167 C CG2   . VAL D 4 36  ? 77.189  -62.682  -11.758 1.00 75.27  ? 238 VAL A CG2   1 
ATOM   1168 N N     . LYS D 4 37  ? 75.533  -60.844  -7.826  1.00 24.86  ? 239 LYS A N     1 
ATOM   1169 C CA    . LYS D 4 37  ? 75.134  -59.736  -6.938  1.00 22.79  ? 239 LYS A CA    1 
ATOM   1170 C C     . LYS D 4 37  ? 76.220  -58.854  -6.319  1.00 19.97  ? 239 LYS A C     1 
ATOM   1171 O O     . LYS D 4 37  ? 77.335  -58.809  -6.817  1.00 19.07  ? 239 LYS A O     1 
ATOM   1172 N N     . PHE D 4 38  ? 75.815  -58.087  -5.297  1.00 52.25  ? 240 PHE A N     1 
ATOM   1173 C CA    . PHE D 4 38  ? 76.637  -57.156  -4.487  1.00 52.30  ? 240 PHE A CA    1 
ATOM   1174 C C     . PHE D 4 38  ? 75.705  -56.509  -3.440  1.00 52.44  ? 240 PHE A C     1 
ATOM   1175 O O     . PHE D 4 38  ? 75.039  -55.503  -3.707  1.00 51.91  ? 240 PHE A O     1 
ATOM   1176 C CB    . PHE D 4 38  ? 77.334  -56.070  -5.343  1.00 114.39 ? 240 PHE A CB    1 
ATOM   1177 C CG    . PHE D 4 38  ? 78.202  -55.134  -4.546  1.00 114.20 ? 240 PHE A CG    1 
ATOM   1178 C CD1   . PHE D 4 38  ? 79.331  -55.613  -3.858  1.00 115.02 ? 240 PHE A CD1   1 
ATOM   1179 C CD2   . PHE D 4 38  ? 77.853  -53.778  -4.417  1.00 114.67 ? 240 PHE A CD2   1 
ATOM   1180 C CE1   . PHE D 4 38  ? 80.105  -54.755  -3.035  1.00 116.00 ? 240 PHE A CE1   1 
ATOM   1181 C CE2   . PHE D 4 38  ? 78.613  -52.901  -3.599  1.00 115.10 ? 240 PHE A CE2   1 
ATOM   1182 C CZ    . PHE D 4 38  ? 79.744  -53.393  -2.904  1.00 115.18 ? 240 PHE A CZ    1 
ATOM   1183 N N     . TYR D 4 39  ? 75.699  -57.075  -2.239  1.00 104.81 ? 241 TYR A N     1 
ATOM   1184 C CA    . TYR D 4 39  ? 74.821  -56.610  -1.166  1.00 106.31 ? 241 TYR A CA    1 
ATOM   1185 C C     . TYR D 4 39  ? 75.535  -55.685  -0.194  1.00 107.44 ? 241 TYR A C     1 
ATOM   1186 O O     . TYR D 4 39  ? 76.552  -56.059  0.393   1.00 108.06 ? 241 TYR A O     1 
ATOM   1187 C CB    . TYR D 4 39  ? 74.201  -57.820  -0.444  1.00 104.15 ? 241 TYR A CB    1 
ATOM   1188 C CG    . TYR D 4 39  ? 73.659  -58.872  -1.402  1.00 104.80 ? 241 TYR A CG    1 
ATOM   1189 C CD1   . TYR D 4 39  ? 74.523  -59.818  -2.008  1.00 105.75 ? 241 TYR A CD1   1 
ATOM   1190 C CD2   . TYR D 4 39  ? 72.301  -58.886  -1.770  1.00 105.82 ? 241 TYR A CD2   1 
ATOM   1191 C CE1   . TYR D 4 39  ? 74.047  -60.749  -2.974  1.00 106.24 ? 241 TYR A CE1   1 
ATOM   1192 C CE2   . TYR D 4 39  ? 71.807  -59.816  -2.735  1.00 106.85 ? 241 TYR A CE2   1 
ATOM   1193 C CZ    . TYR D 4 39  ? 72.692  -60.739  -3.329  1.00 106.73 ? 241 TYR A CZ    1 
ATOM   1194 O OH    . TYR D 4 39  ? 72.238  -61.640  -4.268  1.00 107.35 ? 241 TYR A OH    1 
ATOM   1195 N N     . TYR D 4 40  ? 75.013  -54.465  -0.067  1.00 60.20  ? 242 TYR A N     1 
ATOM   1196 C CA    . TYR D 4 40  ? 75.581  -53.451  0.820   1.00 62.56  ? 242 TYR A CA    1 
ATOM   1197 C C     . TYR D 4 40  ? 74.585  -52.922  1.862   1.00 63.15  ? 242 TYR A C     1 
ATOM   1198 O O     . TYR D 4 40  ? 73.482  -52.503  1.519   1.00 63.01  ? 242 TYR A O     1 
ATOM   1199 C CB    . TYR D 4 40  ? 76.170  -52.278  -0.007  1.00 131.21 ? 242 TYR A CB    1 
ATOM   1200 C CG    . TYR D 4 40  ? 76.797  -51.169  0.833   1.00 132.94 ? 242 TYR A CG    1 
ATOM   1201 C CD1   . TYR D 4 40  ? 77.987  -51.398  1.556   1.00 133.99 ? 242 TYR A CD1   1 
ATOM   1202 C CD2   . TYR D 4 40  ? 76.142  -49.928  1.007   1.00 133.93 ? 242 TYR A CD2   1 
ATOM   1203 C CE1   . TYR D 4 40  ? 78.506  -50.425  2.452   1.00 134.71 ? 242 TYR A CE1   1 
ATOM   1204 C CE2   . TYR D 4 40  ? 76.652  -48.947  1.904   1.00 134.37 ? 242 TYR A CE2   1 
ATOM   1205 C CZ    . TYR D 4 40  ? 77.830  -49.213  2.622   1.00 134.67 ? 242 TYR A CZ    1 
ATOM   1206 O OH    . TYR D 4 40  ? 78.311  -48.299  3.529   1.00 135.26 ? 242 TYR A OH    1 
ATOM   1207 N N     . ASP D 4 41  ? 75.046  -52.873  3.116   1.00 140.29 ? 243 ASP A N     1 
ATOM   1208 C CA    . ASP D 4 41  ? 74.317  -52.375  4.296   1.00 141.31 ? 243 ASP A CA    1 
ATOM   1209 C C     . ASP D 4 41  ? 72.803  -52.550  4.368   1.00 141.77 ? 243 ASP A C     1 
ATOM   1210 O O     . ASP D 4 41  ? 72.081  -51.585  4.636   1.00 142.03 ? 243 ASP A O     1 
ATOM   1211 N N     . GLY D 4 42  ? 72.341  -53.774  4.108   1.00 130.76 ? 244 GLY A N     1 
ATOM   1212 C CA    . GLY D 4 42  ? 70.917  -54.079  4.133   1.00 131.56 ? 244 GLY A CA    1 
ATOM   1213 C C     . GLY D 4 42  ? 70.303  -54.048  2.746   1.00 132.19 ? 244 GLY A C     1 
ATOM   1214 O O     . GLY D 4 42  ? 69.559  -54.958  2.372   1.00 132.25 ? 244 GLY A O     1 
ATOM   1215 N N     . LYS D 4 43  ? 70.622  -52.991  1.995   1.00 119.92 ? 245 LYS A N     1 
ATOM   1216 C CA    . LYS D 4 43  ? 70.145  -52.780  0.623   1.00 119.61 ? 245 LYS A CA    1 
ATOM   1217 C C     . LYS D 4 43  ? 71.166  -53.395  -0.353  1.00 119.60 ? 245 LYS A C     1 
ATOM   1218 O O     . LYS D 4 43  ? 71.950  -54.273  0.029   1.00 119.71 ? 245 LYS A O     1 
ATOM   1219 C CB    . LYS D 4 43  ? 69.977  -51.271  0.347   1.00 90.46  ? 245 LYS A CB    1 
ATOM   1220 C CG    . LYS D 4 43  ? 68.998  -50.537  1.268   1.00 89.87  ? 245 LYS A CG    1 
ATOM   1221 C CD    . LYS D 4 43  ? 69.085  -49.024  1.080   1.00 90.26  ? 245 LYS A CD    1 
ATOM   1222 C CE    . LYS D 4 43  ? 68.142  -48.287  2.023   1.00 90.70  ? 245 LYS A CE    1 
ATOM   1223 N NZ    . LYS D 4 43  ? 68.219  -46.806  1.852   1.00 90.43  ? 245 LYS A NZ    1 
ATOM   1224 N N     . VAL D 4 44  ? 71.123  -52.970  -1.616  1.00 55.90  ? 246 VAL A N     1 
ATOM   1225 C CA    . VAL D 4 44  ? 72.033  -53.457  -2.660  1.00 56.19  ? 246 VAL A CA    1 
ATOM   1226 C C     . VAL D 4 44  ? 72.582  -52.257  -3.466  1.00 57.09  ? 246 VAL A C     1 
ATOM   1227 O O     . VAL D 4 44  ? 71.853  -51.288  -3.726  1.00 57.84  ? 246 VAL A O     1 
ATOM   1228 C CB    . VAL D 4 44  ? 71.301  -54.506  -3.589  1.00 9.31   ? 246 VAL A CB    1 
ATOM   1229 C CG1   . VAL D 4 44  ? 72.143  -54.909  -4.824  1.00 8.92   ? 246 VAL A CG1   1 
ATOM   1230 C CG2   . VAL D 4 44  ? 70.972  -55.754  -2.794  1.00 8.89   ? 246 VAL A CG2   1 
ATOM   1231 N N     . MET D 4 45  ? 73.877  -52.317  -3.798  1.00 64.65  ? 247 MET A N     1 
ATOM   1232 C CA    . MET D 4 45  ? 74.568  -51.284  -4.582  1.00 64.54  ? 247 MET A CA    1 
ATOM   1233 C C     . MET D 4 45  ? 74.912  -51.821  -5.980  1.00 63.30  ? 247 MET A C     1 
ATOM   1234 O O     . MET D 4 45  ? 75.078  -53.029  -6.164  1.00 62.88  ? 247 MET A O     1 
ATOM   1235 N N     . LYS D 4 46  ? 74.983  -50.926  -6.964  1.00 134.05 ? 248 LYS A N     1 
ATOM   1236 C CA    . LYS D 4 46  ? 75.311  -51.298  -8.345  1.00 133.07 ? 248 LYS A CA    1 
ATOM   1237 C C     . LYS D 4 46  ? 76.760  -50.928  -8.649  1.00 132.13 ? 248 LYS A C     1 
ATOM   1238 O O     . LYS D 4 46  ? 77.281  -49.970  -8.072  1.00 132.15 ? 248 LYS A O     1 
ATOM   1239 C CB    . LYS D 4 46  ? 74.375  -50.595  -9.310  1.00 99.18  ? 248 LYS A CB    1 
ATOM   1240 N N     . LEU D 4 47  ? 77.411  -51.687  -9.540  1.00 114.93 ? 249 LEU A N     1 
ATOM   1241 C CA    . LEU D 4 47  ? 78.817  -51.432  -9.899  1.00 113.33 ? 249 LEU A CA    1 
ATOM   1242 C C     . LEU D 4 47  ? 79.128  -51.055  -11.350 1.00 111.98 ? 249 LEU A C     1 
ATOM   1243 O O     . LEU D 4 47  ? 78.569  -51.625  -12.297 1.00 111.42 ? 249 LEU A O     1 
ATOM   1244 C CB    . LEU D 4 47  ? 79.716  -52.609  -9.493  1.00 75.95  ? 249 LEU A CB    1 
ATOM   1245 C CG    . LEU D 4 47  ? 79.873  -52.995  -8.017  1.00 76.49  ? 249 LEU A CG    1 
ATOM   1246 C CD1   . LEU D 4 47  ? 80.818  -54.172  -7.917  1.00 76.68  ? 249 LEU A CD1   1 
ATOM   1247 C CD2   . LEU D 4 47  ? 80.379  -51.828  -7.178  1.00 76.62  ? 249 LEU A CD2   1 
ATOM   1248 N N     . SER D 4 48  ? 80.071  -50.116  -11.490 1.00 66.26  ? 250 SER A N     1 
ATOM   1249 C CA    . SER D 4 48  ? 80.551  -49.602  -12.777 1.00 65.06  ? 250 SER A CA    1 
ATOM   1250 C C     . SER D 4 48  ? 81.570  -50.600  -13.326 1.00 64.20  ? 250 SER A C     1 
ATOM   1251 O O     . SER D 4 48  ? 82.287  -51.198  -12.536 1.00 63.99  ? 250 SER A O     1 
ATOM   1252 C CB    . SER D 4 48  ? 81.242  -48.251  -12.557 1.00 48.94  ? 250 SER A CB    1 
ATOM   1253 O OG    . SER D 4 48  ? 82.483  -48.400  -11.886 1.00 48.38  ? 250 SER A OG    1 
ATOM   1254 N N     . PRO D 4 49  ? 81.674  -50.776  -14.668 1.00 59.54  ? 251 PRO A N     1 
ATOM   1255 C CA    . PRO D 4 49  ? 82.638  -51.720  -15.266 1.00 59.96  ? 251 PRO A CA    1 
ATOM   1256 C C     . PRO D 4 49  ? 84.115  -51.628  -14.804 1.00 60.22  ? 251 PRO A C     1 
ATOM   1257 O O     . PRO D 4 49  ? 84.924  -52.510  -15.113 1.00 60.36  ? 251 PRO A O     1 
ATOM   1258 C CB    . PRO D 4 49  ? 82.481  -51.451  -16.758 1.00 143.80 ? 251 PRO A CB    1 
ATOM   1259 C CG    . PRO D 4 49  ? 81.020  -51.208  -16.870 1.00 143.73 ? 251 PRO A CG    1 
ATOM   1260 C CD    . PRO D 4 49  ? 80.769  -50.259  -15.717 1.00 144.04 ? 251 PRO A CD    1 
ATOM   1261 N N     . LYS D 4 50  ? 84.432  -50.572  -14.047 1.00 64.58  ? 252 LYS A N     1 
ATOM   1262 C CA    . LYS D 4 50  ? 85.765  -50.325  -13.486 1.00 64.04  ? 252 LYS A CA    1 
ATOM   1263 C C     . LYS D 4 50  ? 85.787  -50.900  -12.068 1.00 62.64  ? 252 LYS A C     1 
ATOM   1264 O O     . LYS D 4 50  ? 86.738  -51.579  -11.696 1.00 63.02  ? 252 LYS A O     1 
ATOM   1265 C CB    . LYS D 4 50  ? 86.067  -48.809  -13.478 1.00 158.96 ? 252 LYS A CB    1 
ATOM   1266 C CG    . LYS D 4 50  ? 87.352  -48.335  -12.752 1.00 160.18 ? 252 LYS A CG    1 
ATOM   1267 C CD    . LYS D 4 50  ? 88.666  -48.622  -13.479 1.00 162.21 ? 252 LYS A CD    1 
ATOM   1268 C CE    . LYS D 4 50  ? 89.853  -48.055  -12.692 1.00 161.80 ? 252 LYS A CE    1 
ATOM   1269 N NZ    . LYS D 4 50  ? 91.176  -48.356  -13.313 1.00 162.86 ? 252 LYS A NZ    1 
ATOM   1270 N N     . ALA D 4 51  ? 84.728  -50.636  -11.300 1.00 61.68  ? 253 ALA A N     1 
ATOM   1271 C CA    . ALA D 4 51  ? 84.586  -51.122  -9.917  1.00 59.64  ? 253 ALA A CA    1 
ATOM   1272 C C     . ALA D 4 51  ? 84.176  -52.590  -9.887  1.00 58.42  ? 253 ALA A C     1 
ATOM   1273 O O     . ALA D 4 51  ? 84.379  -53.285  -8.891  1.00 57.99  ? 253 ALA A O     1 
ATOM   1274 C CB    . ALA D 4 51  ? 83.568  -50.287  -9.171  1.00 59.87  ? 253 ALA A CB    1 
ATOM   1275 N N     . GLU D 4 52  ? 83.597  -53.034  -11.000 1.00 85.36  ? 254 GLU A N     1 
ATOM   1276 C CA    . GLU D 4 52  ? 83.145  -54.404  -11.206 1.00 85.33  ? 254 GLU A CA    1 
ATOM   1277 C C     . GLU D 4 52  ? 84.386  -55.254  -11.472 1.00 84.75  ? 254 GLU A C     1 
ATOM   1278 O O     . GLU D 4 52  ? 84.451  -56.417  -11.064 1.00 84.63  ? 254 GLU A O     1 
ATOM   1279 C CB    . GLU D 4 52  ? 82.207  -54.445  -12.414 1.00 145.51 ? 254 GLU A CB    1 
ATOM   1280 C CG    . GLU D 4 52  ? 81.397  -55.708  -12.596 1.00 148.35 ? 254 GLU A CG    1 
ATOM   1281 C CD    . GLU D 4 52  ? 80.621  -55.712  -13.902 1.00 150.29 ? 254 GLU A CD    1 
ATOM   1282 O OE1   . GLU D 4 52  ? 81.090  -56.342  -14.873 1.00 150.70 ? 254 GLU A OE1   1 
ATOM   1283 O OE2   . GLU D 4 52  ? 79.541  -55.085  -13.958 1.00 151.80 ? 254 GLU A OE2   1 
ATOM   1284 N N     . GLU D 4 53  ? 85.380  -54.637  -12.117 1.00 98.84  ? 255 GLU A N     1 
ATOM   1285 C CA    . GLU D 4 53  ? 86.646  -55.290  -12.449 1.00 97.78  ? 255 GLU A CA    1 
ATOM   1286 C C     . GLU D 4 53  ? 87.453  -55.573  -11.195 1.00 95.63  ? 255 GLU A C     1 
ATOM   1287 O O     . GLU D 4 53  ? 87.871  -56.707  -10.975 1.00 95.20  ? 255 GLU A O     1 
ATOM   1288 C CB    . GLU D 4 53  ? 87.461  -54.444  -13.447 1.00 178.46 ? 255 GLU A CB    1 
ATOM   1289 C CG    . GLU D 4 53  ? 88.754  -55.113  -13.963 1.00 181.79 ? 255 GLU A CG    1 
ATOM   1290 C CD    . GLU D 4 53  ? 89.514  -54.281  -14.988 1.00 183.86 ? 255 GLU A CD    1 
ATOM   1291 O OE1   . GLU D 4 53  ? 89.757  -53.080  -14.739 1.00 185.39 ? 255 GLU A OE1   1 
ATOM   1292 O OE2   . GLU D 4 53  ? 89.892  -54.839  -16.041 1.00 185.50 ? 255 GLU A OE2   1 
ATOM   1293 N N     . VAL D 4 54  ? 87.557  -54.565  -10.329 1.00 51.16  ? 256 VAL A N     1 
ATOM   1294 C CA    . VAL D 4 54  ? 88.314  -54.662  -9.078  1.00 49.35  ? 256 VAL A CA    1 
ATOM   1295 C C     . VAL D 4 54  ? 87.620  -55.593  -8.100  1.00 48.76  ? 256 VAL A C     1 
ATOM   1296 O O     . VAL D 4 54  ? 88.267  -56.180  -7.220  1.00 49.66  ? 256 VAL A O     1 
ATOM   1297 C CB    . VAL D 4 54  ? 88.501  -53.274  -8.414  1.00 48.27  ? 256 VAL A CB    1 
ATOM   1298 C CG1   . VAL D 4 54  ? 89.500  -53.351  -7.263  1.00 48.11  ? 256 VAL A CG1   1 
ATOM   1299 C CG2   . VAL D 4 54  ? 88.977  -52.258  -9.433  1.00 49.20  ? 256 VAL A CG2   1 
ATOM   1300 N N     . ALA D 4 55  ? 86.315  -55.772  -8.317  1.00 35.24  ? 257 ALA A N     1 
ATOM   1301 C CA    . ALA D 4 55  ? 85.484  -56.623  -7.480  1.00 33.84  ? 257 ALA A CA    1 
ATOM   1302 C C     . ALA D 4 55  ? 85.935  -58.053  -7.597  1.00 33.09  ? 257 ALA A C     1 
ATOM   1303 O O     . ALA D 4 55  ? 86.271  -58.654  -6.586  1.00 33.70  ? 257 ALA A O     1 
ATOM   1304 C CB    . ALA D 4 55  ? 84.032  -56.500  -7.874  1.00 65.64  ? 257 ALA A CB    1 
ATOM   1305 N N     . THR D 4 56  ? 86.108  -58.513  -8.842  1.00 67.27  ? 258 THR A N     1 
ATOM   1306 C CA    . THR D 4 56  ? 86.523  -59.888  -9.163  1.00 66.59  ? 258 THR A CA    1 
ATOM   1307 C C     . THR D 4 56  ? 87.878  -60.351  -8.592  1.00 66.35  ? 258 THR A C     1 
ATOM   1308 O O     . THR D 4 56  ? 88.148  -61.557  -8.510  1.00 66.28  ? 258 THR A O     1 
ATOM   1309 C CB    . THR D 4 56  ? 86.497  -60.157  -10.705 1.00 100.09 ? 258 THR A CB    1 
ATOM   1310 O OG1   . THR D 4 56  ? 87.568  -59.459  -11.357 1.00 100.61 ? 258 THR A OG1   1 
ATOM   1311 C CG2   . THR D 4 56  ? 85.168  -59.715  -11.310 1.00 100.53 ? 258 THR A CG2   1 
ATOM   1312 N N     . PHE D 4 57  ? 88.694  -59.390  -8.156  1.00 56.02  ? 259 PHE A N     1 
ATOM   1313 C CA    . PHE D 4 57  ? 90.016  -59.664  -7.604  1.00 55.65  ? 259 PHE A CA    1 
ATOM   1314 C C     . PHE D 4 57  ? 89.984  -59.963  -6.121  1.00 56.23  ? 259 PHE A C     1 
ATOM   1315 O O     . PHE D 4 57  ? 90.834  -60.696  -5.592  1.00 56.56  ? 259 PHE A O     1 
ATOM   1316 C CB    . PHE D 4 57  ? 90.964  -58.517  -7.946  1.00 66.15  ? 259 PHE A CB    1 
ATOM   1317 C CG    . PHE D 4 57  ? 91.186  -58.345  -9.426  1.00 63.90  ? 259 PHE A CG    1 
ATOM   1318 C CD1   . PHE D 4 57  ? 91.174  -59.467  -10.297 1.00 63.77  ? 259 PHE A CD1   1 
ATOM   1319 C CD2   . PHE D 4 57  ? 91.367  -57.064  -9.969  1.00 63.08  ? 259 PHE A CD2   1 
ATOM   1320 C CE1   . PHE D 4 57  ? 91.330  -59.316  -11.700 1.00 64.78  ? 259 PHE A CE1   1 
ATOM   1321 C CE2   . PHE D 4 57  ? 91.527  -56.884  -11.372 1.00 63.40  ? 259 PHE A CE2   1 
ATOM   1322 C CZ    . PHE D 4 57  ? 91.507  -58.018  -12.243 1.00 64.61  ? 259 PHE A CZ    1 
ATOM   1323 N N     . PHE D 4 58  ? 88.975  -59.411  -5.462  1.00 28.19  ? 260 PHE A N     1 
ATOM   1324 C CA    . PHE D 4 58  ? 88.756  -59.646  -4.047  1.00 30.50  ? 260 PHE A CA    1 
ATOM   1325 C C     . PHE D 4 58  ? 87.956  -60.955  -3.937  1.00 33.47  ? 260 PHE A C     1 
ATOM   1326 O O     . PHE D 4 58  ? 87.954  -61.619  -2.896  1.00 35.18  ? 260 PHE A O     1 
ATOM   1327 C CB    . PHE D 4 58  ? 87.963  -58.498  -3.438  1.00 39.90  ? 260 PHE A CB    1 
ATOM   1328 C CG    . PHE D 4 58  ? 88.204  -58.316  -1.974  1.00 38.80  ? 260 PHE A CG    1 
ATOM   1329 C CD1   . PHE D 4 58  ? 89.290  -57.544  -1.523  1.00 39.00  ? 260 PHE A CD1   1 
ATOM   1330 C CD2   . PHE D 4 58  ? 87.352  -58.900  -1.028  1.00 39.23  ? 260 PHE A CD2   1 
ATOM   1331 C CE1   . PHE D 4 58  ? 89.533  -57.344  -0.135  1.00 39.28  ? 260 PHE A CE1   1 
ATOM   1332 C CE2   . PHE D 4 58  ? 87.576  -58.713  0.366   1.00 40.40  ? 260 PHE A CE2   1 
ATOM   1333 C CZ    . PHE D 4 58  ? 88.677  -57.927  0.811   1.00 39.49  ? 260 PHE A CZ    1 
ATOM   1334 N N     . ALA D 4 59  ? 87.286  -61.318  -5.031  1.00 88.83  ? 261 ALA A N     1 
ATOM   1335 C CA    . ALA D 4 59  ? 86.496  -62.543  -5.102  1.00 90.79  ? 261 ALA A CA    1 
ATOM   1336 C C     . ALA D 4 59  ? 87.450  -63.710  -5.201  1.00 92.68  ? 261 ALA A C     1 
ATOM   1337 O O     . ALA D 4 59  ? 87.284  -64.706  -4.506  1.00 93.27  ? 261 ALA A O     1 
ATOM   1338 C CB    . ALA D 4 59  ? 85.578  -62.522  -6.308  1.00 68.93  ? 261 ALA A CB    1 
ATOM   1339 N N     . LYS D 4 60  ? 88.504  -63.523  -5.996  1.00 40.03  ? 262 LYS A N     1 
ATOM   1340 C CA    . LYS D 4 60  ? 89.534  -64.536  -6.211  1.00 42.28  ? 262 LYS A CA    1 
ATOM   1341 C C     . LYS D 4 60  ? 90.393  -64.844  -4.974  1.00 43.15  ? 262 LYS A C     1 
ATOM   1342 O O     . LYS D 4 60  ? 91.254  -65.734  -5.025  1.00 43.50  ? 262 LYS A O     1 
ATOM   1343 C CB    . LYS D 4 60  ? 90.433  -64.136  -7.389  1.00 140.45 ? 262 LYS A CB    1 
ATOM   1344 C CG    . LYS D 4 60  ? 89.805  -64.346  -8.761  1.00 142.87 ? 262 LYS A CG    1 
ATOM   1345 C CD    . LYS D 4 60  ? 90.734  -63.872  -9.868  1.00 144.78 ? 262 LYS A CD    1 
ATOM   1346 C CE    . LYS D 4 60  ? 90.117  -64.085  -11.239 1.00 144.91 ? 262 LYS A CE    1 
ATOM   1347 N NZ    . LYS D 4 60  ? 91.027  -63.641  -12.332 1.00 143.81 ? 262 LYS A NZ    1 
ATOM   1348 N N     . MET D 4 61  ? 90.119  -64.143  -3.866  1.00 39.99  ? 263 MET A N     1 
ATOM   1349 C CA    . MET D 4 61  ? 90.847  -64.323  -2.607  1.00 42.30  ? 263 MET A CA    1 
ATOM   1350 C C     . MET D 4 61  ? 89.991  -63.990  -1.380  1.00 43.08  ? 263 MET A C     1 
ATOM   1351 O O     . MET D 4 61  ? 90.296  -63.047  -0.646  1.00 43.09  ? 263 MET A O     1 
ATOM   1352 C CB    . MET D 4 61  ? 92.131  -63.470  -2.610  1.00 91.62  ? 263 MET A CB    1 
ATOM   1353 N N     . LEU D 4 62  ? 88.924  -64.761  -1.155  1.00 70.98  ? 264 LEU A N     1 
ATOM   1354 C CA    . LEU D 4 62  ? 88.048  -64.520  -0.004  1.00 72.36  ? 264 LEU A CA    1 
ATOM   1355 C C     . LEU D 4 62  ? 88.436  -65.261  1.260   1.00 73.62  ? 264 LEU A C     1 
ATOM   1356 O O     . LEU D 4 62  ? 88.509  -64.655  2.331   1.00 73.81  ? 264 LEU A O     1 
ATOM   1357 C CB    . LEU D 4 62  ? 86.589  -64.821  -0.319  1.00 58.54  ? 264 LEU A CB    1 
ATOM   1358 C CG    . LEU D 4 62  ? 85.626  -63.634  -0.202  1.00 58.60  ? 264 LEU A CG    1 
ATOM   1359 C CD1   . LEU D 4 62  ? 84.246  -64.167  -0.379  1.00 59.55  ? 264 LEU A CD1   1 
ATOM   1360 C CD2   . LEU D 4 62  ? 85.698  -62.892  1.138   1.00 58.88  ? 264 LEU A CD2   1 
ATOM   1361 N N     . ASP D 4 63  ? 88.622  -66.573  1.143   1.00 83.89  ? 265 ASP A N     1 
ATOM   1362 C CA    . ASP D 4 63  ? 89.007  -67.407  2.278   1.00 85.13  ? 265 ASP A CA    1 
ATOM   1363 C C     . ASP D 4 63  ? 90.524  -67.540  2.413   1.00 84.40  ? 265 ASP A C     1 
ATOM   1364 O O     . ASP D 4 63  ? 91.059  -68.629  2.643   1.00 84.12  ? 265 ASP A O     1 
ATOM   1365 C CB    . ASP D 4 63  ? 88.307  -68.775  2.211   1.00 151.80 ? 265 ASP A CB    1 
ATOM   1366 C CG    . ASP D 4 63  ? 88.318  -69.377  0.820   1.00 153.76 ? 265 ASP A CG    1 
ATOM   1367 O OD1   . ASP D 4 63  ? 89.246  -70.161  0.518   1.00 155.44 ? 265 ASP A OD1   1 
ATOM   1368 O OD2   . ASP D 4 63  ? 87.398  -69.043  0.040   1.00 153.95 ? 265 ASP A OD2   1 
ATOM   1369 N N     . HIS D 4 64  ? 91.203  -66.403  2.298   1.00 49.37  ? 266 HIS A N     1 
ATOM   1370 C CA    . HIS D 4 64  ? 92.653  -66.332  2.394   1.00 48.41  ? 266 HIS A CA    1 
ATOM   1371 C C     . HIS D 4 64  ? 93.029  -65.535  3.632   1.00 47.94  ? 266 HIS A C     1 
ATOM   1372 O O     . HIS D 4 64  ? 92.353  -64.557  3.967   1.00 46.98  ? 266 HIS A O     1 
ATOM   1373 C CB    . HIS D 4 64  ? 93.174  -65.599  1.178   1.00 97.59  ? 266 HIS A CB    1 
ATOM   1374 C CG    . HIS D 4 64  ? 94.417  -66.181  0.598   1.00 98.12  ? 266 HIS A CG    1 
ATOM   1375 N ND1   . HIS D 4 64  ? 94.544  -66.426  -0.750  1.00 98.48  ? 266 HIS A ND1   1 
ATOM   1376 C CD2   . HIS D 4 64  ? 95.615  -66.477  1.154   1.00 98.50  ? 266 HIS A CD2   1 
ATOM   1377 C CE1   . HIS D 4 64  ? 95.773  -66.837  -1.004  1.00 99.30  ? 266 HIS A CE1   1 
ATOM   1378 N NE2   . HIS D 4 64  ? 96.443  -66.876  0.133   1.00 98.88  ? 266 HIS A NE2   1 
ATOM   1379 N N     . GLU D 4 65  ? 94.155  -65.901  4.253   1.00 62.95  ? 267 GLU A N     1 
ATOM   1380 C CA    . GLU D 4 65  ? 94.673  -65.229  5.453   1.00 62.89  ? 267 GLU A CA    1 
ATOM   1381 C C     . GLU D 4 65  ? 94.927  -63.734  5.203   1.00 61.77  ? 267 GLU A C     1 
ATOM   1382 O O     . GLU D 4 65  ? 95.227  -62.982  6.137   1.00 62.66  ? 267 GLU A O     1 
ATOM   1383 N N     . TYR D 4 66  ? 94.765  -63.322  3.943   1.00 41.62  ? 268 TYR A N     1 
ATOM   1384 C CA    . TYR D 4 66  ? 94.943  -61.946  3.523   1.00 39.05  ? 268 TYR A CA    1 
ATOM   1385 C C     . TYR D 4 66  ? 93.750  -61.074  3.815   1.00 37.76  ? 268 TYR A C     1 
ATOM   1386 O O     . TYR D 4 66  ? 93.910  -59.897  4.141   1.00 36.86  ? 268 TYR A O     1 
ATOM   1387 C CB    . TYR D 4 66  ? 95.286  -61.888  2.044   1.00 62.64  ? 268 TYR A CB    1 
ATOM   1388 C CG    . TYR D 4 66  ? 96.742  -62.113  1.734   1.00 62.33  ? 268 TYR A CG    1 
ATOM   1389 C CD1   . TYR D 4 66  ? 97.125  -63.072  0.784   1.00 62.49  ? 268 TYR A CD1   1 
ATOM   1390 C CD2   . TYR D 4 66  ? 97.750  -61.337  2.350   1.00 61.92  ? 268 TYR A CD2   1 
ATOM   1391 C CE1   . TYR D 4 66  ? 98.480  -63.259  0.441   1.00 62.62  ? 268 TYR A CE1   1 
ATOM   1392 C CE2   . TYR D 4 66  ? 99.118  -61.515  2.017   1.00 62.24  ? 268 TYR A CE2   1 
ATOM   1393 C CZ    . TYR D 4 66  ? 99.470  -62.479  1.058   1.00 62.66  ? 268 TYR A CZ    1 
ATOM   1394 O OH    . TYR D 4 66  ? 100.786 -62.670  0.698   1.00 63.71  ? 268 TYR A OH    1 
ATOM   1395 N N     . THR D 4 67  ? 92.562  -61.659  3.722   1.00 67.95  ? 269 THR A N     1 
ATOM   1396 C CA    . THR D 4 67  ? 91.333  -60.925  3.991   1.00 68.42  ? 269 THR A CA    1 
ATOM   1397 C C     . THR D 4 67  ? 91.201  -60.554  5.468   1.00 68.82  ? 269 THR A C     1 
ATOM   1398 O O     . THR D 4 67  ? 90.762  -59.446  5.789   1.00 69.37  ? 269 THR A O     1 
ATOM   1399 C CB    . THR D 4 67  ? 90.076  -61.709  3.529   1.00 73.35  ? 269 THR A CB    1 
ATOM   1400 O OG1   . THR D 4 67  ? 90.178  -63.086  3.921   1.00 74.20  ? 269 THR A OG1   1 
ATOM   1401 C CG2   . THR D 4 67  ? 89.944  -61.629  2.032   1.00 73.18  ? 269 THR A CG2   1 
ATOM   1402 N N     . THR D 4 68  ? 91.693  -61.442  6.339   1.00 89.64  ? 270 THR A N     1 
ATOM   1403 C CA    . THR D 4 68  ? 91.656  -61.257  7.787   1.00 89.91  ? 270 THR A CA    1 
ATOM   1404 C C     . THR D 4 68  ? 92.843  -60.435  8.260   1.00 89.82  ? 270 THR A C     1 
ATOM   1405 O O     . THR D 4 68  ? 93.151  -60.424  9.452   1.00 89.89  ? 270 THR A O     1 
ATOM   1406 N N     . LYS D 4 69  ? 93.481  -59.749  7.307   1.00 72.02  ? 271 LYS A N     1 
ATOM   1407 C CA    . LYS D 4 69  ? 94.636  -58.884  7.537   1.00 71.68  ? 271 LYS A CA    1 
ATOM   1408 C C     . LYS D 4 69  ? 94.204  -57.416  7.491   1.00 71.46  ? 271 LYS A C     1 
ATOM   1409 O O     . LYS D 4 69  ? 93.756  -56.929  6.454   1.00 71.26  ? 271 LYS A O     1 
ATOM   1410 N N     . GLU D 4 70  ? 94.367  -56.726  8.624   1.00 59.05  ? 272 GLU A N     1 
ATOM   1411 C CA    . GLU D 4 70  ? 94.001  -55.314  8.814   1.00 59.14  ? 272 GLU A CA    1 
ATOM   1412 C C     . GLU D 4 70  ? 94.568  -54.310  7.817   1.00 58.46  ? 272 GLU A C     1 
ATOM   1413 O O     . GLU D 4 70  ? 93.819  -53.506  7.252   1.00 59.30  ? 272 GLU A O     1 
ATOM   1414 N N     . ILE D 4 71  ? 95.876  -54.402  7.567   1.00 132.61 ? 273 ILE A N     1 
ATOM   1415 C CA    . ILE D 4 71  ? 96.587  -53.505  6.642   1.00 130.23 ? 273 ILE A CA    1 
ATOM   1416 C C     . ILE D 4 71  ? 96.057  -53.672  5.215   1.00 127.45 ? 273 ILE A C     1 
ATOM   1417 O O     . ILE D 4 71  ? 95.862  -52.683  4.503   1.00 126.46 ? 273 ILE A O     1 
ATOM   1418 C CB    . ILE D 4 71  ? 98.149  -53.740  6.682   1.00 123.64 ? 273 ILE A CB    1 
ATOM   1419 C CG1   . ILE D 4 71  ? 98.686  -53.689  8.127   1.00 125.12 ? 273 ILE A CG1   1 
ATOM   1420 C CG2   . ILE D 4 71  ? 98.893  -52.708  5.812   1.00 123.06 ? 273 ILE A CG2   1 
ATOM   1421 C CD1   . ILE D 4 71  ? 98.538  -52.347  8.861   1.00 125.52 ? 273 ILE A CD1   1 
ATOM   1422 N N     . PHE D 4 72  ? 95.732  -54.916  4.859   1.00 44.44  ? 274 PHE A N     1 
ATOM   1423 C CA    . PHE D 4 72  ? 95.211  -55.264  3.533   1.00 41.64  ? 274 PHE A CA    1 
ATOM   1424 C C     . PHE D 4 72  ? 93.859  -54.607  3.269   1.00 40.60  ? 274 PHE A C     1 
ATOM   1425 O O     . PHE D 4 72  ? 93.572  -54.193  2.143   1.00 39.89  ? 274 PHE A O     1 
ATOM   1426 C CB    . PHE D 4 72  ? 95.074  -56.785  3.419   1.00 54.64  ? 274 PHE A CB    1 
ATOM   1427 C CG    . PHE D 4 72  ? 94.873  -57.286  2.015   1.00 52.70  ? 274 PHE A CG    1 
ATOM   1428 C CD1   . PHE D 4 72  ? 93.586  -57.390  1.460   1.00 52.27  ? 274 PHE A CD1   1 
ATOM   1429 C CD2   . PHE D 4 72  ? 95.975  -57.692  1.245   1.00 52.19  ? 274 PHE A CD2   1 
ATOM   1430 C CE1   . PHE D 4 72  ? 93.396  -57.895  0.150   1.00 51.15  ? 274 PHE A CE1   1 
ATOM   1431 C CE2   . PHE D 4 72  ? 95.806  -58.205  -0.074  1.00 50.91  ? 274 PHE A CE2   1 
ATOM   1432 C CZ    . PHE D 4 72  ? 94.513  -58.305  -0.619  1.00 50.80  ? 274 PHE A CZ    1 
ATOM   1433 N N     . ARG D 4 73  ? 93.027  -54.562  4.306   1.00 72.61  ? 275 ARG A N     1 
ATOM   1434 C CA    . ARG D 4 73  ? 91.700  -53.974  4.217   1.00 71.73  ? 275 ARG A CA    1 
ATOM   1435 C C     . ARG D 4 73  ? 91.786  -52.457  4.111   1.00 70.98  ? 275 ARG A C     1 
ATOM   1436 O O     . ARG D 4 73  ? 91.094  -51.853  3.281   1.00 71.27  ? 275 ARG A O     1 
ATOM   1437 C CB    . ARG D 4 73  ? 90.859  -54.389  5.426   1.00 142.02 ? 275 ARG A CB    1 
ATOM   1438 C CG    . ARG D 4 73  ? 90.613  -55.887  5.510   1.00 141.20 ? 275 ARG A CG    1 
ATOM   1439 C CD    . ARG D 4 73  ? 90.093  -56.313  6.880   1.00 142.35 ? 275 ARG A CD    1 
ATOM   1440 N NE    . ARG D 4 73  ? 88.694  -55.953  7.133   1.00 142.66 ? 275 ARG A NE    1 
ATOM   1441 C CZ    . ARG D 4 73  ? 87.635  -56.661  6.736   1.00 142.90 ? 275 ARG A CZ    1 
ATOM   1442 N NH1   . ARG D 4 73  ? 87.787  -57.784  6.041   1.00 142.67 ? 275 ARG A NH1   1 
ATOM   1443 N NH2   . ARG D 4 73  ? 86.413  -56.272  7.083   1.00 143.52 ? 275 ARG A NH2   1 
ATOM   1444 N N     . LYS D 4 74  ? 92.718  -51.877  4.874   1.00 54.84  ? 276 LYS A N     1 
ATOM   1445 C CA    . LYS D 4 74  ? 92.958  -50.425  4.922   1.00 54.56  ? 276 LYS A CA    1 
ATOM   1446 C C     . LYS D 4 74  ? 93.309  -49.856  3.556   1.00 54.16  ? 276 LYS A C     1 
ATOM   1447 O O     . LYS D 4 74  ? 92.875  -48.755  3.198   1.00 54.17  ? 276 LYS A O     1 
ATOM   1448 C CB    . LYS D 4 74  ? 94.079  -50.096  5.924   1.00 13.37  ? 276 LYS A CB    1 
ATOM   1449 N N     . ASN D 4 75  ? 94.056  -50.653  2.791   1.00 78.24  ? 277 ASN A N     1 
ATOM   1450 C CA    . ASN D 4 75  ? 94.505  -50.290  1.452   1.00 78.35  ? 277 ASN A CA    1 
ATOM   1451 C C     . ASN D 4 75  ? 93.469  -50.572  0.379   1.00 78.19  ? 277 ASN A C     1 
ATOM   1452 O O     . ASN D 4 75  ? 93.518  -49.963  -0.692  1.00 77.51  ? 277 ASN A O     1 
ATOM   1453 C CB    . ASN D 4 75  ? 95.823  -50.994  1.111   1.00 106.78 ? 277 ASN A CB    1 
ATOM   1454 C CG    . ASN D 4 75  ? 97.009  -50.461  1.914   1.00 107.28 ? 277 ASN A CG    1 
ATOM   1455 O OD1   . ASN D 4 75  ? 96.977  -49.349  2.457   1.00 109.18 ? 277 ASN A OD1   1 
ATOM   1456 N ND2   . ASN D 4 75  ? 98.072  -51.253  1.976   1.00 106.27 ? 277 ASN A ND2   1 
ATOM   1457 N N     . PHE D 4 76  ? 92.531  -51.480  0.667   1.00 26.22  ? 278 PHE A N     1 
ATOM   1458 C CA    . PHE D 4 76  ? 91.478  -51.811  -0.292  1.00 26.04  ? 278 PHE A CA    1 
ATOM   1459 C C     . PHE D 4 76  ? 90.390  -50.758  -0.259  1.00 26.32  ? 278 PHE A C     1 
ATOM   1460 O O     . PHE D 4 76  ? 89.686  -50.567  -1.242  1.00 25.64  ? 278 PHE A O     1 
ATOM   1461 C CB    . PHE D 4 76  ? 90.871  -53.192  -0.040  1.00 62.59  ? 278 PHE A CB    1 
ATOM   1462 C CG    . PHE D 4 76  ? 89.859  -53.613  -1.090  1.00 62.01  ? 278 PHE A CG    1 
ATOM   1463 C CD1   . PHE D 4 76  ? 90.257  -53.839  -2.427  1.00 61.59  ? 278 PHE A CD1   1 
ATOM   1464 C CD2   . PHE D 4 76  ? 88.499  -53.758  -0.754  1.00 61.31  ? 278 PHE A CD2   1 
ATOM   1465 C CE1   . PHE D 4 76  ? 89.307  -54.207  -3.424  1.00 61.27  ? 278 PHE A CE1   1 
ATOM   1466 C CE2   . PHE D 4 76  ? 87.538  -54.124  -1.732  1.00 61.60  ? 278 PHE A CE2   1 
ATOM   1467 C CZ    . PHE D 4 76  ? 87.943  -54.350  -3.075  1.00 60.85  ? 278 PHE A CZ    1 
ATOM   1468 N N     . PHE D 4 77  ? 90.247  -50.097  0.883   1.00 73.67  ? 279 PHE A N     1 
ATOM   1469 C CA    . PHE D 4 77  ? 89.260  -49.045  1.021   1.00 74.73  ? 279 PHE A CA    1 
ATOM   1470 C C     . PHE D 4 77  ? 89.775  -47.791  0.303   1.00 75.61  ? 279 PHE A C     1 
ATOM   1471 O O     . PHE D 4 77  ? 89.016  -47.142  -0.431  1.00 76.48  ? 279 PHE A O     1 
ATOM   1472 C CB    . PHE D 4 77  ? 88.984  -48.765  2.498   1.00 166.71 ? 279 PHE A CB    1 
ATOM   1473 C CG    . PHE D 4 77  ? 87.588  -48.287  2.770   1.00 167.72 ? 279 PHE A CG    1 
ATOM   1474 C CD1   . PHE D 4 77  ? 86.477  -49.033  2.319   1.00 168.52 ? 279 PHE A CD1   1 
ATOM   1475 C CD2   . PHE D 4 77  ? 87.368  -47.080  3.459   1.00 167.84 ? 279 PHE A CD2   1 
ATOM   1476 C CE1   . PHE D 4 77  ? 85.159  -48.583  2.548   1.00 168.43 ? 279 PHE A CE1   1 
ATOM   1477 C CE2   . PHE D 4 77  ? 86.050  -46.609  3.700   1.00 168.89 ? 279 PHE A CE2   1 
ATOM   1478 C CZ    . PHE D 4 77  ? 84.944  -47.365  3.240   1.00 169.66 ? 279 PHE A CZ    1 
ATOM   1479 N N     . LYS D 4 78  ? 91.083  -47.529  0.457   1.00 34.11  ? 280 LYS A N     1 
ATOM   1480 C CA    . LYS D 4 78  ? 91.786  -46.395  -0.157  1.00 34.26  ? 280 LYS A CA    1 
ATOM   1481 C C     . LYS D 4 78  ? 91.786  -46.547  -1.680  1.00 34.26  ? 280 LYS A C     1 
ATOM   1482 O O     . LYS D 4 78  ? 91.121  -45.786  -2.384  1.00 33.50  ? 280 LYS A O     1 
ATOM   1483 N N     . ASP D 4 79  ? 92.405  -47.619  -2.167  1.00 42.67  ? 281 ASP A N     1 
ATOM   1484 C CA    . ASP D 4 79  ? 92.484  -47.881  -3.607  1.00 44.35  ? 281 ASP A CA    1 
ATOM   1485 C C     . ASP D 4 79  ? 91.149  -48.105  -4.326  1.00 44.10  ? 281 ASP A C     1 
ATOM   1486 O O     . ASP D 4 79  ? 91.091  -48.122  -5.569  1.00 44.68  ? 281 ASP A O     1 
ATOM   1487 C CB    . ASP D 4 79  ? 93.462  -49.026  -3.899  1.00 89.62  ? 281 ASP A CB    1 
ATOM   1488 C CG    . ASP D 4 79  ? 94.915  -48.600  -3.761  1.00 92.33  ? 281 ASP A CG    1 
ATOM   1489 O OD1   . ASP D 4 79  ? 95.372  -48.414  -2.613  1.00 93.11  ? 281 ASP A OD1   1 
ATOM   1490 O OD2   . ASP D 4 79  ? 95.600  -48.457  -4.800  1.00 93.28  ? 281 ASP A OD2   1 
ATOM   1491 N N     . TRP D 4 80  ? 90.078  -48.222  -3.544  1.00 46.21  ? 282 TRP A N     1 
ATOM   1492 C CA    . TRP D 4 80  ? 88.767  -48.416  -4.124  1.00 46.67  ? 282 TRP A CA    1 
ATOM   1493 C C     . TRP D 4 80  ? 87.941  -47.160  -4.247  1.00 49.65  ? 282 TRP A C     1 
ATOM   1494 O O     . TRP D 4 80  ? 87.010  -47.131  -5.041  1.00 49.96  ? 282 TRP A O     1 
ATOM   1495 C CB    . TRP D 4 80  ? 87.979  -49.477  -3.399  1.00 40.83  ? 282 TRP A CB    1 
ATOM   1496 C CG    . TRP D 4 80  ? 87.228  -50.341  -4.331  1.00 35.90  ? 282 TRP A CG    1 
ATOM   1497 C CD1   . TRP D 4 80  ? 87.524  -50.593  -5.648  1.00 34.50  ? 282 TRP A CD1   1 
ATOM   1498 C CD2   . TRP D 4 80  ? 86.061  -51.097  -4.031  1.00 33.37  ? 282 TRP A CD2   1 
ATOM   1499 N NE1   . TRP D 4 80  ? 86.610  -51.468  -6.185  1.00 33.11  ? 282 TRP A NE1   1 
ATOM   1500 C CE2   . TRP D 4 80  ? 85.698  -51.797  -5.220  1.00 32.61  ? 282 TRP A CE2   1 
ATOM   1501 C CE3   . TRP D 4 80  ? 85.275  -51.258  -2.871  1.00 31.26  ? 282 TRP A CE3   1 
ATOM   1502 C CZ2   . TRP D 4 80  ? 84.586  -52.649  -5.286  1.00 32.15  ? 282 TRP A CZ2   1 
ATOM   1503 C CZ3   . TRP D 4 80  ? 84.156  -52.109  -2.926  1.00 30.91  ? 282 TRP A CZ3   1 
ATOM   1504 C CH2   . TRP D 4 80  ? 83.824  -52.796  -4.136  1.00 31.90  ? 282 TRP A CH2   1 
ATOM   1505 N N     . ARG D 4 81  ? 88.298  -46.118  -3.493  1.00 71.11  ? 283 ARG A N     1 
ATOM   1506 C CA    . ARG D 4 81  ? 87.604  -44.827  -3.553  1.00 74.77  ? 283 ARG A CA    1 
ATOM   1507 C C     . ARG D 4 81  ? 87.997  -44.085  -4.847  1.00 76.03  ? 283 ARG A C     1 
ATOM   1508 O O     . ARG D 4 81  ? 87.437  -43.032  -5.166  1.00 76.36  ? 283 ARG A O     1 
ATOM   1509 N N     . LYS D 4 82  ? 88.951  -44.676  -5.575  1.00 113.19 ? 284 LYS A N     1 
ATOM   1510 C CA    . LYS D 4 82  ? 89.493  -44.160  -6.834  1.00 114.97 ? 284 LYS A CA    1 
ATOM   1511 C C     . LYS D 4 82  ? 88.876  -44.884  -8.034  1.00 117.02 ? 284 LYS A C     1 
ATOM   1512 O O     . LYS D 4 82  ? 88.527  -44.250  -9.038  1.00 117.30 ? 284 LYS A O     1 
ATOM   1513 C CB    . LYS D 4 82  ? 91.008  -44.380  -6.910  1.00 98.52  ? 284 LYS A CB    1 
ATOM   1514 C CG    . LYS D 4 82  ? 91.820  -43.916  -5.715  1.00 98.01  ? 284 LYS A CG    1 
ATOM   1515 C CD    . LYS D 4 82  ? 93.256  -44.421  -5.851  1.00 97.10  ? 284 LYS A CD    1 
ATOM   1516 C CE    . LYS D 4 82  ? 94.109  -44.136  -4.617  1.00 95.99  ? 284 LYS A CE    1 
ATOM   1517 N NZ    . LYS D 4 82  ? 95.444  -44.808  -4.713  1.00 94.78  ? 284 LYS A NZ    1 
ATOM   1518 N N     . GLU D 4 83  ? 88.725  -46.204  -7.903  1.00 48.44  ? 285 GLU A N     1 
ATOM   1519 C CA    . GLU D 4 83  ? 88.192  -47.058  -8.955  1.00 51.14  ? 285 GLU A CA    1 
ATOM   1520 C C     . GLU D 4 83  ? 86.676  -47.097  -9.154  1.00 51.21  ? 285 GLU A C     1 
ATOM   1521 O O     . GLU D 4 83  ? 86.154  -48.060  -9.720  1.00 50.20  ? 285 GLU A O     1 
ATOM   1522 N N     . MET D 4 84  ? 85.986  -46.047  -8.711  1.00 114.19 ? 286 MET A N     1 
ATOM   1523 C CA    . MET D 4 84  ? 84.526  -45.936  -8.831  1.00 115.24 ? 286 MET A CA    1 
ATOM   1524 C C     . MET D 4 84  ? 84.089  -44.487  -9.084  1.00 116.24 ? 286 MET A C     1 
ATOM   1525 O O     . MET D 4 84  ? 84.913  -43.656  -9.479  1.00 116.90 ? 286 MET A O     1 
ATOM   1526 C CB    . MET D 4 84  ? 83.821  -46.513  -7.587  1.00 198.72 ? 286 MET A CB    1 
ATOM   1527 C CG    . MET D 4 84  ? 84.186  -45.846  -6.258  1.00 198.72 ? 286 MET A CG    1 
ATOM   1528 S SD    . MET D 4 84  ? 83.111  -46.364  -4.905  1.00 198.72 ? 286 MET A SD    1 
ATOM   1529 C CE    . MET D 4 84  ? 83.842  -47.918  -4.438  1.00 198.72 ? 286 MET A CE    1 
ATOM   1530 N N     . THR D 4 85  ? 82.800  -44.197  -8.872  1.00 130.07 ? 287 THR A N     1 
ATOM   1531 C CA    . THR D 4 85  ? 82.240  -42.850  -9.067  1.00 131.42 ? 287 THR A CA    1 
ATOM   1532 C C     . THR D 4 85  ? 82.159  -42.050  -7.756  1.00 132.17 ? 287 THR A C     1 
ATOM   1533 O O     . THR D 4 85  ? 82.640  -42.506  -6.714  1.00 131.76 ? 287 THR A O     1 
ATOM   1534 C CB    . THR D 4 85  ? 80.832  -42.887  -9.753  1.00 89.66  ? 287 THR A CB    1 
ATOM   1535 O OG1   . THR D 4 85  ? 79.828  -43.260  -8.801  1.00 90.05  ? 287 THR A OG1   1 
ATOM   1536 C CG2   . THR D 4 85  ? 80.814  -43.877  -10.920 1.00 89.90  ? 287 THR A CG2   1 
ATOM   1537 N N     . ASN D 4 86  ? 81.527  -40.875  -7.817  1.00 52.60  ? 288 ASN A N     1 
ATOM   1538 C CA    . ASN D 4 86  ? 81.384  -39.987  -6.654  1.00 54.21  ? 288 ASN A CA    1 
ATOM   1539 C C     . ASN D 4 86  ? 80.113  -40.241  -5.850  1.00 54.75  ? 288 ASN A C     1 
ATOM   1540 O O     . ASN D 4 86  ? 80.063  -39.974  -4.643  1.00 54.33  ? 288 ASN A O     1 
ATOM   1541 N N     . GLU D 4 87  ? 79.092  -40.747  -6.541  1.00 166.17 ? 289 GLU A N     1 
ATOM   1542 C CA    . GLU D 4 87  ? 77.796  -41.068  -5.944  1.00 166.10 ? 289 GLU A CA    1 
ATOM   1543 C C     . GLU D 4 87  ? 77.876  -42.394  -5.196  1.00 165.98 ? 289 GLU A C     1 
ATOM   1544 O O     . GLU D 4 87  ? 77.280  -42.547  -4.125  1.00 166.54 ? 289 GLU A O     1 
ATOM   1545 C CB    . GLU D 4 87  ? 76.727  -41.137  -7.022  1.00 152.32 ? 289 GLU A CB    1 
ATOM   1546 N N     . GLU D 4 88  ? 78.648  -43.327  -5.763  1.00 73.47  ? 290 GLU A N     1 
ATOM   1547 C CA    . GLU D 4 88  ? 78.869  -44.665  -5.200  1.00 72.01  ? 290 GLU A CA    1 
ATOM   1548 C C     . GLU D 4 88  ? 79.664  -44.610  -3.896  1.00 71.54  ? 290 GLU A C     1 
ATOM   1549 O O     . GLU D 4 88  ? 79.343  -45.323  -2.942  1.00 70.52  ? 290 GLU A O     1 
ATOM   1550 C CB    . GLU D 4 88  ? 79.590  -45.563  -6.216  1.00 111.62 ? 290 GLU A CB    1 
ATOM   1551 C CG    . GLU D 4 88  ? 78.693  -46.077  -7.345  1.00 111.77 ? 290 GLU A CG    1 
ATOM   1552 C CD    . GLU D 4 88  ? 79.461  -46.685  -8.516  1.00 111.77 ? 290 GLU A CD    1 
ATOM   1553 O OE1   . GLU D 4 88  ? 80.489  -47.361  -8.298  1.00 112.00 ? 290 GLU A OE1   1 
ATOM   1554 O OE2   . GLU D 4 88  ? 79.024  -46.491  -9.671  1.00 111.51 ? 290 GLU A OE2   1 
ATOM   1555 N N     . LYS D 4 89  ? 80.646  -43.706  -3.852  1.00 66.33  ? 291 LYS A N     1 
ATOM   1556 C CA    . LYS D 4 89  ? 81.506  -43.517  -2.684  1.00 66.65  ? 291 LYS A CA    1 
ATOM   1557 C C     . LYS D 4 89  ? 80.930  -42.537  -1.666  1.00 66.61  ? 291 LYS A C     1 
ATOM   1558 O O     . LYS D 4 89  ? 81.577  -42.241  -0.659  1.00 65.51  ? 291 LYS A O     1 
ATOM   1559 N N     . ASN D 4 90  ? 79.714  -42.053  -1.932  1.00 164.82 ? 292 ASN A N     1 
ATOM   1560 C CA    . ASN D 4 90  ? 79.019  -41.099  -1.065  1.00 165.57 ? 292 ASN A CA    1 
ATOM   1561 C C     . ASN D 4 90  ? 78.411  -41.733  0.189   1.00 165.22 ? 292 ASN A C     1 
ATOM   1562 O O     . ASN D 4 90  ? 78.489  -41.156  1.278   1.00 165.10 ? 292 ASN A O     1 
ATOM   1563 N N     . ILE D 4 91  ? 77.825  -42.921  0.025   1.00 198.72 ? 293 ILE A N     1 
ATOM   1564 C CA    . ILE D 4 91  ? 77.186  -43.657  1.125   1.00 198.72 ? 293 ILE A CA    1 
ATOM   1565 C C     . ILE D 4 91  ? 78.172  -44.569  1.878   1.00 198.72 ? 293 ILE A C     1 
ATOM   1566 O O     . ILE D 4 91  ? 78.120  -44.654  3.111   1.00 198.72 ? 293 ILE A O     1 
ATOM   1567 C CB    . ILE D 4 91  ? 75.962  -44.515  0.617   1.00 198.72 ? 293 ILE A CB    1 
ATOM   1568 C CG1   . ILE D 4 91  ? 75.017  -43.655  -0.237  1.00 198.72 ? 293 ILE A CG1   1 
ATOM   1569 C CG2   . ILE D 4 91  ? 75.161  -45.087  1.811   1.00 198.72 ? 293 ILE A CG2   1 
ATOM   1570 C CD1   . ILE D 4 91  ? 73.904  -44.433  -0.950  1.00 198.72 ? 293 ILE A CD1   1 
ATOM   1571 N N     . ILE D 4 92  ? 79.086  -45.201  1.135   1.00 85.96  ? 294 ILE A N     1 
ATOM   1572 C CA    . ILE D 4 92  ? 80.079  -46.140  1.680   1.00 83.72  ? 294 ILE A CA    1 
ATOM   1573 C C     . ILE D 4 92  ? 81.077  -45.559  2.702   1.00 84.11  ? 294 ILE A C     1 
ATOM   1574 O O     . ILE D 4 92  ? 81.941  -44.756  2.348   1.00 84.10  ? 294 ILE A O     1 
ATOM   1575 C CB    . ILE D 4 92  ? 80.836  -46.895  0.528   1.00 11.28  ? 294 ILE A CB    1 
ATOM   1576 C CG1   . ILE D 4 92  ? 79.831  -47.536  -0.457  1.00 10.22  ? 294 ILE A CG1   1 
ATOM   1577 C CG2   . ILE D 4 92  ? 81.694  -47.997  1.107   1.00 10.68  ? 294 ILE A CG2   1 
ATOM   1578 C CD1   . ILE D 4 92  ? 80.421  -48.225  -1.711  1.00 10.01  ? 294 ILE A CD1   1 
ATOM   1579 N N     . THR D 4 93  ? 80.935  -45.984  3.962   1.00 166.09 ? 295 THR A N     1 
ATOM   1580 C CA    . THR D 4 93  ? 81.793  -45.546  5.077   1.00 167.15 ? 295 THR A CA    1 
ATOM   1581 C C     . THR D 4 93  ? 82.518  -46.685  5.816   1.00 167.43 ? 295 THR A C     1 
ATOM   1582 O O     . THR D 4 93  ? 83.438  -46.429  6.603   1.00 167.17 ? 295 THR A O     1 
ATOM   1583 C CB    . THR D 4 93  ? 81.008  -44.702  6.129   1.00 75.83  ? 295 THR A CB    1 
ATOM   1584 O OG1   . THR D 4 93  ? 79.690  -45.242  6.309   1.00 76.16  ? 295 THR A OG1   1 
ATOM   1585 C CG2   . THR D 4 93  ? 80.926  -43.242  5.705   1.00 75.60  ? 295 THR A CG2   1 
ATOM   1586 N N     . ASN D 4 94  ? 82.126  -47.930  5.532   1.00 138.49 ? 296 ASN A N     1 
ATOM   1587 C CA    . ASN D 4 94  ? 82.717  -49.120  6.157   1.00 139.19 ? 296 ASN A CA    1 
ATOM   1588 C C     . ASN D 4 94  ? 82.640  -50.358  5.258   1.00 139.06 ? 296 ASN A C     1 
ATOM   1589 O O     . ASN D 4 94  ? 81.590  -50.650  4.680   1.00 138.27 ? 296 ASN A O     1 
ATOM   1590 N N     . LEU D 4 95  ? 83.755  -51.091  5.175   1.00 89.68  ? 297 LEU A N     1 
ATOM   1591 C CA    . LEU D 4 95  ? 83.882  -52.311  4.360   1.00 89.63  ? 297 LEU A CA    1 
ATOM   1592 C C     . LEU D 4 95  ? 83.208  -53.502  5.042   1.00 89.53  ? 297 LEU A C     1 
ATOM   1593 O O     . LEU D 4 95  ? 82.802  -54.468  4.387   1.00 89.58  ? 297 LEU A O     1 
ATOM   1594 C CB    . LEU D 4 95  ? 85.370  -52.621  4.116   1.00 101.27 ? 297 LEU A CB    1 
ATOM   1595 C CG    . LEU D 4 95  ? 85.805  -53.689  3.098   1.00 100.79 ? 297 LEU A CG    1 
ATOM   1596 C CD1   . LEU D 4 95  ? 85.432  -53.259  1.682   1.00 99.81  ? 297 LEU A CD1   1 
ATOM   1597 C CD2   . LEU D 4 95  ? 87.306  -53.931  3.203   1.00 99.90  ? 297 LEU A CD2   1 
ATOM   1598 N N     . SER D 4 96  ? 83.066  -53.384  6.363   1.00 87.57  ? 298 SER A N     1 
ATOM   1599 C CA    . SER D 4 96  ? 82.448  -54.384  7.240   1.00 87.87  ? 298 SER A CA    1 
ATOM   1600 C C     . SER D 4 96  ? 80.977  -54.650  6.898   1.00 87.37  ? 298 SER A C     1 
ATOM   1601 O O     . SER D 4 96  ? 80.414  -55.697  7.242   1.00 87.22  ? 298 SER A O     1 
ATOM   1602 C CB    . SER D 4 96  ? 82.550  -53.893  8.686   1.00 92.39  ? 298 SER A CB    1 
ATOM   1603 O OG    . SER D 4 96  ? 82.026  -52.578  8.811   1.00 93.80  ? 298 SER A OG    1 
ATOM   1604 N N     . LYS D 4 97  ? 80.383  -53.683  6.204   1.00 97.05  ? 299 LYS A N     1 
ATOM   1605 C CA    . LYS D 4 97  ? 78.991  -53.730  5.788   1.00 96.65  ? 299 LYS A CA    1 
ATOM   1606 C C     . LYS D 4 97  ? 78.824  -54.207  4.330   1.00 95.19  ? 299 LYS A C     1 
ATOM   1607 O O     . LYS D 4 97  ? 77.825  -53.888  3.683   1.00 94.72  ? 299 LYS A O     1 
ATOM   1608 C CB    . LYS D 4 97  ? 78.356  -52.344  6.013   1.00 113.21 ? 299 LYS A CB    1 
ATOM   1609 C CG    . LYS D 4 97  ? 78.498  -51.815  7.450   1.00 115.24 ? 299 LYS A CG    1 
ATOM   1610 C CD    . LYS D 4 97  ? 77.913  -50.420  7.623   1.00 117.43 ? 299 LYS A CD    1 
ATOM   1611 C CE    . LYS D 4 97  ? 78.091  -49.920  9.055   1.00 118.82 ? 299 LYS A CE    1 
ATOM   1612 N NZ    . LYS D 4 97  ? 77.409  -48.613  9.304   1.00 118.46 ? 299 LYS A NZ    1 
ATOM   1613 N N     . CYS D 4 98  ? 79.784  -54.998  3.838   1.00 104.57 ? 300 CYS A N     1 
ATOM   1614 C CA    . CYS D 4 98  ? 79.753  -55.535  2.467   1.00 103.09 ? 300 CYS A CA    1 
ATOM   1615 C C     . CYS D 4 98  ? 79.614  -57.058  2.419   1.00 101.61 ? 300 CYS A C     1 
ATOM   1616 O O     . CYS D 4 98  ? 79.941  -57.755  3.383   1.00 101.69 ? 300 CYS A O     1 
ATOM   1617 C CB    . CYS D 4 98  ? 81.017  -55.148  1.702   1.00 94.72  ? 300 CYS A CB    1 
ATOM   1618 S SG    . CYS D 4 98  ? 81.339  -53.392  1.583   1.00 95.96  ? 300 CYS A SG    1 
ATOM   1619 N N     . ASP D 4 99  ? 79.137  -57.564  1.281   1.00 37.94  ? 301 ASP A N     1 
ATOM   1620 C CA    . ASP D 4 99  ? 78.959  -59.000  1.062   1.00 36.57  ? 301 ASP A CA    1 
ATOM   1621 C C     . ASP D 4 99  ? 79.367  -59.381  -0.352  1.00 35.89  ? 301 ASP A C     1 
ATOM   1622 O O     . ASP D 4 99  ? 78.720  -58.985  -1.331  1.00 35.36  ? 301 ASP A O     1 
ATOM   1623 C CB    . ASP D 4 99  ? 77.509  -59.435  1.328   1.00 87.22  ? 301 ASP A CB    1 
ATOM   1624 C CG    . ASP D 4 99  ? 77.289  -59.959  2.745   1.00 87.47  ? 301 ASP A CG    1 
ATOM   1625 O OD1   . ASP D 4 99  ? 78.266  -60.287  3.455   1.00 87.27  ? 301 ASP A OD1   1 
ATOM   1626 O OD2   . ASP D 4 99  ? 76.109  -60.051  3.141   1.00 87.53  ? 301 ASP A OD2   1 
ATOM   1627 N N     . PHE D 4 100 ? 80.438  -60.170  -0.434  1.00 70.07  ? 302 PHE A N     1 
ATOM   1628 C CA    . PHE D 4 100 ? 80.996  -60.638  -1.706  1.00 69.87  ? 302 PHE A CA    1 
ATOM   1629 C C     . PHE D 4 100 ? 80.603  -62.097  -1.969  1.00 69.84  ? 302 PHE A C     1 
ATOM   1630 O O     . PHE D 4 100 ? 81.028  -62.707  -2.967  1.00 69.48  ? 302 PHE A O     1 
ATOM   1631 C CB    . PHE D 4 100 ? 82.534  -60.473  -1.715  1.00 95.24  ? 302 PHE A CB    1 
ATOM   1632 C CG    . PHE D 4 100 ? 83.015  -59.052  -1.458  1.00 95.35  ? 302 PHE A CG    1 
ATOM   1633 C CD1   . PHE D 4 100 ? 83.167  -58.134  -2.519  1.00 94.94  ? 302 PHE A CD1   1 
ATOM   1634 C CD2   . PHE D 4 100 ? 83.321  -58.623  -0.147  1.00 95.69  ? 302 PHE A CD2   1 
ATOM   1635 C CE1   . PHE D 4 100 ? 83.621  -56.791  -2.279  1.00 95.15  ? 302 PHE A CE1   1 
ATOM   1636 C CE2   . PHE D 4 100 ? 83.775  -57.290  0.114   1.00 95.84  ? 302 PHE A CE2   1 
ATOM   1637 C CZ    . PHE D 4 100 ? 83.924  -56.372  -0.957  1.00 95.40  ? 302 PHE A CZ    1 
ATOM   1638 N N     . THR D 4 101 ? 79.739  -62.596  -1.083  1.00 96.65  ? 303 THR A N     1 
ATOM   1639 C CA    . THR D 4 101 ? 79.193  -63.951  -1.061  1.00 96.85  ? 303 THR A CA    1 
ATOM   1640 C C     . THR D 4 101 ? 78.586  -64.552  -2.352  1.00 96.99  ? 303 THR A C     1 
ATOM   1641 O O     . THR D 4 101 ? 78.826  -65.731  -2.657  1.00 97.01  ? 303 THR A O     1 
ATOM   1642 C CB    . THR D 4 101 ? 78.165  -64.080  0.107   1.00 127.34 ? 303 THR A CB    1 
ATOM   1643 O OG1   . THR D 4 101 ? 77.215  -63.007  0.038   1.00 127.55 ? 303 THR A OG1   1 
ATOM   1644 C CG2   . THR D 4 101 ? 78.873  -64.011  1.458   1.00 127.50 ? 303 THR A CG2   1 
ATOM   1645 N N     . GLN D 4 102 ? 77.822  -63.757  -3.106  1.00 63.75  ? 304 GLN A N     1 
ATOM   1646 C CA    . GLN D 4 102 ? 77.199  -64.229  -4.358  1.00 63.95  ? 304 GLN A CA    1 
ATOM   1647 C C     . GLN D 4 102 ? 78.190  -64.406  -5.516  1.00 63.59  ? 304 GLN A C     1 
ATOM   1648 O O     . GLN D 4 102 ? 77.960  -65.173  -6.454  1.00 62.08  ? 304 GLN A O     1 
ATOM   1649 N N     . MET D 4 103 ? 79.309  -63.706  -5.392  1.00 80.32  ? 305 MET A N     1 
ATOM   1650 C CA    . MET D 4 103 ? 80.398  -63.728  -6.350  1.00 81.51  ? 305 MET A CA    1 
ATOM   1651 C C     . MET D 4 103 ? 81.360  -64.845  -5.956  1.00 81.77  ? 305 MET A C     1 
ATOM   1652 O O     . MET D 4 103 ? 82.179  -65.297  -6.759  1.00 81.69  ? 305 MET A O     1 
ATOM   1653 C CB    . MET D 4 103 ? 81.104  -62.381  -6.304  1.00 135.37 ? 305 MET A CB    1 
ATOM   1654 C CG    . MET D 4 103 ? 80.185  -61.229  -6.592  1.00 137.73 ? 305 MET A CG    1 
ATOM   1655 S SD    . MET D 4 103 ? 81.002  -59.691  -6.369  1.00 140.80 ? 305 MET A SD    1 
ATOM   1656 C CE    . MET D 4 103 ? 80.115  -59.051  -5.070  1.00 140.38 ? 305 MET A CE    1 
ATOM   1657 N N     . SER D 4 104 ? 81.236  -65.272  -4.700  1.00 113.15 ? 306 SER A N     1 
ATOM   1658 C CA    . SER D 4 104 ? 82.062  -66.326  -4.123  1.00 113.92 ? 306 SER A CA    1 
ATOM   1659 C C     . SER D 4 104 ? 81.575  -67.732  -4.455  1.00 114.57 ? 306 SER A C     1 
ATOM   1660 O O     . SER D 4 104 ? 82.354  -68.686  -4.427  1.00 114.51 ? 306 SER A O     1 
ATOM   1661 C CB    . SER D 4 104 ? 82.162  -66.175  -2.612  1.00 114.46 ? 306 SER A CB    1 
ATOM   1662 O OG    . SER D 4 104 ? 83.217  -66.963  -2.098  1.00 115.70 ? 306 SER A OG    1 
ATOM   1663 N N     . GLN D 4 105 ? 80.292  -67.872  -4.768  1.00 62.08  ? 307 GLN A N     1 
ATOM   1664 C CA    . GLN D 4 105 ? 79.771  -69.180  -5.149  1.00 63.60  ? 307 GLN A CA    1 
ATOM   1665 C C     . GLN D 4 105 ? 80.082  -69.322  -6.636  1.00 64.32  ? 307 GLN A C     1 
ATOM   1666 O O     . GLN D 4 105 ? 80.376  -70.411  -7.141  1.00 64.49  ? 307 GLN A O     1 
ATOM   1667 N N     . TYR D 4 106 ? 80.071  -68.157  -7.287  1.00 58.24  ? 308 TYR A N     1 
ATOM   1668 C CA    . TYR D 4 106 ? 80.307  -67.969  -8.711  1.00 59.73  ? 308 TYR A CA    1 
ATOM   1669 C C     . TYR D 4 106 ? 81.751  -68.286  -9.084  1.00 60.72  ? 308 TYR A C     1 
ATOM   1670 O O     . TYR D 4 106 ? 82.005  -69.105  -9.969  1.00 60.37  ? 308 TYR A O     1 
ATOM   1671 C CB    . TYR D 4 106 ? 79.951  -66.521  -9.077  1.00 127.68 ? 308 TYR A CB    1 
ATOM   1672 C CG    . TYR D 4 106 ? 79.841  -66.235  -10.545 1.00 128.72 ? 308 TYR A CG    1 
ATOM   1673 C CD1   . TYR D 4 106 ? 78.648  -66.505  -11.249 1.00 129.66 ? 308 TYR A CD1   1 
ATOM   1674 C CD2   . TYR D 4 106 ? 80.925  -65.688  -11.249 1.00 128.90 ? 308 TYR A CD2   1 
ATOM   1675 C CE1   . TYR D 4 106 ? 78.539  -66.232  -12.640 1.00 130.30 ? 308 TYR A CE1   1 
ATOM   1676 C CE2   . TYR D 4 106 ? 80.834  -65.413  -12.627 1.00 129.99 ? 308 TYR A CE2   1 
ATOM   1677 C CZ    . TYR D 4 106 ? 79.642  -65.688  -13.316 1.00 130.39 ? 308 TYR A CZ    1 
ATOM   1678 O OH    . TYR D 4 106 ? 79.574  -65.439  -14.665 1.00 130.37 ? 308 TYR A OH    1 
ATOM   1679 N N     . PHE D 4 107 ? 82.686  -67.674  -8.359  1.00 66.83  ? 309 PHE A N     1 
ATOM   1680 C CA    . PHE D 4 107 ? 84.119  -67.865  -8.582  1.00 69.04  ? 309 PHE A CA    1 
ATOM   1681 C C     . PHE D 4 107 ? 84.498  -69.318  -8.368  1.00 68.57  ? 309 PHE A C     1 
ATOM   1682 O O     . PHE D 4 107 ? 85.204  -69.899  -9.193  1.00 68.13  ? 309 PHE A O     1 
ATOM   1683 N N     . LYS D 4 108 ? 83.934  -69.914  -7.314  1.00 50.15  ? 310 LYS A N     1 
ATOM   1684 C CA    . LYS D 4 108 ? 84.180  -71.310  -6.974  1.00 49.78  ? 310 LYS A CA    1 
ATOM   1685 C C     . LYS D 4 108 ? 83.548  -72.282  -7.984  1.00 49.89  ? 310 LYS A C     1 
ATOM   1686 O O     . LYS D 4 108 ? 84.159  -73.306  -8.325  1.00 50.11  ? 310 LYS A O     1 
ATOM   1687 C CB    . LYS D 4 108 ? 83.686  -71.625  -5.558  1.00 127.19 ? 310 LYS A CB    1 
ATOM   1688 C CG    . LYS D 4 108 ? 84.541  -71.044  -4.435  1.00 127.61 ? 310 LYS A CG    1 
ATOM   1689 C CD    . LYS D 4 108 ? 83.965  -71.404  -3.066  1.00 128.76 ? 310 LYS A CD    1 
ATOM   1690 C CE    . LYS D 4 108 ? 84.544  -70.562  -1.923  1.00 128.34 ? 310 LYS A CE    1 
ATOM   1691 N NZ    . LYS D 4 108 ? 85.920  -70.957  -1.506  1.00 128.53 ? 310 LYS A NZ    1 
ATOM   1692 N N     . ALA D 4 109 ? 82.353  -71.950  -8.488  1.00 98.49  ? 311 ALA A N     1 
ATOM   1693 C CA    . ALA D 4 109 ? 81.670  -72.803  -9.468  1.00 98.22  ? 311 ALA A CA    1 
ATOM   1694 C C     . ALA D 4 109 ? 82.396  -72.748  -10.807 1.00 98.19  ? 311 ALA A C     1 
ATOM   1695 O O     . ALA D 4 109 ? 82.478  -73.763  -11.504 1.00 97.83  ? 311 ALA A O     1 
ATOM   1696 C CB    . ALA D 4 109 ? 80.196  -72.399  -9.639  1.00 60.81  ? 311 ALA A CB    1 
ATOM   1697 N N     . GLN D 4 110 ? 83.020  -71.596  -11.077 1.00 80.87  ? 312 GLN A N     1 
ATOM   1698 C CA    . GLN D 4 110 ? 83.777  -71.352  -12.301 1.00 81.62  ? 312 GLN A CA    1 
ATOM   1699 C C     . GLN D 4 110 ? 85.083  -72.153  -12.356 1.00 82.50  ? 312 GLN A C     1 
ATOM   1700 O O     . GLN D 4 110 ? 85.611  -72.420  -13.442 1.00 82.41  ? 312 GLN A O     1 
ATOM   1701 N N     . THR D 4 111 ? 85.592  -72.522  -11.179 1.00 134.51 ? 313 THR A N     1 
ATOM   1702 C CA    . THR D 4 111 ? 86.824  -73.305  -11.039 1.00 135.69 ? 313 THR A CA    1 
ATOM   1703 C C     . THR D 4 111 ? 86.475  -74.774  -11.276 1.00 136.42 ? 313 THR A C     1 
ATOM   1704 O O     . THR D 4 111 ? 87.204  -75.494  -11.967 1.00 136.73 ? 313 THR A O     1 
ATOM   1705 C CB    . THR D 4 111 ? 87.424  -73.143  -9.617  1.00 109.94 ? 313 THR A CB    1 
ATOM   1706 O OG1   . THR D 4 111 ? 87.431  -71.756  -9.259  1.00 109.34 ? 313 THR A OG1   1 
ATOM   1707 C CG2   . THR D 4 111 ? 88.851  -73.673  -9.555  1.00 109.29 ? 313 THR A CG2   1 
ATOM   1708 N N     . GLU D 4 112 ? 85.313  -75.173  -10.757 1.00 127.93 ? 314 GLU A N     1 
ATOM   1709 C CA    . GLU D 4 112 ? 84.811  -76.537  -10.887 1.00 128.30 ? 314 GLU A CA    1 
ATOM   1710 C C     . GLU D 4 112 ? 84.174  -76.815  -12.255 1.00 128.84 ? 314 GLU A C     1 
ATOM   1711 O O     . GLU D 4 112 ? 83.991  -77.978  -12.629 1.00 128.49 ? 314 GLU A O     1 
ATOM   1712 C CB    . GLU D 4 112 ? 83.826  -76.842  -9.759  1.00 76.56  ? 314 GLU A CB    1 
ATOM   1713 N N     . ALA D 4 113 ? 83.880  -75.753  -13.011 1.00 88.55  ? 315 ALA A N     1 
ATOM   1714 C CA    . ALA D 4 113 ? 83.275  -75.867  -14.348 1.00 90.12  ? 315 ALA A CA    1 
ATOM   1715 C C     . ALA D 4 113 ? 84.268  -76.344  -15.413 1.00 91.23  ? 315 ALA A C     1 
ATOM   1716 O O     . ALA D 4 113 ? 83.869  -76.846  -16.472 1.00 91.55  ? 315 ALA A O     1 
ATOM   1717 C CB    . ALA D 4 113 ? 82.647  -74.545  -14.766 1.00 88.02  ? 315 ALA A CB    1 
ATOM   1718 N N     . ARG D 4 114 ? 85.558  -76.177  -15.115 1.00 146.41 ? 316 ARG A N     1 
ATOM   1719 C CA    . ARG D 4 114 ? 86.646  -76.608  -15.992 1.00 147.61 ? 316 ARG A CA    1 
ATOM   1720 C C     . ARG D 4 114 ? 86.929  -78.090  -15.716 1.00 148.71 ? 316 ARG A C     1 
ATOM   1721 O O     . ARG D 4 114 ? 87.480  -78.799  -16.566 1.00 149.15 ? 316 ARG A O     1 
ATOM   1722 C CB    . ARG D 4 114 ? 87.890  -75.769  -15.742 1.00 113.99 ? 316 ARG A CB    1 
ATOM   1723 N N     . LYS D 4 115 ? 86.511  -78.541  -14.528 1.00 116.42 ? 317 LYS A N     1 
ATOM   1724 C CA    . LYS D 4 115 ? 86.652  -79.929  -14.077 1.00 116.94 ? 317 LYS A CA    1 
ATOM   1725 C C     . LYS D 4 115 ? 85.479  -80.757  -14.611 1.00 116.99 ? 317 LYS A C     1 
ATOM   1726 O O     . LYS D 4 115 ? 85.398  -81.968  -14.389 1.00 116.97 ? 317 LYS A O     1 
ATOM   1727 C CB    . LYS D 4 115 ? 86.690  -79.983  -12.547 1.00 90.61  ? 317 LYS A CB    1 
ATOM   1728 N N     . GLN D 4 116 ? 84.576  -80.074  -15.312 1.00 152.13 ? 318 GLN A N     1 
ATOM   1729 C CA    . GLN D 4 116 ? 83.397  -80.675  -15.917 1.00 152.91 ? 318 GLN A CA    1 
ATOM   1730 C C     . GLN D 4 116 ? 83.542  -80.733  -17.441 1.00 153.48 ? 318 GLN A C     1 
ATOM   1731 O O     . GLN D 4 116 ? 82.829  -81.495  -18.102 1.00 154.31 ? 318 GLN A O     1 
ATOM   1732 C CB    . GLN D 4 116 ? 82.154  -79.887  -15.528 1.00 114.28 ? 318 GLN A CB    1 
ATOM   1733 N N     . MET D 4 117 ? 84.476  -79.940  -17.983 1.00 156.22 ? 319 MET A N     1 
ATOM   1734 C CA    . MET D 4 117 ? 84.754  -79.875  -19.428 1.00 155.97 ? 319 MET A CA    1 
ATOM   1735 C C     . MET D 4 117 ? 85.346  -81.197  -19.924 1.00 156.03 ? 319 MET A C     1 
ATOM   1736 O O     . MET D 4 117 ? 86.337  -81.685  -19.370 1.00 156.27 ? 319 MET A O     1 
ATOM   1737 C CB    . MET D 4 117 ? 85.700  -78.718  -19.731 1.00 105.18 ? 319 MET A CB    1 
ATOM   1738 N N     . SER D 4 118 ? 84.740  -81.748  -20.980 1.00 81.40  ? 320 SER A N     1 
ATOM   1739 C CA    . SER D 4 118 ? 85.122  -83.044  -21.566 1.00 81.24  ? 320 SER A CA    1 
ATOM   1740 C C     . SER D 4 118 ? 86.543  -83.221  -22.105 1.00 80.84  ? 320 SER A C     1 
ATOM   1741 O O     . SER D 4 118 ? 87.311  -82.260  -22.206 1.00 79.99  ? 320 SER A O     1 
ATOM   1742 C CB    . SER D 4 118 ? 84.107  -83.453  -22.648 1.00 97.93  ? 320 SER A CB    1 
ATOM   1743 O OG    . SER D 4 118 ? 84.141  -82.581  -23.765 1.00 98.08  ? 320 SER A OG    1 
ATOM   1744 N N     . LYS D 4 119 ? 86.863  -84.469  -22.461 1.00 92.62  ? 321 LYS A N     1 
ATOM   1745 C CA    . LYS D 4 119 ? 88.162  -84.854  -23.021 1.00 93.20  ? 321 LYS A CA    1 
ATOM   1746 C C     . LYS D 4 119 ? 88.239  -84.479  -24.516 1.00 93.69  ? 321 LYS A C     1 
ATOM   1747 O O     . LYS D 4 119 ? 88.861  -85.176  -25.327 1.00 93.63  ? 321 LYS A O     1 
ATOM   1748 C CB    . LYS D 4 119 ? 88.389  -86.361  -22.817 1.00 108.67 ? 321 LYS A CB    1 
ATOM   1749 N N     . GLU D 4 120 ? 87.589  -83.360  -24.846 1.00 88.41  ? 322 GLU A N     1 
ATOM   1750 C CA    . GLU D 4 120 ? 87.506  -82.786  -26.189 1.00 88.90  ? 322 GLU A CA    1 
ATOM   1751 C C     . GLU D 4 120 ? 87.209  -81.294  -26.031 1.00 89.20  ? 322 GLU A C     1 
ATOM   1752 O O     . GLU D 4 120 ? 87.612  -80.480  -26.867 1.00 89.56  ? 322 GLU A O     1 
ATOM   1753 C CB    . GLU D 4 120 ? 86.396  -83.463  -26.995 1.00 147.59 ? 322 GLU A CB    1 
ATOM   1754 N N     . GLU D 4 121 ? 86.489  -80.953  -24.958 1.00 129.79 ? 323 GLU A N     1 
ATOM   1755 C CA    . GLU D 4 121 ? 86.138  -79.567  -24.634 1.00 129.61 ? 323 GLU A CA    1 
ATOM   1756 C C     . GLU D 4 121 ? 87.304  -78.911  -23.894 1.00 129.62 ? 323 GLU A C     1 
ATOM   1757 O O     . GLU D 4 121 ? 87.391  -77.681  -23.815 1.00 129.94 ? 323 GLU A O     1 
ATOM   1758 C CB    . GLU D 4 121 ? 84.882  -79.519  -23.779 1.00 157.71 ? 323 GLU A CB    1 
ATOM   1759 N N     . LYS D 4 122 ? 88.190  -79.756  -23.359 1.00 80.11  ? 324 LYS A N     1 
ATOM   1760 C CA    . LYS D 4 122 ? 89.386  -79.329  -22.635 1.00 78.82  ? 324 LYS A CA    1 
ATOM   1761 C C     . LYS D 4 122 ? 90.547  -79.119  -23.607 1.00 78.13  ? 324 LYS A C     1 
ATOM   1762 O O     . LYS D 4 122 ? 91.631  -78.713  -23.197 1.00 77.90  ? 324 LYS A O     1 
ATOM   1763 N N     . LEU D 4 123 ? 90.294  -79.377  -24.894 1.00 141.20 ? 325 LEU A N     1 
ATOM   1764 C CA    . LEU D 4 123 ? 91.286  -79.228  -25.965 1.00 140.92 ? 325 LEU A CA    1 
ATOM   1765 C C     . LEU D 4 123 ? 90.821  -78.236  -27.048 1.00 140.84 ? 325 LEU A C     1 
ATOM   1766 O O     . LEU D 4 123 ? 91.630  -77.760  -27.856 1.00 140.98 ? 325 LEU A O     1 
ATOM   1767 C CB    . LEU D 4 123 ? 91.593  -80.602  -26.585 1.00 86.49  ? 325 LEU A CB    1 
ATOM   1768 C CG    . LEU D 4 123 ? 92.773  -80.823  -27.547 1.00 86.58  ? 325 LEU A CG    1 
ATOM   1769 C CD1   . LEU D 4 123 ? 94.113  -80.450  -26.913 1.00 86.63  ? 325 LEU A CD1   1 
ATOM   1770 C CD2   . LEU D 4 123 ? 92.781  -82.274  -27.972 1.00 86.62  ? 325 LEU A CD2   1 
ATOM   1771 N N     . LYS D 4 124 ? 89.524  -77.907  -27.028 1.00 115.56 ? 326 LYS A N     1 
ATOM   1772 C CA    . LYS D 4 124 ? 88.898  -76.973  -27.976 1.00 115.47 ? 326 LYS A CA    1 
ATOM   1773 C C     . LYS D 4 124 ? 89.519  -75.571  -27.880 1.00 115.55 ? 326 LYS A C     1 
ATOM   1774 O O     . LYS D 4 124 ? 89.904  -74.977  -28.894 1.00 114.93 ? 326 LYS A O     1 
ATOM   1775 C CB    . LYS D 4 124 ? 87.385  -76.911  -27.726 1.00 66.81  ? 326 LYS A CB    1 
ATOM   1776 N N     . ILE D 4 125 ? 89.651  -75.085  -26.647 1.00 170.81 ? 327 ILE A N     1 
ATOM   1777 C CA    . ILE D 4 125 ? 90.250  -73.781  -26.360 1.00 171.78 ? 327 ILE A CA    1 
ATOM   1778 C C     . ILE D 4 125 ? 91.664  -73.951  -25.779 1.00 171.94 ? 327 ILE A C     1 
ATOM   1779 O O     . ILE D 4 125 ? 92.427  -72.981  -25.703 1.00 171.95 ? 327 ILE A O     1 
ATOM   1780 N N     . LYS D 4 126 ? 91.991  -75.187  -25.373 1.00 62.78  ? 328 LYS A N     1 
ATOM   1781 C CA    . LYS D 4 126 ? 93.291  -75.562  -24.783 1.00 63.58  ? 328 LYS A CA    1 
ATOM   1782 C C     . LYS D 4 126 ? 94.401  -75.667  -25.832 1.00 63.24  ? 328 LYS A C     1 
ATOM   1783 O O     . LYS D 4 126 ? 95.595  -75.710  -25.487 1.00 62.98  ? 328 LYS A O     1 
ATOM   1784 N N     . GLU D 4 127 ? 93.978  -75.734  -27.098 1.00 75.80  ? 329 GLU A N     1 
ATOM   1785 C CA    . GLU D 4 127 ? 94.867  -75.810  -28.246 1.00 75.72  ? 329 GLU A CA    1 
ATOM   1786 C C     . GLU D 4 127 ? 95.069  -74.373  -28.717 1.00 74.44  ? 329 GLU A C     1 
ATOM   1787 O O     . GLU D 4 127 ? 96.122  -74.031  -29.259 1.00 74.80  ? 329 GLU A O     1 
ATOM   1788 N N     . GLU D 4 128 ? 94.052  -73.542  -28.473 1.00 75.96  ? 330 GLU A N     1 
ATOM   1789 C CA    . GLU D 4 128 ? 94.061  -72.121  -28.820 1.00 74.19  ? 330 GLU A CA    1 
ATOM   1790 C C     . GLU D 4 128 ? 95.021  -71.307  -27.937 1.00 72.41  ? 330 GLU A C     1 
ATOM   1791 O O     . GLU D 4 128 ? 95.649  -70.351  -28.414 1.00 72.27  ? 330 GLU A O     1 
ATOM   1792 N N     . ASN D 4 129 ? 95.153  -71.719  -26.673 1.00 91.30  ? 331 ASN A N     1 
ATOM   1793 C CA    . ASN D 4 129 ? 96.048  -71.062  -25.725 1.00 89.08  ? 331 ASN A CA    1 
ATOM   1794 C C     . ASN D 4 129 ? 97.484  -71.551  -25.934 1.00 87.04  ? 331 ASN A C     1 
ATOM   1795 O O     . ASN D 4 129 ? 98.408  -71.154  -25.229 1.00 87.05  ? 331 ASN A O     1 
ATOM   1796 N N     . GLU D 4 130 ? 97.639  -72.462  -26.884 1.00 54.54  ? 332 GLU A N     1 
ATOM   1797 C CA    . GLU D 4 130 ? 98.930  -73.035  -27.211 1.00 52.51  ? 332 GLU A CA    1 
ATOM   1798 C C     . GLU D 4 130 ? 99.351  -72.520  -28.570 1.00 50.87  ? 332 GLU A C     1 
ATOM   1799 O O     . GLU D 4 130 ? 100.520 -72.618  -28.927 1.00 50.25  ? 332 GLU A O     1 
ATOM   1800 C CB    . GLU D 4 130 ? 98.861  -74.562  -27.178 1.00 144.48 ? 332 GLU A CB    1 
ATOM   1801 N N     . LYS D 4 131 ? 98.395  -71.917  -29.289 1.00 57.94  ? 333 LYS A N     1 
ATOM   1802 C CA    . LYS D 4 131 ? 98.615  -71.311  -30.614 1.00 56.29  ? 333 LYS A CA    1 
ATOM   1803 C C     . LYS D 4 131 ? 99.380  -70.008  -30.385 1.00 54.86  ? 333 LYS A C     1 
ATOM   1804 O O     . LYS D 4 131 ? 99.968  -69.438  -31.308 1.00 54.79  ? 333 LYS A O     1 
ATOM   1805 C CB    . LYS D 4 131 ? 97.289  -71.014  -31.301 1.00 43.61  ? 333 LYS A CB    1 
ATOM   1806 N N     . LEU D 4 132 ? 99.330  -69.541  -29.135 1.00 40.54  ? 334 LEU A N     1 
ATOM   1807 C CA    . LEU D 4 132 ? 100.026 -68.347  -28.679 1.00 39.47  ? 334 LEU A CA    1 
ATOM   1808 C C     . LEU D 4 132 ? 101.503 -68.716  -28.557 1.00 38.57  ? 334 LEU A C     1 
ATOM   1809 O O     . LEU D 4 132 ? 102.339 -68.148  -29.257 1.00 38.53  ? 334 LEU A O     1 
ATOM   1810 C CB    . LEU D 4 132 ? 99.484  -67.913  -27.307 1.00 113.91 ? 334 LEU A CB    1 
ATOM   1811 C CG    . LEU D 4 132 ? 98.296  -66.949  -27.166 1.00 114.58 ? 334 LEU A CG    1 
ATOM   1812 C CD1   . LEU D 4 132 ? 97.034  -67.478  -27.837 1.00 115.15 ? 334 LEU A CD1   1 
ATOM   1813 C CD2   . LEU D 4 132 ? 98.034  -66.678  -25.689 1.00 114.87 ? 334 LEU A CD2   1 
ATOM   1814 N N     . LEU D 4 133 ? 101.778 -69.767  -27.774 1.00 33.60  ? 335 LEU A N     1 
ATOM   1815 C CA    . LEU D 4 133 ? 103.128 -70.276  -27.505 1.00 32.70  ? 335 LEU A CA    1 
ATOM   1816 C C     . LEU D 4 133 ? 103.999 -70.439  -28.749 1.00 32.57  ? 335 LEU A C     1 
ATOM   1817 O O     . LEU D 4 133 ? 105.210 -70.273  -28.690 1.00 31.71  ? 335 LEU A O     1 
ATOM   1818 N N     . LYS D 4 134 ? 103.355 -70.723  -29.876 1.00 73.01  ? 336 LYS A N     1 
ATOM   1819 C CA    . LYS D 4 134 ? 104.037 -70.900  -31.150 1.00 73.97  ? 336 LYS A CA    1 
ATOM   1820 C C     . LYS D 4 134 ? 104.252 -69.570  -31.858 1.00 73.75  ? 336 LYS A C     1 
ATOM   1821 O O     . LYS D 4 134 ? 105.324 -69.325  -32.417 1.00 73.60  ? 336 LYS A O     1 
ATOM   1822 C CB    . LYS D 4 134 ? 103.235 -71.840  -32.042 1.00 135.82 ? 336 LYS A CB    1 
ATOM   1823 C CG    . LYS D 4 134 ? 103.058 -73.221  -31.447 1.00 137.11 ? 336 LYS A CG    1 
ATOM   1824 C CD    . LYS D 4 134 ? 101.730 -73.814  -31.848 1.00 138.18 ? 336 LYS A CD    1 
ATOM   1825 C CE    . LYS D 4 134 ? 101.458 -75.089  -31.081 1.00 139.18 ? 336 LYS A CE    1 
ATOM   1826 N NZ    . LYS D 4 134 ? 100.057 -75.545  -31.294 1.00 139.44 ? 336 LYS A NZ    1 
ATOM   1827 N N     . GLU D 4 135 ? 103.252 -68.697  -31.781 1.00 85.26  ? 337 GLU A N     1 
ATOM   1828 C CA    . GLU D 4 135 ? 103.316 -67.389  -32.426 1.00 85.35  ? 337 GLU A CA    1 
ATOM   1829 C C     . GLU D 4 135 ? 104.167 -66.355  -31.687 1.00 83.51  ? 337 GLU A C     1 
ATOM   1830 O O     . GLU D 4 135 ? 105.230 -65.943  -32.174 1.00 83.43  ? 337 GLU A O     1 
ATOM   1831 N N     . TYR D 4 136 ? 103.706 -65.991  -30.491 1.00 41.93  ? 338 TYR A N     1 
ATOM   1832 C CA    . TYR D 4 136 ? 104.349 -64.985  -29.647 1.00 40.82  ? 338 TYR A CA    1 
ATOM   1833 C C     . TYR D 4 136 ? 105.359 -65.524  -28.633 1.00 39.04  ? 338 TYR A C     1 
ATOM   1834 O O     . TYR D 4 136 ? 106.061 -64.749  -27.970 1.00 39.00  ? 338 TYR A O     1 
ATOM   1835 C CB    . TYR D 4 136 ? 103.268 -64.160  -28.942 1.00 102.41 ? 338 TYR A CB    1 
ATOM   1836 C CG    . TYR D 4 136 ? 102.334 -63.449  -29.897 1.00 104.06 ? 338 TYR A CG    1 
ATOM   1837 C CD1   . TYR D 4 136 ? 102.572 -62.114  -30.271 1.00 104.13 ? 338 TYR A CD1   1 
ATOM   1838 C CD2   . TYR D 4 136 ? 101.208 -64.110  -30.446 1.00 104.70 ? 338 TYR A CD2   1 
ATOM   1839 C CE1   . TYR D 4 136 ? 101.710 -61.435  -31.179 1.00 105.31 ? 338 TYR A CE1   1 
ATOM   1840 C CE2   . TYR D 4 136 ? 100.331 -63.444  -31.358 1.00 105.72 ? 338 TYR A CE2   1 
ATOM   1841 C CZ    . TYR D 4 136 ? 100.592 -62.106  -31.714 1.00 106.41 ? 338 TYR A CZ    1 
ATOM   1842 O OH    . TYR D 4 136 ? 99.733  -61.431  -32.557 1.00 107.73 ? 338 TYR A OH    1 
ATOM   1843 N N     . GLY D 4 137 ? 105.478 -66.851  -28.581 1.00 42.55  ? 339 GLY A N     1 
ATOM   1844 C CA    . GLY D 4 137 ? 106.375 -67.512  -27.638 1.00 40.64  ? 339 GLY A CA    1 
ATOM   1845 C C     . GLY D 4 137 ? 107.853 -67.619  -27.972 1.00 39.11  ? 339 GLY A C     1 
ATOM   1846 O O     . GLY D 4 137 ? 108.686 -67.699  -27.075 1.00 38.82  ? 339 GLY A O     1 
ATOM   1847 N N     . PHE D 4 138 ? 108.172 -67.692  -29.256 1.00 47.70  ? 340 PHE A N     1 
ATOM   1848 C CA    . PHE D 4 138 ? 109.557 -67.771  -29.700 1.00 47.38  ? 340 PHE A CA    1 
ATOM   1849 C C     . PHE D 4 138 ? 109.936 -66.463  -30.357 1.00 48.28  ? 340 PHE A C     1 
ATOM   1850 O O     . PHE D 4 138 ? 109.072 -65.679  -30.780 1.00 48.64  ? 340 PHE A O     1 
ATOM   1851 C CB    . PHE D 4 138 ? 109.757 -68.926  -30.681 1.00 130.52 ? 340 PHE A CB    1 
ATOM   1852 C CG    . PHE D 4 138 ? 109.962 -70.253  -30.017 1.00 130.42 ? 340 PHE A CG    1 
ATOM   1853 C CD1   . PHE D 4 138 ? 108.884 -70.929  -29.402 1.00 130.35 ? 340 PHE A CD1   1 
ATOM   1854 C CD2   . PHE D 4 138 ? 111.241 -70.839  -29.993 1.00 129.82 ? 340 PHE A CD2   1 
ATOM   1855 C CE1   . PHE D 4 138 ? 109.077 -72.187  -28.761 1.00 129.30 ? 340 PHE A CE1   1 
ATOM   1856 C CE2   . PHE D 4 138 ? 111.461 -72.096  -29.359 1.00 129.01 ? 340 PHE A CE2   1 
ATOM   1857 C CZ    . PHE D 4 138 ? 110.373 -72.774  -28.739 1.00 129.27 ? 340 PHE A CZ    1 
ATOM   1858 N N     . CYS D 4 139 ? 111.236 -66.213  -30.402 1.00 29.30  ? 341 CYS A N     1 
ATOM   1859 C CA    . CYS D 4 139 ? 111.755 -65.005  -31.012 1.00 30.66  ? 341 CYS A CA    1 
ATOM   1860 C C     . CYS D 4 139 ? 113.076 -65.327  -31.689 1.00 33.01  ? 341 CYS A C     1 
ATOM   1861 O O     . CYS D 4 139 ? 113.864 -66.137  -31.182 1.00 33.11  ? 341 CYS A O     1 
ATOM   1862 C CB    . CYS D 4 139 ? 111.984 -63.948  -29.954 1.00 64.16  ? 341 CYS A CB    1 
ATOM   1863 S SG    . CYS D 4 139 ? 113.237 -64.429  -28.782 1.00 63.34  ? 341 CYS A SG    1 
ATOM   1864 N N     . ILE D 4 140 ? 113.317 -64.654  -32.815 1.00 69.56  ? 342 ILE A N     1 
ATOM   1865 C CA    . ILE D 4 140 ? 114.538 -64.817  -33.600 1.00 71.98  ? 342 ILE A CA    1 
ATOM   1866 C C     . ILE D 4 140 ? 115.698 -64.071  -32.951 1.00 72.60  ? 342 ILE A C     1 
ATOM   1867 O O     . ILE D 4 140 ? 115.484 -63.161  -32.145 1.00 71.68  ? 342 ILE A O     1 
ATOM   1868 N N     . MET D 4 141 ? 116.918 -64.500  -33.269 1.00 198.72 ? 343 MET A N     1 
ATOM   1869 C CA    . MET D 4 141 ? 118.130 -63.880  -32.737 1.00 198.72 ? 343 MET A CA    1 
ATOM   1870 C C     . MET D 4 141 ? 119.314 -64.113  -33.683 1.00 198.72 ? 343 MET A C     1 
ATOM   1871 O O     . MET D 4 141 ? 119.112 -64.381  -34.873 1.00 198.72 ? 343 MET A O     1 
ATOM   1872 C CB    . MET D 4 141 ? 118.440 -64.418  -31.335 1.00 83.05  ? 343 MET A CB    1 
ATOM   1873 C CG    . MET D 4 141 ? 119.093 -63.391  -30.440 1.00 85.26  ? 343 MET A CG    1 
ATOM   1874 S SD    . MET D 4 141 ? 120.139 -64.145  -29.212 1.00 90.76  ? 343 MET A SD    1 
ATOM   1875 C CE    . MET D 4 141 ? 119.726 -63.141  -27.787 1.00 90.02  ? 343 MET A CE    1 
ATOM   1876 N N     . ASP D 4 142 ? 120.535 -64.001  -33.145 1.00 78.63  ? 344 ASP A N     1 
ATOM   1877 C CA    . ASP D 4 142 ? 121.790 -64.181  -33.881 1.00 79.12  ? 344 ASP A CA    1 
ATOM   1878 C C     . ASP D 4 142 ? 121.819 -65.513  -34.643 1.00 79.88  ? 344 ASP A C     1 
ATOM   1879 O O     . ASP D 4 142 ? 121.580 -65.540  -35.857 1.00 80.09  ? 344 ASP A O     1 
ATOM   1880 C CB    . ASP D 4 142 ? 122.997 -64.056  -32.919 1.00 66.27  ? 344 ASP A CB    1 
ATOM   1881 C CG    . ASP D 4 142 ? 123.158 -62.644  -32.340 1.00 65.73  ? 344 ASP A CG    1 
ATOM   1882 O OD1   . ASP D 4 142 ? 122.840 -61.675  -33.053 1.00 65.41  ? 344 ASP A OD1   1 
ATOM   1883 O OD2   . ASP D 4 142 ? 123.614 -62.500  -31.181 1.00 65.15  ? 344 ASP A OD2   1 
ATOM   1884 N N     . ASN D 4 143 ? 122.000 -66.614  -33.914 1.00 106.13 ? 345 ASN A N     1 
ATOM   1885 C CA    . ASN D 4 143 ? 122.033 -67.948  -34.507 1.00 107.10 ? 345 ASN A CA    1 
ATOM   1886 C C     . ASN D 4 143 ? 120.604 -68.384  -34.785 1.00 106.59 ? 345 ASN A C     1 
ATOM   1887 O O     . ASN D 4 143 ? 119.981 -67.928  -35.750 1.00 106.38 ? 345 ASN A O     1 
ATOM   1888 N N     . HIS D 4 144 ? 120.077 -69.216  -33.894 1.00 97.77  ? 346 HIS A N     1 
ATOM   1889 C CA    . HIS D 4 144 ? 118.715 -69.724  -34.014 1.00 97.31  ? 346 HIS A CA    1 
ATOM   1890 C C     . HIS D 4 144 ? 117.734 -68.917  -33.172 1.00 94.41  ? 346 HIS A C     1 
ATOM   1891 O O     . HIS D 4 144 ? 118.090 -67.868  -32.619 1.00 93.15  ? 346 HIS A O     1 
ATOM   1892 N N     . LYS D 4 145 ? 116.498 -69.416  -33.100 1.00 68.48  ? 347 LYS A N     1 
ATOM   1893 C CA    . LYS D 4 145 ? 115.426 -68.789  -32.331 1.00 65.11  ? 347 LYS A CA    1 
ATOM   1894 C C     . LYS D 4 145 ? 115.425 -69.264  -30.883 1.00 63.52  ? 347 LYS A C     1 
ATOM   1895 O O     . LYS D 4 145 ? 115.617 -70.453  -30.604 1.00 63.34  ? 347 LYS A O     1 
ATOM   1896 C CB    . LYS D 4 145 ? 114.051 -69.032  -32.985 1.00 107.89 ? 347 LYS A CB    1 
ATOM   1897 C CG    . LYS D 4 145 ? 113.686 -70.491  -33.224 1.00 107.18 ? 347 LYS A CG    1 
ATOM   1898 C CD    . LYS D 4 145 ? 112.283 -70.658  -33.772 1.00 108.57 ? 347 LYS A CD    1 
ATOM   1899 C CE    . LYS D 4 145 ? 111.960 -72.139  -33.911 1.00 108.96 ? 347 LYS A CE    1 
ATOM   1900 N NZ    . LYS D 4 145 ? 110.635 -72.377  -34.532 1.00 109.87 ? 347 LYS A NZ    1 
ATOM   1901 N N     . GLU D 4 146 ? 115.262 -68.319  -29.966 1.00 39.91  ? 348 GLU A N     1 
ATOM   1902 C CA    . GLU D 4 146 ? 115.235 -68.633  -28.547 1.00 38.86  ? 348 GLU A CA    1 
ATOM   1903 C C     . GLU D 4 146 ? 113.812 -68.497  -28.035 1.00 36.85  ? 348 GLU A C     1 
ATOM   1904 O O     . GLU D 4 146 ? 112.997 -67.794  -28.652 1.00 36.87  ? 348 GLU A O     1 
ATOM   1905 C CB    . GLU D 4 146 ? 116.171 -67.702  -27.779 1.00 143.08 ? 348 GLU A CB    1 
ATOM   1906 N N     . ARG D 4 147 ? 113.499 -69.217  -26.954 1.00 56.79  ? 349 ARG A N     1 
ATOM   1907 C CA    . ARG D 4 147 ? 112.169 -69.159  -26.346 1.00 55.47  ? 349 ARG A CA    1 
ATOM   1908 C C     . ARG D 4 147 ? 112.119 -68.043  -25.300 1.00 53.96  ? 349 ARG A C     1 
ATOM   1909 O O     . ARG D 4 147 ? 113.082 -67.827  -24.569 1.00 54.26  ? 349 ARG A O     1 
ATOM   1910 C CB    . ARG D 4 147 ? 111.779 -70.509  -25.723 1.00 88.52  ? 349 ARG A CB    1 
ATOM   1911 C CG    . ARG D 4 147 ? 110.331 -70.566  -25.208 1.00 91.12  ? 349 ARG A CG    1 
ATOM   1912 C CD    . ARG D 4 147 ? 109.899 -71.955  -24.755 1.00 93.55  ? 349 ARG A CD    1 
ATOM   1913 N NE    . ARG D 4 147 ? 108.746 -71.885  -23.853 1.00 95.66  ? 349 ARG A NE    1 
ATOM   1914 C CZ    . ARG D 4 147 ? 108.121 -72.934  -23.320 1.00 97.16  ? 349 ARG A CZ    1 
ATOM   1915 N NH1   . ARG D 4 147 ? 108.515 -74.173  -23.595 1.00 97.80  ? 349 ARG A NH1   1 
ATOM   1916 N NH2   . ARG D 4 147 ? 107.120 -72.742  -22.468 1.00 97.85  ? 349 ARG A NH2   1 
ATOM   1917 N N     . ILE D 4 148 ? 111.017 -67.293  -25.299 1.00 44.27  ? 350 ILE A N     1 
ATOM   1918 C CA    . ILE D 4 148 ? 110.793 -66.198  -24.355 1.00 41.54  ? 350 ILE A CA    1 
ATOM   1919 C C     . ILE D 4 148 ? 110.155 -66.836  -23.120 1.00 40.29  ? 350 ILE A C     1 
ATOM   1920 O O     . ILE D 4 148 ? 109.261 -67.668  -23.254 1.00 39.92  ? 350 ILE A O     1 
ATOM   1921 C CB    . ILE D 4 148 ? 109.857 -65.124  -24.949 1.00 102.66 ? 350 ILE A CB    1 
ATOM   1922 C CG1   . ILE D 4 148 ? 110.353 -64.701  -26.339 1.00 102.67 ? 350 ILE A CG1   1 
ATOM   1923 C CG2   . ILE D 4 148 ? 109.816 -63.910  -24.035 1.00 102.93 ? 350 ILE A CG2   1 
ATOM   1924 C CD1   . ILE D 4 148 ? 109.320 -63.964  -27.188 1.00 102.65 ? 350 ILE A CD1   1 
ATOM   1925 N N     . ALA D 4 149 ? 110.618 -66.442  -21.933 1.00 42.34  ? 351 ALA A N     1 
ATOM   1926 C CA    . ALA D 4 149 ? 110.136 -67.008  -20.671 1.00 42.55  ? 351 ALA A CA    1 
ATOM   1927 C C     . ALA D 4 149 ? 108.766 -66.596  -20.157 1.00 42.56  ? 351 ALA A C     1 
ATOM   1928 O O     . ALA D 4 149 ? 108.061 -67.422  -19.565 1.00 42.72  ? 351 ALA A O     1 
ATOM   1929 C CB    . ALA D 4 149 ? 111.162 -66.791  -19.579 1.00 137.17 ? 351 ALA A CB    1 
ATOM   1930 N N     . ASN D 4 150 ? 108.394 -65.336  -20.380 1.00 87.52  ? 352 ASN A N     1 
ATOM   1931 C CA    . ASN D 4 150 ? 107.127 -64.802  -19.880 1.00 86.48  ? 352 ASN A CA    1 
ATOM   1932 C C     . ASN D 4 150 ? 106.426 -63.817  -20.811 1.00 84.50  ? 352 ASN A C     1 
ATOM   1933 O O     . ASN D 4 150 ? 106.213 -62.657  -20.446 1.00 84.14  ? 352 ASN A O     1 
ATOM   1934 C CB    . ASN D 4 150 ? 107.357 -64.156  -18.491 1.00 67.63  ? 352 ASN A CB    1 
ATOM   1935 C CG    . ASN D 4 150 ? 108.466 -63.077  -18.494 1.00 69.51  ? 352 ASN A CG    1 
ATOM   1936 O OD1   . ASN D 4 150 ? 109.548 -63.259  -19.067 1.00 69.55  ? 352 ASN A OD1   1 
ATOM   1937 N ND2   . ASN D 4 150 ? 108.182 -61.950  -17.847 1.00 69.94  ? 352 ASN A ND2   1 
ATOM   1938 N N     . PHE D 4 151 ? 106.011 -64.287  -21.986 1.00 31.15  ? 353 PHE A N     1 
ATOM   1939 C CA    . PHE D 4 151 ? 105.331 -63.424  -22.968 1.00 30.09  ? 353 PHE A CA    1 
ATOM   1940 C C     . PHE D 4 151 ? 104.008 -62.782  -22.482 1.00 27.54  ? 353 PHE A C     1 
ATOM   1941 O O     . PHE D 4 151 ? 103.690 -61.638  -22.843 1.00 26.86  ? 353 PHE A O     1 
ATOM   1942 C CB    . PHE D 4 151 ? 105.157 -64.140  -24.330 1.00 174.21 ? 353 PHE A CB    1 
ATOM   1943 C CG    . PHE D 4 151 ? 104.398 -65.449  -24.268 1.00 178.87 ? 353 PHE A CG    1 
ATOM   1944 C CD1   . PHE D 4 151 ? 103.063 -65.520  -24.714 1.00 180.53 ? 353 PHE A CD1   1 
ATOM   1945 C CD2   . PHE D 4 151 ? 105.017 -66.623  -23.791 1.00 180.58 ? 353 PHE A CD2   1 
ATOM   1946 C CE1   . PHE D 4 151 ? 102.344 -66.748  -24.689 1.00 181.85 ? 353 PHE A CE1   1 
ATOM   1947 C CE2   . PHE D 4 151 ? 104.316 -67.862  -23.757 1.00 181.44 ? 353 PHE A CE2   1 
ATOM   1948 C CZ    . PHE D 4 151 ? 102.974 -67.923  -24.207 1.00 182.55 ? 353 PHE A CZ    1 
ATOM   1949 N N     . LYS D 4 152 ? 103.290 -63.494  -21.613 1.00 31.43  ? 354 LYS A N     1 
ATOM   1950 C CA    . LYS D 4 152 ? 102.038 -62.998  -21.072 1.00 29.79  ? 354 LYS A CA    1 
ATOM   1951 C C     . LYS D 4 152 ? 102.238 -61.982  -19.946 1.00 29.08  ? 354 LYS A C     1 
ATOM   1952 O O     . LYS D 4 152 ? 102.763 -62.321  -18.870 1.00 29.98  ? 354 LYS A O     1 
ATOM   1953 C CB    . LYS D 4 152 ? 101.153 -64.156  -20.618 1.00 60.39  ? 354 LYS A CB    1 
ATOM   1954 C CG    . LYS D 4 152 ? 100.341 -64.765  -21.744 1.00 60.28  ? 354 LYS A CG    1 
ATOM   1955 C CD    . LYS D 4 152 ? 99.545  -65.970  -21.290 1.00 61.82  ? 354 LYS A CD    1 
ATOM   1956 C CE    . LYS D 4 152 ? 100.424 -67.217  -21.210 1.00 63.36  ? 354 LYS A CE    1 
ATOM   1957 N NZ    . LYS D 4 152 ? 99.646  -68.454  -20.903 1.00 65.84  ? 354 LYS A NZ    1 
ATOM   1958 N N     . ILE D 4 153 ? 101.820 -60.739  -20.235 1.00 43.78  ? 355 ILE A N     1 
ATOM   1959 C CA    . ILE D 4 153 ? 101.881 -59.559  -19.344 1.00 42.69  ? 355 ILE A CA    1 
ATOM   1960 C C     . ILE D 4 153 ? 101.107 -59.798  -18.053 1.00 42.84  ? 355 ILE A C     1 
ATOM   1961 O O     . ILE D 4 153 ? 100.052 -60.424  -18.083 1.00 43.45  ? 355 ILE A O     1 
ATOM   1962 C CB    . ILE D 4 153 ? 101.258 -58.287  -20.053 1.00 28.66  ? 355 ILE A CB    1 
ATOM   1963 C CG1   . ILE D 4 153 ? 102.033 -57.935  -21.322 1.00 28.65  ? 355 ILE A CG1   1 
ATOM   1964 C CG2   . ILE D 4 153 ? 101.205 -57.055  -19.128 1.00 28.51  ? 355 ILE A CG2   1 
ATOM   1965 C CD1   . ILE D 4 153 ? 103.459 -57.484  -21.103 1.00 25.55  ? 355 ILE A CD1   1 
ATOM   1966 N N     . GLU D 4 154 ? 101.614 -59.247  -16.948 1.00 28.75  ? 356 GLU A N     1 
ATOM   1967 C CA    . GLU D 4 154 ? 100.989 -59.373  -15.629 1.00 28.79  ? 356 GLU A CA    1 
ATOM   1968 C C     . GLU D 4 154 ? 99.554  -58.844  -15.612 1.00 28.12  ? 356 GLU A C     1 
ATOM   1969 O O     . GLU D 4 154 ? 99.333  -57.638  -15.787 1.00 29.17  ? 356 GLU A O     1 
ATOM   1970 C CB    . GLU D 4 154 ? 101.803 -58.644  -14.545 1.00 68.20  ? 356 GLU A CB    1 
ATOM   1971 C CG    . GLU D 4 154 ? 103.136 -59.285  -14.154 1.00 71.34  ? 356 GLU A CG    1 
ATOM   1972 C CD    . GLU D 4 154 ? 103.829 -58.588  -12.977 1.00 73.16  ? 356 GLU A CD    1 
ATOM   1973 O OE1   . GLU D 4 154 ? 103.477 -57.434  -12.621 1.00 73.89  ? 356 GLU A OE1   1 
ATOM   1974 O OE2   . GLU D 4 154 ? 104.753 -59.204  -12.404 1.00 73.68  ? 356 GLU A OE2   1 
ATOM   1975 N N     . PRO D 4 155 ? 98.557  -59.748  -15.460 1.00 40.84  ? 357 PRO A N     1 
ATOM   1976 C CA    . PRO D 4 155 ? 97.152  -59.346  -15.424 1.00 39.01  ? 357 PRO A CA    1 
ATOM   1977 C C     . PRO D 4 155 ? 96.908  -58.531  -14.161 1.00 37.42  ? 357 PRO A C     1 
ATOM   1978 O O     . PRO D 4 155 ? 97.520  -58.809  -13.123 1.00 37.62  ? 357 PRO A O     1 
ATOM   1979 C CB    . PRO D 4 155 ? 96.418  -60.692  -15.333 1.00 34.11  ? 357 PRO A CB    1 
ATOM   1980 C CG    . PRO D 4 155 ? 97.323  -61.615  -16.000 1.00 34.62  ? 357 PRO A CG    1 
ATOM   1981 C CD    . PRO D 4 155 ? 98.635  -61.217  -15.395 1.00 35.09  ? 357 PRO A CD    1 
ATOM   1982 N N     . PRO D 4 156 ? 96.037  -57.504  -14.233 1.00 36.09  ? 358 PRO A N     1 
ATOM   1983 C CA    . PRO D 4 156 ? 95.744  -56.677  -13.054 1.00 35.85  ? 358 PRO A CA    1 
ATOM   1984 C C     . PRO D 4 156 ? 95.220  -57.503  -11.889 1.00 35.26  ? 358 PRO A C     1 
ATOM   1985 O O     . PRO D 4 156 ? 94.633  -58.575  -12.081 1.00 35.32  ? 358 PRO A O     1 
ATOM   1986 C CB    . PRO D 4 156 ? 94.675  -55.707  -13.564 1.00 22.18  ? 358 PRO A CB    1 
ATOM   1987 C CG    . PRO D 4 156 ? 94.031  -56.455  -14.725 1.00 22.33  ? 358 PRO A CG    1 
ATOM   1988 C CD    . PRO D 4 156 ? 95.234  -57.062  -15.391 1.00 22.68  ? 358 PRO A CD    1 
ATOM   1989 N N     . GLY D 4 157 ? 95.494  -57.027  -10.687 1.00 31.61  ? 359 GLY A N     1 
ATOM   1990 C CA    . GLY D 4 157 ? 95.047  -57.730  -9.507  1.00 32.26  ? 359 GLY A CA    1 
ATOM   1991 C C     . GLY D 4 157 ? 95.412  -56.954  -8.280  1.00 32.57  ? 359 GLY A C     1 
ATOM   1992 O O     . GLY D 4 157 ? 95.374  -55.717  -8.252  1.00 31.48  ? 359 GLY A O     1 
ATOM   1993 N N     . LEU D 4 158 ? 95.728  -57.704  -7.240  1.00 55.86  ? 360 LEU A N     1 
ATOM   1994 C CA    . LEU D 4 158 ? 96.117  -57.118  -5.980  1.00 57.43  ? 360 LEU A CA    1 
ATOM   1995 C C     . LEU D 4 158 ? 97.541  -57.527  -5.641  1.00 58.66  ? 360 LEU A C     1 
ATOM   1996 O O     . LEU D 4 158 ? 98.109  -58.429  -6.275  1.00 59.14  ? 360 LEU A O     1 
ATOM   1997 C CB    . LEU D 4 158 ? 95.142  -57.545  -4.893  1.00 18.49  ? 360 LEU A CB    1 
ATOM   1998 C CG    . LEU D 4 158 ? 93.733  -56.967  -5.032  1.00 18.08  ? 360 LEU A CG    1 
ATOM   1999 C CD1   . LEU D 4 158 ? 92.738  -57.873  -4.337  1.00 17.63  ? 360 LEU A CD1   1 
ATOM   2000 C CD2   . LEU D 4 158 ? 93.694  -55.524  -4.514  1.00 18.35  ? 360 LEU A CD2   1 
ATOM   2001 N N     . PHE D 4 159 ? 98.120  -56.824  -4.668  1.00 26.15  ? 361 PHE A N     1 
ATOM   2002 C CA    . PHE D 4 159 ? 99.484  -57.071  -4.221  1.00 25.91  ? 361 PHE A CA    1 
ATOM   2003 C C     . PHE D 4 159 ? 99.560  -58.092  -3.083  1.00 26.29  ? 361 PHE A C     1 
ATOM   2004 O O     . PHE D 4 159 ? 99.171  -57.798  -1.960  1.00 24.98  ? 361 PHE A O     1 
ATOM   2005 C CB    . PHE D 4 159 ? 100.158 -55.741  -3.825  1.00 18.01  ? 361 PHE A CB    1 
ATOM   2006 C CG    . PHE D 4 159 ? 101.682 -55.810  -3.753  1.00 18.86  ? 361 PHE A CG    1 
ATOM   2007 C CD1   . PHE D 4 159 ? 102.351 -55.565  -2.538  1.00 18.31  ? 361 PHE A CD1   1 
ATOM   2008 C CD2   . PHE D 4 159 ? 102.452 -56.138  -4.898  1.00 19.84  ? 361 PHE A CD2   1 
ATOM   2009 C CE1   . PHE D 4 159 ? 103.749 -55.644  -2.455  1.00 18.52  ? 361 PHE A CE1   1 
ATOM   2010 C CE2   . PHE D 4 159 ? 103.857 -56.221  -4.829  1.00 18.87  ? 361 PHE A CE2   1 
ATOM   2011 C CZ    . PHE D 4 159 ? 104.505 -55.973  -3.598  1.00 20.14  ? 361 PHE A CZ    1 
ATOM   2012 N N     . ARG D 4 160 ? 100.055 -59.288  -3.408  1.00 20.41  ? 362 ARG A N     1 
ATOM   2013 C CA    . ARG D 4 160 ? 100.233 -60.372  -2.450  1.00 22.00  ? 362 ARG A CA    1 
ATOM   2014 C C     . ARG D 4 160 ? 101.648 -60.287  -1.856  1.00 22.35  ? 362 ARG A C     1 
ATOM   2015 O O     . ARG D 4 160 ? 102.472 -61.184  -2.061  1.00 23.20  ? 362 ARG A O     1 
ATOM   2016 N N     . GLY D 4 161 ? 101.935 -59.188  -1.156  1.00 35.63  ? 363 GLY A N     1 
ATOM   2017 C CA    . GLY D 4 161 ? 103.241 -58.996  -0.537  1.00 36.90  ? 363 GLY A CA    1 
ATOM   2018 C C     . GLY D 4 161 ? 103.339 -59.838  0.717   1.00 37.90  ? 363 GLY A C     1 
ATOM   2019 O O     . GLY D 4 161 ? 102.313 -60.078  1.361   1.00 37.05  ? 363 GLY A O     1 
ATOM   2020 N N     . ARG D 4 162 ? 104.553 -60.265  1.073   1.00 18.07  ? 364 ARG A N     1 
ATOM   2021 C CA    . ARG D 4 162 ? 104.789 -61.130  2.247   1.00 21.63  ? 364 ARG A CA    1 
ATOM   2022 C C     . ARG D 4 162 ? 104.851 -60.494  3.652   1.00 22.52  ? 364 ARG A C     1 
ATOM   2023 O O     . ARG D 4 162 ? 104.917 -59.272  3.789   1.00 22.89  ? 364 ARG A O     1 
ATOM   2024 C CB    . ARG D 4 162 ? 106.024 -62.016  2.000   1.00 117.92 ? 364 ARG A CB    1 
ATOM   2025 C CG    . ARG D 4 162 ? 105.781 -63.211  1.057   1.00 122.45 ? 364 ARG A CG    1 
ATOM   2026 C CD    . ARG D 4 162 ? 105.710 -62.830  -0.427  1.00 126.58 ? 364 ARG A CD    1 
ATOM   2027 N NE    . ARG D 4 162 ? 105.015 -63.846  -1.220  1.00 130.49 ? 364 ARG A NE    1 
ATOM   2028 C CZ    . ARG D 4 162 ? 105.565 -64.567  -2.196  1.00 132.39 ? 364 ARG A CZ    1 
ATOM   2029 N NH1   . ARG D 4 162 ? 106.841 -64.404  -2.531  1.00 133.81 ? 364 ARG A NH1   1 
ATOM   2030 N NH2   . ARG D 4 162 ? 104.830 -65.462  -2.840  1.00 132.69 ? 364 ARG A NH2   1 
ATOM   2031 N N     . GLY D 4 163 ? 104.737 -61.344  4.678   1.00 121.70 ? 365 GLY A N     1 
ATOM   2032 C CA    . GLY D 4 163 ? 104.794 -60.930  6.078   1.00 123.07 ? 365 GLY A CA    1 
ATOM   2033 C C     . GLY D 4 163 ? 103.860 -59.834  6.561   1.00 123.73 ? 365 GLY A C     1 
ATOM   2034 O O     . GLY D 4 163 ? 102.693 -60.090  6.868   1.00 124.87 ? 365 GLY A O     1 
ATOM   2035 N N     . ASN D 4 164 ? 104.404 -58.620  6.649   1.00 85.17  ? 366 ASN A N     1 
ATOM   2036 C CA    . ASN D 4 164 ? 103.669 -57.434  7.084   1.00 85.28  ? 366 ASN A CA    1 
ATOM   2037 C C     . ASN D 4 164 ? 104.029 -56.267  6.167   1.00 85.20  ? 366 ASN A C     1 
ATOM   2038 O O     . ASN D 4 164 ? 104.462 -55.214  6.641   1.00 86.15  ? 366 ASN A O     1 
ATOM   2039 N N     . HIS D 4 165 ? 103.815 -56.470  4.861   1.00 37.41  ? 367 HIS A N     1 
ATOM   2040 C CA    . HIS D 4 165 ? 104.111 -55.496  3.801   1.00 37.83  ? 367 HIS A CA    1 
ATOM   2041 C C     . HIS D 4 165 ? 103.126 -54.326  3.770   1.00 38.22  ? 367 HIS A C     1 
ATOM   2042 O O     . HIS D 4 165 ? 101.987 -54.512  3.375   1.00 38.53  ? 367 HIS A O     1 
ATOM   2043 C CB    . HIS D 4 165 ? 104.112 -56.209  2.446   1.00 47.82  ? 367 HIS A CB    1 
ATOM   2044 C CG    . HIS D 4 165 ? 104.979 -55.551  1.423   1.00 49.69  ? 367 HIS A CG    1 
ATOM   2045 N ND1   . HIS D 4 165 ? 104.784 -54.249  1.010   1.00 51.11  ? 367 HIS A ND1   1 
ATOM   2046 C CD2   . HIS D 4 165 ? 106.049 -56.010  0.731   1.00 50.26  ? 367 HIS A CD2   1 
ATOM   2047 C CE1   . HIS D 4 165 ? 105.696 -53.938  0.107   1.00 51.67  ? 367 HIS A CE1   1 
ATOM   2048 N NE2   . HIS D 4 165 ? 106.477 -54.989  -0.081  1.00 51.62  ? 367 HIS A NE2   1 
ATOM   2049 N N     . PRO D 4 166 ? 103.580 -53.091  4.095   1.00 32.54  ? 368 PRO A N     1 
ATOM   2050 C CA    . PRO D 4 166 ? 102.726 -51.889  4.111   1.00 33.46  ? 368 PRO A CA    1 
ATOM   2051 C C     . PRO D 4 166 ? 101.980 -51.465  2.838   1.00 33.55  ? 368 PRO A C     1 
ATOM   2052 O O     . PRO D 4 166 ? 101.137 -50.557  2.877   1.00 33.42  ? 368 PRO A O     1 
ATOM   2053 C CB    . PRO D 4 166 ? 103.684 -50.797  4.599   1.00 109.10 ? 368 PRO A CB    1 
ATOM   2054 C CG    . PRO D 4 166 ? 104.998 -51.260  4.110   1.00 108.86 ? 368 PRO A CG    1 
ATOM   2055 C CD    . PRO D 4 166 ? 104.952 -52.717  4.473   1.00 108.23 ? 368 PRO A CD    1 
ATOM   2056 N N     . LYS D 4 167 ? 102.300 -52.112  1.722   1.00 56.85  ? 369 LYS A N     1 
ATOM   2057 C CA    . LYS D 4 167 ? 101.650 -51.802  0.462   1.00 57.96  ? 369 LYS A CA    1 
ATOM   2058 C C     . LYS D 4 167 ? 100.872 -52.991  -0.122  1.00 58.64  ? 369 LYS A C     1 
ATOM   2059 O O     . LYS D 4 167 ? 100.654 -53.057  -1.332  1.00 59.17  ? 369 LYS A O     1 
ATOM   2060 C CB    . LYS D 4 167 ? 102.661 -51.235  -0.544  1.00 30.12  ? 369 LYS A CB    1 
ATOM   2061 C CG    . LYS D 4 167 ? 102.931 -49.731  -0.430  1.00 31.33  ? 369 LYS A CG    1 
ATOM   2062 C CD    . LYS D 4 167 ? 103.915 -49.294  -1.520  1.00 32.49  ? 369 LYS A CD    1 
ATOM   2063 C CE    . LYS D 4 167 ? 104.114 -47.791  -1.574  1.00 32.60  ? 369 LYS A CE    1 
ATOM   2064 N NZ    . LYS D 4 167 ? 105.094 -47.471  -2.655  1.00 34.62  ? 369 LYS A NZ    1 
ATOM   2065 N N     . MET D 4 168 ? 100.430 -53.917  0.734   1.00 44.42  ? 370 MET A N     1 
ATOM   2066 C CA    . MET D 4 168 ? 99.648  -55.070  0.272   1.00 45.11  ? 370 MET A CA    1 
ATOM   2067 C C     . MET D 4 168 ? 98.183  -54.688  0.113   1.00 44.00  ? 370 MET A C     1 
ATOM   2068 O O     . MET D 4 168 ? 97.632  -53.967  0.945   1.00 42.63  ? 370 MET A O     1 
ATOM   2069 C CB    . MET D 4 168 ? 99.807  -56.294  1.189   1.00 106.62 ? 370 MET A CB    1 
ATOM   2070 C CG    . MET D 4 168 ? 99.324  -56.136  2.625   1.00 109.41 ? 370 MET A CG    1 
ATOM   2071 S SD    . MET D 4 168 ? 99.126  -57.723  3.440   1.00 112.52 ? 370 MET A SD    1 
ATOM   2072 C CE    . MET D 4 168 ? 100.831 -58.182  3.715   1.00 111.03 ? 370 MET A CE    1 
ATOM   2073 N N     . GLY D 4 169 ? 97.584  -55.116  -0.994  1.00 52.78  ? 371 GLY A N     1 
ATOM   2074 C CA    . GLY D 4 169 ? 96.193  -54.800  -1.264  1.00 53.32  ? 371 GLY A CA    1 
ATOM   2075 C C     . GLY D 4 169 ? 95.993  -53.504  -2.017  1.00 53.61  ? 371 GLY A C     1 
ATOM   2076 O O     . GLY D 4 169 ? 94.988  -52.820  -1.814  1.00 53.93  ? 371 GLY A O     1 
ATOM   2077 N N     . MET D 4 170 ? 96.975  -53.144  -2.843  1.00 46.86  ? 372 MET A N     1 
ATOM   2078 C CA    . MET D 4 170 ? 96.901  -51.937  -3.657  1.00 47.29  ? 372 MET A CA    1 
ATOM   2079 C C     . MET D 4 170 ? 96.523  -52.285  -5.098  1.00 46.66  ? 372 MET A C     1 
ATOM   2080 O O     . MET D 4 170 ? 96.736  -53.422  -5.555  1.00 46.48  ? 372 MET A O     1 
ATOM   2081 C CB    . MET D 4 170 ? 98.212  -51.145  -3.594  1.00 60.18  ? 372 MET A CB    1 
ATOM   2082 C CG    . MET D 4 170 ? 98.411  -50.401  -2.267  1.00 62.51  ? 372 MET A CG    1 
ATOM   2083 S SD    . MET D 4 170 ? 99.810  -49.240  -2.204  1.00 64.88  ? 372 MET A SD    1 
ATOM   2084 C CE    . MET D 4 170 ? 99.034  -47.734  -2.801  1.00 63.80  ? 372 MET A CE    1 
ATOM   2085 N N     . LEU D 4 171 ? 95.914  -51.322  -5.792  1.00 115.38 ? 373 LEU A N     1 
ATOM   2086 C CA    . LEU D 4 171 ? 95.485  -51.522  -7.171  1.00 114.40 ? 373 LEU A CA    1 
ATOM   2087 C C     . LEU D 4 171 ? 96.658  -51.560  -8.141  1.00 113.73 ? 373 LEU A C     1 
ATOM   2088 O O     . LEU D 4 171 ? 97.238  -50.532  -8.494  1.00 115.29 ? 373 LEU A O     1 
ATOM   2089 C CB    . LEU D 4 171 ? 94.451  -50.465  -7.586  1.00 99.02  ? 373 LEU A CB    1 
ATOM   2090 C CG    . LEU D 4 171 ? 93.806  -50.550  -8.981  1.00 99.12  ? 373 LEU A CG    1 
ATOM   2091 C CD1   . LEU D 4 171 ? 93.091  -51.890  -9.190  1.00 99.11  ? 373 LEU A CD1   1 
ATOM   2092 C CD2   . LEU D 4 171 ? 92.851  -49.368  -9.175  1.00 100.88 ? 373 LEU A CD2   1 
ATOM   2093 N N     . LYS D 4 172 ? 97.003  -52.786  -8.519  1.00 7.50   ? 374 LYS A N     1 
ATOM   2094 C CA    . LYS D 4 172 ? 98.076  -53.106  -9.451  1.00 7.01   ? 374 LYS A CA    1 
ATOM   2095 C C     . LYS D 4 172 ? 97.375  -53.100  -10.835 1.00 6.49   ? 374 LYS A C     1 
ATOM   2096 O O     . LYS D 4 172 ? 97.188  -54.150  -11.451 1.00 6.89   ? 374 LYS A O     1 
ATOM   2097 C CB    . LYS D 4 172 ? 98.592  -54.506  -9.065  1.00 90.46  ? 374 LYS A CB    1 
ATOM   2098 C CG    . LYS D 4 172 ? 99.739  -55.104  -9.870  1.00 91.04  ? 374 LYS A CG    1 
ATOM   2099 C CD    . LYS D 4 172 ? 99.903  -56.569  -9.480  1.00 91.89  ? 374 LYS A CD    1 
ATOM   2100 C CE    . LYS D 4 172 ? 100.779 -57.333  -10.459 1.00 92.28  ? 374 LYS A CE    1 
ATOM   2101 N NZ    . LYS D 4 172 ? 100.665 -58.809  -10.246 1.00 91.07  ? 374 LYS A NZ    1 
ATOM   2102 N N     . ARG D 4 173 ? 97.003  -51.906  -11.311 1.00 26.40  ? 375 ARG A N     1 
ATOM   2103 C CA    . ARG D 4 173 ? 96.269  -51.705  -12.578 1.00 26.14  ? 375 ARG A CA    1 
ATOM   2104 C C     . ARG D 4 173 ? 96.737  -52.403  -13.862 1.00 26.59  ? 375 ARG A C     1 
ATOM   2105 O O     . ARG D 4 173 ? 97.878  -52.882  -13.943 1.00 24.91  ? 375 ARG A O     1 
ATOM   2106 C CB    . ARG D 4 173 ? 96.056  -50.214  -12.843 1.00 90.80  ? 375 ARG A CB    1 
ATOM   2107 C CG    . ARG D 4 173 ? 97.323  -49.412  -12.826 1.00 90.91  ? 375 ARG A CG    1 
ATOM   2108 C CD    . ARG D 4 173 ? 97.173  -48.105  -13.563 1.00 91.33  ? 375 ARG A CD    1 
ATOM   2109 N NE    . ARG D 4 173 ? 98.362  -47.854  -14.374 1.00 91.72  ? 375 ARG A NE    1 
ATOM   2110 C CZ    . ARG D 4 173 ? 98.463  -48.128  -15.672 1.00 92.47  ? 375 ARG A CZ    1 
ATOM   2111 N NH1   . ARG D 4 173 ? 97.436  -48.651  -16.335 1.00 92.50  ? 375 ARG A NH1   1 
ATOM   2112 N NH2   . ARG D 4 173 ? 99.624  -47.953  -16.291 1.00 91.79  ? 375 ARG A NH2   1 
ATOM   2113 N N     . ARG D 4 174 ? 95.813  -52.495  -14.831 1.00 48.88  ? 376 ARG A N     1 
ATOM   2114 C CA    . ARG D 4 174 ? 96.048  -53.134  -16.137 1.00 51.26  ? 376 ARG A CA    1 
ATOM   2115 C C     . ARG D 4 174 ? 97.016  -52.357  -16.972 1.00 51.06  ? 376 ARG A C     1 
ATOM   2116 O O     . ARG D 4 174 ? 96.831  -51.163  -17.216 1.00 51.90  ? 376 ARG A O     1 
ATOM   2117 C CB    . ARG D 4 174 ? 94.744  -53.333  -16.941 1.00 91.42  ? 376 ARG A CB    1 
ATOM   2118 C CG    . ARG D 4 174 ? 94.922  -54.170  -18.239 1.00 96.04  ? 376 ARG A CG    1 
ATOM   2119 C CD    . ARG D 4 174 ? 93.631  -54.355  -19.027 1.00 100.48 ? 376 ARG A CD    1 
ATOM   2120 N NE    . ARG D 4 174 ? 92.662  -55.213  -18.342 1.00 104.60 ? 376 ARG A NE    1 
ATOM   2121 C CZ    . ARG D 4 174 ? 92.192  -56.366  -18.820 1.00 105.94 ? 376 ARG A CZ    1 
ATOM   2122 N NH1   . ARG D 4 174 ? 92.593  -56.827  -19.998 1.00 105.42 ? 376 ARG A NH1   1 
ATOM   2123 N NH2   . ARG D 4 174 ? 91.313  -57.066  -18.116 1.00 107.59 ? 376 ARG A NH2   1 
ATOM   2124 N N     . ILE D 4 175 ? 98.026  -53.072  -17.444 1.00 81.40  ? 377 ILE A N     1 
ATOM   2125 C CA    . ILE D 4 175 ? 99.057  -52.481  -18.268 1.00 80.28  ? 377 ILE A CA    1 
ATOM   2126 C C     . ILE D 4 175 ? 98.502  -52.303  -19.670 1.00 79.86  ? 377 ILE A C     1 
ATOM   2127 O O     . ILE D 4 175 ? 97.986  -53.252  -20.276 1.00 80.35  ? 377 ILE A O     1 
ATOM   2128 C CB    . ILE D 4 175 ? 100.339 -53.351  -18.287 1.00 40.98  ? 377 ILE A CB    1 
ATOM   2129 C CG1   . ILE D 4 175 ? 100.763 -53.761  -16.857 1.00 40.68  ? 377 ILE A CG1   1 
ATOM   2130 C CG2   . ILE D 4 175 ? 101.466 -52.619  -18.999 1.00 40.32  ? 377 ILE A CG2   1 
ATOM   2131 C CD1   . ILE D 4 175 ? 101.010 -52.609  -15.840 1.00 40.24  ? 377 ILE A CD1   1 
ATOM   2132 N N     . MET D 4 176 ? 98.518  -51.046  -20.110 1.00 41.69  ? 378 MET A N     1 
ATOM   2133 C CA    . MET D 4 176 ? 98.042  -50.646  -21.430 1.00 40.80  ? 378 MET A CA    1 
ATOM   2134 C C     . MET D 4 176 ? 99.223  -50.650  -22.412 1.00 39.33  ? 378 MET A C     1 
ATOM   2135 O O     . MET D 4 176 ? 100.384 -50.617  -21.976 1.00 38.77  ? 378 MET A O     1 
ATOM   2136 C CB    . MET D 4 176 ? 97.364  -49.267  -21.343 1.00 95.47  ? 378 MET A CB    1 
ATOM   2137 C CG    . MET D 4 176 ? 96.063  -49.283  -20.549 1.00 98.73  ? 378 MET A CG    1 
ATOM   2138 S SD    . MET D 4 176 ? 94.982  -50.672  -20.995 1.00 101.67 ? 378 MET A SD    1 
ATOM   2139 C CE    . MET D 4 176 ? 93.742  -49.845  -21.969 1.00 100.88 ? 378 MET A CE    1 
ATOM   2140 N N     . PRO D 4 177 ? 98.957  -50.779  -23.737 1.00 36.87  ? 379 PRO A N     1 
ATOM   2141 C CA    . PRO D 4 177 ? 100.038 -50.789  -24.733 1.00 36.43  ? 379 PRO A CA    1 
ATOM   2142 C C     . PRO D 4 177 ? 100.947 -49.565  -24.745 1.00 36.39  ? 379 PRO A C     1 
ATOM   2143 O O     . PRO D 4 177 ? 102.030 -49.605  -25.313 1.00 37.00  ? 379 PRO A O     1 
ATOM   2144 C CB    . PRO D 4 177 ? 99.281  -50.910  -26.048 1.00 161.95 ? 379 PRO A CB    1 
ATOM   2145 C CG    . PRO D 4 177 ? 98.123  -51.744  -25.681 1.00 163.24 ? 379 PRO A CG    1 
ATOM   2146 C CD    . PRO D 4 177 ? 97.677  -51.145  -24.384 1.00 162.90 ? 379 PRO A CD    1 
ATOM   2147 N N     . GLU D 4 178 ? 100.519 -48.498  -24.077 1.00 42.04  ? 380 GLU A N     1 
ATOM   2148 C CA    . GLU D 4 178 ? 101.274 -47.252  -24.020 1.00 41.20  ? 380 GLU A CA    1 
ATOM   2149 C C     . GLU D 4 178 ? 102.263 -47.157  -22.862 1.00 40.35  ? 380 GLU A C     1 
ATOM   2150 O O     . GLU D 4 178 ? 102.974 -46.166  -22.747 1.00 41.31  ? 380 GLU A O     1 
ATOM   2151 C CB    . GLU D 4 178 ? 100.315 -46.053  -23.997 1.00 101.05 ? 380 GLU A CB    1 
ATOM   2152 C CG    . GLU D 4 178 ? 99.347  -45.965  -25.184 1.00 100.85 ? 380 GLU A CG    1 
ATOM   2153 C CD    . GLU D 4 178 ? 97.984  -46.593  -24.910 1.00 100.82 ? 380 GLU A CD    1 
ATOM   2154 O OE1   . GLU D 4 178 ? 97.909  -47.775  -24.512 1.00 101.52 ? 380 GLU A OE1   1 
ATOM   2155 O OE2   . GLU D 4 178 ? 96.967  -45.908  -25.129 1.00 99.73  ? 380 GLU A OE2   1 
ATOM   2156 N N     . ASP D 4 179 ? 102.295 -48.171  -21.999 1.00 50.22  ? 381 ASP A N     1 
ATOM   2157 C CA    . ASP D 4 179 ? 103.211 -48.187  -20.849 1.00 50.42  ? 381 ASP A CA    1 
ATOM   2158 C C     . ASP D 4 179 ? 104.449 -49.004  -21.210 1.00 49.35  ? 381 ASP A C     1 
ATOM   2159 O O     . ASP D 4 179 ? 105.519 -48.861  -20.612 1.00 49.03  ? 381 ASP A O     1 
ATOM   2160 C CB    . ASP D 4 179 ? 102.537 -48.814  -19.616 1.00 139.95 ? 381 ASP A CB    1 
ATOM   2161 C CG    . ASP D 4 179 ? 101.230 -48.128  -19.230 1.00 141.19 ? 381 ASP A CG    1 
ATOM   2162 O OD1   . ASP D 4 179 ? 101.214 -46.889  -19.057 1.00 142.40 ? 381 ASP A OD1   1 
ATOM   2163 O OD2   . ASP D 4 179 ? 100.216 -48.842  -19.077 1.00 141.57 ? 381 ASP A OD2   1 
ATOM   2164 N N     . ILE D 4 180 ? 104.271 -49.822  -22.239 1.00 40.79  ? 382 ILE A N     1 
ATOM   2165 C CA    . ILE D 4 180 ? 105.261 -50.741  -22.779 1.00 39.04  ? 382 ILE A CA    1 
ATOM   2166 C C     . ILE D 4 180 ? 106.402 -50.074  -23.562 1.00 38.71  ? 382 ILE A C     1 
ATOM   2167 O O     . ILE D 4 180 ? 106.190 -49.091  -24.275 1.00 40.07  ? 382 ILE A O     1 
ATOM   2168 C CB    . ILE D 4 180 ? 104.515 -51.763  -23.691 1.00 27.06  ? 382 ILE A CB    1 
ATOM   2169 C CG1   . ILE D 4 180 ? 103.433 -52.500  -22.903 1.00 26.64  ? 382 ILE A CG1   1 
ATOM   2170 C CG2   . ILE D 4 180 ? 105.458 -52.741  -24.352 1.00 27.55  ? 382 ILE A CG2   1 
ATOM   2171 C CD1   . ILE D 4 180 ? 103.952 -53.376  -21.770 1.00 25.00  ? 382 ILE A CD1   1 
ATOM   2172 N N     . ILE D 4 181 ? 107.613 -50.608  -23.388 1.00 40.58  ? 383 ILE A N     1 
ATOM   2173 C CA    . ILE D 4 181 ? 108.806 -50.140  -24.093 1.00 38.55  ? 383 ILE A CA    1 
ATOM   2174 C C     . ILE D 4 181 ? 109.412 -51.365  -24.782 1.00 37.72  ? 383 ILE A C     1 
ATOM   2175 O O     . ILE D 4 181 ? 109.900 -52.292  -24.129 1.00 38.19  ? 383 ILE A O     1 
ATOM   2176 C CB    . ILE D 4 181 ? 109.862 -49.506  -23.147 1.00 38.97  ? 383 ILE A CB    1 
ATOM   2177 C CG1   . ILE D 4 181 ? 109.253 -48.349  -22.348 1.00 38.39  ? 383 ILE A CG1   1 
ATOM   2178 C CG2   . ILE D 4 181 ? 111.035 -48.965  -23.971 1.00 39.44  ? 383 ILE A CG2   1 
ATOM   2179 C CD1   . ILE D 4 181 ? 110.011 -47.982  -21.088 1.00 39.49  ? 383 ILE A CD1   1 
ATOM   2180 N N     . ILE D 4 182 ? 109.379 -51.349  -26.107 1.00 21.05  ? 384 ILE A N     1 
ATOM   2181 C CA    . ILE D 4 182 ? 109.903 -52.438  -26.923 1.00 20.12  ? 384 ILE A CA    1 
ATOM   2182 C C     . ILE D 4 182 ? 111.379 -52.234  -27.219 1.00 20.42  ? 384 ILE A C     1 
ATOM   2183 O O     . ILE D 4 182 ? 111.820 -51.126  -27.525 1.00 20.75  ? 384 ILE A O     1 
ATOM   2184 C CB    . ILE D 4 182 ? 109.102 -52.541  -28.243 1.00 35.52  ? 384 ILE A CB    1 
ATOM   2185 C CG1   . ILE D 4 182 ? 107.628 -52.810  -27.937 1.00 35.89  ? 384 ILE A CG1   1 
ATOM   2186 C CG2   . ILE D 4 182 ? 109.675 -53.595  -29.194 1.00 34.71  ? 384 ILE A CG2   1 
ATOM   2187 C CD1   . ILE D 4 182 ? 107.291 -54.181  -27.428 1.00 36.50  ? 384 ILE A CD1   1 
ATOM   2188 N N     . ASN D 4 183 ? 112.116 -53.333  -27.173 1.00 27.16  ? 385 ASN A N     1 
ATOM   2189 C CA    . ASN D 4 183 ? 113.544 -53.334  -27.429 1.00 29.95  ? 385 ASN A CA    1 
ATOM   2190 C C     . ASN D 4 183 ? 113.890 -54.358  -28.512 1.00 32.07  ? 385 ASN A C     1 
ATOM   2191 O O     . ASN D 4 183 ? 113.499 -55.526  -28.410 1.00 32.00  ? 385 ASN A O     1 
ATOM   2192 C CB    . ASN D 4 183 ? 114.280 -53.654  -26.114 1.00 35.03  ? 385 ASN A CB    1 
ATOM   2193 C CG    . ASN D 4 183 ? 115.795 -53.664  -26.248 1.00 34.90  ? 385 ASN A CG    1 
ATOM   2194 O OD1   . ASN D 4 183 ? 116.456 -52.635  -26.090 1.00 33.95  ? 385 ASN A OD1   1 
ATOM   2195 N ND2   . ASN D 4 183 ? 116.353 -54.841  -26.500 1.00 34.79  ? 385 ASN A ND2   1 
ATOM   2196 N N     . CYS D 4 184 ? 114.557 -53.875  -29.566 1.00 55.07  ? 386 CYS A N     1 
ATOM   2197 C CA    . CYS D 4 184 ? 115.067 -54.658  -30.712 1.00 58.37  ? 386 CYS A CA    1 
ATOM   2198 C C     . CYS D 4 184 ? 115.772 -53.750  -31.703 1.00 60.55  ? 386 CYS A C     1 
ATOM   2199 O O     . CYS D 4 184 ? 115.547 -52.541  -31.694 1.00 61.23  ? 386 CYS A O     1 
ATOM   2200 C CB    . CYS D 4 184 ? 114.016 -55.529  -31.425 1.00 70.59  ? 386 CYS A CB    1 
ATOM   2201 S SG    . CYS D 4 184 ? 112.406 -54.836  -31.710 1.00 73.77  ? 386 CYS A SG    1 
ATOM   2202 N N     . SER D 4 185 ? 116.638 -54.341  -32.529 1.00 79.86  ? 387 SER A N     1 
ATOM   2203 C CA    . SER D 4 185 ? 117.442 -53.634  -33.538 1.00 82.80  ? 387 SER A CA    1 
ATOM   2204 C C     . SER D 4 185 ? 116.661 -52.827  -34.585 1.00 85.30  ? 387 SER A C     1 
ATOM   2205 O O     . SER D 4 185 ? 115.564 -53.226  -34.990 1.00 85.58  ? 387 SER A O     1 
ATOM   2206 C CB    . SER D 4 185 ? 118.398 -54.620  -34.211 1.00 36.61  ? 387 SER A CB    1 
ATOM   2207 O OG    . SER D 4 185 ? 117.922 -55.954  -34.082 1.00 35.62  ? 387 SER A OG    1 
ATOM   2208 N N     . LYS D 4 186 ? 117.248 -51.700  -35.012 1.00 117.74 ? 388 LYS A N     1 
ATOM   2209 C CA    . LYS D 4 186 ? 116.653 -50.762  -35.983 1.00 119.86 ? 388 LYS A CA    1 
ATOM   2210 C C     . LYS D 4 186 ? 116.696 -51.160  -37.456 1.00 119.84 ? 388 LYS A C     1 
ATOM   2211 O O     . LYS D 4 186 ? 116.540 -50.316  -38.343 1.00 119.64 ? 388 LYS A O     1 
ATOM   2212 N N     . ASP D 4 187 ? 116.896 -52.453  -37.689 1.00 86.57  ? 389 ASP A N     1 
ATOM   2213 C CA    . ASP D 4 187 ? 116.966 -53.057  -39.018 1.00 86.52  ? 389 ASP A CA    1 
ATOM   2214 C C     . ASP D 4 187 ? 116.218 -54.396  -38.968 1.00 86.41  ? 389 ASP A C     1 
ATOM   2215 O O     . ASP D 4 187 ? 116.602 -55.383  -39.606 1.00 86.80  ? 389 ASP A O     1 
ATOM   2216 C CB    . ASP D 4 187 ? 118.437 -53.231  -39.447 1.00 127.11 ? 389 ASP A CB    1 
ATOM   2217 C CG    . ASP D 4 187 ? 119.338 -53.703  -38.308 1.00 126.25 ? 389 ASP A CG    1 
ATOM   2218 O OD1   . ASP D 4 187 ? 119.608 -52.903  -37.385 1.00 124.79 ? 389 ASP A OD1   1 
ATOM   2219 O OD2   . ASP D 4 187 ? 119.770 -54.871  -38.335 1.00 126.75 ? 389 ASP A OD2   1 
ATOM   2220 N N     . ALA D 4 188 ? 115.126 -54.391  -38.205 1.00 122.36 ? 390 ALA A N     1 
ATOM   2221 C CA    . ALA D 4 188 ? 114.275 -55.561  -38.004 1.00 121.73 ? 390 ALA A CA    1 
ATOM   2222 C C     . ALA D 4 188 ? 112.802 -55.237  -38.208 1.00 120.83 ? 390 ALA A C     1 
ATOM   2223 O O     . ALA D 4 188 ? 112.412 -54.066  -38.273 1.00 120.84 ? 390 ALA A O     1 
ATOM   2224 C CB    . ALA D 4 188 ? 114.480 -56.110  -36.599 1.00 34.74  ? 390 ALA A CB    1 
ATOM   2225 N N     . LYS D 4 189 ? 111.995 -56.295  -38.297 1.00 84.90  ? 391 LYS A N     1 
ATOM   2226 C CA    . LYS D 4 189 ? 110.548 -56.194  -38.464 1.00 84.12  ? 391 LYS A CA    1 
ATOM   2227 C C     . LYS D 4 189 ? 109.957 -55.981  -37.065 1.00 84.11  ? 391 LYS A C     1 
ATOM   2228 O O     . LYS D 4 189 ? 109.795 -56.921  -36.272 1.00 84.39  ? 391 LYS A O     1 
ATOM   2229 C CB    . LYS D 4 189 ? 109.988 -57.470  -39.109 1.00 68.23  ? 391 LYS A CB    1 
ATOM   2230 C CG    . LYS D 4 189 ? 109.142 -57.238  -40.369 1.00 67.23  ? 391 LYS A CG    1 
ATOM   2231 C CD    . LYS D 4 189 ? 108.213 -58.429  -40.685 1.00 65.89  ? 391 LYS A CD    1 
ATOM   2232 C CE    . LYS D 4 189 ? 108.942 -59.648  -41.244 1.00 64.97  ? 391 LYS A CE    1 
ATOM   2233 N NZ    . LYS D 4 189 ? 109.382 -59.418  -42.636 1.00 64.64  ? 391 LYS A NZ    1 
ATOM   2234 N N     . VAL D 4 190 ? 109.691 -54.710  -36.777 1.00 87.87  ? 392 VAL A N     1 
ATOM   2235 C CA    . VAL D 4 190 ? 109.158 -54.214  -35.505 1.00 87.63  ? 392 VAL A CA    1 
ATOM   2236 C C     . VAL D 4 190 ? 107.691 -54.639  -35.225 1.00 87.16  ? 392 VAL A C     1 
ATOM   2237 O O     . VAL D 4 190 ? 106.867 -54.643  -36.149 1.00 87.51  ? 392 VAL A O     1 
ATOM   2238 C CB    . VAL D 4 190 ? 109.289 -52.648  -35.480 1.00 68.52  ? 392 VAL A CB    1 
ATOM   2239 C CG1   . VAL D 4 190 ? 109.032 -52.081  -34.082 1.00 68.68  ? 392 VAL A CG1   1 
ATOM   2240 C CG2   . VAL D 4 190 ? 110.676 -52.221  -35.974 1.00 67.80  ? 392 VAL A CG2   1 
ATOM   2241 N N     . PRO D 4 191 ? 107.372 -55.066  -33.969 1.00 41.64  ? 393 PRO A N     1 
ATOM   2242 C CA    . PRO D 4 191 ? 106.014 -55.482  -33.585 1.00 41.11  ? 393 PRO A CA    1 
ATOM   2243 C C     . PRO D 4 191 ? 104.942 -54.403  -33.749 1.00 39.93  ? 393 PRO A C     1 
ATOM   2244 O O     . PRO D 4 191 ? 105.072 -53.293  -33.226 1.00 39.39  ? 393 PRO A O     1 
ATOM   2245 C CB    . PRO D 4 191 ? 106.174 -55.843  -32.113 1.00 89.51  ? 393 PRO A CB    1 
ATOM   2246 C CG    . PRO D 4 191 ? 107.500 -56.407  -32.070 1.00 88.78  ? 393 PRO A CG    1 
ATOM   2247 C CD    . PRO D 4 191 ? 108.319 -55.465  -32.905 1.00 89.42  ? 393 PRO A CD    1 
ATOM   2248 N N     . SER D 4 192 ? 103.887 -54.764  -34.478 1.00 47.08  ? 394 SER A N     1 
ATOM   2249 C CA    . SER D 4 192 ? 102.750 -53.895  -34.760 1.00 46.69  ? 394 SER A CA    1 
ATOM   2250 C C     . SER D 4 192 ? 101.927 -53.667  -33.495 1.00 46.10  ? 394 SER A C     1 
ATOM   2251 O O     . SER D 4 192 ? 101.390 -54.622  -32.929 1.00 45.24  ? 394 SER A O     1 
ATOM   2252 C CB    . SER D 4 192 ? 101.853 -54.533  -35.828 1.00 108.44 ? 394 SER A CB    1 
ATOM   2253 O OG    . SER D 4 192 ? 102.611 -55.018  -36.917 1.00 110.95 ? 394 SER A OG    1 
ATOM   2254 N N     . PRO D 4 193 ? 101.855 -52.406  -33.011 1.00 24.84  ? 395 PRO A N     1 
ATOM   2255 C CA    . PRO D 4 193 ? 101.106 -51.998  -31.812 1.00 25.99  ? 395 PRO A CA    1 
ATOM   2256 C C     . PRO D 4 193 ? 99.628  -52.382  -31.913 1.00 25.85  ? 395 PRO A C     1 
ATOM   2257 O O     . PRO D 4 193 ? 99.035  -52.219  -32.983 1.00 26.73  ? 395 PRO A O     1 
ATOM   2258 C CB    . PRO D 4 193 ? 101.253 -50.485  -31.830 1.00 16.38  ? 395 PRO A CB    1 
ATOM   2259 C CG    . PRO D 4 193 ? 102.582 -50.287  -32.424 1.00 16.11  ? 395 PRO A CG    1 
ATOM   2260 C CD    . PRO D 4 193 ? 102.587 -51.251  -33.565 1.00 16.26  ? 395 PRO A CD    1 
ATOM   2261 N N     . PRO D 4 194 ? 99.027  -52.927  -30.825 1.00 81.18  ? 396 PRO A N     1 
ATOM   2262 C CA    . PRO D 4 194 ? 97.614  -53.344  -30.780 1.00 82.13  ? 396 PRO A CA    1 
ATOM   2263 C C     . PRO D 4 194 ? 96.663  -52.242  -31.266 1.00 80.89  ? 396 PRO A C     1 
ATOM   2264 O O     . PRO D 4 194 ? 96.744  -51.111  -30.784 1.00 80.72  ? 396 PRO A O     1 
ATOM   2265 C CB    . PRO D 4 194 ? 97.416  -53.675  -29.306 1.00 72.14  ? 396 PRO A CB    1 
ATOM   2266 C CG    . PRO D 4 194 ? 98.734  -54.252  -28.948 1.00 72.47  ? 396 PRO A CG    1 
ATOM   2267 C CD    . PRO D 4 194 ? 99.671  -53.234  -29.535 1.00 71.67  ? 396 PRO A CD    1 
ATOM   2268 N N     . PRO D 4 195 ? 95.765  -52.561  -32.232 1.00 35.58  ? 397 PRO A N     1 
ATOM   2269 C CA    . PRO D 4 195 ? 94.778  -51.672  -32.859 1.00 36.11  ? 397 PRO A CA    1 
ATOM   2270 C C     . PRO D 4 195 ? 94.392  -50.336  -32.211 1.00 36.15  ? 397 PRO A C     1 
ATOM   2271 O O     . PRO D 4 195 ? 93.601  -50.298  -31.261 1.00 35.92  ? 397 PRO A O     1 
ATOM   2272 C CB    . PRO D 4 195 ? 93.587  -52.600  -33.050 1.00 135.32 ? 397 PRO A CB    1 
ATOM   2273 C CG    . PRO D 4 195 ? 94.256  -53.831  -33.523 1.00 134.87 ? 397 PRO A CG    1 
ATOM   2274 C CD    . PRO D 4 195 ? 95.455  -53.964  -32.597 1.00 134.94 ? 397 PRO A CD    1 
ATOM   2275 N N     . GLY D 4 196 ? 95.014  -49.259  -32.698 1.00 74.64  ? 398 GLY A N     1 
ATOM   2276 C CA    . GLY D 4 196 ? 94.726  -47.914  -32.211 1.00 75.41  ? 398 GLY A CA    1 
ATOM   2277 C C     . GLY D 4 196 ? 95.613  -47.271  -31.156 1.00 75.47  ? 398 GLY A C     1 
ATOM   2278 O O     . GLY D 4 196 ? 95.564  -46.050  -30.974 1.00 75.09  ? 398 GLY A O     1 
ATOM   2279 N N     . HIS D 4 197 ? 96.412  -48.073  -30.458 1.00 37.25  ? 399 HIS A N     1 
ATOM   2280 C CA    . HIS D 4 197 ? 97.293  -47.563  -29.417 1.00 37.92  ? 399 HIS A CA    1 
ATOM   2281 C C     . HIS D 4 197 ? 98.766  -47.489  -29.814 1.00 37.27  ? 399 HIS A C     1 
ATOM   2282 O O     . HIS D 4 197 ? 99.212  -48.212  -30.697 1.00 37.42  ? 399 HIS A O     1 
ATOM   2283 C CB    . HIS D 4 197 ? 97.117  -48.390  -28.146 1.00 146.89 ? 399 HIS A CB    1 
ATOM   2284 C CG    . HIS D 4 197 ? 95.872  -48.064  -27.381 1.00 149.23 ? 399 HIS A CG    1 
ATOM   2285 N ND1   . HIS D 4 197 ? 95.222  -46.853  -27.493 1.00 149.94 ? 399 HIS A ND1   1 
ATOM   2286 C CD2   . HIS D 4 197 ? 95.182  -48.774  -26.458 1.00 151.10 ? 399 HIS A CD2   1 
ATOM   2287 C CE1   . HIS D 4 197 ? 94.189  -46.830  -26.671 1.00 152.14 ? 399 HIS A CE1   1 
ATOM   2288 N NE2   . HIS D 4 197 ? 94.142  -47.984  -26.030 1.00 152.94 ? 399 HIS A NE2   1 
ATOM   2289 N N     . LYS D 4 198 ? 99.503  -46.587  -29.170 1.00 67.09  ? 400 LYS A N     1 
ATOM   2290 C CA    . LYS D 4 198 ? 100.938 -46.393  -29.419 1.00 66.48  ? 400 LYS A CA    1 
ATOM   2291 C C     . LYS D 4 198 ? 101.716 -47.082  -28.288 1.00 65.06  ? 400 LYS A C     1 
ATOM   2292 O O     . LYS D 4 198 ? 101.109 -47.641  -27.379 1.00 64.68  ? 400 LYS A O     1 
ATOM   2293 C CB    . LYS D 4 198 ? 101.280 -44.891  -29.397 1.00 116.39 ? 400 LYS A CB    1 
ATOM   2294 C CG    . LYS D 4 198 ? 100.285 -43.965  -30.092 1.00 117.83 ? 400 LYS A CG    1 
ATOM   2295 C CD    . LYS D 4 198 ? 100.778 -42.525  -30.118 1.00 119.35 ? 400 LYS A CD    1 
ATOM   2296 C CE    . LYS D 4 198 ? 99.842  -41.637  -30.926 1.00 119.67 ? 400 LYS A CE    1 
ATOM   2297 N NZ    . LYS D 4 198 ? 100.389 -40.262  -31.108 1.00 119.43 ? 400 LYS A NZ    1 
ATOM   2298 N N     . TRP D 4 199 ? 103.047 -47.099  -28.377 1.00 71.30  ? 401 TRP A N     1 
ATOM   2299 C CA    . TRP D 4 199 ? 103.888 -47.660  -27.311 1.00 69.42  ? 401 TRP A CA    1 
ATOM   2300 C C     . TRP D 4 199 ? 104.395 -46.460  -26.541 1.00 70.64  ? 401 TRP A C     1 
ATOM   2301 O O     . TRP D 4 199 ? 104.153 -45.327  -26.961 1.00 72.07  ? 401 TRP A O     1 
ATOM   2302 C CB    . TRP D 4 199 ? 105.125 -48.360  -27.847 1.00 35.86  ? 401 TRP A CB    1 
ATOM   2303 C CG    . TRP D 4 199 ? 104.949 -49.480  -28.801 1.00 32.77  ? 401 TRP A CG    1 
ATOM   2304 C CD1   . TRP D 4 199 ? 105.482 -49.549  -30.055 1.00 31.78  ? 401 TRP A CD1   1 
ATOM   2305 C CD2   . TRP D 4 199 ? 104.386 -50.767  -28.537 1.00 30.85  ? 401 TRP A CD2   1 
ATOM   2306 N NE1   . TRP D 4 199 ? 105.317 -50.801  -30.582 1.00 29.96  ? 401 TRP A NE1   1 
ATOM   2307 C CE2   . TRP D 4 199 ? 104.650 -51.576  -29.678 1.00 29.76  ? 401 TRP A CE2   1 
ATOM   2308 C CE3   . TRP D 4 199 ? 103.701 -51.331  -27.444 1.00 30.29  ? 401 TRP A CE3   1 
ATOM   2309 C CZ2   . TRP D 4 199 ? 104.255 -52.925  -29.762 1.00 30.31  ? 401 TRP A CZ2   1 
ATOM   2310 C CZ3   . TRP D 4 199 ? 103.302 -52.678  -27.514 1.00 29.54  ? 401 TRP A CZ3   1 
ATOM   2311 C CH2   . TRP D 4 199 ? 103.587 -53.463  -28.676 1.00 30.21  ? 401 TRP A CH2   1 
ATOM   2312 N N     . LYS D 4 200 ? 105.135 -46.681  -25.453 1.00 54.30  ? 402 LYS A N     1 
ATOM   2313 C CA    . LYS D 4 200 ? 105.681 -45.550  -24.703 1.00 55.54  ? 402 LYS A CA    1 
ATOM   2314 C C     . LYS D 4 200 ? 106.856 -45.035  -25.512 1.00 54.94  ? 402 LYS A C     1 
ATOM   2315 O O     . LYS D 4 200 ? 106.867 -43.873  -25.937 1.00 55.09  ? 402 LYS A O     1 
ATOM   2316 C CB    . LYS D 4 200 ? 106.150 -45.943  -23.297 1.00 132.59 ? 402 LYS A CB    1 
ATOM   2317 C CG    . LYS D 4 200 ? 106.491 -44.734  -22.420 1.00 136.44 ? 402 LYS A CG    1 
ATOM   2318 C CD    . LYS D 4 200 ? 107.152 -45.119  -21.112 1.00 138.66 ? 402 LYS A CD    1 
ATOM   2319 C CE    . LYS D 4 200 ? 107.637 -43.881  -20.374 1.00 140.11 ? 402 LYS A CE    1 
ATOM   2320 N NZ    . LYS D 4 200 ? 108.380 -44.223  -19.131 1.00 140.21 ? 402 LYS A NZ    1 
ATOM   2321 N N     . GLU D 4 201 ? 107.767 -45.955  -25.820 1.00 28.02  ? 403 GLU A N     1 
ATOM   2322 C CA    . GLU D 4 201 ? 108.979 -45.649  -26.576 1.00 28.96  ? 403 GLU A CA    1 
ATOM   2323 C C     . GLU D 4 201 ? 109.493 -46.946  -27.185 1.00 27.09  ? 403 GLU A C     1 
ATOM   2324 O O     . GLU D 4 201 ? 108.878 -48.006  -27.010 1.00 27.03  ? 403 GLU A O     1 
ATOM   2325 C CB    . GLU D 4 201 ? 110.041 -45.069  -25.628 1.00 153.49 ? 403 GLU A CB    1 
ATOM   2326 C CG    . GLU D 4 201 ? 111.114 -44.222  -26.290 1.00 159.25 ? 403 GLU A CG    1 
ATOM   2327 C CD    . GLU D 4 201 ? 112.298 -44.002  -25.380 1.00 162.24 ? 403 GLU A CD    1 
ATOM   2328 O OE1   . GLU D 4 201 ? 112.218 -43.111  -24.509 1.00 163.24 ? 403 GLU A OE1   1 
ATOM   2329 O OE2   . GLU D 4 201 ? 113.304 -44.729  -25.528 1.00 164.80 ? 403 GLU A OE2   1 
ATOM   2330 N N     . VAL D 4 202 ? 110.545 -46.833  -27.997 1.00 45.17  ? 404 VAL A N     1 
ATOM   2331 C CA    . VAL D 4 202 ? 111.204 -47.978  -28.626 1.00 43.85  ? 404 VAL A CA    1 
ATOM   2332 C C     . VAL D 4 202 ? 112.680 -47.677  -28.538 1.00 44.78  ? 404 VAL A C     1 
ATOM   2333 O O     . VAL D 4 202 ? 113.114 -46.581  -28.922 1.00 45.95  ? 404 VAL A O     1 
ATOM   2334 C CB    . VAL D 4 202 ? 110.922 -48.131  -30.144 1.00 10.00  ? 404 VAL A CB    1 
ATOM   2335 C CG1   . VAL D 4 202 ? 111.443 -49.473  -30.630 1.00 9.27   ? 404 VAL A CG1   1 
ATOM   2336 C CG2   . VAL D 4 202 ? 109.457 -48.008  -30.461 1.00 9.87   ? 404 VAL A CG2   1 
ATOM   2337 N N     . ARG D 4 203 ? 113.450 -48.622  -28.013 1.00 28.01  ? 405 ARG A N     1 
ATOM   2338 C CA    . ARG D 4 203 ? 114.886 -48.415  -27.949 1.00 28.25  ? 405 ARG A CA    1 
ATOM   2339 C C     . ARG D 4 203 ? 115.623 -49.561  -28.602 1.00 27.49  ? 405 ARG A C     1 
ATOM   2340 O O     . ARG D 4 203 ? 115.126 -50.687  -28.673 1.00 26.50  ? 405 ARG A O     1 
ATOM   2341 C CB    . ARG D 4 203 ? 115.406 -48.066  -26.532 1.00 60.27  ? 405 ARG A CB    1 
ATOM   2342 C CG    . ARG D 4 203 ? 115.124 -49.051  -25.405 1.00 62.59  ? 405 ARG A CG    1 
ATOM   2343 C CD    . ARG D 4 203 ? 115.870 -48.661  -24.106 1.00 65.63  ? 405 ARG A CD    1 
ATOM   2344 N NE    . ARG D 4 203 ? 115.093 -47.825  -23.180 1.00 67.87  ? 405 ARG A NE    1 
ATOM   2345 C CZ    . ARG D 4 203 ? 115.223 -47.836  -21.848 1.00 69.07  ? 405 ARG A CZ    1 
ATOM   2346 N NH1   . ARG D 4 203 ? 116.108 -48.638  -21.251 1.00 69.53  ? 405 ARG A NH1   1 
ATOM   2347 N NH2   . ARG D 4 203 ? 114.452 -47.050  -21.101 1.00 68.49  ? 405 ARG A NH2   1 
ATOM   2348 N N     . HIS D 4 204 ? 116.737 -49.204  -29.225 1.00 46.97  ? 406 HIS A N     1 
ATOM   2349 C CA    . HIS D 4 204 ? 117.585 -50.144  -29.925 1.00 47.08  ? 406 HIS A CA    1 
ATOM   2350 C C     . HIS D 4 204 ? 118.841 -50.298  -29.071 1.00 47.11  ? 406 HIS A C     1 
ATOM   2351 O O     . HIS D 4 204 ? 119.972 -50.160  -29.557 1.00 47.11  ? 406 HIS A O     1 
ATOM   2352 C CB    . HIS D 4 204 ? 117.924 -49.594  -31.322 1.00 71.44  ? 406 HIS A CB    1 
ATOM   2353 C CG    . HIS D 4 204 ? 116.737 -49.098  -32.097 1.00 72.10  ? 406 HIS A CG    1 
ATOM   2354 N ND1   . HIS D 4 204 ? 115.568 -49.818  -32.220 1.00 72.95  ? 406 HIS A ND1   1 
ATOM   2355 C CD2   . HIS D 4 204 ? 116.547 -47.954  -32.798 1.00 71.87  ? 406 HIS A CD2   1 
ATOM   2356 C CE1   . HIS D 4 204 ? 114.711 -49.142  -32.964 1.00 72.66  ? 406 HIS A CE1   1 
ATOM   2357 N NE2   . HIS D 4 204 ? 115.280 -48.007  -33.329 1.00 72.42  ? 406 HIS A NE2   1 
ATOM   2358 N N     . ASP D 4 205 ? 118.628 -50.561  -27.782 1.00 59.16  ? 407 ASP A N     1 
ATOM   2359 C CA    . ASP D 4 205 ? 119.712 -50.729  -26.810 1.00 58.54  ? 407 ASP A CA    1 
ATOM   2360 C C     . ASP D 4 205 ? 120.214 -52.174  -26.820 1.00 56.48  ? 407 ASP A C     1 
ATOM   2361 O O     . ASP D 4 205 ? 119.523 -53.071  -26.341 1.00 56.18  ? 407 ASP A O     1 
ATOM   2362 C CB    . ASP D 4 205 ? 119.199 -50.342  -25.414 1.00 71.84  ? 407 ASP A CB    1 
ATOM   2363 C CG    . ASP D 4 205 ? 120.306 -50.202  -24.374 1.00 73.49  ? 407 ASP A CG    1 
ATOM   2364 O OD1   . ASP D 4 205 ? 121.504 -50.357  -24.701 1.00 73.93  ? 407 ASP A OD1   1 
ATOM   2365 O OD2   . ASP D 4 205 ? 119.958 -49.925  -23.206 1.00 73.91  ? 407 ASP A OD2   1 
ATOM   2366 N N     . ASN D 4 206 ? 121.414 -52.392  -27.355 1.00 35.72  ? 408 ASN A N     1 
ATOM   2367 C CA    . ASN D 4 206 ? 121.971 -53.739  -27.410 1.00 34.93  ? 408 ASN A CA    1 
ATOM   2368 C C     . ASN D 4 206 ? 122.778 -54.187  -26.193 1.00 33.50  ? 408 ASN A C     1 
ATOM   2369 O O     . ASN D 4 206 ? 123.230 -55.329  -26.135 1.00 32.77  ? 408 ASN A O     1 
ATOM   2370 C CB    . ASN D 4 206 ? 122.729 -53.984  -28.716 1.00 75.23  ? 408 ASN A CB    1 
ATOM   2371 C CG    . ASN D 4 206 ? 123.905 -53.069  -28.887 1.00 78.10  ? 408 ASN A CG    1 
ATOM   2372 O OD1   . ASN D 4 206 ? 125.053 -53.514  -28.867 1.00 78.14  ? 408 ASN A OD1   1 
ATOM   2373 N ND2   . ASN D 4 206 ? 123.632 -51.773  -29.044 1.00 80.92  ? 408 ASN A ND2   1 
ATOM   2374 N N     . LYS D 4 207 ? 122.896 -53.306  -25.202 1.00 45.01  ? 409 LYS A N     1 
ATOM   2375 C CA    . LYS D 4 207 ? 123.621 -53.601  -23.967 1.00 46.12  ? 409 LYS A CA    1 
ATOM   2376 C C     . LYS D 4 207 ? 122.734 -54.236  -22.868 1.00 45.68  ? 409 LYS A C     1 
ATOM   2377 O O     . LYS D 4 207 ? 123.199 -54.452  -21.737 1.00 46.36  ? 409 LYS A O     1 
ATOM   2378 C CB    . LYS D 4 207 ? 124.303 -52.329  -23.434 1.00 163.81 ? 409 LYS A CB    1 
ATOM   2379 C CG    . LYS D 4 207 ? 125.595 -51.930  -24.150 1.00 165.73 ? 409 LYS A CG    1 
ATOM   2380 C CD    . LYS D 4 207 ? 125.366 -51.161  -25.448 1.00 167.39 ? 409 LYS A CD    1 
ATOM   2381 C CE    . LYS D 4 207 ? 126.672 -50.945  -26.213 1.00 168.68 ? 409 LYS A CE    1 
ATOM   2382 N NZ    . LYS D 4 207 ? 127.689 -50.157  -25.454 1.00 169.57 ? 409 LYS A NZ    1 
ATOM   2383 N N     . VAL D 4 208 ? 121.481 -54.559  -23.212 1.00 10.99  ? 410 VAL A N     1 
ATOM   2384 C CA    . VAL D 4 208 ? 120.515 -55.157  -22.276 1.00 10.19  ? 410 VAL A CA    1 
ATOM   2385 C C     . VAL D 4 208 ? 120.023 -56.528  -22.700 1.00 10.43  ? 410 VAL A C     1 
ATOM   2386 O O     . VAL D 4 208 ? 119.956 -56.819  -23.882 1.00 10.40  ? 410 VAL A O     1 
ATOM   2387 C CB    . VAL D 4 208 ? 119.272 -54.255  -22.038 1.00 53.33  ? 410 VAL A CB    1 
ATOM   2388 C CG1   . VAL D 4 208 ? 119.596 -53.104  -21.091 1.00 53.91  ? 410 VAL A CG1   1 
ATOM   2389 C CG2   . VAL D 4 208 ? 118.708 -53.740  -23.348 1.00 53.77  ? 410 VAL A CG2   1 
ATOM   2390 N N     . THR D 4 209 ? 119.615 -57.335  -21.724 1.00 43.50  ? 411 THR A N     1 
ATOM   2391 C CA    . THR D 4 209 ? 119.134 -58.699  -21.963 1.00 45.97  ? 411 THR A CA    1 
ATOM   2392 C C     . THR D 4 209 ? 117.637 -58.789  -22.227 1.00 48.02  ? 411 THR A C     1 
ATOM   2393 O O     . THR D 4 209 ? 117.134 -59.864  -22.566 1.00 49.42  ? 411 THR A O     1 
ATOM   2394 C CB    . THR D 4 209 ? 119.433 -59.646  -20.749 1.00 73.76  ? 411 THR A CB    1 
ATOM   2395 O OG1   . THR D 4 209 ? 118.611 -59.294  -19.628 1.00 74.56  ? 411 THR A OG1   1 
ATOM   2396 C CG2   . THR D 4 209 ? 120.884 -59.567  -20.328 1.00 75.39  ? 411 THR A CG2   1 
ATOM   2397 N N     . TRP D 4 210 ? 116.931 -57.672  -22.059 1.00 64.27  ? 412 TRP A N     1 
ATOM   2398 C CA    . TRP D 4 210 ? 115.478 -57.650  -22.215 1.00 66.18  ? 412 TRP A CA    1 
ATOM   2399 C C     . TRP D 4 210 ? 114.861 -57.245  -23.547 1.00 65.94  ? 412 TRP A C     1 
ATOM   2400 O O     . TRP D 4 210 ? 115.460 -56.499  -24.317 1.00 67.44  ? 412 TRP A O     1 
ATOM   2401 C CB    . TRP D 4 210 ? 114.854 -56.847  -21.075 1.00 11.74  ? 412 TRP A CB    1 
ATOM   2402 C CG    . TRP D 4 210 ? 115.298 -55.415  -20.918 1.00 17.08  ? 412 TRP A CG    1 
ATOM   2403 C CD1   . TRP D 4 210 ? 116.263 -54.955  -20.078 1.00 20.57  ? 412 TRP A CD1   1 
ATOM   2404 C CD2   . TRP D 4 210 ? 114.679 -54.256  -21.492 1.00 19.41  ? 412 TRP A CD2   1 
ATOM   2405 N NE1   . TRP D 4 210 ? 116.279 -53.577  -20.066 1.00 22.72  ? 412 TRP A NE1   1 
ATOM   2406 C CE2   . TRP D 4 210 ? 115.319 -53.118  -20.928 1.00 22.01  ? 412 TRP A CE2   1 
ATOM   2407 C CE3   . TRP D 4 210 ? 113.636 -54.063  -22.424 1.00 20.19  ? 412 TRP A CE3   1 
ATOM   2408 C CZ2   . TRP D 4 210 ? 114.949 -51.789  -21.265 1.00 23.35  ? 412 TRP A CZ2   1 
ATOM   2409 C CZ3   . TRP D 4 210 ? 113.260 -52.736  -22.765 1.00 21.77  ? 412 TRP A CZ3   1 
ATOM   2410 C CH2   . TRP D 4 210 ? 113.922 -51.618  -22.180 1.00 22.44  ? 412 TRP A CH2   1 
ATOM   2411 N N     . LEU D 4 211 ? 113.619 -57.678  -23.765 1.00 33.41  ? 413 LEU A N     1 
ATOM   2412 C CA    . LEU D 4 211 ? 112.895 -57.378  -25.001 1.00 32.68  ? 413 LEU A CA    1 
ATOM   2413 C C     . LEU D 4 211 ? 111.810 -56.337  -24.822 1.00 31.43  ? 413 LEU A C     1 
ATOM   2414 O O     . LEU D 4 211 ? 111.539 -55.543  -25.717 1.00 31.01  ? 413 LEU A O     1 
ATOM   2415 C CB    . LEU D 4 211 ? 112.204 -58.622  -25.539 1.00 46.85  ? 413 LEU A CB    1 
ATOM   2416 C CG    . LEU D 4 211 ? 112.800 -60.012  -25.418 1.00 47.43  ? 413 LEU A CG    1 
ATOM   2417 C CD1   . LEU D 4 211 ? 111.761 -61.023  -25.841 1.00 49.92  ? 413 LEU A CD1   1 
ATOM   2418 C CD2   . LEU D 4 211 ? 114.012 -60.123  -26.270 1.00 47.90  ? 413 LEU A CD2   1 
ATOM   2419 N N     . VAL D 4 212 ? 111.095 -56.453  -23.712 1.00 30.87  ? 414 VAL A N     1 
ATOM   2420 C CA    . VAL D 4 212 ? 109.980 -55.579  -23.397 1.00 29.42  ? 414 VAL A CA    1 
ATOM   2421 C C     . VAL D 4 212 ? 110.055 -55.259  -21.916 1.00 28.48  ? 414 VAL A C     1 
ATOM   2422 O O     . VAL D 4 212 ? 110.479 -56.101  -21.121 1.00 28.73  ? 414 VAL A O     1 
ATOM   2423 C CB    . VAL D 4 212 ? 108.651 -56.319  -23.654 1.00 19.23  ? 414 VAL A CB    1 
ATOM   2424 C CG1   . VAL D 4 212 ? 107.479 -55.536  -23.149 1.00 19.18  ? 414 VAL A CG1   1 
ATOM   2425 C CG2   . VAL D 4 212 ? 108.468 -56.652  -25.114 1.00 19.78  ? 414 VAL A CG2   1 
ATOM   2426 N N     . SER D 4 213 ? 109.605 -54.060  -21.551 1.00 4.97   ? 415 SER A N     1 
ATOM   2427 C CA    . SER D 4 213 ? 109.592 -53.626  -20.161 1.00 4.82   ? 415 SER A CA    1 
ATOM   2428 C C     . SER D 4 213 ? 108.600 -52.514  -19.943 1.00 5.87   ? 415 SER A C     1 
ATOM   2429 O O     . SER D 4 213 ? 108.387 -51.673  -20.828 1.00 6.01   ? 415 SER A O     1 
ATOM   2430 C CB    . SER D 4 213 ? 110.969 -53.159  -19.683 1.00 16.77  ? 415 SER A CB    1 
ATOM   2431 O OG    . SER D 4 213 ? 111.398 -51.948  -20.289 1.00 16.70  ? 415 SER A OG    1 
ATOM   2432 N N     . TRP D 4 214 ? 108.026 -52.515  -18.739 1.00 22.38  ? 416 TRP A N     1 
ATOM   2433 C CA    . TRP D 4 214 ? 107.053 -51.524  -18.305 1.00 23.73  ? 416 TRP A CA    1 
ATOM   2434 C C     . TRP D 4 214 ? 107.396 -51.105  -16.881 1.00 24.83  ? 416 TRP A C     1 
ATOM   2435 O O     . TRP D 4 214 ? 108.365 -51.608  -16.315 1.00 24.54  ? 416 TRP A O     1 
ATOM   2436 C CB    . TRP D 4 214 ? 105.628 -52.088  -18.413 1.00 40.25  ? 416 TRP A CB    1 
ATOM   2437 C CG    . TRP D 4 214 ? 105.276 -53.234  -17.504 1.00 42.35  ? 416 TRP A CG    1 
ATOM   2438 C CD1   . TRP D 4 214 ? 104.575 -53.157  -16.337 1.00 43.99  ? 416 TRP A CD1   1 
ATOM   2439 C CD2   . TRP D 4 214 ? 105.551 -54.621  -17.710 1.00 43.82  ? 416 TRP A CD2   1 
ATOM   2440 N NE1   . TRP D 4 214 ? 104.384 -54.409  -15.800 1.00 44.93  ? 416 TRP A NE1   1 
ATOM   2441 C CE2   . TRP D 4 214 ? 104.971 -55.329  -16.619 1.00 44.73  ? 416 TRP A CE2   1 
ATOM   2442 C CE3   . TRP D 4 214 ? 106.225 -55.341  -18.706 1.00 44.73  ? 416 TRP A CE3   1 
ATOM   2443 C CZ2   . TRP D 4 214 ? 105.049 -56.726  -16.493 1.00 45.12  ? 416 TRP A CZ2   1 
ATOM   2444 C CZ3   . TRP D 4 214 ? 106.307 -56.738  -18.585 1.00 45.87  ? 416 TRP A CZ3   1 
ATOM   2445 C CH2   . TRP D 4 214 ? 105.715 -57.416  -17.480 1.00 46.73  ? 416 TRP A CH2   1 
ATOM   2446 N N     . THR D 4 215 ? 106.584 -50.222  -16.298 1.00 46.69  ? 417 THR A N     1 
ATOM   2447 C CA    . THR D 4 215 ? 106.804 -49.723  -14.936 1.00 48.11  ? 417 THR A CA    1 
ATOM   2448 C C     . THR D 4 215 ? 105.667 -50.162  -14.009 1.00 48.39  ? 417 THR A C     1 
ATOM   2449 O O     . THR D 4 215 ? 104.516 -50.198  -14.440 1.00 48.82  ? 417 THR A O     1 
ATOM   2450 C CB    . THR D 4 215 ? 106.880 -48.170  -14.917 1.00 130.43 ? 417 THR A CB    1 
ATOM   2451 O OG1   . THR D 4 215 ? 107.222 -47.681  -16.220 1.00 131.95 ? 417 THR A OG1   1 
ATOM   2452 C CG2   . THR D 4 215 ? 107.941 -47.702  -13.932 1.00 130.80 ? 417 THR A CG2   1 
ATOM   2453 N N     . GLU D 4 216 ? 105.991 -50.519  -12.758 1.00 35.22  ? 418 GLU A N     1 
ATOM   2454 C CA    . GLU D 4 216 ? 104.980 -50.927  -11.770 1.00 36.01  ? 418 GLU A CA    1 
ATOM   2455 C C     . GLU D 4 216 ? 104.444 -49.679  -11.056 1.00 36.04  ? 418 GLU A C     1 
ATOM   2456 O O     . GLU D 4 216 ? 105.200 -48.895  -10.494 1.00 36.50  ? 418 GLU A O     1 
ATOM   2457 C CB    . GLU D 4 216 ? 105.552 -51.919  -10.750 1.00 130.76 ? 418 GLU A CB    1 
ATOM   2458 C CG    . GLU D 4 216 ? 104.490 -52.628  -9.906  1.00 133.83 ? 418 GLU A CG    1 
ATOM   2459 C CD    . GLU D 4 216 ? 105.062 -53.279  -8.659  1.00 135.83 ? 418 GLU A CD    1 
ATOM   2460 O OE1   . GLU D 4 216 ? 105.502 -52.541  -7.748  1.00 137.93 ? 418 GLU A OE1   1 
ATOM   2461 O OE2   . GLU D 4 216 ? 105.055 -54.526  -8.579  1.00 136.46 ? 418 GLU A OE2   1 
ATOM   2462 N N     . ASN D 4 217 ? 103.127 -49.526  -11.077 1.00 82.93  ? 419 ASN A N     1 
ATOM   2463 C CA    . ASN D 4 217 ? 102.433 -48.389  -10.477 1.00 84.73  ? 419 ASN A CA    1 
ATOM   2464 C C     . ASN D 4 217 ? 102.495 -48.291  -8.954  1.00 84.96  ? 419 ASN A C     1 
ATOM   2465 O O     . ASN D 4 217 ? 102.365 -47.197  -8.391  1.00 85.92  ? 419 ASN A O     1 
ATOM   2466 C CB    . ASN D 4 217 ? 100.973 -48.403  -10.936 1.00 115.02 ? 419 ASN A CB    1 
ATOM   2467 C CG    . ASN D 4 217 ? 100.296 -49.753  -10.716 1.00 115.49 ? 419 ASN A CG    1 
ATOM   2468 O OD1   . ASN D 4 217 ? 100.722 -50.785  -11.248 1.00 116.79 ? 419 ASN A OD1   1 
ATOM   2469 N ND2   . ASN D 4 217 ? 99.221  -49.741  -9.947  1.00 115.29 ? 419 ASN A ND2   1 
ATOM   2470 N N     . ILE D 4 218 ? 102.737 -49.435  -8.311  1.00 34.38  ? 420 ILE A N     1 
ATOM   2471 C CA    . ILE D 4 218 ? 102.798 -49.543  -6.850  1.00 35.53  ? 420 ILE A CA    1 
ATOM   2472 C C     . ILE D 4 218 ? 104.053 -48.955  -6.214  1.00 36.24  ? 420 ILE A C     1 
ATOM   2473 O O     . ILE D 4 218 ? 103.978 -47.928  -5.532  1.00 36.78  ? 420 ILE A O     1 
ATOM   2474 C CB    . ILE D 4 218 ? 102.660 -51.025  -6.369  1.00 50.20  ? 420 ILE A CB    1 
ATOM   2475 C CG1   . ILE D 4 218 ? 101.543 -51.742  -7.128  1.00 50.34  ? 420 ILE A CG1   1 
ATOM   2476 C CG2   . ILE D 4 218 ? 102.370 -51.075  -4.859  1.00 49.91  ? 420 ILE A CG2   1 
ATOM   2477 C CD1   . ILE D 4 218 ? 101.578 -53.243  -6.988  1.00 49.52  ? 420 ILE A CD1   1 
ATOM   2478 N N     . GLN D 4 219 ? 105.182 -49.640  -6.411  1.00 72.18  ? 421 GLN A N     1 
ATOM   2479 C CA    . GLN D 4 219 ? 106.461 -49.232  -5.841  1.00 72.15  ? 421 GLN A CA    1 
ATOM   2480 C C     . GLN D 4 219 ? 107.318 -48.356  -6.726  1.00 71.47  ? 421 GLN A C     1 
ATOM   2481 O O     . GLN D 4 219 ? 108.164 -47.612  -6.223  1.00 72.83  ? 421 GLN A O     1 
ATOM   2482 C CB    . GLN D 4 219 ? 107.251 -50.452  -5.403  1.00 95.66  ? 421 GLN A CB    1 
ATOM   2483 C CG    . GLN D 4 219 ? 106.559 -51.224  -4.314  1.00 98.26  ? 421 GLN A CG    1 
ATOM   2484 C CD    . GLN D 4 219 ? 107.391 -52.356  -3.781  1.00 99.87  ? 421 GLN A CD    1 
ATOM   2485 O OE1   . GLN D 4 219 ? 108.090 -53.043  -4.528  1.00 101.41 ? 421 GLN A OE1   1 
ATOM   2486 N NE2   . GLN D 4 219 ? 107.314 -52.572  -2.477  1.00 100.88 ? 421 GLN A NE2   1 
ATOM   2487 N N     . GLY D 4 220 ? 107.099 -48.447  -8.035  1.00 90.10  ? 422 GLY A N     1 
ATOM   2488 C CA    . GLY D 4 220 ? 107.860 -47.645  -8.981  1.00 87.73  ? 422 GLY A CA    1 
ATOM   2489 C C     . GLY D 4 220 ? 109.040 -48.361  -9.612  1.00 85.95  ? 422 GLY A C     1 
ATOM   2490 O O     . GLY D 4 220 ? 109.916 -47.719  -10.202 1.00 86.70  ? 422 GLY A O     1 
ATOM   2491 N N     . SER D 4 221 ? 109.057 -49.687  -9.483  1.00 49.32  ? 423 SER A N     1 
ATOM   2492 C CA    . SER D 4 221 ? 110.114 -50.527  -10.036 1.00 47.11  ? 423 SER A CA    1 
ATOM   2493 C C     . SER D 4 221 ? 109.750 -51.000  -11.444 1.00 45.60  ? 423 SER A C     1 
ATOM   2494 O O     . SER D 4 221 ? 108.579 -51.217  -11.757 1.00 45.53  ? 423 SER A O     1 
ATOM   2495 C CB    . SER D 4 221 ? 110.386 -51.718  -9.115  1.00 87.20  ? 423 SER A CB    1 
ATOM   2496 O OG    . SER D 4 221 ? 109.204 -52.458  -8.867  1.00 87.65  ? 423 SER A OG    1 
ATOM   2497 N N     . ILE D 4 222 ? 110.775 -51.162  -12.277 1.00 48.96  ? 424 ILE A N     1 
ATOM   2498 C CA    . ILE D 4 222 ? 110.634 -51.573  -13.675 1.00 45.97  ? 424 ILE A CA    1 
ATOM   2499 C C     . ILE D 4 222 ? 110.664 -53.100  -13.807 1.00 43.84  ? 424 ILE A C     1 
ATOM   2500 O O     . ILE D 4 222 ? 111.577 -53.749  -13.293 1.00 43.35  ? 424 ILE A O     1 
ATOM   2501 C CB    . ILE D 4 222 ? 111.779 -50.957  -14.565 1.00 38.64  ? 424 ILE A CB    1 
ATOM   2502 C CG1   . ILE D 4 222 ? 112.318 -49.649  -13.978 1.00 38.80  ? 424 ILE A CG1   1 
ATOM   2503 C CG2   . ILE D 4 222 ? 111.278 -50.631  -15.950 1.00 40.00  ? 424 ILE A CG2   1 
ATOM   2504 C CD1   . ILE D 4 222 ? 113.479 -49.837  -13.006 1.00 39.43  ? 424 ILE A CD1   1 
ATOM   2505 N N     . LYS D 4 223 ? 109.644 -53.664  -14.457 1.00 37.31  ? 425 LYS A N     1 
ATOM   2506 C CA    . LYS D 4 223 ? 109.552 -55.116  -14.679 1.00 35.39  ? 425 LYS A CA    1 
ATOM   2507 C C     . LYS D 4 223 ? 109.804 -55.456  -16.139 1.00 33.28  ? 425 LYS A C     1 
ATOM   2508 O O     . LYS D 4 223 ? 109.273 -54.805  -17.038 1.00 33.18  ? 425 LYS A O     1 
ATOM   2509 C CB    . LYS D 4 223 ? 108.213 -55.675  -14.200 1.00 69.94  ? 425 LYS A CB    1 
ATOM   2510 C CG    . LYS D 4 223 ? 108.184 -55.935  -12.696 1.00 72.01  ? 425 LYS A CG    1 
ATOM   2511 C CD    . LYS D 4 223 ? 106.884 -56.576  -12.255 1.00 74.43  ? 425 LYS A CD    1 
ATOM   2512 C CE    . LYS D 4 223 ? 106.898 -56.933  -10.777 1.00 75.55  ? 425 LYS A CE    1 
ATOM   2513 N NZ    . LYS D 4 223 ? 105.572 -57.433  -10.334 1.00 77.32  ? 425 LYS A NZ    1 
ATOM   2514 N N     . TYR D 4 224 ? 110.611 -56.492  -16.359 1.00 22.12  ? 426 TYR A N     1 
ATOM   2515 C CA    . TYR D 4 224 ? 111.035 -56.901  -17.701 1.00 21.26  ? 426 TYR A CA    1 
ATOM   2516 C C     . TYR D 4 224 ? 110.543 -58.248  -18.179 1.00 22.94  ? 426 TYR A C     1 
ATOM   2517 O O     . TYR D 4 224 ? 109.999 -59.043  -17.403 1.00 22.13  ? 426 TYR A O     1 
ATOM   2518 C CB    . TYR D 4 224 ? 112.568 -56.916  -17.787 1.00 30.23  ? 426 TYR A CB    1 
ATOM   2519 C CG    . TYR D 4 224 ? 113.258 -55.722  -17.175 1.00 28.30  ? 426 TYR A CG    1 
ATOM   2520 C CD1   . TYR D 4 224 ? 113.525 -55.662  -15.796 1.00 27.91  ? 426 TYR A CD1   1 
ATOM   2521 C CD2   . TYR D 4 224 ? 113.599 -54.623  -17.952 1.00 28.61  ? 426 TYR A CD2   1 
ATOM   2522 C CE1   . TYR D 4 224 ? 114.107 -54.512  -15.210 1.00 26.86  ? 426 TYR A CE1   1 
ATOM   2523 C CE2   . TYR D 4 224 ? 114.190 -53.468  -17.389 1.00 27.97  ? 426 TYR A CE2   1 
ATOM   2524 C CZ    . TYR D 4 224 ? 114.434 -53.417  -16.017 1.00 26.56  ? 426 TYR A CZ    1 
ATOM   2525 O OH    . TYR D 4 224 ? 114.953 -52.272  -15.460 1.00 27.16  ? 426 TYR A OH    1 
ATOM   2526 N N     . ILE D 4 225 ? 110.736 -58.468  -19.482 1.00 24.06  ? 427 ILE A N     1 
ATOM   2527 C CA    . ILE D 4 225 ? 110.394 -59.703  -20.179 1.00 26.34  ? 427 ILE A CA    1 
ATOM   2528 C C     . ILE D 4 225 ? 111.690 -60.135  -20.817 1.00 28.65  ? 427 ILE A C     1 
ATOM   2529 O O     . ILE D 4 225 ? 112.237 -59.438  -21.688 1.00 28.67  ? 427 ILE A O     1 
ATOM   2530 C CB    . ILE D 4 225 ? 109.320 -59.496  -21.264 1.00 34.01  ? 427 ILE A CB    1 
ATOM   2531 C CG1   . ILE D 4 225 ? 107.943 -59.398  -20.606 1.00 34.81  ? 427 ILE A CG1   1 
ATOM   2532 C CG2   . ILE D 4 225 ? 109.343 -60.635  -22.294 1.00 33.38  ? 427 ILE A CG2   1 
ATOM   2533 C CD1   . ILE D 4 225 ? 106.790 -59.113  -21.548 1.00 35.20  ? 427 ILE A CD1   1 
ATOM   2534 N N     . MET D 4 226 ? 112.182 -61.272  -20.331 1.00 33.01  ? 428 MET A N     1 
ATOM   2535 C CA    . MET D 4 226 ? 113.425 -61.868  -20.785 1.00 36.05  ? 428 MET A CA    1 
ATOM   2536 C C     . MET D 4 226 ? 113.197 -63.252  -21.355 1.00 36.13  ? 428 MET A C     1 
ATOM   2537 O O     . MET D 4 226 ? 112.079 -63.776  -21.359 1.00 35.55  ? 428 MET A O     1 
ATOM   2538 C CB    . MET D 4 226 ? 114.411 -61.962  -19.627 1.00 68.95  ? 428 MET A CB    1 
ATOM   2539 C CG    . MET D 4 226 ? 114.958 -60.640  -19.175 1.00 73.34  ? 428 MET A CG    1 
ATOM   2540 S SD    . MET D 4 226 ? 115.157 -60.626  -17.406 1.00 80.31  ? 428 MET A SD    1 
ATOM   2541 C CE    . MET D 4 226 ? 116.094 -59.117  -17.237 1.00 77.59  ? 428 MET A CE    1 
ATOM   2542 N N     . LEU D 4 227 ? 114.298 -63.861  -21.772 1.00 31.85  ? 429 LEU A N     1 
ATOM   2543 C CA    . LEU D 4 227 ? 114.294 -65.179  -22.366 1.00 32.25  ? 429 LEU A CA    1 
ATOM   2544 C C     . LEU D 4 227 ? 114.288 -66.346  -21.393 1.00 33.44  ? 429 LEU A C     1 
ATOM   2545 O O     . LEU D 4 227 ? 114.342 -66.178  -20.173 1.00 34.12  ? 429 LEU A O     1 
ATOM   2546 C CB    . LEU D 4 227 ? 115.473 -65.300  -23.329 1.00 17.88  ? 429 LEU A CB    1 
ATOM   2547 C CG    . LEU D 4 227 ? 115.544 -64.253  -24.442 1.00 17.94  ? 429 LEU A CG    1 
ATOM   2548 C CD1   . LEU D 4 227 ? 116.614 -64.646  -25.424 1.00 17.23  ? 429 LEU A CD1   1 
ATOM   2549 C CD2   . LEU D 4 227 ? 114.213 -64.156  -25.155 1.00 18.96  ? 429 LEU A CD2   1 
ATOM   2550 N N     . ASN D 4 228 ? 114.206 -67.536  -21.973 1.00 40.65  ? 430 ASN A N     1 
ATOM   2551 C CA    . ASN D 4 228 ? 114.175 -68.801  -21.264 1.00 41.94  ? 430 ASN A CA    1 
ATOM   2552 C C     . ASN D 4 228 ? 115.559 -69.118  -20.717 1.00 42.56  ? 430 ASN A C     1 
ATOM   2553 O O     . ASN D 4 228 ? 116.565 -68.757  -21.343 1.00 42.02  ? 430 ASN A O     1 
ATOM   2554 C CB    . ASN D 4 228 ? 113.757 -69.894  -22.252 1.00 105.81 ? 430 ASN A CB    1 
ATOM   2555 C CG    . ASN D 4 228 ? 113.090 -71.065  -21.585 1.00 108.11 ? 430 ASN A CG    1 
ATOM   2556 O OD1   . ASN D 4 228 ? 112.053 -70.920  -20.935 1.00 109.12 ? 430 ASN A OD1   1 
ATOM   2557 N ND2   . ASN D 4 228 ? 113.682 -72.240  -21.736 1.00 108.08 ? 430 ASN A ND2   1 
ATOM   2558 N N     . PRO D 4 229 ? 115.638 -69.739  -19.515 1.00 38.35  ? 431 PRO A N     1 
ATOM   2559 C CA    . PRO D 4 229 ? 116.917 -70.109  -18.895 1.00 39.30  ? 431 PRO A CA    1 
ATOM   2560 C C     . PRO D 4 229 ? 117.808 -71.046  -19.723 1.00 39.82  ? 431 PRO A C     1 
ATOM   2561 O O     . PRO D 4 229 ? 118.960 -71.301  -19.360 1.00 40.66  ? 431 PRO A O     1 
ATOM   2562 C CB    . PRO D 4 229 ? 116.475 -70.730  -17.585 1.00 101.24 ? 431 PRO A CB    1 
ATOM   2563 C CG    . PRO D 4 229 ? 115.375 -69.831  -17.201 1.00 102.36 ? 431 PRO A CG    1 
ATOM   2564 C CD    . PRO D 4 229 ? 114.581 -69.748  -18.483 1.00 101.66 ? 431 PRO A CD    1 
ATOM   2565 N N     . SER D 4 230 ? 117.280 -71.477  -20.869 1.00 41.90  ? 432 SER A N     1 
ATOM   2566 C CA    . SER D 4 230 ? 117.969 -72.342  -21.823 1.00 42.03  ? 432 SER A CA    1 
ATOM   2567 C C     . SER D 4 230 ? 118.919 -71.522  -22.692 1.00 41.92  ? 432 SER A C     1 
ATOM   2568 O O     . SER D 4 230 ? 120.004 -71.991  -23.059 1.00 43.18  ? 432 SER A O     1 
ATOM   2569 C CB    . SER D 4 230 ? 116.946 -73.020  -22.745 1.00 63.08  ? 432 SER A CB    1 
ATOM   2570 O OG    . SER D 4 230 ? 116.245 -72.072  -23.548 1.00 63.35  ? 432 SER A OG    1 
ATOM   2571 N N     . SER D 4 231 ? 118.502 -70.285  -22.975 1.00 38.73  ? 433 SER A N     1 
ATOM   2572 C CA    . SER D 4 231 ? 119.225 -69.348  -23.834 1.00 36.59  ? 433 SER A CA    1 
ATOM   2573 C C     . SER D 4 231 ? 120.681 -69.050  -23.514 1.00 34.98  ? 433 SER A C     1 
ATOM   2574 O O     . SER D 4 231 ? 121.133 -69.241  -22.384 1.00 34.22  ? 433 SER A O     1 
ATOM   2575 C CB    . SER D 4 231 ? 118.445 -68.045  -23.947 1.00 118.80 ? 433 SER A CB    1 
ATOM   2576 O OG    . SER D 4 231 ? 117.127 -68.308  -24.393 1.00 120.66 ? 433 SER A OG    1 
ATOM   2577 N N     . ARG D 4 232 ? 121.403 -68.616  -24.550 1.00 21.74  ? 434 ARG A N     1 
ATOM   2578 C CA    . ARG D 4 232 ? 122.819 -68.263  -24.490 1.00 21.34  ? 434 ARG A CA    1 
ATOM   2579 C C     . ARG D 4 232 ? 123.003 -67.172  -23.481 1.00 19.74  ? 434 ARG A C     1 
ATOM   2580 O O     . ARG D 4 232 ? 123.721 -67.333  -22.520 1.00 18.21  ? 434 ARG A O     1 
ATOM   2581 C CB    . ARG D 4 232 ? 123.289 -67.746  -25.847 1.00 59.59  ? 434 ARG A CB    1 
ATOM   2582 C CG    . ARG D 4 232 ? 124.716 -67.244  -25.878 1.00 62.42  ? 434 ARG A CG    1 
ATOM   2583 C CD    . ARG D 4 232 ? 124.988 -66.488  -27.157 1.00 65.77  ? 434 ARG A CD    1 
ATOM   2584 N NE    . ARG D 4 232 ? 124.737 -65.052  -27.031 1.00 70.24  ? 434 ARG A NE    1 
ATOM   2585 C CZ    . ARG D 4 232 ? 124.841 -64.173  -28.032 1.00 72.82  ? 434 ARG A CZ    1 
ATOM   2586 N NH1   . ARG D 4 232 ? 125.183 -64.569  -29.260 1.00 74.37  ? 434 ARG A NH1   1 
ATOM   2587 N NH2   . ARG D 4 232 ? 124.646 -62.880  -27.798 1.00 74.30  ? 434 ARG A NH2   1 
ATOM   2588 N N     . ILE D 4 233 ? 122.239 -66.110  -23.665 1.00 59.01  ? 435 ILE A N     1 
ATOM   2589 C CA    . ILE D 4 233 ? 122.281 -64.930  -22.828 1.00 62.32  ? 435 ILE A CA    1 
ATOM   2590 C C     . ILE D 4 233 ? 121.893 -65.165  -21.353 1.00 64.35  ? 435 ILE A C     1 
ATOM   2591 O O     . ILE D 4 233 ? 122.407 -64.492  -20.459 1.00 65.75  ? 435 ILE A O     1 
ATOM   2592 C CB    . ILE D 4 233 ? 121.444 -63.828  -23.519 1.00 102.12 ? 435 ILE A CB    1 
ATOM   2593 C CG1   . ILE D 4 233 ? 121.825 -62.448  -23.002 1.00 101.98 ? 435 ILE A CG1   1 
ATOM   2594 C CG2   . ILE D 4 233 ? 119.942 -64.139  -23.439 1.00 102.08 ? 435 ILE A CG2   1 
ATOM   2595 C CD1   . ILE D 4 233 ? 121.448 -61.342  -23.958 1.00 103.40 ? 435 ILE A CD1   1 
ATOM   2596 N N     . LYS D 4 234 ? 121.033 -66.153  -21.113 1.00 53.37  ? 436 LYS A N     1 
ATOM   2597 C CA    . LYS D 4 234 ? 120.578 -66.493  -19.762 1.00 54.55  ? 436 LYS A CA    1 
ATOM   2598 C C     . LYS D 4 234 ? 121.442 -67.578  -19.134 1.00 55.11  ? 436 LYS A C     1 
ATOM   2599 O O     . LYS D 4 234 ? 121.407 -67.787  -17.911 1.00 55.05  ? 436 LYS A O     1 
ATOM   2600 C CB    . LYS D 4 234 ? 119.130 -66.978  -19.803 1.00 50.72  ? 436 LYS A CB    1 
ATOM   2601 C CG    . LYS D 4 234 ? 118.099 -65.934  -19.440 1.00 52.10  ? 436 LYS A CG    1 
ATOM   2602 C CD    . LYS D 4 234 ? 118.059 -65.665  -17.936 1.00 53.50  ? 436 LYS A CD    1 
ATOM   2603 C CE    . LYS D 4 234 ? 117.070 -64.554  -17.606 1.00 54.38  ? 436 LYS A CE    1 
ATOM   2604 N NZ    . LYS D 4 234 ? 117.487 -63.250  -18.199 1.00 54.94  ? 436 LYS A NZ    1 
ATOM   2605 N N     . GLY D 4 235 ? 122.193 -68.268  -19.996 1.00 41.32  ? 437 GLY A N     1 
ATOM   2606 C CA    . GLY D 4 235 ? 123.067 -69.351  -19.579 1.00 41.50  ? 437 GLY A CA    1 
ATOM   2607 C C     . GLY D 4 235 ? 124.513 -68.948  -19.393 1.00 41.38  ? 437 GLY A C     1 
ATOM   2608 O O     . GLY D 4 235 ? 125.133 -69.353  -18.413 1.00 40.01  ? 437 GLY A O     1 
ATOM   2609 N N     . GLU D 4 236 ? 125.040 -68.147  -20.325 1.00 26.08  ? 438 GLU A N     1 
ATOM   2610 C CA    . GLU D 4 236 ? 126.416 -67.663  -20.285 1.00 26.58  ? 438 GLU A CA    1 
ATOM   2611 C C     . GLU D 4 236 ? 126.658 -66.855  -19.020 1.00 26.34  ? 438 GLU A C     1 
ATOM   2612 O O     . GLU D 4 236 ? 127.760 -66.883  -18.481 1.00 25.90  ? 438 GLU A O     1 
ATOM   2613 C CB    . GLU D 4 236 ? 126.755 -66.849  -21.544 1.00 97.81  ? 438 GLU A CB    1 
ATOM   2614 C CG    . GLU D 4 236 ? 128.260 -66.809  -21.881 1.00 101.49 ? 438 GLU A CG    1 
ATOM   2615 C CD    . GLU D 4 236 ? 128.575 -66.430  -23.331 1.00 103.22 ? 438 GLU A CD    1 
ATOM   2616 O OE1   . GLU D 4 236 ? 129.616 -66.898  -23.856 1.00 104.16 ? 438 GLU A OE1   1 
ATOM   2617 O OE2   . GLU D 4 236 ? 127.797 -65.664  -23.944 1.00 105.09 ? 438 GLU A OE2   1 
ATOM   2618 N N     . LYS D 4 237 ? 125.594 -66.243  -18.491 1.00 42.76  ? 439 LYS A N     1 
ATOM   2619 C CA    . LYS D 4 237 ? 125.671 -65.452  -17.261 1.00 44.29  ? 439 LYS A CA    1 
ATOM   2620 C C     . LYS D 4 237 ? 125.745 -66.372  -16.045 1.00 45.58  ? 439 LYS A C     1 
ATOM   2621 O O     . LYS D 4 237 ? 126.416 -66.050  -15.065 1.00 46.75  ? 439 LYS A O     1 
ATOM   2622 C CB    . LYS D 4 237 ? 124.474 -64.506  -17.126 1.00 71.65  ? 439 LYS A CB    1 
ATOM   2623 C CG    . LYS D 4 237 ? 124.836 -63.137  -16.553 1.00 71.58  ? 439 LYS A CG    1 
ATOM   2624 C CD    . LYS D 4 237 ? 123.597 -62.367  -16.136 1.00 70.19  ? 439 LYS A CD    1 
ATOM   2625 C CE    . LYS D 4 237 ? 123.901 -60.932  -15.725 1.00 68.02  ? 439 LYS A CE    1 
ATOM   2626 N NZ    . LYS D 4 237 ? 123.726 -59.968  -16.853 1.00 65.74  ? 439 LYS A NZ    1 
ATOM   2627 N N     . ASP D 4 238 ? 125.081 -67.528  -16.123 1.00 55.06  ? 440 ASP A N     1 
ATOM   2628 C CA    . ASP D 4 238 ? 125.103 -68.489  -15.021 1.00 55.90  ? 440 ASP A CA    1 
ATOM   2629 C C     . ASP D 4 238 ? 126.401 -69.276  -15.078 1.00 55.56  ? 440 ASP A C     1 
ATOM   2630 O O     . ASP D 4 238 ? 126.951 -69.624  -14.044 1.00 54.72  ? 440 ASP A O     1 
ATOM   2631 C CB    . ASP D 4 238 ? 123.885 -69.413  -15.031 1.00 69.08  ? 440 ASP A CB    1 
ATOM   2632 C CG    . ASP D 4 238 ? 123.364 -69.717  -13.621 1.00 69.81  ? 440 ASP A CG    1 
ATOM   2633 O OD1   . ASP D 4 238 ? 123.540 -68.884  -12.704 1.00 70.59  ? 440 ASP A OD1   1 
ATOM   2634 O OD2   . ASP D 4 238 ? 122.763 -70.793  -13.432 1.00 69.46  ? 440 ASP A OD2   1 
ATOM   2635 N N     . TRP D 4 239 ? 126.921 -69.465  -16.294 1.00 47.26  ? 441 TRP A N     1 
ATOM   2636 C CA    . TRP D 4 239 ? 128.198 -70.147  -16.551 1.00 47.10  ? 441 TRP A CA    1 
ATOM   2637 C C     . TRP D 4 239 ? 129.255 -69.253  -15.929 1.00 45.75  ? 441 TRP A C     1 
ATOM   2638 O O     . TRP D 4 239 ? 130.093 -69.726  -15.174 1.00 45.70  ? 441 TRP A O     1 
ATOM   2639 C CB    . TRP D 4 239 ? 128.427 -70.291  -18.070 1.00 83.08  ? 441 TRP A CB    1 
ATOM   2640 C CG    . TRP D 4 239 ? 129.842 -70.610  -18.541 1.00 85.87  ? 441 TRP A CG    1 
ATOM   2641 C CD1   . TRP D 4 239 ? 130.417 -71.838  -18.605 1.00 86.48  ? 441 TRP A CD1   1 
ATOM   2642 C CD2   . TRP D 4 239 ? 130.828 -69.680  -19.034 1.00 87.73  ? 441 TRP A CD2   1 
ATOM   2643 N NE1   . TRP D 4 239 ? 131.692 -71.749  -19.104 1.00 87.65  ? 441 TRP A NE1   1 
ATOM   2644 C CE2   . TRP D 4 239 ? 131.979 -70.437  -19.378 1.00 88.11  ? 441 TRP A CE2   1 
ATOM   2645 C CE3   . TRP D 4 239 ? 130.857 -68.279  -19.219 1.00 88.41  ? 441 TRP A CE3   1 
ATOM   2646 C CZ2   . TRP D 4 239 ? 133.161 -69.845  -19.898 1.00 88.77  ? 441 TRP A CZ2   1 
ATOM   2647 C CZ3   . TRP D 4 239 ? 132.041 -67.677  -19.740 1.00 88.69  ? 441 TRP A CZ3   1 
ATOM   2648 C CH2   . TRP D 4 239 ? 133.174 -68.471  -20.071 1.00 88.99  ? 441 TRP A CH2   1 
ATOM   2649 N N     . GLN D 4 240 ? 129.142 -67.950  -16.198 1.00 60.02  ? 442 GLN A N     1 
ATOM   2650 C CA    . GLN D 4 240 ? 130.064 -66.964  -15.664 1.00 59.64  ? 442 GLN A CA    1 
ATOM   2651 C C     . GLN D 4 240 ? 129.935 -66.887  -14.157 1.00 57.62  ? 442 GLN A C     1 
ATOM   2652 O O     . GLN D 4 240 ? 130.954 -66.764  -13.489 1.00 58.05  ? 442 GLN A O     1 
ATOM   2653 C CB    . GLN D 4 240 ? 129.851 -65.583  -16.286 1.00 137.51 ? 442 GLN A CB    1 
ATOM   2654 C CG    . GLN D 4 240 ? 131.111 -64.967  -16.913 1.00 142.50 ? 442 GLN A CG    1 
ATOM   2655 C CD    . GLN D 4 240 ? 132.222 -64.661  -15.906 1.00 145.16 ? 442 GLN A CD    1 
ATOM   2656 O OE1   . GLN D 4 240 ? 132.067 -63.808  -15.031 1.00 146.66 ? 442 GLN A OE1   1 
ATOM   2657 N NE2   . GLN D 4 240 ? 133.346 -65.361  -16.033 1.00 145.12 ? 442 GLN A NE2   1 
ATOM   2658 N N     . LYS D 4 241 ? 128.716 -67.086  -13.631 1.00 37.71  ? 443 LYS A N     1 
ATOM   2659 C CA    . LYS D 4 241 ? 128.463 -67.045  -12.181 1.00 35.03  ? 443 LYS A CA    1 
ATOM   2660 C C     . LYS D 4 241 ? 129.227 -68.160  -11.485 1.00 33.41  ? 443 LYS A C     1 
ATOM   2661 O O     . LYS D 4 241 ? 129.794 -67.954  -10.410 1.00 32.97  ? 443 LYS A O     1 
ATOM   2662 C CB    . LYS D 4 241 ? 126.975 -67.165  -11.854 1.00 67.22  ? 443 LYS A CB    1 
ATOM   2663 C CG    . LYS D 4 241 ? 126.611 -66.780  -10.423 1.00 67.76  ? 443 LYS A CG    1 
ATOM   2664 C CD    . LYS D 4 241 ? 125.195 -67.201  -10.065 1.00 68.82  ? 443 LYS A CD    1 
ATOM   2665 C CE    . LYS D 4 241 ? 125.128 -68.660  -9.646  1.00 67.00  ? 443 LYS A CE    1 
ATOM   2666 N NZ    . LYS D 4 241 ? 123.741 -69.171  -9.426  1.00 68.09  ? 443 LYS A NZ    1 
ATOM   2667 N N     . TYR D 4 242 ? 129.313 -69.309  -12.146 1.00 30.91  ? 444 TYR A N     1 
ATOM   2668 C CA    . TYR D 4 242 ? 130.042 -70.438  -11.589 1.00 31.43  ? 444 TYR A CA    1 
ATOM   2669 C C     . TYR D 4 242 ? 131.535 -70.288  -11.820 1.00 32.01  ? 444 TYR A C     1 
ATOM   2670 O O     . TYR D 4 242 ? 132.326 -70.592  -10.930 1.00 32.15  ? 444 TYR A O     1 
ATOM   2671 C CB    . TYR D 4 242 ? 129.504 -71.768  -12.125 1.00 46.77  ? 444 TYR A CB    1 
ATOM   2672 C CG    . TYR D 4 242 ? 128.078 -72.034  -11.687 1.00 46.37  ? 444 TYR A CG    1 
ATOM   2673 C CD1   . TYR D 4 242 ? 127.718 -71.976  -10.326 1.00 45.87  ? 444 TYR A CD1   1 
ATOM   2674 C CD2   . TYR D 4 242 ? 127.053 -72.225  -12.635 1.00 46.54  ? 444 TYR A CD2   1 
ATOM   2675 C CE1   . TYR D 4 242 ? 126.371 -72.086  -9.921  1.00 45.85  ? 444 TYR A CE1   1 
ATOM   2676 C CE2   . TYR D 4 242 ? 125.696 -72.329  -12.243 1.00 45.99  ? 444 TYR A CE2   1 
ATOM   2677 C CZ    . TYR D 4 242 ? 125.369 -72.251  -10.883 1.00 45.78  ? 444 TYR A CZ    1 
ATOM   2678 O OH    . TYR D 4 242 ? 124.056 -72.275  -10.478 1.00 47.35  ? 444 TYR A OH    1 
ATOM   2679 N N     . GLU D 4 243 ? 131.904 -69.712  -12.969 1.00 24.34  ? 445 GLU A N     1 
ATOM   2680 C CA    . GLU D 4 243 ? 133.305 -69.479  -13.327 1.00 25.38  ? 445 GLU A CA    1 
ATOM   2681 C C     . GLU D 4 243 ? 133.927 -68.471  -12.397 1.00 25.27  ? 445 GLU A C     1 
ATOM   2682 O O     . GLU D 4 243 ? 135.131 -68.522  -12.161 1.00 23.99  ? 445 GLU A O     1 
ATOM   2683 C CB    . GLU D 4 243 ? 133.446 -68.977  -14.765 1.00 96.41  ? 445 GLU A CB    1 
ATOM   2684 C CG    . GLU D 4 243 ? 133.525 -70.072  -15.812 1.00 99.79  ? 445 GLU A CG    1 
ATOM   2685 C CD    . GLU D 4 243 ? 134.716 -70.997  -15.619 1.00 102.09 ? 445 GLU A CD    1 
ATOM   2686 O OE1   . GLU D 4 243 ? 135.836 -70.501  -15.341 1.00 102.13 ? 445 GLU A OE1   1 
ATOM   2687 O OE2   . GLU D 4 243 ? 134.522 -72.225  -15.740 1.00 103.15 ? 445 GLU A OE2   1 
ATOM   2688 N N     . THR D 4 244 ? 133.081 -67.586  -11.851 1.00 18.33  ? 446 THR A N     1 
ATOM   2689 C CA    . THR D 4 244 ? 133.507 -66.548  -10.913 1.00 19.67  ? 446 THR A CA    1 
ATOM   2690 C C     . THR D 4 244 ? 133.881 -67.252  -9.621  1.00 20.66  ? 446 THR A C     1 
ATOM   2691 O O     . THR D 4 244 ? 134.938 -66.989  -9.053  1.00 19.93  ? 446 THR A O     1 
ATOM   2692 C CB    . THR D 4 244 ? 132.404 -65.491  -10.638 1.00 45.76  ? 446 THR A CB    1 
ATOM   2693 O OG1   . THR D 4 244 ? 131.839 -65.049  -11.872 1.00 46.28  ? 446 THR A OG1   1 
ATOM   2694 C CG2   . THR D 4 244 ? 132.994 -64.269  -9.971  1.00 45.70  ? 446 THR A CG2   1 
ATOM   2695 N N     . ALA D 4 245 ? 133.071 -68.235  -9.245  1.00 58.94  ? 447 ALA A N     1 
ATOM   2696 C CA    . ALA D 4 245 ? 133.312 -69.017  -8.040  1.00 62.23  ? 447 ALA A CA    1 
ATOM   2697 C C     . ALA D 4 245 ? 134.568 -69.913  -8.149  1.00 64.14  ? 447 ALA A C     1 
ATOM   2698 O O     . ALA D 4 245 ? 135.184 -70.257  -7.133  1.00 65.25  ? 447 ALA A O     1 
ATOM   2699 C CB    . ALA D 4 245 ? 132.090 -69.841  -7.724  1.00 61.31  ? 447 ALA A CB    1 
ATOM   2700 N N     . ARG D 4 246 ? 134.962 -70.243  -9.385  1.00 82.63  ? 448 ARG A N     1 
ATOM   2701 C CA    . ARG D 4 246 ? 136.148 -71.066  -9.639  1.00 83.69  ? 448 ARG A CA    1 
ATOM   2702 C C     . ARG D 4 246 ? 137.406 -70.264  -9.368  1.00 84.11  ? 448 ARG A C     1 
ATOM   2703 O O     . ARG D 4 246 ? 138.304 -70.737  -8.678  1.00 83.43  ? 448 ARG A O     1 
ATOM   2704 C CB    . ARG D 4 246 ? 136.195 -71.576  -11.082 1.00 108.76 ? 448 ARG A CB    1 
ATOM   2705 C CG    . ARG D 4 246 ? 135.138 -72.592  -11.435 1.00 110.34 ? 448 ARG A CG    1 
ATOM   2706 C CD    . ARG D 4 246 ? 135.625 -73.517  -12.531 1.00 111.80 ? 448 ARG A CD    1 
ATOM   2707 N NE    . ARG D 4 246 ? 136.622 -74.461  -12.027 1.00 111.82 ? 448 ARG A NE    1 
ATOM   2708 C CZ    . ARG D 4 246 ? 137.297 -75.332  -12.775 1.00 112.01 ? 448 ARG A CZ    1 
ATOM   2709 N NH1   . ARG D 4 246 ? 137.100 -75.398  -14.087 1.00 112.10 ? 448 ARG A NH1   1 
ATOM   2710 N NH2   . ARG D 4 246 ? 138.162 -76.157  -12.200 1.00 112.94 ? 448 ARG A NH2   1 
ATOM   2711 N N     . ARG D 4 247 ? 137.430 -69.024  -9.859  1.00 115.73 ? 449 ARG A N     1 
ATOM   2712 C CA    . ARG D 4 247 ? 138.568 -68.118  -9.684  1.00 116.50 ? 449 ARG A CA    1 
ATOM   2713 C C     . ARG D 4 247 ? 138.768 -67.662  -8.240  1.00 117.11 ? 449 ARG A C     1 
ATOM   2714 O O     . ARG D 4 247 ? 139.745 -66.971  -7.919  1.00 117.72 ? 449 ARG A O     1 
ATOM   2715 C CB    . ARG D 4 247 ? 138.429 -66.903  -10.598 1.00 96.53  ? 449 ARG A CB    1 
ATOM   2716 C CG    . ARG D 4 247 ? 139.012 -67.099  -11.985 1.00 96.32  ? 449 ARG A CG    1 
ATOM   2717 C CD    . ARG D 4 247 ? 138.776 -65.884  -12.856 1.00 96.28  ? 449 ARG A CD    1 
ATOM   2718 N NE    . ARG D 4 247 ? 137.456 -65.900  -13.486 1.00 96.40  ? 449 ARG A NE    1 
ATOM   2719 C CZ    . ARG D 4 247 ? 136.401 -65.194  -13.083 1.00 96.53  ? 449 ARG A CZ    1 
ATOM   2720 N NH1   . ARG D 4 247 ? 136.481 -64.394  -12.021 1.00 95.10  ? 449 ARG A NH1   1 
ATOM   2721 N NH2   . ARG D 4 247 ? 135.258 -65.287  -13.754 1.00 97.45  ? 449 ARG A NH2   1 
ATOM   2722 N N     . LEU D 4 248 ? 137.854 -68.087  -7.373  1.00 50.50  ? 450 LEU A N     1 
ATOM   2723 C CA    . LEU D 4 248 ? 137.923 -67.746  -5.966  1.00 50.87  ? 450 LEU A CA    1 
ATOM   2724 C C     . LEU D 4 248 ? 138.747 -68.759  -5.170  1.00 51.10  ? 450 LEU A C     1 
ATOM   2725 O O     . LEU D 4 248 ? 139.586 -68.360  -4.360  1.00 50.20  ? 450 LEU A O     1 
ATOM   2726 C CB    . LEU D 4 248 ? 136.515 -67.630  -5.386  1.00 46.70  ? 450 LEU A CB    1 
ATOM   2727 C CG    . LEU D 4 248 ? 136.363 -66.941  -4.030  1.00 47.41  ? 450 LEU A CG    1 
ATOM   2728 C CD1   . LEU D 4 248 ? 136.861 -65.513  -4.093  1.00 47.31  ? 450 LEU A CD1   1 
ATOM   2729 C CD2   . LEU D 4 248 ? 134.926 -66.982  -3.580  1.00 48.06  ? 450 LEU A CD2   1 
ATOM   2730 N N     . LYS D 4 249 ? 138.529 -70.049  -5.458  1.00 74.87  ? 451 LYS A N     1 
ATOM   2731 C CA    . LYS D 4 249 ? 139.170 -71.212  -4.816  1.00 76.10  ? 451 LYS A CA    1 
ATOM   2732 C C     . LYS D 4 249 ? 140.565 -71.030  -4.201  1.00 76.69  ? 451 LYS A C     1 
ATOM   2733 O O     . LYS D 4 249 ? 140.782 -71.408  -3.045  1.00 76.50  ? 451 LYS A O     1 
ATOM   2734 C CB    . LYS D 4 249 ? 139.175 -72.404  -5.790  1.00 106.02 ? 451 LYS A CB    1 
ATOM   2735 C CG    . LYS D 4 249 ? 139.424 -73.774  -5.151  1.00 108.38 ? 451 LYS A CG    1 
ATOM   2736 C CD    . LYS D 4 249 ? 140.660 -74.456  -5.738  1.00 109.95 ? 451 LYS A CD    1 
ATOM   2737 C CE    . LYS D 4 249 ? 141.091 -75.655  -4.896  1.00 110.18 ? 451 LYS A CE    1 
ATOM   2738 N NZ    . LYS D 4 249 ? 142.375 -76.257  -5.366  1.00 109.05 ? 451 LYS A NZ    1 
ATOM   2739 N N     . LYS D 4 250 ? 141.483 -70.434  -4.966  1.00 90.67  ? 452 LYS A N     1 
ATOM   2740 C CA    . LYS D 4 250 ? 142.862 -70.202  -4.521  1.00 91.19  ? 452 LYS A CA    1 
ATOM   2741 C C     . LYS D 4 250 ? 143.017 -68.955  -3.657  1.00 90.23  ? 452 LYS A C     1 
ATOM   2742 O O     . LYS D 4 250 ? 143.729 -68.965  -2.643  1.00 91.92  ? 452 LYS A O     1 
ATOM   2743 N N     . CYS D 4 251 ? 142.300 -67.903  -4.044  1.00 64.36  ? 453 CYS A N     1 
ATOM   2744 C CA    . CYS D 4 251 ? 142.335 -66.622  -3.350  1.00 61.92  ? 453 CYS A CA    1 
ATOM   2745 C C     . CYS D 4 251 ? 141.572 -66.614  -2.017  1.00 59.92  ? 453 CYS A C     1 
ATOM   2746 O O     . CYS D 4 251 ? 141.661 -65.643  -1.271  1.00 59.79  ? 453 CYS A O     1 
ATOM   2747 C CB    . CYS D 4 251 ? 141.810 -65.521  -4.279  1.00 100.51 ? 453 CYS A CB    1 
ATOM   2748 S SG    . CYS D 4 251 ? 142.533 -63.878  -4.008  1.00 102.53 ? 453 CYS A SG    1 
ATOM   2749 N N     . VAL D 4 252 ? 140.879 -67.713  -1.701  1.00 57.26  ? 454 VAL A N     1 
ATOM   2750 C CA    . VAL D 4 252 ? 140.094 -67.856  -0.456  1.00 54.34  ? 454 VAL A CA    1 
ATOM   2751 C C     . VAL D 4 252 ? 140.945 -67.886  0.808   1.00 51.74  ? 454 VAL A C     1 
ATOM   2752 O O     . VAL D 4 252 ? 140.637 -67.176  1.771   1.00 50.39  ? 454 VAL A O     1 
ATOM   2753 C CB    . VAL D 4 252 ? 139.225 -69.142  -0.452  1.00 47.76  ? 454 VAL A CB    1 
ATOM   2754 C CG1   . VAL D 4 252 ? 138.455 -69.285  0.855   1.00 47.46  ? 454 VAL A CG1   1 
ATOM   2755 C CG2   . VAL D 4 252 ? 138.242 -69.106  -1.564  1.00 48.93  ? 454 VAL A CG2   1 
ATOM   2756 N N     . ASP D 4 253 ? 141.985 -68.729  0.799   1.00 46.15  ? 455 ASP A N     1 
ATOM   2757 C CA    . ASP D 4 253 ? 142.905 -68.891  1.925   1.00 44.85  ? 455 ASP A CA    1 
ATOM   2758 C C     . ASP D 4 253 ? 143.332 -67.522  2.439   1.00 42.48  ? 455 ASP A C     1 
ATOM   2759 O O     . ASP D 4 253 ? 143.215 -67.238  3.633   1.00 41.42  ? 455 ASP A O     1 
ATOM   2760 N N     . LYS D 4 254 ? 143.599 -66.625  1.486   1.00 22.92  ? 456 LYS A N     1 
ATOM   2761 C CA    . LYS D 4 254 ? 144.043 -65.262  1.768   1.00 21.55  ? 456 LYS A CA    1 
ATOM   2762 C C     . LYS D 4 254 ? 142.955 -64.335  2.284   1.00 19.75  ? 456 LYS A C     1 
ATOM   2763 O O     . LYS D 4 254 ? 143.243 -63.402  3.023   1.00 18.71  ? 456 LYS A O     1 
ATOM   2764 C CB    . LYS D 4 254 ? 144.689 -64.654  0.525   1.00 63.82  ? 456 LYS A CB    1 
ATOM   2765 C CG    . LYS D 4 254 ? 145.785 -63.658  0.837   1.00 66.98  ? 456 LYS A CG    1 
ATOM   2766 C CD    . LYS D 4 254 ? 145.485 -62.280  0.270   1.00 70.30  ? 456 LYS A CD    1 
ATOM   2767 C CE    . LYS D 4 254 ? 145.086 -61.259  1.338   1.00 71.53  ? 456 LYS A CE    1 
ATOM   2768 N NZ    . LYS D 4 254 ? 143.622 -61.234  1.612   1.00 71.72  ? 456 LYS A NZ    1 
ATOM   2769 N N     . ILE D 4 255 ? 141.709 -64.597  1.907   1.00 24.43  ? 457 ILE A N     1 
ATOM   2770 C CA    . ILE D 4 255 ? 140.598 -63.750  2.328   1.00 24.88  ? 457 ILE A CA    1 
ATOM   2771 C C     . ILE D 4 255 ? 140.248 -63.972  3.790   1.00 24.69  ? 457 ILE A C     1 
ATOM   2772 O O     . ILE D 4 255 ? 140.024 -63.010  4.537   1.00 23.25  ? 457 ILE A O     1 
ATOM   2773 C CB    . ILE D 4 255 ? 139.375 -63.946  1.402   1.00 18.68  ? 457 ILE A CB    1 
ATOM   2774 C CG1   . ILE D 4 255 ? 139.684 -63.327  0.039   1.00 18.61  ? 457 ILE A CG1   1 
ATOM   2775 C CG2   . ILE D 4 255 ? 138.127 -63.259  1.968   1.00 19.92  ? 457 ILE A CG2   1 
ATOM   2776 C CD1   . ILE D 4 255 ? 138.703 -63.690  -1.069  1.00 18.95  ? 457 ILE A CD1   1 
ATOM   2777 N N     . ARG D 4 256 ? 140.274 -65.239  4.197   1.00 37.48  ? 458 ARG A N     1 
ATOM   2778 C CA    . ARG D 4 256 ? 139.963 -65.607  5.565   1.00 38.27  ? 458 ARG A CA    1 
ATOM   2779 C C     . ARG D 4 256 ? 141.007 -65.059  6.530   1.00 39.30  ? 458 ARG A C     1 
ATOM   2780 O O     . ARG D 4 256 ? 140.648 -64.294  7.427   1.00 38.32  ? 458 ARG A O     1 
ATOM   2781 C CB    . ARG D 4 256 ? 139.726 -67.109  5.668   1.00 63.04  ? 458 ARG A CB    1 
ATOM   2782 C CG    . ARG D 4 256 ? 138.445 -67.488  4.923   1.00 62.86  ? 458 ARG A CG    1 
ATOM   2783 C CD    . ARG D 4 256 ? 138.155 -68.975  4.819   1.00 62.49  ? 458 ARG A CD    1 
ATOM   2784 N NE    . ARG D 4 256 ? 136.811 -69.199  4.265   1.00 62.17  ? 458 ARG A NE    1 
ATOM   2785 C CZ    . ARG D 4 256 ? 136.344 -70.357  3.791   1.00 61.25  ? 458 ARG A CZ    1 
ATOM   2786 N NH1   . ARG D 4 256 ? 137.102 -71.449  3.775   1.00 61.54  ? 458 ARG A NH1   1 
ATOM   2787 N NH2   . ARG D 4 256 ? 135.087 -70.436  3.362   1.00 60.87  ? 458 ARG A NH2   1 
ATOM   2788 N N     . ASN D 4 257 ? 142.291 -65.275  6.200   1.00 46.89  ? 459 ASN A N     1 
ATOM   2789 C CA    . ASN D 4 257 ? 143.440 -64.791  6.989   1.00 49.19  ? 459 ASN A CA    1 
ATOM   2790 C C     . ASN D 4 257 ? 143.435 -63.277  6.998   1.00 49.90  ? 459 ASN A C     1 
ATOM   2791 O O     . ASN D 4 257 ? 143.883 -62.650  7.959   1.00 50.48  ? 459 ASN A O     1 
ATOM   2792 C CB    . ASN D 4 257 ? 144.783 -65.240  6.385   1.00 117.45 ? 459 ASN A CB    1 
ATOM   2793 C CG    . ASN D 4 257 ? 144.993 -66.741  6.433   1.00 120.82 ? 459 ASN A CG    1 
ATOM   2794 O OD1   . ASN D 4 257 ? 144.368 -67.447  7.225   1.00 122.26 ? 459 ASN A OD1   1 
ATOM   2795 N ND2   . ASN D 4 257 ? 145.879 -67.239  5.570   1.00 122.49 ? 459 ASN A ND2   1 
ATOM   2796 N N     . GLN D 4 258 ? 142.888 -62.721  5.916   1.00 39.49  ? 460 GLN A N     1 
ATOM   2797 C CA    . GLN D 4 258 ? 142.774 -61.284  5.697   1.00 40.34  ? 460 GLN A CA    1 
ATOM   2798 C C     . GLN D 4 258 ? 141.780 -60.672  6.668   1.00 38.66  ? 460 GLN A C     1 
ATOM   2799 O O     . GLN D 4 258 ? 142.145 -59.787  7.438   1.00 37.55  ? 460 GLN A O     1 
ATOM   2800 N N     . TYR D 4 259 ? 140.549 -61.186  6.687   1.00 56.35  ? 461 TYR A N     1 
ATOM   2801 C CA    . TYR D 4 259 ? 139.559 -60.642  7.604   1.00 55.48  ? 461 TYR A CA    1 
ATOM   2802 C C     . TYR D 4 259 ? 139.811 -61.032  9.057   1.00 54.04  ? 461 TYR A C     1 
ATOM   2803 O O     . TYR D 4 259 ? 139.461 -60.274  9.966   1.00 54.18  ? 461 TYR A O     1 
ATOM   2804 C CB    . TYR D 4 259 ? 138.105 -60.925  7.154   1.00 44.44  ? 461 TYR A CB    1 
ATOM   2805 C CG    . TYR D 4 259 ? 137.550 -62.340  7.258   1.00 43.73  ? 461 TYR A CG    1 
ATOM   2806 C CD1   . TYR D 4 259 ? 137.380 -62.980  8.503   1.00 43.57  ? 461 TYR A CD1   1 
ATOM   2807 C CD2   . TYR D 4 259 ? 137.117 -63.018  6.116   1.00 44.71  ? 461 TYR A CD2   1 
ATOM   2808 C CE1   . TYR D 4 259 ? 136.800 -64.258  8.613   1.00 44.70  ? 461 TYR A CE1   1 
ATOM   2809 C CE2   . TYR D 4 259 ? 136.514 -64.311  6.213   1.00 46.29  ? 461 TYR A CE2   1 
ATOM   2810 C CZ    . TYR D 4 259 ? 136.369 -64.916  7.471   1.00 46.37  ? 461 TYR A CZ    1 
ATOM   2811 O OH    . TYR D 4 259 ? 135.811 -66.163  7.594   1.00 48.50  ? 461 TYR A OH    1 
ATOM   2812 N N     . ARG D 4 260 ? 140.428 -62.206  9.263   1.00 23.92  ? 462 ARG A N     1 
ATOM   2813 C CA    . ARG D 4 260 ? 140.731 -62.703  10.611  1.00 21.62  ? 462 ARG A CA    1 
ATOM   2814 C C     . ARG D 4 260 ? 141.691 -61.760  11.306  1.00 20.93  ? 462 ARG A C     1 
ATOM   2815 O O     . ARG D 4 260 ? 141.584 -61.524  12.508  1.00 19.37  ? 462 ARG A O     1 
ATOM   2816 C CB    . ARG D 4 260 ? 141.282 -64.121  10.585  1.00 0.00   ? 462 ARG A CB    1 
ATOM   2817 N N     . GLU D 4 261 ? 142.534 -61.125  10.496  1.00 31.94  ? 463 GLU A N     1 
ATOM   2818 C CA    . GLU D 4 261 ? 143.511 -60.161  10.971  1.00 33.22  ? 463 GLU A CA    1 
ATOM   2819 C C     . GLU D 4 261 ? 142.808 -58.854  11.305  1.00 34.16  ? 463 GLU A C     1 
ATOM   2820 O O     . GLU D 4 261 ? 143.033 -58.283  12.372  1.00 33.37  ? 463 GLU A O     1 
ATOM   2821 C CB    . GLU D 4 261 ? 144.578 -59.930  9.909   1.00 14.65  ? 463 GLU A CB    1 
ATOM   2822 N N     . ASP D 4 262 ? 141.871 -58.461  10.437  1.00 61.90  ? 464 ASP A N     1 
ATOM   2823 C CA    . ASP D 4 262 ? 141.093 -57.224  10.576  1.00 63.89  ? 464 ASP A CA    1 
ATOM   2824 C C     . ASP D 4 262 ? 140.218 -57.159  11.836  1.00 64.53  ? 464 ASP A C     1 
ATOM   2825 O O     . ASP D 4 262 ? 139.583 -56.138  12.089  1.00 65.33  ? 464 ASP A O     1 
ATOM   2826 C CB    . ASP D 4 262 ? 140.219 -56.981  9.329   1.00 117.68 ? 464 ASP A CB    1 
ATOM   2827 C CG    . ASP D 4 262 ? 141.012 -56.525  8.109   1.00 119.64 ? 464 ASP A CG    1 
ATOM   2828 O OD1   . ASP D 4 262 ? 141.090 -57.286  7.118   1.00 120.82 ? 464 ASP A OD1   1 
ATOM   2829 O OD2   . ASP D 4 262 ? 141.513 -55.384  8.118   1.00 121.10 ? 464 ASP A OD2   1 
ATOM   2830 N N     . TRP D 4 263 ? 140.195 -58.242  12.618  1.00 38.48  ? 465 TRP A N     1 
ATOM   2831 C CA    . TRP D 4 263 ? 139.425 -58.299  13.865  1.00 38.96  ? 465 TRP A CA    1 
ATOM   2832 C C     . TRP D 4 263 ? 140.125 -57.512  14.975  1.00 40.86  ? 465 TRP A C     1 
ATOM   2833 O O     . TRP D 4 263 ? 139.474 -56.850  15.788  1.00 40.68  ? 465 TRP A O     1 
ATOM   2834 C CB    . TRP D 4 263 ? 139.222 -59.750  14.321  1.00 28.28  ? 465 TRP A CB    1 
ATOM   2835 C CG    . TRP D 4 263 ? 138.226 -60.543  13.521  1.00 26.39  ? 465 TRP A CG    1 
ATOM   2836 C CD1   . TRP D 4 263 ? 137.211 -60.049  12.759  1.00 27.06  ? 465 TRP A CD1   1 
ATOM   2837 C CD2   . TRP D 4 263 ? 138.164 -61.973  13.389  1.00 26.09  ? 465 TRP A CD2   1 
ATOM   2838 N NE1   . TRP D 4 263 ? 136.524 -61.073  12.148  1.00 27.02  ? 465 TRP A NE1   1 
ATOM   2839 C CE2   . TRP D 4 263 ? 137.083 -62.265  12.514  1.00 25.97  ? 465 TRP A CE2   1 
ATOM   2840 C CE3   . TRP D 4 263 ? 138.920 -63.041  13.915  1.00 27.50  ? 465 TRP A CE3   1 
ATOM   2841 C CZ2   . TRP D 4 263 ? 136.735 -63.583  12.147  1.00 26.22  ? 465 TRP A CZ2   1 
ATOM   2842 C CZ3   . TRP D 4 263 ? 138.575 -64.371  13.545  1.00 27.35  ? 465 TRP A CZ3   1 
ATOM   2843 C CH2   . TRP D 4 263 ? 137.488 -64.619  12.667  1.00 26.78  ? 465 TRP A CH2   1 
ATOM   2844 N N     . LYS D 4 264 ? 141.457 -57.583  14.978  1.00 72.32  ? 466 LYS A N     1 
ATOM   2845 C CA    . LYS D 4 264 ? 142.297 -56.894  15.956  1.00 73.97  ? 466 LYS A CA    1 
ATOM   2846 C C     . LYS D 4 264 ? 142.833 -55.582  15.370  1.00 74.98  ? 466 LYS A C     1 
ATOM   2847 O O     . LYS D 4 264 ? 143.969 -55.179  15.641  1.00 75.25  ? 466 LYS A O     1 
ATOM   2848 C CB    . LYS D 4 264 ? 143.448 -57.814  16.399  1.00 79.69  ? 466 LYS A CB    1 
ATOM   2849 N N     . SER D 4 265 ? 141.986 -54.911  14.587  1.00 76.74  ? 467 SER A N     1 
ATOM   2850 C CA    . SER D 4 265 ? 142.307 -53.637  13.934  1.00 78.58  ? 467 SER A CA    1 
ATOM   2851 C C     . SER D 4 265 ? 142.293 -52.460  14.904  1.00 79.96  ? 467 SER A C     1 
ATOM   2852 O O     . SER D 4 265 ? 142.056 -52.625  16.104  1.00 80.68  ? 467 SER A O     1 
ATOM   2853 C CB    . SER D 4 265 ? 141.331 -53.375  12.776  1.00 61.49  ? 467 SER A CB    1 
ATOM   2854 O OG    . SER D 4 265 ? 141.350 -52.026  12.330  1.00 62.49  ? 467 SER A OG    1 
ATOM   2855 N N     . LYS D 4 266 ? 142.549 -51.275  14.364  1.00 61.24  ? 468 LYS A N     1 
ATOM   2856 C CA    . LYS D 4 266 ? 142.577 -50.064  15.149  1.00 61.62  ? 468 LYS A CA    1 
ATOM   2857 C C     . LYS D 4 266 ? 141.380 -49.167  14.873  1.00 62.45  ? 468 LYS A C     1 
ATOM   2858 O O     . LYS D 4 266 ? 141.078 -48.290  15.689  1.00 62.88  ? 468 LYS A O     1 
ATOM   2859 C CB    . LYS D 4 266 ? 143.878 -49.315  14.898  1.00 50.48  ? 468 LYS A CB    1 
ATOM   2860 N N     . GLU D 4 267 ? 140.683 -49.378  13.754  1.00 47.28  ? 469 GLU A N     1 
ATOM   2861 C CA    . GLU D 4 267 ? 139.540 -48.514  13.454  1.00 48.23  ? 469 GLU A CA    1 
ATOM   2862 C C     . GLU D 4 267 ? 138.168 -49.155  13.301  1.00 47.15  ? 469 GLU A C     1 
ATOM   2863 O O     . GLU D 4 267 ? 138.037 -50.318  12.918  1.00 45.55  ? 469 GLU A O     1 
ATOM   2864 C CB    . GLU D 4 267 ? 139.831 -47.591  12.263  1.00 127.92 ? 469 GLU A CB    1 
ATOM   2865 C CG    . GLU D 4 267 ? 139.328 -46.155  12.466  1.00 131.02 ? 469 GLU A CG    1 
ATOM   2866 C CD    . GLU D 4 267 ? 139.115 -45.410  11.162  1.00 133.10 ? 469 GLU A CD    1 
ATOM   2867 O OE1   . GLU D 4 267 ? 140.098 -44.878  10.602  1.00 134.24 ? 469 GLU A OE1   1 
ATOM   2868 O OE2   . GLU D 4 267 ? 137.955 -45.350  10.699  1.00 133.81 ? 469 GLU A OE2   1 
ATOM   2869 N N     . MET D 4 268 ? 137.162 -48.327  13.600  1.00 34.13  ? 470 MET A N     1 
ATOM   2870 C CA    . MET D 4 268 ? 135.720 -48.602  13.561  1.00 34.74  ? 470 MET A CA    1 
ATOM   2871 C C     . MET D 4 268 ? 135.295 -49.380  12.317  1.00 32.96  ? 470 MET A C     1 
ATOM   2872 O O     . MET D 4 268 ? 135.269 -50.603  12.344  1.00 34.09  ? 470 MET A O     1 
ATOM   2873 C CB    . MET D 4 268 ? 134.975 -47.249  13.624  1.00 84.08  ? 470 MET A CB    1 
ATOM   2874 C CG    . MET D 4 268 ? 133.445 -47.302  13.786  1.00 89.52  ? 470 MET A CG    1 
ATOM   2875 S SD    . MET D 4 268 ? 132.588 -45.866  13.059  1.00 97.17  ? 470 MET A SD    1 
ATOM   2876 C CE    . MET D 4 268 ? 133.236 -44.522  14.061  1.00 96.16  ? 470 MET A CE    1 
ATOM   2877 N N     . LYS D 4 269 ? 135.091 -48.655  11.214  1.00 43.15  ? 471 LYS A N     1 
ATOM   2878 C CA    . LYS D 4 269 ? 134.667 -49.182  9.914   1.00 40.28  ? 471 LYS A CA    1 
ATOM   2879 C C     . LYS D 4 269 ? 135.438 -50.394  9.398   1.00 38.19  ? 471 LYS A C     1 
ATOM   2880 O O     . LYS D 4 269 ? 134.912 -51.156  8.590   1.00 37.34  ? 471 LYS A O     1 
ATOM   2881 C CB    . LYS D 4 269 ? 134.697 -48.063  8.877   1.00 42.22  ? 471 LYS A CB    1 
ATOM   2882 N N     . VAL D 4 270 ? 136.657 -50.584  9.910   1.00 34.72  ? 472 VAL A N     1 
ATOM   2883 C CA    . VAL D 4 270 ? 137.529 -51.693  9.519   1.00 32.63  ? 472 VAL A CA    1 
ATOM   2884 C C     . VAL D 4 270 ? 137.193 -52.947  10.309  1.00 31.22  ? 472 VAL A C     1 
ATOM   2885 O O     . VAL D 4 270 ? 137.087 -54.044  9.738   1.00 31.59  ? 472 VAL A O     1 
ATOM   2886 C CB    . VAL D 4 270 ? 139.003 -51.367  9.764   1.00 49.69  ? 472 VAL A CB    1 
ATOM   2887 C CG1   . VAL D 4 270 ? 139.884 -52.386  9.059   1.00 49.65  ? 472 VAL A CG1   1 
ATOM   2888 C CG2   . VAL D 4 270 ? 139.320 -49.960  9.301   1.00 49.00  ? 472 VAL A CG2   1 
ATOM   2889 N N     . ARG D 4 271 ? 137.067 -52.775  11.628  1.00 17.98  ? 473 ARG A N     1 
ATOM   2890 C CA    . ARG D 4 271 ? 136.726 -53.860  12.550  1.00 15.89  ? 473 ARG A CA    1 
ATOM   2891 C C     . ARG D 4 271 ? 135.297 -54.307  12.241  1.00 14.54  ? 473 ARG A C     1 
ATOM   2892 O O     . ARG D 4 271 ? 134.995 -55.493  12.294  1.00 14.45  ? 473 ARG A O     1 
ATOM   2893 C CB    . ARG D 4 271 ? 136.839 -53.383  14.004  1.00 67.00  ? 473 ARG A CB    1 
ATOM   2894 C CG    . ARG D 4 271 ? 138.020 -53.963  14.787  1.00 68.57  ? 473 ARG A CG    1 
ATOM   2895 C CD    . ARG D 4 271 ? 138.144 -53.350  16.190  1.00 70.32  ? 473 ARG A CD    1 
ATOM   2896 N NE    . ARG D 4 271 ? 139.147 -54.025  17.023  1.00 72.54  ? 473 ARG A NE    1 
ATOM   2897 C CZ    . ARG D 4 271 ? 139.500 -53.647  18.254  1.00 74.39  ? 473 ARG A CZ    1 
ATOM   2898 N NH1   . ARG D 4 271 ? 138.942 -52.584  18.827  1.00 75.20  ? 473 ARG A NH1   1 
ATOM   2899 N NH2   . ARG D 4 271 ? 140.419 -54.339  18.920  1.00 75.37  ? 473 ARG A NH2   1 
ATOM   2900 N N     . GLN D 4 272 ? 134.463 -53.348  11.821  1.00 24.59  ? 474 GLN A N     1 
ATOM   2901 C CA    . GLN D 4 272 ? 133.062 -53.576  11.449  1.00 22.80  ? 474 GLN A CA    1 
ATOM   2902 C C     . GLN D 4 272 ? 132.988 -54.432  10.191  1.00 22.26  ? 474 GLN A C     1 
ATOM   2903 O O     . GLN D 4 272 ? 132.268 -55.416  10.142  1.00 22.64  ? 474 GLN A O     1 
ATOM   2904 C CB    . GLN D 4 272 ? 132.371 -52.248  11.158  1.00 30.72  ? 474 GLN A CB    1 
ATOM   2905 C CG    . GLN D 4 272 ? 132.177 -51.345  12.356  1.00 30.63  ? 474 GLN A CG    1 
ATOM   2906 C CD    . GLN D 4 272 ? 130.758 -51.330  12.836  1.00 30.78  ? 474 GLN A CD    1 
ATOM   2907 O OE1   . GLN D 4 272 ? 130.107 -52.365  12.869  1.00 34.34  ? 474 GLN A OE1   1 
ATOM   2908 N NE2   . GLN D 4 272 ? 130.260 -50.155  13.208  1.00 30.35  ? 474 GLN A NE2   1 
ATOM   2909 N N     . ARG D 4 273 ? 133.795 -54.067  9.202   1.00 12.89  ? 475 ARG A N     1 
ATOM   2910 C CA    . ARG D 4 273 ? 133.887 -54.738  7.914   1.00 13.30  ? 475 ARG A CA    1 
ATOM   2911 C C     . ARG D 4 273 ? 134.069 -56.252  8.087   1.00 12.44  ? 475 ARG A C     1 
ATOM   2912 O O     . ARG D 4 273 ? 133.171 -57.039  7.753   1.00 11.86  ? 475 ARG A O     1 
ATOM   2913 C CB    . ARG D 4 273 ? 135.076 -54.131  7.166   1.00 107.07 ? 475 ARG A CB    1 
ATOM   2914 C CG    . ARG D 4 273 ? 135.208 -54.421  5.693   1.00 112.02 ? 475 ARG A CG    1 
ATOM   2915 C CD    . ARG D 4 273 ? 136.402 -53.653  5.159   1.00 114.35 ? 475 ARG A CD    1 
ATOM   2916 N NE    . ARG D 4 273 ? 137.667 -54.149  5.703   1.00 117.06 ? 475 ARG A NE    1 
ATOM   2917 C CZ    . ARG D 4 273 ? 138.847 -53.554  5.548   1.00 118.98 ? 475 ARG A CZ    1 
ATOM   2918 N NH1   . ARG D 4 273 ? 138.955 -52.419  4.863   1.00 118.94 ? 475 ARG A NH1   1 
ATOM   2919 N NH2   . ARG D 4 273 ? 139.933 -54.111  6.062   1.00 119.97 ? 475 ARG A NH2   1 
ATOM   2920 N N     . ALA D 4 274 ? 135.166 -56.623  8.743   1.00 28.05  ? 476 ALA A N     1 
ATOM   2921 C CA    . ALA D 4 274 ? 135.518 -58.016  8.978   1.00 27.07  ? 476 ALA A CA    1 
ATOM   2922 C C     . ALA D 4 274 ? 134.462 -58.929  9.629   1.00 27.03  ? 476 ALA A C     1 
ATOM   2923 O O     . ALA D 4 274 ? 134.217 -60.022  9.128   1.00 29.78  ? 476 ALA A O     1 
ATOM   2924 C CB    . ALA D 4 274 ? 136.784 -58.075  9.747   1.00 70.09  ? 476 ALA A CB    1 
ATOM   2925 N N     . VAL D 4 275 ? 133.818 -58.467  10.707  1.00 18.25  ? 477 VAL A N     1 
ATOM   2926 C CA    . VAL D 4 275 ? 132.787 -59.233  11.443  1.00 15.34  ? 477 VAL A CA    1 
ATOM   2927 C C     . VAL D 4 275 ? 131.679 -59.691  10.500  1.00 13.54  ? 477 VAL A C     1 
ATOM   2928 O O     . VAL D 4 275 ? 131.302 -60.864  10.473  1.00 11.91  ? 477 VAL A O     1 
ATOM   2929 C CB    . VAL D 4 275 ? 132.114 -58.371  12.570  1.00 25.75  ? 477 VAL A CB    1 
ATOM   2930 C CG1   . VAL D 4 275 ? 131.232 -59.224  13.433  1.00 25.23  ? 477 VAL A CG1   1 
ATOM   2931 C CG2   . VAL D 4 275 ? 133.145 -57.693  13.437  1.00 27.10  ? 477 VAL A CG2   1 
ATOM   2932 N N     . ALA D 4 276 ? 131.219 -58.746  9.689   1.00 29.01  ? 478 ALA A N     1 
ATOM   2933 C CA    . ALA D 4 276 ? 130.161 -58.966  8.722   1.00 28.58  ? 478 ALA A CA    1 
ATOM   2934 C C     . ALA D 4 276 ? 130.571 -60.033  7.732   1.00 28.89  ? 478 ALA A C     1 
ATOM   2935 O O     . ALA D 4 276 ? 129.854 -61.007  7.517   1.00 28.93  ? 478 ALA A O     1 
ATOM   2936 C CB    . ALA D 4 276 ? 129.878 -57.692  8.014   1.00 3.54   ? 478 ALA A CB    1 
ATOM   2937 N N     . LEU D 4 277 ? 131.805 -59.908  7.264   1.00 34.09  ? 479 LEU A N     1 
ATOM   2938 C CA    . LEU D 4 277 ? 132.389 -60.824  6.302   1.00 35.88  ? 479 LEU A CA    1 
ATOM   2939 C C     . LEU D 4 277 ? 132.503 -62.235  6.874   1.00 36.40  ? 479 LEU A C     1 
ATOM   2940 O O     . LEU D 4 277 ? 132.410 -63.211  6.141   1.00 38.66  ? 479 LEU A O     1 
ATOM   2941 C CB    . LEU D 4 277 ? 133.755 -60.278  5.890   1.00 55.44  ? 479 LEU A CB    1 
ATOM   2942 C CG    . LEU D 4 277 ? 134.393 -60.553  4.533   1.00 56.49  ? 479 LEU A CG    1 
ATOM   2943 C CD1   . LEU D 4 277 ? 133.395 -60.390  3.408   1.00 57.20  ? 479 LEU A CD1   1 
ATOM   2944 C CD2   . LEU D 4 277 ? 135.550 -59.579  4.362   1.00 56.80  ? 479 LEU A CD2   1 
ATOM   2945 N N     . TYR D 4 278 ? 132.585 -62.322  8.199   1.00 15.37  ? 480 TYR A N     1 
ATOM   2946 C CA    . TYR D 4 278 ? 132.688 -63.594  8.899   1.00 14.51  ? 480 TYR A CA    1 
ATOM   2947 C C     . TYR D 4 278 ? 131.353 -64.296  8.809   1.00 12.53  ? 480 TYR A C     1 
ATOM   2948 O O     . TYR D 4 278 ? 131.300 -65.491  8.537   1.00 12.78  ? 480 TYR A O     1 
ATOM   2949 C CB    . TYR D 4 278 ? 133.060 -63.356  10.369  1.00 47.62  ? 480 TYR A CB    1 
ATOM   2950 C CG    . TYR D 4 278 ? 133.162 -64.577  11.267  1.00 50.04  ? 480 TYR A CG    1 
ATOM   2951 C CD1   . TYR D 4 278 ? 133.940 -65.699  10.898  1.00 50.89  ? 480 TYR A CD1   1 
ATOM   2952 C CD2   . TYR D 4 278 ? 132.544 -64.586  12.528  1.00 49.39  ? 480 TYR A CD2   1 
ATOM   2953 C CE1   . TYR D 4 278 ? 134.105 -66.805  11.780  1.00 51.92  ? 480 TYR A CE1   1 
ATOM   2954 C CE2   . TYR D 4 278 ? 132.699 -65.680  13.417  1.00 50.50  ? 480 TYR A CE2   1 
ATOM   2955 C CZ    . TYR D 4 278 ? 133.482 -66.783  13.039  1.00 51.54  ? 480 TYR A CZ    1 
ATOM   2956 O OH    . TYR D 4 278 ? 133.670 -67.840  13.905  1.00 51.83  ? 480 TYR A OH    1 
ATOM   2957 N N     . PHE D 4 279 ? 130.278 -63.535  8.964   1.00 22.73  ? 481 PHE A N     1 
ATOM   2958 C CA    . PHE D 4 279 ? 128.939 -64.106  8.912   1.00 22.09  ? 481 PHE A CA    1 
ATOM   2959 C C     . PHE D 4 279 ? 128.537 -64.555  7.547   1.00 21.87  ? 481 PHE A C     1 
ATOM   2960 O O     . PHE D 4 279 ? 128.078 -65.680  7.366   1.00 21.72  ? 481 PHE A O     1 
ATOM   2961 C CB    . PHE D 4 279 ? 127.935 -63.121  9.464   1.00 19.12  ? 481 PHE A CB    1 
ATOM   2962 C CG    . PHE D 4 279 ? 128.176 -62.785  10.886  1.00 20.55  ? 481 PHE A CG    1 
ATOM   2963 C CD1   . PHE D 4 279 ? 128.734 -63.743  11.767  1.00 21.33  ? 481 PHE A CD1   1 
ATOM   2964 C CD2   . PHE D 4 279 ? 127.872 -61.511  11.369  1.00 21.56  ? 481 PHE A CD2   1 
ATOM   2965 C CE1   . PHE D 4 279 ? 128.988 -63.437  13.107  1.00 22.11  ? 481 PHE A CE1   1 
ATOM   2966 C CE2   . PHE D 4 279 ? 128.120 -61.181  12.722  1.00 22.64  ? 481 PHE A CE2   1 
ATOM   2967 C CZ    . PHE D 4 279 ? 128.683 -62.155  13.593  1.00 22.39  ? 481 PHE A CZ    1 
ATOM   2968 N N     . ILE D 4 280 ? 128.851 -63.719  6.574   1.00 25.69  ? 482 ILE A N     1 
ATOM   2969 C CA    . ILE D 4 280 ? 128.537 -64.005  5.200   1.00 26.64  ? 482 ILE A CA    1 
ATOM   2970 C C     . ILE D 4 280 ? 129.353 -65.200  4.691   1.00 28.04  ? 482 ILE A C     1 
ATOM   2971 O O     . ILE D 4 280 ? 128.897 -65.942  3.806   1.00 27.39  ? 482 ILE A O     1 
ATOM   2972 C CB    . ILE D 4 280 ? 128.700 -62.748  4.375   1.00 42.89  ? 482 ILE A CB    1 
ATOM   2973 C CG1   . ILE D 4 280 ? 127.759 -61.690  4.956   1.00 43.01  ? 482 ILE A CG1   1 
ATOM   2974 C CG2   . ILE D 4 280 ? 128.313 -63.002  2.911   1.00 44.64  ? 482 ILE A CG2   1 
ATOM   2975 C CD1   . ILE D 4 280 ? 128.051 -60.294  4.531   1.00 44.09  ? 482 ILE A CD1   1 
ATOM   2976 N N     . ASP D 4 281 ? 130.488 -65.456  5.342   1.00 16.12  ? 483 ASP A N     1 
ATOM   2977 C CA    . ASP D 4 281 ? 131.323 -66.593  4.993   1.00 17.71  ? 483 ASP A CA    1 
ATOM   2978 C C     . ASP D 4 281 ? 130.688 -67.842  5.623   1.00 18.52  ? 483 ASP A C     1 
ATOM   2979 O O     . ASP D 4 281 ? 130.225 -68.737  4.904   1.00 17.02  ? 483 ASP A O     1 
ATOM   2980 C CB    . ASP D 4 281 ? 132.744 -66.390  5.532   1.00 55.14  ? 483 ASP A CB    1 
ATOM   2981 C CG    . ASP D 4 281 ? 133.775 -67.304  4.877   1.00 56.86  ? 483 ASP A CG    1 
ATOM   2982 O OD1   . ASP D 4 281 ? 133.404 -68.241  4.129   1.00 55.68  ? 483 ASP A OD1   1 
ATOM   2983 O OD2   . ASP D 4 281 ? 134.977 -67.068  5.110   1.00 57.06  ? 483 ASP A OD2   1 
ATOM   2984 N N     . LYS D 4 282 ? 130.570 -67.820  6.956   1.00 74.09  ? 484 LYS A N     1 
ATOM   2985 C CA    . LYS D 4 282 ? 130.032 -68.924  7.768   1.00 76.40  ? 484 LYS A CA    1 
ATOM   2986 C C     . LYS D 4 282 ? 128.539 -69.188  7.668   1.00 78.18  ? 484 LYS A C     1 
ATOM   2987 O O     . LYS D 4 282 ? 128.113 -70.176  7.062   1.00 79.98  ? 484 LYS A O     1 
ATOM   2988 C CB    . LYS D 4 282 ? 130.415 -68.730  9.253   1.00 0.00   ? 484 LYS A CB    1 
ATOM   2989 N N     . LEU D 4 283 ? 127.766 -68.281  8.259   1.00 30.70  ? 485 LEU A N     1 
ATOM   2990 C CA    . LEU D 4 283 ? 126.310 -68.344  8.331   1.00 31.20  ? 485 LEU A CA    1 
ATOM   2991 C C     . LEU D 4 283 ? 125.538 -68.441  7.029   1.00 32.38  ? 485 LEU A C     1 
ATOM   2992 O O     . LEU D 4 283 ? 124.347 -68.789  7.044   1.00 33.37  ? 485 LEU A O     1 
ATOM   2993 C CB    . LEU D 4 283 ? 125.797 -67.140  9.104   1.00 71.76  ? 485 LEU A CB    1 
ATOM   2994 C CG    . LEU D 4 283 ? 125.888 -67.037  10.619  1.00 71.63  ? 485 LEU A CG    1 
ATOM   2995 C CD1   . LEU D 4 283 ? 124.990 -68.091  11.218  1.00 71.62  ? 485 LEU A CD1   1 
ATOM   2996 C CD2   . LEU D 4 283 ? 127.317 -67.158  11.127  1.00 72.47  ? 485 LEU A CD2   1 
ATOM   2997 N N     . ALA D 4 284 ? 126.227 -68.156  5.917   1.00 55.01  ? 486 ALA A N     1 
ATOM   2998 C CA    . ALA D 4 284 ? 125.681 -68.172  4.551   1.00 56.42  ? 486 ALA A CA    1 
ATOM   2999 C C     . ALA D 4 284 ? 124.565 -67.140  4.441   1.00 56.80  ? 486 ALA A C     1 
ATOM   3000 O O     . ALA D 4 284 ? 123.480 -67.399  3.908   1.00 57.69  ? 486 ALA A O     1 
ATOM   3001 C CB    . ALA D 4 284 ? 125.191 -69.595  4.147   1.00 98.13  ? 486 ALA A CB    1 
ATOM   3002 N N     . LEU D 4 285 ? 124.846 -65.973  5.007   1.00 31.83  ? 487 LEU A N     1 
ATOM   3003 C CA    . LEU D 4 285 ? 123.906 -64.867  5.016   1.00 31.94  ? 487 LEU A CA    1 
ATOM   3004 C C     . LEU D 4 285 ? 123.895 -64.007  3.776   1.00 32.19  ? 487 LEU A C     1 
ATOM   3005 O O     . LEU D 4 285 ? 124.815 -64.042  2.961   1.00 32.29  ? 487 LEU A O     1 
ATOM   3006 C CB    . LEU D 4 285 ? 124.152 -63.971  6.221   1.00 52.80  ? 487 LEU A CB    1 
ATOM   3007 C CG    . LEU D 4 285 ? 123.691 -64.497  7.573   1.00 53.67  ? 487 LEU A CG    1 
ATOM   3008 C CD1   . LEU D 4 285 ? 123.953 -63.422  8.602   1.00 54.28  ? 487 LEU A CD1   1 
ATOM   3009 C CD2   . LEU D 4 285 ? 122.218 -64.909  7.567   1.00 53.77  ? 487 LEU A CD2   1 
ATOM   3010 N N     . ARG D 4 286 ? 122.808 -63.263  3.628   1.00 43.84  ? 488 ARG A N     1 
ATOM   3011 C CA    . ARG D 4 286 ? 122.659 -62.347  2.520   1.00 44.71  ? 488 ARG A CA    1 
ATOM   3012 C C     . ARG D 4 286 ? 123.120 -60.994  3.042   1.00 44.17  ? 488 ARG A C     1 
ATOM   3013 O O     . ARG D 4 286 ? 123.269 -60.818  4.252   1.00 43.25  ? 488 ARG A O     1 
ATOM   3014 C CB    . ARG D 4 286 ? 121.209 -62.320  2.050   1.00 47.67  ? 488 ARG A CB    1 
ATOM   3015 C CG    . ARG D 4 286 ? 120.961 -63.220  0.856   1.00 49.76  ? 488 ARG A CG    1 
ATOM   3016 C CD    . ARG D 4 286 ? 119.494 -63.494  0.699   1.00 54.10  ? 488 ARG A CD    1 
ATOM   3017 N NE    . ARG D 4 286 ? 119.005 -64.252  1.844   1.00 57.98  ? 488 ARG A NE    1 
ATOM   3018 C CZ    . ARG D 4 286 ? 118.586 -65.512  1.792   1.00 61.07  ? 488 ARG A CZ    1 
ATOM   3019 N NH1   . ARG D 4 286 ? 118.576 -66.169  0.638   1.00 61.74  ? 488 ARG A NH1   1 
ATOM   3020 N NH2   . ARG D 4 286 ? 118.241 -66.138  2.913   1.00 62.28  ? 488 ARG A NH2   1 
ATOM   3021 N N     . ALA D 4 287 ? 123.349 -60.054  2.130   1.00 47.16  ? 489 ALA A N     1 
ATOM   3022 C CA    . ALA D 4 287 ? 123.832 -58.720  2.471   1.00 46.77  ? 489 ALA A CA    1 
ATOM   3023 C C     . ALA D 4 287 ? 122.855 -57.710  3.074   1.00 46.57  ? 489 ALA A C     1 
ATOM   3024 O O     . ALA D 4 287 ? 123.216 -57.018  4.019   1.00 45.10  ? 489 ALA A O     1 
ATOM   3025 C CB    . ALA D 4 287 ? 124.529 -58.122  1.289   1.00 0.00   ? 489 ALA A CB    1 
ATOM   3026 N N     . GLY D 4 288 ? 121.646 -57.598  2.520   1.00 22.47  ? 490 GLY A N     1 
ATOM   3027 C CA    . GLY D 4 288 ? 120.659 -56.651  3.026   1.00 23.64  ? 490 GLY A CA    1 
ATOM   3028 C C     . GLY D 4 288 ? 121.016 -55.199  2.785   1.00 25.10  ? 490 GLY A C     1 
ATOM   3029 O O     . GLY D 4 288 ? 121.736 -54.584  3.585   1.00 24.08  ? 490 GLY A O     1 
ATOM   3030 N N     . ASN D 4 289 ? 120.479 -54.654  1.693   1.00 21.23  ? 491 ASN A N     1 
ATOM   3031 C CA    . ASN D 4 289 ? 120.727 -53.269  1.297   1.00 24.58  ? 491 ASN A CA    1 
ATOM   3032 C C     . ASN D 4 289 ? 119.778 -52.280  1.996   1.00 26.86  ? 491 ASN A C     1 
ATOM   3033 O O     . ASN D 4 289 ? 118.943 -52.681  2.820   1.00 27.86  ? 491 ASN A O     1 
ATOM   3034 C CB    . ASN D 4 289 ? 120.639 -53.135  -0.237  1.00 48.53  ? 491 ASN A CB    1 
ATOM   3035 C CG    . ASN D 4 289 ? 121.476 -54.185  -0.985  1.00 48.96  ? 491 ASN A CG    1 
ATOM   3036 O OD1   . ASN D 4 289 ? 122.241 -53.855  -1.894  1.00 48.92  ? 491 ASN A OD1   1 
ATOM   3037 N ND2   . ASN D 4 289 ? 121.311 -55.452  -0.616  1.00 49.04  ? 491 ASN A ND2   1 
ATOM   3038 N N     . GLU D 4 290 ? 119.950 -50.990  1.699   1.00 54.93  ? 492 GLU A N     1 
ATOM   3039 C CA    . GLU D 4 290 ? 119.128 -49.928  2.265   1.00 57.80  ? 492 GLU A CA    1 
ATOM   3040 C C     . GLU D 4 290 ? 117.693 -50.132  1.796   1.00 59.40  ? 492 GLU A C     1 
ATOM   3041 O O     . GLU D 4 290 ? 117.423 -50.194  0.588   1.00 58.73  ? 492 GLU A O     1 
ATOM   3042 N N     . LYS D 4 291 ? 116.806 -50.375  2.759   1.00 62.18  ? 493 LYS A N     1 
ATOM   3043 C CA    . LYS D 4 291 ? 115.386 -50.592  2.468   1.00 64.82  ? 493 LYS A CA    1 
ATOM   3044 C C     . LYS D 4 291 ? 114.586 -49.327  2.688   1.00 66.27  ? 493 LYS A C     1 
ATOM   3045 O O     . LYS D 4 291 ? 115.022 -48.434  3.420   1.00 66.61  ? 493 LYS A O     1 
ATOM   3046 C CB    . LYS D 4 291 ? 114.807 -51.694  3.352   1.00 85.60  ? 493 LYS A CB    1 
ATOM   3047 C CG    . LYS D 4 291 ? 115.438 -53.055  3.164   1.00 86.38  ? 493 LYS A CG    1 
ATOM   3048 C CD    . LYS D 4 291 ? 114.448 -54.169  3.484   1.00 85.91  ? 493 LYS A CD    1 
ATOM   3049 C CE    . LYS D 4 291 ? 113.508 -54.446  2.314   1.00 84.81  ? 493 LYS A CE    1 
ATOM   3050 N NZ    . LYS D 4 291 ? 112.356 -55.301  2.688   1.00 86.48  ? 493 LYS A NZ    1 
ATOM   3051 N N     . GLU D 4 292 ? 113.426 -49.250  2.037   1.00 53.70  ? 494 GLU A N     1 
ATOM   3052 C CA    . GLU D 4 292 ? 112.534 -48.102  2.167   1.00 55.87  ? 494 GLU A CA    1 
ATOM   3053 C C     . GLU D 4 292 ? 111.503 -48.432  3.232   1.00 56.04  ? 494 GLU A C     1 
ATOM   3054 O O     . GLU D 4 292 ? 110.649 -49.309  3.034   1.00 56.08  ? 494 GLU A O     1 
ATOM   3055 N N     . GLU D 4 293 ? 111.653 -47.786  4.388   1.00 107.53 ? 495 GLU A N     1 
ATOM   3056 C CA    . GLU D 4 293 ? 110.748 -47.971  5.521   1.00 108.35 ? 495 GLU A CA    1 
ATOM   3057 C C     . GLU D 4 293 ? 109.482 -47.148  5.251   1.00 108.78 ? 495 GLU A C     1 
ATOM   3058 O O     . GLU D 4 293 ? 109.498 -45.913  5.298   1.00 109.11 ? 495 GLU A O     1 
ATOM   3059 C CB    . GLU D 4 293 ? 111.422 -47.537  6.827   1.00 51.61  ? 495 GLU A CB    1 
ATOM   3060 N N     . GLY D 4 294 ? 108.406 -47.859  4.920   1.00 118.53 ? 496 GLY A N     1 
ATOM   3061 C CA    . GLY D 4 294 ? 107.131 -47.246  4.593   1.00 118.14 ? 496 GLY A CA    1 
ATOM   3062 C C     . GLY D 4 294 ? 106.787 -47.689  3.185   1.00 117.51 ? 496 GLY A C     1 
ATOM   3063 O O     . GLY D 4 294 ? 105.640 -47.589  2.763   1.00 117.56 ? 496 GLY A O     1 
ATOM   3064 N N     . GLU D 4 295 ? 107.794 -48.182  2.465   1.00 63.95  ? 497 GLU A N     1 
ATOM   3065 C CA    . GLU D 4 295 ? 107.637 -48.656  1.095   1.00 63.02  ? 497 GLU A CA    1 
ATOM   3066 C C     . GLU D 4 295 ? 107.554 -50.178  1.089   1.00 60.30  ? 497 GLU A C     1 
ATOM   3067 O O     . GLU D 4 295 ? 106.680 -50.755  0.436   1.00 60.03  ? 497 GLU A O     1 
ATOM   3068 N N     . THR D 4 296 ? 108.467 -50.818  1.819   1.00 52.78  ? 498 THR A N     1 
ATOM   3069 C CA    . THR D 4 296 ? 108.508 -52.277  1.912   1.00 50.04  ? 498 THR A CA    1 
ATOM   3070 C C     . THR D 4 296 ? 108.428 -52.764  3.336   1.00 48.16  ? 498 THR A C     1 
ATOM   3071 O O     . THR D 4 296 ? 108.407 -51.961  4.271   1.00 48.25  ? 498 THR A O     1 
ATOM   3072 C CB    . THR D 4 296 ? 109.792 -52.877  1.339   1.00 55.44  ? 498 THR A CB    1 
ATOM   3073 O OG1   . THR D 4 296 ? 110.921 -52.147  1.826   1.00 55.21  ? 498 THR A OG1   1 
ATOM   3074 C CG2   . THR D 4 296 ? 109.769 -52.897  -0.155  1.00 54.64  ? 498 THR A CG2   1 
ATOM   3075 N N     . ALA D 4 297 ? 108.395 -54.091  3.490   1.00 99.14  ? 499 ALA A N     1 
ATOM   3076 C CA    . ALA D 4 297 ? 108.346 -54.755  4.793   1.00 97.32  ? 499 ALA A CA    1 
ATOM   3077 C C     . ALA D 4 297 ? 109.691 -54.579  5.487   1.00 95.92  ? 499 ALA A C     1 
ATOM   3078 O O     . ALA D 4 297 ? 110.702 -54.288  4.831   1.00 96.27  ? 499 ALA A O     1 
ATOM   3079 C CB    . ALA D 4 297 ? 108.048 -56.224  4.612   1.00 2.58   ? 499 ALA A CB    1 
ATOM   3080 N N     . ASP D 4 298 ? 109.705 -54.746  6.805   1.00 47.38  ? 500 ASP A N     1 
ATOM   3081 C CA    . ASP D 4 298 ? 110.939 -54.598  7.562   1.00 44.11  ? 500 ASP A CA    1 
ATOM   3082 C C     . ASP D 4 298 ? 111.700 -55.916  7.676   1.00 41.04  ? 500 ASP A C     1 
ATOM   3083 O O     . ASP D 4 298 ? 111.462 -56.707  8.584   1.00 40.46  ? 500 ASP A O     1 
ATOM   3084 C CB    . ASP D 4 298 ? 110.649 -53.994  8.944   1.00 85.33  ? 500 ASP A CB    1 
ATOM   3085 C CG    . ASP D 4 298 ? 111.903 -53.464  9.640   1.00 87.21  ? 500 ASP A CG    1 
ATOM   3086 O OD1   . ASP D 4 298 ? 111.843 -53.241  10.871  1.00 88.37  ? 500 ASP A OD1   1 
ATOM   3087 O OD2   . ASP D 4 298 ? 112.940 -53.261  8.963   1.00 88.32  ? 500 ASP A OD2   1 
ATOM   3088 N N     . THR D 4 299 ? 112.542 -56.186  6.682   1.00 42.92  ? 501 THR A N     1 
ATOM   3089 C CA    . THR D 4 299 ? 113.377 -57.387  6.686   1.00 39.54  ? 501 THR A CA    1 
ATOM   3090 C C     . THR D 4 299 ? 114.782 -56.866  6.885   1.00 36.97  ? 501 THR A C     1 
ATOM   3091 O O     . THR D 4 299 ? 114.996 -55.651  6.861   1.00 38.41  ? 501 THR A O     1 
ATOM   3092 C CB    . THR D 4 299 ? 113.319 -58.216  5.357   1.00 38.74  ? 501 THR A CB    1 
ATOM   3093 O OG1   . THR D 4 299 ? 114.103 -57.593  4.327   1.00 40.16  ? 501 THR A OG1   1 
ATOM   3094 C CG2   . THR D 4 299 ? 111.884 -58.400  4.889   1.00 38.17  ? 501 THR A CG2   1 
ATOM   3095 N N     . VAL D 4 300 ? 115.727 -57.769  7.121   1.00 14.66  ? 502 VAL A N     1 
ATOM   3096 C CA    . VAL D 4 300 ? 117.123 -57.394  7.318   1.00 14.04  ? 502 VAL A CA    1 
ATOM   3097 C C     . VAL D 4 300 ? 118.080 -58.457  6.815   1.00 15.12  ? 502 VAL A C     1 
ATOM   3098 O O     . VAL D 4 300 ? 117.814 -59.660  6.931   1.00 15.45  ? 502 VAL A O     1 
ATOM   3099 C CB    . VAL D 4 300 ? 117.467 -57.119  8.810   1.00 36.53  ? 502 VAL A CB    1 
ATOM   3100 C CG1   . VAL D 4 300 ? 117.087 -55.691  9.211   1.00 36.81  ? 502 VAL A CG1   1 
ATOM   3101 C CG2   . VAL D 4 300 ? 116.761 -58.108  9.703   1.00 35.93  ? 502 VAL A CG2   1 
ATOM   3102 N N     . GLY D 4 301 ? 119.165 -57.998  6.194   1.00 65.44  ? 503 GLY A N     1 
ATOM   3103 C CA    . GLY D 4 301 ? 120.207 -58.888  5.710   1.00 67.15  ? 503 GLY A CA    1 
ATOM   3104 C C     . GLY D 4 301 ? 121.373 -58.653  6.649   1.00 67.84  ? 503 GLY A C     1 
ATOM   3105 O O     . GLY D 4 301 ? 121.141 -58.185  7.767   1.00 67.64  ? 503 GLY A O     1 
ATOM   3106 N N     . CYS D 4 302 ? 122.610 -58.892  6.212   1.00 26.13  ? 504 CYS A N     1 
ATOM   3107 C CA    . CYS D 4 302 ? 123.746 -58.695  7.110   1.00 27.67  ? 504 CYS A CA    1 
ATOM   3108 C C     . CYS D 4 302 ? 124.153 -57.262  7.452   1.00 28.73  ? 504 CYS A C     1 
ATOM   3109 O O     . CYS D 4 302 ? 124.389 -56.957  8.620   1.00 29.39  ? 504 CYS A O     1 
ATOM   3110 C CB    . CYS D 4 302 ? 124.966 -59.481  6.669   1.00 42.56  ? 504 CYS A CB    1 
ATOM   3111 S SG    . CYS D 4 302 ? 126.269 -59.536  7.944   1.00 45.88  ? 504 CYS A SG    1 
ATOM   3112 N N     . CYS D 4 303 ? 124.228 -56.390  6.450   1.00 44.83  ? 505 CYS A N     1 
ATOM   3113 C CA    . CYS D 4 303 ? 124.619 -54.989  6.646   1.00 45.29  ? 505 CYS A CA    1 
ATOM   3114 C C     . CYS D 4 303 ? 123.528 -54.177  7.338   1.00 44.53  ? 505 CYS A C     1 
ATOM   3115 O O     . CYS D 4 303 ? 123.817 -53.280  8.133   1.00 44.11  ? 505 CYS A O     1 
ATOM   3116 C CB    . CYS D 4 303 ? 124.940 -54.359  5.295   1.00 81.38  ? 505 CYS A CB    1 
ATOM   3117 S SG    . CYS D 4 303 ? 125.835 -55.473  4.190   1.00 84.29  ? 505 CYS A SG    1 
ATOM   3118 N N     . SER D 4 304 ? 122.279 -54.541  7.050   1.00 53.50  ? 506 SER A N     1 
ATOM   3119 C CA    . SER D 4 304 ? 121.109 -53.877  7.599   1.00 52.29  ? 506 SER A CA    1 
ATOM   3120 C C     . SER D 4 304 ? 120.686 -54.380  8.980   1.00 51.17  ? 506 SER A C     1 
ATOM   3121 O O     . SER D 4 304 ? 119.659 -53.941  9.500   1.00 52.00  ? 506 SER A O     1 
ATOM   3122 C CB    . SER D 4 304 ? 119.940 -53.961  6.604   1.00 75.27  ? 506 SER A CB    1 
ATOM   3123 O OG    . SER D 4 304 ? 119.672 -55.298  6.213   1.00 76.22  ? 506 SER A OG    1 
ATOM   3124 N N     . LEU D 4 305 ? 121.495 -55.258  9.585   1.00 45.51  ? 507 LEU A N     1 
ATOM   3125 C CA    . LEU D 4 305 ? 121.227 -55.821  10.924  1.00 45.27  ? 507 LEU A CA    1 
ATOM   3126 C C     . LEU D 4 305 ? 121.174 -54.784  12.044  1.00 45.39  ? 507 LEU A C     1 
ATOM   3127 O O     . LEU D 4 305 ? 121.933 -53.813  12.024  1.00 44.12  ? 507 LEU A O     1 
ATOM   3128 C CB    . LEU D 4 305 ? 122.288 -56.854  11.304  1.00 40.48  ? 507 LEU A CB    1 
ATOM   3129 C CG    . LEU D 4 305 ? 122.118 -58.327  10.941  1.00 40.16  ? 507 LEU A CG    1 
ATOM   3130 C CD1   . LEU D 4 305 ? 123.402 -59.040  11.260  1.00 40.45  ? 507 LEU A CD1   1 
ATOM   3131 C CD2   . LEU D 4 305 ? 120.956 -58.964  11.681  1.00 41.32  ? 507 LEU A CD2   1 
ATOM   3132 N N     . ARG D 4 306 ? 120.277 -55.000  13.010  1.00 25.35  ? 508 ARG A N     1 
ATOM   3133 C CA    . ARG D 4 306 ? 120.105 -54.094  14.152  1.00 27.50  ? 508 ARG A CA    1 
ATOM   3134 C C     . ARG D 4 306 ? 120.444 -54.741  15.505  1.00 27.83  ? 508 ARG A C     1 
ATOM   3135 O O     . ARG D 4 306 ? 120.584 -55.964  15.592  1.00 27.26  ? 508 ARG A O     1 
ATOM   3136 C CB    . ARG D 4 306 ? 118.696 -53.489  14.161  1.00 32.42  ? 508 ARG A CB    1 
ATOM   3137 C CG    . ARG D 4 306 ? 118.430 -52.536  12.991  1.00 36.36  ? 508 ARG A CG    1 
ATOM   3138 C CD    . ARG D 4 306 ? 117.169 -51.697  13.180  1.00 39.97  ? 508 ARG A CD    1 
ATOM   3139 N NE    . ARG D 4 306 ? 115.949 -52.500  13.174  1.00 44.08  ? 508 ARG A NE    1 
ATOM   3140 C CZ    . ARG D 4 306 ? 115.349 -52.967  12.081  1.00 46.44  ? 508 ARG A CZ    1 
ATOM   3141 N NH1   . ARG D 4 306 ? 115.846 -52.721  10.870  1.00 47.65  ? 508 ARG A NH1   1 
ATOM   3142 N NH2   . ARG D 4 306 ? 114.251 -53.702  12.204  1.00 47.23  ? 508 ARG A NH2   1 
ATOM   3143 N N     . VAL D 4 307 ? 120.615 -53.905  16.538  1.00 38.84  ? 509 VAL A N     1 
ATOM   3144 C CA    . VAL D 4 307 ? 120.963 -54.323  17.915  1.00 39.47  ? 509 VAL A CA    1 
ATOM   3145 C C     . VAL D 4 307 ? 119.982 -55.352  18.493  1.00 39.55  ? 509 VAL A C     1 
ATOM   3146 O O     . VAL D 4 307 ? 120.393 -56.415  18.982  1.00 39.56  ? 509 VAL A O     1 
ATOM   3147 C CB    . VAL D 4 307 ? 121.020 -53.087  18.860  1.00 90.07  ? 509 VAL A CB    1 
ATOM   3148 C CG1   . VAL D 4 307 ? 121.486 -53.472  20.269  1.00 91.97  ? 509 VAL A CG1   1 
ATOM   3149 C CG2   . VAL D 4 307 ? 121.923 -52.019  18.277  1.00 90.99  ? 509 VAL A CG2   1 
ATOM   3150 N N     . GLU D 4 308 ? 118.692 -55.023  18.377  1.00 47.39  ? 510 GLU A N     1 
ATOM   3151 C CA    . GLU D 4 308 ? 117.557 -55.840  18.827  1.00 48.70  ? 510 GLU A CA    1 
ATOM   3152 C C     . GLU D 4 308 ? 117.532 -57.250  18.184  1.00 46.69  ? 510 GLU A C     1 
ATOM   3153 O O     . GLU D 4 308 ? 116.874 -58.169  18.691  1.00 46.29  ? 510 GLU A O     1 
ATOM   3154 C CB    . GLU D 4 308 ? 116.257 -55.086  18.500  1.00 96.00  ? 510 GLU A CB    1 
ATOM   3155 C CG    . GLU D 4 308 ? 116.070 -54.779  17.001  1.00 99.86  ? 510 GLU A CG    1 
ATOM   3156 C CD    . GLU D 4 308 ? 115.093 -53.651  16.714  1.00 103.39 ? 510 GLU A CD    1 
ATOM   3157 O OE1   . GLU D 4 308 ? 113.905 -53.763  17.084  1.00 103.80 ? 510 GLU A OE1   1 
ATOM   3158 O OE2   . GLU D 4 308 ? 115.517 -52.653  16.095  1.00 106.65 ? 510 GLU A OE2   1 
ATOM   3159 N N     . HIS D 4 309 ? 118.287 -57.398  17.090  1.00 39.43  ? 511 HIS A N     1 
ATOM   3160 C CA    . HIS D 4 309 ? 118.381 -58.642  16.338  1.00 38.08  ? 511 HIS A CA    1 
ATOM   3161 C C     . HIS D 4 309 ? 119.370 -59.663  16.824  1.00 37.24  ? 511 HIS A C     1 
ATOM   3162 O O     . HIS D 4 309 ? 119.363 -60.784  16.326  1.00 38.50  ? 511 HIS A O     1 
ATOM   3163 C CB    . HIS D 4 309 ? 118.632 -58.367  14.867  1.00 44.66  ? 511 HIS A CB    1 
ATOM   3164 C CG    . HIS D 4 309 ? 117.467 -57.750  14.171  1.00 44.12  ? 511 HIS A CG    1 
ATOM   3165 N ND1   . HIS D 4 309 ? 117.593 -56.663  13.340  1.00 44.61  ? 511 HIS A ND1   1 
ATOM   3166 C CD2   . HIS D 4 309 ? 116.153 -58.075  14.173  1.00 43.55  ? 511 HIS A CD2   1 
ATOM   3167 C CE1   . HIS D 4 309 ? 116.405 -56.345  12.855  1.00 44.67  ? 511 HIS A CE1   1 
ATOM   3168 N NE2   . HIS D 4 309 ? 115.514 -57.187  13.343  1.00 44.62  ? 511 HIS A NE2   1 
ATOM   3169 N N     . ILE D 4 310 ? 120.277 -59.271  17.715  1.00 32.78  ? 512 ILE A N     1 
ATOM   3170 C CA    . ILE D 4 310 ? 121.231 -60.232  18.270  1.00 32.55  ? 512 ILE A CA    1 
ATOM   3171 C C     . ILE D 4 310 ? 121.271 -60.229  19.772  1.00 33.97  ? 512 ILE A C     1 
ATOM   3172 O O     . ILE D 4 310 ? 121.186 -59.180  20.433  1.00 34.33  ? 512 ILE A O     1 
ATOM   3173 C CB    . ILE D 4 310 ? 122.691 -60.097  17.764  1.00 70.63  ? 512 ILE A CB    1 
ATOM   3174 C CG1   . ILE D 4 310 ? 123.173 -58.643  17.813  1.00 71.77  ? 512 ILE A CG1   1 
ATOM   3175 C CG2   . ILE D 4 310 ? 122.856 -60.797  16.426  1.00 69.59  ? 512 ILE A CG2   1 
ATOM   3176 C CD1   . ILE D 4 310 ? 124.678 -58.495  17.675  1.00 72.29  ? 512 ILE A CD1   1 
ATOM   3177 N N     . ASN D 4 311 ? 121.369 -61.442  20.291  1.00 37.88  ? 513 ASN A N     1 
ATOM   3178 C CA    . ASN D 4 311 ? 121.452 -61.704  21.712  1.00 39.17  ? 513 ASN A CA    1 
ATOM   3179 C C     . ASN D 4 311 ? 122.742 -62.505  21.828  1.00 38.36  ? 513 ASN A C     1 
ATOM   3180 O O     . ASN D 4 311 ? 123.021 -63.365  20.984  1.00 38.83  ? 513 ASN A O     1 
ATOM   3181 C CB    . ASN D 4 311 ? 120.218 -62.490  22.169  1.00 103.40 ? 513 ASN A CB    1 
ATOM   3182 C CG    . ASN D 4 311 ? 118.928 -61.676  22.040  1.00 106.48 ? 513 ASN A CG    1 
ATOM   3183 O OD1   . ASN D 4 311 ? 118.755 -60.652  22.707  1.00 109.60 ? 513 ASN A OD1   1 
ATOM   3184 N ND2   . ASN D 4 311 ? 118.039 -62.110  21.152  1.00 107.91 ? 513 ASN A ND2   1 
ATOM   3185 N N     . LEU D 4 312 ? 123.576 -62.128  22.796  1.00 37.37  ? 514 LEU A N     1 
ATOM   3186 C CA    . LEU D 4 312 ? 124.887 -62.753  23.004  1.00 38.00  ? 514 LEU A CA    1 
ATOM   3187 C C     . LEU D 4 312 ? 125.073 -63.435  24.376  1.00 38.50  ? 514 LEU A C     1 
ATOM   3188 O O     . LEU D 4 312 ? 124.791 -62.828  25.409  1.00 38.72  ? 514 LEU A O     1 
ATOM   3189 C CB    . LEU D 4 312 ? 125.962 -61.678  22.798  1.00 17.43  ? 514 LEU A CB    1 
ATOM   3190 C CG    . LEU D 4 312 ? 126.597 -61.315  21.448  1.00 16.53  ? 514 LEU A CG    1 
ATOM   3191 C CD1   . LEU D 4 312 ? 125.612 -61.060  20.366  1.00 18.09  ? 514 LEU A CD1   1 
ATOM   3192 C CD2   . LEU D 4 312 ? 127.426 -60.078  21.648  1.00 15.99  ? 514 LEU A CD2   1 
ATOM   3193 N N     . HIS D 4 313 ? 125.553 -64.688  24.378  1.00 59.70  ? 515 HIS A N     1 
ATOM   3194 C CA    . HIS D 4 313 ? 125.764 -65.480  25.612  1.00 61.23  ? 515 HIS A CA    1 
ATOM   3195 C C     . HIS D 4 313 ? 127.192 -66.040  25.666  1.00 61.97  ? 515 HIS A C     1 
ATOM   3196 O O     . HIS D 4 313 ? 127.650 -66.646  24.694  1.00 60.80  ? 515 HIS A O     1 
ATOM   3197 C CB    . HIS D 4 313 ? 124.768 -66.660  25.699  1.00 74.36  ? 515 HIS A CB    1 
ATOM   3198 C CG    . HIS D 4 313 ? 123.361 -66.298  25.339  1.00 75.94  ? 515 HIS A CG    1 
ATOM   3199 N ND1   . HIS D 4 313 ? 122.532 -65.597  26.186  1.00 76.52  ? 515 HIS A ND1   1 
ATOM   3200 C CD2   . HIS D 4 313 ? 122.667 -66.470  24.189  1.00 76.85  ? 515 HIS A CD2   1 
ATOM   3201 C CE1   . HIS D 4 313 ? 121.390 -65.347  25.570  1.00 76.55  ? 515 HIS A CE1   1 
ATOM   3202 N NE2   . HIS D 4 313 ? 121.445 -65.866  24.357  1.00 77.79  ? 515 HIS A NE2   1 
ATOM   3203 N N     . PRO D 4 314 ? 127.922 -65.833  26.789  1.00 50.67  ? 516 PRO A N     1 
ATOM   3204 C CA    . PRO D 4 314 ? 129.304 -66.324  26.950  1.00 52.25  ? 516 PRO A CA    1 
ATOM   3205 C C     . PRO D 4 314 ? 129.495 -67.841  26.966  1.00 54.01  ? 516 PRO A C     1 
ATOM   3206 O O     . PRO D 4 314 ? 130.503 -68.338  26.466  1.00 53.59  ? 516 PRO A O     1 
ATOM   3207 C CB    . PRO D 4 314 ? 129.730 -65.711  28.282  1.00 88.93  ? 516 PRO A CB    1 
ATOM   3208 C CG    . PRO D 4 314 ? 128.935 -64.460  28.348  1.00 87.82  ? 516 PRO A CG    1 
ATOM   3209 C CD    . PRO D 4 314 ? 127.581 -64.940  27.912  1.00 88.09  ? 516 PRO A CD    1 
ATOM   3210 N N     . GLU D 4 315 ? 128.548 -68.549  27.584  1.00 52.67  ? 517 GLU A N     1 
ATOM   3211 C CA    . GLU D 4 315 ? 128.561 -70.008  27.695  1.00 55.43  ? 517 GLU A CA    1 
ATOM   3212 C C     . GLU D 4 315 ? 127.119 -70.462  27.596  1.00 56.59  ? 517 GLU A C     1 
ATOM   3213 O O     . GLU D 4 315 ? 126.281 -70.065  28.414  1.00 55.52  ? 517 GLU A O     1 
ATOM   3214 C CB    . GLU D 4 315 ? 129.156 -70.457  29.036  1.00 100.83 ? 517 GLU A CB    1 
ATOM   3215 N N     . LEU D 4 316 ? 126.823 -71.238  26.553  1.00 57.57  ? 518 LEU A N     1 
ATOM   3216 C CA    . LEU D 4 316 ? 125.476 -71.751  26.316  1.00 58.98  ? 518 LEU A CA    1 
ATOM   3217 C C     . LEU D 4 316 ? 125.503 -73.101  25.627  1.00 59.97  ? 518 LEU A C     1 
ATOM   3218 O O     . LEU D 4 316 ? 126.113 -73.253  24.563  1.00 60.14  ? 518 LEU A O     1 
ATOM   3219 C CB    . LEU D 4 316 ? 124.654 -70.767  25.479  1.00 68.73  ? 518 LEU A CB    1 
ATOM   3220 C CG    . LEU D 4 316 ? 123.171 -71.098  25.278  1.00 69.21  ? 518 LEU A CG    1 
ATOM   3221 C CD1   . LEU D 4 316 ? 122.408 -71.017  26.600  1.00 69.01  ? 518 LEU A CD1   1 
ATOM   3222 C CD2   . LEU D 4 316 ? 122.572 -70.160  24.253  1.00 70.23  ? 518 LEU A CD2   1 
ATOM   3223 N N     . ASP D 4 317 ? 124.778 -74.050  26.229  1.00 77.68  ? 519 ASP A N     1 
ATOM   3224 C CA    . ASP D 4 317 ? 124.643 -75.441  25.774  1.00 79.56  ? 519 ASP A CA    1 
ATOM   3225 C C     . ASP D 4 317 ? 125.992 -76.168  25.660  1.00 80.00  ? 519 ASP A C     1 
ATOM   3226 O O     . ASP D 4 317 ? 126.258 -76.870  24.681  1.00 80.90  ? 519 ASP A O     1 
ATOM   3227 C CB    . ASP D 4 317 ? 123.823 -75.532  24.466  1.00 109.97 ? 519 ASP A CB    1 
ATOM   3228 C CG    . ASP D 4 317 ? 122.344 -75.178  24.659  1.00 112.58 ? 519 ASP A CG    1 
ATOM   3229 O OD1   . ASP D 4 317 ? 121.769 -75.492  25.727  1.00 112.83 ? 519 ASP A OD1   1 
ATOM   3230 O OD2   . ASP D 4 317 ? 121.748 -74.597  23.725  1.00 113.97 ? 519 ASP A OD2   1 
ATOM   3231 N N     . GLY D 4 318 ? 126.846 -75.945  26.664  1.00 83.58  ? 520 GLY A N     1 
ATOM   3232 C CA    . GLY D 4 318 ? 128.167 -76.558  26.723  1.00 83.33  ? 520 GLY A CA    1 
ATOM   3233 C C     . GLY D 4 318 ? 129.233 -75.929  25.839  1.00 83.42  ? 520 GLY A C     1 
ATOM   3234 O O     . GLY D 4 318 ? 130.402 -76.342  25.876  1.00 84.11  ? 520 GLY A O     1 
ATOM   3235 N N     . GLN D 4 319 ? 128.823 -74.939  25.041  1.00 71.28  ? 521 GLN A N     1 
ATOM   3236 C CA    . GLN D 4 319 ? 129.704 -74.226  24.112  1.00 70.96  ? 521 GLN A CA    1 
ATOM   3237 C C     . GLN D 4 319 ? 129.963 -72.804  24.577  1.00 69.58  ? 521 GLN A C     1 
ATOM   3238 O O     . GLN D 4 319 ? 129.088 -72.175  25.174  1.00 68.96  ? 521 GLN A O     1 
ATOM   3239 C CB    . GLN D 4 319 ? 129.077 -74.197  22.721  1.00 92.89  ? 521 GLN A CB    1 
ATOM   3240 C CG    . GLN D 4 319 ? 128.885 -75.564  22.097  1.00 96.17  ? 521 GLN A CG    1 
ATOM   3241 C CD    . GLN D 4 319 ? 127.833 -75.577  21.012  1.00 98.38  ? 521 GLN A CD    1 
ATOM   3242 O OE1   . GLN D 4 319 ? 126.818 -74.876  21.096  1.00 99.88  ? 521 GLN A OE1   1 
ATOM   3243 N NE2   . GLN D 4 319 ? 128.064 -76.387  19.983  1.00 99.25  ? 521 GLN A NE2   1 
ATOM   3244 N N     . GLU D 4 320 ? 131.168 -72.313  24.283  1.00 58.28  ? 522 GLU A N     1 
ATOM   3245 C CA    . GLU D 4 320 ? 131.597 -70.965  24.655  1.00 57.02  ? 522 GLU A CA    1 
ATOM   3246 C C     . GLU D 4 320 ? 131.424 -69.968  23.510  1.00 54.53  ? 522 GLU A C     1 
ATOM   3247 O O     . GLU D 4 320 ? 131.598 -70.327  22.347  1.00 55.76  ? 522 GLU A O     1 
ATOM   3248 N N     . TYR D 4 321 ? 131.103 -68.718  23.856  1.00 24.89  ? 523 TYR A N     1 
ATOM   3249 C CA    . TYR D 4 321 ? 130.895 -67.605  22.909  1.00 19.69  ? 523 TYR A CA    1 
ATOM   3250 C C     . TYR D 4 321 ? 129.825 -67.875  21.835  1.00 17.18  ? 523 TYR A C     1 
ATOM   3251 O O     . TYR D 4 321 ? 130.140 -68.164  20.680  1.00 16.11  ? 523 TYR A O     1 
ATOM   3252 C CB    . TYR D 4 321 ? 132.227 -67.171  22.264  1.00 67.83  ? 523 TYR A CB    1 
ATOM   3253 C CG    . TYR D 4 321 ? 133.325 -66.875  23.251  1.00 67.80  ? 523 TYR A CG    1 
ATOM   3254 C CD1   . TYR D 4 321 ? 133.162 -65.879  24.231  1.00 68.86  ? 523 TYR A CD1   1 
ATOM   3255 C CD2   . TYR D 4 321 ? 134.522 -67.618  23.244  1.00 67.53  ? 523 TYR A CD2   1 
ATOM   3256 C CE1   . TYR D 4 321 ? 134.171 -65.621  25.201  1.00 69.18  ? 523 TYR A CE1   1 
ATOM   3257 C CE2   . TYR D 4 321 ? 135.547 -67.376  24.209  1.00 68.93  ? 523 TYR A CE2   1 
ATOM   3258 C CZ    . TYR D 4 321 ? 135.358 -66.371  25.186  1.00 69.25  ? 523 TYR A CZ    1 
ATOM   3259 O OH    . TYR D 4 321 ? 136.324 -66.108  26.138  1.00 69.90  ? 523 TYR A OH    1 
ATOM   3260 N N     . VAL D 4 322 ? 128.557 -67.799  22.231  1.00 33.63  ? 524 VAL A N     1 
ATOM   3261 C CA    . VAL D 4 322 ? 127.451 -68.073  21.308  1.00 32.90  ? 524 VAL A CA    1 
ATOM   3262 C C     . VAL D 4 322 ? 126.648 -66.816  20.974  1.00 32.19  ? 524 VAL A C     1 
ATOM   3263 O O     . VAL D 4 322 ? 126.424 -65.968  21.843  1.00 32.62  ? 524 VAL A O     1 
ATOM   3264 C CB    . VAL D 4 322 ? 126.477 -69.191  21.859  1.00 26.02  ? 524 VAL A CB    1 
ATOM   3265 C CG1   . VAL D 4 322 ? 125.509 -69.652  20.782  1.00 26.46  ? 524 VAL A CG1   1 
ATOM   3266 C CG2   . VAL D 4 322 ? 127.253 -70.407  22.360  1.00 27.24  ? 524 VAL A CG2   1 
ATOM   3267 N N     . VAL D 4 323 ? 126.271 -66.695  19.693  1.00 29.59  ? 525 VAL A N     1 
ATOM   3268 C CA    . VAL D 4 323 ? 125.468 -65.584  19.177  1.00 28.81  ? 525 VAL A CA    1 
ATOM   3269 C C     . VAL D 4 323 ? 124.166 -66.161  18.661  1.00 29.24  ? 525 VAL A C     1 
ATOM   3270 O O     . VAL D 4 323 ? 124.159 -67.099  17.858  1.00 29.45  ? 525 VAL A O     1 
ATOM   3271 C CB    . VAL D 4 323 ? 126.149 -64.834  18.038  1.00 16.10  ? 525 VAL A CB    1 
ATOM   3272 C CG1   . VAL D 4 323 ? 125.328 -63.623  17.656  1.00 16.31  ? 525 VAL A CG1   1 
ATOM   3273 C CG2   . VAL D 4 323 ? 127.512 -64.377  18.453  1.00 16.73  ? 525 VAL A CG2   1 
ATOM   3274 N N     . GLU D 4 324 ? 123.080 -65.522  19.075  1.00 20.20  ? 526 GLU A N     1 
ATOM   3275 C CA    . GLU D 4 324 ? 121.734 -65.947  18.745  1.00 21.88  ? 526 GLU A CA    1 
ATOM   3276 C C     . GLU D 4 324 ? 121.078 -64.965  17.791  1.00 20.96  ? 526 GLU A C     1 
ATOM   3277 O O     . GLU D 4 324 ? 120.615 -63.886  18.184  1.00 21.95  ? 526 GLU A O     1 
ATOM   3278 C CB    . GLU D 4 324 ? 120.935 -66.066  20.044  1.00 97.09  ? 526 GLU A CB    1 
ATOM   3279 C CG    . GLU D 4 324 ? 119.554 -66.640  19.907  1.00 103.39 ? 526 GLU A CG    1 
ATOM   3280 C CD    . GLU D 4 324 ? 118.675 -66.248  21.065  1.00 106.75 ? 526 GLU A CD    1 
ATOM   3281 O OE1   . GLU D 4 324 ? 118.108 -65.136  21.025  1.00 108.90 ? 526 GLU A OE1   1 
ATOM   3282 O OE2   . GLU D 4 324 ? 118.561 -67.041  22.019  1.00 108.96 ? 526 GLU A OE2   1 
ATOM   3283 N N     . PHE D 4 325 ? 121.017 -65.373  16.534  1.00 21.99  ? 527 PHE A N     1 
ATOM   3284 C CA    . PHE D 4 325 ? 120.427 -64.562  15.486  1.00 22.14  ? 527 PHE A CA    1 
ATOM   3285 C C     . PHE D 4 325 ? 118.938 -64.803  15.428  1.00 21.72  ? 527 PHE A C     1 
ATOM   3286 O O     . PHE D 4 325 ? 118.505 -65.942  15.288  1.00 22.02  ? 527 PHE A O     1 
ATOM   3287 C CB    . PHE D 4 325 ? 121.048 -64.921  14.146  1.00 80.23  ? 527 PHE A CB    1 
ATOM   3288 C CG    . PHE D 4 325 ? 122.527 -64.807  14.130  1.00 80.41  ? 527 PHE A CG    1 
ATOM   3289 C CD1   . PHE D 4 325 ? 123.329 -65.926  14.422  1.00 80.20  ? 527 PHE A CD1   1 
ATOM   3290 C CD2   . PHE D 4 325 ? 123.139 -63.575  13.847  1.00 81.43  ? 527 PHE A CD2   1 
ATOM   3291 C CE1   . PHE D 4 325 ? 124.740 -65.822  14.430  1.00 80.76  ? 527 PHE A CE1   1 
ATOM   3292 C CE2   . PHE D 4 325 ? 124.546 -63.443  13.849  1.00 82.15  ? 527 PHE A CE2   1 
ATOM   3293 C CZ    . PHE D 4 325 ? 125.355 -64.572  14.142  1.00 81.44  ? 527 PHE A CZ    1 
ATOM   3294 N N     . ASP D 4 326 ? 118.165 -63.729  15.555  1.00 54.50  ? 528 ASP A N     1 
ATOM   3295 C CA    . ASP D 4 326 ? 116.712 -63.798  15.519  1.00 55.44  ? 528 ASP A CA    1 
ATOM   3296 C C     . ASP D 4 326 ? 116.218 -62.641  14.664  1.00 53.37  ? 528 ASP A C     1 
ATOM   3297 O O     . ASP D 4 326 ? 116.233 -61.488  15.103  1.00 52.32  ? 528 ASP A O     1 
ATOM   3298 C CB    . ASP D 4 326 ? 116.141 -63.718  16.948  1.00 167.29 ? 528 ASP A CB    1 
ATOM   3299 C CG    . ASP D 4 326 ? 114.636 -63.944  17.001  1.00 171.61 ? 528 ASP A CG    1 
ATOM   3300 O OD1   . ASP D 4 326 ? 114.172 -65.027  16.580  1.00 172.68 ? 528 ASP A OD1   1 
ATOM   3301 O OD2   . ASP D 4 326 ? 113.920 -63.032  17.469  1.00 174.88 ? 528 ASP A OD2   1 
ATOM   3302 N N     . PHE D 4 327 ? 115.838 -62.962  13.426  1.00 63.77  ? 529 PHE A N     1 
ATOM   3303 C CA    . PHE D 4 327 ? 115.328 -61.987  12.456  1.00 62.34  ? 529 PHE A CA    1 
ATOM   3304 C C     . PHE D 4 327 ? 114.556 -62.622  11.295  1.00 62.94  ? 529 PHE A C     1 
ATOM   3305 O O     . PHE D 4 327 ? 114.564 -63.835  11.124  1.00 63.40  ? 529 PHE A O     1 
ATOM   3306 C CB    . PHE D 4 327 ? 116.464 -61.095  11.913  1.00 16.45  ? 529 PHE A CB    1 
ATOM   3307 C CG    . PHE D 4 327 ? 117.505 -61.820  11.094  1.00 15.57  ? 529 PHE A CG    1 
ATOM   3308 C CD1   . PHE D 4 327 ? 117.466 -61.776  9.684   1.00 15.58  ? 529 PHE A CD1   1 
ATOM   3309 C CD2   . PHE D 4 327 ? 118.549 -62.517  11.721  1.00 15.64  ? 529 PHE A CD2   1 
ATOM   3310 C CE1   . PHE D 4 327 ? 118.454 -62.414  8.904   1.00 16.12  ? 529 PHE A CE1   1 
ATOM   3311 C CE2   . PHE D 4 327 ? 119.553 -63.164  10.955  1.00 15.31  ? 529 PHE A CE2   1 
ATOM   3312 C CZ    . PHE D 4 327 ? 119.505 -63.111  9.542   1.00 16.14  ? 529 PHE A CZ    1 
ATOM   3313 N N     . LEU D 4 328 ? 113.958 -61.770  10.464  1.00 20.54  ? 530 LEU A N     1 
ATOM   3314 C CA    . LEU D 4 328 ? 113.176 -62.195  9.306   1.00 20.25  ? 530 LEU A CA    1 
ATOM   3315 C C     . LEU D 4 328 ? 113.893 -61.787  8.018   1.00 19.33  ? 530 LEU A C     1 
ATOM   3316 O O     . LEU D 4 328 ? 114.061 -60.596  7.750   1.00 18.45  ? 530 LEU A O     1 
ATOM   3317 C CB    . LEU D 4 328 ? 111.785 -61.555  9.358   1.00 61.89  ? 530 LEU A CB    1 
ATOM   3318 C CG    . LEU D 4 328 ? 110.953 -61.690  10.640  1.00 61.96  ? 530 LEU A CG    1 
ATOM   3319 C CD1   . LEU D 4 328 ? 109.896 -60.618  10.679  1.00 62.87  ? 530 LEU A CD1   1 
ATOM   3320 C CD2   . LEU D 4 328 ? 110.333 -63.062  10.752  1.00 62.52  ? 530 LEU A CD2   1 
ATOM   3321 N N     . GLY D 4 329 ? 114.306 -62.781  7.228   1.00 24.98  ? 531 GLY A N     1 
ATOM   3322 C CA    . GLY D 4 329 ? 115.009 -62.533  5.973   1.00 24.55  ? 531 GLY A CA    1 
ATOM   3323 C C     . GLY D 4 329 ? 114.105 -62.305  4.777   1.00 24.10  ? 531 GLY A C     1 
ATOM   3324 O O     . GLY D 4 329 ? 113.038 -61.730  4.916   1.00 21.79  ? 531 GLY A O     1 
ATOM   3325 N N     . LYS D 4 330 ? 114.539 -62.774  3.609   1.00 46.86  ? 532 LYS A N     1 
ATOM   3326 C CA    . LYS D 4 330 ? 113.807 -62.649  2.343   1.00 48.23  ? 532 LYS A CA    1 
ATOM   3327 C C     . LYS D 4 330 ? 112.572 -63.536  2.348   1.00 48.74  ? 532 LYS A C     1 
ATOM   3328 C CB    . LYS D 4 330 ? 114.729 -63.042  1.187   1.00 54.50  ? 532 LYS A CB    1 
ATOM   3329 C CG    . LYS D 4 330 ? 114.159 -62.939  -0.218  1.00 55.73  ? 532 LYS A CG    1 
ATOM   3330 C CD    . LYS D 4 330 ? 115.192 -63.461  -1.205  1.00 57.57  ? 532 LYS A CD    1 
ATOM   3331 C CE    . LYS D 4 330 ? 114.785 -63.227  -2.650  1.00 56.95  ? 532 LYS A CE    1 
ATOM   3332 N NZ    . LYS D 4 330 ? 115.971 -63.252  -3.570  1.00 57.24  ? 532 LYS A NZ    1 
ATOM   3333 N N     . ASP D 4 331 ? 111.448 -62.926  1.996   1.00 73.72  ? 533 ASP A N     1 
ATOM   3334 C CA    . ASP D 4 331 ? 110.169 -63.623  1.974   1.00 75.65  ? 533 ASP A CA    1 
ATOM   3335 C C     . ASP D 4 331 ? 109.617 -63.712  3.399   1.00 75.68  ? 533 ASP A C     1 
ATOM   3336 O O     . ASP D 4 331 ? 108.729 -64.518  3.682   1.00 74.95  ? 533 ASP A O     1 
ATOM   3337 N N     . SER D 4 332 ? 110.195 -62.899  4.288   1.00 32.88  ? 534 SER A N     1 
ATOM   3338 C CA    . SER D 4 332 ? 109.845 -62.810  5.710   1.00 33.25  ? 534 SER A CA    1 
ATOM   3339 C C     . SER D 4 332 ? 110.037 -64.117  6.481   1.00 33.49  ? 534 SER A C     1 
ATOM   3340 O O     . SER D 4 332 ? 109.388 -64.363  7.492   1.00 33.41  ? 534 SER A O     1 
ATOM   3341 C CB    . SER D 4 332 ? 108.429 -62.230  5.902   1.00 31.15  ? 534 SER A CB    1 
ATOM   3342 O OG    . SER D 4 332 ? 108.374 -60.852  5.544   1.00 30.30  ? 534 SER A OG    1 
ATOM   3343 N N     . ILE D 4 333 ? 110.972 -64.933  6.007   1.00 37.84  ? 535 ILE A N     1 
ATOM   3344 C CA    . ILE D 4 333 ? 111.280 -66.218  6.627   1.00 38.53  ? 535 ILE A CA    1 
ATOM   3345 C C     . ILE D 4 333 ? 112.272 -65.986  7.768   1.00 38.72  ? 535 ILE A C     1 
ATOM   3346 O O     . ILE D 4 333 ? 113.397 -65.529  7.546   1.00 39.30  ? 535 ILE A O     1 
ATOM   3347 C CB    . ILE D 4 333 ? 111.892 -67.214  5.608   1.00 57.25  ? 535 ILE A CB    1 
ATOM   3348 C CG1   . ILE D 4 333 ? 111.159 -67.138  4.261   1.00 58.13  ? 535 ILE A CG1   1 
ATOM   3349 C CG2   . ILE D 4 333 ? 111.789 -68.639  6.151   1.00 58.54  ? 535 ILE A CG2   1 
ATOM   3350 C CD1   . ILE D 4 333 ? 112.041 -67.429  3.045   1.00 59.24  ? 535 ILE A CD1   1 
ATOM   3351 N N     . ARG D 4 334 ? 111.820 -66.285  8.984   1.00 23.22  ? 536 ARG A N     1 
ATOM   3352 C CA    . ARG D 4 334 ? 112.602 -66.140  10.210  1.00 23.63  ? 536 ARG A CA    1 
ATOM   3353 C C     . ARG D 4 334 ? 113.879 -66.964  10.257  1.00 23.40  ? 536 ARG A C     1 
ATOM   3354 O O     . ARG D 4 334 ? 113.863 -68.172  10.013  1.00 23.00  ? 536 ARG A O     1 
ATOM   3355 N N     . TYR D 4 335 ? 114.999 -66.280  10.450  1.00 22.23  ? 537 TYR A N     1 
ATOM   3356 C CA    . TYR D 4 335 ? 116.274 -66.966  10.567  1.00 22.30  ? 537 TYR A CA    1 
ATOM   3357 C C     . TYR D 4 335 ? 116.617 -67.065  12.047  1.00 22.28  ? 537 TYR A C     1 
ATOM   3358 O O     . TYR D 4 335 ? 116.676 -66.048  12.754  1.00 22.22  ? 537 TYR A O     1 
ATOM   3359 C CB    . TYR D 4 335 ? 117.407 -66.245  9.821   1.00 43.40  ? 537 TYR A CB    1 
ATOM   3360 C CG    . TYR D 4 335 ? 118.729 -67.011  9.847   1.00 43.46  ? 537 TYR A CG    1 
ATOM   3361 C CD1   . TYR D 4 335 ? 119.801 -66.610  10.675  1.00 43.50  ? 537 TYR A CD1   1 
ATOM   3362 C CD2   . TYR D 4 335 ? 118.899 -68.170  9.066   1.00 45.09  ? 537 TYR A CD2   1 
ATOM   3363 C CE1   . TYR D 4 335 ? 121.021 -67.354  10.728  1.00 44.32  ? 537 TYR A CE1   1 
ATOM   3364 C CE2   . TYR D 4 335 ? 120.112 -68.926  9.107   1.00 45.48  ? 537 TYR A CE2   1 
ATOM   3365 C CZ    . TYR D 4 335 ? 121.166 -68.512  9.937   1.00 44.78  ? 537 TYR A CZ    1 
ATOM   3366 O OH    . TYR D 4 335 ? 122.333 -69.256  9.948   1.00 43.72  ? 537 TYR A OH    1 
ATOM   3367 N N     . TYR D 4 336 ? 116.829 -68.297  12.497  1.00 41.79  ? 538 TYR A N     1 
ATOM   3368 C CA    . TYR D 4 336 ? 117.208 -68.563  13.875  1.00 42.99  ? 538 TYR A CA    1 
ATOM   3369 C C     . TYR D 4 336 ? 118.351 -69.570  13.878  1.00 43.67  ? 538 TYR A C     1 
ATOM   3370 O O     . TYR D 4 336 ? 118.257 -70.641  13.251  1.00 44.42  ? 538 TYR A O     1 
ATOM   3371 C CB    . TYR D 4 336 ? 116.015 -69.065  14.711  1.00 59.89  ? 538 TYR A CB    1 
ATOM   3372 C CG    . TYR D 4 336 ? 116.248 -69.071  16.221  1.00 60.44  ? 538 TYR A CG    1 
ATOM   3373 C CD1   . TYR D 4 336 ? 115.927 -67.949  17.007  1.00 60.87  ? 538 TYR A CD1   1 
ATOM   3374 C CD2   . TYR D 4 336 ? 116.796 -70.205  16.872  1.00 61.82  ? 538 TYR A CD2   1 
ATOM   3375 C CE1   . TYR D 4 336 ? 116.148 -67.953  18.417  1.00 62.70  ? 538 TYR A CE1   1 
ATOM   3376 C CE2   . TYR D 4 336 ? 117.024 -70.222  18.274  1.00 63.32  ? 538 TYR A CE2   1 
ATOM   3377 C CZ    . TYR D 4 336 ? 116.697 -69.096  19.036  1.00 63.91  ? 538 TYR A CZ    1 
ATOM   3378 O OH    . TYR D 4 336 ? 116.920 -69.112  20.394  1.00 65.33  ? 538 TYR A OH    1 
ATOM   3379 N N     . ASN D 4 337 ? 119.432 -69.192  14.569  1.00 33.09  ? 539 ASN A N     1 
ATOM   3380 C CA    . ASN D 4 337 ? 120.627 -70.018  14.724  1.00 33.33  ? 539 ASN A CA    1 
ATOM   3381 C C     . ASN D 4 337 ? 121.403 -69.558  15.950  1.00 34.76  ? 539 ASN A C     1 
ATOM   3382 O O     . ASN D 4 337 ? 121.670 -68.359  16.114  1.00 34.46  ? 539 ASN A O     1 
ATOM   3383 C CB    . ASN D 4 337 ? 121.532 -69.939  13.485  1.00 59.71  ? 539 ASN A CB    1 
ATOM   3384 C CG    . ASN D 4 337 ? 121.695 -71.283  12.785  1.00 59.72  ? 539 ASN A CG    1 
ATOM   3385 O OD1   . ASN D 4 337 ? 122.811 -71.788  12.646  1.00 60.07  ? 539 ASN A OD1   1 
ATOM   3386 N ND2   . ASN D 4 337 ? 120.585 -71.857  12.320  1.00 60.60  ? 539 ASN A ND2   1 
ATOM   3387 N N     . LYS D 4 338 ? 121.675 -70.506  16.850  1.00 61.07  ? 540 LYS A N     1 
ATOM   3388 C CA    . LYS D 4 338 ? 122.464 -70.263  18.060  1.00 63.53  ? 540 LYS A CA    1 
ATOM   3389 C C     . LYS D 4 338 ? 123.878 -70.667  17.622  1.00 63.86  ? 540 LYS A C     1 
ATOM   3390 O O     . LYS D 4 338 ? 124.337 -71.784  17.894  1.00 64.60  ? 540 LYS A O     1 
ATOM   3391 C CB    . LYS D 4 338 ? 121.987 -71.151  19.222  1.00 68.90  ? 540 LYS A CB    1 
ATOM   3392 C CG    . LYS D 4 338 ? 120.726 -70.693  19.957  1.00 72.11  ? 540 LYS A CG    1 
ATOM   3393 C CD    . LYS D 4 338 ? 120.310 -71.729  21.021  1.00 76.17  ? 540 LYS A CD    1 
ATOM   3394 C CE    . LYS D 4 338 ? 119.033 -71.335  21.767  1.00 77.49  ? 540 LYS A CE    1 
ATOM   3395 N NZ    . LYS D 4 338 ? 118.496 -72.434  22.627  1.00 80.44  ? 540 LYS A NZ    1 
ATOM   3396 N N     . VAL D 4 339 ? 124.550 -69.760  16.913  1.00 24.23  ? 541 VAL A N     1 
ATOM   3397 C CA    . VAL D 4 339 ? 125.877 -70.040  16.383  1.00 24.27  ? 541 VAL A CA    1 
ATOM   3398 C C     . VAL D 4 339 ? 127.083 -69.660  17.226  1.00 24.86  ? 541 VAL A C     1 
ATOM   3399 O O     . VAL D 4 339 ? 127.213 -68.511  17.641  1.00 25.08  ? 541 VAL A O     1 
ATOM   3400 C CB    . VAL D 4 339 ? 125.988 -69.566  14.899  1.00 65.21  ? 541 VAL A CB    1 
ATOM   3401 C CG1   . VAL D 4 339 ? 127.429 -69.214  14.488  1.00 66.51  ? 541 VAL A CG1   1 
ATOM   3402 C CG2   . VAL D 4 339 ? 125.492 -70.691  14.004  1.00 64.80  ? 541 VAL A CG2   1 
ATOM   3403 N N     . PRO D 4 340 ? 127.974 -70.645  17.497  1.00 54.84  ? 542 PRO A N     1 
ATOM   3404 C CA    . PRO D 4 340 ? 129.191 -70.443  18.285  1.00 55.15  ? 542 PRO A CA    1 
ATOM   3405 C C     . PRO D 4 340 ? 130.239 -69.759  17.420  1.00 55.70  ? 542 PRO A C     1 
ATOM   3406 O O     . PRO D 4 340 ? 130.473 -70.182  16.283  1.00 56.48  ? 542 PRO A O     1 
ATOM   3407 C CB    . PRO D 4 340 ? 129.637 -71.872  18.599  1.00 32.94  ? 542 PRO A CB    1 
ATOM   3408 C CG    . PRO D 4 340 ? 128.407 -72.687  18.444  1.00 33.00  ? 542 PRO A CG    1 
ATOM   3409 C CD    . PRO D 4 340 ? 127.798 -72.088  17.236  1.00 32.73  ? 542 PRO A CD    1 
ATOM   3410 N N     . VAL D 4 341 ? 130.846 -68.699  17.955  1.00 54.82  ? 543 VAL A N     1 
ATOM   3411 C CA    . VAL D 4 341 ? 131.878 -67.934  17.247  1.00 53.42  ? 543 VAL A CA    1 
ATOM   3412 C C     . VAL D 4 341 ? 133.267 -68.042  17.902  1.00 53.20  ? 543 VAL A C     1 
ATOM   3413 O O     . VAL D 4 341 ? 133.473 -68.850  18.817  1.00 52.85  ? 543 VAL A O     1 
ATOM   3414 C CB    . VAL D 4 341 ? 131.471 -66.431  17.108  1.00 30.25  ? 543 VAL A CB    1 
ATOM   3415 C CG1   . VAL D 4 341 ? 130.252 -66.278  16.218  1.00 29.84  ? 543 VAL A CG1   1 
ATOM   3416 C CG2   . VAL D 4 341 ? 131.193 -65.818  18.458  1.00 30.05  ? 543 VAL A CG2   1 
ATOM   3417 N N     . GLU D 4 342 ? 134.221 -67.263  17.389  1.00 39.32  ? 544 GLU A N     1 
ATOM   3418 C CA    . GLU D 4 342 ? 135.585 -67.224  17.921  1.00 40.88  ? 544 GLU A CA    1 
ATOM   3419 C C     . GLU D 4 342 ? 135.623 -66.092  18.957  1.00 40.15  ? 544 GLU A C     1 
ATOM   3420 O O     . GLU D 4 342 ? 134.779 -65.188  18.902  1.00 40.08  ? 544 GLU A O     1 
ATOM   3421 C CB    . GLU D 4 342 ? 136.603 -66.991  16.790  1.00 111.51 ? 544 GLU A CB    1 
ATOM   3422 C CG    . GLU D 4 342 ? 136.748 -68.181  15.824  1.00 114.04 ? 544 GLU A CG    1 
ATOM   3423 C CD    . GLU D 4 342 ? 137.815 -67.987  14.743  1.00 114.92 ? 544 GLU A CD    1 
ATOM   3424 O OE1   . GLU D 4 342 ? 137.531 -68.297  13.566  1.00 115.76 ? 544 GLU A OE1   1 
ATOM   3425 O OE2   . GLU D 4 342 ? 138.944 -67.550  15.061  1.00 114.31 ? 544 GLU A OE2   1 
ATOM   3426 N N     . LYS D 4 343 ? 136.572 -66.158  19.902  1.00 34.58  ? 545 LYS A N     1 
ATOM   3427 C CA    . LYS D 4 343 ? 136.729 -65.161  20.983  1.00 34.18  ? 545 LYS A CA    1 
ATOM   3428 C C     . LYS D 4 343 ? 136.699 -63.688  20.523  1.00 34.00  ? 545 LYS A C     1 
ATOM   3429 O O     . LYS D 4 343 ? 135.772 -62.948  20.869  1.00 34.08  ? 545 LYS A O     1 
ATOM   3430 C CB    . LYS D 4 343 ? 138.012 -65.442  21.803  1.00 87.00  ? 545 LYS A CB    1 
ATOM   3431 C CG    . LYS D 4 343 ? 138.147 -64.625  23.116  1.00 86.60  ? 545 LYS A CG    1 
ATOM   3432 C CD    . LYS D 4 343 ? 139.555 -64.682  23.731  1.00 86.22  ? 545 LYS A CD    1 
ATOM   3433 C CE    . LYS D 4 343 ? 139.693 -63.730  24.928  1.00 85.60  ? 545 LYS A CE    1 
ATOM   3434 N NZ    . LYS D 4 343 ? 141.110 -63.483  25.340  1.00 85.59  ? 545 LYS A NZ    1 
ATOM   3435 N N     . ARG D 4 344 ? 137.658 -63.314  19.676  1.00 78.31  ? 546 ARG A N     1 
ATOM   3436 C CA    . ARG D 4 344 ? 137.796 -61.951  19.154  1.00 77.12  ? 546 ARG A CA    1 
ATOM   3437 C C     . ARG D 4 344 ? 136.515 -61.328  18.594  1.00 76.00  ? 546 ARG A C     1 
ATOM   3438 O O     . ARG D 4 344 ? 136.220 -60.167  18.881  1.00 75.92  ? 546 ARG A O     1 
ATOM   3439 C CB    . ARG D 4 344 ? 138.904 -61.906  18.104  1.00 21.58  ? 546 ARG A CB    1 
ATOM   3440 N N     . VAL D 4 345 ? 135.712 -62.149  17.911  1.00 24.03  ? 547 VAL A N     1 
ATOM   3441 C CA    . VAL D 4 345 ? 134.456 -61.725  17.277  1.00 22.08  ? 547 VAL A CA    1 
ATOM   3442 C C     . VAL D 4 345 ? 133.410 -61.315  18.295  1.00 21.05  ? 547 VAL A C     1 
ATOM   3443 O O     . VAL D 4 345 ? 132.796 -60.245  18.160  1.00 20.77  ? 547 VAL A O     1 
ATOM   3444 C CB    . VAL D 4 345 ? 133.843 -62.838  16.402  1.00 15.87  ? 547 VAL A CB    1 
ATOM   3445 C CG1   . VAL D 4 345 ? 132.732 -62.283  15.538  1.00 15.70  ? 547 VAL A CG1   1 
ATOM   3446 C CG2   . VAL D 4 345 ? 134.897 -63.483  15.544  1.00 16.98  ? 547 VAL A CG2   1 
ATOM   3447 N N     . PHE D 4 346 ? 133.233 -62.173  19.309  1.00 31.64  ? 548 PHE A N     1 
ATOM   3448 C CA    . PHE D 4 346 ? 132.284 -61.964  20.401  1.00 30.38  ? 548 PHE A CA    1 
ATOM   3449 C C     . PHE D 4 346 ? 132.628 -60.637  21.050  1.00 30.44  ? 548 PHE A C     1 
ATOM   3450 O O     . PHE D 4 346 ? 131.770 -59.758  21.154  1.00 31.10  ? 548 PHE A O     1 
ATOM   3451 C CB    . PHE D 4 346 ? 132.410 -63.090  21.423  1.00 47.19  ? 548 PHE A CB    1 
ATOM   3452 C CG    . PHE D 4 346 ? 131.239 -63.205  22.356  1.00 47.83  ? 548 PHE A CG    1 
ATOM   3453 C CD1   . PHE D 4 346 ? 130.117 -63.968  22.000  1.00 48.45  ? 548 PHE A CD1   1 
ATOM   3454 C CD2   . PHE D 4 346 ? 131.251 -62.566  23.608  1.00 48.27  ? 548 PHE A CD2   1 
ATOM   3455 C CE1   . PHE D 4 346 ? 129.016 -64.101  22.880  1.00 48.00  ? 548 PHE A CE1   1 
ATOM   3456 C CE2   . PHE D 4 346 ? 130.155 -62.684  24.502  1.00 48.44  ? 548 PHE A CE2   1 
ATOM   3457 C CZ    . PHE D 4 346 ? 129.039 -63.453  24.135  1.00 48.08  ? 548 PHE A CZ    1 
ATOM   3458 N N     . LYS D 4 347 ? 133.920 -60.468  21.341  1.00 18.15  ? 549 LYS A N     1 
ATOM   3459 C CA    . LYS D 4 347 ? 134.445 -59.256  21.960  1.00 19.07  ? 549 LYS A CA    1 
ATOM   3460 C C     . LYS D 4 347 ? 134.183 -58.004  21.106  1.00 18.96  ? 549 LYS A C     1 
ATOM   3461 O O     . LYS D 4 347 ? 133.795 -56.953  21.631  1.00 18.15  ? 549 LYS A O     1 
ATOM   3462 C CB    . LYS D 4 347 ? 135.946 -59.408  22.231  1.00 125.55 ? 549 LYS A CB    1 
ATOM   3463 C CG    . LYS D 4 347 ? 136.326 -60.581  23.139  1.00 126.96 ? 549 LYS A CG    1 
ATOM   3464 C CD    . LYS D 4 347 ? 136.024 -60.320  24.611  1.00 128.98 ? 549 LYS A CD    1 
ATOM   3465 C CE    . LYS D 4 347 ? 136.410 -61.522  25.466  1.00 128.59 ? 549 LYS A CE    1 
ATOM   3466 N NZ    . LYS D 4 347 ? 136.308 -61.268  26.933  1.00 128.14 ? 549 LYS A NZ    1 
ATOM   3467 N N     . ASN D 4 348 ? 134.305 -58.165  19.786  1.00 33.78  ? 550 ASN A N     1 
ATOM   3468 C CA    . ASN D 4 348 ? 134.098 -57.071  18.833  1.00 34.71  ? 550 ASN A CA    1 
ATOM   3469 C C     . ASN D 4 348 ? 132.639 -56.712  18.767  1.00 34.34  ? 550 ASN A C     1 
ATOM   3470 O O     . ASN D 4 348 ? 132.274 -55.533  18.769  1.00 34.16  ? 550 ASN A O     1 
ATOM   3471 C CB    . ASN D 4 348 ? 134.600 -57.451  17.429  1.00 64.67  ? 550 ASN A CB    1 
ATOM   3472 C CG    . ASN D 4 348 ? 136.130 -57.415  17.307  1.00 65.38  ? 550 ASN A CG    1 
ATOM   3473 O OD1   . ASN D 4 348 ? 136.852 -57.396  18.307  1.00 66.17  ? 550 ASN A OD1   1 
ATOM   3474 N ND2   . ASN D 4 348 ? 136.623 -57.423  16.072  1.00 65.37  ? 550 ASN A ND2   1 
ATOM   3475 N N     . LEU D 4 349 ? 131.807 -57.746  18.806  1.00 33.54  ? 551 LEU A N     1 
ATOM   3476 C CA    . LEU D 4 349 ? 130.365 -57.575  18.749  1.00 34.64  ? 551 LEU A CA    1 
ATOM   3477 C C     . LEU D 4 349 ? 129.838 -56.815  19.934  1.00 35.71  ? 551 LEU A C     1 
ATOM   3478 O O     . LEU D 4 349 ? 129.098 -55.846  19.752  1.00 36.51  ? 551 LEU A O     1 
ATOM   3479 C CB    . LEU D 4 349 ? 129.674 -58.922  18.617  1.00 10.28  ? 551 LEU A CB    1 
ATOM   3480 C CG    . LEU D 4 349 ? 129.681 -59.358  17.150  1.00 9.70   ? 551 LEU A CG    1 
ATOM   3481 C CD1   . LEU D 4 349 ? 129.706 -60.856  17.034  1.00 9.68   ? 551 LEU A CD1   1 
ATOM   3482 C CD2   . LEU D 4 349 ? 128.505 -58.734  16.386  1.00 8.59   ? 551 LEU A CD2   1 
ATOM   3483 N N     . GLN D 4 350 ? 130.358 -57.172  21.116  1.00 47.63  ? 552 GLN A N     1 
ATOM   3484 C CA    . GLN D 4 350 ? 130.000 -56.556  22.395  1.00 49.30  ? 552 GLN A CA    1 
ATOM   3485 C C     . GLN D 4 350 ? 130.154 -55.048  22.317  1.00 49.87  ? 552 GLN A C     1 
ATOM   3486 O O     . GLN D 4 350 ? 129.210 -54.301  22.588  1.00 50.15  ? 552 GLN A O     1 
ATOM   3487 C CB    . GLN D 4 350 ? 130.891 -57.083  23.526  1.00 113.89 ? 552 GLN A CB    1 
ATOM   3488 C CG    . GLN D 4 350 ? 130.555 -58.479  24.016  1.00 116.98 ? 552 GLN A CG    1 
ATOM   3489 C CD    . GLN D 4 350 ? 131.303 -58.851  25.287  1.00 118.78 ? 552 GLN A CD    1 
ATOM   3490 O OE1   . GLN D 4 350 ? 132.531 -58.957  25.295  1.00 120.48 ? 552 GLN A OE1   1 
ATOM   3491 N NE2   . GLN D 4 350 ? 130.559 -59.056  26.370  1.00 118.33 ? 552 GLN A NE2   1 
ATOM   3492 N N     . LEU D 4 351 ? 131.294 -54.639  21.768  1.00 44.26  ? 553 LEU A N     1 
ATOM   3493 C CA    . LEU D 4 351 ? 131.667 -53.242  21.596  1.00 45.17  ? 553 LEU A CA    1 
ATOM   3494 C C     . LEU D 4 351 ? 130.749 -52.385  20.702  1.00 46.04  ? 553 LEU A C     1 
ATOM   3495 O O     . LEU D 4 351 ? 130.734 -51.157  20.823  1.00 46.86  ? 553 LEU A O     1 
ATOM   3496 C CB    . LEU D 4 351 ? 133.131 -53.177  21.131  1.00 79.63  ? 553 LEU A CB    1 
ATOM   3497 C CG    . LEU D 4 351 ? 134.296 -53.318  22.138  1.00 80.13  ? 553 LEU A CG    1 
ATOM   3498 C CD1   . LEU D 4 351 ? 133.997 -54.209  23.348  1.00 80.71  ? 553 LEU A CD1   1 
ATOM   3499 C CD2   . LEU D 4 351 ? 135.519 -53.835  21.393  1.00 79.91  ? 553 LEU A CD2   1 
ATOM   3500 N N     . PHE D 4 352 ? 129.933 -53.018  19.862  1.00 32.81  ? 554 PHE A N     1 
ATOM   3501 C CA    . PHE D 4 352 ? 129.032 -52.260  18.996  1.00 33.87  ? 554 PHE A CA    1 
ATOM   3502 C C     . PHE D 4 352 ? 127.801 -51.861  19.793  1.00 35.52  ? 554 PHE A C     1 
ATOM   3503 O O     . PHE D 4 352 ? 127.610 -50.679  20.087  1.00 36.20  ? 554 PHE A O     1 
ATOM   3504 C CB    . PHE D 4 352 ? 128.638 -53.078  17.762  1.00 45.71  ? 554 PHE A CB    1 
ATOM   3505 C CG    . PHE D 4 352 ? 129.815 -53.576  16.942  1.00 46.42  ? 554 PHE A CG    1 
ATOM   3506 C CD1   . PHE D 4 352 ? 131.065 -52.923  16.983  1.00 47.17  ? 554 PHE A CD1   1 
ATOM   3507 C CD2   . PHE D 4 352 ? 129.675 -54.710  16.108  1.00 47.09  ? 554 PHE A CD2   1 
ATOM   3508 C CE1   . PHE D 4 352 ? 132.170 -53.388  16.206  1.00 48.09  ? 554 PHE A CE1   1 
ATOM   3509 C CE2   . PHE D 4 352 ? 130.775 -55.193  15.317  1.00 48.34  ? 554 PHE A CE2   1 
ATOM   3510 C CZ    . PHE D 4 352 ? 132.024 -54.525  15.372  1.00 48.32  ? 554 PHE A CZ    1 
ATOM   3511 N N     . MET D 4 353 ? 127.073 -52.878  20.256  1.00 38.16  ? 555 MET A N     1 
ATOM   3512 C CA    . MET D 4 353 ? 125.843 -52.740  21.040  1.00 40.35  ? 555 MET A CA    1 
ATOM   3513 C C     . MET D 4 353 ? 126.048 -52.125  22.424  1.00 41.44  ? 555 MET A C     1 
ATOM   3514 O O     . MET D 4 353 ? 125.142 -51.249  22.552  1.00 41.02  ? 555 MET A O     1 
ATOM   3515 C CB    . MET D 4 353 ? 125.157 -54.105  21.226  1.00 93.19  ? 555 MET A CB    1 
ATOM   3516 C CG    . MET D 4 353 ? 125.646 -55.294  20.380  1.00 94.86  ? 555 MET A CG    1 
ATOM   3517 S SD    . MET D 4 353 ? 124.661 -56.774  20.750  1.00 97.65  ? 555 MET A SD    1 
ATOM   3518 C CE    . MET D 4 353 ? 125.154 -57.130  22.473  1.00 95.57  ? 555 MET A CE    1 
ATOM   3519 N N     . GLU D 4 354 ? 127.110 -51.406  22.910  1.00 60.33  ? 556 GLU A N     1 
ATOM   3520 C CA    . GLU D 4 354 ? 127.895 -50.552  23.847  1.00 61.37  ? 556 GLU A CA    1 
ATOM   3521 C C     . GLU D 4 354 ? 127.286 -49.170  23.597  1.00 61.11  ? 556 GLU A C     1 
ATOM   3522 O O     . GLU D 4 354 ? 126.077 -49.375  23.420  1.00 61.53  ? 556 GLU A O     1 
ATOM   3523 N N     . ASN D 4 355 ? 126.890 -47.951  23.818  1.00 76.69  ? 557 ASN A N     1 
ATOM   3524 C CA    . ASN D 4 355 ? 125.715 -47.258  24.434  1.00 76.98  ? 557 ASN A CA    1 
ATOM   3525 C C     . ASN D 4 355 ? 124.985 -47.074  23.100  1.00 76.18  ? 557 ASN A C     1 
ATOM   3526 O O     . ASN D 4 355 ? 125.297 -46.183  22.294  1.00 76.64  ? 557 ASN A O     1 
ATOM   3527 C CB    . ASN D 4 355 ? 127.029 -46.455  24.488  1.00 89.48  ? 557 ASN A CB    1 
ATOM   3528 C CG    . ASN D 4 355 ? 127.668 -46.463  25.868  1.00 90.97  ? 557 ASN A CG    1 
ATOM   3529 O OD1   . ASN D 4 355 ? 127.410 -45.580  26.685  1.00 91.76  ? 557 ASN A OD1   1 
ATOM   3530 N ND2   . ASN D 4 355 ? 128.501 -47.462  26.134  1.00 91.34  ? 557 ASN A ND2   1 
ATOM   3531 N N     . LYS D 4 356 ? 123.954 -47.908  22.941  1.00 55.77  ? 558 LYS A N     1 
ATOM   3532 C CA    . LYS D 4 356 ? 123.086 -47.975  21.770  1.00 53.58  ? 558 LYS A CA    1 
ATOM   3533 C C     . LYS D 4 356 ? 121.667 -48.413  22.120  1.00 55.12  ? 558 LYS A C     1 
ATOM   3534 O O     . LYS D 4 356 ? 121.468 -49.376  22.872  1.00 55.45  ? 558 LYS A O     1 
ATOM   3535 C CB    . LYS D 4 356 ? 123.646 -48.979  20.773  1.00 25.89  ? 558 LYS A CB    1 
ATOM   3536 C CG    . LYS D 4 356 ? 124.359 -48.344  19.609  1.00 21.33  ? 558 LYS A CG    1 
ATOM   3537 C CD    . LYS D 4 356 ? 124.765 -49.385  18.592  1.00 17.06  ? 558 LYS A CD    1 
ATOM   3538 C CE    . LYS D 4 356 ? 125.547 -48.765  17.444  1.00 13.79  ? 558 LYS A CE    1 
ATOM   3539 N NZ    . LYS D 4 356 ? 126.045 -49.829  16.541  1.00 12.13  ? 558 LYS A NZ    1 
ATOM   3540 N N     . GLN D 4 357 ? 120.681 -47.701  21.572  1.00 73.35  ? 559 GLN A N     1 
ATOM   3541 C CA    . GLN D 4 357 ? 119.262 -48.025  21.790  1.00 74.79  ? 559 GLN A CA    1 
ATOM   3542 C C     . GLN D 4 357 ? 118.901 -49.128  20.768  1.00 74.21  ? 559 GLN A C     1 
ATOM   3543 O O     . GLN D 4 357 ? 119.402 -49.099  19.634  1.00 74.53  ? 559 GLN A O     1 
ATOM   3544 C CB    . GLN D 4 357 ? 118.396 -46.780  21.604  1.00 119.19 ? 559 GLN A CB    1 
ATOM   3545 N N     . PRO D 4 358 ? 118.083 -50.138  21.165  1.00 40.58  ? 560 PRO A N     1 
ATOM   3546 C CA    . PRO D 4 358 ? 117.664 -51.264  20.308  1.00 40.15  ? 560 PRO A CA    1 
ATOM   3547 C C     . PRO D 4 358 ? 117.162 -51.005  18.873  1.00 39.26  ? 560 PRO A C     1 
ATOM   3548 O O     . PRO D 4 358 ? 117.451 -51.802  17.962  1.00 38.13  ? 560 PRO A O     1 
ATOM   3549 C CB    . PRO D 4 358 ? 116.603 -51.975  21.157  1.00 149.10 ? 560 PRO A CB    1 
ATOM   3550 C CG    . PRO D 4 358 ? 116.155 -50.940  22.133  1.00 149.13 ? 560 PRO A CG    1 
ATOM   3551 C CD    . PRO D 4 358 ? 117.453 -50.282  22.488  1.00 149.07 ? 560 PRO A CD    1 
ATOM   3552 N N     . GLU D 4 359 ? 116.442 -49.890  18.681  1.00 53.62  ? 561 GLU A N     1 
ATOM   3553 C CA    . GLU D 4 359 ? 115.883 -49.486  17.377  1.00 54.11  ? 561 GLU A CA    1 
ATOM   3554 C C     . GLU D 4 359 ? 116.902 -48.995  16.347  1.00 53.92  ? 561 GLU A C     1 
ATOM   3555 O O     . GLU D 4 359 ? 116.598 -48.937  15.154  1.00 53.74  ? 561 GLU A O     1 
ATOM   3556 N N     . ASP D 4 360 ? 118.108 -48.663  16.819  1.00 65.17  ? 562 ASP A N     1 
ATOM   3557 C CA    . ASP D 4 360 ? 119.204 -48.171  15.971  1.00 65.60  ? 562 ASP A CA    1 
ATOM   3558 C C     . ASP D 4 360 ? 119.945 -49.324  15.323  1.00 65.28  ? 562 ASP A C     1 
ATOM   3559 O O     . ASP D 4 360 ? 119.788 -50.473  15.732  1.00 64.92  ? 562 ASP A O     1 
ATOM   3560 C CB    . ASP D 4 360 ? 120.199 -47.316  16.781  1.00 108.17 ? 562 ASP A CB    1 
ATOM   3561 C CG    . ASP D 4 360 ? 119.588 -46.017  17.294  1.00 109.74 ? 562 ASP A CG    1 
ATOM   3562 O OD1   . ASP D 4 360 ? 119.222 -45.144  16.470  1.00 110.73 ? 562 ASP A OD1   1 
ATOM   3563 O OD2   . ASP D 4 360 ? 119.485 -45.868  18.532  1.00 109.68 ? 562 ASP A OD2   1 
ATOM   3564 N N     . ASP D 4 361 ? 120.791 -48.992  14.348  1.00 84.13  ? 563 ASP A N     1 
ATOM   3565 C CA    . ASP D 4 361 ? 121.590 -49.970  13.606  1.00 84.78  ? 563 ASP A CA    1 
ATOM   3566 C C     . ASP D 4 361 ? 122.649 -50.630  14.475  1.00 84.04  ? 563 ASP A C     1 
ATOM   3567 O O     . ASP D 4 361 ? 122.928 -50.169  15.583  1.00 84.34  ? 563 ASP A O     1 
ATOM   3568 C CB    . ASP D 4 361 ? 122.274 -49.310  12.404  1.00 118.89 ? 563 ASP A CB    1 
ATOM   3569 C CG    . ASP D 4 361 ? 121.291 -48.838  11.358  1.00 120.92 ? 563 ASP A CG    1 
ATOM   3570 O OD1   . ASP D 4 361 ? 120.968 -49.627  10.443  1.00 122.85 ? 563 ASP A OD1   1 
ATOM   3571 O OD2   . ASP D 4 361 ? 120.843 -47.677  11.454  1.00 122.23 ? 563 ASP A OD2   1 
ATOM   3572 N N     . LEU D 4 362 ? 123.188 -51.742  13.986  1.00 77.80  ? 564 LEU A N     1 
ATOM   3573 C CA    . LEU D 4 362 ? 124.236 -52.476  14.689  1.00 77.20  ? 564 LEU A CA    1 
ATOM   3574 C C     . LEU D 4 362 ? 125.564 -52.026  14.125  1.00 77.57  ? 564 LEU A C     1 
ATOM   3575 O O     . LEU D 4 362 ? 126.486 -51.695  14.873  1.00 78.03  ? 564 LEU A O     1 
ATOM   3576 C CB    . LEU D 4 362 ? 124.090 -53.973  14.460  1.00 42.25  ? 564 LEU A CB    1 
ATOM   3577 C CG    . LEU D 4 362 ? 125.144 -54.911  15.030  1.00 40.69  ? 564 LEU A CG    1 
ATOM   3578 C CD1   . LEU D 4 362 ? 125.108 -54.905  16.552  1.00 40.07  ? 564 LEU A CD1   1 
ATOM   3579 C CD2   . LEU D 4 362 ? 124.890 -56.293  14.481  1.00 40.14  ? 564 LEU A CD2   1 
ATOM   3580 N N     . PHE D 4 363 ? 125.659 -52.080  12.799  1.00 51.26  ? 565 PHE A N     1 
ATOM   3581 C CA    . PHE D 4 363 ? 126.854 -51.671  12.078  1.00 50.06  ? 565 PHE A CA    1 
ATOM   3582 C C     . PHE D 4 363 ? 126.764 -50.168  11.739  1.00 50.62  ? 565 PHE A C     1 
ATOM   3583 O O     . PHE D 4 363 ? 126.308 -49.781  10.658  1.00 49.85  ? 565 PHE A O     1 
ATOM   3584 C CB    . PHE D 4 363 ? 127.041 -52.547  10.824  1.00 25.24  ? 565 PHE A CB    1 
ATOM   3585 C CG    . PHE D 4 363 ? 127.333 -54.014  11.107  1.00 21.18  ? 565 PHE A CG    1 
ATOM   3586 C CD1   . PHE D 4 363 ? 126.967 -54.997  10.167  1.00 19.86  ? 565 PHE A CD1   1 
ATOM   3587 C CD2   . PHE D 4 363 ? 128.000 -54.426  12.280  1.00 20.33  ? 565 PHE A CD2   1 
ATOM   3588 C CE1   . PHE D 4 363 ? 127.263 -56.391  10.380  1.00 18.59  ? 565 PHE A CE1   1 
ATOM   3589 C CE2   . PHE D 4 363 ? 128.311 -55.817  12.521  1.00 18.88  ? 565 PHE A CE2   1 
ATOM   3590 C CZ    . PHE D 4 363 ? 127.935 -56.798  11.561  1.00 17.99  ? 565 PHE A CZ    1 
ATOM   3591 N N     . ASP D 4 364 ? 127.180 -49.349  12.709  1.00 106.85 ? 566 ASP A N     1 
ATOM   3592 C CA    . ASP D 4 364 ? 127.176 -47.883  12.646  1.00 109.42 ? 566 ASP A CA    1 
ATOM   3593 C C     . ASP D 4 364 ? 127.728 -47.257  11.364  1.00 110.70 ? 566 ASP A C     1 
ATOM   3594 O O     . ASP D 4 364 ? 126.985 -46.643  10.596  1.00 110.95 ? 566 ASP A O     1 
ATOM   3595 C CB    . ASP D 4 364 ? 127.905 -47.318  13.867  1.00 122.82 ? 566 ASP A CB    1 
ATOM   3596 N N     . ARG D 4 365 ? 129.022 -47.442  11.131  1.00 53.27  ? 567 ARG A N     1 
ATOM   3597 C CA    . ARG D 4 365 ? 129.682 -46.914  9.953   1.00 55.05  ? 567 ARG A CA    1 
ATOM   3598 C C     . ARG D 4 365 ? 129.885 -48.062  9.003   1.00 53.40  ? 567 ARG A C     1 
ATOM   3599 O O     . ARG D 4 365 ? 131.007 -48.535  8.875   1.00 53.26  ? 567 ARG A O     1 
ATOM   3600 N N     . LEU D 4 366 ? 128.780 -48.553  8.423   1.00 57.98  ? 568 LEU A N     1 
ATOM   3601 C CA    . LEU D 4 366 ? 128.771 -49.675  7.458   1.00 55.88  ? 568 LEU A CA    1 
ATOM   3602 C C     . LEU D 4 366 ? 127.443 -49.998  6.723   1.00 53.85  ? 568 LEU A C     1 
ATOM   3603 O O     . LEU D 4 366 ? 126.368 -50.113  7.335   1.00 54.09  ? 568 LEU A O     1 
ATOM   3604 C CB    . LEU D 4 366 ? 129.316 -50.961  8.118   1.00 43.24  ? 568 LEU A CB    1 
ATOM   3605 C CG    . LEU D 4 366 ? 129.789 -52.252  7.414   1.00 44.52  ? 568 LEU A CG    1 
ATOM   3606 C CD1   . LEU D 4 366 ? 128.665 -53.243  7.261   1.00 44.13  ? 568 LEU A CD1   1 
ATOM   3607 C CD2   . LEU D 4 366 ? 130.498 -51.996  6.091   1.00 46.01  ? 568 LEU A CD2   1 
ATOM   3608 N N     . ASN D 4 367 ? 127.584 -50.220  5.412   1.00 29.36  ? 569 ASN A N     1 
ATOM   3609 C CA    . ASN D 4 367 ? 126.510 -50.600  4.485   1.00 27.23  ? 569 ASN A CA    1 
ATOM   3610 C C     . ASN D 4 367 ? 127.109 -51.481  3.366   1.00 24.74  ? 569 ASN A C     1 
ATOM   3611 O O     . ASN D 4 367 ? 128.336 -51.602  3.244   1.00 24.90  ? 569 ASN A O     1 
ATOM   3612 C CB    . ASN D 4 367 ? 125.768 -49.374  3.904   1.00 79.25  ? 569 ASN A CB    1 
ATOM   3613 C CG    . ASN D 4 367 ? 126.608 -48.575  2.918   1.00 82.19  ? 569 ASN A CG    1 
ATOM   3614 O OD1   . ASN D 4 367 ? 126.576 -48.818  1.713   1.00 84.59  ? 569 ASN A OD1   1 
ATOM   3615 N ND2   . ASN D 4 367 ? 127.350 -47.608  3.430   1.00 84.54  ? 569 ASN A ND2   1 
ATOM   3616 N N     . THR D 4 368 ? 126.232 -52.062  2.545   1.00 34.79  ? 570 THR A N     1 
ATOM   3617 C CA    . THR D 4 368 ? 126.596 -52.943  1.423   1.00 31.57  ? 570 THR A CA    1 
ATOM   3618 C C     . THR D 4 368 ? 127.658 -52.398  0.467   1.00 30.10  ? 570 THR A C     1 
ATOM   3619 O O     . THR D 4 368 ? 128.530 -53.137  0.010   1.00 29.54  ? 570 THR A O     1 
ATOM   3620 C CB    . THR D 4 368 ? 125.371 -53.267  0.572   1.00 45.11  ? 570 THR A CB    1 
ATOM   3621 O OG1   . THR D 4 368 ? 124.191 -52.755  1.201   1.00 46.45  ? 570 THR A OG1   1 
ATOM   3622 C CG2   . THR D 4 368 ? 125.244 -54.744  0.398   1.00 44.54  ? 570 THR A CG2   1 
ATOM   3623 N N     . GLY D 4 369 ? 127.582 -51.092  0.210   1.00 57.24  ? 571 GLY A N     1 
ATOM   3624 C CA    . GLY D 4 369 ? 128.504 -50.417  -0.688  1.00 57.30  ? 571 GLY A CA    1 
ATOM   3625 C C     . GLY D 4 369 ? 129.949 -50.558  -0.279  1.00 56.89  ? 571 GLY A C     1 
ATOM   3626 O O     . GLY D 4 369 ? 130.755 -51.054  -1.061  1.00 57.41  ? 571 GLY A O     1 
ATOM   3627 N N     . ILE D 4 370 ? 130.225 -50.251  0.992   1.00 18.85  ? 572 ILE A N     1 
ATOM   3628 C CA    . ILE D 4 370 ? 131.572 -50.321  1.580   1.00 17.68  ? 572 ILE A CA    1 
ATOM   3629 C C     . ILE D 4 370 ? 132.064 -51.766  1.618   1.00 16.21  ? 572 ILE A C     1 
ATOM   3630 O O     . ILE D 4 370 ? 133.247 -52.029  1.426   1.00 15.26  ? 572 ILE A O     1 
ATOM   3631 C CB    . ILE D 4 370 ? 131.609 -49.702  2.998   1.00 102.23 ? 572 ILE A CB    1 
ATOM   3632 C CG1   . ILE D 4 370 ? 130.853 -48.364  3.003   1.00 103.39 ? 572 ILE A CG1   1 
ATOM   3633 C CG2   . ILE D 4 370 ? 133.064 -49.462  3.428   1.00 103.52 ? 572 ILE A CG2   1 
ATOM   3634 C CD1   . ILE D 4 370 ? 130.645 -47.738  4.376   1.00 104.33 ? 572 ILE A CD1   1 
ATOM   3635 N N     . LEU D 4 371 ? 131.121 -52.692  1.749   1.00 10.75  ? 573 LEU A N     1 
ATOM   3636 C CA    . LEU D 4 371 ? 131.433 -54.105  1.771   1.00 9.15   ? 573 LEU A CA    1 
ATOM   3637 C C     . LEU D 4 371 ? 131.872 -54.579  0.387   1.00 8.83   ? 573 LEU A C     1 
ATOM   3638 O O     . LEU D 4 371 ? 132.959 -55.146  0.240   1.00 7.50   ? 573 LEU A O     1 
ATOM   3639 C CB    . LEU D 4 371 ? 130.222 -54.912  2.237   1.00 82.73  ? 573 LEU A CB    1 
ATOM   3640 C CG    . LEU D 4 371 ? 130.360 -56.437  2.276   1.00 83.42  ? 573 LEU A CG    1 
ATOM   3641 C CD1   . LEU D 4 371 ? 131.199 -56.872  3.473   1.00 82.33  ? 573 LEU A CD1   1 
ATOM   3642 C CD2   . LEU D 4 371 ? 128.982 -57.060  2.324   1.00 83.08  ? 573 LEU A CD2   1 
ATOM   3643 N N     . ASN D 4 372 ? 131.045 -54.308  -0.622  1.00 31.73  ? 574 ASN A N     1 
ATOM   3644 C CA    . ASN D 4 372 ? 131.345 -54.731  -1.985  1.00 33.95  ? 574 ASN A CA    1 
ATOM   3645 C C     . ASN D 4 372 ? 132.511 -53.987  -2.614  1.00 36.27  ? 574 ASN A C     1 
ATOM   3646 O O     . ASN D 4 372 ? 133.266 -54.590  -3.381  1.00 35.84  ? 574 ASN A O     1 
ATOM   3647 C CB    . ASN D 4 372 ? 130.098 -54.679  -2.879  1.00 58.12  ? 574 ASN A CB    1 
ATOM   3648 C CG    . ASN D 4 372 ? 129.197 -55.914  -2.721  1.00 57.57  ? 574 ASN A CG    1 
ATOM   3649 O OD1   . ASN D 4 372 ? 129.608 -57.049  -2.978  1.00 55.76  ? 574 ASN A OD1   1 
ATOM   3650 N ND2   . ASN D 4 372 ? 127.954 -55.683  -2.322  1.00 57.78  ? 574 ASN A ND2   1 
ATOM   3651 N N     . LYS D 4 373 ? 132.718 -52.726  -2.209  1.00 67.62  ? 575 LYS A N     1 
ATOM   3652 C CA    . LYS D 4 373 ? 133.819 -51.891  -2.723  1.00 68.34  ? 575 LYS A CA    1 
ATOM   3653 C C     . LYS D 4 373 ? 135.137 -52.498  -2.262  1.00 67.59  ? 575 LYS A C     1 
ATOM   3654 O O     . LYS D 4 373 ? 136.132 -52.456  -2.992  1.00 67.80  ? 575 LYS A O     1 
ATOM   3655 C CB    . LYS D 4 373 ? 133.690 -50.429  -2.240  1.00 83.38  ? 575 LYS A CB    1 
ATOM   3656 C CG    . LYS D 4 373 ? 134.796 -49.437  -2.700  1.00 86.05  ? 575 LYS A CG    1 
ATOM   3657 C CD    . LYS D 4 373 ? 134.720 -49.038  -4.180  1.00 87.46  ? 575 LYS A CD    1 
ATOM   3658 C CE    . LYS D 4 373 ? 133.977 -47.716  -4.384  1.00 87.99  ? 575 LYS A CE    1 
ATOM   3659 N NZ    . LYS D 4 373 ? 134.112 -47.181  -5.777  1.00 87.21  ? 575 LYS A NZ    1 
ATOM   3660 N N     . HIS D 4 374 ? 135.103 -53.117  -1.078  1.00 17.21  ? 576 HIS A N     1 
ATOM   3661 C CA    . HIS D 4 374 ? 136.268 -53.786  -0.496  1.00 16.75  ? 576 HIS A CA    1 
ATOM   3662 C C     . HIS D 4 374 ? 136.524 -55.077  -1.265  1.00 16.07  ? 576 HIS A C     1 
ATOM   3663 O O     . HIS D 4 374 ? 137.600 -55.265  -1.825  1.00 15.06  ? 576 HIS A O     1 
ATOM   3664 C CB    . HIS D 4 374 ? 136.021 -54.091  0.994   1.00 60.88  ? 576 HIS A CB    1 
ATOM   3665 C CG    . HIS D 4 374 ? 137.165 -54.770  1.695   1.00 62.11  ? 576 HIS A CG    1 
ATOM   3666 N ND1   . HIS D 4 374 ? 136.998 -55.919  2.438   1.00 62.07  ? 576 HIS A ND1   1 
ATOM   3667 C CD2   . HIS D 4 374 ? 138.476 -54.443  1.805   1.00 62.69  ? 576 HIS A CD2   1 
ATOM   3668 C CE1   . HIS D 4 374 ? 138.153 -56.270  2.973   1.00 63.11  ? 576 HIS A CE1   1 
ATOM   3669 N NE2   . HIS D 4 374 ? 139.067 -55.390  2.605   1.00 63.26  ? 576 HIS A NE2   1 
ATOM   3670 N N     . LEU D 4 375 ? 135.492 -55.908  -1.369  1.00 17.32  ? 577 LEU A N     1 
ATOM   3671 C CA    . LEU D 4 375 ? 135.574 -57.193  -2.053  1.00 19.47  ? 577 LEU A CA    1 
ATOM   3672 C C     . LEU D 4 375 ? 136.097 -57.118  -3.472  1.00 21.23  ? 577 LEU A C     1 
ATOM   3673 O O     . LEU D 4 375 ? 136.758 -58.045  -3.920  1.00 21.05  ? 577 LEU A O     1 
ATOM   3674 C CB    . LEU D 4 375 ? 134.217 -57.891  -2.054  1.00 49.56  ? 577 LEU A CB    1 
ATOM   3675 C CG    . LEU D 4 375 ? 133.437 -58.226  -0.775  1.00 50.72  ? 577 LEU A CG    1 
ATOM   3676 C CD1   . LEU D 4 375 ? 132.943 -59.639  -0.914  1.00 51.24  ? 577 LEU A CD1   1 
ATOM   3677 C CD2   . LEU D 4 375 ? 134.237 -58.074  0.509   1.00 52.90  ? 577 LEU A CD2   1 
ATOM   3678 N N     . GLN D 4 376 ? 135.855 -55.993  -4.146  1.00 77.64  ? 578 GLN A N     1 
ATOM   3679 C CA    . GLN D 4 376 ? 136.311 -55.793  -5.525  1.00 80.10  ? 578 GLN A CA    1 
ATOM   3680 C C     . GLN D 4 376 ? 137.810 -55.580  -5.655  1.00 80.84  ? 578 GLN A C     1 
ATOM   3681 O O     . GLN D 4 376 ? 138.417 -55.964  -6.660  1.00 80.98  ? 578 GLN A O     1 
ATOM   3682 C CB    . GLN D 4 376 ? 135.571 -54.633  -6.196  1.00 114.95 ? 578 GLN A CB    1 
ATOM   3683 C CG    . GLN D 4 376 ? 134.447 -55.060  -7.152  1.00 116.94 ? 578 GLN A CG    1 
ATOM   3684 C CD    . GLN D 4 376 ? 134.922 -55.940  -8.309  1.00 117.67 ? 578 GLN A CD    1 
ATOM   3685 O OE1   . GLN D 4 376 ? 135.911 -55.638  -8.983  1.00 117.38 ? 578 GLN A OE1   1 
ATOM   3686 N NE2   . GLN D 4 376 ? 134.211 -57.035  -8.539  1.00 118.19 ? 578 GLN A NE2   1 
ATOM   3687 N N     . ASP D 4 377 ? 138.398 -54.986  -4.619  1.00 43.42  ? 579 ASP A N     1 
ATOM   3688 C CA    . ASP D 4 377 ? 139.828 -54.719  -4.575  1.00 44.45  ? 579 ASP A CA    1 
ATOM   3689 C C     . ASP D 4 377 ? 140.541 -56.053  -4.454  1.00 43.98  ? 579 ASP A C     1 
ATOM   3690 O O     . ASP D 4 377 ? 141.514 -56.308  -5.166  1.00 45.13  ? 579 ASP A O     1 
ATOM   3691 N N     . LEU D 4 378 ? 139.952 -56.942  -3.656  1.00 52.74  ? 580 LEU A N     1 
ATOM   3692 C CA    . LEU D 4 378 ? 140.506 -58.269  -3.403  1.00 51.80  ? 580 LEU A CA    1 
ATOM   3693 C C     . LEU D 4 378 ? 140.531 -59.211  -4.599  1.00 50.69  ? 580 LEU A C     1 
ATOM   3694 O O     . LEU D 4 378 ? 141.447 -60.030  -4.720  1.00 50.86  ? 580 LEU A O     1 
ATOM   3695 C CB    . LEU D 4 378 ? 139.806 -58.930  -2.209  1.00 104.55 ? 580 LEU A CB    1 
ATOM   3696 C CG    . LEU D 4 378 ? 139.972 -58.282  -0.823  1.00 105.33 ? 580 LEU A CG    1 
ATOM   3697 C CD1   . LEU D 4 378 ? 139.076 -58.983  0.176   1.00 105.46 ? 580 LEU A CD1   1 
ATOM   3698 C CD2   . LEU D 4 378 ? 141.421 -58.333  -0.346  1.00 106.10 ? 580 LEU A CD2   1 
ATOM   3699 N N     . MET D 4 379 ? 139.560 -59.064  -5.498  1.00 43.28  ? 581 MET A N     1 
ATOM   3700 C CA    . MET D 4 379 ? 139.468 -59.903  -6.701  1.00 43.23  ? 581 MET A CA    1 
ATOM   3701 C C     . MET D 4 379 ? 138.483 -59.282  -7.688  1.00 42.10  ? 581 MET A C     1 
ATOM   3702 O O     . MET D 4 379 ? 137.610 -58.505  -7.295  1.00 41.45  ? 581 MET A O     1 
ATOM   3703 C CB    . MET D 4 379 ? 139.003 -61.322  -6.338  1.00 102.07 ? 581 MET A CB    1 
ATOM   3704 C CG    . MET D 4 379 ? 139.425 -62.402  -7.316  1.00 105.47 ? 581 MET A CG    1 
ATOM   3705 S SD    . MET D 4 379 ? 138.692 -63.984  -6.894  1.00 108.19 ? 581 MET A SD    1 
ATOM   3706 C CE    . MET D 4 379 ? 137.229 -63.952  -7.908  1.00 108.56 ? 581 MET A CE    1 
ATOM   3707 N N     . GLU D 4 380 ? 138.627 -59.622  -8.968  1.00 57.51  ? 582 GLU A N     1 
ATOM   3708 C CA    . GLU D 4 380 ? 137.745 -59.096  -10.008 1.00 56.67  ? 582 GLU A CA    1 
ATOM   3709 C C     . GLU D 4 380 ? 136.514 -59.980  -10.195 1.00 55.33  ? 582 GLU A C     1 
ATOM   3710 O O     . GLU D 4 380 ? 136.631 -61.187  -10.461 1.00 54.44  ? 582 GLU A O     1 
ATOM   3711 C CB    . GLU D 4 380 ? 138.504 -58.930  -11.323 1.00 62.69  ? 582 GLU A CB    1 
ATOM   3712 N N     . GLY D 4 381 ? 135.343 -59.368  -10.011 1.00 63.11  ? 583 GLY A N     1 
ATOM   3713 C CA    . GLY D 4 381 ? 134.071 -60.065  -10.151 1.00 60.75  ? 583 GLY A CA    1 
ATOM   3714 C C     . GLY D 4 381 ? 133.480 -60.561  -8.841  1.00 58.96  ? 583 GLY A C     1 
ATOM   3715 O O     . GLY D 4 381 ? 132.328 -61.020  -8.789  1.00 60.20  ? 583 GLY A O     1 
ATOM   3716 N N     . LEU D 4 382 ? 134.268 -60.452  -7.775  1.00 23.88  ? 584 LEU A N     1 
ATOM   3717 C CA    . LEU D 4 382 ? 133.865 -60.891  -6.450  1.00 20.63  ? 584 LEU A CA    1 
ATOM   3718 C C     . LEU D 4 382 ? 132.890 -59.947  -5.781  1.00 18.50  ? 584 LEU A C     1 
ATOM   3719 O O     . LEU D 4 382 ? 133.141 -58.745  -5.666  1.00 17.36  ? 584 LEU A O     1 
ATOM   3720 C CB    . LEU D 4 382 ? 135.097 -61.076  -5.563  1.00 49.57  ? 584 LEU A CB    1 
ATOM   3721 C CG    . LEU D 4 382 ? 134.909 -61.430  -4.086  1.00 51.02  ? 584 LEU A CG    1 
ATOM   3722 C CD1   . LEU D 4 382 ? 134.315 -62.817  -3.904  1.00 53.18  ? 584 LEU A CD1   1 
ATOM   3723 C CD2   . LEU D 4 382 ? 136.242 -61.333  -3.399  1.00 51.16  ? 584 LEU A CD2   1 
ATOM   3724 N N     . THR D 4 383 ? 131.753 -60.509  -5.388  1.00 9.46   ? 585 THR A N     1 
ATOM   3725 C CA    . THR D 4 383 ? 130.711 -59.779  -4.675  1.00 6.50   ? 585 THR A CA    1 
ATOM   3726 C C     . THR D 4 383 ? 130.267 -60.642  -3.513  1.00 4.07   ? 585 THR A C     1 
ATOM   3727 O O     . THR D 4 383 ? 130.582 -61.844  -3.460  1.00 2.01   ? 585 THR A O     1 
ATOM   3728 C CB    . THR D 4 383 ? 129.497 -59.432  -5.570  1.00 45.70  ? 585 THR A CB    1 
ATOM   3729 O OG1   . THR D 4 383 ? 129.237 -60.494  -6.502  1.00 45.58  ? 585 THR A OG1   1 
ATOM   3730 C CG2   . THR D 4 383 ? 129.739 -58.118  -6.298  1.00 46.21  ? 585 THR A CG2   1 
ATOM   3731 N N     . ALA D 4 384 ? 129.531 -60.034  -2.587  1.00 24.04  ? 586 ALA A N     1 
ATOM   3732 C CA    . ALA D 4 384 ? 129.035 -60.742  -1.409  1.00 24.39  ? 586 ALA A CA    1 
ATOM   3733 C C     . ALA D 4 384 ? 128.301 -62.063  -1.720  1.00 24.48  ? 586 ALA A C     1 
ATOM   3734 O O     . ALA D 4 384 ? 128.556 -63.074  -1.067  1.00 24.48  ? 586 ALA A O     1 
ATOM   3735 C CB    . ALA D 4 384 ? 128.153 -59.823  -0.585  1.00 26.75  ? 586 ALA A CB    1 
ATOM   3736 N N     . LYS D 4 385 ? 127.514 -62.083  -2.799  1.00 20.43  ? 587 LYS A N     1 
ATOM   3737 C CA    . LYS D 4 385 ? 126.760 -63.270  -3.160  1.00 22.01  ? 587 LYS A CA    1 
ATOM   3738 C C     . LYS D 4 385 ? 127.603 -64.477  -3.499  1.00 22.68  ? 587 LYS A C     1 
ATOM   3739 O O     . LYS D 4 385 ? 127.226 -65.589  -3.134  1.00 21.07  ? 587 LYS A O     1 
ATOM   3740 C CB    . LYS D 4 385 ? 125.706 -62.989  -4.258  1.00 70.11  ? 587 LYS A CB    1 
ATOM   3741 C CG    . LYS D 4 385 ? 126.159 -62.390  -5.624  1.00 74.92  ? 587 LYS A CG    1 
ATOM   3742 C CD    . LYS D 4 385 ? 126.587 -63.413  -6.722  1.00 78.05  ? 587 LYS A CD    1 
ATOM   3743 C CE    . LYS D 4 385 ? 125.622 -64.601  -6.925  1.00 79.50  ? 587 LYS A CE    1 
ATOM   3744 N NZ    . LYS D 4 385 ? 124.230 -64.211  -7.271  1.00 80.86  ? 587 LYS A NZ    1 
ATOM   3745 N N     . VAL D 4 386 ? 128.790 -64.242  -4.073  1.00 33.38  ? 588 VAL A N     1 
ATOM   3746 C CA    . VAL D 4 386 ? 129.715 -65.313  -4.506  1.00 35.12  ? 588 VAL A CA    1 
ATOM   3747 C C     . VAL D 4 386 ? 130.038 -66.341  -3.414  1.00 36.85  ? 588 VAL A C     1 
ATOM   3748 O O     . VAL D 4 386 ? 130.266 -67.519  -3.707  1.00 37.88  ? 588 VAL A O     1 
ATOM   3749 C CB    . VAL D 4 386 ? 131.048 -64.742  -5.093  1.00 16.47  ? 588 VAL A CB    1 
ATOM   3750 C CG1   . VAL D 4 386 ? 131.822 -65.812  -5.875  1.00 17.48  ? 588 VAL A CG1   1 
ATOM   3751 C CG2   . VAL D 4 386 ? 130.771 -63.584  -6.010  1.00 18.98  ? 588 VAL A CG2   1 
ATOM   3752 N N     . PHE D 4 387 ? 129.989 -65.897  -2.158  1.00 13.74  ? 589 PHE A N     1 
ATOM   3753 C CA    . PHE D 4 387 ? 130.252 -66.769  -1.027  1.00 15.52  ? 589 PHE A CA    1 
ATOM   3754 C C     . PHE D 4 387 ? 129.205 -67.862  -0.904  1.00 16.19  ? 589 PHE A C     1 
ATOM   3755 O O     . PHE D 4 387 ? 129.557 -69.030  -0.731  1.00 15.70  ? 589 PHE A O     1 
ATOM   3756 C CB    . PHE D 4 387 ? 130.335 -65.960  0.262   1.00 90.49  ? 589 PHE A CB    1 
ATOM   3757 C CG    . PHE D 4 387 ? 131.649 -65.265  0.447   1.00 90.89  ? 589 PHE A CG    1 
ATOM   3758 C CD1   . PHE D 4 387 ? 131.907 -64.038  -0.187  1.00 90.65  ? 589 PHE A CD1   1 
ATOM   3759 C CD2   . PHE D 4 387 ? 132.651 -65.845  1.246   1.00 90.79  ? 589 PHE A CD2   1 
ATOM   3760 C CE1   . PHE D 4 387 ? 133.157 -63.388  -0.030  1.00 89.84  ? 589 PHE A CE1   1 
ATOM   3761 C CE2   . PHE D 4 387 ? 133.910 -65.209  1.416   1.00 90.84  ? 589 PHE A CE2   1 
ATOM   3762 C CZ    . PHE D 4 387 ? 134.163 -63.978  0.775   1.00 90.19  ? 589 PHE A CZ    1 
ATOM   3763 N N     . ARG D 4 388 ? 127.940 -67.492  -1.117  1.00 24.19  ? 590 ARG A N     1 
ATOM   3764 C CA    . ARG D 4 388 ? 126.827 -68.440  -1.047  1.00 27.19  ? 590 ARG A CA    1 
ATOM   3765 C C     . ARG D 4 388 ? 126.990 -69.499  -2.119  1.00 27.84  ? 590 ARG A C     1 
ATOM   3766 O O     . ARG D 4 388 ? 126.667 -70.662  -1.905  1.00 28.84  ? 590 ARG A O     1 
ATOM   3767 C CB    . ARG D 4 388 ? 125.471 -67.755  -1.254  1.00 59.07  ? 590 ARG A CB    1 
ATOM   3768 C CG    . ARG D 4 388 ? 125.176 -66.576  -0.351  1.00 60.68  ? 590 ARG A CG    1 
ATOM   3769 C CD    . ARG D 4 388 ? 123.687 -66.334  -0.269  1.00 60.26  ? 590 ARG A CD    1 
ATOM   3770 N NE    . ARG D 4 388 ? 123.052 -67.249  0.676   1.00 59.95  ? 590 ARG A NE    1 
ATOM   3771 C CZ    . ARG D 4 388 ? 121.751 -67.508  0.713   1.00 60.34  ? 590 ARG A CZ    1 
ATOM   3772 N NH1   . ARG D 4 388 ? 120.934 -66.930  -0.158  1.00 61.38  ? 590 ARG A NH1   1 
ATOM   3773 N NH2   . ARG D 4 388 ? 121.258 -68.290  1.666   1.00 59.23  ? 590 ARG A NH2   1 
ATOM   3774 N N     . THR D 4 389 ? 127.562 -69.091  -3.247  1.00 30.34  ? 591 THR A N     1 
ATOM   3775 C CA    . THR D 4 389 ? 127.785 -69.992  -4.364  1.00 29.68  ? 591 THR A CA    1 
ATOM   3776 C C     . THR D 4 389 ? 129.042 -70.830  -4.142  1.00 29.80  ? 591 THR A C     1 
ATOM   3777 O O     . THR D 4 389 ? 129.046 -72.009  -4.483  1.00 28.75  ? 591 THR A O     1 
ATOM   3778 C CB    . THR D 4 389 ? 127.897 -69.233  -5.707  1.00 18.06  ? 591 THR A CB    1 
ATOM   3779 O OG1   . THR D 4 389 ? 126.997 -68.114  -5.720  1.00 18.28  ? 591 THR A OG1   1 
ATOM   3780 C CG2   . THR D 4 389 ? 127.527 -70.145  -6.847  1.00 18.89  ? 591 THR A CG2   1 
ATOM   3781 N N     . TYR D 4 390 ? 130.082 -70.244  -3.537  1.00 39.16  ? 592 TYR A N     1 
ATOM   3782 C CA    . TYR D 4 390 ? 131.339 -70.970  -3.282  1.00 40.93  ? 592 TYR A CA    1 
ATOM   3783 C C     . TYR D 4 390 ? 131.169 -72.073  -2.243  1.00 41.67  ? 592 TYR A C     1 
ATOM   3784 O O     . TYR D 4 390 ? 131.343 -73.255  -2.560  1.00 41.12  ? 592 TYR A O     1 
ATOM   3785 C CB    . TYR D 4 390 ? 132.483 -70.010  -2.868  1.00 95.81  ? 592 TYR A CB    1 
ATOM   3786 C CG    . TYR D 4 390 ? 133.724 -70.691  -2.272  1.00 97.32  ? 592 TYR A CG    1 
ATOM   3787 C CD1   . TYR D 4 390 ? 134.585 -71.482  -3.070  1.00 99.20  ? 592 TYR A CD1   1 
ATOM   3788 C CD2   . TYR D 4 390 ? 133.986 -70.623  -0.883  1.00 98.86  ? 592 TYR A CD2   1 
ATOM   3789 C CE1   . TYR D 4 390 ? 135.678 -72.204  -2.486  1.00 100.31 ? 592 TYR A CE1   1 
ATOM   3790 C CE2   . TYR D 4 390 ? 135.066 -71.340  -0.291  1.00 100.46 ? 592 TYR A CE2   1 
ATOM   3791 C CZ    . TYR D 4 390 ? 135.901 -72.127  -1.094  1.00 101.35 ? 592 TYR A CZ    1 
ATOM   3792 O OH    . TYR D 4 390 ? 136.921 -72.841  -0.498  1.00 101.01 ? 592 TYR A OH    1 
ATOM   3793 N N     . ASN D 4 391 ? 130.864 -71.652  -1.010  1.00 48.57  ? 593 ASN A N     1 
ATOM   3794 C CA    . ASN D 4 391 ? 130.687 -72.533  0.140   1.00 49.47  ? 593 ASN A CA    1 
ATOM   3795 C C     . ASN D 4 391 ? 129.816 -73.733  -0.142  1.00 49.61  ? 593 ASN A C     1 
ATOM   3796 O O     . ASN D 4 391 ? 130.269 -74.862  0.042   1.00 49.57  ? 593 ASN A O     1 
ATOM   3797 C CB    . ASN D 4 391 ? 130.156 -71.757  1.347   1.00 75.85  ? 593 ASN A CB    1 
ATOM   3798 C CG    . ASN D 4 391 ? 131.258 -71.048  2.119   1.00 77.90  ? 593 ASN A CG    1 
ATOM   3799 O OD1   . ASN D 4 391 ? 131.423 -69.831  2.012   1.00 78.72  ? 593 ASN A OD1   1 
ATOM   3800 N ND2   . ASN D 4 391 ? 132.012 -71.808  2.913   1.00 79.31  ? 593 ASN A ND2   1 
ATOM   3801 N N     . ALA D 4 392 ? 128.654 -73.472  -0.748  1.00 66.64  ? 594 ALA A N     1 
ATOM   3802 C CA    . ALA D 4 392 ? 127.657 -74.492  -1.102  1.00 68.18  ? 594 ALA A CA    1 
ATOM   3803 C C     . ALA D 4 392 ? 128.117 -75.534  -2.117  1.00 68.91  ? 594 ALA A C     1 
ATOM   3804 O O     . ALA D 4 392 ? 127.662 -76.679  -2.091  1.00 68.28  ? 594 ALA A O     1 
ATOM   3805 C CB    . ALA D 4 392 ? 126.394 -73.826  -1.599  1.00 92.54  ? 594 ALA A CB    1 
ATOM   3806 N N     . SER D 4 393 ? 129.051 -75.144  -2.976  1.00 41.60  ? 595 SER A N     1 
ATOM   3807 C CA    . SER D 4 393 ? 129.565 -76.032  -4.003  1.00 43.09  ? 595 SER A CA    1 
ATOM   3808 C C     . SER D 4 393 ? 130.763 -76.880  -3.588  1.00 44.88  ? 595 SER A C     1 
ATOM   3809 O O     . SER D 4 393 ? 130.724 -78.095  -3.748  1.00 46.17  ? 595 SER A O     1 
ATOM   3810 C CB    . SER D 4 393 ? 129.884 -75.235  -5.267  1.00 61.19  ? 595 SER A CB    1 
ATOM   3811 O OG    . SER D 4 393 ? 128.699 -74.710  -5.845  1.00 59.02  ? 595 SER A OG    1 
ATOM   3812 N N     . ILE D 4 394 ? 131.792 -76.250  -3.008  1.00 46.53  ? 596 ILE A N     1 
ATOM   3813 C CA    . ILE D 4 394 ? 133.032 -76.926  -2.575  1.00 47.61  ? 596 ILE A CA    1 
ATOM   3814 C C     . ILE D 4 394 ? 132.788 -78.057  -1.555  1.00 49.00  ? 596 ILE A C     1 
ATOM   3815 O O     . ILE D 4 394 ? 133.616 -78.963  -1.364  1.00 49.63  ? 596 ILE A O     1 
ATOM   3816 C CB    . ILE D 4 394 ? 134.043 -75.883  -2.037  1.00 53.19  ? 596 ILE A CB    1 
ATOM   3817 C CG1   . ILE D 4 394 ? 135.456 -76.474  -1.925  1.00 53.89  ? 596 ILE A CG1   1 
ATOM   3818 C CG2   . ILE D 4 394 ? 133.551 -75.287  -0.724  1.00 53.38  ? 596 ILE A CG2   1 
ATOM   3819 C CD1   . ILE D 4 394 ? 136.144 -76.736  -3.263  1.00 53.77  ? 596 ILE A CD1   1 
ATOM   3820 N N     . THR D 4 395 ? 131.611 -77.983  -0.940  1.00 33.37  ? 597 THR A N     1 
ATOM   3821 C CA    . THR D 4 395 ? 131.121 -78.945  0.028   1.00 34.75  ? 597 THR A CA    1 
ATOM   3822 C C     . THR D 4 395 ? 130.857 -80.203  -0.790  1.00 35.77  ? 597 THR A C     1 
ATOM   3823 O O     . THR D 4 395 ? 131.575 -81.191  -0.649  1.00 35.87  ? 597 THR A O     1 
ATOM   3824 C CB    . THR D 4 395 ? 129.811 -78.409  0.672   1.00 53.00  ? 597 THR A CB    1 
ATOM   3825 O OG1   . THR D 4 395 ? 130.113 -77.225  1.415   1.00 53.18  ? 597 THR A OG1   1 
ATOM   3826 C CG2   . THR D 4 395 ? 129.169 -79.422  1.607   1.00 52.38  ? 597 THR A CG2   1 
ATOM   3827 N N     . LEU D 4 396 ? 129.966 -80.064  -1.775  1.00 32.16  ? 598 LEU A N     1 
ATOM   3828 C CA    . LEU D 4 396 ? 129.546 -81.138  -2.676  1.00 34.87  ? 598 LEU A CA    1 
ATOM   3829 C C     . LEU D 4 396 ? 130.668 -81.914  -3.351  1.00 37.61  ? 598 LEU A C     1 
ATOM   3830 O O     . LEU D 4 396 ? 130.483 -83.075  -3.713  1.00 37.71  ? 598 LEU A O     1 
ATOM   3831 C CB    . LEU D 4 396 ? 128.627 -80.570  -3.738  1.00 59.70  ? 598 LEU A CB    1 
ATOM   3832 C CG    . LEU D 4 396 ? 127.392 -81.400  -4.025  1.00 59.83  ? 598 LEU A CG    1 
ATOM   3833 C CD1   . LEU D 4 396 ? 126.446 -81.340  -2.829  1.00 59.76  ? 598 LEU A CD1   1 
ATOM   3834 C CD2   . LEU D 4 396 ? 126.729 -80.847  -5.273  1.00 60.86  ? 598 LEU A CD2   1 
ATOM   3835 N N     . GLN D 4 397 ? 131.818 -81.259  -3.525  1.00 55.39  ? 599 GLN A N     1 
ATOM   3836 C CA    . GLN D 4 397 ? 133.000 -81.882  -4.116  1.00 59.86  ? 599 GLN A CA    1 
ATOM   3837 C C     . GLN D 4 397 ? 133.563 -82.868  -3.078  1.00 62.98  ? 599 GLN A C     1 
ATOM   3838 O O     . GLN D 4 397 ? 133.730 -84.061  -3.375  1.00 63.57  ? 599 GLN A O     1 
ATOM   3839 C CB    . GLN D 4 397 ? 134.031 -80.800  -4.513  1.00 89.89  ? 599 GLN A CB    1 
ATOM   3840 C CG    . GLN D 4 397 ? 135.471 -81.266  -4.908  1.00 90.68  ? 599 GLN A CG    1 
ATOM   3841 C CD    . GLN D 4 397 ? 135.555 -82.123  -6.176  1.00 91.82  ? 599 GLN A CD    1 
ATOM   3842 O OE1   . GLN D 4 397 ? 136.311 -83.100  -6.222  1.00 91.62  ? 599 GLN A OE1   1 
ATOM   3843 N NE2   . GLN D 4 397 ? 134.798 -81.750  -7.209  1.00 92.02  ? 599 GLN A NE2   1 
ATOM   3844 N N     . GLN D 4 398 ? 133.736 -82.381  -1.845  1.00 115.88 ? 600 GLN A N     1 
ATOM   3845 C CA    . GLN D 4 398 ? 134.255 -83.178  -0.727  1.00 120.09 ? 600 GLN A CA    1 
ATOM   3846 C C     . GLN D 4 398 ? 133.266 -84.245  -0.254  1.00 122.08 ? 600 GLN A C     1 
ATOM   3847 O O     . GLN D 4 398 ? 133.672 -85.305  0.224   1.00 122.46 ? 600 GLN A O     1 
ATOM   3848 N N     . GLN D 4 399 ? 131.975 -83.960  -0.431  1.00 56.63  ? 601 GLN A N     1 
ATOM   3849 C CA    . GLN D 4 399 ? 130.888 -84.863  -0.053  1.00 59.82  ? 601 GLN A CA    1 
ATOM   3850 C C     . GLN D 4 399 ? 130.718 -85.942  -1.100  1.00 60.91  ? 601 GLN A C     1 
ATOM   3851 O O     . GLN D 4 399 ? 130.615 -87.116  -0.764  1.00 61.15  ? 601 GLN A O     1 
ATOM   3852 C CB    . GLN D 4 399 ? 129.569 -84.102  0.101   1.00 113.16 ? 601 GLN A CB    1 
ATOM   3853 C CG    . GLN D 4 399 ? 129.501 -83.152  1.280   1.00 116.24 ? 601 GLN A CG    1 
ATOM   3854 C CD    . GLN D 4 399 ? 129.176 -83.837  2.584   1.00 117.88 ? 601 GLN A CD    1 
ATOM   3855 O OE1   . GLN D 4 399 ? 128.042 -84.261  2.810   1.00 119.11 ? 601 GLN A OE1   1 
ATOM   3856 N NE2   . GLN D 4 399 ? 130.168 -83.942  3.458   1.00 118.93 ? 601 GLN A NE2   1 
ATOM   3857 N N     . LEU D 4 400 ? 130.759 -85.545  -2.371  1.00 67.40  ? 602 LEU A N     1 
ATOM   3858 C CA    . LEU D 4 400 ? 130.622 -86.476  -3.490  1.00 68.86  ? 602 LEU A CA    1 
ATOM   3859 C C     . LEU D 4 400 ? 131.898 -87.292  -3.715  1.00 69.80  ? 602 LEU A C     1 
ATOM   3860 O O     . LEU D 4 400 ? 132.006 -88.013  -4.706  1.00 70.12  ? 602 LEU A O     1 
ATOM   3861 N N     . LYS D 4 401 ? 132.830 -87.201  -2.764  1.00 190.23 ? 603 LYS A N     1 
ATOM   3862 C CA    . LYS D 4 401 ? 134.115 -87.900  -2.810  1.00 190.81 ? 603 LYS A CA    1 
ATOM   3863 C C     . LYS D 4 401 ? 134.215 -89.044  -1.783  1.00 190.63 ? 603 LYS A C     1 
ATOM   3864 O O     . LYS D 4 401 ? 134.933 -90.024  -2.016  1.00 190.31 ? 603 LYS A O     1 
ATOM   3865 C CB    . LYS D 4 401 ? 135.251 -86.887  -2.588  1.00 102.26 ? 603 LYS A CB    1 
ATOM   3866 C CG    . LYS D 4 401 ? 136.675 -87.370  -2.911  1.00 102.65 ? 603 LYS A CG    1 
ATOM   3867 C CD    . LYS D 4 401 ? 137.740 -86.393  -2.402  1.00 102.63 ? 603 LYS A CD    1 
ATOM   3868 C CE    . LYS D 4 401 ? 137.752 -86.281  -0.871  1.00 102.29 ? 603 LYS A CE    1 
ATOM   3869 N NZ    . LYS D 4 401 ? 137.955 -87.597  -0.193  1.00 101.39 ? 603 LYS A NZ    1 
ATOM   3870 N N     . GLU D 4 402 ? 133.486 -88.933  -0.669  1.00 109.66 ? 604 GLU A N     1 
ATOM   3871 C CA    . GLU D 4 402 ? 133.540 -89.953  0.380   1.00 110.21 ? 604 GLU A CA    1 
ATOM   3872 C C     . GLU D 4 402 ? 132.258 -90.755  0.644   1.00 110.17 ? 604 GLU A C     1 
ATOM   3873 O O     . GLU D 4 402 ? 132.337 -91.939  0.994   1.00 110.82 ? 604 GLU A O     1 
ATOM   3874 C CB    . GLU D 4 402 ? 134.061 -89.340  1.689   1.00 127.33 ? 604 GLU A CB    1 
ATOM   3875 C CG    . GLU D 4 402 ? 134.677 -90.359  2.664   1.00 128.65 ? 604 GLU A CG    1 
ATOM   3876 C CD    . GLU D 4 402 ? 135.259 -89.729  3.918   1.00 129.35 ? 604 GLU A CD    1 
ATOM   3877 O OE1   . GLU D 4 402 ? 136.009 -88.737  3.801   1.00 129.65 ? 604 GLU A OE1   1 
ATOM   3878 O OE2   . GLU D 4 402 ? 134.980 -90.242  5.024   1.00 129.43 ? 604 GLU A OE2   1 
ATOM   3879 N N     . LEU D 4 403 ? 131.094 -90.129  0.461   1.00 120.10 ? 605 LEU A N     1 
ATOM   3880 C CA    . LEU D 4 403 ? 129.798 -90.783  0.704   1.00 120.14 ? 605 LEU A CA    1 
ATOM   3881 C C     . LEU D 4 403 ? 129.352 -91.871  -0.277  1.00 120.33 ? 605 LEU A C     1 
ATOM   3882 O O     . LEU D 4 403 ? 128.379 -92.592  -0.010  1.00 119.84 ? 605 LEU A O     1 
ATOM   3883 C CB    . LEU D 4 403 ? 128.686 -89.741  0.848   1.00 137.08 ? 605 LEU A CB    1 
ATOM   3884 C CG    . LEU D 4 403 ? 128.241 -89.354  2.261   1.00 136.51 ? 605 LEU A CG    1 
ATOM   3885 C CD1   . LEU D 4 403 ? 127.262 -88.195  2.171   1.00 135.79 ? 605 LEU A CD1   1 
ATOM   3886 C CD2   . LEU D 4 403 ? 127.599 -90.544  2.976   1.00 135.96 ? 605 LEU A CD2   1 
ATOM   3887 N N     . THR D 4 404 ? 130.057 -91.986  -1.401  1.00 83.71  ? 606 THR A N     1 
ATOM   3888 C CA    . THR D 4 404 ? 129.742 -92.993  -2.410  1.00 84.80  ? 606 THR A CA    1 
ATOM   3889 C C     . THR D 4 404 ? 130.543 -94.263  -2.126  1.00 85.28  ? 606 THR A C     1 
ATOM   3890 O O     . THR D 4 404 ? 131.764 -94.212  -1.944  1.00 85.24  ? 606 THR A O     1 
ATOM   3891 C CB    . THR D 4 404 ? 130.069 -92.493  -3.840  1.00 154.61 ? 606 THR A CB    1 
ATOM   3892 O OG1   . THR D 4 404 ? 129.570 -91.161  -4.007  1.00 154.38 ? 606 THR A OG1   1 
ATOM   3893 C CG2   . THR D 4 404 ? 129.417 -93.396  -4.895  1.00 154.52 ? 606 THR A CG2   1 
ATOM   3894 N N     . ALA D 4 405 ? 129.840 -95.390  -2.053  1.00 158.43 ? 607 ALA A N     1 
ATOM   3895 C CA    . ALA D 4 405 ? 130.476 -96.679  -1.811  1.00 158.90 ? 607 ALA A CA    1 
ATOM   3896 C C     . ALA D 4 405 ? 130.992 -97.207  -3.157  1.00 159.19 ? 607 ALA A C     1 
ATOM   3897 O O     . ALA D 4 405 ? 130.265 -97.153  -4.155  1.00 158.78 ? 607 ALA A O     1 
ATOM   3898 C CB    . ALA D 4 405 ? 129.479 -97.653  -1.185  1.00 143.87 ? 607 ALA A CB    1 
ATOM   3899 N N     . PRO D 4 406 ? 132.283 -97.618  -3.226  1.00 122.07 ? 608 PRO A N     1 
ATOM   3900 C CA    . PRO D 4 406 ? 132.892 -98.145  -4.458  1.00 122.27 ? 608 PRO A CA    1 
ATOM   3901 C C     . PRO D 4 406 ? 132.201 -99.364  -5.091  1.00 122.17 ? 608 PRO A C     1 
ATOM   3902 O O     . PRO D 4 406 ? 131.715 -99.280  -6.224  1.00 121.64 ? 608 PRO A O     1 
ATOM   3903 C CB    . PRO D 4 406 ? 134.323 -98.451  -4.018  1.00 151.27 ? 608 PRO A CB    1 
ATOM   3904 C CG    . PRO D 4 406 ? 134.591 -97.363  -3.034  1.00 151.21 ? 608 PRO A CG    1 
ATOM   3905 C CD    . PRO D 4 406 ? 133.330 -97.401  -2.204  1.00 150.72 ? 608 PRO A CD    1 
ATOM   3906 N N     . ASP D 4 407 ? 132.113 -100.465 -4.342  1.00 127.66 ? 609 ASP A N     1 
ATOM   3907 C CA    . ASP D 4 407 ? 131.476 -101.692 -4.828  1.00 127.83 ? 609 ASP A CA    1 
ATOM   3908 C C     . ASP D 4 407 ? 129.962 -101.700 -4.600  1.00 128.01 ? 609 ASP A C     1 
ATOM   3909 O O     . ASP D 4 407 ? 129.384 -102.755 -4.328  1.00 128.28 ? 609 ASP A O     1 
ATOM   3910 N N     . GLU D 4 408 ? 129.333 -100.530 -4.755  1.00 168.30 ? 610 GLU A N     1 
ATOM   3911 C CA    . GLU D 4 408 ? 127.889 -100.344 -4.562  1.00 167.52 ? 610 GLU A CA    1 
ATOM   3912 C C     . GLU D 4 408 ? 127.011 -100.784 -5.732  1.00 167.13 ? 610 GLU A C     1 
ATOM   3913 O O     . GLU D 4 408 ? 127.510 -101.186 -6.789  1.00 167.11 ? 610 GLU A O     1 
ATOM   3914 C CB    . GLU D 4 408 ? 127.585 -98.888  -4.218  1.00 53.52  ? 610 GLU A CB    1 
ATOM   3915 N N     . ASN D 4 409 ? 125.698 -100.687 -5.516  1.00 96.71  ? 611 ASN A N     1 
ATOM   3916 C CA    . ASN D 4 409 ? 124.681 -101.050 -6.502  1.00 96.52  ? 611 ASN A CA    1 
ATOM   3917 C C     . ASN D 4 409 ? 124.033 -99.783  -7.072  1.00 96.53  ? 611 ASN A C     1 
ATOM   3918 O O     . ASN D 4 409 ? 124.672 -98.727  -7.099  1.00 96.30  ? 611 ASN A O     1 
ATOM   3919 C CB    . ASN D 4 409 ? 123.630 -101.973 -5.860  1.00 134.32 ? 611 ASN A CB    1 
ATOM   3920 N N     . ILE D 4 410 ? 122.772 -99.891  -7.506  1.00 158.04 ? 612 ILE A N     1 
ATOM   3921 C CA    . ILE D 4 410 ? 122.006 -98.785  -8.098  1.00 158.07 ? 612 ILE A CA    1 
ATOM   3922 C C     . ILE D 4 410 ? 121.802 -97.534  -7.218  1.00 157.70 ? 612 ILE A C     1 
ATOM   3923 O O     . ILE D 4 410 ? 122.694 -96.684  -7.147  1.00 157.28 ? 612 ILE A O     1 
ATOM   3924 N N     . PRO D 4 411 ? 120.619 -97.391  -6.568  1.00 118.83 ? 613 PRO A N     1 
ATOM   3925 C CA    . PRO D 4 411 ? 120.283 -96.253  -5.695  1.00 118.41 ? 613 PRO A CA    1 
ATOM   3926 C C     . PRO D 4 411 ? 121.112 -96.031  -4.422  1.00 117.89 ? 613 PRO A C     1 
ATOM   3927 O O     . PRO D 4 411 ? 120.868 -95.065  -3.693  1.00 117.36 ? 613 PRO A O     1 
ATOM   3928 C CB    . PRO D 4 411 ? 118.809 -96.499  -5.367  1.00 95.91  ? 613 PRO A CB    1 
ATOM   3929 C CG    . PRO D 4 411 ? 118.310 -97.154  -6.589  1.00 96.48  ? 613 PRO A CG    1 
ATOM   3930 C CD    . PRO D 4 411 ? 119.396 -98.168  -6.847  1.00 96.41  ? 613 PRO A CD    1 
ATOM   3931 N N     . ALA D 4 412 ? 122.109 -96.892  -4.186  1.00 86.52  ? 614 ALA A N     1 
ATOM   3932 C CA    . ALA D 4 412 ? 123.009 -96.806  -3.020  1.00 85.79  ? 614 ALA A CA    1 
ATOM   3933 C C     . ALA D 4 412 ? 124.036 -95.678  -3.186  1.00 85.32  ? 614 ALA A C     1 
ATOM   3934 O O     . ALA D 4 412 ? 124.900 -95.458  -2.321  1.00 85.10  ? 614 ALA A O     1 
ATOM   3935 C CB    . ALA D 4 412 ? 123.723 -98.143  -2.809  1.00 177.34 ? 614 ALA A CB    1 
ATOM   3936 N N     . LYS D 4 413 ? 123.932 -95.004  -4.332  1.00 110.86 ? 615 LYS A N     1 
ATOM   3937 C CA    . LYS D 4 413 ? 124.770 -93.879  -4.718  1.00 111.00 ? 615 LYS A CA    1 
ATOM   3938 C C     . LYS D 4 413 ? 123.886 -92.638  -4.831  1.00 110.48 ? 615 LYS A C     1 
ATOM   3939 O O     . LYS D 4 413 ? 124.327 -91.536  -4.524  1.00 110.34 ? 615 LYS A O     1 
ATOM   3940 N N     . ILE D 4 414 ? 122.632 -92.830  -5.254  1.00 93.86  ? 616 ILE A N     1 
ATOM   3941 C CA    . ILE D 4 414 ? 121.662 -91.732  -5.397  1.00 92.83  ? 616 ILE A CA    1 
ATOM   3942 C C     . ILE D 4 414 ? 121.102 -91.376  -4.013  1.00 92.05  ? 616 ILE A C     1 
ATOM   3943 O O     . ILE D 4 414 ? 120.572 -90.281  -3.794  1.00 92.58  ? 616 ILE A O     1 
ATOM   3944 C CB    . ILE D 4 414 ? 120.523 -92.093  -6.385  1.00 68.37  ? 616 ILE A CB    1 
ATOM   3945 C CG1   . ILE D 4 414 ? 121.121 -92.691  -7.662  1.00 69.02  ? 616 ILE A CG1   1 
ATOM   3946 C CG2   . ILE D 4 414 ? 119.731 -90.836  -6.773  1.00 68.22  ? 616 ILE A CG2   1 
ATOM   3947 C CD1   . ILE D 4 414 ? 120.118 -93.359  -8.573  1.00 69.82  ? 616 ILE A CD1   1 
ATOM   3948 N N     . LEU D 4 415 ? 121.273 -92.309  -3.077  1.00 144.60 ? 617 LEU A N     1 
ATOM   3949 C CA    . LEU D 4 415 ? 120.868 -92.130  -1.687  1.00 143.25 ? 617 LEU A CA    1 
ATOM   3950 C C     . LEU D 4 415 ? 121.968 -91.293  -1.022  1.00 141.71 ? 617 LEU A C     1 
ATOM   3951 O O     . LEU D 4 415 ? 121.764 -90.713  0.045   1.00 141.70 ? 617 LEU A O     1 
ATOM   3952 N N     . SER D 4 416 ? 123.127 -91.242  -1.684  1.00 106.49 ? 618 SER A N     1 
ATOM   3953 C CA    . SER D 4 416 ? 124.283 -90.475  -1.227  1.00 105.07 ? 618 SER A CA    1 
ATOM   3954 C C     . SER D 4 416 ? 124.276 -89.067  -1.845  1.00 103.94 ? 618 SER A C     1 
ATOM   3955 O O     . SER D 4 416 ? 124.855 -88.139  -1.272  1.00 104.06 ? 618 SER A O     1 
ATOM   3956 C CB    . SER D 4 416 ? 125.592 -91.205  -1.566  1.00 106.42 ? 618 SER A CB    1 
ATOM   3957 O OG    . SER D 4 416 ? 125.661 -92.484  -0.952  1.00 106.79 ? 618 SER A OG    1 
ATOM   3958 N N     . TYR D 4 417 ? 123.616 -88.913  -3.001  1.00 72.45  ? 619 TYR A N     1 
ATOM   3959 C CA    . TYR D 4 417 ? 123.504 -87.615  -3.689  1.00 71.45  ? 619 TYR A CA    1 
ATOM   3960 C C     . TYR D 4 417 ? 122.585 -86.721  -2.869  1.00 70.83  ? 619 TYR A C     1 
ATOM   3961 O O     . TYR D 4 417 ? 122.874 -85.542  -2.665  1.00 70.84  ? 619 TYR A O     1 
ATOM   3962 C CB    . TYR D 4 417 ? 122.942 -87.773  -5.125  1.00 132.05 ? 619 TYR A CB    1 
ATOM   3963 C CG    . TYR D 4 417 ? 122.447 -86.476  -5.778  1.00 133.42 ? 619 TYR A CG    1 
ATOM   3964 C CD1   . TYR D 4 417 ? 121.066 -86.256  -5.999  1.00 133.43 ? 619 TYR A CD1   1 
ATOM   3965 C CD2   . TYR D 4 417 ? 123.345 -85.431  -6.100  1.00 133.97 ? 619 TYR A CD2   1 
ATOM   3966 C CE1   . TYR D 4 417 ? 120.590 -85.016  -6.517  1.00 133.20 ? 619 TYR A CE1   1 
ATOM   3967 C CE2   . TYR D 4 417 ? 122.879 -84.191  -6.616  1.00 133.29 ? 619 TYR A CE2   1 
ATOM   3968 C CZ    . TYR D 4 417 ? 121.507 -83.994  -6.820  1.00 133.03 ? 619 TYR A CZ    1 
ATOM   3969 O OH    . TYR D 4 417 ? 121.063 -82.792  -7.319  1.00 132.62 ? 619 TYR A OH    1 
ATOM   3970 N N     . ASN D 4 418 ? 121.460 -87.295  -2.455  1.00 93.09  ? 620 ASN A N     1 
ATOM   3971 C CA    . ASN D 4 418 ? 120.470 -86.591  -1.657  1.00 93.80  ? 620 ASN A CA    1 
ATOM   3972 C C     . ASN D 4 418 ? 120.974 -86.340  -0.229  1.00 94.48  ? 620 ASN A C     1 
ATOM   3973 O O     . ASN D 4 418 ? 120.512 -85.414  0.451   1.00 94.01  ? 620 ASN A O     1 
ATOM   3974 C CB    . ASN D 4 418 ? 119.150 -87.363  -1.669  1.00 75.90  ? 620 ASN A CB    1 
ATOM   3975 C CG    . ASN D 4 418 ? 118.469 -87.322  -3.022  1.00 75.43  ? 620 ASN A CG    1 
ATOM   3976 O OD1   . ASN D 4 418 ? 117.846 -86.322  -3.391  1.00 75.08  ? 620 ASN A OD1   1 
ATOM   3977 N ND2   . ASN D 4 418 ? 118.591 -88.405  -3.773  1.00 75.58  ? 620 ASN A ND2   1 
ATOM   3978 N N     . ARG D 4 419 ? 121.968 -87.131  0.182   1.00 95.83  ? 621 ARG A N     1 
ATOM   3979 C CA    . ARG D 4 419 ? 122.596 -87.012  1.498   1.00 97.46  ? 621 ARG A CA    1 
ATOM   3980 C C     . ARG D 4 419 ? 123.529 -85.806  1.462   1.00 98.36  ? 621 ARG A C     1 
ATOM   3981 O O     . ARG D 4 419 ? 123.648 -85.059  2.435   1.00 98.46  ? 621 ARG A O     1 
ATOM   3982 N N     . ALA D 4 420 ? 124.150 -85.610  0.302   1.00 137.23 ? 622 ALA A N     1 
ATOM   3983 C CA    . ALA D 4 420 ? 125.054 -84.494  0.060   1.00 138.16 ? 622 ALA A CA    1 
ATOM   3984 C C     . ALA D 4 420 ? 124.208 -83.257  -0.236  1.00 139.08 ? 622 ALA A C     1 
ATOM   3985 O O     . ALA D 4 420 ? 124.608 -82.135  0.080   1.00 138.78 ? 622 ALA A O     1 
ATOM   3986 C CB    . ALA D 4 420 ? 125.958 -84.810  -1.110  1.00 109.28 ? 622 ALA A CB    1 
ATOM   3987 N N     . ASN D 4 421 ? 123.023 -83.490  -0.809  1.00 135.85 ? 623 ASN A N     1 
ATOM   3988 C CA    . ASN D 4 421 ? 122.058 -82.442  -1.150  1.00 137.93 ? 623 ASN A CA    1 
ATOM   3989 C C     . ASN D 4 421 ? 121.311 -81.984  0.104   1.00 139.26 ? 623 ASN A C     1 
ATOM   3990 O O     . ASN D 4 421 ? 120.653 -80.940  0.099   1.00 139.32 ? 623 ASN A O     1 
ATOM   3991 N N     . ARG D 4 422 ? 121.416 -82.788  1.165   1.00 90.39  ? 624 ARG A N     1 
ATOM   3992 C CA    . ARG D 4 422 ? 120.801 -82.501  2.459   1.00 92.44  ? 624 ARG A CA    1 
ATOM   3993 C C     . ARG D 4 422 ? 121.781 -81.692  3.314   1.00 92.76  ? 624 ARG A C     1 
ATOM   3994 O O     . ARG D 4 422 ? 121.372 -80.971  4.232   1.00 93.21  ? 624 ARG A O     1 
ATOM   3995 N N     . ALA D 4 423 ? 123.068 -81.790  2.967   1.00 101.79 ? 625 ALA A N     1 
ATOM   3996 C CA    . ALA D 4 423 ? 124.160 -81.095  3.656   1.00 102.41 ? 625 ALA A CA    1 
ATOM   3997 C C     . ALA D 4 423 ? 124.201 -79.581  3.351   1.00 103.18 ? 625 ALA A C     1 
ATOM   3998 O O     . ALA D 4 423 ? 125.043 -79.099  2.576   1.00 103.27 ? 625 ALA A O     1 
ATOM   3999 C CB    . ALA D 4 423 ? 125.510 -81.775  3.319   1.00 0.30   ? 625 ALA A CB    1 
ATOM   4000 N N     . VAL D 4 424 ? 123.264 -78.852  3.965   1.00 100.47 ? 626 VAL A N     1 
ATOM   4001 C CA    . VAL D 4 424 ? 123.132 -77.400  3.805   1.00 100.84 ? 626 VAL A CA    1 
ATOM   4002 C C     . VAL D 4 424 ? 123.873 -76.671  4.938   1.00 101.15 ? 626 VAL A C     1 
ATOM   4003 O O     . VAL D 4 424 ? 124.106 -77.230  6.012   1.00 101.03 ? 626 VAL A O     1 
ATOM   4004 C CB    . VAL D 4 424 ? 121.624 -76.957  3.782   1.00 137.17 ? 626 VAL A CB    1 
ATOM   4005 C CG1   . VAL D 4 424 ? 121.492 -75.479  3.389   1.00 137.94 ? 626 VAL A CG1   1 
ATOM   4006 C CG2   . VAL D 4 424 ? 120.815 -77.821  2.811   1.00 137.24 ? 626 VAL A CG2   1 
ATOM   4007 N N     . SER D 4 517 ? 116.965 -73.704  -2.364  1.00 76.06  ? 719 SER A N     1 
ATOM   4008 C CA    . SER D 4 517 ? 118.357 -73.870  -1.954  1.00 73.73  ? 719 SER A CA    1 
ATOM   4009 C C     . SER D 4 517 ? 119.079 -74.905  -2.823  1.00 72.47  ? 719 SER A C     1 
ATOM   4010 O O     . SER D 4 517 ? 120.310 -74.899  -2.920  1.00 71.72  ? 719 SER A O     1 
ATOM   4011 C CB    . SER D 4 517 ? 118.419 -74.267  -0.475  1.00 114.20 ? 719 SER A CB    1 
ATOM   4012 O OG    . SER D 4 517 ? 117.729 -73.322  0.330   1.00 113.79 ? 719 SER A OG    1 
ATOM   4013 N N     . LYS D 4 518 ? 118.294 -75.769  -3.468  1.00 106.11 ? 720 LYS A N     1 
ATOM   4014 C CA    . LYS D 4 518 ? 118.794 -76.828  -4.350  1.00 104.98 ? 720 LYS A CA    1 
ATOM   4015 C C     . LYS D 4 518 ? 119.091 -76.288  -5.750  1.00 103.95 ? 720 LYS A C     1 
ATOM   4016 O O     . LYS D 4 518 ? 120.213 -76.403  -6.249  1.00 103.86 ? 720 LYS A O     1 
ATOM   4017 C CB    . LYS D 4 518 ? 117.746 -77.968  -4.438  1.00 110.65 ? 720 LYS A CB    1 
ATOM   4018 C CG    . LYS D 4 518 ? 117.929 -79.034  -5.575  1.00 110.06 ? 720 LYS A CG    1 
ATOM   4019 C CD    . LYS D 4 518 ? 116.648 -79.868  -5.777  1.00 109.23 ? 720 LYS A CD    1 
ATOM   4020 C CE    . LYS D 4 518 ? 116.557 -80.514  -7.164  1.00 108.55 ? 720 LYS A CE    1 
ATOM   4021 N NZ    . LYS D 4 518 ? 117.470 -81.668  -7.350  1.00 107.91 ? 720 LYS A NZ    1 
ATOM   4022 N N     . LEU D 4 519 ? 118.064 -75.686  -6.348  1.00 135.00 ? 721 LEU A N     1 
ATOM   4023 C CA    . LEU D 4 519 ? 118.086 -75.136  -7.704  1.00 133.53 ? 721 LEU A CA    1 
ATOM   4024 C C     . LEU D 4 519 ? 119.237 -74.190  -8.054  1.00 131.66 ? 721 LEU A C     1 
ATOM   4025 O O     . LEU D 4 519 ? 119.889 -74.354  -9.088  1.00 131.57 ? 721 LEU A O     1 
ATOM   4026 C CB    . LEU D 4 519 ? 116.735 -74.467  -7.989  1.00 198.72 ? 721 LEU A CB    1 
ATOM   4027 C CG    . LEU D 4 519 ? 116.071 -74.621  -9.364  1.00 198.72 ? 721 LEU A CG    1 
ATOM   4028 C CD1   . LEU D 4 519 ? 115.826 -76.094  -9.709  1.00 198.72 ? 721 LEU A CD1   1 
ATOM   4029 C CD2   . LEU D 4 519 ? 114.751 -73.857  -9.359  1.00 198.72 ? 721 LEU A CD2   1 
ATOM   4030 N N     . ASN D 4 520 ? 119.501 -73.231  -7.172  1.00 55.32  ? 722 ASN A N     1 
ATOM   4031 C CA    . ASN D 4 520 ? 120.569 -72.257  -7.379  1.00 52.44  ? 722 ASN A CA    1 
ATOM   4032 C C     . ASN D 4 520 ? 121.773 -72.664  -6.547  1.00 50.37  ? 722 ASN A C     1 
ATOM   4033 O O     . ASN D 4 520 ? 121.756 -73.722  -5.895  1.00 49.40  ? 722 ASN A O     1 
ATOM   4034 C CB    . ASN D 4 520 ? 120.096 -70.866  -6.947  1.00 102.92 ? 722 ASN A CB    1 
ATOM   4035 C CG    . ASN D 4 520 ? 118.850 -70.425  -7.677  1.00 103.04 ? 722 ASN A CG    1 
ATOM   4036 O OD1   . ASN D 4 520 ? 118.917 -69.951  -8.811  1.00 103.29 ? 722 ASN A OD1   1 
ATOM   4037 N ND2   . ASN D 4 520 ? 117.700 -70.590  -7.036  1.00 102.66 ? 722 ASN A ND2   1 
HETATM 4038 N N     . PTR D 4 521 ? 122.792 -71.798  -6.556  1.00 108.48 ? 723 PTR A N     1 
HETATM 4039 C CA    . PTR D 4 521 ? 124.052 -71.938  -5.806  1.00 106.83 ? 723 PTR A CA    1 
HETATM 4040 C C     . PTR D 4 521 ? 124.995 -73.105  -6.133  1.00 106.25 ? 723 PTR A C     1 
HETATM 4041 O O     . PTR D 4 521 ? 126.213 -72.933  -6.120  1.00 105.74 ? 723 PTR A O     1 
HETATM 4042 C CB    . PTR D 4 521 ? 123.811 -71.878  -4.280  1.00 106.20 ? 723 PTR A CB    1 
HETATM 4043 C CG    . PTR D 4 521 ? 122.890 -70.764  -3.817  1.00 106.31 ? 723 PTR A CG    1 
HETATM 4044 C CD1   . PTR D 4 521 ? 121.553 -71.039  -3.473  1.00 106.84 ? 723 PTR A CD1   1 
HETATM 4045 C CD2   . PTR D 4 521 ? 123.335 -69.429  -3.750  1.00 106.41 ? 723 PTR A CD2   1 
HETATM 4046 C CE1   . PTR D 4 521 ? 120.657 -69.997  -3.130  1.00 107.49 ? 723 PTR A CE1   1 
HETATM 4047 C CE2   . PTR D 4 521 ? 122.465 -68.385  -3.348  1.00 106.82 ? 723 PTR A CE2   1 
HETATM 4048 C CZ    . PTR D 4 521 ? 121.136 -68.680  -3.011  1.00 107.31 ? 723 PTR A CZ    1 
HETATM 4049 O OH    . PTR D 4 521 ? 120.322 -67.617  -2.703  1.00 107.52 ? 723 PTR A OH    1 
HETATM 4050 P P     . PTR D 4 521 ? 118.740 -67.706  -2.563  1.00 108.17 ? 723 PTR A P     1 
HETATM 4051 O O1P   . PTR D 4 521 ? 118.212 -69.017  -2.089  1.00 108.60 ? 723 PTR A O1P   1 
HETATM 4052 O O2P   . PTR D 4 521 ? 118.253 -66.478  -1.898  1.00 108.27 ? 723 PTR A O2P   1 
HETATM 4053 O O3P   . PTR D 4 521 ? 118.223 -67.537  -4.062  1.00 107.18 ? 723 PTR A O3P   1 
ATOM   4054 N N     . LEU D 4 522 ? 124.439 -74.284  -6.406  1.00 50.61  ? 724 LEU A N     1 
ATOM   4055 C CA    . LEU D 4 522 ? 125.222 -75.485  -6.720  1.00 51.32  ? 724 LEU A CA    1 
ATOM   4056 C C     . LEU D 4 522 ? 125.648 -75.516  -8.175  1.00 50.92  ? 724 LEU A C     1 
ATOM   4057 O O     . LEU D 4 522 ? 124.843 -75.223  -9.054  1.00 51.37  ? 724 LEU A O     1 
ATOM   4058 C CB    . LEU D 4 522 ? 124.399 -76.742  -6.430  1.00 69.04  ? 724 LEU A CB    1 
ATOM   4059 C CG    . LEU D 4 522 ? 123.797 -76.913  -5.034  1.00 70.25  ? 724 LEU A CG    1 
ATOM   4060 C CD1   . LEU D 4 522 ? 122.773 -78.038  -5.035  1.00 71.77  ? 724 LEU A CD1   1 
ATOM   4061 C CD2   . LEU D 4 522 ? 124.893 -77.177  -4.019  1.00 69.74  ? 724 LEU A CD2   1 
ATOM   4062 N N     . ASP D 4 523 ? 126.907 -75.875  -8.425  1.00 38.19  ? 725 ASP A N     1 
ATOM   4063 C CA    . ASP D 4 523 ? 127.435 -75.967  -9.794  1.00 37.60  ? 725 ASP A CA    1 
ATOM   4064 C C     . ASP D 4 523 ? 127.069 -77.314  -10.391 1.00 38.03  ? 725 ASP A C     1 
ATOM   4065 O O     . ASP D 4 523 ? 127.551 -78.351  -9.934  1.00 38.74  ? 725 ASP A O     1 
ATOM   4066 C CB    . ASP D 4 523 ? 128.965 -75.776  -9.847  1.00 31.69  ? 725 ASP A CB    1 
ATOM   4067 C CG    . ASP D 4 523 ? 129.510 -75.706  -11.277 1.00 32.63  ? 725 ASP A CG    1 
ATOM   4068 O OD1   . ASP D 4 523 ? 129.103 -76.520  -12.117 1.00 33.74  ? 725 ASP A OD1   1 
ATOM   4069 O OD2   . ASP D 4 523 ? 130.347 -74.833  -11.566 1.00 33.11  ? 725 ASP A OD2   1 
ATOM   4070 N N     . PRO D 4 524 ? 126.305 -77.304  -11.495 1.00 35.54  ? 726 PRO A N     1 
ATOM   4071 C CA    . PRO D 4 524 ? 125.908 -78.555  -12.128 1.00 36.60  ? 726 PRO A CA    1 
ATOM   4072 C C     . PRO D 4 524 ? 127.070 -79.398  -12.628 1.00 37.20  ? 726 PRO A C     1 
ATOM   4073 O O     . PRO D 4 524 ? 126.972 -80.615  -12.642 1.00 37.42  ? 726 PRO A O     1 
ATOM   4074 C CB    . PRO D 4 524 ? 124.975 -78.092  -13.243 1.00 53.80  ? 726 PRO A CB    1 
ATOM   4075 C CG    . PRO D 4 524 ? 125.444 -76.726  -13.539 1.00 53.22  ? 726 PRO A CG    1 
ATOM   4076 C CD    . PRO D 4 524 ? 125.686 -76.165  -12.192 1.00 52.51  ? 726 PRO A CD    1 
ATOM   4077 N N     . ARG D 4 525 ? 128.208 -78.772  -12.905 1.00 25.08  ? 727 ARG A N     1 
ATOM   4078 C CA    . ARG D 4 525 ? 129.359 -79.529  -13.379 1.00 28.18  ? 727 ARG A CA    1 
ATOM   4079 C C     . ARG D 4 525 ? 129.984 -80.455  -12.341 1.00 30.84  ? 727 ARG A C     1 
ATOM   4080 O O     . ARG D 4 525 ? 130.741 -81.334  -12.717 1.00 32.02  ? 727 ARG A O     1 
ATOM   4081 C CB    . ARG D 4 525 ? 130.424 -78.621  -13.966 1.00 44.71  ? 727 ARG A CB    1 
ATOM   4082 C CG    . ARG D 4 525 ? 130.127 -78.091  -15.328 1.00 44.10  ? 727 ARG A CG    1 
ATOM   4083 C CD    . ARG D 4 525 ? 131.224 -77.162  -15.747 1.00 44.39  ? 727 ARG A CD    1 
ATOM   4084 N NE    . ARG D 4 525 ? 131.253 -75.978  -14.901 1.00 44.66  ? 727 ARG A NE    1 
ATOM   4085 C CZ    . ARG D 4 525 ? 132.204 -75.053  -14.938 1.00 45.93  ? 727 ARG A CZ    1 
ATOM   4086 N NH1   . ARG D 4 525 ? 133.226 -75.165  -15.781 1.00 47.43  ? 727 ARG A NH1   1 
ATOM   4087 N NH2   . ARG D 4 525 ? 132.132 -74.011  -14.124 1.00 45.79  ? 727 ARG A NH2   1 
ATOM   4088 N N     . ILE D 4 526 ? 129.685 -80.254  -11.053 1.00 37.65  ? 728 ILE A N     1 
ATOM   4089 C CA    . ILE D 4 526 ? 130.206 -81.130  -9.986  1.00 41.24  ? 728 ILE A CA    1 
ATOM   4090 C C     . ILE D 4 526 ? 129.306 -82.352  -9.968  1.00 44.17  ? 728 ILE A C     1 
ATOM   4091 O O     . ILE D 4 526 ? 129.776 -83.481  -9.797  1.00 45.14  ? 728 ILE A O     1 
ATOM   4092 C CB    . ILE D 4 526 ? 130.127 -80.500  -8.569  1.00 29.65  ? 728 ILE A CB    1 
ATOM   4093 C CG1   . ILE D 4 526 ? 130.917 -79.196  -8.522  1.00 30.82  ? 728 ILE A CG1   1 
ATOM   4094 C CG2   . ILE D 4 526 ? 130.698 -81.479  -7.511  1.00 29.16  ? 728 ILE A CG2   1 
ATOM   4095 C CD1   . ILE D 4 526 ? 130.742 -78.423  -7.232  1.00 30.65  ? 728 ILE A CD1   1 
ATOM   4096 N N     . THR D 4 527 ? 128.010 -82.090  -10.139 1.00 47.21  ? 729 THR A N     1 
ATOM   4097 C CA    . THR D 4 527 ? 126.973 -83.111  -10.157 1.00 50.23  ? 729 THR A CA    1 
ATOM   4098 C C     . THR D 4 527 ? 127.139 -83.991  -11.396 1.00 52.09  ? 729 THR A C     1 
ATOM   4099 O O     . THR D 4 527 ? 126.911 -85.193  -11.332 1.00 53.60  ? 729 THR A O     1 
ATOM   4100 C CB    . THR D 4 527 ? 125.566 -82.468  -10.126 1.00 73.02  ? 729 THR A CB    1 
ATOM   4101 O OG1   . THR D 4 527 ? 125.543 -81.416  -9.151  1.00 74.56  ? 729 THR A OG1   1 
ATOM   4102 C CG2   . THR D 4 527 ? 124.501 -83.499  -9.760  1.00 73.48  ? 729 THR A CG2   1 
ATOM   4103 N N     . VAL D 4 528 ? 127.622 -83.403  -12.490 1.00 56.14  ? 730 VAL A N     1 
ATOM   4104 C CA    . VAL D 4 528 ? 127.838 -84.143  -13.735 1.00 57.98  ? 730 VAL A CA    1 
ATOM   4105 C C     . VAL D 4 528 ? 129.217 -84.830  -13.737 1.00 59.97  ? 730 VAL A C     1 
ATOM   4106 O O     . VAL D 4 528 ? 129.378 -85.892  -14.347 1.00 60.39  ? 730 VAL A O     1 
ATOM   4107 C CB    . VAL D 4 528 ? 127.627 -83.231  -14.990 1.00 46.08  ? 730 VAL A CB    1 
ATOM   4108 C CG1   . VAL D 4 528 ? 127.835 -84.010  -16.291 1.00 47.14  ? 730 VAL A CG1   1 
ATOM   4109 C CG2   . VAL D 4 528 ? 126.217 -82.648  -14.987 1.00 47.79  ? 730 VAL A CG2   1 
ATOM   4110 N N     . ALA D 4 529 ? 130.176 -84.266  -12.995 1.00 103.60 ? 731 ALA A N     1 
ATOM   4111 C CA    . ALA D 4 529 ? 131.538 -84.817  -12.878 1.00 105.59 ? 731 ALA A CA    1 
ATOM   4112 C C     . ALA D 4 529 ? 131.527 -86.159  -12.165 1.00 106.82 ? 731 ALA A C     1 
ATOM   4113 O O     . ALA D 4 529 ? 132.345 -87.042  -12.434 1.00 107.45 ? 731 ALA A O     1 
ATOM   4114 C CB    . ALA D 4 529 ? 132.408 -83.872  -12.107 1.00 123.04 ? 731 ALA A CB    1 
ATOM   4115 N N     . TRP D 4 530 ? 130.562 -86.261  -11.257 1.00 56.53  ? 732 TRP A N     1 
ATOM   4116 C CA    . TRP D 4 530 ? 130.280 -87.406  -10.408 1.00 57.66  ? 732 TRP A CA    1 
ATOM   4117 C C     . TRP D 4 530 ? 129.488 -88.478  -11.181 1.00 58.11  ? 732 TRP A C     1 
ATOM   4118 O O     . TRP D 4 530 ? 129.613 -89.679  -10.907 1.00 58.09  ? 732 TRP A O     1 
ATOM   4119 C CB    . TRP D 4 530 ? 129.484 -86.868  -9.212  1.00 60.93  ? 732 TRP A CB    1 
ATOM   4120 C CG    . TRP D 4 530 ? 129.078 -87.844  -8.182  1.00 61.16  ? 732 TRP A CG    1 
ATOM   4121 C CD1   . TRP D 4 530 ? 129.830 -88.300  -7.143  1.00 61.74  ? 732 TRP A CD1   1 
ATOM   4122 C CD2   . TRP D 4 530 ? 127.802 -88.473  -8.070  1.00 61.23  ? 732 TRP A CD2   1 
ATOM   4123 N NE1   . TRP D 4 530 ? 129.103 -89.182  -6.381  1.00 62.12  ? 732 TRP A NE1   1 
ATOM   4124 C CE2   . TRP D 4 530 ? 127.853 -89.309  -6.924  1.00 62.04  ? 732 TRP A CE2   1 
ATOM   4125 C CE3   . TRP D 4 530 ? 126.613 -88.414  -8.825  1.00 60.80  ? 732 TRP A CE3   1 
ATOM   4126 C CZ2   . TRP D 4 530 ? 126.755 -90.091  -6.512  1.00 61.95  ? 732 TRP A CZ2   1 
ATOM   4127 C CZ3   . TRP D 4 530 ? 125.513 -89.192  -8.418  1.00 61.03  ? 732 TRP A CZ3   1 
ATOM   4128 C CH2   . TRP D 4 530 ? 125.596 -90.020  -7.266  1.00 61.53  ? 732 TRP A CH2   1 
ATOM   4129 N N     . CYS D 4 531 ? 128.679 -88.026  -12.139 1.00 60.16  ? 733 CYS A N     1 
ATOM   4130 C CA    . CYS D 4 531 ? 127.846 -88.896  -12.973 1.00 61.97  ? 733 CYS A CA    1 
ATOM   4131 C C     . CYS D 4 531 ? 128.580 -89.633  -14.086 1.00 62.11  ? 733 CYS A C     1 
ATOM   4132 O O     . CYS D 4 531 ? 127.960 -90.372  -14.849 1.00 61.56  ? 733 CYS A O     1 
ATOM   4133 C CB    . CYS D 4 531 ? 126.694 -88.104  -13.588 1.00 114.55 ? 733 CYS A CB    1 
ATOM   4134 S SG    . CYS D 4 531 ? 125.293 -87.868  -12.504 1.00 117.49 ? 733 CYS A SG    1 
ATOM   4135 N N     . LYS D 4 532 ? 129.871 -89.355  -14.238 1.00 75.70  ? 734 LYS A N     1 
ATOM   4136 C CA    . LYS D 4 532 ? 130.698 -90.007  -15.247 1.00 76.18  ? 734 LYS A CA    1 
ATOM   4137 C C     . LYS D 4 532 ? 131.891 -90.651  -14.567 1.00 76.58  ? 734 LYS A C     1 
ATOM   4138 O O     . LYS D 4 532 ? 132.546 -91.520  -15.144 1.00 76.93  ? 734 LYS A O     1 
ATOM   4139 C CB    . LYS D 4 532 ? 131.153 -89.022  -16.326 1.00 196.71 ? 734 LYS A CB    1 
ATOM   4140 C CG    . LYS D 4 532 ? 130.053 -88.610  -17.289 1.00 196.42 ? 734 LYS A CG    1 
ATOM   4141 C CD    . LYS D 4 532 ? 130.602 -87.899  -18.507 1.00 197.39 ? 734 LYS A CD    1 
ATOM   4142 C CE    . LYS D 4 532 ? 129.480 -87.570  -19.481 1.00 197.89 ? 734 LYS A CE    1 
ATOM   4143 N NZ    . LYS D 4 532 ? 129.980 -87.068  -20.794 1.00 198.03 ? 734 LYS A NZ    1 
ATOM   4144 N N     . LYS D 4 533 ? 132.180 -90.204  -13.341 1.00 73.55  ? 735 LYS A N     1 
ATOM   4145 C CA    . LYS D 4 533 ? 133.267 -90.762  -12.537 1.00 73.89  ? 735 LYS A CA    1 
ATOM   4146 C C     . LYS D 4 533 ? 132.742 -92.088  -12.021 1.00 74.84  ? 735 LYS A C     1 
ATOM   4147 O O     . LYS D 4 533 ? 133.509 -93.028  -11.817 1.00 75.51  ? 735 LYS A O     1 
ATOM   4148 C CB    . LYS D 4 533 ? 133.617 -89.846  -11.378 1.00 71.56  ? 735 LYS A CB    1 
ATOM   4149 N N     . TRP D 4 534 ? 131.420 -92.146  -11.836 1.00 118.57 ? 736 TRP A N     1 
ATOM   4150 C CA    . TRP D 4 534 ? 130.737 -93.352  -11.383 1.00 119.70 ? 736 TRP A CA    1 
ATOM   4151 C C     . TRP D 4 534 ? 129.814 -93.907  -12.462 1.00 121.02 ? 736 TRP A C     1 
ATOM   4152 O O     . TRP D 4 534 ? 129.754 -95.123  -12.646 1.00 121.97 ? 736 TRP A O     1 
ATOM   4153 C CB    . TRP D 4 534 ? 130.001 -93.123  -10.055 1.00 122.79 ? 736 TRP A CB    1 
ATOM   4154 C CG    . TRP D 4 534 ? 130.952 -92.767  -8.939  1.00 121.62 ? 736 TRP A CG    1 
ATOM   4155 C CD1   . TRP D 4 534 ? 131.231 -91.510  -8.484  1.00 121.34 ? 736 TRP A CD1   1 
ATOM   4156 C CD2   . TRP D 4 534 ? 131.845 -93.653  -8.238  1.00 121.11 ? 736 TRP A CD2   1 
ATOM   4157 N NE1   . TRP D 4 534 ? 132.250 -91.545  -7.565  1.00 121.47 ? 736 TRP A NE1   1 
ATOM   4158 C CE2   . TRP D 4 534 ? 132.650 -92.844  -7.389  1.00 121.18 ? 736 TRP A CE2   1 
ATOM   4159 C CE3   . TRP D 4 534 ? 132.055 -95.053  -8.249  1.00 121.23 ? 736 TRP A CE3   1 
ATOM   4160 C CZ2   . TRP D 4 534 ? 133.662 -93.385  -6.551  1.00 121.30 ? 736 TRP A CZ2   1 
ATOM   4161 C CZ3   . TRP D 4 534 ? 133.068 -95.601  -7.413  1.00 121.81 ? 736 TRP A CZ3   1 
ATOM   4162 C CH2   . TRP D 4 534 ? 133.856 -94.758  -6.577  1.00 121.94 ? 736 TRP A CH2   1 
ATOM   4163 N N     . GLY D 4 535 ? 129.123 -93.023  -13.185 1.00 120.43 ? 737 GLY A N     1 
ATOM   4164 C CA    . GLY D 4 535 ? 128.245 -93.453  -14.269 1.00 121.78 ? 737 GLY A CA    1 
ATOM   4165 C C     . GLY D 4 535 ? 126.747 -93.542  -14.024 1.00 122.56 ? 737 GLY A C     1 
ATOM   4166 O O     . GLY D 4 535 ? 126.155 -94.595  -14.265 1.00 122.81 ? 737 GLY A O     1 
ATOM   4167 N N     . VAL D 4 536 ? 126.123 -92.439  -13.603 1.00 139.27 ? 738 VAL A N     1 
ATOM   4168 C CA    . VAL D 4 536 ? 124.675 -92.399  -13.326 1.00 138.78 ? 738 VAL A CA    1 
ATOM   4169 C C     . VAL D 4 536 ? 123.943 -91.535  -14.378 1.00 139.22 ? 738 VAL A C     1 
ATOM   4170 O O     . VAL D 4 536 ? 124.373 -90.408  -14.650 1.00 139.26 ? 738 VAL A O     1 
ATOM   4171 C CB    . VAL D 4 536 ? 124.379 -91.824  -11.885 1.00 93.20  ? 738 VAL A CB    1 
ATOM   4172 C CG1   . VAL D 4 536 ? 122.900 -91.997  -11.512 1.00 92.91  ? 738 VAL A CG1   1 
ATOM   4173 C CG2   . VAL D 4 536 ? 125.253 -92.498  -10.834 1.00 93.08  ? 738 VAL A CG2   1 
ATOM   4174 N N     . PRO D 4 537 ? 122.853 -92.061  -15.004 1.00 151.11 ? 739 PRO A N     1 
ATOM   4175 C CA    . PRO D 4 537 ? 122.096 -91.300  -16.010 1.00 151.57 ? 739 PRO A CA    1 
ATOM   4176 C C     . PRO D 4 537 ? 121.453 -90.025  -15.465 1.00 151.20 ? 739 PRO A C     1 
ATOM   4177 O O     . PRO D 4 537 ? 120.801 -90.034  -14.416 1.00 151.12 ? 739 PRO A O     1 
ATOM   4178 C CB    . PRO D 4 537 ? 121.036 -92.300  -16.468 1.00 80.60  ? 739 PRO A CB    1 
ATOM   4179 C CG    . PRO D 4 537 ? 121.750 -93.578  -16.383 1.00 80.40  ? 739 PRO A CG    1 
ATOM   4180 C CD    . PRO D 4 537 ? 122.419 -93.473  -15.031 1.00 80.03  ? 739 PRO A CD    1 
ATOM   4181 N N     . ILE D 4 538 ? 121.685 -88.934  -16.189 1.00 76.10  ? 740 ILE A N     1 
ATOM   4182 C CA    . ILE D 4 538 ? 121.176 -87.599  -15.862 1.00 76.82  ? 740 ILE A CA    1 
ATOM   4183 C C     . ILE D 4 538 ? 119.646 -87.470  -15.798 1.00 77.12  ? 740 ILE A C     1 
ATOM   4184 O O     . ILE D 4 538 ? 119.114 -86.720  -14.973 1.00 77.08  ? 740 ILE A O     1 
ATOM   4185 C CB    . ILE D 4 538 ? 121.745 -86.512  -16.832 1.00 105.25 ? 740 ILE A CB    1 
ATOM   4186 C CG1   . ILE D 4 538 ? 122.486 -87.130  -18.040 1.00 105.41 ? 740 ILE A CG1   1 
ATOM   4187 C CG2   . ILE D 4 538 ? 122.669 -85.585  -16.063 1.00 105.55 ? 740 ILE A CG2   1 
ATOM   4188 C CD1   . ILE D 4 538 ? 121.593 -87.709  -19.150 1.00 105.27 ? 740 ILE A CD1   1 
ATOM   4189 N N     . GLU D 4 539 ? 118.960 -88.269  -16.620 1.00 135.38 ? 741 GLU A N     1 
ATOM   4190 C CA    . GLU D 4 539 ? 117.495 -88.302  -16.709 1.00 135.24 ? 741 GLU A CA    1 
ATOM   4191 C C     . GLU D 4 539 ? 116.831 -88.753  -15.409 1.00 134.77 ? 741 GLU A C     1 
ATOM   4192 O O     . GLU D 4 539 ? 115.641 -88.501  -15.185 1.00 135.18 ? 741 GLU A O     1 
ATOM   4193 C CB    . GLU D 4 539 ? 117.072 -89.216  -17.848 1.00 43.53  ? 741 GLU A CB    1 
ATOM   4194 N N     . LYS D 4 540 ? 117.634 -89.386  -14.553 1.00 69.63  ? 742 LYS A N     1 
ATOM   4195 C CA    . LYS D 4 540 ? 117.195 -89.899  -13.261 1.00 68.98  ? 742 LYS A CA    1 
ATOM   4196 C C     . LYS D 4 540 ? 117.104 -88.811  -12.188 1.00 68.66  ? 742 LYS A C     1 
ATOM   4197 O O     . LYS D 4 540 ? 116.207 -88.852  -11.338 1.00 68.27  ? 742 LYS A O     1 
ATOM   4198 C CB    . LYS D 4 540 ? 118.120 -91.020  -12.810 1.00 29.52  ? 742 LYS A CB    1 
ATOM   4199 N N     . ILE D 4 541 ? 118.011 -87.833  -12.258 1.00 197.16 ? 743 ILE A N     1 
ATOM   4200 C CA    . ILE D 4 541 ? 118.072 -86.710  -11.311 1.00 197.49 ? 743 ILE A CA    1 
ATOM   4201 C C     . ILE D 4 541 ? 117.293 -85.509  -11.863 1.00 197.72 ? 743 ILE A C     1 
ATOM   4202 O O     . ILE D 4 541 ? 116.269 -85.100  -11.303 1.00 198.17 ? 743 ILE A O     1 
ATOM   4203 C CB    . ILE D 4 541 ? 119.572 -86.288  -11.005 1.00 69.79  ? 743 ILE A CB    1 
ATOM   4204 C CG1   . ILE D 4 541 ? 120.322 -87.407  -10.269 1.00 69.84  ? 743 ILE A CG1   1 
ATOM   4205 C CG2   . ILE D 4 541 ? 119.639 -85.028  -10.136 1.00 69.15  ? 743 ILE A CG2   1 
ATOM   4206 C CD1   . ILE D 4 541 ? 120.897 -88.484  -11.165 1.00 69.54  ? 743 ILE A CD1   1 
ATOM   4207 N N     . TYR D 4 542 ? 117.806 -84.959  -12.962 1.00 79.71  ? 744 TYR A N     1 
ATOM   4208 C CA    . TYR D 4 542 ? 117.227 -83.800  -13.629 1.00 79.32  ? 744 TYR A CA    1 
ATOM   4209 C C     . TYR D 4 542 ? 116.286 -84.192  -14.751 1.00 78.47  ? 744 TYR A C     1 
ATOM   4210 O O     . TYR D 4 542 ? 116.686 -84.886  -15.691 1.00 78.62  ? 744 TYR A O     1 
ATOM   4211 C CB    . TYR D 4 542 ? 118.347 -82.917  -14.184 1.00 119.18 ? 744 TYR A CB    1 
ATOM   4212 C CG    . TYR D 4 542 ? 119.323 -82.418  -13.142 1.00 120.22 ? 744 TYR A CG    1 
ATOM   4213 C CD1   . TYR D 4 542 ? 120.710 -82.566  -13.331 1.00 120.90 ? 744 TYR A CD1   1 
ATOM   4214 C CD2   . TYR D 4 542 ? 118.871 -81.811  -11.948 1.00 120.57 ? 744 TYR A CD2   1 
ATOM   4215 C CE1   . TYR D 4 542 ? 121.635 -82.123  -12.352 1.00 122.02 ? 744 TYR A CE1   1 
ATOM   4216 C CE2   . TYR D 4 542 ? 119.784 -81.365  -10.960 1.00 121.53 ? 744 TYR A CE2   1 
ATOM   4217 C CZ    . TYR D 4 542 ? 121.161 -81.527  -11.173 1.00 122.04 ? 744 TYR A CZ    1 
ATOM   4218 O OH    . TYR D 4 542 ? 122.051 -81.102  -10.216 1.00 122.14 ? 744 TYR A OH    1 
ATOM   4219 N N     . ASN D 4 543 ? 115.049 -83.699  -14.673 1.00 58.65  ? 745 ASN A N     1 
ATOM   4220 C CA    . ASN D 4 543 ? 114.013 -83.982  -15.676 1.00 57.42  ? 745 ASN A CA    1 
ATOM   4221 C C     . ASN D 4 543 ? 114.267 -83.235  -16.989 1.00 57.04  ? 745 ASN A C     1 
ATOM   4222 O O     . ASN D 4 543 ? 115.330 -82.652  -17.166 1.00 56.64  ? 745 ASN A O     1 
ATOM   4223 C CB    . ASN D 4 543 ? 112.621 -83.641  -15.119 1.00 64.88  ? 745 ASN A CB    1 
ATOM   4224 C CG    . ASN D 4 543 ? 112.515 -82.205  -14.630 1.00 64.23  ? 745 ASN A CG    1 
ATOM   4225 O OD1   . ASN D 4 543 ? 112.398 -81.272  -15.421 1.00 64.14  ? 745 ASN A OD1   1 
ATOM   4226 N ND2   . ASN D 4 543 ? 112.559 -82.026  -13.318 1.00 63.31  ? 745 ASN A ND2   1 
ATOM   4227 N N     . LYS D 4 544 ? 113.274 -83.231  -17.879 1.00 49.27  ? 746 LYS A N     1 
ATOM   4228 C CA    . LYS D 4 544 ? 113.357 -82.550  -19.178 1.00 49.59  ? 746 LYS A CA    1 
ATOM   4229 C C     . LYS D 4 544 ? 113.589 -81.038  -19.064 1.00 49.69  ? 746 LYS A C     1 
ATOM   4230 O O     . LYS D 4 544 ? 114.420 -80.481  -19.787 1.00 49.12  ? 746 LYS A O     1 
ATOM   4231 N N     . THR D 4 545 ? 112.896 -80.406  -18.113 1.00 60.34  ? 747 THR A N     1 
ATOM   4232 C CA    . THR D 4 545 ? 113.001 -78.967  -17.867 1.00 61.68  ? 747 THR A CA    1 
ATOM   4233 C C     . THR D 4 545 ? 114.363 -78.589  -17.285 1.00 61.37  ? 747 THR A C     1 
ATOM   4234 O O     . THR D 4 545 ? 114.987 -77.624  -17.731 1.00 60.70  ? 747 THR A O     1 
ATOM   4235 N N     . GLN D 4 546 ? 114.832 -79.389  -16.327 1.00 35.18  ? 748 GLN A N     1 
ATOM   4236 C CA    . GLN D 4 546 ? 116.123 -79.171  -15.680 1.00 35.14  ? 748 GLN A CA    1 
ATOM   4237 C C     . GLN D 4 546 ? 117.295 -79.556  -16.592 1.00 35.50  ? 748 GLN A C     1 
ATOM   4238 O O     . GLN D 4 546 ? 118.361 -78.938  -16.526 1.00 35.00  ? 748 GLN A O     1 
ATOM   4239 C CB    . GLN D 4 546 ? 116.210 -79.958  -14.385 1.00 76.42  ? 748 GLN A CB    1 
ATOM   4240 C CG    . GLN D 4 546 ? 115.217 -79.595  -13.324 1.00 76.62  ? 748 GLN A CG    1 
ATOM   4241 C CD    . GLN D 4 546 ? 115.406 -80.435  -12.081 1.00 77.12  ? 748 GLN A CD    1 
ATOM   4242 O OE1   . GLN D 4 546 ? 114.802 -81.500  -11.932 1.00 76.57  ? 748 GLN A OE1   1 
ATOM   4243 N NE2   . GLN D 4 546 ? 116.267 -79.972  -11.187 1.00 77.76  ? 748 GLN A NE2   1 
ATOM   4244 N N     . ARG D 4 547 ? 117.081 -80.531  -17.479 1.00 135.93 ? 749 ARG A N     1 
ATOM   4245 C CA    . ARG D 4 547 ? 118.128 -80.956  -18.416 1.00 136.79 ? 749 ARG A CA    1 
ATOM   4246 C C     . ARG D 4 547 ? 118.241 -79.971  -19.585 1.00 137.35 ? 749 ARG A C     1 
ATOM   4247 O O     . ARG D 4 547 ? 119.077 -80.139  -20.478 1.00 137.61 ? 749 ARG A O     1 
ATOM   4248 C CB    . ARG D 4 547 ? 117.882 -82.380  -18.928 1.00 143.60 ? 749 ARG A CB    1 
ATOM   4249 N N     . GLU D 4 548 ? 117.404 -78.931  -19.534 1.00 63.90  ? 750 GLU A N     1 
ATOM   4250 C CA    . GLU D 4 548 ? 117.360 -77.860  -20.523 1.00 63.37  ? 750 GLU A CA    1 
ATOM   4251 C C     . GLU D 4 548 ? 118.270 -76.716  -20.080 1.00 61.84  ? 750 GLU A C     1 
ATOM   4252 O O     . GLU D 4 548 ? 119.024 -76.183  -20.886 1.00 61.53  ? 750 GLU A O     1 
ATOM   4253 N N     . LYS D 4 549 ? 118.233 -76.397  -18.783 1.00 57.69  ? 751 LYS A N     1 
ATOM   4254 C CA    . LYS D 4 549 ? 119.040 -75.319  -18.191 1.00 55.85  ? 751 LYS A CA    1 
ATOM   4255 C C     . LYS D 4 549 ? 120.512 -75.701  -17.977 1.00 54.84  ? 751 LYS A C     1 
ATOM   4256 O O     . LYS D 4 549 ? 121.404 -74.864  -18.152 1.00 56.06  ? 751 LYS A O     1 
ATOM   4257 C CB    . LYS D 4 549 ? 118.430 -74.841  -16.862 1.00 99.47  ? 751 LYS A CB    1 
ATOM   4258 C CG    . LYS D 4 549 ? 119.044 -73.539  -16.343 1.00 98.29  ? 751 LYS A CG    1 
ATOM   4259 C CD    . LYS D 4 549 ? 118.737 -73.248  -14.887 1.00 98.77  ? 751 LYS A CD    1 
ATOM   4260 C CE    . LYS D 4 549 ? 119.482 -71.991  -14.446 1.00 98.87  ? 751 LYS A CE    1 
ATOM   4261 N NZ    . LYS D 4 549 ? 119.381 -71.712  -12.985 1.00 98.97  ? 751 LYS A NZ    1 
ATOM   4262 N N     . PHE D 4 550 ? 120.755 -76.955  -17.590 1.00 43.95  ? 752 PHE A N     1 
ATOM   4263 C CA    . PHE D 4 550 ? 122.110 -77.456  -17.358 1.00 42.03  ? 752 PHE A CA    1 
ATOM   4264 C C     . PHE D 4 550 ? 122.747 -78.047  -18.625 1.00 39.65  ? 752 PHE A C     1 
ATOM   4265 O O     . PHE D 4 550 ? 123.804 -78.668  -18.546 1.00 39.22  ? 752 PHE A O     1 
ATOM   4266 N N     . ALA D 4 551 ? 122.132 -77.790  -19.786 1.00 52.95  ? 753 ALA A N     1 
ATOM   4267 C CA    . ALA D 4 551 ? 122.572 -78.285  -21.108 1.00 51.11  ? 753 ALA A CA    1 
ATOM   4268 C C     . ALA D 4 551 ? 124.032 -78.034  -21.498 1.00 49.91  ? 753 ALA A C     1 
ATOM   4269 O O     . ALA D 4 551 ? 124.632 -78.819  -22.249 1.00 50.16  ? 753 ALA A O     1 
ATOM   4270 C CB    . ALA D 4 551 ? 121.650 -77.747  -22.194 1.00 142.76 ? 753 ALA A CB    1 
ATOM   4271 N N     . TRP D 4 552 ? 124.580 -76.929  -20.998 1.00 46.31  ? 754 TRP A N     1 
ATOM   4272 C CA    . TRP D 4 552 ? 125.964 -76.555  -21.246 1.00 44.34  ? 754 TRP A CA    1 
ATOM   4273 C C     . TRP D 4 552 ? 126.884 -77.425  -20.411 1.00 42.40  ? 754 TRP A C     1 
ATOM   4274 O O     . TRP D 4 552 ? 127.860 -77.961  -20.916 1.00 41.94  ? 754 TRP A O     1 
ATOM   4275 C CB    . TRP D 4 552 ? 126.195 -75.062  -20.953 1.00 85.53  ? 754 TRP A CB    1 
ATOM   4276 C CG    . TRP D 4 552 ? 125.792 -74.579  -19.570 1.00 87.62  ? 754 TRP A CG    1 
ATOM   4277 C CD1   . TRP D 4 552 ? 124.536 -74.224  -19.154 1.00 87.93  ? 754 TRP A CD1   1 
ATOM   4278 C CD2   . TRP D 4 552 ? 126.652 -74.411  -18.437 1.00 88.31  ? 754 TRP A CD2   1 
ATOM   4279 N NE1   . TRP D 4 552 ? 124.559 -73.852  -17.830 1.00 88.27  ? 754 TRP A NE1   1 
ATOM   4280 C CE2   . TRP D 4 552 ? 125.840 -73.956  -17.362 1.00 88.39  ? 754 TRP A CE2   1 
ATOM   4281 C CE3   . TRP D 4 552 ? 128.031 -74.604  -18.219 1.00 88.21  ? 754 TRP A CE3   1 
ATOM   4282 C CZ2   . TRP D 4 552 ? 126.366 -73.690  -16.078 1.00 88.18  ? 754 TRP A CZ2   1 
ATOM   4283 C CZ3   . TRP D 4 552 ? 128.560 -74.341  -16.936 1.00 88.03  ? 754 TRP A CZ3   1 
ATOM   4284 C CH2   . TRP D 4 552 ? 127.722 -73.889  -15.884 1.00 87.66  ? 754 TRP A CH2   1 
ATOM   4285 N N     . ALA D 4 553 ? 126.474 -77.646  -19.163 1.00 30.20  ? 755 ALA A N     1 
ATOM   4286 C CA    . ALA D 4 553 ? 127.211 -78.441  -18.189 1.00 30.77  ? 755 ALA A CA    1 
ATOM   4287 C C     . ALA D 4 553 ? 127.308 -79.900  -18.557 1.00 31.44  ? 755 ALA A C     1 
ATOM   4288 O O     . ALA D 4 553 ? 128.317 -80.549  -18.281 1.00 30.95  ? 755 ALA A O     1 
ATOM   4289 C CB    . ALA D 4 553 ? 126.572 -78.308  -16.842 1.00 5.52   ? 755 ALA A CB    1 
ATOM   4290 N N     . ILE D 4 554 ? 126.257 -80.408  -19.192 1.00 43.72  ? 756 ILE A N     1 
ATOM   4291 C CA    . ILE D 4 554 ? 126.205 -81.799  -19.619 1.00 46.13  ? 756 ILE A CA    1 
ATOM   4292 C C     . ILE D 4 554 ? 127.347 -82.056  -20.599 1.00 48.43  ? 756 ILE A C     1 
ATOM   4293 O O     . ILE D 4 554 ? 128.208 -82.888  -20.317 1.00 49.44  ? 756 ILE A O     1 
ATOM   4294 C CB    . ILE D 4 554 ? 124.813 -82.153  -20.226 1.00 33.48  ? 756 ILE A CB    1 
ATOM   4295 C CG1   . ILE D 4 554 ? 123.747 -82.102  -19.122 1.00 33.04  ? 756 ILE A CG1   1 
ATOM   4296 C CG2   . ILE D 4 554 ? 124.824 -83.540  -20.886 1.00 33.89  ? 756 ILE A CG2   1 
ATOM   4297 C CD1   . ILE D 4 554 ? 122.317 -82.204  -19.627 1.00 33.90  ? 756 ILE A CD1   1 
ATOM   4298 N N     . ASP D 4 555 ? 127.436 -81.230  -21.643 1.00 60.72  ? 757 ASP A N     1 
ATOM   4299 C CA    . ASP D 4 555 ? 128.480 -81.384  -22.649 1.00 62.53  ? 757 ASP A CA    1 
ATOM   4300 C C     . ASP D 4 555 ? 129.892 -80.865  -22.355 1.00 63.76  ? 757 ASP A C     1 
ATOM   4301 O O     . ASP D 4 555 ? 130.757 -80.965  -23.227 1.00 63.39  ? 757 ASP A O     1 
ATOM   4302 C CB    . ASP D 4 555 ? 127.991 -80.931  -24.027 1.00 162.48 ? 757 ASP A CB    1 
ATOM   4303 C CG    . ASP D 4 555 ? 127.322 -82.055  -24.799 1.00 163.58 ? 757 ASP A CG    1 
ATOM   4304 O OD1   . ASP D 4 555 ? 126.101 -82.250  -24.632 1.00 162.49 ? 757 ASP A OD1   1 
ATOM   4305 O OD2   . ASP D 4 555 ? 128.022 -82.755  -25.565 1.00 164.79 ? 757 ASP A OD2   1 
ATOM   4306 N N     . MET D 4 556 ? 130.138 -80.333  -21.152 1.00 82.56  ? 758 MET A N     1 
ATOM   4307 C CA    . MET D 4 556 ? 131.491 -79.879  -20.794 1.00 85.86  ? 758 MET A CA    1 
ATOM   4308 C C     . MET D 4 556 ? 131.982 -80.243  -19.383 1.00 87.28  ? 758 MET A C     1 
ATOM   4309 O O     . MET D 4 556 ? 132.568 -79.417  -18.679 1.00 87.52  ? 758 MET A O     1 
ATOM   4310 C CB    . MET D 4 556 ? 131.753 -78.386  -21.125 1.00 85.19  ? 758 MET A CB    1 
ATOM   4311 C CG    . MET D 4 556 ? 130.765 -77.357  -20.606 1.00 86.21  ? 758 MET A CG    1 
ATOM   4312 S SD    . MET D 4 556 ? 131.511 -75.765  -20.169 1.00 88.50  ? 758 MET A SD    1 
ATOM   4313 C CE    . MET D 4 556 ? 132.094 -75.136  -21.764 1.00 89.29  ? 758 MET A CE    1 
ATOM   4314 N N     . ALA D 4 557 ? 131.802 -81.505  -19.004 1.00 119.27 ? 759 ALA A N     1 
ATOM   4315 C CA    . ALA D 4 557 ? 132.241 -81.997  -17.699 1.00 121.05 ? 759 ALA A CA    1 
ATOM   4316 C C     . ALA D 4 557 ? 132.595 -83.463  -17.837 1.00 122.30 ? 759 ALA A C     1 
ATOM   4317 O O     . ALA D 4 557 ? 131.781 -84.247  -18.325 1.00 122.87 ? 759 ALA A O     1 
ATOM   4318 C CB    . ALA D 4 557 ? 131.129 -81.819  -16.670 1.00 42.13  ? 759 ALA A CB    1 
ATOM   4319 N N     . ASP D 4 558 ? 133.796 -83.840  -17.408 1.00 140.89 ? 760 ASP A N     1 
ATOM   4320 C CA    . ASP D 4 558 ? 134.225 -85.225  -17.536 1.00 141.58 ? 760 ASP A CA    1 
ATOM   4321 C C     . ASP D 4 558 ? 134.208 -86.042  -16.244 1.00 142.22 ? 760 ASP A C     1 
ATOM   4322 O O     . ASP D 4 558 ? 133.549 -85.673  -15.266 1.00 142.17 ? 760 ASP A O     1 
ATOM   4323 C CB    . ASP D 4 558 ? 135.606 -85.279  -18.220 1.00 128.79 ? 760 ASP A CB    1 
ATOM   4324 N N     . GLU D 4 559 ? 134.906 -87.175  -16.265 1.00 87.70  ? 761 GLU A N     1 
ATOM   4325 C CA    . GLU D 4 559 ? 134.971 -88.058  -15.113 1.00 88.19  ? 761 GLU A CA    1 
ATOM   4326 C C     . GLU D 4 559 ? 135.996 -87.624  -14.078 1.00 87.56  ? 761 GLU A C     1 
ATOM   4327 O O     . GLU D 4 559 ? 136.202 -88.348  -13.114 1.00 87.29  ? 761 GLU A O     1 
ATOM   4328 N N     . ASP D 4 560 ? 136.621 -86.455  -14.264 1.00 175.83 ? 762 ASP A N     1 
ATOM   4329 C CA    . ASP D 4 560 ? 137.631 -85.937  -13.326 1.00 175.45 ? 762 ASP A CA    1 
ATOM   4330 C C     . ASP D 4 560 ? 137.533 -84.427  -13.051 1.00 174.88 ? 762 ASP A C     1 
ATOM   4331 O O     . ASP D 4 560 ? 138.507 -83.811  -12.597 1.00 175.16 ? 762 ASP A O     1 
ATOM   4332 C CB    . ASP D 4 560 ? 139.054 -86.306  -13.816 1.00 119.78 ? 762 ASP A CB    1 
ATOM   4333 N N     . TYR D 4 561 ? 136.367 -83.830  -13.319 1.00 73.62  ? 763 TYR A N     1 
ATOM   4334 C CA    . TYR D 4 561 ? 136.172 -82.393  -13.085 1.00 72.12  ? 763 TYR A CA    1 
ATOM   4335 C C     . TYR D 4 561 ? 136.183 -82.052  -11.581 1.00 72.13  ? 763 TYR A C     1 
ATOM   4336 O O     . TYR D 4 561 ? 135.235 -82.331  -10.834 1.00 72.23  ? 763 TYR A O     1 
ATOM   4337 C CB    . TYR D 4 561 ? 134.892 -81.877  -13.784 1.00 67.87  ? 763 TYR A CB    1 
ATOM   4338 C CG    . TYR D 4 561 ? 134.540 -80.421  -13.518 1.00 66.39  ? 763 TYR A CG    1 
ATOM   4339 C CD1   . TYR D 4 561 ? 135.082 -79.390  -14.308 1.00 65.57  ? 763 TYR A CD1   1 
ATOM   4340 C CD2   . TYR D 4 561 ? 133.716 -80.063  -12.419 1.00 65.28  ? 763 TYR A CD2   1 
ATOM   4341 C CE1   . TYR D 4 561 ? 134.817 -78.031  -14.004 1.00 64.99  ? 763 TYR A CE1   1 
ATOM   4342 C CE2   . TYR D 4 561 ? 133.459 -78.721  -12.102 1.00 64.43  ? 763 TYR A CE2   1 
ATOM   4343 C CZ    . TYR D 4 561 ? 134.010 -77.713  -12.897 1.00 64.21  ? 763 TYR A CZ    1 
ATOM   4344 O OH    . TYR D 4 561 ? 133.761 -76.405  -12.581 1.00 63.50  ? 763 TYR A OH    1 
ATOM   4345 N N     . GLU D 4 562 ? 137.298 -81.465  -11.166 1.00 49.80  ? 764 GLU A N     1 
ATOM   4346 C CA    . GLU D 4 562 ? 137.511 -81.024  -9.799  1.00 50.10  ? 764 GLU A CA    1 
ATOM   4347 C C     . GLU D 4 562 ? 137.249 -79.528  -9.837  1.00 50.45  ? 764 GLU A C     1 
ATOM   4348 O O     . GLU D 4 562 ? 137.627 -78.848  -10.797 1.00 50.27  ? 764 GLU A O     1 
ATOM   4349 C CB    . GLU D 4 562 ? 138.946 -81.313  -9.368  1.00 106.09 ? 764 GLU A CB    1 
ATOM   4350 N N     . PHE D 4 563 ? 136.562 -79.035  -8.809  1.00 198.24 ? 765 PHE A N     1 
ATOM   4351 C CA    . PHE D 4 563 ? 136.195 -77.622  -8.687  1.00 198.24 ? 765 PHE A CA    1 
ATOM   4352 C C     . PHE D 4 563 ? 137.402 -76.719  -8.380  1.00 198.24 ? 765 PHE A C     1 
ATOM   4353 O O     . PHE D 4 563 ? 137.867 -76.038  -9.321  1.00 198.24 ? 765 PHE A O     1 
ATOM   4354 C CB    . PHE D 4 563 ? 135.096 -77.472  -7.615  1.00 131.46 ? 765 PHE A CB    1 
ATOM   4355 C CG    . PHE D 4 563 ? 134.381 -76.140  -7.630  1.00 128.70 ? 765 PHE A CG    1 
ATOM   4356 C CD1   . PHE D 4 563 ? 133.703 -75.695  -8.784  1.00 127.19 ? 765 PHE A CD1   1 
ATOM   4357 C CD2   . PHE D 4 563 ? 134.371 -75.325  -6.478  1.00 128.01 ? 765 PHE A CD2   1 
ATOM   4358 C CE1   . PHE D 4 563 ? 133.020 -74.450  -8.795  1.00 126.42 ? 765 PHE A CE1   1 
ATOM   4359 C CE2   . PHE D 4 563 ? 133.691 -74.074  -6.469  1.00 126.66 ? 765 PHE A CE2   1 
ATOM   4360 C CZ    . PHE D 4 563 ? 133.016 -73.638  -7.633  1.00 126.23 ? 765 PHE A CZ    1 
ATOM   4361 O OXT   . PHE D 4 563 ? 137.870 -76.709  -7.220  1.00 134.35 ? 765 PHE A OXT   1 
HETATM 4362 O O     . HOH E 5 .   ? 128.025 -43.309  2.872   1.00 36.52  ? 13  HOH B O     1 
HETATM 4363 O O     . HOH E 5 .   ? 131.166 -43.092  2.166   1.00 27.53  ? 28  HOH B O     1 
HETATM 4364 O O     . HOH F 5 .   ? 97.990  -97.735  0.543   1.00 40.26  ? 23  HOH C O     1 
HETATM 4365 O O     . HOH F 5 .   ? 111.467 -70.680  -9.221  1.00 52.81  ? 24  HOH C O     1 
HETATM 4366 O O     . HOH F 5 .   ? 106.443 -90.199  -21.305 1.00 63.52  ? 25  HOH C O     1 
HETATM 4367 O O     . HOH F 5 .   ? 102.952 -90.337  -20.421 1.00 58.07  ? 26  HOH C O     1 
HETATM 4368 O O     . HOH F 5 .   ? 102.949 -82.189  -20.864 1.00 24.77  ? 27  HOH C O     1 
HETATM 4369 O O     . HOH G 5 .   ? 128.351 -40.612  -12.578 1.00 32.08  ? 2   HOH D O     1 
HETATM 4370 O O     . HOH G 5 .   ? 123.886 -39.324  -19.882 1.00 24.78  ? 21  HOH D O     1 
HETATM 4371 O O     . HOH G 5 .   ? 126.881 -54.852  -13.740 1.00 71.90  ? 23  HOH D O     1 
HETATM 4372 O O     . HOH G 5 .   ? 126.598 -44.222  -16.168 1.00 42.65  ? 31  HOH D O     1 
HETATM 4373 O O     . HOH G 5 .   ? 112.494 -54.478  -6.716  1.00 46.24  ? 32  HOH D O     1 
HETATM 4374 O O     . HOH H 5 .   ? 123.899 -50.745  7.797   1.00 42.50  ? 3   HOH A O     1 
HETATM 4375 O O     . HOH H 5 .   ? 130.811 -63.933  -23.991 1.00 47.62  ? 4   HOH A O     1 
HETATM 4376 O O     . HOH H 5 .   ? 133.796 -70.807  -33.525 1.00 39.27  ? 5   HOH A O     1 
HETATM 4377 O O     . HOH H 5 .   ? 138.861 -69.010  20.160  1.00 25.40  ? 6   HOH A O     1 
HETATM 4378 O O     . HOH H 5 .   ? 134.121 -61.855  -20.588 1.00 51.48  ? 7   HOH A O     1 
HETATM 4379 O O     . HOH H 5 .   ? 107.312 -56.279  -6.202  1.00 54.07  ? 8   HOH A O     1 
HETATM 4380 O O     . HOH H 5 .   ? 121.761 -74.552  10.675  1.00 37.23  ? 9   HOH A O     1 
HETATM 4381 O O     . HOH H 5 .   ? 112.523 -55.604  14.491  1.00 58.86  ? 10  HOH A O     1 
HETATM 4382 O O     . HOH H 5 .   ? 82.141  -64.060  -16.289 1.00 60.78  ? 14  HOH A O     1 
HETATM 4383 O O     . HOH H 5 .   ? 133.342 -71.303  7.470   1.00 37.98  ? 15  HOH A O     1 
HETATM 4384 O O     . HOH H 5 .   ? 126.120 -45.272  7.744   1.00 18.06  ? 17  HOH A O     1 
HETATM 4385 O O     . HOH H 5 .   ? 140.432 -73.717  -1.363  1.00 56.12  ? 18  HOH A O     1 
HETATM 4386 O O     . HOH H 5 .   ? 115.551 -73.952  -19.840 1.00 31.52  ? 20  HOH A O     1 
HETATM 4387 O O     . HOH H 5 .   ? 112.907 -76.214  9.881   1.00 60.76  ? 22  HOH A O     1 
HETATM 4388 O O     . HOH H 5 .   ? 135.488 -70.157  13.320  1.00 34.51  ? 24  HOH A O     1 
HETATM 4389 O O     . HOH H 5 .   ? 95.857  -61.760  -31.830 1.00 31.15  ? 25  HOH A O     1 
HETATM 4390 O O     . HOH H 5 .   ? 106.677 -41.157  -24.805 1.00 34.70  ? 26  HOH A O     1 
HETATM 4391 O O     . HOH H 5 .   ? 76.802  -59.025  -18.257 1.00 40.61  ? 27  HOH A O     1 
HETATM 4392 O O     . HOH H 5 .   ? 138.568 -49.513  18.970  1.00 55.99  ? 29  HOH A O     1 
HETATM 4393 O O     . HOH H 5 .   ? 89.065  -72.021  -13.777 1.00 62.01  ? 30  HOH A O     1 
HETATM 4394 O O     . HOH H 5 .   ? 124.675 -44.861  26.919  1.00 60.24  ? 33  HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   1   1   DA  ADE B . n 
A 1 2   DA  2   2   2   DA  ADE B . n 
A 1 3   DA  3   3   3   DA  ADE B . n 
A 1 4   DA  4   4   4   DA  ADE B . n 
A 1 5   DA  5   5   5   DA  ADE B . n 
A 1 6   DG  6   6   6   DG  GUA B . n 
A 1 7   DA  7   7   7   DA  ADE B . n 
A 1 8   DC  8   8   8   DC  CYT B . n 
A 1 9   DU  9   9   9   DU  URI B . n 
A 1 10  UBB 10  10  10  UBB URI B . n 
B 2 1   GNG 1   11  11  GNG GUA C . n 
B 2 2   DG  2   12  12  DG  GUA C . n 
B 2 3   DA  3   13  13  DA  ADE C . n 
B 2 4   DA  4   14  14  DA  ADE C . n 
B 2 5   DA  5   15  15  DA  ADE C . n 
B 2 6   DA  6   16  16  DA  ADE C . n 
B 2 7   DA  7   17  17  DA  ADE C . n 
B 2 8   DU  8   18  18  DU  URI C . n 
B 2 9   DU  9   19  19  DU  URI C . n 
B 2 10  DU  10  20  20  DU  URI C . n 
B 2 11  DU  11  21  21  DU  URI C . n 
B 2 12  DT  12  22  22  DT  THY C . n 
C 3 1   DA  1   101 101 DA  ADE D . n 
C 3 2   DA  2   102 102 DA  ADE D . n 
C 3 3   DA  3   103 103 DA  ADE D . n 
C 3 4   DA  4   104 104 DA  ADE D . n 
C 3 5   DA  5   105 105 DA  ADE D . n 
C 3 6   DT  6   106 106 DT  THY D . n 
C 3 7   DU  7   107 107 DU  URI D . n 
C 3 8   DU  8   108 108 DU  URI D . n 
C 3 9   DU  9   109 109 DU  URI D . n 
C 3 10  DU  10  110 110 DU  URI D . n 
C 3 11  DC  11  111 111 DC  CYT D . n 
C 3 12  CAR 12  112 112 CAR CAR D . n 
C 3 13  DA  13  113 113 DA  ADE D . n 
C 3 14  DA  14  114 114 DA  ADE D . n 
C 3 15  DG  15  115 115 DG  GUA D . n 
C 3 16  DU  16  116 116 DU  URI D . n 
C 3 17  DC  17  117 117 DC  CYT D . n 
C 3 18  DU  18  118 118 DU  URI D . n 
C 3 19  DU  19  119 119 DU  URI D . n 
C 3 20  DU  20  120 120 DU  URI D . n 
C 3 21  DU  21  121 121 DU  URI D . n 
C 3 22  DT  22  122 122 DT  THY D . n 
D 4 1   TRP 1   203 203 TRP TRP A . n 
D 4 2   LYS 2   204 204 LYS LYS A . n 
D 4 3   TRP 3   205 205 TRP TRP A . n 
D 4 4   TRP 4   206 206 TRP TRP A . n 
D 4 5   GLU 5   207 207 GLU GLU A . n 
D 4 6   GLU 6   208 208 GLU GLU A . n 
D 4 7   GLU 7   209 209 GLU GLU A . n 
D 4 8   ARG 8   210 210 ARG ARG A . n 
D 4 9   TYR 9   211 211 TYR TYR A . n 
D 4 10  PRO 10  212 212 PRO PRO A . n 
D 4 11  GLU 11  213 213 GLU GLU A . n 
D 4 12  GLY 12  214 214 GLY GLY A . n 
D 4 13  ILE 13  215 215 ILE ILE A . n 
D 4 14  LYS 14  216 216 LYS LYS A . n 
D 4 15  TRP 15  217 217 TRP TRP A . n 
D 4 16  LYS 16  218 218 LYS LYS A . n 
D 4 17  PHE 17  219 219 PHE PHE A . n 
D 4 18  LEU 18  220 220 LEU LEU A . n 
D 4 19  GLU 19  221 221 GLU GLU A . n 
D 4 20  HIS 20  222 222 HIS HIS A . n 
D 4 21  LYS 21  223 223 LYS LYS A . n 
D 4 22  GLY 22  224 224 GLY GLY A . n 
D 4 23  PRO 23  225 225 PRO PRO A . n 
D 4 24  VAL 24  226 226 VAL VAL A . n 
D 4 25  PHE 25  227 227 PHE PHE A . n 
D 4 26  ALA 26  228 228 ALA ALA A . n 
D 4 27  PRO 27  229 229 PRO PRO A . n 
D 4 28  PRO 28  230 230 PRO PRO A . n 
D 4 29  TYR 29  231 231 TYR TYR A . n 
D 4 30  GLU 30  232 232 GLU GLU A . n 
D 4 31  PRO 31  233 233 PRO PRO A . n 
D 4 32  LEU 32  234 234 LEU LEU A . n 
D 4 33  PRO 33  235 235 PRO PRO A . n 
D 4 34  GLU 34  236 236 GLU GLU A . n 
D 4 35  ASN 35  237 237 ASN ASN A . n 
D 4 36  VAL 36  238 238 VAL VAL A . n 
D 4 37  LYS 37  239 239 LYS LYS A . n 
D 4 38  PHE 38  240 240 PHE PHE A . n 
D 4 39  TYR 39  241 241 TYR TYR A . n 
D 4 40  TYR 40  242 242 TYR TYR A . n 
D 4 41  ASP 41  243 243 ASP ASP A . n 
D 4 42  GLY 42  244 244 GLY GLY A . n 
D 4 43  LYS 43  245 245 LYS LYS A . n 
D 4 44  VAL 44  246 246 VAL VAL A . n 
D 4 45  MET 45  247 247 MET MET A . n 
D 4 46  LYS 46  248 248 LYS ALA A . n 
D 4 47  LEU 47  249 249 LEU LEU A . n 
D 4 48  SER 48  250 250 SER SER A . n 
D 4 49  PRO 49  251 251 PRO PRO A . n 
D 4 50  LYS 50  252 252 LYS LYS A . n 
D 4 51  ALA 51  253 253 ALA ALA A . n 
D 4 52  GLU 52  254 254 GLU GLU A . n 
D 4 53  GLU 53  255 255 GLU GLU A . n 
D 4 54  VAL 54  256 256 VAL VAL A . n 
D 4 55  ALA 55  257 257 ALA ALA A . n 
D 4 56  THR 56  258 258 THR THR A . n 
D 4 57  PHE 57  259 259 PHE PHE A . n 
D 4 58  PHE 58  260 260 PHE PHE A . n 
D 4 59  ALA 59  261 261 ALA ALA A . n 
D 4 60  LYS 60  262 262 LYS LYS A . n 
D 4 61  MET 61  263 263 MET MET A . n 
D 4 62  LEU 62  264 264 LEU LEU A . n 
D 4 63  ASP 63  265 265 ASP ASP A . n 
D 4 64  HIS 64  266 266 HIS HIS A . n 
D 4 65  GLU 65  267 267 GLU GLU A . n 
D 4 66  TYR 66  268 268 TYR TYR A . n 
D 4 67  THR 67  269 269 THR THR A . n 
D 4 68  THR 68  270 270 THR THR A . n 
D 4 69  LYS 69  271 271 LYS LYS A . n 
D 4 70  GLU 70  272 272 GLU GLU A . n 
D 4 71  ILE 71  273 273 ILE ILE A . n 
D 4 72  PHE 72  274 274 PHE PHE A . n 
D 4 73  ARG 73  275 275 ARG ARG A . n 
D 4 74  LYS 74  276 276 LYS ALA A . n 
D 4 75  ASN 75  277 277 ASN ASN A . n 
D 4 76  PHE 76  278 278 PHE PHE A . n 
D 4 77  PHE 77  279 279 PHE PHE A . n 
D 4 78  LYS 78  280 280 LYS LYS A . n 
D 4 79  ASP 79  281 281 ASP ASP A . n 
D 4 80  TRP 80  282 282 TRP TRP A . n 
D 4 81  ARG 81  283 283 ARG ARG A . n 
D 4 82  LYS 82  284 284 LYS LYS A . n 
D 4 83  GLU 83  285 285 GLU GLU A . n 
D 4 84  MET 84  286 286 MET MET A . n 
D 4 85  THR 85  287 287 THR THR A . n 
D 4 86  ASN 86  288 288 ASN ASN A . n 
D 4 87  GLU 87  289 289 GLU ALA A . n 
D 4 88  GLU 88  290 290 GLU GLU A . n 
D 4 89  LYS 89  291 291 LYS LYS A . n 
D 4 90  ASN 90  292 292 ASN ASN A . n 
D 4 91  ILE 91  293 293 ILE ILE A . n 
D 4 92  ILE 92  294 294 ILE ILE A . n 
D 4 93  THR 93  295 295 THR THR A . n 
D 4 94  ASN 94  296 296 ASN ASN A . n 
D 4 95  LEU 95  297 297 LEU LEU A . n 
D 4 96  SER 96  298 298 SER SER A . n 
D 4 97  LYS 97  299 299 LYS LYS A . n 
D 4 98  CYS 98  300 300 CYS CYS A . n 
D 4 99  ASP 99  301 301 ASP ASP A . n 
D 4 100 PHE 100 302 302 PHE PHE A . n 
D 4 101 THR 101 303 303 THR THR A . n 
D 4 102 GLN 102 304 304 GLN GLN A . n 
D 4 103 MET 103 305 305 MET MET A . n 
D 4 104 SER 104 306 306 SER SER A . n 
D 4 105 GLN 105 307 307 GLN GLN A . n 
D 4 106 TYR 106 308 308 TYR TYR A . n 
D 4 107 PHE 107 309 309 PHE PHE A . n 
D 4 108 LYS 108 310 310 LYS LYS A . n 
D 4 109 ALA 109 311 311 ALA ALA A . n 
D 4 110 GLN 110 312 312 GLN GLN A . n 
D 4 111 THR 111 313 313 THR THR A . n 
D 4 112 GLU 112 314 314 GLU ALA A . n 
D 4 113 ALA 113 315 315 ALA ALA A . n 
D 4 114 ARG 114 316 316 ARG ALA A . n 
D 4 115 LYS 115 317 317 LYS ALA A . n 
D 4 116 GLN 116 318 318 GLN ALA A . n 
D 4 117 MET 117 319 319 MET ALA A . n 
D 4 118 SER 118 320 320 SER SER A . n 
D 4 119 LYS 119 321 321 LYS ALA A . n 
D 4 120 GLU 120 322 322 GLU ALA A . n 
D 4 121 GLU 121 323 323 GLU ALA A . n 
D 4 122 LYS 122 324 324 LYS LYS A . n 
D 4 123 LEU 123 325 325 LEU LEU A . n 
D 4 124 LYS 124 326 326 LYS ALA A . n 
D 4 125 ILE 125 327 327 ILE ILE A . n 
D 4 126 LYS 126 328 328 LYS LYS A . n 
D 4 127 GLU 127 329 329 GLU GLU A . n 
D 4 128 GLU 128 330 330 GLU GLU A . n 
D 4 129 ASN 129 331 331 ASN ASN A . n 
D 4 130 GLU 130 332 332 GLU ALA A . n 
D 4 131 LYS 131 333 333 LYS ALA A . n 
D 4 132 LEU 132 334 334 LEU LEU A . n 
D 4 133 LEU 133 335 335 LEU LEU A . n 
D 4 134 LYS 134 336 336 LYS LYS A . n 
D 4 135 GLU 135 337 337 GLU GLU A . n 
D 4 136 TYR 136 338 338 TYR TYR A . n 
D 4 137 GLY 137 339 339 GLY GLY A . n 
D 4 138 PHE 138 340 340 PHE PHE A . n 
D 4 139 CYS 139 341 341 CYS CYS A . n 
D 4 140 ILE 140 342 342 ILE ILE A . n 
D 4 141 MET 141 343 343 MET MET A . n 
D 4 142 ASP 142 344 344 ASP ASP A . n 
D 4 143 ASN 143 345 345 ASN ASN A . n 
D 4 144 HIS 144 346 346 HIS HIS A . n 
D 4 145 LYS 145 347 347 LYS LYS A . n 
D 4 146 GLU 146 348 348 GLU GLU A . n 
D 4 147 ARG 147 349 349 ARG ARG A . n 
D 4 148 ILE 148 350 350 ILE ILE A . n 
D 4 149 ALA 149 351 351 ALA ALA A . n 
D 4 150 ASN 150 352 352 ASN ASN A . n 
D 4 151 PHE 151 353 353 PHE PHE A . n 
D 4 152 LYS 152 354 354 LYS LYS A . n 
D 4 153 ILE 153 355 355 ILE ILE A . n 
D 4 154 GLU 154 356 356 GLU GLU A . n 
D 4 155 PRO 155 357 357 PRO PRO A . n 
D 4 156 PRO 156 358 358 PRO PRO A . n 
D 4 157 GLY 157 359 359 GLY GLY A . n 
D 4 158 LEU 158 360 360 LEU LEU A . n 
D 4 159 PHE 159 361 361 PHE PHE A . n 
D 4 160 ARG 160 362 362 ARG ARG A . n 
D 4 161 GLY 161 363 363 GLY GLY A . n 
D 4 162 ARG 162 364 364 ARG ARG A . n 
D 4 163 GLY 163 365 365 GLY GLY A . n 
D 4 164 ASN 164 366 366 ASN ASN A . n 
D 4 165 HIS 165 367 367 HIS HIS A . n 
D 4 166 PRO 166 368 368 PRO PRO A . n 
D 4 167 LYS 167 369 369 LYS LYS A . n 
D 4 168 MET 168 370 370 MET MET A . n 
D 4 169 GLY 169 371 371 GLY GLY A . n 
D 4 170 MET 170 372 372 MET MET A . n 
D 4 171 LEU 171 373 373 LEU LEU A . n 
D 4 172 LYS 172 374 374 LYS LYS A . n 
D 4 173 ARG 173 375 375 ARG ARG A . n 
D 4 174 ARG 174 376 376 ARG ARG A . n 
D 4 175 ILE 175 377 377 ILE ILE A . n 
D 4 176 MET 176 378 378 MET MET A . n 
D 4 177 PRO 177 379 379 PRO PRO A . n 
D 4 178 GLU 178 380 380 GLU GLU A . n 
D 4 179 ASP 179 381 381 ASP ASP A . n 
D 4 180 ILE 180 382 382 ILE ILE A . n 
D 4 181 ILE 181 383 383 ILE ILE A . n 
D 4 182 ILE 182 384 384 ILE ILE A . n 
D 4 183 ASN 183 385 385 ASN ASN A . n 
D 4 184 CYS 184 386 386 CYS CYS A . n 
D 4 185 SER 185 387 387 SER SER A . n 
D 4 186 LYS 186 388 388 LYS LYS A . n 
D 4 187 ASP 187 389 389 ASP ASP A . n 
D 4 188 ALA 188 390 390 ALA ALA A . n 
D 4 189 LYS 189 391 391 LYS LYS A . n 
D 4 190 VAL 190 392 392 VAL VAL A . n 
D 4 191 PRO 191 393 393 PRO PRO A . n 
D 4 192 SER 192 394 394 SER SER A . n 
D 4 193 PRO 193 395 395 PRO PRO A . n 
D 4 194 PRO 194 396 396 PRO PRO A . n 
D 4 195 PRO 195 397 397 PRO PRO A . n 
D 4 196 GLY 196 398 398 GLY GLY A . n 
D 4 197 HIS 197 399 399 HIS HIS A . n 
D 4 198 LYS 198 400 400 LYS LYS A . n 
D 4 199 TRP 199 401 401 TRP TRP A . n 
D 4 200 LYS 200 402 402 LYS LYS A . n 
D 4 201 GLU 201 403 403 GLU GLU A . n 
D 4 202 VAL 202 404 404 VAL VAL A . n 
D 4 203 ARG 203 405 405 ARG ARG A . n 
D 4 204 HIS 204 406 406 HIS HIS A . n 
D 4 205 ASP 205 407 407 ASP ASP A . n 
D 4 206 ASN 206 408 408 ASN ASN A . n 
D 4 207 LYS 207 409 409 LYS LYS A . n 
D 4 208 VAL 208 410 410 VAL VAL A . n 
D 4 209 THR 209 411 411 THR THR A . n 
D 4 210 TRP 210 412 412 TRP TRP A . n 
D 4 211 LEU 211 413 413 LEU LEU A . n 
D 4 212 VAL 212 414 414 VAL VAL A . n 
D 4 213 SER 213 415 415 SER SER A . n 
D 4 214 TRP 214 416 416 TRP TRP A . n 
D 4 215 THR 215 417 417 THR THR A . n 
D 4 216 GLU 216 418 418 GLU GLU A . n 
D 4 217 ASN 217 419 419 ASN ASN A . n 
D 4 218 ILE 218 420 420 ILE ILE A . n 
D 4 219 GLN 219 421 421 GLN GLN A . n 
D 4 220 GLY 220 422 422 GLY GLY A . n 
D 4 221 SER 221 423 423 SER SER A . n 
D 4 222 ILE 222 424 424 ILE ILE A . n 
D 4 223 LYS 223 425 425 LYS LYS A . n 
D 4 224 TYR 224 426 426 TYR TYR A . n 
D 4 225 ILE 225 427 427 ILE ILE A . n 
D 4 226 MET 226 428 428 MET MET A . n 
D 4 227 LEU 227 429 429 LEU LEU A . n 
D 4 228 ASN 228 430 430 ASN ASN A . n 
D 4 229 PRO 229 431 431 PRO PRO A . n 
D 4 230 SER 230 432 432 SER SER A . n 
D 4 231 SER 231 433 433 SER SER A . n 
D 4 232 ARG 232 434 434 ARG ARG A . n 
D 4 233 ILE 233 435 435 ILE ILE A . n 
D 4 234 LYS 234 436 436 LYS LYS A . n 
D 4 235 GLY 235 437 437 GLY GLY A . n 
D 4 236 GLU 236 438 438 GLU GLU A . n 
D 4 237 LYS 237 439 439 LYS LYS A . n 
D 4 238 ASP 238 440 440 ASP ASP A . n 
D 4 239 TRP 239 441 441 TRP TRP A . n 
D 4 240 GLN 240 442 442 GLN GLN A . n 
D 4 241 LYS 241 443 443 LYS LYS A . n 
D 4 242 TYR 242 444 444 TYR TYR A . n 
D 4 243 GLU 243 445 445 GLU GLU A . n 
D 4 244 THR 244 446 446 THR THR A . n 
D 4 245 ALA 245 447 447 ALA ALA A . n 
D 4 246 ARG 246 448 448 ARG ARG A . n 
D 4 247 ARG 247 449 449 ARG ARG A . n 
D 4 248 LEU 248 450 450 LEU LEU A . n 
D 4 249 LYS 249 451 451 LYS LYS A . n 
D 4 250 LYS 250 452 452 LYS LYS A . n 
D 4 251 CYS 251 453 453 CYS CYS A . n 
D 4 252 VAL 252 454 454 VAL VAL A . n 
D 4 253 ASP 253 455 455 ASP ASP A . n 
D 4 254 LYS 254 456 456 LYS LYS A . n 
D 4 255 ILE 255 457 457 ILE ILE A . n 
D 4 256 ARG 256 458 458 ARG ARG A . n 
D 4 257 ASN 257 459 459 ASN ASN A . n 
D 4 258 GLN 258 460 460 GLN GLN A . n 
D 4 259 TYR 259 461 461 TYR TYR A . n 
D 4 260 ARG 260 462 462 ARG ALA A . n 
D 4 261 GLU 261 463 463 GLU ALA A . n 
D 4 262 ASP 262 464 464 ASP ASP A . n 
D 4 263 TRP 263 465 465 TRP TRP A . n 
D 4 264 LYS 264 466 466 LYS ALA A . n 
D 4 265 SER 265 467 467 SER SER A . n 
D 4 266 LYS 266 468 468 LYS ALA A . n 
D 4 267 GLU 267 469 469 GLU GLU A . n 
D 4 268 MET 268 470 470 MET MET A . n 
D 4 269 LYS 269 471 471 LYS ALA A . n 
D 4 270 VAL 270 472 472 VAL VAL A . n 
D 4 271 ARG 271 473 473 ARG ARG A . n 
D 4 272 GLN 272 474 474 GLN GLN A . n 
D 4 273 ARG 273 475 475 ARG ARG A . n 
D 4 274 ALA 274 476 476 ALA ALA A . n 
D 4 275 VAL 275 477 477 VAL VAL A . n 
D 4 276 ALA 276 478 478 ALA ALA A . n 
D 4 277 LEU 277 479 479 LEU LEU A . n 
D 4 278 TYR 278 480 480 TYR TYR A . n 
D 4 279 PHE 279 481 481 PHE PHE A . n 
D 4 280 ILE 280 482 482 ILE ILE A . n 
D 4 281 ASP 281 483 483 ASP ASP A . n 
D 4 282 LYS 282 484 484 LYS ALA A . n 
D 4 283 LEU 283 485 485 LEU LEU A . n 
D 4 284 ALA 284 486 486 ALA ALA A . n 
D 4 285 LEU 285 487 487 LEU LEU A . n 
D 4 286 ARG 286 488 488 ARG ARG A . n 
D 4 287 ALA 287 489 489 ALA ALA A . n 
D 4 288 GLY 288 490 490 GLY GLY A . n 
D 4 289 ASN 289 491 491 ASN ASN A . n 
D 4 290 GLU 290 492 492 GLU GLU A . n 
D 4 291 LYS 291 493 493 LYS LYS A . n 
D 4 292 GLU 292 494 494 GLU GLU A . n 
D 4 293 GLU 293 495 495 GLU ALA A . n 
D 4 294 GLY 294 496 496 GLY GLY A . n 
D 4 295 GLU 295 497 497 GLU GLU A . n 
D 4 296 THR 296 498 498 THR THR A . n 
D 4 297 ALA 297 499 499 ALA ALA A . n 
D 4 298 ASP 298 500 500 ASP ASP A . n 
D 4 299 THR 299 501 501 THR THR A . n 
D 4 300 VAL 300 502 502 VAL VAL A . n 
D 4 301 GLY 301 503 503 GLY GLY A . n 
D 4 302 CYS 302 504 504 CYS CYS A . n 
D 4 303 CYS 303 505 505 CYS CYS A . n 
D 4 304 SER 304 506 506 SER SER A . n 
D 4 305 LEU 305 507 507 LEU LEU A . n 
D 4 306 ARG 306 508 508 ARG ARG A . n 
D 4 307 VAL 307 509 509 VAL VAL A . n 
D 4 308 GLU 308 510 510 GLU GLU A . n 
D 4 309 HIS 309 511 511 HIS HIS A . n 
D 4 310 ILE 310 512 512 ILE ILE A . n 
D 4 311 ASN 311 513 513 ASN ASN A . n 
D 4 312 LEU 312 514 514 LEU LEU A . n 
D 4 313 HIS 313 515 515 HIS HIS A . n 
D 4 314 PRO 314 516 516 PRO PRO A . n 
D 4 315 GLU 315 517 517 GLU GLU A . n 
D 4 316 LEU 316 518 518 LEU LEU A . n 
D 4 317 ASP 317 519 519 ASP ASP A . n 
D 4 318 GLY 318 520 520 GLY GLY A . n 
D 4 319 GLN 319 521 521 GLN GLN A . n 
D 4 320 GLU 320 522 522 GLU GLU A . n 
D 4 321 TYR 321 523 523 TYR TYR A . n 
D 4 322 VAL 322 524 524 VAL VAL A . n 
D 4 323 VAL 323 525 525 VAL VAL A . n 
D 4 324 GLU 324 526 526 GLU GLU A . n 
D 4 325 PHE 325 527 527 PHE PHE A . n 
D 4 326 ASP 326 528 528 ASP ASP A . n 
D 4 327 PHE 327 529 529 PHE PHE A . n 
D 4 328 LEU 328 530 530 LEU LEU A . n 
D 4 329 GLY 329 531 531 GLY GLY A . n 
D 4 330 LYS 330 532 532 LYS LYS A . n 
D 4 331 ASP 331 533 533 ASP ASP A . n 
D 4 332 SER 332 534 534 SER SER A . n 
D 4 333 ILE 333 535 535 ILE ILE A . n 
D 4 334 ARG 334 536 536 ARG ARG A . n 
D 4 335 TYR 335 537 537 TYR TYR A . n 
D 4 336 TYR 336 538 538 TYR TYR A . n 
D 4 337 ASN 337 539 539 ASN ASN A . n 
D 4 338 LYS 338 540 540 LYS LYS A . n 
D 4 339 VAL 339 541 541 VAL VAL A . n 
D 4 340 PRO 340 542 542 PRO PRO A . n 
D 4 341 VAL 341 543 543 VAL VAL A . n 
D 4 342 GLU 342 544 544 GLU GLU A . n 
D 4 343 LYS 343 545 545 LYS LYS A . n 
D 4 344 ARG 344 546 546 ARG ALA A . n 
D 4 345 VAL 345 547 547 VAL VAL A . n 
D 4 346 PHE 346 548 548 PHE PHE A . n 
D 4 347 LYS 347 549 549 LYS LYS A . n 
D 4 348 ASN 348 550 550 ASN ASN A . n 
D 4 349 LEU 349 551 551 LEU LEU A . n 
D 4 350 GLN 350 552 552 GLN GLN A . n 
D 4 351 LEU 351 553 553 LEU LEU A . n 
D 4 352 PHE 352 554 554 PHE PHE A . n 
D 4 353 MET 353 555 555 MET MET A . n 
D 4 354 GLU 354 556 556 GLU GLU A . n 
D 4 355 ASN 355 557 557 ASN ASN A . n 
D 4 356 LYS 356 558 558 LYS LYS A . n 
D 4 357 GLN 357 559 559 GLN GLN A . n 
D 4 358 PRO 358 560 560 PRO PRO A . n 
D 4 359 GLU 359 561 561 GLU GLU A . n 
D 4 360 ASP 360 562 562 ASP ASP A . n 
D 4 361 ASP 361 563 563 ASP ASP A . n 
D 4 362 LEU 362 564 564 LEU LEU A . n 
D 4 363 PHE 363 565 565 PHE PHE A . n 
D 4 364 ASP 364 566 566 ASP ASP A . n 
D 4 365 ARG 365 567 567 ARG ARG A . n 
D 4 366 LEU 366 568 568 LEU LEU A . n 
D 4 367 ASN 367 569 569 ASN ASN A . n 
D 4 368 THR 368 570 570 THR THR A . n 
D 4 369 GLY 369 571 571 GLY GLY A . n 
D 4 370 ILE 370 572 572 ILE ILE A . n 
D 4 371 LEU 371 573 573 LEU LEU A . n 
D 4 372 ASN 372 574 574 ASN ASN A . n 
D 4 373 LYS 373 575 575 LYS LYS A . n 
D 4 374 HIS 374 576 576 HIS HIS A . n 
D 4 375 LEU 375 577 577 LEU LEU A . n 
D 4 376 GLN 376 578 578 GLN GLN A . n 
D 4 377 ASP 377 579 579 ASP ASP A . n 
D 4 378 LEU 378 580 580 LEU LEU A . n 
D 4 379 MET 379 581 581 MET MET A . n 
D 4 380 GLU 380 582 582 GLU ALA A . n 
D 4 381 GLY 381 583 583 GLY GLY A . n 
D 4 382 LEU 382 584 584 LEU LEU A . n 
D 4 383 THR 383 585 585 THR THR A . n 
D 4 384 ALA 384 586 586 ALA ALA A . n 
D 4 385 LYS 385 587 587 LYS LYS A . n 
D 4 386 VAL 386 588 588 VAL VAL A . n 
D 4 387 PHE 387 589 589 PHE PHE A . n 
D 4 388 ARG 388 590 590 ARG ARG A . n 
D 4 389 THR 389 591 591 THR THR A . n 
D 4 390 TYR 390 592 592 TYR TYR A . n 
D 4 391 ASN 391 593 593 ASN ASN A . n 
D 4 392 ALA 392 594 594 ALA ALA A . n 
D 4 393 SER 393 595 595 SER SER A . n 
D 4 394 ILE 394 596 596 ILE ILE A . n 
D 4 395 THR 395 597 597 THR THR A . n 
D 4 396 LEU 396 598 598 LEU LEU A . n 
D 4 397 GLN 397 599 599 GLN GLN A . n 
D 4 398 GLN 398 600 600 GLN GLN A . n 
D 4 399 GLN 399 601 601 GLN GLN A . n 
D 4 400 LEU 400 602 602 LEU LEU A . n 
D 4 401 LYS 401 603 603 LYS LYS A . n 
D 4 402 GLU 402 604 604 GLU GLU A . n 
D 4 403 LEU 403 605 605 LEU LEU A . n 
D 4 404 THR 404 606 606 THR THR A . n 
D 4 405 ALA 405 607 607 ALA ALA A . n 
D 4 406 PRO 406 608 608 PRO PRO A . n 
D 4 407 ASP 407 609 609 ASP ALA A . n 
D 4 408 GLU 408 610 610 GLU ALA A . n 
D 4 409 ASN 409 611 611 ASN ALA A . n 
D 4 410 ILE 410 612 612 ILE ILE A . n 
D 4 411 PRO 411 613 613 PRO PRO A . n 
D 4 412 ALA 412 614 614 ALA ALA A . n 
D 4 413 LYS 413 615 615 LYS LYS A . n 
D 4 414 ILE 414 616 616 ILE ILE A . n 
D 4 415 LEU 415 617 617 LEU LEU A . n 
D 4 416 SER 416 618 618 SER SER A . n 
D 4 417 TYR 417 619 619 TYR TYR A . n 
D 4 418 ASN 418 620 620 ASN ASN A . n 
D 4 419 ARG 419 621 621 ARG ARG A . n 
D 4 420 ALA 420 622 622 ALA ALA A . n 
D 4 421 ASN 421 623 623 ASN ASN A . n 
D 4 422 ARG 422 624 624 ARG ARG A . n 
D 4 423 ALA 423 625 625 ALA ALA A . n 
D 4 424 VAL 424 626 626 VAL VAL A . n 
D 4 425 ALA 425 627 ?   ?   ?   A . n 
D 4 426 ILE 426 628 ?   ?   ?   A . n 
D 4 427 LEU 427 629 ?   ?   ?   A . n 
D 4 428 CYS 428 630 ?   ?   ?   A . n 
D 4 429 ASN 429 631 ?   ?   ?   A . n 
D 4 430 HIS 430 632 ?   ?   ?   A . n 
D 4 431 GLN 431 633 ?   ?   ?   A . n 
D 4 432 ARG 432 634 ?   ?   ?   A . n 
D 4 433 ALA 433 635 ?   ?   ?   A . n 
D 4 434 PRO 434 636 ?   ?   ?   A . n 
D 4 435 PRO 435 637 ?   ?   ?   A . n 
D 4 436 LYS 436 638 ?   ?   ?   A . n 
D 4 437 THR 437 639 ?   ?   ?   A . n 
D 4 438 PHE 438 640 ?   ?   ?   A . n 
D 4 439 GLU 439 641 ?   ?   ?   A . n 
D 4 440 LYS 440 642 ?   ?   ?   A . n 
D 4 441 SER 441 643 ?   ?   ?   A . n 
D 4 442 MET 442 644 ?   ?   ?   A . n 
D 4 443 MET 443 645 ?   ?   ?   A . n 
D 4 444 ASN 444 646 ?   ?   ?   A . n 
D 4 445 LEU 445 647 ?   ?   ?   A . n 
D 4 446 GLN 446 648 ?   ?   ?   A . n 
D 4 447 THR 447 649 ?   ?   ?   A . n 
D 4 448 LYS 448 650 ?   ?   ?   A . n 
D 4 449 ILE 449 651 ?   ?   ?   A . n 
D 4 450 ASP 450 652 ?   ?   ?   A . n 
D 4 451 ALA 451 653 ?   ?   ?   A . n 
D 4 452 LYS 452 654 ?   ?   ?   A . n 
D 4 453 LYS 453 655 ?   ?   ?   A . n 
D 4 454 GLU 454 656 ?   ?   ?   A . n 
D 4 455 GLN 455 657 ?   ?   ?   A . n 
D 4 456 LEU 456 658 ?   ?   ?   A . n 
D 4 457 ALA 457 659 ?   ?   ?   A . n 
D 4 458 ASP 458 660 ?   ?   ?   A . n 
D 4 459 ALA 459 661 ?   ?   ?   A . n 
D 4 460 ARG 460 662 ?   ?   ?   A . n 
D 4 461 ARG 461 663 ?   ?   ?   A . n 
D 4 462 ASP 462 664 ?   ?   ?   A . n 
D 4 463 LEU 463 665 ?   ?   ?   A . n 
D 4 464 LYS 464 666 ?   ?   ?   A . n 
D 4 465 SER 465 667 ?   ?   ?   A . n 
D 4 466 ALA 466 668 ?   ?   ?   A . n 
D 4 467 LYS 467 669 ?   ?   ?   A . n 
D 4 468 ALA 468 670 ?   ?   ?   A . n 
D 4 469 ASP 469 671 ?   ?   ?   A . n 
D 4 470 ALA 470 672 ?   ?   ?   A . n 
D 4 471 LYS 471 673 ?   ?   ?   A . n 
D 4 472 VAL 472 674 ?   ?   ?   A . n 
D 4 473 MET 473 675 ?   ?   ?   A . n 
D 4 474 LYS 474 676 ?   ?   ?   A . n 
D 4 475 ASP 475 677 ?   ?   ?   A . n 
D 4 476 ALA 476 678 ?   ?   ?   A . n 
D 4 477 LYS 477 679 ?   ?   ?   A . n 
D 4 478 THR 478 680 ?   ?   ?   A . n 
D 4 479 LYS 479 681 ?   ?   ?   A . n 
D 4 480 LYS 480 682 ?   ?   ?   A . n 
D 4 481 VAL 481 683 ?   ?   ?   A . n 
D 4 482 VAL 482 684 ?   ?   ?   A . n 
D 4 483 GLU 483 685 ?   ?   ?   A . n 
D 4 484 SER 484 686 ?   ?   ?   A . n 
D 4 485 LYS 485 687 ?   ?   ?   A . n 
D 4 486 LYS 486 688 ?   ?   ?   A . n 
D 4 487 LYS 487 689 ?   ?   ?   A . n 
D 4 488 ALA 488 690 ?   ?   ?   A . n 
D 4 489 VAL 489 691 ?   ?   ?   A . n 
D 4 490 GLN 490 692 ?   ?   ?   A . n 
D 4 491 ARG 491 693 ?   ?   ?   A . n 
D 4 492 LEU 492 694 ?   ?   ?   A . n 
D 4 493 GLU 493 695 ?   ?   ?   A . n 
D 4 494 GLU 494 696 ?   ?   ?   A . n 
D 4 495 GLN 495 697 ?   ?   ?   A . n 
D 4 496 LEU 496 698 ?   ?   ?   A . n 
D 4 497 MET 497 699 ?   ?   ?   A . n 
D 4 498 LYS 498 700 ?   ?   ?   A . n 
D 4 499 LEU 499 701 ?   ?   ?   A . n 
D 4 500 GLU 500 702 ?   ?   ?   A . n 
D 4 501 VAL 501 703 ?   ?   ?   A . n 
D 4 502 GLN 502 704 ?   ?   ?   A . n 
D 4 503 ALA 503 705 ?   ?   ?   A . n 
D 4 504 THR 504 706 ?   ?   ?   A . n 
D 4 505 ASP 505 707 ?   ?   ?   A . n 
D 4 506 ARG 506 708 ?   ?   ?   A . n 
D 4 507 GLU 507 709 ?   ?   ?   A . n 
D 4 508 GLU 508 710 ?   ?   ?   A . n 
D 4 509 ASN 509 711 ?   ?   ?   A . n 
D 4 510 LYS 510 712 ?   ?   ?   A . n 
D 4 511 GLN 511 713 ?   ?   ?   A . n 
D 4 512 ILE 512 714 ?   ?   ?   A . n 
D 4 513 ALA 513 715 ?   ?   ?   A . n 
D 4 514 LEU 514 716 ?   ?   ?   A . n 
D 4 515 GLY 515 717 ?   ?   ?   A . n 
D 4 516 THR 516 718 ?   ?   ?   A . n 
D 4 517 SER 517 719 719 SER SER A . n 
D 4 518 LYS 518 720 720 LYS LYS A . n 
D 4 519 LEU 519 721 721 LEU LEU A . n 
D 4 520 ASN 520 722 722 ASN ASN A . n 
D 4 521 PTR 521 723 723 PTR PTR A . n 
D 4 522 LEU 522 724 724 LEU LEU A . n 
D 4 523 ASP 523 725 725 ASP ASP A . n 
D 4 524 PRO 524 726 726 PRO PRO A . n 
D 4 525 ARG 525 727 727 ARG ARG A . n 
D 4 526 ILE 526 728 728 ILE ILE A . n 
D 4 527 THR 527 729 729 THR THR A . n 
D 4 528 VAL 528 730 730 VAL VAL A . n 
D 4 529 ALA 529 731 731 ALA ALA A . n 
D 4 530 TRP 530 732 732 TRP TRP A . n 
D 4 531 CYS 531 733 733 CYS CYS A . n 
D 4 532 LYS 532 734 734 LYS LYS A . n 
D 4 533 LYS 533 735 735 LYS ALA A . n 
D 4 534 TRP 534 736 736 TRP TRP A . n 
D 4 535 GLY 535 737 737 GLY GLY A . n 
D 4 536 VAL 536 738 738 VAL VAL A . n 
D 4 537 PRO 537 739 739 PRO PRO A . n 
D 4 538 ILE 538 740 740 ILE ILE A . n 
D 4 539 GLU 539 741 741 GLU ALA A . n 
D 4 540 LYS 540 742 742 LYS ALA A . n 
D 4 541 ILE 541 743 743 ILE ILE A . n 
D 4 542 TYR 542 744 744 TYR TYR A . n 
D 4 543 ASN 543 745 745 ASN ASN A . n 
D 4 544 LYS 544 746 746 LYS LYS A . n 
D 4 545 THR 545 747 747 THR THR A . n 
D 4 546 GLN 546 748 748 GLN GLN A . n 
D 4 547 ARG 547 749 749 ARG ARG A . n 
D 4 548 GLU 548 750 750 GLU GLU A . n 
D 4 549 LYS 549 751 751 LYS LYS A . n 
D 4 550 PHE 550 752 752 PHE PHE A . n 
D 4 551 ALA 551 753 753 ALA ALA A . n 
D 4 552 TRP 552 754 754 TRP TRP A . n 
D 4 553 ALA 553 755 755 ALA ALA A . n 
D 4 554 ILE 554 756 756 ILE ILE A . n 
D 4 555 ASP 555 757 757 ASP ASP A . n 
D 4 556 MET 556 758 758 MET MET A . n 
D 4 557 ALA 557 759 759 ALA ALA A . n 
D 4 558 ASP 558 760 760 ASP ALA A . n 
D 4 559 GLU 559 761 761 GLU GLU A . n 
D 4 560 ASP 560 762 762 ASP ALA A . n 
D 4 561 TYR 561 763 763 TYR TYR A . n 
D 4 562 GLU 562 764 764 GLU ALA A . n 
D 4 563 PHE 563 765 765 PHE PHE A . n 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A UBB 10  B UBB 10  ? U   "2',3'-DIDEOXY-URIDINE-5'-MONOPHOSPHATE" 
2 B GNG 1   C GNG 11  ? G   "2'-DEOXY-GUANOSINE"                     
3 C CAR 12  D CAR 112 ? DC  
;CYTOSINE ARABINOSE-5'-PHOSPHATE
;
4 D PTR 521 A PTR 723 ? TYR O-PHOSPHOTYROSINE                        
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2003-03-04 
2 'Structure model' 1 1 2008-04-29 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
AMoRE     phasing           . ? 3 
CNS       refinement        . ? 4 
HKL-2000  'data reduction'  . ? 5 
# 
_pdbx_database_remark.id     999 
_pdbx_database_remark.text   
;SEQUENCE
The DNA (duplex oligo) was added to the 
protein during crystallization.  At this 
time, the protein initiates a transesterification 
reaction in which one strand of DNA is broken into
chains B and C, and the protein chain A is covalently 
linked to the DNA through residue 723.
;
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    556 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   N 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ASN 
_pdbx_validate_close_contact.auth_seq_id_2    557 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.69 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C3'" D CAR 112 ? ? "O3'" D CAR 112 ? ? P     D DA  113 ? ? 92.83  119.70 -26.87 1.20 Y 
2  1 "O3'" D CAR 112 ? ? P     D DA  113 ? ? "O5'" D DA  113 ? ? 86.13  104.00 -17.87 1.90 Y 
3  1 CA    A MET 555 ? ? C     A MET 555 ? ? O     A MET 555 ? ? 105.89 120.10 -14.21 2.10 N 
4  1 O     A MET 555 ? ? C     A MET 555 ? ? N     A GLU 556 ? ? 98.94  122.70 -23.76 1.60 Y 
5  1 C     A MET 555 ? ? N     A GLU 556 ? ? CA    A GLU 556 ? ? 158.52 121.70 36.82  2.50 Y 
6  1 CA    A GLU 556 ? ? C     A GLU 556 ? ? O     A GLU 556 ? ? 105.20 120.10 -14.90 2.10 N 
7  1 CA    A GLU 556 ? ? C     A GLU 556 ? ? N     A ASN 557 ? ? 159.97 117.20 42.77  2.20 Y 
8  1 O     A GLU 556 ? ? C     A GLU 556 ? ? N     A ASN 557 ? ? 83.24  122.70 -39.46 1.60 Y 
9  1 C     A GLU 556 ? ? N     A ASN 557 ? ? CA    A ASN 557 ? ? 137.98 121.70 16.28  2.50 Y 
10 1 N     A ASN 557 ? ? CA    A ASN 557 ? ? CB    A ASN 557 ? ? 65.56  110.60 -45.04 1.80 N 
11 1 N     A ASN 557 ? ? CA    A ASN 557 ? ? C     A ASN 557 ? ? 94.09  111.00 -16.91 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PRO A 212 ? ? -58.83  175.30  
2  1 PRO A 230 ? ? -27.32  116.52  
3  1 TYR A 231 ? ? -27.57  119.12  
4  1 LYS A 239 ? ? -123.55 -164.98 
5  1 PHE A 240 ? ? 179.79  96.23   
6  1 ASP A 243 ? ? 32.44   49.33   
7  1 PRO A 251 ? ? -50.50  -9.49   
8  1 MET A 263 ? ? -151.59 64.33   
9  1 ASP A 265 ? ? -91.07  45.92   
10 1 GLU A 267 ? ? -58.37  -6.00   
11 1 GLU A 285 ? ? -79.42  22.92   
12 1 SER A 320 ? ? -59.78  171.79  
13 1 LYS A 321 ? ? -78.65  34.18   
14 1 GLU A 322 ? ? -156.71 -30.88  
15 1 MET A 343 ? ? -154.83 -158.75 
16 1 ASP A 344 ? ? -52.35  -74.37  
17 1 ASN A 345 ? ? -78.52  -100.45 
18 1 PRO A 368 ? ? -57.92  -9.29   
19 1 ARG A 375 ? ? -47.97  160.57  
20 1 PRO A 397 ? ? -16.98  98.06   
21 1 HIS A 406 ? ? -108.11 50.45   
22 1 ILE A 420 ? ? -73.70  -71.56  
23 1 PRO A 431 ? ? -58.37  -3.92   
24 1 LYS A 451 ? ? -26.78  -49.02  
25 1 LYS A 466 ? ? -98.15  37.44   
26 1 MET A 470 ? ? -43.10  -83.00  
27 1 LYS A 484 ? ? -70.92  -72.29  
28 1 TYR A 523 ? ? 56.26   76.00   
29 1 MET A 555 ? ? -66.34  17.46   
30 1 ARG A 567 ? ? -103.62 70.36   
31 1 LEU A 568 ? ? -171.53 135.27  
32 1 ASP A 609 ? ? -86.17  37.07   
33 1 ASN A 611 ? ? -106.87 -152.00 
34 1 ILE A 612 ? ? -59.27  -99.35  
35 1 PRO A 613 ? ? -62.99  0.47    
36 1 PTR A 723 ? ? 63.98   -38.94  
37 1 ILE A 743 ? ? -94.12  -65.92  
38 1 ASN A 745 ? ? -73.07  -168.52 
39 1 ASP A 760 ? ? -104.55 -163.36 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLU 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    556 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASN 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    557 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -81.25 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 MET A 555 ? ? -41.10 
2 1 GLU A 556 ? ? 55.55  
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 DC B 8   ? ? 0.070 'SIDE CHAIN' 
2 1 DU C 18  ? ? 0.068 'SIDE CHAIN' 
3 1 DG D 115 ? ? 0.062 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ARG 210 ? CB  ? D ARG 8   CB  
2   1 Y 1 A ARG 210 ? CG  ? D ARG 8   CG  
3   1 Y 1 A ARG 210 ? CD  ? D ARG 8   CD  
4   1 Y 1 A ARG 210 ? NE  ? D ARG 8   NE  
5   1 Y 1 A ARG 210 ? CZ  ? D ARG 8   CZ  
6   1 Y 1 A ARG 210 ? NH1 ? D ARG 8   NH1 
7   1 Y 1 A ARG 210 ? NH2 ? D ARG 8   NH2 
8   1 Y 1 A TYR 211 ? CB  ? D TYR 9   CB  
9   1 Y 1 A TYR 211 ? CG  ? D TYR 9   CG  
10  1 Y 1 A TYR 211 ? CD1 ? D TYR 9   CD1 
11  1 Y 1 A TYR 211 ? CD2 ? D TYR 9   CD2 
12  1 Y 1 A TYR 211 ? CE1 ? D TYR 9   CE1 
13  1 Y 1 A TYR 211 ? CE2 ? D TYR 9   CE2 
14  1 Y 1 A TYR 211 ? CZ  ? D TYR 9   CZ  
15  1 Y 1 A TYR 211 ? OH  ? D TYR 9   OH  
16  1 Y 1 A GLU 213 ? CB  ? D GLU 11  CB  
17  1 Y 1 A GLU 213 ? CG  ? D GLU 11  CG  
18  1 Y 1 A GLU 213 ? CD  ? D GLU 11  CD  
19  1 Y 1 A GLU 213 ? OE1 ? D GLU 11  OE1 
20  1 Y 1 A GLU 213 ? OE2 ? D GLU 11  OE2 
21  1 Y 1 A ILE 215 ? CB  ? D ILE 13  CB  
22  1 Y 1 A ILE 215 ? CG1 ? D ILE 13  CG1 
23  1 Y 1 A ILE 215 ? CG2 ? D ILE 13  CG2 
24  1 Y 1 A ILE 215 ? CD1 ? D ILE 13  CD1 
25  1 Y 1 A LYS 218 ? CB  ? D LYS 16  CB  
26  1 Y 1 A LYS 218 ? CG  ? D LYS 16  CG  
27  1 Y 1 A LYS 218 ? CD  ? D LYS 16  CD  
28  1 Y 1 A LYS 218 ? CE  ? D LYS 16  CE  
29  1 Y 1 A LYS 218 ? NZ  ? D LYS 16  NZ  
30  1 Y 1 A GLU 236 ? CB  ? D GLU 34  CB  
31  1 Y 1 A GLU 236 ? CG  ? D GLU 34  CG  
32  1 Y 1 A GLU 236 ? CD  ? D GLU 34  CD  
33  1 Y 1 A GLU 236 ? OE1 ? D GLU 34  OE1 
34  1 Y 1 A GLU 236 ? OE2 ? D GLU 34  OE2 
35  1 Y 1 A LYS 239 ? CB  ? D LYS 37  CB  
36  1 Y 1 A LYS 239 ? CG  ? D LYS 37  CG  
37  1 Y 1 A LYS 239 ? CD  ? D LYS 37  CD  
38  1 Y 1 A LYS 239 ? CE  ? D LYS 37  CE  
39  1 Y 1 A LYS 239 ? NZ  ? D LYS 37  NZ  
40  1 Y 1 A ASP 243 ? CB  ? D ASP 41  CB  
41  1 Y 1 A ASP 243 ? CG  ? D ASP 41  CG  
42  1 Y 1 A ASP 243 ? OD1 ? D ASP 41  OD1 
43  1 Y 1 A ASP 243 ? OD2 ? D ASP 41  OD2 
44  1 Y 1 A MET 247 ? CB  ? D MET 45  CB  
45  1 Y 1 A MET 247 ? CG  ? D MET 45  CG  
46  1 Y 1 A MET 247 ? SD  ? D MET 45  SD  
47  1 Y 1 A MET 247 ? CE  ? D MET 45  CE  
48  1 Y 1 A LYS 248 ? CG  ? D LYS 46  CG  
49  1 Y 1 A LYS 248 ? CD  ? D LYS 46  CD  
50  1 Y 1 A LYS 248 ? CE  ? D LYS 46  CE  
51  1 Y 1 A LYS 248 ? NZ  ? D LYS 46  NZ  
52  1 Y 1 A MET 263 ? CG  ? D MET 61  CG  
53  1 Y 1 A MET 263 ? SD  ? D MET 61  SD  
54  1 Y 1 A MET 263 ? CE  ? D MET 61  CE  
55  1 Y 1 A GLU 267 ? CB  ? D GLU 65  CB  
56  1 Y 1 A GLU 267 ? CG  ? D GLU 65  CG  
57  1 Y 1 A GLU 267 ? CD  ? D GLU 65  CD  
58  1 Y 1 A GLU 267 ? OE1 ? D GLU 65  OE1 
59  1 Y 1 A GLU 267 ? OE2 ? D GLU 65  OE2 
60  1 Y 1 A THR 270 ? CB  ? D THR 68  CB  
61  1 Y 1 A THR 270 ? OG1 ? D THR 68  OG1 
62  1 Y 1 A THR 270 ? CG2 ? D THR 68  CG2 
63  1 Y 1 A LYS 271 ? CB  ? D LYS 69  CB  
64  1 Y 1 A LYS 271 ? CG  ? D LYS 69  CG  
65  1 Y 1 A LYS 271 ? CD  ? D LYS 69  CD  
66  1 Y 1 A LYS 271 ? CE  ? D LYS 69  CE  
67  1 Y 1 A LYS 271 ? NZ  ? D LYS 69  NZ  
68  1 Y 1 A GLU 272 ? CB  ? D GLU 70  CB  
69  1 Y 1 A GLU 272 ? CG  ? D GLU 70  CG  
70  1 Y 1 A GLU 272 ? CD  ? D GLU 70  CD  
71  1 Y 1 A GLU 272 ? OE1 ? D GLU 70  OE1 
72  1 Y 1 A GLU 272 ? OE2 ? D GLU 70  OE2 
73  1 Y 1 A LYS 276 ? CG  ? D LYS 74  CG  
74  1 Y 1 A LYS 276 ? CD  ? D LYS 74  CD  
75  1 Y 1 A LYS 276 ? CE  ? D LYS 74  CE  
76  1 Y 1 A LYS 276 ? NZ  ? D LYS 74  NZ  
77  1 Y 1 A LYS 280 ? CB  ? D LYS 78  CB  
78  1 Y 1 A LYS 280 ? CG  ? D LYS 78  CG  
79  1 Y 1 A LYS 280 ? CD  ? D LYS 78  CD  
80  1 Y 1 A LYS 280 ? CE  ? D LYS 78  CE  
81  1 Y 1 A LYS 280 ? NZ  ? D LYS 78  NZ  
82  1 Y 1 A ARG 283 ? CB  ? D ARG 81  CB  
83  1 Y 1 A ARG 283 ? CG  ? D ARG 81  CG  
84  1 Y 1 A ARG 283 ? CD  ? D ARG 81  CD  
85  1 Y 1 A ARG 283 ? NE  ? D ARG 81  NE  
86  1 Y 1 A ARG 283 ? CZ  ? D ARG 81  CZ  
87  1 Y 1 A ARG 283 ? NH1 ? D ARG 81  NH1 
88  1 Y 1 A ARG 283 ? NH2 ? D ARG 81  NH2 
89  1 Y 1 A GLU 285 ? CB  ? D GLU 83  CB  
90  1 Y 1 A GLU 285 ? CG  ? D GLU 83  CG  
91  1 Y 1 A GLU 285 ? CD  ? D GLU 83  CD  
92  1 Y 1 A GLU 285 ? OE1 ? D GLU 83  OE1 
93  1 Y 1 A GLU 285 ? OE2 ? D GLU 83  OE2 
94  1 Y 1 A ASN 288 ? CB  ? D ASN 86  CB  
95  1 Y 1 A ASN 288 ? CG  ? D ASN 86  CG  
96  1 Y 1 A ASN 288 ? OD1 ? D ASN 86  OD1 
97  1 Y 1 A ASN 288 ? ND2 ? D ASN 86  ND2 
98  1 Y 1 A GLU 289 ? CG  ? D GLU 87  CG  
99  1 Y 1 A GLU 289 ? CD  ? D GLU 87  CD  
100 1 Y 1 A GLU 289 ? OE1 ? D GLU 87  OE1 
101 1 Y 1 A GLU 289 ? OE2 ? D GLU 87  OE2 
102 1 Y 1 A LYS 291 ? CB  ? D LYS 89  CB  
103 1 Y 1 A LYS 291 ? CG  ? D LYS 89  CG  
104 1 Y 1 A LYS 291 ? CD  ? D LYS 89  CD  
105 1 Y 1 A LYS 291 ? CE  ? D LYS 89  CE  
106 1 Y 1 A LYS 291 ? NZ  ? D LYS 89  NZ  
107 1 Y 1 A ASN 292 ? CB  ? D ASN 90  CB  
108 1 Y 1 A ASN 292 ? CG  ? D ASN 90  CG  
109 1 Y 1 A ASN 292 ? OD1 ? D ASN 90  OD1 
110 1 Y 1 A ASN 292 ? ND2 ? D ASN 90  ND2 
111 1 Y 1 A ASN 296 ? CB  ? D ASN 94  CB  
112 1 Y 1 A ASN 296 ? CG  ? D ASN 94  CG  
113 1 Y 1 A ASN 296 ? OD1 ? D ASN 94  OD1 
114 1 Y 1 A ASN 296 ? ND2 ? D ASN 94  ND2 
115 1 Y 1 A GLN 304 ? CB  ? D GLN 102 CB  
116 1 Y 1 A GLN 304 ? CG  ? D GLN 102 CG  
117 1 Y 1 A GLN 304 ? CD  ? D GLN 102 CD  
118 1 Y 1 A GLN 304 ? OE1 ? D GLN 102 OE1 
119 1 Y 1 A GLN 304 ? NE2 ? D GLN 102 NE2 
120 1 Y 1 A GLN 307 ? CB  ? D GLN 105 CB  
121 1 Y 1 A GLN 307 ? CG  ? D GLN 105 CG  
122 1 Y 1 A GLN 307 ? CD  ? D GLN 105 CD  
123 1 Y 1 A GLN 307 ? OE1 ? D GLN 105 OE1 
124 1 Y 1 A GLN 307 ? NE2 ? D GLN 105 NE2 
125 1 Y 1 A PHE 309 ? CB  ? D PHE 107 CB  
126 1 Y 1 A PHE 309 ? CG  ? D PHE 107 CG  
127 1 Y 1 A PHE 309 ? CD1 ? D PHE 107 CD1 
128 1 Y 1 A PHE 309 ? CD2 ? D PHE 107 CD2 
129 1 Y 1 A PHE 309 ? CE1 ? D PHE 107 CE1 
130 1 Y 1 A PHE 309 ? CE2 ? D PHE 107 CE2 
131 1 Y 1 A PHE 309 ? CZ  ? D PHE 107 CZ  
132 1 Y 1 A GLN 312 ? CB  ? D GLN 110 CB  
133 1 Y 1 A GLN 312 ? CG  ? D GLN 110 CG  
134 1 Y 1 A GLN 312 ? CD  ? D GLN 110 CD  
135 1 Y 1 A GLN 312 ? OE1 ? D GLN 110 OE1 
136 1 Y 1 A GLN 312 ? NE2 ? D GLN 110 NE2 
137 1 Y 1 A GLU 314 ? CG  ? D GLU 112 CG  
138 1 Y 1 A GLU 314 ? CD  ? D GLU 112 CD  
139 1 Y 1 A GLU 314 ? OE1 ? D GLU 112 OE1 
140 1 Y 1 A GLU 314 ? OE2 ? D GLU 112 OE2 
141 1 Y 1 A ARG 316 ? CG  ? D ARG 114 CG  
142 1 Y 1 A ARG 316 ? CD  ? D ARG 114 CD  
143 1 Y 1 A ARG 316 ? NE  ? D ARG 114 NE  
144 1 Y 1 A ARG 316 ? CZ  ? D ARG 114 CZ  
145 1 Y 1 A ARG 316 ? NH1 ? D ARG 114 NH1 
146 1 Y 1 A ARG 316 ? NH2 ? D ARG 114 NH2 
147 1 Y 1 A LYS 317 ? CG  ? D LYS 115 CG  
148 1 Y 1 A LYS 317 ? CD  ? D LYS 115 CD  
149 1 Y 1 A LYS 317 ? CE  ? D LYS 115 CE  
150 1 Y 1 A LYS 317 ? NZ  ? D LYS 115 NZ  
151 1 Y 1 A GLN 318 ? CG  ? D GLN 116 CG  
152 1 Y 1 A GLN 318 ? CD  ? D GLN 116 CD  
153 1 Y 1 A GLN 318 ? OE1 ? D GLN 116 OE1 
154 1 Y 1 A GLN 318 ? NE2 ? D GLN 116 NE2 
155 1 Y 1 A MET 319 ? CG  ? D MET 117 CG  
156 1 Y 1 A MET 319 ? SD  ? D MET 117 SD  
157 1 Y 1 A MET 319 ? CE  ? D MET 117 CE  
158 1 Y 1 A LYS 321 ? CG  ? D LYS 119 CG  
159 1 Y 1 A LYS 321 ? CD  ? D LYS 119 CD  
160 1 Y 1 A LYS 321 ? CE  ? D LYS 119 CE  
161 1 Y 1 A LYS 321 ? NZ  ? D LYS 119 NZ  
162 1 Y 1 A GLU 322 ? CG  ? D GLU 120 CG  
163 1 Y 1 A GLU 322 ? CD  ? D GLU 120 CD  
164 1 Y 1 A GLU 322 ? OE1 ? D GLU 120 OE1 
165 1 Y 1 A GLU 322 ? OE2 ? D GLU 120 OE2 
166 1 Y 1 A GLU 323 ? CG  ? D GLU 121 CG  
167 1 Y 1 A GLU 323 ? CD  ? D GLU 121 CD  
168 1 Y 1 A GLU 323 ? OE1 ? D GLU 121 OE1 
169 1 Y 1 A GLU 323 ? OE2 ? D GLU 121 OE2 
170 1 Y 1 A LYS 324 ? CB  ? D LYS 122 CB  
171 1 Y 1 A LYS 324 ? CG  ? D LYS 122 CG  
172 1 Y 1 A LYS 324 ? CD  ? D LYS 122 CD  
173 1 Y 1 A LYS 324 ? CE  ? D LYS 122 CE  
174 1 Y 1 A LYS 324 ? NZ  ? D LYS 122 NZ  
175 1 Y 1 A LYS 326 ? CG  ? D LYS 124 CG  
176 1 Y 1 A LYS 326 ? CD  ? D LYS 124 CD  
177 1 Y 1 A LYS 326 ? CE  ? D LYS 124 CE  
178 1 Y 1 A LYS 326 ? NZ  ? D LYS 124 NZ  
179 1 Y 1 A ILE 327 ? CB  ? D ILE 125 CB  
180 1 Y 1 A ILE 327 ? CG1 ? D ILE 125 CG1 
181 1 Y 1 A ILE 327 ? CG2 ? D ILE 125 CG2 
182 1 Y 1 A ILE 327 ? CD1 ? D ILE 125 CD1 
183 1 Y 1 A LYS 328 ? CB  ? D LYS 126 CB  
184 1 Y 1 A LYS 328 ? CG  ? D LYS 126 CG  
185 1 Y 1 A LYS 328 ? CD  ? D LYS 126 CD  
186 1 Y 1 A LYS 328 ? CE  ? D LYS 126 CE  
187 1 Y 1 A LYS 328 ? NZ  ? D LYS 126 NZ  
188 1 Y 1 A GLU 329 ? CB  ? D GLU 127 CB  
189 1 Y 1 A GLU 329 ? CG  ? D GLU 127 CG  
190 1 Y 1 A GLU 329 ? CD  ? D GLU 127 CD  
191 1 Y 1 A GLU 329 ? OE1 ? D GLU 127 OE1 
192 1 Y 1 A GLU 329 ? OE2 ? D GLU 127 OE2 
193 1 Y 1 A GLU 330 ? CB  ? D GLU 128 CB  
194 1 Y 1 A GLU 330 ? CG  ? D GLU 128 CG  
195 1 Y 1 A GLU 330 ? CD  ? D GLU 128 CD  
196 1 Y 1 A GLU 330 ? OE1 ? D GLU 128 OE1 
197 1 Y 1 A GLU 330 ? OE2 ? D GLU 128 OE2 
198 1 Y 1 A ASN 331 ? CB  ? D ASN 129 CB  
199 1 Y 1 A ASN 331 ? CG  ? D ASN 129 CG  
200 1 Y 1 A ASN 331 ? OD1 ? D ASN 129 OD1 
201 1 Y 1 A ASN 331 ? ND2 ? D ASN 129 ND2 
202 1 Y 1 A GLU 332 ? CG  ? D GLU 130 CG  
203 1 Y 1 A GLU 332 ? CD  ? D GLU 130 CD  
204 1 Y 1 A GLU 332 ? OE1 ? D GLU 130 OE1 
205 1 Y 1 A GLU 332 ? OE2 ? D GLU 130 OE2 
206 1 Y 1 A LYS 333 ? CG  ? D LYS 131 CG  
207 1 Y 1 A LYS 333 ? CD  ? D LYS 131 CD  
208 1 Y 1 A LYS 333 ? CE  ? D LYS 131 CE  
209 1 Y 1 A LYS 333 ? NZ  ? D LYS 131 NZ  
210 1 Y 1 A LEU 335 ? CB  ? D LEU 133 CB  
211 1 Y 1 A LEU 335 ? CG  ? D LEU 133 CG  
212 1 Y 1 A LEU 335 ? CD1 ? D LEU 133 CD1 
213 1 Y 1 A LEU 335 ? CD2 ? D LEU 133 CD2 
214 1 Y 1 A GLU 337 ? CB  ? D GLU 135 CB  
215 1 Y 1 A GLU 337 ? CG  ? D GLU 135 CG  
216 1 Y 1 A GLU 337 ? CD  ? D GLU 135 CD  
217 1 Y 1 A GLU 337 ? OE1 ? D GLU 135 OE1 
218 1 Y 1 A GLU 337 ? OE2 ? D GLU 135 OE2 
219 1 Y 1 A ILE 342 ? CB  ? D ILE 140 CB  
220 1 Y 1 A ILE 342 ? CG1 ? D ILE 140 CG1 
221 1 Y 1 A ILE 342 ? CG2 ? D ILE 140 CG2 
222 1 Y 1 A ILE 342 ? CD1 ? D ILE 140 CD1 
223 1 Y 1 A ASN 345 ? CB  ? D ASN 143 CB  
224 1 Y 1 A ASN 345 ? CG  ? D ASN 143 CG  
225 1 Y 1 A ASN 345 ? OD1 ? D ASN 143 OD1 
226 1 Y 1 A ASN 345 ? ND2 ? D ASN 143 ND2 
227 1 Y 1 A HIS 346 ? CB  ? D HIS 144 CB  
228 1 Y 1 A HIS 346 ? CG  ? D HIS 144 CG  
229 1 Y 1 A HIS 346 ? ND1 ? D HIS 144 ND1 
230 1 Y 1 A HIS 346 ? CD2 ? D HIS 144 CD2 
231 1 Y 1 A HIS 346 ? CE1 ? D HIS 144 CE1 
232 1 Y 1 A HIS 346 ? NE2 ? D HIS 144 NE2 
233 1 Y 1 A GLU 348 ? CG  ? D GLU 146 CG  
234 1 Y 1 A GLU 348 ? CD  ? D GLU 146 CD  
235 1 Y 1 A GLU 348 ? OE1 ? D GLU 146 OE1 
236 1 Y 1 A GLU 348 ? OE2 ? D GLU 146 OE2 
237 1 Y 1 A ARG 362 ? CB  ? D ARG 160 CB  
238 1 Y 1 A ARG 362 ? CG  ? D ARG 160 CG  
239 1 Y 1 A ARG 362 ? CD  ? D ARG 160 CD  
240 1 Y 1 A ARG 362 ? NE  ? D ARG 160 NE  
241 1 Y 1 A ARG 362 ? CZ  ? D ARG 160 CZ  
242 1 Y 1 A ARG 362 ? NH1 ? D ARG 160 NH1 
243 1 Y 1 A ARG 362 ? NH2 ? D ARG 160 NH2 
244 1 Y 1 A ASN 366 ? CB  ? D ASN 164 CB  
245 1 Y 1 A ASN 366 ? CG  ? D ASN 164 CG  
246 1 Y 1 A ASN 366 ? OD1 ? D ASN 164 OD1 
247 1 Y 1 A ASN 366 ? ND2 ? D ASN 164 ND2 
248 1 Y 1 A LYS 388 ? CB  ? D LYS 186 CB  
249 1 Y 1 A LYS 388 ? CG  ? D LYS 186 CG  
250 1 Y 1 A LYS 388 ? CD  ? D LYS 186 CD  
251 1 Y 1 A LYS 388 ? CE  ? D LYS 186 CE  
252 1 Y 1 A LYS 388 ? NZ  ? D LYS 186 NZ  
253 1 Y 1 A LYS 452 ? CB  ? D LYS 250 CB  
254 1 Y 1 A LYS 452 ? CG  ? D LYS 250 CG  
255 1 Y 1 A LYS 452 ? CD  ? D LYS 250 CD  
256 1 Y 1 A LYS 452 ? CE  ? D LYS 250 CE  
257 1 Y 1 A LYS 452 ? NZ  ? D LYS 250 NZ  
258 1 Y 1 A ASP 455 ? CB  ? D ASP 253 CB  
259 1 Y 1 A ASP 455 ? CG  ? D ASP 253 CG  
260 1 Y 1 A ASP 455 ? OD1 ? D ASP 253 OD1 
261 1 Y 1 A ASP 455 ? OD2 ? D ASP 253 OD2 
262 1 Y 1 A GLN 460 ? CB  ? D GLN 258 CB  
263 1 Y 1 A GLN 460 ? CG  ? D GLN 258 CG  
264 1 Y 1 A GLN 460 ? CD  ? D GLN 258 CD  
265 1 Y 1 A GLN 460 ? OE1 ? D GLN 258 OE1 
266 1 Y 1 A GLN 460 ? NE2 ? D GLN 258 NE2 
267 1 Y 1 A ARG 462 ? CG  ? D ARG 260 CG  
268 1 Y 1 A ARG 462 ? CD  ? D ARG 260 CD  
269 1 Y 1 A ARG 462 ? NE  ? D ARG 260 NE  
270 1 Y 1 A ARG 462 ? CZ  ? D ARG 260 CZ  
271 1 Y 1 A ARG 462 ? NH1 ? D ARG 260 NH1 
272 1 Y 1 A ARG 462 ? NH2 ? D ARG 260 NH2 
273 1 Y 1 A GLU 463 ? CG  ? D GLU 261 CG  
274 1 Y 1 A GLU 463 ? CD  ? D GLU 261 CD  
275 1 Y 1 A GLU 463 ? OE1 ? D GLU 261 OE1 
276 1 Y 1 A GLU 463 ? OE2 ? D GLU 261 OE2 
277 1 Y 1 A LYS 466 ? CG  ? D LYS 264 CG  
278 1 Y 1 A LYS 466 ? CD  ? D LYS 264 CD  
279 1 Y 1 A LYS 466 ? CE  ? D LYS 264 CE  
280 1 Y 1 A LYS 466 ? NZ  ? D LYS 264 NZ  
281 1 Y 1 A LYS 468 ? CG  ? D LYS 266 CG  
282 1 Y 1 A LYS 468 ? CD  ? D LYS 266 CD  
283 1 Y 1 A LYS 468 ? CE  ? D LYS 266 CE  
284 1 Y 1 A LYS 468 ? NZ  ? D LYS 266 NZ  
285 1 Y 1 A LYS 471 ? CG  ? D LYS 269 CG  
286 1 Y 1 A LYS 471 ? CD  ? D LYS 269 CD  
287 1 Y 1 A LYS 471 ? CE  ? D LYS 269 CE  
288 1 Y 1 A LYS 471 ? NZ  ? D LYS 269 NZ  
289 1 Y 1 A LYS 484 ? CG  ? D LYS 282 CG  
290 1 Y 1 A LYS 484 ? CD  ? D LYS 282 CD  
291 1 Y 1 A LYS 484 ? CE  ? D LYS 282 CE  
292 1 Y 1 A LYS 484 ? NZ  ? D LYS 282 NZ  
293 1 Y 1 A GLU 492 ? CB  ? D GLU 290 CB  
294 1 Y 1 A GLU 492 ? CG  ? D GLU 290 CG  
295 1 Y 1 A GLU 492 ? CD  ? D GLU 290 CD  
296 1 Y 1 A GLU 492 ? OE1 ? D GLU 290 OE1 
297 1 Y 1 A GLU 492 ? OE2 ? D GLU 290 OE2 
298 1 Y 1 A GLU 494 ? CB  ? D GLU 292 CB  
299 1 Y 1 A GLU 494 ? CG  ? D GLU 292 CG  
300 1 Y 1 A GLU 494 ? CD  ? D GLU 292 CD  
301 1 Y 1 A GLU 494 ? OE1 ? D GLU 292 OE1 
302 1 Y 1 A GLU 494 ? OE2 ? D GLU 292 OE2 
303 1 Y 1 A GLU 495 ? CG  ? D GLU 293 CG  
304 1 Y 1 A GLU 495 ? CD  ? D GLU 293 CD  
305 1 Y 1 A GLU 495 ? OE1 ? D GLU 293 OE1 
306 1 Y 1 A GLU 495 ? OE2 ? D GLU 293 OE2 
307 1 Y 1 A GLU 497 ? CB  ? D GLU 295 CB  
308 1 Y 1 A GLU 497 ? CG  ? D GLU 295 CG  
309 1 Y 1 A GLU 497 ? CD  ? D GLU 295 CD  
310 1 Y 1 A GLU 497 ? OE1 ? D GLU 295 OE1 
311 1 Y 1 A GLU 497 ? OE2 ? D GLU 295 OE2 
312 1 Y 1 A GLU 517 ? CG  ? D GLU 315 CG  
313 1 Y 1 A GLU 517 ? CD  ? D GLU 315 CD  
314 1 Y 1 A GLU 517 ? OE1 ? D GLU 315 OE1 
315 1 Y 1 A GLU 517 ? OE2 ? D GLU 315 OE2 
316 1 Y 1 A GLU 522 ? CB  ? D GLU 320 CB  
317 1 Y 1 A GLU 522 ? CG  ? D GLU 320 CG  
318 1 Y 1 A GLU 522 ? CD  ? D GLU 320 CD  
319 1 Y 1 A GLU 522 ? OE1 ? D GLU 320 OE1 
320 1 Y 1 A GLU 522 ? OE2 ? D GLU 320 OE2 
321 1 Y 1 A LYS 532 ? O   ? D LYS 330 O   
322 1 Y 1 A ASP 533 ? CB  ? D ASP 331 CB  
323 1 Y 1 A ASP 533 ? CG  ? D ASP 331 CG  
324 1 Y 1 A ASP 533 ? OD1 ? D ASP 331 OD1 
325 1 Y 1 A ASP 533 ? OD2 ? D ASP 331 OD2 
326 1 Y 1 A ARG 536 ? CB  ? D ARG 334 CB  
327 1 Y 1 A ARG 536 ? CG  ? D ARG 334 CG  
328 1 Y 1 A ARG 536 ? CD  ? D ARG 334 CD  
329 1 Y 1 A ARG 536 ? NE  ? D ARG 334 NE  
330 1 Y 1 A ARG 536 ? CZ  ? D ARG 334 CZ  
331 1 Y 1 A ARG 536 ? NH1 ? D ARG 334 NH1 
332 1 Y 1 A ARG 536 ? NH2 ? D ARG 334 NH2 
333 1 Y 1 A ARG 546 ? CG  ? D ARG 344 CG  
334 1 Y 1 A ARG 546 ? CD  ? D ARG 344 CD  
335 1 Y 1 A ARG 546 ? NE  ? D ARG 344 NE  
336 1 Y 1 A ARG 546 ? CZ  ? D ARG 344 CZ  
337 1 Y 1 A ARG 546 ? NH1 ? D ARG 344 NH1 
338 1 Y 1 A ARG 546 ? NH2 ? D ARG 344 NH2 
339 1 Y 1 A GLU 556 ? CB  ? D GLU 354 CB  
340 1 Y 1 A GLU 556 ? CG  ? D GLU 354 CG  
341 1 Y 1 A GLU 556 ? CD  ? D GLU 354 CD  
342 1 Y 1 A GLU 556 ? OE1 ? D GLU 354 OE1 
343 1 Y 1 A GLU 556 ? OE2 ? D GLU 354 OE2 
344 1 Y 1 A GLN 559 ? CG  ? D GLN 357 CG  
345 1 Y 1 A GLN 559 ? CD  ? D GLN 357 CD  
346 1 Y 1 A GLN 559 ? OE1 ? D GLN 357 OE1 
347 1 Y 1 A GLN 559 ? NE2 ? D GLN 357 NE2 
348 1 Y 1 A GLU 561 ? CB  ? D GLU 359 CB  
349 1 Y 1 A GLU 561 ? CG  ? D GLU 359 CG  
350 1 Y 1 A GLU 561 ? CD  ? D GLU 359 CD  
351 1 Y 1 A GLU 561 ? OE1 ? D GLU 359 OE1 
352 1 Y 1 A GLU 561 ? OE2 ? D GLU 359 OE2 
353 1 Y 1 A ASP 566 ? CG  ? D ASP 364 CG  
354 1 Y 1 A ASP 566 ? OD1 ? D ASP 364 OD1 
355 1 Y 1 A ASP 566 ? OD2 ? D ASP 364 OD2 
356 1 Y 1 A ARG 567 ? CB  ? D ARG 365 CB  
357 1 Y 1 A ARG 567 ? CG  ? D ARG 365 CG  
358 1 Y 1 A ARG 567 ? CD  ? D ARG 365 CD  
359 1 Y 1 A ARG 567 ? NE  ? D ARG 365 NE  
360 1 Y 1 A ARG 567 ? CZ  ? D ARG 365 CZ  
361 1 Y 1 A ARG 567 ? NH1 ? D ARG 365 NH1 
362 1 Y 1 A ARG 567 ? NH2 ? D ARG 365 NH2 
363 1 Y 1 A ASP 579 ? CB  ? D ASP 377 CB  
364 1 Y 1 A ASP 579 ? CG  ? D ASP 377 CG  
365 1 Y 1 A ASP 579 ? OD1 ? D ASP 377 OD1 
366 1 Y 1 A ASP 579 ? OD2 ? D ASP 377 OD2 
367 1 Y 1 A GLU 582 ? CG  ? D GLU 380 CG  
368 1 Y 1 A GLU 582 ? CD  ? D GLU 380 CD  
369 1 Y 1 A GLU 582 ? OE1 ? D GLU 380 OE1 
370 1 Y 1 A GLU 582 ? OE2 ? D GLU 380 OE2 
371 1 Y 1 A GLN 600 ? CB  ? D GLN 398 CB  
372 1 Y 1 A GLN 600 ? CG  ? D GLN 398 CG  
373 1 Y 1 A GLN 600 ? CD  ? D GLN 398 CD  
374 1 Y 1 A GLN 600 ? OE1 ? D GLN 398 OE1 
375 1 Y 1 A GLN 600 ? NE2 ? D GLN 398 NE2 
376 1 Y 1 A LEU 602 ? CB  ? D LEU 400 CB  
377 1 Y 1 A LEU 602 ? CG  ? D LEU 400 CG  
378 1 Y 1 A LEU 602 ? CD1 ? D LEU 400 CD1 
379 1 Y 1 A LEU 602 ? CD2 ? D LEU 400 CD2 
380 1 Y 1 A ASP 609 ? CB  ? D ASP 407 CB  
381 1 Y 1 A ASP 609 ? CG  ? D ASP 407 CG  
382 1 Y 1 A ASP 609 ? OD1 ? D ASP 407 OD1 
383 1 Y 1 A ASP 609 ? OD2 ? D ASP 407 OD2 
384 1 Y 1 A GLU 610 ? CG  ? D GLU 408 CG  
385 1 Y 1 A GLU 610 ? CD  ? D GLU 408 CD  
386 1 Y 1 A GLU 610 ? OE1 ? D GLU 408 OE1 
387 1 Y 1 A GLU 610 ? OE2 ? D GLU 408 OE2 
388 1 Y 1 A ASN 611 ? CG  ? D ASN 409 CG  
389 1 Y 1 A ASN 611 ? OD1 ? D ASN 409 OD1 
390 1 Y 1 A ASN 611 ? ND2 ? D ASN 409 ND2 
391 1 Y 1 A ILE 612 ? CB  ? D ILE 410 CB  
392 1 Y 1 A ILE 612 ? CG1 ? D ILE 410 CG1 
393 1 Y 1 A ILE 612 ? CG2 ? D ILE 410 CG2 
394 1 Y 1 A ILE 612 ? CD1 ? D ILE 410 CD1 
395 1 Y 1 A LYS 615 ? CB  ? D LYS 413 CB  
396 1 Y 1 A LYS 615 ? CG  ? D LYS 413 CG  
397 1 Y 1 A LYS 615 ? CD  ? D LYS 413 CD  
398 1 Y 1 A LYS 615 ? CE  ? D LYS 413 CE  
399 1 Y 1 A LYS 615 ? NZ  ? D LYS 413 NZ  
400 1 Y 1 A LEU 617 ? CB  ? D LEU 415 CB  
401 1 Y 1 A LEU 617 ? CG  ? D LEU 415 CG  
402 1 Y 1 A LEU 617 ? CD1 ? D LEU 415 CD1 
403 1 Y 1 A LEU 617 ? CD2 ? D LEU 415 CD2 
404 1 Y 1 A ARG 621 ? CB  ? D ARG 419 CB  
405 1 Y 1 A ARG 621 ? CG  ? D ARG 419 CG  
406 1 Y 1 A ARG 621 ? CD  ? D ARG 419 CD  
407 1 Y 1 A ARG 621 ? NE  ? D ARG 419 NE  
408 1 Y 1 A ARG 621 ? CZ  ? D ARG 419 CZ  
409 1 Y 1 A ARG 621 ? NH1 ? D ARG 419 NH1 
410 1 Y 1 A ARG 621 ? NH2 ? D ARG 419 NH2 
411 1 Y 1 A ASN 623 ? CB  ? D ASN 421 CB  
412 1 Y 1 A ASN 623 ? CG  ? D ASN 421 CG  
413 1 Y 1 A ASN 623 ? OD1 ? D ASN 421 OD1 
414 1 Y 1 A ASN 623 ? ND2 ? D ASN 421 ND2 
415 1 Y 1 A ARG 624 ? CB  ? D ARG 422 CB  
416 1 Y 1 A ARG 624 ? CG  ? D ARG 422 CG  
417 1 Y 1 A ARG 624 ? CD  ? D ARG 422 CD  
418 1 Y 1 A ARG 624 ? NE  ? D ARG 422 NE  
419 1 Y 1 A ARG 624 ? CZ  ? D ARG 422 CZ  
420 1 Y 1 A ARG 624 ? NH1 ? D ARG 422 NH1 
421 1 Y 1 A ARG 624 ? NH2 ? D ARG 422 NH2 
422 1 Y 1 A LYS 735 ? CG  ? D LYS 533 CG  
423 1 Y 1 A LYS 735 ? CD  ? D LYS 533 CD  
424 1 Y 1 A LYS 735 ? CE  ? D LYS 533 CE  
425 1 Y 1 A LYS 735 ? NZ  ? D LYS 533 NZ  
426 1 Y 1 A GLU 741 ? CG  ? D GLU 539 CG  
427 1 Y 1 A GLU 741 ? CD  ? D GLU 539 CD  
428 1 Y 1 A GLU 741 ? OE1 ? D GLU 539 OE1 
429 1 Y 1 A GLU 741 ? OE2 ? D GLU 539 OE2 
430 1 Y 1 A LYS 742 ? CG  ? D LYS 540 CG  
431 1 Y 1 A LYS 742 ? CD  ? D LYS 540 CD  
432 1 Y 1 A LYS 742 ? CE  ? D LYS 540 CE  
433 1 Y 1 A LYS 742 ? NZ  ? D LYS 540 NZ  
434 1 Y 1 A LYS 746 ? CB  ? D LYS 544 CB  
435 1 Y 1 A LYS 746 ? CG  ? D LYS 544 CG  
436 1 Y 1 A LYS 746 ? CD  ? D LYS 544 CD  
437 1 Y 1 A LYS 746 ? CE  ? D LYS 544 CE  
438 1 Y 1 A LYS 746 ? NZ  ? D LYS 544 NZ  
439 1 Y 1 A THR 747 ? CB  ? D THR 545 CB  
440 1 Y 1 A THR 747 ? OG1 ? D THR 545 OG1 
441 1 Y 1 A THR 747 ? CG2 ? D THR 545 CG2 
442 1 Y 1 A ARG 749 ? CG  ? D ARG 547 CG  
443 1 Y 1 A ARG 749 ? CD  ? D ARG 547 CD  
444 1 Y 1 A ARG 749 ? NE  ? D ARG 547 NE  
445 1 Y 1 A ARG 749 ? CZ  ? D ARG 547 CZ  
446 1 Y 1 A ARG 749 ? NH1 ? D ARG 547 NH1 
447 1 Y 1 A ARG 749 ? NH2 ? D ARG 547 NH2 
448 1 Y 1 A GLU 750 ? CB  ? D GLU 548 CB  
449 1 Y 1 A GLU 750 ? CG  ? D GLU 548 CG  
450 1 Y 1 A GLU 750 ? CD  ? D GLU 548 CD  
451 1 Y 1 A GLU 750 ? OE1 ? D GLU 548 OE1 
452 1 Y 1 A GLU 750 ? OE2 ? D GLU 548 OE2 
453 1 Y 1 A PHE 752 ? CB  ? D PHE 550 CB  
454 1 Y 1 A PHE 752 ? CG  ? D PHE 550 CG  
455 1 Y 1 A PHE 752 ? CD1 ? D PHE 550 CD1 
456 1 Y 1 A PHE 752 ? CD2 ? D PHE 550 CD2 
457 1 Y 1 A PHE 752 ? CE1 ? D PHE 550 CE1 
458 1 Y 1 A PHE 752 ? CE2 ? D PHE 550 CE2 
459 1 Y 1 A PHE 752 ? CZ  ? D PHE 550 CZ  
460 1 Y 1 A ASP 760 ? CG  ? D ASP 558 CG  
461 1 Y 1 A ASP 760 ? OD1 ? D ASP 558 OD1 
462 1 Y 1 A ASP 760 ? OD2 ? D ASP 558 OD2 
463 1 Y 1 A GLU 761 ? CB  ? D GLU 559 CB  
464 1 Y 1 A GLU 761 ? CG  ? D GLU 559 CG  
465 1 Y 1 A GLU 761 ? CD  ? D GLU 559 CD  
466 1 Y 1 A GLU 761 ? OE1 ? D GLU 559 OE1 
467 1 Y 1 A GLU 761 ? OE2 ? D GLU 559 OE2 
468 1 Y 1 A ASP 762 ? CG  ? D ASP 560 CG  
469 1 Y 1 A ASP 762 ? OD1 ? D ASP 560 OD1 
470 1 Y 1 A ASP 762 ? OD2 ? D ASP 560 OD2 
471 1 Y 1 A GLU 764 ? CG  ? D GLU 562 CG  
472 1 Y 1 A GLU 764 ? CD  ? D GLU 562 CD  
473 1 Y 1 A GLU 764 ? OE1 ? D GLU 562 OE1 
474 1 Y 1 A GLU 764 ? OE2 ? D GLU 562 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 627 ? D ALA 425 
2  1 Y 1 A ILE 628 ? D ILE 426 
3  1 Y 1 A LEU 629 ? D LEU 427 
4  1 Y 1 A CYS 630 ? D CYS 428 
5  1 Y 1 A ASN 631 ? D ASN 429 
6  1 Y 1 A HIS 632 ? D HIS 430 
7  1 Y 1 A GLN 633 ? D GLN 431 
8  1 Y 1 A ARG 634 ? D ARG 432 
9  1 Y 1 A ALA 635 ? D ALA 433 
10 1 Y 1 A PRO 636 ? D PRO 434 
11 1 Y 1 A PRO 637 ? D PRO 435 
12 1 Y 1 A LYS 638 ? D LYS 436 
13 1 Y 1 A THR 639 ? D THR 437 
14 1 Y 1 A PHE 640 ? D PHE 438 
15 1 Y 1 A GLU 641 ? D GLU 439 
16 1 Y 1 A LYS 642 ? D LYS 440 
17 1 Y 1 A SER 643 ? D SER 441 
18 1 Y 1 A MET 644 ? D MET 442 
19 1 Y 1 A MET 645 ? D MET 443 
20 1 Y 1 A ASN 646 ? D ASN 444 
21 1 Y 1 A LEU 647 ? D LEU 445 
22 1 Y 1 A GLN 648 ? D GLN 446 
23 1 Y 1 A THR 649 ? D THR 447 
24 1 Y 1 A LYS 650 ? D LYS 448 
25 1 Y 1 A ILE 651 ? D ILE 449 
26 1 Y 1 A ASP 652 ? D ASP 450 
27 1 Y 1 A ALA 653 ? D ALA 451 
28 1 Y 1 A LYS 654 ? D LYS 452 
29 1 Y 1 A LYS 655 ? D LYS 453 
30 1 Y 1 A GLU 656 ? D GLU 454 
31 1 Y 1 A GLN 657 ? D GLN 455 
32 1 Y 1 A LEU 658 ? D LEU 456 
33 1 Y 1 A ALA 659 ? D ALA 457 
34 1 Y 1 A ASP 660 ? D ASP 458 
35 1 Y 1 A ALA 661 ? D ALA 459 
36 1 Y 1 A ARG 662 ? D ARG 460 
37 1 Y 1 A ARG 663 ? D ARG 461 
38 1 Y 1 A ASP 664 ? D ASP 462 
39 1 Y 1 A LEU 665 ? D LEU 463 
40 1 Y 1 A LYS 666 ? D LYS 464 
41 1 Y 1 A SER 667 ? D SER 465 
42 1 Y 1 A ALA 668 ? D ALA 466 
43 1 Y 1 A LYS 669 ? D LYS 467 
44 1 Y 1 A ALA 670 ? D ALA 468 
45 1 Y 1 A ASP 671 ? D ASP 469 
46 1 Y 1 A ALA 672 ? D ALA 470 
47 1 Y 1 A LYS 673 ? D LYS 471 
48 1 Y 1 A VAL 674 ? D VAL 472 
49 1 Y 1 A MET 675 ? D MET 473 
50 1 Y 1 A LYS 676 ? D LYS 474 
51 1 Y 1 A ASP 677 ? D ASP 475 
52 1 Y 1 A ALA 678 ? D ALA 476 
53 1 Y 1 A LYS 679 ? D LYS 477 
54 1 Y 1 A THR 680 ? D THR 478 
55 1 Y 1 A LYS 681 ? D LYS 479 
56 1 Y 1 A LYS 682 ? D LYS 480 
57 1 Y 1 A VAL 683 ? D VAL 481 
58 1 Y 1 A VAL 684 ? D VAL 482 
59 1 Y 1 A GLU 685 ? D GLU 483 
60 1 Y 1 A SER 686 ? D SER 484 
61 1 Y 1 A LYS 687 ? D LYS 485 
62 1 Y 1 A LYS 688 ? D LYS 486 
63 1 Y 1 A LYS 689 ? D LYS 487 
64 1 Y 1 A ALA 690 ? D ALA 488 
65 1 Y 1 A VAL 691 ? D VAL 489 
66 1 Y 1 A GLN 692 ? D GLN 490 
67 1 Y 1 A ARG 693 ? D ARG 491 
68 1 Y 1 A LEU 694 ? D LEU 492 
69 1 Y 1 A GLU 695 ? D GLU 493 
70 1 Y 1 A GLU 696 ? D GLU 494 
71 1 Y 1 A GLN 697 ? D GLN 495 
72 1 Y 1 A LEU 698 ? D LEU 496 
73 1 Y 1 A MET 699 ? D MET 497 
74 1 Y 1 A LYS 700 ? D LYS 498 
75 1 Y 1 A LEU 701 ? D LEU 499 
76 1 Y 1 A GLU 702 ? D GLU 500 
77 1 Y 1 A VAL 703 ? D VAL 501 
78 1 Y 1 A GLN 704 ? D GLN 502 
79 1 Y 1 A ALA 705 ? D ALA 503 
80 1 Y 1 A THR 706 ? D THR 504 
81 1 Y 1 A ASP 707 ? D ASP 505 
82 1 Y 1 A ARG 708 ? D ARG 506 
83 1 Y 1 A GLU 709 ? D GLU 507 
84 1 Y 1 A GLU 710 ? D GLU 508 
85 1 Y 1 A ASN 711 ? D ASN 509 
86 1 Y 1 A LYS 712 ? D LYS 510 
87 1 Y 1 A GLN 713 ? D GLN 511 
88 1 Y 1 A ILE 714 ? D ILE 512 
89 1 Y 1 A ALA 715 ? D ALA 513 
90 1 Y 1 A LEU 716 ? D LEU 514 
91 1 Y 1 A GLY 717 ? D GLY 515 
92 1 Y 1 A THR 718 ? D THR 516 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1NH3 'double helix'        
1NH3 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA  1  1_555 C DT  22 1_555 0.282  0.427  0.291  3.173  -11.318 8.755  1  B_DA1:DT122_D    B 1  ? D 122 ? ?  ? 
1 A DA  2  1_555 C DU  21 1_555 -0.439 0.192  0.152  3.169  -6.061  -2.714 2  B_DA2:DU121_D    B 2  ? D 121 ? 20 1 
1 A DA  3  1_555 C DU  20 1_555 0.566  -0.031 0.492  7.640  -5.538  7.099  3  B_DA3:DU120_D    B 3  ? D 120 ? 20 1 
1 A DA  4  1_555 C DU  19 1_555 -0.154 -0.043 -0.449 -0.699 -16.638 -7.437 4  B_DA4:DU119_D    B 4  ? D 119 ? 20 1 
1 A DA  5  1_555 C DU  18 1_555 -0.549 -0.116 0.629  -1.920 -2.978  4.199  5  B_DA5:DU118_D    B 5  ? D 118 ? 20 1 
1 A DG  6  1_555 C DC  17 1_555 -0.846 -0.360 0.160  -2.549 -12.412 -5.677 6  B_DG6:DC117_D    B 6  ? D 117 ? 19 1 
1 A DA  7  1_555 C DU  16 1_555 -0.106 0.309  -0.117 -1.909 -11.712 0.655  7  B_DA7:DU116_D    B 7  ? D 116 ? 20 1 
1 A DC  8  1_555 C DG  15 1_555 -0.713 -0.044 -0.630 12.851 -16.590 4.720  8  B_DC8:DG115_D    B 8  ? D 115 ? 19 1 
1 A DU  9  1_555 C DA  14 1_555 0.786  -0.436 0.606  -9.621 -2.219  -7.511 9  B_DU9:DA114_D    B 9  ? D 114 ? 20 1 
1 A UBB 10 1_555 C DA  13 1_555 0.206  -0.009 -0.106 -0.429 -8.122  -9.382 10 B_UBB10:DA113_D  B 10 ? D 113 ? 20 1 
1 B GNG 1  1_555 C CAR 12 1_555 -0.277 0.051  -0.055 9.873  -11.394 3.152  11 C_GNG11:CAR112_D C 11 ? D 112 ? 19 1 
1 B DG  2  1_555 C DC  11 1_555 0.735  -0.241 0.112  1.712  -18.982 -2.530 12 C_DG12:DC111_D   C 12 ? D 111 ? 19 1 
1 B DA  3  1_555 C DU  10 1_555 0.957  0.086  0.110  7.839  -9.862  -9.147 13 C_DA13:DU110_D   C 13 ? D 110 ? 20 1 
1 B DA  4  1_555 C DU  9  1_555 -1.225 -0.156 -0.011 9.018  -8.482  1.651  14 C_DA14:DU109_D   C 14 ? D 109 ? 20 1 
1 B DA  5  1_555 C DU  8  1_555 1.327  0.150  0.525  -3.790 -9.326  -8.862 15 C_DA15:DU108_D   C 15 ? D 108 ? 20 1 
1 B DA  6  1_555 C DU  7  1_555 -0.485 -0.143 -0.038 3.452  -11.962 -5.957 16 C_DA16:DU107_D   C 16 ? D 107 ? 20 1 
1 B DA  7  1_555 C DT  6  1_555 0.122  0.281  -0.012 3.650  -14.898 7.625  17 C_DA17:DT106_D   C 17 ? D 106 ? ?  ? 
1 B DU  8  1_555 C DA  5  1_555 0.236  0.548  -0.195 -3.297 -7.060  4.773  18 C_DU18:DA105_D   C 18 ? D 105 ? ?  ? 
1 B DU  9  1_555 C DA  4  1_555 0.418  0.275  -0.293 -1.655 -16.475 -0.355 19 C_DU19:DA104_D   C 19 ? D 104 ? 20 1 
1 B DU  11 1_555 C DA  2  1_555 0.753  -0.157 -0.389 -8.308 -19.700 -2.223 20 C_DU21:DA102_D   C 21 ? D 102 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA  1  1_555 C DT  22 1_555 A DA  2  1_555 C DU  21 1_555 -0.120 -0.529 3.009 -0.778 3.221  31.371 -1.519 0.090  2.943 5.936   
1.433   31.541 1  BB_DA1DA2:DU121DT122_DD      B 1  ? D 122 ? B 2  ? D 121 ? 
1 A DA  2  1_555 C DU  21 1_555 A DA  3  1_555 C DU  20 1_555 0.295  -0.212 3.123 -1.695 -7.385 43.402 0.385  -0.546 3.104 -9.896  
2.271   44.027 2  BB_DA2DA3:DU120DU121_DD      B 2  ? D 121 ? B 3  ? D 120 ? 
1 A DA  3  1_555 C DU  20 1_555 A DA  4  1_555 C DU  19 1_555 -0.293 -0.673 3.481 5.824  -2.189 31.356 -0.801 1.656  3.411 -4.000  
-10.644 31.952 3  BB_DA3DA4:DU119DU120_DD      B 3  ? D 120 ? B 4  ? D 119 ? 
1 A DA  4  1_555 C DU  19 1_555 A DA  5  1_555 C DU  18 1_555 1.021  -0.237 3.262 -9.042 -4.322 33.667 0.231  -2.999 2.907 -7.264  
15.198  35.086 4  BB_DA4DA5:DU118DU119_DD      B 4  ? D 119 ? B 5  ? D 118 ? 
1 A DA  5  1_555 C DU  18 1_555 A DG  6  1_555 C DC  17 1_555 -0.528 -1.268 3.288 7.454  -3.708 36.436 -1.487 1.818  3.230 -5.836  
-11.733 37.343 5  BB_DA5DG6:DC117DU118_DD      B 5  ? D 118 ? B 6  ? D 117 ? 
1 A DG  6  1_555 C DC  17 1_555 A DA  7  1_555 C DU  16 1_555 0.475  -0.374 3.173 1.647  2.828  32.907 -1.120 -0.566 3.150 4.978   
-2.899  33.064 6  BB_DG6DA7:DU116DC117_DD      B 6  ? D 117 ? B 7  ? D 116 ? 
1 A DA  7  1_555 C DU  16 1_555 A DC  8  1_555 C DG  15 1_555 0.357  -0.150 3.104 2.071  1.153  29.264 -0.533 -0.280 3.113 2.278   
-4.091  29.358 7  BB_DA7DC8:DG115DU116_DD      B 7  ? D 116 ? B 8  ? D 115 ? 
1 A DC  8  1_555 C DG  15 1_555 A DU  9  1_555 C DA  14 1_555 -0.441 -0.361 4.122 -7.088 -3.047 48.427 -0.142 -0.151 4.158 -3.687  
8.577   49.001 8  BB_DC8DU9:DA114DG115_DD      B 8  ? D 115 ? B 9  ? D 114 ? 
1 A DU  9  1_555 C DA  14 1_555 A UBB 10 1_555 C DA  13 1_555 -0.621 -1.183 2.906 4.900  -1.661 32.664 -1.831 1.824  2.841 -2.931  
-8.644  33.060 9  BB_DU9UBB10:DA113DA114_DD    B 9  ? D 114 ? B 10 ? D 113 ? 
1 A UBB 10 1_555 C DA  13 1_555 B GNG 1  1_555 C CAR 12 1_555 0.878  -0.089 3.374 -3.949 6.176  27.875 -1.576 -2.658 3.131 12.549  
8.023   28.804 10 BC_UBB10GNG11:CAR112DA113_DD B 10 ? D 113 ? C 11 ? D 112 ? 
1 B GNG 1  1_555 C CAR 12 1_555 B DG  2  1_555 C DC  11 1_555 -1.482 -0.337 3.679 -0.715 -7.087 40.642 0.391  2.016  3.709 -10.110 
1.020   41.235 11 CC_GNG11DG12:DC111CAR112_DD  C 11 ? D 112 ? C 12 ? D 111 ? 
1 B DG  2  1_555 C DC  11 1_555 B DA  3  1_555 C DU  10 1_555 -0.583 -0.408 3.087 -4.604 -2.074 35.508 -0.378 0.314  3.154 -3.380  
7.502   35.853 12 CC_DG12DA13:DU110DC111_DD    C 12 ? D 111 ? C 13 ? D 110 ? 
1 B DA  3  1_555 C DU  10 1_555 B DA  4  1_555 C DU  9  1_555 1.001  -0.401 3.239 3.353  1.467  21.285 -1.663 -1.318 3.320 3.933   
-8.992  21.593 13 CC_DA13DA14:DU109DU110_DD    C 13 ? D 110 ? C 14 ? D 109 ? 
1 B DA  4  1_555 C DU  9  1_555 B DA  5  1_555 C DU  8  1_555 -0.829 -0.084 3.487 -5.496 -3.388 51.230 0.152  0.550  3.551 -3.900  
6.327   51.608 14 CC_DA14DA15:DU108DU109_DD    C 14 ? D 109 ? C 15 ? D 108 ? 
1 B DA  5  1_555 C DU  8  1_555 B DA  6  1_555 C DU  7  1_555 0.091  -1.164 3.099 6.534  -3.094 25.761 -1.735 1.454  3.142 -6.771  
-14.301 26.739 15 CC_DA15DA16:DU107DU108_DD    C 15 ? D 108 ? C 16 ? D 107 ? 
1 B DA  6  1_555 C DU  7  1_555 B DA  7  1_555 C DT  6  1_555 0.574  -0.109 3.224 -0.254 -1.952 40.954 0.054  -0.847 3.222 -2.789  
0.363   40.999 16 CC_DA16DA17:DT106DU107_DD    C 16 ? D 107 ? C 17 ? D 106 ? 
1 B DA  7  1_555 C DT  6  1_555 B DU  8  1_555 C DA  5  1_555 0.024  -0.922 3.358 1.162  2.100  31.312 -2.105 0.177  3.290 3.884   
-2.149  31.402 17 CC_DA17DU18:DA105DT106_DD    C 17 ? D 106 ? C 18 ? D 105 ? 
1 B DU  8  1_555 C DA  5  1_555 B DU  9  1_555 C DA  4  1_555 -0.403 -0.222 3.185 -1.183 -0.332 39.534 -0.289 0.460  3.197 -0.491  
1.749   39.552 18 CC_DU18DU19:DA104DA105_DD    C 18 ? D 105 ? C 19 ? D 104 ? 
1 B DU  9  1_555 C DA  4  1_555 B DU  11 1_555 C DA  2  1_555 -0.271 -0.199 6.491 5.062  -2.679 81.621 -0.018 0.460  6.472 -2.047  
-3.868  81.786 19 CC_DU19DU21:DA102DA104_DD    C 19 ? D 104 ? C 21 ? D 102 ? 
# 
_pdbx_entity_nonpoly.entity_id   5 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 HOH 1  13 13 HOH TIP B . 
E 5 HOH 2  28 28 HOH TIP B . 
F 5 HOH 1  23 1  HOH TIP C . 
F 5 HOH 2  24 11 HOH TIP C . 
F 5 HOH 3  25 12 HOH TIP C . 
F 5 HOH 4  26 16 HOH TIP C . 
F 5 HOH 5  27 19 HOH TIP C . 
G 5 HOH 1  2  2  HOH TIP D . 
G 5 HOH 2  21 21 HOH TIP D . 
G 5 HOH 3  23 23 HOH TIP D . 
G 5 HOH 4  31 31 HOH TIP D . 
G 5 HOH 5  32 32 HOH TIP D . 
H 5 HOH 1  3  3  HOH TIP A . 
H 5 HOH 2  4  4  HOH TIP A . 
H 5 HOH 3  5  5  HOH TIP A . 
H 5 HOH 4  6  6  HOH TIP A . 
H 5 HOH 5  7  7  HOH TIP A . 
H 5 HOH 6  8  8  HOH TIP A . 
H 5 HOH 7  9  9  HOH TIP A . 
H 5 HOH 8  10 10 HOH TIP A . 
H 5 HOH 9  14 14 HOH TIP A . 
H 5 HOH 10 15 15 HOH TIP A . 
H 5 HOH 11 17 17 HOH TIP A . 
H 5 HOH 12 18 18 HOH TIP A . 
H 5 HOH 13 20 20 HOH TIP A . 
H 5 HOH 14 22 22 HOH TIP A . 
H 5 HOH 15 24 24 HOH TIP A . 
H 5 HOH 16 25 25 HOH TIP A . 
H 5 HOH 17 26 26 HOH TIP A . 
H 5 HOH 18 27 27 HOH TIP A . 
H 5 HOH 19 29 29 HOH TIP A . 
H 5 HOH 20 30 30 HOH TIP A . 
H 5 HOH 21 33 33 HOH TIP A . 
#